data_2DK6
# 
_entry.id   2DK6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DK6         
RCSB  RCSB025511   
WWPDB D_1000025511 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DK6 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-06 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, F.'                                                 1 
'Muto, Y.'                                               2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Shirouzu, M.'                                           5 
'Terada, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of WWE domain in poly (ADP-ribose) polymerase family, member 11 (PARP 11)' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'He, F.'       1 
primary 'Muto, Y.'     2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Shirouzu, M.' 5 
primary 'Terada, T.'   6 
primary 'Yokoyama, S.' 7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PARP11 protein' 
_entity.formula_weight             11283.387 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'WWE domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQM
NLTTGKQRLIKRAPFSSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQM
NLTTGKQRLIKRAPFSSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ASN n 
1 9   GLU n 
1 10  VAL n 
1 11  ASP n 
1 12  ASP n 
1 13  MET n 
1 14  ASP n 
1 15  THR n 
1 16  SER n 
1 17  ASP n 
1 18  THR n 
1 19  GLN n 
1 20  TRP n 
1 21  GLY n 
1 22  TRP n 
1 23  PHE n 
1 24  TYR n 
1 25  LEU n 
1 26  ALA n 
1 27  GLU n 
1 28  CYS n 
1 29  GLY n 
1 30  LYS n 
1 31  TRP n 
1 32  HIS n 
1 33  MET n 
1 34  PHE n 
1 35  GLN n 
1 36  PRO n 
1 37  ASP n 
1 38  THR n 
1 39  ASN n 
1 40  SER n 
1 41  GLN n 
1 42  CYS n 
1 43  SER n 
1 44  VAL n 
1 45  SER n 
1 46  SER n 
1 47  GLU n 
1 48  ASP n 
1 49  ILE n 
1 50  GLU n 
1 51  LYS n 
1 52  SER n 
1 53  PHE n 
1 54  LYS n 
1 55  THR n 
1 56  ASN n 
1 57  PRO n 
1 58  CYS n 
1 59  GLY n 
1 60  SER n 
1 61  ILE n 
1 62  SER n 
1 63  PHE n 
1 64  THR n 
1 65  THR n 
1 66  SER n 
1 67  LYS n 
1 68  PHE n 
1 69  SER n 
1 70  TYR n 
1 71  LYS n 
1 72  ILE n 
1 73  ASP n 
1 74  PHE n 
1 75  ALA n 
1 76  GLU n 
1 77  MET n 
1 78  LYS n 
1 79  GLN n 
1 80  MET n 
1 81  ASN n 
1 82  LEU n 
1 83  THR n 
1 84  THR n 
1 85  GLY n 
1 86  LYS n 
1 87  GLN n 
1 88  ARG n 
1 89  LEU n 
1 90  ILE n 
1 91  LYS n 
1 92  ARG n 
1 93  ALA n 
1 94  PRO n 
1 95  PHE n 
1 96  SER n 
1 97  SER n 
1 98  GLY n 
1 99  PRO n 
1 100 SER n 
1 101 SER n 
1 102 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PARP11 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050912-01 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    AAH31073 
_struct_ref.pdbx_db_accession          21411376 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQ
RLIKRAPFS
;
_struct_ref.pdbx_align_begin           15 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DK6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 96 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             21411376 
_struct_ref_seq.db_align_beg                  15 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  103 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       96 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DK6 GLY A 1   ? GB 21411376 ? ? 'CLONING ARTIFACT' 1   1  
1 2DK6 SER A 2   ? GB 21411376 ? ? 'CLONING ARTIFACT' 2   2  
1 2DK6 SER A 3   ? GB 21411376 ? ? 'CLONING ARTIFACT' 3   3  
1 2DK6 GLY A 4   ? GB 21411376 ? ? 'CLONING ARTIFACT' 4   4  
1 2DK6 SER A 5   ? GB 21411376 ? ? 'CLONING ARTIFACT' 5   5  
1 2DK6 SER A 6   ? GB 21411376 ? ? 'CLONING ARTIFACT' 6   6  
1 2DK6 GLY A 7   ? GB 21411376 ? ? 'CLONING ARTIFACT' 7   7  
1 2DK6 SER A 97  ? GB 21411376 ? ? 'CLONING ARTIFACT' 97  8  
1 2DK6 GLY A 98  ? GB 21411376 ? ? 'CLONING ARTIFACT' 98  9  
1 2DK6 PRO A 99  ? GB 21411376 ? ? 'CLONING ARTIFACT' 99  10 
1 2DK6 SER A 100 ? GB 21411376 ? ? 'CLONING ARTIFACT' 100 11 
1 2DK6 SER A 101 ? GB 21411376 ? ? 'CLONING ARTIFACT' 101 12 
1 2DK6 GLY A 102 ? GB 21411376 ? ? 'CLONING ARTIFACT' 102 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;0.8mM U-15N, 13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 
0.02% NaN3; 90% H2O, 10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DK6 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DK6 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DK6 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9321   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2DK6 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DK6 
_struct.title                     'Solution structure of WWE domain in poly (ADP-ribose) polymerase family, member 11 (PARP 11)' 
_struct.pdbx_descriptor           'PARP11 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DK6 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;structural genomics, WWE domain, PARP11, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        46 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       THR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        55 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         46 
_struct_conf.end_auth_comp_id        THR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         55 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 32 ? MET A 33 ? HIS A 32 MET A 33 
A 2 TRP A 20 ? TYR A 24 ? TRP A 20 TYR A 24 
A 3 GLN A 87 ? PRO A 94 ? GLN A 87 PRO A 94 
A 4 LYS A 78 ? ASN A 81 ? LYS A 78 ASN A 81 
A 5 SER A 69 ? ASP A 73 ? SER A 69 ASP A 73 
A 6 SER A 60 ? THR A 64 ? SER A 60 THR A 64 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 32 ? O HIS A 32 N TYR A 24 ? N TYR A 24 
A 2 3 N GLY A 21 ? N GLY A 21 O ALA A 93 ? O ALA A 93 
A 3 4 O ARG A 88 ? O ARG A 88 N GLN A 79 ? N GLN A 79 
A 4 5 O MET A 80 ? O MET A 80 N LYS A 71 ? N LYS A 71 
A 5 6 O PHE A 68 ? O PHE A 68 N THR A 65 ? N THR A 65 
# 
_database_PDB_matrix.entry_id          2DK6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DK6 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 17.095  11.867  -22.791 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 17.898  11.649  -21.602 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 17.469  10.416  -20.831 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 16.422  10.413  -20.184 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 17.465  12.375  -23.543 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 18.931  11.537  -21.894 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 17.808  12.511  -20.957 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 18.280  9.365   -20.901 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 17.976  8.118   -20.209 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 19.109  7.730   -19.264 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 20.277  8.018   -19.527 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 17.733  6.995   -21.219 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 16.431  7.080   -21.772 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 19.101  9.429   -21.433 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 17.077  8.270   -19.630 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 18.455  7.070   -22.017 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 17.840  6.040   -20.725 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 15.788  6.783   -21.124 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 18.756  7.076   -18.162 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 19.742  6.652   -17.175 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 19.371  5.295   -16.584 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 18.204  4.906   -16.580 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 19.858  7.692   -16.059 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 18.667  7.753   -15.293 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 17.808  6.876   -18.009 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 20.695  6.565   -17.675 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 20.677  7.429   -15.408 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 20.042  8.664   -16.495 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 18.060  8.380   -15.694 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 20.374  4.579   -16.086 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 20.134  3.274   -15.499 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 21.385  2.419   -15.455 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 22.241  2.513   -16.335 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 21.285  4.941   -16.116 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 19.764  3.406   -14.493 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 19.383  2.762   -16.084 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 21.493  1.584   -14.427 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 22.652  0.713   -14.268 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 22.218  -0.726  -14.008 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 21.086  -0.980  -13.596 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 23.535  1.207   -13.121 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 22.787  1.346   -11.925 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 20.777  1.555   -13.758 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 23.219  0.745   -15.187 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 24.332  0.499   -12.952 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 23.955  2.167   -13.382 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 22.871  2.244   -11.597 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 23.127  -1.665  -14.250 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 22.839  -3.080  -14.046 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 24.123  -3.868  -13.809 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 25.163  -3.573  -14.397 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 22.093  -3.650  -15.254 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 20.744  -3.216  -15.273 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 24.012  -1.400  -14.577 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 22.210  -3.167  -13.172 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 22.577  -3.319  -16.161 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 22.112  -4.729  -15.209 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 20.221  -3.820  -15.804 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 24.043  -4.872  -12.941 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 25.205  -5.687  -12.640 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 25.025  -6.511  -11.380 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 25.230  -7.724  -11.389 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 23.187  -5.061  -12.502 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 25.389  -6.353  -13.470 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 26.061  -5.041  -12.514 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ASN A 1 8   ? 24.642  -5.849  -10.292 1.00 0.00 ? 8   ASN A N    1  
ATOM 67    C CA   . ASN A 1 8   ? 24.437  -6.528  -9.018  1.00 0.00 ? 8   ASN A CA   1  
ATOM 68    C C    . ASN A 1 8   ? 23.109  -7.278  -9.008  1.00 0.00 ? 8   ASN A C    1  
ATOM 69    O O    . ASN A 1 8   ? 22.297  -7.132  -9.921  1.00 0.00 ? 8   ASN A O    1  
ATOM 70    C CB   . ASN A 1 8   ? 24.475  -5.520  -7.868  1.00 0.00 ? 8   ASN A CB   1  
ATOM 71    C CG   . ASN A 1 8   ? 23.436  -4.426  -8.023  1.00 0.00 ? 8   ASN A CG   1  
ATOM 72    O OD1  . ASN A 1 8   ? 23.749  -3.312  -8.443  1.00 0.00 ? 8   ASN A OD1  1  
ATOM 73    N ND2  . ASN A 1 8   ? 22.191  -4.740  -7.685  1.00 0.00 ? 8   ASN A ND2  1  
ATOM 74    H H    . ASN A 1 8   ? 24.495  -4.882  -10.348 1.00 0.00 ? 8   ASN A H    1  
ATOM 75    H HA   . ASN A 1 8   ? 25.239  -7.239  -8.888  1.00 0.00 ? 8   ASN A HA   1  
ATOM 76    H HB2  . ASN A 1 8   ? 24.289  -6.037  -6.938  1.00 0.00 ? 8   ASN A HB2  1  
ATOM 77    H HB3  . ASN A 1 8   ? 25.452  -5.061  -7.830  1.00 0.00 ? 8   ASN A HB3  1  
ATOM 78    H HD21 . ASN A 1 8   ? 22.015  -5.648  -7.358  1.00 0.00 ? 8   ASN A HD21 1  
ATOM 79    H HD22 . ASN A 1 8   ? 21.499  -4.052  -7.776  1.00 0.00 ? 8   ASN A HD22 1  
ATOM 80    N N    . GLU A 1 9   ? 22.895  -8.079  -7.970  1.00 0.00 ? 9   GLU A N    1  
ATOM 81    C CA   . GLU A 1 9   ? 21.665  -8.852  -7.842  1.00 0.00 ? 9   GLU A CA   1  
ATOM 82    C C    . GLU A 1 9   ? 21.373  -9.173  -6.379  1.00 0.00 ? 9   GLU A C    1  
ATOM 83    O O    . GLU A 1 9   ? 22.267  -9.561  -5.627  1.00 0.00 ? 9   GLU A O    1  
ATOM 84    C CB   . GLU A 1 9   ? 21.764  -10.147 -8.650  1.00 0.00 ? 9   GLU A CB   1  
ATOM 85    C CG   . GLU A 1 9   ? 22.803  -11.119 -8.117  1.00 0.00 ? 9   GLU A CG   1  
ATOM 86    C CD   . GLU A 1 9   ? 22.866  -12.404 -8.920  1.00 0.00 ? 9   GLU A CD   1  
ATOM 87    O OE1  . GLU A 1 9   ? 22.106  -13.341 -8.599  1.00 0.00 ? 9   GLU A OE1  1  
ATOM 88    O OE2  . GLU A 1 9   ? 23.675  -12.473 -9.869  1.00 0.00 ? 9   GLU A OE2  1  
ATOM 89    H H    . GLU A 1 9   ? 23.581  -8.153  -7.274  1.00 0.00 ? 9   GLU A H    1  
ATOM 90    H HA   . GLU A 1 9   ? 20.856  -8.254  -8.235  1.00 0.00 ? 9   GLU A HA   1  
ATOM 91    H HB2  . GLU A 1 9   ? 20.802  -10.639 -8.639  1.00 0.00 ? 9   GLU A HB2  1  
ATOM 92    H HB3  . GLU A 1 9   ? 22.021  -9.902  -9.670  1.00 0.00 ? 9   GLU A HB3  1  
ATOM 93    H HG2  . GLU A 1 9   ? 23.772  -10.644 -8.151  1.00 0.00 ? 9   GLU A HG2  1  
ATOM 94    H HG3  . GLU A 1 9   ? 22.558  -11.363 -7.094  1.00 0.00 ? 9   GLU A HG3  1  
ATOM 95    N N    . VAL A 1 10  ? 20.115  -9.007  -5.982  1.00 0.00 ? 10  VAL A N    1  
ATOM 96    C CA   . VAL A 1 10  ? 19.705  -9.279  -4.610  1.00 0.00 ? 10  VAL A CA   1  
ATOM 97    C C    . VAL A 1 10  ? 18.656  -10.385 -4.559  1.00 0.00 ? 10  VAL A C    1  
ATOM 98    O O    . VAL A 1 10  ? 17.479  -10.151 -4.836  1.00 0.00 ? 10  VAL A O    1  
ATOM 99    C CB   . VAL A 1 10  ? 19.137  -8.017  -3.933  1.00 0.00 ? 10  VAL A CB   1  
ATOM 100   C CG1  . VAL A 1 10  ? 18.701  -8.326  -2.509  1.00 0.00 ? 10  VAL A CG1  1  
ATOM 101   C CG2  . VAL A 1 10  ? 20.164  -6.895  -3.954  1.00 0.00 ? 10  VAL A CG2  1  
ATOM 102   H H    . VAL A 1 10  ? 19.448  -8.695  -6.628  1.00 0.00 ? 10  VAL A H    1  
ATOM 103   H HA   . VAL A 1 10  ? 20.577  -9.598  -4.057  1.00 0.00 ? 10  VAL A HA   1  
ATOM 104   H HB   . VAL A 1 10  ? 18.270  -7.694  -4.490  1.00 0.00 ? 10  VAL A HB   1  
ATOM 105   H HG11 . VAL A 1 10  ? 19.439  -8.956  -2.035  1.00 0.00 ? 10  VAL A HG11 1  
ATOM 106   H HG12 . VAL A 1 10  ? 18.604  -7.404  -1.954  1.00 0.00 ? 10  VAL A HG12 1  
ATOM 107   H HG13 . VAL A 1 10  ? 17.750  -8.837  -2.527  1.00 0.00 ? 10  VAL A HG13 1  
ATOM 108   H HG21 . VAL A 1 10  ? 20.499  -6.733  -4.967  1.00 0.00 ? 10  VAL A HG21 1  
ATOM 109   H HG22 . VAL A 1 10  ? 19.715  -5.988  -3.574  1.00 0.00 ? 10  VAL A HG22 1  
ATOM 110   H HG23 . VAL A 1 10  ? 21.006  -7.165  -3.334  1.00 0.00 ? 10  VAL A HG23 1  
ATOM 111   N N    . ASP A 1 11  ? 19.090  -11.589 -4.204  1.00 0.00 ? 11  ASP A N    1  
ATOM 112   C CA   . ASP A 1 11  ? 18.189  -12.731 -4.115  1.00 0.00 ? 11  ASP A CA   1  
ATOM 113   C C    . ASP A 1 11  ? 17.973  -13.142 -2.662  1.00 0.00 ? 11  ASP A C    1  
ATOM 114   O O    . ASP A 1 11  ? 16.971  -13.773 -2.327  1.00 0.00 ? 11  ASP A O    1  
ATOM 115   C CB   . ASP A 1 11  ? 18.746  -13.911 -4.914  1.00 0.00 ? 11  ASP A CB   1  
ATOM 116   C CG   . ASP A 1 11  ? 20.090  -14.380 -4.393  1.00 0.00 ? 11  ASP A CG   1  
ATOM 117   O OD1  . ASP A 1 11  ? 21.123  -13.854 -4.857  1.00 0.00 ? 11  ASP A OD1  1  
ATOM 118   O OD2  . ASP A 1 11  ? 20.108  -15.273 -3.520  1.00 0.00 ? 11  ASP A OD2  1  
ATOM 119   H H    . ASP A 1 11  ? 20.040  -11.712 -3.996  1.00 0.00 ? 11  ASP A H    1  
ATOM 120   H HA   . ASP A 1 11  ? 17.240  -12.439 -4.538  1.00 0.00 ? 11  ASP A HA   1  
ATOM 121   H HB2  . ASP A 1 11  ? 18.051  -14.736 -4.857  1.00 0.00 ? 11  ASP A HB2  1  
ATOM 122   H HB3  . ASP A 1 11  ? 18.863  -13.615 -5.946  1.00 0.00 ? 11  ASP A HB3  1  
ATOM 123   N N    . ASP A 1 12  ? 18.920  -12.780 -1.804  1.00 0.00 ? 12  ASP A N    1  
ATOM 124   C CA   . ASP A 1 12  ? 18.834  -13.111 -0.386  1.00 0.00 ? 12  ASP A CA   1  
ATOM 125   C C    . ASP A 1 12  ? 17.967  -12.099 0.356   1.00 0.00 ? 12  ASP A C    1  
ATOM 126   O O    . ASP A 1 12  ? 17.634  -12.292 1.525   1.00 0.00 ? 12  ASP A O    1  
ATOM 127   C CB   . ASP A 1 12  ? 20.231  -13.156 0.235   1.00 0.00 ? 12  ASP A CB   1  
ATOM 128   C CG   . ASP A 1 12  ? 20.318  -14.127 1.395   1.00 0.00 ? 12  ASP A CG   1  
ATOM 129   O OD1  . ASP A 1 12  ? 19.874  -15.284 1.236   1.00 0.00 ? 12  ASP A OD1  1  
ATOM 130   O OD2  . ASP A 1 12  ? 20.832  -13.731 2.463   1.00 0.00 ? 12  ASP A OD2  1  
ATOM 131   H H    . ASP A 1 12  ? 19.696  -12.278 -2.132  1.00 0.00 ? 12  ASP A H    1  
ATOM 132   H HA   . ASP A 1 12  ? 18.381  -14.086 -0.300  1.00 0.00 ? 12  ASP A HA   1  
ATOM 133   H HB2  . ASP A 1 12  ? 20.944  -13.460 -0.519  1.00 0.00 ? 12  ASP A HB2  1  
ATOM 134   H HB3  . ASP A 1 12  ? 20.491  -12.170 0.593   1.00 0.00 ? 12  ASP A HB3  1  
ATOM 135   N N    . MET A 1 13  ? 17.605  -11.020 -0.331  1.00 0.00 ? 13  MET A N    1  
ATOM 136   C CA   . MET A 1 13  ? 16.776  -9.978  0.264   1.00 0.00 ? 13  MET A CA   1  
ATOM 137   C C    . MET A 1 13  ? 17.086  -9.818  1.749   1.00 0.00 ? 13  MET A C    1  
ATOM 138   O O    . MET A 1 13  ? 16.185  -9.608  2.561   1.00 0.00 ? 13  MET A O    1  
ATOM 139   C CB   . MET A 1 13  ? 15.294  -10.305 0.072   1.00 0.00 ? 13  MET A CB   1  
ATOM 140   C CG   . MET A 1 13  ? 14.852  -10.291 -1.382  1.00 0.00 ? 13  MET A CG   1  
ATOM 141   S SD   . MET A 1 13  ? 15.059  -8.676  -2.156  1.00 0.00 ? 13  MET A SD   1  
ATOM 142   C CE   . MET A 1 13  ? 13.465  -8.474  -2.949  1.00 0.00 ? 13  MET A CE   1  
ATOM 143   H H    . MET A 1 13  ? 17.902  -10.923 -1.260  1.00 0.00 ? 13  MET A H    1  
ATOM 144   H HA   . MET A 1 13  ? 16.999  -9.050  -0.241  1.00 0.00 ? 13  MET A HA   1  
ATOM 145   H HB2  . MET A 1 13  ? 15.099  -11.287 0.476   1.00 0.00 ? 13  MET A HB2  1  
ATOM 146   H HB3  . MET A 1 13  ? 14.705  -9.578  0.611   1.00 0.00 ? 13  MET A HB3  1  
ATOM 147   H HG2  . MET A 1 13  ? 15.438  -11.014 -1.930  1.00 0.00 ? 13  MET A HG2  1  
ATOM 148   H HG3  . MET A 1 13  ? 13.809  -10.567 -1.429  1.00 0.00 ? 13  MET A HG3  1  
ATOM 149   H HE1  . MET A 1 13  ? 12.782  -7.993  -2.265  1.00 0.00 ? 13  MET A HE1  1  
ATOM 150   H HE2  . MET A 1 13  ? 13.578  -7.864  -3.833  1.00 0.00 ? 13  MET A HE2  1  
ATOM 151   H HE3  . MET A 1 13  ? 13.076  -9.443  -3.226  1.00 0.00 ? 13  MET A HE3  1  
ATOM 152   N N    . ASP A 1 14  ? 18.364  -9.919  2.096   1.00 0.00 ? 14  ASP A N    1  
ATOM 153   C CA   . ASP A 1 14  ? 18.793  -9.785  3.483   1.00 0.00 ? 14  ASP A CA   1  
ATOM 154   C C    . ASP A 1 14  ? 18.943  -8.316  3.866   1.00 0.00 ? 14  ASP A C    1  
ATOM 155   O O    . ASP A 1 14  ? 19.646  -7.558  3.197   1.00 0.00 ? 14  ASP A O    1  
ATOM 156   C CB   . ASP A 1 14  ? 20.115  -10.521 3.705   1.00 0.00 ? 14  ASP A CB   1  
ATOM 157   C CG   . ASP A 1 14  ? 20.491  -10.607 5.171   1.00 0.00 ? 14  ASP A CG   1  
ATOM 158   O OD1  . ASP A 1 14  ? 21.166  -9.679  5.666   1.00 0.00 ? 14  ASP A OD1  1  
ATOM 159   O OD2  . ASP A 1 14  ? 20.111  -11.601 5.823   1.00 0.00 ? 14  ASP A OD2  1  
ATOM 160   H H    . ASP A 1 14  ? 19.036  -10.088 1.402   1.00 0.00 ? 14  ASP A H    1  
ATOM 161   H HA   . ASP A 1 14  ? 18.034  -10.231 4.109   1.00 0.00 ? 14  ASP A HA   1  
ATOM 162   H HB2  . ASP A 1 14  ? 20.031  -11.525 3.315   1.00 0.00 ? 14  ASP A HB2  1  
ATOM 163   H HB3  . ASP A 1 14  ? 20.902  -10.000 3.179   1.00 0.00 ? 14  ASP A HB3  1  
ATOM 164   N N    . THR A 1 15  ? 18.277  -7.920  4.946   1.00 0.00 ? 15  THR A N    1  
ATOM 165   C CA   . THR A 1 15  ? 18.334  -6.542  5.417   1.00 0.00 ? 15  THR A CA   1  
ATOM 166   C C    . THR A 1 15  ? 17.976  -5.565  4.302   1.00 0.00 ? 15  THR A C    1  
ATOM 167   O O    . THR A 1 15  ? 18.737  -4.646  4.001   1.00 0.00 ? 15  THR A O    1  
ATOM 168   C CB   . THR A 1 15  ? 19.732  -6.192  5.961   1.00 0.00 ? 15  THR A CB   1  
ATOM 169   O OG1  . THR A 1 15  ? 20.350  -7.359  6.513   1.00 0.00 ? 15  THR A OG1  1  
ATOM 170   C CG2  . THR A 1 15  ? 19.643  -5.107  7.024   1.00 0.00 ? 15  THR A CG2  1  
ATOM 171   H H    . THR A 1 15  ? 17.734  -8.571  5.437   1.00 0.00 ? 15  THR A H    1  
ATOM 172   H HA   . THR A 1 15  ? 17.621  -6.433  6.220   1.00 0.00 ? 15  THR A HA   1  
ATOM 173   H HB   . THR A 1 15  ? 20.339  -5.825  5.144   1.00 0.00 ? 15  THR A HB   1  
ATOM 174   H HG1  . THR A 1 15  ? 20.244  -8.096  5.906   1.00 0.00 ? 15  THR A HG1  1  
ATOM 175   H HG21 . THR A 1 15  ? 20.594  -4.601  7.103   1.00 0.00 ? 15  THR A HG21 1  
ATOM 176   H HG22 . THR A 1 15  ? 19.394  -5.555  7.974   1.00 0.00 ? 15  THR A HG22 1  
ATOM 177   H HG23 . THR A 1 15  ? 18.880  -4.396  6.749   1.00 0.00 ? 15  THR A HG23 1  
ATOM 178   N N    . SER A 1 16  ? 16.812  -5.769  3.694   1.00 0.00 ? 16  SER A N    1  
ATOM 179   C CA   . SER A 1 16  ? 16.354  -4.908  2.611   1.00 0.00 ? 16  SER A CA   1  
ATOM 180   C C    . SER A 1 16  ? 14.904  -4.485  2.828   1.00 0.00 ? 16  SER A C    1  
ATOM 181   O O    . SER A 1 16  ? 13.977  -5.134  2.342   1.00 0.00 ? 16  SER A O    1  
ATOM 182   C CB   . SER A 1 16  ? 16.492  -5.626  1.267   1.00 0.00 ? 16  SER A CB   1  
ATOM 183   O OG   . SER A 1 16  ? 17.768  -5.398  0.695   1.00 0.00 ? 16  SER A OG   1  
ATOM 184   H H    . SER A 1 16  ? 16.249  -6.519  3.980   1.00 0.00 ? 16  SER A H    1  
ATOM 185   H HA   . SER A 1 16  ? 16.976  -4.025  2.603   1.00 0.00 ? 16  SER A HA   1  
ATOM 186   H HB2  . SER A 1 16  ? 16.361  -6.687  1.414   1.00 0.00 ? 16  SER A HB2  1  
ATOM 187   H HB3  . SER A 1 16  ? 15.735  -5.260  0.587   1.00 0.00 ? 16  SER A HB3  1  
ATOM 188   H HG   . SER A 1 16  ? 17.664  -5.009  -0.176  1.00 0.00 ? 16  SER A HG   1  
ATOM 189   N N    . ASP A 1 17  ? 14.716  -3.394  3.562   1.00 0.00 ? 17  ASP A N    1  
ATOM 190   C CA   . ASP A 1 17  ? 13.380  -2.884  3.845   1.00 0.00 ? 17  ASP A CA   1  
ATOM 191   C C    . ASP A 1 17  ? 12.640  -2.554  2.552   1.00 0.00 ? 17  ASP A C    1  
ATOM 192   O O    . ASP A 1 17  ? 12.664  -1.416  2.082   1.00 0.00 ? 17  ASP A O    1  
ATOM 193   C CB   . ASP A 1 17  ? 13.463  -1.639  4.730   1.00 0.00 ? 17  ASP A CB   1  
ATOM 194   C CG   . ASP A 1 17  ? 14.159  -0.483  4.041   1.00 0.00 ? 17  ASP A CG   1  
ATOM 195   O OD1  . ASP A 1 17  ? 15.407  -0.489  3.986   1.00 0.00 ? 17  ASP A OD1  1  
ATOM 196   O OD2  . ASP A 1 17  ? 13.457  0.428   3.555   1.00 0.00 ? 17  ASP A OD2  1  
ATOM 197   H H    . ASP A 1 17  ? 15.495  -2.921  3.923   1.00 0.00 ? 17  ASP A H    1  
ATOM 198   H HA   . ASP A 1 17  ? 12.835  -3.653  4.371   1.00 0.00 ? 17  ASP A HA   1  
ATOM 199   H HB2  . ASP A 1 17  ? 12.463  -1.327  4.995   1.00 0.00 ? 17  ASP A HB2  1  
ATOM 200   H HB3  . ASP A 1 17  ? 14.010  -1.882  5.630   1.00 0.00 ? 17  ASP A HB3  1  
ATOM 201   N N    . THR A 1 18  ? 11.982  -3.559  1.980   1.00 0.00 ? 18  THR A N    1  
ATOM 202   C CA   . THR A 1 18  ? 11.237  -3.377  0.741   1.00 0.00 ? 18  THR A CA   1  
ATOM 203   C C    . THR A 1 18  ? 9.756   -3.148  1.018   1.00 0.00 ? 18  THR A C    1  
ATOM 204   O O    . THR A 1 18  ? 9.007   -4.096  1.254   1.00 0.00 ? 18  THR A O    1  
ATOM 205   C CB   . THR A 1 18  ? 11.392  -4.594  -0.191  1.00 0.00 ? 18  THR A CB   1  
ATOM 206   O OG1  . THR A 1 18  ? 12.776  -4.930  -0.333  1.00 0.00 ? 18  THR A OG1  1  
ATOM 207   C CG2  . THR A 1 18  ? 10.792  -4.307  -1.560  1.00 0.00 ? 18  THR A CG2  1  
ATOM 208   H H    . THR A 1 18  ? 12.001  -4.442  2.402   1.00 0.00 ? 18  THR A H    1  
ATOM 209   H HA   . THR A 1 18  ? 11.637  -2.510  0.235   1.00 0.00 ? 18  THR A HA   1  
ATOM 210   H HB   . THR A 1 18  ? 10.868  -5.432  0.246   1.00 0.00 ? 18  THR A HB   1  
ATOM 211   H HG1  . THR A 1 18  ? 12.901  -5.445  -1.133  1.00 0.00 ? 18  THR A HG1  1  
ATOM 212   H HG21 . THR A 1 18  ? 10.099  -5.093  -1.821  1.00 0.00 ? 18  THR A HG21 1  
ATOM 213   H HG22 . THR A 1 18  ? 11.581  -4.262  -2.296  1.00 0.00 ? 18  THR A HG22 1  
ATOM 214   H HG23 . THR A 1 18  ? 10.271  -3.362  -1.533  1.00 0.00 ? 18  THR A HG23 1  
ATOM 215   N N    . GLN A 1 19  ? 9.341   -1.886  0.988   1.00 0.00 ? 19  GLN A N    1  
ATOM 216   C CA   . GLN A 1 19  ? 7.948   -1.534  1.236   1.00 0.00 ? 19  GLN A CA   1  
ATOM 217   C C    . GLN A 1 19  ? 7.136   -1.579  -0.055  1.00 0.00 ? 19  GLN A C    1  
ATOM 218   O O    . GLN A 1 19  ? 7.509   -0.965  -1.055  1.00 0.00 ? 19  GLN A O    1  
ATOM 219   C CB   . GLN A 1 19  ? 7.855   -0.142  1.863   1.00 0.00 ? 19  GLN A CB   1  
ATOM 220   C CG   . GLN A 1 19  ? 8.473   -0.057  3.249   1.00 0.00 ? 19  GLN A CG   1  
ATOM 221   C CD   . GLN A 1 19  ? 8.454   1.351   3.811   1.00 0.00 ? 19  GLN A CD   1  
ATOM 222   O OE1  . GLN A 1 19  ? 9.498   1.913   4.144   1.00 0.00 ? 19  GLN A OE1  1  
ATOM 223   N NE2  . GLN A 1 19  ? 7.264   1.930   3.919   1.00 0.00 ? 19  GLN A NE2  1  
ATOM 224   H H    . GLN A 1 19  ? 9.986   -1.175  0.794   1.00 0.00 ? 19  GLN A H    1  
ATOM 225   H HA   . GLN A 1 19  ? 7.542   -2.258  1.927   1.00 0.00 ? 19  GLN A HA   1  
ATOM 226   H HB2  . GLN A 1 19  ? 8.363   0.563   1.222   1.00 0.00 ? 19  GLN A HB2  1  
ATOM 227   H HB3  . GLN A 1 19  ? 6.815   0.137   1.939   1.00 0.00 ? 19  GLN A HB3  1  
ATOM 228   H HG2  . GLN A 1 19  ? 7.919   -0.701  3.917   1.00 0.00 ? 19  GLN A HG2  1  
ATOM 229   H HG3  . GLN A 1 19  ? 9.497   -0.394  3.194   1.00 0.00 ? 19  GLN A HG3  1  
ATOM 230   H HE21 . GLN A 1 19  ? 6.475   1.421   3.636   1.00 0.00 ? 19  GLN A HE21 1  
ATOM 231   H HE22 . GLN A 1 19  ? 7.223   2.839   4.280   1.00 0.00 ? 19  GLN A HE22 1  
ATOM 232   N N    . TRP A 1 20  ? 6.027   -2.308  -0.025  1.00 0.00 ? 20  TRP A N    1  
ATOM 233   C CA   . TRP A 1 20  ? 5.163   -2.432  -1.194  1.00 0.00 ? 20  TRP A CA   1  
ATOM 234   C C    . TRP A 1 20  ? 4.102   -1.337  -1.205  1.00 0.00 ? 20  TRP A C    1  
ATOM 235   O O    . TRP A 1 20  ? 3.420   -1.110  -0.207  1.00 0.00 ? 20  TRP A O    1  
ATOM 236   C CB   . TRP A 1 20  ? 4.494   -3.808  -1.215  1.00 0.00 ? 20  TRP A CB   1  
ATOM 237   C CG   . TRP A 1 20  ? 5.470   -4.942  -1.302  1.00 0.00 ? 20  TRP A CG   1  
ATOM 238   C CD1  . TRP A 1 20  ? 6.155   -5.515  -0.268  1.00 0.00 ? 20  TRP A CD1  1  
ATOM 239   C CD2  . TRP A 1 20  ? 5.872   -5.637  -2.487  1.00 0.00 ? 20  TRP A CD2  1  
ATOM 240   N NE1  . TRP A 1 20  ? 6.958   -6.526  -0.739  1.00 0.00 ? 20  TRP A NE1  1  
ATOM 241   C CE2  . TRP A 1 20  ? 6.802   -6.621  -2.097  1.00 0.00 ? 20  TRP A CE2  1  
ATOM 242   C CE3  . TRP A 1 20  ? 5.536   -5.527  -3.838  1.00 0.00 ? 20  TRP A CE3  1  
ATOM 243   C CZ2  . TRP A 1 20  ? 7.398   -7.486  -3.011  1.00 0.00 ? 20  TRP A CZ2  1  
ATOM 244   C CZ3  . TRP A 1 20  ? 6.129   -6.385  -4.745  1.00 0.00 ? 20  TRP A CZ3  1  
ATOM 245   C CH2  . TRP A 1 20  ? 7.050   -7.355  -4.328  1.00 0.00 ? 20  TRP A CH2  1  
ATOM 246   H H    . TRP A 1 20  ? 5.782   -2.774  0.802   1.00 0.00 ? 20  TRP A H    1  
ATOM 247   H HA   . TRP A 1 20  ? 5.780   -2.329  -2.074  1.00 0.00 ? 20  TRP A HA   1  
ATOM 248   H HB2  . TRP A 1 20  ? 3.916   -3.934  -0.312  1.00 0.00 ? 20  TRP A HB2  1  
ATOM 249   H HB3  . TRP A 1 20  ? 3.837   -3.867  -2.070  1.00 0.00 ? 20  TRP A HB3  1  
ATOM 250   H HD1  . TRP A 1 20  ? 6.068   -5.208  0.763   1.00 0.00 ? 20  TRP A HD1  1  
ATOM 251   H HE1  . TRP A 1 20  ? 7.545   -7.088  -0.191  1.00 0.00 ? 20  TRP A HE1  1  
ATOM 252   H HE3  . TRP A 1 20  ? 4.828   -4.786  -4.179  1.00 0.00 ? 20  TRP A HE3  1  
ATOM 253   H HZ2  . TRP A 1 20  ? 8.110   -8.239  -2.706  1.00 0.00 ? 20  TRP A HZ2  1  
ATOM 254   H HZ3  . TRP A 1 20  ? 5.882   -6.314  -5.794  1.00 0.00 ? 20  TRP A HZ3  1  
ATOM 255   H HH2  . TRP A 1 20  ? 7.489   -8.004  -5.071  1.00 0.00 ? 20  TRP A HH2  1  
ATOM 256   N N    . GLY A 1 21  ? 3.968   -0.661  -2.342  1.00 0.00 ? 21  GLY A N    1  
ATOM 257   C CA   . GLY A 1 21  ? 2.988   0.402   -2.462  1.00 0.00 ? 21  GLY A CA   1  
ATOM 258   C C    . GLY A 1 21  ? 1.812   0.012   -3.335  1.00 0.00 ? 21  GLY A C    1  
ATOM 259   O O    . GLY A 1 21  ? 1.950   -0.809  -4.242  1.00 0.00 ? 21  GLY A O    1  
ATOM 260   H H    . GLY A 1 21  ? 4.540   -0.886  -3.106  1.00 0.00 ? 21  GLY A H    1  
ATOM 261   H HA2  . GLY A 1 21  ? 2.623   0.653   -1.477  1.00 0.00 ? 21  GLY A HA2  1  
ATOM 262   H HA3  . GLY A 1 21  ? 3.466   1.271   -2.890  1.00 0.00 ? 21  GLY A HA3  1  
ATOM 263   N N    . TRP A 1 22  ? 0.653   0.599   -3.062  1.00 0.00 ? 22  TRP A N    1  
ATOM 264   C CA   . TRP A 1 22  ? -0.552  0.306   -3.830  1.00 0.00 ? 22  TRP A CA   1  
ATOM 265   C C    . TRP A 1 22  ? -0.923  1.480   -4.729  1.00 0.00 ? 22  TRP A C    1  
ATOM 266   O O    . TRP A 1 22  ? -0.794  2.640   -4.338  1.00 0.00 ? 22  TRP A O    1  
ATOM 267   C CB   . TRP A 1 22  ? -1.714  -0.019  -2.890  1.00 0.00 ? 22  TRP A CB   1  
ATOM 268   C CG   . TRP A 1 22  ? -1.811  -1.475  -2.547  1.00 0.00 ? 22  TRP A CG   1  
ATOM 269   C CD1  . TRP A 1 22  ? -1.147  -2.128  -1.548  1.00 0.00 ? 22  TRP A CD1  1  
ATOM 270   C CD2  . TRP A 1 22  ? -2.618  -2.458  -3.204  1.00 0.00 ? 22  TRP A CD2  1  
ATOM 271   N NE1  . TRP A 1 22  ? -1.493  -3.458  -1.545  1.00 0.00 ? 22  TRP A NE1  1  
ATOM 272   C CE2  . TRP A 1 22  ? -2.394  -3.685  -2.551  1.00 0.00 ? 22  TRP A CE2  1  
ATOM 273   C CE3  . TRP A 1 22  ? -3.509  -2.420  -4.280  1.00 0.00 ? 22  TRP A CE3  1  
ATOM 274   C CZ2  . TRP A 1 22  ? -3.029  -4.862  -2.940  1.00 0.00 ? 22  TRP A CZ2  1  
ATOM 275   C CZ3  . TRP A 1 22  ? -4.138  -3.589  -4.665  1.00 0.00 ? 22  TRP A CZ3  1  
ATOM 276   C CH2  . TRP A 1 22  ? -3.896  -4.796  -3.996  1.00 0.00 ? 22  TRP A CH2  1  
ATOM 277   H H    . TRP A 1 22  ? 0.606   1.246   -2.326  1.00 0.00 ? 22  TRP A H    1  
ATOM 278   H HA   . TRP A 1 22  ? -0.349  -0.556  -4.448  1.00 0.00 ? 22  TRP A HA   1  
ATOM 279   H HB2  . TRP A 1 22  ? -1.590  0.532   -1.970  1.00 0.00 ? 22  TRP A HB2  1  
ATOM 280   H HB3  . TRP A 1 22  ? -2.641  0.276   -3.360  1.00 0.00 ? 22  TRP A HB3  1  
ATOM 281   H HD1  . TRP A 1 22  ? -0.453  -1.656  -0.869  1.00 0.00 ? 22  TRP A HD1  1  
ATOM 282   H HE1  . TRP A 1 22  ? -1.150  -4.133  -0.922  1.00 0.00 ? 22  TRP A HE1  1  
ATOM 283   H HE3  . TRP A 1 22  ? -3.709  -1.500  -4.808  1.00 0.00 ? 22  TRP A HE3  1  
ATOM 284   H HZ2  . TRP A 1 22  ? -2.854  -5.800  -2.434  1.00 0.00 ? 22  TRP A HZ2  1  
ATOM 285   H HZ3  . TRP A 1 22  ? -4.830  -3.579  -5.495  1.00 0.00 ? 22  TRP A HZ3  1  
ATOM 286   H HH2  . TRP A 1 22  ? -4.409  -5.684  -4.331  1.00 0.00 ? 22  TRP A HH2  1  
ATOM 287   N N    . PHE A 1 23  ? -1.385  1.172   -5.937  1.00 0.00 ? 23  PHE A N    1  
ATOM 288   C CA   . PHE A 1 23  ? -1.774  2.202   -6.893  1.00 0.00 ? 23  PHE A CA   1  
ATOM 289   C C    . PHE A 1 23  ? -3.090  1.842   -7.575  1.00 0.00 ? 23  PHE A C    1  
ATOM 290   O O    . PHE A 1 23  ? -3.516  0.687   -7.555  1.00 0.00 ? 23  PHE A O    1  
ATOM 291   C CB   . PHE A 1 23  ? -0.678  2.394   -7.943  1.00 0.00 ? 23  PHE A CB   1  
ATOM 292   C CG   . PHE A 1 23  ? 0.655   2.765   -7.357  1.00 0.00 ? 23  PHE A CG   1  
ATOM 293   C CD1  . PHE A 1 23  ? 1.468   1.801   -6.784  1.00 0.00 ? 23  PHE A CD1  1  
ATOM 294   C CD2  . PHE A 1 23  ? 1.095   4.079   -7.381  1.00 0.00 ? 23  PHE A CD2  1  
ATOM 295   C CE1  . PHE A 1 23  ? 2.694   2.141   -6.244  1.00 0.00 ? 23  PHE A CE1  1  
ATOM 296   C CE2  . PHE A 1 23  ? 2.320   4.425   -6.843  1.00 0.00 ? 23  PHE A CE2  1  
ATOM 297   C CZ   . PHE A 1 23  ? 3.121   3.454   -6.275  1.00 0.00 ? 23  PHE A CZ   1  
ATOM 298   H H    . PHE A 1 23  ? -1.465  0.228   -6.191  1.00 0.00 ? 23  PHE A H    1  
ATOM 299   H HA   . PHE A 1 23  ? -1.905  3.125   -6.349  1.00 0.00 ? 23  PHE A HA   1  
ATOM 300   H HB2  . PHE A 1 23  ? -0.552  1.474   -8.494  1.00 0.00 ? 23  PHE A HB2  1  
ATOM 301   H HB3  . PHE A 1 23  ? -0.974  3.179   -8.622  1.00 0.00 ? 23  PHE A HB3  1  
ATOM 302   H HD1  . PHE A 1 23  ? 1.135   0.774   -6.760  1.00 0.00 ? 23  PHE A HD1  1  
ATOM 303   H HD2  . PHE A 1 23  ? 0.469   4.840   -7.826  1.00 0.00 ? 23  PHE A HD2  1  
ATOM 304   H HE1  . PHE A 1 23  ? 3.318   1.380   -5.800  1.00 0.00 ? 23  PHE A HE1  1  
ATOM 305   H HE2  . PHE A 1 23  ? 2.651   5.452   -6.869  1.00 0.00 ? 23  PHE A HE2  1  
ATOM 306   H HZ   . PHE A 1 23  ? 4.078   3.721   -5.853  1.00 0.00 ? 23  PHE A HZ   1  
ATOM 307   N N    . TYR A 1 24  ? -3.729  2.838   -8.178  1.00 0.00 ? 24  TYR A N    1  
ATOM 308   C CA   . TYR A 1 24  ? -4.998  2.628   -8.864  1.00 0.00 ? 24  TYR A CA   1  
ATOM 309   C C    . TYR A 1 24  ? -5.093  3.499   -10.113 1.00 0.00 ? 24  TYR A C    1  
ATOM 310   O O    . TYR A 1 24  ? -4.834  4.703   -10.066 1.00 0.00 ? 24  TYR A O    1  
ATOM 311   C CB   . TYR A 1 24  ? -6.167  2.933   -7.925  1.00 0.00 ? 24  TYR A CB   1  
ATOM 312   C CG   . TYR A 1 24  ? -6.378  4.410   -7.682  1.00 0.00 ? 24  TYR A CG   1  
ATOM 313   C CD1  . TYR A 1 24  ? -5.719  5.066   -6.650  1.00 0.00 ? 24  TYR A CD1  1  
ATOM 314   C CD2  . TYR A 1 24  ? -7.238  5.150   -8.485  1.00 0.00 ? 24  TYR A CD2  1  
ATOM 315   C CE1  . TYR A 1 24  ? -5.909  6.416   -6.424  1.00 0.00 ? 24  TYR A CE1  1  
ATOM 316   C CE2  . TYR A 1 24  ? -7.433  6.500   -8.267  1.00 0.00 ? 24  TYR A CE2  1  
ATOM 317   C CZ   . TYR A 1 24  ? -6.767  7.128   -7.236  1.00 0.00 ? 24  TYR A CZ   1  
ATOM 318   O OH   . TYR A 1 24  ? -6.961  8.473   -7.014  1.00 0.00 ? 24  TYR A OH   1  
ATOM 319   H H    . TYR A 1 24  ? -3.339  3.737   -8.160  1.00 0.00 ? 24  TYR A H    1  
ATOM 320   H HA   . TYR A 1 24  ? -5.048  1.590   -9.159  1.00 0.00 ? 24  TYR A HA   1  
ATOM 321   H HB2  . TYR A 1 24  ? -7.075  2.534   -8.350  1.00 0.00 ? 24  TYR A HB2  1  
ATOM 322   H HB3  . TYR A 1 24  ? -5.984  2.462   -6.970  1.00 0.00 ? 24  TYR A HB3  1  
ATOM 323   H HD1  . TYR A 1 24  ? -5.047  4.505   -6.016  1.00 0.00 ? 24  TYR A HD1  1  
ATOM 324   H HD2  . TYR A 1 24  ? -7.758  4.655   -9.292  1.00 0.00 ? 24  TYR A HD2  1  
ATOM 325   H HE1  . TYR A 1 24  ? -5.388  6.908   -5.616  1.00 0.00 ? 24  TYR A HE1  1  
ATOM 326   H HE2  . TYR A 1 24  ? -8.106  7.058   -8.902  1.00 0.00 ? 24  TYR A HE2  1  
ATOM 327   H HH   . TYR A 1 24  ? -7.241  8.610   -6.107  1.00 0.00 ? 24  TYR A HH   1  
ATOM 328   N N    . LEU A 1 25  ? -5.468  2.883   -11.229 1.00 0.00 ? 25  LEU A N    1  
ATOM 329   C CA   . LEU A 1 25  ? -5.599  3.602   -12.492 1.00 0.00 ? 25  LEU A CA   1  
ATOM 330   C C    . LEU A 1 25  ? -6.707  4.647   -12.411 1.00 0.00 ? 25  LEU A C    1  
ATOM 331   O O    . LEU A 1 25  ? -7.729  4.433   -11.760 1.00 0.00 ? 25  LEU A O    1  
ATOM 332   C CB   . LEU A 1 25  ? -5.887  2.622   -13.630 1.00 0.00 ? 25  LEU A CB   1  
ATOM 333   C CG   . LEU A 1 25  ? -6.101  3.242   -15.012 1.00 0.00 ? 25  LEU A CG   1  
ATOM 334   C CD1  . LEU A 1 25  ? -4.767  3.489   -15.699 1.00 0.00 ? 25  LEU A CD1  1  
ATOM 335   C CD2  . LEU A 1 25  ? -6.987  2.348   -15.867 1.00 0.00 ? 25  LEU A CD2  1  
ATOM 336   H H    . LEU A 1 25  ? -5.661  1.923   -11.204 1.00 0.00 ? 25  LEU A H    1  
ATOM 337   H HA   . LEU A 1 25  ? -4.662  4.102   -12.687 1.00 0.00 ? 25  LEU A HA   1  
ATOM 338   H HB2  . LEU A 1 25  ? -5.053  1.941   -13.700 1.00 0.00 ? 25  LEU A HB2  1  
ATOM 339   H HB3  . LEU A 1 25  ? -6.780  2.070   -13.373 1.00 0.00 ? 25  LEU A HB3  1  
ATOM 340   H HG   . LEU A 1 25  ? -6.599  4.196   -14.898 1.00 0.00 ? 25  LEU A HG   1  
ATOM 341   H HD11 . LEU A 1 25  ? -4.830  3.175   -16.730 1.00 0.00 ? 25  LEU A HD11 1  
ATOM 342   H HD12 . LEU A 1 25  ? -3.995  2.926   -15.197 1.00 0.00 ? 25  LEU A HD12 1  
ATOM 343   H HD13 . LEU A 1 25  ? -4.530  4.542   -15.656 1.00 0.00 ? 25  LEU A HD13 1  
ATOM 344   H HD21 . LEU A 1 25  ? -7.676  2.958   -16.431 1.00 0.00 ? 25  LEU A HD21 1  
ATOM 345   H HD22 . LEU A 1 25  ? -7.541  1.674   -15.229 1.00 0.00 ? 25  LEU A HD22 1  
ATOM 346   H HD23 . LEU A 1 25  ? -6.372  1.777   -16.546 1.00 0.00 ? 25  LEU A HD23 1  
ATOM 347   N N    . ALA A 1 26  ? -6.497  5.776   -13.080 1.00 0.00 ? 26  ALA A N    1  
ATOM 348   C CA   . ALA A 1 26  ? -7.480  6.853   -13.088 1.00 0.00 ? 26  ALA A CA   1  
ATOM 349   C C    . ALA A 1 26  ? -8.230  6.902   -14.415 1.00 0.00 ? 26  ALA A C    1  
ATOM 350   O O    . ALA A 1 26  ? -8.037  6.047   -15.278 1.00 0.00 ? 26  ALA A O    1  
ATOM 351   C CB   . ALA A 1 26  ? -6.804  8.187   -12.812 1.00 0.00 ? 26  ALA A CB   1  
ATOM 352   H H    . ALA A 1 26  ? -5.663  5.887   -13.581 1.00 0.00 ? 26  ALA A H    1  
ATOM 353   H HA   . ALA A 1 26  ? -8.188  6.664   -12.293 1.00 0.00 ? 26  ALA A HA   1  
ATOM 354   H HB1  . ALA A 1 26  ? -7.529  8.983   -12.901 1.00 0.00 ? 26  ALA A HB1  1  
ATOM 355   H HB2  . ALA A 1 26  ? -6.394  8.183   -11.813 1.00 0.00 ? 26  ALA A HB2  1  
ATOM 356   H HB3  . ALA A 1 26  ? -6.010  8.342   -13.527 1.00 0.00 ? 26  ALA A HB3  1  
ATOM 357   N N    . GLU A 1 27  ? -9.086  7.907   -14.569 1.00 0.00 ? 27  GLU A N    1  
ATOM 358   C CA   . GLU A 1 27  ? -9.865  8.065   -15.791 1.00 0.00 ? 27  GLU A CA   1  
ATOM 359   C C    . GLU A 1 27  ? -9.015  8.672   -16.904 1.00 0.00 ? 27  GLU A C    1  
ATOM 360   O O    . GLU A 1 27  ? -9.192  8.351   -18.080 1.00 0.00 ? 27  GLU A O    1  
ATOM 361   C CB   . GLU A 1 27  ? -11.089 8.946   -15.531 1.00 0.00 ? 27  GLU A CB   1  
ATOM 362   C CG   . GLU A 1 27  ? -10.744 10.323  -14.990 1.00 0.00 ? 27  GLU A CG   1  
ATOM 363   C CD   . GLU A 1 27  ? -11.974 11.156  -14.686 1.00 0.00 ? 27  GLU A CD   1  
ATOM 364   O OE1  . GLU A 1 27  ? -12.869 10.656  -13.974 1.00 0.00 ? 27  GLU A OE1  1  
ATOM 365   O OE2  . GLU A 1 27  ? -12.041 12.309  -15.162 1.00 0.00 ? 27  GLU A OE2  1  
ATOM 366   H H    . GLU A 1 27  ? -9.196  8.557   -13.844 1.00 0.00 ? 27  GLU A H    1  
ATOM 367   H HA   . GLU A 1 27  ? -10.198 7.086   -16.101 1.00 0.00 ? 27  GLU A HA   1  
ATOM 368   H HB2  . GLU A 1 27  ? -11.631 9.071   -16.457 1.00 0.00 ? 27  GLU A HB2  1  
ATOM 369   H HB3  . GLU A 1 27  ? -11.728 8.451   -14.815 1.00 0.00 ? 27  GLU A HB3  1  
ATOM 370   H HG2  . GLU A 1 27  ? -10.175 10.206  -14.080 1.00 0.00 ? 27  GLU A HG2  1  
ATOM 371   H HG3  . GLU A 1 27  ? -10.146 10.845  -15.722 1.00 0.00 ? 27  GLU A HG3  1  
ATOM 372   N N    . CYS A 1 28  ? -8.094  9.550   -16.524 1.00 0.00 ? 28  CYS A N    1  
ATOM 373   C CA   . CYS A 1 28  ? -7.217  10.203  -17.489 1.00 0.00 ? 28  CYS A CA   1  
ATOM 374   C C    . CYS A 1 28  ? -6.215  9.212   -18.072 1.00 0.00 ? 28  CYS A C    1  
ATOM 375   O O    . CYS A 1 28  ? -5.791  9.344   -19.219 1.00 0.00 ? 28  CYS A O    1  
ATOM 376   C CB   . CYS A 1 28  ? -6.476  11.368  -16.830 1.00 0.00 ? 28  CYS A CB   1  
ATOM 377   S SG   . CYS A 1 28  ? -7.466  12.871  -16.660 1.00 0.00 ? 28  CYS A SG   1  
ATOM 378   H H    . CYS A 1 28  ? -8.001  9.765   -15.573 1.00 0.00 ? 28  CYS A H    1  
ATOM 379   H HA   . CYS A 1 28  ? -7.832  10.586  -18.289 1.00 0.00 ? 28  CYS A HA   1  
ATOM 380   H HB2  . CYS A 1 28  ? -6.160  11.070  -15.841 1.00 0.00 ? 28  CYS A HB2  1  
ATOM 381   H HB3  . CYS A 1 28  ? -5.605  11.611  -17.421 1.00 0.00 ? 28  CYS A HB3  1  
ATOM 382   H HG   . CYS A 1 28  ? -8.741  12.517  -16.612 1.00 0.00 ? 28  CYS A HG   1  
ATOM 383   N N    . GLY A 1 29  ? -5.839  8.219   -17.271 1.00 0.00 ? 29  GLY A N    1  
ATOM 384   C CA   . GLY A 1 29  ? -4.888  7.220   -17.724 1.00 0.00 ? 29  GLY A CA   1  
ATOM 385   C C    . GLY A 1 29  ? -3.578  7.281   -16.965 1.00 0.00 ? 29  GLY A C    1  
ATOM 386   O O    . GLY A 1 29  ? -2.512  7.031   -17.528 1.00 0.00 ? 29  GLY A O    1  
ATOM 387   H H    . GLY A 1 29  ? -6.211  8.164   -16.366 1.00 0.00 ? 29  GLY A H    1  
ATOM 388   H HA2  . GLY A 1 29  ? -5.323  6.240   -17.595 1.00 0.00 ? 29  GLY A HA2  1  
ATOM 389   H HA3  . GLY A 1 29  ? -4.690  7.379   -18.774 1.00 0.00 ? 29  GLY A HA3  1  
ATOM 390   N N    . LYS A 1 30  ? -3.655  7.615   -15.681 1.00 0.00 ? 30  LYS A N    1  
ATOM 391   C CA   . LYS A 1 30  ? -2.467  7.709   -14.842 1.00 0.00 ? 30  LYS A CA   1  
ATOM 392   C C    . LYS A 1 30  ? -2.700  7.039   -13.491 1.00 0.00 ? 30  LYS A C    1  
ATOM 393   O O    . LYS A 1 30  ? -3.569  7.453   -12.724 1.00 0.00 ? 30  LYS A O    1  
ATOM 394   C CB   . LYS A 1 30  ? -2.077  9.174   -14.635 1.00 0.00 ? 30  LYS A CB   1  
ATOM 395   C CG   . LYS A 1 30  ? -1.343  9.781   -15.818 1.00 0.00 ? 30  LYS A CG   1  
ATOM 396   C CD   . LYS A 1 30  ? 0.129   9.403   -15.814 1.00 0.00 ? 30  LYS A CD   1  
ATOM 397   C CE   . LYS A 1 30  ? 0.937   10.317  -14.906 1.00 0.00 ? 30  LYS A CE   1  
ATOM 398   N NZ   . LYS A 1 30  ? 2.214   9.684   -14.475 1.00 0.00 ? 30  LYS A NZ   1  
ATOM 399   H H    . LYS A 1 30  ? -4.534  7.803   -15.288 1.00 0.00 ? 30  LYS A H    1  
ATOM 400   H HA   . LYS A 1 30  ? -1.661  7.199   -15.349 1.00 0.00 ? 30  LYS A HA   1  
ATOM 401   H HB2  . LYS A 1 30  ? -2.974  9.751   -14.460 1.00 0.00 ? 30  LYS A HB2  1  
ATOM 402   H HB3  . LYS A 1 30  ? -1.439  9.245   -13.766 1.00 0.00 ? 30  LYS A HB3  1  
ATOM 403   H HG2  . LYS A 1 30  ? -1.793  9.423   -16.732 1.00 0.00 ? 30  LYS A HG2  1  
ATOM 404   H HG3  . LYS A 1 30  ? -1.428  10.857  -15.769 1.00 0.00 ? 30  LYS A HG3  1  
ATOM 405   H HD2  . LYS A 1 30  ? 0.230   8.386   -15.463 1.00 0.00 ? 30  LYS A HD2  1  
ATOM 406   H HD3  . LYS A 1 30  ? 0.514   9.477   -16.821 1.00 0.00 ? 30  LYS A HD3  1  
ATOM 407   H HE2  . LYS A 1 30  ? 1.160   11.228  -15.441 1.00 0.00 ? 30  LYS A HE2  1  
ATOM 408   H HE3  . LYS A 1 30  ? 0.347   10.549  -14.032 1.00 0.00 ? 30  LYS A HE3  1  
ATOM 409   H HZ1  . LYS A 1 30  ? 3.012   10.093  -15.002 1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 410   H HZ2  . LYS A 1 30  ? 2.184   8.660   -14.655 1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 411   H HZ3  . LYS A 1 30  ? 2.366   9.842   -13.459 1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 412   N N    . TRP A 1 31  ? -1.919  6.003   -13.208 1.00 0.00 ? 31  TRP A N    1  
ATOM 413   C CA   . TRP A 1 31  ? -2.040  5.276   -11.949 1.00 0.00 ? 31  TRP A CA   1  
ATOM 414   C C    . TRP A 1 31  ? -1.627  6.153   -10.772 1.00 0.00 ? 31  TRP A C    1  
ATOM 415   O O    . TRP A 1 31  ? -0.468  6.555   -10.662 1.00 0.00 ? 31  TRP A O    1  
ATOM 416   C CB   . TRP A 1 31  ? -1.183  4.010   -11.982 1.00 0.00 ? 31  TRP A CB   1  
ATOM 417   C CG   . TRP A 1 31  ? -1.547  3.076   -13.097 1.00 0.00 ? 31  TRP A CG   1  
ATOM 418   C CD1  . TRP A 1 31  ? -1.166  3.173   -14.405 1.00 0.00 ? 31  TRP A CD1  1  
ATOM 419   C CD2  . TRP A 1 31  ? -2.364  1.905   -13.001 1.00 0.00 ? 31  TRP A CD2  1  
ATOM 420   N NE1  . TRP A 1 31  ? -1.698  2.133   -15.128 1.00 0.00 ? 31  TRP A NE1  1  
ATOM 421   C CE2  . TRP A 1 31  ? -2.436  1.340   -14.290 1.00 0.00 ? 31  TRP A CE2  1  
ATOM 422   C CE3  . TRP A 1 31  ? -3.041  1.277   -11.953 1.00 0.00 ? 31  TRP A CE3  1  
ATOM 423   C CZ2  . TRP A 1 31  ? -3.159  0.180   -14.555 1.00 0.00 ? 31  TRP A CZ2  1  
ATOM 424   C CZ3  . TRP A 1 31  ? -3.758  0.125   -12.217 1.00 0.00 ? 31  TRP A CZ3  1  
ATOM 425   C CH2  . TRP A 1 31  ? -3.812  -0.414  -13.509 1.00 0.00 ? 31  TRP A CH2  1  
ATOM 426   H H    . TRP A 1 31  ? -1.244  5.719   -13.860 1.00 0.00 ? 31  TRP A H    1  
ATOM 427   H HA   . TRP A 1 31  ? -3.076  4.996   -11.827 1.00 0.00 ? 31  TRP A HA   1  
ATOM 428   H HB2  . TRP A 1 31  ? -0.147  4.287   -12.104 1.00 0.00 ? 31  TRP A HB2  1  
ATOM 429   H HB3  . TRP A 1 31  ? -1.303  3.479   -11.049 1.00 0.00 ? 31  TRP A HB3  1  
ATOM 430   H HD1  . TRP A 1 31  ? -0.540  3.959   -14.799 1.00 0.00 ? 31  TRP A HD1  1  
ATOM 431   H HE1  . TRP A 1 31  ? -1.568  1.983   -16.088 1.00 0.00 ? 31  TRP A HE1  1  
ATOM 432   H HE3  . TRP A 1 31  ? -3.012  1.677   -10.950 1.00 0.00 ? 31  TRP A HE3  1  
ATOM 433   H HZ2  . TRP A 1 31  ? -3.210  -0.248  -15.546 1.00 0.00 ? 31  TRP A HZ2  1  
ATOM 434   H HZ3  . TRP A 1 31  ? -4.288  -0.374  -11.419 1.00 0.00 ? 31  TRP A HZ3  1  
ATOM 435   H HH2  . TRP A 1 31  ? -4.384  -1.314  -13.670 1.00 0.00 ? 31  TRP A HH2  1  
ATOM 436   N N    . HIS A 1 32  ? -2.581  6.447   -9.895  1.00 0.00 ? 32  HIS A N    1  
ATOM 437   C CA   . HIS A 1 32  ? -2.315  7.277   -8.725  1.00 0.00 ? 32  HIS A CA   1  
ATOM 438   C C    . HIS A 1 32  ? -2.167  6.418   -7.472  1.00 0.00 ? 32  HIS A C    1  
ATOM 439   O O    . HIS A 1 32  ? -2.928  5.475   -7.262  1.00 0.00 ? 32  HIS A O    1  
ATOM 440   C CB   . HIS A 1 32  ? -3.439  8.295   -8.529  1.00 0.00 ? 32  HIS A CB   1  
ATOM 441   C CG   . HIS A 1 32  ? -3.601  9.236   -9.683  1.00 0.00 ? 32  HIS A CG   1  
ATOM 442   N ND1  . HIS A 1 32  ? -2.536  9.831   -10.326 1.00 0.00 ? 32  HIS A ND1  1  
ATOM 443   C CD2  . HIS A 1 32  ? -4.714  9.683   -10.311 1.00 0.00 ? 32  HIS A CD2  1  
ATOM 444   C CE1  . HIS A 1 32  ? -2.987  10.604  -11.297 1.00 0.00 ? 32  HIS A CE1  1  
ATOM 445   N NE2  . HIS A 1 32  ? -4.305  10.532  -11.310 1.00 0.00 ? 32  HIS A NE2  1  
ATOM 446   H H    . HIS A 1 32  ? -3.485  6.097   -10.037 1.00 0.00 ? 32  HIS A H    1  
ATOM 447   H HA   . HIS A 1 32  ? -1.389  7.804   -8.896  1.00 0.00 ? 32  HIS A HA   1  
ATOM 448   H HB2  . HIS A 1 32  ? -4.373  7.770   -8.396  1.00 0.00 ? 32  HIS A HB2  1  
ATOM 449   H HB3  . HIS A 1 32  ? -3.233  8.884   -7.647  1.00 0.00 ? 32  HIS A HB3  1  
ATOM 450   H HD1  . HIS A 1 32  ? -1.591  9.706   -10.101 1.00 0.00 ? 32  HIS A HD1  1  
ATOM 451   H HD2  . HIS A 1 32  ? -5.735  9.422   -10.070 1.00 0.00 ? 32  HIS A HD2  1  
ATOM 452   H HE1  . HIS A 1 32  ? -2.381  11.195  -11.968 1.00 0.00 ? 32  HIS A HE1  1  
ATOM 453   N N    . MET A 1 33  ? -1.182  6.752   -6.645  1.00 0.00 ? 33  MET A N    1  
ATOM 454   C CA   . MET A 1 33  ? -0.934  6.012   -5.413  1.00 0.00 ? 33  MET A CA   1  
ATOM 455   C C    . MET A 1 33  ? -1.993  6.334   -4.364  1.00 0.00 ? 33  MET A C    1  
ATOM 456   O O    . MET A 1 33  ? -2.594  7.409   -4.383  1.00 0.00 ? 33  MET A O    1  
ATOM 457   C CB   . MET A 1 33  ? 0.457   6.338   -4.868  1.00 0.00 ? 33  MET A CB   1  
ATOM 458   C CG   . MET A 1 33  ? 0.949   5.346   -3.826  1.00 0.00 ? 33  MET A CG   1  
ATOM 459   S SD   . MET A 1 33  ? 0.492   5.818   -2.147  1.00 0.00 ? 33  MET A SD   1  
ATOM 460   C CE   . MET A 1 33  ? 2.104   5.924   -1.374  1.00 0.00 ? 33  MET A CE   1  
ATOM 461   H H    . MET A 1 33  ? -0.608  7.515   -6.867  1.00 0.00 ? 33  MET A H    1  
ATOM 462   H HA   . MET A 1 33  ? -0.983  4.959   -5.645  1.00 0.00 ? 33  MET A HA   1  
ATOM 463   H HB2  . MET A 1 33  ? 1.160   6.345   -5.687  1.00 0.00 ? 33  MET A HB2  1  
ATOM 464   H HB3  . MET A 1 33  ? 0.434   7.318   -4.416  1.00 0.00 ? 33  MET A HB3  1  
ATOM 465   H HG2  . MET A 1 33  ? 0.523   4.377   -4.041  1.00 0.00 ? 33  MET A HG2  1  
ATOM 466   H HG3  . MET A 1 33  ? 2.026   5.285   -3.888  1.00 0.00 ? 33  MET A HG3  1  
ATOM 467   H HE1  . MET A 1 33  ? 2.624   4.985   -1.495  1.00 0.00 ? 33  MET A HE1  1  
ATOM 468   H HE2  . MET A 1 33  ? 2.675   6.714   -1.840  1.00 0.00 ? 33  MET A HE2  1  
ATOM 469   H HE3  . MET A 1 33  ? 1.985   6.137   -0.322  1.00 0.00 ? 33  MET A HE3  1  
ATOM 470   N N    . PHE A 1 34  ? -2.217  5.397   -3.448  1.00 0.00 ? 34  PHE A N    1  
ATOM 471   C CA   . PHE A 1 34  ? -3.205  5.581   -2.391  1.00 0.00 ? 34  PHE A CA   1  
ATOM 472   C C    . PHE A 1 34  ? -2.667  6.500   -1.298  1.00 0.00 ? 34  PHE A C    1  
ATOM 473   O O    . PHE A 1 34  ? -1.777  6.120   -0.537  1.00 0.00 ? 34  PHE A O    1  
ATOM 474   C CB   . PHE A 1 34  ? -3.597  4.230   -1.790  1.00 0.00 ? 34  PHE A CB   1  
ATOM 475   C CG   . PHE A 1 34  ? -4.441  3.389   -2.705  1.00 0.00 ? 34  PHE A CG   1  
ATOM 476   C CD1  . PHE A 1 34  ? -5.815  3.561   -2.756  1.00 0.00 ? 34  PHE A CD1  1  
ATOM 477   C CD2  . PHE A 1 34  ? -3.860  2.426   -3.515  1.00 0.00 ? 34  PHE A CD2  1  
ATOM 478   C CE1  . PHE A 1 34  ? -6.593  2.788   -3.596  1.00 0.00 ? 34  PHE A CE1  1  
ATOM 479   C CE2  . PHE A 1 34  ? -4.633  1.650   -4.358  1.00 0.00 ? 34  PHE A CE2  1  
ATOM 480   C CZ   . PHE A 1 34  ? -6.002  1.832   -4.399  1.00 0.00 ? 34  PHE A CZ   1  
ATOM 481   H H    . PHE A 1 34  ? -1.706  4.561   -3.485  1.00 0.00 ? 34  PHE A H    1  
ATOM 482   H HA   . PHE A 1 34  ? -4.078  6.037   -2.831  1.00 0.00 ? 34  PHE A HA   1  
ATOM 483   H HB2  . PHE A 1 34  ? -2.702  3.673   -1.560  1.00 0.00 ? 34  PHE A HB2  1  
ATOM 484   H HB3  . PHE A 1 34  ? -4.156  4.397   -0.882  1.00 0.00 ? 34  PHE A HB3  1  
ATOM 485   H HD1  . PHE A 1 34  ? -6.279  4.309   -2.130  1.00 0.00 ? 34  PHE A HD1  1  
ATOM 486   H HD2  . PHE A 1 34  ? -2.789  2.283   -3.483  1.00 0.00 ? 34  PHE A HD2  1  
ATOM 487   H HE1  . PHE A 1 34  ? -7.663  2.933   -3.627  1.00 0.00 ? 34  PHE A HE1  1  
ATOM 488   H HE2  . PHE A 1 34  ? -4.167  0.904   -4.984  1.00 0.00 ? 34  PHE A HE2  1  
ATOM 489   H HZ   . PHE A 1 34  ? -6.608  1.227   -5.056  1.00 0.00 ? 34  PHE A HZ   1  
ATOM 490   N N    . GLN A 1 35  ? -3.213  7.709   -1.229  1.00 0.00 ? 35  GLN A N    1  
ATOM 491   C CA   . GLN A 1 35  ? -2.787  8.683   -0.230  1.00 0.00 ? 35  GLN A CA   1  
ATOM 492   C C    . GLN A 1 35  ? -3.852  8.859   0.847   1.00 0.00 ? 35  GLN A C    1  
ATOM 493   O O    . GLN A 1 35  ? -5.053  8.817   0.580   1.00 0.00 ? 35  GLN A O    1  
ATOM 494   C CB   . GLN A 1 35  ? -2.489  10.028  -0.894  1.00 0.00 ? 35  GLN A CB   1  
ATOM 495   C CG   . GLN A 1 35  ? -1.298  9.991   -1.837  1.00 0.00 ? 35  GLN A CG   1  
ATOM 496   C CD   . GLN A 1 35  ? -1.690  9.639   -3.259  1.00 0.00 ? 35  GLN A CD   1  
ATOM 497   O OE1  . GLN A 1 35  ? -2.867  9.680   -3.618  1.00 0.00 ? 35  GLN A OE1  1  
ATOM 498   N NE2  . GLN A 1 35  ? -0.703  9.291   -4.076  1.00 0.00 ? 35  GLN A NE2  1  
ATOM 499   H H    . GLN A 1 35  ? -3.918  7.953   -1.863  1.00 0.00 ? 35  GLN A H    1  
ATOM 500   H HA   . GLN A 1 35  ? -1.885  8.311   0.231   1.00 0.00 ? 35  GLN A HA   1  
ATOM 501   H HB2  . GLN A 1 35  ? -3.357  10.339  -1.456  1.00 0.00 ? 35  GLN A HB2  1  
ATOM 502   H HB3  . GLN A 1 35  ? -2.288  10.759  -0.124  1.00 0.00 ? 35  GLN A HB3  1  
ATOM 503   H HG2  . GLN A 1 35  ? -0.826  10.962  -1.841  1.00 0.00 ? 35  GLN A HG2  1  
ATOM 504   H HG3  . GLN A 1 35  ? -0.595  9.252   -1.480  1.00 0.00 ? 35  GLN A HG3  1  
ATOM 505   H HE21 . GLN A 1 35  ? 0.210   9.279   -3.720  1.00 0.00 ? 35  GLN A HE21 1  
ATOM 506   H HE22 . GLN A 1 35  ? -0.928  9.058   -5.000  1.00 0.00 ? 35  GLN A HE22 1  
ATOM 507   N N    . PRO A 1 36  ? -3.404  9.060   2.096   1.00 0.00 ? 36  PRO A N    1  
ATOM 508   C CA   . PRO A 1 36  ? -4.303  9.247   3.239   1.00 0.00 ? 36  PRO A CA   1  
ATOM 509   C C    . PRO A 1 36  ? -5.041  10.580  3.184   1.00 0.00 ? 36  PRO A C    1  
ATOM 510   O O    . PRO A 1 36  ? -4.495  11.585  2.730   1.00 0.00 ? 36  PRO A O    1  
ATOM 511   C CB   . PRO A 1 36  ? -3.358  9.208   4.442   1.00 0.00 ? 36  PRO A CB   1  
ATOM 512   C CG   . PRO A 1 36  ? -2.036  9.632   3.901   1.00 0.00 ? 36  PRO A CG   1  
ATOM 513   C CD   . PRO A 1 36  ? -1.986  9.122   2.487   1.00 0.00 ? 36  PRO A CD   1  
ATOM 514   H HA   . PRO A 1 36  ? -5.019  8.442   3.315   1.00 0.00 ? 36  PRO A HA   1  
ATOM 515   H HB2  . PRO A 1 36  ? -3.711  9.891   5.203   1.00 0.00 ? 36  PRO A HB2  1  
ATOM 516   H HB3  . PRO A 1 36  ? -3.318  8.206   4.841   1.00 0.00 ? 36  PRO A HB3  1  
ATOM 517   H HG2  . PRO A 1 36  ? -1.962  10.709  3.914   1.00 0.00 ? 36  PRO A HG2  1  
ATOM 518   H HG3  . PRO A 1 36  ? -1.242  9.192   4.486   1.00 0.00 ? 36  PRO A HG3  1  
ATOM 519   H HD2  . PRO A 1 36  ? -1.442  9.810   1.857   1.00 0.00 ? 36  PRO A HD2  1  
ATOM 520   H HD3  . PRO A 1 36  ? -1.535  8.141   2.455   1.00 0.00 ? 36  PRO A HD3  1  
ATOM 521   N N    . ASP A 1 37  ? -6.286  10.581  3.649   1.00 0.00 ? 37  ASP A N    1  
ATOM 522   C CA   . ASP A 1 37  ? -7.099  11.791  3.655   1.00 0.00 ? 37  ASP A CA   1  
ATOM 523   C C    . ASP A 1 37  ? -8.160  11.728  4.749   1.00 0.00 ? 37  ASP A C    1  
ATOM 524   O O    . ASP A 1 37  ? -8.810  10.699  4.941   1.00 0.00 ? 37  ASP A O    1  
ATOM 525   C CB   . ASP A 1 37  ? -7.765  11.990  2.292   1.00 0.00 ? 37  ASP A CB   1  
ATOM 526   C CG   . ASP A 1 37  ? -6.759  12.265  1.192   1.00 0.00 ? 37  ASP A CG   1  
ATOM 527   O OD1  . ASP A 1 37  ? -5.871  13.118  1.400   1.00 0.00 ? 37  ASP A OD1  1  
ATOM 528   O OD2  . ASP A 1 37  ? -6.861  11.629  0.122   1.00 0.00 ? 37  ASP A OD2  1  
ATOM 529   H H    . ASP A 1 37  ? -6.666  9.747   3.999   1.00 0.00 ? 37  ASP A H    1  
ATOM 530   H HA   . ASP A 1 37  ? -6.447  12.628  3.852   1.00 0.00 ? 37  ASP A HA   1  
ATOM 531   H HB2  . ASP A 1 37  ? -8.316  11.097  2.035   1.00 0.00 ? 37  ASP A HB2  1  
ATOM 532   H HB3  . ASP A 1 37  ? -8.446  12.825  2.350   1.00 0.00 ? 37  ASP A HB3  1  
ATOM 533   N N    . THR A 1 38  ? -8.331  12.834  5.466   1.00 0.00 ? 38  THR A N    1  
ATOM 534   C CA   . THR A 1 38  ? -9.312  12.904  6.542   1.00 0.00 ? 38  THR A CA   1  
ATOM 535   C C    . THR A 1 38  ? -10.511 13.753  6.138   1.00 0.00 ? 38  THR A C    1  
ATOM 536   O O    . THR A 1 38  ? -11.656 13.316  6.242   1.00 0.00 ? 38  THR A O    1  
ATOM 537   C CB   . THR A 1 38  ? -8.694  13.486  7.827   1.00 0.00 ? 38  THR A CB   1  
ATOM 538   O OG1  . THR A 1 38  ? -9.672  13.512  8.872   1.00 0.00 ? 38  THR A OG1  1  
ATOM 539   C CG2  . THR A 1 38  ? -8.166  14.892  7.585   1.00 0.00 ? 38  THR A CG2  1  
ATOM 540   H H    . THR A 1 38  ? -7.784  13.622  5.265   1.00 0.00 ? 38  THR A H    1  
ATOM 541   H HA   . THR A 1 38  ? -9.648  11.899  6.752   1.00 0.00 ? 38  THR A HA   1  
ATOM 542   H HB   . THR A 1 38  ? -7.871  12.855  8.131   1.00 0.00 ? 38  THR A HB   1  
ATOM 543   H HG1  . THR A 1 38  ? -9.991  12.621  9.034   1.00 0.00 ? 38  THR A HG1  1  
ATOM 544   H HG21 . THR A 1 38  ? -7.551  15.194  8.420   1.00 0.00 ? 38  THR A HG21 1  
ATOM 545   H HG22 . THR A 1 38  ? -8.995  15.576  7.482   1.00 0.00 ? 38  THR A HG22 1  
ATOM 546   H HG23 . THR A 1 38  ? -7.575  14.903  6.681   1.00 0.00 ? 38  THR A HG23 1  
ATOM 547   N N    . ASN A 1 39  ? -10.241 14.970  5.676   1.00 0.00 ? 39  ASN A N    1  
ATOM 548   C CA   . ASN A 1 39  ? -11.300 15.881  5.257   1.00 0.00 ? 39  ASN A CA   1  
ATOM 549   C C    . ASN A 1 39  ? -11.297 16.057  3.741   1.00 0.00 ? 39  ASN A C    1  
ATOM 550   O O    . ASN A 1 39  ? -12.306 15.824  3.077   1.00 0.00 ? 39  ASN A O    1  
ATOM 551   C CB   . ASN A 1 39  ? -11.132 17.240  5.940   1.00 0.00 ? 39  ASN A CB   1  
ATOM 552   C CG   . ASN A 1 39  ? -12.342 18.135  5.750   1.00 0.00 ? 39  ASN A CG   1  
ATOM 553   O OD1  . ASN A 1 39  ? -12.481 18.800  4.723   1.00 0.00 ? 39  ASN A OD1  1  
ATOM 554   N ND2  . ASN A 1 39  ? -13.224 18.156  6.742   1.00 0.00 ? 39  ASN A ND2  1  
ATOM 555   H H    . ASN A 1 39  ? -9.308  15.262  5.617   1.00 0.00 ? 39  ASN A H    1  
ATOM 556   H HA   . ASN A 1 39  ? -12.244 15.452  5.556   1.00 0.00 ? 39  ASN A HA   1  
ATOM 557   H HB2  . ASN A 1 39  ? -10.984 17.087  6.999   1.00 0.00 ? 39  ASN A HB2  1  
ATOM 558   H HB3  . ASN A 1 39  ? -10.269 17.739  5.528   1.00 0.00 ? 39  ASN A HB3  1  
ATOM 559   H HD21 . ASN A 1 39  ? -13.048 17.601  7.531   1.00 0.00 ? 39  ASN A HD21 1  
ATOM 560   H HD22 . ASN A 1 39  ? -14.015 18.726  6.646   1.00 0.00 ? 39  ASN A HD22 1  
ATOM 561   N N    . SER A 1 40  ? -10.155 16.470  3.201   1.00 0.00 ? 40  SER A N    1  
ATOM 562   C CA   . SER A 1 40  ? -10.020 16.681  1.765   1.00 0.00 ? 40  SER A CA   1  
ATOM 563   C C    . SER A 1 40  ? -9.915  15.349  1.028   1.00 0.00 ? 40  SER A C    1  
ATOM 564   O O    . SER A 1 40  ? -8.883  14.680  1.079   1.00 0.00 ? 40  SER A O    1  
ATOM 565   C CB   . SER A 1 40  ? -8.791  17.540  1.466   1.00 0.00 ? 40  SER A CB   1  
ATOM 566   O OG   . SER A 1 40  ? -7.602  16.894  1.887   1.00 0.00 ? 40  SER A OG   1  
ATOM 567   H H    . SER A 1 40  ? -9.385  16.639  3.784   1.00 0.00 ? 40  SER A H    1  
ATOM 568   H HA   . SER A 1 40  ? -10.903 17.199  1.422   1.00 0.00 ? 40  SER A HA   1  
ATOM 569   H HB2  . SER A 1 40  ? -8.731  17.722  0.404   1.00 0.00 ? 40  SER A HB2  1  
ATOM 570   H HB3  . SER A 1 40  ? -8.878  18.482  1.989   1.00 0.00 ? 40  SER A HB3  1  
ATOM 571   H HG   . SER A 1 40  ? -7.795  16.324  2.635   1.00 0.00 ? 40  SER A HG   1  
ATOM 572   N N    . GLN A 1 41  ? -10.990 14.971  0.343   1.00 0.00 ? 41  GLN A N    1  
ATOM 573   C CA   . GLN A 1 41  ? -11.018 13.719  -0.403  1.00 0.00 ? 41  GLN A CA   1  
ATOM 574   C C    . GLN A 1 41  ? -10.675 12.539  0.499   1.00 0.00 ? 41  GLN A C    1  
ATOM 575   O O    . GLN A 1 41  ? -9.967  11.618  0.090   1.00 0.00 ? 41  GLN A O    1  
ATOM 576   C CB   . GLN A 1 41  ? -10.041 13.779  -1.578  1.00 0.00 ? 41  GLN A CB   1  
ATOM 577   C CG   . GLN A 1 41  ? -10.581 14.537  -2.781  1.00 0.00 ? 41  GLN A CG   1  
ATOM 578   C CD   . GLN A 1 41  ? -10.717 16.024  -2.521  1.00 0.00 ? 41  GLN A CD   1  
ATOM 579   O OE1  . GLN A 1 41  ? -9.738  16.703  -2.208  1.00 0.00 ? 41  GLN A OE1  1  
ATOM 580   N NE2  . GLN A 1 41  ? -11.934 16.539  -2.649  1.00 0.00 ? 41  GLN A NE2  1  
ATOM 581   H H    . GLN A 1 41  ? -11.781 15.547  0.341   1.00 0.00 ? 41  GLN A H    1  
ATOM 582   H HA   . GLN A 1 41  ? -12.019 13.584  -0.786  1.00 0.00 ? 41  GLN A HA   1  
ATOM 583   H HB2  . GLN A 1 41  ? -9.133  14.264  -1.252  1.00 0.00 ? 41  GLN A HB2  1  
ATOM 584   H HB3  . GLN A 1 41  ? -9.809  12.771  -1.890  1.00 0.00 ? 41  GLN A HB3  1  
ATOM 585   H HG2  . GLN A 1 41  ? -9.907  14.393  -3.613  1.00 0.00 ? 41  GLN A HG2  1  
ATOM 586   H HG3  . GLN A 1 41  ? -11.553 14.140  -3.033  1.00 0.00 ? 41  GLN A HG3  1  
ATOM 587   H HE21 . GLN A 1 41  ? -12.666 15.937  -2.900  1.00 0.00 ? 41  GLN A HE21 1  
ATOM 588   H HE22 . GLN A 1 41  ? -12.051 17.497  -2.486  1.00 0.00 ? 41  GLN A HE22 1  
ATOM 589   N N    . CYS A 1 42  ? -11.180 12.573  1.727   1.00 0.00 ? 42  CYS A N    1  
ATOM 590   C CA   . CYS A 1 42  ? -10.926 11.506  2.689   1.00 0.00 ? 42  CYS A CA   1  
ATOM 591   C C    . CYS A 1 42  ? -10.836 10.154  1.989   1.00 0.00 ? 42  CYS A C    1  
ATOM 592   O O    . CYS A 1 42  ? -11.644 9.841   1.116   1.00 0.00 ? 42  CYS A O    1  
ATOM 593   C CB   . CYS A 1 42  ? -12.027 11.473  3.749   1.00 0.00 ? 42  CYS A CB   1  
ATOM 594   S SG   . CYS A 1 42  ? -11.661 10.406  5.162   1.00 0.00 ? 42  CYS A SG   1  
ATOM 595   H H    . CYS A 1 42  ? -11.737 13.334  1.995   1.00 0.00 ? 42  CYS A H    1  
ATOM 596   H HA   . CYS A 1 42  ? -9.981  11.713  3.169   1.00 0.00 ? 42  CYS A HA   1  
ATOM 597   H HB2  . CYS A 1 42  ? -12.184 12.474  4.126   1.00 0.00 ? 42  CYS A HB2  1  
ATOM 598   H HB3  . CYS A 1 42  ? -12.941 11.119  3.296   1.00 0.00 ? 42  CYS A HB3  1  
ATOM 599   H HG   . CYS A 1 42  ? -12.185 10.965  6.242   1.00 0.00 ? 42  CYS A HG   1  
ATOM 600   N N    . SER A 1 43  ? -9.846  9.357   2.378   1.00 0.00 ? 43  SER A N    1  
ATOM 601   C CA   . SER A 1 43  ? -9.646  8.040   1.785   1.00 0.00 ? 43  SER A CA   1  
ATOM 602   C C    . SER A 1 43  ? -8.750  7.177   2.667   1.00 0.00 ? 43  SER A C    1  
ATOM 603   O O    . SER A 1 43  ? -8.276  7.620   3.713   1.00 0.00 ? 43  SER A O    1  
ATOM 604   C CB   . SER A 1 43  ? -9.032  8.174   0.390   1.00 0.00 ? 43  SER A CB   1  
ATOM 605   O OG   . SER A 1 43  ? -10.020 8.499   -0.573  1.00 0.00 ? 43  SER A OG   1  
ATOM 606   H H    . SER A 1 43  ? -9.233  9.663   3.080   1.00 0.00 ? 43  SER A H    1  
ATOM 607   H HA   . SER A 1 43  ? -10.612 7.565   1.700   1.00 0.00 ? 43  SER A HA   1  
ATOM 608   H HB2  . SER A 1 43  ? -8.287  8.954   0.401   1.00 0.00 ? 43  SER A HB2  1  
ATOM 609   H HB3  . SER A 1 43  ? -8.570  7.238   0.112   1.00 0.00 ? 43  SER A HB3  1  
ATOM 610   H HG   . SER A 1 43  ? -10.872 8.167   -0.282  1.00 0.00 ? 43  SER A HG   1  
ATOM 611   N N    . VAL A 1 44  ? -8.520  5.940   2.236   1.00 0.00 ? 44  VAL A N    1  
ATOM 612   C CA   . VAL A 1 44  ? -7.680  5.013   2.985   1.00 0.00 ? 44  VAL A CA   1  
ATOM 613   C C    . VAL A 1 44  ? -6.221  5.124   2.555   1.00 0.00 ? 44  VAL A C    1  
ATOM 614   O O    . VAL A 1 44  ? -5.925  5.383   1.389   1.00 0.00 ? 44  VAL A O    1  
ATOM 615   C CB   . VAL A 1 44  ? -8.148  3.558   2.802   1.00 0.00 ? 44  VAL A CB   1  
ATOM 616   C CG1  . VAL A 1 44  ? -9.308  3.248   3.736   1.00 0.00 ? 44  VAL A CG1  1  
ATOM 617   C CG2  . VAL A 1 44  ? -8.537  3.302   1.353   1.00 0.00 ? 44  VAL A CG2  1  
ATOM 618   H H    . VAL A 1 44  ? -8.925  5.644   1.394   1.00 0.00 ? 44  VAL A H    1  
ATOM 619   H HA   . VAL A 1 44  ? -7.757  5.265   4.033   1.00 0.00 ? 44  VAL A HA   1  
ATOM 620   H HB   . VAL A 1 44  ? -7.327  2.902   3.053   1.00 0.00 ? 44  VAL A HB   1  
ATOM 621   H HG11 . VAL A 1 44  ? -8.943  2.702   4.594   1.00 0.00 ? 44  VAL A HG11 1  
ATOM 622   H HG12 . VAL A 1 44  ? -9.764  4.171   4.062   1.00 0.00 ? 44  VAL A HG12 1  
ATOM 623   H HG13 . VAL A 1 44  ? -10.040 2.649   3.214   1.00 0.00 ? 44  VAL A HG13 1  
ATOM 624   H HG21 . VAL A 1 44  ? -9.607  3.394   1.247   1.00 0.00 ? 44  VAL A HG21 1  
ATOM 625   H HG22 . VAL A 1 44  ? -8.049  4.025   0.716   1.00 0.00 ? 44  VAL A HG22 1  
ATOM 626   H HG23 . VAL A 1 44  ? -8.230  2.306   1.068   1.00 0.00 ? 44  VAL A HG23 1  
ATOM 627   N N    . SER A 1 45  ? -5.313  4.927   3.506   1.00 0.00 ? 45  SER A N    1  
ATOM 628   C CA   . SER A 1 45  ? -3.884  5.008   3.227   1.00 0.00 ? 45  SER A CA   1  
ATOM 629   C C    . SER A 1 45  ? -3.379  3.713   2.599   1.00 0.00 ? 45  SER A C    1  
ATOM 630   O O    . SER A 1 45  ? -3.931  2.638   2.837   1.00 0.00 ? 45  SER A O    1  
ATOM 631   C CB   . SER A 1 45  ? -3.108  5.302   4.512   1.00 0.00 ? 45  SER A CB   1  
ATOM 632   O OG   . SER A 1 45  ? -3.884  6.076   5.411   1.00 0.00 ? 45  SER A OG   1  
ATOM 633   H H    . SER A 1 45  ? -5.612  4.725   4.417   1.00 0.00 ? 45  SER A H    1  
ATOM 634   H HA   . SER A 1 45  ? -3.728  5.817   2.529   1.00 0.00 ? 45  SER A HA   1  
ATOM 635   H HB2  . SER A 1 45  ? -2.846  4.372   4.992   1.00 0.00 ? 45  SER A HB2  1  
ATOM 636   H HB3  . SER A 1 45  ? -2.208  5.848   4.269   1.00 0.00 ? 45  SER A HB3  1  
ATOM 637   H HG   . SER A 1 45  ? -3.523  5.996   6.297   1.00 0.00 ? 45  SER A HG   1  
ATOM 638   N N    . SER A 1 46  ? -2.326  3.823   1.796   1.00 0.00 ? 46  SER A N    1  
ATOM 639   C CA   . SER A 1 46  ? -1.747  2.662   1.131   1.00 0.00 ? 46  SER A CA   1  
ATOM 640   C C    . SER A 1 46  ? -1.512  1.527   2.123   1.00 0.00 ? 46  SER A C    1  
ATOM 641   O O    . SER A 1 46  ? -1.370  0.369   1.734   1.00 0.00 ? 46  SER A O    1  
ATOM 642   C CB   . SER A 1 46  ? -0.429  3.041   0.451   1.00 0.00 ? 46  SER A CB   1  
ATOM 643   O OG   . SER A 1 46  ? 0.506   3.535   1.394   1.00 0.00 ? 46  SER A OG   1  
ATOM 644   H H    . SER A 1 46  ? -1.930  4.707   1.646   1.00 0.00 ? 46  SER A H    1  
ATOM 645   H HA   . SER A 1 46  ? -2.446  2.328   0.379   1.00 0.00 ? 46  SER A HA   1  
ATOM 646   H HB2  . SER A 1 46  ? -0.012  2.170   -0.030  1.00 0.00 ? 46  SER A HB2  1  
ATOM 647   H HB3  . SER A 1 46  ? -0.616  3.807   -0.288  1.00 0.00 ? 46  SER A HB3  1  
ATOM 648   H HG   . SER A 1 46  ? 1.389   3.502   1.017   1.00 0.00 ? 46  SER A HG   1  
ATOM 649   N N    . GLU A 1 47  ? -1.473  1.871   3.407   1.00 0.00 ? 47  GLU A N    1  
ATOM 650   C CA   . GLU A 1 47  ? -1.255  0.882   4.455   1.00 0.00 ? 47  GLU A CA   1  
ATOM 651   C C    . GLU A 1 47  ? -2.532  0.094   4.735   1.00 0.00 ? 47  GLU A C    1  
ATOM 652   O O    . GLU A 1 47  ? -2.516  -1.135  4.790   1.00 0.00 ? 47  GLU A O    1  
ATOM 653   C CB   . GLU A 1 47  ? -0.772  1.563   5.738   1.00 0.00 ? 47  GLU A CB   1  
ATOM 654   C CG   . GLU A 1 47  ? -0.130  0.608   6.730   1.00 0.00 ? 47  GLU A CG   1  
ATOM 655   C CD   . GLU A 1 47  ? 0.513   1.327   7.899   1.00 0.00 ? 47  GLU A CD   1  
ATOM 656   O OE1  . GLU A 1 47  ? -0.192  2.097   8.584   1.00 0.00 ? 47  GLU A OE1  1  
ATOM 657   O OE2  . GLU A 1 47  ? 1.723   1.120   8.129   1.00 0.00 ? 47  GLU A OE2  1  
ATOM 658   H H    . GLU A 1 47  ? -1.594  2.812   3.654   1.00 0.00 ? 47  GLU A H    1  
ATOM 659   H HA   . GLU A 1 47  ? -0.493  0.198   4.113   1.00 0.00 ? 47  GLU A HA   1  
ATOM 660   H HB2  . GLU A 1 47  ? -0.048  2.321   5.478   1.00 0.00 ? 47  GLU A HB2  1  
ATOM 661   H HB3  . GLU A 1 47  ? -1.616  2.035   6.219   1.00 0.00 ? 47  GLU A HB3  1  
ATOM 662   H HG2  . GLU A 1 47  ? -0.889  -0.059  7.111   1.00 0.00 ? 47  GLU A HG2  1  
ATOM 663   H HG3  . GLU A 1 47  ? 0.628   0.034   6.218   1.00 0.00 ? 47  GLU A HG3  1  
ATOM 664   N N    . ASP A 1 48  ? -3.636  0.812   4.910   1.00 0.00 ? 48  ASP A N    1  
ATOM 665   C CA   . ASP A 1 48  ? -4.922  0.182   5.184   1.00 0.00 ? 48  ASP A CA   1  
ATOM 666   C C    . ASP A 1 48  ? -5.249  -0.868  4.126   1.00 0.00 ? 48  ASP A C    1  
ATOM 667   O O    . ASP A 1 48  ? -5.368  -2.055  4.431   1.00 0.00 ? 48  ASP A O    1  
ATOM 668   C CB   . ASP A 1 48  ? -6.030  1.235   5.234   1.00 0.00 ? 48  ASP A CB   1  
ATOM 669   C CG   . ASP A 1 48  ? -7.406  0.639   5.011   1.00 0.00 ? 48  ASP A CG   1  
ATOM 670   O OD1  . ASP A 1 48  ? -7.659  0.128   3.900   1.00 0.00 ? 48  ASP A OD1  1  
ATOM 671   O OD2  . ASP A 1 48  ? -8.231  0.684   5.948   1.00 0.00 ? 48  ASP A OD2  1  
ATOM 672   H H    . ASP A 1 48  ? -3.585  1.789   4.854   1.00 0.00 ? 48  ASP A H    1  
ATOM 673   H HA   . ASP A 1 48  ? -4.856  -0.304  6.146   1.00 0.00 ? 48  ASP A HA   1  
ATOM 674   H HB2  . ASP A 1 48  ? -6.018  1.715   6.202   1.00 0.00 ? 48  ASP A HB2  1  
ATOM 675   H HB3  . ASP A 1 48  ? -5.849  1.975   4.468   1.00 0.00 ? 48  ASP A HB3  1  
ATOM 676   N N    . ILE A 1 49  ? -5.393  -0.422  2.882   1.00 0.00 ? 49  ILE A N    1  
ATOM 677   C CA   . ILE A 1 49  ? -5.705  -1.323  1.780   1.00 0.00 ? 49  ILE A CA   1  
ATOM 678   C C    . ILE A 1 49  ? -4.810  -2.557  1.808   1.00 0.00 ? 49  ILE A C    1  
ATOM 679   O O    . ILE A 1 49  ? -5.296  -3.686  1.867   1.00 0.00 ? 49  ILE A O    1  
ATOM 680   C CB   . ILE A 1 49  ? -5.550  -0.621  0.418   1.00 0.00 ? 49  ILE A CB   1  
ATOM 681   C CG1  . ILE A 1 49  ? -6.480  0.591   0.336   1.00 0.00 ? 49  ILE A CG1  1  
ATOM 682   C CG2  . ILE A 1 49  ? -5.838  -1.594  -0.715  1.00 0.00 ? 49  ILE A CG2  1  
ATOM 683   C CD1  . ILE A 1 49  ? -6.039  1.623   -0.678  1.00 0.00 ? 49  ILE A CD1  1  
ATOM 684   H H    . ILE A 1 49  ? -5.285  0.535   2.702   1.00 0.00 ? 49  ILE A H    1  
ATOM 685   H HA   . ILE A 1 49  ? -6.734  -1.635  1.886   1.00 0.00 ? 49  ILE A HA   1  
ATOM 686   H HB   . ILE A 1 49  ? -4.528  -0.289  0.324   1.00 0.00 ? 49  ILE A HB   1  
ATOM 687   H HG12 . ILE A 1 49  ? -7.469  0.260   0.062   1.00 0.00 ? 49  ILE A HG12 1  
ATOM 688   H HG13 . ILE A 1 49  ? -6.520  1.071   1.303   1.00 0.00 ? 49  ILE A HG13 1  
ATOM 689   H HG21 . ILE A 1 49  ? -5.358  -2.539  -0.509  1.00 0.00 ? 49  ILE A HG21 1  
ATOM 690   H HG22 . ILE A 1 49  ? -6.904  -1.745  -0.798  1.00 0.00 ? 49  ILE A HG22 1  
ATOM 691   H HG23 . ILE A 1 49  ? -5.458  -1.191  -1.642  1.00 0.00 ? 49  ILE A HG23 1  
ATOM 692   H HD11 . ILE A 1 49  ? -6.452  1.378   -1.646  1.00 0.00 ? 49  ILE A HD11 1  
ATOM 693   H HD12 . ILE A 1 49  ? -6.386  2.599   -0.374  1.00 0.00 ? 49  ILE A HD12 1  
ATOM 694   H HD13 . ILE A 1 49  ? -4.960  1.629   -0.740  1.00 0.00 ? 49  ILE A HD13 1  
ATOM 695   N N    . GLU A 1 50  ? -3.500  -2.333  1.766   1.00 0.00 ? 50  GLU A N    1  
ATOM 696   C CA   . GLU A 1 50  ? -2.538  -3.428  1.788   1.00 0.00 ? 50  GLU A CA   1  
ATOM 697   C C    . GLU A 1 50  ? -2.808  -4.367  2.960   1.00 0.00 ? 50  GLU A C    1  
ATOM 698   O O    . GLU A 1 50  ? -3.006  -5.568  2.776   1.00 0.00 ? 50  GLU A O    1  
ATOM 699   C CB   . GLU A 1 50  ? -1.111  -2.881  1.877   1.00 0.00 ? 50  GLU A CB   1  
ATOM 700   C CG   . GLU A 1 50  ? -0.063  -3.951  2.129   1.00 0.00 ? 50  GLU A CG   1  
ATOM 701   C CD   . GLU A 1 50  ? 0.203   -4.807  0.906   1.00 0.00 ? 50  GLU A CD   1  
ATOM 702   O OE1  . GLU A 1 50  ? -0.762  -5.384  0.363   1.00 0.00 ? 50  GLU A OE1  1  
ATOM 703   O OE2  . GLU A 1 50  ? 1.378   -4.899  0.492   1.00 0.00 ? 50  GLU A OE2  1  
ATOM 704   H H    . GLU A 1 50  ? -3.174  -1.410  1.719   1.00 0.00 ? 50  GLU A H    1  
ATOM 705   H HA   . GLU A 1 50  ? -2.644  -3.981  0.867   1.00 0.00 ? 50  GLU A HA   1  
ATOM 706   H HB2  . GLU A 1 50  ? -0.871  -2.382  0.949   1.00 0.00 ? 50  GLU A HB2  1  
ATOM 707   H HB3  . GLU A 1 50  ? -1.064  -2.163  2.683   1.00 0.00 ? 50  GLU A HB3  1  
ATOM 708   H HG2  . GLU A 1 50  ? 0.859   -3.472  2.422   1.00 0.00 ? 50  GLU A HG2  1  
ATOM 709   H HG3  . GLU A 1 50  ? -0.405  -4.590  2.930   1.00 0.00 ? 50  GLU A HG3  1  
ATOM 710   N N    . LYS A 1 51  ? -2.814  -3.811  4.167   1.00 0.00 ? 51  LYS A N    1  
ATOM 711   C CA   . LYS A 1 51  ? -3.060  -4.596  5.370   1.00 0.00 ? 51  LYS A CA   1  
ATOM 712   C C    . LYS A 1 51  ? -4.138  -5.646  5.124   1.00 0.00 ? 51  LYS A C    1  
ATOM 713   O O    . LYS A 1 51  ? -4.042  -6.774  5.609   1.00 0.00 ? 51  LYS A O    1  
ATOM 714   C CB   . LYS A 1 51  ? -3.478  -3.682  6.524   1.00 0.00 ? 51  LYS A CB   1  
ATOM 715   C CG   . LYS A 1 51  ? -3.184  -4.261  7.897   1.00 0.00 ? 51  LYS A CG   1  
ATOM 716   C CD   . LYS A 1 51  ? -3.005  -3.168  8.937   1.00 0.00 ? 51  LYS A CD   1  
ATOM 717   C CE   . LYS A 1 51  ? -4.342  -2.587  9.370   1.00 0.00 ? 51  LYS A CE   1  
ATOM 718   N NZ   . LYS A 1 51  ? -4.906  -1.668  8.343   1.00 0.00 ? 51  LYS A NZ   1  
ATOM 719   H H    . LYS A 1 51  ? -2.649  -2.848  4.250   1.00 0.00 ? 51  LYS A H    1  
ATOM 720   H HA   . LYS A 1 51  ? -2.140  -5.096  5.634   1.00 0.00 ? 51  LYS A HA   1  
ATOM 721   H HB2  . LYS A 1 51  ? -2.951  -2.743  6.433   1.00 0.00 ? 51  LYS A HB2  1  
ATOM 722   H HB3  . LYS A 1 51  ? -4.540  -3.497  6.454   1.00 0.00 ? 51  LYS A HB3  1  
ATOM 723   H HG2  . LYS A 1 51  ? -4.007  -4.894  8.194   1.00 0.00 ? 51  LYS A HG2  1  
ATOM 724   H HG3  . LYS A 1 51  ? -2.278  -4.848  7.844   1.00 0.00 ? 51  LYS A HG3  1  
ATOM 725   H HD2  . LYS A 1 51  ? -2.509  -3.584  9.802   1.00 0.00 ? 51  LYS A HD2  1  
ATOM 726   H HD3  . LYS A 1 51  ? -2.398  -2.379  8.516   1.00 0.00 ? 51  LYS A HD3  1  
ATOM 727   H HE2  . LYS A 1 51  ? -5.036  -3.397  9.536   1.00 0.00 ? 51  LYS A HE2  1  
ATOM 728   H HE3  . LYS A 1 51  ? -4.200  -2.041  10.291  1.00 0.00 ? 51  LYS A HE3  1  
ATOM 729   H HZ1  . LYS A 1 51  ? -5.427  -0.894  8.804   1.00 0.00 ? 51  LYS A HZ1  1  
ATOM 730   H HZ2  . LYS A 1 51  ? -5.557  -2.185  7.720   1.00 0.00 ? 51  LYS A HZ2  1  
ATOM 731   H HZ3  . LYS A 1 51  ? -4.141  -1.261  7.768   1.00 0.00 ? 51  LYS A HZ3  1  
ATOM 732   N N    . SER A 1 52  ? -5.163  -5.269  4.366   1.00 0.00 ? 52  SER A N    1  
ATOM 733   C CA   . SER A 1 52  ? -6.260  -6.178  4.057   1.00 0.00 ? 52  SER A CA   1  
ATOM 734   C C    . SER A 1 52  ? -5.807  -7.269  3.091   1.00 0.00 ? 52  SER A C    1  
ATOM 735   O O    . SER A 1 52  ? -5.783  -8.450  3.437   1.00 0.00 ? 52  SER A O    1  
ATOM 736   C CB   . SER A 1 52  ? -7.437  -5.406  3.457   1.00 0.00 ? 52  SER A CB   1  
ATOM 737   O OG   . SER A 1 52  ? -7.965  -4.477  4.387   1.00 0.00 ? 52  SER A OG   1  
ATOM 738   H H    . SER A 1 52  ? -5.182  -4.357  4.008   1.00 0.00 ? 52  SER A H    1  
ATOM 739   H HA   . SER A 1 52  ? -6.578  -6.640  4.980   1.00 0.00 ? 52  SER A HA   1  
ATOM 740   H HB2  . SER A 1 52  ? -7.103  -4.870  2.581   1.00 0.00 ? 52  SER A HB2  1  
ATOM 741   H HB3  . SER A 1 52  ? -8.215  -6.101  3.178   1.00 0.00 ? 52  SER A HB3  1  
ATOM 742   H HG   . SER A 1 52  ? -7.256  -3.928  4.729   1.00 0.00 ? 52  SER A HG   1  
ATOM 743   N N    . PHE A 1 53  ? -5.447  -6.864  1.878   1.00 0.00 ? 53  PHE A N    1  
ATOM 744   C CA   . PHE A 1 53  ? -4.995  -7.805  0.860   1.00 0.00 ? 53  PHE A CA   1  
ATOM 745   C C    . PHE A 1 53  ? -4.138  -8.905  1.479   1.00 0.00 ? 53  PHE A C    1  
ATOM 746   O O    . PHE A 1 53  ? -4.146  -10.047 1.020   1.00 0.00 ? 53  PHE A O    1  
ATOM 747   C CB   . PHE A 1 53  ? -4.202  -7.074  -0.225  1.00 0.00 ? 53  PHE A CB   1  
ATOM 748   C CG   . PHE A 1 53  ? -3.437  -7.995  -1.132  1.00 0.00 ? 53  PHE A CG   1  
ATOM 749   C CD1  . PHE A 1 53  ? -2.246  -8.567  -0.714  1.00 0.00 ? 53  PHE A CD1  1  
ATOM 750   C CD2  . PHE A 1 53  ? -3.909  -8.289  -2.400  1.00 0.00 ? 53  PHE A CD2  1  
ATOM 751   C CE1  . PHE A 1 53  ? -1.539  -9.414  -1.547  1.00 0.00 ? 53  PHE A CE1  1  
ATOM 752   C CE2  . PHE A 1 53  ? -3.206  -9.136  -3.237  1.00 0.00 ? 53  PHE A CE2  1  
ATOM 753   C CZ   . PHE A 1 53  ? -2.021  -9.700  -2.809  1.00 0.00 ? 53  PHE A CZ   1  
ATOM 754   H H    . PHE A 1 53  ? -5.488  -5.908  1.661   1.00 0.00 ? 53  PHE A H    1  
ATOM 755   H HA   . PHE A 1 53  ? -5.869  -8.254  0.414   1.00 0.00 ? 53  PHE A HA   1  
ATOM 756   H HB2  . PHE A 1 53  ? -4.884  -6.500  -0.835  1.00 0.00 ? 53  PHE A HB2  1  
ATOM 757   H HB3  . PHE A 1 53  ? -3.496  -6.406  0.244   1.00 0.00 ? 53  PHE A HB3  1  
ATOM 758   H HD1  . PHE A 1 53  ? -1.868  -8.345  0.273   1.00 0.00 ? 53  PHE A HD1  1  
ATOM 759   H HD2  . PHE A 1 53  ? -4.837  -7.849  -2.736  1.00 0.00 ? 53  PHE A HD2  1  
ATOM 760   H HE1  . PHE A 1 53  ? -0.612  -9.854  -1.210  1.00 0.00 ? 53  PHE A HE1  1  
ATOM 761   H HE2  . PHE A 1 53  ? -3.586  -9.358  -4.224  1.00 0.00 ? 53  PHE A HE2  1  
ATOM 762   H HZ   . PHE A 1 53  ? -1.470  -10.361 -3.462  1.00 0.00 ? 53  PHE A HZ   1  
ATOM 763   N N    . LYS A 1 54  ? -3.397  -8.551  2.524   1.00 0.00 ? 54  LYS A N    1  
ATOM 764   C CA   . LYS A 1 54  ? -2.533  -9.506  3.208   1.00 0.00 ? 54  LYS A CA   1  
ATOM 765   C C    . LYS A 1 54  ? -3.339  -10.692 3.730   1.00 0.00 ? 54  LYS A C    1  
ATOM 766   O O    . LYS A 1 54  ? -3.158  -11.825 3.281   1.00 0.00 ? 54  LYS A O    1  
ATOM 767   C CB   . LYS A 1 54  ? -1.802  -8.825  4.367   1.00 0.00 ? 54  LYS A CB   1  
ATOM 768   C CG   . LYS A 1 54  ? -0.598  -8.009  3.930   1.00 0.00 ? 54  LYS A CG   1  
ATOM 769   C CD   . LYS A 1 54  ? -0.002  -7.228  5.089   1.00 0.00 ? 54  LYS A CD   1  
ATOM 770   C CE   . LYS A 1 54  ? 1.298   -6.546  4.693   1.00 0.00 ? 54  LYS A CE   1  
ATOM 771   N NZ   . LYS A 1 54  ? 1.812   -5.660  5.773   1.00 0.00 ? 54  LYS A NZ   1  
ATOM 772   H H    . LYS A 1 54  ? -3.433  -7.625  2.844   1.00 0.00 ? 54  LYS A H    1  
ATOM 773   H HA   . LYS A 1 54  ? -1.806  -9.866  2.496   1.00 0.00 ? 54  LYS A HA   1  
ATOM 774   H HB2  . LYS A 1 54  ? -2.491  -8.167  4.875   1.00 0.00 ? 54  LYS A HB2  1  
ATOM 775   H HB3  . LYS A 1 54  ? -1.464  -9.582  5.059   1.00 0.00 ? 54  LYS A HB3  1  
ATOM 776   H HG2  . LYS A 1 54  ? 0.154   -8.676  3.535   1.00 0.00 ? 54  LYS A HG2  1  
ATOM 777   H HG3  . LYS A 1 54  ? -0.905  -7.315  3.160   1.00 0.00 ? 54  LYS A HG3  1  
ATOM 778   H HD2  . LYS A 1 54  ? -0.708  -6.475  5.405   1.00 0.00 ? 54  LYS A HD2  1  
ATOM 779   H HD3  . LYS A 1 54  ? 0.192   -7.907  5.907   1.00 0.00 ? 54  LYS A HD3  1  
ATOM 780   H HE2  . LYS A 1 54  ? 2.036   -7.304  4.480   1.00 0.00 ? 54  LYS A HE2  1  
ATOM 781   H HE3  . LYS A 1 54  ? 1.124   -5.955  3.806   1.00 0.00 ? 54  LYS A HE3  1  
ATOM 782   H HZ1  . LYS A 1 54  ? 1.045   -5.056  6.135   1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 783   H HZ2  . LYS A 1 54  ? 2.571   -5.052  5.406   1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 784   H HZ3  . LYS A 1 54  ? 2.187   -6.231  6.557   1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 785   N N    . THR A 1 55  ? -4.231  -10.425 4.678   1.00 0.00 ? 55  THR A N    1  
ATOM 786   C CA   . THR A 1 55  ? -5.064  -11.469 5.260   1.00 0.00 ? 55  THR A CA   1  
ATOM 787   C C    . THR A 1 55  ? -6.007  -12.064 4.220   1.00 0.00 ? 55  THR A C    1  
ATOM 788   O O    . THR A 1 55  ? -6.249  -13.270 4.205   1.00 0.00 ? 55  THR A O    1  
ATOM 789   C CB   . THR A 1 55  ? -5.895  -10.933 6.442   1.00 0.00 ? 55  THR A CB   1  
ATOM 790   O OG1  . THR A 1 55  ? -6.730  -11.971 6.964   1.00 0.00 ? 55  THR A OG1  1  
ATOM 791   C CG2  . THR A 1 55  ? -6.753  -9.754  6.009   1.00 0.00 ? 55  THR A CG2  1  
ATOM 792   H H    . THR A 1 55  ? -4.329  -9.503  4.994   1.00 0.00 ? 55  THR A H    1  
ATOM 793   H HA   . THR A 1 55  ? -4.413  -12.249 5.629   1.00 0.00 ? 55  THR A HA   1  
ATOM 794   H HB   . THR A 1 55  ? -5.218  -10.601 7.216   1.00 0.00 ? 55  THR A HB   1  
ATOM 795   H HG1  . THR A 1 55  ? -6.195  -12.592 7.465   1.00 0.00 ? 55  THR A HG1  1  
ATOM 796   H HG21 . THR A 1 55  ? -7.329  -9.399  6.850   1.00 0.00 ? 55  THR A HG21 1  
ATOM 797   H HG22 . THR A 1 55  ? -7.421  -10.066 5.220   1.00 0.00 ? 55  THR A HG22 1  
ATOM 798   H HG23 . THR A 1 55  ? -6.117  -8.959  5.648   1.00 0.00 ? 55  THR A HG23 1  
ATOM 799   N N    . ASN A 1 56  ? -6.535  -11.209 3.350   1.00 0.00 ? 56  ASN A N    1  
ATOM 800   C CA   . ASN A 1 56  ? -7.452  -11.651 2.305   1.00 0.00 ? 56  ASN A CA   1  
ATOM 801   C C    . ASN A 1 56  ? -6.963  -11.208 0.930   1.00 0.00 ? 56  ASN A C    1  
ATOM 802   O O    . ASN A 1 56  ? -7.405  -10.198 0.382   1.00 0.00 ? 56  ASN A O    1  
ATOM 803   C CB   . ASN A 1 56  ? -8.856  -11.099 2.562   1.00 0.00 ? 56  ASN A CB   1  
ATOM 804   C CG   . ASN A 1 56  ? -8.941  -9.603  2.325   1.00 0.00 ? 56  ASN A CG   1  
ATOM 805   O OD1  . ASN A 1 56  ? -7.982  -8.869  2.568   1.00 0.00 ? 56  ASN A OD1  1  
ATOM 806   N ND2  . ASN A 1 56  ? -10.092 -9.144  1.849   1.00 0.00 ? 56  ASN A ND2  1  
ATOM 807   H H    . ASN A 1 56  ? -6.304  -10.259 3.412   1.00 0.00 ? 56  ASN A H    1  
ATOM 808   H HA   . ASN A 1 56  ? -7.489  -12.729 2.331   1.00 0.00 ? 56  ASN A HA   1  
ATOM 809   H HB2  . ASN A 1 56  ? -9.555  -11.588 1.900   1.00 0.00 ? 56  ASN A HB2  1  
ATOM 810   H HB3  . ASN A 1 56  ? -9.134  -11.299 3.586   1.00 0.00 ? 56  ASN A HB3  1  
ATOM 811   H HD21 . ASN A 1 56  ? -10.812 -9.787  1.680   1.00 0.00 ? 56  ASN A HD21 1  
ATOM 812   H HD22 . ASN A 1 56  ? -10.174 -8.181  1.686   1.00 0.00 ? 56  ASN A HD22 1  
ATOM 813   N N    . PRO A 1 57  ? -6.029  -11.981 0.356   1.00 0.00 ? 57  PRO A N    1  
ATOM 814   C CA   . PRO A 1 57  ? -5.460  -11.689 -0.963  1.00 0.00 ? 57  PRO A CA   1  
ATOM 815   C C    . PRO A 1 57  ? -6.467  -11.902 -2.088  1.00 0.00 ? 57  PRO A C    1  
ATOM 816   O O    . PRO A 1 57  ? -6.260  -11.446 -3.213  1.00 0.00 ? 57  PRO A O    1  
ATOM 817   C CB   . PRO A 1 57  ? -4.307  -12.689 -1.081  1.00 0.00 ? 57  PRO A CB   1  
ATOM 818   C CG   . PRO A 1 57  ? -4.690  -13.817 -0.185  1.00 0.00 ? 57  PRO A CG   1  
ATOM 819   C CD   . PRO A 1 57  ? -5.456  -13.200 0.952   1.00 0.00 ? 57  PRO A CD   1  
ATOM 820   H HA   . PRO A 1 57  ? -5.073  -10.682 -1.014  1.00 0.00 ? 57  PRO A HA   1  
ATOM 821   H HB2  . PRO A 1 57  ? -4.212  -13.013 -2.108  1.00 0.00 ? 57  PRO A HB2  1  
ATOM 822   H HB3  . PRO A 1 57  ? -3.388  -12.224 -0.758  1.00 0.00 ? 57  PRO A HB3  1  
ATOM 823   H HG2  . PRO A 1 57  ? -5.312  -14.516 -0.722  1.00 0.00 ? 57  PRO A HG2  1  
ATOM 824   H HG3  . PRO A 1 57  ? -3.802  -14.309 0.184   1.00 0.00 ? 57  PRO A HG3  1  
ATOM 825   H HD2  . PRO A 1 57  ? -6.236  -13.868 1.287   1.00 0.00 ? 57  PRO A HD2  1  
ATOM 826   H HD3  . PRO A 1 57  ? -4.791  -12.955 1.766   1.00 0.00 ? 57  PRO A HD3  1  
ATOM 827   N N    . CYS A 1 58  ? -7.556  -12.597 -1.778  1.00 0.00 ? 58  CYS A N    1  
ATOM 828   C CA   . CYS A 1 58  ? -8.595  -12.871 -2.764  1.00 0.00 ? 58  CYS A CA   1  
ATOM 829   C C    . CYS A 1 58  ? -9.966  -12.460 -2.237  1.00 0.00 ? 58  CYS A C    1  
ATOM 830   O O    . CYS A 1 58  ? -10.952 -13.171 -2.423  1.00 0.00 ? 58  CYS A O    1  
ATOM 831   C CB   . CYS A 1 58  ? -8.600  -14.355 -3.132  1.00 0.00 ? 58  CYS A CB   1  
ATOM 832   S SG   . CYS A 1 58  ? -9.067  -15.451 -1.771  1.00 0.00 ? 58  CYS A SG   1  
ATOM 833   H H    . CYS A 1 58  ? -7.664  -12.935 -0.864  1.00 0.00 ? 58  CYS A H    1  
ATOM 834   H HA   . CYS A 1 58  ? -8.374  -12.291 -3.647  1.00 0.00 ? 58  CYS A HA   1  
ATOM 835   H HB2  . CYS A 1 58  ? -9.301  -14.516 -3.937  1.00 0.00 ? 58  CYS A HB2  1  
ATOM 836   H HB3  . CYS A 1 58  ? -7.612  -14.640 -3.461  1.00 0.00 ? 58  CYS A HB3  1  
ATOM 837   H HG   . CYS A 1 58  ? -10.145 -14.946 -1.191  1.00 0.00 ? 58  CYS A HG   1  
ATOM 838   N N    . GLY A 1 59  ? -10.020 -11.307 -1.577  1.00 0.00 ? 59  GLY A N    1  
ATOM 839   C CA   . GLY A 1 59  ? -11.274 -10.822 -1.032  1.00 0.00 ? 59  GLY A CA   1  
ATOM 840   C C    . GLY A 1 59  ? -11.572 -9.394  -1.444  1.00 0.00 ? 59  GLY A C    1  
ATOM 841   O O    . GLY A 1 59  ? -11.294 -8.996  -2.575  1.00 0.00 ? 59  GLY A O    1  
ATOM 842   H H    . GLY A 1 59  ? -9.201  -10.781 -1.460  1.00 0.00 ? 59  GLY A H    1  
ATOM 843   H HA2  . GLY A 1 59  ? -12.074 -11.460 -1.376  1.00 0.00 ? 59  GLY A HA2  1  
ATOM 844   H HA3  . GLY A 1 59  ? -11.227 -10.871 0.047   1.00 0.00 ? 59  GLY A HA3  1  
ATOM 845   N N    . SER A 1 60  ? -12.142 -8.621  -0.524  1.00 0.00 ? 60  SER A N    1  
ATOM 846   C CA   . SER A 1 60  ? -12.483 -7.230  -0.800  1.00 0.00 ? 60  SER A CA   1  
ATOM 847   C C    . SER A 1 60  ? -12.648 -6.444  0.497   1.00 0.00 ? 60  SER A C    1  
ATOM 848   O O    . SER A 1 60  ? -13.171 -6.960  1.486   1.00 0.00 ? 60  SER A O    1  
ATOM 849   C CB   . SER A 1 60  ? -13.770 -7.153  -1.624  1.00 0.00 ? 60  SER A CB   1  
ATOM 850   O OG   . SER A 1 60  ? -14.784 -7.970  -1.065  1.00 0.00 ? 60  SER A OG   1  
ATOM 851   H H    . SER A 1 60  ? -12.339 -8.996  0.359   1.00 0.00 ? 60  SER A H    1  
ATOM 852   H HA   . SER A 1 60  ? -11.674 -6.797  -1.369  1.00 0.00 ? 60  SER A HA   1  
ATOM 853   H HB2  . SER A 1 60  ? -14.119 -6.132  -1.647  1.00 0.00 ? 60  SER A HB2  1  
ATOM 854   H HB3  . SER A 1 60  ? -13.569 -7.487  -2.632  1.00 0.00 ? 60  SER A HB3  1  
ATOM 855   H HG   . SER A 1 60  ? -15.645 -7.622  -1.306  1.00 0.00 ? 60  SER A HG   1  
ATOM 856   N N    . ILE A 1 61  ? -12.199 -5.194  0.485   1.00 0.00 ? 61  ILE A N    1  
ATOM 857   C CA   . ILE A 1 61  ? -12.298 -4.336  1.659   1.00 0.00 ? 61  ILE A CA   1  
ATOM 858   C C    . ILE A 1 61  ? -13.362 -3.261  1.467   1.00 0.00 ? 61  ILE A C    1  
ATOM 859   O O    . ILE A 1 61  ? -13.167 -2.307  0.713   1.00 0.00 ? 61  ILE A O    1  
ATOM 860   C CB   . ILE A 1 61  ? -10.951 -3.658  1.976   1.00 0.00 ? 61  ILE A CB   1  
ATOM 861   C CG1  . ILE A 1 61  ? -11.058 -2.839  3.263   1.00 0.00 ? 61  ILE A CG1  1  
ATOM 862   C CG2  . ILE A 1 61  ? -10.516 -2.776  0.815   1.00 0.00 ? 61  ILE A CG2  1  
ATOM 863   C CD1  . ILE A 1 61  ? -9.745  -2.232  3.704   1.00 0.00 ? 61  ILE A CD1  1  
ATOM 864   H H    . ILE A 1 61  ? -11.793 -4.840  -0.333  1.00 0.00 ? 61  ILE A H    1  
ATOM 865   H HA   . ILE A 1 61  ? -12.574 -4.954  2.501   1.00 0.00 ? 61  ILE A HA   1  
ATOM 866   H HB   . ILE A 1 61  ? -10.208 -4.429  2.109   1.00 0.00 ? 61  ILE A HB   1  
ATOM 867   H HG12 . ILE A 1 61  ? -11.761 -2.034  3.113   1.00 0.00 ? 61  ILE A HG12 1  
ATOM 868   H HG13 . ILE A 1 61  ? -11.413 -3.477  4.059   1.00 0.00 ? 61  ILE A HG13 1  
ATOM 869   H HG21 . ILE A 1 61  ? -9.489  -2.994  0.563   1.00 0.00 ? 61  ILE A HG21 1  
ATOM 870   H HG22 . ILE A 1 61  ? -11.144 -2.973  -0.041  1.00 0.00 ? 61  ILE A HG22 1  
ATOM 871   H HG23 . ILE A 1 61  ? -10.606 -1.738  1.097   1.00 0.00 ? 61  ILE A HG23 1  
ATOM 872   H HD11 . ILE A 1 61  ? -9.001  -2.384  2.936   1.00 0.00 ? 61  ILE A HD11 1  
ATOM 873   H HD12 . ILE A 1 61  ? -9.875  -1.174  3.875   1.00 0.00 ? 61  ILE A HD12 1  
ATOM 874   H HD13 . ILE A 1 61  ? -9.418  -2.706  4.619   1.00 0.00 ? 61  ILE A HD13 1  
ATOM 875   N N    . SER A 1 62  ? -14.488 -3.421  2.154   1.00 0.00 ? 62  SER A N    1  
ATOM 876   C CA   . SER A 1 62  ? -15.585 -2.466  2.058   1.00 0.00 ? 62  SER A CA   1  
ATOM 877   C C    . SER A 1 62  ? -15.389 -1.313  3.038   1.00 0.00 ? 62  SER A C    1  
ATOM 878   O O    . SER A 1 62  ? -15.201 -1.526  4.236   1.00 0.00 ? 62  SER A O    1  
ATOM 879   C CB   . SER A 1 62  ? -16.921 -3.161  2.331   1.00 0.00 ? 62  SER A CB   1  
ATOM 880   O OG   . SER A 1 62  ? -17.078 -3.438  3.712   1.00 0.00 ? 62  SER A OG   1  
ATOM 881   H H    . SER A 1 62  ? -14.584 -4.203  2.738   1.00 0.00 ? 62  SER A H    1  
ATOM 882   H HA   . SER A 1 62  ? -15.594 -2.071  1.053   1.00 0.00 ? 62  SER A HA   1  
ATOM 883   H HB2  . SER A 1 62  ? -17.729 -2.521  2.010   1.00 0.00 ? 62  SER A HB2  1  
ATOM 884   H HB3  . SER A 1 62  ? -16.958 -4.091  1.783   1.00 0.00 ? 62  SER A HB3  1  
ATOM 885   H HG   . SER A 1 62  ? -16.583 -4.228  3.939   1.00 0.00 ? 62  SER A HG   1  
ATOM 886   N N    . PHE A 1 63  ? -15.435 -0.090  2.520   1.00 0.00 ? 63  PHE A N    1  
ATOM 887   C CA   . PHE A 1 63  ? -15.262 1.098   3.348   1.00 0.00 ? 63  PHE A CA   1  
ATOM 888   C C    . PHE A 1 63  ? -16.041 2.279   2.775   1.00 0.00 ? 63  PHE A C    1  
ATOM 889   O O    . PHE A 1 63  ? -16.353 2.313   1.584   1.00 0.00 ? 63  PHE A O    1  
ATOM 890   C CB   . PHE A 1 63  ? -13.778 1.456   3.458   1.00 0.00 ? 63  PHE A CB   1  
ATOM 891   C CG   . PHE A 1 63  ? -13.171 1.901   2.159   1.00 0.00 ? 63  PHE A CG   1  
ATOM 892   C CD1  . PHE A 1 63  ? -13.382 3.185   1.684   1.00 0.00 ? 63  PHE A CD1  1  
ATOM 893   C CD2  . PHE A 1 63  ? -12.388 1.035   1.412   1.00 0.00 ? 63  PHE A CD2  1  
ATOM 894   C CE1  . PHE A 1 63  ? -12.825 3.597   0.488   1.00 0.00 ? 63  PHE A CE1  1  
ATOM 895   C CE2  . PHE A 1 63  ? -11.827 1.441   0.216   1.00 0.00 ? 63  PHE A CE2  1  
ATOM 896   C CZ   . PHE A 1 63  ? -12.045 2.724   -0.246  1.00 0.00 ? 63  PHE A CZ   1  
ATOM 897   H H    . PHE A 1 63  ? -15.589 0.016   1.557   1.00 0.00 ? 63  PHE A H    1  
ATOM 898   H HA   . PHE A 1 63  ? -15.644 0.874   4.332   1.00 0.00 ? 63  PHE A HA   1  
ATOM 899   H HB2  . PHE A 1 63  ? -13.662 2.259   4.170   1.00 0.00 ? 63  PHE A HB2  1  
ATOM 900   H HB3  . PHE A 1 63  ? -13.232 0.592   3.803   1.00 0.00 ? 63  PHE A HB3  1  
ATOM 901   H HD1  . PHE A 1 63  ? -13.990 3.870   2.257   1.00 0.00 ? 63  PHE A HD1  1  
ATOM 902   H HD2  . PHE A 1 63  ? -12.216 0.031   1.774   1.00 0.00 ? 63  PHE A HD2  1  
ATOM 903   H HE1  . PHE A 1 63  ? -12.996 4.601   0.128   1.00 0.00 ? 63  PHE A HE1  1  
ATOM 904   H HE2  . PHE A 1 63  ? -11.219 0.756   -0.355  1.00 0.00 ? 63  PHE A HE2  1  
ATOM 905   H HZ   . PHE A 1 63  ? -11.609 3.043   -1.181  1.00 0.00 ? 63  PHE A HZ   1  
ATOM 906   N N    . THR A 1 64  ? -16.352 3.246   3.631   1.00 0.00 ? 64  THR A N    1  
ATOM 907   C CA   . THR A 1 64  ? -17.095 4.428   3.213   1.00 0.00 ? 64  THR A CA   1  
ATOM 908   C C    . THR A 1 64  ? -16.355 5.705   3.590   1.00 0.00 ? 64  THR A C    1  
ATOM 909   O O    . THR A 1 64  ? -16.004 5.913   4.752   1.00 0.00 ? 64  THR A O    1  
ATOM 910   C CB   . THR A 1 64  ? -18.502 4.459   3.840   1.00 0.00 ? 64  THR A CB   1  
ATOM 911   O OG1  . THR A 1 64  ? -18.413 4.240   5.253   1.00 0.00 ? 64  THR A OG1  1  
ATOM 912   C CG2  . THR A 1 64  ? -19.397 3.400   3.214   1.00 0.00 ? 64  THR A CG2  1  
ATOM 913   H H    . THR A 1 64  ? -16.075 3.161   4.567   1.00 0.00 ? 64  THR A H    1  
ATOM 914   H HA   . THR A 1 64  ? -17.204 4.390   2.138   1.00 0.00 ? 64  THR A HA   1  
ATOM 915   H HB   . THR A 1 64  ? -18.938 5.431   3.661   1.00 0.00 ? 64  THR A HB   1  
ATOM 916   H HG1  . THR A 1 64  ? -18.421 3.296   5.432   1.00 0.00 ? 64  THR A HG1  1  
ATOM 917   H HG21 . THR A 1 64  ? -19.636 2.648   3.951   1.00 0.00 ? 64  THR A HG21 1  
ATOM 918   H HG22 . THR A 1 64  ? -18.884 2.941   2.383   1.00 0.00 ? 64  THR A HG22 1  
ATOM 919   H HG23 . THR A 1 64  ? -20.308 3.862   2.864   1.00 0.00 ? 64  THR A HG23 1  
ATOM 920   N N    . THR A 1 65  ? -16.120 6.562   2.600   1.00 0.00 ? 65  THR A N    1  
ATOM 921   C CA   . THR A 1 65  ? -15.421 7.820   2.829   1.00 0.00 ? 65  THR A CA   1  
ATOM 922   C C    . THR A 1 65  ? -15.843 8.876   1.813   1.00 0.00 ? 65  THR A C    1  
ATOM 923   O O    . THR A 1 65  ? -16.516 8.570   0.829   1.00 0.00 ? 65  THR A O    1  
ATOM 924   C CB   . THR A 1 65  ? -13.893 7.635   2.755   1.00 0.00 ? 65  THR A CB   1  
ATOM 925   O OG1  . THR A 1 65  ? -13.234 8.835   3.174   1.00 0.00 ? 65  THR A OG1  1  
ATOM 926   C CG2  . THR A 1 65  ? -13.459 7.279   1.341   1.00 0.00 ? 65  THR A CG2  1  
ATOM 927   H H    . THR A 1 65  ? -16.425 6.341   1.696   1.00 0.00 ? 65  THR A H    1  
ATOM 928   H HA   . THR A 1 65  ? -15.673 8.167   3.820   1.00 0.00 ? 65  THR A HA   1  
ATOM 929   H HB   . THR A 1 65  ? -13.611 6.828   3.417   1.00 0.00 ? 65  THR A HB   1  
ATOM 930   H HG1  . THR A 1 65  ? -12.283 8.699   3.160   1.00 0.00 ? 65  THR A HG1  1  
ATOM 931   H HG21 . THR A 1 65  ? -14.256 7.512   0.650   1.00 0.00 ? 65  THR A HG21 1  
ATOM 932   H HG22 . THR A 1 65  ? -13.233 6.224   1.289   1.00 0.00 ? 65  THR A HG22 1  
ATOM 933   H HG23 . THR A 1 65  ? -12.580 7.849   1.081   1.00 0.00 ? 65  THR A HG23 1  
ATOM 934   N N    . SER A 1 66  ? -15.442 10.119  2.058   1.00 0.00 ? 66  SER A N    1  
ATOM 935   C CA   . SER A 1 66  ? -15.782 11.222  1.166   1.00 0.00 ? 66  SER A CA   1  
ATOM 936   C C    . SER A 1 66  ? -17.266 11.198  0.813   1.00 0.00 ? 66  SER A C    1  
ATOM 937   O O    . SER A 1 66  ? -17.638 11.220  -0.360  1.00 0.00 ? 66  SER A O    1  
ATOM 938   C CB   . SER A 1 66  ? -14.941 11.150  -0.111  1.00 0.00 ? 66  SER A CB   1  
ATOM 939   O OG   . SER A 1 66  ? -14.866 12.415  -0.743  1.00 0.00 ? 66  SER A OG   1  
ATOM 940   H H    . SER A 1 66  ? -14.907 10.300  2.859   1.00 0.00 ? 66  SER A H    1  
ATOM 941   H HA   . SER A 1 66  ? -15.561 12.145  1.680   1.00 0.00 ? 66  SER A HA   1  
ATOM 942   H HB2  . SER A 1 66  ? -13.943 10.824  0.137   1.00 0.00 ? 66  SER A HB2  1  
ATOM 943   H HB3  . SER A 1 66  ? -15.391 10.445  -0.795  1.00 0.00 ? 66  SER A HB3  1  
ATOM 944   H HG   . SER A 1 66  ? -14.963 12.306  -1.692  1.00 0.00 ? 66  SER A HG   1  
ATOM 945   N N    . LYS A 1 67  ? -18.110 11.152  1.838   1.00 0.00 ? 67  LYS A N    1  
ATOM 946   C CA   . LYS A 1 67  ? -19.554 11.126  1.640   1.00 0.00 ? 67  LYS A CA   1  
ATOM 947   C C    . LYS A 1 67  ? -19.929 10.197  0.490   1.00 0.00 ? 67  LYS A C    1  
ATOM 948   O O    . LYS A 1 67  ? -20.852 10.480  -0.274  1.00 0.00 ? 67  LYS A O    1  
ATOM 949   C CB   . LYS A 1 67  ? -20.077 12.537  1.361   1.00 0.00 ? 67  LYS A CB   1  
ATOM 950   C CG   . LYS A 1 67  ? -19.673 13.077  0.000   1.00 0.00 ? 67  LYS A CG   1  
ATOM 951   C CD   . LYS A 1 67  ? -20.685 14.083  -0.523  1.00 0.00 ? 67  LYS A CD   1  
ATOM 952   C CE   . LYS A 1 67  ? -20.419 15.477  0.024   1.00 0.00 ? 67  LYS A CE   1  
ATOM 953   N NZ   . LYS A 1 67  ? -19.258 16.124  -0.647  1.00 0.00 ? 67  LYS A NZ   1  
ATOM 954   H H    . LYS A 1 67  ? -17.753 11.136  2.752   1.00 0.00 ? 67  LYS A H    1  
ATOM 955   H HA   . LYS A 1 67  ? -20.007 10.757  2.548   1.00 0.00 ? 67  LYS A HA   1  
ATOM 956   H HB2  . LYS A 1 67  ? -21.155 12.526  1.415   1.00 0.00 ? 67  LYS A HB2  1  
ATOM 957   H HB3  . LYS A 1 67  ? -19.694 13.206  2.118   1.00 0.00 ? 67  LYS A HB3  1  
ATOM 958   H HG2  . LYS A 1 67  ? -18.712 13.561  0.085   1.00 0.00 ? 67  LYS A HG2  1  
ATOM 959   H HG3  . LYS A 1 67  ? -19.604 12.254  -0.697  1.00 0.00 ? 67  LYS A HG3  1  
ATOM 960   H HD2  . LYS A 1 67  ? -20.624 14.114  -1.601  1.00 0.00 ? 67  LYS A HD2  1  
ATOM 961   H HD3  . LYS A 1 67  ? -21.676 13.772  -0.225  1.00 0.00 ? 67  LYS A HD3  1  
ATOM 962   H HE2  . LYS A 1 67  ? -21.297 16.084  -0.131  1.00 0.00 ? 67  LYS A HE2  1  
ATOM 963   H HE3  . LYS A 1 67  ? -20.216 15.401  1.082   1.00 0.00 ? 67  LYS A HE3  1  
ATOM 964   H HZ1  . LYS A 1 67  ? -18.382 15.914  -0.126  1.00 0.00 ? 67  LYS A HZ1  1  
ATOM 965   H HZ2  . LYS A 1 67  ? -19.391 17.155  -0.676  1.00 0.00 ? 67  LYS A HZ2  1  
ATOM 966   H HZ3  . LYS A 1 67  ? -19.164 15.770  -1.620  1.00 0.00 ? 67  LYS A HZ3  1  
ATOM 967   N N    . PHE A 1 68  ? -19.208 9.086   0.373   1.00 0.00 ? 68  PHE A N    1  
ATOM 968   C CA   . PHE A 1 68  ? -19.466 8.115   -0.684  1.00 0.00 ? 68  PHE A CA   1  
ATOM 969   C C    . PHE A 1 68  ? -18.898 6.748   -0.316  1.00 0.00 ? 68  PHE A C    1  
ATOM 970   O O    . PHE A 1 68  ? -17.909 6.649   0.411   1.00 0.00 ? 68  PHE A O    1  
ATOM 971   C CB   . PHE A 1 68  ? -18.859 8.594   -2.004  1.00 0.00 ? 68  PHE A CB   1  
ATOM 972   C CG   . PHE A 1 68  ? -19.547 9.800   -2.578  1.00 0.00 ? 68  PHE A CG   1  
ATOM 973   C CD1  . PHE A 1 68  ? -20.894 9.756   -2.902  1.00 0.00 ? 68  PHE A CD1  1  
ATOM 974   C CD2  . PHE A 1 68  ? -18.848 10.976  -2.793  1.00 0.00 ? 68  PHE A CD2  1  
ATOM 975   C CE1  . PHE A 1 68  ? -21.529 10.864  -3.431  1.00 0.00 ? 68  PHE A CE1  1  
ATOM 976   C CE2  . PHE A 1 68  ? -19.478 12.087  -3.321  1.00 0.00 ? 68  PHE A CE2  1  
ATOM 977   C CZ   . PHE A 1 68  ? -20.821 12.031  -3.640  1.00 0.00 ? 68  PHE A CZ   1  
ATOM 978   H H    . PHE A 1 68  ? -18.485 8.916   1.013   1.00 0.00 ? 68  PHE A H    1  
ATOM 979   H HA   . PHE A 1 68  ? -20.535 8.029   -0.799  1.00 0.00 ? 68  PHE A HA   1  
ATOM 980   H HB2  . PHE A 1 68  ? -17.822 8.849   -1.844  1.00 0.00 ? 68  PHE A HB2  1  
ATOM 981   H HB3  . PHE A 1 68  ? -18.921 7.798   -2.730  1.00 0.00 ? 68  PHE A HB3  1  
ATOM 982   H HD1  . PHE A 1 68  ? -21.449 8.845   -2.738  1.00 0.00 ? 68  PHE A HD1  1  
ATOM 983   H HD2  . PHE A 1 68  ? -17.797 11.021  -2.544  1.00 0.00 ? 68  PHE A HD2  1  
ATOM 984   H HE1  . PHE A 1 68  ? -22.579 10.818  -3.679  1.00 0.00 ? 68  PHE A HE1  1  
ATOM 985   H HE2  . PHE A 1 68  ? -18.921 12.998  -3.483  1.00 0.00 ? 68  PHE A HE2  1  
ATOM 986   H HZ   . PHE A 1 68  ? -21.315 12.898  -4.053  1.00 0.00 ? 68  PHE A HZ   1  
ATOM 987   N N    . SER A 1 69  ? -19.531 5.695   -0.823  1.00 0.00 ? 69  SER A N    1  
ATOM 988   C CA   . SER A 1 69  ? -19.092 4.332   -0.545  1.00 0.00 ? 69  SER A CA   1  
ATOM 989   C C    . SER A 1 69  ? -18.146 3.834   -1.633  1.00 0.00 ? 69  SER A C    1  
ATOM 990   O O    . SER A 1 69  ? -18.323 4.138   -2.813  1.00 0.00 ? 69  SER A O    1  
ATOM 991   C CB   . SER A 1 69  ? -20.298 3.398   -0.435  1.00 0.00 ? 69  SER A CB   1  
ATOM 992   O OG   . SER A 1 69  ? -21.053 3.675   0.732   1.00 0.00 ? 69  SER A OG   1  
ATOM 993   H H    . SER A 1 69  ? -20.313 5.838   -1.396  1.00 0.00 ? 69  SER A H    1  
ATOM 994   H HA   . SER A 1 69  ? -18.566 4.339   0.398   1.00 0.00 ? 69  SER A HA   1  
ATOM 995   H HB2  . SER A 1 69  ? -20.932 3.529   -1.299  1.00 0.00 ? 69  SER A HB2  1  
ATOM 996   H HB3  . SER A 1 69  ? -19.955 2.374   -0.392  1.00 0.00 ? 69  SER A HB3  1  
ATOM 997   H HG   . SER A 1 69  ? -21.716 2.992   0.855   1.00 0.00 ? 69  SER A HG   1  
ATOM 998   N N    . TYR A 1 70  ? -17.141 3.065   -1.228  1.00 0.00 ? 70  TYR A N    1  
ATOM 999   C CA   . TYR A 1 70  ? -16.165 2.526   -2.167  1.00 0.00 ? 70  TYR A CA   1  
ATOM 1000  C C    . TYR A 1 70  ? -15.802 1.088   -1.809  1.00 0.00 ? 70  TYR A C    1  
ATOM 1001  O O    . TYR A 1 70  ? -15.762 0.718   -0.635  1.00 0.00 ? 70  TYR A O    1  
ATOM 1002  C CB   . TYR A 1 70  ? -14.905 3.393   -2.180  1.00 0.00 ? 70  TYR A CB   1  
ATOM 1003  C CG   . TYR A 1 70  ? -15.079 4.702   -2.917  1.00 0.00 ? 70  TYR A CG   1  
ATOM 1004  C CD1  . TYR A 1 70  ? -15.074 4.746   -4.305  1.00 0.00 ? 70  TYR A CD1  1  
ATOM 1005  C CD2  . TYR A 1 70  ? -15.248 5.895   -2.224  1.00 0.00 ? 70  TYR A CD2  1  
ATOM 1006  C CE1  . TYR A 1 70  ? -15.231 5.940   -4.983  1.00 0.00 ? 70  TYR A CE1  1  
ATOM 1007  C CE2  . TYR A 1 70  ? -15.408 7.093   -2.893  1.00 0.00 ? 70  TYR A CE2  1  
ATOM 1008  C CZ   . TYR A 1 70  ? -15.398 7.110   -4.272  1.00 0.00 ? 70  TYR A CZ   1  
ATOM 1009  O OH   . TYR A 1 70  ? -15.557 8.301   -4.943  1.00 0.00 ? 70  TYR A OH   1  
ATOM 1010  H H    . TYR A 1 70  ? -17.052 2.857   -0.274  1.00 0.00 ? 70  TYR A H    1  
ATOM 1011  H HA   . TYR A 1 70  ? -16.609 2.539   -3.151  1.00 0.00 ? 70  TYR A HA   1  
ATOM 1012  H HB2  . TYR A 1 70  ? -14.622 3.621   -1.163  1.00 0.00 ? 70  TYR A HB2  1  
ATOM 1013  H HB3  . TYR A 1 70  ? -14.105 2.847   -2.657  1.00 0.00 ? 70  TYR A HB3  1  
ATOM 1014  H HD1  . TYR A 1 70  ? -14.944 3.827   -4.859  1.00 0.00 ? 70  TYR A HD1  1  
ATOM 1015  H HD2  . TYR A 1 70  ? -15.255 5.878   -1.144  1.00 0.00 ? 70  TYR A HD2  1  
ATOM 1016  H HE1  . TYR A 1 70  ? -15.225 5.953   -6.062  1.00 0.00 ? 70  TYR A HE1  1  
ATOM 1017  H HE2  . TYR A 1 70  ? -15.538 8.010   -2.337  1.00 0.00 ? 70  TYR A HE2  1  
ATOM 1018  H HH   . TYR A 1 70  ? -14.850 8.903   -4.698  1.00 0.00 ? 70  TYR A HH   1  
ATOM 1019  N N    . LYS A 1 71  ? -15.536 0.280   -2.830  1.00 0.00 ? 71  LYS A N    1  
ATOM 1020  C CA   . LYS A 1 71  ? -15.174 -1.118  -2.626  1.00 0.00 ? 71  LYS A CA   1  
ATOM 1021  C C    . LYS A 1 71  ? -13.952 -1.490  -3.459  1.00 0.00 ? 71  LYS A C    1  
ATOM 1022  O O    . LYS A 1 71  ? -13.828 -1.079  -4.614  1.00 0.00 ? 71  LYS A O    1  
ATOM 1023  C CB   . LYS A 1 71  ? -16.349 -2.028  -2.989  1.00 0.00 ? 71  LYS A CB   1  
ATOM 1024  C CG   . LYS A 1 71  ? -16.021 -3.509  -2.904  1.00 0.00 ? 71  LYS A CG   1  
ATOM 1025  C CD   . LYS A 1 71  ? -17.249 -4.368  -3.151  1.00 0.00 ? 71  LYS A CD   1  
ATOM 1026  C CE   . LYS A 1 71  ? -17.144 -5.709  -2.440  1.00 0.00 ? 71  LYS A CE   1  
ATOM 1027  N NZ   . LYS A 1 71  ? -16.493 -6.740  -3.294  1.00 0.00 ? 71  LYS A NZ   1  
ATOM 1028  H H    . LYS A 1 71  ? -15.584 0.633   -3.743  1.00 0.00 ? 71  LYS A H    1  
ATOM 1029  H HA   . LYS A 1 71  ? -14.937 -1.250  -1.581  1.00 0.00 ? 71  LYS A HA   1  
ATOM 1030  H HB2  . LYS A 1 71  ? -17.169 -1.823  -2.317  1.00 0.00 ? 71  LYS A HB2  1  
ATOM 1031  H HB3  . LYS A 1 71  ? -16.661 -1.808  -4.000  1.00 0.00 ? 71  LYS A HB3  1  
ATOM 1032  H HG2  . LYS A 1 71  ? -15.274 -3.746  -3.646  1.00 0.00 ? 71  LYS A HG2  1  
ATOM 1033  H HG3  . LYS A 1 71  ? -15.633 -3.726  -1.918  1.00 0.00 ? 71  LYS A HG3  1  
ATOM 1034  H HD2  . LYS A 1 71  ? -18.122 -3.847  -2.785  1.00 0.00 ? 71  LYS A HD2  1  
ATOM 1035  H HD3  . LYS A 1 71  ? -17.349 -4.541  -4.213  1.00 0.00 ? 71  LYS A HD3  1  
ATOM 1036  H HE2  . LYS A 1 71  ? -16.563 -5.579  -1.540  1.00 0.00 ? 71  LYS A HE2  1  
ATOM 1037  H HE3  . LYS A 1 71  ? -18.138 -6.043  -2.181  1.00 0.00 ? 71  LYS A HE3  1  
ATOM 1038  H HZ1  . LYS A 1 71  ? -16.727 -6.575  -4.294  1.00 0.00 ? 71  LYS A HZ1  1  
ATOM 1039  H HZ2  . LYS A 1 71  ? -16.823 -7.688  -3.024  1.00 0.00 ? 71  LYS A HZ2  1  
ATOM 1040  H HZ3  . LYS A 1 71  ? -15.460 -6.699  -3.180  1.00 0.00 ? 71  LYS A HZ3  1  
ATOM 1041  N N    . ILE A 1 72  ? -13.054 -2.271  -2.868  1.00 0.00 ? 72  ILE A N    1  
ATOM 1042  C CA   . ILE A 1 72  ? -11.844 -2.700  -3.558  1.00 0.00 ? 72  ILE A CA   1  
ATOM 1043  C C    . ILE A 1 72  ? -11.724 -4.220  -3.562  1.00 0.00 ? 72  ILE A C    1  
ATOM 1044  O O    . ILE A 1 72  ? -11.436 -4.834  -2.534  1.00 0.00 ? 72  ILE A O    1  
ATOM 1045  C CB   . ILE A 1 72  ? -10.583 -2.099  -2.910  1.00 0.00 ? 72  ILE A CB   1  
ATOM 1046  C CG1  . ILE A 1 72  ? -10.573 -0.578  -3.078  1.00 0.00 ? 72  ILE A CG1  1  
ATOM 1047  C CG2  . ILE A 1 72  ? -9.331  -2.713  -3.517  1.00 0.00 ? 72  ILE A CG2  1  
ATOM 1048  C CD1  . ILE A 1 72  ? -9.394  0.096   -2.410  1.00 0.00 ? 72  ILE A CD1  1  
ATOM 1049  H H    . ILE A 1 72  ? -13.210 -2.566  -1.947  1.00 0.00 ? 72  ILE A H    1  
ATOM 1050  H HA   . ILE A 1 72  ? -11.901 -2.351  -4.579  1.00 0.00 ? 72  ILE A HA   1  
ATOM 1051  H HB   . ILE A 1 72  ? -10.598 -2.337  -1.857  1.00 0.00 ? 72  ILE A HB   1  
ATOM 1052  H HG12 . ILE A 1 72  ? -10.539 -0.338  -4.129  1.00 0.00 ? 72  ILE A HG12 1  
ATOM 1053  H HG13 . ILE A 1 72  ? -11.476 -0.170  -2.648  1.00 0.00 ? 72  ILE A HG13 1  
ATOM 1054  H HG21 . ILE A 1 72  ? -8.718  -1.933  -3.944  1.00 0.00 ? 72  ILE A HG21 1  
ATOM 1055  H HG22 . ILE A 1 72  ? -8.774  -3.227  -2.749  1.00 0.00 ? 72  ILE A HG22 1  
ATOM 1056  H HG23 . ILE A 1 72  ? -9.611  -3.413  -4.289  1.00 0.00 ? 72  ILE A HG23 1  
ATOM 1057  H HD11 . ILE A 1 72  ? -9.581  0.181   -1.350  1.00 0.00 ? 72  ILE A HD11 1  
ATOM 1058  H HD12 . ILE A 1 72  ? -8.503  -0.491  -2.573  1.00 0.00 ? 72  ILE A HD12 1  
ATOM 1059  H HD13 . ILE A 1 72  ? -9.258  1.082   -2.831  1.00 0.00 ? 72  ILE A HD13 1  
ATOM 1060  N N    . ASP A 1 73  ? -11.944 -4.822  -4.726  1.00 0.00 ? 73  ASP A N    1  
ATOM 1061  C CA   . ASP A 1 73  ? -11.858 -6.271  -4.866  1.00 0.00 ? 73  ASP A CA   1  
ATOM 1062  C C    . ASP A 1 73  ? -10.469 -6.690  -5.338  1.00 0.00 ? 73  ASP A C    1  
ATOM 1063  O O    . ASP A 1 73  ? -10.158 -6.615  -6.527  1.00 0.00 ? 73  ASP A O    1  
ATOM 1064  C CB   . ASP A 1 73  ? -12.917 -6.774  -5.848  1.00 0.00 ? 73  ASP A CB   1  
ATOM 1065  C CG   . ASP A 1 73  ? -14.328 -6.570  -5.332  1.00 0.00 ? 73  ASP A CG   1  
ATOM 1066  O OD1  . ASP A 1 73  ? -14.515 -5.722  -4.435  1.00 0.00 ? 73  ASP A OD1  1  
ATOM 1067  O OD2  . ASP A 1 73  ? -15.246 -7.260  -5.825  1.00 0.00 ? 73  ASP A OD2  1  
ATOM 1068  H H    . ASP A 1 73  ? -12.170 -4.279  -5.510  1.00 0.00 ? 73  ASP A H    1  
ATOM 1069  H HA   . ASP A 1 73  ? -12.042 -6.710  -3.897  1.00 0.00 ? 73  ASP A HA   1  
ATOM 1070  H HB2  . ASP A 1 73  ? -12.815 -6.241  -6.782  1.00 0.00 ? 73  ASP A HB2  1  
ATOM 1071  H HB3  . ASP A 1 73  ? -12.765 -7.829  -6.022  1.00 0.00 ? 73  ASP A HB3  1  
ATOM 1072  N N    . PHE A 1 74  ? -9.638  -7.129  -4.399  1.00 0.00 ? 74  PHE A N    1  
ATOM 1073  C CA   . PHE A 1 74  ? -8.281  -7.557  -4.719  1.00 0.00 ? 74  PHE A CA   1  
ATOM 1074  C C    . PHE A 1 74  ? -8.297  -8.728  -5.697  1.00 0.00 ? 74  PHE A C    1  
ATOM 1075  O O    . PHE A 1 74  ? -7.551  -8.743  -6.676  1.00 0.00 ? 74  PHE A O    1  
ATOM 1076  C CB   . PHE A 1 74  ? -7.535  -7.954  -3.443  1.00 0.00 ? 74  PHE A CB   1  
ATOM 1077  C CG   . PHE A 1 74  ? -7.404  -6.833  -2.452  1.00 0.00 ? 74  PHE A CG   1  
ATOM 1078  C CD1  . PHE A 1 74  ? -7.035  -5.564  -2.867  1.00 0.00 ? 74  PHE A CD1  1  
ATOM 1079  C CD2  . PHE A 1 74  ? -7.651  -7.049  -1.106  1.00 0.00 ? 74  PHE A CD2  1  
ATOM 1080  C CE1  . PHE A 1 74  ? -6.913  -4.531  -1.956  1.00 0.00 ? 74  PHE A CE1  1  
ATOM 1081  C CE2  . PHE A 1 74  ? -7.532  -6.020  -0.191  1.00 0.00 ? 74  PHE A CE2  1  
ATOM 1082  C CZ   . PHE A 1 74  ? -7.163  -4.759  -0.617  1.00 0.00 ? 74  PHE A CZ   1  
ATOM 1083  H H    . PHE A 1 74  ? -9.944  -7.165  -3.468  1.00 0.00 ? 74  PHE A H    1  
ATOM 1084  H HA   . PHE A 1 74  ? -7.772  -6.725  -5.180  1.00 0.00 ? 74  PHE A HA   1  
ATOM 1085  H HB2  . PHE A 1 74  ? -8.064  -8.762  -2.962  1.00 0.00 ? 74  PHE A HB2  1  
ATOM 1086  H HB3  . PHE A 1 74  ? -6.541  -8.285  -3.705  1.00 0.00 ? 74  PHE A HB3  1  
ATOM 1087  H HD1  . PHE A 1 74  ? -6.840  -5.383  -3.914  1.00 0.00 ? 74  PHE A HD1  1  
ATOM 1088  H HD2  . PHE A 1 74  ? -7.940  -8.036  -0.771  1.00 0.00 ? 74  PHE A HD2  1  
ATOM 1089  H HE1  . PHE A 1 74  ? -6.626  -3.546  -2.292  1.00 0.00 ? 74  PHE A HE1  1  
ATOM 1090  H HE2  . PHE A 1 74  ? -7.728  -6.202  0.855   1.00 0.00 ? 74  PHE A HE2  1  
ATOM 1091  H HZ   . PHE A 1 74  ? -7.069  -3.954  0.096   1.00 0.00 ? 74  PHE A HZ   1  
ATOM 1092  N N    . ALA A 1 75  ? -9.152  -9.708  -5.424  1.00 0.00 ? 75  ALA A N    1  
ATOM 1093  C CA   . ALA A 1 75  ? -9.267  -10.882 -6.280  1.00 0.00 ? 75  ALA A CA   1  
ATOM 1094  C C    . ALA A 1 75  ? -9.482  -10.482 -7.736  1.00 0.00 ? 75  ALA A C    1  
ATOM 1095  O O    . ALA A 1 75  ? -8.921  -11.092 -8.646  1.00 0.00 ? 75  ALA A O    1  
ATOM 1096  C CB   . ALA A 1 75  ? -10.403 -11.775 -5.803  1.00 0.00 ? 75  ALA A CB   1  
ATOM 1097  H H    . ALA A 1 75  ? -9.720  -9.639  -4.629  1.00 0.00 ? 75  ALA A H    1  
ATOM 1098  H HA   . ALA A 1 75  ? -8.345  -11.442 -6.204  1.00 0.00 ? 75  ALA A HA   1  
ATOM 1099  H HB1  . ALA A 1 75  ? -10.443 -11.758 -4.723  1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1100  H HB2  . ALA A 1 75  ? -11.337 -11.412 -6.203  1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1101  H HB3  . ALA A 1 75  ? -10.233 -12.786 -6.142  1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1102  N N    . GLU A 1 76  ? -10.298 -9.455  -7.948  1.00 0.00 ? 76  GLU A N    1  
ATOM 1103  C CA   . GLU A 1 76  ? -10.588 -8.975  -9.294  1.00 0.00 ? 76  GLU A CA   1  
ATOM 1104  C C    . GLU A 1 76  ? -9.469  -8.069  -9.801  1.00 0.00 ? 76  GLU A C    1  
ATOM 1105  O O    . GLU A 1 76  ? -9.413  -7.739  -10.985 1.00 0.00 ? 76  GLU A O    1  
ATOM 1106  C CB   . GLU A 1 76  ? -11.919 -8.221  -9.315  1.00 0.00 ? 76  GLU A CB   1  
ATOM 1107  C CG   . GLU A 1 76  ? -13.124 -9.105  -9.044  1.00 0.00 ? 76  GLU A CG   1  
ATOM 1108  C CD   . GLU A 1 76  ? -13.700 -9.710  -10.310 1.00 0.00 ? 76  GLU A CD   1  
ATOM 1109  O OE1  . GLU A 1 76  ? -13.013 -10.547 -10.932 1.00 0.00 ? 76  GLU A OE1  1  
ATOM 1110  O OE2  . GLU A 1 76  ? -14.837 -9.347  -10.678 1.00 0.00 ? 76  GLU A OE2  1  
ATOM 1111  H H    . GLU A 1 76  ? -10.716 -9.009  -7.181  1.00 0.00 ? 76  GLU A H    1  
ATOM 1112  H HA   . GLU A 1 76  ? -10.662 -9.834  -9.943  1.00 0.00 ? 76  GLU A HA   1  
ATOM 1113  H HB2  . GLU A 1 76  ? -11.891 -7.445  -8.564  1.00 0.00 ? 76  GLU A HB2  1  
ATOM 1114  H HB3  . GLU A 1 76  ? -12.045 -7.765  -10.286 1.00 0.00 ? 76  GLU A HB3  1  
ATOM 1115  H HG2  . GLU A 1 76  ? -12.826 -9.906  -8.384  1.00 0.00 ? 76  GLU A HG2  1  
ATOM 1116  H HG3  . GLU A 1 76  ? -13.890 -8.512  -8.566  1.00 0.00 ? 76  GLU A HG3  1  
ATOM 1117  N N    . MET A 1 77  ? -8.581  -7.672  -8.896  1.00 0.00 ? 77  MET A N    1  
ATOM 1118  C CA   . MET A 1 77  ? -7.464  -6.805  -9.252  1.00 0.00 ? 77  MET A CA   1  
ATOM 1119  C C    . MET A 1 77  ? -7.962  -5.457  -9.761  1.00 0.00 ? 77  MET A C    1  
ATOM 1120  O O    . MET A 1 77  ? -7.405  -4.893  -10.703 1.00 0.00 ? 77  MET A O    1  
ATOM 1121  C CB   . MET A 1 77  ? -6.590  -7.474  -10.315 1.00 0.00 ? 77  MET A CB   1  
ATOM 1122  C CG   . MET A 1 77  ? -5.476  -8.330  -9.735  1.00 0.00 ? 77  MET A CG   1  
ATOM 1123  S SD   . MET A 1 77  ? -3.966  -7.392  -9.433  1.00 0.00 ? 77  MET A SD   1  
ATOM 1124  C CE   . MET A 1 77  ? -4.221  -6.876  -7.737  1.00 0.00 ? 77  MET A CE   1  
ATOM 1125  H H    . MET A 1 77  ? -8.679  -7.969  -7.967  1.00 0.00 ? 77  MET A H    1  
ATOM 1126  H HA   . MET A 1 77  ? -6.873  -6.645  -8.362  1.00 0.00 ? 77  MET A HA   1  
ATOM 1127  H HB2  . MET A 1 77  ? -7.214  -8.103  -10.932 1.00 0.00 ? 77  MET A HB2  1  
ATOM 1128  H HB3  . MET A 1 77  ? -6.143  -6.708  -10.930 1.00 0.00 ? 77  MET A HB3  1  
ATOM 1129  H HG2  . MET A 1 77  ? -5.813  -8.752  -8.800  1.00 0.00 ? 77  MET A HG2  1  
ATOM 1130  H HG3  . MET A 1 77  ? -5.256  -9.127  -10.429 1.00 0.00 ? 77  MET A HG3  1  
ATOM 1131  H HE1  . MET A 1 77  ? -3.405  -7.231  -7.125  1.00 0.00 ? 77  MET A HE1  1  
ATOM 1132  H HE2  . MET A 1 77  ? -4.263  -5.798  -7.691  1.00 0.00 ? 77  MET A HE2  1  
ATOM 1133  H HE3  . MET A 1 77  ? -5.151  -7.289  -7.371  1.00 0.00 ? 77  MET A HE3  1  
ATOM 1134  N N    . LYS A 1 78  ? -9.015  -4.944  -9.133  1.00 0.00 ? 78  LYS A N    1  
ATOM 1135  C CA   . LYS A 1 78  ? -9.589  -3.662  -9.522  1.00 0.00 ? 78  LYS A CA   1  
ATOM 1136  C C    . LYS A 1 78  ? -10.474 -3.103  -8.412  1.00 0.00 ? 78  LYS A C    1  
ATOM 1137  O O    . LYS A 1 78  ? -10.873 -3.827  -7.501  1.00 0.00 ? 78  LYS A O    1  
ATOM 1138  C CB   . LYS A 1 78  ? -10.402 -3.812  -10.809 1.00 0.00 ? 78  LYS A CB   1  
ATOM 1139  C CG   . LYS A 1 78  ? -11.681 -4.613  -10.631 1.00 0.00 ? 78  LYS A CG   1  
ATOM 1140  C CD   . LYS A 1 78  ? -12.748 -4.188  -11.625 1.00 0.00 ? 78  LYS A CD   1  
ATOM 1141  C CE   . LYS A 1 78  ? -13.686 -5.337  -11.962 1.00 0.00 ? 78  LYS A CE   1  
ATOM 1142  N NZ   . LYS A 1 78  ? -12.972 -6.454  -12.641 1.00 0.00 ? 78  LYS A NZ   1  
ATOM 1143  H H    . LYS A 1 78  ? -9.416  -5.441  -8.389  1.00 0.00 ? 78  LYS A H    1  
ATOM 1144  H HA   . LYS A 1 78  ? -8.776  -2.974  -9.698  1.00 0.00 ? 78  LYS A HA   1  
ATOM 1145  H HB2  . LYS A 1 78  ? -10.665 -2.830  -11.172 1.00 0.00 ? 78  LYS A HB2  1  
ATOM 1146  H HB3  . LYS A 1 78  ? -9.792  -4.309  -11.550 1.00 0.00 ? 78  LYS A HB3  1  
ATOM 1147  H HG2  . LYS A 1 78  ? -11.463 -5.660  -10.779 1.00 0.00 ? 78  LYS A HG2  1  
ATOM 1148  H HG3  . LYS A 1 78  ? -12.054 -4.459  -9.628  1.00 0.00 ? 78  LYS A HG3  1  
ATOM 1149  H HD2  . LYS A 1 78  ? -13.325 -3.381  -11.198 1.00 0.00 ? 78  LYS A HD2  1  
ATOM 1150  H HD3  . LYS A 1 78  ? -12.268 -3.849  -12.532 1.00 0.00 ? 78  LYS A HD3  1  
ATOM 1151  H HE2  . LYS A 1 78  ? -14.126 -5.705  -11.048 1.00 0.00 ? 78  LYS A HE2  1  
ATOM 1152  H HE3  . LYS A 1 78  ? -14.465 -4.970  -12.614 1.00 0.00 ? 78  LYS A HE3  1  
ATOM 1153  H HZ1  . LYS A 1 78  ? -13.657 -7.151  -12.997 1.00 0.00 ? 78  LYS A HZ1  1  
ATOM 1154  H HZ2  . LYS A 1 78  ? -12.330 -6.926  -11.974 1.00 0.00 ? 78  LYS A HZ2  1  
ATOM 1155  H HZ3  . LYS A 1 78  ? -12.417 -6.090  -13.441 1.00 0.00 ? 78  LYS A HZ3  1  
ATOM 1156  N N    . GLN A 1 79  ? -10.776 -1.811  -8.496  1.00 0.00 ? 79  GLN A N    1  
ATOM 1157  C CA   . GLN A 1 79  ? -11.614 -1.157  -7.498  1.00 0.00 ? 79  GLN A CA   1  
ATOM 1158  C C    . GLN A 1 79  ? -13.055 -1.044  -7.987  1.00 0.00 ? 79  GLN A C    1  
ATOM 1159  O O    . GLN A 1 79  ? -13.307 -0.599  -9.106  1.00 0.00 ? 79  GLN A O    1  
ATOM 1160  C CB   . GLN A 1 79  ? -11.064 0.233   -7.171  1.00 0.00 ? 79  GLN A CB   1  
ATOM 1161  C CG   . GLN A 1 79  ? -12.082 1.151   -6.514  1.00 0.00 ? 79  GLN A CG   1  
ATOM 1162  C CD   . GLN A 1 79  ? -11.442 2.365   -5.870  1.00 0.00 ? 79  GLN A CD   1  
ATOM 1163  O OE1  . GLN A 1 79  ? -10.219 2.451   -5.759  1.00 0.00 ? 79  GLN A OE1  1  
ATOM 1164  N NE2  . GLN A 1 79  ? -12.268 3.312   -5.441  1.00 0.00 ? 79  GLN A NE2  1  
ATOM 1165  H H    . GLN A 1 79  ? -10.427 -1.286  -9.246  1.00 0.00 ? 79  GLN A H    1  
ATOM 1166  H HA   . GLN A 1 79  ? -11.597 -1.760  -6.604  1.00 0.00 ? 79  GLN A HA   1  
ATOM 1167  H HB2  . GLN A 1 79  ? -10.223 0.126   -6.503  1.00 0.00 ? 79  GLN A HB2  1  
ATOM 1168  H HB3  . GLN A 1 79  ? -10.729 0.699   -8.086  1.00 0.00 ? 79  GLN A HB3  1  
ATOM 1169  H HG2  . GLN A 1 79  ? -12.781 1.488   -7.265  1.00 0.00 ? 79  GLN A HG2  1  
ATOM 1170  H HG3  . GLN A 1 79  ? -12.611 0.595   -5.755  1.00 0.00 ? 79  GLN A HG3  1  
ATOM 1171  H HE21 . GLN A 1 79  ? -13.231 3.175   -5.561  1.00 0.00 ? 79  GLN A HE21 1  
ATOM 1172  H HE22 . GLN A 1 79  ? -11.882 4.107   -5.019  1.00 0.00 ? 79  GLN A HE22 1  
ATOM 1173  N N    . MET A 1 80  ? -13.995 -1.450  -7.140  1.00 0.00 ? 80  MET A N    1  
ATOM 1174  C CA   . MET A 1 80  ? -15.410 -1.393  -7.486  1.00 0.00 ? 80  MET A CA   1  
ATOM 1175  C C    . MET A 1 80  ? -16.086 -0.199  -6.819  1.00 0.00 ? 80  MET A C    1  
ATOM 1176  O O    . MET A 1 80  ? -16.165 -0.124  -5.594  1.00 0.00 ? 80  MET A O    1  
ATOM 1177  C CB   . MET A 1 80  ? -16.111 -2.688  -7.070  1.00 0.00 ? 80  MET A CB   1  
ATOM 1178  C CG   . MET A 1 80  ? -17.580 -2.736  -7.458  1.00 0.00 ? 80  MET A CG   1  
ATOM 1179  S SD   . MET A 1 80  ? -18.287 -4.387  -7.301  1.00 0.00 ? 80  MET A SD   1  
ATOM 1180  C CE   . MET A 1 80  ? -17.353 -5.275  -8.545  1.00 0.00 ? 80  MET A CE   1  
ATOM 1181  H H    . MET A 1 80  ? -13.731 -1.795  -6.261  1.00 0.00 ? 80  MET A H    1  
ATOM 1182  H HA   . MET A 1 80  ? -15.485 -1.283  -8.557  1.00 0.00 ? 80  MET A HA   1  
ATOM 1183  H HB2  . MET A 1 80  ? -15.610 -3.522  -7.539  1.00 0.00 ? 80  MET A HB2  1  
ATOM 1184  H HB3  . MET A 1 80  ? -16.041 -2.794  -5.998  1.00 0.00 ? 80  MET A HB3  1  
ATOM 1185  H HG2  . MET A 1 80  ? -18.130 -2.062  -6.817  1.00 0.00 ? 80  MET A HG2  1  
ATOM 1186  H HG3  . MET A 1 80  ? -17.678 -2.413  -8.484  1.00 0.00 ? 80  MET A HG3  1  
ATOM 1187  H HE1  . MET A 1 80  ? -16.795 -4.572  -9.146  1.00 0.00 ? 80  MET A HE1  1  
ATOM 1188  H HE2  . MET A 1 80  ? -16.670 -5.958  -8.062  1.00 0.00 ? 80  MET A HE2  1  
ATOM 1189  H HE3  . MET A 1 80  ? -18.032 -5.830  -9.176  1.00 0.00 ? 80  MET A HE3  1  
ATOM 1190  N N    . ASN A 1 81  ? -16.571 0.732   -7.635  1.00 0.00 ? 81  ASN A N    1  
ATOM 1191  C CA   . ASN A 1 81  ? -17.239 1.923   -7.123  1.00 0.00 ? 81  ASN A CA   1  
ATOM 1192  C C    . ASN A 1 81  ? -18.741 1.691   -6.993  1.00 0.00 ? 81  ASN A C    1  
ATOM 1193  O O    . ASN A 1 81  ? -19.329 0.919   -7.752  1.00 0.00 ? 81  ASN A O    1  
ATOM 1194  C CB   . ASN A 1 81  ? -16.973 3.117   -8.042  1.00 0.00 ? 81  ASN A CB   1  
ATOM 1195  C CG   . ASN A 1 81  ? -16.955 4.433   -7.290  1.00 0.00 ? 81  ASN A CG   1  
ATOM 1196  O OD1  . ASN A 1 81  ? -17.077 4.463   -6.065  1.00 0.00 ? 81  ASN A OD1  1  
ATOM 1197  N ND2  . ASN A 1 81  ? -16.802 5.531   -8.022  1.00 0.00 ? 81  ASN A ND2  1  
ATOM 1198  H H    . ASN A 1 81  ? -16.477 0.616   -8.603  1.00 0.00 ? 81  ASN A H    1  
ATOM 1199  H HA   . ASN A 1 81  ? -16.833 2.136   -6.145  1.00 0.00 ? 81  ASN A HA   1  
ATOM 1200  H HB2  . ASN A 1 81  ? -16.014 2.986   -8.523  1.00 0.00 ? 81  ASN A HB2  1  
ATOM 1201  H HB3  . ASN A 1 81  ? -17.746 3.163   -8.795  1.00 0.00 ? 81  ASN A HB3  1  
ATOM 1202  H HD21 . ASN A 1 81  ? -16.711 5.431   -8.993  1.00 0.00 ? 81  ASN A HD21 1  
ATOM 1203  H HD22 . ASN A 1 81  ? -16.786 6.396   -7.561  1.00 0.00 ? 81  ASN A HD22 1  
ATOM 1204  N N    . LEU A 1 82  ? -19.357 2.365   -6.028  1.00 0.00 ? 82  LEU A N    1  
ATOM 1205  C CA   . LEU A 1 82  ? -20.792 2.233   -5.799  1.00 0.00 ? 82  LEU A CA   1  
ATOM 1206  C C    . LEU A 1 82  ? -21.486 3.588   -5.902  1.00 0.00 ? 82  LEU A C    1  
ATOM 1207  O O    . LEU A 1 82  ? -22.671 3.667   -6.228  1.00 0.00 ? 82  LEU A O    1  
ATOM 1208  C CB   . LEU A 1 82  ? -21.054 1.617   -4.424  1.00 0.00 ? 82  LEU A CB   1  
ATOM 1209  C CG   . LEU A 1 82  ? -20.206 0.397   -4.062  1.00 0.00 ? 82  LEU A CG   1  
ATOM 1210  C CD1  . LEU A 1 82  ? -20.430 -0.724  -5.066  1.00 0.00 ? 82  LEU A CD1  1  
ATOM 1211  C CD2  . LEU A 1 82  ? -18.733 0.771   -3.998  1.00 0.00 ? 82  LEU A CD2  1  
ATOM 1212  H H    . LEU A 1 82  ? -18.836 2.965   -5.456  1.00 0.00 ? 82  LEU A H    1  
ATOM 1213  H HA   . LEU A 1 82  ? -21.190 1.579   -6.560  1.00 0.00 ? 82  LEU A HA   1  
ATOM 1214  H HB2  . LEU A 1 82  ? -20.872 2.377   -3.680  1.00 0.00 ? 82  LEU A HB2  1  
ATOM 1215  H HB3  . LEU A 1 82  ? -22.093 1.322   -4.387  1.00 0.00 ? 82  LEU A HB3  1  
ATOM 1216  H HG   . LEU A 1 82  ? -20.504 0.035   -3.088  1.00 0.00 ? 82  LEU A HG   1  
ATOM 1217  H HD11 . LEU A 1 82  ? -21.305 -1.290  -4.784  1.00 0.00 ? 82  LEU A HD11 1  
ATOM 1218  H HD12 . LEU A 1 82  ? -19.568 -1.376  -5.076  1.00 0.00 ? 82  LEU A HD12 1  
ATOM 1219  H HD13 . LEU A 1 82  ? -20.574 -0.303  -6.050  1.00 0.00 ? 82  LEU A HD13 1  
ATOM 1220  H HD21 . LEU A 1 82  ? -18.639 1.823   -3.773  1.00 0.00 ? 82  LEU A HD21 1  
ATOM 1221  H HD22 . LEU A 1 82  ? -18.267 0.563   -4.950  1.00 0.00 ? 82  LEU A HD22 1  
ATOM 1222  H HD23 . LEU A 1 82  ? -18.248 0.193   -3.226  1.00 0.00 ? 82  LEU A HD23 1  
ATOM 1223  N N    . THR A 1 83  ? -20.739 4.652   -5.626  1.00 0.00 ? 83  THR A N    1  
ATOM 1224  C CA   . THR A 1 83  ? -21.282 6.003   -5.689  1.00 0.00 ? 83  THR A CA   1  
ATOM 1225  C C    . THR A 1 83  ? -21.589 6.406   -7.126  1.00 0.00 ? 83  THR A C    1  
ATOM 1226  O O    . THR A 1 83  ? -22.701 6.833   -7.439  1.00 0.00 ? 83  THR A O    1  
ATOM 1227  C CB   . THR A 1 83  ? -20.309 7.029   -5.077  1.00 0.00 ? 83  THR A CB   1  
ATOM 1228  O OG1  . THR A 1 83  ? -20.855 8.348   -5.185  1.00 0.00 ? 83  THR A OG1  1  
ATOM 1229  C CG2  . THR A 1 83  ? -18.958 6.975   -5.774  1.00 0.00 ? 83  THR A CG2  1  
ATOM 1230  H H    . THR A 1 83  ? -19.801 4.524   -5.373  1.00 0.00 ? 83  THR A H    1  
ATOM 1231  H HA   . THR A 1 83  ? -22.198 6.022   -5.116  1.00 0.00 ? 83  THR A HA   1  
ATOM 1232  H HB   . THR A 1 83  ? -20.169 6.790   -4.032  1.00 0.00 ? 83  THR A HB   1  
ATOM 1233  H HG1  . THR A 1 83  ? -21.668 8.401   -4.676  1.00 0.00 ? 83  THR A HG1  1  
ATOM 1234  H HG21 . THR A 1 83  ? -18.208 7.424   -5.139  1.00 0.00 ? 83  THR A HG21 1  
ATOM 1235  H HG22 . THR A 1 83  ? -19.012 7.517   -6.706  1.00 0.00 ? 83  THR A HG22 1  
ATOM 1236  H HG23 . THR A 1 83  ? -18.695 5.947   -5.969  1.00 0.00 ? 83  THR A HG23 1  
ATOM 1237  N N    . THR A 1 84  ? -20.596 6.268   -8.000  1.00 0.00 ? 84  THR A N    1  
ATOM 1238  C CA   . THR A 1 84  ? -20.760 6.618   -9.405  1.00 0.00 ? 84  THR A CA   1  
ATOM 1239  C C    . THR A 1 84  ? -20.748 5.375   -10.286 1.00 0.00 ? 84  THR A C    1  
ATOM 1240  O O    . THR A 1 84  ? -21.231 5.399   -11.417 1.00 0.00 ? 84  THR A O    1  
ATOM 1241  C CB   . THR A 1 84  ? -19.653 7.579   -9.877  1.00 0.00 ? 84  THR A CB   1  
ATOM 1242  O OG1  . THR A 1 84  ? -18.368 6.974   -9.694  1.00 0.00 ? 84  THR A OG1  1  
ATOM 1243  C CG2  . THR A 1 84  ? -19.714 8.893   -9.113  1.00 0.00 ? 84  THR A CG2  1  
ATOM 1244  H H    . THR A 1 84  ? -19.733 5.923   -7.690  1.00 0.00 ? 84  THR A H    1  
ATOM 1245  H HA   . THR A 1 84  ? -21.712 7.117   -9.516  1.00 0.00 ? 84  THR A HA   1  
ATOM 1246  H HB   . THR A 1 84  ? -19.799 7.784   -10.928 1.00 0.00 ? 84  THR A HB   1  
ATOM 1247  H HG1  . THR A 1 84  ? -18.155 6.952   -8.758  1.00 0.00 ? 84  THR A HG1  1  
ATOM 1248  H HG21 . THR A 1 84  ? -20.122 8.718   -8.128  1.00 0.00 ? 84  THR A HG21 1  
ATOM 1249  H HG22 . THR A 1 84  ? -20.344 9.590   -9.645  1.00 0.00 ? 84  THR A HG22 1  
ATOM 1250  H HG23 . THR A 1 84  ? -18.719 9.303   -9.022  1.00 0.00 ? 84  THR A HG23 1  
ATOM 1251  N N    . GLY A 1 85  ? -20.192 4.287   -9.760  1.00 0.00 ? 85  GLY A N    1  
ATOM 1252  C CA   . GLY A 1 85  ? -20.129 3.048   -10.513 1.00 0.00 ? 85  GLY A CA   1  
ATOM 1253  C C    . GLY A 1 85  ? -19.029 3.060   -11.556 1.00 0.00 ? 85  GLY A C    1  
ATOM 1254  O O    . GLY A 1 85  ? -19.152 2.430   -12.607 1.00 0.00 ? 85  GLY A O    1  
ATOM 1255  H H    . GLY A 1 85  ? -19.823 4.326   -8.853  1.00 0.00 ? 85  GLY A H    1  
ATOM 1256  H HA2  . GLY A 1 85  ? -19.953 2.232   -9.829  1.00 0.00 ? 85  GLY A HA2  1  
ATOM 1257  H HA3  . GLY A 1 85  ? -21.076 2.892   -11.008 1.00 0.00 ? 85  GLY A HA3  1  
ATOM 1258  N N    . LYS A 1 86  ? -17.949 3.779   -11.267 1.00 0.00 ? 86  LYS A N    1  
ATOM 1259  C CA   . LYS A 1 86  ? -16.822 3.871   -12.187 1.00 0.00 ? 86  LYS A CA   1  
ATOM 1260  C C    . LYS A 1 86  ? -15.831 2.736   -11.949 1.00 0.00 ? 86  LYS A C    1  
ATOM 1261  O O    . LYS A 1 86  ? -15.435 2.474   -10.814 1.00 0.00 ? 86  LYS A O    1  
ATOM 1262  C CB   . LYS A 1 86  ? -16.116 5.220   -12.028 1.00 0.00 ? 86  LYS A CB   1  
ATOM 1263  C CG   . LYS A 1 86  ? -16.995 6.410   -12.371 1.00 0.00 ? 86  LYS A CG   1  
ATOM 1264  C CD   . LYS A 1 86  ? -17.055 6.646   -13.871 1.00 0.00 ? 86  LYS A CD   1  
ATOM 1265  C CE   . LYS A 1 86  ? -15.774 7.287   -14.385 1.00 0.00 ? 86  LYS A CE   1  
ATOM 1266  N NZ   . LYS A 1 86  ? -15.839 8.773   -14.335 1.00 0.00 ? 86  LYS A NZ   1  
ATOM 1267  H H    . LYS A 1 86  ? -17.909 4.259   -10.413 1.00 0.00 ? 86  LYS A H    1  
ATOM 1268  H HA   . LYS A 1 86  ? -17.207 3.792   -13.193 1.00 0.00 ? 86  LYS A HA   1  
ATOM 1269  H HB2  . LYS A 1 86  ? -15.789 5.323   -11.004 1.00 0.00 ? 86  LYS A HB2  1  
ATOM 1270  H HB3  . LYS A 1 86  ? -15.252 5.239   -12.677 1.00 0.00 ? 86  LYS A HB3  1  
ATOM 1271  H HG2  . LYS A 1 86  ? -17.995 6.225   -12.007 1.00 0.00 ? 86  LYS A HG2  1  
ATOM 1272  H HG3  . LYS A 1 86  ? -16.593 7.292   -11.892 1.00 0.00 ? 86  LYS A HG3  1  
ATOM 1273  H HD2  . LYS A 1 86  ? -17.196 5.699   -14.370 1.00 0.00 ? 86  LYS A HD2  1  
ATOM 1274  H HD3  . LYS A 1 86  ? -17.887 7.299   -14.091 1.00 0.00 ? 86  LYS A HD3  1  
ATOM 1275  H HE2  . LYS A 1 86  ? -14.949 6.950   -13.777 1.00 0.00 ? 86  LYS A HE2  1  
ATOM 1276  H HE3  . LYS A 1 86  ? -15.618 6.976   -15.408 1.00 0.00 ? 86  LYS A HE3  1  
ATOM 1277  H HZ1  . LYS A 1 86  ? -16.760 9.103   -14.691 1.00 0.00 ? 86  LYS A HZ1  1  
ATOM 1278  H HZ2  . LYS A 1 86  ? -15.087 9.184   -14.924 1.00 0.00 ? 86  LYS A HZ2  1  
ATOM 1279  H HZ3  . LYS A 1 86  ? -15.719 9.104   -13.357 1.00 0.00 ? 86  LYS A HZ3  1  
ATOM 1280  N N    . GLN A 1 87  ? -15.435 2.066   -13.027 1.00 0.00 ? 87  GLN A N    1  
ATOM 1281  C CA   . GLN A 1 87  ? -14.490 0.960   -12.934 1.00 0.00 ? 87  GLN A CA   1  
ATOM 1282  C C    . GLN A 1 87  ? -13.055 1.456   -13.079 1.00 0.00 ? 87  GLN A C    1  
ATOM 1283  O O    . GLN A 1 87  ? -12.754 2.271   -13.952 1.00 0.00 ? 87  GLN A O    1  
ATOM 1284  C CB   . GLN A 1 87  ? -14.790 -0.087  -14.008 1.00 0.00 ? 87  GLN A CB   1  
ATOM 1285  C CG   . GLN A 1 87  ? -13.576 -0.904  -14.418 1.00 0.00 ? 87  GLN A CG   1  
ATOM 1286  C CD   . GLN A 1 87  ? -13.948 -2.265  -14.973 1.00 0.00 ? 87  GLN A CD   1  
ATOM 1287  O OE1  . GLN A 1 87  ? -15.034 -2.781  -14.706 1.00 0.00 ? 87  GLN A OE1  1  
ATOM 1288  N NE2  . GLN A 1 87  ? -13.048 -2.854  -15.751 1.00 0.00 ? 87  GLN A NE2  1  
ATOM 1289  H H    . GLN A 1 87  ? -15.787 2.322   -13.905 1.00 0.00 ? 87  GLN A H    1  
ATOM 1290  H HA   . GLN A 1 87  ? -14.605 0.507   -11.961 1.00 0.00 ? 87  GLN A HA   1  
ATOM 1291  H HB2  . GLN A 1 87  ? -15.544 -0.764  -13.634 1.00 0.00 ? 87  GLN A HB2  1  
ATOM 1292  H HB3  . GLN A 1 87  ? -15.172 0.414   -14.886 1.00 0.00 ? 87  GLN A HB3  1  
ATOM 1293  H HG2  . GLN A 1 87  ? -13.031 -0.361  -15.176 1.00 0.00 ? 87  GLN A HG2  1  
ATOM 1294  H HG3  . GLN A 1 87  ? -12.944 -1.045  -13.553 1.00 0.00 ? 87  GLN A HG3  1  
ATOM 1295  H HE21 . GLN A 1 87  ? -12.204 -2.384  -15.919 1.00 0.00 ? 87  GLN A HE21 1  
ATOM 1296  H HE22 . GLN A 1 87  ? -13.262 -3.734  -16.122 1.00 0.00 ? 87  GLN A HE22 1  
ATOM 1297  N N    . ARG A 1 88  ? -12.173 0.961   -12.217 1.00 0.00 ? 88  ARG A N    1  
ATOM 1298  C CA   . ARG A 1 88  ? -10.770 1.355   -12.247 1.00 0.00 ? 88  ARG A CA   1  
ATOM 1299  C C    . ARG A 1 88  ? -9.871  0.200   -11.817 1.00 0.00 ? 88  ARG A C    1  
ATOM 1300  O O    . ARG A 1 88  ? -10.008 -0.330  -10.714 1.00 0.00 ? 88  ARG A O    1  
ATOM 1301  C CB   . ARG A 1 88  ? -10.538 2.563   -11.337 1.00 0.00 ? 88  ARG A CB   1  
ATOM 1302  C CG   . ARG A 1 88  ? -11.473 3.727   -11.620 1.00 0.00 ? 88  ARG A CG   1  
ATOM 1303  C CD   . ARG A 1 88  ? -11.248 4.872   -10.644 1.00 0.00 ? 88  ARG A CD   1  
ATOM 1304  N NE   . ARG A 1 88  ? -11.784 6.134   -11.147 1.00 0.00 ? 88  ARG A NE   1  
ATOM 1305  C CZ   . ARG A 1 88  ? -11.755 7.270   -10.461 1.00 0.00 ? 88  ARG A CZ   1  
ATOM 1306  N NH1  . ARG A 1 88  ? -11.218 7.303   -9.249  1.00 0.00 ? 88  ARG A NH1  1  
ATOM 1307  N NH2  . ARG A 1 88  ? -12.263 8.378   -10.987 1.00 0.00 ? 88  ARG A NH2  1  
ATOM 1308  H H    . ARG A 1 88  ? -12.473 0.315   -11.543 1.00 0.00 ? 88  ARG A H    1  
ATOM 1309  H HA   . ARG A 1 88  ? -10.524 1.628   -13.263 1.00 0.00 ? 88  ARG A HA   1  
ATOM 1310  H HB2  . ARG A 1 88  ? -10.679 2.258   -10.311 1.00 0.00 ? 88  ARG A HB2  1  
ATOM 1311  H HB3  . ARG A 1 88  ? -9.522  2.905   -11.466 1.00 0.00 ? 88  ARG A HB3  1  
ATOM 1312  H HG2  . ARG A 1 88  ? -11.295 4.085   -12.624 1.00 0.00 ? 88  ARG A HG2  1  
ATOM 1313  H HG3  . ARG A 1 88  ? -12.493 3.386   -11.533 1.00 0.00 ? 88  ARG A HG3  1  
ATOM 1314  H HD2  . ARG A 1 88  ? -11.734 4.632   -9.711  1.00 0.00 ? 88  ARG A HD2  1  
ATOM 1315  H HD3  . ARG A 1 88  ? -10.187 4.983   -10.479 1.00 0.00 ? 88  ARG A HD3  1  
ATOM 1316  H HE   . ARG A 1 88  ? -12.186 6.132   -12.041 1.00 0.00 ? 88  ARG A HE   1  
ATOM 1317  H HH11 . ARG A 1 88  ? -10.833 6.471   -8.851  1.00 0.00 ? 88  ARG A HH11 1  
ATOM 1318  H HH12 . ARG A 1 88  ? -11.196 8.161   -8.735  1.00 0.00 ? 88  ARG A HH12 1  
ATOM 1319  H HH21 . ARG A 1 88  ? -12.669 8.357   -11.900 1.00 0.00 ? 88  ARG A HH21 1  
ATOM 1320  H HH22 . ARG A 1 88  ? -12.241 9.232   -10.469 1.00 0.00 ? 88  ARG A HH22 1  
ATOM 1321  N N    . LEU A 1 89  ? -8.951  -0.186  -12.695 1.00 0.00 ? 89  LEU A N    1  
ATOM 1322  C CA   . LEU A 1 89  ? -8.029  -1.279  -12.406 1.00 0.00 ? 89  LEU A CA   1  
ATOM 1323  C C    . LEU A 1 89  ? -6.933  -0.827  -11.447 1.00 0.00 ? 89  LEU A C    1  
ATOM 1324  O O    . LEU A 1 89  ? -6.479  0.316   -11.500 1.00 0.00 ? 89  LEU A O    1  
ATOM 1325  C CB   . LEU A 1 89  ? -7.405  -1.801  -13.702 1.00 0.00 ? 89  LEU A CB   1  
ATOM 1326  C CG   . LEU A 1 89  ? -8.251  -2.792  -14.502 1.00 0.00 ? 89  LEU A CG   1  
ATOM 1327  C CD1  . LEU A 1 89  ? -8.380  -4.110  -13.753 1.00 0.00 ? 89  LEU A CD1  1  
ATOM 1328  C CD2  . LEU A 1 89  ? -9.625  -2.207  -14.794 1.00 0.00 ? 89  LEU A CD2  1  
ATOM 1329  H H    . LEU A 1 89  ? -8.890  0.275   -13.557 1.00 0.00 ? 89  LEU A H    1  
ATOM 1330  H HA   . LEU A 1 89  ? -8.593  -2.074  -11.941 1.00 0.00 ? 89  LEU A HA   1  
ATOM 1331  H HB2  . LEU A 1 89  ? -7.202  -0.952  -14.336 1.00 0.00 ? 89  LEU A HB2  1  
ATOM 1332  H HB3  . LEU A 1 89  ? -6.475  -2.289  -13.447 1.00 0.00 ? 89  LEU A HB3  1  
ATOM 1333  H HG   . LEU A 1 89  ? -7.764  -2.992  -15.446 1.00 0.00 ? 89  LEU A HG   1  
ATOM 1334  H HD11 . LEU A 1 89  ? -9.420  -4.395  -13.703 1.00 0.00 ? 89  LEU A HD11 1  
ATOM 1335  H HD12 . LEU A 1 89  ? -7.989  -3.995  -12.753 1.00 0.00 ? 89  LEU A HD12 1  
ATOM 1336  H HD13 . LEU A 1 89  ? -7.821  -4.875  -14.272 1.00 0.00 ? 89  LEU A HD13 1  
ATOM 1337  H HD21 . LEU A 1 89  ? -9.593  -1.135  -14.668 1.00 0.00 ? 89  LEU A HD21 1  
ATOM 1338  H HD22 . LEU A 1 89  ? -10.349 -2.628  -14.112 1.00 0.00 ? 89  LEU A HD22 1  
ATOM 1339  H HD23 . LEU A 1 89  ? -9.907  -2.441  -15.810 1.00 0.00 ? 89  LEU A HD23 1  
ATOM 1340  N N    . ILE A 1 90  ? -6.510  -1.733  -10.571 1.00 0.00 ? 90  ILE A N    1  
ATOM 1341  C CA   . ILE A 1 90  ? -5.465  -1.429  -9.602  1.00 0.00 ? 90  ILE A CA   1  
ATOM 1342  C C    . ILE A 1 90  ? -4.191  -2.211  -9.904  1.00 0.00 ? 90  ILE A C    1  
ATOM 1343  O O    . ILE A 1 90  ? -4.115  -2.937  -10.895 1.00 0.00 ? 90  ILE A O    1  
ATOM 1344  C CB   . ILE A 1 90  ? -5.920  -1.745  -8.165  1.00 0.00 ? 90  ILE A CB   1  
ATOM 1345  C CG1  . ILE A 1 90  ? -6.290  -3.224  -8.038  1.00 0.00 ? 90  ILE A CG1  1  
ATOM 1346  C CG2  . ILE A 1 90  ? -7.097  -0.864  -7.776  1.00 0.00 ? 90  ILE A CG2  1  
ATOM 1347  C CD1  . ILE A 1 90  ? -7.094  -3.541  -6.797  1.00 0.00 ? 90  ILE A CD1  1  
ATOM 1348  H H    . ILE A 1 90  ? -6.910  -2.627  -10.578 1.00 0.00 ? 90  ILE A H    1  
ATOM 1349  H HA   . ILE A 1 90  ? -5.249  -0.372  -9.666  1.00 0.00 ? 90  ILE A HA   1  
ATOM 1350  H HB   . ILE A 1 90  ? -5.102  -1.527  -7.496  1.00 0.00 ? 90  ILE A HB   1  
ATOM 1351  H HG12 . ILE A 1 90  ? -6.875  -3.518  -8.895  1.00 0.00 ? 90  ILE A HG12 1  
ATOM 1352  H HG13 . ILE A 1 90  ? -5.384  -3.813  -8.007  1.00 0.00 ? 90  ILE A HG13 1  
ATOM 1353  H HG21 . ILE A 1 90  ? -7.462  -1.159  -6.804  1.00 0.00 ? 90  ILE A HG21 1  
ATOM 1354  H HG22 . ILE A 1 90  ? -6.779  0.167   -7.742  1.00 0.00 ? 90  ILE A HG22 1  
ATOM 1355  H HG23 . ILE A 1 90  ? -7.886  -0.973  -8.505  1.00 0.00 ? 90  ILE A HG23 1  
ATOM 1356  H HD11 . ILE A 1 90  ? -8.123  -3.248  -6.949  1.00 0.00 ? 90  ILE A HD11 1  
ATOM 1357  H HD12 . ILE A 1 90  ? -7.047  -4.601  -6.597  1.00 0.00 ? 90  ILE A HD12 1  
ATOM 1358  H HD13 . ILE A 1 90  ? -6.688  -2.998  -5.956  1.00 0.00 ? 90  ILE A HD13 1  
ATOM 1359  N N    . LYS A 1 91  ? -3.192  -2.060  -9.041  1.00 0.00 ? 91  LYS A N    1  
ATOM 1360  C CA   . LYS A 1 91  ? -1.921  -2.754  -9.212  1.00 0.00 ? 91  LYS A CA   1  
ATOM 1361  C C    . LYS A 1 91  ? -1.032  -2.570  -7.986  1.00 0.00 ? 91  LYS A C    1  
ATOM 1362  O O    . LYS A 1 91  ? -1.033  -1.510  -7.360  1.00 0.00 ? 91  LYS A O    1  
ATOM 1363  C CB   . LYS A 1 91  ? -1.200  -2.241  -10.460 1.00 0.00 ? 91  LYS A CB   1  
ATOM 1364  C CG   . LYS A 1 91  ? -0.612  -0.850  -10.294 1.00 0.00 ? 91  LYS A CG   1  
ATOM 1365  C CD   . LYS A 1 91  ? 0.183   -0.431  -11.520 1.00 0.00 ? 91  LYS A CD   1  
ATOM 1366  C CE   . LYS A 1 91  ? 1.307   0.526   -11.154 1.00 0.00 ? 91  LYS A CE   1  
ATOM 1367  N NZ   . LYS A 1 91  ? 0.836   1.937   -11.088 1.00 0.00 ? 91  LYS A NZ   1  
ATOM 1368  H H    . LYS A 1 91  ? -3.313  -1.467  -8.269  1.00 0.00 ? 91  LYS A H    1  
ATOM 1369  H HA   . LYS A 1 91  ? -2.131  -3.806  -9.335  1.00 0.00 ? 91  LYS A HA   1  
ATOM 1370  H HB2  . LYS A 1 91  ? -0.398  -2.922  -10.703 1.00 0.00 ? 91  LYS A HB2  1  
ATOM 1371  H HB3  . LYS A 1 91  ? -1.901  -2.216  -11.282 1.00 0.00 ? 91  LYS A HB3  1  
ATOM 1372  H HG2  . LYS A 1 91  ? -1.415  -0.145  -10.141 1.00 0.00 ? 91  LYS A HG2  1  
ATOM 1373  H HG3  . LYS A 1 91  ? 0.042   -0.846  -9.434  1.00 0.00 ? 91  LYS A HG3  1  
ATOM 1374  H HD2  . LYS A 1 91  ? 0.609   -1.310  -11.980 1.00 0.00 ? 91  LYS A HD2  1  
ATOM 1375  H HD3  . LYS A 1 91  ? -0.482  0.058   -12.218 1.00 0.00 ? 91  LYS A HD3  1  
ATOM 1376  H HE2  . LYS A 1 91  ? 1.705   0.243   -10.192 1.00 0.00 ? 91  LYS A HE2  1  
ATOM 1377  H HE3  . LYS A 1 91  ? 2.084   0.449   -11.901 1.00 0.00 ? 91  LYS A HE3  1  
ATOM 1378  H HZ1  . LYS A 1 91  ? 1.627   2.567   -10.845 1.00 0.00 ? 91  LYS A HZ1  1  
ATOM 1379  H HZ2  . LYS A 1 91  ? 0.096   2.033   -10.364 1.00 0.00 ? 91  LYS A HZ2  1  
ATOM 1380  H HZ3  . LYS A 1 91  ? 0.445   2.227   -12.007 1.00 0.00 ? 91  LYS A HZ3  1  
ATOM 1381  N N    . ARG A 1 92  ? -0.273  -3.608  -7.650  1.00 0.00 ? 92  ARG A N    1  
ATOM 1382  C CA   . ARG A 1 92  ? 0.621   -3.560  -6.500  1.00 0.00 ? 92  ARG A CA   1  
ATOM 1383  C C    . ARG A 1 92  ? 2.081   -3.559  -6.945  1.00 0.00 ? 92  ARG A C    1  
ATOM 1384  O O    . ARG A 1 92  ? 2.511   -4.433  -7.698  1.00 0.00 ? 92  ARG A O    1  
ATOM 1385  C CB   . ARG A 1 92  ? 0.360   -4.750  -5.574  1.00 0.00 ? 92  ARG A CB   1  
ATOM 1386  C CG   . ARG A 1 92  ? 1.216   -4.743  -4.318  1.00 0.00 ? 92  ARG A CG   1  
ATOM 1387  C CD   . ARG A 1 92  ? 0.566   -5.539  -3.197  1.00 0.00 ? 92  ARG A CD   1  
ATOM 1388  N NE   . ARG A 1 92  ? 0.753   -6.977  -3.367  1.00 0.00 ? 92  ARG A NE   1  
ATOM 1389  C CZ   . ARG A 1 92  ? 1.851   -7.625  -2.993  1.00 0.00 ? 92  ARG A CZ   1  
ATOM 1390  N NH1  . ARG A 1 92  ? 2.854   -6.966  -2.431  1.00 0.00 ? 92  ARG A NH1  1  
ATOM 1391  N NH2  . ARG A 1 92  ? 1.946   -8.935  -3.181  1.00 0.00 ? 92  ARG A NH2  1  
ATOM 1392  H H    . ARG A 1 92  ? -0.316  -4.426  -8.188  1.00 0.00 ? 92  ARG A H    1  
ATOM 1393  H HA   . ARG A 1 92  ? 0.421   -2.646  -5.962  1.00 0.00 ? 92  ARG A HA   1  
ATOM 1394  H HB2  . ARG A 1 92  ? -0.678  -4.737  -5.275  1.00 0.00 ? 92  ARG A HB2  1  
ATOM 1395  H HB3  . ARG A 1 92  ? 0.560   -5.662  -6.115  1.00 0.00 ? 92  ARG A HB3  1  
ATOM 1396  H HG2  . ARG A 1 92  ? 2.177   -5.182  -4.546  1.00 0.00 ? 92  ARG A HG2  1  
ATOM 1397  H HG3  . ARG A 1 92  ? 1.353   -3.723  -3.992  1.00 0.00 ? 92  ARG A HG3  1  
ATOM 1398  H HD2  . ARG A 1 92  ? 1.006   -5.237  -2.258  1.00 0.00 ? 92  ARG A HD2  1  
ATOM 1399  H HD3  . ARG A 1 92  ? -0.491  -5.321  -3.186  1.00 0.00 ? 92  ARG A HD3  1  
ATOM 1400  H HE   . ARG A 1 92  ? 0.024   -7.484  -3.781  1.00 0.00 ? 92  ARG A HE   1  
ATOM 1401  H HH11 . ARG A 1 92  ? 2.785   -5.979  -2.287  1.00 0.00 ? 92  ARG A HH11 1  
ATOM 1402  H HH12 . ARG A 1 92  ? 3.679   -7.457  -2.149  1.00 0.00 ? 92  ARG A HH12 1  
ATOM 1403  H HH21 . ARG A 1 92  ? 1.191   -9.436  -3.605  1.00 0.00 ? 92  ARG A HH21 1  
ATOM 1404  H HH22 . ARG A 1 92  ? 2.772   -9.422  -2.900  1.00 0.00 ? 92  ARG A HH22 1  
ATOM 1405  N N    . ALA A 1 93  ? 2.837   -2.573  -6.475  1.00 0.00 ? 93  ALA A N    1  
ATOM 1406  C CA   . ALA A 1 93  ? 4.248   -2.459  -6.824  1.00 0.00 ? 93  ALA A CA   1  
ATOM 1407  C C    . ALA A 1 93  ? 5.009   -1.654  -5.776  1.00 0.00 ? 93  ALA A C    1  
ATOM 1408  O O    . ALA A 1 93  ? 4.453   -0.789  -5.099  1.00 0.00 ? 93  ALA A O    1  
ATOM 1409  C CB   . ALA A 1 93  ? 4.403   -1.822  -8.197  1.00 0.00 ? 93  ALA A CB   1  
ATOM 1410  H H    . ALA A 1 93  ? 2.437   -1.906  -5.879  1.00 0.00 ? 93  ALA A H    1  
ATOM 1411  H HA   . ALA A 1 93  ? 4.662   -3.456  -6.868  1.00 0.00 ? 93  ALA A HA   1  
ATOM 1412  H HB1  . ALA A 1 93  ? 4.944   -2.495  -8.846  1.00 0.00 ? 93  ALA A HB1  1  
ATOM 1413  H HB2  . ALA A 1 93  ? 3.427   -1.625  -8.614  1.00 0.00 ? 93  ALA A HB2  1  
ATOM 1414  H HB3  . ALA A 1 93  ? 4.948   -0.895  -8.104  1.00 0.00 ? 93  ALA A HB3  1  
ATOM 1415  N N    . PRO A 1 94  ? 6.311   -1.944  -5.637  1.00 0.00 ? 94  PRO A N    1  
ATOM 1416  C CA   . PRO A 1 94  ? 7.176   -1.257  -4.673  1.00 0.00 ? 94  PRO A CA   1  
ATOM 1417  C C    . PRO A 1 94  ? 7.440   0.194   -5.061  1.00 0.00 ? 94  PRO A C    1  
ATOM 1418  O O    . PRO A 1 94  ? 7.411   0.546   -6.240  1.00 0.00 ? 94  PRO A O    1  
ATOM 1419  C CB   . PRO A 1 94  ? 8.474   -2.068  -4.721  1.00 0.00 ? 94  PRO A CB   1  
ATOM 1420  C CG   . PRO A 1 94  ? 8.480   -2.694  -6.073  1.00 0.00 ? 94  PRO A CG   1  
ATOM 1421  C CD   . PRO A 1 94  ? 7.039   -2.963  -6.411  1.00 0.00 ? 94  PRO A CD   1  
ATOM 1422  H HA   . PRO A 1 94  ? 6.764   -1.293  -3.675  1.00 0.00 ? 94  PRO A HA   1  
ATOM 1423  H HB2  . PRO A 1 94  ? 9.319   -1.407  -4.587  1.00 0.00 ? 94  PRO A HB2  1  
ATOM 1424  H HB3  . PRO A 1 94  ? 8.465   -2.814  -3.941  1.00 0.00 ? 94  PRO A HB3  1  
ATOM 1425  H HG2  . PRO A 1 94  ? 8.913   -2.014  -6.791  1.00 0.00 ? 94  PRO A HG2  1  
ATOM 1426  H HG3  . PRO A 1 94  ? 9.037   -3.618  -6.046  1.00 0.00 ? 94  PRO A HG3  1  
ATOM 1427  H HD2  . PRO A 1 94  ? 6.870   -2.837  -7.470  1.00 0.00 ? 94  PRO A HD2  1  
ATOM 1428  H HD3  . PRO A 1 94  ? 6.758   -3.958  -6.098  1.00 0.00 ? 94  PRO A HD3  1  
ATOM 1429  N N    . PHE A 1 95  ? 7.697   1.031   -4.062  1.00 0.00 ? 95  PHE A N    1  
ATOM 1430  C CA   . PHE A 1 95  ? 7.966   2.445   -4.299  1.00 0.00 ? 95  PHE A CA   1  
ATOM 1431  C C    . PHE A 1 95  ? 9.264   2.628   -5.080  1.00 0.00 ? 95  PHE A C    1  
ATOM 1432  O O    . PHE A 1 95  ? 9.290   3.296   -6.114  1.00 0.00 ? 95  PHE A O    1  
ATOM 1433  C CB   . PHE A 1 95  ? 8.045   3.200   -2.971  1.00 0.00 ? 95  PHE A CB   1  
ATOM 1434  C CG   . PHE A 1 95  ? 6.867   2.958   -2.072  1.00 0.00 ? 95  PHE A CG   1  
ATOM 1435  C CD1  . PHE A 1 95  ? 5.581   3.245   -2.501  1.00 0.00 ? 95  PHE A CD1  1  
ATOM 1436  C CD2  . PHE A 1 95  ? 7.044   2.443   -0.798  1.00 0.00 ? 95  PHE A CD2  1  
ATOM 1437  C CE1  . PHE A 1 95  ? 4.495   3.024   -1.676  1.00 0.00 ? 95  PHE A CE1  1  
ATOM 1438  C CE2  . PHE A 1 95  ? 5.962   2.219   0.031   1.00 0.00 ? 95  PHE A CE2  1  
ATOM 1439  C CZ   . PHE A 1 95  ? 4.685   2.509   -0.408  1.00 0.00 ? 95  PHE A CZ   1  
ATOM 1440  H H    . PHE A 1 95  ? 7.706   0.690   -3.143  1.00 0.00 ? 95  PHE A H    1  
ATOM 1441  H HA   . PHE A 1 95  ? 7.150   2.843   -4.882  1.00 0.00 ? 95  PHE A HA   1  
ATOM 1442  H HB2  . PHE A 1 95  ? 8.934   2.892   -2.442  1.00 0.00 ? 95  PHE A HB2  1  
ATOM 1443  H HB3  . PHE A 1 95  ? 8.100   4.260   -3.171  1.00 0.00 ? 95  PHE A HB3  1  
ATOM 1444  H HD1  . PHE A 1 95  ? 5.430   3.647   -3.492  1.00 0.00 ? 95  PHE A HD1  1  
ATOM 1445  H HD2  . PHE A 1 95  ? 8.043   2.215   -0.453  1.00 0.00 ? 95  PHE A HD2  1  
ATOM 1446  H HE1  . PHE A 1 95  ? 3.497   3.251   -2.022  1.00 0.00 ? 95  PHE A HE1  1  
ATOM 1447  H HE2  . PHE A 1 95  ? 6.115   1.816   1.022   1.00 0.00 ? 95  PHE A HE2  1  
ATOM 1448  H HZ   . PHE A 1 95  ? 3.838   2.336   0.239   1.00 0.00 ? 95  PHE A HZ   1  
ATOM 1449  N N    . SER A 1 96  ? 10.340  2.031   -4.577  1.00 0.00 ? 96  SER A N    1  
ATOM 1450  C CA   . SER A 1 96  ? 11.643  2.131   -5.224  1.00 0.00 ? 96  SER A CA   1  
ATOM 1451  C C    . SER A 1 96  ? 12.223  0.746   -5.495  1.00 0.00 ? 96  SER A C    1  
ATOM 1452  O O    . SER A 1 96  ? 11.936  -0.211  -4.775  1.00 0.00 ? 96  SER A O    1  
ATOM 1453  C CB   . SER A 1 96  ? 12.607  2.939   -4.354  1.00 0.00 ? 96  SER A CB   1  
ATOM 1454  O OG   . SER A 1 96  ? 12.711  2.382   -3.055  1.00 0.00 ? 96  SER A OG   1  
ATOM 1455  H H    . SER A 1 96  ? 10.255  1.512   -3.750  1.00 0.00 ? 96  SER A H    1  
ATOM 1456  H HA   . SER A 1 96  ? 11.507  2.642   -6.165  1.00 0.00 ? 96  SER A HA   1  
ATOM 1457  H HB2  . SER A 1 96  ? 13.585  2.941   -4.810  1.00 0.00 ? 96  SER A HB2  1  
ATOM 1458  H HB3  . SER A 1 96  ? 12.246  3.954   -4.269  1.00 0.00 ? 96  SER A HB3  1  
ATOM 1459  H HG   . SER A 1 96  ? 12.156  2.878   -2.448  1.00 0.00 ? 96  SER A HG   1  
ATOM 1460  N N    . SER A 1 97  ? 13.041  0.648   -6.538  1.00 0.00 ? 97  SER A N    1  
ATOM 1461  C CA   . SER A 1 97  ? 13.659  -0.620  -6.907  1.00 0.00 ? 97  SER A CA   1  
ATOM 1462  C C    . SER A 1 97  ? 15.173  -0.472  -7.024  1.00 0.00 ? 97  SER A C    1  
ATOM 1463  O O    . SER A 1 97  ? 15.675  0.555   -7.478  1.00 0.00 ? 97  SER A O    1  
ATOM 1464  C CB   . SER A 1 97  ? 13.082  -1.127  -8.231  1.00 0.00 ? 97  SER A CB   1  
ATOM 1465  O OG   . SER A 1 97  ? 13.200  -2.535  -8.332  1.00 0.00 ? 97  SER A OG   1  
ATOM 1466  H H    . SER A 1 97  ? 13.230  1.447   -7.073  1.00 0.00 ? 97  SER A H    1  
ATOM 1467  H HA   . SER A 1 97  ? 13.438  -1.336  -6.130  1.00 0.00 ? 97  SER A HA   1  
ATOM 1468  H HB2  . SER A 1 97  ? 12.038  -0.860  -8.290  1.00 0.00 ? 97  SER A HB2  1  
ATOM 1469  H HB3  . SER A 1 97  ? 13.617  -0.672  -9.051  1.00 0.00 ? 97  SER A HB3  1  
ATOM 1470  H HG   . SER A 1 97  ? 12.326  -2.932  -8.318  1.00 0.00 ? 97  SER A HG   1  
ATOM 1471  N N    . GLY A 1 98  ? 15.896  -1.508  -6.609  1.00 0.00 ? 98  GLY A N    1  
ATOM 1472  C CA   . GLY A 1 98  ? 17.345  -1.475  -6.674  1.00 0.00 ? 98  GLY A CA   1  
ATOM 1473  C C    . GLY A 1 98  ? 17.973  -0.985  -5.383  1.00 0.00 ? 98  GLY A C    1  
ATOM 1474  O O    . GLY A 1 98  ? 17.423  -0.134  -4.685  1.00 0.00 ? 98  GLY A O    1  
ATOM 1475  H H    . GLY A 1 98  ? 15.442  -2.302  -6.255  1.00 0.00 ? 98  GLY A H    1  
ATOM 1476  H HA2  . GLY A 1 98  ? 17.709  -2.470  -6.883  1.00 0.00 ? 98  GLY A HA2  1  
ATOM 1477  H HA3  . GLY A 1 98  ? 17.643  -0.817  -7.477  1.00 0.00 ? 98  GLY A HA3  1  
ATOM 1478  N N    . PRO A 1 99  ? 19.151  -1.532  -5.049  1.00 0.00 ? 99  PRO A N    1  
ATOM 1479  C CA   . PRO A 1 99  ? 19.879  -1.161  -3.832  1.00 0.00 ? 99  PRO A CA   1  
ATOM 1480  C C    . PRO A 1 99  ? 20.443  0.254   -3.901  1.00 0.00 ? 99  PRO A C    1  
ATOM 1481  O O    . PRO A 1 99  ? 20.798  0.842   -2.880  1.00 0.00 ? 99  PRO A O    1  
ATOM 1482  C CB   . PRO A 1 99  ? 21.013  -2.187  -3.770  1.00 0.00 ? 99  PRO A CB   1  
ATOM 1483  C CG   . PRO A 1 99  ? 21.219  -2.609  -5.184  1.00 0.00 ? 99  PRO A CG   1  
ATOM 1484  C CD   . PRO A 1 99  ? 19.865  -2.553  -5.835  1.00 0.00 ? 99  PRO A CD   1  
ATOM 1485  H HA   . PRO A 1 99  ? 19.257  -1.256  -2.954  1.00 0.00 ? 99  PRO A HA   1  
ATOM 1486  H HB2  . PRO A 1 99  ? 21.900  -1.723  -3.362  1.00 0.00 ? 99  PRO A HB2  1  
ATOM 1487  H HB3  . PRO A 1 99  ? 20.718  -3.019  -3.149  1.00 0.00 ? 99  PRO A HB3  1  
ATOM 1488  H HG2  . PRO A 1 99  ? 21.899  -1.930  -5.675  1.00 0.00 ? 99  PRO A HG2  1  
ATOM 1489  H HG3  . PRO A 1 99  ? 21.607  -3.617  -5.213  1.00 0.00 ? 99  PRO A HG3  1  
ATOM 1490  H HD2  . PRO A 1 99  ? 19.955  -2.251  -6.868  1.00 0.00 ? 99  PRO A HD2  1  
ATOM 1491  H HD3  . PRO A 1 99  ? 19.370  -3.510  -5.761  1.00 0.00 ? 99  PRO A HD3  1  
ATOM 1492  N N    . SER A 1 100 ? 20.522  0.795   -5.113  1.00 0.00 ? 100 SER A N    1  
ATOM 1493  C CA   . SER A 1 100 ? 21.047  2.141   -5.316  1.00 0.00 ? 100 SER A CA   1  
ATOM 1494  C C    . SER A 1 100 ? 20.475  3.108   -4.284  1.00 0.00 ? 100 SER A C    1  
ATOM 1495  O O    . SER A 1 100 ? 19.403  3.680   -4.480  1.00 0.00 ? 100 SER A O    1  
ATOM 1496  C CB   . SER A 1 100 ? 20.719  2.631   -6.727  1.00 0.00 ? 100 SER A CB   1  
ATOM 1497  O OG   . SER A 1 100 ? 21.123  1.685   -7.702  1.00 0.00 ? 100 SER A OG   1  
ATOM 1498  H H    . SER A 1 100 ? 20.223  0.276   -5.889  1.00 0.00 ? 100 SER A H    1  
ATOM 1499  H HA   . SER A 1 100 ? 22.119  2.099   -5.198  1.00 0.00 ? 100 SER A HA   1  
ATOM 1500  H HB2  . SER A 1 100 ? 19.655  2.787   -6.814  1.00 0.00 ? 100 SER A HB2  1  
ATOM 1501  H HB3  . SER A 1 100 ? 21.236  3.562   -6.911  1.00 0.00 ? 100 SER A HB3  1  
ATOM 1502  H HG   . SER A 1 100 ? 21.874  1.186   -7.373  1.00 0.00 ? 100 SER A HG   1  
ATOM 1503  N N    . SER A 1 101 ? 21.200  3.286   -3.183  1.00 0.00 ? 101 SER A N    1  
ATOM 1504  C CA   . SER A 1 101 ? 20.764  4.180   -2.118  1.00 0.00 ? 101 SER A CA   1  
ATOM 1505  C C    . SER A 1 101 ? 20.491  5.580   -2.661  1.00 0.00 ? 101 SER A C    1  
ATOM 1506  O O    . SER A 1 101 ? 21.399  6.264   -3.129  1.00 0.00 ? 101 SER A O    1  
ATOM 1507  C CB   . SER A 1 101 ? 21.822  4.247   -1.014  1.00 0.00 ? 101 SER A CB   1  
ATOM 1508  O OG   . SER A 1 101 ? 21.309  4.877   0.147   1.00 0.00 ? 101 SER A OG   1  
ATOM 1509  H H    . SER A 1 101 ? 22.046  2.801   -3.085  1.00 0.00 ? 101 SER A H    1  
ATOM 1510  H HA   . SER A 1 101 ? 19.849  3.783   -1.704  1.00 0.00 ? 101 SER A HA   1  
ATOM 1511  H HB2  . SER A 1 101 ? 22.134  3.246   -0.758  1.00 0.00 ? 101 SER A HB2  1  
ATOM 1512  H HB3  . SER A 1 101 ? 22.673  4.810   -1.369  1.00 0.00 ? 101 SER A HB3  1  
ATOM 1513  H HG   . SER A 1 101 ? 20.752  5.616   -0.109  1.00 0.00 ? 101 SER A HG   1  
ATOM 1514  N N    . GLY A 1 102 ? 19.230  5.998   -2.595  1.00 0.00 ? 102 GLY A N    1  
ATOM 1515  C CA   . GLY A 1 102 ? 18.859  7.313   -3.083  1.00 0.00 ? 102 GLY A CA   1  
ATOM 1516  C C    . GLY A 1 102 ? 17.374  7.586   -2.941  1.00 0.00 ? 102 GLY A C    1  
ATOM 1517  O O    . GLY A 1 102 ? 16.973  8.552   -2.293  1.00 0.00 ? 102 GLY A O    1  
ATOM 1518  H H    . GLY A 1 102 ? 18.547  5.409   -2.211  1.00 0.00 ? 102 GLY A H    1  
ATOM 1519  H HA2  . GLY A 1 102 ? 19.406  8.059   -2.527  1.00 0.00 ? 102 GLY A HA2  1  
ATOM 1520  H HA3  . GLY A 1 102 ? 19.128  7.386   -4.126  1.00 0.00 ? 102 GLY A HA3  1  
ATOM 1521  N N    . GLY A 1 1   ? 29.264  3.410   -17.692 1.00 0.00 ? 1   GLY A N    2  
ATOM 1522  C CA   . GLY A 1 1   ? 28.780  2.147   -17.166 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1523  C C    . GLY A 1 1   ? 29.515  0.956   -17.749 1.00 0.00 ? 1   GLY A C    2  
ATOM 1524  O O    . GLY A 1 1   ? 30.079  1.040   -18.840 1.00 0.00 ? 1   GLY A O    2  
ATOM 1525  H H1   . GLY A 1 1   ? 30.173  3.472   -18.053 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1526  H HA2  . GLY A 1 1   ? 28.906  2.145   -16.093 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1527  H HA3  . GLY A 1 1   ? 27.729  2.053   -17.395 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1528  N N    . SER A 1 2   ? 29.511  -0.155  -17.019 1.00 0.00 ? 2   SER A N    2  
ATOM 1529  C CA   . SER A 1 2   ? 30.187  -1.366  -17.468 1.00 0.00 ? 2   SER A CA   2  
ATOM 1530  C C    . SER A 1 2   ? 29.207  -2.532  -17.565 1.00 0.00 ? 2   SER A C    2  
ATOM 1531  O O    . SER A 1 2   ? 29.024  -3.116  -18.633 1.00 0.00 ? 2   SER A O    2  
ATOM 1532  C CB   . SER A 1 2   ? 31.328  -1.723  -16.513 1.00 0.00 ? 2   SER A CB   2  
ATOM 1533  O OG   . SER A 1 2   ? 32.407  -0.814  -16.646 1.00 0.00 ? 2   SER A OG   2  
ATOM 1534  H H    . SER A 1 2   ? 29.044  -0.159  -16.158 1.00 0.00 ? 2   SER A H    2  
ATOM 1535  H HA   . SER A 1 2   ? 30.597  -1.173  -18.448 1.00 0.00 ? 2   SER A HA   2  
ATOM 1536  H HB2  . SER A 1 2   ? 30.967  -1.687  -15.496 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1537  H HB3  . SER A 1 2   ? 31.682  -2.719  -16.735 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1538  H HG   . SER A 1 2   ? 32.410  -0.447  -17.533 1.00 0.00 ? 2   SER A HG   2  
ATOM 1539  N N    . SER A 1 3   ? 28.580  -2.864  -16.441 1.00 0.00 ? 3   SER A N    2  
ATOM 1540  C CA   . SER A 1 3   ? 27.621  -3.962  -16.397 1.00 0.00 ? 3   SER A CA   2  
ATOM 1541  C C    . SER A 1 3   ? 26.519  -3.762  -17.433 1.00 0.00 ? 3   SER A C    2  
ATOM 1542  O O    . SER A 1 3   ? 25.867  -2.720  -17.469 1.00 0.00 ? 3   SER A O    2  
ATOM 1543  C CB   . SER A 1 3   ? 27.009  -4.076  -15.000 1.00 0.00 ? 3   SER A CB   2  
ATOM 1544  O OG   . SER A 1 3   ? 26.183  -5.223  -14.897 1.00 0.00 ? 3   SER A OG   2  
ATOM 1545  H H    . SER A 1 3   ? 28.769  -2.360  -15.622 1.00 0.00 ? 3   SER A H    2  
ATOM 1546  H HA   . SER A 1 3   ? 28.151  -4.874  -16.624 1.00 0.00 ? 3   SER A HA   2  
ATOM 1547  H HB2  . SER A 1 3   ? 27.799  -4.149  -14.268 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1548  H HB3  . SER A 1 3   ? 26.412  -3.198  -14.798 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1549  H HG   . SER A 1 3   ? 25.461  -5.156  -15.526 1.00 0.00 ? 3   SER A HG   2  
ATOM 1550  N N    . GLY A 1 4   ? 26.317  -4.771  -18.275 1.00 0.00 ? 4   GLY A N    2  
ATOM 1551  C CA   . GLY A 1 4   ? 25.293  -4.688  -19.301 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1552  C C    . GLY A 1 4   ? 23.907  -4.489  -18.721 1.00 0.00 ? 4   GLY A C    2  
ATOM 1553  O O    . GLY A 1 4   ? 23.645  -4.862  -17.578 1.00 0.00 ? 4   GLY A O    2  
ATOM 1554  H H    . GLY A 1 4   ? 26.867  -5.579  -18.199 1.00 0.00 ? 4   GLY A H    2  
ATOM 1555  H HA2  . GLY A 1 4   ? 25.521  -3.860  -19.955 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1556  H HA3  . GLY A 1 4   ? 25.302  -5.602  -19.877 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1557  N N    . SER A 1 5   ? 23.017  -3.897  -19.511 1.00 0.00 ? 5   SER A N    2  
ATOM 1558  C CA   . SER A 1 5   ? 21.651  -3.643  -19.068 1.00 0.00 ? 5   SER A CA   2  
ATOM 1559  C C    . SER A 1 5   ? 20.727  -4.789  -19.471 1.00 0.00 ? 5   SER A C    2  
ATOM 1560  O O    . SER A 1 5   ? 20.156  -4.786  -20.562 1.00 0.00 ? 5   SER A O    2  
ATOM 1561  C CB   . SER A 1 5   ? 21.137  -2.328  -19.657 1.00 0.00 ? 5   SER A CB   2  
ATOM 1562  O OG   . SER A 1 5   ? 19.787  -2.099  -19.292 1.00 0.00 ? 5   SER A OG   2  
ATOM 1563  H H    . SER A 1 5   ? 23.286  -3.622  -20.413 1.00 0.00 ? 5   SER A H    2  
ATOM 1564  H HA   . SER A 1 5   ? 21.661  -3.566  -17.991 1.00 0.00 ? 5   SER A HA   2  
ATOM 1565  H HB2  . SER A 1 5   ? 21.740  -1.512  -19.289 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1566  H HB3  . SER A 1 5   ? 21.205  -2.368  -20.734 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1567  H HG   . SER A 1 5   ? 19.211  -2.371  -20.010 1.00 0.00 ? 5   SER A HG   2  
ATOM 1568  N N    . SER A 1 6   ? 20.586  -5.768  -18.583 1.00 0.00 ? 6   SER A N    2  
ATOM 1569  C CA   . SER A 1 6   ? 19.736  -6.922  -18.846 1.00 0.00 ? 6   SER A CA   2  
ATOM 1570  C C    . SER A 1 6   ? 18.754  -7.146  -17.700 1.00 0.00 ? 6   SER A C    2  
ATOM 1571  O O    . SER A 1 6   ? 19.097  -7.746  -16.682 1.00 0.00 ? 6   SER A O    2  
ATOM 1572  C CB   . SER A 1 6   ? 20.590  -8.175  -19.053 1.00 0.00 ? 6   SER A CB   2  
ATOM 1573  O OG   . SER A 1 6   ? 21.259  -8.539  -17.859 1.00 0.00 ? 6   SER A OG   2  
ATOM 1574  H H    . SER A 1 6   ? 21.068  -5.712  -17.731 1.00 0.00 ? 6   SER A H    2  
ATOM 1575  H HA   . SER A 1 6   ? 19.178  -6.724  -19.749 1.00 0.00 ? 6   SER A HA   2  
ATOM 1576  H HB2  . SER A 1 6   ? 19.956  -8.993  -19.361 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1577  H HB3  . SER A 1 6   ? 21.326  -7.982  -19.820 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1578  H HG   . SER A 1 6   ? 21.452  -7.751  -17.346 1.00 0.00 ? 6   SER A HG   2  
ATOM 1579  N N    . GLY A 1 7   ? 17.529  -6.660  -17.875 1.00 0.00 ? 7   GLY A N    2  
ATOM 1580  C CA   . GLY A 1 7   ? 16.515  -6.816  -16.848 1.00 0.00 ? 7   GLY A CA   2  
ATOM 1581  C C    . GLY A 1 7   ? 16.981  -6.322  -15.493 1.00 0.00 ? 7   GLY A C    2  
ATOM 1582  O O    . GLY A 1 7   ? 18.023  -5.676  -15.385 1.00 0.00 ? 7   GLY A O    2  
ATOM 1583  H H    . GLY A 1 7   ? 17.312  -6.190  -18.708 1.00 0.00 ? 7   GLY A H    2  
ATOM 1584  H HA2  . GLY A 1 7   ? 15.635  -6.262  -17.139 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1585  H HA3  . GLY A 1 7   ? 16.259  -7.862  -16.768 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1586  N N    . ASN A 1 8   ? 16.207  -6.625  -14.456 1.00 0.00 ? 8   ASN A N    2  
ATOM 1587  C CA   . ASN A 1 8   ? 16.546  -6.205  -13.101 1.00 0.00 ? 8   ASN A CA   2  
ATOM 1588  C C    . ASN A 1 8   ? 17.676  -7.058  -12.534 1.00 0.00 ? 8   ASN A C    2  
ATOM 1589  O O    . ASN A 1 8   ? 17.878  -8.197  -12.954 1.00 0.00 ? 8   ASN A O    2  
ATOM 1590  C CB   . ASN A 1 8   ? 15.317  -6.299  -12.194 1.00 0.00 ? 8   ASN A CB   2  
ATOM 1591  C CG   . ASN A 1 8   ? 15.043  -7.718  -11.737 1.00 0.00 ? 8   ASN A CG   2  
ATOM 1592  O OD1  . ASN A 1 8   ? 15.921  -8.388  -11.194 1.00 0.00 ? 8   ASN A OD1  2  
ATOM 1593  N ND2  . ASN A 1 8   ? 13.818  -8.184  -11.955 1.00 0.00 ? 8   ASN A ND2  2  
ATOM 1594  H H    . ASN A 1 8   ? 15.389  -7.143  -14.605 1.00 0.00 ? 8   ASN A H    2  
ATOM 1595  H HA   . ASN A 1 8   ? 16.873  -5.177  -13.145 1.00 0.00 ? 8   ASN A HA   2  
ATOM 1596  H HB2  . ASN A 1 8   ? 15.475  -5.684  -11.320 1.00 0.00 ? 8   ASN A HB2  2  
ATOM 1597  H HB3  . ASN A 1 8   ? 14.452  -5.939  -12.731 1.00 0.00 ? 8   ASN A HB3  2  
ATOM 1598  H HD21 . ASN A 1 8   ? 13.169  -7.594  -12.393 1.00 0.00 ? 8   ASN A HD21 2  
ATOM 1599  H HD22 . ASN A 1 8   ? 13.613  -9.098  -11.668 1.00 0.00 ? 8   ASN A HD22 2  
ATOM 1600  N N    . GLU A 1 9   ? 18.410  -6.498  -11.577 1.00 0.00 ? 9   GLU A N    2  
ATOM 1601  C CA   . GLU A 1 9   ? 19.520  -7.208  -10.953 1.00 0.00 ? 9   GLU A CA   2  
ATOM 1602  C C    . GLU A 1 9   ? 19.324  -7.304  -9.442  1.00 0.00 ? 9   GLU A C    2  
ATOM 1603  O O    . GLU A 1 9   ? 20.273  -7.156  -8.671  1.00 0.00 ? 9   GLU A O    2  
ATOM 1604  C CB   . GLU A 1 9   ? 20.843  -6.505  -11.263 1.00 0.00 ? 9   GLU A CB   2  
ATOM 1605  C CG   . GLU A 1 9   ? 20.859  -5.037  -10.870 1.00 0.00 ? 9   GLU A CG   2  
ATOM 1606  C CD   . GLU A 1 9   ? 21.310  -4.820  -9.439  1.00 0.00 ? 9   GLU A CD   2  
ATOM 1607  O OE1  . GLU A 1 9   ? 22.485  -5.115  -9.136  1.00 0.00 ? 9   GLU A OE1  2  
ATOM 1608  O OE2  . GLU A 1 9   ? 20.488  -4.355  -8.622  1.00 0.00 ? 9   GLU A OE2  2  
ATOM 1609  H H    . GLU A 1 9   ? 18.200  -5.587  -11.284 1.00 0.00 ? 9   GLU A H    2  
ATOM 1610  H HA   . GLU A 1 9   ? 19.549  -8.206  -11.363 1.00 0.00 ? 9   GLU A HA   2  
ATOM 1611  H HB2  . GLU A 1 9   ? 21.638  -7.007  -10.731 1.00 0.00 ? 9   GLU A HB2  2  
ATOM 1612  H HB3  . GLU A 1 9   ? 21.033  -6.574  -12.324 1.00 0.00 ? 9   GLU A HB3  2  
ATOM 1613  H HG2  . GLU A 1 9   ? 21.533  -4.509  -11.528 1.00 0.00 ? 9   GLU A HG2  2  
ATOM 1614  H HG3  . GLU A 1 9   ? 19.861  -4.637  -10.982 1.00 0.00 ? 9   GLU A HG3  2  
ATOM 1615  N N    . VAL A 1 10  ? 18.086  -7.551  -9.026  1.00 0.00 ? 10  VAL A N    2  
ATOM 1616  C CA   . VAL A 1 10  ? 17.765  -7.667  -7.609  1.00 0.00 ? 10  VAL A CA   2  
ATOM 1617  C C    . VAL A 1 10  ? 16.894  -8.890  -7.341  1.00 0.00 ? 10  VAL A C    2  
ATOM 1618  O O    . VAL A 1 10  ? 15.828  -9.048  -7.936  1.00 0.00 ? 10  VAL A O    2  
ATOM 1619  C CB   . VAL A 1 10  ? 17.038  -6.410  -7.094  1.00 0.00 ? 10  VAL A CB   2  
ATOM 1620  C CG1  . VAL A 1 10  ? 16.943  -6.433  -5.576  1.00 0.00 ? 10  VAL A CG1  2  
ATOM 1621  C CG2  . VAL A 1 10  ? 17.747  -5.152  -7.573  1.00 0.00 ? 10  VAL A CG2  2  
ATOM 1622  H H    . VAL A 1 10  ? 17.372  -7.659  -9.689  1.00 0.00 ? 10  VAL A H    2  
ATOM 1623  H HA   . VAL A 1 10  ? 18.691  -7.771  -7.064  1.00 0.00 ? 10  VAL A HA   2  
ATOM 1624  H HB   . VAL A 1 10  ? 16.036  -6.409  -7.495  1.00 0.00 ? 10  VAL A HB   2  
ATOM 1625  H HG11 . VAL A 1 10  ? 17.346  -5.514  -5.176  1.00 0.00 ? 10  VAL A HG11 2  
ATOM 1626  H HG12 . VAL A 1 10  ? 15.909  -6.533  -5.281  1.00 0.00 ? 10  VAL A HG12 2  
ATOM 1627  H HG13 . VAL A 1 10  ? 17.509  -7.270  -5.192  1.00 0.00 ? 10  VAL A HG13 2  
ATOM 1628  H HG21 . VAL A 1 10  ? 18.014  -5.265  -8.613  1.00 0.00 ? 10  VAL A HG21 2  
ATOM 1629  H HG22 . VAL A 1 10  ? 17.088  -4.303  -7.460  1.00 0.00 ? 10  VAL A HG22 2  
ATOM 1630  H HG23 . VAL A 1 10  ? 18.639  -4.996  -6.986  1.00 0.00 ? 10  VAL A HG23 2  
ATOM 1631  N N    . ASP A 1 11  ? 17.355  -9.752  -6.442  1.00 0.00 ? 11  ASP A N    2  
ATOM 1632  C CA   . ASP A 1 11  ? 16.617  -10.961 -6.093  1.00 0.00 ? 11  ASP A CA   2  
ATOM 1633  C C    . ASP A 1 11  ? 15.650  -10.695 -4.944  1.00 0.00 ? 11  ASP A C    2  
ATOM 1634  O O    . ASP A 1 11  ? 16.011  -10.064 -3.950  1.00 0.00 ? 11  ASP A O    2  
ATOM 1635  C CB   . ASP A 1 11  ? 17.585  -12.082 -5.713  1.00 0.00 ? 11  ASP A CB   2  
ATOM 1636  C CG   . ASP A 1 11  ? 18.725  -11.593 -4.842  1.00 0.00 ? 11  ASP A CG   2  
ATOM 1637  O OD1  . ASP A 1 11  ? 18.517  -11.447 -3.619  1.00 0.00 ? 11  ASP A OD1  2  
ATOM 1638  O OD2  . ASP A 1 11  ? 19.825  -11.354 -5.382  1.00 0.00 ? 11  ASP A OD2  2  
ATOM 1639  H H    . ASP A 1 11  ? 18.212  -9.571  -6.001  1.00 0.00 ? 11  ASP A H    2  
ATOM 1640  H HA   . ASP A 1 11  ? 16.051  -11.265 -6.960  1.00 0.00 ? 11  ASP A HA   2  
ATOM 1641  H HB2  . ASP A 1 11  ? 17.046  -12.846 -5.172  1.00 0.00 ? 11  ASP A HB2  2  
ATOM 1642  H HB3  . ASP A 1 11  ? 18.001  -12.510 -6.613  1.00 0.00 ? 11  ASP A HB3  2  
ATOM 1643  N N    . ASP A 1 12  ? 14.421  -11.178 -5.088  1.00 0.00 ? 12  ASP A N    2  
ATOM 1644  C CA   . ASP A 1 12  ? 13.402  -10.992 -4.062  1.00 0.00 ? 12  ASP A CA   2  
ATOM 1645  C C    . ASP A 1 12  ? 12.893  -12.337 -3.552  1.00 0.00 ? 12  ASP A C    2  
ATOM 1646  O O    . ASP A 1 12  ? 11.818  -12.793 -3.940  1.00 0.00 ? 12  ASP A O    2  
ATOM 1647  C CB   . ASP A 1 12  ? 12.237  -10.168 -4.613  1.00 0.00 ? 12  ASP A CB   2  
ATOM 1648  C CG   . ASP A 1 12  ? 12.670  -8.792  -5.078  1.00 0.00 ? 12  ASP A CG   2  
ATOM 1649  O OD1  . ASP A 1 12  ? 13.826  -8.655  -5.532  1.00 0.00 ? 12  ASP A OD1  2  
ATOM 1650  O OD2  . ASP A 1 12  ? 11.854  -7.852  -4.988  1.00 0.00 ? 12  ASP A OD2  2  
ATOM 1651  H H    . ASP A 1 12  ? 14.194  -11.672 -5.904  1.00 0.00 ? 12  ASP A H    2  
ATOM 1652  H HA   . ASP A 1 12  ? 13.852  -10.457 -3.240  1.00 0.00 ? 12  ASP A HA   2  
ATOM 1653  H HB2  . ASP A 1 12  ? 11.801  -10.690 -5.452  1.00 0.00 ? 12  ASP A HB2  2  
ATOM 1654  H HB3  . ASP A 1 12  ? 11.491  -10.050 -3.841  1.00 0.00 ? 12  ASP A HB3  2  
ATOM 1655  N N    . MET A 1 13  ? 13.674  -12.967 -2.680  1.00 0.00 ? 13  MET A N    2  
ATOM 1656  C CA   . MET A 1 13  ? 13.302  -14.260 -2.117  1.00 0.00 ? 13  MET A CA   2  
ATOM 1657  C C    . MET A 1 13  ? 12.754  -14.100 -0.703  1.00 0.00 ? 13  MET A C    2  
ATOM 1658  O O    . MET A 1 13  ? 11.742  -14.704 -0.347  1.00 0.00 ? 13  MET A O    2  
ATOM 1659  C CB   . MET A 1 13  ? 14.508  -15.201 -2.106  1.00 0.00 ? 13  MET A CB   2  
ATOM 1660  C CG   . MET A 1 13  ? 14.815  -15.813 -3.463  1.00 0.00 ? 13  MET A CG   2  
ATOM 1661  S SD   . MET A 1 13  ? 16.393  -16.685 -3.492  1.00 0.00 ? 13  MET A SD   2  
ATOM 1662  C CE   . MET A 1 13  ? 17.394  -15.542 -4.440  1.00 0.00 ? 13  MET A CE   2  
ATOM 1663  H H    . MET A 1 13  ? 14.520  -12.554 -2.409  1.00 0.00 ? 13  MET A H    2  
ATOM 1664  H HA   . MET A 1 13  ? 12.532  -14.685 -2.743  1.00 0.00 ? 13  MET A HA   2  
ATOM 1665  H HB2  . MET A 1 13  ? 15.377  -14.650 -1.779  1.00 0.00 ? 13  MET A HB2  2  
ATOM 1666  H HB3  . MET A 1 13  ? 14.317  -16.004 -1.409  1.00 0.00 ? 13  MET A HB3  2  
ATOM 1667  H HG2  . MET A 1 13  ? 14.030  -16.511 -3.715  1.00 0.00 ? 13  MET A HG2  2  
ATOM 1668  H HG3  . MET A 1 13  ? 14.841  -15.024 -4.200  1.00 0.00 ? 13  MET A HG3  2  
ATOM 1669  H HE1  . MET A 1 13  ? 17.819  -14.801 -3.779  1.00 0.00 ? 13  MET A HE1  2  
ATOM 1670  H HE2  . MET A 1 13  ? 18.188  -16.083 -4.933  1.00 0.00 ? 13  MET A HE2  2  
ATOM 1671  H HE3  . MET A 1 13  ? 16.778  -15.052 -5.180  1.00 0.00 ? 13  MET A HE3  2  
ATOM 1672  N N    . ASP A 1 14  ? 13.428  -13.283 0.099   1.00 0.00 ? 14  ASP A N    2  
ATOM 1673  C CA   . ASP A 1 14  ? 13.008  -13.043 1.475   1.00 0.00 ? 14  ASP A CA   2  
ATOM 1674  C C    . ASP A 1 14  ? 13.864  -11.959 2.123   1.00 0.00 ? 14  ASP A C    2  
ATOM 1675  O O    . ASP A 1 14  ? 14.815  -11.460 1.520   1.00 0.00 ? 14  ASP A O    2  
ATOM 1676  C CB   . ASP A 1 14  ? 13.095  -14.334 2.290   1.00 0.00 ? 14  ASP A CB   2  
ATOM 1677  C CG   . ASP A 1 14  ? 11.830  -15.164 2.196   1.00 0.00 ? 14  ASP A CG   2  
ATOM 1678  O OD1  . ASP A 1 14  ? 10.748  -14.576 1.983   1.00 0.00 ? 14  ASP A OD1  2  
ATOM 1679  O OD2  . ASP A 1 14  ? 11.921  -16.401 2.334   1.00 0.00 ? 14  ASP A OD2  2  
ATOM 1680  H H    . ASP A 1 14  ? 14.228  -12.830 -0.243  1.00 0.00 ? 14  ASP A H    2  
ATOM 1681  H HA   . ASP A 1 14  ? 11.982  -12.709 1.454   1.00 0.00 ? 14  ASP A HA   2  
ATOM 1682  H HB2  . ASP A 1 14  ? 13.920  -14.928 1.925   1.00 0.00 ? 14  ASP A HB2  2  
ATOM 1683  H HB3  . ASP A 1 14  ? 13.266  -14.086 3.327   1.00 0.00 ? 14  ASP A HB3  2  
ATOM 1684  N N    . THR A 1 15  ? 13.520  -11.598 3.355   1.00 0.00 ? 15  THR A N    2  
ATOM 1685  C CA   . THR A 1 15  ? 14.254  -10.572 4.085   1.00 0.00 ? 15  THR A CA   2  
ATOM 1686  C C    . THR A 1 15  ? 14.697  -9.448  3.156   1.00 0.00 ? 15  THR A C    2  
ATOM 1687  O O    . THR A 1 15  ? 15.820  -8.954  3.254   1.00 0.00 ? 15  THR A O    2  
ATOM 1688  C CB   . THR A 1 15  ? 15.493  -11.160 4.786   1.00 0.00 ? 15  THR A CB   2  
ATOM 1689  O OG1  . THR A 1 15  ? 16.478  -11.529 3.815   1.00 0.00 ? 15  THR A OG1  2  
ATOM 1690  C CG2  . THR A 1 15  ? 15.117  -12.376 5.620   1.00 0.00 ? 15  THR A CG2  2  
ATOM 1691  H H    . THR A 1 15  ? 12.752  -12.033 3.782   1.00 0.00 ? 15  THR A H    2  
ATOM 1692  H HA   . THR A 1 15  ? 13.598  -10.165 4.840   1.00 0.00 ? 15  THR A HA   2  
ATOM 1693  H HB   . THR A 1 15  ? 15.908  -10.407 5.441   1.00 0.00 ? 15  THR A HB   2  
ATOM 1694  H HG1  . THR A 1 15  ? 16.043  -11.772 2.994   1.00 0.00 ? 15  THR A HG1  2  
ATOM 1695  H HG21 . THR A 1 15  ? 15.977  -13.020 5.727   1.00 0.00 ? 15  THR A HG21 2  
ATOM 1696  H HG22 . THR A 1 15  ? 14.320  -12.916 5.131   1.00 0.00 ? 15  THR A HG22 2  
ATOM 1697  H HG23 . THR A 1 15  ? 14.786  -12.053 6.596   1.00 0.00 ? 15  THR A HG23 2  
ATOM 1698  N N    . SER A 1 16  ? 13.806  -9.046  2.254   1.00 0.00 ? 16  SER A N    2  
ATOM 1699  C CA   . SER A 1 16  ? 14.107  -7.981  1.305   1.00 0.00 ? 16  SER A CA   2  
ATOM 1700  C C    . SER A 1 16  ? 13.395  -6.689  1.695   1.00 0.00 ? 16  SER A C    2  
ATOM 1701  O O    . SER A 1 16  ? 12.362  -6.339  1.123   1.00 0.00 ? 16  SER A O    2  
ATOM 1702  C CB   . SER A 1 16  ? 13.695  -8.397  -0.109  1.00 0.00 ? 16  SER A CB   2  
ATOM 1703  O OG   . SER A 1 16  ? 14.459  -7.711  -1.085  1.00 0.00 ? 16  SER A OG   2  
ATOM 1704  H H    . SER A 1 16  ? 12.927  -9.479  2.225   1.00 0.00 ? 16  SER A H    2  
ATOM 1705  H HA   . SER A 1 16  ? 15.173  -7.811  1.324   1.00 0.00 ? 16  SER A HA   2  
ATOM 1706  H HB2  . SER A 1 16  ? 13.850  -9.458  -0.228  1.00 0.00 ? 16  SER A HB2  2  
ATOM 1707  H HB3  . SER A 1 16  ? 12.650  -8.166  -0.258  1.00 0.00 ? 16  SER A HB3  2  
ATOM 1708  H HG   . SER A 1 16  ? 15.309  -7.466  -0.713  1.00 0.00 ? 16  SER A HG   2  
ATOM 1709  N N    . ASP A 1 17  ? 13.954  -5.985  2.673   1.00 0.00 ? 17  ASP A N    2  
ATOM 1710  C CA   . ASP A 1 17  ? 13.375  -4.731  3.140   1.00 0.00 ? 17  ASP A CA   2  
ATOM 1711  C C    . ASP A 1 17  ? 12.921  -3.871  1.965   1.00 0.00 ? 17  ASP A C    2  
ATOM 1712  O O    . ASP A 1 17  ? 13.737  -3.240  1.291   1.00 0.00 ? 17  ASP A O    2  
ATOM 1713  C CB   . ASP A 1 17  ? 14.387  -3.962  3.990   1.00 0.00 ? 17  ASP A CB   2  
ATOM 1714  C CG   . ASP A 1 17  ? 13.720  -3.040  4.992   1.00 0.00 ? 17  ASP A CG   2  
ATOM 1715  O OD1  . ASP A 1 17  ? 12.757  -2.343  4.607   1.00 0.00 ? 17  ASP A OD1  2  
ATOM 1716  O OD2  . ASP A 1 17  ? 14.161  -3.015  6.160   1.00 0.00 ? 17  ASP A OD2  2  
ATOM 1717  H H    . ASP A 1 17  ? 14.777  -6.316  3.090   1.00 0.00 ? 17  ASP A H    2  
ATOM 1718  H HA   . ASP A 1 17  ? 12.515  -4.969  3.748   1.00 0.00 ? 17  ASP A HA   2  
ATOM 1719  H HB2  . ASP A 1 17  ? 15.002  -4.667  4.532   1.00 0.00 ? 17  ASP A HB2  2  
ATOM 1720  H HB3  . ASP A 1 17  ? 15.014  -3.368  3.342   1.00 0.00 ? 17  ASP A HB3  2  
ATOM 1721  N N    . THR A 1 18  ? 11.614  -3.850  1.722   1.00 0.00 ? 18  THR A N    2  
ATOM 1722  C CA   . THR A 1 18  ? 11.052  -3.070  0.627   1.00 0.00 ? 18  THR A CA   2  
ATOM 1723  C C    . THR A 1 18  ? 9.648   -2.582  0.964   1.00 0.00 ? 18  THR A C    2  
ATOM 1724  O O    . THR A 1 18  ? 8.857   -3.308  1.566   1.00 0.00 ? 18  THR A O    2  
ATOM 1725  C CB   . THR A 1 18  ? 11.000  -3.888  -0.677  1.00 0.00 ? 18  THR A CB   2  
ATOM 1726  O OG1  . THR A 1 18  ? 12.270  -4.501  -0.922  1.00 0.00 ? 18  THR A OG1  2  
ATOM 1727  C CG2  . THR A 1 18  ? 10.622  -3.004  -1.856  1.00 0.00 ? 18  THR A CG2  2  
ATOM 1728  H H    . THR A 1 18  ? 11.015  -4.374  2.294   1.00 0.00 ? 18  THR A H    2  
ATOM 1729  H HA   . THR A 1 18  ? 11.691  -2.214  0.465   1.00 0.00 ? 18  THR A HA   2  
ATOM 1730  H HB   . THR A 1 18  ? 10.250  -4.660  -0.570  1.00 0.00 ? 18  THR A HB   2  
ATOM 1731  H HG1  . THR A 1 18  ? 12.141  -5.425  -1.152  1.00 0.00 ? 18  THR A HG1  2  
ATOM 1732  H HG21 . THR A 1 18  ? 10.324  -2.031  -1.495  1.00 0.00 ? 18  THR A HG21 2  
ATOM 1733  H HG22 . THR A 1 18  ? 9.803   -3.455  -2.396  1.00 0.00 ? 18  THR A HG22 2  
ATOM 1734  H HG23 . THR A 1 18  ? 11.472  -2.898  -2.513  1.00 0.00 ? 18  THR A HG23 2  
ATOM 1735  N N    . GLN A 1 19  ? 9.345   -1.349  0.571   1.00 0.00 ? 19  GLN A N    2  
ATOM 1736  C CA   . GLN A 1 19  ? 8.034   -0.765  0.833   1.00 0.00 ? 19  GLN A CA   2  
ATOM 1737  C C    . GLN A 1 19  ? 7.064   -1.074  -0.303  1.00 0.00 ? 19  GLN A C    2  
ATOM 1738  O O    . GLN A 1 19  ? 7.410   -0.951  -1.478  1.00 0.00 ? 19  GLN A O    2  
ATOM 1739  C CB   . GLN A 1 19  ? 8.155   0.749   1.019   1.00 0.00 ? 19  GLN A CB   2  
ATOM 1740  C CG   . GLN A 1 19  ? 8.401   1.167   2.459   1.00 0.00 ? 19  GLN A CG   2  
ATOM 1741  C CD   . GLN A 1 19  ? 7.213   0.887   3.359   1.00 0.00 ? 19  GLN A CD   2  
ATOM 1742  O OE1  . GLN A 1 19  ? 6.363   0.055   3.043   1.00 0.00 ? 19  GLN A OE1  2  
ATOM 1743  N NE2  . GLN A 1 19  ? 7.150   1.583   4.488   1.00 0.00 ? 19  GLN A NE2  2  
ATOM 1744  H H    . GLN A 1 19  ? 10.018  -0.820  0.095   1.00 0.00 ? 19  GLN A H    2  
ATOM 1745  H HA   . GLN A 1 19  ? 7.653   -1.201  1.744   1.00 0.00 ? 19  GLN A HA   2  
ATOM 1746  H HB2  . GLN A 1 19  ? 8.976   1.109   0.416   1.00 0.00 ? 19  GLN A HB2  2  
ATOM 1747  H HB3  . GLN A 1 19  ? 7.241   1.215   0.683   1.00 0.00 ? 19  GLN A HB3  2  
ATOM 1748  H HG2  . GLN A 1 19  ? 9.255   0.625   2.838   1.00 0.00 ? 19  GLN A HG2  2  
ATOM 1749  H HG3  . GLN A 1 19  ? 8.610   2.226   2.482   1.00 0.00 ? 19  GLN A HG3  2  
ATOM 1750  H HE21 . GLN A 1 19  ? 7.863   2.230   4.674   1.00 0.00 ? 19  GLN A HE21 2  
ATOM 1751  H HE22 . GLN A 1 19  ? 6.392   1.423   5.088   1.00 0.00 ? 19  GLN A HE22 2  
ATOM 1752  N N    . TRP A 1 20  ? 5.851   -1.475  0.056   1.00 0.00 ? 20  TRP A N    2  
ATOM 1753  C CA   . TRP A 1 20  ? 4.830   -1.802  -0.934  1.00 0.00 ? 20  TRP A CA   2  
ATOM 1754  C C    . TRP A 1 20  ? 3.694   -0.786  -0.901  1.00 0.00 ? 20  TRP A C    2  
ATOM 1755  O O    . TRP A 1 20  ? 3.055   -0.589  0.131   1.00 0.00 ? 20  TRP A O    2  
ATOM 1756  C CB   . TRP A 1 20  ? 4.281   -3.208  -0.686  1.00 0.00 ? 20  TRP A CB   2  
ATOM 1757  C CG   . TRP A 1 20  ? 5.320   -4.282  -0.806  1.00 0.00 ? 20  TRP A CG   2  
ATOM 1758  C CD1  . TRP A 1 20  ? 6.104   -4.779  0.195   1.00 0.00 ? 20  TRP A CD1  2  
ATOM 1759  C CD2  . TRP A 1 20  ? 5.689   -4.988  -1.996  1.00 0.00 ? 20  TRP A CD2  2  
ATOM 1760  N NE1  . TRP A 1 20  ? 6.939   -5.752  -0.301  1.00 0.00 ? 20  TRP A NE1  2  
ATOM 1761  C CE2  . TRP A 1 20  ? 6.703   -5.900  -1.642  1.00 0.00 ? 20  TRP A CE2  2  
ATOM 1762  C CE3  . TRP A 1 20  ? 5.260   -4.940  -3.325  1.00 0.00 ? 20  TRP A CE3  2  
ATOM 1763  C CZ2  . TRP A 1 20  ? 7.293   -6.753  -2.570  1.00 0.00 ? 20  TRP A CZ2  2  
ATOM 1764  C CZ3  . TRP A 1 20  ? 5.847   -5.788  -4.245  1.00 0.00 ? 20  TRP A CZ3  2  
ATOM 1765  C CH2  . TRP A 1 20  ? 6.854   -6.685  -3.864  1.00 0.00 ? 20  TRP A CH2  2  
ATOM 1766  H H    . TRP A 1 20  ? 5.634   -1.554  1.009   1.00 0.00 ? 20  TRP A H    2  
ATOM 1767  H HA   . TRP A 1 20  ? 5.295   -1.774  -1.909  1.00 0.00 ? 20  TRP A HA   2  
ATOM 1768  H HB2  . TRP A 1 20  ? 3.868   -3.255  0.311   1.00 0.00 ? 20  TRP A HB2  2  
ATOM 1769  H HB3  . TRP A 1 20  ? 3.502   -3.415  -1.405  1.00 0.00 ? 20  TRP A HB3  2  
ATOM 1770  H HD1  . TRP A 1 20  ? 6.065   -4.446  1.221   1.00 0.00 ? 20  TRP A HD1  2  
ATOM 1771  H HE1  . TRP A 1 20  ? 7.595   -6.260  0.223   1.00 0.00 ? 20  TRP A HE1  2  
ATOM 1772  H HE3  . TRP A 1 20  ? 4.486   -4.255  -3.638  1.00 0.00 ? 20  TRP A HE3  2  
ATOM 1773  H HZ2  . TRP A 1 20  ? 8.069   -7.451  -2.292  1.00 0.00 ? 20  TRP A HZ2  2  
ATOM 1774  H HZ3  . TRP A 1 20  ? 5.529   -5.765  -5.277  1.00 0.00 ? 20  TRP A HZ3  2  
ATOM 1775  H HH2  . TRP A 1 20  ? 7.284   -7.328  -4.616  1.00 0.00 ? 20  TRP A HH2  2  
ATOM 1776  N N    . GLY A 1 21  ? 3.447   -0.143  -2.038  1.00 0.00 ? 21  GLY A N    2  
ATOM 1777  C CA   . GLY A 1 21  ? 2.387   0.845   -2.117  1.00 0.00 ? 21  GLY A CA   2  
ATOM 1778  C C    . GLY A 1 21  ? 1.268   0.422   -3.048  1.00 0.00 ? 21  GLY A C    2  
ATOM 1779  O O    . GLY A 1 21  ? 1.474   -0.394  -3.946  1.00 0.00 ? 21  GLY A O    2  
ATOM 1780  H H    . GLY A 1 21  ? 3.989   -0.342  -2.831  1.00 0.00 ? 21  GLY A H    2  
ATOM 1781  H HA2  . GLY A 1 21  ? 1.980   1.000   -1.129  1.00 0.00 ? 21  GLY A HA2  2  
ATOM 1782  H HA3  . GLY A 1 21  ? 2.804   1.775   -2.474  1.00 0.00 ? 21  GLY A HA3  2  
ATOM 1783  N N    . TRP A 1 22  ? 0.081   0.976   -2.833  1.00 0.00 ? 22  TRP A N    2  
ATOM 1784  C CA   . TRP A 1 22  ? -1.076  0.650   -3.659  1.00 0.00 ? 22  TRP A CA   2  
ATOM 1785  C C    . TRP A 1 22  ? -1.443  1.818   -4.567  1.00 0.00 ? 22  TRP A C    2  
ATOM 1786  O O    . TRP A 1 22  ? -1.492  2.967   -4.128  1.00 0.00 ? 22  TRP A O    2  
ATOM 1787  C CB   . TRP A 1 22  ? -2.269  0.278   -2.778  1.00 0.00 ? 22  TRP A CB   2  
ATOM 1788  C CG   . TRP A 1 22  ? -2.326  -1.181  -2.440  1.00 0.00 ? 22  TRP A CG   2  
ATOM 1789  C CD1  . TRP A 1 22  ? -1.512  -1.853  -1.573  1.00 0.00 ? 22  TRP A CD1  2  
ATOM 1790  C CD2  . TRP A 1 22  ? -3.245  -2.147  -2.963  1.00 0.00 ? 22  TRP A CD2  2  
ATOM 1791  N NE1  . TRP A 1 22  ? -1.870  -3.179  -1.526  1.00 0.00 ? 22  TRP A NE1  2  
ATOM 1792  C CE2  . TRP A 1 22  ? -2.930  -3.385  -2.369  1.00 0.00 ? 22  TRP A CE2  2  
ATOM 1793  C CE3  . TRP A 1 22  ? -4.303  -2.086  -3.873  1.00 0.00 ? 22  TRP A CE3  2  
ATOM 1794  C CZ2  . TRP A 1 22  ? -3.636  -4.550  -2.658  1.00 0.00 ? 22  TRP A CZ2  2  
ATOM 1795  C CZ3  . TRP A 1 22  ? -5.003  -3.243  -4.159  1.00 0.00 ? 22  TRP A CZ3  2  
ATOM 1796  C CH2  . TRP A 1 22  ? -4.667  -4.461  -3.553  1.00 0.00 ? 22  TRP A CH2  2  
ATOM 1797  H H    . TRP A 1 22  ? -0.021  1.620   -2.101  1.00 0.00 ? 22  TRP A H    2  
ATOM 1798  H HA   . TRP A 1 22  ? -0.815  -0.200  -4.273  1.00 0.00 ? 22  TRP A HA   2  
ATOM 1799  H HB2  . TRP A 1 22  ? -2.213  0.833   -1.853  1.00 0.00 ? 22  TRP A HB2  2  
ATOM 1800  H HB3  . TRP A 1 22  ? -3.183  0.537   -3.294  1.00 0.00 ? 22  TRP A HB3  2  
ATOM 1801  H HD1  . TRP A 1 22  ? -0.709  -1.397  -1.016  1.00 0.00 ? 22  TRP A HD1  2  
ATOM 1802  H HE1  . TRP A 1 22  ? -1.436  -3.866  -0.977  1.00 0.00 ? 22  TRP A HE1  2  
ATOM 1803  H HE3  . TRP A 1 22  ? -4.577  -1.157  -4.350  1.00 0.00 ? 22  TRP A HE3  2  
ATOM 1804  H HZ2  . TRP A 1 22  ? -3.390  -5.496  -2.199  1.00 0.00 ? 22  TRP A HZ2  2  
ATOM 1805  H HZ3  . TRP A 1 22  ? -5.824  -3.216  -4.861  1.00 0.00 ? 22  TRP A HZ3  2  
ATOM 1806  H HH2  . TRP A 1 22  ? -5.241  -5.339  -3.807  1.00 0.00 ? 22  TRP A HH2  2  
ATOM 1807  N N    . PHE A 1 23  ? -1.701  1.518   -5.836  1.00 0.00 ? 23  PHE A N    2  
ATOM 1808  C CA   . PHE A 1 23  ? -2.063  2.545   -6.806  1.00 0.00 ? 23  PHE A CA   2  
ATOM 1809  C C    . PHE A 1 23  ? -3.309  2.139   -7.588  1.00 0.00 ? 23  PHE A C    2  
ATOM 1810  O O    . PHE A 1 23  ? -3.445  0.989   -8.007  1.00 0.00 ? 23  PHE A O    2  
ATOM 1811  C CB   . PHE A 1 23  ? -0.902  2.797   -7.770  1.00 0.00 ? 23  PHE A CB   2  
ATOM 1812  C CG   . PHE A 1 23  ? 0.366   3.220   -7.085  1.00 0.00 ? 23  PHE A CG   2  
ATOM 1813  C CD1  . PHE A 1 23  ? 1.273   2.275   -6.634  1.00 0.00 ? 23  PHE A CD1  2  
ATOM 1814  C CD2  . PHE A 1 23  ? 0.650   4.562   -6.892  1.00 0.00 ? 23  PHE A CD2  2  
ATOM 1815  C CE1  . PHE A 1 23  ? 2.440   2.661   -6.002  1.00 0.00 ? 23  PHE A CE1  2  
ATOM 1816  C CE2  . PHE A 1 23  ? 1.816   4.954   -6.261  1.00 0.00 ? 23  PHE A CE2  2  
ATOM 1817  C CZ   . PHE A 1 23  ? 2.712   4.003   -5.816  1.00 0.00 ? 23  PHE A CZ   2  
ATOM 1818  H H    . PHE A 1 23  ? -1.645  0.583   -6.127  1.00 0.00 ? 23  PHE A H    2  
ATOM 1819  H HA   . PHE A 1 23  ? -2.273  3.453   -6.263  1.00 0.00 ? 23  PHE A HA   2  
ATOM 1820  H HB2  . PHE A 1 23  ? -0.696  1.891   -8.319  1.00 0.00 ? 23  PHE A HB2  2  
ATOM 1821  H HB3  . PHE A 1 23  ? -1.182  3.577   -8.463  1.00 0.00 ? 23  PHE A HB3  2  
ATOM 1822  H HD1  . PHE A 1 23  ? 1.062   1.226   -6.779  1.00 0.00 ? 23  PHE A HD1  2  
ATOM 1823  H HD2  . PHE A 1 23  ? -0.051  5.308   -7.240  1.00 0.00 ? 23  PHE A HD2  2  
ATOM 1824  H HE1  . PHE A 1 23  ? 3.139   1.915   -5.655  1.00 0.00 ? 23  PHE A HE1  2  
ATOM 1825  H HE2  . PHE A 1 23  ? 2.026   6.004   -6.118  1.00 0.00 ? 23  PHE A HE2  2  
ATOM 1826  H HZ   . PHE A 1 23  ? 3.623   4.307   -5.323  1.00 0.00 ? 23  PHE A HZ   2  
ATOM 1827  N N    . TYR A 1 24  ? -4.216  3.090   -7.779  1.00 0.00 ? 24  TYR A N    2  
ATOM 1828  C CA   . TYR A 1 24  ? -5.452  2.833   -8.507  1.00 0.00 ? 24  TYR A CA   2  
ATOM 1829  C C    . TYR A 1 24  ? -5.577  3.757   -9.715  1.00 0.00 ? 24  TYR A C    2  
ATOM 1830  O O    . TYR A 1 24  ? -5.252  4.943   -9.640  1.00 0.00 ? 24  TYR A O    2  
ATOM 1831  C CB   . TYR A 1 24  ? -6.659  3.015   -7.585  1.00 0.00 ? 24  TYR A CB   2  
ATOM 1832  C CG   . TYR A 1 24  ? -6.862  4.442   -7.128  1.00 0.00 ? 24  TYR A CG   2  
ATOM 1833  C CD1  . TYR A 1 24  ? -6.084  4.983   -6.111  1.00 0.00 ? 24  TYR A CD1  2  
ATOM 1834  C CD2  . TYR A 1 24  ? -7.831  5.248   -7.711  1.00 0.00 ? 24  TYR A CD2  2  
ATOM 1835  C CE1  . TYR A 1 24  ? -6.266  6.286   -5.689  1.00 0.00 ? 24  TYR A CE1  2  
ATOM 1836  C CE2  . TYR A 1 24  ? -8.019  6.552   -7.297  1.00 0.00 ? 24  TYR A CE2  2  
ATOM 1837  C CZ   . TYR A 1 24  ? -7.234  7.066   -6.285  1.00 0.00 ? 24  TYR A CZ   2  
ATOM 1838  O OH   . TYR A 1 24  ? -7.419  8.365   -5.869  1.00 0.00 ? 24  TYR A OH   2  
ATOM 1839  H H    . TYR A 1 24  ? -4.051  3.988   -7.421  1.00 0.00 ? 24  TYR A H    2  
ATOM 1840  H HA   . TYR A 1 24  ? -5.427  1.809   -8.853  1.00 0.00 ? 24  TYR A HA   2  
ATOM 1841  H HB2  . TYR A 1 24  ? -7.552  2.704   -8.106  1.00 0.00 ? 24  TYR A HB2  2  
ATOM 1842  H HB3  . TYR A 1 24  ? -6.529  2.400   -6.707  1.00 0.00 ? 24  TYR A HB3  2  
ATOM 1843  H HD1  . TYR A 1 24  ? -5.327  4.368   -5.646  1.00 0.00 ? 24  TYR A HD1  2  
ATOM 1844  H HD2  . TYR A 1 24  ? -8.444  4.842   -8.503  1.00 0.00 ? 24  TYR A HD2  2  
ATOM 1845  H HE1  . TYR A 1 24  ? -5.652  6.689   -4.897  1.00 0.00 ? 24  TYR A HE1  2  
ATOM 1846  H HE2  . TYR A 1 24  ? -8.777  7.164   -7.763  1.00 0.00 ? 24  TYR A HE2  2  
ATOM 1847  H HH   . TYR A 1 24  ? -8.356  8.526   -5.729  1.00 0.00 ? 24  TYR A HH   2  
ATOM 1848  N N    . LEU A 1 25  ? -6.049  3.206   -10.827 1.00 0.00 ? 25  LEU A N    2  
ATOM 1849  C CA   . LEU A 1 25  ? -6.218  3.979   -12.052 1.00 0.00 ? 25  LEU A CA   2  
ATOM 1850  C C    . LEU A 1 25  ? -7.290  5.050   -11.877 1.00 0.00 ? 25  LEU A C    2  
ATOM 1851  O O    . LEU A 1 25  ? -8.296  4.831   -11.203 1.00 0.00 ? 25  LEU A O    2  
ATOM 1852  C CB   . LEU A 1 25  ? -6.588  3.056   -13.215 1.00 0.00 ? 25  LEU A CB   2  
ATOM 1853  C CG   . LEU A 1 25  ? -6.983  3.747   -14.521 1.00 0.00 ? 25  LEU A CG   2  
ATOM 1854  C CD1  . LEU A 1 25  ? -5.748  4.248   -15.254 1.00 0.00 ? 25  LEU A CD1  2  
ATOM 1855  C CD2  . LEU A 1 25  ? -7.782  2.800   -15.404 1.00 0.00 ? 25  LEU A CD2  2  
ATOM 1856  H H    . LEU A 1 25  ? -6.290  2.256   -10.826 1.00 0.00 ? 25  LEU A H    2  
ATOM 1857  H HA   . LEU A 1 25  ? -5.277  4.461   -12.272 1.00 0.00 ? 25  LEU A HA   2  
ATOM 1858  H HB2  . LEU A 1 25  ? -5.738  2.424   -13.419 1.00 0.00 ? 25  LEU A HB2  2  
ATOM 1859  H HB3  . LEU A 1 25  ? -7.421  2.445   -12.898 1.00 0.00 ? 25  LEU A HB3  2  
ATOM 1860  H HG   . LEU A 1 25  ? -7.606  4.601   -14.295 1.00 0.00 ? 25  LEU A HG   2  
ATOM 1861  H HD11 . LEU A 1 25  ? -5.960  4.318   -16.310 1.00 0.00 ? 25  LEU A HD11 2  
ATOM 1862  H HD12 . LEU A 1 25  ? -4.931  3.560   -15.095 1.00 0.00 ? 25  LEU A HD12 2  
ATOM 1863  H HD13 . LEU A 1 25  ? -5.476  5.223   -14.875 1.00 0.00 ? 25  LEU A HD13 2  
ATOM 1864  H HD21 . LEU A 1 25  ? -7.670  3.092   -16.438 1.00 0.00 ? 25  LEU A HD21 2  
ATOM 1865  H HD22 . LEU A 1 25  ? -8.826  2.846   -15.129 1.00 0.00 ? 25  LEU A HD22 2  
ATOM 1866  H HD23 . LEU A 1 25  ? -7.418  1.792   -15.273 1.00 0.00 ? 25  LEU A HD23 2  
ATOM 1867  N N    . ALA A 1 26  ? -7.067  6.208   -12.490 1.00 0.00 ? 26  ALA A N    2  
ATOM 1868  C CA   . ALA A 1 26  ? -8.016  7.312   -12.405 1.00 0.00 ? 26  ALA A CA   2  
ATOM 1869  C C    . ALA A 1 26  ? -8.742  7.515   -13.730 1.00 0.00 ? 26  ALA A C    2  
ATOM 1870  O O    . ALA A 1 26  ? -8.358  6.947   -14.752 1.00 0.00 ? 26  ALA A O    2  
ATOM 1871  C CB   . ALA A 1 26  ? -7.303  8.590   -11.991 1.00 0.00 ? 26  ALA A CB   2  
ATOM 1872  H H    . ALA A 1 26  ? -6.247  6.323   -13.013 1.00 0.00 ? 26  ALA A H    2  
ATOM 1873  H HA   . ALA A 1 26  ? -8.742  7.070   -11.642 1.00 0.00 ? 26  ALA A HA   2  
ATOM 1874  H HB1  . ALA A 1 26  ? -6.295  8.355   -11.679 1.00 0.00 ? 26  ALA A HB1  2  
ATOM 1875  H HB2  . ALA A 1 26  ? -7.271  9.272   -12.827 1.00 0.00 ? 26  ALA A HB2  2  
ATOM 1876  H HB3  . ALA A 1 26  ? -7.835  9.050   -11.171 1.00 0.00 ? 26  ALA A HB3  2  
ATOM 1877  N N    . GLU A 1 27  ? -9.794  8.327   -13.705 1.00 0.00 ? 27  GLU A N    2  
ATOM 1878  C CA   . GLU A 1 27  ? -10.574 8.603   -14.906 1.00 0.00 ? 27  GLU A CA   2  
ATOM 1879  C C    . GLU A 1 27  ? -9.729  9.327   -15.950 1.00 0.00 ? 27  GLU A C    2  
ATOM 1880  O O    . GLU A 1 27  ? -9.840  9.060   -17.147 1.00 0.00 ? 27  GLU A O    2  
ATOM 1881  C CB   . GLU A 1 27  ? -11.806 9.443   -14.559 1.00 0.00 ? 27  GLU A CB   2  
ATOM 1882  C CG   . GLU A 1 27  ? -12.750 9.651   -15.731 1.00 0.00 ? 27  GLU A CG   2  
ATOM 1883  C CD   . GLU A 1 27  ? -13.426 8.368   -16.171 1.00 0.00 ? 27  GLU A CD   2  
ATOM 1884  O OE1  . GLU A 1 27  ? -13.971 7.656   -15.302 1.00 0.00 ? 27  GLU A OE1  2  
ATOM 1885  O OE2  . GLU A 1 27  ? -13.410 8.075   -17.385 1.00 0.00 ? 27  GLU A OE2  2  
ATOM 1886  H H    . GLU A 1 27  ? -10.051 8.751   -12.860 1.00 0.00 ? 27  GLU A H    2  
ATOM 1887  H HA   . GLU A 1 27  ? -10.899 7.658   -15.315 1.00 0.00 ? 27  GLU A HA   2  
ATOM 1888  H HB2  . GLU A 1 27  ? -12.351 8.951   -13.767 1.00 0.00 ? 27  GLU A HB2  2  
ATOM 1889  H HB3  . GLU A 1 27  ? -11.479 10.412  -14.211 1.00 0.00 ? 27  GLU A HB3  2  
ATOM 1890  H HG2  . GLU A 1 27  ? -13.511 10.360  -15.442 1.00 0.00 ? 27  GLU A HG2  2  
ATOM 1891  H HG3  . GLU A 1 27  ? -12.188 10.048  -16.564 1.00 0.00 ? 27  GLU A HG3  2  
ATOM 1892  N N    . CYS A 1 28  ? -8.885  10.243  -15.488 1.00 0.00 ? 28  CYS A N    2  
ATOM 1893  C CA   . CYS A 1 28  ? -8.022  11.007  -16.381 1.00 0.00 ? 28  CYS A CA   2  
ATOM 1894  C C    . CYS A 1 28  ? -7.141  10.078  -17.211 1.00 0.00 ? 28  CYS A C    2  
ATOM 1895  O O    . CYS A 1 28  ? -6.755  10.410  -18.331 1.00 0.00 ? 28  CYS A O    2  
ATOM 1896  C CB   . CYS A 1 28  ? -7.150  11.973  -15.578 1.00 0.00 ? 28  CYS A CB   2  
ATOM 1897  S SG   . CYS A 1 28  ? -8.084  13.204  -14.639 1.00 0.00 ? 28  CYS A SG   2  
ATOM 1898  H H    . CYS A 1 28  ? -8.842  10.410  -14.523 1.00 0.00 ? 28  CYS A H    2  
ATOM 1899  H HA   . CYS A 1 28  ? -8.654  11.574  -17.047 1.00 0.00 ? 28  CYS A HA   2  
ATOM 1900  H HB2  . CYS A 1 28  ? -6.553  11.410  -14.876 1.00 0.00 ? 28  CYS A HB2  2  
ATOM 1901  H HB3  . CYS A 1 28  ? -6.494  12.501  -16.254 1.00 0.00 ? 28  CYS A HB3  2  
ATOM 1902  H HG   . CYS A 1 28  ? -7.497  14.379  -14.809 1.00 0.00 ? 28  CYS A HG   2  
ATOM 1903  N N    . GLY A 1 29  ? -6.826  8.914   -16.653 1.00 0.00 ? 29  GLY A N    2  
ATOM 1904  C CA   . GLY A 1 29  ? -5.992  7.956   -17.355 1.00 0.00 ? 29  GLY A CA   2  
ATOM 1905  C C    . GLY A 1 29  ? -4.783  7.535   -16.542 1.00 0.00 ? 29  GLY A C    2  
ATOM 1906  O O    . GLY A 1 29  ? -4.361  6.380   -16.596 1.00 0.00 ? 29  GLY A O    2  
ATOM 1907  H H    . GLY A 1 29  ? -7.163  8.703   -15.757 1.00 0.00 ? 29  GLY A H    2  
ATOM 1908  H HA2  . GLY A 1 29  ? -6.581  7.081   -17.583 1.00 0.00 ? 29  GLY A HA2  2  
ATOM 1909  H HA3  . GLY A 1 29  ? -5.653  8.401   -18.279 1.00 0.00 ? 29  GLY A HA3  2  
ATOM 1910  N N    . LYS A 1 30  ? -4.222  8.475   -15.789 1.00 0.00 ? 30  LYS A N    2  
ATOM 1911  C CA   . LYS A 1 30  ? -3.054  8.197   -14.962 1.00 0.00 ? 30  LYS A CA   2  
ATOM 1912  C C    . LYS A 1 30  ? -3.463  7.549   -13.643 1.00 0.00 ? 30  LYS A C    2  
ATOM 1913  O O    . LYS A 1 30  ? -4.595  7.709   -13.187 1.00 0.00 ? 30  LYS A O    2  
ATOM 1914  C CB   . LYS A 1 30  ? -2.278  9.488   -14.689 1.00 0.00 ? 30  LYS A CB   2  
ATOM 1915  C CG   . LYS A 1 30  ? -3.100  10.554  -13.984 1.00 0.00 ? 30  LYS A CG   2  
ATOM 1916  C CD   . LYS A 1 30  ? -2.586  11.950  -14.295 1.00 0.00 ? 30  LYS A CD   2  
ATOM 1917  C CE   . LYS A 1 30  ? -3.570  13.019  -13.842 1.00 0.00 ? 30  LYS A CE   2  
ATOM 1918  N NZ   . LYS A 1 30  ? -2.989  14.386  -13.946 1.00 0.00 ? 30  LYS A NZ   2  
ATOM 1919  H H    . LYS A 1 30  ? -4.605  9.378   -15.788 1.00 0.00 ? 30  LYS A H    2  
ATOM 1920  H HA   . LYS A 1 30  ? -2.419  7.514   -15.504 1.00 0.00 ? 30  LYS A HA   2  
ATOM 1921  H HB2  . LYS A 1 30  ? -1.423  9.256   -14.072 1.00 0.00 ? 30  LYS A HB2  2  
ATOM 1922  H HB3  . LYS A 1 30  ? -1.934  9.893   -15.630 1.00 0.00 ? 30  LYS A HB3  2  
ATOM 1923  H HG2  . LYS A 1 30  ? -4.127  10.479  -14.310 1.00 0.00 ? 30  LYS A HG2  2  
ATOM 1924  H HG3  . LYS A 1 30  ? -3.046  10.390  -12.917 1.00 0.00 ? 30  LYS A HG3  2  
ATOM 1925  H HD2  . LYS A 1 30  ? -1.647  12.101  -13.783 1.00 0.00 ? 30  LYS A HD2  2  
ATOM 1926  H HD3  . LYS A 1 30  ? -2.436  12.039  -15.361 1.00 0.00 ? 30  LYS A HD3  2  
ATOM 1927  H HE2  . LYS A 1 30  ? -4.451  12.964  -14.462 1.00 0.00 ? 30  LYS A HE2  2  
ATOM 1928  H HE3  . LYS A 1 30  ? -3.840  12.828  -12.814 1.00 0.00 ? 30  LYS A HE3  2  
ATOM 1929  H HZ1  . LYS A 1 30  ? -2.890  14.805  -12.999 1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 1930  H HZ2  . LYS A 1 30  ? -3.607  14.995  -14.519 1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 1931  H HZ3  . LYS A 1 30  ? -2.051  14.343  -14.394 1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 1932  N N    . TRP A 1 31  ? -2.535  6.818   -13.036 1.00 0.00 ? 31  TRP A N    2  
ATOM 1933  C CA   . TRP A 1 31  ? -2.799  6.147   -11.768 1.00 0.00 ? 31  TRP A CA   2  
ATOM 1934  C C    . TRP A 1 31  ? -2.411  7.035   -10.591 1.00 0.00 ? 31  TRP A C    2  
ATOM 1935  O O    . TRP A 1 31  ? -1.422  7.765   -10.651 1.00 0.00 ? 31  TRP A O    2  
ATOM 1936  C CB   . TRP A 1 31  ? -2.034  4.824   -11.699 1.00 0.00 ? 31  TRP A CB   2  
ATOM 1937  C CG   . TRP A 1 31  ? -2.361  3.889   -12.824 1.00 0.00 ? 31  TRP A CG   2  
ATOM 1938  C CD1  . TRP A 1 31  ? -2.156  4.107   -14.157 1.00 0.00 ? 31  TRP A CD1  2  
ATOM 1939  C CD2  . TRP A 1 31  ? -2.954  2.591   -12.714 1.00 0.00 ? 31  TRP A CD2  2  
ATOM 1940  N NE1  . TRP A 1 31  ? -2.585  3.022   -14.882 1.00 0.00 ? 31  TRP A NE1  2  
ATOM 1941  C CE2  . TRP A 1 31  ? -3.078  2.078   -14.020 1.00 0.00 ? 31  TRP A CE2  2  
ATOM 1942  C CE3  . TRP A 1 31  ? -3.391  1.811   -11.640 1.00 0.00 ? 31  TRP A CE3  2  
ATOM 1943  C CZ2  . TRP A 1 31  ? -3.621  0.822   -14.278 1.00 0.00 ? 31  TRP A CZ2  2  
ATOM 1944  C CZ3  . TRP A 1 31  ? -3.929  0.565   -11.897 1.00 0.00 ? 31  TRP A CZ3  2  
ATOM 1945  C CH2  . TRP A 1 31  ? -4.040  0.080   -13.207 1.00 0.00 ? 31  TRP A CH2  2  
ATOM 1946  H H    . TRP A 1 31  ? -1.650  6.728   -13.450 1.00 0.00 ? 31  TRP A H    2  
ATOM 1947  H HA   . TRP A 1 31  ? -3.858  5.943   -11.717 1.00 0.00 ? 31  TRP A HA   2  
ATOM 1948  H HB2  . TRP A 1 31  ? -0.974  5.026   -11.731 1.00 0.00 ? 31  TRP A HB2  2  
ATOM 1949  H HB3  . TRP A 1 31  ? -2.274  4.326   -10.771 1.00 0.00 ? 31  TRP A HB3  2  
ATOM 1950  H HD1  . TRP A 1 31  ? -1.720  5.006   -14.566 1.00 0.00 ? 31  TRP A HD1  2  
ATOM 1951  H HE1  . TRP A 1 31  ? -2.543  2.937   -15.858 1.00 0.00 ? 31  TRP A HE1  2  
ATOM 1952  H HE3  . TRP A 1 31  ? -3.314  2.167   -10.623 1.00 0.00 ? 31  TRP A HE3  2  
ATOM 1953  H HZ2  . TRP A 1 31  ? -3.713  0.434   -15.282 1.00 0.00 ? 31  TRP A HZ2  2  
ATOM 1954  H HZ3  . TRP A 1 31  ? -4.273  -0.052  -11.080 1.00 0.00 ? 31  TRP A HZ3  2  
ATOM 1955  H HH2  . TRP A 1 31  ? -4.468  -0.899  -13.361 1.00 0.00 ? 31  TRP A HH2  2  
ATOM 1956  N N    . HIS A 1 32  ? -3.196  6.967   -9.520  1.00 0.00 ? 32  HIS A N    2  
ATOM 1957  C CA   . HIS A 1 32  ? -2.933  7.765   -8.328  1.00 0.00 ? 32  HIS A CA   2  
ATOM 1958  C C    . HIS A 1 32  ? -2.573  6.871   -7.145  1.00 0.00 ? 32  HIS A C    2  
ATOM 1959  O O    . HIS A 1 32  ? -3.053  5.743   -7.038  1.00 0.00 ? 32  HIS A O    2  
ATOM 1960  C CB   . HIS A 1 32  ? -4.152  8.622   -7.983  1.00 0.00 ? 32  HIS A CB   2  
ATOM 1961  C CG   . HIS A 1 32  ? -4.420  9.709   -8.977  1.00 0.00 ? 32  HIS A CG   2  
ATOM 1962  N ND1  . HIS A 1 32  ? -3.496  10.681  -9.297  1.00 0.00 ? 32  HIS A ND1  2  
ATOM 1963  C CD2  . HIS A 1 32  ? -5.517  9.974   -9.725  1.00 0.00 ? 32  HIS A CD2  2  
ATOM 1964  C CE1  . HIS A 1 32  ? -4.013  11.498  -10.198 1.00 0.00 ? 32  HIS A CE1  2  
ATOM 1965  N NE2  . HIS A 1 32  ? -5.238  11.090  -10.475 1.00 0.00 ? 32  HIS A NE2  2  
ATOM 1966  H H    . HIS A 1 32  ? -3.970  6.366   -9.532  1.00 0.00 ? 32  HIS A H    2  
ATOM 1967  H HA   . HIS A 1 32  ? -2.097  8.413   -8.541  1.00 0.00 ? 32  HIS A HA   2  
ATOM 1968  H HB2  . HIS A 1 32  ? -5.027  7.990   -7.939  1.00 0.00 ? 32  HIS A HB2  2  
ATOM 1969  H HB3  . HIS A 1 32  ? -3.998  9.083   -7.018  1.00 0.00 ? 32  HIS A HB3  2  
ATOM 1970  H HD1  . HIS A 1 32  ? -2.595  10.761  -8.920  1.00 0.00 ? 32  HIS A HD1  2  
ATOM 1971  H HD2  . HIS A 1 32  ? -6.440  9.412   -9.731  1.00 0.00 ? 32  HIS A HD2  2  
ATOM 1972  H HE1  . HIS A 1 32  ? -3.518  12.352  -10.634 1.00 0.00 ? 32  HIS A HE1  2  
ATOM 1973  N N    . MET A 1 33  ? -1.725  7.384   -6.259  1.00 0.00 ? 33  MET A N    2  
ATOM 1974  C CA   . MET A 1 33  ? -1.302  6.632   -5.083  1.00 0.00 ? 33  MET A CA   2  
ATOM 1975  C C    . MET A 1 33  ? -2.415  6.580   -4.041  1.00 0.00 ? 33  MET A C    2  
ATOM 1976  O O    . MET A 1 33  ? -2.993  7.606   -3.685  1.00 0.00 ? 33  MET A O    2  
ATOM 1977  C CB   . MET A 1 33  ? -0.046  7.259   -4.475  1.00 0.00 ? 33  MET A CB   2  
ATOM 1978  C CG   . MET A 1 33  ? 0.453   6.539   -3.233  1.00 0.00 ? 33  MET A CG   2  
ATOM 1979  S SD   . MET A 1 33  ? 1.491   7.584   -2.194  1.00 0.00 ? 33  MET A SD   2  
ATOM 1980  C CE   . MET A 1 33  ? 2.715   6.400   -1.639  1.00 0.00 ? 33  MET A CE   2  
ATOM 1981  H H    . MET A 1 33  ? -1.376  8.289   -6.398  1.00 0.00 ? 33  MET A H    2  
ATOM 1982  H HA   . MET A 1 33  ? -1.073  5.625   -5.399  1.00 0.00 ? 33  MET A HA   2  
ATOM 1983  H HB2  . MET A 1 33  ? 0.742   7.247   -5.213  1.00 0.00 ? 33  MET A HB2  2  
ATOM 1984  H HB3  . MET A 1 33  ? -0.263  8.283   -4.208  1.00 0.00 ? 33  MET A HB3  2  
ATOM 1985  H HG2  . MET A 1 33  ? -0.399  6.214   -2.654  1.00 0.00 ? 33  MET A HG2  2  
ATOM 1986  H HG3  . MET A 1 33  ? 1.026   5.676   -3.540  1.00 0.00 ? 33  MET A HG3  2  
ATOM 1987  H HE1  . MET A 1 33  ? 3.469   6.908   -1.056  1.00 0.00 ? 33  MET A HE1  2  
ATOM 1988  H HE2  . MET A 1 33  ? 2.237   5.646   -1.031  1.00 0.00 ? 33  MET A HE2  2  
ATOM 1989  H HE3  . MET A 1 33  ? 3.178   5.932   -2.496  1.00 0.00 ? 33  MET A HE3  2  
ATOM 1990  N N    . PHE A 1 34  ? -2.709  5.378   -3.556  1.00 0.00 ? 34  PHE A N    2  
ATOM 1991  C CA   . PHE A 1 34  ? -3.754  5.193   -2.555  1.00 0.00 ? 34  PHE A CA   2  
ATOM 1992  C C    . PHE A 1 34  ? -3.645  6.244   -1.455  1.00 0.00 ? 34  PHE A C    2  
ATOM 1993  O O    . PHE A 1 34  ? -2.613  6.361   -0.794  1.00 0.00 ? 34  PHE A O    2  
ATOM 1994  C CB   . PHE A 1 34  ? -3.666  3.791   -1.949  1.00 0.00 ? 34  PHE A CB   2  
ATOM 1995  C CG   . PHE A 1 34  ? -4.421  2.752   -2.727  1.00 0.00 ? 34  PHE A CG   2  
ATOM 1996  C CD1  . PHE A 1 34  ? -4.285  2.664   -4.103  1.00 0.00 ? 34  PHE A CD1  2  
ATOM 1997  C CD2  . PHE A 1 34  ? -5.267  1.864   -2.083  1.00 0.00 ? 34  PHE A CD2  2  
ATOM 1998  C CE1  . PHE A 1 34  ? -4.978  1.709   -4.823  1.00 0.00 ? 34  PHE A CE1  2  
ATOM 1999  C CE2  . PHE A 1 34  ? -5.963  0.907   -2.797  1.00 0.00 ? 34  PHE A CE2  2  
ATOM 2000  C CZ   . PHE A 1 34  ? -5.819  0.830   -4.169  1.00 0.00 ? 34  PHE A CZ   2  
ATOM 2001  H H    . PHE A 1 34  ? -2.213  4.597   -3.879  1.00 0.00 ? 34  PHE A H    2  
ATOM 2002  H HA   . PHE A 1 34  ? -4.707  5.303   -3.049  1.00 0.00 ? 34  PHE A HA   2  
ATOM 2003  H HB2  . PHE A 1 34  ? -2.630  3.488   -1.910  1.00 0.00 ? 34  PHE A HB2  2  
ATOM 2004  H HB3  . PHE A 1 34  ? -4.068  3.815   -0.947  1.00 0.00 ? 34  PHE A HB3  2  
ATOM 2005  H HD1  . PHE A 1 34  ? -3.627  3.352   -4.616  1.00 0.00 ? 34  PHE A HD1  2  
ATOM 2006  H HD2  . PHE A 1 34  ? -5.382  1.924   -1.011  1.00 0.00 ? 34  PHE A HD2  2  
ATOM 2007  H HE1  . PHE A 1 34  ? -4.863  1.651   -5.895  1.00 0.00 ? 34  PHE A HE1  2  
ATOM 2008  H HE2  . PHE A 1 34  ? -6.620  0.221   -2.284  1.00 0.00 ? 34  PHE A HE2  2  
ATOM 2009  H HZ   . PHE A 1 34  ? -6.361  0.082   -4.729  1.00 0.00 ? 34  PHE A HZ   2  
ATOM 2010  N N    . GLN A 1 35  ? -4.717  7.006   -1.264  1.00 0.00 ? 35  GLN A N    2  
ATOM 2011  C CA   . GLN A 1 35  ? -4.742  8.048   -0.244  1.00 0.00 ? 35  GLN A CA   2  
ATOM 2012  C C    . GLN A 1 35  ? -6.126  8.160   0.387   1.00 0.00 ? 35  GLN A C    2  
ATOM 2013  O O    . GLN A 1 35  ? -7.147  7.892   -0.247  1.00 0.00 ? 35  GLN A O    2  
ATOM 2014  C CB   . GLN A 1 35  ? -4.333  9.392   -0.849  1.00 0.00 ? 35  GLN A CB   2  
ATOM 2015  C CG   . GLN A 1 35  ? -2.892  9.431   -1.330  1.00 0.00 ? 35  GLN A CG   2  
ATOM 2016  C CD   . GLN A 1 35  ? -1.928  9.879   -0.249  1.00 0.00 ? 35  GLN A CD   2  
ATOM 2017  O OE1  . GLN A 1 35  ? -2.155  10.884  0.424   1.00 0.00 ? 35  GLN A OE1  2  
ATOM 2018  N NE2  . GLN A 1 35  ? -0.843  9.133   -0.078  1.00 0.00 ? 35  GLN A NE2  2  
ATOM 2019  H H    . GLN A 1 35  ? -5.509  6.865   -1.822  1.00 0.00 ? 35  GLN A H    2  
ATOM 2020  H HA   . GLN A 1 35  ? -4.031  7.778   0.522   1.00 0.00 ? 35  GLN A HA   2  
ATOM 2021  H HB2  . GLN A 1 35  ? -4.977  9.606   -1.689  1.00 0.00 ? 35  GLN A HB2  2  
ATOM 2022  H HB3  . GLN A 1 35  ? -4.461  10.163  -0.103  1.00 0.00 ? 35  GLN A HB3  2  
ATOM 2023  H HG2  . GLN A 1 35  ? -2.608  8.441   -1.656  1.00 0.00 ? 35  GLN A HG2  2  
ATOM 2024  H HG3  . GLN A 1 35  ? -2.822  10.116  -2.162  1.00 0.00 ? 35  GLN A HG3  2  
ATOM 2025  H HE21 . GLN A 1 35  ? -0.727  8.346   -0.652  1.00 0.00 ? 35  GLN A HE21 2  
ATOM 2026  H HE22 . GLN A 1 35  ? -0.202  9.399   0.613   1.00 0.00 ? 35  GLN A HE22 2  
ATOM 2027  N N    . PRO A 1 36  ? -6.163  8.564   1.665   1.00 0.00 ? 36  PRO A N    2  
ATOM 2028  C CA   . PRO A 1 36  ? -7.416  8.721   2.409   1.00 0.00 ? 36  PRO A CA   2  
ATOM 2029  C C    . PRO A 1 36  ? -8.244  9.900   1.909   1.00 0.00 ? 36  PRO A C    2  
ATOM 2030  O O    . PRO A 1 36  ? -7.841  11.056  2.046   1.00 0.00 ? 36  PRO A O    2  
ATOM 2031  C CB   . PRO A 1 36  ? -6.947  8.968   3.845   1.00 0.00 ? 36  PRO A CB   2  
ATOM 2032  C CG   . PRO A 1 36  ? -5.580  9.543   3.704   1.00 0.00 ? 36  PRO A CG   2  
ATOM 2033  C CD   . PRO A 1 36  ? -4.985  8.901   2.482   1.00 0.00 ? 36  PRO A CD   2  
ATOM 2034  H HA   . PRO A 1 36  ? -8.014  7.822   2.373   1.00 0.00 ? 36  PRO A HA   2  
ATOM 2035  H HB2  . PRO A 1 36  ? -7.619  9.660   4.333   1.00 0.00 ? 36  PRO A HB2  2  
ATOM 2036  H HB3  . PRO A 1 36  ? -6.928  8.034   4.387   1.00 0.00 ? 36  PRO A HB3  2  
ATOM 2037  H HG2  . PRO A 1 36  ? -5.644  10.613  3.572   1.00 0.00 ? 36  PRO A HG2  2  
ATOM 2038  H HG3  . PRO A 1 36  ? -4.990  9.306   4.577   1.00 0.00 ? 36  PRO A HG3  2  
ATOM 2039  H HD2  . PRO A 1 36  ? -4.343  9.598   1.964   1.00 0.00 ? 36  PRO A HD2  2  
ATOM 2040  H HD3  . PRO A 1 36  ? -4.437  8.010   2.752   1.00 0.00 ? 36  PRO A HD3  2  
ATOM 2041  N N    . ASP A 1 37  ? -9.402  9.601   1.331   1.00 0.00 ? 37  ASP A N    2  
ATOM 2042  C CA   . ASP A 1 37  ? -10.287 10.637  0.812   1.00 0.00 ? 37  ASP A CA   2  
ATOM 2043  C C    . ASP A 1 37  ? -10.241 11.882  1.692   1.00 0.00 ? 37  ASP A C    2  
ATOM 2044  O O    . ASP A 1 37  ? -9.938  12.979  1.222   1.00 0.00 ? 37  ASP A O    2  
ATOM 2045  C CB   . ASP A 1 37  ? -11.721 10.114  0.721   1.00 0.00 ? 37  ASP A CB   2  
ATOM 2046  C CG   . ASP A 1 37  ? -12.723 11.216  0.439   1.00 0.00 ? 37  ASP A CG   2  
ATOM 2047  O OD1  . ASP A 1 37  ? -13.141 11.897  1.398   1.00 0.00 ? 37  ASP A OD1  2  
ATOM 2048  O OD2  . ASP A 1 37  ? -13.090 11.397  -0.741  1.00 0.00 ? 37  ASP A OD2  2  
ATOM 2049  H H    . ASP A 1 37  ? -9.668  8.661   1.252   1.00 0.00 ? 37  ASP A H    2  
ATOM 2050  H HA   . ASP A 1 37  ? -9.946  10.900  -0.178  1.00 0.00 ? 37  ASP A HA   2  
ATOM 2051  H HB2  . ASP A 1 37  ? -11.782 9.385   -0.075  1.00 0.00 ? 37  ASP A HB2  2  
ATOM 2052  H HB3  . ASP A 1 37  ? -11.985 9.642   1.656   1.00 0.00 ? 37  ASP A HB3  2  
ATOM 2053  N N    . THR A 1 38  ? -10.546 11.706  2.975   1.00 0.00 ? 38  THR A N    2  
ATOM 2054  C CA   . THR A 1 38  ? -10.542 12.814  3.921   1.00 0.00 ? 38  THR A CA   2  
ATOM 2055  C C    . THR A 1 38  ? -9.543  12.573  5.047   1.00 0.00 ? 38  THR A C    2  
ATOM 2056  O O    . THR A 1 38  ? -9.678  11.622  5.815   1.00 0.00 ? 38  THR A O    2  
ATOM 2057  C CB   . THR A 1 38  ? -11.940 13.038  4.529   1.00 0.00 ? 38  THR A CB   2  
ATOM 2058  O OG1  . THR A 1 38  ? -11.818 13.588  5.846   1.00 0.00 ? 38  THR A OG1  2  
ATOM 2059  C CG2  . THR A 1 38  ? -12.720 11.734  4.588   1.00 0.00 ? 38  THR A CG2  2  
ATOM 2060  H H    . THR A 1 38  ? -10.779 10.808  3.290   1.00 0.00 ? 38  THR A H    2  
ATOM 2061  H HA   . THR A 1 38  ? -10.258 13.709  3.385   1.00 0.00 ? 38  THR A HA   2  
ATOM 2062  H HB   . THR A 1 38  ? -12.480 13.736  3.904   1.00 0.00 ? 38  THR A HB   2  
ATOM 2063  H HG1  . THR A 1 38  ? -11.557 12.896  6.458   1.00 0.00 ? 38  THR A HG1  2  
ATOM 2064  H HG21 . THR A 1 38  ? -13.499 11.814  5.331   1.00 0.00 ? 38  THR A HG21 2  
ATOM 2065  H HG22 . THR A 1 38  ? -12.052 10.927  4.851   1.00 0.00 ? 38  THR A HG22 2  
ATOM 2066  H HG23 . THR A 1 38  ? -13.162 11.535  3.623   1.00 0.00 ? 38  THR A HG23 2  
ATOM 2067  N N    . ASN A 1 39  ? -8.541  13.440  5.138   1.00 0.00 ? 39  ASN A N    2  
ATOM 2068  C CA   . ASN A 1 39  ? -7.518  13.321  6.171   1.00 0.00 ? 39  ASN A CA   2  
ATOM 2069  C C    . ASN A 1 39  ? -8.153  13.175  7.551   1.00 0.00 ? 39  ASN A C    2  
ATOM 2070  O O    . ASN A 1 39  ? -7.774  12.302  8.331   1.00 0.00 ? 39  ASN A O    2  
ATOM 2071  C CB   . ASN A 1 39  ? -6.596  14.541  6.148   1.00 0.00 ? 39  ASN A CB   2  
ATOM 2072  C CG   . ASN A 1 39  ? -5.762  14.660  7.410   1.00 0.00 ? 39  ASN A CG   2  
ATOM 2073  O OD1  . ASN A 1 39  ? -6.089  15.431  8.313   1.00 0.00 ? 39  ASN A OD1  2  
ATOM 2074  N ND2  . ASN A 1 39  ? -4.680  13.894  7.478   1.00 0.00 ? 39  ASN A ND2  2  
ATOM 2075  H H    . ASN A 1 39  ? -8.486  14.178  4.495   1.00 0.00 ? 39  ASN A H    2  
ATOM 2076  H HA   . ASN A 1 39  ? -6.936  12.436  5.960   1.00 0.00 ? 39  ASN A HA   2  
ATOM 2077  H HB2  . ASN A 1 39  ? -5.926  14.463  5.304   1.00 0.00 ? 39  ASN A HB2  2  
ATOM 2078  H HB3  . ASN A 1 39  ? -7.193  15.435  6.048   1.00 0.00 ? 39  ASN A HB3  2  
ATOM 2079  H HD21 . ASN A 1 39  ? -4.482  13.303  6.721   1.00 0.00 ? 39  ASN A HD21 2  
ATOM 2080  H HD22 . ASN A 1 39  ? -4.123  13.950  8.283   1.00 0.00 ? 39  ASN A HD22 2  
ATOM 2081  N N    . SER A 1 40  ? -9.122  14.036  7.844   1.00 0.00 ? 40  SER A N    2  
ATOM 2082  C CA   . SER A 1 40  ? -9.808  14.006  9.130   1.00 0.00 ? 40  SER A CA   2  
ATOM 2083  C C    . SER A 1 40  ? -10.457 12.645  9.368   1.00 0.00 ? 40  SER A C    2  
ATOM 2084  O O    . SER A 1 40  ? -11.416 12.277  8.691   1.00 0.00 ? 40  SER A O    2  
ATOM 2085  C CB   . SER A 1 40  ? -10.869 15.107  9.193   1.00 0.00 ? 40  SER A CB   2  
ATOM 2086  O OG   . SER A 1 40  ? -10.275 16.375  9.412   1.00 0.00 ? 40  SER A OG   2  
ATOM 2087  H H    . SER A 1 40  ? -9.380  14.710  7.180   1.00 0.00 ? 40  SER A H    2  
ATOM 2088  H HA   . SER A 1 40  ? -9.074  14.181  9.902   1.00 0.00 ? 40  SER A HA   2  
ATOM 2089  H HB2  . SER A 1 40  ? -11.412 15.133  8.260   1.00 0.00 ? 40  SER A HB2  2  
ATOM 2090  H HB3  . SER A 1 40  ? -11.553 14.898  10.002  1.00 0.00 ? 40  SER A HB3  2  
ATOM 2091  H HG   . SER A 1 40  ? -9.548  16.285  10.031  1.00 0.00 ? 40  SER A HG   2  
ATOM 2092  N N    . GLN A 1 41  ? -9.925  11.904  10.335  1.00 0.00 ? 41  GLN A N    2  
ATOM 2093  C CA   . GLN A 1 41  ? -10.451 10.584  10.662  1.00 0.00 ? 41  GLN A CA   2  
ATOM 2094  C C    . GLN A 1 41  ? -10.771 9.797   9.396   1.00 0.00 ? 41  GLN A C    2  
ATOM 2095  O O    . GLN A 1 41  ? -11.888 9.308   9.223   1.00 0.00 ? 41  GLN A O    2  
ATOM 2096  C CB   . GLN A 1 41  ? -11.706 10.712  11.528  1.00 0.00 ? 41  GLN A CB   2  
ATOM 2097  C CG   . GLN A 1 41  ? -11.409 11.011  12.988  1.00 0.00 ? 41  GLN A CG   2  
ATOM 2098  C CD   . GLN A 1 41  ? -10.334 12.066  13.161  1.00 0.00 ? 41  GLN A CD   2  
ATOM 2099  O OE1  . GLN A 1 41  ? -10.628 13.255  13.284  1.00 0.00 ? 41  GLN A OE1  2  
ATOM 2100  N NE2  . GLN A 1 41  ? -9.078  11.635  13.173  1.00 0.00 ? 41  GLN A NE2  2  
ATOM 2101  H H    . GLN A 1 41  ? -9.161  12.253  10.839  1.00 0.00 ? 41  GLN A H    2  
ATOM 2102  H HA   . GLN A 1 41  ? -9.693  10.054  11.219  1.00 0.00 ? 41  GLN A HA   2  
ATOM 2103  H HB2  . GLN A 1 41  ? -12.319 11.510  11.136  1.00 0.00 ? 41  GLN A HB2  2  
ATOM 2104  H HB3  . GLN A 1 41  ? -12.259 9.786   11.478  1.00 0.00 ? 41  GLN A HB3  2  
ATOM 2105  H HG2  . GLN A 1 41  ? -12.314 11.361  13.462  1.00 0.00 ? 41  GLN A HG2  2  
ATOM 2106  H HG3  . GLN A 1 41  ? -11.081 10.101  13.469  1.00 0.00 ? 41  GLN A HG3  2  
ATOM 2107  H HE21 . GLN A 1 41  ? -8.918  10.673  13.068  1.00 0.00 ? 41  GLN A HE21 2  
ATOM 2108  H HE22 . GLN A 1 41  ? -8.363  12.295  13.282  1.00 0.00 ? 41  GLN A HE22 2  
ATOM 2109  N N    . CYS A 1 42  ? -9.785  9.678   8.514   1.00 0.00 ? 42  CYS A N    2  
ATOM 2110  C CA   . CYS A 1 42  ? -9.961  8.951   7.262   1.00 0.00 ? 42  CYS A CA   2  
ATOM 2111  C C    . CYS A 1 42  ? -10.479 7.540   7.522   1.00 0.00 ? 42  CYS A C    2  
ATOM 2112  O O    . CYS A 1 42  ? -10.736 7.163   8.665   1.00 0.00 ? 42  CYS A O    2  
ATOM 2113  C CB   . CYS A 1 42  ? -8.641  8.889   6.493   1.00 0.00 ? 42  CYS A CB   2  
ATOM 2114  S SG   . CYS A 1 42  ? -7.257  8.232   7.454   1.00 0.00 ? 42  CYS A SG   2  
ATOM 2115  H H    . CYS A 1 42  ? -8.917  10.090  8.708   1.00 0.00 ? 42  CYS A H    2  
ATOM 2116  H HA   . CYS A 1 42  ? -10.689 9.484   6.669   1.00 0.00 ? 42  CYS A HA   2  
ATOM 2117  H HB2  . CYS A 1 42  ? -8.767  8.257   5.626   1.00 0.00 ? 42  CYS A HB2  2  
ATOM 2118  H HB3  . CYS A 1 42  ? -8.375  9.884   6.169   1.00 0.00 ? 42  CYS A HB3  2  
ATOM 2119  H HG   . CYS A 1 42  ? -6.187  8.963   7.181   1.00 0.00 ? 42  CYS A HG   2  
ATOM 2120  N N    . SER A 1 43  ? -10.632 6.765   6.453   1.00 0.00 ? 43  SER A N    2  
ATOM 2121  C CA   . SER A 1 43  ? -11.125 5.397   6.564   1.00 0.00 ? 43  SER A CA   2  
ATOM 2122  C C    . SER A 1 43  ? -9.996  4.394   6.349   1.00 0.00 ? 43  SER A C    2  
ATOM 2123  O O    . SER A 1 43  ? -9.589  3.691   7.275   1.00 0.00 ? 43  SER A O    2  
ATOM 2124  C CB   . SER A 1 43  ? -12.242 5.151   5.548   1.00 0.00 ? 43  SER A CB   2  
ATOM 2125  O OG   . SER A 1 43  ? -13.164 4.188   6.028   1.00 0.00 ? 43  SER A OG   2  
ATOM 2126  H H    . SER A 1 43  ? -10.410 7.123   5.567   1.00 0.00 ? 43  SER A H    2  
ATOM 2127  H HA   . SER A 1 43  ? -11.521 5.267   7.560   1.00 0.00 ? 43  SER A HA   2  
ATOM 2128  H HB2  . SER A 1 43  ? -12.767 6.075   5.364   1.00 0.00 ? 43  SER A HB2  2  
ATOM 2129  H HB3  . SER A 1 43  ? -11.812 4.790   4.625   1.00 0.00 ? 43  SER A HB3  2  
ATOM 2130  H HG   . SER A 1 43  ? -13.260 3.485   5.382   1.00 0.00 ? 43  SER A HG   2  
ATOM 2131  N N    . VAL A 1 44  ? -9.493  4.332   5.120   1.00 0.00 ? 44  VAL A N    2  
ATOM 2132  C CA   . VAL A 1 44  ? -8.410  3.416   4.781   1.00 0.00 ? 44  VAL A CA   2  
ATOM 2133  C C    . VAL A 1 44  ? -7.303  4.133   4.017   1.00 0.00 ? 44  VAL A C    2  
ATOM 2134  O O    . VAL A 1 44  ? -7.546  5.139   3.351   1.00 0.00 ? 44  VAL A O    2  
ATOM 2135  C CB   . VAL A 1 44  ? -8.920  2.233   3.937   1.00 0.00 ? 44  VAL A CB   2  
ATOM 2136  C CG1  . VAL A 1 44  ? -10.111 1.569   4.611   1.00 0.00 ? 44  VAL A CG1  2  
ATOM 2137  C CG2  . VAL A 1 44  ? -9.281  2.696   2.534   1.00 0.00 ? 44  VAL A CG2  2  
ATOM 2138  H H    . VAL A 1 44  ? -9.859  4.917   4.424   1.00 0.00 ? 44  VAL A H    2  
ATOM 2139  H HA   . VAL A 1 44  ? -8.004  3.025   5.703   1.00 0.00 ? 44  VAL A HA   2  
ATOM 2140  H HB   . VAL A 1 44  ? -8.126  1.504   3.860   1.00 0.00 ? 44  VAL A HB   2  
ATOM 2141  H HG11 . VAL A 1 44  ? -9.819  1.214   5.588   1.00 0.00 ? 44  VAL A HG11 2  
ATOM 2142  H HG12 . VAL A 1 44  ? -10.913 2.285   4.712   1.00 0.00 ? 44  VAL A HG12 2  
ATOM 2143  H HG13 . VAL A 1 44  ? -10.445 0.735   4.011   1.00 0.00 ? 44  VAL A HG13 2  
ATOM 2144  H HG21 . VAL A 1 44  ? -10.136 2.139   2.180   1.00 0.00 ? 44  VAL A HG21 2  
ATOM 2145  H HG22 . VAL A 1 44  ? -9.521  3.750   2.553   1.00 0.00 ? 44  VAL A HG22 2  
ATOM 2146  H HG23 . VAL A 1 44  ? -8.444  2.530   1.873   1.00 0.00 ? 44  VAL A HG23 2  
ATOM 2147  N N    . SER A 1 45  ? -6.087  3.607   4.116   1.00 0.00 ? 45  SER A N    2  
ATOM 2148  C CA   . SER A 1 45  ? -4.940  4.198   3.436   1.00 0.00 ? 45  SER A CA   2  
ATOM 2149  C C    . SER A 1 45  ? -4.071  3.119   2.798   1.00 0.00 ? 45  SER A C    2  
ATOM 2150  O O    . SER A 1 45  ? -4.243  1.930   3.066   1.00 0.00 ? 45  SER A O    2  
ATOM 2151  C CB   . SER A 1 45  ? -4.108  5.025   4.419   1.00 0.00 ? 45  SER A CB   2  
ATOM 2152  O OG   . SER A 1 45  ? -4.902  6.013   5.053   1.00 0.00 ? 45  SER A OG   2  
ATOM 2153  H H    . SER A 1 45  ? -5.957  2.803   4.662   1.00 0.00 ? 45  SER A H    2  
ATOM 2154  H HA   . SER A 1 45  ? -5.315  4.848   2.659   1.00 0.00 ? 45  SER A HA   2  
ATOM 2155  H HB2  . SER A 1 45  ? -3.695  4.373   5.173   1.00 0.00 ? 45  SER A HB2  2  
ATOM 2156  H HB3  . SER A 1 45  ? -3.305  5.512   3.885   1.00 0.00 ? 45  SER A HB3  2  
ATOM 2157  H HG   . SER A 1 45  ? -4.391  6.820   5.150   1.00 0.00 ? 45  SER A HG   2  
ATOM 2158  N N    . SER A 1 46  ? -3.137  3.543   1.954   1.00 0.00 ? 46  SER A N    2  
ATOM 2159  C CA   . SER A 1 46  ? -2.242  2.614   1.274   1.00 0.00 ? 46  SER A CA   2  
ATOM 2160  C C    . SER A 1 46  ? -1.781  1.511   2.222   1.00 0.00 ? 46  SER A C    2  
ATOM 2161  O O    . SER A 1 46  ? -1.418  0.418   1.789   1.00 0.00 ? 46  SER A O    2  
ATOM 2162  C CB   . SER A 1 46  ? -1.029  3.358   0.713   1.00 0.00 ? 46  SER A CB   2  
ATOM 2163  O OG   . SER A 1 46  ? -0.181  3.809   1.754   1.00 0.00 ? 46  SER A OG   2  
ATOM 2164  H H    . SER A 1 46  ? -3.049  4.504   1.782   1.00 0.00 ? 46  SER A H    2  
ATOM 2165  H HA   . SER A 1 46  ? -2.788  2.165   0.457   1.00 0.00 ? 46  SER A HA   2  
ATOM 2166  H HB2  . SER A 1 46  ? -0.469  2.697   0.070   1.00 0.00 ? 46  SER A HB2  2  
ATOM 2167  H HB3  . SER A 1 46  ? -1.366  4.213   0.144   1.00 0.00 ? 46  SER A HB3  2  
ATOM 2168  H HG   . SER A 1 46  ? 0.653   3.334   1.717   1.00 0.00 ? 46  SER A HG   2  
ATOM 2169  N N    . GLU A 1 47  ? -1.799  1.807   3.518   1.00 0.00 ? 47  GLU A N    2  
ATOM 2170  C CA   . GLU A 1 47  ? -1.383  0.842   4.528   1.00 0.00 ? 47  GLU A CA   2  
ATOM 2171  C C    . GLU A 1 47  ? -2.517  -0.126  4.855   1.00 0.00 ? 47  GLU A C    2  
ATOM 2172  O O    . GLU A 1 47  ? -2.344  -1.344  4.797   1.00 0.00 ? 47  GLU A O    2  
ATOM 2173  C CB   . GLU A 1 47  ? -0.930  1.563   5.799   1.00 0.00 ? 47  GLU A CB   2  
ATOM 2174  C CG   . GLU A 1 47  ? 0.064   0.768   6.628   1.00 0.00 ? 47  GLU A CG   2  
ATOM 2175  C CD   . GLU A 1 47  ? 0.821   1.632   7.618   1.00 0.00 ? 47  GLU A CD   2  
ATOM 2176  O OE1  . GLU A 1 47  ? 1.277   2.726   7.223   1.00 0.00 ? 47  GLU A OE1  2  
ATOM 2177  O OE2  . GLU A 1 47  ? 0.957   1.216   8.788   1.00 0.00 ? 47  GLU A OE2  2  
ATOM 2178  H H    . GLU A 1 47  ? -2.099  2.696   3.801   1.00 0.00 ? 47  GLU A H    2  
ATOM 2179  H HA   . GLU A 1 47  ? -0.552  0.281   4.128   1.00 0.00 ? 47  GLU A HA   2  
ATOM 2180  H HB2  . GLU A 1 47  ? -0.470  2.500   5.523   1.00 0.00 ? 47  GLU A HB2  2  
ATOM 2181  H HB3  . GLU A 1 47  ? -1.797  1.765   6.412   1.00 0.00 ? 47  GLU A HB3  2  
ATOM 2182  H HG2  . GLU A 1 47  ? -0.470  0.006   7.175   1.00 0.00 ? 47  GLU A HG2  2  
ATOM 2183  H HG3  . GLU A 1 47  ? 0.776   0.301   5.963   1.00 0.00 ? 47  GLU A HG3  2  
ATOM 2184  N N    . ASP A 1 48  ? -3.675  0.425   5.200   1.00 0.00 ? 48  ASP A N    2  
ATOM 2185  C CA   . ASP A 1 48  ? -4.838  -0.389  5.537   1.00 0.00 ? 48  ASP A CA   2  
ATOM 2186  C C    . ASP A 1 48  ? -5.056  -1.483  4.496   1.00 0.00 ? 48  ASP A C    2  
ATOM 2187  O O    . ASP A 1 48  ? -5.187  -2.659  4.836   1.00 0.00 ? 48  ASP A O    2  
ATOM 2188  C CB   . ASP A 1 48  ? -6.087  0.488   5.642   1.00 0.00 ? 48  ASP A CB   2  
ATOM 2189  C CG   . ASP A 1 48  ? -7.255  -0.242  6.275   1.00 0.00 ? 48  ASP A CG   2  
ATOM 2190  O OD1  . ASP A 1 48  ? -7.620  -1.325  5.773   1.00 0.00 ? 48  ASP A OD1  2  
ATOM 2191  O OD2  . ASP A 1 48  ? -7.805  0.271   7.272   1.00 0.00 ? 48  ASP A OD2  2  
ATOM 2192  H H    . ASP A 1 48  ? -3.751  1.402   5.228   1.00 0.00 ? 48  ASP A H    2  
ATOM 2193  H HA   . ASP A 1 48  ? -4.653  -0.852  6.494   1.00 0.00 ? 48  ASP A HA   2  
ATOM 2194  H HB2  . ASP A 1 48  ? -5.860  1.356   6.244   1.00 0.00 ? 48  ASP A HB2  2  
ATOM 2195  H HB3  . ASP A 1 48  ? -6.379  0.808   4.652   1.00 0.00 ? 48  ASP A HB3  2  
ATOM 2196  N N    . ILE A 1 49  ? -5.094  -1.087  3.228   1.00 0.00 ? 49  ILE A N    2  
ATOM 2197  C CA   . ILE A 1 49  ? -5.295  -2.034  2.139   1.00 0.00 ? 49  ILE A CA   2  
ATOM 2198  C C    . ILE A 1 49  ? -4.224  -3.119  2.148   1.00 0.00 ? 49  ILE A C    2  
ATOM 2199  O O    . ILE A 1 49  ? -4.503  -4.278  2.452   1.00 0.00 ? 49  ILE A O    2  
ATOM 2200  C CB   . ILE A 1 49  ? -5.283  -1.328  0.770   1.00 0.00 ? 49  ILE A CB   2  
ATOM 2201  C CG1  . ILE A 1 49  ? -6.403  -0.288  0.699   1.00 0.00 ? 49  ILE A CG1  2  
ATOM 2202  C CG2  . ILE A 1 49  ? -5.427  -2.346  -0.352  1.00 0.00 ? 49  ILE A CG2  2  
ATOM 2203  C CD1  . ILE A 1 49  ? -5.981  1.086   1.170   1.00 0.00 ? 49  ILE A CD1  2  
ATOM 2204  H H    . ILE A 1 49  ? -4.982  -0.136  3.021   1.00 0.00 ? 49  ILE A H    2  
ATOM 2205  H HA   . ILE A 1 49  ? -6.262  -2.497  2.275   1.00 0.00 ? 49  ILE A HA   2  
ATOM 2206  H HB   . ILE A 1 49  ? -4.332  -0.832  0.654   1.00 0.00 ? 49  ILE A HB   2  
ATOM 2207  H HG12 . ILE A 1 49  ? -6.739  -0.198  -0.322  1.00 0.00 ? 49  ILE A HG12 2  
ATOM 2208  H HG13 . ILE A 1 49  ? -7.227  -0.613  1.317   1.00 0.00 ? 49  ILE A HG13 2  
ATOM 2209  H HG21 . ILE A 1 49  ? -5.830  -1.861  -1.229  1.00 0.00 ? 49  ILE A HG21 2  
ATOM 2210  H HG22 . ILE A 1 49  ? -4.458  -2.762  -0.586  1.00 0.00 ? 49  ILE A HG22 2  
ATOM 2211  H HG23 . ILE A 1 49  ? -6.093  -3.136  -0.039  1.00 0.00 ? 49  ILE A HG23 2  
ATOM 2212  H HD11 . ILE A 1 49  ? -6.573  1.837   0.668   1.00 0.00 ? 49  ILE A HD11 2  
ATOM 2213  H HD12 . ILE A 1 49  ? -6.130  1.163   2.237   1.00 0.00 ? 49  ILE A HD12 2  
ATOM 2214  H HD13 . ILE A 1 49  ? -4.936  1.241   0.941   1.00 0.00 ? 49  ILE A HD13 2  
ATOM 2215  N N    . GLU A 1 50  ? -2.996  -2.734  1.814   1.00 0.00 ? 50  GLU A N    2  
ATOM 2216  C CA   . GLU A 1 50  ? -1.882  -3.674  1.785   1.00 0.00 ? 50  GLU A CA   2  
ATOM 2217  C C    . GLU A 1 50  ? -2.012  -4.706  2.902   1.00 0.00 ? 50  GLU A C    2  
ATOM 2218  O O    . GLU A 1 50  ? -1.873  -5.907  2.673   1.00 0.00 ? 50  GLU A O    2  
ATOM 2219  C CB   . GLU A 1 50  ? -0.552  -2.929  1.916   1.00 0.00 ? 50  GLU A CB   2  
ATOM 2220  C CG   . GLU A 1 50  ? 0.661   -3.844  1.921   1.00 0.00 ? 50  GLU A CG   2  
ATOM 2221  C CD   . GLU A 1 50  ? 0.733   -4.710  3.164   1.00 0.00 ? 50  GLU A CD   2  
ATOM 2222  O OE1  . GLU A 1 50  ? 0.204   -4.287  4.214   1.00 0.00 ? 50  GLU A OE1  2  
ATOM 2223  O OE2  . GLU A 1 50  ? 1.318   -5.810  3.086   1.00 0.00 ? 50  GLU A OE2  2  
ATOM 2224  H H    . GLU A 1 50  ? -2.836  -1.795  1.581   1.00 0.00 ? 50  GLU A H    2  
ATOM 2225  H HA   . GLU A 1 50  ? -1.905  -4.186  0.835   1.00 0.00 ? 50  GLU A HA   2  
ATOM 2226  H HB2  . GLU A 1 50  ? -0.456  -2.241  1.089   1.00 0.00 ? 50  GLU A HB2  2  
ATOM 2227  H HB3  . GLU A 1 50  ? -0.558  -2.368  2.839   1.00 0.00 ? 50  GLU A HB3  2  
ATOM 2228  H HG2  . GLU A 1 50  ? 0.614   -4.487  1.056   1.00 0.00 ? 50  GLU A HG2  2  
ATOM 2229  H HG3  . GLU A 1 50  ? 1.553   -3.237  1.870   1.00 0.00 ? 50  GLU A HG3  2  
ATOM 2230  N N    . LYS A 1 51  ? -2.278  -4.227  4.113   1.00 0.00 ? 51  LYS A N    2  
ATOM 2231  C CA   . LYS A 1 51  ? -2.427  -5.105  5.267   1.00 0.00 ? 51  LYS A CA   2  
ATOM 2232  C C    . LYS A 1 51  ? -3.616  -6.045  5.086   1.00 0.00 ? 51  LYS A C    2  
ATOM 2233  O O    . LYS A 1 51  ? -3.533  -7.233  5.398   1.00 0.00 ? 51  LYS A O    2  
ATOM 2234  C CB   . LYS A 1 51  ? -2.607  -4.279  6.543   1.00 0.00 ? 51  LYS A CB   2  
ATOM 2235  C CG   . LYS A 1 51  ? -2.187  -5.011  7.806   1.00 0.00 ? 51  LYS A CG   2  
ATOM 2236  C CD   . LYS A 1 51  ? -2.517  -4.207  9.052   1.00 0.00 ? 51  LYS A CD   2  
ATOM 2237  C CE   . LYS A 1 51  ? -1.842  -4.788  10.285  1.00 0.00 ? 51  LYS A CE   2  
ATOM 2238  N NZ   . LYS A 1 51  ? -0.437  -4.316  10.422  1.00 0.00 ? 51  LYS A NZ   2  
ATOM 2239  H H    . LYS A 1 51  ? -2.377  -3.259  4.233   1.00 0.00 ? 51  LYS A H    2  
ATOM 2240  H HA   . LYS A 1 51  ? -1.528  -5.695  5.354   1.00 0.00 ? 51  LYS A HA   2  
ATOM 2241  H HB2  . LYS A 1 51  ? -2.016  -3.379  6.460   1.00 0.00 ? 51  LYS A HB2  2  
ATOM 2242  H HB3  . LYS A 1 51  ? -3.649  -4.008  6.638   1.00 0.00 ? 51  LYS A HB3  2  
ATOM 2243  H HG2  . LYS A 1 51  ? -2.706  -5.957  7.852   1.00 0.00 ? 51  LYS A HG2  2  
ATOM 2244  H HG3  . LYS A 1 51  ? -1.121  -5.185  7.772   1.00 0.00 ? 51  LYS A HG3  2  
ATOM 2245  H HD2  . LYS A 1 51  ? -2.178  -3.191  8.915   1.00 0.00 ? 51  LYS A HD2  2  
ATOM 2246  H HD3  . LYS A 1 51  ? -3.588  -4.214  9.201   1.00 0.00 ? 51  LYS A HD3  2  
ATOM 2247  H HE2  . LYS A 1 51  ? -2.400  -4.489  11.159  1.00 0.00 ? 51  LYS A HE2  2  
ATOM 2248  H HE3  . LYS A 1 51  ? -1.845  -5.865  10.207  1.00 0.00 ? 51  LYS A HE3  2  
ATOM 2249  H HZ1  . LYS A 1 51  ? -0.255  -4.015  11.401  1.00 0.00 ? 51  LYS A HZ1  2  
ATOM 2250  H HZ2  . LYS A 1 51  ? -0.267  -3.510  9.787   1.00 0.00 ? 51  LYS A HZ2  2  
ATOM 2251  H HZ3  . LYS A 1 51  ? 0.223   -5.082  10.177  1.00 0.00 ? 51  LYS A HZ3  2  
ATOM 2252  N N    . SER A 1 52  ? -4.719  -5.504  4.579   1.00 0.00 ? 52  SER A N    2  
ATOM 2253  C CA   . SER A 1 52  ? -5.925  -6.294  4.359   1.00 0.00 ? 52  SER A CA   2  
ATOM 2254  C C    . SER A 1 52  ? -5.693  -7.353  3.285   1.00 0.00 ? 52  SER A C    2  
ATOM 2255  O O    . SER A 1 52  ? -5.985  -8.532  3.486   1.00 0.00 ? 52  SER A O    2  
ATOM 2256  C CB   . SER A 1 52  ? -7.088  -5.386  3.952   1.00 0.00 ? 52  SER A CB   2  
ATOM 2257  O OG   . SER A 1 52  ? -8.312  -6.099  3.943   1.00 0.00 ? 52  SER A OG   2  
ATOM 2258  H H    . SER A 1 52  ? -4.723  -4.551  4.350   1.00 0.00 ? 52  SER A H    2  
ATOM 2259  H HA   . SER A 1 52  ? -6.173  -6.788  5.287   1.00 0.00 ? 52  SER A HA   2  
ATOM 2260  H HB2  . SER A 1 52  ? -7.166  -4.570  4.654   1.00 0.00 ? 52  SER A HB2  2  
ATOM 2261  H HB3  . SER A 1 52  ? -6.905  -4.994  2.962   1.00 0.00 ? 52  SER A HB3  2  
ATOM 2262  H HG   . SER A 1 52  ? -8.347  -6.686  4.702   1.00 0.00 ? 52  SER A HG   2  
ATOM 2263  N N    . PHE A 1 53  ? -5.164  -6.923  2.144   1.00 0.00 ? 53  PHE A N    2  
ATOM 2264  C CA   . PHE A 1 53  ? -4.893  -7.833  1.037   1.00 0.00 ? 53  PHE A CA   2  
ATOM 2265  C C    . PHE A 1 53  ? -4.066  -9.027  1.505   1.00 0.00 ? 53  PHE A C    2  
ATOM 2266  O O    . PHE A 1 53  ? -4.306  -10.162 1.092   1.00 0.00 ? 53  PHE A O    2  
ATOM 2267  C CB   . PHE A 1 53  ? -4.158  -7.098  -0.086  1.00 0.00 ? 53  PHE A CB   2  
ATOM 2268  C CG   . PHE A 1 53  ? -3.729  -7.997  -1.210  1.00 0.00 ? 53  PHE A CG   2  
ATOM 2269  C CD1  . PHE A 1 53  ? -2.520  -8.673  -1.151  1.00 0.00 ? 53  PHE A CD1  2  
ATOM 2270  C CD2  . PHE A 1 53  ? -4.533  -8.167  -2.325  1.00 0.00 ? 53  PHE A CD2  2  
ATOM 2271  C CE1  . PHE A 1 53  ? -2.123  -9.500  -2.185  1.00 0.00 ? 53  PHE A CE1  2  
ATOM 2272  C CE2  . PHE A 1 53  ? -4.141  -8.993  -3.361  1.00 0.00 ? 53  PHE A CE2  2  
ATOM 2273  C CZ   . PHE A 1 53  ? -2.934  -9.661  -3.291  1.00 0.00 ? 53  PHE A CZ   2  
ATOM 2274  H H    . PHE A 1 53  ? -4.953  -5.971  2.044   1.00 0.00 ? 53  PHE A H    2  
ATOM 2275  H HA   . PHE A 1 53  ? -5.840  -8.190  0.662   1.00 0.00 ? 53  PHE A HA   2  
ATOM 2276  H HB2  . PHE A 1 53  ? -4.808  -6.341  -0.498  1.00 0.00 ? 53  PHE A HB2  2  
ATOM 2277  H HB3  . PHE A 1 53  ? -3.275  -6.627  0.319   1.00 0.00 ? 53  PHE A HB3  2  
ATOM 2278  H HD1  . PHE A 1 53  ? -1.885  -8.548  -0.287  1.00 0.00 ? 53  PHE A HD1  2  
ATOM 2279  H HD2  . PHE A 1 53  ? -5.478  -7.644  -2.381  1.00 0.00 ? 53  PHE A HD2  2  
ATOM 2280  H HE1  . PHE A 1 53  ? -1.179  -10.021 -2.127  1.00 0.00 ? 53  PHE A HE1  2  
ATOM 2281  H HE2  . PHE A 1 53  ? -4.778  -9.117  -4.224  1.00 0.00 ? 53  PHE A HE2  2  
ATOM 2282  H HZ   . PHE A 1 53  ? -2.626  -10.306 -4.099  1.00 0.00 ? 53  PHE A HZ   2  
ATOM 2283  N N    . LYS A 1 54  ? -3.092  -8.763  2.368   1.00 0.00 ? 54  LYS A N    2  
ATOM 2284  C CA   . LYS A 1 54  ? -2.229  -9.814  2.894   1.00 0.00 ? 54  LYS A CA   2  
ATOM 2285  C C    . LYS A 1 54  ? -3.051  -10.906 3.570   1.00 0.00 ? 54  LYS A C    2  
ATOM 2286  O O    . LYS A 1 54  ? -2.871  -12.093 3.297   1.00 0.00 ? 54  LYS A O    2  
ATOM 2287  C CB   . LYS A 1 54  ? -1.224  -9.227  3.888   1.00 0.00 ? 54  LYS A CB   2  
ATOM 2288  C CG   . LYS A 1 54  ? -0.074  -8.487  3.227   1.00 0.00 ? 54  LYS A CG   2  
ATOM 2289  C CD   . LYS A 1 54  ? 1.178   -8.520  4.087   1.00 0.00 ? 54  LYS A CD   2  
ATOM 2290  C CE   . LYS A 1 54  ? 0.958   -7.818  5.418   1.00 0.00 ? 54  LYS A CE   2  
ATOM 2291  N NZ   . LYS A 1 54  ? 2.228   -7.273  5.974   1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2292  H H    . LYS A 1 54  ? -2.950  -7.837  2.659   1.00 0.00 ? 54  LYS A H    2  
ATOM 2293  H HA   . LYS A 1 54  ? -1.690  -10.247 2.064   1.00 0.00 ? 54  LYS A HA   2  
ATOM 2294  H HB2  . LYS A 1 54  ? -1.741  -8.538  4.540   1.00 0.00 ? 54  LYS A HB2  2  
ATOM 2295  H HB3  . LYS A 1 54  ? -0.813  -10.031 4.482   1.00 0.00 ? 54  LYS A HB3  2  
ATOM 2296  H HG2  . LYS A 1 54  ? 0.142   -8.953  2.277   1.00 0.00 ? 54  LYS A HG2  2  
ATOM 2297  H HG3  . LYS A 1 54  ? -0.364  -7.458  3.068   1.00 0.00 ? 54  LYS A HG3  2  
ATOM 2298  H HD2  . LYS A 1 54  ? 1.448   -9.548  4.276   1.00 0.00 ? 54  LYS A HD2  2  
ATOM 2299  H HD3  . LYS A 1 54  ? 1.981   -8.026  3.557   1.00 0.00 ? 54  LYS A HD3  2  
ATOM 2300  H HE2  . LYS A 1 54  ? 0.262   -7.007  5.272   1.00 0.00 ? 54  LYS A HE2  2  
ATOM 2301  H HE3  . LYS A 1 54  ? 0.543   -8.527  6.119   1.00 0.00 ? 54  LYS A HE3  2  
ATOM 2302  H HZ1  . LYS A 1 54  ? 2.962   -7.258  5.238   1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 2303  H HZ2  . LYS A 1 54  ? 2.556   -7.866  6.763   1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 2304  H HZ3  . LYS A 1 54  ? 2.079   -6.304  6.322   1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 2305  N N    . THR A 1 55  ? -3.957  -10.497 4.453   1.00 0.00 ? 55  THR A N    2  
ATOM 2306  C CA   . THR A 1 55  ? -4.808  -11.440 5.167   1.00 0.00 ? 55  THR A CA   2  
ATOM 2307  C C    . THR A 1 55  ? -5.636  -12.277 4.199   1.00 0.00 ? 55  THR A C    2  
ATOM 2308  O O    . THR A 1 55  ? -5.625  -13.505 4.259   1.00 0.00 ? 55  THR A O    2  
ATOM 2309  C CB   . THR A 1 55  ? -5.756  -10.715 6.142   1.00 0.00 ? 55  THR A CB   2  
ATOM 2310  O OG1  . THR A 1 55  ? -4.996  -9.994  7.118   1.00 0.00 ? 55  THR A OG1  2  
ATOM 2311  C CG2  . THR A 1 55  ? -6.677  -11.705 6.838   1.00 0.00 ? 55  THR A CG2  2  
ATOM 2312  H H    . THR A 1 55  ? -4.054  -9.537  4.627   1.00 0.00 ? 55  THR A H    2  
ATOM 2313  H HA   . THR A 1 55  ? -4.170  -12.097 5.741   1.00 0.00 ? 55  THR A HA   2  
ATOM 2314  H HB   . THR A 1 55  ? -6.361  -10.018 5.580   1.00 0.00 ? 55  THR A HB   2  
ATOM 2315  H HG1  . THR A 1 55  ? -5.498  -9.230  7.414   1.00 0.00 ? 55  THR A HG1  2  
ATOM 2316  H HG21 . THR A 1 55  ? -7.202  -11.207 7.640   1.00 0.00 ? 55  THR A HG21 2  
ATOM 2317  H HG22 . THR A 1 55  ? -6.092  -12.518 7.242   1.00 0.00 ? 55  THR A HG22 2  
ATOM 2318  H HG23 . THR A 1 55  ? -7.391  -12.094 6.128   1.00 0.00 ? 55  THR A HG23 2  
ATOM 2319  N N    . ASN A 1 56  ? -6.353  -11.603 3.306   1.00 0.00 ? 56  ASN A N    2  
ATOM 2320  C CA   . ASN A 1 56  ? -7.188  -12.285 2.323   1.00 0.00 ? 56  ASN A CA   2  
ATOM 2321  C C    . ASN A 1 56  ? -6.929  -11.744 0.920   1.00 0.00 ? 56  ASN A C    2  
ATOM 2322  O O    . ASN A 1 56  ? -7.562  -10.788 0.470   1.00 0.00 ? 56  ASN A O    2  
ATOM 2323  C CB   . ASN A 1 56  ? -8.667  -12.124 2.680   1.00 0.00 ? 56  ASN A CB   2  
ATOM 2324  C CG   . ASN A 1 56  ? -9.501  -13.311 2.237   1.00 0.00 ? 56  ASN A CG   2  
ATOM 2325  O OD1  . ASN A 1 56  ? -9.003  -14.433 2.146   1.00 0.00 ? 56  ASN A OD1  2  
ATOM 2326  N ND2  . ASN A 1 56  ? -10.776 -13.067 1.960   1.00 0.00 ? 56  ASN A ND2  2  
ATOM 2327  H H    . ASN A 1 56  ? -6.321  -10.623 3.307   1.00 0.00 ? 56  ASN A H    2  
ATOM 2328  H HA   . ASN A 1 56  ? -6.934  -13.334 2.344   1.00 0.00 ? 56  ASN A HA   2  
ATOM 2329  H HB2  . ASN A 1 56  ? -8.763  -12.020 3.751   1.00 0.00 ? 56  ASN A HB2  2  
ATOM 2330  H HB3  . ASN A 1 56  ? -9.052  -11.237 2.200   1.00 0.00 ? 56  ASN A HB3  2  
ATOM 2331  H HD21 . ASN A 1 56  ? -11.104 -12.148 2.055   1.00 0.00 ? 56  ASN A HD21 2  
ATOM 2332  H HD22 . ASN A 1 56  ? -11.338 -13.817 1.673   1.00 0.00 ? 56  ASN A HD22 2  
ATOM 2333  N N    . PRO A 1 57  ? -5.977  -12.369 0.211   1.00 0.00 ? 57  PRO A N    2  
ATOM 2334  C CA   . PRO A 1 57  ? -5.614  -11.968 -1.151  1.00 0.00 ? 57  PRO A CA   2  
ATOM 2335  C C    . PRO A 1 57  ? -6.712  -12.285 -2.161  1.00 0.00 ? 57  PRO A C    2  
ATOM 2336  O O    . PRO A 1 57  ? -6.573  -12.002 -3.352  1.00 0.00 ? 57  PRO A O    2  
ATOM 2337  C CB   . PRO A 1 57  ? -4.362  -12.800 -1.443  1.00 0.00 ? 57  PRO A CB   2  
ATOM 2338  C CG   . PRO A 1 57  ? -4.484  -13.992 -0.558  1.00 0.00 ? 57  PRO A CG   2  
ATOM 2339  C CD   . PRO A 1 57  ? -5.183  -13.515 0.685   1.00 0.00 ? 57  PRO A CD   2  
ATOM 2340  H HA   . PRO A 1 57  ? -5.370  -10.917 -1.204  1.00 0.00 ? 57  PRO A HA   2  
ATOM 2341  H HB2  . PRO A 1 57  ? -4.350  -13.081 -2.487  1.00 0.00 ? 57  PRO A HB2  2  
ATOM 2342  H HB3  . PRO A 1 57  ? -3.480  -12.223 -1.210  1.00 0.00 ? 57  PRO A HB3  2  
ATOM 2343  H HG2  . PRO A 1 57  ? -5.070  -14.755 -1.048  1.00 0.00 ? 57  PRO A HG2  2  
ATOM 2344  H HG3  . PRO A 1 57  ? -3.502  -14.369 -0.314  1.00 0.00 ? 57  PRO A HG3  2  
ATOM 2345  H HD2  . PRO A 1 57  ? -5.822  -14.290 1.080   1.00 0.00 ? 57  PRO A HD2  2  
ATOM 2346  H HD3  . PRO A 1 57  ? -4.462  -13.203 1.427   1.00 0.00 ? 57  PRO A HD3  2  
ATOM 2347  N N    . CYS A 1 58  ? -7.801  -12.873 -1.679  1.00 0.00 ? 58  CYS A N    2  
ATOM 2348  C CA   . CYS A 1 58  ? -8.923  -13.228 -2.540  1.00 0.00 ? 58  CYS A CA   2  
ATOM 2349  C C    . CYS A 1 58  ? -10.242 -12.753 -1.939  1.00 0.00 ? 58  CYS A C    2  
ATOM 2350  O O    . CYS A 1 58  ? -11.289 -13.362 -2.153  1.00 0.00 ? 58  CYS A O    2  
ATOM 2351  C CB   . CYS A 1 58  ? -8.965  -14.741 -2.760  1.00 0.00 ? 58  CYS A CB   2  
ATOM 2352  S SG   . CYS A 1 58  ? -7.615  -15.376 -3.783  1.00 0.00 ? 58  CYS A SG   2  
ATOM 2353  H H    . CYS A 1 58  ? -7.852  -13.073 -0.721  1.00 0.00 ? 58  CYS A H    2  
ATOM 2354  H HA   . CYS A 1 58  ? -8.778  -12.739 -3.491  1.00 0.00 ? 58  CYS A HA   2  
ATOM 2355  H HB2  . CYS A 1 58  ? -8.912  -15.238 -1.802  1.00 0.00 ? 58  CYS A HB2  2  
ATOM 2356  H HB3  . CYS A 1 58  ? -9.895  -15.002 -3.242  1.00 0.00 ? 58  CYS A HB3  2  
ATOM 2357  H HG   . CYS A 1 58  ? -6.565  -14.589 -3.607  1.00 0.00 ? 58  CYS A HG   2  
ATOM 2358  N N    . GLY A 1 59  ? -10.182 -11.661 -1.183  1.00 0.00 ? 59  GLY A N    2  
ATOM 2359  C CA   . GLY A 1 59  ? -11.378 -11.123 -0.561  1.00 0.00 ? 59  GLY A CA   2  
ATOM 2360  C C    . GLY A 1 59  ? -11.738 -9.748  -1.087  1.00 0.00 ? 59  GLY A C    2  
ATOM 2361  O O    . GLY A 1 59  ? -11.462 -9.427  -2.243  1.00 0.00 ? 59  GLY A O    2  
ATOM 2362  H H    . GLY A 1 59  ? -9.320  -11.216 -1.047  1.00 0.00 ? 59  GLY A H    2  
ATOM 2363  H HA2  . GLY A 1 59  ? -12.202 -11.796 -0.749  1.00 0.00 ? 59  GLY A HA2  2  
ATOM 2364  H HA3  . GLY A 1 59  ? -11.217 -11.057 0.505   1.00 0.00 ? 59  GLY A HA3  2  
ATOM 2365  N N    . SER A 1 60  ? -12.356 -8.934  -0.238  1.00 0.00 ? 60  SER A N    2  
ATOM 2366  C CA   . SER A 1 60  ? -12.759 -7.587  -0.626  1.00 0.00 ? 60  SER A CA   2  
ATOM 2367  C C    . SER A 1 60  ? -12.851 -6.675  0.594   1.00 0.00 ? 60  SER A C    2  
ATOM 2368  O O    . SER A 1 60  ? -13.301 -7.092  1.661   1.00 0.00 ? 60  SER A O    2  
ATOM 2369  C CB   . SER A 1 60  ? -14.106 -7.624  -1.352  1.00 0.00 ? 60  SER A CB   2  
ATOM 2370  O OG   . SER A 1 60  ? -15.041 -8.425  -0.651  1.00 0.00 ? 60  SER A OG   2  
ATOM 2371  H H    . SER A 1 60  ? -12.549 -9.248  0.671   1.00 0.00 ? 60  SER A H    2  
ATOM 2372  H HA   . SER A 1 60  ? -12.009 -7.197  -1.297  1.00 0.00 ? 60  SER A HA   2  
ATOM 2373  H HB2  . SER A 1 60  ? -14.497 -6.621  -1.431  1.00 0.00 ? 60  SER A HB2  2  
ATOM 2374  H HB3  . SER A 1 60  ? -13.967 -8.036  -2.341  1.00 0.00 ? 60  SER A HB3  2  
ATOM 2375  H HG   . SER A 1 60  ? -15.885 -7.969  -0.607  1.00 0.00 ? 60  SER A HG   2  
ATOM 2376  N N    . ILE A 1 61  ? -12.421 -5.429  0.426   1.00 0.00 ? 61  ILE A N    2  
ATOM 2377  C CA   . ILE A 1 61  ? -12.455 -4.457  1.512   1.00 0.00 ? 61  ILE A CA   2  
ATOM 2378  C C    . ILE A 1 61  ? -13.417 -3.316  1.199   1.00 0.00 ? 61  ILE A C    2  
ATOM 2379  O O    . ILE A 1 61  ? -13.164 -2.505  0.308   1.00 0.00 ? 61  ILE A O    2  
ATOM 2380  C CB   . ILE A 1 61  ? -11.057 -3.874  1.789   1.00 0.00 ? 61  ILE A CB   2  
ATOM 2381  C CG1  . ILE A 1 61  ? -11.124 -2.849  2.924   1.00 0.00 ? 61  ILE A CG1  2  
ATOM 2382  C CG2  . ILE A 1 61  ? -10.488 -3.240  0.529   1.00 0.00 ? 61  ILE A CG2  2  
ATOM 2383  C CD1  . ILE A 1 61  ? -9.772  -2.299  3.322   1.00 0.00 ? 61  ILE A CD1  2  
ATOM 2384  H H    . ILE A 1 61  ? -12.073 -5.157  -0.448  1.00 0.00 ? 61  ILE A H    2  
ATOM 2385  H HA   . ILE A 1 61  ? -12.794 -4.966  2.403   1.00 0.00 ? 61  ILE A HA   2  
ATOM 2386  H HB   . ILE A 1 61  ? -10.405 -4.683  2.082   1.00 0.00 ? 61  ILE A HB   2  
ATOM 2387  H HG12 . ILE A 1 61  ? -11.741 -2.020  2.616   1.00 0.00 ? 61  ILE A HG12 2  
ATOM 2388  H HG13 . ILE A 1 61  ? -11.563 -3.316  3.794   1.00 0.00 ? 61  ILE A HG13 2  
ATOM 2389  H HG21 . ILE A 1 61  ? -10.659 -3.895  -0.312  1.00 0.00 ? 61  ILE A HG21 2  
ATOM 2390  H HG22 . ILE A 1 61  ? -10.976 -2.293  0.351   1.00 0.00 ? 61  ILE A HG22 2  
ATOM 2391  H HG23 . ILE A 1 61  ? -9.427  -3.082  0.652   1.00 0.00 ? 61  ILE A HG23 2  
ATOM 2392  H HD11 . ILE A 1 61  ? -9.904  -1.510  4.047   1.00 0.00 ? 61  ILE A HD11 2  
ATOM 2393  H HD12 . ILE A 1 61  ? -9.175  -3.089  3.752   1.00 0.00 ? 61  ILE A HD12 2  
ATOM 2394  H HD13 . ILE A 1 61  ? -9.273  -1.905  2.449   1.00 0.00 ? 61  ILE A HD13 2  
ATOM 2395  N N    . SER A 1 62  ? -14.520 -3.260  1.938   1.00 0.00 ? 62  SER A N    2  
ATOM 2396  C CA   . SER A 1 62  ? -15.522 -2.219  1.738   1.00 0.00 ? 62  SER A CA   2  
ATOM 2397  C C    . SER A 1 62  ? -15.257 -1.027  2.652   1.00 0.00 ? 62  SER A C    2  
ATOM 2398  O O    . SER A 1 62  ? -15.097 -1.182  3.863   1.00 0.00 ? 62  SER A O    2  
ATOM 2399  C CB   . SER A 1 62  ? -16.924 -2.774  1.998   1.00 0.00 ? 62  SER A CB   2  
ATOM 2400  O OG   . SER A 1 62  ? -16.991 -3.420  3.257   1.00 0.00 ? 62  SER A OG   2  
ATOM 2401  H H    . SER A 1 62  ? -14.665 -3.936  2.632   1.00 0.00 ? 62  SER A H    2  
ATOM 2402  H HA   . SER A 1 62  ? -15.459 -1.891  0.711   1.00 0.00 ? 62  SER A HA   2  
ATOM 2403  H HB2  . SER A 1 62  ? -17.637 -1.964  1.983   1.00 0.00 ? 62  SER A HB2  2  
ATOM 2404  H HB3  . SER A 1 62  ? -17.174 -3.488  1.226   1.00 0.00 ? 62  SER A HB3  2  
ATOM 2405  H HG   . SER A 1 62  ? -17.903 -3.647  3.453   1.00 0.00 ? 62  SER A HG   2  
ATOM 2406  N N    . PHE A 1 63  ? -15.211 0.163   2.064   1.00 0.00 ? 63  PHE A N    2  
ATOM 2407  C CA   . PHE A 1 63  ? -14.964 1.383   2.824   1.00 0.00 ? 63  PHE A CA   2  
ATOM 2408  C C    . PHE A 1 63  ? -15.626 2.584   2.154   1.00 0.00 ? 63  PHE A C    2  
ATOM 2409  O O    . PHE A 1 63  ? -15.510 2.777   0.944   1.00 0.00 ? 63  PHE A O    2  
ATOM 2410  C CB   . PHE A 1 63  ? -13.460 1.627   2.963   1.00 0.00 ? 63  PHE A CB   2  
ATOM 2411  C CG   . PHE A 1 63  ? -12.800 2.052   1.682   1.00 0.00 ? 63  PHE A CG   2  
ATOM 2412  C CD1  . PHE A 1 63  ? -12.967 3.338   1.195   1.00 0.00 ? 63  PHE A CD1  2  
ATOM 2413  C CD2  . PHE A 1 63  ? -12.013 1.165   0.966   1.00 0.00 ? 63  PHE A CD2  2  
ATOM 2414  C CE1  . PHE A 1 63  ? -12.362 3.731   0.017   1.00 0.00 ? 63  PHE A CE1  2  
ATOM 2415  C CE2  . PHE A 1 63  ? -11.405 1.553   -0.213  1.00 0.00 ? 63  PHE A CE2  2  
ATOM 2416  C CZ   . PHE A 1 63  ? -11.579 2.838   -0.688  1.00 0.00 ? 63  PHE A CZ   2  
ATOM 2417  H H    . PHE A 1 63  ? -15.346 0.223   1.094   1.00 0.00 ? 63  PHE A H    2  
ATOM 2418  H HA   . PHE A 1 63  ? -15.392 1.253   3.806   1.00 0.00 ? 63  PHE A HA   2  
ATOM 2419  H HB2  . PHE A 1 63  ? -13.295 2.404   3.694   1.00 0.00 ? 63  PHE A HB2  2  
ATOM 2420  H HB3  . PHE A 1 63  ? -12.985 0.717   3.297   1.00 0.00 ? 63  PHE A HB3  2  
ATOM 2421  H HD1  . PHE A 1 63  ? -13.579 4.038   1.746   1.00 0.00 ? 63  PHE A HD1  2  
ATOM 2422  H HD2  . PHE A 1 63  ? -11.876 0.159   1.337   1.00 0.00 ? 63  PHE A HD2  2  
ATOM 2423  H HE1  . PHE A 1 63  ? -12.500 4.737   -0.352  1.00 0.00 ? 63  PHE A HE1  2  
ATOM 2424  H HE2  . PHE A 1 63  ? -10.793 0.852   -0.762  1.00 0.00 ? 63  PHE A HE2  2  
ATOM 2425  H HZ   . PHE A 1 63  ? -11.105 3.143   -1.609  1.00 0.00 ? 63  PHE A HZ   2  
ATOM 2426  N N    . THR A 1 64  ? -16.321 3.390   2.952   1.00 0.00 ? 64  THR A N    2  
ATOM 2427  C CA   . THR A 1 64  ? -17.002 4.571   2.438   1.00 0.00 ? 64  THR A CA   2  
ATOM 2428  C C    . THR A 1 64  ? -16.455 5.843   3.076   1.00 0.00 ? 64  THR A C    2  
ATOM 2429  O O    . THR A 1 64  ? -16.453 5.986   4.299   1.00 0.00 ? 64  THR A O    2  
ATOM 2430  C CB   . THR A 1 64  ? -18.520 4.497   2.688   1.00 0.00 ? 64  THR A CB   2  
ATOM 2431  O OG1  . THR A 1 64  ? -18.788 4.547   4.094   1.00 0.00 ? 64  THR A OG1  2  
ATOM 2432  C CG2  . THR A 1 64  ? -19.104 3.221   2.100   1.00 0.00 ? 64  THR A CG2  2  
ATOM 2433  H H    . THR A 1 64  ? -16.375 3.183   3.908   1.00 0.00 ? 64  THR A H    2  
ATOM 2434  H HA   . THR A 1 64  ? -16.836 4.615   1.371   1.00 0.00 ? 64  THR A HA   2  
ATOM 2435  H HB   . THR A 1 64  ? -18.991 5.344   2.209   1.00 0.00 ? 64  THR A HB   2  
ATOM 2436  H HG1  . THR A 1 64  ? -19.736 4.496   4.241   1.00 0.00 ? 64  THR A HG1  2  
ATOM 2437  H HG21 . THR A 1 64  ? -18.473 2.875   1.294   1.00 0.00 ? 64  THR A HG21 2  
ATOM 2438  H HG22 . THR A 1 64  ? -20.095 3.420   1.722   1.00 0.00 ? 64  THR A HG22 2  
ATOM 2439  H HG23 . THR A 1 64  ? -19.156 2.463   2.867   1.00 0.00 ? 64  THR A HG23 2  
ATOM 2440  N N    . THR A 1 65  ? -15.992 6.767   2.240   1.00 0.00 ? 65  THR A N    2  
ATOM 2441  C CA   . THR A 1 65  ? -15.441 8.027   2.723   1.00 0.00 ? 65  THR A CA   2  
ATOM 2442  C C    . THR A 1 65  ? -16.514 9.109   2.782   1.00 0.00 ? 65  THR A C    2  
ATOM 2443  O O    . THR A 1 65  ? -17.543 9.013   2.114   1.00 0.00 ? 65  THR A O    2  
ATOM 2444  C CB   . THR A 1 65  ? -14.286 8.515   1.829   1.00 0.00 ? 65  THR A CB   2  
ATOM 2445  O OG1  . THR A 1 65  ? -14.769 8.790   0.510   1.00 0.00 ? 65  THR A OG1  2  
ATOM 2446  C CG2  . THR A 1 65  ? -13.177 7.475   1.762   1.00 0.00 ? 65  THR A CG2  2  
ATOM 2447  H H    . THR A 1 65  ? -16.020 6.595   1.276   1.00 0.00 ? 65  THR A H    2  
ATOM 2448  H HA   . THR A 1 65  ? -15.054 7.863   3.718   1.00 0.00 ? 65  THR A HA   2  
ATOM 2449  H HB   . THR A 1 65  ? -13.882 9.424   2.253   1.00 0.00 ? 65  THR A HB   2  
ATOM 2450  H HG1  . THR A 1 65  ? -14.025 8.896   -0.088  1.00 0.00 ? 65  THR A HG1  2  
ATOM 2451  H HG21 . THR A 1 65  ? -12.710 7.509   0.789   1.00 0.00 ? 65  THR A HG21 2  
ATOM 2452  H HG22 . THR A 1 65  ? -13.595 6.493   1.928   1.00 0.00 ? 65  THR A HG22 2  
ATOM 2453  H HG23 . THR A 1 65  ? -12.440 7.686   2.522   1.00 0.00 ? 65  THR A HG23 2  
ATOM 2454  N N    . SER A 1 66  ? -16.266 10.138  3.586   1.00 0.00 ? 66  SER A N    2  
ATOM 2455  C CA   . SER A 1 66  ? -17.213 11.237  3.734   1.00 0.00 ? 66  SER A CA   2  
ATOM 2456  C C    . SER A 1 66  ? -17.576 11.829  2.376   1.00 0.00 ? 66  SER A C    2  
ATOM 2457  O O    . SER A 1 66  ? -18.554 12.567  2.248   1.00 0.00 ? 66  SER A O    2  
ATOM 2458  C CB   . SER A 1 66  ? -16.627 12.325  4.637   1.00 0.00 ? 66  SER A CB   2  
ATOM 2459  O OG   . SER A 1 66  ? -17.616 13.271  5.003   1.00 0.00 ? 66  SER A OG   2  
ATOM 2460  H H    . SER A 1 66  ? -15.427 10.158  4.093   1.00 0.00 ? 66  SER A H    2  
ATOM 2461  H HA   . SER A 1 66  ? -18.108 10.844  4.194   1.00 0.00 ? 66  SER A HA   2  
ATOM 2462  H HB2  . SER A 1 66  ? -16.231 11.872  5.532   1.00 0.00 ? 66  SER A HB2  2  
ATOM 2463  H HB3  . SER A 1 66  ? -15.834 12.836  4.110   1.00 0.00 ? 66  SER A HB3  2  
ATOM 2464  H HG   . SER A 1 66  ? -18.459 12.826  5.119   1.00 0.00 ? 66  SER A HG   2  
ATOM 2465  N N    . LYS A 1 67  ? -16.782 11.500  1.363   1.00 0.00 ? 67  LYS A N    2  
ATOM 2466  C CA   . LYS A 1 67  ? -17.018 11.996  0.012   1.00 0.00 ? 67  LYS A CA   2  
ATOM 2467  C C    . LYS A 1 67  ? -17.918 11.043  -0.768  1.00 0.00 ? 67  LYS A C    2  
ATOM 2468  O O    . LYS A 1 67  ? -18.963 11.441  -1.283  1.00 0.00 ? 67  LYS A O    2  
ATOM 2469  C CB   . LYS A 1 67  ? -15.690 12.178  -0.726  1.00 0.00 ? 67  LYS A CB   2  
ATOM 2470  C CG   . LYS A 1 67  ? -15.732 13.255  -1.796  1.00 0.00 ? 67  LYS A CG   2  
ATOM 2471  C CD   . LYS A 1 67  ? -14.412 13.351  -2.543  1.00 0.00 ? 67  LYS A CD   2  
ATOM 2472  C CE   . LYS A 1 67  ? -14.224 12.179  -3.495  1.00 0.00 ? 67  LYS A CE   2  
ATOM 2473  N NZ   . LYS A 1 67  ? -12.914 12.243  -4.200  1.00 0.00 ? 67  LYS A NZ   2  
ATOM 2474  H H    . LYS A 1 67  ? -16.018 10.907  1.528   1.00 0.00 ? 67  LYS A H    2  
ATOM 2475  H HA   . LYS A 1 67  ? -17.511 12.953  0.092   1.00 0.00 ? 67  LYS A HA   2  
ATOM 2476  H HB2  . LYS A 1 67  ? -14.927 12.443  -0.009  1.00 0.00 ? 67  LYS A HB2  2  
ATOM 2477  H HB3  . LYS A 1 67  ? -15.422 11.243  -1.196  1.00 0.00 ? 67  LYS A HB3  2  
ATOM 2478  H HG2  . LYS A 1 67  ? -16.515 13.019  -2.501  1.00 0.00 ? 67  LYS A HG2  2  
ATOM 2479  H HG3  . LYS A 1 67  ? -15.941 14.207  -1.329  1.00 0.00 ? 67  LYS A HG3  2  
ATOM 2480  H HD2  . LYS A 1 67  ? -14.396 14.268  -3.112  1.00 0.00 ? 67  LYS A HD2  2  
ATOM 2481  H HD3  . LYS A 1 67  ? -13.603 13.355  -1.826  1.00 0.00 ? 67  LYS A HD3  2  
ATOM 2482  H HE2  . LYS A 1 67  ? -14.274 11.261  -2.929  1.00 0.00 ? 67  LYS A HE2  2  
ATOM 2483  H HE3  . LYS A 1 67  ? -15.018 12.196  -4.226  1.00 0.00 ? 67  LYS A HE3  2  
ATOM 2484  H HZ1  . LYS A 1 67  ? -13.010 12.784  -5.083  1.00 0.00 ? 67  LYS A HZ1  2  
ATOM 2485  H HZ2  . LYS A 1 67  ? -12.584 11.284  -4.429  1.00 0.00 ? 67  LYS A HZ2  2  
ATOM 2486  H HZ3  . LYS A 1 67  ? -12.205 12.707  -3.597  1.00 0.00 ? 67  LYS A HZ3  2  
ATOM 2487  N N    . PHE A 1 68  ? -17.507 9.782   -0.850  1.00 0.00 ? 68  PHE A N    2  
ATOM 2488  C CA   . PHE A 1 68  ? -18.277 8.772   -1.567  1.00 0.00 ? 68  PHE A CA   2  
ATOM 2489  C C    . PHE A 1 68  ? -17.902 7.369   -1.098  1.00 0.00 ? 68  PHE A C    2  
ATOM 2490  O O    . PHE A 1 68  ? -17.011 7.198   -0.266  1.00 0.00 ? 68  PHE A O    2  
ATOM 2491  C CB   . PHE A 1 68  ? -18.044 8.897   -3.074  1.00 0.00 ? 68  PHE A CB   2  
ATOM 2492  C CG   . PHE A 1 68  ? -18.680 10.116  -3.679  1.00 0.00 ? 68  PHE A CG   2  
ATOM 2493  C CD1  . PHE A 1 68  ? -20.059 10.238  -3.736  1.00 0.00 ? 68  PHE A CD1  2  
ATOM 2494  C CD2  . PHE A 1 68  ? -17.899 11.140  -4.191  1.00 0.00 ? 68  PHE A CD2  2  
ATOM 2495  C CE1  . PHE A 1 68  ? -20.647 11.358  -4.293  1.00 0.00 ? 68  PHE A CE1  2  
ATOM 2496  C CE2  . PHE A 1 68  ? -18.482 12.262  -4.749  1.00 0.00 ? 68  PHE A CE2  2  
ATOM 2497  C CZ   . PHE A 1 68  ? -19.857 12.372  -4.799  1.00 0.00 ? 68  PHE A CZ   2  
ATOM 2498  H H    . PHE A 1 68  ? -16.665 9.525   -0.419  1.00 0.00 ? 68  PHE A H    2  
ATOM 2499  H HA   . PHE A 1 68  ? -19.321 8.942   -1.357  1.00 0.00 ? 68  PHE A HA   2  
ATOM 2500  H HB2  . PHE A 1 68  ? -16.983 8.949   -3.264  1.00 0.00 ? 68  PHE A HB2  2  
ATOM 2501  H HB3  . PHE A 1 68  ? -18.453 8.028   -3.567  1.00 0.00 ? 68  PHE A HB3  2  
ATOM 2502  H HD1  . PHE A 1 68  ? -20.678 9.447   -3.339  1.00 0.00 ? 68  PHE A HD1  2  
ATOM 2503  H HD2  . PHE A 1 68  ? -16.822 11.055  -4.152  1.00 0.00 ? 68  PHE A HD2  2  
ATOM 2504  H HE1  . PHE A 1 68  ? -21.723 11.441  -4.331  1.00 0.00 ? 68  PHE A HE1  2  
ATOM 2505  H HE2  . PHE A 1 68  ? -17.861 13.053  -5.143  1.00 0.00 ? 68  PHE A HE2  2  
ATOM 2506  H HZ   . PHE A 1 68  ? -20.314 13.248  -5.235  1.00 0.00 ? 68  PHE A HZ   2  
ATOM 2507  N N    . SER A 1 69  ? -18.590 6.368   -1.639  1.00 0.00 ? 69  SER A N    2  
ATOM 2508  C CA   . SER A 1 69  ? -18.334 4.979   -1.273  1.00 0.00 ? 69  SER A CA   2  
ATOM 2509  C C    . SER A 1 69  ? -17.374 4.326   -2.263  1.00 0.00 ? 69  SER A C    2  
ATOM 2510  O O    . SER A 1 69  ? -17.315 4.708   -3.432  1.00 0.00 ? 69  SER A O    2  
ATOM 2511  C CB   . SER A 1 69  ? -19.645 4.193   -1.221  1.00 0.00 ? 69  SER A CB   2  
ATOM 2512  O OG   . SER A 1 69  ? -20.592 4.720   -2.134  1.00 0.00 ? 69  SER A OG   2  
ATOM 2513  H H    . SER A 1 69  ? -19.288 6.568   -2.297  1.00 0.00 ? 69  SER A H    2  
ATOM 2514  H HA   . SER A 1 69  ? -17.881 4.973   -0.293  1.00 0.00 ? 69  SER A HA   2  
ATOM 2515  H HB2  . SER A 1 69  ? -19.454 3.162   -1.476  1.00 0.00 ? 69  SER A HB2  2  
ATOM 2516  H HB3  . SER A 1 69  ? -20.055 4.248   -0.223  1.00 0.00 ? 69  SER A HB3  2  
ATOM 2517  H HG   . SER A 1 69  ? -20.988 5.512   -1.763  1.00 0.00 ? 69  SER A HG   2  
ATOM 2518  N N    . TYR A 1 70  ? -16.626 3.337   -1.786  1.00 0.00 ? 70  TYR A N    2  
ATOM 2519  C CA   . TYR A 1 70  ? -15.667 2.631   -2.627  1.00 0.00 ? 70  TYR A CA   2  
ATOM 2520  C C    . TYR A 1 70  ? -15.429 1.215   -2.112  1.00 0.00 ? 70  TYR A C    2  
ATOM 2521  O O    . TYR A 1 70  ? -15.358 0.984   -0.905  1.00 0.00 ? 70  TYR A O    2  
ATOM 2522  C CB   . TYR A 1 70  ? -14.343 3.395   -2.680  1.00 0.00 ? 70  TYR A CB   2  
ATOM 2523  C CG   . TYR A 1 70  ? -14.451 4.749   -3.344  1.00 0.00 ? 70  TYR A CG   2  
ATOM 2524  C CD1  . TYR A 1 70  ? -14.963 4.875   -4.630  1.00 0.00 ? 70  TYR A CD1  2  
ATOM 2525  C CD2  . TYR A 1 70  ? -14.042 5.902   -2.686  1.00 0.00 ? 70  TYR A CD2  2  
ATOM 2526  C CE1  . TYR A 1 70  ? -15.063 6.111   -5.240  1.00 0.00 ? 70  TYR A CE1  2  
ATOM 2527  C CE2  . TYR A 1 70  ? -14.140 7.142   -3.288  1.00 0.00 ? 70  TYR A CE2  2  
ATOM 2528  C CZ   . TYR A 1 70  ? -14.650 7.240   -4.566  1.00 0.00 ? 70  TYR A CZ   2  
ATOM 2529  O OH   . TYR A 1 70  ? -14.749 8.473   -5.170  1.00 0.00 ? 70  TYR A OH   2  
ATOM 2530  H H    . TYR A 1 70  ? -16.718 3.078   -0.846  1.00 0.00 ? 70  TYR A H    2  
ATOM 2531  H HA   . TYR A 1 70  ? -16.078 2.575   -3.625  1.00 0.00 ? 70  TYR A HA   2  
ATOM 2532  H HB2  . TYR A 1 70  ? -13.983 3.548   -1.674  1.00 0.00 ? 70  TYR A HB2  2  
ATOM 2533  H HB3  . TYR A 1 70  ? -13.620 2.812   -3.232  1.00 0.00 ? 70  TYR A HB3  2  
ATOM 2534  H HD1  . TYR A 1 70  ? -15.285 3.988   -5.155  1.00 0.00 ? 70  TYR A HD1  2  
ATOM 2535  H HD2  . TYR A 1 70  ? -13.643 5.822   -1.685  1.00 0.00 ? 70  TYR A HD2  2  
ATOM 2536  H HE1  . TYR A 1 70  ? -15.463 6.188   -6.241  1.00 0.00 ? 70  TYR A HE1  2  
ATOM 2537  H HE2  . TYR A 1 70  ? -13.817 8.027   -2.760  1.00 0.00 ? 70  TYR A HE2  2  
ATOM 2538  H HH   . TYR A 1 70  ? -14.002 9.017   -4.912  1.00 0.00 ? 70  TYR A HH   2  
ATOM 2539  N N    . LYS A 1 71  ? -15.308 0.268   -3.036  1.00 0.00 ? 71  LYS A N    2  
ATOM 2540  C CA   . LYS A 1 71  ? -15.076 -1.126  -2.679  1.00 0.00 ? 71  LYS A CA   2  
ATOM 2541  C C    . LYS A 1 71  ? -13.907 -1.704  -3.469  1.00 0.00 ? 71  LYS A C    2  
ATOM 2542  O O    . LYS A 1 71  ? -13.904 -1.676  -4.700  1.00 0.00 ? 71  LYS A O    2  
ATOM 2543  C CB   . LYS A 1 71  ? -16.337 -1.955  -2.934  1.00 0.00 ? 71  LYS A CB   2  
ATOM 2544  C CG   . LYS A 1 71  ? -16.090 -3.454  -2.930  1.00 0.00 ? 71  LYS A CG   2  
ATOM 2545  C CD   . LYS A 1 71  ? -17.377 -4.232  -3.149  1.00 0.00 ? 71  LYS A CD   2  
ATOM 2546  C CE   . LYS A 1 71  ? -17.280 -5.640  -2.583  1.00 0.00 ? 71  LYS A CE   2  
ATOM 2547  N NZ   . LYS A 1 71  ? -16.695 -6.593  -3.567  1.00 0.00 ? 71  LYS A NZ   2  
ATOM 2548  H H    . LYS A 1 71  ? -15.374 0.514   -3.983  1.00 0.00 ? 71  LYS A H    2  
ATOM 2549  H HA   . LYS A 1 71  ? -14.838 -1.164  -1.627  1.00 0.00 ? 71  LYS A HA   2  
ATOM 2550  H HB2  . LYS A 1 71  ? -17.063 -1.729  -2.167  1.00 0.00 ? 71  LYS A HB2  2  
ATOM 2551  H HB3  . LYS A 1 71  ? -16.745 -1.681  -3.896  1.00 0.00 ? 71  LYS A HB3  2  
ATOM 2552  H HG2  . LYS A 1 71  ? -15.397 -3.697  -3.722  1.00 0.00 ? 71  LYS A HG2  2  
ATOM 2553  H HG3  . LYS A 1 71  ? -15.666 -3.738  -1.978  1.00 0.00 ? 71  LYS A HG3  2  
ATOM 2554  H HD2  . LYS A 1 71  ? -18.188 -3.714  -2.657  1.00 0.00 ? 71  LYS A HD2  2  
ATOM 2555  H HD3  . LYS A 1 71  ? -17.576 -4.291  -4.209  1.00 0.00 ? 71  LYS A HD3  2  
ATOM 2556  H HE2  . LYS A 1 71  ? -16.657 -5.618  -1.702  1.00 0.00 ? 71  LYS A HE2  2  
ATOM 2557  H HE3  . LYS A 1 71  ? -18.271 -5.976  -2.315  1.00 0.00 ? 71  LYS A HE3  2  
ATOM 2558  H HZ1  . LYS A 1 71  ? -16.478 -6.100  -4.456  1.00 0.00 ? 71  LYS A HZ1  2  
ATOM 2559  H HZ2  . LYS A 1 71  ? -17.369 -7.360  -3.765  1.00 0.00 ? 71  LYS A HZ2  2  
ATOM 2560  H HZ3  . LYS A 1 71  ? -15.819 -7.005  -3.188  1.00 0.00 ? 71  LYS A HZ3  2  
ATOM 2561  N N    . ILE A 1 72  ? -12.916 -2.227  -2.755  1.00 0.00 ? 72  ILE A N    2  
ATOM 2562  C CA   . ILE A 1 72  ? -11.743 -2.813  -3.390  1.00 0.00 ? 72  ILE A CA   2  
ATOM 2563  C C    . ILE A 1 72  ? -11.737 -4.331  -3.240  1.00 0.00 ? 72  ILE A C    2  
ATOM 2564  O O    . ILE A 1 72  ? -11.443 -4.858  -2.167  1.00 0.00 ? 72  ILE A O    2  
ATOM 2565  C CB   . ILE A 1 72  ? -10.439 -2.245  -2.799  1.00 0.00 ? 72  ILE A CB   2  
ATOM 2566  C CG1  . ILE A 1 72  ? -10.393 -0.726  -2.975  1.00 0.00 ? 72  ILE A CG1  2  
ATOM 2567  C CG2  . ILE A 1 72  ? -9.232  -2.897  -3.456  1.00 0.00 ? 72  ILE A CG2  2  
ATOM 2568  C CD1  . ILE A 1 72  ? -9.117  -0.097  -2.463  1.00 0.00 ? 72  ILE A CD1  2  
ATOM 2569  H H    . ILE A 1 72  ? -12.976 -2.219  -1.777  1.00 0.00 ? 72  ILE A H    2  
ATOM 2570  H HA   . ILE A 1 72  ? -11.776 -2.566  -4.442  1.00 0.00 ? 72  ILE A HA   2  
ATOM 2571  H HB   . ILE A 1 72  ? -10.416 -2.479  -1.746  1.00 0.00 ? 72  ILE A HB   2  
ATOM 2572  H HG12 . ILE A 1 72  ? -10.482 -0.489  -4.024  1.00 0.00 ? 72  ILE A HG12 2  
ATOM 2573  H HG13 . ILE A 1 72  ? -11.220 -0.284  -2.439  1.00 0.00 ? 72  ILE A HG13 2  
ATOM 2574  H HG21 . ILE A 1 72  ? -8.997  -2.378  -4.373  1.00 0.00 ? 72  ILE A HG21 2  
ATOM 2575  H HG22 . ILE A 1 72  ? -8.386  -2.844  -2.787  1.00 0.00 ? 72  ILE A HG22 2  
ATOM 2576  H HG23 . ILE A 1 72  ? -9.454  -3.931  -3.674  1.00 0.00 ? 72  ILE A HG23 2  
ATOM 2577  H HD11 . ILE A 1 72  ? -8.789  -0.618  -1.576  1.00 0.00 ? 72  ILE A HD11 2  
ATOM 2578  H HD12 . ILE A 1 72  ? -8.352  -0.161  -3.223  1.00 0.00 ? 72  ILE A HD12 2  
ATOM 2579  H HD13 . ILE A 1 72  ? -9.298  0.941   -2.223  1.00 0.00 ? 72  ILE A HD13 2  
ATOM 2580  N N    . ASP A 1 73  ? -12.062 -5.028  -4.323  1.00 0.00 ? 73  ASP A N    2  
ATOM 2581  C CA   . ASP A 1 73  ? -12.091 -6.486  -4.314  1.00 0.00 ? 73  ASP A CA   2  
ATOM 2582  C C    . ASP A 1 73  ? -10.724 -7.059  -4.671  1.00 0.00 ? 73  ASP A C    2  
ATOM 2583  O O    . ASP A 1 73  ? -10.364 -7.148  -5.846  1.00 0.00 ? 73  ASP A O    2  
ATOM 2584  C CB   . ASP A 1 73  ? -13.147 -7.002  -5.293  1.00 0.00 ? 73  ASP A CB   2  
ATOM 2585  C CG   . ASP A 1 73  ? -13.355 -6.065  -6.466  1.00 0.00 ? 73  ASP A CG   2  
ATOM 2586  O OD1  . ASP A 1 73  ? -12.391 -5.845  -7.228  1.00 0.00 ? 73  ASP A OD1  2  
ATOM 2587  O OD2  . ASP A 1 73  ? -14.483 -5.551  -6.623  1.00 0.00 ? 73  ASP A OD2  2  
ATOM 2588  H H    . ASP A 1 73  ? -12.286 -4.550  -5.150  1.00 0.00 ? 73  ASP A H    2  
ATOM 2589  H HA   . ASP A 1 73  ? -12.352 -6.806  -3.316  1.00 0.00 ? 73  ASP A HA   2  
ATOM 2590  H HB2  . ASP A 1 73  ? -12.834 -7.963  -5.675  1.00 0.00 ? 73  ASP A HB2  2  
ATOM 2591  H HB3  . ASP A 1 73  ? -14.086 -7.115  -4.773  1.00 0.00 ? 73  ASP A HB3  2  
ATOM 2592  N N    . PHE A 1 74  ? -9.965  -7.446  -3.651  1.00 0.00 ? 74  PHE A N    2  
ATOM 2593  C CA   . PHE A 1 74  ? -8.636  -8.009  -3.858  1.00 0.00 ? 74  PHE A CA   2  
ATOM 2594  C C    . PHE A 1 74  ? -8.686  -9.177  -4.838  1.00 0.00 ? 74  PHE A C    2  
ATOM 2595  O O    . PHE A 1 74  ? -7.856  -9.280  -5.741  1.00 0.00 ? 74  PHE A O    2  
ATOM 2596  C CB   . PHE A 1 74  ? -8.042  -8.473  -2.526  1.00 0.00 ? 74  PHE A CB   2  
ATOM 2597  C CG   . PHE A 1 74  ? -7.961  -7.383  -1.495  1.00 0.00 ? 74  PHE A CG   2  
ATOM 2598  C CD1  . PHE A 1 74  ? -7.696  -6.076  -1.869  1.00 0.00 ? 74  PHE A CD1  2  
ATOM 2599  C CD2  . PHE A 1 74  ? -8.150  -7.667  -0.152  1.00 0.00 ? 74  PHE A CD2  2  
ATOM 2600  C CE1  . PHE A 1 74  ? -7.619  -5.072  -0.922  1.00 0.00 ? 74  PHE A CE1  2  
ATOM 2601  C CE2  . PHE A 1 74  ? -8.076  -6.667  0.800   1.00 0.00 ? 74  PHE A CE2  2  
ATOM 2602  C CZ   . PHE A 1 74  ? -7.811  -5.368  0.414   1.00 0.00 ? 74  PHE A CZ   2  
ATOM 2603  H H    . PHE A 1 74  ? -10.307 -7.350  -2.738  1.00 0.00 ? 74  PHE A H    2  
ATOM 2604  H HA   . PHE A 1 74  ? -8.009  -7.235  -4.271  1.00 0.00 ? 74  PHE A HA   2  
ATOM 2605  H HB2  . PHE A 1 74  ? -8.655  -9.265  -2.123  1.00 0.00 ? 74  PHE A HB2  2  
ATOM 2606  H HB3  . PHE A 1 74  ? -7.044  -8.846  -2.695  1.00 0.00 ? 74  PHE A HB3  2  
ATOM 2607  H HD1  . PHE A 1 74  ? -7.547  -5.843  -2.913  1.00 0.00 ? 74  PHE A HD1  2  
ATOM 2608  H HD2  . PHE A 1 74  ? -8.358  -8.684  0.151   1.00 0.00 ? 74  PHE A HD2  2  
ATOM 2609  H HE1  . PHE A 1 74  ? -7.413  -4.057  -1.226  1.00 0.00 ? 74  PHE A HE1  2  
ATOM 2610  H HE2  . PHE A 1 74  ? -8.226  -6.902  1.843   1.00 0.00 ? 74  PHE A HE2  2  
ATOM 2611  H HZ   . PHE A 1 74  ? -7.751  -4.585  1.155   1.00 0.00 ? 74  PHE A HZ   2  
ATOM 2612  N N    . ALA A 1 75  ? -9.666  -10.056 -4.653  1.00 0.00 ? 75  ALA A N    2  
ATOM 2613  C CA   . ALA A 1 75  ? -9.826  -11.216 -5.522  1.00 0.00 ? 75  ALA A CA   2  
ATOM 2614  C C    . ALA A 1 75  ? -10.026 -10.792 -6.973  1.00 0.00 ? 75  ALA A C    2  
ATOM 2615  O O    . ALA A 1 75  ? -9.416  -11.353 -7.882  1.00 0.00 ? 75  ALA A O    2  
ATOM 2616  C CB   . ALA A 1 75  ? -10.996 -12.068 -5.053  1.00 0.00 ? 75  ALA A CB   2  
ATOM 2617  H H    . ALA A 1 75  ? -10.297 -9.920  -3.916  1.00 0.00 ? 75  ALA A H    2  
ATOM 2618  H HA   . ALA A 1 75  ? -8.928  -11.812 -5.452  1.00 0.00 ? 75  ALA A HA   2  
ATOM 2619  H HB1  . ALA A 1 75  ? -11.170 -11.893 -4.001  1.00 0.00 ? 75  ALA A HB1  2  
ATOM 2620  H HB2  . ALA A 1 75  ? -11.881 -11.804 -5.613  1.00 0.00 ? 75  ALA A HB2  2  
ATOM 2621  H HB3  . ALA A 1 75  ? -10.768 -13.111 -5.212  1.00 0.00 ? 75  ALA A HB3  2  
ATOM 2622  N N    . GLU A 1 76  ? -10.885 -9.799  -7.182  1.00 0.00 ? 76  GLU A N    2  
ATOM 2623  C CA   . GLU A 1 76  ? -11.165 -9.302  -8.523  1.00 0.00 ? 76  GLU A CA   2  
ATOM 2624  C C    . GLU A 1 76  ? -10.071 -8.346  -8.989  1.00 0.00 ? 76  GLU A C    2  
ATOM 2625  O O    . GLU A 1 76  ? -10.061 -7.911  -10.140 1.00 0.00 ? 76  GLU A O    2  
ATOM 2626  C CB   . GLU A 1 76  ? -12.523 -8.596  -8.557  1.00 0.00 ? 76  GLU A CB   2  
ATOM 2627  C CG   . GLU A 1 76  ? -13.703 -9.550  -8.625  1.00 0.00 ? 76  GLU A CG   2  
ATOM 2628  C CD   . GLU A 1 76  ? -14.936 -8.909  -9.232  1.00 0.00 ? 76  GLU A CD   2  
ATOM 2629  O OE1  . GLU A 1 76  ? -15.310 -7.803  -8.790  1.00 0.00 ? 76  GLU A OE1  2  
ATOM 2630  O OE2  . GLU A 1 76  ? -15.528 -9.515  -10.151 1.00 0.00 ? 76  GLU A OE2  2  
ATOM 2631  H H    . GLU A 1 76  ? -11.341 -9.392  -6.416  1.00 0.00 ? 76  GLU A H    2  
ATOM 2632  H HA   . GLU A 1 76  ? -11.194 -10.149 -9.192  1.00 0.00 ? 76  GLU A HA   2  
ATOM 2633  H HB2  . GLU A 1 76  ? -12.624 -7.994  -7.666  1.00 0.00 ? 76  GLU A HB2  2  
ATOM 2634  H HB3  . GLU A 1 76  ? -12.558 -7.951  -9.422  1.00 0.00 ? 76  GLU A HB3  2  
ATOM 2635  H HG2  . GLU A 1 76  ? -13.426 -10.402 -9.227  1.00 0.00 ? 76  GLU A HG2  2  
ATOM 2636  H HG3  . GLU A 1 76  ? -13.942 -9.879  -7.625  1.00 0.00 ? 76  GLU A HG3  2  
ATOM 2637  N N    . MET A 1 77  ? -9.152  -8.022  -8.085  1.00 0.00 ? 77  MET A N    2  
ATOM 2638  C CA   . MET A 1 77  ? -8.053  -7.118  -8.403  1.00 0.00 ? 77  MET A CA   2  
ATOM 2639  C C    . MET A 1 77  ? -8.568  -5.855  -9.086  1.00 0.00 ? 77  MET A C    2  
ATOM 2640  O O    . MET A 1 77  ? -8.081  -5.470  -10.150 1.00 0.00 ? 77  MET A O    2  
ATOM 2641  C CB   . MET A 1 77  ? -7.032  -7.819  -9.302  1.00 0.00 ? 77  MET A CB   2  
ATOM 2642  C CG   . MET A 1 77  ? -5.936  -8.538  -8.533  1.00 0.00 ? 77  MET A CG   2  
ATOM 2643  S SD   . MET A 1 77  ? -4.510  -7.485  -8.207  1.00 0.00 ? 77  MET A SD   2  
ATOM 2644  C CE   . MET A 1 77  ? -5.081  -6.573  -6.776  1.00 0.00 ? 77  MET A CE   2  
ATOM 2645  H H    . MET A 1 77  ? -9.213  -8.401  -7.183  1.00 0.00 ? 77  MET A H    2  
ATOM 2646  H HA   . MET A 1 77  ? -7.573  -6.842  -7.477  1.00 0.00 ? 77  MET A HA   2  
ATOM 2647  H HB2  . MET A 1 77  ? -7.547  -8.543  -9.915  1.00 0.00 ? 77  MET A HB2  2  
ATOM 2648  H HB3  . MET A 1 77  ? -6.568  -7.083  -9.942  1.00 0.00 ? 77  MET A HB3  2  
ATOM 2649  H HG2  . MET A 1 77  ? -6.339  -8.875  -7.589  1.00 0.00 ? 77  MET A HG2  2  
ATOM 2650  H HG3  . MET A 1 77  ? -5.613  -9.392  -9.109  1.00 0.00 ? 77  MET A HG3  2  
ATOM 2651  H HE1  . MET A 1 77  ? -5.936  -7.075  -6.347  1.00 0.00 ? 77  MET A HE1  2  
ATOM 2652  H HE2  . MET A 1 77  ? -4.289  -6.521  -6.043  1.00 0.00 ? 77  MET A HE2  2  
ATOM 2653  H HE3  . MET A 1 77  ? -5.362  -5.574  -7.075  1.00 0.00 ? 77  MET A HE3  2  
ATOM 2654  N N    . LYS A 1 78  ? -9.555  -5.215  -8.469  1.00 0.00 ? 78  LYS A N    2  
ATOM 2655  C CA   . LYS A 1 78  ? -10.136 -3.995  -9.017  1.00 0.00 ? 78  LYS A CA   2  
ATOM 2656  C C    . LYS A 1 78  ? -10.898 -3.226  -7.942  1.00 0.00 ? 78  LYS A C    2  
ATOM 2657  O O    . LYS A 1 78  ? -11.228 -3.774  -6.891  1.00 0.00 ? 78  LYS A O    2  
ATOM 2658  C CB   . LYS A 1 78  ? -11.072 -4.329  -10.181 1.00 0.00 ? 78  LYS A CB   2  
ATOM 2659  C CG   . LYS A 1 78  ? -12.409 -4.898  -9.741  1.00 0.00 ? 78  LYS A CG   2  
ATOM 2660  C CD   . LYS A 1 78  ? -13.470 -4.722  -10.815 1.00 0.00 ? 78  LYS A CD   2  
ATOM 2661  C CE   . LYS A 1 78  ? -13.415 -5.843  -11.842 1.00 0.00 ? 78  LYS A CE   2  
ATOM 2662  N NZ   . LYS A 1 78  ? -13.998 -7.108  -11.315 1.00 0.00 ? 78  LYS A NZ   2  
ATOM 2663  H H    . LYS A 1 78  ? -9.901  -5.571  -7.624  1.00 0.00 ? 78  LYS A H    2  
ATOM 2664  H HA   . LYS A 1 78  ? -9.329  -3.377  -9.381  1.00 0.00 ? 78  LYS A HA   2  
ATOM 2665  H HB2  . LYS A 1 78  ? -11.256 -3.429  -10.748 1.00 0.00 ? 78  LYS A HB2  2  
ATOM 2666  H HB3  . LYS A 1 78  ? -10.588 -5.054  -10.819 1.00 0.00 ? 78  LYS A HB3  2  
ATOM 2667  H HG2  . LYS A 1 78  ? -12.292 -5.952  -9.536  1.00 0.00 ? 78  LYS A HG2  2  
ATOM 2668  H HG3  . LYS A 1 78  ? -12.730 -4.388  -8.844  1.00 0.00 ? 78  LYS A HG3  2  
ATOM 2669  H HD2  . LYS A 1 78  ? -14.445 -4.724  -10.350 1.00 0.00 ? 78  LYS A HD2  2  
ATOM 2670  H HD3  . LYS A 1 78  ? -13.309 -3.778  -11.316 1.00 0.00 ? 78  LYS A HD3  2  
ATOM 2671  H HE2  . LYS A 1 78  ? -13.968 -5.539  -12.717 1.00 0.00 ? 78  LYS A HE2  2  
ATOM 2672  H HE3  . LYS A 1 78  ? -12.383 -6.017  -12.110 1.00 0.00 ? 78  LYS A HE3  2  
ATOM 2673  H HZ1  . LYS A 1 78  ? -14.781 -7.421  -11.924 1.00 0.00 ? 78  LYS A HZ1  2  
ATOM 2674  H HZ2  . LYS A 1 78  ? -14.362 -6.959  -10.352 1.00 0.00 ? 78  LYS A HZ2  2  
ATOM 2675  H HZ3  . LYS A 1 78  ? -13.273 -7.853  -11.289 1.00 0.00 ? 78  LYS A HZ3  2  
ATOM 2676  N N    . GLN A 1 79  ? -11.174 -1.954  -8.215  1.00 0.00 ? 79  GLN A N    2  
ATOM 2677  C CA   . GLN A 1 79  ? -11.898 -1.111  -7.271  1.00 0.00 ? 79  GLN A CA   2  
ATOM 2678  C C    . GLN A 1 79  ? -13.324 -0.858  -7.750  1.00 0.00 ? 79  GLN A C    2  
ATOM 2679  O O    . GLN A 1 79  ? -13.552 -0.055  -8.653  1.00 0.00 ? 79  GLN A O    2  
ATOM 2680  C CB   . GLN A 1 79  ? -11.168 0.219   -7.079  1.00 0.00 ? 79  GLN A CB   2  
ATOM 2681  C CG   . GLN A 1 79  ? -11.767 1.090   -5.987  1.00 0.00 ? 79  GLN A CG   2  
ATOM 2682  C CD   . GLN A 1 79  ? -10.821 2.180   -5.524  1.00 0.00 ? 79  GLN A CD   2  
ATOM 2683  O OE1  . GLN A 1 79  ? -9.601  2.046   -5.632  1.00 0.00 ? 79  GLN A OE1  2  
ATOM 2684  N NE2  . GLN A 1 79  ? -11.378 3.267   -5.005  1.00 0.00 ? 79  GLN A NE2  2  
ATOM 2685  H H    . GLN A 1 79  ? -10.884 -1.575  -9.070  1.00 0.00 ? 79  GLN A H    2  
ATOM 2686  H HA   . GLN A 1 79  ? -11.936 -1.630  -6.325  1.00 0.00 ? 79  GLN A HA   2  
ATOM 2687  H HB2  . GLN A 1 79  ? -10.138 0.018   -6.826  1.00 0.00 ? 79  GLN A HB2  2  
ATOM 2688  H HB3  . GLN A 1 79  ? -11.201 0.771   -8.007  1.00 0.00 ? 79  GLN A HB3  2  
ATOM 2689  H HG2  . GLN A 1 79  ? -12.667 1.553   -6.365  1.00 0.00 ? 79  GLN A HG2  2  
ATOM 2690  H HG3  . GLN A 1 79  ? -12.014 0.465   -5.141  1.00 0.00 ? 79  GLN A HG3  2  
ATOM 2691  H HE21 . GLN A 1 79  ? -12.356 3.304   -4.949  1.00 0.00 ? 79  GLN A HE21 2  
ATOM 2692  H HE22 . GLN A 1 79  ? -10.790 3.987   -4.697  1.00 0.00 ? 79  GLN A HE22 2  
ATOM 2693  N N    . MET A 1 80  ? -14.280 -1.550  -7.138  1.00 0.00 ? 80  MET A N    2  
ATOM 2694  C CA   . MET A 1 80  ? -15.684 -1.399  -7.502  1.00 0.00 ? 80  MET A CA   2  
ATOM 2695  C C    . MET A 1 80  ? -16.276 -0.142  -6.873  1.00 0.00 ? 80  MET A C    2  
ATOM 2696  O O    . MET A 1 80  ? -16.258 0.021   -5.653  1.00 0.00 ? 80  MET A O    2  
ATOM 2697  C CB   . MET A 1 80  ? -16.482 -2.628  -7.062  1.00 0.00 ? 80  MET A CB   2  
ATOM 2698  C CG   . MET A 1 80  ? -17.942 -2.587  -7.481  1.00 0.00 ? 80  MET A CG   2  
ATOM 2699  S SD   . MET A 1 80  ? -18.200 -3.190  -9.160  1.00 0.00 ? 80  MET A SD   2  
ATOM 2700  C CE   . MET A 1 80  ? -18.430 -4.941  -8.859  1.00 0.00 ? 80  MET A CE   2  
ATOM 2701  H H    . MET A 1 80  ? -14.036 -2.176  -6.424  1.00 0.00 ? 80  MET A H    2  
ATOM 2702  H HA   . MET A 1 80  ? -15.740 -1.311  -8.576  1.00 0.00 ? 80  MET A HA   2  
ATOM 2703  H HB2  . MET A 1 80  ? -16.030 -3.509  -7.493  1.00 0.00 ? 80  MET A HB2  2  
ATOM 2704  H HB3  . MET A 1 80  ? -16.441 -2.703  -5.985  1.00 0.00 ? 80  MET A HB3  2  
ATOM 2705  H HG2  . MET A 1 80  ? -18.516 -3.200  -6.802  1.00 0.00 ? 80  MET A HG2  2  
ATOM 2706  H HG3  . MET A 1 80  ? -18.290 -1.566  -7.422  1.00 0.00 ? 80  MET A HG3  2  
ATOM 2707  H HE1  . MET A 1 80  ? -19.383 -5.253  -9.261  1.00 0.00 ? 80  MET A HE1  2  
ATOM 2708  H HE2  . MET A 1 80  ? -17.638 -5.496  -9.340  1.00 0.00 ? 80  MET A HE2  2  
ATOM 2709  H HE3  . MET A 1 80  ? -18.409 -5.129  -7.796  1.00 0.00 ? 80  MET A HE3  2  
ATOM 2710  N N    . ASN A 1 81  ? -16.802 0.744   -7.713  1.00 0.00 ? 81  ASN A N    2  
ATOM 2711  C CA   . ASN A 1 81  ? -17.399 1.987   -7.239  1.00 0.00 ? 81  ASN A CA   2  
ATOM 2712  C C    . ASN A 1 81  ? -18.864 1.779   -6.867  1.00 0.00 ? 81  ASN A C    2  
ATOM 2713  O O    . ASN A 1 81  ? -19.577 1.010   -7.513  1.00 0.00 ? 81  ASN A O    2  
ATOM 2714  C CB   . ASN A 1 81  ? -17.282 3.074   -8.308  1.00 0.00 ? 81  ASN A CB   2  
ATOM 2715  C CG   . ASN A 1 81  ? -17.721 4.434   -7.801  1.00 0.00 ? 81  ASN A CG   2  
ATOM 2716  O OD1  . ASN A 1 81  ? -18.737 4.555   -7.116  1.00 0.00 ? 81  ASN A OD1  2  
ATOM 2717  N ND2  . ASN A 1 81  ? -16.956 5.466   -8.137  1.00 0.00 ? 81  ASN A ND2  2  
ATOM 2718  H H    . ASN A 1 81  ? -16.787 0.557   -8.675  1.00 0.00 ? 81  ASN A H    2  
ATOM 2719  H HA   . ASN A 1 81  ? -16.857 2.300   -6.359  1.00 0.00 ? 81  ASN A HA   2  
ATOM 2720  H HB2  . ASN A 1 81  ? -16.252 3.146   -8.628  1.00 0.00 ? 81  ASN A HB2  2  
ATOM 2721  H HB3  . ASN A 1 81  ? -17.899 2.808   -9.153  1.00 0.00 ? 81  ASN A HB3  2  
ATOM 2722  H HD21 . ASN A 1 81  ? -16.162 5.295   -8.685  1.00 0.00 ? 81  ASN A HD21 2  
ATOM 2723  H HD22 . ASN A 1 81  ? -17.217 6.357   -7.822  1.00 0.00 ? 81  ASN A HD22 2  
ATOM 2724  N N    . LEU A 1 82  ? -19.307 2.470   -5.822  1.00 0.00 ? 82  LEU A N    2  
ATOM 2725  C CA   . LEU A 1 82  ? -20.688 2.362   -5.364  1.00 0.00 ? 82  LEU A CA   2  
ATOM 2726  C C    . LEU A 1 82  ? -21.438 3.671   -5.586  1.00 0.00 ? 82  LEU A C    2  
ATOM 2727  O O    . LEU A 1 82  ? -22.592 3.673   -6.017  1.00 0.00 ? 82  LEU A O    2  
ATOM 2728  C CB   . LEU A 1 82  ? -20.726 1.984   -3.882  1.00 0.00 ? 82  LEU A CB   2  
ATOM 2729  C CG   . LEU A 1 82  ? -19.926 0.743   -3.485  1.00 0.00 ? 82  LEU A CG   2  
ATOM 2730  C CD1  . LEU A 1 82  ? -20.448 -0.484  -4.216  1.00 0.00 ? 82  LEU A CD1  2  
ATOM 2731  C CD2  . LEU A 1 82  ? -18.446 0.947   -3.773  1.00 0.00 ? 82  LEU A CD2  2  
ATOM 2732  H H    . LEU A 1 82  ? -18.692 3.067   -5.347  1.00 0.00 ? 82  LEU A H    2  
ATOM 2733  H HA   . LEU A 1 82  ? -21.168 1.584   -5.938  1.00 0.00 ? 82  LEU A HA   2  
ATOM 2734  H HB2  . LEU A 1 82  ? -20.341 2.820   -3.318  1.00 0.00 ? 82  LEU A HB2  2  
ATOM 2735  H HB3  . LEU A 1 82  ? -21.758 1.815   -3.611  1.00 0.00 ? 82  LEU A HB3  2  
ATOM 2736  H HG   . LEU A 1 82  ? -20.041 0.572   -2.424  1.00 0.00 ? 82  LEU A HG   2  
ATOM 2737  H HD11 . LEU A 1 82  ? -20.509 -1.314  -3.528  1.00 0.00 ? 82  LEU A HD11 2  
ATOM 2738  H HD12 . LEU A 1 82  ? -19.777 -0.735  -5.024  1.00 0.00 ? 82  LEU A HD12 2  
ATOM 2739  H HD13 . LEU A 1 82  ? -21.430 -0.275  -4.616  1.00 0.00 ? 82  LEU A HD13 2  
ATOM 2740  H HD21 . LEU A 1 82  ? -18.192 0.470   -4.708  1.00 0.00 ? 82  LEU A HD21 2  
ATOM 2741  H HD22 . LEU A 1 82  ? -17.861 0.511   -2.976  1.00 0.00 ? 82  LEU A HD22 2  
ATOM 2742  H HD23 . LEU A 1 82  ? -18.235 2.004   -3.838  1.00 0.00 ? 82  LEU A HD23 2  
ATOM 2743  N N    . THR A 1 83  ? -20.776 4.785   -5.290  1.00 0.00 ? 83  THR A N    2  
ATOM 2744  C CA   . THR A 1 83  ? -21.379 6.101   -5.459  1.00 0.00 ? 83  THR A CA   2  
ATOM 2745  C C    . THR A 1 83  ? -21.867 6.304   -6.888  1.00 0.00 ? 83  THR A C    2  
ATOM 2746  O O    . THR A 1 83  ? -22.973 6.796   -7.115  1.00 0.00 ? 83  THR A O    2  
ATOM 2747  C CB   . THR A 1 83  ? -20.387 7.224   -5.103  1.00 0.00 ? 83  THR A CB   2  
ATOM 2748  O OG1  . THR A 1 83  ? -20.934 8.496   -5.470  1.00 0.00 ? 83  THR A OG1  2  
ATOM 2749  C CG2  . THR A 1 83  ? -19.057 7.015   -5.812  1.00 0.00 ? 83  THR A CG2  2  
ATOM 2750  H H    . THR A 1 83  ? -19.859 4.719   -4.951  1.00 0.00 ? 83  THR A H    2  
ATOM 2751  H HA   . THR A 1 83  ? -22.223 6.169   -4.787  1.00 0.00 ? 83  THR A HA   2  
ATOM 2752  H HB   . THR A 1 83  ? -20.215 7.208   -4.036  1.00 0.00 ? 83  THR A HB   2  
ATOM 2753  H HG1  . THR A 1 83  ? -21.854 8.538   -5.200  1.00 0.00 ? 83  THR A HG1  2  
ATOM 2754  H HG21 . THR A 1 83  ? -19.216 7.008   -6.880  1.00 0.00 ? 83  THR A HG21 2  
ATOM 2755  H HG22 . THR A 1 83  ? -18.629 6.073   -5.505  1.00 0.00 ? 83  THR A HG22 2  
ATOM 2756  H HG23 . THR A 1 83  ? -18.382 7.818   -5.555  1.00 0.00 ? 83  THR A HG23 2  
ATOM 2757  N N    . THR A 1 84  ? -21.036 5.920   -7.853  1.00 0.00 ? 84  THR A N    2  
ATOM 2758  C CA   . THR A 1 84  ? -21.383 6.060   -9.261  1.00 0.00 ? 84  THR A CA   2  
ATOM 2759  C C    . THR A 1 84  ? -21.605 4.699   -9.911  1.00 0.00 ? 84  THR A C    2  
ATOM 2760  O O    . THR A 1 84  ? -22.224 4.598   -10.969 1.00 0.00 ? 84  THR A O    2  
ATOM 2761  C CB   . THR A 1 84  ? -20.287 6.814   -10.037 1.00 0.00 ? 84  THR A CB   2  
ATOM 2762  O OG1  . THR A 1 84  ? -19.050 6.097   -9.961  1.00 0.00 ? 84  THR A OG1  2  
ATOM 2763  C CG2  . THR A 1 84  ? -20.100 8.218   -9.483  1.00 0.00 ? 84  THR A CG2  2  
ATOM 2764  H H    . THR A 1 84  ? -20.169 5.535   -7.609  1.00 0.00 ? 84  THR A H    2  
ATOM 2765  H HA   . THR A 1 84  ? -22.298 6.631   -9.324  1.00 0.00 ? 84  THR A HA   2  
ATOM 2766  H HB   . THR A 1 84  ? -20.588 6.889   -11.073 1.00 0.00 ? 84  THR A HB   2  
ATOM 2767  H HG1  . THR A 1 84  ? -19.191 5.265   -9.502  1.00 0.00 ? 84  THR A HG1  2  
ATOM 2768  H HG21 . THR A 1 84  ? -19.182 8.638   -9.868  1.00 0.00 ? 84  THR A HG21 2  
ATOM 2769  H HG22 . THR A 1 84  ? -20.052 8.176   -8.405  1.00 0.00 ? 84  THR A HG22 2  
ATOM 2770  H HG23 . THR A 1 84  ? -20.932 8.837   -9.782  1.00 0.00 ? 84  THR A HG23 2  
ATOM 2771  N N    . GLY A 1 85  ? -21.094 3.652   -9.269  1.00 0.00 ? 85  GLY A N    2  
ATOM 2772  C CA   . GLY A 1 85  ? -21.248 2.310   -9.799  1.00 0.00 ? 85  GLY A CA   2  
ATOM 2773  C C    . GLY A 1 85  ? -20.273 2.015   -10.923 1.00 0.00 ? 85  GLY A C    2  
ATOM 2774  O O    . GLY A 1 85  ? -20.462 1.068   -11.686 1.00 0.00 ? 85  GLY A O    2  
ATOM 2775  H H    . GLY A 1 85  ? -20.610 3.792   -8.429  1.00 0.00 ? 85  GLY A H    2  
ATOM 2776  H HA2  . GLY A 1 85  ? -21.088 1.599   -9.002  1.00 0.00 ? 85  GLY A HA2  2  
ATOM 2777  H HA3  . GLY A 1 85  ? -22.255 2.196   -10.173 1.00 0.00 ? 85  GLY A HA3  2  
ATOM 2778  N N    . LYS A 1 86  ? -19.228 2.829   -11.025 1.00 0.00 ? 86  LYS A N    2  
ATOM 2779  C CA   . LYS A 1 86  ? -18.220 2.652   -12.064 1.00 0.00 ? 86  LYS A CA   2  
ATOM 2780  C C    . LYS A 1 86  ? -17.211 1.580   -11.665 1.00 0.00 ? 86  LYS A C    2  
ATOM 2781  O O    . LYS A 1 86  ? -17.210 1.109   -10.528 1.00 0.00 ? 86  LYS A O    2  
ATOM 2782  C CB   . LYS A 1 86  ? -17.496 3.974   -12.331 1.00 0.00 ? 86  LYS A CB   2  
ATOM 2783  C CG   . LYS A 1 86  ? -18.296 4.944   -13.183 1.00 0.00 ? 86  LYS A CG   2  
ATOM 2784  C CD   . LYS A 1 86  ? -18.373 4.483   -14.629 1.00 0.00 ? 86  LYS A CD   2  
ATOM 2785  C CE   . LYS A 1 86  ? -17.036 4.641   -15.336 1.00 0.00 ? 86  LYS A CE   2  
ATOM 2786  N NZ   . LYS A 1 86  ? -17.147 4.375   -16.797 1.00 0.00 ? 86  LYS A NZ   2  
ATOM 2787  H H    . LYS A 1 86  ? -19.132 3.567   -10.387 1.00 0.00 ? 86  LYS A H    2  
ATOM 2788  H HA   . LYS A 1 86  ? -18.723 2.339   -12.965 1.00 0.00 ? 86  LYS A HA   2  
ATOM 2789  H HB2  . LYS A 1 86  ? -17.282 4.451   -11.385 1.00 0.00 ? 86  LYS A HB2  2  
ATOM 2790  H HB3  . LYS A 1 86  ? -16.565 3.765   -12.838 1.00 0.00 ? 86  LYS A HB3  2  
ATOM 2791  H HG2  . LYS A 1 86  ? -19.298 5.017   -12.786 1.00 0.00 ? 86  LYS A HG2  2  
ATOM 2792  H HG3  . LYS A 1 86  ? -17.822 5.915   -13.149 1.00 0.00 ? 86  LYS A HG3  2  
ATOM 2793  H HD2  . LYS A 1 86  ? -18.659 3.442   -14.651 1.00 0.00 ? 86  LYS A HD2  2  
ATOM 2794  H HD3  . LYS A 1 86  ? -19.116 5.073   -15.147 1.00 0.00 ? 86  LYS A HD3  2  
ATOM 2795  H HE2  . LYS A 1 86  ? -16.682 5.649   -15.188 1.00 0.00 ? 86  LYS A HE2  2  
ATOM 2796  H HE3  . LYS A 1 86  ? -16.331 3.945   -14.905 1.00 0.00 ? 86  LYS A HE3  2  
ATOM 2797  H HZ1  . LYS A 1 86  ? -18.146 4.384   -17.087 1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 2798  H HZ2  . LYS A 1 86  ? -16.740 3.445   -17.023 1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 2799  H HZ3  . LYS A 1 86  ? -16.635 5.105   -17.333 1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 2800  N N    . GLN A 1 87  ? -16.354 1.201   -12.608 1.00 0.00 ? 87  GLN A N    2  
ATOM 2801  C CA   . GLN A 1 87  ? -15.340 0.184   -12.353 1.00 0.00 ? 87  GLN A CA   2  
ATOM 2802  C C    . GLN A 1 87  ? -13.967 0.656   -12.821 1.00 0.00 ? 87  GLN A C    2  
ATOM 2803  O O    . GLN A 1 87  ? -13.845 1.310   -13.857 1.00 0.00 ? 87  GLN A O    2  
ATOM 2804  C CB   . GLN A 1 87  ? -15.710 -1.123  -13.056 1.00 0.00 ? 87  GLN A CB   2  
ATOM 2805  C CG   . GLN A 1 87  ? -15.693 -1.025  -14.572 1.00 0.00 ? 87  GLN A CG   2  
ATOM 2806  C CD   . GLN A 1 87  ? -14.332 -1.336  -15.162 1.00 0.00 ? 87  GLN A CD   2  
ATOM 2807  O OE1  . GLN A 1 87  ? -13.641 -0.447  -15.662 1.00 0.00 ? 87  GLN A OE1  2  
ATOM 2808  N NE2  . GLN A 1 87  ? -13.938 -2.603  -15.107 1.00 0.00 ? 87  GLN A NE2  2  
ATOM 2809  H H    . GLN A 1 87  ? -16.406 1.613   -13.494 1.00 0.00 ? 87  GLN A H    2  
ATOM 2810  H HA   . GLN A 1 87  ? -15.304 0.012   -11.288 1.00 0.00 ? 87  GLN A HA   2  
ATOM 2811  H HB2  . GLN A 1 87  ? -15.010 -1.889  -12.758 1.00 0.00 ? 87  GLN A HB2  2  
ATOM 2812  H HB3  . GLN A 1 87  ? -16.703 -1.415  -12.747 1.00 0.00 ? 87  GLN A HB3  2  
ATOM 2813  H HG2  . GLN A 1 87  ? -16.410 -1.725  -14.974 1.00 0.00 ? 87  GLN A HG2  2  
ATOM 2814  H HG3  . GLN A 1 87  ? -15.973 -0.021  -14.858 1.00 0.00 ? 87  GLN A HG3  2  
ATOM 2815  H HE21 . GLN A 1 87  ? -14.541 -3.257  -14.696 1.00 0.00 ? 87  GLN A HE21 2  
ATOM 2816  H HE22 . GLN A 1 87  ? -13.063 -2.832  -15.481 1.00 0.00 ? 87  GLN A HE22 2  
ATOM 2817  N N    . ARG A 1 88  ? -12.937 0.320   -12.052 1.00 0.00 ? 88  ARG A N    2  
ATOM 2818  C CA   . ARG A 1 88  ? -11.573 0.710   -12.387 1.00 0.00 ? 88  ARG A CA   2  
ATOM 2819  C C    . ARG A 1 88  ? -10.584 -0.387  -12.007 1.00 0.00 ? 88  ARG A C    2  
ATOM 2820  O O    . ARG A 1 88  ? -10.904 -1.282  -11.222 1.00 0.00 ? 88  ARG A O    2  
ATOM 2821  C CB   . ARG A 1 88  ? -11.204 2.013   -11.676 1.00 0.00 ? 88  ARG A CB   2  
ATOM 2822  C CG   . ARG A 1 88  ? -11.241 1.912   -10.160 1.00 0.00 ? 88  ARG A CG   2  
ATOM 2823  C CD   . ARG A 1 88  ? -10.925 3.247   -9.504  1.00 0.00 ? 88  ARG A CD   2  
ATOM 2824  N NE   . ARG A 1 88  ? -11.927 4.262   -9.818  1.00 0.00 ? 88  ARG A NE   2  
ATOM 2825  C CZ   . ARG A 1 88  ? -12.034 5.415   -9.168  1.00 0.00 ? 88  ARG A CZ   2  
ATOM 2826  N NH1  . ARG A 1 88  ? -11.205 5.698   -8.173  1.00 0.00 ? 88  ARG A NH1  2  
ATOM 2827  N NH2  . ARG A 1 88  ? -12.972 6.288   -9.512  1.00 0.00 ? 88  ARG A NH2  2  
ATOM 2828  H H    . ARG A 1 88  ? -13.099 -0.202  -11.238 1.00 0.00 ? 88  ARG A H    2  
ATOM 2829  H HA   . ARG A 1 88  ? -11.526 0.867   -13.454 1.00 0.00 ? 88  ARG A HA   2  
ATOM 2830  H HB2  . ARG A 1 88  ? -10.205 2.300   -11.971 1.00 0.00 ? 88  ARG A HB2  2  
ATOM 2831  H HB3  . ARG A 1 88  ? -11.896 2.784   -11.981 1.00 0.00 ? 88  ARG A HB3  2  
ATOM 2832  H HG2  . ARG A 1 88  ? -12.228 1.597   -9.854  1.00 0.00 ? 88  ARG A HG2  2  
ATOM 2833  H HG3  . ARG A 1 88  ? -10.513 1.182   -9.840  1.00 0.00 ? 88  ARG A HG3  2  
ATOM 2834  H HD2  . ARG A 1 88  ? -10.891 3.108   -8.434  1.00 0.00 ? 88  ARG A HD2  2  
ATOM 2835  H HD3  . ARG A 1 88  ? -9.961  3.585   -9.854  1.00 0.00 ? 88  ARG A HD3  2  
ATOM 2836  H HE   . ARG A 1 88  ? -12.551 4.073   -10.550 1.00 0.00 ? 88  ARG A HE   2  
ATOM 2837  H HH11 . ARG A 1 88  ? -10.496 5.043   -7.912  1.00 0.00 ? 88  ARG A HH11 2  
ATOM 2838  H HH12 . ARG A 1 88  ? -11.287 6.568   -7.686  1.00 0.00 ? 88  ARG A HH12 2  
ATOM 2839  H HH21 . ARG A 1 88  ? -13.599 6.078   -10.262 1.00 0.00 ? 88  ARG A HH21 2  
ATOM 2840  H HH22 . ARG A 1 88  ? -13.052 7.155   -9.022  1.00 0.00 ? 88  ARG A HH22 2  
ATOM 2841  N N    . LEU A 1 89  ? -9.382  -0.314  -12.567 1.00 0.00 ? 89  LEU A N    2  
ATOM 2842  C CA   . LEU A 1 89  ? -8.346  -1.301  -12.287 1.00 0.00 ? 89  LEU A CA   2  
ATOM 2843  C C    . LEU A 1 89  ? -7.360  -0.777  -11.248 1.00 0.00 ? 89  LEU A C    2  
ATOM 2844  O O    . LEU A 1 89  ? -7.163  0.432   -11.120 1.00 0.00 ? 89  LEU A O    2  
ATOM 2845  C CB   . LEU A 1 89  ? -7.602  -1.667  -13.573 1.00 0.00 ? 89  LEU A CB   2  
ATOM 2846  C CG   . LEU A 1 89  ? -8.329  -2.623  -14.520 1.00 0.00 ? 89  LEU A CG   2  
ATOM 2847  C CD1  . LEU A 1 89  ? -8.732  -3.895  -13.790 1.00 0.00 ? 89  LEU A CD1  2  
ATOM 2848  C CD2  . LEU A 1 89  ? -9.549  -1.946  -15.128 1.00 0.00 ? 89  LEU A CD2  2  
ATOM 2849  H H    . LEU A 1 89  ? -9.186  0.422   -13.184 1.00 0.00 ? 89  LEU A H    2  
ATOM 2850  H HA   . LEU A 1 89  ? -8.827  -2.185  -11.896 1.00 0.00 ? 89  LEU A HA   2  
ATOM 2851  H HB2  . LEU A 1 89  ? -7.405  -0.754  -14.113 1.00 0.00 ? 89  LEU A HB2  2  
ATOM 2852  H HB3  . LEU A 1 89  ? -6.665  -2.127  -13.293 1.00 0.00 ? 89  LEU A HB3  2  
ATOM 2853  H HG   . LEU A 1 89  ? -7.662  -2.898  -15.325 1.00 0.00 ? 89  LEU A HG   2  
ATOM 2854  H HD11 . LEU A 1 89  ? -9.796  -3.884  -13.608 1.00 0.00 ? 89  LEU A HD11 2  
ATOM 2855  H HD12 . LEU A 1 89  ? -8.206  -3.950  -12.848 1.00 0.00 ? 89  LEU A HD12 2  
ATOM 2856  H HD13 . LEU A 1 89  ? -8.478  -4.753  -14.395 1.00 0.00 ? 89  LEU A HD13 2  
ATOM 2857  H HD21 . LEU A 1 89  ? -9.800  -2.428  -16.061 1.00 0.00 ? 89  LEU A HD21 2  
ATOM 2858  H HD22 . LEU A 1 89  ? -9.329  -0.904  -15.310 1.00 0.00 ? 89  LEU A HD22 2  
ATOM 2859  H HD23 . LEU A 1 89  ? -10.382 -2.025  -14.446 1.00 0.00 ? 89  LEU A HD23 2  
ATOM 2860  N N    . ILE A 1 90  ? -6.743  -1.693  -10.510 1.00 0.00 ? 90  ILE A N    2  
ATOM 2861  C CA   . ILE A 1 90  ? -5.775  -1.323  -9.485  1.00 0.00 ? 90  ILE A CA   2  
ATOM 2862  C C    . ILE A 1 90  ? -4.465  -2.080  -9.667  1.00 0.00 ? 90  ILE A C    2  
ATOM 2863  O O    . ILE A 1 90  ? -4.350  -2.947  -10.534 1.00 0.00 ? 90  ILE A O    2  
ATOM 2864  C CB   . ILE A 1 90  ? -6.321  -1.596  -8.071  1.00 0.00 ? 90  ILE A CB   2  
ATOM 2865  C CG1  . ILE A 1 90  ? -6.700  -3.071  -7.923  1.00 0.00 ? 90  ILE A CG1  2  
ATOM 2866  C CG2  . ILE A 1 90  ? -7.520  -0.704  -7.785  1.00 0.00 ? 90  ILE A CG2  2  
ATOM 2867  C CD1  . ILE A 1 90  ? -7.707  -3.329  -6.824  1.00 0.00 ? 90  ILE A CD1  2  
ATOM 2868  H H    . ILE A 1 90  ? -6.942  -2.641  -10.659 1.00 0.00 ? 90  ILE A H    2  
ATOM 2869  H HA   . ILE A 1 90  ? -5.582  -0.264  -9.576  1.00 0.00 ? 90  ILE A HA   2  
ATOM 2870  H HB   . ILE A 1 90  ? -5.547  -1.357  -7.358  1.00 0.00 ? 90  ILE A HB   2  
ATOM 2871  H HG12 . ILE A 1 90  ? -7.125  -3.422  -8.850  1.00 0.00 ? 90  ILE A HG12 2  
ATOM 2872  H HG13 . ILE A 1 90  ? -5.810  -3.642  -7.700  1.00 0.00 ? 90  ILE A HG13 2  
ATOM 2873  H HG21 . ILE A 1 90  ? -7.284  0.314   -8.056  1.00 0.00 ? 90  ILE A HG21 2  
ATOM 2874  H HG22 . ILE A 1 90  ? -8.366  -1.043  -8.363  1.00 0.00 ? 90  ILE A HG22 2  
ATOM 2875  H HG23 . ILE A 1 90  ? -7.760  -0.750  -6.733  1.00 0.00 ? 90  ILE A HG23 2  
ATOM 2876  H HD11 . ILE A 1 90  ? -8.690  -3.034  -7.159  1.00 0.00 ? 90  ILE A HD11 2  
ATOM 2877  H HD12 . ILE A 1 90  ? -7.709  -4.380  -6.576  1.00 0.00 ? 90  ILE A HD12 2  
ATOM 2878  H HD13 . ILE A 1 90  ? -7.439  -2.754  -5.948  1.00 0.00 ? 90  ILE A HD13 2  
ATOM 2879  N N    . LYS A 1 91  ? -3.477  -1.749  -8.842  1.00 0.00 ? 91  LYS A N    2  
ATOM 2880  C CA   . LYS A 1 91  ? -2.174  -2.400  -8.908  1.00 0.00 ? 91  LYS A CA   2  
ATOM 2881  C C    . LYS A 1 91  ? -1.394  -2.189  -7.614  1.00 0.00 ? 91  LYS A C    2  
ATOM 2882  O O    . LYS A 1 91  ? -1.505  -1.142  -6.976  1.00 0.00 ? 91  LYS A O    2  
ATOM 2883  C CB   . LYS A 1 91  ? -1.371  -1.859  -10.094 1.00 0.00 ? 91  LYS A CB   2  
ATOM 2884  C CG   . LYS A 1 91  ? -0.880  -0.436  -9.897  1.00 0.00 ? 91  LYS A CG   2  
ATOM 2885  C CD   . LYS A 1 91  ? 0.089   -0.024  -10.994 1.00 0.00 ? 91  LYS A CD   2  
ATOM 2886  C CE   . LYS A 1 91  ? 0.674   1.355   -10.730 1.00 0.00 ? 91  LYS A CE   2  
ATOM 2887  N NZ   . LYS A 1 91  ? 2.017   1.516   -11.353 1.00 0.00 ? 91  LYS A NZ   2  
ATOM 2888  H H    . LYS A 1 91  ? -3.629  -1.050  -8.171  1.00 0.00 ? 91  LYS A H    2  
ATOM 2889  H HA   . LYS A 1 91  ? -2.337  -3.457  -9.047  1.00 0.00 ? 91  LYS A HA   2  
ATOM 2890  H HB2  . LYS A 1 91  ? -0.512  -2.496  -10.252 1.00 0.00 ? 91  LYS A HB2  2  
ATOM 2891  H HB3  . LYS A 1 91  ? -1.994  -1.884  -10.976 1.00 0.00 ? 91  LYS A HB3  2  
ATOM 2892  H HG2  . LYS A 1 91  ? -1.727  0.233   -9.911  1.00 0.00 ? 91  LYS A HG2  2  
ATOM 2893  H HG3  . LYS A 1 91  ? -0.379  -0.366  -8.942  1.00 0.00 ? 91  LYS A HG3  2  
ATOM 2894  H HD2  . LYS A 1 91  ? 0.894   -0.741  -11.039 1.00 0.00 ? 91  LYS A HD2  2  
ATOM 2895  H HD3  . LYS A 1 91  ? -0.436  -0.008  -11.938 1.00 0.00 ? 91  LYS A HD3  2  
ATOM 2896  H HE2  . LYS A 1 91  ? 0.007   2.099   -11.138 1.00 0.00 ? 91  LYS A HE2  2  
ATOM 2897  H HE3  . LYS A 1 91  ? 0.763   1.497   -9.663  1.00 0.00 ? 91  LYS A HE3  2  
ATOM 2898  H HZ1  . LYS A 1 91  ? 2.501   0.596   -11.400 1.00 0.00 ? 91  LYS A HZ1  2  
ATOM 2899  H HZ2  . LYS A 1 91  ? 2.597   2.171   -10.791 1.00 0.00 ? 91  LYS A HZ2  2  
ATOM 2900  H HZ3  . LYS A 1 91  ? 1.922   1.894   -12.317 1.00 0.00 ? 91  LYS A HZ3  2  
ATOM 2901  N N    . ARG A 1 92  ? -0.605  -3.189  -7.234  1.00 0.00 ? 92  ARG A N    2  
ATOM 2902  C CA   . ARG A 1 92  ? 0.193   -3.112  -6.017  1.00 0.00 ? 92  ARG A CA   2  
ATOM 2903  C C    . ARG A 1 92  ? 1.684   -3.165  -6.339  1.00 0.00 ? 92  ARG A C    2  
ATOM 2904  O O    . ARG A 1 92  ? 2.200   -4.197  -6.767  1.00 0.00 ? 92  ARG A O    2  
ATOM 2905  C CB   . ARG A 1 92  ? -0.175  -4.253  -5.067  1.00 0.00 ? 92  ARG A CB   2  
ATOM 2906  C CG   . ARG A 1 92  ? 0.513   -4.166  -3.715  1.00 0.00 ? 92  ARG A CG   2  
ATOM 2907  C CD   . ARG A 1 92  ? -0.092  -5.143  -2.718  1.00 0.00 ? 92  ARG A CD   2  
ATOM 2908  N NE   . ARG A 1 92  ? 0.419   -6.498  -2.901  1.00 0.00 ? 92  ARG A NE   2  
ATOM 2909  C CZ   . ARG A 1 92  ? 1.633   -6.883  -2.522  1.00 0.00 ? 92  ARG A CZ   2  
ATOM 2910  N NH1  . ARG A 1 92  ? 2.456   -6.019  -1.944  1.00 0.00 ? 92  ARG A NH1  2  
ATOM 2911  N NH2  . ARG A 1 92  ? 2.027   -8.134  -2.722  1.00 0.00 ? 92  ARG A NH2  2  
ATOM 2912  H H    . ARG A 1 92  ? -0.559  -3.998  -7.786  1.00 0.00 ? 92  ARG A H    2  
ATOM 2913  H HA   . ARG A 1 92  ? -0.025  -2.170  -5.536  1.00 0.00 ? 92  ARG A HA   2  
ATOM 2914  H HB2  . ARG A 1 92  ? -1.243  -4.241  -4.905  1.00 0.00 ? 92  ARG A HB2  2  
ATOM 2915  H HB3  . ARG A 1 92  ? 0.100   -5.190  -5.527  1.00 0.00 ? 92  ARG A HB3  2  
ATOM 2916  H HG2  . ARG A 1 92  ? 1.560   -4.399  -3.838  1.00 0.00 ? 92  ARG A HG2  2  
ATOM 2917  H HG3  . ARG A 1 92  ? 0.407   -3.162  -3.332  1.00 0.00 ? 92  ARG A HG3  2  
ATOM 2918  H HD2  . ARG A 1 92  ? 0.146   -4.810  -1.719  1.00 0.00 ? 92  ARG A HD2  2  
ATOM 2919  H HD3  . ARG A 1 92  ? -1.164  -5.151  -2.849  1.00 0.00 ? 92  ARG A HD3  2  
ATOM 2920  H HE   . ARG A 1 92  ? -0.172  -7.153  -3.326  1.00 0.00 ? 92  ARG A HE   2  
ATOM 2921  H HH11 . ARG A 1 92  ? 2.162   -5.075  -1.791  1.00 0.00 ? 92  ARG A HH11 2  
ATOM 2922  H HH12 . ARG A 1 92  ? 3.369   -6.311  -1.658  1.00 0.00 ? 92  ARG A HH12 2  
ATOM 2923  H HH21 . ARG A 1 92  ? 1.409   -8.789  -3.158  1.00 0.00 ? 92  ARG A HH21 2  
ATOM 2924  H HH22 . ARG A 1 92  ? 2.940   -8.423  -2.437  1.00 0.00 ? 92  ARG A HH22 2  
ATOM 2925  N N    . ALA A 1 93  ? 2.369   -2.045  -6.132  1.00 0.00 ? 93  ALA A N    2  
ATOM 2926  C CA   . ALA A 1 93  ? 3.800   -1.965  -6.400  1.00 0.00 ? 93  ALA A CA   2  
ATOM 2927  C C    . ALA A 1 93  ? 4.500   -1.074  -5.379  1.00 0.00 ? 93  ALA A C    2  
ATOM 2928  O O    . ALA A 1 93  ? 3.896   -0.186  -4.777  1.00 0.00 ? 93  ALA A O    2  
ATOM 2929  C CB   . ALA A 1 93  ? 4.045   -1.449  -7.810  1.00 0.00 ? 93  ALA A CB   2  
ATOM 2930  H H    . ALA A 1 93  ? 1.902   -1.255  -5.790  1.00 0.00 ? 93  ALA A H    2  
ATOM 2931  H HA   . ALA A 1 93  ? 4.209   -2.963  -6.331  1.00 0.00 ? 93  ALA A HA   2  
ATOM 2932  H HB1  . ALA A 1 93  ? 4.626   -2.175  -8.361  1.00 0.00 ? 93  ALA A HB1  2  
ATOM 2933  H HB2  . ALA A 1 93  ? 3.099   -1.293  -8.305  1.00 0.00 ? 93  ALA A HB2  2  
ATOM 2934  H HB3  . ALA A 1 93  ? 4.586   -0.516  -7.762  1.00 0.00 ? 93  ALA A HB3  2  
ATOM 2935  N N    . PRO A 1 94  ? 5.804   -1.314  -5.178  1.00 0.00 ? 94  PRO A N    2  
ATOM 2936  C CA   . PRO A 1 94  ? 6.614   -0.544  -4.230  1.00 0.00 ? 94  PRO A CA   2  
ATOM 2937  C C    . PRO A 1 94  ? 6.850   0.888   -4.699  1.00 0.00 ? 94  PRO A C    2  
ATOM 2938  O O    . PRO A 1 94  ? 6.970   1.148   -5.897  1.00 0.00 ? 94  PRO A O    2  
ATOM 2939  C CB   . PRO A 1 94  ? 7.935   -1.315  -4.183  1.00 0.00 ? 94  PRO A CB   2  
ATOM 2940  C CG   . PRO A 1 94  ? 8.007   -2.023  -5.492  1.00 0.00 ? 94  PRO A CG   2  
ATOM 2941  C CD   . PRO A 1 94  ? 6.588   -2.357  -5.861  1.00 0.00 ? 94  PRO A CD   2  
ATOM 2942  H HA   . PRO A 1 94  ? 6.168   -0.530  -3.246  1.00 0.00 ? 94  PRO A HA   2  
ATOM 2943  H HB2  . PRO A 1 94  ? 8.756   -0.622  -4.062  1.00 0.00 ? 94  PRO A HB2  2  
ATOM 2944  H HB3  . PRO A 1 94  ? 7.920   -2.012  -3.359  1.00 0.00 ? 94  PRO A HB3  2  
ATOM 2945  H HG2  . PRO A 1 94  ? 8.446   -1.375  -6.236  1.00 0.00 ? 94  PRO A HG2  2  
ATOM 2946  H HG3  . PRO A 1 94  ? 8.589   -2.926  -5.389  1.00 0.00 ? 94  PRO A HG3  2  
ATOM 2947  H HD2  . PRO A 1 94  ? 6.454   -2.301  -6.931  1.00 0.00 ? 94  PRO A HD2  2  
ATOM 2948  H HD3  . PRO A 1 94  ? 6.324   -3.338  -5.496  1.00 0.00 ? 94  PRO A HD3  2  
ATOM 2949  N N    . PHE A 1 95  ? 6.915   1.814   -3.748  1.00 0.00 ? 95  PHE A N    2  
ATOM 2950  C CA   . PHE A 1 95  ? 7.136   3.220   -4.065  1.00 0.00 ? 95  PHE A CA   2  
ATOM 2951  C C    . PHE A 1 95  ? 8.386   3.395   -4.922  1.00 0.00 ? 95  PHE A C    2  
ATOM 2952  O O    . PHE A 1 95  ? 8.354   4.062   -5.956  1.00 0.00 ? 95  PHE A O    2  
ATOM 2953  C CB   . PHE A 1 95  ? 7.267   4.040   -2.779  1.00 0.00 ? 95  PHE A CB   2  
ATOM 2954  C CG   . PHE A 1 95  ? 6.122   3.847   -1.826  1.00 0.00 ? 95  PHE A CG   2  
ATOM 2955  C CD1  . PHE A 1 95  ? 4.813   3.932   -2.270  1.00 0.00 ? 95  PHE A CD1  2  
ATOM 2956  C CD2  . PHE A 1 95  ? 6.356   3.581   -0.486  1.00 0.00 ? 95  PHE A CD2  2  
ATOM 2957  C CE1  . PHE A 1 95  ? 3.757   3.756   -1.394  1.00 0.00 ? 95  PHE A CE1  2  
ATOM 2958  C CE2  . PHE A 1 95  ? 5.305   3.404   0.393   1.00 0.00 ? 95  PHE A CE2  2  
ATOM 2959  C CZ   . PHE A 1 95  ? 4.004   3.491   -0.062  1.00 0.00 ? 95  PHE A CZ   2  
ATOM 2960  H H    . PHE A 1 95  ? 6.811   1.545   -2.811  1.00 0.00 ? 95  PHE A H    2  
ATOM 2961  H HA   . PHE A 1 95  ? 6.280   3.573   -4.620  1.00 0.00 ? 95  PHE A HA   2  
ATOM 2962  H HB2  . PHE A 1 95  ? 8.175   3.753   -2.269  1.00 0.00 ? 95  PHE A HB2  2  
ATOM 2963  H HB3  . PHE A 1 95  ? 7.317   5.088   -3.032  1.00 0.00 ? 95  PHE A HB3  2  
ATOM 2964  H HD1  . PHE A 1 95  ? 4.618   4.139   -3.312  1.00 0.00 ? 95  PHE A HD1  2  
ATOM 2965  H HD2  . PHE A 1 95  ? 7.374   3.512   -0.129  1.00 0.00 ? 95  PHE A HD2  2  
ATOM 2966  H HE1  . PHE A 1 95  ? 2.741   3.824   -1.753  1.00 0.00 ? 95  PHE A HE1  2  
ATOM 2967  H HE2  . PHE A 1 95  ? 5.501   3.196   1.435   1.00 0.00 ? 95  PHE A HE2  2  
ATOM 2968  H HZ   . PHE A 1 95  ? 3.181   3.353   0.624   1.00 0.00 ? 95  PHE A HZ   2  
ATOM 2969  N N    . SER A 1 96  ? 9.486   2.791   -4.484  1.00 0.00 ? 96  SER A N    2  
ATOM 2970  C CA   . SER A 1 96  ? 10.748  2.883   -5.209  1.00 0.00 ? 96  SER A CA   2  
ATOM 2971  C C    . SER A 1 96  ? 10.667  2.137   -6.537  1.00 0.00 ? 96  SER A C    2  
ATOM 2972  O O    . SER A 1 96  ? 10.168  1.014   -6.602  1.00 0.00 ? 96  SER A O    2  
ATOM 2973  C CB   . SER A 1 96  ? 11.889  2.316   -4.361  1.00 0.00 ? 96  SER A CB   2  
ATOM 2974  O OG   . SER A 1 96  ? 12.043  3.048   -3.158  1.00 0.00 ? 96  SER A OG   2  
ATOM 2975  H H    . SER A 1 96  ? 9.448   2.273   -3.653  1.00 0.00 ? 96  SER A H    2  
ATOM 2976  H HA   . SER A 1 96  ? 10.942  3.926   -5.406  1.00 0.00 ? 96  SER A HA   2  
ATOM 2977  H HB2  . SER A 1 96  ? 11.676  1.286   -4.117  1.00 0.00 ? 96  SER A HB2  2  
ATOM 2978  H HB3  . SER A 1 96  ? 12.811  2.370   -4.922  1.00 0.00 ? 96  SER A HB3  2  
ATOM 2979  H HG   . SER A 1 96  ? 12.817  2.732   -2.687  1.00 0.00 ? 96  SER A HG   2  
ATOM 2980  N N    . SER A 1 97  ? 11.162  2.771   -7.595  1.00 0.00 ? 97  SER A N    2  
ATOM 2981  C CA   . SER A 1 97  ? 11.143  2.171   -8.924  1.00 0.00 ? 97  SER A CA   2  
ATOM 2982  C C    . SER A 1 97  ? 12.507  1.584   -9.275  1.00 0.00 ? 97  SER A C    2  
ATOM 2983  O O    . SER A 1 97  ? 12.998  1.748   -10.391 1.00 0.00 ? 97  SER A O    2  
ATOM 2984  C CB   . SER A 1 97  ? 10.739  3.211   -9.971  1.00 0.00 ? 97  SER A CB   2  
ATOM 2985  O OG   . SER A 1 97  ? 11.782  4.143   -10.193 1.00 0.00 ? 97  SER A OG   2  
ATOM 2986  H H    . SER A 1 97  ? 11.547  3.665   -7.480  1.00 0.00 ? 97  SER A H    2  
ATOM 2987  H HA   . SER A 1 97  ? 10.413  1.376   -8.918  1.00 0.00 ? 97  SER A HA   2  
ATOM 2988  H HB2  . SER A 1 97  ? 10.514  2.712   -10.902 1.00 0.00 ? 97  SER A HB2  2  
ATOM 2989  H HB3  . SER A 1 97  ? 9.864   3.742   -9.627  1.00 0.00 ? 97  SER A HB3  2  
ATOM 2990  H HG   . SER A 1 97  ? 11.786  4.794   -9.487  1.00 0.00 ? 97  SER A HG   2  
ATOM 2991  N N    . GLY A 1 98  ? 13.115  0.898   -8.311  1.00 0.00 ? 98  GLY A N    2  
ATOM 2992  C CA   . GLY A 1 98  ? 14.416  0.297   -8.536  1.00 0.00 ? 98  GLY A CA   2  
ATOM 2993  C C    . GLY A 1 98  ? 15.017  -0.276  -7.268  1.00 0.00 ? 98  GLY A C    2  
ATOM 2994  O O    . GLY A 1 98  ? 14.314  -0.582  -6.305  1.00 0.00 ? 98  GLY A O    2  
ATOM 2995  H H    . GLY A 1 98  ? 12.676  0.800   -7.440  1.00 0.00 ? 98  GLY A H    2  
ATOM 2996  H HA2  . GLY A 1 98  ? 14.314  -0.495  -9.263  1.00 0.00 ? 98  GLY A HA2  2  
ATOM 2997  H HA3  . GLY A 1 98  ? 15.085  1.049   -8.929  1.00 0.00 ? 98  GLY A HA3  2  
ATOM 2998  N N    . PRO A 1 99  ? 16.350  -0.430  -7.257  1.00 0.00 ? 99  PRO A N    2  
ATOM 2999  C CA   . PRO A 1 99  ? 17.075  -0.972  -6.103  1.00 0.00 ? 99  PRO A CA   2  
ATOM 3000  C C    . PRO A 1 99  ? 17.077  -0.014  -4.918  1.00 0.00 ? 99  PRO A C    2  
ATOM 3001  O O    . PRO A 1 99  ? 16.519  1.081   -4.991  1.00 0.00 ? 99  PRO A O    2  
ATOM 3002  C CB   . PRO A 1 99  ? 18.496  -1.167  -6.637  1.00 0.00 ? 99  PRO A CB   2  
ATOM 3003  C CG   . PRO A 1 99  ? 18.619  -0.186  -7.752  1.00 0.00 ? 99  PRO A CG   2  
ATOM 3004  C CD   . PRO A 1 99  ? 17.251  -0.086  -8.369  1.00 0.00 ? 99  PRO A CD   2  
ATOM 3005  H HA   . PRO A 1 99  ? 16.671  -1.925  -5.794  1.00 0.00 ? 99  PRO A HA   2  
ATOM 3006  H HB2  . PRO A 1 99  ? 19.209  -0.964  -5.851  1.00 0.00 ? 99  PRO A HB2  2  
ATOM 3007  H HB3  . PRO A 1 99  ? 18.617  -2.181  -6.988  1.00 0.00 ? 99  PRO A HB3  2  
ATOM 3008  H HG2  . PRO A 1 99  ? 18.927  0.773   -7.365  1.00 0.00 ? 99  PRO A HG2  2  
ATOM 3009  H HG3  . PRO A 1 99  ? 19.332  -0.546  -8.479  1.00 0.00 ? 99  PRO A HG3  2  
ATOM 3010  H HD2  . PRO A 1 99  ? 17.067  0.919   -8.718  1.00 0.00 ? 99  PRO A HD2  2  
ATOM 3011  H HD3  . PRO A 1 99  ? 17.150  -0.793  -9.179  1.00 0.00 ? 99  PRO A HD3  2  
ATOM 3012  N N    . SER A 1 100 ? 17.710  -0.432  -3.826  1.00 0.00 ? 100 SER A N    2  
ATOM 3013  C CA   . SER A 1 100 ? 17.782  0.388   -2.623  1.00 0.00 ? 100 SER A CA   2  
ATOM 3014  C C    . SER A 1 100 ? 19.112  1.132   -2.552  1.00 0.00 ? 100 SER A C    2  
ATOM 3015  O O    . SER A 1 100 ? 20.179  0.532   -2.679  1.00 0.00 ? 100 SER A O    2  
ATOM 3016  C CB   . SER A 1 100 ? 17.603  -0.480  -1.376  1.00 0.00 ? 100 SER A CB   2  
ATOM 3017  O OG   . SER A 1 100 ? 18.594  -1.491  -1.313  1.00 0.00 ? 100 SER A OG   2  
ATOM 3018  H H    . SER A 1 100 ? 18.135  -1.315  -3.829  1.00 0.00 ? 100 SER A H    2  
ATOM 3019  H HA   . SER A 1 100 ? 16.981  1.111   -2.665  1.00 0.00 ? 100 SER A HA   2  
ATOM 3020  H HB2  . SER A 1 100 ? 17.681  0.139   -0.495  1.00 0.00 ? 100 SER A HB2  2  
ATOM 3021  H HB3  . SER A 1 100 ? 16.630  -0.947  -1.403  1.00 0.00 ? 100 SER A HB3  2  
ATOM 3022  H HG   . SER A 1 100 ? 18.423  -2.060  -0.558  1.00 0.00 ? 100 SER A HG   2  
ATOM 3023  N N    . SER A 1 101 ? 19.039  2.444   -2.348  1.00 0.00 ? 101 SER A N    2  
ATOM 3024  C CA   . SER A 1 101 ? 20.237  3.272   -2.264  1.00 0.00 ? 101 SER A CA   2  
ATOM 3025  C C    . SER A 1 101 ? 19.935  4.593   -1.563  1.00 0.00 ? 101 SER A C    2  
ATOM 3026  O O    . SER A 1 101 ? 19.078  5.360   -2.001  1.00 0.00 ? 101 SER A O    2  
ATOM 3027  C CB   . SER A 1 101 ? 20.797  3.539   -3.662  1.00 0.00 ? 101 SER A CB   2  
ATOM 3028  O OG   . SER A 1 101 ? 21.552  2.435   -4.129  1.00 0.00 ? 101 SER A OG   2  
ATOM 3029  H H    . SER A 1 101 ? 18.159  2.865   -2.255  1.00 0.00 ? 101 SER A H    2  
ATOM 3030  H HA   . SER A 1 101 ? 20.973  2.732   -1.687  1.00 0.00 ? 101 SER A HA   2  
ATOM 3031  H HB2  . SER A 1 101 ? 19.981  3.717   -4.346  1.00 0.00 ? 101 SER A HB2  2  
ATOM 3032  H HB3  . SER A 1 101 ? 21.436  4.410   -3.630  1.00 0.00 ? 101 SER A HB3  2  
ATOM 3033  H HG   . SER A 1 101 ? 22.463  2.525   -3.841  1.00 0.00 ? 101 SER A HG   2  
ATOM 3034  N N    . GLY A 1 102 ? 20.647  4.853   -0.471  1.00 0.00 ? 102 GLY A N    2  
ATOM 3035  C CA   . GLY A 1 102 ? 20.442  6.081   0.274   1.00 0.00 ? 102 GLY A CA   2  
ATOM 3036  C C    . GLY A 1 102 ? 21.564  6.359   1.255   1.00 0.00 ? 102 GLY A C    2  
ATOM 3037  O O    . GLY A 1 102 ? 22.658  5.810   1.128   1.00 0.00 ? 102 GLY A O    2  
ATOM 3038  H H    . GLY A 1 102 ? 21.317  4.205   -0.168  1.00 0.00 ? 102 GLY A H    2  
ATOM 3039  H HA2  . GLY A 1 102 ? 20.373  6.904   -0.421  1.00 0.00 ? 102 GLY A HA2  2  
ATOM 3040  H HA3  . GLY A 1 102 ? 19.513  6.007   0.820   1.00 0.00 ? 102 GLY A HA3  2  
ATOM 3041  N N    . GLY A 1 1   ? 6.819   20.939  -12.513 1.00 0.00 ? 1   GLY A N    3  
ATOM 3042  C CA   . GLY A 1 1   ? 7.592   20.101  -11.616 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3043  C C    . GLY A 1 1   ? 8.101   18.843  -12.292 1.00 0.00 ? 1   GLY A C    3  
ATOM 3044  O O    . GLY A 1 1   ? 7.545   17.761  -12.103 1.00 0.00 ? 1   GLY A O    3  
ATOM 3045  H H1   . GLY A 1 1   ? 7.269   21.624  -13.051 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3046  H HA2  . GLY A 1 1   ? 8.436   20.667  -11.250 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3047  H HA3  . GLY A 1 1   ? 6.970   19.820  -10.779 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3048  N N    . SER A 1 2   ? 9.160   18.985  -13.083 1.00 0.00 ? 2   SER A N    3  
ATOM 3049  C CA   . SER A 1 2   ? 9.740   17.851  -13.793 1.00 0.00 ? 2   SER A CA   3  
ATOM 3050  C C    . SER A 1 2   ? 10.343  16.848  -12.815 1.00 0.00 ? 2   SER A C    3  
ATOM 3051  O O    . SER A 1 2   ? 11.536  16.896  -12.515 1.00 0.00 ? 2   SER A O    3  
ATOM 3052  C CB   . SER A 1 2   ? 10.812  18.332  -14.774 1.00 0.00 ? 2   SER A CB   3  
ATOM 3053  O OG   . SER A 1 2   ? 10.232  19.038  -15.857 1.00 0.00 ? 2   SER A OG   3  
ATOM 3054  H H    . SER A 1 2   ? 9.559   19.874  -13.192 1.00 0.00 ? 2   SER A H    3  
ATOM 3055  H HA   . SER A 1 2   ? 8.949   17.367  -14.346 1.00 0.00 ? 2   SER A HA   3  
ATOM 3056  H HB2  . SER A 1 2   ? 11.499  18.986  -14.260 1.00 0.00 ? 2   SER A HB2  3  
ATOM 3057  H HB3  . SER A 1 2   ? 11.349  17.478  -15.162 1.00 0.00 ? 2   SER A HB3  3  
ATOM 3058  H HG   . SER A 1 2   ? 9.958   19.909  -15.561 1.00 0.00 ? 2   SER A HG   3  
ATOM 3059  N N    . SER A 1 3   ? 9.508   15.939  -12.320 1.00 0.00 ? 3   SER A N    3  
ATOM 3060  C CA   . SER A 1 3   ? 9.957   14.925  -11.372 1.00 0.00 ? 3   SER A CA   3  
ATOM 3061  C C    . SER A 1 3   ? 11.348  14.417  -11.739 1.00 0.00 ? 3   SER A C    3  
ATOM 3062  O O    . SER A 1 3   ? 12.207  14.248  -10.874 1.00 0.00 ? 3   SER A O    3  
ATOM 3063  C CB   . SER A 1 3   ? 8.968   13.759  -11.335 1.00 0.00 ? 3   SER A CB   3  
ATOM 3064  O OG   . SER A 1 3   ? 9.045   13.064  -10.103 1.00 0.00 ? 3   SER A OG   3  
ATOM 3065  H H    . SER A 1 3   ? 8.568   15.952  -12.597 1.00 0.00 ? 3   SER A H    3  
ATOM 3066  H HA   . SER A 1 3   ? 9.999   15.381  -10.395 1.00 0.00 ? 3   SER A HA   3  
ATOM 3067  H HB2  . SER A 1 3   ? 7.964   14.136  -11.460 1.00 0.00 ? 3   SER A HB2  3  
ATOM 3068  H HB3  . SER A 1 3   ? 9.196   13.072  -12.138 1.00 0.00 ? 3   SER A HB3  3  
ATOM 3069  H HG   . SER A 1 3   ? 9.377   13.654  -9.423  1.00 0.00 ? 3   SER A HG   3  
ATOM 3070  N N    . GLY A 1 4   ? 11.562  14.173  -13.028 1.00 0.00 ? 4   GLY A N    3  
ATOM 3071  C CA   . GLY A 1 4   ? 12.849  13.686  -13.488 1.00 0.00 ? 4   GLY A CA   3  
ATOM 3072  C C    . GLY A 1 4   ? 12.908  12.173  -13.547 1.00 0.00 ? 4   GLY A C    3  
ATOM 3073  O O    . GLY A 1 4   ? 11.884  11.500  -13.437 1.00 0.00 ? 4   GLY A O    3  
ATOM 3074  H H    . GLY A 1 4   ? 10.839  14.326  -13.673 1.00 0.00 ? 4   GLY A H    3  
ATOM 3075  H HA2  . GLY A 1 4   ? 13.041  14.083  -14.474 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3076  H HA3  . GLY A 1 4   ? 13.616  14.038  -12.813 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3077  N N    . SER A 1 5   ? 14.112  11.636  -13.723 1.00 0.00 ? 5   SER A N    3  
ATOM 3078  C CA   . SER A 1 5   ? 14.300  10.192  -13.803 1.00 0.00 ? 5   SER A CA   3  
ATOM 3079  C C    . SER A 1 5   ? 13.496  9.602   -14.958 1.00 0.00 ? 5   SER A C    3  
ATOM 3080  O O    . SER A 1 5   ? 12.875  8.548   -14.822 1.00 0.00 ? 5   SER A O    3  
ATOM 3081  C CB   . SER A 1 5   ? 13.886  9.529   -12.488 1.00 0.00 ? 5   SER A CB   3  
ATOM 3082  O OG   . SER A 1 5   ? 14.585  8.312   -12.288 1.00 0.00 ? 5   SER A OG   3  
ATOM 3083  H H    . SER A 1 5   ? 14.891  12.225  -13.804 1.00 0.00 ? 5   SER A H    3  
ATOM 3084  H HA   . SER A 1 5   ? 15.349  10.004  -13.977 1.00 0.00 ? 5   SER A HA   3  
ATOM 3085  H HB2  . SER A 1 5   ? 14.106  10.195  -11.667 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3086  H HB3  . SER A 1 5   ? 12.826  9.323   -12.510 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3087  H HG   . SER A 1 5   ? 15.249  8.208   -12.974 1.00 0.00 ? 5   SER A HG   3  
ATOM 3088  N N    . SER A 1 6   ? 13.513  10.290  -16.095 1.00 0.00 ? 6   SER A N    3  
ATOM 3089  C CA   . SER A 1 6   ? 12.783  9.838   -17.273 1.00 0.00 ? 6   SER A CA   3  
ATOM 3090  C C    . SER A 1 6   ? 13.388  8.551   -17.826 1.00 0.00 ? 6   SER A C    3  
ATOM 3091  O O    . SER A 1 6   ? 14.603  8.360   -17.797 1.00 0.00 ? 6   SER A O    3  
ATOM 3092  C CB   . SER A 1 6   ? 12.791  10.923  -18.352 1.00 0.00 ? 6   SER A CB   3  
ATOM 3093  O OG   . SER A 1 6   ? 11.649  10.822  -19.184 1.00 0.00 ? 6   SER A OG   3  
ATOM 3094  H H    . SER A 1 6   ? 14.027  11.123  -16.141 1.00 0.00 ? 6   SER A H    3  
ATOM 3095  H HA   . SER A 1 6   ? 11.763  9.644   -16.977 1.00 0.00 ? 6   SER A HA   3  
ATOM 3096  H HB2  . SER A 1 6   ? 12.794  11.894  -17.881 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3097  H HB3  . SER A 1 6   ? 13.677  10.815  -18.961 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3098  H HG   . SER A 1 6   ? 11.416  9.898   -19.299 1.00 0.00 ? 6   SER A HG   3  
ATOM 3099  N N    . GLY A 1 7   ? 12.530  7.670   -18.331 1.00 0.00 ? 7   GLY A N    3  
ATOM 3100  C CA   . GLY A 1 7   ? 12.997  6.412   -18.884 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3101  C C    . GLY A 1 7   ? 13.918  5.669   -17.937 1.00 0.00 ? 7   GLY A C    3  
ATOM 3102  O O    . GLY A 1 7   ? 15.094  5.467   -18.235 1.00 0.00 ? 7   GLY A O    3  
ATOM 3103  H H    . GLY A 1 7   ? 11.572  7.876   -18.328 1.00 0.00 ? 7   GLY A H    3  
ATOM 3104  H HA2  . GLY A 1 7   ? 12.143  5.788   -19.103 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3105  H HA3  . GLY A 1 7   ? 13.530  6.611   -19.803 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3106  N N    . ASN A 1 8   ? 13.383  5.263   -16.790 1.00 0.00 ? 8   ASN A N    3  
ATOM 3107  C CA   . ASN A 1 8   ? 14.166  4.540   -15.795 1.00 0.00 ? 8   ASN A CA   3  
ATOM 3108  C C    . ASN A 1 8   ? 13.275  3.623   -14.963 1.00 0.00 ? 8   ASN A C    3  
ATOM 3109  O O    . ASN A 1 8   ? 12.247  4.049   -14.438 1.00 0.00 ? 8   ASN A O    3  
ATOM 3110  C CB   . ASN A 1 8   ? 14.900  5.523   -14.880 1.00 0.00 ? 8   ASN A CB   3  
ATOM 3111  C CG   . ASN A 1 8   ? 15.848  4.826   -13.924 1.00 0.00 ? 8   ASN A CG   3  
ATOM 3112  O OD1  . ASN A 1 8   ? 15.446  3.940   -13.170 1.00 0.00 ? 8   ASN A OD1  3  
ATOM 3113  N ND2  . ASN A 1 8   ? 17.115  5.224   -13.951 1.00 0.00 ? 8   ASN A ND2  3  
ATOM 3114  H H    . ASN A 1 8   ? 12.439  5.454   -16.609 1.00 0.00 ? 8   ASN A H    3  
ATOM 3115  H HA   . ASN A 1 8   ? 14.893  3.938   -16.319 1.00 0.00 ? 8   ASN A HA   3  
ATOM 3116  H HB2  . ASN A 1 8   ? 15.472  6.210   -15.487 1.00 0.00 ? 8   ASN A HB2  3  
ATOM 3117  H HB3  . ASN A 1 8   ? 14.176  6.077   -14.302 1.00 0.00 ? 8   ASN A HB3  3  
ATOM 3118  H HD21 . ASN A 1 8   ? 17.363  5.936   -14.578 1.00 0.00 ? 8   ASN A HD21 3  
ATOM 3119  H HD22 . ASN A 1 8   ? 17.749  4.790   -13.344 1.00 0.00 ? 8   ASN A HD22 3  
ATOM 3120  N N    . GLU A 1 9   ? 13.678  2.361   -14.847 1.00 0.00 ? 9   GLU A N    3  
ATOM 3121  C CA   . GLU A 1 9   ? 12.915  1.384   -14.079 1.00 0.00 ? 9   GLU A CA   3  
ATOM 3122  C C    . GLU A 1 9   ? 13.813  0.247   -13.600 1.00 0.00 ? 9   GLU A C    3  
ATOM 3123  O O    . GLU A 1 9   ? 14.766  -0.134  -14.280 1.00 0.00 ? 9   GLU A O    3  
ATOM 3124  C CB   . GLU A 1 9   ? 11.768  0.822   -14.922 1.00 0.00 ? 9   GLU A CB   3  
ATOM 3125  C CG   . GLU A 1 9   ? 10.613  0.281   -14.095 1.00 0.00 ? 9   GLU A CG   3  
ATOM 3126  C CD   . GLU A 1 9   ? 9.840   1.376   -13.387 1.00 0.00 ? 9   GLU A CD   3  
ATOM 3127  O OE1  . GLU A 1 9   ? 9.586   2.425   -14.014 1.00 0.00 ? 9   GLU A OE1  3  
ATOM 3128  O OE2  . GLU A 1 9   ? 9.489   1.183   -12.204 1.00 0.00 ? 9   GLU A OE2  3  
ATOM 3129  H H    . GLU A 1 9   ? 14.506  2.081   -15.289 1.00 0.00 ? 9   GLU A H    3  
ATOM 3130  H HA   . GLU A 1 9   ? 12.503  1.888   -13.218 1.00 0.00 ? 9   GLU A HA   3  
ATOM 3131  H HB2  . GLU A 1 9   ? 11.390  1.606   -15.562 1.00 0.00 ? 9   GLU A HB2  3  
ATOM 3132  H HB3  . GLU A 1 9   ? 12.149  0.020   -15.537 1.00 0.00 ? 9   GLU A HB3  3  
ATOM 3133  H HG2  . GLU A 1 9   ? 9.938   -0.250  -14.749 1.00 0.00 ? 9   GLU A HG2  3  
ATOM 3134  H HG3  . GLU A 1 9   ? 11.006  -0.400  -13.354 1.00 0.00 ? 9   GLU A HG3  3  
ATOM 3135  N N    . VAL A 1 10  ? 13.502  -0.291  -12.425 1.00 0.00 ? 10  VAL A N    3  
ATOM 3136  C CA   . VAL A 1 10  ? 14.280  -1.384  -11.855 1.00 0.00 ? 10  VAL A CA   3  
ATOM 3137  C C    . VAL A 1 10  ? 13.489  -2.687  -11.870 1.00 0.00 ? 10  VAL A C    3  
ATOM 3138  O O    . VAL A 1 10  ? 12.895  -3.076  -10.864 1.00 0.00 ? 10  VAL A O    3  
ATOM 3139  C CB   . VAL A 1 10  ? 14.709  -1.073  -10.408 1.00 0.00 ? 10  VAL A CB   3  
ATOM 3140  C CG1  . VAL A 1 10  ? 15.703  0.078   -10.381 1.00 0.00 ? 10  VAL A CG1  3  
ATOM 3141  C CG2  . VAL A 1 10  ? 13.493  -0.759  -9.549  1.00 0.00 ? 10  VAL A CG2  3  
ATOM 3142  H H    . VAL A 1 10  ? 12.731  0.056   -11.930 1.00 0.00 ? 10  VAL A H    3  
ATOM 3143  H HA   . VAL A 1 10  ? 15.171  -1.508  -12.453 1.00 0.00 ? 10  VAL A HA   3  
ATOM 3144  H HB   . VAL A 1 10  ? 15.194  -1.948  -10.002 1.00 0.00 ? 10  VAL A HB   3  
ATOM 3145  H HG11 . VAL A 1 10  ? 16.247  0.105   -11.314 1.00 0.00 ? 10  VAL A HG11 3  
ATOM 3146  H HG12 . VAL A 1 10  ? 15.173  1.009   -10.245 1.00 0.00 ? 10  VAL A HG12 3  
ATOM 3147  H HG13 . VAL A 1 10  ? 16.396  -0.065  -9.566  1.00 0.00 ? 10  VAL A HG13 3  
ATOM 3148  H HG21 . VAL A 1 10  ? 13.394  -1.510  -8.780  1.00 0.00 ? 10  VAL A HG21 3  
ATOM 3149  H HG22 . VAL A 1 10  ? 13.618  0.211   -9.090  1.00 0.00 ? 10  VAL A HG22 3  
ATOM 3150  H HG23 . VAL A 1 10  ? 12.607  -0.754  -10.165 1.00 0.00 ? 10  VAL A HG23 3  
ATOM 3151  N N    . ASP A 1 11  ? 13.487  -3.358  -13.016 1.00 0.00 ? 11  ASP A N    3  
ATOM 3152  C CA   . ASP A 1 11  ? 12.770  -4.619  -13.163 1.00 0.00 ? 11  ASP A CA   3  
ATOM 3153  C C    . ASP A 1 11  ? 13.734  -5.801  -13.117 1.00 0.00 ? 11  ASP A C    3  
ATOM 3154  O O    . ASP A 1 11  ? 14.198  -6.277  -14.153 1.00 0.00 ? 11  ASP A O    3  
ATOM 3155  C CB   . ASP A 1 11  ? 11.986  -4.636  -14.476 1.00 0.00 ? 11  ASP A CB   3  
ATOM 3156  C CG   . ASP A 1 11  ? 12.790  -4.085  -15.637 1.00 0.00 ? 11  ASP A CG   3  
ATOM 3157  O OD1  . ASP A 1 11  ? 13.539  -4.865  -16.262 1.00 0.00 ? 11  ASP A OD1  3  
ATOM 3158  O OD2  . ASP A 1 11  ? 12.671  -2.875  -15.921 1.00 0.00 ? 11  ASP A OD2  3  
ATOM 3159  H H    . ASP A 1 11  ? 13.980  -2.996  -13.783 1.00 0.00 ? 11  ASP A H    3  
ATOM 3160  H HA   . ASP A 1 11  ? 12.077  -4.705  -12.339 1.00 0.00 ? 11  ASP A HA   3  
ATOM 3161  H HB2  . ASP A 1 11  ? 11.705  -5.653  -14.707 1.00 0.00 ? 11  ASP A HB2  3  
ATOM 3162  H HB3  . ASP A 1 11  ? 11.094  -4.037  -14.362 1.00 0.00 ? 11  ASP A HB3  3  
ATOM 3163  N N    . ASP A 1 12  ? 14.032  -6.268  -11.910 1.00 0.00 ? 12  ASP A N    3  
ATOM 3164  C CA   . ASP A 1 12  ? 14.941  -7.394  -11.728 1.00 0.00 ? 12  ASP A CA   3  
ATOM 3165  C C    . ASP A 1 12  ? 14.235  -8.557  -11.039 1.00 0.00 ? 12  ASP A C    3  
ATOM 3166  O O    . ASP A 1 12  ? 13.266  -8.362  -10.306 1.00 0.00 ? 12  ASP A O    3  
ATOM 3167  C CB   . ASP A 1 12  ? 16.161  -6.966  -10.911 1.00 0.00 ? 12  ASP A CB   3  
ATOM 3168  C CG   . ASP A 1 12  ? 15.804  -5.991  -9.805  1.00 0.00 ? 12  ASP A CG   3  
ATOM 3169  O OD1  . ASP A 1 12  ? 15.236  -6.433  -8.785  1.00 0.00 ? 12  ASP A OD1  3  
ATOM 3170  O OD2  . ASP A 1 12  ? 16.093  -4.787  -9.961  1.00 0.00 ? 12  ASP A OD2  3  
ATOM 3171  H H    . ASP A 1 12  ? 13.630  -5.846  -11.121 1.00 0.00 ? 12  ASP A H    3  
ATOM 3172  H HA   . ASP A 1 12  ? 15.269  -7.716  -12.705 1.00 0.00 ? 12  ASP A HA   3  
ATOM 3173  H HB2  . ASP A 1 12  ? 16.611  -7.840  -10.463 1.00 0.00 ? 12  ASP A HB2  3  
ATOM 3174  H HB3  . ASP A 1 12  ? 16.877  -6.492  -11.566 1.00 0.00 ? 12  ASP A HB3  3  
ATOM 3175  N N    . MET A 1 13  ? 14.726  -9.768  -11.282 1.00 0.00 ? 13  MET A N    3  
ATOM 3176  C CA   . MET A 1 13  ? 14.141  -10.963 -10.685 1.00 0.00 ? 13  MET A CA   3  
ATOM 3177  C C    . MET A 1 13  ? 14.421  -11.015 -9.186  1.00 0.00 ? 13  MET A C    3  
ATOM 3178  O O    . MET A 1 13  ? 13.544  -11.355 -8.393  1.00 0.00 ? 13  MET A O    3  
ATOM 3179  C CB   . MET A 1 13  ? 14.692  -12.220 -11.362 1.00 0.00 ? 13  MET A CB   3  
ATOM 3180  C CG   . MET A 1 13  ? 14.047  -12.518 -12.706 1.00 0.00 ? 13  MET A CG   3  
ATOM 3181  S SD   . MET A 1 13  ? 12.426  -13.291 -12.542 1.00 0.00 ? 13  MET A SD   3  
ATOM 3182  C CE   . MET A 1 13  ? 12.429  -14.387 -13.959 1.00 0.00 ? 13  MET A CE   3  
ATOM 3183  H H    . MET A 1 13  ? 15.500  -9.861  -11.876 1.00 0.00 ? 13  MET A H    3  
ATOM 3184  H HA   . MET A 1 13  ? 13.073  -10.922 -10.838 1.00 0.00 ? 13  MET A HA   3  
ATOM 3185  H HB2  . MET A 1 13  ? 15.753  -12.095 -11.516 1.00 0.00 ? 13  MET A HB2  3  
ATOM 3186  H HB3  . MET A 1 13  ? 14.527  -13.067 -10.713 1.00 0.00 ? 13  MET A HB3  3  
ATOM 3187  H HG2  . MET A 1 13  ? 13.934  -11.592 -13.250 1.00 0.00 ? 13  MET A HG2  3  
ATOM 3188  H HG3  . MET A 1 13  ? 14.693  -13.182 -13.260 1.00 0.00 ? 13  MET A HG3  3  
ATOM 3189  H HE1  . MET A 1 13  ? 11.922  -13.909 -14.785 1.00 0.00 ? 13  MET A HE1  3  
ATOM 3190  H HE2  . MET A 1 13  ? 13.447  -14.608 -14.241 1.00 0.00 ? 13  MET A HE2  3  
ATOM 3191  H HE3  . MET A 1 13  ? 11.917  -15.304 -13.706 1.00 0.00 ? 13  MET A HE3  3  
ATOM 3192  N N    . ASP A 1 14  ? 15.648  -10.676 -8.807  1.00 0.00 ? 14  ASP A N    3  
ATOM 3193  C CA   . ASP A 1 14  ? 16.044  -10.683 -7.403  1.00 0.00 ? 14  ASP A CA   3  
ATOM 3194  C C    . ASP A 1 14  ? 15.338  -9.570  -6.634  1.00 0.00 ? 14  ASP A C    3  
ATOM 3195  O O    . ASP A 1 14  ? 15.805  -8.431  -6.602  1.00 0.00 ? 14  ASP A O    3  
ATOM 3196  C CB   . ASP A 1 14  ? 17.560  -10.526 -7.277  1.00 0.00 ? 14  ASP A CB   3  
ATOM 3197  C CG   . ASP A 1 14  ? 18.054  -10.788 -5.869  1.00 0.00 ? 14  ASP A CG   3  
ATOM 3198  O OD1  . ASP A 1 14  ? 17.687  -10.017 -4.957  1.00 0.00 ? 14  ASP A OD1  3  
ATOM 3199  O OD2  . ASP A 1 14  ? 18.807  -11.766 -5.677  1.00 0.00 ? 14  ASP A OD2  3  
ATOM 3200  H H    . ASP A 1 14  ? 16.304  -10.414 -9.487  1.00 0.00 ? 14  ASP A H    3  
ATOM 3201  H HA   . ASP A 1 14  ? 15.754  -11.634 -6.982  1.00 0.00 ? 14  ASP A HA   3  
ATOM 3202  H HB2  . ASP A 1 14  ? 18.044  -11.223 -7.945  1.00 0.00 ? 14  ASP A HB2  3  
ATOM 3203  H HB3  . ASP A 1 14  ? 17.834  -9.519  -7.554  1.00 0.00 ? 14  ASP A HB3  3  
ATOM 3204  N N    . THR A 1 15  ? 14.210  -9.907  -6.016  1.00 0.00 ? 15  THR A N    3  
ATOM 3205  C CA   . THR A 1 15  ? 13.440  -8.936  -5.250  1.00 0.00 ? 15  THR A CA   3  
ATOM 3206  C C    . THR A 1 15  ? 13.409  -9.303  -3.771  1.00 0.00 ? 15  THR A C    3  
ATOM 3207  O O    . THR A 1 15  ? 12.972  -10.393 -3.401  1.00 0.00 ? 15  THR A O    3  
ATOM 3208  C CB   . THR A 1 15  ? 11.994  -8.829  -5.771  1.00 0.00 ? 15  THR A CB   3  
ATOM 3209  O OG1  . THR A 1 15  ? 11.997  -8.653  -7.192  1.00 0.00 ? 15  THR A OG1  3  
ATOM 3210  C CG2  . THR A 1 15  ? 11.266  -7.668  -5.112  1.00 0.00 ? 15  THR A CG2  3  
ATOM 3211  H H    . THR A 1 15  ? 13.890  -10.831 -6.079  1.00 0.00 ? 15  THR A H    3  
ATOM 3212  H HA   . THR A 1 15  ? 13.913  -7.971  -5.362  1.00 0.00 ? 15  THR A HA   3  
ATOM 3213  H HB   . THR A 1 15  ? 11.472  -9.745  -5.531  1.00 0.00 ? 15  THR A HB   3  
ATOM 3214  H HG1  . THR A 1 15  ? 12.826  -8.976  -7.553  1.00 0.00 ? 15  THR A HG1  3  
ATOM 3215  H HG21 . THR A 1 15  ? 11.552  -7.607  -4.072  1.00 0.00 ? 15  THR A HG21 3  
ATOM 3216  H HG22 . THR A 1 15  ? 10.200  -7.824  -5.184  1.00 0.00 ? 15  THR A HG22 3  
ATOM 3217  H HG23 . THR A 1 15  ? 11.530  -6.748  -5.612  1.00 0.00 ? 15  THR A HG23 3  
ATOM 3218  N N    . SER A 1 16  ? 13.875  -8.386  -2.929  1.00 0.00 ? 16  SER A N    3  
ATOM 3219  C CA   . SER A 1 16  ? 13.903  -8.615  -1.489  1.00 0.00 ? 16  SER A CA   3  
ATOM 3220  C C    . SER A 1 16  ? 13.212  -7.477  -0.744  1.00 0.00 ? 16  SER A C    3  
ATOM 3221  O O    . SER A 1 16  ? 12.740  -6.518  -1.354  1.00 0.00 ? 16  SER A O    3  
ATOM 3222  C CB   . SER A 1 16  ? 15.347  -8.756  -1.002  1.00 0.00 ? 16  SER A CB   3  
ATOM 3223  O OG   . SER A 1 16  ? 16.019  -7.509  -1.032  1.00 0.00 ? 16  SER A OG   3  
ATOM 3224  H H    . SER A 1 16  ? 14.210  -7.537  -3.285  1.00 0.00 ? 16  SER A H    3  
ATOM 3225  H HA   . SER A 1 16  ? 13.374  -9.535  -1.289  1.00 0.00 ? 16  SER A HA   3  
ATOM 3226  H HB2  . SER A 1 16  ? 15.348  -9.127  0.012   1.00 0.00 ? 16  SER A HB2  3  
ATOM 3227  H HB3  . SER A 1 16  ? 15.873  -9.451  -1.640  1.00 0.00 ? 16  SER A HB3  3  
ATOM 3228  H HG   . SER A 1 16  ? 15.486  -6.847  -0.588  1.00 0.00 ? 16  SER A HG   3  
ATOM 3229  N N    . ASP A 1 17  ? 13.157  -7.592  0.578   1.00 0.00 ? 17  ASP A N    3  
ATOM 3230  C CA   . ASP A 1 17  ? 12.524  -6.573  1.408   1.00 0.00 ? 17  ASP A CA   3  
ATOM 3231  C C    . ASP A 1 17  ? 12.746  -5.182  0.824   1.00 0.00 ? 17  ASP A C    3  
ATOM 3232  O O    . ASP A 1 17  ? 13.874  -4.689  0.776   1.00 0.00 ? 17  ASP A O    3  
ATOM 3233  C CB   . ASP A 1 17  ? 13.073  -6.635  2.835   1.00 0.00 ? 17  ASP A CB   3  
ATOM 3234  C CG   . ASP A 1 17  ? 14.579  -6.805  2.869   1.00 0.00 ? 17  ASP A CG   3  
ATOM 3235  O OD1  . ASP A 1 17  ? 15.050  -7.954  2.738   1.00 0.00 ? 17  ASP A OD1  3  
ATOM 3236  O OD2  . ASP A 1 17  ? 15.287  -5.788  3.026   1.00 0.00 ? 17  ASP A OD2  3  
ATOM 3237  H H    . ASP A 1 17  ? 13.551  -8.381  1.007   1.00 0.00 ? 17  ASP A H    3  
ATOM 3238  H HA   . ASP A 1 17  ? 11.464  -6.775  1.431   1.00 0.00 ? 17  ASP A HA   3  
ATOM 3239  H HB2  . ASP A 1 17  ? 12.821  -5.719  3.350   1.00 0.00 ? 17  ASP A HB2  3  
ATOM 3240  H HB3  . ASP A 1 17  ? 12.622  -7.469  3.351   1.00 0.00 ? 17  ASP A HB3  3  
ATOM 3241  N N    . THR A 1 18  ? 11.663  -4.552  0.380   1.00 0.00 ? 18  THR A N    3  
ATOM 3242  C CA   . THR A 1 18  ? 11.739  -3.219  -0.203  1.00 0.00 ? 18  THR A CA   3  
ATOM 3243  C C    . THR A 1 18  ? 10.436  -2.454  0.000   1.00 0.00 ? 18  THR A C    3  
ATOM 3244  O O    . THR A 1 18  ? 9.473   -2.988  0.550   1.00 0.00 ? 18  THR A O    3  
ATOM 3245  C CB   . THR A 1 18  ? 12.055  -3.282  -1.710  1.00 0.00 ? 18  THR A CB   3  
ATOM 3246  O OG1  . THR A 1 18  ? 12.583  -2.026  -2.152  1.00 0.00 ? 18  THR A OG1  3  
ATOM 3247  C CG2  . THR A 1 18  ? 10.807  -3.623  -2.510  1.00 0.00 ? 18  THR A CG2  3  
ATOM 3248  H H    . THR A 1 18  ? 10.792  -4.997  0.446   1.00 0.00 ? 18  THR A H    3  
ATOM 3249  H HA   . THR A 1 18  ? 12.539  -2.685  0.289   1.00 0.00 ? 18  THR A HA   3  
ATOM 3250  H HB   . THR A 1 18  ? 12.793  -4.053  -1.875  1.00 0.00 ? 18  THR A HB   3  
ATOM 3251  H HG1  . THR A 1 18  ? 13.414  -1.853  -1.703  1.00 0.00 ? 18  THR A HG1  3  
ATOM 3252  H HG21 . THR A 1 18  ? 10.533  -2.779  -3.126  1.00 0.00 ? 18  THR A HG21 3  
ATOM 3253  H HG22 . THR A 1 18  ? 9.998   -3.854  -1.834  1.00 0.00 ? 18  THR A HG22 3  
ATOM 3254  H HG23 . THR A 1 18  ? 11.006  -4.478  -3.139  1.00 0.00 ? 18  THR A HG23 3  
ATOM 3255  N N    . GLN A 1 19  ? 10.413  -1.204  -0.449  1.00 0.00 ? 19  GLN A N    3  
ATOM 3256  C CA   . GLN A 1 19  ? 9.226   -0.367  -0.316  1.00 0.00 ? 19  GLN A CA   3  
ATOM 3257  C C    . GLN A 1 19  ? 8.147   -0.791  -1.307  1.00 0.00 ? 19  GLN A C    3  
ATOM 3258  O O    . GLN A 1 19  ? 8.355   -0.754  -2.519  1.00 0.00 ? 19  GLN A O    3  
ATOM 3259  C CB   . GLN A 1 19  ? 9.586   1.104   -0.535  1.00 0.00 ? 19  GLN A CB   3  
ATOM 3260  C CG   . GLN A 1 19  ? 10.201  1.768   0.687   1.00 0.00 ? 19  GLN A CG   3  
ATOM 3261  C CD   . GLN A 1 19  ? 11.020  2.994   0.334   1.00 0.00 ? 19  GLN A CD   3  
ATOM 3262  O OE1  . GLN A 1 19  ? 11.294  3.256   -0.837  1.00 0.00 ? 19  GLN A OE1  3  
ATOM 3263  N NE2  . GLN A 1 19  ? 11.416  3.754   1.349   1.00 0.00 ? 19  GLN A NE2  3  
ATOM 3264  H H    . GLN A 1 19  ? 11.212  -0.835  -0.879  1.00 0.00 ? 19  GLN A H    3  
ATOM 3265  H HA   . GLN A 1 19  ? 8.845   -0.489  0.687   1.00 0.00 ? 19  GLN A HA   3  
ATOM 3266  H HB2  . GLN A 1 19  ? 10.292  1.172   -1.349  1.00 0.00 ? 19  GLN A HB2  3  
ATOM 3267  H HB3  . GLN A 1 19  ? 8.690   1.646   -0.799  1.00 0.00 ? 19  GLN A HB3  3  
ATOM 3268  H HG2  . GLN A 1 19  ? 9.408   2.064   1.357   1.00 0.00 ? 19  GLN A HG2  3  
ATOM 3269  H HG3  . GLN A 1 19  ? 10.842  1.054   1.183   1.00 0.00 ? 19  GLN A HG3  3  
ATOM 3270  H HE21 . GLN A 1 19  ? 11.161  3.482   2.257   1.00 0.00 ? 19  GLN A HE21 3  
ATOM 3271  H HE22 . GLN A 1 19  ? 11.947  4.551   1.150   1.00 0.00 ? 19  GLN A HE22 3  
ATOM 3272  N N    . TRP A 1 20  ? 6.995   -1.193  -0.782  1.00 0.00 ? 20  TRP A N    3  
ATOM 3273  C CA   . TRP A 1 20  ? 5.883   -1.625  -1.621  1.00 0.00 ? 20  TRP A CA   3  
ATOM 3274  C C    . TRP A 1 20  ? 4.671   -0.721  -1.425  1.00 0.00 ? 20  TRP A C    3  
ATOM 3275  O O    . TRP A 1 20  ? 4.209   -0.521  -0.303  1.00 0.00 ? 20  TRP A O    3  
ATOM 3276  C CB   . TRP A 1 20  ? 5.511   -3.074  -1.304  1.00 0.00 ? 20  TRP A CB   3  
ATOM 3277  C CG   . TRP A 1 20  ? 6.631   -4.041  -1.542  1.00 0.00 ? 20  TRP A CG   3  
ATOM 3278  C CD1  . TRP A 1 20  ? 7.562   -4.457  -0.633  1.00 0.00 ? 20  TRP A CD1  3  
ATOM 3279  C CD2  . TRP A 1 20  ? 6.939   -4.711  -2.769  1.00 0.00 ? 20  TRP A CD2  3  
ATOM 3280  N NE1  . TRP A 1 20  ? 8.429   -5.345  -1.221  1.00 0.00 ? 20  TRP A NE1  3  
ATOM 3281  C CE2  . TRP A 1 20  ? 8.068   -5.518  -2.531  1.00 0.00 ? 20  TRP A CE2  3  
ATOM 3282  C CE3  . TRP A 1 20  ? 6.369   -4.709  -4.045  1.00 0.00 ? 20  TRP A CE3  3  
ATOM 3283  C CZ2  . TRP A 1 20  ? 8.637   -6.313  -3.523  1.00 0.00 ? 20  TRP A CZ2  3  
ATOM 3284  C CZ3  . TRP A 1 20  ? 6.935   -5.498  -5.028  1.00 0.00 ? 20  TRP A CZ3  3  
ATOM 3285  C CH2  . TRP A 1 20  ? 8.059   -6.291  -4.763  1.00 0.00 ? 20  TRP A CH2  3  
ATOM 3286  H H    . TRP A 1 20  ? 6.890   -1.201  0.193   1.00 0.00 ? 20  TRP A H    3  
ATOM 3287  H HA   . TRP A 1 20  ? 6.202   -1.562  -2.651  1.00 0.00 ? 20  TRP A HA   3  
ATOM 3288  H HB2  . TRP A 1 20  ? 5.223   -3.147  -0.266  1.00 0.00 ? 20  TRP A HB2  3  
ATOM 3289  H HB3  . TRP A 1 20  ? 4.678   -3.369  -1.926  1.00 0.00 ? 20  TRP A HB3  3  
ATOM 3290  H HD1  . TRP A 1 20  ? 7.599   -4.126  0.394   1.00 0.00 ? 20  TRP A HD1  3  
ATOM 3291  H HE1  . TRP A 1 20  ? 9.184   -5.784  -0.775  1.00 0.00 ? 20  TRP A HE1  3  
ATOM 3292  H HE3  . TRP A 1 20  ? 5.502   -4.104  -4.269  1.00 0.00 ? 20  TRP A HE3  3  
ATOM 3293  H HZ2  . TRP A 1 20  ? 9.503   -6.930  -3.334  1.00 0.00 ? 20  TRP A HZ2  3  
ATOM 3294  H HZ3  . TRP A 1 20  ? 6.508   -5.509  -6.021  1.00 0.00 ? 20  TRP A HZ3  3  
ATOM 3295  H HH2  . TRP A 1 20  ? 8.468   -6.891  -5.561  1.00 0.00 ? 20  TRP A HH2  3  
ATOM 3296  N N    . GLY A 1 21  ? 4.159   -0.178  -2.526  1.00 0.00 ? 21  GLY A N    3  
ATOM 3297  C CA   . GLY A 1 21  ? 3.004   0.698   -2.452  1.00 0.00 ? 21  GLY A CA   3  
ATOM 3298  C C    . GLY A 1 21  ? 1.898   0.279   -3.399  1.00 0.00 ? 21  GLY A C    3  
ATOM 3299  O O    . GLY A 1 21  ? 2.149   -0.392  -4.400  1.00 0.00 ? 21  GLY A O    3  
ATOM 3300  H H    . GLY A 1 21  ? 4.569   -0.373  -3.394  1.00 0.00 ? 21  GLY A H    3  
ATOM 3301  H HA2  . GLY A 1 21  ? 2.623   0.689   -1.442  1.00 0.00 ? 21  GLY A HA2  3  
ATOM 3302  H HA3  . GLY A 1 21  ? 3.313   1.703   -2.700  1.00 0.00 ? 21  GLY A HA3  3  
ATOM 3303  N N    . TRP A 1 22  ? 0.670   0.675   -3.083  1.00 0.00 ? 22  TRP A N    3  
ATOM 3304  C CA   . TRP A 1 22  ? -0.480  0.334   -3.913  1.00 0.00 ? 22  TRP A CA   3  
ATOM 3305  C C    . TRP A 1 22  ? -0.820  1.474   -4.867  1.00 0.00 ? 22  TRP A C    3  
ATOM 3306  O O    . TRP A 1 22  ? -0.676  2.648   -4.523  1.00 0.00 ? 22  TRP A O    3  
ATOM 3307  C CB   . TRP A 1 22  ? -1.690  0.008   -3.036  1.00 0.00 ? 22  TRP A CB   3  
ATOM 3308  C CG   . TRP A 1 22  ? -1.767  -1.436  -2.643  1.00 0.00 ? 22  TRP A CG   3  
ATOM 3309  C CD1  . TRP A 1 22  ? -1.020  -2.066  -1.688  1.00 0.00 ? 22  TRP A CD1  3  
ATOM 3310  C CD2  . TRP A 1 22  ? -2.637  -2.429  -3.195  1.00 0.00 ? 22  TRP A CD2  3  
ATOM 3311  N NE1  . TRP A 1 22  ? -1.374  -3.392  -1.614  1.00 0.00 ? 22  TRP A NE1  3  
ATOM 3312  C CE2  . TRP A 1 22  ? -2.364  -3.640  -2.528  1.00 0.00 ? 22  TRP A CE2  3  
ATOM 3313  C CE3  . TRP A 1 22  ? -3.621  -2.414  -4.187  1.00 0.00 ? 22  TRP A CE3  3  
ATOM 3314  C CZ2  . TRP A 1 22  ? -3.040  -4.821  -2.823  1.00 0.00 ? 22  TRP A CZ2  3  
ATOM 3315  C CZ3  . TRP A 1 22  ? -4.291  -3.587  -4.479  1.00 0.00 ? 22  TRP A CZ3  3  
ATOM 3316  C CH2  . TRP A 1 22  ? -3.999  -4.777  -3.798  1.00 0.00 ? 22  TRP A CH2  3  
ATOM 3317  H H    . TRP A 1 22  ? 0.533   1.208   -2.272  1.00 0.00 ? 22  TRP A H    3  
ATOM 3318  H HA   . TRP A 1 22  ? -0.222  -0.540  -4.493  1.00 0.00 ? 22  TRP A HA   3  
ATOM 3319  H HB2  . TRP A 1 22  ? -1.641  0.598   -2.133  1.00 0.00 ? 22  TRP A HB2  3  
ATOM 3320  H HB3  . TRP A 1 22  ? -2.593  0.256   -3.575  1.00 0.00 ? 22  TRP A HB3  3  
ATOM 3321  H HD1  . TRP A 1 22  ? -0.265  -1.581  -1.089  1.00 0.00 ? 22  TRP A HD1  3  
ATOM 3322  H HE1  . TRP A 1 22  ? -0.982  -4.052  -1.005  1.00 0.00 ? 22  TRP A HE1  3  
ATOM 3323  H HE3  . TRP A 1 22  ? -3.860  -1.507  -4.723  1.00 0.00 ? 22  TRP A HE3  3  
ATOM 3324  H HZ2  . TRP A 1 22  ? -2.827  -5.745  -2.307  1.00 0.00 ? 22  TRP A HZ2  3  
ATOM 3325  H HZ3  . TRP A 1 22  ? -5.054  -3.595  -5.243  1.00 0.00 ? 22  TRP A HZ3  3  
ATOM 3326  H HH2  . TRP A 1 22  ? -4.546  -5.669  -4.059  1.00 0.00 ? 22  TRP A HH2  3  
ATOM 3327  N N    . PHE A 1 23  ? -1.272  1.122   -6.066  1.00 0.00 ? 23  PHE A N    3  
ATOM 3328  C CA   . PHE A 1 23  ? -1.632  2.118   -7.070  1.00 0.00 ? 23  PHE A CA   3  
ATOM 3329  C C    . PHE A 1 23  ? -2.984  1.792   -7.697  1.00 0.00 ? 23  PHE A C    3  
ATOM 3330  O O    . PHE A 1 23  ? -3.442  0.650   -7.654  1.00 0.00 ? 23  PHE A O    3  
ATOM 3331  C CB   . PHE A 1 23  ? -0.557  2.189   -8.156  1.00 0.00 ? 23  PHE A CB   3  
ATOM 3332  C CG   . PHE A 1 23  ? 0.769   2.687   -7.655  1.00 0.00 ? 23  PHE A CG   3  
ATOM 3333  C CD1  . PHE A 1 23  ? 1.574   1.880   -6.866  1.00 0.00 ? 23  PHE A CD1  3  
ATOM 3334  C CD2  . PHE A 1 23  ? 1.211   3.961   -7.974  1.00 0.00 ? 23  PHE A CD2  3  
ATOM 3335  C CE1  . PHE A 1 23  ? 2.794   2.336   -6.404  1.00 0.00 ? 23  PHE A CE1  3  
ATOM 3336  C CE2  . PHE A 1 23  ? 2.431   4.422   -7.515  1.00 0.00 ? 23  PHE A CE2  3  
ATOM 3337  C CZ   . PHE A 1 23  ? 3.223   3.608   -6.729  1.00 0.00 ? 23  PHE A CZ   3  
ATOM 3338  H H    . PHE A 1 23  ? -1.365  0.171   -6.281  1.00 0.00 ? 23  PHE A H    3  
ATOM 3339  H HA   . PHE A 1 23  ? -1.698  3.075   -6.577  1.00 0.00 ? 23  PHE A HA   3  
ATOM 3340  H HB2  . PHE A 1 23  ? -0.406  1.203   -8.569  1.00 0.00 ? 23  PHE A HB2  3  
ATOM 3341  H HB3  . PHE A 1 23  ? -0.889  2.855   -8.938  1.00 0.00 ? 23  PHE A HB3  3  
ATOM 3342  H HD1  . PHE A 1 23  ? 1.240   0.885   -6.612  1.00 0.00 ? 23  PHE A HD1  3  
ATOM 3343  H HD2  . PHE A 1 23  ? 0.591   4.598   -8.589  1.00 0.00 ? 23  PHE A HD2  3  
ATOM 3344  H HE1  . PHE A 1 23  ? 3.412   1.698   -5.790  1.00 0.00 ? 23  PHE A HE1  3  
ATOM 3345  H HE2  . PHE A 1 23  ? 2.763   5.417   -7.771  1.00 0.00 ? 23  PHE A HE2  3  
ATOM 3346  H HZ   . PHE A 1 23  ? 4.176   3.967   -6.369  1.00 0.00 ? 23  PHE A HZ   3  
ATOM 3347  N N    . TYR A 1 24  ? -3.618  2.804   -8.279  1.00 0.00 ? 24  TYR A N    3  
ATOM 3348  C CA   . TYR A 1 24  ? -4.919  2.628   -8.913  1.00 0.00 ? 24  TYR A CA   3  
ATOM 3349  C C    . TYR A 1 24  ? -5.058  3.534   -10.132 1.00 0.00 ? 24  TYR A C    3  
ATOM 3350  O O    . TYR A 1 24  ? -4.909  4.753   -10.035 1.00 0.00 ? 24  TYR A O    3  
ATOM 3351  C CB   . TYR A 1 24  ? -6.040  2.922   -7.915  1.00 0.00 ? 24  TYR A CB   3  
ATOM 3352  C CG   . TYR A 1 24  ? -6.243  4.397   -7.649  1.00 0.00 ? 24  TYR A CG   3  
ATOM 3353  C CD1  . TYR A 1 24  ? -5.533  5.046   -6.646  1.00 0.00 ? 24  TYR A CD1  3  
ATOM 3354  C CD2  . TYR A 1 24  ? -7.145  5.141   -8.400  1.00 0.00 ? 24  TYR A CD2  3  
ATOM 3355  C CE1  . TYR A 1 24  ? -5.716  6.393   -6.399  1.00 0.00 ? 24  TYR A CE1  3  
ATOM 3356  C CE2  . TYR A 1 24  ? -7.333  6.488   -8.161  1.00 0.00 ? 24  TYR A CE2  3  
ATOM 3357  C CZ   . TYR A 1 24  ? -6.616  7.110   -7.160  1.00 0.00 ? 24  TYR A CZ   3  
ATOM 3358  O OH   . TYR A 1 24  ? -6.802  8.452   -6.918  1.00 0.00 ? 24  TYR A OH   3  
ATOM 3359  H H    . TYR A 1 24  ? -3.202  3.692   -8.281  1.00 0.00 ? 24  TYR A H    3  
ATOM 3360  H HA   . TYR A 1 24  ? -4.995  1.599   -9.233  1.00 0.00 ? 24  TYR A HA   3  
ATOM 3361  H HB2  . TYR A 1 24  ? -6.967  2.524   -8.298  1.00 0.00 ? 24  TYR A HB2  3  
ATOM 3362  H HB3  . TYR A 1 24  ? -5.810  2.444   -6.974  1.00 0.00 ? 24  TYR A HB3  3  
ATOM 3363  H HD1  . TYR A 1 24  ? -4.829  4.482   -6.052  1.00 0.00 ? 24  TYR A HD1  3  
ATOM 3364  H HD2  . TYR A 1 24  ? -7.705  4.651   -9.184  1.00 0.00 ? 24  TYR A HD2  3  
ATOM 3365  H HE1  . TYR A 1 24  ? -5.155  6.880   -5.615  1.00 0.00 ? 24  TYR A HE1  3  
ATOM 3366  H HE2  . TYR A 1 24  ? -8.038  7.050   -8.756  1.00 0.00 ? 24  TYR A HE2  3  
ATOM 3367  H HH   . TYR A 1 24  ? -6.457  8.671   -6.049  1.00 0.00 ? 24  TYR A HH   3  
ATOM 3368  N N    . LEU A 1 25  ? -5.345  2.931   -11.280 1.00 0.00 ? 25  LEU A N    3  
ATOM 3369  C CA   . LEU A 1 25  ? -5.506  3.681   -12.521 1.00 0.00 ? 25  LEU A CA   3  
ATOM 3370  C C    . LEU A 1 25  ? -6.496  4.827   -12.339 1.00 0.00 ? 25  LEU A C    3  
ATOM 3371  O O    . LEU A 1 25  ? -7.325  4.806   -11.430 1.00 0.00 ? 25  LEU A O    3  
ATOM 3372  C CB   . LEU A 1 25  ? -5.979  2.756   -13.643 1.00 0.00 ? 25  LEU A CB   3  
ATOM 3373  C CG   . LEU A 1 25  ? -6.036  3.371   -15.041 1.00 0.00 ? 25  LEU A CG   3  
ATOM 3374  C CD1  . LEU A 1 25  ? -4.633  3.589   -15.586 1.00 0.00 ? 25  LEU A CD1  3  
ATOM 3375  C CD2  . LEU A 1 25  ? -6.844  2.487   -15.980 1.00 0.00 ? 25  LEU A CD2  3  
ATOM 3376  H H    . LEU A 1 25  ? -5.452  1.957   -11.295 1.00 0.00 ? 25  LEU A H    3  
ATOM 3377  H HA   . LEU A 1 25  ? -4.543  4.092   -12.786 1.00 0.00 ? 25  LEU A HA   3  
ATOM 3378  H HB2  . LEU A 1 25  ? -5.309  1.911   -13.680 1.00 0.00 ? 25  LEU A HB2  3  
ATOM 3379  H HB3  . LEU A 1 25  ? -6.973  2.413   -13.390 1.00 0.00 ? 25  LEU A HB3  3  
ATOM 3380  H HG   . LEU A 1 25  ? -6.525  4.334   -14.985 1.00 0.00 ? 25  LEU A HG   3  
ATOM 3381  H HD11 . LEU A 1 25  ? -4.025  4.067   -14.833 1.00 0.00 ? 25  LEU A HD11 3  
ATOM 3382  H HD12 . LEU A 1 25  ? -4.681  4.217   -16.463 1.00 0.00 ? 25  LEU A HD12 3  
ATOM 3383  H HD13 . LEU A 1 25  ? -4.198  2.636   -15.850 1.00 0.00 ? 25  LEU A HD13 3  
ATOM 3384  H HD21 . LEU A 1 25  ? -6.687  1.450   -15.721 1.00 0.00 ? 25  LEU A HD21 3  
ATOM 3385  H HD22 . LEU A 1 25  ? -6.523  2.655   -16.998 1.00 0.00 ? 25  LEU A HD22 3  
ATOM 3386  H HD23 . LEU A 1 25  ? -7.892  2.727   -15.888 1.00 0.00 ? 25  LEU A HD23 3  
ATOM 3387  N N    . ALA A 1 26  ? -6.404  5.826   -13.212 1.00 0.00 ? 26  ALA A N    3  
ATOM 3388  C CA   . ALA A 1 26  ? -7.294  6.978   -13.150 1.00 0.00 ? 26  ALA A CA   3  
ATOM 3389  C C    . ALA A 1 26  ? -7.821  7.339   -14.535 1.00 0.00 ? 26  ALA A C    3  
ATOM 3390  O O    . ALA A 1 26  ? -7.220  6.986   -15.549 1.00 0.00 ? 26  ALA A O    3  
ATOM 3391  C CB   . ALA A 1 26  ? -6.575  8.168   -12.531 1.00 0.00 ? 26  ALA A CB   3  
ATOM 3392  H H    . ALA A 1 26  ? -5.722  5.785   -13.914 1.00 0.00 ? 26  ALA A H    3  
ATOM 3393  H HA   . ALA A 1 26  ? -8.129  6.722   -12.514 1.00 0.00 ? 26  ALA A HA   3  
ATOM 3394  H HB1  . ALA A 1 26  ? -7.072  9.081   -12.826 1.00 0.00 ? 26  ALA A HB1  3  
ATOM 3395  H HB2  . ALA A 1 26  ? -6.594  8.079   -11.455 1.00 0.00 ? 26  ALA A HB2  3  
ATOM 3396  H HB3  . ALA A 1 26  ? -5.552  8.188   -12.873 1.00 0.00 ? 26  ALA A HB3  3  
ATOM 3397  N N    . GLU A 1 27  ? -8.948  8.044   -14.569 1.00 0.00 ? 27  GLU A N    3  
ATOM 3398  C CA   . GLU A 1 27  ? -9.556  8.450   -15.831 1.00 0.00 ? 27  GLU A CA   3  
ATOM 3399  C C    . GLU A 1 27  ? -8.560  9.223   -16.690 1.00 0.00 ? 27  GLU A C    3  
ATOM 3400  O O    . GLU A 1 27  ? -8.515  9.056   -17.910 1.00 0.00 ? 27  GLU A O    3  
ATOM 3401  C CB   . GLU A 1 27  ? -10.796 9.308   -15.572 1.00 0.00 ? 27  GLU A CB   3  
ATOM 3402  C CG   . GLU A 1 27  ? -12.053 8.497   -15.309 1.00 0.00 ? 27  GLU A CG   3  
ATOM 3403  C CD   . GLU A 1 27  ? -13.241 9.364   -14.941 1.00 0.00 ? 27  GLU A CD   3  
ATOM 3404  O OE1  . GLU A 1 27  ? -13.030 10.427  -14.321 1.00 0.00 ? 27  GLU A OE1  3  
ATOM 3405  O OE2  . GLU A 1 27  ? -14.382 8.980   -15.272 1.00 0.00 ? 27  GLU A OE2  3  
ATOM 3406  H H    . GLU A 1 27  ? -9.380  8.296   -13.727 1.00 0.00 ? 27  GLU A H    3  
ATOM 3407  H HA   . GLU A 1 27  ? -9.852  7.557   -16.359 1.00 0.00 ? 27  GLU A HA   3  
ATOM 3408  H HB2  . GLU A 1 27  ? -10.611 9.937   -14.713 1.00 0.00 ? 27  GLU A HB2  3  
ATOM 3409  H HB3  . GLU A 1 27  ? -10.971 9.935   -16.434 1.00 0.00 ? 27  GLU A HB3  3  
ATOM 3410  H HG2  . GLU A 1 27  ? -12.298 7.937   -16.200 1.00 0.00 ? 27  GLU A HG2  3  
ATOM 3411  H HG3  . GLU A 1 27  ? -11.861 7.811   -14.496 1.00 0.00 ? 27  GLU A HG3  3  
ATOM 3412  N N    . CYS A 1 28  ? -7.764  10.070  -16.047 1.00 0.00 ? 28  CYS A N    3  
ATOM 3413  C CA   . CYS A 1 28  ? -6.769  10.871  -16.752 1.00 0.00 ? 28  CYS A CA   3  
ATOM 3414  C C    . CYS A 1 28  ? -5.820  9.981   -17.547 1.00 0.00 ? 28  CYS A C    3  
ATOM 3415  O O    . CYS A 1 28  ? -5.328  10.371  -18.606 1.00 0.00 ? 28  CYS A O    3  
ATOM 3416  C CB   . CYS A 1 28  ? -5.977  11.725  -15.761 1.00 0.00 ? 28  CYS A CB   3  
ATOM 3417  S SG   . CYS A 1 28  ? -5.425  10.830  -14.291 1.00 0.00 ? 28  CYS A SG   3  
ATOM 3418  H H    . CYS A 1 28  ? -7.848  10.160  -15.074 1.00 0.00 ? 28  CYS A H    3  
ATOM 3419  H HA   . CYS A 1 28  ? -7.293  11.521  -17.436 1.00 0.00 ? 28  CYS A HA   3  
ATOM 3420  H HB2  . CYS A 1 28  ? -5.100  12.116  -16.255 1.00 0.00 ? 28  CYS A HB2  3  
ATOM 3421  H HB3  . CYS A 1 28  ? -6.594  12.549  -15.434 1.00 0.00 ? 28  CYS A HB3  3  
ATOM 3422  H HG   . CYS A 1 28  ? -5.331  9.547   -14.605 1.00 0.00 ? 28  CYS A HG   3  
ATOM 3423  N N    . GLY A 1 29  ? -5.566  8.783   -17.029 1.00 0.00 ? 29  GLY A N    3  
ATOM 3424  C CA   . GLY A 1 29  ? -4.675  7.858   -17.704 1.00 0.00 ? 29  GLY A CA   3  
ATOM 3425  C C    . GLY A 1 29  ? -3.535  7.398   -16.816 1.00 0.00 ? 29  GLY A C    3  
ATOM 3426  O O    . GLY A 1 29  ? -3.159  6.226   -16.832 1.00 0.00 ? 29  GLY A O    3  
ATOM 3427  H H    . GLY A 1 29  ? -5.987  8.526   -16.182 1.00 0.00 ? 29  GLY A H    3  
ATOM 3428  H HA2  . GLY A 1 29  ? -5.241  6.995   -18.020 1.00 0.00 ? 29  GLY A HA2  3  
ATOM 3429  H HA3  . GLY A 1 29  ? -4.262  8.344   -18.576 1.00 0.00 ? 29  GLY A HA3  3  
ATOM 3430  N N    . LYS A 1 30  ? -2.983  8.324   -16.039 1.00 0.00 ? 30  LYS A N    3  
ATOM 3431  C CA   . LYS A 1 30  ? -1.879  8.010   -15.140 1.00 0.00 ? 30  LYS A CA   3  
ATOM 3432  C C    . LYS A 1 30  ? -2.393  7.401   -13.839 1.00 0.00 ? 30  LYS A C    3  
ATOM 3433  O O    . LYS A 1 30  ? -3.408  7.839   -13.297 1.00 0.00 ? 30  LYS A O    3  
ATOM 3434  C CB   . LYS A 1 30  ? -1.064  9.270   -14.839 1.00 0.00 ? 30  LYS A CB   3  
ATOM 3435  C CG   . LYS A 1 30  ? -0.019  9.586   -15.894 1.00 0.00 ? 30  LYS A CG   3  
ATOM 3436  C CD   . LYS A 1 30  ? 0.949   10.656  -15.418 1.00 0.00 ? 30  LYS A CD   3  
ATOM 3437  C CE   . LYS A 1 30  ? 2.081   10.058  -14.597 1.00 0.00 ? 30  LYS A CE   3  
ATOM 3438  N NZ   . LYS A 1 30  ? 3.218   11.007  -14.446 1.00 0.00 ? 30  LYS A NZ   3  
ATOM 3439  H H    . LYS A 1 30  ? -3.327  9.242   -16.071 1.00 0.00 ? 30  LYS A H    3  
ATOM 3440  H HA   . LYS A 1 30  ? -1.243  7.290   -15.634 1.00 0.00 ? 30  LYS A HA   3  
ATOM 3441  H HB2  . LYS A 1 30  ? -1.738  10.111  -14.766 1.00 0.00 ? 30  LYS A HB2  3  
ATOM 3442  H HB3  . LYS A 1 30  ? -0.561  9.141   -13.891 1.00 0.00 ? 30  LYS A HB3  3  
ATOM 3443  H HG2  . LYS A 1 30  ? 0.536   8.687   -16.118 1.00 0.00 ? 30  LYS A HG2  3  
ATOM 3444  H HG3  . LYS A 1 30  ? -0.517  9.935   -16.788 1.00 0.00 ? 30  LYS A HG3  3  
ATOM 3445  H HD2  . LYS A 1 30  ? 1.369   11.157  -16.278 1.00 0.00 ? 30  LYS A HD2  3  
ATOM 3446  H HD3  . LYS A 1 30  ? 0.412   11.370  -14.810 1.00 0.00 ? 30  LYS A HD3  3  
ATOM 3447  H HE2  . LYS A 1 30  ? 1.703   9.805   -13.618 1.00 0.00 ? 30  LYS A HE2  3  
ATOM 3448  H HE3  . LYS A 1 30  ? 2.432   9.163   -15.089 1.00 0.00 ? 30  LYS A HE3  3  
ATOM 3449  H HZ1  . LYS A 1 30  ? 3.977   10.569  -13.885 1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 3450  H HZ2  . LYS A 1 30  ? 2.901   11.872  -13.964 1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 3451  H HZ3  . LYS A 1 30  ? 3.596   11.263  -15.381 1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 3452  N N    . TRP A 1 31  ? -1.686  6.392   -13.344 1.00 0.00 ? 31  TRP A N    3  
ATOM 3453  C CA   . TRP A 1 31  ? -2.071  5.724   -12.106 1.00 0.00 ? 31  TRP A CA   3  
ATOM 3454  C C    . TRP A 1 31  ? -1.788  6.611   -10.898 1.00 0.00 ? 31  TRP A C    3  
ATOM 3455  O O    . TRP A 1 31  ? -0.881  7.444   -10.927 1.00 0.00 ? 31  TRP A O    3  
ATOM 3456  C CB   . TRP A 1 31  ? -1.325  4.396   -11.965 1.00 0.00 ? 31  TRP A CB   3  
ATOM 3457  C CG   . TRP A 1 31  ? -1.604  3.437   -13.082 1.00 0.00 ? 31  TRP A CG   3  
ATOM 3458  C CD1  . TRP A 1 31  ? -1.282  3.598   -14.400 1.00 0.00 ? 31  TRP A CD1  3  
ATOM 3459  C CD2  . TRP A 1 31  ? -2.262  2.170   -12.980 1.00 0.00 ? 31  TRP A CD2  3  
ATOM 3460  N NE1  . TRP A 1 31  ? -1.701  2.507   -15.123 1.00 0.00 ? 31  TRP A NE1  3  
ATOM 3461  C CE2  . TRP A 1 31  ? -2.304  1.616   -14.274 1.00 0.00 ? 31  TRP A CE2  3  
ATOM 3462  C CE3  . TRP A 1 31  ? -2.818  1.448   -11.920 1.00 0.00 ? 31  TRP A CE3  3  
ATOM 3463  C CZ2  . TRP A 1 31  ? -2.882  0.376   -14.535 1.00 0.00 ? 31  TRP A CZ2  3  
ATOM 3464  C CZ3  . TRP A 1 31  ? -3.391  0.217   -12.181 1.00 0.00 ? 31  TRP A CZ3  3  
ATOM 3465  C CH2  . TRP A 1 31  ? -3.418  -0.309  -13.479 1.00 0.00 ? 31  TRP A CH2  3  
ATOM 3466  H H    . TRP A 1 31  ? -0.886  6.087   -13.822 1.00 0.00 ? 31  TRP A H    3  
ATOM 3467  H HA   . TRP A 1 31  ? -3.132  5.528   -12.152 1.00 0.00 ? 31  TRP A HA   3  
ATOM 3468  H HB2  . TRP A 1 31  ? -0.263  4.587   -11.947 1.00 0.00 ? 31  TRP A HB2  3  
ATOM 3469  H HB3  . TRP A 1 31  ? -1.619  3.924   -11.038 1.00 0.00 ? 31  TRP A HB3  3  
ATOM 3470  H HD1  . TRP A 1 31  ? -0.775  4.462   -14.801 1.00 0.00 ? 31  TRP A HD1  3  
ATOM 3471  H HE1  . TRP A 1 31  ? -1.585  2.386   -16.089 1.00 0.00 ? 31  TRP A HE1  3  
ATOM 3472  H HE3  . TRP A 1 31  ? -2.806  1.836   -10.913 1.00 0.00 ? 31  TRP A HE3  3  
ATOM 3473  H HZ2  . TRP A 1 31  ? -2.910  -0.043  -15.530 1.00 0.00 ? 31  TRP A HZ2  3  
ATOM 3474  H HZ3  . TRP A 1 31  ? -3.825  -0.355  -11.375 1.00 0.00 ? 31  TRP A HZ3  3  
ATOM 3475  H HH2  . TRP A 1 31  ? -3.876  -1.273  -13.636 1.00 0.00 ? 31  TRP A HH2  3  
ATOM 3476  N N    . HIS A 1 32  ? -2.568  6.428   -9.838  1.00 0.00 ? 32  HIS A N    3  
ATOM 3477  C CA   . HIS A 1 32  ? -2.400  7.212   -8.620  1.00 0.00 ? 32  HIS A CA   3  
ATOM 3478  C C    . HIS A 1 32  ? -2.081  6.309   -7.432  1.00 0.00 ? 32  HIS A C    3  
ATOM 3479  O O    . HIS A 1 32  ? -2.825  5.376   -7.132  1.00 0.00 ? 32  HIS A O    3  
ATOM 3480  C CB   . HIS A 1 32  ? -3.663  8.024   -8.332  1.00 0.00 ? 32  HIS A CB   3  
ATOM 3481  C CG   . HIS A 1 32  ? -3.863  9.172   -9.274  1.00 0.00 ? 32  HIS A CG   3  
ATOM 3482  N ND1  . HIS A 1 32  ? -2.851  10.036  -9.633  1.00 0.00 ? 32  HIS A ND1  3  
ATOM 3483  C CD2  . HIS A 1 32  ? -4.968  9.595   -9.931  1.00 0.00 ? 32  HIS A CD2  3  
ATOM 3484  C CE1  . HIS A 1 32  ? -3.324  10.942  -10.470 1.00 0.00 ? 32  HIS A CE1  3  
ATOM 3485  N NE2  . HIS A 1 32  ? -4.607  10.697  -10.668 1.00 0.00 ? 32  HIS A NE2  3  
ATOM 3486  H H    . HIS A 1 32  ? -3.274  5.749   -9.876  1.00 0.00 ? 32  HIS A H    3  
ATOM 3487  H HA   . HIS A 1 32  ? -1.574  7.889   -8.773  1.00 0.00 ? 32  HIS A HA   3  
ATOM 3488  H HB2  . HIS A 1 32  ? -4.524  7.378   -8.410  1.00 0.00 ? 32  HIS A HB2  3  
ATOM 3489  H HB3  . HIS A 1 32  ? -3.606  8.422   -7.329  1.00 0.00 ? 32  HIS A HB3  3  
ATOM 3490  H HD1  . HIS A 1 32  ? -1.923  9.993   -9.321  1.00 0.00 ? 32  HIS A HD1  3  
ATOM 3491  H HD2  . HIS A 1 32  ? -5.952  9.150   -9.885  1.00 0.00 ? 32  HIS A HD2  3  
ATOM 3492  H HE1  . HIS A 1 32  ? -2.760  11.746  -10.918 1.00 0.00 ? 32  HIS A HE1  3  
ATOM 3493  N N    . MET A 1 33  ? -0.969  6.592   -6.762  1.00 0.00 ? 33  MET A N    3  
ATOM 3494  C CA   . MET A 1 33  ? -0.552  5.805   -5.607  1.00 0.00 ? 33  MET A CA   3  
ATOM 3495  C C    . MET A 1 33  ? -1.423  6.116   -4.394  1.00 0.00 ? 33  MET A C    3  
ATOM 3496  O O    . MET A 1 33  ? -1.524  7.267   -3.969  1.00 0.00 ? 33  MET A O    3  
ATOM 3497  C CB   . MET A 1 33  ? 0.917   6.080   -5.279  1.00 0.00 ? 33  MET A CB   3  
ATOM 3498  C CG   . MET A 1 33  ? 1.558   5.006   -4.415  1.00 0.00 ? 33  MET A CG   3  
ATOM 3499  S SD   . MET A 1 33  ? 3.197   5.475   -3.827  1.00 0.00 ? 33  MET A SD   3  
ATOM 3500  C CE   . MET A 1 33  ? 3.166   4.803   -2.167  1.00 0.00 ? 33  MET A CE   3  
ATOM 3501  H H    . MET A 1 33  ? -0.415  7.348   -7.049  1.00 0.00 ? 33  MET A H    3  
ATOM 3502  H HA   . MET A 1 33  ? -0.665  4.761   -5.859  1.00 0.00 ? 33  MET A HA   3  
ATOM 3503  H HB2  . MET A 1 33  ? 1.473   6.148   -6.202  1.00 0.00 ? 33  MET A HB2  3  
ATOM 3504  H HB3  . MET A 1 33  ? 0.987   7.021   -4.755  1.00 0.00 ? 33  MET A HB3  3  
ATOM 3505  H HG2  . MET A 1 33  ? 0.924   4.824   -3.560  1.00 0.00 ? 33  MET A HG2  3  
ATOM 3506  H HG3  . MET A 1 33  ? 1.644   4.100   -4.996  1.00 0.00 ? 33  MET A HG3  3  
ATOM 3507  H HE1  . MET A 1 33  ? 3.666   5.483   -1.493  1.00 0.00 ? 33  MET A HE1  3  
ATOM 3508  H HE2  . MET A 1 33  ? 2.141   4.672   -1.851  1.00 0.00 ? 33  MET A HE2  3  
ATOM 3509  H HE3  . MET A 1 33  ? 3.671   3.848   -2.155  1.00 0.00 ? 33  MET A HE3  3  
ATOM 3510  N N    . PHE A 1 34  ? -2.050  5.083   -3.842  1.00 0.00 ? 34  PHE A N    3  
ATOM 3511  C CA   . PHE A 1 34  ? -2.914  5.247   -2.678  1.00 0.00 ? 34  PHE A CA   3  
ATOM 3512  C C    . PHE A 1 34  ? -2.279  6.186   -1.657  1.00 0.00 ? 34  PHE A C    3  
ATOM 3513  O O    . PHE A 1 34  ? -1.190  5.921   -1.149  1.00 0.00 ? 34  PHE A O    3  
ATOM 3514  C CB   . PHE A 1 34  ? -3.198  3.889   -2.032  1.00 0.00 ? 34  PHE A CB   3  
ATOM 3515  C CG   . PHE A 1 34  ? -4.276  3.108   -2.726  1.00 0.00 ? 34  PHE A CG   3  
ATOM 3516  C CD1  . PHE A 1 34  ? -3.968  2.257   -3.775  1.00 0.00 ? 34  PHE A CD1  3  
ATOM 3517  C CD2  . PHE A 1 34  ? -5.599  3.226   -2.330  1.00 0.00 ? 34  PHE A CD2  3  
ATOM 3518  C CE1  . PHE A 1 34  ? -4.958  1.536   -4.416  1.00 0.00 ? 34  PHE A CE1  3  
ATOM 3519  C CE2  . PHE A 1 34  ? -6.593  2.508   -2.967  1.00 0.00 ? 34  PHE A CE2  3  
ATOM 3520  C CZ   . PHE A 1 34  ? -6.273  1.663   -4.012  1.00 0.00 ? 34  PHE A CZ   3  
ATOM 3521  H H    . PHE A 1 34  ? -1.930  4.189   -4.226  1.00 0.00 ? 34  PHE A H    3  
ATOM 3522  H HA   . PHE A 1 34  ? -3.845  5.677   -3.015  1.00 0.00 ? 34  PHE A HA   3  
ATOM 3523  H HB2  . PHE A 1 34  ? -2.296  3.296   -2.048  1.00 0.00 ? 34  PHE A HB2  3  
ATOM 3524  H HB3  . PHE A 1 34  ? -3.504  4.043   -1.008  1.00 0.00 ? 34  PHE A HB3  3  
ATOM 3525  H HD1  . PHE A 1 34  ? -2.939  2.157   -4.091  1.00 0.00 ? 34  PHE A HD1  3  
ATOM 3526  H HD2  . PHE A 1 34  ? -5.852  3.887   -1.514  1.00 0.00 ? 34  PHE A HD2  3  
ATOM 3527  H HE1  . PHE A 1 34  ? -4.704  0.877   -5.232  1.00 0.00 ? 34  PHE A HE1  3  
ATOM 3528  H HE2  . PHE A 1 34  ? -7.620  2.609   -2.650  1.00 0.00 ? 34  PHE A HE2  3  
ATOM 3529  H HZ   . PHE A 1 34  ? -7.048  1.100   -4.511  1.00 0.00 ? 34  PHE A HZ   3  
ATOM 3530  N N    . GLN A 1 35  ? -2.968  7.284   -1.363  1.00 0.00 ? 35  GLN A N    3  
ATOM 3531  C CA   . GLN A 1 35  ? -2.470  8.264   -0.405  1.00 0.00 ? 35  GLN A CA   3  
ATOM 3532  C C    . GLN A 1 35  ? -3.600  8.783   0.479   1.00 0.00 ? 35  GLN A C    3  
ATOM 3533  O O    . GLN A 1 35  ? -4.751  8.890   0.057   1.00 0.00 ? 35  GLN A O    3  
ATOM 3534  C CB   . GLN A 1 35  ? -1.801  9.430   -1.135  1.00 0.00 ? 35  GLN A CB   3  
ATOM 3535  C CG   . GLN A 1 35  ? -0.391  9.120   -1.612  1.00 0.00 ? 35  GLN A CG   3  
ATOM 3536  C CD   . GLN A 1 35  ? 0.582   8.921   -0.467  1.00 0.00 ? 35  GLN A CD   3  
ATOM 3537  O OE1  . GLN A 1 35  ? 0.642   9.731   0.459   1.00 0.00 ? 35  GLN A OE1  3  
ATOM 3538  N NE2  . GLN A 1 35  ? 1.351   7.840   -0.524  1.00 0.00 ? 35  GLN A NE2  3  
ATOM 3539  H H    . GLN A 1 35  ? -3.829  7.440   -1.802  1.00 0.00 ? 35  GLN A H    3  
ATOM 3540  H HA   . GLN A 1 35  ? -1.738  7.774   0.219   1.00 0.00 ? 35  GLN A HA   3  
ATOM 3541  H HB2  . GLN A 1 35  ? -2.400  9.692   -1.994  1.00 0.00 ? 35  GLN A HB2  3  
ATOM 3542  H HB3  . GLN A 1 35  ? -1.753  10.277  -0.467  1.00 0.00 ? 35  GLN A HB3  3  
ATOM 3543  H HG2  . GLN A 1 35  ? -0.416  8.217   -2.204  1.00 0.00 ? 35  GLN A HG2  3  
ATOM 3544  H HG3  . GLN A 1 35  ? -0.044  9.940   -2.223  1.00 0.00 ? 35  GLN A HG3  3  
ATOM 3545  H HE21 . GLN A 1 35  ? 1.249   7.241   -1.293  1.00 0.00 ? 35  GLN A HE21 3  
ATOM 3546  H HE22 . GLN A 1 35  ? 1.990   7.688   0.202   1.00 0.00 ? 35  GLN A HE22 3  
ATOM 3547  N N    . PRO A 1 36  ? -3.265  9.113   1.735   1.00 0.00 ? 36  PRO A N    3  
ATOM 3548  C CA   . PRO A 1 36  ? -4.238  9.627   2.704   1.00 0.00 ? 36  PRO A CA   3  
ATOM 3549  C C    . PRO A 1 36  ? -4.715  11.033  2.357   1.00 0.00 ? 36  PRO A C    3  
ATOM 3550  O O    . PRO A 1 36  ? -3.908  11.928  2.107   1.00 0.00 ? 36  PRO A O    3  
ATOM 3551  C CB   . PRO A 1 36  ? -3.455  9.637   4.020   1.00 0.00 ? 36  PRO A CB   3  
ATOM 3552  C CG   . PRO A 1 36  ? -2.027  9.749   3.611   1.00 0.00 ? 36  PRO A CG   3  
ATOM 3553  C CD   . PRO A 1 36  ? -1.911  9.012   2.306   1.00 0.00 ? 36  PRO A CD   3  
ATOM 3554  H HA   . PRO A 1 36  ? -5.091  8.971   2.796   1.00 0.00 ? 36  PRO A HA   3  
ATOM 3555  H HB2  . PRO A 1 36  ? -3.763  10.483  4.618   1.00 0.00 ? 36  PRO A HB2  3  
ATOM 3556  H HB3  . PRO A 1 36  ? -3.640  8.721   4.560   1.00 0.00 ? 36  PRO A HB3  3  
ATOM 3557  H HG2  . PRO A 1 36  ? -1.763  10.787  3.480   1.00 0.00 ? 36  PRO A HG2  3  
ATOM 3558  H HG3  . PRO A 1 36  ? -1.395  9.291   4.357   1.00 0.00 ? 36  PRO A HG3  3  
ATOM 3559  H HD2  . PRO A 1 36  ? -1.186  9.490   1.665   1.00 0.00 ? 36  PRO A HD2  3  
ATOM 3560  H HD3  . PRO A 1 36  ? -1.643  7.980   2.478   1.00 0.00 ? 36  PRO A HD3  3  
ATOM 3561  N N    . ASP A 1 37  ? -6.030  11.220  2.345   1.00 0.00 ? 37  ASP A N    3  
ATOM 3562  C CA   . ASP A 1 37  ? -6.614  12.519  2.030   1.00 0.00 ? 37  ASP A CA   3  
ATOM 3563  C C    . ASP A 1 37  ? -7.012  13.259  3.303   1.00 0.00 ? 37  ASP A C    3  
ATOM 3564  O O    . ASP A 1 37  ? -7.194  12.649  4.358   1.00 0.00 ? 37  ASP A O    3  
ATOM 3565  C CB   . ASP A 1 37  ? -7.834  12.346  1.123   1.00 0.00 ? 37  ASP A CB   3  
ATOM 3566  C CG   . ASP A 1 37  ? -8.330  13.665  0.563   1.00 0.00 ? 37  ASP A CG   3  
ATOM 3567  O OD1  . ASP A 1 37  ? -7.512  14.600  0.434   1.00 0.00 ? 37  ASP A OD1  3  
ATOM 3568  O OD2  . ASP A 1 37  ? -9.535  13.761  0.252   1.00 0.00 ? 37  ASP A OD2  3  
ATOM 3569  H H    . ASP A 1 37  ? -6.622  10.467  2.553   1.00 0.00 ? 37  ASP A H    3  
ATOM 3570  H HA   . ASP A 1 37  ? -5.869  13.100  1.509   1.00 0.00 ? 37  ASP A HA   3  
ATOM 3571  H HB2  . ASP A 1 37  ? -7.572  11.701  0.297   1.00 0.00 ? 37  ASP A HB2  3  
ATOM 3572  H HB3  . ASP A 1 37  ? -8.634  11.893  1.690   1.00 0.00 ? 37  ASP A HB3  3  
ATOM 3573  N N    . THR A 1 38  ? -7.145  14.577  3.199   1.00 0.00 ? 38  THR A N    3  
ATOM 3574  C CA   . THR A 1 38  ? -7.519  15.401  4.341   1.00 0.00 ? 38  THR A CA   3  
ATOM 3575  C C    . THR A 1 38  ? -8.688  14.786  5.103   1.00 0.00 ? 38  THR A C    3  
ATOM 3576  O O    . THR A 1 38  ? -9.455  13.999  4.551   1.00 0.00 ? 38  THR A O    3  
ATOM 3577  C CB   . THR A 1 38  ? -7.899  16.828  3.905   1.00 0.00 ? 38  THR A CB   3  
ATOM 3578  O OG1  . THR A 1 38  ? -6.910  17.346  3.008   1.00 0.00 ? 38  THR A OG1  3  
ATOM 3579  C CG2  . THR A 1 38  ? -8.029  17.747  5.110   1.00 0.00 ? 38  THR A CG2  3  
ATOM 3580  H H    . THR A 1 38  ? -6.987  15.005  2.331   1.00 0.00 ? 38  THR A H    3  
ATOM 3581  H HA   . THR A 1 38  ? -6.665  15.464  5.001   1.00 0.00 ? 38  THR A HA   3  
ATOM 3582  H HB   . THR A 1 38  ? -8.852  16.791  3.395   1.00 0.00 ? 38  THR A HB   3  
ATOM 3583  H HG1  . THR A 1 38  ? -7.042  16.970  2.134   1.00 0.00 ? 38  THR A HG1  3  
ATOM 3584  H HG21 . THR A 1 38  ? -8.845  17.411  5.733   1.00 0.00 ? 38  THR A HG21 3  
ATOM 3585  H HG22 . THR A 1 38  ? -8.222  18.755  4.776   1.00 0.00 ? 38  THR A HG22 3  
ATOM 3586  H HG23 . THR A 1 38  ? -7.111  17.726  5.678   1.00 0.00 ? 38  THR A HG23 3  
ATOM 3587  N N    . ASN A 1 39  ? -8.817  15.152  6.375   1.00 0.00 ? 39  ASN A N    3  
ATOM 3588  C CA   . ASN A 1 39  ? -9.893  14.636  7.212   1.00 0.00 ? 39  ASN A CA   3  
ATOM 3589  C C    . ASN A 1 39  ? -11.245 14.799  6.523   1.00 0.00 ? 39  ASN A C    3  
ATOM 3590  O O    . ASN A 1 39  ? -12.025 13.851  6.432   1.00 0.00 ? 39  ASN A O    3  
ATOM 3591  C CB   . ASN A 1 39  ? -9.906  15.356  8.563   1.00 0.00 ? 39  ASN A CB   3  
ATOM 3592  C CG   . ASN A 1 39  ? -8.570  15.273  9.275   1.00 0.00 ? 39  ASN A CG   3  
ATOM 3593  O OD1  . ASN A 1 39  ? -8.285  14.298  9.971   1.00 0.00 ? 39  ASN A OD1  3  
ATOM 3594  N ND2  . ASN A 1 39  ? -7.744  16.298  9.104   1.00 0.00 ? 39  ASN A ND2  3  
ATOM 3595  H H    . ASN A 1 39  ? -8.173  15.783  6.759   1.00 0.00 ? 39  ASN A H    3  
ATOM 3596  H HA   . ASN A 1 39  ? -9.710  13.585  7.377   1.00 0.00 ? 39  ASN A HA   3  
ATOM 3597  H HB2  . ASN A 1 39  ? -10.144 16.398  8.406   1.00 0.00 ? 39  ASN A HB2  3  
ATOM 3598  H HB3  . ASN A 1 39  ? -10.660 14.910  9.195   1.00 0.00 ? 39  ASN A HB3  3  
ATOM 3599  H HD21 . ASN A 1 39  ? -8.038  17.040  8.535   1.00 0.00 ? 39  ASN A HD21 3  
ATOM 3600  H HD22 . ASN A 1 39  ? -6.873  16.270  9.552   1.00 0.00 ? 39  ASN A HD22 3  
ATOM 3601  N N    . SER A 1 40  ? -11.514 16.007  6.040   1.00 0.00 ? 40  SER A N    3  
ATOM 3602  C CA   . SER A 1 40  ? -12.772 16.296  5.362   1.00 0.00 ? 40  SER A CA   3  
ATOM 3603  C C    . SER A 1 40  ? -13.173 15.144  4.445   1.00 0.00 ? 40  SER A C    3  
ATOM 3604  O O    . SER A 1 40  ? -14.298 14.651  4.507   1.00 0.00 ? 40  SER A O    3  
ATOM 3605  C CB   . SER A 1 40  ? -12.655 17.589  4.552   1.00 0.00 ? 40  SER A CB   3  
ATOM 3606  O OG   . SER A 1 40  ? -12.266 18.674  5.377   1.00 0.00 ? 40  SER A OG   3  
ATOM 3607  H H    . SER A 1 40  ? -10.852 16.722  6.144   1.00 0.00 ? 40  SER A H    3  
ATOM 3608  H HA   . SER A 1 40  ? -13.535 16.422  6.116   1.00 0.00 ? 40  SER A HA   3  
ATOM 3609  H HB2  . SER A 1 40  ? -11.916 17.459  3.777   1.00 0.00 ? 40  SER A HB2  3  
ATOM 3610  H HB3  . SER A 1 40  ? -13.611 17.818  4.104   1.00 0.00 ? 40  SER A HB3  3  
ATOM 3611  H HG   . SER A 1 40  ? -11.383 18.516  5.719   1.00 0.00 ? 40  SER A HG   3  
ATOM 3612  N N    . GLN A 1 41  ? -12.242 14.721  3.596   1.00 0.00 ? 41  GLN A N    3  
ATOM 3613  C CA   . GLN A 1 41  ? -12.497 13.627  2.666   1.00 0.00 ? 41  GLN A CA   3  
ATOM 3614  C C    . GLN A 1 41  ? -11.474 12.510  2.845   1.00 0.00 ? 41  GLN A C    3  
ATOM 3615  O O    . GLN A 1 41  ? -11.006 11.922  1.869   1.00 0.00 ? 41  GLN A O    3  
ATOM 3616  C CB   . GLN A 1 41  ? -12.466 14.138  1.224   1.00 0.00 ? 41  GLN A CB   3  
ATOM 3617  C CG   . GLN A 1 41  ? -13.447 15.267  0.957   1.00 0.00 ? 41  GLN A CG   3  
ATOM 3618  C CD   . GLN A 1 41  ? -13.698 15.485  -0.522  1.00 0.00 ? 41  GLN A CD   3  
ATOM 3619  O OE1  . GLN A 1 41  ? -12.878 16.080  -1.221  1.00 0.00 ? 41  GLN A OE1  3  
ATOM 3620  N NE2  . GLN A 1 41  ? -14.836 15.003  -1.007  1.00 0.00 ? 41  GLN A NE2  3  
ATOM 3621  H H    . GLN A 1 41  ? -11.364 15.154  3.595   1.00 0.00 ? 41  GLN A H    3  
ATOM 3622  H HA   . GLN A 1 41  ? -13.480 13.235  2.878   1.00 0.00 ? 41  GLN A HA   3  
ATOM 3623  H HB2  . GLN A 1 41  ? -11.471 14.494  1.003   1.00 0.00 ? 41  GLN A HB2  3  
ATOM 3624  H HB3  . GLN A 1 41  ? -12.703 13.320  0.560   1.00 0.00 ? 41  GLN A HB3  3  
ATOM 3625  H HG2  . GLN A 1 41  ? -14.387 15.031  1.435   1.00 0.00 ? 41  GLN A HG2  3  
ATOM 3626  H HG3  . GLN A 1 41  ? -13.050 16.179  1.379   1.00 0.00 ? 41  GLN A HG3  3  
ATOM 3627  H HE21 . GLN A 1 41  ? -15.443 14.540  -0.390  1.00 0.00 ? 41  GLN A HE21 3  
ATOM 3628  H HE22 . GLN A 1 41  ? -15.025 15.130  -1.959  1.00 0.00 ? 41  GLN A HE22 3  
ATOM 3629  N N    . CYS A 1 42  ? -11.132 12.223  4.096   1.00 0.00 ? 42  CYS A N    3  
ATOM 3630  C CA   . CYS A 1 42  ? -10.163 11.177  4.403   1.00 0.00 ? 42  CYS A CA   3  
ATOM 3631  C C    . CYS A 1 42  ? -10.344 9.980   3.476   1.00 0.00 ? 42  CYS A C    3  
ATOM 3632  O O    . CYS A 1 42  ? -11.433 9.748   2.950   1.00 0.00 ? 42  CYS A O    3  
ATOM 3633  C CB   . CYS A 1 42  ? -10.303 10.735  5.860   1.00 0.00 ? 42  CYS A CB   3  
ATOM 3634  S SG   . CYS A 1 42  ? -11.768 9.728   6.189   1.00 0.00 ? 42  CYS A SG   3  
ATOM 3635  H H    . CYS A 1 42  ? -11.540 12.727  4.831   1.00 0.00 ? 42  CYS A H    3  
ATOM 3636  H HA   . CYS A 1 42  ? -9.176  11.587  4.253   1.00 0.00 ? 42  CYS A HA   3  
ATOM 3637  H HB2  . CYS A 1 42  ? -9.436  10.152  6.136   1.00 0.00 ? 42  CYS A HB2  3  
ATOM 3638  H HB3  . CYS A 1 42  ? -10.355 11.610  6.490   1.00 0.00 ? 42  CYS A HB3  3  
ATOM 3639  H HG   . CYS A 1 42  ? -12.730 10.533  6.613   1.00 0.00 ? 42  CYS A HG   3  
ATOM 3640  N N    . SER A 1 43  ? -9.269  9.223   3.278   1.00 0.00 ? 43  SER A N    3  
ATOM 3641  C CA   . SER A 1 43  ? -9.307  8.052   2.409   1.00 0.00 ? 43  SER A CA   3  
ATOM 3642  C C    . SER A 1 43  ? -8.411  6.944   2.952   1.00 0.00 ? 43  SER A C    3  
ATOM 3643  O O    . SER A 1 43  ? -7.766  7.102   3.989   1.00 0.00 ? 43  SER A O    3  
ATOM 3644  C CB   . SER A 1 43  ? -8.872  8.428   0.992   1.00 0.00 ? 43  SER A CB   3  
ATOM 3645  O OG   . SER A 1 43  ? -7.512  8.828   0.965   1.00 0.00 ? 43  SER A OG   3  
ATOM 3646  H H    . SER A 1 43  ? -8.429  9.460   3.725   1.00 0.00 ? 43  SER A H    3  
ATOM 3647  H HA   . SER A 1 43  ? -10.326 7.694   2.381   1.00 0.00 ? 43  SER A HA   3  
ATOM 3648  H HB2  . SER A 1 43  ? -8.996  7.575   0.342   1.00 0.00 ? 43  SER A HB2  3  
ATOM 3649  H HB3  . SER A 1 43  ? -9.482  9.245   0.635   1.00 0.00 ? 43  SER A HB3  3  
ATOM 3650  H HG   . SER A 1 43  ? -6.951  8.065   1.122   1.00 0.00 ? 43  SER A HG   3  
ATOM 3651  N N    . VAL A 1 44  ? -8.376  5.820   2.244   1.00 0.00 ? 44  VAL A N    3  
ATOM 3652  C CA   . VAL A 1 44  ? -7.558  4.684   2.652   1.00 0.00 ? 44  VAL A CA   3  
ATOM 3653  C C    . VAL A 1 44  ? -6.187  4.726   1.988   1.00 0.00 ? 44  VAL A C    3  
ATOM 3654  O O    . VAL A 1 44  ? -6.080  4.775   0.763   1.00 0.00 ? 44  VAL A O    3  
ATOM 3655  C CB   . VAL A 1 44  ? -8.242  3.347   2.308   1.00 0.00 ? 44  VAL A CB   3  
ATOM 3656  C CG1  . VAL A 1 44  ? -9.569  3.222   3.040   1.00 0.00 ? 44  VAL A CG1  3  
ATOM 3657  C CG2  . VAL A 1 44  ? -8.439  3.222   0.805   1.00 0.00 ? 44  VAL A CG2  3  
ATOM 3658  H H    . VAL A 1 44  ? -8.912  5.753   1.426   1.00 0.00 ? 44  VAL A H    3  
ATOM 3659  H HA   . VAL A 1 44  ? -7.430  4.733   3.724   1.00 0.00 ? 44  VAL A HA   3  
ATOM 3660  H HB   . VAL A 1 44  ? -7.599  2.543   2.634   1.00 0.00 ? 44  VAL A HB   3  
ATOM 3661  H HG11 . VAL A 1 44  ? -9.912  4.203   3.334   1.00 0.00 ? 44  VAL A HG11 3  
ATOM 3662  H HG12 . VAL A 1 44  ? -10.299 2.765   2.387   1.00 0.00 ? 44  VAL A HG12 3  
ATOM 3663  H HG13 . VAL A 1 44  ? -9.439  2.609   3.919   1.00 0.00 ? 44  VAL A HG13 3  
ATOM 3664  H HG21 . VAL A 1 44  ? -9.304  2.608   0.606   1.00 0.00 ? 44  VAL A HG21 3  
ATOM 3665  H HG22 . VAL A 1 44  ? -8.588  4.203   0.378   1.00 0.00 ? 44  VAL A HG22 3  
ATOM 3666  H HG23 . VAL A 1 44  ? -7.565  2.767   0.363   1.00 0.00 ? 44  VAL A HG23 3  
ATOM 3667  N N    . SER A 1 45  ? -5.139  4.707   2.805   1.00 0.00 ? 45  SER A N    3  
ATOM 3668  C CA   . SER A 1 45  ? -3.772  4.747   2.297   1.00 0.00 ? 45  SER A CA   3  
ATOM 3669  C C    . SER A 1 45  ? -3.295  3.350   1.913   1.00 0.00 ? 45  SER A C    3  
ATOM 3670  O O    . SER A 1 45  ? -3.871  2.348   2.334   1.00 0.00 ? 45  SER A O    3  
ATOM 3671  C CB   . SER A 1 45  ? -2.834  5.349   3.345   1.00 0.00 ? 45  SER A CB   3  
ATOM 3672  O OG   . SER A 1 45  ? -3.282  6.629   3.757   1.00 0.00 ? 45  SER A OG   3  
ATOM 3673  H H    . SER A 1 45  ? -5.288  4.668   3.773   1.00 0.00 ? 45  SER A H    3  
ATOM 3674  H HA   . SER A 1 45  ? -3.764  5.373   1.417   1.00 0.00 ? 45  SER A HA   3  
ATOM 3675  H HB2  . SER A 1 45  ? -2.796  4.700   4.206   1.00 0.00 ? 45  SER A HB2  3  
ATOM 3676  H HB3  . SER A 1 45  ? -1.843  5.447   2.923   1.00 0.00 ? 45  SER A HB3  3  
ATOM 3677  H HG   . SER A 1 45  ? -4.239  6.670   3.689   1.00 0.00 ? 45  SER A HG   3  
ATOM 3678  N N    . SER A 1 46  ? -2.237  3.294   1.109   1.00 0.00 ? 46  SER A N    3  
ATOM 3679  C CA   . SER A 1 46  ? -1.683  2.021   0.663   1.00 0.00 ? 46  SER A CA   3  
ATOM 3680  C C    . SER A 1 46  ? -1.557  1.045   1.830   1.00 0.00 ? 46  SER A C    3  
ATOM 3681  O O    . SER A 1 46  ? -1.690  -0.166  1.657   1.00 0.00 ? 46  SER A O    3  
ATOM 3682  C CB   . SER A 1 46  ? -0.316  2.235   0.013   1.00 0.00 ? 46  SER A CB   3  
ATOM 3683  O OG   . SER A 1 46  ? 0.650   2.628   0.973   1.00 0.00 ? 46  SER A OG   3  
ATOM 3684  H H    . SER A 1 46  ? -1.822  4.128   0.807   1.00 0.00 ? 46  SER A H    3  
ATOM 3685  H HA   . SER A 1 46  ? -2.359  1.603   -0.068  1.00 0.00 ? 46  SER A HA   3  
ATOM 3686  H HB2  . SER A 1 46  ? 0.008   1.316   -0.450  1.00 0.00 ? 46  SER A HB2  3  
ATOM 3687  H HB3  . SER A 1 46  ? -0.395  3.008   -0.738  1.00 0.00 ? 46  SER A HB3  3  
ATOM 3688  H HG   . SER A 1 46  ? 0.696   3.587   1.007   1.00 0.00 ? 46  SER A HG   3  
ATOM 3689  N N    . GLU A 1 47  ? -1.298  1.583   3.018   1.00 0.00 ? 47  GLU A N    3  
ATOM 3690  C CA   . GLU A 1 47  ? -1.152  0.761   4.213   1.00 0.00 ? 47  GLU A CA   3  
ATOM 3691  C C    . GLU A 1 47  ? -2.462  0.054   4.550   1.00 0.00 ? 47  GLU A C    3  
ATOM 3692  O O    . GLU A 1 47  ? -2.489  -1.159  4.762   1.00 0.00 ? 47  GLU A O    3  
ATOM 3693  C CB   . GLU A 1 47  ? -0.704  1.618   5.398   1.00 0.00 ? 47  GLU A CB   3  
ATOM 3694  C CG   . GLU A 1 47  ? 0.090   0.849   6.440   1.00 0.00 ? 47  GLU A CG   3  
ATOM 3695  C CD   . GLU A 1 47  ? 0.354   1.664   7.691   1.00 0.00 ? 47  GLU A CD   3  
ATOM 3696  O OE1  . GLU A 1 47  ? -0.484  2.528   8.025   1.00 0.00 ? 47  GLU A OE1  3  
ATOM 3697  O OE2  . GLU A 1 47  ? 1.399   1.437   8.337   1.00 0.00 ? 47  GLU A OE2  3  
ATOM 3698  H H    . GLU A 1 47  ? -1.202  2.556   3.092   1.00 0.00 ? 47  GLU A H    3  
ATOM 3699  H HA   . GLU A 1 47  ? -0.397  0.016   4.013   1.00 0.00 ? 47  GLU A HA   3  
ATOM 3700  H HB2  . GLU A 1 47  ? -0.088  2.426   5.030   1.00 0.00 ? 47  GLU A HB2  3  
ATOM 3701  H HB3  . GLU A 1 47  ? -1.578  2.034   5.877   1.00 0.00 ? 47  GLU A HB3  3  
ATOM 3702  H HG2  . GLU A 1 47  ? -0.464  -0.036  6.716   1.00 0.00 ? 47  GLU A HG2  3  
ATOM 3703  H HG3  . GLU A 1 47  ? 1.038   0.559   6.011   1.00 0.00 ? 47  GLU A HG3  3  
ATOM 3704  N N    . ASP A 1 48  ? -3.546  0.820   4.597   1.00 0.00 ? 48  ASP A N    3  
ATOM 3705  C CA   . ASP A 1 48  ? -4.860  0.269   4.908   1.00 0.00 ? 48  ASP A CA   3  
ATOM 3706  C C    . ASP A 1 48  ? -5.189  -0.902  3.986   1.00 0.00 ? 48  ASP A C    3  
ATOM 3707  O O    . ASP A 1 48  ? -5.607  -1.966  4.444   1.00 0.00 ? 48  ASP A O    3  
ATOM 3708  C CB   . ASP A 1 48  ? -5.933  1.351   4.782   1.00 0.00 ? 48  ASP A CB   3  
ATOM 3709  C CG   . ASP A 1 48  ? -5.720  2.494   5.754   1.00 0.00 ? 48  ASP A CG   3  
ATOM 3710  O OD1  . ASP A 1 48  ? -4.858  3.355   5.478   1.00 0.00 ? 48  ASP A OD1  3  
ATOM 3711  O OD2  . ASP A 1 48  ? -6.415  2.529   6.791   1.00 0.00 ? 48  ASP A OD2  3  
ATOM 3712  H H    . ASP A 1 48  ? -3.460  1.780   4.418   1.00 0.00 ? 48  ASP A H    3  
ATOM 3713  H HA   . ASP A 1 48  ? -4.838  -0.087  5.927   1.00 0.00 ? 48  ASP A HA   3  
ATOM 3714  H HB2  . ASP A 1 48  ? -5.918  1.749   3.778   1.00 0.00 ? 48  ASP A HB2  3  
ATOM 3715  H HB3  . ASP A 1 48  ? -6.901  0.912   4.976   1.00 0.00 ? 48  ASP A HB3  3  
ATOM 3716  N N    . ILE A 1 49  ? -5.000  -0.697  2.687   1.00 0.00 ? 49  ILE A N    3  
ATOM 3717  C CA   . ILE A 1 49  ? -5.277  -1.735  1.702   1.00 0.00 ? 49  ILE A CA   3  
ATOM 3718  C C    . ILE A 1 49  ? -4.318  -2.910  1.857   1.00 0.00 ? 49  ILE A C    3  
ATOM 3719  O O    . ILE A 1 49  ? -4.729  -4.019  2.198   1.00 0.00 ? 49  ILE A O    3  
ATOM 3720  C CB   . ILE A 1 49  ? -5.175  -1.189  0.266   1.00 0.00 ? 49  ILE A CB   3  
ATOM 3721  C CG1  . ILE A 1 49  ? -6.139  -0.017  0.072   1.00 0.00 ? 49  ILE A CG1  3  
ATOM 3722  C CG2  . ILE A 1 49  ? -5.465  -2.292  -0.741  1.00 0.00 ? 49  ILE A CG2  3  
ATOM 3723  C CD1  . ILE A 1 49  ? -5.550  1.320   0.464   1.00 0.00 ? 49  ILE A CD1  3  
ATOM 3724  H H    . ILE A 1 49  ? -4.665  0.173   2.384   1.00 0.00 ? 49  ILE A H    3  
ATOM 3725  H HA   . ILE A 1 49  ? -6.287  -2.085  1.862   1.00 0.00 ? 49  ILE A HA   3  
ATOM 3726  H HB   . ILE A 1 49  ? -4.164  -0.846  0.106   1.00 0.00 ? 49  ILE A HB   3  
ATOM 3727  H HG12 . ILE A 1 49  ? -6.424  0.039   -0.967  1.00 0.00 ? 49  ILE A HG12 3  
ATOM 3728  H HG13 . ILE A 1 49  ? -7.020  -0.182  0.675   1.00 0.00 ? 49  ILE A HG13 3  
ATOM 3729  H HG21 . ILE A 1 49  ? -4.795  -2.196  -1.583  1.00 0.00 ? 49  ILE A HG21 3  
ATOM 3730  H HG22 . ILE A 1 49  ? -5.317  -3.254  -0.274  1.00 0.00 ? 49  ILE A HG22 3  
ATOM 3731  H HG23 . ILE A 1 49  ? -6.486  -2.210  -1.082  1.00 0.00 ? 49  ILE A HG23 3  
ATOM 3732  H HD11 . ILE A 1 49  ? -5.807  2.059   -0.280  1.00 0.00 ? 49  ILE A HD11 3  
ATOM 3733  H HD12 . ILE A 1 49  ? -5.945  1.620   1.423   1.00 0.00 ? 49  ILE A HD12 3  
ATOM 3734  H HD13 . ILE A 1 49  ? -4.475  1.235   0.529   1.00 0.00 ? 49  ILE A HD13 3  
ATOM 3735  N N    . GLU A 1 50  ? -3.037  -2.658  1.607   1.00 0.00 ? 50  GLU A N    3  
ATOM 3736  C CA   . GLU A 1 50  ? -2.019  -3.696  1.720   1.00 0.00 ? 50  GLU A CA   3  
ATOM 3737  C C    . GLU A 1 50  ? -2.269  -4.572  2.944   1.00 0.00 ? 50  GLU A C    3  
ATOM 3738  O O    . GLU A 1 50  ? -2.089  -5.790  2.898   1.00 0.00 ? 50  GLU A O    3  
ATOM 3739  C CB   . GLU A 1 50  ? -0.626  -3.068  1.804   1.00 0.00 ? 50  GLU A CB   3  
ATOM 3740  C CG   . GLU A 1 50  ? 0.503   -4.085  1.774   1.00 0.00 ? 50  GLU A CG   3  
ATOM 3741  C CD   . GLU A 1 50  ? 0.886   -4.572  3.158   1.00 0.00 ? 50  GLU A CD   3  
ATOM 3742  O OE1  . GLU A 1 50  ? 0.725   -3.800  4.125   1.00 0.00 ? 50  GLU A OE1  3  
ATOM 3743  O OE2  . GLU A 1 50  ? 1.348   -5.727  3.273   1.00 0.00 ? 50  GLU A OE2  3  
ATOM 3744  H H    . GLU A 1 50  ? -2.770  -1.754  1.339   1.00 0.00 ? 50  GLU A H    3  
ATOM 3745  H HA   . GLU A 1 50  ? -2.073  -4.312  0.835   1.00 0.00 ? 50  GLU A HA   3  
ATOM 3746  H HB2  . GLU A 1 50  ? -0.497  -2.393  0.971   1.00 0.00 ? 50  GLU A HB2  3  
ATOM 3747  H HB3  . GLU A 1 50  ? -0.552  -2.508  2.725   1.00 0.00 ? 50  GLU A HB3  3  
ATOM 3748  H HG2  . GLU A 1 50  ? 0.190   -4.934  1.184   1.00 0.00 ? 50  GLU A HG2  3  
ATOM 3749  H HG3  . GLU A 1 50  ? 1.369   -3.629  1.316   1.00 0.00 ? 50  GLU A HG3  3  
ATOM 3750  N N    . LYS A 1 51  ? -2.683  -3.944  4.039   1.00 0.00 ? 51  LYS A N    3  
ATOM 3751  C CA   . LYS A 1 51  ? -2.959  -4.664  5.277   1.00 0.00 ? 51  LYS A CA   3  
ATOM 3752  C C    . LYS A 1 51  ? -4.109  -5.649  5.088   1.00 0.00 ? 51  LYS A C    3  
ATOM 3753  O O    . LYS A 1 51  ? -4.044  -6.788  5.550   1.00 0.00 ? 51  LYS A O    3  
ATOM 3754  C CB   . LYS A 1 51  ? -3.295  -3.680  6.399   1.00 0.00 ? 51  LYS A CB   3  
ATOM 3755  C CG   . LYS A 1 51  ? -2.997  -4.217  7.788   1.00 0.00 ? 51  LYS A CG   3  
ATOM 3756  C CD   . LYS A 1 51  ? -3.127  -3.133  8.845   1.00 0.00 ? 51  LYS A CD   3  
ATOM 3757  C CE   . LYS A 1 51  ? -4.565  -2.988  9.320   1.00 0.00 ? 51  LYS A CE   3  
ATOM 3758  N NZ   . LYS A 1 51  ? -4.996  -4.148  10.148  1.00 0.00 ? 51  LYS A NZ   3  
ATOM 3759  H H    . LYS A 1 51  ? -2.808  -2.972  4.014   1.00 0.00 ? 51  LYS A H    3  
ATOM 3760  H HA   . LYS A 1 51  ? -2.070  -5.214  5.546   1.00 0.00 ? 51  LYS A HA   3  
ATOM 3761  H HB2  . LYS A 1 51  ? -2.721  -2.777  6.254   1.00 0.00 ? 51  LYS A HB2  3  
ATOM 3762  H HB3  . LYS A 1 51  ? -4.347  -3.440  6.347   1.00 0.00 ? 51  LYS A HB3  3  
ATOM 3763  H HG2  . LYS A 1 51  ? -3.693  -5.011  8.015   1.00 0.00 ? 51  LYS A HG2  3  
ATOM 3764  H HG3  . LYS A 1 51  ? -1.988  -4.605  7.806   1.00 0.00 ? 51  LYS A HG3  3  
ATOM 3765  H HD2  . LYS A 1 51  ? -2.506  -3.389  9.690   1.00 0.00 ? 51  LYS A HD2  3  
ATOM 3766  H HD3  . LYS A 1 51  ? -2.799  -2.193  8.426   1.00 0.00 ? 51  LYS A HD3  3  
ATOM 3767  H HE2  . LYS A 1 51  ? -4.647  -2.087  9.908   1.00 0.00 ? 51  LYS A HE2  3  
ATOM 3768  H HE3  . LYS A 1 51  ? -5.210  -2.914  8.457   1.00 0.00 ? 51  LYS A HE3  3  
ATOM 3769  H HZ1  . LYS A 1 51  ? -5.726  -4.693  9.647   1.00 0.00 ? 51  LYS A HZ1  3  
ATOM 3770  H HZ2  . LYS A 1 51  ? -5.387  -3.816  11.053  1.00 0.00 ? 51  LYS A HZ2  3  
ATOM 3771  H HZ3  . LYS A 1 51  ? -4.185  -4.771  10.341  1.00 0.00 ? 51  LYS A HZ3  3  
ATOM 3772  N N    . SER A 1 52  ? -5.159  -5.203  4.406   1.00 0.00 ? 52  SER A N    3  
ATOM 3773  C CA   . SER A 1 52  ? -6.323  -6.045  4.159   1.00 0.00 ? 52  SER A CA   3  
ATOM 3774  C C    . SER A 1 52  ? -5.999  -7.137  3.145   1.00 0.00 ? 52  SER A C    3  
ATOM 3775  O O    . SER A 1 52  ? -6.298  -8.312  3.363   1.00 0.00 ? 52  SER A O    3  
ATOM 3776  C CB   . SER A 1 52  ? -7.494  -5.197  3.656   1.00 0.00 ? 52  SER A CB   3  
ATOM 3777  O OG   . SER A 1 52  ? -7.917  -4.274  4.644   1.00 0.00 ? 52  SER A OG   3  
ATOM 3778  H H    . SER A 1 52  ? -5.150  -4.285  4.063   1.00 0.00 ? 52  SER A H    3  
ATOM 3779  H HA   . SER A 1 52  ? -6.602  -6.508  5.094   1.00 0.00 ? 52  SER A HA   3  
ATOM 3780  H HB2  . SER A 1 52  ? -7.187  -4.651  2.777   1.00 0.00 ? 52  SER A HB2  3  
ATOM 3781  H HB3  . SER A 1 52  ? -8.322  -5.845  3.406   1.00 0.00 ? 52  SER A HB3  3  
ATOM 3782  H HG   . SER A 1 52  ? -8.451  -4.728  5.299   1.00 0.00 ? 52  SER A HG   3  
ATOM 3783  N N    . PHE A 1 53  ? -5.385  -6.742  2.035   1.00 0.00 ? 53  PHE A N    3  
ATOM 3784  C CA   . PHE A 1 53  ? -5.019  -7.686  0.986   1.00 0.00 ? 53  PHE A CA   3  
ATOM 3785  C C    . PHE A 1 53  ? -4.421  -8.957  1.582   1.00 0.00 ? 53  PHE A C    3  
ATOM 3786  O O    . PHE A 1 53  ? -4.659  -10.060 1.089   1.00 0.00 ? 53  PHE A O    3  
ATOM 3787  C CB   . PHE A 1 53  ? -4.022  -7.045  0.018   1.00 0.00 ? 53  PHE A CB   3  
ATOM 3788  C CG   . PHE A 1 53  ? -3.524  -7.988  -1.041  1.00 0.00 ? 53  PHE A CG   3  
ATOM 3789  C CD1  . PHE A 1 53  ? -4.317  -8.309  -2.130  1.00 0.00 ? 53  PHE A CD1  3  
ATOM 3790  C CD2  . PHE A 1 53  ? -2.262  -8.553  -0.945  1.00 0.00 ? 53  PHE A CD2  3  
ATOM 3791  C CE1  . PHE A 1 53  ? -3.861  -9.175  -3.106  1.00 0.00 ? 53  PHE A CE1  3  
ATOM 3792  C CE2  . PHE A 1 53  ? -1.801  -9.419  -1.918  1.00 0.00 ? 53  PHE A CE2  3  
ATOM 3793  C CZ   . PHE A 1 53  ? -2.602  -9.732  -2.999  1.00 0.00 ? 53  PHE A CZ   3  
ATOM 3794  H H    . PHE A 1 53  ? -5.172  -5.792  1.919   1.00 0.00 ? 53  PHE A H    3  
ATOM 3795  H HA   . PHE A 1 53  ? -5.917  -7.944  0.446   1.00 0.00 ? 53  PHE A HA   3  
ATOM 3796  H HB2  . PHE A 1 53  ? -4.498  -6.212  -0.478  1.00 0.00 ? 53  PHE A HB2  3  
ATOM 3797  H HB3  . PHE A 1 53  ? -3.169  -6.689  0.575   1.00 0.00 ? 53  PHE A HB3  3  
ATOM 3798  H HD1  . PHE A 1 53  ? -5.303  -7.874  -2.215  1.00 0.00 ? 53  PHE A HD1  3  
ATOM 3799  H HD2  . PHE A 1 53  ? -1.635  -8.310  -0.100  1.00 0.00 ? 53  PHE A HD2  3  
ATOM 3800  H HE1  . PHE A 1 53  ? -4.491  -9.417  -3.950  1.00 0.00 ? 53  PHE A HE1  3  
ATOM 3801  H HE2  . PHE A 1 53  ? -0.816  -9.854  -1.832  1.00 0.00 ? 53  PHE A HE2  3  
ATOM 3802  H HZ   . PHE A 1 53  ? -2.244  -10.408 -3.761  1.00 0.00 ? 53  PHE A HZ   3  
ATOM 3803  N N    . LYS A 1 54  ? -3.642  -8.795  2.646   1.00 0.00 ? 54  LYS A N    3  
ATOM 3804  C CA   . LYS A 1 54  ? -3.010  -9.927  3.312   1.00 0.00 ? 54  LYS A CA   3  
ATOM 3805  C C    . LYS A 1 54  ? -4.057  -10.903 3.838   1.00 0.00 ? 54  LYS A C    3  
ATOM 3806  O O    . LYS A 1 54  ? -4.109  -12.060 3.420   1.00 0.00 ? 54  LYS A O    3  
ATOM 3807  C CB   . LYS A 1 54  ? -2.126  -9.440  4.463   1.00 0.00 ? 54  LYS A CB   3  
ATOM 3808  C CG   . LYS A 1 54  ? -0.830  -8.796  4.004   1.00 0.00 ? 54  LYS A CG   3  
ATOM 3809  C CD   . LYS A 1 54  ? -0.202  -7.959  5.106   1.00 0.00 ? 54  LYS A CD   3  
ATOM 3810  C CE   . LYS A 1 54  ? 0.550   -8.827  6.105   1.00 0.00 ? 54  LYS A CE   3  
ATOM 3811  N NZ   . LYS A 1 54  ? -0.329  -9.277  7.220   1.00 0.00 ? 54  LYS A NZ   3  
ATOM 3812  H H    . LYS A 1 54  ? -3.490  -7.890  2.993   1.00 0.00 ? 54  LYS A H    3  
ATOM 3813  H HA   . LYS A 1 54  ? -2.393  -10.436 2.586   1.00 0.00 ? 54  LYS A HA   3  
ATOM 3814  H HB2  . LYS A 1 54  ? -2.679  -8.715  5.042   1.00 0.00 ? 54  LYS A HB2  3  
ATOM 3815  H HB3  . LYS A 1 54  ? -1.882  -10.282 5.094   1.00 0.00 ? 54  LYS A HB3  3  
ATOM 3816  H HG2  . LYS A 1 54  ? -0.135  -9.571  3.716   1.00 0.00 ? 54  LYS A HG2  3  
ATOM 3817  H HG3  . LYS A 1 54  ? -1.035  -8.160  3.154   1.00 0.00 ? 54  LYS A HG3  3  
ATOM 3818  H HD2  . LYS A 1 54  ? 0.490   -7.258  4.664   1.00 0.00 ? 54  LYS A HD2  3  
ATOM 3819  H HD3  . LYS A 1 54  ? -0.982  -7.421  5.626   1.00 0.00 ? 54  LYS A HD3  3  
ATOM 3820  H HE2  . LYS A 1 54  ? 0.936   -9.693  5.590   1.00 0.00 ? 54  LYS A HE2  3  
ATOM 3821  H HE3  . LYS A 1 54  ? 1.370   -8.255  6.512   1.00 0.00 ? 54  LYS A HE3  3  
ATOM 3822  H HZ1  . LYS A 1 54  ? -1.043  -8.550  7.427   1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 3823  H HZ2  . LYS A 1 54  ? 0.238   -9.443  8.076   1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 3824  H HZ3  . LYS A 1 54  ? -0.812  -10.160 6.960   1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 3825  N N    . THR A 1 55  ? -4.891  -10.430 4.758   1.00 0.00 ? 55  THR A N    3  
ATOM 3826  C CA   . THR A 1 55  ? -5.937  -11.260 5.342   1.00 0.00 ? 55  THR A CA   3  
ATOM 3827  C C    . THR A 1 55  ? -6.717  -12.002 4.262   1.00 0.00 ? 55  THR A C    3  
ATOM 3828  O O    . THR A 1 55  ? -6.747  -13.231 4.239   1.00 0.00 ? 55  THR A O    3  
ATOM 3829  C CB   . THR A 1 55  ? -6.918  -10.421 6.182   1.00 0.00 ? 55  THR A CB   3  
ATOM 3830  O OG1  . THR A 1 55  ? -6.239  -9.859  7.311   1.00 0.00 ? 55  THR A OG1  3  
ATOM 3831  C CG2  . THR A 1 55  ? -8.087  -11.270 6.658   1.00 0.00 ? 55  THR A CG2  3  
ATOM 3832  H H    . THR A 1 55  ? -4.800  -9.499  5.051   1.00 0.00 ? 55  THR A H    3  
ATOM 3833  H HA   . THR A 1 55  ? -5.465  -11.983 5.992   1.00 0.00 ? 55  THR A HA   3  
ATOM 3834  H HB   . THR A 1 55  ? -7.301  -9.620  5.566   1.00 0.00 ? 55  THR A HB   3  
ATOM 3835  H HG1  . THR A 1 55  ? -5.334  -9.650  7.069   1.00 0.00 ? 55  THR A HG1  3  
ATOM 3836  H HG21 . THR A 1 55  ? -8.648  -11.620 5.804   1.00 0.00 ? 55  THR A HG21 3  
ATOM 3837  H HG22 . THR A 1 55  ? -8.729  -10.676 7.292   1.00 0.00 ? 55  THR A HG22 3  
ATOM 3838  H HG23 . THR A 1 55  ? -7.714  -12.116 7.214   1.00 0.00 ? 55  THR A HG23 3  
ATOM 3839  N N    . ASN A 1 56  ? -7.345  -11.246 3.367   1.00 0.00 ? 56  ASN A N    3  
ATOM 3840  C CA   . ASN A 1 56  ? -8.125  -11.832 2.284   1.00 0.00 ? 56  ASN A CA   3  
ATOM 3841  C C    . ASN A 1 56  ? -7.654  -11.310 0.930   1.00 0.00 ? 56  ASN A C    3  
ATOM 3842  O O    . ASN A 1 56  ? -8.183  -10.336 0.394   1.00 0.00 ? 56  ASN A O    3  
ATOM 3843  C CB   . ASN A 1 56  ? -9.612  -11.524 2.473   1.00 0.00 ? 56  ASN A CB   3  
ATOM 3844  C CG   . ASN A 1 56  ? -9.927  -10.054 2.276   1.00 0.00 ? 56  ASN A CG   3  
ATOM 3845  O OD1  . ASN A 1 56  ? -9.048  -9.199  2.387   1.00 0.00 ? 56  ASN A OD1  3  
ATOM 3846  N ND2  . ASN A 1 56  ? -11.186 -9.753  1.982   1.00 0.00 ? 56  ASN A ND2  3  
ATOM 3847  H H    . ASN A 1 56  ? -7.283  -10.270 3.438   1.00 0.00 ? 56  ASN A H    3  
ATOM 3848  H HA   . ASN A 1 56  ? -7.982  -12.902 2.314   1.00 0.00 ? 56  ASN A HA   3  
ATOM 3849  H HB2  . ASN A 1 56  ? -10.185 -12.094 1.756   1.00 0.00 ? 56  ASN A HB2  3  
ATOM 3850  H HB3  . ASN A 1 56  ? -9.908  -11.807 3.472   1.00 0.00 ? 56  ASN A HB3  3  
ATOM 3851  H HD21 . ASN A 1 56  ? -11.833 -10.486 1.909   1.00 0.00 ? 56  ASN A HD21 3  
ATOM 3852  H HD22 . ASN A 1 56  ? -11.418 -8.810  1.848   1.00 0.00 ? 56  ASN A HD22 3  
ATOM 3853  N N    . PRO A 1 57  ? -6.636  -11.973 0.362   1.00 0.00 ? 57  PRO A N    3  
ATOM 3854  C CA   . PRO A 1 57  ? -6.071  -11.595 -0.937  1.00 0.00 ? 57  PRO A CA   3  
ATOM 3855  C C    . PRO A 1 57  ? -7.028  -11.880 -2.090  1.00 0.00 ? 57  PRO A C    3  
ATOM 3856  O O    . PRO A 1 57  ? -6.844  -11.379 -3.200  1.00 0.00 ? 57  PRO A O    3  
ATOM 3857  C CB   . PRO A 1 57  ? -4.822  -12.472 -1.050  1.00 0.00 ? 57  PRO A CB   3  
ATOM 3858  C CG   . PRO A 1 57  ? -5.109  -13.653 -0.189  1.00 0.00 ? 57  PRO A CG   3  
ATOM 3859  C CD   . PRO A 1 57  ? -5.957  -13.144 0.944   1.00 0.00 ? 57  PRO A CD   3  
ATOM 3860  H HA   . PRO A 1 57  ? -5.785  -10.554 -0.957  1.00 0.00 ? 57  PRO A HA   3  
ATOM 3861  H HB2  . PRO A 1 57  ? -4.674  -12.761 -2.081  1.00 0.00 ? 57  PRO A HB2  3  
ATOM 3862  H HB3  . PRO A 1 57  ? -3.961  -11.926 -0.696  1.00 0.00 ? 57  PRO A HB3  3  
ATOM 3863  H HG2  . PRO A 1 57  ? -5.648  -14.398 -0.754  1.00 0.00 ? 57  PRO A HG2  3  
ATOM 3864  H HG3  . PRO A 1 57  ? -4.185  -14.064 0.191   1.00 0.00 ? 57  PRO A HG3  3  
ATOM 3865  H HD2  . PRO A 1 57  ? -6.673  -13.893 1.247   1.00 0.00 ? 57  PRO A HD2  3  
ATOM 3866  H HD3  . PRO A 1 57  ? -5.337  -12.853 1.779   1.00 0.00 ? 57  PRO A HD3  3  
ATOM 3867  N N    . CYS A 1 58  ? -8.049  -12.685 -1.820  1.00 0.00 ? 58  CYS A N    3  
ATOM 3868  C CA   . CYS A 1 58  ? -9.035  -13.036 -2.835  1.00 0.00 ? 58  CYS A CA   3  
ATOM 3869  C C    . CYS A 1 58  ? -10.425 -12.552 -2.435  1.00 0.00 ? 58  CYS A C    3  
ATOM 3870  O O    . CYS A 1 58  ? -11.427 -13.208 -2.715  1.00 0.00 ? 58  CYS A O    3  
ATOM 3871  C CB   . CYS A 1 58  ? -9.054  -14.550 -3.056  1.00 0.00 ? 58  CYS A CB   3  
ATOM 3872  S SG   . CYS A 1 58  ? -10.065 -15.079 -4.459  1.00 0.00 ? 58  CYS A SG   3  
ATOM 3873  H H    . CYS A 1 58  ? -8.143  -13.053 -0.916  1.00 0.00 ? 58  CYS A H    3  
ATOM 3874  H HA   . CYS A 1 58  ? -8.750  -12.550 -3.756  1.00 0.00 ? 58  CYS A HA   3  
ATOM 3875  H HB2  . CYS A 1 58  ? -8.045  -14.893 -3.232  1.00 0.00 ? 58  CYS A HB2  3  
ATOM 3876  H HB3  . CYS A 1 58  ? -9.441  -15.030 -2.170  1.00 0.00 ? 58  CYS A HB3  3  
ATOM 3877  H HG   . CYS A 1 58  ? -11.291 -15.311 -4.014  1.00 0.00 ? 58  CYS A HG   3  
ATOM 3878  N N    . GLY A 1 59  ? -10.477 -11.398 -1.776  1.00 0.00 ? 59  GLY A N    3  
ATOM 3879  C CA   . GLY A 1 59  ? -11.748 -10.846 -1.345  1.00 0.00 ? 59  GLY A CA   3  
ATOM 3880  C C    . GLY A 1 59  ? -11.918 -9.396  -1.752  1.00 0.00 ? 59  GLY A C    3  
ATOM 3881  O O    . GLY A 1 59  ? -11.683 -9.037  -2.906  1.00 0.00 ? 59  GLY A O    3  
ATOM 3882  H H    . GLY A 1 59  ? -9.645  -10.918 -1.580  1.00 0.00 ? 59  GLY A H    3  
ATOM 3883  H HA2  . GLY A 1 59  ? -12.547 -11.428 -1.781  1.00 0.00 ? 59  GLY A HA2  3  
ATOM 3884  H HA3  . GLY A 1 59  ? -11.811 -10.915 -0.269  1.00 0.00 ? 59  GLY A HA3  3  
ATOM 3885  N N    . SER A 1 60  ? -12.329 -8.561  -0.803  1.00 0.00 ? 60  SER A N    3  
ATOM 3886  C CA   . SER A 1 60  ? -12.535 -7.142  -1.071  1.00 0.00 ? 60  SER A CA   3  
ATOM 3887  C C    . SER A 1 60  ? -12.595 -6.347  0.230   1.00 0.00 ? 60  SER A C    3  
ATOM 3888  O O    . SER A 1 60  ? -12.714 -6.919  1.314   1.00 0.00 ? 60  SER A O    3  
ATOM 3889  C CB   . SER A 1 60  ? -13.824 -6.935  -1.868  1.00 0.00 ? 60  SER A CB   3  
ATOM 3890  O OG   . SER A 1 60  ? -14.927 -7.550  -1.225  1.00 0.00 ? 60  SER A OG   3  
ATOM 3891  H H    . SER A 1 60  ? -12.499 -8.908  0.098   1.00 0.00 ? 60  SER A H    3  
ATOM 3892  H HA   . SER A 1 60  ? -11.699 -6.790  -1.656  1.00 0.00 ? 60  SER A HA   3  
ATOM 3893  H HB2  . SER A 1 60  ? -14.021 -5.877  -1.961  1.00 0.00 ? 60  SER A HB2  3  
ATOM 3894  H HB3  . SER A 1 60  ? -13.709 -7.367  -2.852  1.00 0.00 ? 60  SER A HB3  3  
ATOM 3895  H HG   . SER A 1 60  ? -15.443 -6.883  -0.767  1.00 0.00 ? 60  SER A HG   3  
ATOM 3896  N N    . ILE A 1 61  ? -12.512 -5.026  0.113   1.00 0.00 ? 61  ILE A N    3  
ATOM 3897  C CA   . ILE A 1 61  ? -12.558 -4.152  1.279   1.00 0.00 ? 61  ILE A CA   3  
ATOM 3898  C C    . ILE A 1 61  ? -13.603 -3.056  1.103   1.00 0.00 ? 61  ILE A C    3  
ATOM 3899  O O    . ILE A 1 61  ? -13.514 -2.240  0.186   1.00 0.00 ? 61  ILE A O    3  
ATOM 3900  C CB   . ILE A 1 61  ? -11.188 -3.502  1.549   1.00 0.00 ? 61  ILE A CB   3  
ATOM 3901  C CG1  . ILE A 1 61  ? -11.294 -2.498  2.699   1.00 0.00 ? 61  ILE A CG1  3  
ATOM 3902  C CG2  . ILE A 1 61  ? -10.668 -2.822  0.292   1.00 0.00 ? 61  ILE A CG2  3  
ATOM 3903  C CD1  . ILE A 1 61  ? -9.957  -1.950  3.147   1.00 0.00 ? 61  ILE A CD1  3  
ATOM 3904  H H    . ILE A 1 61  ? -12.419 -4.630  -0.778  1.00 0.00 ? 61  ILE A H    3  
ATOM 3905  H HA   . ILE A 1 61  ? -12.824 -4.754  2.136   1.00 0.00 ? 61  ILE A HA   3  
ATOM 3906  H HB   . ILE A 1 61  ? -10.493 -4.280  1.823   1.00 0.00 ? 61  ILE A HB   3  
ATOM 3907  H HG12 . ILE A 1 61  ? -11.905 -1.666  2.387   1.00 0.00 ? 61  ILE A HG12 3  
ATOM 3908  H HG13 . ILE A 1 61  ? -11.757 -2.982  3.547   1.00 0.00 ? 61  ILE A HG13 3  
ATOM 3909  H HG21 . ILE A 1 61  ? -10.887 -3.439  -0.568  1.00 0.00 ? 61  ILE A HG21 3  
ATOM 3910  H HG22 . ILE A 1 61  ? -11.148 -1.862  0.177   1.00 0.00 ? 61  ILE A HG22 3  
ATOM 3911  H HG23 . ILE A 1 61  ? -9.600  -2.684  0.372   1.00 0.00 ? 61  ILE A HG23 3  
ATOM 3912  H HD11 . ILE A 1 61  ? -10.096 -1.331  4.021   1.00 0.00 ? 61  ILE A HD11 3  
ATOM 3913  H HD12 . ILE A 1 61  ? -9.294  -2.768  3.385   1.00 0.00 ? 61  ILE A HD12 3  
ATOM 3914  H HD13 . ILE A 1 61  ? -9.527  -1.357  2.353   1.00 0.00 ? 61  ILE A HD13 3  
ATOM 3915  N N    . SER A 1 62  ? -14.593 -3.042  1.990   1.00 0.00 ? 62  SER A N    3  
ATOM 3916  C CA   . SER A 1 62  ? -15.657 -2.046  1.932   1.00 0.00 ? 62  SER A CA   3  
ATOM 3917  C C    . SER A 1 62  ? -15.433 -0.951  2.970   1.00 0.00 ? 62  SER A C    3  
ATOM 3918  O O    . SER A 1 62  ? -15.017 -1.222  4.096   1.00 0.00 ? 62  SER A O    3  
ATOM 3919  C CB   . SER A 1 62  ? -17.017 -2.709  2.159   1.00 0.00 ? 62  SER A CB   3  
ATOM 3920  O OG   . SER A 1 62  ? -17.126 -3.210  3.480   1.00 0.00 ? 62  SER A OG   3  
ATOM 3921  H H    . SER A 1 62  ? -14.609 -3.719  2.699   1.00 0.00 ? 62  SER A H    3  
ATOM 3922  H HA   . SER A 1 62  ? -15.643 -1.602  0.948   1.00 0.00 ? 62  SER A HA   3  
ATOM 3923  H HB2  . SER A 1 62  ? -17.800 -1.984  1.997   1.00 0.00 ? 62  SER A HB2  3  
ATOM 3924  H HB3  . SER A 1 62  ? -17.136 -3.529  1.465   1.00 0.00 ? 62  SER A HB3  3  
ATOM 3925  H HG   . SER A 1 62  ? -18.053 -3.330  3.702   1.00 0.00 ? 62  SER A HG   3  
ATOM 3926  N N    . PHE A 1 63  ? -15.712 0.289   2.582   1.00 0.00 ? 63  PHE A N    3  
ATOM 3927  C CA   . PHE A 1 63  ? -15.541 1.428   3.477   1.00 0.00 ? 63  PHE A CA   3  
ATOM 3928  C C    . PHE A 1 63  ? -16.245 2.664   2.925   1.00 0.00 ? 63  PHE A C    3  
ATOM 3929  O O    . PHE A 1 63  ? -16.817 2.633   1.835   1.00 0.00 ? 63  PHE A O    3  
ATOM 3930  C CB   . PHE A 1 63  ? -14.054 1.723   3.682   1.00 0.00 ? 63  PHE A CB   3  
ATOM 3931  C CG   . PHE A 1 63  ? -13.343 2.122   2.420   1.00 0.00 ? 63  PHE A CG   3  
ATOM 3932  C CD1  . PHE A 1 63  ? -12.760 1.166   1.605   1.00 0.00 ? 63  PHE A CD1  3  
ATOM 3933  C CD2  . PHE A 1 63  ? -13.257 3.455   2.050   1.00 0.00 ? 63  PHE A CD2  3  
ATOM 3934  C CE1  . PHE A 1 63  ? -12.105 1.530   0.443   1.00 0.00 ? 63  PHE A CE1  3  
ATOM 3935  C CE2  . PHE A 1 63  ? -12.603 3.825   0.890   1.00 0.00 ? 63  PHE A CE2  3  
ATOM 3936  C CZ   . PHE A 1 63  ? -12.026 2.862   0.086   1.00 0.00 ? 63  PHE A CZ   3  
ATOM 3937  H H    . PHE A 1 63  ? -16.041 0.442   1.671   1.00 0.00 ? 63  PHE A H    3  
ATOM 3938  H HA   . PHE A 1 63  ? -15.982 1.170   4.427   1.00 0.00 ? 63  PHE A HA   3  
ATOM 3939  H HB2  . PHE A 1 63  ? -13.948 2.530   4.391   1.00 0.00 ? 63  PHE A HB2  3  
ATOM 3940  H HB3  . PHE A 1 63  ? -13.569 0.840   4.072   1.00 0.00 ? 63  PHE A HB3  3  
ATOM 3941  H HD1  . PHE A 1 63  ? -12.821 0.123   1.884   1.00 0.00 ? 63  PHE A HD1  3  
ATOM 3942  H HD2  . PHE A 1 63  ? -13.707 4.210   2.678   1.00 0.00 ? 63  PHE A HD2  3  
ATOM 3943  H HE1  . PHE A 1 63  ? -11.655 0.774   -0.183  1.00 0.00 ? 63  PHE A HE1  3  
ATOM 3944  H HE2  . PHE A 1 63  ? -12.543 4.867   0.613   1.00 0.00 ? 63  PHE A HE2  3  
ATOM 3945  H HZ   . PHE A 1 63  ? -11.516 3.149   -0.821  1.00 0.00 ? 63  PHE A HZ   3  
ATOM 3946  N N    . THR A 1 64  ? -16.200 3.752   3.687   1.00 0.00 ? 64  THR A N    3  
ATOM 3947  C CA   . THR A 1 64  ? -16.834 4.999   3.278   1.00 0.00 ? 64  THR A CA   3  
ATOM 3948  C C    . THR A 1 64  ? -15.984 6.203   3.668   1.00 0.00 ? 64  THR A C    3  
ATOM 3949  O O    . THR A 1 64  ? -15.253 6.165   4.658   1.00 0.00 ? 64  THR A O    3  
ATOM 3950  C CB   . THR A 1 64  ? -18.234 5.149   3.903   1.00 0.00 ? 64  THR A CB   3  
ATOM 3951  O OG1  . THR A 1 64  ? -18.134 5.162   5.331   1.00 0.00 ? 64  THR A OG1  3  
ATOM 3952  C CG2  . THR A 1 64  ? -19.147 4.014   3.463   1.00 0.00 ? 64  THR A CG2  3  
ATOM 3953  H H    . THR A 1 64  ? -15.729 3.714   4.546   1.00 0.00 ? 64  THR A H    3  
ATOM 3954  H HA   . THR A 1 64  ? -16.943 4.980   2.203   1.00 0.00 ? 64  THR A HA   3  
ATOM 3955  H HB   . THR A 1 64  ? -18.661 6.084   3.571   1.00 0.00 ? 64  THR A HB   3  
ATOM 3956  H HG1  . THR A 1 64  ? -19.009 5.271   5.712   1.00 0.00 ? 64  THR A HG1  3  
ATOM 3957  H HG21 . THR A 1 64  ? -19.322 3.350   4.296   1.00 0.00 ? 64  THR A HG21 3  
ATOM 3958  H HG22 . THR A 1 64  ? -18.680 3.468   2.658   1.00 0.00 ? 64  THR A HG22 3  
ATOM 3959  H HG23 . THR A 1 64  ? -20.088 4.421   3.125   1.00 0.00 ? 64  THR A HG23 3  
ATOM 3960  N N    . THR A 1 65  ? -16.085 7.272   2.884   1.00 0.00 ? 65  THR A N    3  
ATOM 3961  C CA   . THR A 1 65  ? -15.325 8.487   3.148   1.00 0.00 ? 65  THR A CA   3  
ATOM 3962  C C    . THR A 1 65  ? -16.227 9.716   3.124   1.00 0.00 ? 65  THR A C    3  
ATOM 3963  O O    . THR A 1 65  ? -16.453 10.352  4.153   1.00 0.00 ? 65  THR A O    3  
ATOM 3964  C CB   . THR A 1 65  ? -14.193 8.675   2.121   1.00 0.00 ? 65  THR A CB   3  
ATOM 3965  O OG1  . THR A 1 65  ? -14.745 8.905   0.820   1.00 0.00 ? 65  THR A OG1  3  
ATOM 3966  C CG2  . THR A 1 65  ? -13.287 7.454   2.084   1.00 0.00 ? 65  THR A CG2  3  
ATOM 3967  H H    . THR A 1 65  ? -16.685 7.241   2.110   1.00 0.00 ? 65  THR A H    3  
ATOM 3968  H HA   . THR A 1 65  ? -14.882 8.397   4.129   1.00 0.00 ? 65  THR A HA   3  
ATOM 3969  H HB   . THR A 1 65  ? -13.604 9.534   2.411   1.00 0.00 ? 65  THR A HB   3  
ATOM 3970  H HG1  . THR A 1 65  ? -14.133 8.587   0.152   1.00 0.00 ? 65  THR A HG1  3  
ATOM 3971  H HG21 . THR A 1 65  ? -12.666 7.439   2.968   1.00 0.00 ? 65  THR A HG21 3  
ATOM 3972  H HG22 . THR A 1 65  ? -12.661 7.496   1.205   1.00 0.00 ? 65  THR A HG22 3  
ATOM 3973  H HG23 . THR A 1 65  ? -13.890 6.559   2.055   1.00 0.00 ? 65  THR A HG23 3  
ATOM 3974  N N    . SER A 1 66  ? -16.741 10.044  1.942   1.00 0.00 ? 66  SER A N    3  
ATOM 3975  C CA   . SER A 1 66  ? -17.616 11.199  1.784   1.00 0.00 ? 66  SER A CA   3  
ATOM 3976  C C    . SER A 1 66  ? -19.006 10.769  1.326   1.00 0.00 ? 66  SER A C    3  
ATOM 3977  O O    . SER A 1 66  ? -19.248 10.571  0.135   1.00 0.00 ? 66  SER A O    3  
ATOM 3978  C CB   . SER A 1 66  ? -17.018 12.185  0.777   1.00 0.00 ? 66  SER A CB   3  
ATOM 3979  O OG   . SER A 1 66  ? -15.807 12.737  1.262   1.00 0.00 ? 66  SER A OG   3  
ATOM 3980  H H    . SER A 1 66  ? -16.523 9.497   1.158   1.00 0.00 ? 66  SER A H    3  
ATOM 3981  H HA   . SER A 1 66  ? -17.700 11.686  2.744   1.00 0.00 ? 66  SER A HA   3  
ATOM 3982  H HB2  . SER A 1 66  ? -16.819 11.671  -0.151  1.00 0.00 ? 66  SER A HB2  3  
ATOM 3983  H HB3  . SER A 1 66  ? -17.721 12.986  0.602   1.00 0.00 ? 66  SER A HB3  3  
ATOM 3984  H HG   . SER A 1 66  ? -15.867 13.695  1.256   1.00 0.00 ? 66  SER A HG   3  
ATOM 3985  N N    . LYS A 1 67  ? -19.918 10.625  2.282   1.00 0.00 ? 67  LYS A N    3  
ATOM 3986  C CA   . LYS A 1 67  ? -21.286 10.219  1.980   1.00 0.00 ? 67  LYS A CA   3  
ATOM 3987  C C    . LYS A 1 67  ? -21.322 9.277   0.781   1.00 0.00 ? 67  LYS A C    3  
ATOM 3988  O O    . LYS A 1 67  ? -22.257 9.310   -0.019  1.00 0.00 ? 67  LYS A O    3  
ATOM 3989  C CB   . LYS A 1 67  ? -22.155 11.447  1.704   1.00 0.00 ? 67  LYS A CB   3  
ATOM 3990  C CG   . LYS A 1 67  ? -21.681 12.274  0.521   1.00 0.00 ? 67  LYS A CG   3  
ATOM 3991  C CD   . LYS A 1 67  ? -22.137 13.720  0.633   1.00 0.00 ? 67  LYS A CD   3  
ATOM 3992  C CE   . LYS A 1 67  ? -23.593 13.878  0.222   1.00 0.00 ? 67  LYS A CE   3  
ATOM 3993  N NZ   . LYS A 1 67  ? -24.518 13.698  1.375   1.00 0.00 ? 67  LYS A NZ   3  
ATOM 3994  H H    . LYS A 1 67  ? -19.665 10.797  3.214   1.00 0.00 ? 67  LYS A H    3  
ATOM 3995  H HA   . LYS A 1 67  ? -21.676 9.699   2.843   1.00 0.00 ? 67  LYS A HA   3  
ATOM 3996  H HB2  . LYS A 1 67  ? -23.166 11.121  1.507   1.00 0.00 ? 67  LYS A HB2  3  
ATOM 3997  H HB3  . LYS A 1 67  ? -22.155 12.079  2.581   1.00 0.00 ? 67  LYS A HB3  3  
ATOM 3998  H HG2  . LYS A 1 67  ? -20.602 12.250  0.486   1.00 0.00 ? 67  LYS A HG2  3  
ATOM 3999  H HG3  . LYS A 1 67  ? -22.083 11.849  -0.388  1.00 0.00 ? 67  LYS A HG3  3  
ATOM 4000  H HD2  . LYS A 1 67  ? -22.027 14.045  1.657   1.00 0.00 ? 67  LYS A HD2  3  
ATOM 4001  H HD3  . LYS A 1 67  ? -21.522 14.333  -0.010  1.00 0.00 ? 67  LYS A HD3  3  
ATOM 4002  H HE2  . LYS A 1 67  ? -23.732 14.866  -0.189  1.00 0.00 ? 67  LYS A HE2  3  
ATOM 4003  H HE3  . LYS A 1 67  ? -23.823 13.139  -0.532  1.00 0.00 ? 67  LYS A HE3  3  
ATOM 4004  H HZ1  . LYS A 1 67  ? -24.406 12.745  1.777   1.00 0.00 ? 67  LYS A HZ1  3  
ATOM 4005  H HZ2  . LYS A 1 67  ? -25.503 13.816  1.064   1.00 0.00 ? 67  LYS A HZ2  3  
ATOM 4006  H HZ3  . LYS A 1 67  ? -24.311 14.401  2.112   1.00 0.00 ? 67  LYS A HZ3  3  
ATOM 4007  N N    . PHE A 1 68  ? -20.299 8.437   0.663   1.00 0.00 ? 68  PHE A N    3  
ATOM 4008  C CA   . PHE A 1 68  ? -20.214 7.486   -0.439  1.00 0.00 ? 68  PHE A CA   3  
ATOM 4009  C C    . PHE A 1 68  ? -19.558 6.185   0.015   1.00 0.00 ? 68  PHE A C    3  
ATOM 4010  O O    . PHE A 1 68  ? -18.998 6.108   1.109   1.00 0.00 ? 68  PHE A O    3  
ATOM 4011  C CB   . PHE A 1 68  ? -19.425 8.090   -1.603  1.00 0.00 ? 68  PHE A CB   3  
ATOM 4012  C CG   . PHE A 1 68  ? -20.127 9.237   -2.271  1.00 0.00 ? 68  PHE A CG   3  
ATOM 4013  C CD1  . PHE A 1 68  ? -21.481 9.167   -2.556  1.00 0.00 ? 68  PHE A CD1  3  
ATOM 4014  C CD2  . PHE A 1 68  ? -19.433 10.386  -2.615  1.00 0.00 ? 68  PHE A CD2  3  
ATOM 4015  C CE1  . PHE A 1 68  ? -22.129 10.220  -3.172  1.00 0.00 ? 68  PHE A CE1  3  
ATOM 4016  C CE2  . PHE A 1 68  ? -20.075 11.443  -3.231  1.00 0.00 ? 68  PHE A CE2  3  
ATOM 4017  C CZ   . PHE A 1 68  ? -21.426 11.361  -3.509  1.00 0.00 ? 68  PHE A CZ   3  
ATOM 4018  H H    . PHE A 1 68  ? -19.583 8.458   1.333   1.00 0.00 ? 68  PHE A H    3  
ATOM 4019  H HA   . PHE A 1 68  ? -21.219 7.272   -0.769  1.00 0.00 ? 68  PHE A HA   3  
ATOM 4020  H HB2  . PHE A 1 68  ? -18.476 8.450   -1.236  1.00 0.00 ? 68  PHE A HB2  3  
ATOM 4021  H HB3  . PHE A 1 68  ? -19.253 7.326   -2.346  1.00 0.00 ? 68  PHE A HB3  3  
ATOM 4022  H HD1  . PHE A 1 68  ? -22.033 8.276   -2.293  1.00 0.00 ? 68  PHE A HD1  3  
ATOM 4023  H HD2  . PHE A 1 68  ? -18.376 10.451  -2.397  1.00 0.00 ? 68  PHE A HD2  3  
ATOM 4024  H HE1  . PHE A 1 68  ? -23.185 10.154  -3.388  1.00 0.00 ? 68  PHE A HE1  3  
ATOM 4025  H HE2  . PHE A 1 68  ? -19.522 12.333  -3.492  1.00 0.00 ? 68  PHE A HE2  3  
ATOM 4026  H HZ   . PHE A 1 68  ? -21.930 12.185  -3.990  1.00 0.00 ? 68  PHE A HZ   3  
ATOM 4027  N N    . SER A 1 69  ? -19.631 5.165   -0.834  1.00 0.00 ? 69  SER A N    3  
ATOM 4028  C CA   . SER A 1 69  ? -19.048 3.866   -0.519  1.00 0.00 ? 69  SER A CA   3  
ATOM 4029  C C    . SER A 1 69  ? -18.122 3.400   -1.639  1.00 0.00 ? 69  SER A C    3  
ATOM 4030  O O    . SER A 1 69  ? -18.279 3.795   -2.794  1.00 0.00 ? 69  SER A O    3  
ATOM 4031  C CB   . SER A 1 69  ? -20.151 2.830   -0.291  1.00 0.00 ? 69  SER A CB   3  
ATOM 4032  O OG   . SER A 1 69  ? -20.851 3.088   0.914   1.00 0.00 ? 69  SER A OG   3  
ATOM 4033  H H    . SER A 1 69  ? -20.090 5.288   -1.691  1.00 0.00 ? 69  SER A H    3  
ATOM 4034  H HA   . SER A 1 69  ? -18.472 3.972   0.388   1.00 0.00 ? 69  SER A HA   3  
ATOM 4035  H HB2  . SER A 1 69  ? -20.849 2.864   -1.113  1.00 0.00 ? 69  SER A HB2  3  
ATOM 4036  H HB3  . SER A 1 69  ? -19.710 1.846   -0.233  1.00 0.00 ? 69  SER A HB3  3  
ATOM 4037  H HG   . SER A 1 69  ? -21.434 2.351   1.110   1.00 0.00 ? 69  SER A HG   3  
ATOM 4038  N N    . TYR A 1 70  ? -17.156 2.559   -1.287  1.00 0.00 ? 70  TYR A N    3  
ATOM 4039  C CA   . TYR A 1 70  ? -16.202 2.041   -2.261  1.00 0.00 ? 70  TYR A CA   3  
ATOM 4040  C C    . TYR A 1 70  ? -15.796 0.610   -1.918  1.00 0.00 ? 70  TYR A C    3  
ATOM 4041  O O    . TYR A 1 70  ? -15.378 0.322   -0.796  1.00 0.00 ? 70  TYR A O    3  
ATOM 4042  C CB   . TYR A 1 70  ? -14.962 2.935   -2.317  1.00 0.00 ? 70  TYR A CB   3  
ATOM 4043  C CG   . TYR A 1 70  ? -15.244 4.328   -2.832  1.00 0.00 ? 70  TYR A CG   3  
ATOM 4044  C CD1  . TYR A 1 70  ? -15.638 4.538   -4.147  1.00 0.00 ? 70  TYR A CD1  3  
ATOM 4045  C CD2  . TYR A 1 70  ? -15.116 5.436   -2.002  1.00 0.00 ? 70  TYR A CD2  3  
ATOM 4046  C CE1  . TYR A 1 70  ? -15.895 5.810   -4.622  1.00 0.00 ? 70  TYR A CE1  3  
ATOM 4047  C CE2  . TYR A 1 70  ? -15.372 6.711   -2.467  1.00 0.00 ? 70  TYR A CE2  3  
ATOM 4048  C CZ   . TYR A 1 70  ? -15.761 6.892   -3.778  1.00 0.00 ? 70  TYR A CZ   3  
ATOM 4049  O OH   . TYR A 1 70  ? -16.018 8.161   -4.247  1.00 0.00 ? 70  TYR A OH   3  
ATOM 4050  H H    . TYR A 1 70  ? -17.082 2.280   -0.351  1.00 0.00 ? 70  TYR A H    3  
ATOM 4051  H HA   . TYR A 1 70  ? -16.681 2.045   -3.229  1.00 0.00 ? 70  TYR A HA   3  
ATOM 4052  H HB2  . TYR A 1 70  ? -14.547 3.026   -1.325  1.00 0.00 ? 70  TYR A HB2  3  
ATOM 4053  H HB3  . TYR A 1 70  ? -14.229 2.482   -2.968  1.00 0.00 ? 70  TYR A HB3  3  
ATOM 4054  H HD1  . TYR A 1 70  ? -15.743 3.687   -4.805  1.00 0.00 ? 70  TYR A HD1  3  
ATOM 4055  H HD2  . TYR A 1 70  ? -14.811 5.290   -0.976  1.00 0.00 ? 70  TYR A HD2  3  
ATOM 4056  H HE1  . TYR A 1 70  ? -16.201 5.952   -5.648  1.00 0.00 ? 70  TYR A HE1  3  
ATOM 4057  H HE2  . TYR A 1 70  ? -15.267 7.559   -1.807  1.00 0.00 ? 70  TYR A HE2  3  
ATOM 4058  H HH   . TYR A 1 70  ? -16.744 8.129   -4.874  1.00 0.00 ? 70  TYR A HH   3  
ATOM 4059  N N    . LYS A 1 71  ? -15.922 -0.283  -2.893  1.00 0.00 ? 71  LYS A N    3  
ATOM 4060  C CA   . LYS A 1 71  ? -15.568 -1.684  -2.699  1.00 0.00 ? 71  LYS A CA   3  
ATOM 4061  C C    . LYS A 1 71  ? -14.369 -2.067  -3.560  1.00 0.00 ? 71  LYS A C    3  
ATOM 4062  O O    . LYS A 1 71  ? -14.508 -2.317  -4.758  1.00 0.00 ? 71  LYS A O    3  
ATOM 4063  C CB   . LYS A 1 71  ? -16.759 -2.584  -3.035  1.00 0.00 ? 71  LYS A CB   3  
ATOM 4064  C CG   . LYS A 1 71  ? -16.395 -4.054  -3.157  1.00 0.00 ? 71  LYS A CG   3  
ATOM 4065  C CD   . LYS A 1 71  ? -17.566 -4.877  -3.668  1.00 0.00 ? 71  LYS A CD   3  
ATOM 4066  C CE   . LYS A 1 71  ? -17.520 -6.301  -3.135  1.00 0.00 ? 71  LYS A CE   3  
ATOM 4067  N NZ   . LYS A 1 71  ? -18.453 -7.199  -3.871  1.00 0.00 ? 71  LYS A NZ   3  
ATOM 4068  H H    . LYS A 1 71  ? -16.262 0.007   -3.766  1.00 0.00 ? 71  LYS A H    3  
ATOM 4069  H HA   . LYS A 1 71  ? -15.307 -1.819  -1.660  1.00 0.00 ? 71  LYS A HA   3  
ATOM 4070  H HB2  . LYS A 1 71  ? -17.502 -2.482  -2.258  1.00 0.00 ? 71  LYS A HB2  3  
ATOM 4071  H HB3  . LYS A 1 71  ? -17.185 -2.261  -3.974  1.00 0.00 ? 71  LYS A HB3  3  
ATOM 4072  H HG2  . LYS A 1 71  ? -15.570 -4.155  -3.846  1.00 0.00 ? 71  LYS A HG2  3  
ATOM 4073  H HG3  . LYS A 1 71  ? -16.103 -4.425  -2.185  1.00 0.00 ? 71  LYS A HG3  3  
ATOM 4074  H HD2  . LYS A 1 71  ? -18.487 -4.415  -3.348  1.00 0.00 ? 71  LYS A HD2  3  
ATOM 4075  H HD3  . LYS A 1 71  ? -17.531 -4.905  -4.748  1.00 0.00 ? 71  LYS A HD3  3  
ATOM 4076  H HE2  . LYS A 1 71  ? -16.514 -6.679  -3.240  1.00 0.00 ? 71  LYS A HE2  3  
ATOM 4077  H HE3  . LYS A 1 71  ? -17.793 -6.290  -2.091  1.00 0.00 ? 71  LYS A HE3  3  
ATOM 4078  H HZ1  . LYS A 1 71  ? -17.916 -7.869  -4.457  1.00 0.00 ? 71  LYS A HZ1  3  
ATOM 4079  H HZ2  . LYS A 1 71  ? -19.076 -6.639  -4.487  1.00 0.00 ? 71  LYS A HZ2  3  
ATOM 4080  H HZ3  . LYS A 1 71  ? -19.038 -7.734  -3.198  1.00 0.00 ? 71  LYS A HZ3  3  
ATOM 4081  N N    . ILE A 1 72  ? -13.193 -2.111  -2.944  1.00 0.00 ? 72  ILE A N    3  
ATOM 4082  C CA   . ILE A 1 72  ? -11.971 -2.466  -3.655  1.00 0.00 ? 72  ILE A CA   3  
ATOM 4083  C C    . ILE A 1 72  ? -11.734 -3.972  -3.623  1.00 0.00 ? 72  ILE A C    3  
ATOM 4084  O O    . ILE A 1 72  ? -11.362 -4.531  -2.591  1.00 0.00 ? 72  ILE A O    3  
ATOM 4085  C CB   . ILE A 1 72  ? -10.744 -1.752  -3.057  1.00 0.00 ? 72  ILE A CB   3  
ATOM 4086  C CG1  . ILE A 1 72  ? -10.911 -0.234  -3.156  1.00 0.00 ? 72  ILE A CG1  3  
ATOM 4087  C CG2  . ILE A 1 72  ? -9.474  -2.198  -3.765  1.00 0.00 ? 72  ILE A CG2  3  
ATOM 4088  C CD1  . ILE A 1 72  ? -9.814  0.541   -2.461  1.00 0.00 ? 72  ILE A CD1  3  
ATOM 4089  H H    . ILE A 1 72  ? -13.146 -1.901  -1.988  1.00 0.00 ? 72  ILE A H    3  
ATOM 4090  H HA   . ILE A 1 72  ? -12.080 -2.151  -4.682  1.00 0.00 ? 72  ILE A HA   3  
ATOM 4091  H HB   . ILE A 1 72  ? -10.665 -2.031  -2.017  1.00 0.00 ? 72  ILE A HB   3  
ATOM 4092  H HG12 . ILE A 1 72  ? -10.913 0.054   -4.195  1.00 0.00 ? 72  ILE A HG12 3  
ATOM 4093  H HG13 . ILE A 1 72  ? -11.853 0.047   -2.707  1.00 0.00 ? 72  ILE A HG13 3  
ATOM 4094  H HG21 . ILE A 1 72  ? -9.675  -3.094  -4.334  1.00 0.00 ? 72  ILE A HG21 3  
ATOM 4095  H HG22 . ILE A 1 72  ? -9.141  -1.417  -4.432  1.00 0.00 ? 72  ILE A HG22 3  
ATOM 4096  H HG23 . ILE A 1 72  ? -8.706  -2.401  -3.035  1.00 0.00 ? 72  ILE A HG23 3  
ATOM 4097  H HD11 . ILE A 1 72  ? -8.857  0.099   -2.694  1.00 0.00 ? 72  ILE A HD11 3  
ATOM 4098  H HD12 . ILE A 1 72  ? -9.829  1.567   -2.797  1.00 0.00 ? 72  ILE A HD12 3  
ATOM 4099  H HD13 . ILE A 1 72  ? -9.974  0.510   -1.392  1.00 0.00 ? 72  ILE A HD13 3  
ATOM 4100  N N    . ASP A 1 73  ? -11.951 -4.623  -4.761  1.00 0.00 ? 73  ASP A N    3  
ATOM 4101  C CA   . ASP A 1 73  ? -11.758 -6.065  -4.865  1.00 0.00 ? 73  ASP A CA   3  
ATOM 4102  C C    . ASP A 1 73  ? -10.303 -6.397  -5.181  1.00 0.00 ? 73  ASP A C    3  
ATOM 4103  O O    . ASP A 1 73  ? -9.693  -5.788  -6.060  1.00 0.00 ? 73  ASP A O    3  
ATOM 4104  C CB   . ASP A 1 73  ? -12.673 -6.646  -5.943  1.00 0.00 ? 73  ASP A CB   3  
ATOM 4105  C CG   . ASP A 1 73  ? -14.116 -6.211  -5.775  1.00 0.00 ? 73  ASP A CG   3  
ATOM 4106  O OD1  . ASP A 1 73  ? -14.527 -5.953  -4.624  1.00 0.00 ? 73  ASP A OD1  3  
ATOM 4107  O OD2  . ASP A 1 73  ? -14.832 -6.127  -6.794  1.00 0.00 ? 73  ASP A OD2  3  
ATOM 4108  H H    . ASP A 1 73  ? -12.246 -4.122  -5.549  1.00 0.00 ? 73  ASP A H    3  
ATOM 4109  H HA   . ASP A 1 73  ? -12.015 -6.503  -3.913  1.00 0.00 ? 73  ASP A HA   3  
ATOM 4110  H HB2  . ASP A 1 73  ? -12.329 -6.318  -6.914  1.00 0.00 ? 73  ASP A HB2  3  
ATOM 4111  H HB3  . ASP A 1 73  ? -12.633 -7.725  -5.897  1.00 0.00 ? 73  ASP A HB3  3  
ATOM 4112  N N    . PHE A 1 74  ? -9.752  -7.366  -4.458  1.00 0.00 ? 74  PHE A N    3  
ATOM 4113  C CA   . PHE A 1 74  ? -8.368  -7.779  -4.660  1.00 0.00 ? 74  PHE A CA   3  
ATOM 4114  C C    . PHE A 1 74  ? -8.281  -8.913  -5.677  1.00 0.00 ? 74  PHE A C    3  
ATOM 4115  O O    . PHE A 1 74  ? -7.450  -8.885  -6.584  1.00 0.00 ? 74  PHE A O    3  
ATOM 4116  C CB   . PHE A 1 74  ? -7.746  -8.220  -3.333  1.00 0.00 ? 74  PHE A CB   3  
ATOM 4117  C CG   . PHE A 1 74  ? -7.579  -7.099  -2.347  1.00 0.00 ? 74  PHE A CG   3  
ATOM 4118  C CD1  . PHE A 1 74  ? -7.087  -5.870  -2.753  1.00 0.00 ? 74  PHE A CD1  3  
ATOM 4119  C CD2  . PHE A 1 74  ? -7.916  -7.276  -1.015  1.00 0.00 ? 74  PHE A CD2  3  
ATOM 4120  C CE1  . PHE A 1 74  ? -6.932  -4.837  -1.848  1.00 0.00 ? 74  PHE A CE1  3  
ATOM 4121  C CE2  . PHE A 1 74  ? -7.763  -6.246  -0.105  1.00 0.00 ? 74  PHE A CE2  3  
ATOM 4122  C CZ   . PHE A 1 74  ? -7.271  -5.025  -0.522  1.00 0.00 ? 74  PHE A CZ   3  
ATOM 4123  H H    . PHE A 1 74  ? -10.290 -7.815  -3.772  1.00 0.00 ? 74  PHE A H    3  
ATOM 4124  H HA   . PHE A 1 74  ? -7.822  -6.929  -5.039  1.00 0.00 ? 74  PHE A HA   3  
ATOM 4125  H HB2  . PHE A 1 74  ? -8.378  -8.969  -2.880  1.00 0.00 ? 74  PHE A HB2  3  
ATOM 4126  H HB3  . PHE A 1 74  ? -6.772  -8.644  -3.524  1.00 0.00 ? 74  PHE A HB3  3  
ATOM 4127  H HD1  . PHE A 1 74  ? -6.822  -5.720  -3.790  1.00 0.00 ? 74  PHE A HD1  3  
ATOM 4128  H HD2  . PHE A 1 74  ? -8.301  -8.231  -0.687  1.00 0.00 ? 74  PHE A HD2  3  
ATOM 4129  H HE1  . PHE A 1 74  ? -6.547  -3.883  -2.177  1.00 0.00 ? 74  PHE A HE1  3  
ATOM 4130  H HE2  . PHE A 1 74  ? -8.029  -6.397  0.931   1.00 0.00 ? 74  PHE A HE2  3  
ATOM 4131  H HZ   . PHE A 1 74  ? -7.150  -4.220  0.187   1.00 0.00 ? 74  PHE A HZ   3  
ATOM 4132  N N    . ALA A 1 75  ? -9.146  -9.909  -5.519  1.00 0.00 ? 75  ALA A N    3  
ATOM 4133  C CA   . ALA A 1 75  ? -9.169  -11.052 -6.424  1.00 0.00 ? 75  ALA A CA   3  
ATOM 4134  C C    . ALA A 1 75  ? -9.386  -10.606 -7.866  1.00 0.00 ? 75  ALA A C    3  
ATOM 4135  O O    . ALA A 1 75  ? -8.781  -11.148 -8.790  1.00 0.00 ? 75  ALA A O    3  
ATOM 4136  C CB   . ALA A 1 75  ? -10.251 -12.036 -6.004  1.00 0.00 ? 75  ALA A CB   3  
ATOM 4137  H H    . ALA A 1 75  ? -9.785  -9.874  -4.777  1.00 0.00 ? 75  ALA A H    3  
ATOM 4138  H HA   . ALA A 1 75  ? -8.214  -11.553 -6.353  1.00 0.00 ? 75  ALA A HA   3  
ATOM 4139  H HB1  . ALA A 1 75  ? -11.102 -11.936 -6.662  1.00 0.00 ? 75  ALA A HB1  3  
ATOM 4140  H HB2  . ALA A 1 75  ? -9.865  -13.042 -6.065  1.00 0.00 ? 75  ALA A HB2  3  
ATOM 4141  H HB3  . ALA A 1 75  ? -10.553 -11.826 -4.989  1.00 0.00 ? 75  ALA A HB3  3  
ATOM 4142  N N    . GLU A 1 76  ? -10.255 -9.617  -8.050  1.00 0.00 ? 76  GLU A N    3  
ATOM 4143  C CA   . GLU A 1 76  ? -10.553 -9.100  -9.381  1.00 0.00 ? 76  GLU A CA   3  
ATOM 4144  C C    . GLU A 1 76  ? -9.513  -8.069  -9.809  1.00 0.00 ? 76  GLU A C    3  
ATOM 4145  O O    . GLU A 1 76  ? -9.495  -7.631  -10.959 1.00 0.00 ? 76  GLU A O    3  
ATOM 4146  C CB   . GLU A 1 76  ? -11.949 -8.476  -9.409  1.00 0.00 ? 76  GLU A CB   3  
ATOM 4147  C CG   . GLU A 1 76  ? -13.074 -9.497  -9.358  1.00 0.00 ? 76  GLU A CG   3  
ATOM 4148  C CD   . GLU A 1 76  ? -14.431 -8.884  -9.644  1.00 0.00 ? 76  GLU A CD   3  
ATOM 4149  O OE1  . GLU A 1 76  ? -14.590 -8.271  -10.721 1.00 0.00 ? 76  GLU A OE1  3  
ATOM 4150  O OE2  . GLU A 1 76  ? -15.334 -9.017  -8.792  1.00 0.00 ? 76  GLU A OE2  3  
ATOM 4151  H H    . GLU A 1 76  ? -10.706 -9.225  -7.273  1.00 0.00 ? 76  GLU A H    3  
ATOM 4152  H HA   . GLU A 1 76  ? -10.525 -9.929  -10.072 1.00 0.00 ? 76  GLU A HA   3  
ATOM 4153  H HB2  . GLU A 1 76  ? -12.052 -7.815  -8.561  1.00 0.00 ? 76  GLU A HB2  3  
ATOM 4154  H HB3  . GLU A 1 76  ? -12.054 -7.901  -10.317 1.00 0.00 ? 76  GLU A HB3  3  
ATOM 4155  H HG2  . GLU A 1 76  ? -12.880 -10.263 -10.094 1.00 0.00 ? 76  GLU A HG2  3  
ATOM 4156  H HG3  . GLU A 1 76  ? -13.096 -9.941  -8.374  1.00 0.00 ? 76  GLU A HG3  3  
ATOM 4157  N N    . MET A 1 77  ? -8.650  -7.684  -8.875  1.00 0.00 ? 77  MET A N    3  
ATOM 4158  C CA   . MET A 1 77  ? -7.608  -6.703  -9.155  1.00 0.00 ? 77  MET A CA   3  
ATOM 4159  C C    . MET A 1 77  ? -8.205  -5.425  -9.735  1.00 0.00 ? 77  MET A C    3  
ATOM 4160  O O    . MET A 1 77  ? -7.717  -4.898  -10.735 1.00 0.00 ? 77  MET A O    3  
ATOM 4161  C CB   . MET A 1 77  ? -6.579  -7.286  -10.126 1.00 0.00 ? 77  MET A CB   3  
ATOM 4162  C CG   . MET A 1 77  ? -5.552  -8.185  -9.456  1.00 0.00 ? 77  MET A CG   3  
ATOM 4163  S SD   . MET A 1 77  ? -4.095  -7.280  -8.899  1.00 0.00 ? 77  MET A SD   3  
ATOM 4164  C CE   . MET A 1 77  ? -4.646  -6.708  -7.293  1.00 0.00 ? 77  MET A CE   3  
ATOM 4165  H H    . MET A 1 77  ? -8.715  -8.068  -7.975  1.00 0.00 ? 77  MET A H    3  
ATOM 4166  H HA   . MET A 1 77  ? -7.116  -6.467  -8.223  1.00 0.00 ? 77  MET A HA   3  
ATOM 4167  H HB2  . MET A 1 77  ? -7.096  -7.864  -10.877 1.00 0.00 ? 77  MET A HB2  3  
ATOM 4168  H HB3  . MET A 1 77  ? -6.054  -6.474  -10.607 1.00 0.00 ? 77  MET A HB3  3  
ATOM 4169  H HG2  . MET A 1 77  ? -6.011  -8.660  -8.602  1.00 0.00 ? 77  MET A HG2  3  
ATOM 4170  H HG3  . MET A 1 77  ? -5.241  -8.940  -10.162 1.00 0.00 ? 77  MET A HG3  3  
ATOM 4171  H HE1  . MET A 1 77  ? -5.224  -5.804  -7.411  1.00 0.00 ? 77  MET A HE1  3  
ATOM 4172  H HE2  . MET A 1 77  ? -5.258  -7.469  -6.831  1.00 0.00 ? 77  MET A HE2  3  
ATOM 4173  H HE3  . MET A 1 77  ? -3.788  -6.508  -6.668  1.00 0.00 ? 77  MET A HE3  3  
ATOM 4174  N N    . LYS A 1 78  ? -9.264  -4.932  -9.102  1.00 0.00 ? 78  LYS A N    3  
ATOM 4175  C CA   . LYS A 1 78  ? -9.927  -3.715  -9.554  1.00 0.00 ? 78  LYS A CA   3  
ATOM 4176  C C    . LYS A 1 78  ? -10.769 -3.107  -8.437  1.00 0.00 ? 78  LYS A C    3  
ATOM 4177  O O    . LYS A 1 78  ? -11.147 -3.795  -7.489  1.00 0.00 ? 78  LYS A O    3  
ATOM 4178  C CB   . LYS A 1 78  ? -10.810 -4.012  -10.768 1.00 0.00 ? 78  LYS A CB   3  
ATOM 4179  C CG   . LYS A 1 78  ? -11.868 -5.070  -10.507 1.00 0.00 ? 78  LYS A CG   3  
ATOM 4180  C CD   . LYS A 1 78  ? -12.430 -5.628  -11.803 1.00 0.00 ? 78  LYS A CD   3  
ATOM 4181  C CE   . LYS A 1 78  ? -13.360 -4.634  -12.482 1.00 0.00 ? 78  LYS A CE   3  
ATOM 4182  N NZ   . LYS A 1 78  ? -13.933 -5.182  -13.742 1.00 0.00 ? 78  LYS A NZ   3  
ATOM 4183  H H    . LYS A 1 78  ? -9.607  -5.398  -8.310  1.00 0.00 ? 78  LYS A H    3  
ATOM 4184  H HA   . LYS A 1 78  ? -9.164  -3.007  -9.839  1.00 0.00 ? 78  LYS A HA   3  
ATOM 4185  H HB2  . LYS A 1 78  ? -11.308 -3.101  -11.068 1.00 0.00 ? 78  LYS A HB2  3  
ATOM 4186  H HB3  . LYS A 1 78  ? -10.183 -4.353  -11.580 1.00 0.00 ? 78  LYS A HB3  3  
ATOM 4187  H HG2  . LYS A 1 78  ? -11.426 -5.877  -9.942  1.00 0.00 ? 78  LYS A HG2  3  
ATOM 4188  H HG3  . LYS A 1 78  ? -12.673 -4.628  -9.937  1.00 0.00 ? 78  LYS A HG3  3  
ATOM 4189  H HD2  . LYS A 1 78  ? -11.613 -5.854  -12.472 1.00 0.00 ? 78  LYS A HD2  3  
ATOM 4190  H HD3  . LYS A 1 78  ? -12.981 -6.533  -11.587 1.00 0.00 ? 78  LYS A HD3  3  
ATOM 4191  H HE2  . LYS A 1 78  ? -14.165 -4.394  -11.805 1.00 0.00 ? 78  LYS A HE2  3  
ATOM 4192  H HE3  . LYS A 1 78  ? -12.802 -3.738  -12.710 1.00 0.00 ? 78  LYS A HE3  3  
ATOM 4193  H HZ1  . LYS A 1 78  ? -14.259 -6.159  -13.592 1.00 0.00 ? 78  LYS A HZ1  3  
ATOM 4194  H HZ2  . LYS A 1 78  ? -13.214 -5.181  -14.493 1.00 0.00 ? 78  LYS A HZ2  3  
ATOM 4195  H HZ3  . LYS A 1 78  ? -14.740 -4.603  -14.050 1.00 0.00 ? 78  LYS A HZ3  3  
ATOM 4196  N N    . GLN A 1 79  ? -11.060 -1.816  -8.556  1.00 0.00 ? 79  GLN A N    3  
ATOM 4197  C CA   . GLN A 1 79  ? -11.858 -1.117  -7.556  1.00 0.00 ? 79  GLN A CA   3  
ATOM 4198  C C    . GLN A 1 79  ? -13.312 -1.003  -8.002  1.00 0.00 ? 79  GLN A C    3  
ATOM 4199  O O    . GLN A 1 79  ? -13.612 -0.374  -9.017  1.00 0.00 ? 79  GLN A O    3  
ATOM 4200  C CB   . GLN A 1 79  ? -11.281 0.275   -7.294  1.00 0.00 ? 79  GLN A CB   3  
ATOM 4201  C CG   . GLN A 1 79  ? -12.070 1.078   -6.272  1.00 0.00 ? 79  GLN A CG   3  
ATOM 4202  C CD   . GLN A 1 79  ? -11.202 2.049   -5.497  1.00 0.00 ? 79  GLN A CD   3  
ATOM 4203  O OE1  . GLN A 1 79  ? -10.171 2.508   -5.990  1.00 0.00 ? 79  GLN A OE1  3  
ATOM 4204  N NE2  . GLN A 1 79  ? -11.616 2.369   -4.276  1.00 0.00 ? 79  GLN A NE2  3  
ATOM 4205  H H    . GLN A 1 79  ? -10.730 -1.322  -9.335  1.00 0.00 ? 79  GLN A H    3  
ATOM 4206  H HA   . GLN A 1 79  ? -11.820 -1.691  -6.642  1.00 0.00 ? 79  GLN A HA   3  
ATOM 4207  H HB2  . GLN A 1 79  ? -10.269 0.170   -6.934  1.00 0.00 ? 79  GLN A HB2  3  
ATOM 4208  H HB3  . GLN A 1 79  ? -11.270 0.827   -8.222  1.00 0.00 ? 79  GLN A HB3  3  
ATOM 4209  H HG2  . GLN A 1 79  ? -12.837 1.638   -6.787  1.00 0.00 ? 79  GLN A HG2  3  
ATOM 4210  H HG3  . GLN A 1 79  ? -12.532 0.394   -5.575  1.00 0.00 ? 79  GLN A HG3  3  
ATOM 4211  H HE21 . GLN A 1 79  ? -12.446 1.964   -3.949  1.00 0.00 ? 79  GLN A HE21 3  
ATOM 4212  H HE22 . GLN A 1 79  ? -11.073 2.994   -3.752  1.00 0.00 ? 79  GLN A HE22 3  
ATOM 4213  N N    . MET A 1 80  ? -14.211 -1.615  -7.238  1.00 0.00 ? 80  MET A N    3  
ATOM 4214  C CA   . MET A 1 80  ? -15.634 -1.580  -7.555  1.00 0.00 ? 80  MET A CA   3  
ATOM 4215  C C    . MET A 1 80  ? -16.307 -0.378  -6.902  1.00 0.00 ? 80  MET A C    3  
ATOM 4216  O O    . MET A 1 80  ? -16.425 -0.309  -5.679  1.00 0.00 ? 80  MET A O    3  
ATOM 4217  C CB   . MET A 1 80  ? -16.312 -2.872  -7.095  1.00 0.00 ? 80  MET A CB   3  
ATOM 4218  C CG   . MET A 1 80  ? -17.785 -2.949  -7.462  1.00 0.00 ? 80  MET A CG   3  
ATOM 4219  S SD   . MET A 1 80  ? -18.051 -3.516  -9.153  1.00 0.00 ? 80  MET A SD   3  
ATOM 4220  C CE   . MET A 1 80  ? -17.686 -5.261  -8.987  1.00 0.00 ? 80  MET A CE   3  
ATOM 4221  H H    . MET A 1 80  ? -13.911 -2.101  -6.442  1.00 0.00 ? 80  MET A H    3  
ATOM 4222  H HA   . MET A 1 80  ? -15.732 -1.495  -8.627  1.00 0.00 ? 80  MET A HA   3  
ATOM 4223  H HB2  . MET A 1 80  ? -15.806 -3.711  -7.548  1.00 0.00 ? 80  MET A HB2  3  
ATOM 4224  H HB3  . MET A 1 80  ? -16.227 -2.947  -6.021  1.00 0.00 ? 80  MET A HB3  3  
ATOM 4225  H HG2  . MET A 1 80  ? -18.276 -3.634  -6.788  1.00 0.00 ? 80  MET A HG2  3  
ATOM 4226  H HG3  . MET A 1 80  ? -18.220 -1.966  -7.354  1.00 0.00 ? 80  MET A HG3  3  
ATOM 4227  H HE1  . MET A 1 80  ? -17.767 -5.548  -7.949  1.00 0.00 ? 80  MET A HE1  3  
ATOM 4228  H HE2  . MET A 1 80  ? -18.389 -5.833  -9.574  1.00 0.00 ? 80  MET A HE2  3  
ATOM 4229  H HE3  . MET A 1 80  ? -16.683 -5.454  -9.337  1.00 0.00 ? 80  MET A HE3  3  
ATOM 4230  N N    . ASN A 1 81  ? -16.747 0.568   -7.726  1.00 0.00 ? 81  ASN A N    3  
ATOM 4231  C CA   . ASN A 1 81  ? -17.408 1.769   -7.227  1.00 0.00 ? 81  ASN A CA   3  
ATOM 4232  C C    . ASN A 1 81  ? -18.891 1.509   -6.977  1.00 0.00 ? 81  ASN A C    3  
ATOM 4233  O O    . ASN A 1 81  ? -19.539 0.776   -7.724  1.00 0.00 ? 81  ASN A O    3  
ATOM 4234  C CB   . ASN A 1 81  ? -17.241 2.919   -8.222  1.00 0.00 ? 81  ASN A CB   3  
ATOM 4235  C CG   . ASN A 1 81  ? -17.449 4.276   -7.578  1.00 0.00 ? 81  ASN A CG   3  
ATOM 4236  O OD1  . ASN A 1 81  ? -18.390 4.473   -6.809  1.00 0.00 ? 81  ASN A OD1  3  
ATOM 4237  N ND2  . ASN A 1 81  ? -16.567 5.219   -7.889  1.00 0.00 ? 81  ASN A ND2  3  
ATOM 4238  H H    . ASN A 1 81  ? -16.625 0.457   -8.691  1.00 0.00 ? 81  ASN A H    3  
ATOM 4239  H HA   . ASN A 1 81  ? -16.940 2.041   -6.293  1.00 0.00 ? 81  ASN A HA   3  
ATOM 4240  H HB2  . ASN A 1 81  ? -16.244 2.887   -8.635  1.00 0.00 ? 81  ASN A HB2  3  
ATOM 4241  H HB3  . ASN A 1 81  ? -17.961 2.805   -9.019  1.00 0.00 ? 81  ASN A HB3  3  
ATOM 4242  H HD21 . ASN A 1 81  ? -15.843 4.990   -8.508  1.00 0.00 ? 81  ASN A HD21 3  
ATOM 4243  H HD22 . ASN A 1 81  ? -16.677 6.106   -7.486  1.00 0.00 ? 81  ASN A HD22 3  
ATOM 4244  N N    . LEU A 1 82  ? -19.422 2.116   -5.921  1.00 0.00 ? 82  LEU A N    3  
ATOM 4245  C CA   . LEU A 1 82  ? -20.829 1.952   -5.572  1.00 0.00 ? 82  LEU A CA   3  
ATOM 4246  C C    . LEU A 1 82  ? -21.580 3.273   -5.701  1.00 0.00 ? 82  LEU A C    3  
ATOM 4247  O O    . LEU A 1 82  ? -22.704 3.315   -6.201  1.00 0.00 ? 82  LEU A O    3  
ATOM 4248  C CB   . LEU A 1 82  ? -20.961 1.414   -4.146  1.00 0.00 ? 82  LEU A CB   3  
ATOM 4249  C CG   . LEU A 1 82  ? -20.267 0.081   -3.864  1.00 0.00 ? 82  LEU A CG   3  
ATOM 4250  C CD1  . LEU A 1 82  ? -20.786 -0.999  -4.800  1.00 0.00 ? 82  LEU A CD1  3  
ATOM 4251  C CD2  . LEU A 1 82  ? -18.759 0.226   -3.997  1.00 0.00 ? 82  LEU A CD2  3  
ATOM 4252  H H    . LEU A 1 82  ? -18.856 2.688   -5.363  1.00 0.00 ? 82  LEU A H    3  
ATOM 4253  H HA   . LEU A 1 82  ? -21.259 1.238   -6.258  1.00 0.00 ? 82  LEU A HA   3  
ATOM 4254  H HB2  . LEU A 1 82  ? -20.546 2.151   -3.475  1.00 0.00 ? 82  LEU A HB2  3  
ATOM 4255  H HB3  . LEU A 1 82  ? -22.014 1.292   -3.936  1.00 0.00 ? 82  LEU A HB3  3  
ATOM 4256  H HG   . LEU A 1 82  ? -20.487 -0.224  -2.850  1.00 0.00 ? 82  LEU A HG   3  
ATOM 4257  H HD11 . LEU A 1 82  ? -21.565 -0.589  -5.425  1.00 0.00 ? 82  LEU A HD11 3  
ATOM 4258  H HD12 . LEU A 1 82  ? -21.183 -1.818  -4.220  1.00 0.00 ? 82  LEU A HD12 3  
ATOM 4259  H HD13 . LEU A 1 82  ? -19.977 -1.356  -5.421  1.00 0.00 ? 82  LEU A HD13 3  
ATOM 4260  H HD21 . LEU A 1 82  ? -18.271 -0.549  -3.425  1.00 0.00 ? 82  LEU A HD21 3  
ATOM 4261  H HD22 . LEU A 1 82  ? -18.456 1.194   -3.624  1.00 0.00 ? 82  LEU A HD22 3  
ATOM 4262  H HD23 . LEU A 1 82  ? -18.479 0.137   -5.036  1.00 0.00 ? 82  LEU A HD23 3  
ATOM 4263  N N    . THR A 1 83  ? -20.950 4.353   -5.248  1.00 0.00 ? 83  THR A N    3  
ATOM 4264  C CA   . THR A 1 83  ? -21.557 5.676   -5.314  1.00 0.00 ? 83  THR A CA   3  
ATOM 4265  C C    . THR A 1 83  ? -21.864 6.069   -6.755  1.00 0.00 ? 83  THR A C    3  
ATOM 4266  O O    . THR A 1 83  ? -22.940 6.588   -7.053  1.00 0.00 ? 83  THR A O    3  
ATOM 4267  C CB   . THR A 1 83  ? -20.644 6.745   -4.685  1.00 0.00 ? 83  THR A CB   3  
ATOM 4268  O OG1  . THR A 1 83  ? -21.178 8.051   -4.931  1.00 0.00 ? 83  THR A OG1  3  
ATOM 4269  C CG2  . THR A 1 83  ? -19.235 6.653   -5.250  1.00 0.00 ? 83  THR A CG2  3  
ATOM 4270  H H    . THR A 1 83  ? -20.055 4.255   -4.860  1.00 0.00 ? 83  THR A H    3  
ATOM 4271  H HA   . THR A 1 83  ? -22.481 5.647   -4.755  1.00 0.00 ? 83  THR A HA   3  
ATOM 4272  H HB   . THR A 1 83  ? -20.600 6.577   -3.619  1.00 0.00 ? 83  THR A HB   3  
ATOM 4273  H HG1  . THR A 1 83  ? -21.166 8.230   -5.875  1.00 0.00 ? 83  THR A HG1  3  
ATOM 4274  H HG21 . THR A 1 83  ? -18.816 5.685   -5.018  1.00 0.00 ? 83  THR A HG21 3  
ATOM 4275  H HG22 . THR A 1 83  ? -18.620 7.426   -4.812  1.00 0.00 ? 83  THR A HG22 3  
ATOM 4276  H HG23 . THR A 1 83  ? -19.267 6.784   -6.321  1.00 0.00 ? 83  THR A HG23 3  
ATOM 4277  N N    . THR A 1 84  ? -20.911 5.819   -7.647  1.00 0.00 ? 84  THR A N    3  
ATOM 4278  C CA   . THR A 1 84  ? -21.079 6.147   -9.057  1.00 0.00 ? 84  THR A CA   3  
ATOM 4279  C C    . THR A 1 84  ? -21.284 4.890   -9.894  1.00 0.00 ? 84  THR A C    3  
ATOM 4280  O O    . THR A 1 84  ? -21.890 4.936   -10.964 1.00 0.00 ? 84  THR A O    3  
ATOM 4281  C CB   . THR A 1 84  ? -19.863 6.921   -9.603  1.00 0.00 ? 84  THR A CB   3  
ATOM 4282  O OG1  . THR A 1 84  ? -18.665 6.169   -9.380  1.00 0.00 ? 84  THR A OG1  3  
ATOM 4283  C CG2  . THR A 1 84  ? -19.745 8.283   -8.936  1.00 0.00 ? 84  THR A CG2  3  
ATOM 4284  H H    . THR A 1 84  ? -20.075 5.404   -7.349  1.00 0.00 ? 84  THR A H    3  
ATOM 4285  H HA   . THR A 1 84  ? -21.951 6.777   -9.151  1.00 0.00 ? 84  THR A HA   3  
ATOM 4286  H HB   . THR A 1 84  ? -19.996 7.066   -10.665 1.00 0.00 ? 84  THR A HB   3  
ATOM 4287  H HG1  . THR A 1 84  ? -18.892 5.264   -9.156  1.00 0.00 ? 84  THR A HG1  3  
ATOM 4288  H HG21 . THR A 1 84  ? -20.306 9.011   -9.503  1.00 0.00 ? 84  THR A HG21 3  
ATOM 4289  H HG22 . THR A 1 84  ? -18.707 8.577   -8.899  1.00 0.00 ? 84  THR A HG22 3  
ATOM 4290  H HG23 . THR A 1 84  ? -20.140 8.228   -7.933  1.00 0.00 ? 84  THR A HG23 3  
ATOM 4291  N N    . GLY A 1 85  ? -20.775 3.765   -9.399  1.00 0.00 ? 85  GLY A N    3  
ATOM 4292  C CA   . GLY A 1 85  ? -20.914 2.510   -10.114 1.00 0.00 ? 85  GLY A CA   3  
ATOM 4293  C C    . GLY A 1 85  ? -19.837 2.319   -11.163 1.00 0.00 ? 85  GLY A C    3  
ATOM 4294  O O    . GLY A 1 85  ? -19.881 1.367   -11.943 1.00 0.00 ? 85  GLY A O    3  
ATOM 4295  H H    . GLY A 1 85  ? -20.302 3.788   -8.541  1.00 0.00 ? 85  GLY A H    3  
ATOM 4296  H HA2  . GLY A 1 85  ? -20.861 1.697   -9.406  1.00 0.00 ? 85  GLY A HA2  3  
ATOM 4297  H HA3  . GLY A 1 85  ? -21.879 2.490   -10.598 1.00 0.00 ? 85  GLY A HA3  3  
ATOM 4298  N N    . LYS A 1 86  ? -18.866 3.226   -11.185 1.00 0.00 ? 86  LYS A N    3  
ATOM 4299  C CA   . LYS A 1 86  ? -17.772 3.154   -12.146 1.00 0.00 ? 86  LYS A CA   3  
ATOM 4300  C C    . LYS A 1 86  ? -16.776 2.068   -11.756 1.00 0.00 ? 86  LYS A C    3  
ATOM 4301  O O    . LYS A 1 86  ? -16.857 1.501   -10.666 1.00 0.00 ? 86  LYS A O    3  
ATOM 4302  C CB   . LYS A 1 86  ? -17.060 4.505   -12.241 1.00 0.00 ? 86  LYS A CB   3  
ATOM 4303  C CG   . LYS A 1 86  ? -17.628 5.419   -13.312 1.00 0.00 ? 86  LYS A CG   3  
ATOM 4304  C CD   . LYS A 1 86  ? -19.132 5.583   -13.165 1.00 0.00 ? 86  LYS A CD   3  
ATOM 4305  C CE   . LYS A 1 86  ? -19.679 6.611   -14.143 1.00 0.00 ? 86  LYS A CE   3  
ATOM 4306  N NZ   . LYS A 1 86  ? -21.107 6.933   -13.869 1.00 0.00 ? 86  LYS A NZ   3  
ATOM 4307  H H    . LYS A 1 86  ? -18.886 3.962   -10.537 1.00 0.00 ? 86  LYS A H    3  
ATOM 4308  H HA   . LYS A 1 86  ? -18.193 2.910   -13.110 1.00 0.00 ? 86  LYS A HA   3  
ATOM 4309  H HB2  . LYS A 1 86  ? -17.139 5.008   -11.288 1.00 0.00 ? 86  LYS A HB2  3  
ATOM 4310  H HB3  . LYS A 1 86  ? -16.016 4.333   -12.461 1.00 0.00 ? 86  LYS A HB3  3  
ATOM 4311  H HG2  . LYS A 1 86  ? -17.161 6.389   -13.230 1.00 0.00 ? 86  LYS A HG2  3  
ATOM 4312  H HG3  . LYS A 1 86  ? -17.415 4.996   -14.284 1.00 0.00 ? 86  LYS A HG3  3  
ATOM 4313  H HD2  . LYS A 1 86  ? -19.609 4.633   -13.355 1.00 0.00 ? 86  LYS A HD2  3  
ATOM 4314  H HD3  . LYS A 1 86  ? -19.353 5.905   -12.157 1.00 0.00 ? 86  LYS A HD3  3  
ATOM 4315  H HE2  . LYS A 1 86  ? -19.093 7.514   -14.061 1.00 0.00 ? 86  LYS A HE2  3  
ATOM 4316  H HE3  . LYS A 1 86  ? -19.593 6.217   -15.145 1.00 0.00 ? 86  LYS A HE3  3  
ATOM 4317  H HZ1  . LYS A 1 86  ? -21.326 7.894   -14.200 1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 4318  H HZ2  . LYS A 1 86  ? -21.296 6.878   -12.848 1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 4319  H HZ3  . LYS A 1 86  ? -21.726 6.259   -14.363 1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 4320  N N    . GLN A 1 87  ? -15.835 1.784   -12.651 1.00 0.00 ? 87  GLN A N    3  
ATOM 4321  C CA   . GLN A 1 87  ? -14.823 0.765   -12.399 1.00 0.00 ? 87  GLN A CA   3  
ATOM 4322  C C    . GLN A 1 87  ? -13.421 1.331   -12.598 1.00 0.00 ? 87  GLN A C    3  
ATOM 4323  O O    . GLN A 1 87  ? -13.221 2.259   -13.382 1.00 0.00 ? 87  GLN A O    3  
ATOM 4324  C CB   . GLN A 1 87  ? -15.037 -0.436  -13.321 1.00 0.00 ? 87  GLN A CB   3  
ATOM 4325  C CG   . GLN A 1 87  ? -16.249 -1.276  -12.954 1.00 0.00 ? 87  GLN A CG   3  
ATOM 4326  C CD   . GLN A 1 87  ? -16.744 -2.122  -14.111 1.00 0.00 ? 87  GLN A CD   3  
ATOM 4327  O OE1  . GLN A 1 87  ? -16.305 -3.258  -14.297 1.00 0.00 ? 87  GLN A OE1  3  
ATOM 4328  N NE2  . GLN A 1 87  ? -17.664 -1.573  -14.895 1.00 0.00 ? 87  GLN A NE2  3  
ATOM 4329  H H    . GLN A 1 87  ? -15.823 2.270   -13.502 1.00 0.00 ? 87  GLN A H    3  
ATOM 4330  H HA   . GLN A 1 87  ? -14.925 0.444   -11.374 1.00 0.00 ? 87  GLN A HA   3  
ATOM 4331  H HB2  . GLN A 1 87  ? -15.164 -0.081  -14.332 1.00 0.00 ? 87  GLN A HB2  3  
ATOM 4332  H HB3  . GLN A 1 87  ? -14.162 -1.068  -13.278 1.00 0.00 ? 87  GLN A HB3  3  
ATOM 4333  H HG2  . GLN A 1 87  ? -15.984 -1.932  -12.137 1.00 0.00 ? 87  GLN A HG2  3  
ATOM 4334  H HG3  . GLN A 1 87  ? -17.046 -0.618  -12.641 1.00 0.00 ? 87  GLN A HG3  3  
ATOM 4335  H HE21 . GLN A 1 87  ? -17.966 -0.663  -14.686 1.00 0.00 ? 87  GLN A HE21 3  
ATOM 4336  H HE22 . GLN A 1 87  ? -18.001 -2.097  -15.650 1.00 0.00 ? 87  GLN A HE22 3  
ATOM 4337  N N    . ARG A 1 88  ? -12.453 0.767   -11.883 1.00 0.00 ? 88  ARG A N    3  
ATOM 4338  C CA   . ARG A 1 88  ? -11.069 1.216   -11.980 1.00 0.00 ? 88  ARG A CA   3  
ATOM 4339  C C    . ARG A 1 88  ? -10.106 0.040   -11.848 1.00 0.00 ? 88  ARG A C    3  
ATOM 4340  O O    . ARG A 1 88  ? -10.511 -1.075  -11.519 1.00 0.00 ? 88  ARG A O    3  
ATOM 4341  C CB   . ARG A 1 88  ? -10.772 2.257   -10.900 1.00 0.00 ? 88  ARG A CB   3  
ATOM 4342  C CG   . ARG A 1 88  ? -11.680 3.475   -10.961 1.00 0.00 ? 88  ARG A CG   3  
ATOM 4343  C CD   . ARG A 1 88  ? -11.188 4.584   -10.044 1.00 0.00 ? 88  ARG A CD   3  
ATOM 4344  N NE   . ARG A 1 88  ? -11.706 4.441   -8.686  1.00 0.00 ? 88  ARG A NE   3  
ATOM 4345  C CZ   . ARG A 1 88  ? -11.756 5.439   -7.810  1.00 0.00 ? 88  ARG A CZ   3  
ATOM 4346  N NH1  . ARG A 1 88  ? -11.323 6.645   -8.149  1.00 0.00 ? 88  ARG A NH1  3  
ATOM 4347  N NH2  . ARG A 1 88  ? -12.241 5.231   -6.593  1.00 0.00 ? 88  ARG A NH2  3  
ATOM 4348  H H    . ARG A 1 88  ? -12.675 0.030   -11.275 1.00 0.00 ? 88  ARG A H    3  
ATOM 4349  H HA   . ARG A 1 88  ? -10.935 1.669   -12.951 1.00 0.00 ? 88  ARG A HA   3  
ATOM 4350  H HB2  . ARG A 1 88  ? -10.889 1.797   -9.930  1.00 0.00 ? 88  ARG A HB2  3  
ATOM 4351  H HB3  . ARG A 1 88  ? -9.751  2.591   -11.010 1.00 0.00 ? 88  ARG A HB3  3  
ATOM 4352  H HG2  . ARG A 1 88  ? -11.703 3.845   -11.975 1.00 0.00 ? 88  ARG A HG2  3  
ATOM 4353  H HG3  . ARG A 1 88  ? -12.676 3.185   -10.659 1.00 0.00 ? 88  ARG A HG3  3  
ATOM 4354  H HD2  . ARG A 1 88  ? -10.109 4.554   -10.013 1.00 0.00 ? 88  ARG A HD2  3  
ATOM 4355  H HD3  . ARG A 1 88  ? -11.510 5.533   -10.445 1.00 0.00 ? 88  ARG A HD3  3  
ATOM 4356  H HE   . ARG A 1 88  ? -12.031 3.558   -8.414  1.00 0.00 ? 88  ARG A HE   3  
ATOM 4357  H HH11 . ARG A 1 88  ? -10.958 6.805   -9.066  1.00 0.00 ? 88  ARG A HH11 3  
ATOM 4358  H HH12 . ARG A 1 88  ? -11.363 7.395   -7.489  1.00 0.00 ? 88  ARG A HH12 3  
ATOM 4359  H HH21 . ARG A 1 88  ? -12.569 4.323   -6.334  1.00 0.00 ? 88  ARG A HH21 3  
ATOM 4360  H HH22 . ARG A 1 88  ? -12.278 5.982   -5.935  1.00 0.00 ? 88  ARG A HH22 3  
ATOM 4361  N N    . LEU A 1 89  ? -8.828  0.298   -12.106 1.00 0.00 ? 89  LEU A N    3  
ATOM 4362  C CA   . LEU A 1 89  ? -7.805  -0.739  -12.016 1.00 0.00 ? 89  LEU A CA   3  
ATOM 4363  C C    . LEU A 1 89  ? -6.907  -0.513  -10.804 1.00 0.00 ? 89  LEU A C    3  
ATOM 4364  O O    . LEU A 1 89  ? -6.814  0.600   -10.286 1.00 0.00 ? 89  LEU A O    3  
ATOM 4365  C CB   . LEU A 1 89  ? -6.963  -0.763  -13.293 1.00 0.00 ? 89  LEU A CB   3  
ATOM 4366  C CG   . LEU A 1 89  ? -7.588  -1.471  -14.495 1.00 0.00 ? 89  LEU A CG   3  
ATOM 4367  C CD1  . LEU A 1 89  ? -7.862  -2.932  -14.172 1.00 0.00 ? 89  LEU A CD1  3  
ATOM 4368  C CD2  . LEU A 1 89  ? -8.868  -0.768  -14.923 1.00 0.00 ? 89  LEU A CD2  3  
ATOM 4369  H H    . LEU A 1 89  ? -8.565  1.206   -12.363 1.00 0.00 ? 89  LEU A H    3  
ATOM 4370  H HA   . LEU A 1 89  ? -8.306  -1.689  -11.906 1.00 0.00 ? 89  LEU A HA   3  
ATOM 4371  H HB2  . LEU A 1 89  ? -6.764  0.258   -13.577 1.00 0.00 ? 89  LEU A HB2  3  
ATOM 4372  H HB3  . LEU A 1 89  ? -6.031  -1.259  -13.063 1.00 0.00 ? 89  LEU A HB3  3  
ATOM 4373  H HG   . LEU A 1 89  ? -6.894  -1.438  -15.325 1.00 0.00 ? 89  LEU A HG   3  
ATOM 4374  H HD11 . LEU A 1 89  ? -7.002  -3.359  -13.678 1.00 0.00 ? 89  LEU A HD11 3  
ATOM 4375  H HD12 . LEU A 1 89  ? -8.057  -3.472  -15.086 1.00 0.00 ? 89  LEU A HD12 3  
ATOM 4376  H HD13 . LEU A 1 89  ? -8.722  -3.001  -13.522 1.00 0.00 ? 89  LEU A HD13 3  
ATOM 4377  H HD21 . LEU A 1 89  ? -8.623  0.185   -15.369 1.00 0.00 ? 89  LEU A HD21 3  
ATOM 4378  H HD22 . LEU A 1 89  ? -9.497  -0.610  -14.059 1.00 0.00 ? 89  LEU A HD22 3  
ATOM 4379  H HD23 . LEU A 1 89  ? -9.391  -1.379  -15.643 1.00 0.00 ? 89  LEU A HD23 3  
ATOM 4380  N N    . ILE A 1 90  ? -6.245  -1.576  -10.359 1.00 0.00 ? 90  ILE A N    3  
ATOM 4381  C CA   . ILE A 1 90  ? -5.352  -1.493  -9.211  1.00 0.00 ? 90  ILE A CA   3  
ATOM 4382  C C    . ILE A 1 90  ? -4.127  -2.382  -9.402  1.00 0.00 ? 90  ILE A C    3  
ATOM 4383  O O    . ILE A 1 90  ? -4.211  -3.453  -10.003 1.00 0.00 ? 90  ILE A O    3  
ATOM 4384  C CB   . ILE A 1 90  ? -6.068  -1.899  -7.909  1.00 0.00 ? 90  ILE A CB   3  
ATOM 4385  C CG1  . ILE A 1 90  ? -6.696  -3.286  -8.058  1.00 0.00 ? 90  ILE A CG1  3  
ATOM 4386  C CG2  . ILE A 1 90  ? -7.127  -0.869  -7.544  1.00 0.00 ? 90  ILE A CG2  3  
ATOM 4387  C CD1  . ILE A 1 90  ? -7.328  -3.803  -6.785  1.00 0.00 ? 90  ILE A CD1  3  
ATOM 4388  H H    . ILE A 1 90  ? -6.361  -2.436  -10.814 1.00 0.00 ? 90  ILE A H    3  
ATOM 4389  H HA   . ILE A 1 90  ? -5.027  -0.467  -9.115  1.00 0.00 ? 90  ILE A HA   3  
ATOM 4390  H HB   . ILE A 1 90  ? -5.337  -1.926  -7.115  1.00 0.00 ? 90  ILE A HB   3  
ATOM 4391  H HG12 . ILE A 1 90  ? -7.462  -3.249  -8.816  1.00 0.00 ? 90  ILE A HG12 3  
ATOM 4392  H HG13 . ILE A 1 90  ? -5.932  -3.989  -8.359  1.00 0.00 ? 90  ILE A HG13 3  
ATOM 4393  H HG21 . ILE A 1 90  ? -8.019  -1.048  -8.126  1.00 0.00 ? 90  ILE A HG21 3  
ATOM 4394  H HG22 . ILE A 1 90  ? -7.361  -0.951  -6.494  1.00 0.00 ? 90  ILE A HG22 3  
ATOM 4395  H HG23 . ILE A 1 90  ? -6.753  0.122   -7.754  1.00 0.00 ? 90  ILE A HG23 3  
ATOM 4396  H HD11 . ILE A 1 90  ? -8.175  -4.427  -7.030  1.00 0.00 ? 90  ILE A HD11 3  
ATOM 4397  H HD12 . ILE A 1 90  ? -6.603  -4.380  -6.231  1.00 0.00 ? 90  ILE A HD12 3  
ATOM 4398  H HD13 . ILE A 1 90  ? -7.659  -2.969  -6.183  1.00 0.00 ? 90  ILE A HD13 3  
ATOM 4399  N N    . LYS A 1 91  ? -2.989  -1.931  -8.885  1.00 0.00 ? 91  LYS A N    3  
ATOM 4400  C CA   . LYS A 1 91  ? -1.746  -2.685  -8.995  1.00 0.00 ? 91  LYS A CA   3  
ATOM 4401  C C    . LYS A 1 91  ? -0.854  -2.444  -7.782  1.00 0.00 ? 91  LYS A C    3  
ATOM 4402  O O    . LYS A 1 91  ? -0.950  -1.406  -7.126  1.00 0.00 ? 91  LYS A O    3  
ATOM 4403  C CB   . LYS A 1 91  ? -1.002  -2.298  -10.275 1.00 0.00 ? 91  LYS A CB   3  
ATOM 4404  C CG   . LYS A 1 91  ? -0.511  -0.860  -10.281 1.00 0.00 ? 91  LYS A CG   3  
ATOM 4405  C CD   . LYS A 1 91  ? 0.481   -0.615  -11.405 1.00 0.00 ? 91  LYS A CD   3  
ATOM 4406  C CE   . LYS A 1 91  ? 1.080   0.781   -11.325 1.00 0.00 ? 91  LYS A CE   3  
ATOM 4407  N NZ   . LYS A 1 91  ? 2.177   0.858   -10.321 1.00 0.00 ? 91  LYS A NZ   3  
ATOM 4408  H H    . LYS A 1 91  ? -2.986  -1.069  -8.417  1.00 0.00 ? 91  LYS A H    3  
ATOM 4409  H HA   . LYS A 1 91  ? -1.998  -3.734  -9.039  1.00 0.00 ? 91  LYS A HA   3  
ATOM 4410  H HB2  . LYS A 1 91  ? -0.148  -2.948  -10.391 1.00 0.00 ? 91  LYS A HB2  3  
ATOM 4411  H HB3  . LYS A 1 91  ? -1.664  -2.433  -11.117 1.00 0.00 ? 91  LYS A HB3  3  
ATOM 4412  H HG2  . LYS A 1 91  ? -1.356  -0.201  -10.411 1.00 0.00 ? 91  LYS A HG2  3  
ATOM 4413  H HG3  . LYS A 1 91  ? -0.030  -0.650  -9.336  1.00 0.00 ? 91  LYS A HG3  3  
ATOM 4414  H HD2  . LYS A 1 91  ? 1.279   -1.340  -11.335 1.00 0.00 ? 91  LYS A HD2  3  
ATOM 4415  H HD3  . LYS A 1 91  ? -0.027  -0.726  -12.353 1.00 0.00 ? 91  LYS A HD3  3  
ATOM 4416  H HE2  . LYS A 1 91  ? 1.472   1.047   -12.295 1.00 0.00 ? 91  LYS A HE2  3  
ATOM 4417  H HE3  . LYS A 1 91  ? 0.301   1.477   -11.050 1.00 0.00 ? 91  LYS A HE3  3  
ATOM 4418  H HZ1  . LYS A 1 91  ? 2.357   -0.083  -9.917  1.00 0.00 ? 91  LYS A HZ1  3  
ATOM 4419  H HZ2  . LYS A 1 91  ? 1.913   1.508   -9.553  1.00 0.00 ? 91  LYS A HZ2  3  
ATOM 4420  H HZ3  . LYS A 1 91  ? 3.048   1.205   -10.770 1.00 0.00 ? 91  LYS A HZ3  3  
ATOM 4421  N N    . ARG A 1 92  ? 0.014   -3.407  -7.490  1.00 0.00 ? 92  ARG A N    3  
ATOM 4422  C CA   . ARG A 1 92  ? 0.924   -3.298  -6.356  1.00 0.00 ? 92  ARG A CA   3  
ATOM 4423  C C    . ARG A 1 92  ? 2.375   -3.257  -6.825  1.00 0.00 ? 92  ARG A C    3  
ATOM 4424  O O    . ARG A 1 92  ? 2.960   -4.288  -7.155  1.00 0.00 ? 92  ARG A O    3  
ATOM 4425  C CB   . ARG A 1 92  ? 0.719   -4.471  -5.396  1.00 0.00 ? 92  ARG A CB   3  
ATOM 4426  C CG   . ARG A 1 92  ? 1.523   -4.354  -4.111  1.00 0.00 ? 92  ARG A CG   3  
ATOM 4427  C CD   . ARG A 1 92  ? 0.825   -5.049  -2.953  1.00 0.00 ? 92  ARG A CD   3  
ATOM 4428  N NE   . ARG A 1 92  ? 1.153   -6.470  -2.888  1.00 0.00 ? 92  ARG A NE   3  
ATOM 4429  C CZ   . ARG A 1 92  ? 2.265   -6.944  -2.336  1.00 0.00 ? 92  ARG A CZ   3  
ATOM 4430  N NH1  . ARG A 1 92  ? 3.149   -6.113  -1.802  1.00 0.00 ? 92  ARG A NH1  3  
ATOM 4431  N NH2  . ARG A 1 92  ? 2.492   -8.251  -2.316  1.00 0.00 ? 92  ARG A NH2  3  
ATOM 4432  H H    . ARG A 1 92  ? 0.043   -4.210  -8.050  1.00 0.00 ? 92  ARG A H    3  
ATOM 4433  H HA   . ARG A 1 92  ? 0.699   -2.377  -5.838  1.00 0.00 ? 92  ARG A HA   3  
ATOM 4434  H HB2  . ARG A 1 92  ? -0.327  -4.530  -5.136  1.00 0.00 ? 92  ARG A HB2  3  
ATOM 4435  H HB3  . ARG A 1 92  ? 1.010   -5.383  -5.895  1.00 0.00 ? 92  ARG A HB3  3  
ATOM 4436  H HG2  . ARG A 1 92  ? 2.491   -4.811  -4.260  1.00 0.00 ? 92  ARG A HG2  3  
ATOM 4437  H HG3  . ARG A 1 92  ? 1.649   -3.309  -3.871  1.00 0.00 ? 92  ARG A HG3  3  
ATOM 4438  H HD2  . ARG A 1 92  ? 1.131   -4.576  -2.031  1.00 0.00 ? 92  ARG A HD2  3  
ATOM 4439  H HD3  . ARG A 1 92  ? -0.242  -4.940  -3.076  1.00 0.00 ? 92  ARG A HD3  3  
ATOM 4440  H HE   . ARG A 1 92  ? 0.513   -7.102  -3.277  1.00 0.00 ? 92  ARG A HE   3  
ATOM 4441  H HH11 . ARG A 1 92  ? 2.980   -5.128  -1.814  1.00 0.00 ? 92  ARG A HH11 3  
ATOM 4442  H HH12 . ARG A 1 92  ? 3.985   -6.472  -1.385  1.00 0.00 ? 92  ARG A HH12 3  
ATOM 4443  H HH21 . ARG A 1 92  ? 1.827   -8.880  -2.717  1.00 0.00 ? 92  ARG A HH21 3  
ATOM 4444  H HH22 . ARG A 1 92  ? 3.329   -8.606  -1.900  1.00 0.00 ? 92  ARG A HH22 3  
ATOM 4445  N N    . ALA A 1 93  ? 2.950   -2.059  -6.852  1.00 0.00 ? 93  ALA A N    3  
ATOM 4446  C CA   . ALA A 1 93  ? 4.332   -1.884  -7.279  1.00 0.00 ? 93  ALA A CA   3  
ATOM 4447  C C    . ALA A 1 93  ? 5.130   -1.096  -6.246  1.00 0.00 ? 93  ALA A C    3  
ATOM 4448  O O    . ALA A 1 93  ? 4.584   -0.312  -5.470  1.00 0.00 ? 93  ALA A O    3  
ATOM 4449  C CB   . ALA A 1 93  ? 4.383   -1.187  -8.631  1.00 0.00 ? 93  ALA A CB   3  
ATOM 4450  H H    . ALA A 1 93  ? 2.431   -1.274  -6.578  1.00 0.00 ? 93  ALA A H    3  
ATOM 4451  H HA   . ALA A 1 93  ? 4.774   -2.864  -7.390  1.00 0.00 ? 93  ALA A HA   3  
ATOM 4452  H HB1  . ALA A 1 93  ? 3.769   -0.299  -8.601  1.00 0.00 ? 93  ALA A HB1  3  
ATOM 4453  H HB2  . ALA A 1 93  ? 5.403   -0.913  -8.857  1.00 0.00 ? 93  ALA A HB2  3  
ATOM 4454  H HB3  . ALA A 1 93  ? 4.012   -1.855  -9.394  1.00 0.00 ? 93  ALA A HB3  3  
ATOM 4455  N N    . PRO A 1 94  ? 6.455   -1.309  -6.233  1.00 0.00 ? 94  PRO A N    3  
ATOM 4456  C CA   . PRO A 1 94  ? 7.356   -0.628  -5.299  1.00 0.00 ? 94  PRO A CA   3  
ATOM 4457  C C    . PRO A 1 94  ? 7.499   0.858   -5.610  1.00 0.00 ? 94  PRO A C    3  
ATOM 4458  O O    . PRO A 1 94  ? 7.356   1.279   -6.759  1.00 0.00 ? 94  PRO A O    3  
ATOM 4459  C CB   . PRO A 1 94  ? 8.691   -1.348  -5.506  1.00 0.00 ? 94  PRO A CB   3  
ATOM 4460  C CG   . PRO A 1 94  ? 8.619   -1.889  -6.892  1.00 0.00 ? 94  PRO A CG   3  
ATOM 4461  C CD   . PRO A 1 94  ? 7.174   -2.230  -7.129  1.00 0.00 ? 94  PRO A CD   3  
ATOM 4462  H HA   . PRO A 1 94  ? 7.034   -0.751  -4.275  1.00 0.00 ? 94  PRO A HA   3  
ATOM 4463  H HB2  . PRO A 1 94  ? 9.504   -0.643  -5.397  1.00 0.00 ? 94  PRO A HB2  3  
ATOM 4464  H HB3  . PRO A 1 94  ? 8.794   -2.139  -4.779  1.00 0.00 ? 94  PRO A HB3  3  
ATOM 4465  H HG2  . PRO A 1 94  ? 8.948   -1.139  -7.596  1.00 0.00 ? 94  PRO A HG2  3  
ATOM 4466  H HG3  . PRO A 1 94  ? 9.231   -2.775  -6.972  1.00 0.00 ? 94  PRO A HG3  3  
ATOM 4467  H HD2  . PRO A 1 94  ? 6.908   -2.051  -8.160  1.00 0.00 ? 94  PRO A HD2  3  
ATOM 4468  H HD3  . PRO A 1 94  ? 6.980   -3.258  -6.861  1.00 0.00 ? 94  PRO A HD3  3  
ATOM 4469  N N    . PHE A 1 95  ? 7.783   1.649   -4.581  1.00 0.00 ? 95  PHE A N    3  
ATOM 4470  C CA   . PHE A 1 95  ? 7.944   3.089   -4.745  1.00 0.00 ? 95  PHE A CA   3  
ATOM 4471  C C    . PHE A 1 95  ? 9.345   3.530   -4.329  1.00 0.00 ? 95  PHE A C    3  
ATOM 4472  O O    . PHE A 1 95  ? 9.750   3.347   -3.181  1.00 0.00 ? 95  PHE A O    3  
ATOM 4473  C CB   . PHE A 1 95  ? 6.896   3.839   -3.920  1.00 0.00 ? 95  PHE A CB   3  
ATOM 4474  C CG   . PHE A 1 95  ? 6.899   3.466   -2.465  1.00 0.00 ? 95  PHE A CG   3  
ATOM 4475  C CD1  . PHE A 1 95  ? 6.320   2.282   -2.038  1.00 0.00 ? 95  PHE A CD1  3  
ATOM 4476  C CD2  . PHE A 1 95  ? 7.482   4.300   -1.524  1.00 0.00 ? 95  PHE A CD2  3  
ATOM 4477  C CE1  . PHE A 1 95  ? 6.322   1.937   -0.699  1.00 0.00 ? 95  PHE A CE1  3  
ATOM 4478  C CE2  . PHE A 1 95  ? 7.487   3.960   -0.184  1.00 0.00 ? 95  PHE A CE2  3  
ATOM 4479  C CZ   . PHE A 1 95  ? 6.907   2.777   0.228   1.00 0.00 ? 95  PHE A CZ   3  
ATOM 4480  H H    . PHE A 1 95  ? 7.885   1.255   -3.689  1.00 0.00 ? 95  PHE A H    3  
ATOM 4481  H HA   . PHE A 1 95  ? 7.801   3.321   -5.789  1.00 0.00 ? 95  PHE A HA   3  
ATOM 4482  H HB2  . PHE A 1 95  ? 7.083   4.899   -3.991  1.00 0.00 ? 95  PHE A HB2  3  
ATOM 4483  H HB3  . PHE A 1 95  ? 5.915   3.623   -4.317  1.00 0.00 ? 95  PHE A HB3  3  
ATOM 4484  H HD1  . PHE A 1 95  ? 5.863   1.624   -2.762  1.00 0.00 ? 95  PHE A HD1  3  
ATOM 4485  H HD2  . PHE A 1 95  ? 7.937   5.226   -1.846  1.00 0.00 ? 95  PHE A HD2  3  
ATOM 4486  H HE1  . PHE A 1 95  ? 5.867   1.011   -0.379  1.00 0.00 ? 95  PHE A HE1  3  
ATOM 4487  H HE2  . PHE A 1 95  ? 7.945   4.619   0.538   1.00 0.00 ? 95  PHE A HE2  3  
ATOM 4488  H HZ   . PHE A 1 95  ? 6.909   2.510   1.275   1.00 0.00 ? 95  PHE A HZ   3  
ATOM 4489  N N    . SER A 1 96  ? 10.079  4.112   -5.272  1.00 0.00 ? 96  SER A N    3  
ATOM 4490  C CA   . SER A 1 96  ? 11.436  4.575   -5.006  1.00 0.00 ? 96  SER A CA   3  
ATOM 4491  C C    . SER A 1 96  ? 11.996  5.332   -6.206  1.00 0.00 ? 96  SER A C    3  
ATOM 4492  O O    . SER A 1 96  ? 11.664  5.034   -7.353  1.00 0.00 ? 96  SER A O    3  
ATOM 4493  C CB   . SER A 1 96  ? 12.345  3.392   -4.666  1.00 0.00 ? 96  SER A CB   3  
ATOM 4494  O OG   . SER A 1 96  ? 12.688  2.661   -5.831  1.00 0.00 ? 96  SER A OG   3  
ATOM 4495  H H    . SER A 1 96  ? 9.700   4.229   -6.168  1.00 0.00 ? 96  SER A H    3  
ATOM 4496  H HA   . SER A 1 96  ? 11.398  5.244   -4.159  1.00 0.00 ? 96  SER A HA   3  
ATOM 4497  H HB2  . SER A 1 96  ? 13.250  3.757   -4.206  1.00 0.00 ? 96  SER A HB2  3  
ATOM 4498  H HB3  . SER A 1 96  ? 11.831  2.733   -3.981  1.00 0.00 ? 96  SER A HB3  3  
ATOM 4499  H HG   . SER A 1 96  ? 12.332  1.772   -5.768  1.00 0.00 ? 96  SER A HG   3  
ATOM 4500  N N    . SER A 1 97  ? 12.849  6.315   -5.933  1.00 0.00 ? 97  SER A N    3  
ATOM 4501  C CA   . SER A 1 97  ? 13.453  7.119   -6.989  1.00 0.00 ? 97  SER A CA   3  
ATOM 4502  C C    . SER A 1 97  ? 13.930  6.236   -8.138  1.00 0.00 ? 97  SER A C    3  
ATOM 4503  O O    . SER A 1 97  ? 13.575  6.458   -9.295  1.00 0.00 ? 97  SER A O    3  
ATOM 4504  C CB   . SER A 1 97  ? 14.625  7.930   -6.434  1.00 0.00 ? 97  SER A CB   3  
ATOM 4505  O OG   . SER A 1 97  ? 15.009  8.954   -7.335  1.00 0.00 ? 97  SER A OG   3  
ATOM 4506  H H    . SER A 1 97  ? 13.075  6.505   -4.998  1.00 0.00 ? 97  SER A H    3  
ATOM 4507  H HA   . SER A 1 97  ? 12.700  7.798   -7.360  1.00 0.00 ? 97  SER A HA   3  
ATOM 4508  H HB2  . SER A 1 97  ? 14.336  8.381   -5.497  1.00 0.00 ? 97  SER A HB2  3  
ATOM 4509  H HB3  . SER A 1 97  ? 15.469  7.274   -6.272  1.00 0.00 ? 97  SER A HB3  3  
ATOM 4510  H HG   . SER A 1 97  ? 14.670  9.797   -7.025  1.00 0.00 ? 97  SER A HG   3  
ATOM 4511  N N    . GLY A 1 98  ? 14.737  5.232   -7.810  1.00 0.00 ? 98  GLY A N    3  
ATOM 4512  C CA   . GLY A 1 98  ? 15.251  4.330   -8.824  1.00 0.00 ? 98  GLY A CA   3  
ATOM 4513  C C    . GLY A 1 98  ? 16.601  3.750   -8.455  1.00 0.00 ? 98  GLY A C    3  
ATOM 4514  O O    . GLY A 1 98  ? 16.979  3.696   -7.284  1.00 0.00 ? 98  GLY A O    3  
ATOM 4515  H H    . GLY A 1 98  ? 14.987  5.103   -6.871  1.00 0.00 ? 98  GLY A H    3  
ATOM 4516  H HA2  . GLY A 1 98  ? 14.548  3.522   -8.960  1.00 0.00 ? 98  GLY A HA2  3  
ATOM 4517  H HA3  . GLY A 1 98  ? 15.346  4.871   -9.755  1.00 0.00 ? 98  GLY A HA3  3  
ATOM 4518  N N    . PRO A 1 99  ? 17.355  3.302   -9.470  1.00 0.00 ? 99  PRO A N    3  
ATOM 4519  C CA   . PRO A 1 99  ? 18.683  2.714   -9.271  1.00 0.00 ? 99  PRO A CA   3  
ATOM 4520  C C    . PRO A 1 99  ? 19.715  3.747   -8.833  1.00 0.00 ? 99  PRO A C    3  
ATOM 4521  O O    . PRO A 1 99  ? 19.664  4.905   -9.249  1.00 0.00 ? 99  PRO A O    3  
ATOM 4522  C CB   . PRO A 1 99  ? 19.036  2.159   -10.653 1.00 0.00 ? 99  PRO A CB   3  
ATOM 4523  C CG   . PRO A 1 99  ? 18.244  2.985   -11.607 1.00 0.00 ? 99  PRO A CG   3  
ATOM 4524  C CD   . PRO A 1 99  ? 16.969  3.335   -10.891 1.00 0.00 ? 99  PRO A CD   3  
ATOM 4525  H HA   . PRO A 1 99  ? 18.656  1.907   -8.553  1.00 0.00 ? 99  PRO A HA   3  
ATOM 4526  H HB2  . PRO A 1 99  ? 20.098  2.264   -10.826 1.00 0.00 ? 99  PRO A HB2  3  
ATOM 4527  H HB3  . PRO A 1 99  ? 18.758  1.117   -10.708 1.00 0.00 ? 99  PRO A HB3  3  
ATOM 4528  H HG2  . PRO A 1 99  ? 18.791  3.880   -11.859 1.00 0.00 ? 99  PRO A HG2  3  
ATOM 4529  H HG3  . PRO A 1 99  ? 18.028  2.412   -12.497 1.00 0.00 ? 99  PRO A HG3  3  
ATOM 4530  H HD2  . PRO A 1 99  ? 16.634  4.322   -11.177 1.00 0.00 ? 99  PRO A HD2  3  
ATOM 4531  H HD3  . PRO A 1 99  ? 16.205  2.601   -11.099 1.00 0.00 ? 99  PRO A HD3  3  
ATOM 4532  N N    . SER A 1 100 ? 20.651  3.322   -7.990  1.00 0.00 ? 100 SER A N    3  
ATOM 4533  C CA   . SER A 1 100 ? 21.693  4.212   -7.493  1.00 0.00 ? 100 SER A CA   3  
ATOM 4534  C C    . SER A 1 100 ? 22.544  4.747   -8.641  1.00 0.00 ? 100 SER A C    3  
ATOM 4535  O O    . SER A 1 100 ? 23.167  3.981   -9.376  1.00 0.00 ? 100 SER A O    3  
ATOM 4536  C CB   . SER A 1 100 ? 22.580  3.479   -6.484  1.00 0.00 ? 100 SER A CB   3  
ATOM 4537  O OG   . SER A 1 100 ? 21.956  3.408   -5.214  1.00 0.00 ? 100 SER A OG   3  
ATOM 4538  H H    . SER A 1 100 ? 20.638  2.387   -7.694  1.00 0.00 ? 100 SER A H    3  
ATOM 4539  H HA   . SER A 1 100 ? 21.212  5.043   -6.999  1.00 0.00 ? 100 SER A HA   3  
ATOM 4540  H HB2  . SER A 1 100 ? 22.769  2.477   -6.836  1.00 0.00 ? 100 SER A HB2  3  
ATOM 4541  H HB3  . SER A 1 100 ? 23.517  4.008   -6.382  1.00 0.00 ? 100 SER A HB3  3  
ATOM 4542  H HG   . SER A 1 100 ? 21.703  2.500   -5.032  1.00 0.00 ? 100 SER A HG   3  
ATOM 4543  N N    . SER A 1 101 ? 22.565  6.068   -8.787  1.00 0.00 ? 101 SER A N    3  
ATOM 4544  C CA   . SER A 1 101 ? 23.335  6.707   -9.848  1.00 0.00 ? 101 SER A CA   3  
ATOM 4545  C C    . SER A 1 101 ? 23.329  5.855   -11.113 1.00 0.00 ? 101 SER A C    3  
ATOM 4546  O O    . SER A 1 101 ? 24.357  5.692   -11.770 1.00 0.00 ? 101 SER A O    3  
ATOM 4547  C CB   . SER A 1 101 ? 24.774  6.947   -9.387  1.00 0.00 ? 101 SER A CB   3  
ATOM 4548  O OG   . SER A 1 101 ? 25.468  5.722   -9.221  1.00 0.00 ? 101 SER A OG   3  
ATOM 4549  H H    . SER A 1 101 ? 22.047  6.626   -8.169  1.00 0.00 ? 101 SER A H    3  
ATOM 4550  H HA   . SER A 1 101 ? 22.873  7.658   -10.066 1.00 0.00 ? 101 SER A HA   3  
ATOM 4551  H HB2  . SER A 1 101 ? 25.291  7.542   -10.125 1.00 0.00 ? 101 SER A HB2  3  
ATOM 4552  H HB3  . SER A 1 101 ? 24.764  7.473   -8.443  1.00 0.00 ? 101 SER A HB3  3  
ATOM 4553  H HG   . SER A 1 101 ? 26.156  5.651   -9.886  1.00 0.00 ? 101 SER A HG   3  
ATOM 4554  N N    . GLY A 1 102 ? 22.163  5.312   -11.448 1.00 0.00 ? 102 GLY A N    3  
ATOM 4555  C CA   . GLY A 1 102 ? 22.044  4.482   -12.633 1.00 0.00 ? 102 GLY A CA   3  
ATOM 4556  C C    . GLY A 1 102 ? 22.655  3.109   -12.443 1.00 0.00 ? 102 GLY A C    3  
ATOM 4557  O O    . GLY A 1 102 ? 22.643  2.564   -11.339 1.00 0.00 ? 102 GLY A O    3  
ATOM 4558  H H    . GLY A 1 102 ? 21.377  5.476   -10.886 1.00 0.00 ? 102 GLY A H    3  
ATOM 4559  H HA2  . GLY A 1 102 ? 20.998  4.369   -12.876 1.00 0.00 ? 102 GLY A HA2  3  
ATOM 4560  H HA3  . GLY A 1 102 ? 22.543  4.975   -13.455 1.00 0.00 ? 102 GLY A HA3  3  
ATOM 4561  N N    . GLY A 1 1   ? 21.178  18.445  -1.000  1.00 0.00 ? 1   GLY A N    4  
ATOM 4562  C CA   . GLY A 1 1   ? 21.388  18.510  -2.435  1.00 0.00 ? 1   GLY A CA   4  
ATOM 4563  C C    . GLY A 1 1   ? 20.955  17.242  -3.142  1.00 0.00 ? 1   GLY A C    4  
ATOM 4564  O O    . GLY A 1 1   ? 21.771  16.560  -3.763  1.00 0.00 ? 1   GLY A O    4  
ATOM 4565  H H1   . GLY A 1 1   ? 20.288  18.239  -0.646  1.00 0.00 ? 1   GLY A H1   4  
ATOM 4566  H HA2  . GLY A 1 1   ? 20.826  19.342  -2.832  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 4567  H HA3  . GLY A 1 1   ? 22.438  18.675  -2.626  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 4568  N N    . SER A 1 2   ? 19.668  16.923  -3.048  1.00 0.00 ? 2   SER A N    4  
ATOM 4569  C CA   . SER A 1 2   ? 19.129  15.725  -3.680  1.00 0.00 ? 2   SER A CA   4  
ATOM 4570  C C    . SER A 1 2   ? 18.028  16.083  -4.674  1.00 0.00 ? 2   SER A C    4  
ATOM 4571  O O    . SER A 1 2   ? 16.895  16.367  -4.287  1.00 0.00 ? 2   SER A O    4  
ATOM 4572  C CB   . SER A 1 2   ? 18.583  14.766  -2.621  1.00 0.00 ? 2   SER A CB   4  
ATOM 4573  O OG   . SER A 1 2   ? 19.584  14.423  -1.678  1.00 0.00 ? 2   SER A OG   4  
ATOM 4574  H H    . SER A 1 2   ? 19.067  17.507  -2.539  1.00 0.00 ? 2   SER A H    4  
ATOM 4575  H HA   . SER A 1 2   ? 19.934  15.240  -4.212  1.00 0.00 ? 2   SER A HA   4  
ATOM 4576  H HB2  . SER A 1 2   ? 17.762  15.237  -2.101  1.00 0.00 ? 2   SER A HB2  4  
ATOM 4577  H HB3  . SER A 1 2   ? 18.234  13.863  -3.102  1.00 0.00 ? 2   SER A HB3  4  
ATOM 4578  H HG   . SER A 1 2   ? 19.203  13.870  -0.993  1.00 0.00 ? 2   SER A HG   4  
ATOM 4579  N N    . SER A 1 3   ? 18.371  16.067  -5.958  1.00 0.00 ? 3   SER A N    4  
ATOM 4580  C CA   . SER A 1 3   ? 17.414  16.394  -7.009  1.00 0.00 ? 3   SER A CA   4  
ATOM 4581  C C    . SER A 1 3   ? 17.822  15.754  -8.333  1.00 0.00 ? 3   SER A C    4  
ATOM 4582  O O    . SER A 1 3   ? 19.007  15.639  -8.641  1.00 0.00 ? 3   SER A O    4  
ATOM 4583  C CB   . SER A 1 3   ? 17.305  17.911  -7.175  1.00 0.00 ? 3   SER A CB   4  
ATOM 4584  O OG   . SER A 1 3   ? 18.504  18.454  -7.700  1.00 0.00 ? 3   SER A OG   4  
ATOM 4585  H H    . SER A 1 3   ? 19.291  15.832  -6.204  1.00 0.00 ? 3   SER A H    4  
ATOM 4586  H HA   . SER A 1 3   ? 16.452  16.002  -6.714  1.00 0.00 ? 3   SER A HA   4  
ATOM 4587  H HB2  . SER A 1 3   ? 16.495  18.139  -7.850  1.00 0.00 ? 3   SER A HB2  4  
ATOM 4588  H HB3  . SER A 1 3   ? 17.110  18.362  -6.213  1.00 0.00 ? 3   SER A HB3  4  
ATOM 4589  H HG   . SER A 1 3   ? 19.245  17.900  -7.444  1.00 0.00 ? 3   SER A HG   4  
ATOM 4590  N N    . GLY A 1 4   ? 16.828  15.338  -9.113  1.00 0.00 ? 4   GLY A N    4  
ATOM 4591  C CA   . GLY A 1 4   ? 17.102  14.715  -10.394 1.00 0.00 ? 4   GLY A CA   4  
ATOM 4592  C C    . GLY A 1 4   ? 16.545  13.308  -10.485 1.00 0.00 ? 4   GLY A C    4  
ATOM 4593  O O    . GLY A 1 4   ? 16.392  12.627  -9.472  1.00 0.00 ? 4   GLY A O    4  
ATOM 4594  H H    . GLY A 1 4   ? 15.901  15.456  -8.815  1.00 0.00 ? 4   GLY A H    4  
ATOM 4595  H HA2  . GLY A 1 4   ? 16.663  15.316  -11.176 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 4596  H HA3  . GLY A 1 4   ? 18.171  14.676  -10.541 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 4597  N N    . SER A 1 5   ? 16.239  12.872  -11.703 1.00 0.00 ? 5   SER A N    4  
ATOM 4598  C CA   . SER A 1 5   ? 15.691  11.539  -11.922 1.00 0.00 ? 5   SER A CA   4  
ATOM 4599  C C    . SER A 1 5   ? 16.140  10.981  -13.269 1.00 0.00 ? 5   SER A C    4  
ATOM 4600  O O    . SER A 1 5   ? 16.416  11.733  -14.204 1.00 0.00 ? 5   SER A O    4  
ATOM 4601  C CB   . SER A 1 5   ? 14.162  11.576  -11.858 1.00 0.00 ? 5   SER A CB   4  
ATOM 4602  O OG   . SER A 1 5   ? 13.600  10.390  -12.391 1.00 0.00 ? 5   SER A OG   4  
ATOM 4603  H H    . SER A 1 5   ? 16.384  13.463  -12.472 1.00 0.00 ? 5   SER A H    4  
ATOM 4604  H HA   . SER A 1 5   ? 16.060  10.895  -11.138 1.00 0.00 ? 5   SER A HA   4  
ATOM 4605  H HB2  . SER A 1 5   ? 13.851  11.677  -10.829 1.00 0.00 ? 5   SER A HB2  4  
ATOM 4606  H HB3  . SER A 1 5   ? 13.801  12.420  -12.428 1.00 0.00 ? 5   SER A HB3  4  
ATOM 4607  H HG   . SER A 1 5   ? 12.673  10.537  -12.593 1.00 0.00 ? 5   SER A HG   4  
ATOM 4608  N N    . SER A 1 6   ? 16.213  9.657   -13.360 1.00 0.00 ? 6   SER A N    4  
ATOM 4609  C CA   . SER A 1 6   ? 16.633  8.997   -14.590 1.00 0.00 ? 6   SER A CA   4  
ATOM 4610  C C    . SER A 1 6   ? 16.377  7.495   -14.516 1.00 0.00 ? 6   SER A C    4  
ATOM 4611  O O    . SER A 1 6   ? 16.436  6.896   -13.442 1.00 0.00 ? 6   SER A O    4  
ATOM 4612  C CB   . SER A 1 6   ? 18.116  9.261   -14.855 1.00 0.00 ? 6   SER A CB   4  
ATOM 4613  O OG   . SER A 1 6   ? 18.525  8.687   -16.085 1.00 0.00 ? 6   SER A OG   4  
ATOM 4614  H H    . SER A 1 6   ? 15.980  9.111   -12.579 1.00 0.00 ? 6   SER A H    4  
ATOM 4615  H HA   . SER A 1 6   ? 16.052  9.409   -15.403 1.00 0.00 ? 6   SER A HA   4  
ATOM 4616  H HB2  . SER A 1 6   ? 18.289  10.325  -14.893 1.00 0.00 ? 6   SER A HB2  4  
ATOM 4617  H HB3  . SER A 1 6   ? 18.704  8.829   -14.057 1.00 0.00 ? 6   SER A HB3  4  
ATOM 4618  H HG   . SER A 1 6   ? 19.435  8.389   -16.012 1.00 0.00 ? 6   SER A HG   4  
ATOM 4619  N N    . GLY A 1 7   ? 16.092  6.891   -15.666 1.00 0.00 ? 7   GLY A N    4  
ATOM 4620  C CA   . GLY A 1 7   ? 15.831  5.464   -15.710 1.00 0.00 ? 7   GLY A CA   4  
ATOM 4621  C C    . GLY A 1 7   ? 17.099  4.639   -15.603 1.00 0.00 ? 7   GLY A C    4  
ATOM 4622  O O    . GLY A 1 7   ? 18.193  5.185   -15.472 1.00 0.00 ? 7   GLY A O    4  
ATOM 4623  H H    . GLY A 1 7   ? 16.059  7.419   -16.491 1.00 0.00 ? 7   GLY A H    4  
ATOM 4624  H HA2  . GLY A 1 7   ? 15.175  5.204   -14.893 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 4625  H HA3  . GLY A 1 7   ? 15.340  5.228   -16.642 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 4626  N N    . ASN A 1 8   ? 16.951  3.320   -15.658 1.00 0.00 ? 8   ASN A N    4  
ATOM 4627  C CA   . ASN A 1 8   ? 18.093  2.418   -15.565 1.00 0.00 ? 8   ASN A CA   4  
ATOM 4628  C C    . ASN A 1 8   ? 17.858  1.156   -16.389 1.00 0.00 ? 8   ASN A C    4  
ATOM 4629  O O    . ASN A 1 8   ? 16.720  0.811   -16.703 1.00 0.00 ? 8   ASN A O    4  
ATOM 4630  C CB   . ASN A 1 8   ? 18.356  2.045   -14.105 1.00 0.00 ? 8   ASN A CB   4  
ATOM 4631  C CG   . ASN A 1 8   ? 17.077  1.776   -13.336 1.00 0.00 ? 8   ASN A CG   4  
ATOM 4632  O OD1  . ASN A 1 8   ? 16.264  2.677   -13.127 1.00 0.00 ? 8   ASN A OD1  4  
ATOM 4633  N ND2  . ASN A 1 8   ? 16.892  0.532   -12.912 1.00 0.00 ? 8   ASN A ND2  4  
ATOM 4634  H H    . ASN A 1 8   ? 16.052  2.943   -15.764 1.00 0.00 ? 8   ASN A H    4  
ATOM 4635  H HA   . ASN A 1 8   ? 18.956  2.935   -15.957 1.00 0.00 ? 8   ASN A HA   4  
ATOM 4636  H HB2  . ASN A 1 8   ? 18.967  1.154   -14.072 1.00 0.00 ? 8   ASN A HB2  4  
ATOM 4637  H HB3  . ASN A 1 8   ? 18.882  2.855   -13.621 1.00 0.00 ? 8   ASN A HB3  4  
ATOM 4638  H HD21 . ASN A 1 8   ? 17.582  -0.134  -13.115 1.00 0.00 ? 8   ASN A HD21 4  
ATOM 4639  H HD22 . ASN A 1 8   ? 16.073  0.330   -12.413 1.00 0.00 ? 8   ASN A HD22 4  
ATOM 4640  N N    . GLU A 1 9   ? 18.944  0.471   -16.736 1.00 0.00 ? 9   GLU A N    4  
ATOM 4641  C CA   . GLU A 1 9   ? 18.856  -0.752  -17.524 1.00 0.00 ? 9   GLU A CA   4  
ATOM 4642  C C    . GLU A 1 9   ? 19.070  -1.982  -16.646 1.00 0.00 ? 9   GLU A C    4  
ATOM 4643  O O    . GLU A 1 9   ? 19.405  -3.059  -17.138 1.00 0.00 ? 9   GLU A O    4  
ATOM 4644  C CB   . GLU A 1 9   ? 19.888  -0.733  -18.654 1.00 0.00 ? 9   GLU A CB   4  
ATOM 4645  C CG   . GLU A 1 9   ? 19.667  -1.815  -19.698 1.00 0.00 ? 9   GLU A CG   4  
ATOM 4646  C CD   . GLU A 1 9   ? 18.214  -1.935  -20.115 1.00 0.00 ? 9   GLU A CD   4  
ATOM 4647  O OE1  . GLU A 1 9   ? 17.588  -0.892  -20.396 1.00 0.00 ? 9   GLU A OE1  4  
ATOM 4648  O OE2  . GLU A 1 9   ? 17.703  -3.074  -20.160 1.00 0.00 ? 9   GLU A OE2  4  
ATOM 4649  H H    . GLU A 1 9   ? 19.825  0.797   -16.456 1.00 0.00 ? 9   GLU A H    4  
ATOM 4650  H HA   . GLU A 1 9   ? 17.867  -0.799  -17.954 1.00 0.00 ? 9   GLU A HA   4  
ATOM 4651  H HB2  . GLU A 1 9   ? 19.847  0.228   -19.146 1.00 0.00 ? 9   GLU A HB2  4  
ATOM 4652  H HB3  . GLU A 1 9   ? 20.871  -0.869  -18.229 1.00 0.00 ? 9   GLU A HB3  4  
ATOM 4653  H HG2  . GLU A 1 9   ? 20.257  -1.580  -20.571 1.00 0.00 ? 9   GLU A HG2  4  
ATOM 4654  H HG3  . GLU A 1 9   ? 19.989  -2.762  -19.291 1.00 0.00 ? 9   GLU A HG3  4  
ATOM 4655  N N    . VAL A 1 10  ? 18.874  -1.812  -15.342 1.00 0.00 ? 10  VAL A N    4  
ATOM 4656  C CA   . VAL A 1 10  ? 19.044  -2.906  -14.394 1.00 0.00 ? 10  VAL A CA   4  
ATOM 4657  C C    . VAL A 1 10  ? 17.794  -3.097  -13.544 1.00 0.00 ? 10  VAL A C    4  
ATOM 4658  O O    . VAL A 1 10  ? 17.249  -2.136  -12.999 1.00 0.00 ? 10  VAL A O    4  
ATOM 4659  C CB   . VAL A 1 10  ? 20.250  -2.663  -13.467 1.00 0.00 ? 10  VAL A CB   4  
ATOM 4660  C CG1  . VAL A 1 10  ? 21.544  -2.644  -14.267 1.00 0.00 ? 10  VAL A CG1  4  
ATOM 4661  C CG2  . VAL A 1 10  ? 20.073  -1.366  -12.693 1.00 0.00 ? 10  VAL A CG2  4  
ATOM 4662  H H    . VAL A 1 10  ? 18.607  -0.929  -15.010 1.00 0.00 ? 10  VAL A H    4  
ATOM 4663  H HA   . VAL A 1 10  ? 19.226  -3.810  -14.957 1.00 0.00 ? 10  VAL A HA   4  
ATOM 4664  H HB   . VAL A 1 10  ? 20.303  -3.477  -12.758 1.00 0.00 ? 10  VAL A HB   4  
ATOM 4665  H HG11 . VAL A 1 10  ? 21.801  -3.652  -14.559 1.00 0.00 ? 10  VAL A HG11 4  
ATOM 4666  H HG12 . VAL A 1 10  ? 21.413  -2.035  -15.150 1.00 0.00 ? 10  VAL A HG12 4  
ATOM 4667  H HG13 . VAL A 1 10  ? 22.336  -2.232  -13.660 1.00 0.00 ? 10  VAL A HG13 4  
ATOM 4668  H HG21 . VAL A 1 10  ? 19.840  -0.566  -13.380 1.00 0.00 ? 10  VAL A HG21 4  
ATOM 4669  H HG22 . VAL A 1 10  ? 19.266  -1.477  -11.983 1.00 0.00 ? 10  VAL A HG22 4  
ATOM 4670  H HG23 . VAL A 1 10  ? 20.986  -1.133  -12.166 1.00 0.00 ? 10  VAL A HG23 4  
ATOM 4671  N N    . ASP A 1 11  ? 17.344  -4.342  -13.434 1.00 0.00 ? 11  ASP A N    4  
ATOM 4672  C CA   . ASP A 1 11  ? 16.157  -4.659  -12.647 1.00 0.00 ? 11  ASP A CA   4  
ATOM 4673  C C    . ASP A 1 11  ? 16.499  -5.617  -11.510 1.00 0.00 ? 11  ASP A C    4  
ATOM 4674  O O    . ASP A 1 11  ? 16.668  -6.817  -11.725 1.00 0.00 ? 11  ASP A O    4  
ATOM 4675  C CB   . ASP A 1 11  ? 15.077  -5.273  -13.540 1.00 0.00 ? 11  ASP A CB   4  
ATOM 4676  C CG   . ASP A 1 11  ? 13.741  -5.391  -12.834 1.00 0.00 ? 11  ASP A CG   4  
ATOM 4677  O OD1  . ASP A 1 11  ? 13.737  -5.619  -11.606 1.00 0.00 ? 11  ASP A OD1  4  
ATOM 4678  O OD2  . ASP A 1 11  ? 12.700  -5.255  -13.509 1.00 0.00 ? 11  ASP A OD2  4  
ATOM 4679  H H    . ASP A 1 11  ? 17.822  -5.065  -13.891 1.00 0.00 ? 11  ASP A H    4  
ATOM 4680  H HA   . ASP A 1 11  ? 15.783  -3.739  -12.226 1.00 0.00 ? 11  ASP A HA   4  
ATOM 4681  H HB2  . ASP A 1 11  ? 14.947  -4.653  -14.415 1.00 0.00 ? 11  ASP A HB2  4  
ATOM 4682  H HB3  . ASP A 1 11  ? 15.391  -6.260  -13.847 1.00 0.00 ? 11  ASP A HB3  4  
ATOM 4683  N N    . ASP A 1 12  ? 16.600  -5.078  -10.300 1.00 0.00 ? 12  ASP A N    4  
ATOM 4684  C CA   . ASP A 1 12  ? 16.922  -5.884  -9.128  1.00 0.00 ? 12  ASP A CA   4  
ATOM 4685  C C    . ASP A 1 12  ? 15.877  -5.693  -8.034  1.00 0.00 ? 12  ASP A C    4  
ATOM 4686  O O    . ASP A 1 12  ? 15.566  -4.566  -7.649  1.00 0.00 ? 12  ASP A O    4  
ATOM 4687  C CB   . ASP A 1 12  ? 18.309  -5.518  -8.596  1.00 0.00 ? 12  ASP A CB   4  
ATOM 4688  C CG   . ASP A 1 12  ? 18.526  -4.019  -8.531  1.00 0.00 ? 12  ASP A CG   4  
ATOM 4689  O OD1  . ASP A 1 12  ? 18.907  -3.429  -9.563  1.00 0.00 ? 12  ASP A OD1  4  
ATOM 4690  O OD2  . ASP A 1 12  ? 18.317  -3.435  -7.446  1.00 0.00 ? 12  ASP A OD2  4  
ATOM 4691  H H    . ASP A 1 12  ? 16.454  -4.114  -10.192 1.00 0.00 ? 12  ASP A H    4  
ATOM 4692  H HA   . ASP A 1 12  ? 16.924  -6.920  -9.429  1.00 0.00 ? 12  ASP A HA   4  
ATOM 4693  H HB2  . ASP A 1 12  ? 18.424  -5.923  -7.602  1.00 0.00 ? 12  ASP A HB2  4  
ATOM 4694  H HB3  . ASP A 1 12  ? 19.060  -5.945  -9.244  1.00 0.00 ? 12  ASP A HB3  4  
ATOM 4695  N N    . MET A 1 13  ? 15.338  -6.801  -7.537  1.00 0.00 ? 13  MET A N    4  
ATOM 4696  C CA   . MET A 1 13  ? 14.328  -6.755  -6.486  1.00 0.00 ? 13  MET A CA   4  
ATOM 4697  C C    . MET A 1 13  ? 14.879  -7.311  -5.177  1.00 0.00 ? 13  MET A C    4  
ATOM 4698  O O    . MET A 1 13  ? 15.517  -8.364  -5.159  1.00 0.00 ? 13  MET A O    4  
ATOM 4699  C CB   . MET A 1 13  ? 13.087  -7.546  -6.907  1.00 0.00 ? 13  MET A CB   4  
ATOM 4700  C CG   . MET A 1 13  ? 13.385  -8.988  -7.285  1.00 0.00 ? 13  MET A CG   4  
ATOM 4701  S SD   . MET A 1 13  ? 11.899  -9.912  -7.722  1.00 0.00 ? 13  MET A SD   4  
ATOM 4702  C CE   . MET A 1 13  ? 12.420  -11.585 -7.350  1.00 0.00 ? 13  MET A CE   4  
ATOM 4703  H H    . MET A 1 13  ? 15.627  -7.671  -7.884  1.00 0.00 ? 13  MET A H    4  
ATOM 4704  H HA   . MET A 1 13  ? 14.052  -5.722  -6.337  1.00 0.00 ? 13  MET A HA   4  
ATOM 4705  H HB2  . MET A 1 13  ? 12.382  -7.549  -6.089  1.00 0.00 ? 13  MET A HB2  4  
ATOM 4706  H HB3  . MET A 1 13  ? 12.637  -7.059  -7.759  1.00 0.00 ? 13  MET A HB3  4  
ATOM 4707  H HG2  . MET A 1 13  ? 14.056  -8.993  -8.131  1.00 0.00 ? 13  MET A HG2  4  
ATOM 4708  H HG3  . MET A 1 13  ? 13.862  -9.474  -6.447  1.00 0.00 ? 13  MET A HG3  4  
ATOM 4709  H HE1  . MET A 1 13  ? 13.493  -11.610 -7.233  1.00 0.00 ? 13  MET A HE1  4  
ATOM 4710  H HE2  . MET A 1 13  ? 11.950  -11.912 -6.434  1.00 0.00 ? 13  MET A HE2  4  
ATOM 4711  H HE3  . MET A 1 13  ? 12.130  -12.240 -8.159  1.00 0.00 ? 13  MET A HE3  4  
ATOM 4712  N N    . ASP A 1 14  ? 14.630  -6.597  -4.085  1.00 0.00 ? 14  ASP A N    4  
ATOM 4713  C CA   . ASP A 1 14  ? 15.101  -7.020  -2.771  1.00 0.00 ? 14  ASP A CA   4  
ATOM 4714  C C    . ASP A 1 14  ? 13.953  -7.580  -1.936  1.00 0.00 ? 14  ASP A C    4  
ATOM 4715  O O    . ASP A 1 14  ? 12.793  -7.218  -2.135  1.00 0.00 ? 14  ASP A O    4  
ATOM 4716  C CB   . ASP A 1 14  ? 15.756  -5.848  -2.039  1.00 0.00 ? 14  ASP A CB   4  
ATOM 4717  C CG   . ASP A 1 14  ? 16.863  -5.205  -2.851  1.00 0.00 ? 14  ASP A CG   4  
ATOM 4718  O OD1  . ASP A 1 14  ? 17.967  -5.785  -2.914  1.00 0.00 ? 14  ASP A OD1  4  
ATOM 4719  O OD2  . ASP A 1 14  ? 16.626  -4.121  -3.424  1.00 0.00 ? 14  ASP A OD2  4  
ATOM 4720  H H    . ASP A 1 14  ? 14.116  -5.766  -4.164  1.00 0.00 ? 14  ASP A H    4  
ATOM 4721  H HA   . ASP A 1 14  ? 15.836  -7.798  -2.917  1.00 0.00 ? 14  ASP A HA   4  
ATOM 4722  H HB2  . ASP A 1 14  ? 15.007  -5.098  -1.830  1.00 0.00 ? 14  ASP A HB2  4  
ATOM 4723  H HB3  . ASP A 1 14  ? 16.175  -6.202  -1.109  1.00 0.00 ? 14  ASP A HB3  4  
ATOM 4724  N N    . THR A 1 15  ? 14.285  -8.465  -1.002  1.00 0.00 ? 15  THR A N    4  
ATOM 4725  C CA   . THR A 1 15  ? 13.282  -9.076  -0.138  1.00 0.00 ? 15  THR A CA   4  
ATOM 4726  C C    . THR A 1 15  ? 13.186  -8.345  1.196   1.00 0.00 ? 15  THR A C    4  
ATOM 4727  O O    . THR A 1 15  ? 12.098  -7.975  1.635   1.00 0.00 ? 15  THR A O    4  
ATOM 4728  C CB   . THR A 1 15  ? 13.596  -10.561 0.124   1.00 0.00 ? 15  THR A CB   4  
ATOM 4729  O OG1  . THR A 1 15  ? 13.688  -11.269 -1.117  1.00 0.00 ? 15  THR A OG1  4  
ATOM 4730  C CG2  . THR A 1 15  ? 12.525  -11.195 0.998   1.00 0.00 ? 15  THR A CG2  4  
ATOM 4731  H H    . THR A 1 15  ? 15.226  -8.712  -0.892  1.00 0.00 ? 15  THR A H    4  
ATOM 4732  H HA   . THR A 1 15  ? 12.327  -9.015  -0.641  1.00 0.00 ? 15  THR A HA   4  
ATOM 4733  H HB   . THR A 1 15  ? 14.545  -10.627 0.638   1.00 0.00 ? 15  THR A HB   4  
ATOM 4734  H HG1  . THR A 1 15  ? 13.057  -10.902 -1.742  1.00 0.00 ? 15  THR A HG1  4  
ATOM 4735  H HG21 . THR A 1 15  ? 11.563  -11.095 0.517   1.00 0.00 ? 15  THR A HG21 4  
ATOM 4736  H HG22 . THR A 1 15  ? 12.502  -10.699 1.956   1.00 0.00 ? 15  THR A HG22 4  
ATOM 4737  H HG23 . THR A 1 15  ? 12.749  -12.241 1.139   1.00 0.00 ? 15  THR A HG23 4  
ATOM 4738  N N    . SER A 1 16  ? 14.333  -8.140  1.837   1.00 0.00 ? 16  SER A N    4  
ATOM 4739  C CA   . SER A 1 16  ? 14.377  -7.455  3.123   1.00 0.00 ? 16  SER A CA   4  
ATOM 4740  C C    . SER A 1 16  ? 14.422  -5.942  2.933   1.00 0.00 ? 16  SER A C    4  
ATOM 4741  O O    . SER A 1 16  ? 14.983  -5.445  1.956   1.00 0.00 ? 16  SER A O    4  
ATOM 4742  C CB   . SER A 1 16  ? 15.595  -7.915  3.928   1.00 0.00 ? 16  SER A CB   4  
ATOM 4743  O OG   . SER A 1 16  ? 15.610  -9.325  4.068   1.00 0.00 ? 16  SER A OG   4  
ATOM 4744  H H    . SER A 1 16  ? 15.168  -8.459  1.435   1.00 0.00 ? 16  SER A H    4  
ATOM 4745  H HA   . SER A 1 16  ? 13.480  -7.712  3.667   1.00 0.00 ? 16  SER A HA   4  
ATOM 4746  H HB2  . SER A 1 16  ? 16.496  -7.606  3.420   1.00 0.00 ? 16  SER A HB2  4  
ATOM 4747  H HB3  . SER A 1 16  ? 15.563  -7.468  4.911   1.00 0.00 ? 16  SER A HB3  4  
ATOM 4748  H HG   . SER A 1 16  ? 16.499  -9.616  4.283   1.00 0.00 ? 16  SER A HG   4  
ATOM 4749  N N    . ASP A 1 17  ? 13.826  -5.216  3.872   1.00 0.00 ? 17  ASP A N    4  
ATOM 4750  C CA   . ASP A 1 17  ? 13.798  -3.760  3.810   1.00 0.00 ? 17  ASP A CA   4  
ATOM 4751  C C    . ASP A 1 17  ? 13.160  -3.284  2.509   1.00 0.00 ? 17  ASP A C    4  
ATOM 4752  O O    . ASP A 1 17  ? 13.701  -2.419  1.818   1.00 0.00 ? 17  ASP A O    4  
ATOM 4753  C CB   . ASP A 1 17  ? 15.214  -3.195  3.934   1.00 0.00 ? 17  ASP A CB   4  
ATOM 4754  C CG   . ASP A 1 17  ? 15.966  -3.773  5.117   1.00 0.00 ? 17  ASP A CG   4  
ATOM 4755  O OD1  . ASP A 1 17  ? 16.564  -4.858  4.966   1.00 0.00 ? 17  ASP A OD1  4  
ATOM 4756  O OD2  . ASP A 1 17  ? 15.956  -3.140  6.194   1.00 0.00 ? 17  ASP A OD2  4  
ATOM 4757  H H    . ASP A 1 17  ? 13.396  -5.671  4.627   1.00 0.00 ? 17  ASP A H    4  
ATOM 4758  H HA   . ASP A 1 17  ? 13.204  -3.404  4.638   1.00 0.00 ? 17  ASP A HA   4  
ATOM 4759  H HB2  . ASP A 1 17  ? 15.766  -3.423  3.034   1.00 0.00 ? 17  ASP A HB2  4  
ATOM 4760  H HB3  . ASP A 1 17  ? 15.157  -2.123  4.055   1.00 0.00 ? 17  ASP A HB3  4  
ATOM 4761  N N    . THR A 1 18  ? 12.005  -3.855  2.178   1.00 0.00 ? 18  THR A N    4  
ATOM 4762  C CA   . THR A 1 18  ? 11.294  -3.491  0.959   1.00 0.00 ? 18  THR A CA   4  
ATOM 4763  C C    . THR A 1 18  ? 9.835   -3.161  1.251   1.00 0.00 ? 18  THR A C    4  
ATOM 4764  O O    . THR A 1 18  ? 9.084   -4.005  1.738   1.00 0.00 ? 18  THR A O    4  
ATOM 4765  C CB   . THR A 1 18  ? 11.353  -4.623  -0.085  1.00 0.00 ? 18  THR A CB   4  
ATOM 4766  O OG1  . THR A 1 18  ? 12.706  -5.057  -0.260  1.00 0.00 ? 18  THR A OG1  4  
ATOM 4767  C CG2  . THR A 1 18  ? 10.787  -4.160  -1.418  1.00 0.00 ? 18  THR A CG2  4  
ATOM 4768  H H    . THR A 1 18  ? 11.625  -4.538  2.769   1.00 0.00 ? 18  THR A H    4  
ATOM 4769  H HA   . THR A 1 18  ? 11.775  -2.619  0.540   1.00 0.00 ? 18  THR A HA   4  
ATOM 4770  H HB   . THR A 1 18  ? 10.760  -5.453  0.273   1.00 0.00 ? 18  THR A HB   4  
ATOM 4771  H HG1  . THR A 1 18  ? 12.772  -5.993  -0.053  1.00 0.00 ? 18  THR A HG1  4  
ATOM 4772  H HG21 . THR A 1 18  ? 10.156  -3.297  -1.261  1.00 0.00 ? 18  THR A HG21 4  
ATOM 4773  H HG22 . THR A 1 18  ? 10.205  -4.956  -1.858  1.00 0.00 ? 18  THR A HG22 4  
ATOM 4774  H HG23 . THR A 1 18  ? 11.597  -3.897  -2.081  1.00 0.00 ? 18  THR A HG23 4  
ATOM 4775  N N    . GLN A 1 19  ? 9.441   -1.927  0.951   1.00 0.00 ? 19  GLN A N    4  
ATOM 4776  C CA   . GLN A 1 19  ? 8.071   -1.486  1.182   1.00 0.00 ? 19  GLN A CA   4  
ATOM 4777  C C    . GLN A 1 19  ? 7.213   -1.702  -0.060  1.00 0.00 ? 19  GLN A C    4  
ATOM 4778  O O    . GLN A 1 19  ? 7.659   -1.469  -1.183  1.00 0.00 ? 19  GLN A O    4  
ATOM 4779  C CB   . GLN A 1 19  ? 8.049   -0.010  1.581   1.00 0.00 ? 19  GLN A CB   4  
ATOM 4780  C CG   . GLN A 1 19  ? 8.743   0.273   2.904   1.00 0.00 ? 19  GLN A CG   4  
ATOM 4781  C CD   . GLN A 1 19  ? 9.026   1.748   3.110   1.00 0.00 ? 19  GLN A CD   4  
ATOM 4782  O OE1  . GLN A 1 19  ? 10.049  2.265   2.660   1.00 0.00 ? 19  GLN A OE1  4  
ATOM 4783  N NE2  . GLN A 1 19  ? 8.119   2.435   3.794   1.00 0.00 ? 19  GLN A NE2  4  
ATOM 4784  H H    . GLN A 1 19  ? 10.087  -1.300  0.565   1.00 0.00 ? 19  GLN A H    4  
ATOM 4785  H HA   . GLN A 1 19  ? 7.666   -2.074  1.991   1.00 0.00 ? 19  GLN A HA   4  
ATOM 4786  H HB2  . GLN A 1 19  ? 8.539   0.567   0.811   1.00 0.00 ? 19  GLN A HB2  4  
ATOM 4787  H HB3  . GLN A 1 19  ? 7.022   0.314   1.663   1.00 0.00 ? 19  GLN A HB3  4  
ATOM 4788  H HG2  . GLN A 1 19  ? 8.112   -0.072  3.709   1.00 0.00 ? 19  GLN A HG2  4  
ATOM 4789  H HG3  . GLN A 1 19  ? 9.679   -0.265  2.926   1.00 0.00 ? 19  GLN A HG3  4  
ATOM 4790  H HE21 . GLN A 1 19  ? 7.329   1.957   4.124   1.00 0.00 ? 19  GLN A HE21 4  
ATOM 4791  H HE22 . GLN A 1 19  ? 8.277   3.390   3.944   1.00 0.00 ? 19  GLN A HE22 4  
ATOM 4792  N N    . TRP A 1 20  ? 5.980   -2.149  0.150   1.00 0.00 ? 20  TRP A N    4  
ATOM 4793  C CA   . TRP A 1 20  ? 5.059   -2.396  -0.954  1.00 0.00 ? 20  TRP A CA   4  
ATOM 4794  C C    . TRP A 1 20  ? 3.936   -1.365  -0.968  1.00 0.00 ? 20  TRP A C    4  
ATOM 4795  O O    . TRP A 1 20  ? 3.174   -1.250  -0.009  1.00 0.00 ? 20  TRP A O    4  
ATOM 4796  C CB   . TRP A 1 20  ? 4.473   -3.805  -0.849  1.00 0.00 ? 20  TRP A CB   4  
ATOM 4797  C CG   . TRP A 1 20  ? 5.497   -4.888  -1.006  1.00 0.00 ? 20  TRP A CG   4  
ATOM 4798  C CD1  . TRP A 1 20  ? 6.207   -5.495  -0.009  1.00 0.00 ? 20  TRP A CD1  4  
ATOM 4799  C CD2  . TRP A 1 20  ? 5.928   -5.490  -2.231  1.00 0.00 ? 20  TRP A CD2  4  
ATOM 4800  N NE1  . TRP A 1 20  ? 7.052   -6.438  -0.542  1.00 0.00 ? 20  TRP A NE1  4  
ATOM 4801  C CE2  . TRP A 1 20  ? 6.900   -6.455  -1.903  1.00 0.00 ? 20  TRP A CE2  4  
ATOM 4802  C CE3  . TRP A 1 20  ? 5.585   -5.309  -3.574  1.00 0.00 ? 20  TRP A CE3  4  
ATOM 4803  C CZ2  . TRP A 1 20  ? 7.532   -7.234  -2.869  1.00 0.00 ? 20  TRP A CZ2  4  
ATOM 4804  C CZ3  . TRP A 1 20  ? 6.214   -6.082  -4.532  1.00 0.00 ? 20  TRP A CZ3  4  
ATOM 4805  C CH2  . TRP A 1 20  ? 7.177   -7.035  -4.175  1.00 0.00 ? 20  TRP A CH2  4  
ATOM 4806  H H    . TRP A 1 20  ? 5.681   -2.316  1.068   1.00 0.00 ? 20  TRP A H    4  
ATOM 4807  H HA   . TRP A 1 20  ? 5.617   -2.316  -1.875  1.00 0.00 ? 20  TRP A HA   4  
ATOM 4808  H HB2  . TRP A 1 20  ? 4.007   -3.924  0.118   1.00 0.00 ? 20  TRP A HB2  4  
ATOM 4809  H HB3  . TRP A 1 20  ? 3.728   -3.936  -1.622  1.00 0.00 ? 20  TRP A HB3  4  
ATOM 4810  H HD1  . TRP A 1 20  ? 6.108   -5.257  1.039   1.00 0.00 ? 20  TRP A HD1  4  
ATOM 4811  H HE1  . TRP A 1 20  ? 7.664   -7.007  -0.029  1.00 0.00 ? 20  TRP A HE1  4  
ATOM 4812  H HE3  . TRP A 1 20  ? 4.845   -4.580  -3.868  1.00 0.00 ? 20  TRP A HE3  4  
ATOM 4813  H HZ2  . TRP A 1 20  ? 8.276   -7.973  -2.610  1.00 0.00 ? 20  TRP A HZ2  4  
ATOM 4814  H HZ3  . TRP A 1 20  ? 5.962   -5.956  -5.575  1.00 0.00 ? 20  TRP A HZ3  4  
ATOM 4815  H HH2  . TRP A 1 20  ? 7.642   -7.617  -4.957  1.00 0.00 ? 20  TRP A HH2  4  
ATOM 4816  N N    . GLY A 1 21  ? 3.839   -0.617  -2.063  1.00 0.00 ? 21  GLY A N    4  
ATOM 4817  C CA   . GLY A 1 21  ? 2.806   0.395   -2.180  1.00 0.00 ? 21  GLY A CA   4  
ATOM 4818  C C    . GLY A 1 21  ? 1.680   -0.029  -3.102  1.00 0.00 ? 21  GLY A C    4  
ATOM 4819  O O    . GLY A 1 21  ? 1.833   -0.964  -3.888  1.00 0.00 ? 21  GLY A O    4  
ATOM 4820  H H    . GLY A 1 21  ? 4.474   -0.753  -2.796  1.00 0.00 ? 21  GLY A H    4  
ATOM 4821  H HA2  . GLY A 1 21  ? 2.398   0.594   -1.200  1.00 0.00 ? 21  GLY A HA2  4  
ATOM 4822  H HA3  . GLY A 1 21  ? 3.248   1.302   -2.565  1.00 0.00 ? 21  GLY A HA3  4  
ATOM 4823  N N    . TRP A 1 22  ? 0.547   0.657   -3.006  1.00 0.00 ? 22  TRP A N    4  
ATOM 4824  C CA   . TRP A 1 22  ? -0.609  0.344   -3.837  1.00 0.00 ? 22  TRP A CA   4  
ATOM 4825  C C    . TRP A 1 22  ? -0.896  1.475   -4.819  1.00 0.00 ? 22  TRP A C    4  
ATOM 4826  O O    . TRP A 1 22  ? -0.556  2.631   -4.566  1.00 0.00 ? 22  TRP A O    4  
ATOM 4827  C CB   . TRP A 1 22  ? -1.838  0.088   -2.963  1.00 0.00 ? 22  TRP A CB   4  
ATOM 4828  C CG   . TRP A 1 22  ? -1.971  -1.341  -2.529  1.00 0.00 ? 22  TRP A CG   4  
ATOM 4829  C CD1  . TRP A 1 22  ? -1.237  -1.978  -1.570  1.00 0.00 ? 22  TRP A CD1  4  
ATOM 4830  C CD2  . TRP A 1 22  ? -2.893  -2.309  -3.041  1.00 0.00 ? 22  TRP A CD2  4  
ATOM 4831  N NE1  . TRP A 1 22  ? -1.648  -3.284  -1.455  1.00 0.00 ? 22  TRP A NE1  4  
ATOM 4832  C CE2  . TRP A 1 22  ? -2.663  -3.512  -2.346  1.00 0.00 ? 22  TRP A CE2  4  
ATOM 4833  C CE3  . TRP A 1 22  ? -3.892  -2.276  -4.018  1.00 0.00 ? 22  TRP A CE3  4  
ATOM 4834  C CZ2  . TRP A 1 22  ? -3.395  -4.669  -2.599  1.00 0.00 ? 22  TRP A CZ2  4  
ATOM 4835  C CZ3  . TRP A 1 22  ? -4.618  -3.425  -4.268  1.00 0.00 ? 22  TRP A CZ3  4  
ATOM 4836  C CH2  . TRP A 1 22  ? -4.367  -4.608  -3.560  1.00 0.00 ? 22  TRP A CH2  4  
ATOM 4837  H H    . TRP A 1 22  ? 0.487   1.392   -2.360  1.00 0.00 ? 22  TRP A H    4  
ATOM 4838  H HA   . TRP A 1 22  ? -0.382  -0.553  -4.395  1.00 0.00 ? 22  TRP A HA   4  
ATOM 4839  H HB2  . TRP A 1 22  ? -1.775  0.701   -2.076  1.00 0.00 ? 22  TRP A HB2  4  
ATOM 4840  H HB3  . TRP A 1 22  ? -2.726  0.354   -3.517  1.00 0.00 ? 22  TRP A HB3  4  
ATOM 4841  H HD1  . TRP A 1 22  ? -0.452  -1.512  -0.996  1.00 0.00 ? 22  TRP A HD1  4  
ATOM 4842  H HE1  . TRP A 1 22  ? -1.275  -3.945  -0.834  1.00 0.00 ? 22  TRP A HE1  4  
ATOM 4843  H HE3  . TRP A 1 22  ? -4.101  -1.374  -4.574  1.00 0.00 ? 22  TRP A HE3  4  
ATOM 4844  H HZ2  . TRP A 1 22  ? -3.214  -5.589  -2.061  1.00 0.00 ? 22  TRP A HZ2  4  
ATOM 4845  H HZ3  . TRP A 1 22  ? -5.394  -3.419  -5.019  1.00 0.00 ? 22  TRP A HZ3  4  
ATOM 4846  H HH2  . TRP A 1 22  ? -4.957  -5.482  -3.788  1.00 0.00 ? 22  TRP A HH2  4  
ATOM 4847  N N    . PHE A 1 23  ? -1.522  1.134   -5.941  1.00 0.00 ? 23  PHE A N    4  
ATOM 4848  C CA   . PHE A 1 23  ? -1.853  2.121   -6.961  1.00 0.00 ? 23  PHE A CA   4  
ATOM 4849  C C    . PHE A 1 23  ? -3.175  1.777   -7.643  1.00 0.00 ? 23  PHE A C    4  
ATOM 4850  O O    . PHE A 1 23  ? -3.598  0.621   -7.652  1.00 0.00 ? 23  PHE A O    4  
ATOM 4851  C CB   . PHE A 1 23  ? -0.736  2.204   -8.003  1.00 0.00 ? 23  PHE A CB   4  
ATOM 4852  C CG   . PHE A 1 23  ? 0.606   2.538   -7.417  1.00 0.00 ? 23  PHE A CG   4  
ATOM 4853  C CD1  . PHE A 1 23  ? 1.291   1.610   -6.648  1.00 0.00 ? 23  PHE A CD1  4  
ATOM 4854  C CD2  . PHE A 1 23  ? 1.183   3.778   -7.635  1.00 0.00 ? 23  PHE A CD2  4  
ATOM 4855  C CE1  . PHE A 1 23  ? 2.526   1.915   -6.107  1.00 0.00 ? 23  PHE A CE1  4  
ATOM 4856  C CE2  . PHE A 1 23  ? 2.418   4.088   -7.096  1.00 0.00 ? 23  PHE A CE2  4  
ATOM 4857  C CZ   . PHE A 1 23  ? 3.091   3.155   -6.333  1.00 0.00 ? 23  PHE A CZ   4  
ATOM 4858  H H    . PHE A 1 23  ? -1.767  0.196   -6.085  1.00 0.00 ? 23  PHE A H    4  
ATOM 4859  H HA   . PHE A 1 23  ? -1.952  3.080   -6.475  1.00 0.00 ? 23  PHE A HA   4  
ATOM 4860  H HB2  . PHE A 1 23  ? -0.651  1.252   -8.505  1.00 0.00 ? 23  PHE A HB2  4  
ATOM 4861  H HB3  . PHE A 1 23  ? -0.983  2.967   -8.725  1.00 0.00 ? 23  PHE A HB3  4  
ATOM 4862  H HD1  . PHE A 1 23  ? 0.851   0.639   -6.472  1.00 0.00 ? 23  PHE A HD1  4  
ATOM 4863  H HD2  . PHE A 1 23  ? 0.658   4.510   -8.233  1.00 0.00 ? 23  PHE A HD2  4  
ATOM 4864  H HE1  . PHE A 1 23  ? 3.050   1.183   -5.510  1.00 0.00 ? 23  PHE A HE1  4  
ATOM 4865  H HE2  . PHE A 1 23  ? 2.857   5.059   -7.275  1.00 0.00 ? 23  PHE A HE2  4  
ATOM 4866  H HZ   . PHE A 1 23  ? 4.055   3.395   -5.911  1.00 0.00 ? 23  PHE A HZ   4  
ATOM 4867  N N    . TYR A 1 24  ? -3.821  2.788   -8.212  1.00 0.00 ? 24  TYR A N    4  
ATOM 4868  C CA   . TYR A 1 24  ? -5.095  2.594   -8.893  1.00 0.00 ? 24  TYR A CA   4  
ATOM 4869  C C    . TYR A 1 24  ? -5.142  3.386   -10.197 1.00 0.00 ? 24  TYR A C    4  
ATOM 4870  O O    . TYR A 1 24  ? -4.632  4.504   -10.277 1.00 0.00 ? 24  TYR A O    4  
ATOM 4871  C CB   . TYR A 1 24  ? -6.252  3.016   -7.986  1.00 0.00 ? 24  TYR A CB   4  
ATOM 4872  C CG   . TYR A 1 24  ? -6.230  4.483   -7.618  1.00 0.00 ? 24  TYR A CG   4  
ATOM 4873  C CD1  . TYR A 1 24  ? -6.826  5.434   -8.437  1.00 0.00 ? 24  TYR A CD1  4  
ATOM 4874  C CD2  . TYR A 1 24  ? -5.613  4.917   -6.451  1.00 0.00 ? 24  TYR A CD2  4  
ATOM 4875  C CE1  . TYR A 1 24  ? -6.807  6.775   -8.106  1.00 0.00 ? 24  TYR A CE1  4  
ATOM 4876  C CE2  . TYR A 1 24  ? -5.591  6.256   -6.111  1.00 0.00 ? 24  TYR A CE2  4  
ATOM 4877  C CZ   . TYR A 1 24  ? -6.189  7.181   -6.942  1.00 0.00 ? 24  TYR A CZ   4  
ATOM 4878  O OH   . TYR A 1 24  ? -6.169  8.516   -6.607  1.00 0.00 ? 24  TYR A OH   4  
ATOM 4879  H H    . TYR A 1 24  ? -3.433  3.687   -8.172  1.00 0.00 ? 24  TYR A H    4  
ATOM 4880  H HA   . TYR A 1 24  ? -5.194  1.543   -9.120  1.00 0.00 ? 24  TYR A HA   4  
ATOM 4881  H HB2  . TYR A 1 24  ? -7.186  2.815   -8.487  1.00 0.00 ? 24  TYR A HB2  4  
ATOM 4882  H HB3  . TYR A 1 24  ? -6.210  2.444   -7.071  1.00 0.00 ? 24  TYR A HB3  4  
ATOM 4883  H HD1  . TYR A 1 24  ? -7.310  5.112   -9.348  1.00 0.00 ? 24  TYR A HD1  4  
ATOM 4884  H HD2  . TYR A 1 24  ? -5.146  4.191   -5.803  1.00 0.00 ? 24  TYR A HD2  4  
ATOM 4885  H HE1  . TYR A 1 24  ? -7.275  7.499   -8.756  1.00 0.00 ? 24  TYR A HE1  4  
ATOM 4886  H HE2  . TYR A 1 24  ? -5.107  6.575   -5.200  1.00 0.00 ? 24  TYR A HE2  4  
ATOM 4887  H HH   . TYR A 1 24  ? -5.786  8.621   -5.733  1.00 0.00 ? 24  TYR A HH   4  
ATOM 4888  N N    . LEU A 1 25  ? -5.758  2.798   -11.216 1.00 0.00 ? 25  LEU A N    4  
ATOM 4889  C CA   . LEU A 1 25  ? -5.874  3.447   -12.518 1.00 0.00 ? 25  LEU A CA   4  
ATOM 4890  C C    . LEU A 1 25  ? -6.872  4.599   -12.465 1.00 0.00 ? 25  LEU A C    4  
ATOM 4891  O O    . LEU A 1 25  ? -7.951  4.472   -11.889 1.00 0.00 ? 25  LEU A O    4  
ATOM 4892  C CB   . LEU A 1 25  ? -6.304  2.432   -13.579 1.00 0.00 ? 25  LEU A CB   4  
ATOM 4893  C CG   . LEU A 1 25  ? -6.632  3.003   -14.959 1.00 0.00 ? 25  LEU A CG   4  
ATOM 4894  C CD1  . LEU A 1 25  ? -5.369  3.506   -15.642 1.00 0.00 ? 25  LEU A CD1  4  
ATOM 4895  C CD2  . LEU A 1 25  ? -7.324  1.955   -15.819 1.00 0.00 ? 25  LEU A CD2  4  
ATOM 4896  H H    . LEU A 1 25  ? -6.145  1.906   -11.092 1.00 0.00 ? 25  LEU A H    4  
ATOM 4897  H HA   . LEU A 1 25  ? -4.902  3.839   -12.780 1.00 0.00 ? 25  LEU A HA   4  
ATOM 4898  H HB2  . LEU A 1 25  ? -5.504  1.719   -13.698 1.00 0.00 ? 25  LEU A HB2  4  
ATOM 4899  H HB3  . LEU A 1 25  ? -7.185  1.925   -13.212 1.00 0.00 ? 25  LEU A HB3  4  
ATOM 4900  H HG   . LEU A 1 25  ? -7.305  3.841   -14.845 1.00 0.00 ? 25  LEU A HG   4  
ATOM 4901  H HD11 . LEU A 1 25  ? -4.716  3.952   -14.907 1.00 0.00 ? 25  LEU A HD11 4  
ATOM 4902  H HD12 . LEU A 1 25  ? -5.632  4.244   -16.385 1.00 0.00 ? 25  LEU A HD12 4  
ATOM 4903  H HD13 . LEU A 1 25  ? -4.864  2.679   -16.119 1.00 0.00 ? 25  LEU A HD13 4  
ATOM 4904  H HD21 . LEU A 1 25  ? -8.352  2.244   -15.979 1.00 0.00 ? 25  LEU A HD21 4  
ATOM 4905  H HD22 . LEU A 1 25  ? -7.292  0.999   -15.316 1.00 0.00 ? 25  LEU A HD22 4  
ATOM 4906  H HD23 . LEU A 1 25  ? -6.818  1.880   -16.770 1.00 0.00 ? 25  LEU A HD23 4  
ATOM 4907  N N    . ALA A 1 26  ? -6.503  5.722   -13.072 1.00 0.00 ? 26  ALA A N    4  
ATOM 4908  C CA   . ALA A 1 26  ? -7.367  6.896   -13.098 1.00 0.00 ? 26  ALA A CA   4  
ATOM 4909  C C    . ALA A 1 26  ? -7.974  7.100   -14.482 1.00 0.00 ? 26  ALA A C    4  
ATOM 4910  O O    . ALA A 1 26  ? -7.453  6.599   -15.478 1.00 0.00 ? 26  ALA A O    4  
ATOM 4911  C CB   . ALA A 1 26  ? -6.591  8.133   -12.672 1.00 0.00 ? 26  ALA A CB   4  
ATOM 4912  H H    . ALA A 1 26  ? -5.630  5.762   -13.515 1.00 0.00 ? 26  ALA A H    4  
ATOM 4913  H HA   . ALA A 1 26  ? -8.165  6.739   -12.386 1.00 0.00 ? 26  ALA A HA   4  
ATOM 4914  H HB1  . ALA A 1 26  ? -5.690  8.212   -13.263 1.00 0.00 ? 26  ALA A HB1  4  
ATOM 4915  H HB2  . ALA A 1 26  ? -7.200  9.011   -12.825 1.00 0.00 ? 26  ALA A HB2  4  
ATOM 4916  H HB3  . ALA A 1 26  ? -6.330  8.052   -11.628 1.00 0.00 ? 26  ALA A HB3  4  
ATOM 4917  N N    . GLU A 1 27  ? -9.078  7.839   -14.536 1.00 0.00 ? 27  GLU A N    4  
ATOM 4918  C CA   . GLU A 1 27  ? -9.756  8.107   -15.799 1.00 0.00 ? 27  GLU A CA   4  
ATOM 4919  C C    . GLU A 1 27  ? -8.810  8.777   -16.792 1.00 0.00 ? 27  GLU A C    4  
ATOM 4920  O O    . GLU A 1 27  ? -8.880  8.528   -17.996 1.00 0.00 ? 27  GLU A O    4  
ATOM 4921  C CB   . GLU A 1 27  ? -10.981 8.994   -15.567 1.00 0.00 ? 27  GLU A CB   4  
ATOM 4922  C CG   . GLU A 1 27  ? -11.833 9.192   -16.810 1.00 0.00 ? 27  GLU A CG   4  
ATOM 4923  C CD   . GLU A 1 27  ? -13.201 9.764   -16.495 1.00 0.00 ? 27  GLU A CD   4  
ATOM 4924  O OE1  . GLU A 1 27  ? -14.128 8.970   -16.228 1.00 0.00 ? 27  GLU A OE1  4  
ATOM 4925  O OE2  . GLU A 1 27  ? -13.346 11.004  -16.515 1.00 0.00 ? 27  GLU A OE2  4  
ATOM 4926  H H    . GLU A 1 27  ? -9.445  8.211   -13.708 1.00 0.00 ? 27  GLU A H    4  
ATOM 4927  H HA   . GLU A 1 27  ? -10.079 7.163   -16.209 1.00 0.00 ? 27  GLU A HA   4  
ATOM 4928  H HB2  . GLU A 1 27  ? -11.596 8.545   -14.802 1.00 0.00 ? 27  GLU A HB2  4  
ATOM 4929  H HB3  . GLU A 1 27  ? -10.649 9.963   -15.226 1.00 0.00 ? 27  GLU A HB3  4  
ATOM 4930  H HG2  . GLU A 1 27  ? -11.322 9.870   -17.477 1.00 0.00 ? 27  GLU A HG2  4  
ATOM 4931  H HG3  . GLU A 1 27  ? -11.961 8.237   -17.299 1.00 0.00 ? 27  GLU A HG3  4  
ATOM 4932  N N    . CYS A 1 28  ? -7.928  9.627   -16.279 1.00 0.00 ? 28  CYS A N    4  
ATOM 4933  C CA   . CYS A 1 28  ? -6.969  10.334  -17.120 1.00 0.00 ? 28  CYS A CA   4  
ATOM 4934  C C    . CYS A 1 28  ? -6.078  9.352   -17.873 1.00 0.00 ? 28  CYS A C    4  
ATOM 4935  O O    . CYS A 1 28  ? -5.615  9.637   -18.976 1.00 0.00 ? 28  CYS A O    4  
ATOM 4936  C CB   . CYS A 1 28  ? -6.110  11.273  -16.272 1.00 0.00 ? 28  CYS A CB   4  
ATOM 4937  S SG   . CYS A 1 28  ? -4.804  12.116  -17.195 1.00 0.00 ? 28  CYS A SG   4  
ATOM 4938  H H    . CYS A 1 28  ? -7.921  9.784   -15.312 1.00 0.00 ? 28  CYS A H    4  
ATOM 4939  H HA   . CYS A 1 28  ? -7.525  10.918  -17.837 1.00 0.00 ? 28  CYS A HA   4  
ATOM 4940  H HB2  . CYS A 1 28  ? -6.743  12.031  -15.834 1.00 0.00 ? 28  CYS A HB2  4  
ATOM 4941  H HB3  . CYS A 1 28  ? -5.642  10.705  -15.482 1.00 0.00 ? 28  CYS A HB3  4  
ATOM 4942  H HG   . CYS A 1 28  ? -4.631  11.471  -18.339 1.00 0.00 ? 28  CYS A HG   4  
ATOM 4943  N N    . GLY A 1 29  ? -5.840  8.192   -17.267 1.00 0.00 ? 29  GLY A N    4  
ATOM 4944  C CA   . GLY A 1 29  ? -5.003  7.186   -17.894 1.00 0.00 ? 29  GLY A CA   4  
ATOM 4945  C C    . GLY A 1 29  ? -3.829  6.784   -17.024 1.00 0.00 ? 29  GLY A C    4  
ATOM 4946  O O    . GLY A 1 29  ? -3.479  5.606   -16.945 1.00 0.00 ? 29  GLY A O    4  
ATOM 4947  H H    . GLY A 1 29  ? -6.236  8.019   -16.387 1.00 0.00 ? 29  GLY A H    4  
ATOM 4948  H HA2  . GLY A 1 29  ? -5.603  6.311   -18.098 1.00 0.00 ? 29  GLY A HA2  4  
ATOM 4949  H HA3  . GLY A 1 29  ? -4.627  7.577   -18.827 1.00 0.00 ? 29  GLY A HA3  4  
ATOM 4950  N N    . LYS A 1 30  ? -3.217  7.765   -16.369 1.00 0.00 ? 30  LYS A N    4  
ATOM 4951  C CA   . LYS A 1 30  ? -2.074  7.509   -15.500 1.00 0.00 ? 30  LYS A CA   4  
ATOM 4952  C C    . LYS A 1 30  ? -2.530  6.984   -14.142 1.00 0.00 ? 30  LYS A C    4  
ATOM 4953  O O    . LYS A 1 30  ? -3.567  7.397   -13.623 1.00 0.00 ? 30  LYS A O    4  
ATOM 4954  C CB   . LYS A 1 30  ? -1.252  8.787   -15.315 1.00 0.00 ? 30  LYS A CB   4  
ATOM 4955  C CG   . LYS A 1 30  ? 0.227   8.530   -15.081 1.00 0.00 ? 30  LYS A CG   4  
ATOM 4956  C CD   . LYS A 1 30  ? 0.530   8.320   -13.607 1.00 0.00 ? 30  LYS A CD   4  
ATOM 4957  C CE   . LYS A 1 30  ? 2.017   8.457   -13.319 1.00 0.00 ? 30  LYS A CE   4  
ATOM 4958  N NZ   . LYS A 1 30  ? 2.494   9.854   -13.517 1.00 0.00 ? 30  LYS A NZ   4  
ATOM 4959  H H    . LYS A 1 30  ? -3.542  8.684   -16.472 1.00 0.00 ? 30  LYS A H    4  
ATOM 4960  H HA   . LYS A 1 30  ? -1.458  6.760   -15.974 1.00 0.00 ? 30  LYS A HA   4  
ATOM 4961  H HB2  . LYS A 1 30  ? -1.355  9.398   -16.200 1.00 0.00 ? 30  LYS A HB2  4  
ATOM 4962  H HB3  . LYS A 1 30  ? -1.640  9.330   -14.465 1.00 0.00 ? 30  LYS A HB3  4  
ATOM 4963  H HG2  . LYS A 1 30  ? 0.520   7.646   -15.627 1.00 0.00 ? 30  LYS A HG2  4  
ATOM 4964  H HG3  . LYS A 1 30  ? 0.791   9.380   -15.438 1.00 0.00 ? 30  LYS A HG3  4  
ATOM 4965  H HD2  . LYS A 1 30  ? -0.007  9.058   -13.029 1.00 0.00 ? 30  LYS A HD2  4  
ATOM 4966  H HD3  . LYS A 1 30  ? 0.206   7.330   -13.319 1.00 0.00 ? 30  LYS A HD3  4  
ATOM 4967  H HE2  . LYS A 1 30  ? 2.201   8.165   -12.296 1.00 0.00 ? 30  LYS A HE2  4  
ATOM 4968  H HE3  . LYS A 1 30  ? 2.561   7.802   -13.984 1.00 0.00 ? 30  LYS A HE3  4  
ATOM 4969  H HZ1  . LYS A 1 30  ? 2.643   10.040  -14.529 1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 4970  H HZ2  . LYS A 1 30  ? 3.392   9.999   -13.013 1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 4971  H HZ3  . LYS A 1 30  ? 1.791   10.527  -13.151 1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 4972  N N    . TRP A 1 31  ? -1.748  6.074   -13.573 1.00 0.00 ? 31  TRP A N    4  
ATOM 4973  C CA   . TRP A 1 31  ? -2.072  5.494   -12.274 1.00 0.00 ? 31  TRP A CA   4  
ATOM 4974  C C    . TRP A 1 31  ? -1.584  6.390   -11.141 1.00 0.00 ? 31  TRP A C    4  
ATOM 4975  O O    . TRP A 1 31  ? -0.484  6.941   -11.202 1.00 0.00 ? 31  TRP A O    4  
ATOM 4976  C CB   . TRP A 1 31  ? -1.449  4.103   -12.145 1.00 0.00 ? 31  TRP A CB   4  
ATOM 4977  C CG   . TRP A 1 31  ? -1.986  3.117   -13.139 1.00 0.00 ? 31  TRP A CG   4  
ATOM 4978  C CD1  . TRP A 1 31  ? -1.911  3.202   -14.500 1.00 0.00 ? 31  TRP A CD1  4  
ATOM 4979  C CD2  . TRP A 1 31  ? -2.681  1.900   -12.849 1.00 0.00 ? 31  TRP A CD2  4  
ATOM 4980  N NE1  . TRP A 1 31  ? -2.518  2.111   -15.073 1.00 0.00 ? 31  TRP A NE1  4  
ATOM 4981  C CE2  . TRP A 1 31  ? -2.997  1.297   -14.082 1.00 0.00 ? 31  TRP A CE2  4  
ATOM 4982  C CE3  . TRP A 1 31  ? -3.065  1.259   -11.668 1.00 0.00 ? 31  TRP A CE3  4  
ATOM 4983  C CZ2  . TRP A 1 31  ? -3.680  0.086   -14.165 1.00 0.00 ? 31  TRP A CZ2  4  
ATOM 4984  C CZ3  . TRP A 1 31  ? -3.742  0.057   -11.752 1.00 0.00 ? 31  TRP A CZ3  4  
ATOM 4985  C CH2  . TRP A 1 31  ? -4.044  -0.519  -12.993 1.00 0.00 ? 31  TRP A CH2  4  
ATOM 4986  H H    . TRP A 1 31  ? -0.934  5.784   -14.037 1.00 0.00 ? 31  TRP A H    4  
ATOM 4987  H HA   . TRP A 1 31  ? -3.146  5.405   -12.210 1.00 0.00 ? 31  TRP A HA   4  
ATOM 4988  H HB2  . TRP A 1 31  ? -0.382  4.177   -12.292 1.00 0.00 ? 31  TRP A HB2  4  
ATOM 4989  H HB3  . TRP A 1 31  ? -1.647  3.719   -11.154 1.00 0.00 ? 31  TRP A HB3  4  
ATOM 4990  H HD1  . TRP A 1 31  ? -1.442  4.015   -15.033 1.00 0.00 ? 31  TRP A HD1  4  
ATOM 4991  H HE1  . TRP A 1 31  ? -2.593  1.943   -16.036 1.00 0.00 ? 31  TRP A HE1  4  
ATOM 4992  H HE3  . TRP A 1 31  ? -2.842  1.688   -10.702 1.00 0.00 ? 31  TRP A HE3  4  
ATOM 4993  H HZ2  . TRP A 1 31  ? -3.919  -0.372  -15.114 1.00 0.00 ? 31  TRP A HZ2  4  
ATOM 4994  H HZ3  . TRP A 1 31  ? -4.048  -0.452  -10.850 1.00 0.00 ? 31  TRP A HZ3  4  
ATOM 4995  H HH2  . TRP A 1 31  ? -4.575  -1.459  -13.011 1.00 0.00 ? 31  TRP A HH2  4  
ATOM 4996  N N    . HIS A 1 32  ? -2.408  6.532   -10.108 1.00 0.00 ? 32  HIS A N    4  
ATOM 4997  C CA   . HIS A 1 32  ? -2.059  7.361   -8.960  1.00 0.00 ? 32  HIS A CA   4  
ATOM 4998  C C    . HIS A 1 32  ? -2.013  6.529   -7.682  1.00 0.00 ? 32  HIS A C    4  
ATOM 4999  O O    . HIS A 1 32  ? -2.993  5.879   -7.318  1.00 0.00 ? 32  HIS A O    4  
ATOM 5000  C CB   . HIS A 1 32  ? -3.064  8.502   -8.804  1.00 0.00 ? 32  HIS A CB   4  
ATOM 5001  C CG   . HIS A 1 32  ? -2.925  9.570   -9.845  1.00 0.00 ? 32  HIS A CG   4  
ATOM 5002  N ND1  . HIS A 1 32  ? -2.827  10.911  -9.539  1.00 0.00 ? 32  HIS A ND1  4  
ATOM 5003  C CD2  . HIS A 1 32  ? -2.866  9.488   -11.195 1.00 0.00 ? 32  HIS A CD2  4  
ATOM 5004  C CE1  . HIS A 1 32  ? -2.715  11.608  -10.656 1.00 0.00 ? 32  HIS A CE1  4  
ATOM 5005  N NE2  . HIS A 1 32  ? -2.736  10.768  -11.675 1.00 0.00 ? 32  HIS A NE2  4  
ATOM 5006  H H    . HIS A 1 32  ? -3.271  6.067   -10.118 1.00 0.00 ? 32  HIS A H    4  
ATOM 5007  H HA   . HIS A 1 32  ? -1.079  7.778   -9.138  1.00 0.00 ? 32  HIS A HA   4  
ATOM 5008  H HB2  . HIS A 1 32  ? -4.065  8.102   -8.871  1.00 0.00 ? 32  HIS A HB2  4  
ATOM 5009  H HB3  . HIS A 1 32  ? -2.930  8.962   -7.835  1.00 0.00 ? 32  HIS A HB3  4  
ATOM 5010  H HD1  . HIS A 1 32  ? -2.839  11.294  -8.638  1.00 0.00 ? 32  HIS A HD1  4  
ATOM 5011  H HD2  . HIS A 1 32  ? -2.913  8.584   -11.786 1.00 0.00 ? 32  HIS A HD2  4  
ATOM 5012  H HE1  . HIS A 1 32  ? -2.623  12.681  -10.725 1.00 0.00 ? 32  HIS A HE1  4  
ATOM 5013  N N    . MET A 1 33  ? -0.870  6.553   -7.006  1.00 0.00 ? 33  MET A N    4  
ATOM 5014  C CA   . MET A 1 33  ? -0.697  5.800   -5.769  1.00 0.00 ? 33  MET A CA   4  
ATOM 5015  C C    . MET A 1 33  ? -1.813  6.120   -4.779  1.00 0.00 ? 33  MET A C    4  
ATOM 5016  O O    . MET A 1 33  ? -2.412  7.194   -4.829  1.00 0.00 ? 33  MET A O    4  
ATOM 5017  C CB   . MET A 1 33  ? 0.662   6.114   -5.141  1.00 0.00 ? 33  MET A CB   4  
ATOM 5018  C CG   . MET A 1 33  ? 1.124   5.068   -4.139  1.00 0.00 ? 33  MET A CG   4  
ATOM 5019  S SD   . MET A 1 33  ? 2.642   5.544   -3.290  1.00 0.00 ? 33  MET A SD   4  
ATOM 5020  C CE   . MET A 1 33  ? 2.187   5.235   -1.585  1.00 0.00 ? 33  MET A CE   4  
ATOM 5021  H H    . MET A 1 33  ? -0.123  7.090   -7.346  1.00 0.00 ? 33  MET A H    4  
ATOM 5022  H HA   . MET A 1 33  ? -0.738  4.749   -6.012  1.00 0.00 ? 33  MET A HA   4  
ATOM 5023  H HB2  . MET A 1 33  ? 1.401   6.181   -5.926  1.00 0.00 ? 33  MET A HB2  4  
ATOM 5024  H HB3  . MET A 1 33  ? 0.601   7.065   -4.633  1.00 0.00 ? 33  MET A HB3  4  
ATOM 5025  H HG2  . MET A 1 33  ? 0.347   4.926   -3.403  1.00 0.00 ? 33  MET A HG2  4  
ATOM 5026  H HG3  . MET A 1 33  ? 1.296   4.140   -4.663  1.00 0.00 ? 33  MET A HG3  4  
ATOM 5027  H HE1  . MET A 1 33  ? 1.897   4.201   -1.472  1.00 0.00 ? 33  MET A HE1  4  
ATOM 5028  H HE2  . MET A 1 33  ? 3.031   5.445   -0.944  1.00 0.00 ? 33  MET A HE2  4  
ATOM 5029  H HE3  . MET A 1 33  ? 1.359   5.873   -1.313  1.00 0.00 ? 33  MET A HE3  4  
ATOM 5030  N N    . PHE A 1 34  ? -2.088  5.180   -3.880  1.00 0.00 ? 34  PHE A N    4  
ATOM 5031  C CA   . PHE A 1 34  ? -3.133  5.361   -2.880  1.00 0.00 ? 34  PHE A CA   4  
ATOM 5032  C C    . PHE A 1 34  ? -2.723  6.409   -1.849  1.00 0.00 ? 34  PHE A C    4  
ATOM 5033  O O    . PHE A 1 34  ? -1.592  6.409   -1.366  1.00 0.00 ? 34  PHE A O    4  
ATOM 5034  C CB   . PHE A 1 34  ? -3.435  4.034   -2.181  1.00 0.00 ? 34  PHE A CB   4  
ATOM 5035  C CG   . PHE A 1 34  ? -4.455  3.197   -2.899  1.00 0.00 ? 34  PHE A CG   4  
ATOM 5036  C CD1  . PHE A 1 34  ? -4.070  2.316   -3.896  1.00 0.00 ? 34  PHE A CD1  4  
ATOM 5037  C CD2  . PHE A 1 34  ? -5.799  3.292   -2.577  1.00 0.00 ? 34  PHE A CD2  4  
ATOM 5038  C CE1  . PHE A 1 34  ? -5.006  1.544   -4.559  1.00 0.00 ? 34  PHE A CE1  4  
ATOM 5039  C CE2  . PHE A 1 34  ? -6.740  2.523   -3.236  1.00 0.00 ? 34  PHE A CE2  4  
ATOM 5040  C CZ   . PHE A 1 34  ? -6.343  1.649   -4.228  1.00 0.00 ? 34  PHE A CZ   4  
ATOM 5041  H H    . PHE A 1 34  ? -1.576  4.344   -3.891  1.00 0.00 ? 34  PHE A H    4  
ATOM 5042  H HA   . PHE A 1 34  ? -4.022  5.701   -3.388  1.00 0.00 ? 34  PHE A HA   4  
ATOM 5043  H HB2  . PHE A 1 34  ? -2.525  3.457   -2.109  1.00 0.00 ? 34  PHE A HB2  4  
ATOM 5044  H HB3  . PHE A 1 34  ? -3.808  4.235   -1.188  1.00 0.00 ? 34  PHE A HB3  4  
ATOM 5045  H HD1  . PHE A 1 34  ? -3.024  2.233   -4.156  1.00 0.00 ? 34  PHE A HD1  4  
ATOM 5046  H HD2  . PHE A 1 34  ? -6.112  3.976   -1.802  1.00 0.00 ? 34  PHE A HD2  4  
ATOM 5047  H HE1  . PHE A 1 34  ? -4.692  0.862   -5.334  1.00 0.00 ? 34  PHE A HE1  4  
ATOM 5048  H HE2  . PHE A 1 34  ? -7.785  2.607   -2.976  1.00 0.00 ? 34  PHE A HE2  4  
ATOM 5049  H HZ   . PHE A 1 34  ? -7.076  1.046   -4.744  1.00 0.00 ? 34  PHE A HZ   4  
ATOM 5050  N N    . GLN A 1 35  ? -3.652  7.301   -1.519  1.00 0.00 ? 35  GLN A N    4  
ATOM 5051  C CA   . GLN A 1 35  ? -3.388  8.355   -0.548  1.00 0.00 ? 35  GLN A CA   4  
ATOM 5052  C C    . GLN A 1 35  ? -4.645  8.689   0.249   1.00 0.00 ? 35  GLN A C    4  
ATOM 5053  O O    . GLN A 1 35  ? -5.765  8.624   -0.257  1.00 0.00 ? 35  GLN A O    4  
ATOM 5054  C CB   . GLN A 1 35  ? -2.869  9.609   -1.253  1.00 0.00 ? 35  GLN A CB   4  
ATOM 5055  C CG   . GLN A 1 35  ? -1.380  9.564   -1.558  1.00 0.00 ? 35  GLN A CG   4  
ATOM 5056  C CD   . GLN A 1 35  ? -0.752  10.942  -1.606  1.00 0.00 ? 35  GLN A CD   4  
ATOM 5057  O OE1  . GLN A 1 35  ? -1.278  11.897  -1.034  1.00 0.00 ? 35  GLN A OE1  4  
ATOM 5058  N NE2  . GLN A 1 35  ? 0.380   11.054  -2.291  1.00 0.00 ? 35  GLN A NE2  4  
ATOM 5059  H H    . GLN A 1 35  ? -4.536  7.248   -1.939  1.00 0.00 ? 35  GLN A H    4  
ATOM 5060  H HA   . GLN A 1 35  ? -2.630  7.996   0.133   1.00 0.00 ? 35  GLN A HA   4  
ATOM 5061  H HB2  . GLN A 1 35  ? -3.401  9.731   -2.184  1.00 0.00 ? 35  GLN A HB2  4  
ATOM 5062  H HB3  . GLN A 1 35  ? -3.059  10.466  -0.624  1.00 0.00 ? 35  GLN A HB3  4  
ATOM 5063  H HG2  . GLN A 1 35  ? -0.886  8.987   -0.790  1.00 0.00 ? 35  GLN A HG2  4  
ATOM 5064  H HG3  . GLN A 1 35  ? -1.236  9.084   -2.515  1.00 0.00 ? 35  GLN A HG3  4  
ATOM 5065  H HE21 . GLN A 1 35  ? 0.741   10.250  -2.723  1.00 0.00 ? 35  GLN A HE21 4  
ATOM 5066  H HE22 . GLN A 1 35  ? 0.807   11.933  -2.340  1.00 0.00 ? 35  GLN A HE22 4  
ATOM 5067  N N    . PRO A 1 36  ? -4.457  9.055   1.526   1.00 0.00 ? 36  PRO A N    4  
ATOM 5068  C CA   . PRO A 1 36  ? -5.564  9.407   2.420   1.00 0.00 ? 36  PRO A CA   4  
ATOM 5069  C C    . PRO A 1 36  ? -6.223  10.727  2.035   1.00 0.00 ? 36  PRO A C    4  
ATOM 5070  O O    . PRO A 1 36  ? -5.550  11.748  1.890   1.00 0.00 ? 36  PRO A O    4  
ATOM 5071  C CB   . PRO A 1 36  ? -4.891  9.524   3.789   1.00 0.00 ? 36  PRO A CB   4  
ATOM 5072  C CG   . PRO A 1 36  ? -3.470  9.855   3.486   1.00 0.00 ? 36  PRO A CG   4  
ATOM 5073  C CD   . PRO A 1 36  ? -3.149  9.155   2.195   1.00 0.00 ? 36  PRO A CD   4  
ATOM 5074  H HA   . PRO A 1 36  ? -6.312  8.628   2.450   1.00 0.00 ? 36  PRO A HA   4  
ATOM 5075  H HB2  . PRO A 1 36  ? -5.367  10.308  4.361   1.00 0.00 ? 36  PRO A HB2  4  
ATOM 5076  H HB3  . PRO A 1 36  ? -4.974  8.585   4.316   1.00 0.00 ? 36  PRO A HB3  4  
ATOM 5077  H HG2  . PRO A 1 36  ? -3.358  10.922  3.372   1.00 0.00 ? 36  PRO A HG2  4  
ATOM 5078  H HG3  . PRO A 1 36  ? -2.832  9.491   4.278   1.00 0.00 ? 36  PRO A HG3  4  
ATOM 5079  H HD2  . PRO A 1 36  ? -2.459  9.744   1.608   1.00 0.00 ? 36  PRO A HD2  4  
ATOM 5080  H HD3  . PRO A 1 36  ? -2.740  8.174   2.389   1.00 0.00 ? 36  PRO A HD3  4  
ATOM 5081  N N    . ASP A 1 37  ? -7.541  10.701  1.872   1.00 0.00 ? 37  ASP A N    4  
ATOM 5082  C CA   . ASP A 1 37  ? -8.291  11.897  1.506   1.00 0.00 ? 37  ASP A CA   4  
ATOM 5083  C C    . ASP A 1 37  ? -8.538  12.778  2.727   1.00 0.00 ? 37  ASP A C    4  
ATOM 5084  O O    . ASP A 1 37  ? -8.232  12.394  3.856   1.00 0.00 ? 37  ASP A O    4  
ATOM 5085  C CB   . ASP A 1 37  ? -9.623  11.512  0.861   1.00 0.00 ? 37  ASP A CB   4  
ATOM 5086  C CG   . ASP A 1 37  ? -10.122 12.564  -0.109  1.00 0.00 ? 37  ASP A CG   4  
ATOM 5087  O OD1  . ASP A 1 37  ? -9.307  13.067  -0.910  1.00 0.00 ? 37  ASP A OD1  4  
ATOM 5088  O OD2  . ASP A 1 37  ? -11.328 12.885  -0.067  1.00 0.00 ? 37  ASP A OD2  4  
ATOM 5089  H H    . ASP A 1 37  ? -8.021  9.856   2.002   1.00 0.00 ? 37  ASP A H    4  
ATOM 5090  H HA   . ASP A 1 37  ? -7.702  12.451  0.791   1.00 0.00 ? 37  ASP A HA   4  
ATOM 5091  H HB2  . ASP A 1 37  ? -9.500  10.583  0.323   1.00 0.00 ? 37  ASP A HB2  4  
ATOM 5092  H HB3  . ASP A 1 37  ? -10.365 11.380  1.635   1.00 0.00 ? 37  ASP A HB3  4  
ATOM 5093  N N    . THR A 1 38  ? -9.092  13.963  2.492   1.00 0.00 ? 38  THR A N    4  
ATOM 5094  C CA   . THR A 1 38  ? -9.379  14.900  3.571   1.00 0.00 ? 38  THR A CA   4  
ATOM 5095  C C    . THR A 1 38  ? -10.017 14.191  4.760   1.00 0.00 ? 38  THR A C    4  
ATOM 5096  O O    . THR A 1 38  ? -10.530 13.081  4.630   1.00 0.00 ? 38  THR A O    4  
ATOM 5097  C CB   . THR A 1 38  ? -10.313 16.031  3.100   1.00 0.00 ? 38  THR A CB   4  
ATOM 5098  O OG1  . THR A 1 38  ? -11.481 15.477  2.484   1.00 0.00 ? 38  THR A OG1  4  
ATOM 5099  C CG2  . THR A 1 38  ? -9.601  16.947  2.117   1.00 0.00 ? 38  THR A CG2  4  
ATOM 5100  H H    . THR A 1 38  ? -9.313  14.212  1.570   1.00 0.00 ? 38  THR A H    4  
ATOM 5101  H HA   . THR A 1 38  ? -8.444  15.341  3.886   1.00 0.00 ? 38  THR A HA   4  
ATOM 5102  H HB   . THR A 1 38  ? -10.611 16.613  3.961   1.00 0.00 ? 38  THR A HB   4  
ATOM 5103  H HG1  . THR A 1 38  ? -11.853 16.115  1.870   1.00 0.00 ? 38  THR A HG1  4  
ATOM 5104  H HG21 . THR A 1 38  ? -9.488  16.441  1.169   1.00 0.00 ? 38  THR A HG21 4  
ATOM 5105  H HG22 . THR A 1 38  ? -8.627  17.205  2.505   1.00 0.00 ? 38  THR A HG22 4  
ATOM 5106  H HG23 . THR A 1 38  ? -10.182 17.846  1.977   1.00 0.00 ? 38  THR A HG23 4  
ATOM 5107  N N    . ASN A 1 39  ? -9.981  14.841  5.919   1.00 0.00 ? 39  ASN A N    4  
ATOM 5108  C CA   . ASN A 1 39  ? -10.557 14.271  7.132   1.00 0.00 ? 39  ASN A CA   4  
ATOM 5109  C C    . ASN A 1 39  ? -11.999 13.834  6.896   1.00 0.00 ? 39  ASN A C    4  
ATOM 5110  O O    . ASN A 1 39  ? -12.400 12.740  7.293   1.00 0.00 ? 39  ASN A O    4  
ATOM 5111  C CB   . ASN A 1 39  ? -10.501 15.288  8.274   1.00 0.00 ? 39  ASN A CB   4  
ATOM 5112  C CG   . ASN A 1 39  ? -9.146  15.318  8.955   1.00 0.00 ? 39  ASN A CG   4  
ATOM 5113  O OD1  . ASN A 1 39  ? -8.232  16.014  8.512   1.00 0.00 ? 39  ASN A OD1  4  
ATOM 5114  N ND2  . ASN A 1 39  ? -9.011  14.562  10.038  1.00 0.00 ? 39  ASN A ND2  4  
ATOM 5115  H H    . ASN A 1 39  ? -9.558  15.723  5.960   1.00 0.00 ? 39  ASN A H    4  
ATOM 5116  H HA   . ASN A 1 39  ? -9.970  13.407  7.403   1.00 0.00 ? 39  ASN A HA   4  
ATOM 5117  H HB2  . ASN A 1 39  ? -10.706 16.273  7.881   1.00 0.00 ? 39  ASN A HB2  4  
ATOM 5118  H HB3  . ASN A 1 39  ? -11.248 15.036  9.011   1.00 0.00 ? 39  ASN A HB3  4  
ATOM 5119  H HD21 . ASN A 1 39  ? -9.783  14.034  10.333  1.00 0.00 ? 39  ASN A HD21 4  
ATOM 5120  H HD22 . ASN A 1 39  ? -8.146  14.563  10.499  1.00 0.00 ? 39  ASN A HD22 4  
ATOM 5121  N N    . SER A 1 40  ? -12.775 14.697  6.248   1.00 0.00 ? 40  SER A N    4  
ATOM 5122  C CA   . SER A 1 40  ? -14.174 14.401  5.961   1.00 0.00 ? 40  SER A CA   4  
ATOM 5123  C C    . SER A 1 40  ? -14.303 13.116  5.149   1.00 0.00 ? 40  SER A C    4  
ATOM 5124  O O    . SER A 1 40  ? -14.772 12.096  5.652   1.00 0.00 ? 40  SER A O    4  
ATOM 5125  C CB   . SER A 1 40  ? -14.818 15.564  5.204   1.00 0.00 ? 40  SER A CB   4  
ATOM 5126  O OG   . SER A 1 40  ? -14.056 15.912  4.061   1.00 0.00 ? 40  SER A OG   4  
ATOM 5127  H H    . SER A 1 40  ? -12.398 15.553  5.957   1.00 0.00 ? 40  SER A H    4  
ATOM 5128  H HA   . SER A 1 40  ? -14.685 14.270  6.904   1.00 0.00 ? 40  SER A HA   4  
ATOM 5129  H HB2  . SER A 1 40  ? -15.810 15.278  4.887   1.00 0.00 ? 40  SER A HB2  4  
ATOM 5130  H HB3  . SER A 1 40  ? -14.882 16.423  5.855   1.00 0.00 ? 40  SER A HB3  4  
ATOM 5131  H HG   . SER A 1 40  ? -13.600 16.741  4.221   1.00 0.00 ? 40  SER A HG   4  
ATOM 5132  N N    . GLN A 1 41  ? -13.882 13.175  3.889   1.00 0.00 ? 41  GLN A N    4  
ATOM 5133  C CA   . GLN A 1 41  ? -13.951 12.017  3.006   1.00 0.00 ? 41  GLN A CA   4  
ATOM 5134  C C    . GLN A 1 41  ? -12.739 11.113  3.200   1.00 0.00 ? 41  GLN A C    4  
ATOM 5135  O O    . GLN A 1 41  ? -12.370 10.352  2.304   1.00 0.00 ? 41  GLN A O    4  
ATOM 5136  C CB   . GLN A 1 41  ? -14.040 12.467  1.547   1.00 0.00 ? 41  GLN A CB   4  
ATOM 5137  C CG   . GLN A 1 41  ? -15.438 12.887  1.123   1.00 0.00 ? 41  GLN A CG   4  
ATOM 5138  C CD   . GLN A 1 41  ? -15.467 13.504  -0.261  1.00 0.00 ? 41  GLN A CD   4  
ATOM 5139  O OE1  . GLN A 1 41  ? -15.140 12.850  -1.252  1.00 0.00 ? 41  GLN A OE1  4  
ATOM 5140  N NE2  . GLN A 1 41  ? -15.862 14.769  -0.338  1.00 0.00 ? 41  GLN A NE2  4  
ATOM 5141  H H    . GLN A 1 41  ? -13.518 14.017  3.546   1.00 0.00 ? 41  GLN A H    4  
ATOM 5142  H HA   . GLN A 1 41  ? -14.842 11.462  3.257   1.00 0.00 ? 41  GLN A HA   4  
ATOM 5143  H HB2  . GLN A 1 41  ? -13.375 13.305  1.400   1.00 0.00 ? 41  GLN A HB2  4  
ATOM 5144  H HB3  . GLN A 1 41  ? -13.725 11.652  0.912   1.00 0.00 ? 41  GLN A HB3  4  
ATOM 5145  H HG2  . GLN A 1 41  ? -16.078 12.017  1.126   1.00 0.00 ? 41  GLN A HG2  4  
ATOM 5146  H HG3  . GLN A 1 41  ? -15.812 13.611  1.832   1.00 0.00 ? 41  GLN A HG3  4  
ATOM 5147  H HE21 . GLN A 1 41  ? -16.107 15.228  0.494   1.00 0.00 ? 41  GLN A HE21 4  
ATOM 5148  H HE22 . GLN A 1 41  ? -15.890 15.193  -1.220  1.00 0.00 ? 41  GLN A HE22 4  
ATOM 5149  N N    . CYS A 1 42  ? -12.122 11.201  4.373   1.00 0.00 ? 42  CYS A N    4  
ATOM 5150  C CA   . CYS A 1 42  ? -10.950 10.390  4.683   1.00 0.00 ? 42  CYS A CA   4  
ATOM 5151  C C    . CYS A 1 42  ? -11.077 8.996   4.079   1.00 0.00 ? 42  CYS A C    4  
ATOM 5152  O O    . CYS A 1 42  ? -11.984 8.239   4.425   1.00 0.00 ? 42  CYS A O    4  
ATOM 5153  C CB   . CYS A 1 42  ? -10.761 10.288  6.198   1.00 0.00 ? 42  CYS A CB   4  
ATOM 5154  S SG   . CYS A 1 42  ? -9.271  9.395   6.697   1.00 0.00 ? 42  CYS A SG   4  
ATOM 5155  H H    . CYS A 1 42  ? -12.463 11.825  5.047   1.00 0.00 ? 42  CYS A H    4  
ATOM 5156  H HA   . CYS A 1 42  ? -10.088 10.878  4.254   1.00 0.00 ? 42  CYS A HA   4  
ATOM 5157  H HB2  . CYS A 1 42  ? -10.702 11.283  6.614   1.00 0.00 ? 42  CYS A HB2  4  
ATOM 5158  H HB3  . CYS A 1 42  ? -11.611 9.777   6.625   1.00 0.00 ? 42  CYS A HB3  4  
ATOM 5159  H HG   . CYS A 1 42  ? -8.374  9.524   5.731   1.00 0.00 ? 42  CYS A HG   4  
ATOM 5160  N N    . SER A 1 43  ? -10.163 8.663   3.173   1.00 0.00 ? 43  SER A N    4  
ATOM 5161  C CA   . SER A 1 43  ? -10.176 7.362   2.516   1.00 0.00 ? 43  SER A CA   4  
ATOM 5162  C C    . SER A 1 43  ? -9.113  6.442   3.111   1.00 0.00 ? 43  SER A C    4  
ATOM 5163  O O    . SER A 1 43  ? -8.430  6.803   4.069   1.00 0.00 ? 43  SER A O    4  
ATOM 5164  C CB   . SER A 1 43  ? -9.943  7.523   1.013   1.00 0.00 ? 43  SER A CB   4  
ATOM 5165  O OG   . SER A 1 43  ? -11.015 8.220   0.403   1.00 0.00 ? 43  SER A OG   4  
ATOM 5166  H H    . SER A 1 43  ? -9.464  9.310   2.940   1.00 0.00 ? 43  SER A H    4  
ATOM 5167  H HA   . SER A 1 43  ? -11.148 6.919   2.676   1.00 0.00 ? 43  SER A HA   4  
ATOM 5168  H HB2  . SER A 1 43  ? -9.031  8.077   0.850   1.00 0.00 ? 43  SER A HB2  4  
ATOM 5169  H HB3  . SER A 1 43  ? -9.858  6.547   0.558   1.00 0.00 ? 43  SER A HB3  4  
ATOM 5170  H HG   . SER A 1 43  ? -11.198 9.023   0.896   1.00 0.00 ? 43  SER A HG   4  
ATOM 5171  N N    . VAL A 1 44  ? -8.981  5.251   2.535   1.00 0.00 ? 44  VAL A N    4  
ATOM 5172  C CA   . VAL A 1 44  ? -8.002  4.279   3.007   1.00 0.00 ? 44  VAL A CA   4  
ATOM 5173  C C    . VAL A 1 44  ? -6.640  4.514   2.362   1.00 0.00 ? 44  VAL A C    4  
ATOM 5174  O O    . VAL A 1 44  ? -6.541  4.721   1.153   1.00 0.00 ? 44  VAL A O    4  
ATOM 5175  C CB   . VAL A 1 44  ? -8.455  2.837   2.711   1.00 0.00 ? 44  VAL A CB   4  
ATOM 5176  C CG1  . VAL A 1 44  ? -9.734  2.513   3.469   1.00 0.00 ? 44  VAL A CG1  4  
ATOM 5177  C CG2  . VAL A 1 44  ? -8.647  2.636   1.215   1.00 0.00 ? 44  VAL A CG2  4  
ATOM 5178  H H    . VAL A 1 44  ? -9.555  5.022   1.775   1.00 0.00 ? 44  VAL A H    4  
ATOM 5179  H HA   . VAL A 1 44  ? -7.907  4.392   4.077   1.00 0.00 ? 44  VAL A HA   4  
ATOM 5180  H HB   . VAL A 1 44  ? -7.682  2.162   3.048   1.00 0.00 ? 44  VAL A HB   4  
ATOM 5181  H HG11 . VAL A 1 44  ? -10.054 3.384   4.023   1.00 0.00 ? 44  VAL A HG11 4  
ATOM 5182  H HG12 . VAL A 1 44  ? -10.505 2.227   2.769   1.00 0.00 ? 44  VAL A HG12 4  
ATOM 5183  H HG13 . VAL A 1 44  ? -9.549  1.699   4.154   1.00 0.00 ? 44  VAL A HG13 4  
ATOM 5184  H HG21 . VAL A 1 44  ? -7.913  1.933   0.851   1.00 0.00 ? 44  VAL A HG21 4  
ATOM 5185  H HG22 . VAL A 1 44  ? -9.638  2.250   1.027   1.00 0.00 ? 44  VAL A HG22 4  
ATOM 5186  H HG23 . VAL A 1 44  ? -8.526  3.580   0.706   1.00 0.00 ? 44  VAL A HG23 4  
ATOM 5187  N N    . SER A 1 45  ? -5.592  4.481   3.179   1.00 0.00 ? 45  SER A N    4  
ATOM 5188  C CA   . SER A 1 45  ? -4.235  4.693   2.689   1.00 0.00 ? 45  SER A CA   4  
ATOM 5189  C C    . SER A 1 45  ? -3.591  3.372   2.282   1.00 0.00 ? 45  SER A C    4  
ATOM 5190  O O    . SER A 1 45  ? -4.012  2.302   2.721   1.00 0.00 ? 45  SER A O    4  
ATOM 5191  C CB   . SER A 1 45  ? -3.385  5.379   3.761   1.00 0.00 ? 45  SER A CB   4  
ATOM 5192  O OG   . SER A 1 45  ? -4.030  6.537   4.260   1.00 0.00 ? 45  SER A OG   4  
ATOM 5193  H H    . SER A 1 45  ? -5.735  4.311   4.134   1.00 0.00 ? 45  SER A H    4  
ATOM 5194  H HA   . SER A 1 45  ? -4.292  5.335   1.823   1.00 0.00 ? 45  SER A HA   4  
ATOM 5195  H HB2  . SER A 1 45  ? -3.219  4.694   4.578   1.00 0.00 ? 45  SER A HB2  4  
ATOM 5196  H HB3  . SER A 1 45  ? -2.435  5.666   3.334   1.00 0.00 ? 45  SER A HB3  4  
ATOM 5197  H HG   . SER A 1 45  ? -3.411  7.271   4.267   1.00 0.00 ? 45  SER A HG   4  
ATOM 5198  N N    . SER A 1 46  ? -2.566  3.455   1.439   1.00 0.00 ? 46  SER A N    4  
ATOM 5199  C CA   . SER A 1 46  ? -1.865  2.266   0.969   1.00 0.00 ? 46  SER A CA   4  
ATOM 5200  C C    . SER A 1 46  ? -1.717  1.242   2.091   1.00 0.00 ? 46  SER A C    4  
ATOM 5201  O O    . SER A 1 46  ? -1.932  0.048   1.887   1.00 0.00 ? 46  SER A O    4  
ATOM 5202  C CB   . SER A 1 46  ? -0.486  2.643   0.423   1.00 0.00 ? 46  SER A CB   4  
ATOM 5203  O OG   . SER A 1 46  ? 0.311   3.249   1.426   1.00 0.00 ? 46  SER A OG   4  
ATOM 5204  H H    . SER A 1 46  ? -2.276  4.337   1.125   1.00 0.00 ? 46  SER A H    4  
ATOM 5205  H HA   . SER A 1 46  ? -2.450  1.829   0.174   1.00 0.00 ? 46  SER A HA   4  
ATOM 5206  H HB2  . SER A 1 46  ? 0.014   1.754   0.070   1.00 0.00 ? 46  SER A HB2  4  
ATOM 5207  H HB3  . SER A 1 46  ? -0.605  3.339   -0.395  1.00 0.00 ? 46  SER A HB3  4  
ATOM 5208  H HG   . SER A 1 46  ? 1.232   3.015   1.288   1.00 0.00 ? 46  SER A HG   4  
ATOM 5209  N N    . GLU A 1 47  ? -1.350  1.721   3.275   1.00 0.00 ? 47  GLU A N    4  
ATOM 5210  C CA   . GLU A 1 47  ? -1.172  0.847   4.429   1.00 0.00 ? 47  GLU A CA   4  
ATOM 5211  C C    . GLU A 1 47  ? -2.432  0.025   4.687   1.00 0.00 ? 47  GLU A C    4  
ATOM 5212  O O    . GLU A 1 47  ? -2.389  -1.205  4.706   1.00 0.00 ? 47  GLU A O    4  
ATOM 5213  C CB   . GLU A 1 47  ? -0.825  1.671   5.671   1.00 0.00 ? 47  GLU A CB   4  
ATOM 5214  C CG   . GLU A 1 47  ? -0.108  0.874   6.749   1.00 0.00 ? 47  GLU A CG   4  
ATOM 5215  C CD   . GLU A 1 47  ? -0.046  1.609   8.073   1.00 0.00 ? 47  GLU A CD   4  
ATOM 5216  O OE1  . GLU A 1 47  ? 0.769   2.548   8.193   1.00 0.00 ? 47  GLU A OE1  4  
ATOM 5217  O OE2  . GLU A 1 47  ? -0.811  1.245   8.991   1.00 0.00 ? 47  GLU A OE2  4  
ATOM 5218  H H    . GLU A 1 47  ? -1.193  2.683   3.375   1.00 0.00 ? 47  GLU A H    4  
ATOM 5219  H HA   . GLU A 1 47  ? -0.356  0.175   4.214   1.00 0.00 ? 47  GLU A HA   4  
ATOM 5220  H HB2  . GLU A 1 47  ? -0.189  2.493   5.377   1.00 0.00 ? 47  GLU A HB2  4  
ATOM 5221  H HB3  . GLU A 1 47  ? -1.737  2.066   6.093   1.00 0.00 ? 47  GLU A HB3  4  
ATOM 5222  H HG2  . GLU A 1 47  ? -0.631  -0.059  6.896   1.00 0.00 ? 47  GLU A HG2  4  
ATOM 5223  H HG3  . GLU A 1 47  ? 0.900   0.672   6.418   1.00 0.00 ? 47  GLU A HG3  4  
ATOM 5224  N N    . ASP A 1 48  ? -3.550  0.713   4.887   1.00 0.00 ? 48  ASP A N    4  
ATOM 5225  C CA   . ASP A 1 48  ? -4.822  0.048   5.144   1.00 0.00 ? 48  ASP A CA   4  
ATOM 5226  C C    . ASP A 1 48  ? -5.103  -1.014  4.085   1.00 0.00 ? 48  ASP A C    4  
ATOM 5227  O O    . ASP A 1 48  ? -5.393  -2.166  4.409   1.00 0.00 ? 48  ASP A O    4  
ATOM 5228  C CB   . ASP A 1 48  ? -5.960  1.069   5.175   1.00 0.00 ? 48  ASP A CB   4  
ATOM 5229  C CG   . ASP A 1 48  ? -7.286  0.447   5.563   1.00 0.00 ? 48  ASP A CG   4  
ATOM 5230  O OD1  . ASP A 1 48  ? -7.474  -0.760  5.303   1.00 0.00 ? 48  ASP A OD1  4  
ATOM 5231  O OD2  . ASP A 1 48  ? -8.138  1.167   6.126   1.00 0.00 ? 48  ASP A OD2  4  
ATOM 5232  H H    . ASP A 1 48  ? -3.520  1.693   4.861   1.00 0.00 ? 48  ASP A H    4  
ATOM 5233  H HA   . ASP A 1 48  ? -4.756  -0.433  6.109   1.00 0.00 ? 48  ASP A HA   4  
ATOM 5234  H HB2  . ASP A 1 48  ? -5.722  1.842   5.892   1.00 0.00 ? 48  ASP A HB2  4  
ATOM 5235  H HB3  . ASP A 1 48  ? -6.063  1.513   4.195   1.00 0.00 ? 48  ASP A HB3  4  
ATOM 5236  N N    . ILE A 1 49  ? -5.017  -0.618  2.820   1.00 0.00 ? 49  ILE A N    4  
ATOM 5237  C CA   . ILE A 1 49  ? -5.262  -1.535  1.714   1.00 0.00 ? 49  ILE A CA   4  
ATOM 5238  C C    . ILE A 1 49  ? -4.359  -2.761  1.806   1.00 0.00 ? 49  ILE A C    4  
ATOM 5239  O O    . ILE A 1 49  ? -4.836  -3.885  1.955   1.00 0.00 ? 49  ILE A O    4  
ATOM 5240  C CB   . ILE A 1 49  ? -5.040  -0.849  0.354   1.00 0.00 ? 49  ILE A CB   4  
ATOM 5241  C CG1  . ILE A 1 49  ? -6.040  0.294   0.165   1.00 0.00 ? 49  ILE A CG1  4  
ATOM 5242  C CG2  . ILE A 1 49  ? -5.164  -1.860  -0.776  1.00 0.00 ? 49  ILE A CG2  4  
ATOM 5243  C CD1  . ILE A 1 49  ? -5.539  1.626   0.679   1.00 0.00 ? 49  ILE A CD1  4  
ATOM 5244  H H    . ILE A 1 49  ? -4.781  0.313   2.626   1.00 0.00 ? 49  ILE A H    4  
ATOM 5245  H HA   . ILE A 1 49  ? -6.292  -1.855  1.770   1.00 0.00 ? 49  ILE A HA   4  
ATOM 5246  H HB   . ILE A 1 49  ? -4.038  -0.448  0.337   1.00 0.00 ? 49  ILE A HB   4  
ATOM 5247  H HG12 . ILE A 1 49  ? -6.257  0.405   -0.886  1.00 0.00 ? 49  ILE A HG12 4  
ATOM 5248  H HG13 . ILE A 1 49  ? -6.952  0.055   0.693   1.00 0.00 ? 49  ILE A HG13 4  
ATOM 5249  H HG21 . ILE A 1 49  ? -6.037  -2.476  -0.614  1.00 0.00 ? 49  ILE A HG21 4  
ATOM 5250  H HG22 . ILE A 1 49  ? -5.263  -1.339  -1.716  1.00 0.00 ? 49  ILE A HG22 4  
ATOM 5251  H HG23 . ILE A 1 49  ? -4.283  -2.484  -0.800  1.00 0.00 ? 49  ILE A HG23 4  
ATOM 5252  H HD11 . ILE A 1 49  ? -5.897  1.782   1.686   1.00 0.00 ? 49  ILE A HD11 4  
ATOM 5253  H HD12 . ILE A 1 49  ? -4.460  1.631   0.675   1.00 0.00 ? 49  ILE A HD12 4  
ATOM 5254  H HD13 . ILE A 1 49  ? -5.905  2.418   0.041   1.00 0.00 ? 49  ILE A HD13 4  
ATOM 5255  N N    . GLU A 1 50  ? -3.052  -2.534  1.719   1.00 0.00 ? 50  GLU A N    4  
ATOM 5256  C CA   . GLU A 1 50  ? -2.082  -3.621  1.793   1.00 0.00 ? 50  GLU A CA   4  
ATOM 5257  C C    . GLU A 1 50  ? -2.370  -4.526  2.987   1.00 0.00 ? 50  GLU A C    4  
ATOM 5258  O O    . GLU A 1 50  ? -2.543  -5.736  2.837   1.00 0.00 ? 50  GLU A O    4  
ATOM 5259  C CB   . GLU A 1 50  ? -0.662  -3.060  1.895   1.00 0.00 ? 50  GLU A CB   4  
ATOM 5260  C CG   . GLU A 1 50  ? 0.420   -4.096  1.643   1.00 0.00 ? 50  GLU A CG   4  
ATOM 5261  C CD   . GLU A 1 50  ? 0.679   -4.976  2.851   1.00 0.00 ? 50  GLU A CD   4  
ATOM 5262  O OE1  . GLU A 1 50  ? 0.643   -4.454  3.984   1.00 0.00 ? 50  GLU A OE1  4  
ATOM 5263  O OE2  . GLU A 1 50  ? 0.916   -6.187  2.662   1.00 0.00 ? 50  GLU A OE2  4  
ATOM 5264  H H    . GLU A 1 50  ? -2.733  -1.615  1.601   1.00 0.00 ? 50  GLU A H    4  
ATOM 5265  H HA   . GLU A 1 50  ? -2.166  -4.202  0.888   1.00 0.00 ? 50  GLU A HA   4  
ATOM 5266  H HB2  . GLU A 1 50  ? -0.548  -2.267  1.171   1.00 0.00 ? 50  GLU A HB2  4  
ATOM 5267  H HB3  . GLU A 1 50  ? -0.519  -2.654  2.885   1.00 0.00 ? 50  GLU A HB3  4  
ATOM 5268  H HG2  . GLU A 1 50  ? 0.115   -4.724  0.819   1.00 0.00 ? 50  GLU A HG2  4  
ATOM 5269  H HG3  . GLU A 1 50  ? 1.337   -3.586  1.385   1.00 0.00 ? 50  GLU A HG3  4  
ATOM 5270  N N    . LYS A 1 51  ? -2.421  -3.931  4.174   1.00 0.00 ? 51  LYS A N    4  
ATOM 5271  C CA   . LYS A 1 51  ? -2.688  -4.682  5.396   1.00 0.00 ? 51  LYS A CA   4  
ATOM 5272  C C    . LYS A 1 51  ? -3.810  -5.692  5.179   1.00 0.00 ? 51  LYS A C    4  
ATOM 5273  O O    . LYS A 1 51  ? -3.731  -6.830  5.641   1.00 0.00 ? 51  LYS A O    4  
ATOM 5274  C CB   . LYS A 1 51  ? -3.059  -3.728  6.534   1.00 0.00 ? 51  LYS A CB   4  
ATOM 5275  C CG   . LYS A 1 51  ? -2.690  -4.252  7.911   1.00 0.00 ? 51  LYS A CG   4  
ATOM 5276  C CD   . LYS A 1 51  ? -3.408  -3.485  9.009   1.00 0.00 ? 51  LYS A CD   4  
ATOM 5277  C CE   . LYS A 1 51  ? -3.212  -4.143  10.367  1.00 0.00 ? 51  LYS A CE   4  
ATOM 5278  N NZ   . LYS A 1 51  ? -1.853  -3.881  10.919  1.00 0.00 ? 51  LYS A NZ   4  
ATOM 5279  H H    . LYS A 1 51  ? -2.275  -2.963  4.230   1.00 0.00 ? 51  LYS A H    4  
ATOM 5280  H HA   . LYS A 1 51  ? -1.787  -5.213  5.662   1.00 0.00 ? 51  LYS A HA   4  
ATOM 5281  H HB2  . LYS A 1 51  ? -2.549  -2.788  6.380   1.00 0.00 ? 51  LYS A HB2  4  
ATOM 5282  H HB3  . LYS A 1 51  ? -4.126  -3.557  6.510   1.00 0.00 ? 51  LYS A HB3  4  
ATOM 5283  H HG2  . LYS A 1 51  ? -2.965  -5.294  7.975   1.00 0.00 ? 51  LYS A HG2  4  
ATOM 5284  H HG3  . LYS A 1 51  ? -1.623  -4.150  8.051   1.00 0.00 ? 51  LYS A HG3  4  
ATOM 5285  H HD2  . LYS A 1 51  ? -3.017  -2.480  9.049   1.00 0.00 ? 51  LYS A HD2  4  
ATOM 5286  H HD3  . LYS A 1 51  ? -4.464  -3.454  8.783   1.00 0.00 ? 51  LYS A HD3  4  
ATOM 5287  H HE2  . LYS A 1 51  ? -3.950  -3.753  11.051  1.00 0.00 ? 51  LYS A HE2  4  
ATOM 5288  H HE3  . LYS A 1 51  ? -3.348  -5.209  10.259  1.00 0.00 ? 51  LYS A HE3  4  
ATOM 5289  H HZ1  . LYS A 1 51  ? -1.785  -4.249  11.889  1.00 0.00 ? 51  LYS A HZ1  4  
ATOM 5290  H HZ2  . LYS A 1 51  ? -1.665  -2.859  10.934  1.00 0.00 ? 51  LYS A HZ2  4  
ATOM 5291  H HZ3  . LYS A 1 51  ? -1.133  -4.347  10.331  1.00 0.00 ? 51  LYS A HZ3  4  
ATOM 5292  N N    . SER A 1 52  ? -4.853  -5.268  4.472   1.00 0.00 ? 52  SER A N    4  
ATOM 5293  C CA   . SER A 1 52  ? -5.993  -6.136  4.196   1.00 0.00 ? 52  SER A CA   4  
ATOM 5294  C C    . SER A 1 52  ? -5.626  -7.205  3.171   1.00 0.00 ? 52  SER A C    4  
ATOM 5295  O O    . SER A 1 52  ? -5.708  -8.401  3.449   1.00 0.00 ? 52  SER A O    4  
ATOM 5296  C CB   . SER A 1 52  ? -7.177  -5.312  3.689   1.00 0.00 ? 52  SER A CB   4  
ATOM 5297  O OG   . SER A 1 52  ? -7.514  -4.285  4.606   1.00 0.00 ? 52  SER A OG   4  
ATOM 5298  H H    . SER A 1 52  ? -4.858  -4.350  4.131   1.00 0.00 ? 52  SER A H    4  
ATOM 5299  H HA   . SER A 1 52  ? -6.272  -6.621  5.120   1.00 0.00 ? 52  SER A HA   4  
ATOM 5300  H HB2  . SER A 1 52  ? -6.920  -4.862  2.742   1.00 0.00 ? 52  SER A HB2  4  
ATOM 5301  H HB3  . SER A 1 52  ? -8.033  -5.958  3.560   1.00 0.00 ? 52  SER A HB3  4  
ATOM 5302  H HG   . SER A 1 52  ? -7.238  -4.541  5.489   1.00 0.00 ? 52  SER A HG   4  
ATOM 5303  N N    . PHE A 1 53  ? -5.221  -6.763  1.985   1.00 0.00 ? 53  PHE A N    4  
ATOM 5304  C CA   . PHE A 1 53  ? -4.842  -7.681  0.917   1.00 0.00 ? 53  PHE A CA   4  
ATOM 5305  C C    . PHE A 1 53  ? -4.003  -8.833  1.462   1.00 0.00 ? 53  PHE A C    4  
ATOM 5306  O O    . PHE A 1 53  ? -4.006  -9.934  0.909   1.00 0.00 ? 53  PHE A O    4  
ATOM 5307  C CB   . PHE A 1 53  ? -4.062  -6.938  -0.170  1.00 0.00 ? 53  PHE A CB   4  
ATOM 5308  C CG   . PHE A 1 53  ? -3.481  -7.844  -1.217  1.00 0.00 ? 53  PHE A CG   4  
ATOM 5309  C CD1  . PHE A 1 53  ? -2.274  -8.489  -1.000  1.00 0.00 ? 53  PHE A CD1  4  
ATOM 5310  C CD2  . PHE A 1 53  ? -4.141  -8.051  -2.417  1.00 0.00 ? 53  PHE A CD2  4  
ATOM 5311  C CE1  . PHE A 1 53  ? -1.736  -9.323  -1.962  1.00 0.00 ? 53  PHE A CE1  4  
ATOM 5312  C CE2  . PHE A 1 53  ? -3.608  -8.884  -3.383  1.00 0.00 ? 53  PHE A CE2  4  
ATOM 5313  C CZ   . PHE A 1 53  ? -2.405  -9.522  -3.154  1.00 0.00 ? 53  PHE A CZ   4  
ATOM 5314  H H    . PHE A 1 53  ? -5.176  -5.797  1.824   1.00 0.00 ? 53  PHE A H    4  
ATOM 5315  H HA   . PHE A 1 53  ? -5.747  -8.081  0.488   1.00 0.00 ? 53  PHE A HA   4  
ATOM 5316  H HB2  . PHE A 1 53  ? -4.723  -6.242  -0.665  1.00 0.00 ? 53  PHE A HB2  4  
ATOM 5317  H HB3  . PHE A 1 53  ? -3.250  -6.393  0.288   1.00 0.00 ? 53  PHE A HB3  4  
ATOM 5318  H HD1  . PHE A 1 53  ? -1.750  -8.336  -0.068  1.00 0.00 ? 53  PHE A HD1  4  
ATOM 5319  H HD2  . PHE A 1 53  ? -5.083  -7.553  -2.597  1.00 0.00 ? 53  PHE A HD2  4  
ATOM 5320  H HE1  . PHE A 1 53  ? -0.795  -9.821  -1.781  1.00 0.00 ? 53  PHE A HE1  4  
ATOM 5321  H HE2  . PHE A 1 53  ? -4.134  -9.037  -4.314  1.00 0.00 ? 53  PHE A HE2  4  
ATOM 5322  H HZ   . PHE A 1 53  ? -1.987  -10.173 -3.908  1.00 0.00 ? 53  PHE A HZ   4  
ATOM 5323  N N    . LYS A 1 54  ? -3.286  -8.573  2.549   1.00 0.00 ? 54  LYS A N    4  
ATOM 5324  C CA   . LYS A 1 54  ? -2.442  -9.586  3.171   1.00 0.00 ? 54  LYS A CA   4  
ATOM 5325  C C    . LYS A 1 54  ? -3.283  -10.740 3.708   1.00 0.00 ? 54  LYS A C    4  
ATOM 5326  O O    . LYS A 1 54  ? -3.155  -11.879 3.257   1.00 0.00 ? 54  LYS A O    4  
ATOM 5327  C CB   . LYS A 1 54  ? -1.620  -8.970  4.305   1.00 0.00 ? 54  LYS A CB   4  
ATOM 5328  C CG   . LYS A 1 54  ? -0.533  -8.024  3.823   1.00 0.00 ? 54  LYS A CG   4  
ATOM 5329  C CD   . LYS A 1 54  ? 0.655   -8.012  4.771   1.00 0.00 ? 54  LYS A CD   4  
ATOM 5330  C CE   . LYS A 1 54  ? 0.367   -7.186  6.015   1.00 0.00 ? 54  LYS A CE   4  
ATOM 5331  N NZ   . LYS A 1 54  ? 1.602   -6.923  6.804   1.00 0.00 ? 54  LYS A NZ   4  
ATOM 5332  H H    . LYS A 1 54  ? -3.325  -7.676  2.944   1.00 0.00 ? 54  LYS A H    4  
ATOM 5333  H HA   . LYS A 1 54  ? -1.770  -9.967  2.417   1.00 0.00 ? 54  LYS A HA   4  
ATOM 5334  H HB2  . LYS A 1 54  ? -2.283  -8.420  4.957   1.00 0.00 ? 54  LYS A HB2  4  
ATOM 5335  H HB3  . LYS A 1 54  ? -1.153  -9.765  4.868   1.00 0.00 ? 54  LYS A HB3  4  
ATOM 5336  H HG2  . LYS A 1 54  ? -0.198  -8.342  2.847   1.00 0.00 ? 54  LYS A HG2  4  
ATOM 5337  H HG3  . LYS A 1 54  ? -0.940  -7.025  3.758   1.00 0.00 ? 54  LYS A HG3  4  
ATOM 5338  H HD2  . LYS A 1 54  ? 0.877   -9.026  5.069   1.00 0.00 ? 54  LYS A HD2  4  
ATOM 5339  H HD3  . LYS A 1 54  ? 1.508   -7.590  4.258   1.00 0.00 ? 54  LYS A HD3  4  
ATOM 5340  H HE2  . LYS A 1 54  ? -0.065  -6.244  5.714   1.00 0.00 ? 54  LYS A HE2  4  
ATOM 5341  H HE3  . LYS A 1 54  ? -0.337  -7.724  6.633   1.00 0.00 ? 54  LYS A HE3  4  
ATOM 5342  H HZ1  . LYS A 1 54  ? 2.031   -7.822  7.106   1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 5343  H HZ2  . LYS A 1 54  ? 1.374   -6.361  7.649   1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 5344  H HZ3  . LYS A 1 54  ? 2.290   -6.399  6.227   1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 5345  N N    . THR A 1 55  ? -4.146  -10.438 4.673   1.00 0.00 ? 55  THR A N    4  
ATOM 5346  C CA   . THR A 1 55  ? -5.009  -11.449 5.271   1.00 0.00 ? 55  THR A CA   4  
ATOM 5347  C C    . THR A 1 55  ? -5.955  -12.047 4.236   1.00 0.00 ? 55  THR A C    4  
ATOM 5348  O O    . THR A 1 55  ? -6.141  -13.261 4.180   1.00 0.00 ? 55  THR A O    4  
ATOM 5349  C CB   . THR A 1 55  ? -5.838  -10.865 6.431   1.00 0.00 ? 55  THR A CB   4  
ATOM 5350  O OG1  . THR A 1 55  ? -6.759  -11.848 6.917   1.00 0.00 ? 55  THR A OG1  4  
ATOM 5351  C CG2  . THR A 1 55  ? -6.600  -9.627  5.982   1.00 0.00 ? 55  THR A CG2  4  
ATOM 5352  H H    . THR A 1 55  ? -4.202  -9.512  4.990   1.00 0.00 ? 55  THR A H    4  
ATOM 5353  H HA   . THR A 1 55  ? -4.380  -12.233 5.666   1.00 0.00 ? 55  THR A HA   4  
ATOM 5354  H HB   . THR A 1 55  ? -5.166  -10.586 7.229   1.00 0.00 ? 55  THR A HB   4  
ATOM 5355  H HG1  . THR A 1 55  ? -6.276  -12.629 7.197   1.00 0.00 ? 55  THR A HG1  4  
ATOM 5356  H HG21 . THR A 1 55  ? -7.306  -9.898  5.211   1.00 0.00 ? 55  THR A HG21 4  
ATOM 5357  H HG22 . THR A 1 55  ? -5.904  -8.898  5.593   1.00 0.00 ? 55  THR A HG22 4  
ATOM 5358  H HG23 . THR A 1 55  ? -7.130  -9.207  6.823   1.00 0.00 ? 55  THR A HG23 4  
ATOM 5359  N N    . ASN A 1 56  ? -6.549  -11.185 3.417   1.00 0.00 ? 56  ASN A N    4  
ATOM 5360  C CA   . ASN A 1 56  ? -7.476  -11.629 2.382   1.00 0.00 ? 56  ASN A CA   4  
ATOM 5361  C C    . ASN A 1 56  ? -6.973  -11.237 0.996   1.00 0.00 ? 56  ASN A C    4  
ATOM 5362  O O    . ASN A 1 56  ? -7.396  -10.237 0.415   1.00 0.00 ? 56  ASN A O    4  
ATOM 5363  C CB   . ASN A 1 56  ? -8.864  -11.032 2.621   1.00 0.00 ? 56  ASN A CB   4  
ATOM 5364  C CG   . ASN A 1 56  ? -8.908  -9.541  2.346   1.00 0.00 ? 56  ASN A CG   4  
ATOM 5365  O OD1  . ASN A 1 56  ? -7.947  -8.821  2.615   1.00 0.00 ? 56  ASN A OD1  4  
ATOM 5366  N ND2  . ASN A 1 56  ? -10.027 -9.072  1.806   1.00 0.00 ? 56  ASN A ND2  4  
ATOM 5367  H H    . ASN A 1 56  ? -6.361  -10.228 3.510   1.00 0.00 ? 56  ASN A H    4  
ATOM 5368  H HA   . ASN A 1 56  ? -7.543  -12.705 2.437   1.00 0.00 ? 56  ASN A HA   4  
ATOM 5369  H HB2  . ASN A 1 56  ? -9.576  -11.519 1.971   1.00 0.00 ? 56  ASN A HB2  4  
ATOM 5370  H HB3  . ASN A 1 56  ? -9.149  -11.198 3.649   1.00 0.00 ? 56  ASN A HB3  4  
ATOM 5371  H HD21 . ASN A 1 56  ? -10.751 -9.705  1.618   1.00 0.00 ? 56  ASN A HD21 4  
ATOM 5372  H HD22 . ASN A 1 56  ? -10.081 -8.112  1.616   1.00 0.00 ? 56  ASN A HD22 4  
ATOM 5373  N N    . PRO A 1 57  ? -6.049  -12.042 0.452   1.00 0.00 ? 57  PRO A N    4  
ATOM 5374  C CA   . PRO A 1 57  ? -5.469  -11.801 -0.872  1.00 0.00 ? 57  PRO A CA   4  
ATOM 5375  C C    . PRO A 1 57  ? -6.474  -12.032 -1.996  1.00 0.00 ? 57  PRO A C    4  
ATOM 5376  O O    . PRO A 1 57  ? -6.267  -11.591 -3.127  1.00 0.00 ? 57  PRO A O    4  
ATOM 5377  C CB   . PRO A 1 57  ? -4.332  -12.822 -0.953  1.00 0.00 ? 57  PRO A CB   4  
ATOM 5378  C CG   . PRO A 1 57  ? -4.737  -13.915 -0.025  1.00 0.00 ? 57  PRO A CG   4  
ATOM 5379  C CD   . PRO A 1 57  ? -5.499  -13.251 1.088   1.00 0.00 ? 57  PRO A CD   4  
ATOM 5380  H HA   . PRO A 1 57  ? -5.065  -10.802 -0.952  1.00 0.00 ? 57  PRO A HA   4  
ATOM 5381  H HB2  . PRO A 1 57  ? -4.237  -13.179 -1.969  1.00 0.00 ? 57  PRO A HB2  4  
ATOM 5382  H HB3  . PRO A 1 57  ? -3.407  -12.361 -0.640  1.00 0.00 ? 57  PRO A HB3  4  
ATOM 5383  H HG2  . PRO A 1 57  ? -5.368  -14.621 -0.543  1.00 0.00 ? 57  PRO A HG2  4  
ATOM 5384  H HG3  . PRO A 1 57  ? -3.860  -14.409 0.364   1.00 0.00 ? 57  PRO A HG3  4  
ATOM 5385  H HD2  . PRO A 1 57  ? -6.291  -13.896 1.440   1.00 0.00 ? 57  PRO A HD2  4  
ATOM 5386  H HD3  . PRO A 1 57  ? -4.834  -12.992 1.898   1.00 0.00 ? 57  PRO A HD3  4  
ATOM 5387  N N    . CYS A 1 58  ? -7.561  -12.726 -1.677  1.00 0.00 ? 58  CYS A N    4  
ATOM 5388  C CA   . CYS A 1 58  ? -8.598  -13.016 -2.661  1.00 0.00 ? 58  CYS A CA   4  
ATOM 5389  C C    . CYS A 1 58  ? -9.963  -12.547 -2.167  1.00 0.00 ? 58  CYS A C    4  
ATOM 5390  O O    . CYS A 1 58  ? -10.979 -13.197 -2.408  1.00 0.00 ? 58  CYS A O    4  
ATOM 5391  C CB   . CYS A 1 58  ? -8.639  -14.515 -2.963  1.00 0.00 ? 58  CYS A CB   4  
ATOM 5392  S SG   . CYS A 1 58  ? -7.236  -15.110 -3.936  1.00 0.00 ? 58  CYS A SG   4  
ATOM 5393  H H    . CYS A 1 58  ? -7.670  -13.051 -0.759  1.00 0.00 ? 58  CYS A H    4  
ATOM 5394  H HA   . CYS A 1 58  ? -8.354  -12.481 -3.566  1.00 0.00 ? 58  CYS A HA   4  
ATOM 5395  H HB2  . CYS A 1 58  ? -8.647  -15.062 -2.031  1.00 0.00 ? 58  CYS A HB2  4  
ATOM 5396  H HB3  . CYS A 1 58  ? -9.541  -14.739 -3.512  1.00 0.00 ? 58  CYS A HB3  4  
ATOM 5397  H HG   . CYS A 1 58  ? -6.975  -14.208 -4.870  1.00 0.00 ? 58  CYS A HG   4  
ATOM 5398  N N    . GLY A 1 59  ? -9.977  -11.413 -1.471  1.00 0.00 ? 59  GLY A N    4  
ATOM 5399  C CA   . GLY A 1 59  ? -11.222 -10.878 -0.952  1.00 0.00 ? 59  GLY A CA   4  
ATOM 5400  C C    . GLY A 1 59  ? -11.505 -9.476  -1.456  1.00 0.00 ? 59  GLY A C    4  
ATOM 5401  O O    . GLY A 1 59  ? -11.259 -9.167  -2.622  1.00 0.00 ? 59  GLY A O    4  
ATOM 5402  H H    . GLY A 1 59  ? -9.136  -10.937 -1.310  1.00 0.00 ? 59  GLY A H    4  
ATOM 5403  H HA2  . GLY A 1 59  ? -12.033 -11.526 -1.250  1.00 0.00 ? 59  GLY A HA2  4  
ATOM 5404  H HA3  . GLY A 1 59  ? -11.169 -10.856 0.126   1.00 0.00 ? 59  GLY A HA3  4  
ATOM 5405  N N    . SER A 1 60  ? -12.024 -8.626  -0.575  1.00 0.00 ? 60  SER A N    4  
ATOM 5406  C CA   . SER A 1 60  ? -12.345 -7.251  -0.939  1.00 0.00 ? 60  SER A CA   4  
ATOM 5407  C C    . SER A 1 60  ? -12.504 -6.383  0.306   1.00 0.00 ? 60  SER A C    4  
ATOM 5408  O O    . SER A 1 60  ? -13.055 -6.822  1.316   1.00 0.00 ? 60  SER A O    4  
ATOM 5409  C CB   . SER A 1 60  ? -13.628 -7.208  -1.771  1.00 0.00 ? 60  SER A CB   4  
ATOM 5410  O OG   . SER A 1 60  ? -14.605 -8.091  -1.248  1.00 0.00 ? 60  SER A OG   4  
ATOM 5411  H H    . SER A 1 60  ? -12.197 -8.932  0.340   1.00 0.00 ? 60  SER A H    4  
ATOM 5412  H HA   . SER A 1 60  ? -11.529 -6.865  -1.531  1.00 0.00 ? 60  SER A HA   4  
ATOM 5413  H HB2  . SER A 1 60  ? -14.026 -6.204  -1.762  1.00 0.00 ? 60  SER A HB2  4  
ATOM 5414  H HB3  . SER A 1 60  ? -13.405 -7.498  -2.787  1.00 0.00 ? 60  SER A HB3  4  
ATOM 5415  H HG   . SER A 1 60  ? -14.504 -8.956  -1.652  1.00 0.00 ? 60  SER A HG   4  
ATOM 5416  N N    . ILE A 1 61  ? -12.016 -5.150  0.226   1.00 0.00 ? 61  ILE A N    4  
ATOM 5417  C CA   . ILE A 1 61  ? -12.104 -4.220  1.345   1.00 0.00 ? 61  ILE A CA   4  
ATOM 5418  C C    . ILE A 1 61  ? -13.215 -3.199  1.125   1.00 0.00 ? 61  ILE A C    4  
ATOM 5419  O O    . ILE A 1 61  ? -13.054 -2.246  0.363   1.00 0.00 ? 61  ILE A O    4  
ATOM 5420  C CB   . ILE A 1 61  ? -10.773 -3.475  1.563   1.00 0.00 ? 61  ILE A CB   4  
ATOM 5421  C CG1  . ILE A 1 61  ? -10.913 -2.459  2.699   1.00 0.00 ? 61  ILE A CG1  4  
ATOM 5422  C CG2  . ILE A 1 61  ? -10.335 -2.786  0.280   1.00 0.00 ? 61  ILE A CG2  4  
ATOM 5423  C CD1  . ILE A 1 61  ? -9.620  -1.752  3.040   1.00 0.00 ? 61  ILE A CD1  4  
ATOM 5424  H H    . ILE A 1 61  ? -11.587 -4.859  -0.606  1.00 0.00 ? 61  ILE A H    4  
ATOM 5425  H HA   . ILE A 1 61  ? -12.325 -4.790  2.235   1.00 0.00 ? 61  ILE A HA   4  
ATOM 5426  H HB   . ILE A 1 61  ? -10.020 -4.201  1.830   1.00 0.00 ? 61  ILE A HB   4  
ATOM 5427  H HG12 . ILE A 1 61  ? -11.635 -1.710  2.416   1.00 0.00 ? 61  ILE A HG12 4  
ATOM 5428  H HG13 . ILE A 1 61  ? -11.258 -2.968  3.587   1.00 0.00 ? 61  ILE A HG13 4  
ATOM 5429  H HG21 . ILE A 1 61  ? -9.339  -3.113  0.018   1.00 0.00 ? 61  ILE A HG21 4  
ATOM 5430  H HG22 . ILE A 1 61  ? -11.017 -3.042  -0.517  1.00 0.00 ? 61  ILE A HG22 4  
ATOM 5431  H HG23 . ILE A 1 61  ? -10.336 -1.717  0.426   1.00 0.00 ? 61  ILE A HG23 4  
ATOM 5432  H HD11 . ILE A 1 61  ? -9.822  -0.939  3.722   1.00 0.00 ? 61  ILE A HD11 4  
ATOM 5433  H HD12 . ILE A 1 61  ? -8.939  -2.450  3.503   1.00 0.00 ? 61  ILE A HD12 4  
ATOM 5434  H HD13 . ILE A 1 61  ? -9.175  -1.361  2.136   1.00 0.00 ? 61  ILE A HD13 4  
ATOM 5435  N N    . SER A 1 62  ? -14.341 -3.404  1.799   1.00 0.00 ? 62  SER A N    4  
ATOM 5436  C CA   . SER A 1 62  ? -15.481 -2.502  1.676   1.00 0.00 ? 62  SER A CA   4  
ATOM 5437  C C    . SER A 1 62  ? -15.364 -1.342  2.660   1.00 0.00 ? 62  SER A C    4  
ATOM 5438  O O    . SER A 1 62  ? -15.247 -1.547  3.868   1.00 0.00 ? 62  SER A O    4  
ATOM 5439  C CB   . SER A 1 62  ? -16.787 -3.261  1.918   1.00 0.00 ? 62  SER A CB   4  
ATOM 5440  O OG   . SER A 1 62  ? -16.905 -3.655  3.274   1.00 0.00 ? 62  SER A OG   4  
ATOM 5441  H H    . SER A 1 62  ? -14.409 -4.182  2.391   1.00 0.00 ? 62  SER A H    4  
ATOM 5442  H HA   . SER A 1 62  ? -15.484 -2.108  0.671   1.00 0.00 ? 62  SER A HA   4  
ATOM 5443  H HB2  . SER A 1 62  ? -17.622 -2.625  1.666   1.00 0.00 ? 62  SER A HB2  4  
ATOM 5444  H HB3  . SER A 1 62  ? -16.807 -4.144  1.295   1.00 0.00 ? 62  SER A HB3  4  
ATOM 5445  H HG   . SER A 1 62  ? -16.229 -4.306  3.478   1.00 0.00 ? 62  SER A HG   4  
ATOM 5446  N N    . PHE A 1 63  ? -15.396 -0.123  2.133   1.00 0.00 ? 63  PHE A N    4  
ATOM 5447  C CA   . PHE A 1 63  ? -15.293 1.072   2.964   1.00 0.00 ? 63  PHE A CA   4  
ATOM 5448  C C    . PHE A 1 63  ? -16.113 2.216   2.375   1.00 0.00 ? 63  PHE A C    4  
ATOM 5449  O O    . PHE A 1 63  ? -16.113 2.438   1.164   1.00 0.00 ? 63  PHE A O    4  
ATOM 5450  C CB   . PHE A 1 63  ? -13.830 1.497   3.103   1.00 0.00 ? 63  PHE A CB   4  
ATOM 5451  C CG   . PHE A 1 63  ? -13.291 2.197   1.889   1.00 0.00 ? 63  PHE A CG   4  
ATOM 5452  C CD1  . PHE A 1 63  ? -13.522 3.550   1.693   1.00 0.00 ? 63  PHE A CD1  4  
ATOM 5453  C CD2  . PHE A 1 63  ? -12.553 1.504   0.943   1.00 0.00 ? 63  PHE A CD2  4  
ATOM 5454  C CE1  . PHE A 1 63  ? -13.028 4.196   0.576   1.00 0.00 ? 63  PHE A CE1  4  
ATOM 5455  C CE2  . PHE A 1 63  ? -12.056 2.145   -0.176  1.00 0.00 ? 63  PHE A CE2  4  
ATOM 5456  C CZ   . PHE A 1 63  ? -12.293 3.494   -0.359  1.00 0.00 ? 63  PHE A CZ   4  
ATOM 5457  H H    . PHE A 1 63  ? -15.491 -0.023  1.163   1.00 0.00 ? 63  PHE A H    4  
ATOM 5458  H HA   . PHE A 1 63  ? -15.684 0.830   3.940   1.00 0.00 ? 63  PHE A HA   4  
ATOM 5459  H HB2  . PHE A 1 63  ? -13.737 2.170   3.942   1.00 0.00 ? 63  PHE A HB2  4  
ATOM 5460  H HB3  . PHE A 1 63  ? -13.224 0.622   3.279   1.00 0.00 ? 63  PHE A HB3  4  
ATOM 5461  H HD1  . PHE A 1 63  ? -14.096 4.101   2.423   1.00 0.00 ? 63  PHE A HD1  4  
ATOM 5462  H HD2  . PHE A 1 63  ? -12.367 0.449   1.086   1.00 0.00 ? 63  PHE A HD2  4  
ATOM 5463  H HE1  . PHE A 1 63  ? -13.215 5.250   0.435   1.00 0.00 ? 63  PHE A HE1  4  
ATOM 5464  H HE2  . PHE A 1 63  ? -11.482 1.593   -0.905  1.00 0.00 ? 63  PHE A HE2  4  
ATOM 5465  H HZ   . PHE A 1 63  ? -11.907 3.996   -1.233  1.00 0.00 ? 63  PHE A HZ   4  
ATOM 5466  N N    . THR A 1 64  ? -16.814 2.941   3.242   1.00 0.00 ? 64  THR A N    4  
ATOM 5467  C CA   . THR A 1 64  ? -17.640 4.061   2.810   1.00 0.00 ? 64  THR A CA   4  
ATOM 5468  C C    . THR A 1 64  ? -17.151 5.371   3.415   1.00 0.00 ? 64  THR A C    4  
ATOM 5469  O O    . THR A 1 64  ? -17.134 5.536   4.635   1.00 0.00 ? 64  THR A O    4  
ATOM 5470  C CB   . THR A 1 64  ? -19.117 3.851   3.194   1.00 0.00 ? 64  THR A CB   4  
ATOM 5471  O OG1  . THR A 1 64  ? -19.226 3.596   4.599   1.00 0.00 ? 64  THR A OG1  4  
ATOM 5472  C CG2  . THR A 1 64  ? -19.720 2.692   2.415   1.00 0.00 ? 64  THR A CG2  4  
ATOM 5473  H H    . THR A 1 64  ? -16.774 2.715   4.195   1.00 0.00 ? 64  THR A H    4  
ATOM 5474  H HA   . THR A 1 64  ? -17.576 4.127   1.733   1.00 0.00 ? 64  THR A HA   4  
ATOM 5475  H HB   . THR A 1 64  ? -19.667 4.750   2.956   1.00 0.00 ? 64  THR A HB   4  
ATOM 5476  H HG1  . THR A 1 64  ? -18.374 3.741   5.018   1.00 0.00 ? 64  THR A HG1  4  
ATOM 5477  H HG21 . THR A 1 64  ? -18.973 2.274   1.757   1.00 0.00 ? 64  THR A HG21 4  
ATOM 5478  H HG22 . THR A 1 64  ? -20.557 3.047   1.832   1.00 0.00 ? 64  THR A HG22 4  
ATOM 5479  H HG23 . THR A 1 64  ? -20.057 1.932   3.105   1.00 0.00 ? 64  THR A HG23 4  
ATOM 5480  N N    . THR A 1 65  ? -16.752 6.303   2.554   1.00 0.00 ? 65  THR A N    4  
ATOM 5481  C CA   . THR A 1 65  ? -16.262 7.600   3.004   1.00 0.00 ? 65  THR A CA   4  
ATOM 5482  C C    . THR A 1 65  ? -17.410 8.579   3.216   1.00 0.00 ? 65  THR A C    4  
ATOM 5483  O O    . THR A 1 65  ? -18.580 8.213   3.103   1.00 0.00 ? 65  THR A O    4  
ATOM 5484  C CB   . THR A 1 65  ? -15.266 8.204   1.997   1.00 0.00 ? 65  THR A CB   4  
ATOM 5485  O OG1  . THR A 1 65  ? -15.857 8.252   0.693   1.00 0.00 ? 65  THR A OG1  4  
ATOM 5486  C CG2  . THR A 1 65  ? -13.983 7.388   1.948   1.00 0.00 ? 65  THR A CG2  4  
ATOM 5487  H H    . THR A 1 65  ? -16.790 6.112   1.594   1.00 0.00 ? 65  THR A H    4  
ATOM 5488  H HA   . THR A 1 65  ? -15.748 7.454   3.943   1.00 0.00 ? 65  THR A HA   4  
ATOM 5489  H HB   . THR A 1 65  ? -15.024 9.209   2.312   1.00 0.00 ? 65  THR A HB   4  
ATOM 5490  H HG1  . THR A 1 65  ? -15.165 8.317   0.030   1.00 0.00 ? 65  THR A HG1  4  
ATOM 5491  H HG21 . THR A 1 65  ? -13.288 7.765   2.683   1.00 0.00 ? 65  THR A HG21 4  
ATOM 5492  H HG22 . THR A 1 65  ? -13.544 7.466   0.964   1.00 0.00 ? 65  THR A HG22 4  
ATOM 5493  H HG23 . THR A 1 65  ? -14.206 6.354   2.162   1.00 0.00 ? 65  THR A HG23 4  
ATOM 5494  N N    . SER A 1 66  ? -17.069 9.826   3.524   1.00 0.00 ? 66  SER A N    4  
ATOM 5495  C CA   . SER A 1 66  ? -18.073 10.858  3.755   1.00 0.00 ? 66  SER A CA   4  
ATOM 5496  C C    . SER A 1 66  ? -19.160 10.809  2.685   1.00 0.00 ? 66  SER A C    4  
ATOM 5497  O O    . SER A 1 66  ? -18.893 11.023  1.502   1.00 0.00 ? 66  SER A O    4  
ATOM 5498  C CB   . SER A 1 66  ? -17.419 12.241  3.770   1.00 0.00 ? 66  SER A CB   4  
ATOM 5499  O OG   . SER A 1 66  ? -18.200 13.167  4.507   1.00 0.00 ? 66  SER A OG   4  
ATOM 5500  H H    . SER A 1 66  ? -16.120 10.057  3.600   1.00 0.00 ? 66  SER A H    4  
ATOM 5501  H HA   . SER A 1 66  ? -18.524 10.672  4.718   1.00 0.00 ? 66  SER A HA   4  
ATOM 5502  H HB2  . SER A 1 66  ? -16.443 12.170  4.224   1.00 0.00 ? 66  SER A HB2  4  
ATOM 5503  H HB3  . SER A 1 66  ? -17.319 12.600  2.756   1.00 0.00 ? 66  SER A HB3  4  
ATOM 5504  H HG   . SER A 1 66  ? -18.050 13.036  5.446   1.00 0.00 ? 66  SER A HG   4  
ATOM 5505  N N    . LYS A 1 67  ? -20.386 10.524  3.109   1.00 0.00 ? 67  LYS A N    4  
ATOM 5506  C CA   . LYS A 1 67  ? -21.515 10.447  2.190   1.00 0.00 ? 67  LYS A CA   4  
ATOM 5507  C C    . LYS A 1 67  ? -21.098 9.810   0.868   1.00 0.00 ? 67  LYS A C    4  
ATOM 5508  O O    . LYS A 1 67  ? -21.671 10.103  -0.182  1.00 0.00 ? 67  LYS A O    4  
ATOM 5509  C CB   . LYS A 1 67  ? -22.090 11.842  1.937   1.00 0.00 ? 67  LYS A CB   4  
ATOM 5510  C CG   . LYS A 1 67  ? -21.034 12.887  1.621   1.00 0.00 ? 67  LYS A CG   4  
ATOM 5511  C CD   . LYS A 1 67  ? -21.660 14.185  1.139   1.00 0.00 ? 67  LYS A CD   4  
ATOM 5512  C CE   . LYS A 1 67  ? -21.920 15.141  2.293   1.00 0.00 ? 67  LYS A CE   4  
ATOM 5513  N NZ   . LYS A 1 67  ? -22.339 16.488  1.814   1.00 0.00 ? 67  LYS A NZ   4  
ATOM 5514  H H    . LYS A 1 67  ? -20.536 10.363  4.065   1.00 0.00 ? 67  LYS A H    4  
ATOM 5515  H HA   . LYS A 1 67  ? -22.275 9.832   2.648   1.00 0.00 ? 67  LYS A HA   4  
ATOM 5516  H HB2  . LYS A 1 67  ? -22.776 11.791  1.104   1.00 0.00 ? 67  LYS A HB2  4  
ATOM 5517  H HB3  . LYS A 1 67  ? -22.630 12.161  2.817   1.00 0.00 ? 67  LYS A HB3  4  
ATOM 5518  H HG2  . LYS A 1 67  ? -20.460 13.087  2.514   1.00 0.00 ? 67  LYS A HG2  4  
ATOM 5519  H HG3  . LYS A 1 67  ? -20.381 12.504  0.850   1.00 0.00 ? 67  LYS A HG3  4  
ATOM 5520  H HD2  . LYS A 1 67  ? -20.990 14.659  0.437   1.00 0.00 ? 67  LYS A HD2  4  
ATOM 5521  H HD3  . LYS A 1 67  ? -22.598 13.962  0.649   1.00 0.00 ? 67  LYS A HD3  4  
ATOM 5522  H HE2  . LYS A 1 67  ? -22.701 14.731  2.915   1.00 0.00 ? 67  LYS A HE2  4  
ATOM 5523  H HE3  . LYS A 1 67  ? -21.014 15.240  2.872   1.00 0.00 ? 67  LYS A HE3  4  
ATOM 5524  H HZ1  . LYS A 1 67  ? -21.562 16.938  1.290   1.00 0.00 ? 67  LYS A HZ1  4  
ATOM 5525  H HZ2  . LYS A 1 67  ? -22.593 17.091  2.622   1.00 0.00 ? 67  LYS A HZ2  4  
ATOM 5526  H HZ3  . LYS A 1 67  ? -23.164 16.403  1.186   1.00 0.00 ? 67  LYS A HZ3  4  
ATOM 5527  N N    . PHE A 1 68  ? -20.098 8.937   0.927   1.00 0.00 ? 68  PHE A N    4  
ATOM 5528  C CA   . PHE A 1 68  ? -19.605 8.259   -0.266  1.00 0.00 ? 68  PHE A CA   4  
ATOM 5529  C C    . PHE A 1 68  ? -19.367 6.777   0.010   1.00 0.00 ? 68  PHE A C    4  
ATOM 5530  O O    . PHE A 1 68  ? -19.315 6.350   1.164   1.00 0.00 ? 68  PHE A O    4  
ATOM 5531  C CB   . PHE A 1 68  ? -18.309 8.912   -0.752  1.00 0.00 ? 68  PHE A CB   4  
ATOM 5532  C CG   . PHE A 1 68  ? -18.529 9.991   -1.774  1.00 0.00 ? 68  PHE A CG   4  
ATOM 5533  C CD1  . PHE A 1 68  ? -19.317 11.092  -1.480  1.00 0.00 ? 68  PHE A CD1  4  
ATOM 5534  C CD2  . PHE A 1 68  ? -17.947 9.903   -3.028  1.00 0.00 ? 68  PHE A CD2  4  
ATOM 5535  C CE1  . PHE A 1 68  ? -19.521 12.086  -2.418  1.00 0.00 ? 68  PHE A CE1  4  
ATOM 5536  C CE2  . PHE A 1 68  ? -18.147 10.895  -3.970  1.00 0.00 ? 68  PHE A CE2  4  
ATOM 5537  C CZ   . PHE A 1 68  ? -18.935 11.987  -3.666  1.00 0.00 ? 68  PHE A CZ   4  
ATOM 5538  H H    . PHE A 1 68  ? -19.681 8.745   1.793   1.00 0.00 ? 68  PHE A H    4  
ATOM 5539  H HA   . PHE A 1 68  ? -20.356 8.353   -1.035  1.00 0.00 ? 68  PHE A HA   4  
ATOM 5540  H HB2  . PHE A 1 68  ? -17.799 9.354   0.091   1.00 0.00 ? 68  PHE A HB2  4  
ATOM 5541  H HB3  . PHE A 1 68  ? -17.678 8.157   -1.195  1.00 0.00 ? 68  PHE A HB3  4  
ATOM 5542  H HD1  . PHE A 1 68  ? -19.776 11.170  -0.504  1.00 0.00 ? 68  PHE A HD1  4  
ATOM 5543  H HD2  . PHE A 1 68  ? -17.331 9.049   -3.269  1.00 0.00 ? 68  PHE A HD2  4  
ATOM 5544  H HE1  . PHE A 1 68  ? -20.138 12.939  -2.176  1.00 0.00 ? 68  PHE A HE1  4  
ATOM 5545  H HE2  . PHE A 1 68  ? -17.689 10.815  -4.945  1.00 0.00 ? 68  PHE A HE2  4  
ATOM 5546  H HZ   . PHE A 1 68  ? -19.093 12.763  -4.400  1.00 0.00 ? 68  PHE A HZ   4  
ATOM 5547  N N    . SER A 1 69  ? -19.225 5.997   -1.057  1.00 0.00 ? 69  SER A N    4  
ATOM 5548  C CA   . SER A 1 69  ? -18.998 4.562   -0.931  1.00 0.00 ? 69  SER A CA   4  
ATOM 5549  C C    . SER A 1 69  ? -17.908 4.098   -1.893  1.00 0.00 ? 69  SER A C    4  
ATOM 5550  O O    . SER A 1 69  ? -17.785 4.614   -3.004  1.00 0.00 ? 69  SER A O    4  
ATOM 5551  C CB   . SER A 1 69  ? -20.293 3.794   -1.200  1.00 0.00 ? 69  SER A CB   4  
ATOM 5552  O OG   . SER A 1 69  ? -21.208 3.947   -0.129  1.00 0.00 ? 69  SER A OG   4  
ATOM 5553  H H    . SER A 1 69  ? -19.277 6.397   -1.951  1.00 0.00 ? 69  SER A H    4  
ATOM 5554  H HA   . SER A 1 69  ? -18.676 4.366   0.081   1.00 0.00 ? 69  SER A HA   4  
ATOM 5555  H HB2  . SER A 1 69  ? -20.749 4.168   -2.104  1.00 0.00 ? 69  SER A HB2  4  
ATOM 5556  H HB3  . SER A 1 69  ? -20.067 2.744   -1.318  1.00 0.00 ? 69  SER A HB3  4  
ATOM 5557  H HG   . SER A 1 69  ? -22.027 3.493   -0.340  1.00 0.00 ? 69  SER A HG   4  
ATOM 5558  N N    . TYR A 1 70  ? -17.121 3.121   -1.458  1.00 0.00 ? 70  TYR A N    4  
ATOM 5559  C CA   . TYR A 1 70  ? -16.040 2.588   -2.278  1.00 0.00 ? 70  TYR A CA   4  
ATOM 5560  C C    . TYR A 1 70  ? -15.716 1.150   -1.885  1.00 0.00 ? 70  TYR A C    4  
ATOM 5561  O O    . TYR A 1 70  ? -15.587 0.831   -0.703  1.00 0.00 ? 70  TYR A O    4  
ATOM 5562  C CB   . TYR A 1 70  ? -14.790 3.460   -2.142  1.00 0.00 ? 70  TYR A CB   4  
ATOM 5563  C CG   . TYR A 1 70  ? -14.939 4.831   -2.762  1.00 0.00 ? 70  TYR A CG   4  
ATOM 5564  C CD1  . TYR A 1 70  ? -14.773 5.020   -4.128  1.00 0.00 ? 70  TYR A CD1  4  
ATOM 5565  C CD2  . TYR A 1 70  ? -15.246 5.938   -1.980  1.00 0.00 ? 70  TYR A CD2  4  
ATOM 5566  C CE1  . TYR A 1 70  ? -14.906 6.271   -4.698  1.00 0.00 ? 70  TYR A CE1  4  
ATOM 5567  C CE2  . TYR A 1 70  ? -15.383 7.193   -2.542  1.00 0.00 ? 70  TYR A CE2  4  
ATOM 5568  C CZ   . TYR A 1 70  ? -15.211 7.355   -3.901  1.00 0.00 ? 70  TYR A CZ   4  
ATOM 5569  O OH   . TYR A 1 70  ? -15.347 8.602   -4.465  1.00 0.00 ? 70  TYR A OH   4  
ATOM 5570  H H    . TYR A 1 70  ? -17.269 2.750   -0.563  1.00 0.00 ? 70  TYR A H    4  
ATOM 5571  H HA   . TYR A 1 70  ? -16.367 2.603   -3.308  1.00 0.00 ? 70  TYR A HA   4  
ATOM 5572  H HB2  . TYR A 1 70  ? -14.564 3.592   -1.096  1.00 0.00 ? 70  TYR A HB2  4  
ATOM 5573  H HB3  . TYR A 1 70  ? -13.960 2.965   -2.625  1.00 0.00 ? 70  TYR A HB3  4  
ATOM 5574  H HD1  . TYR A 1 70  ? -14.534 4.169   -4.750  1.00 0.00 ? 70  TYR A HD1  4  
ATOM 5575  H HD2  . TYR A 1 70  ? -15.379 5.809   -0.916  1.00 0.00 ? 70  TYR A HD2  4  
ATOM 5576  H HE1  . TYR A 1 70  ? -14.773 6.398   -5.762  1.00 0.00 ? 70  TYR A HE1  4  
ATOM 5577  H HE2  . TYR A 1 70  ? -15.622 8.042   -1.918  1.00 0.00 ? 70  TYR A HE2  4  
ATOM 5578  H HH   . TYR A 1 70  ? -15.150 8.552   -5.403  1.00 0.00 ? 70  TYR A HH   4  
ATOM 5579  N N    . LYS A 1 71  ? -15.584 0.285   -2.885  1.00 0.00 ? 71  LYS A N    4  
ATOM 5580  C CA   . LYS A 1 71  ? -15.273 -1.119  -2.647  1.00 0.00 ? 71  LYS A CA   4  
ATOM 5581  C C    . LYS A 1 71  ? -14.072 -1.559  -3.480  1.00 0.00 ? 71  LYS A C    4  
ATOM 5582  O O    . LYS A 1 71  ? -14.167 -1.690  -4.700  1.00 0.00 ? 71  LYS A O    4  
ATOM 5583  C CB   . LYS A 1 71  ? -16.484 -1.994  -2.978  1.00 0.00 ? 71  LYS A CB   4  
ATOM 5584  C CG   . LYS A 1 71  ? -16.191 -3.484  -2.922  1.00 0.00 ? 71  LYS A CG   4  
ATOM 5585  C CD   . LYS A 1 71  ? -17.411 -4.306  -3.304  1.00 0.00 ? 71  LYS A CD   4  
ATOM 5586  C CE   . LYS A 1 71  ? -17.421 -5.651  -2.594  1.00 0.00 ? 71  LYS A CE   4  
ATOM 5587  N NZ   . LYS A 1 71  ? -17.445 -5.495  -1.113  1.00 0.00 ? 71  LYS A NZ   4  
ATOM 5588  H H    . LYS A 1 71  ? -15.698 0.600   -3.807  1.00 0.00 ? 71  LYS A H    4  
ATOM 5589  H HA   . LYS A 1 71  ? -15.031 -1.233  -1.601  1.00 0.00 ? 71  LYS A HA   4  
ATOM 5590  H HB2  . LYS A 1 71  ? -17.273 -1.777  -2.273  1.00 0.00 ? 71  LYS A HB2  4  
ATOM 5591  H HB3  . LYS A 1 71  ? -16.826 -1.753  -3.974  1.00 0.00 ? 71  LYS A HB3  4  
ATOM 5592  H HG2  . LYS A 1 71  ? -15.389 -3.710  -3.608  1.00 0.00 ? 71  LYS A HG2  4  
ATOM 5593  H HG3  . LYS A 1 71  ? -15.893 -3.745  -1.917  1.00 0.00 ? 71  LYS A HG3  4  
ATOM 5594  H HD2  . LYS A 1 71  ? -18.302 -3.761  -3.032  1.00 0.00 ? 71  LYS A HD2  4  
ATOM 5595  H HD3  . LYS A 1 71  ? -17.401 -4.473  -4.372  1.00 0.00 ? 71  LYS A HD3  4  
ATOM 5596  H HE2  . LYS A 1 71  ? -18.297 -6.200  -2.903  1.00 0.00 ? 71  LYS A HE2  4  
ATOM 5597  H HE3  . LYS A 1 71  ? -16.534 -6.199  -2.875  1.00 0.00 ? 71  LYS A HE3  4  
ATOM 5598  H HZ1  . LYS A 1 71  ? -18.372 -5.784  -0.739  1.00 0.00 ? 71  LYS A HZ1  4  
ATOM 5599  H HZ2  . LYS A 1 71  ? -17.274 -4.503  -0.855  1.00 0.00 ? 71  LYS A HZ2  4  
ATOM 5600  H HZ3  . LYS A 1 71  ? -16.708 -6.087  -0.679  1.00 0.00 ? 71  LYS A HZ3  4  
ATOM 5601  N N    . ILE A 1 72  ? -12.947 -1.786  -2.812  1.00 0.00 ? 72  ILE A N    4  
ATOM 5602  C CA   . ILE A 1 72  ? -11.729 -2.214  -3.490  1.00 0.00 ? 72  ILE A CA   4  
ATOM 5603  C C    . ILE A 1 72  ? -11.541 -3.723  -3.382  1.00 0.00 ? 72  ILE A C    4  
ATOM 5604  O O    . ILE A 1 72  ? -11.057 -4.227  -2.369  1.00 0.00 ? 72  ILE A O    4  
ATOM 5605  C CB   . ILE A 1 72  ? -10.487 -1.510  -2.914  1.00 0.00 ? 72  ILE A CB   4  
ATOM 5606  C CG1  . ILE A 1 72  ? -10.516 -0.018  -3.251  1.00 0.00 ? 72  ILE A CG1  4  
ATOM 5607  C CG2  . ILE A 1 72  ? -9.217  -2.155  -3.450  1.00 0.00 ? 72  ILE A CG2  4  
ATOM 5608  C CD1  . ILE A 1 72  ? -9.430  0.779   -2.563  1.00 0.00 ? 72  ILE A CD1  4  
ATOM 5609  H H    . ILE A 1 72  ? -12.934 -1.664  -1.840  1.00 0.00 ? 72  ILE A H    4  
ATOM 5610  H HA   . ILE A 1 72  ? -11.818 -1.947  -4.534  1.00 0.00 ? 72  ILE A HA   4  
ATOM 5611  H HB   . ILE A 1 72  ? -10.498 -1.630  -1.842  1.00 0.00 ? 72  ILE A HB   4  
ATOM 5612  H HG12 . ILE A 1 72  ? -10.394 0.107   -4.316  1.00 0.00 ? 72  ILE A HG12 4  
ATOM 5613  H HG13 . ILE A 1 72  ? -11.470 0.392   -2.952  1.00 0.00 ? 72  ILE A HG13 4  
ATOM 5614  H HG21 . ILE A 1 72  ? -9.455  -2.751  -4.318  1.00 0.00 ? 72  ILE A HG21 4  
ATOM 5615  H HG22 . ILE A 1 72  ? -8.512  -1.385  -3.725  1.00 0.00 ? 72  ILE A HG22 4  
ATOM 5616  H HG23 . ILE A 1 72  ? -8.784  -2.785  -2.688  1.00 0.00 ? 72  ILE A HG23 4  
ATOM 5617  H HD11 . ILE A 1 72  ? -8.470  0.519   -2.985  1.00 0.00 ? 72  ILE A HD11 4  
ATOM 5618  H HD12 . ILE A 1 72  ? -9.613  1.833   -2.703  1.00 0.00 ? 72  ILE A HD12 4  
ATOM 5619  H HD13 . ILE A 1 72  ? -9.432  0.551   -1.507  1.00 0.00 ? 72  ILE A HD13 4  
ATOM 5620  N N    . ASP A 1 73  ? -11.926 -4.439  -4.433  1.00 0.00 ? 73  ASP A N    4  
ATOM 5621  C CA   . ASP A 1 73  ? -11.797 -5.891  -4.458  1.00 0.00 ? 73  ASP A CA   4  
ATOM 5622  C C    . ASP A 1 73  ? -10.399 -6.305  -4.908  1.00 0.00 ? 73  ASP A C    4  
ATOM 5623  O O    . ASP A 1 73  ? -9.911  -5.855  -5.946  1.00 0.00 ? 73  ASP A O    4  
ATOM 5624  C CB   . ASP A 1 73  ? -12.847 -6.502  -5.388  1.00 0.00 ? 73  ASP A CB   4  
ATOM 5625  C CG   . ASP A 1 73  ? -14.258 -6.089  -5.017  1.00 0.00 ? 73  ASP A CG   4  
ATOM 5626  O OD1  . ASP A 1 73  ? -14.668 -4.972  -5.397  1.00 0.00 ? 73  ASP A OD1  4  
ATOM 5627  O OD2  . ASP A 1 73  ? -14.952 -6.882  -4.347  1.00 0.00 ? 73  ASP A OD2  4  
ATOM 5628  H H    . ASP A 1 73  ? -12.305 -3.979  -5.212  1.00 0.00 ? 73  ASP A H    4  
ATOM 5629  H HA   . ASP A 1 73  ? -11.961 -6.256  -3.456  1.00 0.00 ? 73  ASP A HA   4  
ATOM 5630  H HB2  . ASP A 1 73  ? -12.652 -6.181  -6.401  1.00 0.00 ? 73  ASP A HB2  4  
ATOM 5631  H HB3  . ASP A 1 73  ? -12.781 -7.578  -5.336  1.00 0.00 ? 73  ASP A HB3  4  
ATOM 5632  N N    . PHE A 1 74  ? -9.759  -7.163  -4.121  1.00 0.00 ? 74  PHE A N    4  
ATOM 5633  C CA   . PHE A 1 74  ? -8.417  -7.636  -4.437  1.00 0.00 ? 74  PHE A CA   4  
ATOM 5634  C C    . PHE A 1 74  ? -8.469  -8.818  -5.401  1.00 0.00 ? 74  PHE A C    4  
ATOM 5635  O O    . PHE A 1 74  ? -7.732  -8.863  -6.385  1.00 0.00 ? 74  PHE A O    4  
ATOM 5636  C CB   . PHE A 1 74  ? -7.680  -8.038  -3.158  1.00 0.00 ? 74  PHE A CB   4  
ATOM 5637  C CG   . PHE A 1 74  ? -7.495  -6.904  -2.191  1.00 0.00 ? 74  PHE A CG   4  
ATOM 5638  C CD1  . PHE A 1 74  ? -7.138  -5.644  -2.641  1.00 0.00 ? 74  PHE A CD1  4  
ATOM 5639  C CD2  . PHE A 1 74  ? -7.679  -7.099  -0.831  1.00 0.00 ? 74  PHE A CD2  4  
ATOM 5640  C CE1  . PHE A 1 74  ? -6.967  -4.599  -1.753  1.00 0.00 ? 74  PHE A CE1  4  
ATOM 5641  C CE2  . PHE A 1 74  ? -7.510  -6.058  0.062   1.00 0.00 ? 74  PHE A CE2  4  
ATOM 5642  C CZ   . PHE A 1 74  ? -7.154  -4.806  -0.400  1.00 0.00 ? 74  PHE A CZ   4  
ATOM 5643  H H    . PHE A 1 74  ? -10.201 -7.486  -3.307  1.00 0.00 ? 74  PHE A H    4  
ATOM 5644  H HA   . PHE A 1 74  ? -7.883  -6.826  -4.910  1.00 0.00 ? 74  PHE A HA   4  
ATOM 5645  H HB2  . PHE A 1 74  ? -8.241  -8.813  -2.657  1.00 0.00 ? 74  PHE A HB2  4  
ATOM 5646  H HB3  . PHE A 1 74  ? -6.703  -8.417  -3.418  1.00 0.00 ? 74  PHE A HB3  4  
ATOM 5647  H HD1  . PHE A 1 74  ? -6.993  -5.480  -3.698  1.00 0.00 ? 74  PHE A HD1  4  
ATOM 5648  H HD2  . PHE A 1 74  ? -7.958  -8.079  -0.469  1.00 0.00 ? 74  PHE A HD2  4  
ATOM 5649  H HE1  . PHE A 1 74  ? -6.689  -3.621  -2.116  1.00 0.00 ? 74  PHE A HE1  4  
ATOM 5650  H HE2  . PHE A 1 74  ? -7.657  -6.223  1.119   1.00 0.00 ? 74  PHE A HE2  4  
ATOM 5651  H HZ   . PHE A 1 74  ? -7.021  -3.991  0.296   1.00 0.00 ? 74  PHE A HZ   4  
ATOM 5652  N N    . ALA A 1 75  ? -9.345  -9.774  -5.108  1.00 0.00 ? 75  ALA A N    4  
ATOM 5653  C CA   . ALA A 1 75  ? -9.496  -10.955 -5.948  1.00 0.00 ? 75  ALA A CA   4  
ATOM 5654  C C    . ALA A 1 75  ? -9.671  -10.569 -7.413  1.00 0.00 ? 75  ALA A C    4  
ATOM 5655  O O    . ALA A 1 75  ? -9.055  -11.161 -8.298  1.00 0.00 ? 75  ALA A O    4  
ATOM 5656  C CB   . ALA A 1 75  ? -10.676 -11.792 -5.476  1.00 0.00 ? 75  ALA A CB   4  
ATOM 5657  H H    . ALA A 1 75  ? -9.905  -9.681  -4.309  1.00 0.00 ? 75  ALA A H    4  
ATOM 5658  H HA   . ALA A 1 75  ? -8.601  -11.552 -5.848  1.00 0.00 ? 75  ALA A HA   4  
ATOM 5659  H HB1  . ALA A 1 75  ? -10.965 -12.478 -6.258  1.00 0.00 ? 75  ALA A HB1  4  
ATOM 5660  H HB2  . ALA A 1 75  ? -10.393 -12.348 -4.595  1.00 0.00 ? 75  ALA A HB2  4  
ATOM 5661  H HB3  . ALA A 1 75  ? -11.506 -11.142 -5.241  1.00 0.00 ? 75  ALA A HB3  4  
ATOM 5662  N N    . GLU A 1 76  ? -10.516 -9.573  -7.660  1.00 0.00 ? 76  GLU A N    4  
ATOM 5663  C CA   . GLU A 1 76  ? -10.773 -9.110  -9.019  1.00 0.00 ? 76  GLU A CA   4  
ATOM 5664  C C    . GLU A 1 76  ? -9.694  -8.131  -9.473  1.00 0.00 ? 76  GLU A C    4  
ATOM 5665  O O    . GLU A 1 76  ? -9.705  -7.663  -10.611 1.00 0.00 ? 76  GLU A O    4  
ATOM 5666  C CB   . GLU A 1 76  ? -12.149 -8.445  -9.104  1.00 0.00 ? 76  GLU A CB   4  
ATOM 5667  C CG   . GLU A 1 76  ? -13.304 -9.431  -9.066  1.00 0.00 ? 76  GLU A CG   4  
ATOM 5668  C CD   . GLU A 1 76  ? -14.612 -8.816  -9.526  1.00 0.00 ? 76  GLU A CD   4  
ATOM 5669  O OE1  . GLU A 1 76  ? -14.707 -8.448  -10.716 1.00 0.00 ? 76  GLU A OE1  4  
ATOM 5670  O OE2  . GLU A 1 76  ? -15.538 -8.701  -8.697  1.00 0.00 ? 76  GLU A OE2  4  
ATOM 5671  H H    . GLU A 1 76  ? -10.978 -9.140  -6.912  1.00 0.00 ? 76  GLU A H    4  
ATOM 5672  H HA   . GLU A 1 76  ? -10.759 -9.970  -9.671  1.00 0.00 ? 76  GLU A HA   4  
ATOM 5673  H HB2  . GLU A 1 76  ? -12.257 -7.763  -8.274  1.00 0.00 ? 76  GLU A HB2  4  
ATOM 5674  H HB3  . GLU A 1 76  ? -12.209 -7.888  -10.027 1.00 0.00 ? 76  GLU A HB3  4  
ATOM 5675  H HG2  . GLU A 1 76  ? -13.070 -10.265 -9.711  1.00 0.00 ? 76  GLU A HG2  4  
ATOM 5676  H HG3  . GLU A 1 76  ? -13.427 -9.785  -8.053  1.00 0.00 ? 76  GLU A HG3  4  
ATOM 5677  N N    . MET A 1 77  ? -8.764  -7.826  -8.574  1.00 0.00 ? 77  MET A N    4  
ATOM 5678  C CA   . MET A 1 77  ? -7.678  -6.903  -8.882  1.00 0.00 ? 77  MET A CA   4  
ATOM 5679  C C    . MET A 1 77  ? -8.210  -5.642  -9.556  1.00 0.00 ? 77  MET A C    4  
ATOM 5680  O O    . MET A 1 77  ? -7.679  -5.198  -10.574 1.00 0.00 ? 77  MET A O    4  
ATOM 5681  C CB   . MET A 1 77  ? -6.645  -7.580  -9.785  1.00 0.00 ? 77  MET A CB   4  
ATOM 5682  C CG   . MET A 1 77  ? -5.541  -8.290  -9.018  1.00 0.00 ? 77  MET A CG   4  
ATOM 5683  S SD   . MET A 1 77  ? -4.204  -7.180  -8.538  1.00 0.00 ? 77  MET A SD   4  
ATOM 5684  C CE   . MET A 1 77  ? -4.737  -6.697  -6.898  1.00 0.00 ? 77  MET A CE   4  
ATOM 5685  H H    . MET A 1 77  ? -8.808  -8.231  -7.683  1.00 0.00 ? 77  MET A H    4  
ATOM 5686  H HA   . MET A 1 77  ? -7.204  -6.627  -7.952  1.00 0.00 ? 77  MET A HA   4  
ATOM 5687  H HB2  . MET A 1 77  ? -7.148  -8.307  -10.405 1.00 0.00 ? 77  MET A HB2  4  
ATOM 5688  H HB3  . MET A 1 77  ? -6.190  -6.832  -10.417 1.00 0.00 ? 77  MET A HB3  4  
ATOM 5689  H HG2  . MET A 1 77  ? -5.964  -8.727  -8.126  1.00 0.00 ? 77  MET A HG2  4  
ATOM 5690  H HG3  . MET A 1 77  ? -5.135  -9.073  -9.642  1.00 0.00 ? 77  MET A HG3  4  
ATOM 5691  H HE1  . MET A 1 77  ? -5.708  -7.124  -6.695  1.00 0.00 ? 77  MET A HE1  4  
ATOM 5692  H HE2  . MET A 1 77  ? -4.026  -7.054  -6.169  1.00 0.00 ? 77  MET A HE2  4  
ATOM 5693  H HE3  . MET A 1 77  ? -4.799  -5.619  -6.844  1.00 0.00 ? 77  MET A HE3  4  
ATOM 5694  N N    . LYS A 1 78  ? -9.263  -5.070  -8.983  1.00 0.00 ? 78  LYS A N    4  
ATOM 5695  C CA   . LYS A 1 78  ? -9.868  -3.859  -9.527  1.00 0.00 ? 78  LYS A CA   4  
ATOM 5696  C C    . LYS A 1 78  ? -10.573 -3.064  -8.433  1.00 0.00 ? 78  LYS A C    4  
ATOM 5697  O O    . LYS A 1 78  ? -10.880 -3.597  -7.367  1.00 0.00 ? 78  LYS A O    4  
ATOM 5698  C CB   . LYS A 1 78  ? -10.862 -4.215  -10.635 1.00 0.00 ? 78  LYS A CB   4  
ATOM 5699  C CG   . LYS A 1 78  ? -12.189 -4.741  -10.115 1.00 0.00 ? 78  LYS A CG   4  
ATOM 5700  C CD   . LYS A 1 78  ? -12.948 -5.499  -11.192 1.00 0.00 ? 78  LYS A CD   4  
ATOM 5701  C CE   . LYS A 1 78  ? -13.821 -4.567  -12.019 1.00 0.00 ? 78  LYS A CE   4  
ATOM 5702  N NZ   . LYS A 1 78  ? -14.543 -5.296  -13.098 1.00 0.00 ? 78  LYS A NZ   4  
ATOM 5703  H H    . LYS A 1 78  ? -9.643  -5.471  -8.173  1.00 0.00 ? 78  LYS A H    4  
ATOM 5704  H HA   . LYS A 1 78  ? -9.078  -3.253  -9.944  1.00 0.00 ? 78  LYS A HA   4  
ATOM 5705  H HB2  . LYS A 1 78  ? -11.055 -3.332  -11.225 1.00 0.00 ? 78  LYS A HB2  4  
ATOM 5706  H HB3  . LYS A 1 78  ? -10.421 -4.971  -11.268 1.00 0.00 ? 78  LYS A HB3  4  
ATOM 5707  H HG2  . LYS A 1 78  ? -12.002 -5.407  -9.286  1.00 0.00 ? 78  LYS A HG2  4  
ATOM 5708  H HG3  . LYS A 1 78  ? -12.791 -3.908  -9.782  1.00 0.00 ? 78  LYS A HG3  4  
ATOM 5709  H HD2  . LYS A 1 78  ? -12.239 -5.984  -11.846 1.00 0.00 ? 78  LYS A HD2  4  
ATOM 5710  H HD3  . LYS A 1 78  ? -13.575 -6.243  -10.722 1.00 0.00 ? 78  LYS A HD3  4  
ATOM 5711  H HE2  . LYS A 1 78  ? -14.543 -4.099  -11.367 1.00 0.00 ? 78  LYS A HE2  4  
ATOM 5712  H HE3  . LYS A 1 78  ? -13.194 -3.809  -12.464 1.00 0.00 ? 78  LYS A HE3  4  
ATOM 5713  H HZ1  . LYS A 1 78  ? -14.663 -6.295  -12.835 1.00 0.00 ? 78  LYS A HZ1  4  
ATOM 5714  H HZ2  . LYS A 1 78  ? -14.003 -5.245  -13.986 1.00 0.00 ? 78  LYS A HZ2  4  
ATOM 5715  H HZ3  . LYS A 1 78  ? -15.480 -4.873  -13.250 1.00 0.00 ? 78  LYS A HZ3  4  
ATOM 5716  N N    . GLN A 1 79  ? -10.827 -1.788  -8.705  1.00 0.00 ? 79  GLN A N    4  
ATOM 5717  C CA   . GLN A 1 79  ? -11.496 -0.921  -7.743  1.00 0.00 ? 79  GLN A CA   4  
ATOM 5718  C C    . GLN A 1 79  ? -12.975 -0.768  -8.085  1.00 0.00 ? 79  GLN A C    4  
ATOM 5719  O O    . GLN A 1 79  ? -13.326 -0.234  -9.136  1.00 0.00 ? 79  GLN A O    4  
ATOM 5720  C CB   . GLN A 1 79  ? -10.824 0.453   -7.709  1.00 0.00 ? 79  GLN A CB   4  
ATOM 5721  C CG   . GLN A 1 79  ? -11.747 1.571   -7.251  1.00 0.00 ? 79  GLN A CG   4  
ATOM 5722  C CD   . GLN A 1 79  ? -11.106 2.940   -7.364  1.00 0.00 ? 79  GLN A CD   4  
ATOM 5723  O OE1  . GLN A 1 79  ? -10.051 3.095   -7.980  1.00 0.00 ? 79  GLN A OE1  4  
ATOM 5724  N NE2  . GLN A 1 79  ? -11.742 3.942   -6.770  1.00 0.00 ? 79  GLN A NE2  4  
ATOM 5725  H H    . GLN A 1 79  ? -10.557 -1.422  -9.572  1.00 0.00 ? 79  GLN A H    4  
ATOM 5726  H HA   . GLN A 1 79  ? -11.410 -1.378  -6.769  1.00 0.00 ? 79  GLN A HA   4  
ATOM 5727  H HB2  . GLN A 1 79  ? -9.981  0.411   -7.035  1.00 0.00 ? 79  GLN A HB2  4  
ATOM 5728  H HB3  . GLN A 1 79  ? -10.470 0.692   -8.701  1.00 0.00 ? 79  GLN A HB3  4  
ATOM 5729  H HG2  . GLN A 1 79  ? -12.639 1.556   -7.859  1.00 0.00 ? 79  GLN A HG2  4  
ATOM 5730  H HG3  . GLN A 1 79  ? -12.014 1.399   -6.218  1.00 0.00 ? 79  GLN A HG3  4  
ATOM 5731  H HE21 . GLN A 1 79  ? -12.577 3.744   -6.296  1.00 0.00 ? 79  GLN A HE21 4  
ATOM 5732  H HE22 . GLN A 1 79  ? -11.350 4.838   -6.827  1.00 0.00 ? 79  GLN A HE22 4  
ATOM 5733  N N    . MET A 1 80  ? -13.836 -1.240  -7.190  1.00 0.00 ? 80  MET A N    4  
ATOM 5734  C CA   . MET A 1 80  ? -15.277 -1.155  -7.397  1.00 0.00 ? 80  MET A CA   4  
ATOM 5735  C C    . MET A 1 80  ? -15.841 0.117   -6.772  1.00 0.00 ? 80  MET A C    4  
ATOM 5736  O O    . MET A 1 80  ? -15.954 0.222   -5.552  1.00 0.00 ? 80  MET A O    4  
ATOM 5737  C CB   . MET A 1 80  ? -15.972 -2.381  -6.803  1.00 0.00 ? 80  MET A CB   4  
ATOM 5738  C CG   . MET A 1 80  ? -17.383 -2.593  -7.328  1.00 0.00 ? 80  MET A CG   4  
ATOM 5739  S SD   . MET A 1 80  ? -17.428 -3.639  -8.796  1.00 0.00 ? 80  MET A SD   4  
ATOM 5740  C CE   . MET A 1 80  ? -16.597 -2.589  -9.985  1.00 0.00 ? 80  MET A CE   4  
ATOM 5741  H H    . MET A 1 80  ? -13.495 -1.656  -6.370  1.00 0.00 ? 80  MET A H    4  
ATOM 5742  H HA   . MET A 1 80  ? -15.457 -1.130  -8.461  1.00 0.00 ? 80  MET A HA   4  
ATOM 5743  H HB2  . MET A 1 80  ? -15.389 -3.260  -7.036  1.00 0.00 ? 80  MET A HB2  4  
ATOM 5744  H HB3  . MET A 1 80  ? -16.024 -2.268  -5.731  1.00 0.00 ? 80  MET A HB3  4  
ATOM 5745  H HG2  . MET A 1 80  ? -17.975 -3.059  -6.554  1.00 0.00 ? 80  MET A HG2  4  
ATOM 5746  H HG3  . MET A 1 80  ? -17.809 -1.632  -7.573  1.00 0.00 ? 80  MET A HG3  4  
ATOM 5747  H HE1  . MET A 1 80  ? -15.530 -2.644  -9.830  1.00 0.00 ? 80  MET A HE1  4  
ATOM 5748  H HE2  . MET A 1 80  ? -16.833 -2.921  -10.985 1.00 0.00 ? 80  MET A HE2  4  
ATOM 5749  H HE3  . MET A 1 80  ? -16.927 -1.568  -9.856  1.00 0.00 ? 80  MET A HE3  4  
ATOM 5750  N N    . ASN A 1 81  ? -16.195 1.080   -7.617  1.00 0.00 ? 81  ASN A N    4  
ATOM 5751  C CA   . ASN A 1 81  ? -16.747 2.345   -7.147  1.00 0.00 ? 81  ASN A CA   4  
ATOM 5752  C C    . ASN A 1 81  ? -18.262 2.254   -6.996  1.00 0.00 ? 81  ASN A C    4  
ATOM 5753  O O    . ASN A 1 81  ? -18.959 1.774   -7.891  1.00 0.00 ? 81  ASN A O    4  
ATOM 5754  C CB   . ASN A 1 81  ? -16.387 3.474   -8.115  1.00 0.00 ? 81  ASN A CB   4  
ATOM 5755  C CG   . ASN A 1 81  ? -15.068 4.137   -7.765  1.00 0.00 ? 81  ASN A CG   4  
ATOM 5756  O OD1  . ASN A 1 81  ? -14.079 3.463   -7.477  1.00 0.00 ? 81  ASN A OD1  4  
ATOM 5757  N ND2  . ASN A 1 81  ? -15.050 5.464   -7.788  1.00 0.00 ? 81  ASN A ND2  4  
ATOM 5758  H H    . ASN A 1 81  ? -16.081 0.936   -8.580  1.00 0.00 ? 81  ASN A H    4  
ATOM 5759  H HA   . ASN A 1 81  ? -16.312 2.558   -6.182  1.00 0.00 ? 81  ASN A HA   4  
ATOM 5760  H HB2  . ASN A 1 81  ? -16.310 3.072   -9.115  1.00 0.00 ? 81  ASN A HB2  4  
ATOM 5761  H HB3  . ASN A 1 81  ? -17.163 4.223   -8.091  1.00 0.00 ? 81  ASN A HB3  4  
ATOM 5762  H HD21 . ASN A 1 81  ? -15.876 5.935   -8.027  1.00 0.00 ? 81  ASN A HD21 4  
ATOM 5763  H HD22 . ASN A 1 81  ? -14.210 5.919   -7.567  1.00 0.00 ? 81  ASN A HD22 4  
ATOM 5764  N N    . LEU A 1 82  ? -18.766 2.718   -5.858  1.00 0.00 ? 82  LEU A N    4  
ATOM 5765  C CA   . LEU A 1 82  ? -20.200 2.690   -5.588  1.00 0.00 ? 82  LEU A CA   4  
ATOM 5766  C C    . LEU A 1 82  ? -20.788 4.097   -5.624  1.00 0.00 ? 82  LEU A C    4  
ATOM 5767  O O    . LEU A 1 82  ? -21.888 4.310   -6.136  1.00 0.00 ? 82  LEU A O    4  
ATOM 5768  C CB   . LEU A 1 82  ? -20.470 2.047   -4.227  1.00 0.00 ? 82  LEU A CB   4  
ATOM 5769  C CG   . LEU A 1 82  ? -19.879 0.653   -4.014  1.00 0.00 ? 82  LEU A CG   4  
ATOM 5770  C CD1  . LEU A 1 82  ? -20.503 -0.345  -4.977  1.00 0.00 ? 82  LEU A CD1  4  
ATOM 5771  C CD2  . LEU A 1 82  ? -18.367 0.684   -4.182  1.00 0.00 ? 82  LEU A CD2  4  
ATOM 5772  H H    . LEU A 1 82  ? -18.161 3.088   -5.182  1.00 0.00 ? 82  LEU A H    4  
ATOM 5773  H HA   . LEU A 1 82  ? -20.670 2.097   -6.358  1.00 0.00 ? 82  LEU A HA   4  
ATOM 5774  H HB2  . LEU A 1 82  ? -20.065 2.698   -3.467  1.00 0.00 ? 82  LEU A HB2  4  
ATOM 5775  H HB3  . LEU A 1 82  ? -21.542 1.976   -4.103  1.00 0.00 ? 82  LEU A HB3  4  
ATOM 5776  H HG   . LEU A 1 82  ? -20.098 0.326   -3.007  1.00 0.00 ? 82  LEU A HG   4  
ATOM 5777  H HD11 . LEU A 1 82  ? -20.834 0.171   -5.865  1.00 0.00 ? 82  LEU A HD11 4  
ATOM 5778  H HD12 . LEU A 1 82  ? -21.348 -0.822  -4.503  1.00 0.00 ? 82  LEU A HD12 4  
ATOM 5779  H HD13 . LEU A 1 82  ? -19.771 -1.092  -5.245  1.00 0.00 ? 82  LEU A HD13 4  
ATOM 5780  H HD21 . LEU A 1 82  ? -18.114 0.448   -5.205  1.00 0.00 ? 82  LEU A HD21 4  
ATOM 5781  H HD22 . LEU A 1 82  ? -17.917 -0.045  -3.523  1.00 0.00 ? 82  LEU A HD22 4  
ATOM 5782  H HD23 . LEU A 1 82  ? -17.998 1.669   -3.936  1.00 0.00 ? 82  LEU A HD23 4  
ATOM 5783  N N    . THR A 1 83  ? -20.047 5.057   -5.079  1.00 0.00 ? 83  THR A N    4  
ATOM 5784  C CA   . THR A 1 83  ? -20.494 6.444   -5.050  1.00 0.00 ? 83  THR A CA   4  
ATOM 5785  C C    . THR A 1 83  ? -21.068 6.865   -6.397  1.00 0.00 ? 83  THR A C    4  
ATOM 5786  O O    . THR A 1 83  ? -22.116 7.509   -6.464  1.00 0.00 ? 83  THR A O    4  
ATOM 5787  C CB   . THR A 1 83  ? -19.343 7.397   -4.674  1.00 0.00 ? 83  THR A CB   4  
ATOM 5788  O OG1  . THR A 1 83  ? -19.795 8.755   -4.727  1.00 0.00 ? 83  THR A OG1  4  
ATOM 5789  C CG2  . THR A 1 83  ? -18.161 7.214   -5.613  1.00 0.00 ? 83  THR A CG2  4  
ATOM 5790  H H    . THR A 1 83  ? -19.179 4.825   -4.687  1.00 0.00 ? 83  THR A H    4  
ATOM 5791  H HA   . THR A 1 83  ? -21.265 6.530   -4.298  1.00 0.00 ? 83  THR A HA   4  
ATOM 5792  H HB   . THR A 1 83  ? -19.023 7.171   -3.667  1.00 0.00 ? 83  THR A HB   4  
ATOM 5793  H HG1  . THR A 1 83  ? -20.278 8.963   -3.923  1.00 0.00 ? 83  THR A HG1  4  
ATOM 5794  H HG21 . THR A 1 83  ? -17.898 6.168   -5.661  1.00 0.00 ? 83  THR A HG21 4  
ATOM 5795  H HG22 . THR A 1 83  ? -17.318 7.781   -5.246  1.00 0.00 ? 83  THR A HG22 4  
ATOM 5796  H HG23 . THR A 1 83  ? -18.427 7.564   -6.599  1.00 0.00 ? 83  THR A HG23 4  
ATOM 5797  N N    . THR A 1 84  ? -20.376 6.497   -7.472  1.00 0.00 ? 84  THR A N    4  
ATOM 5798  C CA   . THR A 1 84  ? -20.817 6.838   -8.818  1.00 0.00 ? 84  THR A CA   4  
ATOM 5799  C C    . THR A 1 84  ? -21.225 5.591   -9.595  1.00 0.00 ? 84  THR A C    4  
ATOM 5800  O O    . THR A 1 84  ? -22.027 5.661   -10.525 1.00 0.00 ? 84  THR A O    4  
ATOM 5801  C CB   . THR A 1 84  ? -19.716 7.579   -9.600  1.00 0.00 ? 84  THR A CB   4  
ATOM 5802  O OG1  . THR A 1 84  ? -18.752 6.642   -10.094 1.00 0.00 ? 84  THR A OG1  4  
ATOM 5803  C CG2  . THR A 1 84  ? -19.025 8.608   -8.718  1.00 0.00 ? 84  THR A CG2  4  
ATOM 5804  H H    . THR A 1 84  ? -19.549 5.986   -7.354  1.00 0.00 ? 84  THR A H    4  
ATOM 5805  H HA   . THR A 1 84  ? -21.672 7.493   -8.734  1.00 0.00 ? 84  THR A HA   4  
ATOM 5806  H HB   . THR A 1 84  ? -20.171 8.090   -10.436 1.00 0.00 ? 84  THR A HB   4  
ATOM 5807  H HG1  . THR A 1 84  ? -19.067 6.263   -10.918 1.00 0.00 ? 84  THR A HG1  4  
ATOM 5808  H HG21 . THR A 1 84  ? -18.959 9.548   -9.245  1.00 0.00 ? 84  THR A HG21 4  
ATOM 5809  H HG22 . THR A 1 84  ? -18.033 8.262   -8.471  1.00 0.00 ? 84  THR A HG22 4  
ATOM 5810  H HG23 . THR A 1 84  ? -19.595 8.744   -7.811  1.00 0.00 ? 84  THR A HG23 4  
ATOM 5811  N N    . GLY A 1 85  ? -20.666 4.448   -9.207  1.00 0.00 ? 85  GLY A N    4  
ATOM 5812  C CA   . GLY A 1 85  ? -20.984 3.201   -9.877  1.00 0.00 ? 85  GLY A CA   4  
ATOM 5813  C C    . GLY A 1 85  ? -20.104 2.952   -11.086 1.00 0.00 ? 85  GLY A C    4  
ATOM 5814  O O    . GLY A 1 85  ? -20.530 2.323   -12.055 1.00 0.00 ? 85  GLY A O    4  
ATOM 5815  H H    . GLY A 1 85  ? -20.033 4.452   -8.459  1.00 0.00 ? 85  GLY A H    4  
ATOM 5816  H HA2  . GLY A 1 85  ? -20.858 2.387   -9.179  1.00 0.00 ? 85  GLY A HA2  4  
ATOM 5817  H HA3  . GLY A 1 85  ? -22.015 3.231   -10.198 1.00 0.00 ? 85  GLY A HA3  4  
ATOM 5818  N N    . LYS A 1 86  ? -18.872 3.447   -11.031 1.00 0.00 ? 86  LYS A N    4  
ATOM 5819  C CA   . LYS A 1 86  ? -17.929 3.276   -12.129 1.00 0.00 ? 86  LYS A CA   4  
ATOM 5820  C C    . LYS A 1 86  ? -17.013 2.082   -11.879 1.00 0.00 ? 86  LYS A C    4  
ATOM 5821  O O    . LYS A 1 86  ? -17.050 1.475   -10.809 1.00 0.00 ? 86  LYS A O    4  
ATOM 5822  C CB   . LYS A 1 86  ? -17.092 4.544   -12.313 1.00 0.00 ? 86  LYS A CB   4  
ATOM 5823  C CG   . LYS A 1 86  ? -17.818 5.648   -13.062 1.00 0.00 ? 86  LYS A CG   4  
ATOM 5824  C CD   . LYS A 1 86  ? -17.681 5.485   -14.566 1.00 0.00 ? 86  LYS A CD   4  
ATOM 5825  C CE   . LYS A 1 86  ? -16.304 5.912   -15.050 1.00 0.00 ? 86  LYS A CE   4  
ATOM 5826  N NZ   . LYS A 1 86  ? -16.221 5.934   -16.537 1.00 0.00 ? 86  LYS A NZ   4  
ATOM 5827  H H    . LYS A 1 86  ? -18.590 3.939   -10.231 1.00 0.00 ? 86  LYS A H    4  
ATOM 5828  H HA   . LYS A 1 86  ? -18.496 3.096   -13.030 1.00 0.00 ? 86  LYS A HA   4  
ATOM 5829  H HB2  . LYS A 1 86  ? -16.813 4.921   -11.340 1.00 0.00 ? 86  LYS A HB2  4  
ATOM 5830  H HB3  . LYS A 1 86  ? -16.196 4.294   -12.863 1.00 0.00 ? 86  LYS A HB3  4  
ATOM 5831  H HG2  . LYS A 1 86  ? -18.865 5.620   -12.801 1.00 0.00 ? 86  LYS A HG2  4  
ATOM 5832  H HG3  . LYS A 1 86  ? -17.399 6.602   -12.773 1.00 0.00 ? 86  LYS A HG3  4  
ATOM 5833  H HD2  . LYS A 1 86  ? -17.834 4.447   -14.822 1.00 0.00 ? 86  LYS A HD2  4  
ATOM 5834  H HD3  . LYS A 1 86  ? -18.429 6.093   -15.055 1.00 0.00 ? 86  LYS A HD3  4  
ATOM 5835  H HE2  . LYS A 1 86  ? -16.094 6.901   -14.672 1.00 0.00 ? 86  LYS A HE2  4  
ATOM 5836  H HE3  . LYS A 1 86  ? -15.571 5.217   -14.667 1.00 0.00 ? 86  LYS A HE3  4  
ATOM 5837  H HZ1  . LYS A 1 86  ? -16.199 4.963   -16.908 1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 5838  H HZ2  . LYS A 1 86  ? -15.356 6.428   -16.839 1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 5839  H HZ3  . LYS A 1 86  ? -17.045 6.428   -16.934 1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 5840  N N    . GLN A 1 87  ? -16.192 1.753   -12.871 1.00 0.00 ? 87  GLN A N    4  
ATOM 5841  C CA   . GLN A 1 87  ? -15.267 0.632   -12.756 1.00 0.00 ? 87  GLN A CA   4  
ATOM 5842  C C    . GLN A 1 87  ? -13.831 1.084   -13.001 1.00 0.00 ? 87  GLN A C    4  
ATOM 5843  O O    . GLN A 1 87  ? -13.533 1.716   -14.015 1.00 0.00 ? 87  GLN A O    4  
ATOM 5844  C CB   . GLN A 1 87  ? -15.643 -0.471  -13.748 1.00 0.00 ? 87  GLN A CB   4  
ATOM 5845  C CG   . GLN A 1 87  ? -16.976 -1.135  -13.443 1.00 0.00 ? 87  GLN A CG   4  
ATOM 5846  C CD   . GLN A 1 87  ? -17.665 -1.658  -14.688 1.00 0.00 ? 87  GLN A CD   4  
ATOM 5847  O OE1  . GLN A 1 87  ? -17.103 -2.466  -15.429 1.00 0.00 ? 87  GLN A OE1  4  
ATOM 5848  N NE2  . GLN A 1 87  ? -18.889 -1.201  -14.924 1.00 0.00 ? 87  GLN A NE2  4  
ATOM 5849  H H    . GLN A 1 87  ? -16.210 2.275   -13.699 1.00 0.00 ? 87  GLN A H    4  
ATOM 5850  H HA   . GLN A 1 87  ? -15.342 0.242   -11.753 1.00 0.00 ? 87  GLN A HA   4  
ATOM 5851  H HB2  . GLN A 1 87  ? -15.695 -0.045  -14.739 1.00 0.00 ? 87  GLN A HB2  4  
ATOM 5852  H HB3  . GLN A 1 87  ? -14.875 -1.230  -13.731 1.00 0.00 ? 87  GLN A HB3  4  
ATOM 5853  H HG2  . GLN A 1 87  ? -16.806 -1.962  -12.770 1.00 0.00 ? 87  GLN A HG2  4  
ATOM 5854  H HG3  . GLN A 1 87  ? -17.623 -0.412  -12.968 1.00 0.00 ? 87  GLN A HG3  4  
ATOM 5855  H HE21 . GLN A 1 87  ? -19.272 -0.558  -14.290 1.00 0.00 ? 87  GLN A HE21 4  
ATOM 5856  H HE22 . GLN A 1 87  ? -19.357 -1.522  -15.722 1.00 0.00 ? 87  GLN A HE22 4  
ATOM 5857  N N    . ARG A 1 88  ? -12.945 0.757   -12.065 1.00 0.00 ? 88  ARG A N    4  
ATOM 5858  C CA   . ARG A 1 88  ? -11.541 1.132   -12.178 1.00 0.00 ? 88  ARG A CA   4  
ATOM 5859  C C    . ARG A 1 88  ? -10.637 -0.082  -11.979 1.00 0.00 ? 88  ARG A C    4  
ATOM 5860  O O    . ARG A 1 88  ? -11.112 -1.186  -11.711 1.00 0.00 ? 88  ARG A O    4  
ATOM 5861  C CB   . ARG A 1 88  ? -11.195 2.212   -11.153 1.00 0.00 ? 88  ARG A CB   4  
ATOM 5862  C CG   . ARG A 1 88  ? -11.863 3.549   -11.428 1.00 0.00 ? 88  ARG A CG   4  
ATOM 5863  C CD   . ARG A 1 88  ? -11.388 4.620   -10.458 1.00 0.00 ? 88  ARG A CD   4  
ATOM 5864  N NE   . ARG A 1 88  ? -12.048 5.902   -10.691 1.00 0.00 ? 88  ARG A NE   4  
ATOM 5865  C CZ   . ARG A 1 88  ? -11.885 6.965   -9.911  1.00 0.00 ? 88  ARG A CZ   4  
ATOM 5866  N NH1  . ARG A 1 88  ? -11.088 6.899   -8.853  1.00 0.00 ? 88  ARG A NH1  4  
ATOM 5867  N NH2  . ARG A 1 88  ? -12.520 8.096   -10.189 1.00 0.00 ? 88  ARG A NH2  4  
ATOM 5868  H H    . ARG A 1 88  ? -13.244 0.253   -11.280 1.00 0.00 ? 88  ARG A H    4  
ATOM 5869  H HA   . ARG A 1 88  ? -11.381 1.525   -13.171 1.00 0.00 ? 88  ARG A HA   4  
ATOM 5870  H HB2  . ARG A 1 88  ? -11.503 1.876   -10.174 1.00 0.00 ? 88  ARG A HB2  4  
ATOM 5871  H HB3  . ARG A 1 88  ? -10.126 2.362   -11.153 1.00 0.00 ? 88  ARG A HB3  4  
ATOM 5872  H HG2  . ARG A 1 88  ? -11.625 3.861   -12.434 1.00 0.00 ? 88  ARG A HG2  4  
ATOM 5873  H HG3  . ARG A 1 88  ? -12.932 3.434   -11.328 1.00 0.00 ? 88  ARG A HG3  4  
ATOM 5874  H HD2  . ARG A 1 88  ? -11.602 4.294   -9.450  1.00 0.00 ? 88  ARG A HD2  4  
ATOM 5875  H HD3  . ARG A 1 88  ? -10.323 4.747   -10.576 1.00 0.00 ? 88  ARG A HD3  4  
ATOM 5876  H HE   . ARG A 1 88  ? -12.642 5.972   -11.467 1.00 0.00 ? 88  ARG A HE   4  
ATOM 5877  H HH11 . ARG A 1 88  ? -10.608 6.048   -8.642  1.00 0.00 ? 88  ARG A HH11 4  
ATOM 5878  H HH12 . ARG A 1 88  ? -10.966 7.702   -8.269  1.00 0.00 ? 88  ARG A HH12 4  
ATOM 5879  H HH21 . ARG A 1 88  ? -13.121 8.149   -10.985 1.00 0.00 ? 88  ARG A HH21 4  
ATOM 5880  H HH22 . ARG A 1 88  ? -12.397 8.896   -9.601  1.00 0.00 ? 88  ARG A HH22 4  
ATOM 5881  N N    . LEU A 1 89  ? -9.333  0.131   -12.114 1.00 0.00 ? 89  LEU A N    4  
ATOM 5882  C CA   . LEU A 1 89  ? -8.362  -0.946  -11.949 1.00 0.00 ? 89  LEU A CA   4  
ATOM 5883  C C    . LEU A 1 89  ? -7.394  -0.636  -10.811 1.00 0.00 ? 89  LEU A C    4  
ATOM 5884  O O    . LEU A 1 89  ? -7.323  0.497   -10.334 1.00 0.00 ? 89  LEU A O    4  
ATOM 5885  C CB   . LEU A 1 89  ? -7.585  -1.162  -13.249 1.00 0.00 ? 89  LEU A CB   4  
ATOM 5886  C CG   . LEU A 1 89  ? -8.226  -2.109  -14.264 1.00 0.00 ? 89  LEU A CG   4  
ATOM 5887  C CD1  . LEU A 1 89  ? -7.371  -2.208  -15.517 1.00 0.00 ? 89  LEU A CD1  4  
ATOM 5888  C CD2  . LEU A 1 89  ? -8.436  -3.486  -13.650 1.00 0.00 ? 89  LEU A CD2  4  
ATOM 5889  H H    . LEU A 1 89  ? -9.014  1.032   -12.328 1.00 0.00 ? 89  LEU A H    4  
ATOM 5890  H HA   . LEU A 1 89  ? -8.904  -1.848  -11.709 1.00 0.00 ? 89  LEU A HA   4  
ATOM 5891  H HB2  . LEU A 1 89  ? -7.464  -0.201  -13.725 1.00 0.00 ? 89  LEU A HB2  4  
ATOM 5892  H HB3  . LEU A 1 89  ? -6.614  -1.559  -12.991 1.00 0.00 ? 89  LEU A HB3  4  
ATOM 5893  H HG   . LEU A 1 89  ? -9.193  -1.719  -14.550 1.00 0.00 ? 89  LEU A HG   4  
ATOM 5894  H HD11 . LEU A 1 89  ? -7.728  -3.017  -16.135 1.00 0.00 ? 89  LEU A HD11 4  
ATOM 5895  H HD12 . LEU A 1 89  ? -6.344  -2.394  -15.238 1.00 0.00 ? 89  LEU A HD12 4  
ATOM 5896  H HD13 . LEU A 1 89  ? -7.431  -1.280  -16.068 1.00 0.00 ? 89  LEU A HD13 4  
ATOM 5897  H HD21 . LEU A 1 89  ? -8.098  -3.477  -12.624 1.00 0.00 ? 89  LEU A HD21 4  
ATOM 5898  H HD22 . LEU A 1 89  ? -7.871  -4.219  -14.208 1.00 0.00 ? 89  LEU A HD22 4  
ATOM 5899  H HD23 . LEU A 1 89  ? -9.485  -3.738  -13.681 1.00 0.00 ? 89  LEU A HD23 4  
ATOM 5900  N N    . ILE A 1 90  ? -6.650  -1.650  -10.383 1.00 0.00 ? 90  ILE A N    4  
ATOM 5901  C CA   . ILE A 1 90  ? -5.684  -1.485  -9.303  1.00 0.00 ? 90  ILE A CA   4  
ATOM 5902  C C    . ILE A 1 90  ? -4.452  -2.355  -9.531  1.00 0.00 ? 90  ILE A C    4  
ATOM 5903  O O    . ILE A 1 90  ? -4.404  -3.150  -10.470 1.00 0.00 ? 90  ILE A O    4  
ATOM 5904  C CB   . ILE A 1 90  ? -6.301  -1.837  -7.937  1.00 0.00 ? 90  ILE A CB   4  
ATOM 5905  C CG1  . ILE A 1 90  ? -6.783  -3.289  -7.929  1.00 0.00 ? 90  ILE A CG1  4  
ATOM 5906  C CG2  . ILE A 1 90  ? -7.448  -0.891  -7.615  1.00 0.00 ? 90  ILE A CG2  4  
ATOM 5907  C CD1  . ILE A 1 90  ? -7.419  -3.708  -6.622  1.00 0.00 ? 90  ILE A CD1  4  
ATOM 5908  H H    . ILE A 1 90  ? -6.752  -2.529  -10.803 1.00 0.00 ? 90  ILE A H    4  
ATOM 5909  H HA   . ILE A 1 90  ? -5.381  -0.448  -9.283  1.00 0.00 ? 90  ILE A HA   4  
ATOM 5910  H HB   . ILE A 1 90  ? -5.541  -1.713  -7.181  1.00 0.00 ? 90  ILE A HB   4  
ATOM 5911  H HG12 . ILE A 1 90  ? -7.513  -3.424  -8.711  1.00 0.00 ? 90  ILE A HG12 4  
ATOM 5912  H HG13 . ILE A 1 90  ? -5.941  -3.941  -8.113  1.00 0.00 ? 90  ILE A HG13 4  
ATOM 5913  H HG21 . ILE A 1 90  ? -7.157  0.121   -7.853  1.00 0.00 ? 90  ILE A HG21 4  
ATOM 5914  H HG22 . ILE A 1 90  ? -8.314  -1.163  -8.201  1.00 0.00 ? 90  ILE A HG22 4  
ATOM 5915  H HG23 . ILE A 1 90  ? -7.688  -0.960  -6.565  1.00 0.00 ? 90  ILE A HG23 4  
ATOM 5916  H HD11 . ILE A 1 90  ? -7.257  -2.940  -5.880  1.00 0.00 ? 90  ILE A HD11 4  
ATOM 5917  H HD12 . ILE A 1 90  ? -8.478  -3.853  -6.766  1.00 0.00 ? 90  ILE A HD12 4  
ATOM 5918  H HD13 . ILE A 1 90  ? -6.972  -4.632  -6.284  1.00 0.00 ? 90  ILE A HD13 4  
ATOM 5919  N N    . LYS A 1 91  ? -3.457  -2.199  -8.664  1.00 0.00 ? 91  LYS A N    4  
ATOM 5920  C CA   . LYS A 1 91  ? -2.224  -2.972  -8.767  1.00 0.00 ? 91  LYS A CA   4  
ATOM 5921  C C    . LYS A 1 91  ? -1.343  -2.756  -7.541  1.00 0.00 ? 91  LYS A C    4  
ATOM 5922  O O    . LYS A 1 91  ? -1.437  -1.727  -6.871  1.00 0.00 ? 91  LYS A O    4  
ATOM 5923  C CB   . LYS A 1 91  ? -1.459  -2.583  -10.033 1.00 0.00 ? 91  LYS A CB   4  
ATOM 5924  C CG   . LYS A 1 91  ? -0.822  -1.206  -9.960  1.00 0.00 ? 91  LYS A CG   4  
ATOM 5925  C CD   . LYS A 1 91  ? 0.177   -0.993  -11.086 1.00 0.00 ? 91  LYS A CD   4  
ATOM 5926  C CE   . LYS A 1 91  ? 1.016   0.255   -10.858 1.00 0.00 ? 91  LYS A CE   4  
ATOM 5927  N NZ   . LYS A 1 91  ? 1.944   0.097   -9.704  1.00 0.00 ? 91  LYS A NZ   4  
ATOM 5928  H H    . LYS A 1 91  ? -3.554  -1.550  -7.936  1.00 0.00 ? 91  LYS A H    4  
ATOM 5929  H HA   . LYS A 1 91  ? -2.491  -4.016  -8.824  1.00 0.00 ? 91  LYS A HA   4  
ATOM 5930  H HB2  . LYS A 1 91  ? -0.678  -3.309  -10.205 1.00 0.00 ? 91  LYS A HB2  4  
ATOM 5931  H HB3  . LYS A 1 91  ? -2.142  -2.596  -10.871 1.00 0.00 ? 91  LYS A HB3  4  
ATOM 5932  H HG2  . LYS A 1 91  ? -1.595  -0.457  -10.034 1.00 0.00 ? 91  LYS A HG2  4  
ATOM 5933  H HG3  . LYS A 1 91  ? -0.310  -1.106  -9.013  1.00 0.00 ? 91  LYS A HG3  4  
ATOM 5934  H HD2  . LYS A 1 91  ? 0.833   -1.849  -11.140 1.00 0.00 ? 91  LYS A HD2  4  
ATOM 5935  H HD3  . LYS A 1 91  ? -0.361  -0.890  -12.018 1.00 0.00 ? 91  LYS A HD3  4  
ATOM 5936  H HE2  . LYS A 1 91  ? 1.593   0.452   -11.748 1.00 0.00 ? 91  LYS A HE2  4  
ATOM 5937  H HE3  . LYS A 1 91  ? 0.354   1.087   -10.666 1.00 0.00 ? 91  LYS A HE3  4  
ATOM 5938  H HZ1  . LYS A 1 91  ? 1.422   0.199   -8.810  1.00 0.00 ? 91  LYS A HZ1  4  
ATOM 5939  H HZ2  . LYS A 1 91  ? 2.688   0.822   -9.742  1.00 0.00 ? 91  LYS A HZ2  4  
ATOM 5940  H HZ3  . LYS A 1 91  ? 2.388   -0.843  -9.728  1.00 0.00 ? 91  LYS A HZ3  4  
ATOM 5941  N N    . ARG A 1 92  ? -0.487  -3.731  -7.254  1.00 0.00 ? 92  ARG A N    4  
ATOM 5942  C CA   . ARG A 1 92  ? 0.411   -3.646  -6.108  1.00 0.00 ? 92  ARG A CA   4  
ATOM 5943  C C    . ARG A 1 92  ? 1.869   -3.659  -6.558  1.00 0.00 ? 92  ARG A C    4  
ATOM 5944  O O    . ARG A 1 92  ? 2.287   -4.534  -7.316  1.00 0.00 ? 92  ARG A O    4  
ATOM 5945  C CB   . ARG A 1 92  ? 0.154   -4.807  -5.145  1.00 0.00 ? 92  ARG A CB   4  
ATOM 5946  C CG   . ARG A 1 92  ? 0.887   -4.672  -3.820  1.00 0.00 ? 92  ARG A CG   4  
ATOM 5947  C CD   . ARG A 1 92  ? 0.126   -5.349  -2.691  1.00 0.00 ? 92  ARG A CD   4  
ATOM 5948  N NE   . ARG A 1 92  ? 0.498   -6.753  -2.544  1.00 0.00 ? 92  ARG A NE   4  
ATOM 5949  C CZ   . ARG A 1 92  ? 1.613   -7.159  -1.946  1.00 0.00 ? 92  ARG A CZ   4  
ATOM 5950  N NH1  . ARG A 1 92  ? 2.459   -6.272  -1.442  1.00 0.00 ? 92  ARG A NH1  4  
ATOM 5951  N NH2  . ARG A 1 92  ? 1.882   -8.455  -1.851  1.00 0.00 ? 92  ARG A NH2  4  
ATOM 5952  H H    . ARG A 1 92  ? -0.459  -4.527  -7.825  1.00 0.00 ? 92  ARG A H    4  
ATOM 5953  H HA   . ARG A 1 92  ? 0.212   -2.716  -5.598  1.00 0.00 ? 92  ARG A HA   4  
ATOM 5954  H HB2  . ARG A 1 92  ? -0.905  -4.862  -4.940  1.00 0.00 ? 92  ARG A HB2  4  
ATOM 5955  H HB3  . ARG A 1 92  ? 0.470   -5.726  -5.615  1.00 0.00 ? 92  ARG A HB3  4  
ATOM 5956  H HG2  . ARG A 1 92  ? 1.860   -5.133  -3.910  1.00 0.00 ? 92  ARG A HG2  4  
ATOM 5957  H HG3  . ARG A 1 92  ? 1.003   -3.624  -3.588  1.00 0.00 ? 92  ARG A HG3  4  
ATOM 5958  H HD2  . ARG A 1 92  ? 0.342   -4.831  -1.768  1.00 0.00 ? 92  ARG A HD2  4  
ATOM 5959  H HD3  . ARG A 1 92  ? -0.932  -5.286  -2.900  1.00 0.00 ? 92  ARG A HD3  4  
ATOM 5960  H HE   . ARG A 1 92  ? -0.113  -7.425  -2.909  1.00 0.00 ? 92  ARG A HE   4  
ATOM 5961  H HH11 . ARG A 1 92  ? 2.259   -5.295  -1.511  1.00 0.00 ? 92  ARG A HH11 4  
ATOM 5962  H HH12 . ARG A 1 92  ? 3.297   -6.581  -0.991  1.00 0.00 ? 92  ARG A HH12 4  
ATOM 5963  H HH21 . ARG A 1 92  ? 1.245   -9.127  -2.230  1.00 0.00 ? 92  ARG A HH21 4  
ATOM 5964  H HH22 . ARG A 1 92  ? 2.720   -8.760  -1.402  1.00 0.00 ? 92  ARG A HH22 4  
ATOM 5965  N N    . ALA A 1 93  ? 2.637   -2.682  -6.087  1.00 0.00 ? 93  ALA A N    4  
ATOM 5966  C CA   . ALA A 1 93  ? 4.048   -2.581  -6.440  1.00 0.00 ? 93  ALA A CA   4  
ATOM 5967  C C    . ALA A 1 93  ? 4.798   -1.695  -5.452  1.00 0.00 ? 93  ALA A C    4  
ATOM 5968  O O    . ALA A 1 93  ? 4.218   -0.840  -4.783  1.00 0.00 ? 93  ALA A O    4  
ATOM 5969  C CB   . ALA A 1 93  ? 4.201   -2.045  -7.855  1.00 0.00 ? 93  ALA A CB   4  
ATOM 5970  H H    . ALA A 1 93  ? 2.245   -2.014  -5.487  1.00 0.00 ? 93  ALA A H    4  
ATOM 5971  H HA   . ALA A 1 93  ? 4.471   -3.575  -6.410  1.00 0.00 ? 93  ALA A HA   4  
ATOM 5972  H HB1  . ALA A 1 93  ? 4.271   -2.872  -8.547  1.00 0.00 ? 93  ALA A HB1  4  
ATOM 5973  H HB2  . ALA A 1 93  ? 3.343   -1.438  -8.105  1.00 0.00 ? 93  ALA A HB2  4  
ATOM 5974  H HB3  . ALA A 1 93  ? 5.097   -1.446  -7.918  1.00 0.00 ? 93  ALA A HB3  4  
ATOM 5975  N N    . PRO A 1 94  ? 6.120   -1.902  -5.356  1.00 0.00 ? 94  PRO A N    4  
ATOM 5976  C CA   . PRO A 1 94  ? 6.979   -1.130  -4.452  1.00 0.00 ? 94  PRO A CA   4  
ATOM 5977  C C    . PRO A 1 94  ? 7.139   0.318   -4.900  1.00 0.00 ? 94  PRO A C    4  
ATOM 5978  O O    . PRO A 1 94  ? 6.879   0.654   -6.056  1.00 0.00 ? 94  PRO A O    4  
ATOM 5979  C CB   . PRO A 1 94  ? 8.320   -1.864  -4.525  1.00 0.00 ? 94  PRO A CB   4  
ATOM 5980  C CG   . PRO A 1 94  ? 8.312   -2.538  -5.854  1.00 0.00 ? 94  PRO A CG   4  
ATOM 5981  C CD   . PRO A 1 94  ? 6.878   -2.904  -6.124  1.00 0.00 ? 94  PRO A CD   4  
ATOM 5982  H HA   . PRO A 1 94  ? 6.609   -1.154  -3.438  1.00 0.00 ? 94  PRO A HA   4  
ATOM 5983  H HB2  . PRO A 1 94  ? 9.128   -1.150  -4.448  1.00 0.00 ? 94  PRO A HB2  4  
ATOM 5984  H HB3  . PRO A 1 94  ? 8.387   -2.580  -3.721  1.00 0.00 ? 94  PRO A HB3  4  
ATOM 5985  H HG2  . PRO A 1 94  ? 8.675   -1.860  -6.612  1.00 0.00 ? 94  PRO A HG2  4  
ATOM 5986  H HG3  . PRO A 1 94  ? 8.925   -3.426  -5.819  1.00 0.00 ? 94  PRO A HG3  4  
ATOM 5987  H HD2  . PRO A 1 94  ? 6.661   -2.827  -7.179  1.00 0.00 ? 94  PRO A HD2  4  
ATOM 5988  H HD3  . PRO A 1 94  ? 6.670   -3.901  -5.766  1.00 0.00 ? 94  PRO A HD3  4  
ATOM 5989  N N    . PHE A 1 95  ? 7.569   1.174   -3.978  1.00 0.00 ? 95  PHE A N    4  
ATOM 5990  C CA   . PHE A 1 95  ? 7.763   2.587   -4.279  1.00 0.00 ? 95  PHE A CA   4  
ATOM 5991  C C    . PHE A 1 95  ? 8.898   2.780   -5.280  1.00 0.00 ? 95  PHE A C    4  
ATOM 5992  O O    . PHE A 1 95  ? 8.666   3.133   -6.436  1.00 0.00 ? 95  PHE A O    4  
ATOM 5993  C CB   . PHE A 1 95  ? 8.062   3.366   -2.996  1.00 0.00 ? 95  PHE A CB   4  
ATOM 5994  C CG   . PHE A 1 95  ? 7.028   3.176   -1.924  1.00 0.00 ? 95  PHE A CG   4  
ATOM 5995  C CD1  . PHE A 1 95  ? 5.679   3.311   -2.212  1.00 0.00 ? 95  PHE A CD1  4  
ATOM 5996  C CD2  . PHE A 1 95  ? 7.404   2.862   -0.628  1.00 0.00 ? 95  PHE A CD2  4  
ATOM 5997  C CE1  . PHE A 1 95  ? 4.725   3.137   -1.227  1.00 0.00 ? 95  PHE A CE1  4  
ATOM 5998  C CE2  . PHE A 1 95  ? 6.454   2.687   0.361   1.00 0.00 ? 95  PHE A CE2  4  
ATOM 5999  C CZ   . PHE A 1 95  ? 5.113   2.823   0.061   1.00 0.00 ? 95  PHE A CZ   4  
ATOM 6000  H H    . PHE A 1 95  ? 7.759   0.846   -3.074  1.00 0.00 ? 95  PHE A H    4  
ATOM 6001  H HA   . PHE A 1 95  ? 6.849   2.962   -4.712  1.00 0.00 ? 95  PHE A HA   4  
ATOM 6002  H HB2  . PHE A 1 95  ? 9.013   3.043   -2.600  1.00 0.00 ? 95  PHE A HB2  4  
ATOM 6003  H HB3  . PHE A 1 95  ? 8.113   4.420   -3.227  1.00 0.00 ? 95  PHE A HB3  4  
ATOM 6004  H HD1  . PHE A 1 95  ? 5.374   3.555   -3.219  1.00 0.00 ? 95  PHE A HD1  4  
ATOM 6005  H HD2  . PHE A 1 95  ? 8.453   2.755   -0.392  1.00 0.00 ? 95  PHE A HD2  4  
ATOM 6006  H HE1  . PHE A 1 95  ? 3.677   3.244   -1.465  1.00 0.00 ? 95  PHE A HE1  4  
ATOM 6007  H HE2  . PHE A 1 95  ? 6.761   2.441   1.367   1.00 0.00 ? 95  PHE A HE2  4  
ATOM 6008  H HZ   . PHE A 1 95  ? 4.370   2.687   0.832   1.00 0.00 ? 95  PHE A HZ   4  
ATOM 6009  N N    . SER A 1 96  ? 10.125  2.545   -4.827  1.00 0.00 ? 96  SER A N    4  
ATOM 6010  C CA   . SER A 1 96  ? 11.297  2.696   -5.681  1.00 0.00 ? 96  SER A CA   4  
ATOM 6011  C C    . SER A 1 96  ? 11.852  1.334   -6.088  1.00 0.00 ? 96  SER A C    4  
ATOM 6012  O O    . SER A 1 96  ? 12.101  0.475   -5.242  1.00 0.00 ? 96  SER A O    4  
ATOM 6013  C CB   . SER A 1 96  ? 12.378  3.506   -4.962  1.00 0.00 ? 96  SER A CB   4  
ATOM 6014  O OG   . SER A 1 96  ? 13.251  4.128   -5.889  1.00 0.00 ? 96  SER A OG   4  
ATOM 6015  H H    . SER A 1 96  ? 10.245  2.266   -3.895  1.00 0.00 ? 96  SER A H    4  
ATOM 6016  H HA   . SER A 1 96  ? 10.993  3.228   -6.570  1.00 0.00 ? 96  SER A HA   4  
ATOM 6017  H HB2  . SER A 1 96  ? 11.910  4.269   -4.359  1.00 0.00 ? 96  SER A HB2  4  
ATOM 6018  H HB3  . SER A 1 96  ? 12.954  2.848   -4.328  1.00 0.00 ? 96  SER A HB3  4  
ATOM 6019  H HG   . SER A 1 96  ? 12.789  4.841   -6.335  1.00 0.00 ? 96  SER A HG   4  
ATOM 6020  N N    . SER A 1 97  ? 12.044  1.146   -7.390  1.00 0.00 ? 97  SER A N    4  
ATOM 6021  C CA   . SER A 1 97  ? 12.566  -0.112  -7.911  1.00 0.00 ? 97  SER A CA   4  
ATOM 6022  C C    . SER A 1 97  ? 13.834  0.122   -8.726  1.00 0.00 ? 97  SER A C    4  
ATOM 6023  O O    . SER A 1 97  ? 13.774  0.524   -9.887  1.00 0.00 ? 97  SER A O    4  
ATOM 6024  C CB   . SER A 1 97  ? 11.512  -0.808  -8.775  1.00 0.00 ? 97  SER A CB   4  
ATOM 6025  O OG   . SER A 1 97  ? 10.562  -1.487  -7.972  1.00 0.00 ? 97  SER A OG   4  
ATOM 6026  H H    . SER A 1 97  ? 11.827  1.869   -8.015  1.00 0.00 ? 97  SER A H    4  
ATOM 6027  H HA   . SER A 1 97  ? 12.804  -0.746  -7.070  1.00 0.00 ? 97  SER A HA   4  
ATOM 6028  H HB2  . SER A 1 97  ? 10.998  -0.071  -9.374  1.00 0.00 ? 97  SER A HB2  4  
ATOM 6029  H HB3  . SER A 1 97  ? 11.997  -1.524  -9.422  1.00 0.00 ? 97  SER A HB3  4  
ATOM 6030  H HG   . SER A 1 97  ? 10.300  -2.302  -8.407  1.00 0.00 ? 97  SER A HG   4  
ATOM 6031  N N    . GLY A 1 98  ? 14.983  -0.133  -8.107  1.00 0.00 ? 98  GLY A N    4  
ATOM 6032  C CA   . GLY A 1 98  ? 16.251  0.055   -8.789  1.00 0.00 ? 98  GLY A CA   4  
ATOM 6033  C C    . GLY A 1 98  ? 17.406  0.236   -7.825  1.00 0.00 ? 98  GLY A C    4  
ATOM 6034  O O    . GLY A 1 98  ? 17.237  0.204   -6.606  1.00 0.00 ? 98  GLY A O    4  
ATOM 6035  H H    . GLY A 1 98  ? 14.970  -0.452  -7.180  1.00 0.00 ? 98  GLY A H    4  
ATOM 6036  H HA2  . GLY A 1 98  ? 16.445  -0.807  -9.409  1.00 0.00 ? 98  GLY A HA2  4  
ATOM 6037  H HA3  . GLY A 1 98  ? 16.181  0.931   -9.418  1.00 0.00 ? 98  GLY A HA3  4  
ATOM 6038  N N    . PRO A 1 99  ? 18.615  0.431   -8.373  1.00 0.00 ? 99  PRO A N    4  
ATOM 6039  C CA   . PRO A 1 99  ? 19.827  0.621   -7.571  1.00 0.00 ? 99  PRO A CA   4  
ATOM 6040  C C    . PRO A 1 99  ? 19.835  1.959   -6.840  1.00 0.00 ? 99  PRO A C    4  
ATOM 6041  O O    . PRO A 1 99  ? 18.853  2.701   -6.873  1.00 0.00 ? 99  PRO A O    4  
ATOM 6042  C CB   . PRO A 1 99  ? 20.950  0.572   -8.610  1.00 0.00 ? 99  PRO A CB   4  
ATOM 6043  C CG   . PRO A 1 99  ? 20.305  0.988   -9.886  1.00 0.00 ? 99  PRO A CG   4  
ATOM 6044  C CD   . PRO A 1 99  ? 18.890  0.482   -9.819  1.00 0.00 ? 99  PRO A CD   4  
ATOM 6045  H HA   . PRO A 1 99  ? 19.959  -0.179  -6.857  1.00 0.00 ? 99  PRO A HA   4  
ATOM 6046  H HB2  . PRO A 1 99  ? 21.738  1.255   -8.323  1.00 0.00 ? 99  PRO A HB2  4  
ATOM 6047  H HB3  . PRO A 1 99  ? 21.342  -0.432  -8.674  1.00 0.00 ? 99  PRO A HB3  4  
ATOM 6048  H HG2  . PRO A 1 99  ? 20.314  2.064   -9.969  1.00 0.00 ? 99  PRO A HG2  4  
ATOM 6049  H HG3  . PRO A 1 99  ? 20.823  0.541   -10.722 1.00 0.00 ? 99  PRO A HG3  4  
ATOM 6050  H HD2  . PRO A 1 99  ? 18.220  1.168   -10.316 1.00 0.00 ? 99  PRO A HD2  4  
ATOM 6051  H HD3  . PRO A 1 99  ? 18.821  -0.502  -10.259 1.00 0.00 ? 99  PRO A HD3  4  
ATOM 6052  N N    . SER A 1 100 ? 20.948  2.261   -6.181  1.00 0.00 ? 100 SER A N    4  
ATOM 6053  C CA   . SER A 1 100 ? 21.083  3.509   -5.438  1.00 0.00 ? 100 SER A CA   4  
ATOM 6054  C C    . SER A 1 100 ? 22.075  4.444   -6.123  1.00 0.00 ? 100 SER A C    4  
ATOM 6055  O O    . SER A 1 100 ? 22.859  4.021   -6.972  1.00 0.00 ? 100 SER A O    4  
ATOM 6056  C CB   . SER A 1 100 ? 21.535  3.228   -4.004  1.00 0.00 ? 100 SER A CB   4  
ATOM 6057  O OG   . SER A 1 100 ? 20.473  2.699   -3.229  1.00 0.00 ? 100 SER A OG   4  
ATOM 6058  H H    . SER A 1 100 ? 21.697  1.628   -6.192  1.00 0.00 ? 100 SER A H    4  
ATOM 6059  H HA   . SER A 1 100 ? 20.114  3.986   -5.414  1.00 0.00 ? 100 SER A HA   4  
ATOM 6060  H HB2  . SER A 1 100 ? 22.345  2.515   -4.018  1.00 0.00 ? 100 SER A HB2  4  
ATOM 6061  H HB3  . SER A 1 100 ? 21.873  4.148   -3.549  1.00 0.00 ? 100 SER A HB3  4  
ATOM 6062  H HG   . SER A 1 100 ? 20.394  1.757   -3.396  1.00 0.00 ? 100 SER A HG   4  
ATOM 6063  N N    . SER A 1 101 ? 22.035  5.718   -5.745  1.00 0.00 ? 101 SER A N    4  
ATOM 6064  C CA   . SER A 1 101 ? 22.927  6.716   -6.324  1.00 0.00 ? 101 SER A CA   4  
ATOM 6065  C C    . SER A 1 101 ? 24.210  6.836   -5.508  1.00 0.00 ? 101 SER A C    4  
ATOM 6066  O O    . SER A 1 101 ? 25.313  6.753   -6.047  1.00 0.00 ? 101 SER A O    4  
ATOM 6067  C CB   . SER A 1 101 ? 22.228  8.074   -6.400  1.00 0.00 ? 101 SER A CB   4  
ATOM 6068  O OG   . SER A 1 101 ? 21.209  8.069   -7.385  1.00 0.00 ? 101 SER A OG   4  
ATOM 6069  H H    . SER A 1 101 ? 21.387  5.994   -5.063  1.00 0.00 ? 101 SER A H    4  
ATOM 6070  H HA   . SER A 1 101 ? 23.180  6.394   -7.324  1.00 0.00 ? 101 SER A HA   4  
ATOM 6071  H HB2  . SER A 1 101 ? 21.785  8.302   -5.443  1.00 0.00 ? 101 SER A HB2  4  
ATOM 6072  H HB3  . SER A 1 101 ? 22.952  8.835   -6.652  1.00 0.00 ? 101 SER A HB3  4  
ATOM 6073  H HG   . SER A 1 101 ? 21.120  8.949   -7.759  1.00 0.00 ? 101 SER A HG   4  
ATOM 6074  N N    . GLY A 1 102 ? 24.057  7.033   -4.202  1.00 0.00 ? 102 GLY A N    4  
ATOM 6075  C CA   . GLY A 1 102 ? 25.210  7.162   -3.330  1.00 0.00 ? 102 GLY A CA   4  
ATOM 6076  C C    . GLY A 1 102 ? 25.037  6.413   -2.024  1.00 0.00 ? 102 GLY A C    4  
ATOM 6077  O O    . GLY A 1 102 ? 25.822  6.586   -1.092  1.00 0.00 ? 102 GLY A O    4  
ATOM 6078  H H    . GLY A 1 102 ? 23.153  7.091   -3.827  1.00 0.00 ? 102 GLY A H    4  
ATOM 6079  H HA2  . GLY A 1 102 ? 26.079  6.777   -3.842  1.00 0.00 ? 102 GLY A HA2  4  
ATOM 6080  H HA3  . GLY A 1 102 ? 25.367  8.209   -3.113  1.00 0.00 ? 102 GLY A HA3  4  
ATOM 6081  N N    . GLY A 1 1   ? 24.208  17.757  -5.765  1.00 0.00 ? 1   GLY A N    5  
ATOM 6082  C CA   . GLY A 1 1   ? 23.238  16.772  -5.323  1.00 0.00 ? 1   GLY A CA   5  
ATOM 6083  C C    . GLY A 1 1   ? 23.884  15.456  -4.936  1.00 0.00 ? 1   GLY A C    5  
ATOM 6084  O O    . GLY A 1 1   ? 25.036  15.196  -5.284  1.00 0.00 ? 1   GLY A O    5  
ATOM 6085  H H1   . GLY A 1 1   ? 24.012  18.319  -6.544  1.00 0.00 ? 1   GLY A H1   5  
ATOM 6086  H HA2  . GLY A 1 1   ? 22.706  17.164  -4.469  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6087  H HA3  . GLY A 1 1   ? 22.534  16.592  -6.122  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6088  N N    . SER A 1 2   ? 23.141  14.624  -4.213  1.00 0.00 ? 2   SER A N    5  
ATOM 6089  C CA   . SER A 1 2   ? 23.650  13.330  -3.773  1.00 0.00 ? 2   SER A CA   5  
ATOM 6090  C C    . SER A 1 2   ? 23.312  12.241  -4.787  1.00 0.00 ? 2   SER A C    5  
ATOM 6091  O O    . SER A 1 2   ? 22.172  12.130  -5.238  1.00 0.00 ? 2   SER A O    5  
ATOM 6092  C CB   . SER A 1 2   ? 23.070  12.968  -2.405  1.00 0.00 ? 2   SER A CB   5  
ATOM 6093  O OG   . SER A 1 2   ? 23.524  13.863  -1.405  1.00 0.00 ? 2   SER A OG   5  
ATOM 6094  H H    . SER A 1 2   ? 22.230  14.888  -3.967  1.00 0.00 ? 2   SER A H    5  
ATOM 6095  H HA   . SER A 1 2   ? 24.724  13.407  -3.691  1.00 0.00 ? 2   SER A HA   5  
ATOM 6096  H HB2  . SER A 1 2   ? 21.992  13.015  -2.450  1.00 0.00 ? 2   SER A HB2  5  
ATOM 6097  H HB3  . SER A 1 2   ? 23.376  11.966  -2.141  1.00 0.00 ? 2   SER A HB3  5  
ATOM 6098  H HG   . SER A 1 2   ? 23.486  13.433  -0.548  1.00 0.00 ? 2   SER A HG   5  
ATOM 6099  N N    . SER A 1 3   ? 24.311  11.439  -5.140  1.00 0.00 ? 3   SER A N    5  
ATOM 6100  C CA   . SER A 1 3   ? 24.122  10.360  -6.102  1.00 0.00 ? 3   SER A CA   5  
ATOM 6101  C C    . SER A 1 3   ? 24.739  9.061   -5.591  1.00 0.00 ? 3   SER A C    5  
ATOM 6102  O O    . SER A 1 3   ? 25.347  9.028   -4.522  1.00 0.00 ? 3   SER A O    5  
ATOM 6103  C CB   . SER A 1 3   ? 24.741  10.736  -7.450  1.00 0.00 ? 3   SER A CB   5  
ATOM 6104  O OG   . SER A 1 3   ? 24.260  9.895   -8.484  1.00 0.00 ? 3   SER A OG   5  
ATOM 6105  H H    . SER A 1 3   ? 25.198  11.578  -4.745  1.00 0.00 ? 3   SER A H    5  
ATOM 6106  H HA   . SER A 1 3   ? 23.060  10.213  -6.232  1.00 0.00 ? 3   SER A HA   5  
ATOM 6107  H HB2  . SER A 1 3   ? 24.487  11.758  -7.687  1.00 0.00 ? 3   SER A HB2  5  
ATOM 6108  H HB3  . SER A 1 3   ? 25.815  10.636  -7.390  1.00 0.00 ? 3   SER A HB3  5  
ATOM 6109  H HG   . SER A 1 3   ? 24.890  9.188   -8.641  1.00 0.00 ? 3   SER A HG   5  
ATOM 6110  N N    . GLY A 1 4   ? 24.578  7.992   -6.365  1.00 0.00 ? 4   GLY A N    5  
ATOM 6111  C CA   . GLY A 1 4   ? 25.124  6.705   -5.975  1.00 0.00 ? 4   GLY A CA   5  
ATOM 6112  C C    . GLY A 1 4   ? 25.947  6.067   -7.077  1.00 0.00 ? 4   GLY A C    5  
ATOM 6113  O O    . GLY A 1 4   ? 27.176  6.039   -7.005  1.00 0.00 ? 4   GLY A O    5  
ATOM 6114  H H    . GLY A 1 4   ? 24.084  8.078   -7.207  1.00 0.00 ? 4   GLY A H    5  
ATOM 6115  H HA2  . GLY A 1 4   ? 25.748  6.840   -5.105  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6116  H HA3  . GLY A 1 4   ? 24.309  6.043   -5.722  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6117  N N    . SER A 1 5   ? 25.270  5.552   -8.097  1.00 0.00 ? 5   SER A N    5  
ATOM 6118  C CA   . SER A 1 5   ? 25.946  4.906   -9.216  1.00 0.00 ? 5   SER A CA   5  
ATOM 6119  C C    . SER A 1 5   ? 25.121  5.027   -10.493 1.00 0.00 ? 5   SER A C    5  
ATOM 6120  O O    . SER A 1 5   ? 23.996  5.526   -10.473 1.00 0.00 ? 5   SER A O    5  
ATOM 6121  C CB   . SER A 1 5   ? 26.204  3.431   -8.900  1.00 0.00 ? 5   SER A CB   5  
ATOM 6122  O OG   . SER A 1 5   ? 27.364  2.962   -9.566  1.00 0.00 ? 5   SER A OG   5  
ATOM 6123  H H    . SER A 1 5   ? 24.291  5.605   -8.096  1.00 0.00 ? 5   SER A H    5  
ATOM 6124  H HA   . SER A 1 5   ? 26.893  5.404   -9.363  1.00 0.00 ? 5   SER A HA   5  
ATOM 6125  H HB2  . SER A 1 5   ? 26.342  3.312   -7.836  1.00 0.00 ? 5   SER A HB2  5  
ATOM 6126  H HB3  . SER A 1 5   ? 25.356  2.843   -9.222  1.00 0.00 ? 5   SER A HB3  5  
ATOM 6127  H HG   . SER A 1 5   ? 28.129  3.080   -8.998  1.00 0.00 ? 5   SER A HG   5  
ATOM 6128  N N    . SER A 1 6   ? 25.690  4.568   -11.603 1.00 0.00 ? 6   SER A N    5  
ATOM 6129  C CA   . SER A 1 6   ? 25.010  4.628   -12.892 1.00 0.00 ? 6   SER A CA   5  
ATOM 6130  C C    . SER A 1 6   ? 23.514  4.377   -12.729 1.00 0.00 ? 6   SER A C    5  
ATOM 6131  O O    . SER A 1 6   ? 23.098  3.317   -12.262 1.00 0.00 ? 6   SER A O    5  
ATOM 6132  C CB   . SER A 1 6   ? 25.608  3.602   -13.857 1.00 0.00 ? 6   SER A CB   5  
ATOM 6133  O OG   . SER A 1 6   ? 26.689  4.158   -14.585 1.00 0.00 ? 6   SER A OG   5  
ATOM 6134  H H    . SER A 1 6   ? 26.589  4.181   -11.554 1.00 0.00 ? 6   SER A H    5  
ATOM 6135  H HA   . SER A 1 6   ? 25.155  5.618   -13.297 1.00 0.00 ? 6   SER A HA   5  
ATOM 6136  H HB2  . SER A 1 6   ? 25.966  2.752   -13.297 1.00 0.00 ? 6   SER A HB2  5  
ATOM 6137  H HB3  . SER A 1 6   ? 24.847  3.281   -14.553 1.00 0.00 ? 6   SER A HB3  5  
ATOM 6138  H HG   . SER A 1 6   ? 27.447  4.260   -14.005 1.00 0.00 ? 6   SER A HG   5  
ATOM 6139  N N    . GLY A 1 7   ? 22.709  5.361   -13.118 1.00 0.00 ? 7   GLY A N    5  
ATOM 6140  C CA   . GLY A 1 7   ? 21.268  5.229   -13.007 1.00 0.00 ? 7   GLY A CA   5  
ATOM 6141  C C    . GLY A 1 7   ? 20.816  4.980   -11.582 1.00 0.00 ? 7   GLY A C    5  
ATOM 6142  O O    . GLY A 1 7   ? 21.380  5.535   -10.639 1.00 0.00 ? 7   GLY A O    5  
ATOM 6143  H H    . GLY A 1 7   ? 23.097  6.184   -13.483 1.00 0.00 ? 7   GLY A H    5  
ATOM 6144  H HA2  . GLY A 1 7   ? 20.805  6.136   -13.367 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6145  H HA3  . GLY A 1 7   ? 20.945  4.403   -13.624 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6146  N N    . ASN A 1 8   ? 19.795  4.144   -11.424 1.00 0.00 ? 8   ASN A N    5  
ATOM 6147  C CA   . ASN A 1 8   ? 19.267  3.824   -10.102 1.00 0.00 ? 8   ASN A CA   5  
ATOM 6148  C C    . ASN A 1 8   ? 19.354  2.326   -9.830  1.00 0.00 ? 8   ASN A C    5  
ATOM 6149  O O    . ASN A 1 8   ? 19.881  1.902   -8.802  1.00 0.00 ? 8   ASN A O    5  
ATOM 6150  C CB   . ASN A 1 8   ? 17.815  4.292   -9.985  1.00 0.00 ? 8   ASN A CB   5  
ATOM 6151  C CG   . ASN A 1 8   ? 17.706  5.787   -9.754  1.00 0.00 ? 8   ASN A CG   5  
ATOM 6152  O OD1  . ASN A 1 8   ? 17.924  6.584   -10.667 1.00 0.00 ? 8   ASN A OD1  5  
ATOM 6153  N ND2  . ASN A 1 8   ? 17.367  6.174   -8.530  1.00 0.00 ? 8   ASN A ND2  5  
ATOM 6154  H H    . ASN A 1 8   ? 19.387  3.732   -12.214 1.00 0.00 ? 8   ASN A H    5  
ATOM 6155  H HA   . ASN A 1 8   ? 19.864  4.347   -9.371  1.00 0.00 ? 8   ASN A HA   5  
ATOM 6156  H HB2  . ASN A 1 8   ? 17.289  4.049   -10.897 1.00 0.00 ? 8   ASN A HB2  5  
ATOM 6157  H HB3  . ASN A 1 8   ? 17.345  3.783   -9.157  1.00 0.00 ? 8   ASN A HB3  5  
ATOM 6158  H HD21 . ASN A 1 8   ? 17.209  5.483   -7.853  1.00 0.00 ? 8   ASN A HD21 5  
ATOM 6159  H HD22 . ASN A 1 8   ? 17.289  7.134   -8.353  1.00 0.00 ? 8   ASN A HD22 5  
ATOM 6160  N N    . GLU A 1 9   ? 18.833  1.529   -10.758 1.00 0.00 ? 9   GLU A N    5  
ATOM 6161  C CA   . GLU A 1 9   ? 18.852  0.078   -10.616 1.00 0.00 ? 9   GLU A CA   5  
ATOM 6162  C C    . GLU A 1 9   ? 18.164  -0.352  -9.324  1.00 0.00 ? 9   GLU A C    5  
ATOM 6163  O O    . GLU A 1 9   ? 18.666  -1.208  -8.595  1.00 0.00 ? 9   GLU A O    5  
ATOM 6164  C CB   . GLU A 1 9   ? 20.291  -0.440  -10.638 1.00 0.00 ? 9   GLU A CB   5  
ATOM 6165  C CG   . GLU A 1 9   ? 20.869  -0.575  -12.037 1.00 0.00 ? 9   GLU A CG   5  
ATOM 6166  C CD   . GLU A 1 9   ? 21.520  0.704   -12.526 1.00 0.00 ? 9   GLU A CD   5  
ATOM 6167  O OE1  . GLU A 1 9   ? 22.728  0.891   -12.271 1.00 0.00 ? 9   GLU A OE1  5  
ATOM 6168  O OE2  . GLU A 1 9   ? 20.820  1.518   -13.164 1.00 0.00 ? 9   GLU A OE2  5  
ATOM 6169  H H    . GLU A 1 9   ? 18.426  1.927   -11.556 1.00 0.00 ? 9   GLU A H    5  
ATOM 6170  H HA   . GLU A 1 9   ? 18.315  -0.344  -11.453 1.00 0.00 ? 9   GLU A HA   5  
ATOM 6171  H HB2  . GLU A 1 9   ? 20.915  0.241   -10.077 1.00 0.00 ? 9   GLU A HB2  5  
ATOM 6172  H HB3  . GLU A 1 9   ? 20.319  -1.410  -10.165 1.00 0.00 ? 9   GLU A HB3  5  
ATOM 6173  H HG2  . GLU A 1 9   ? 21.611  -1.359  -12.032 1.00 0.00 ? 9   GLU A HG2  5  
ATOM 6174  H HG3  . GLU A 1 9   ? 20.072  -0.840  -12.717 1.00 0.00 ? 9   GLU A HG3  5  
ATOM 6175  N N    . VAL A 1 10  ? 17.012  0.250   -9.045  1.00 0.00 ? 10  VAL A N    5  
ATOM 6176  C CA   . VAL A 1 10  ? 16.254  -0.070  -7.841  1.00 0.00 ? 10  VAL A CA   5  
ATOM 6177  C C    . VAL A 1 10  ? 15.864  -1.544  -7.812  1.00 0.00 ? 10  VAL A C    5  
ATOM 6178  O O    . VAL A 1 10  ? 15.839  -2.169  -6.752  1.00 0.00 ? 10  VAL A O    5  
ATOM 6179  C CB   . VAL A 1 10  ? 14.980  0.789   -7.735  1.00 0.00 ? 10  VAL A CB   5  
ATOM 6180  C CG1  . VAL A 1 10  ? 14.182  0.409   -6.497  1.00 0.00 ? 10  VAL A CG1  5  
ATOM 6181  C CG2  . VAL A 1 10  ? 15.336  2.268   -7.717  1.00 0.00 ? 10  VAL A CG2  5  
ATOM 6182  H H    . VAL A 1 10  ? 16.663  0.924   -9.664  1.00 0.00 ? 10  VAL A H    5  
ATOM 6183  H HA   . VAL A 1 10  ? 16.880  0.144   -6.986  1.00 0.00 ? 10  VAL A HA   5  
ATOM 6184  H HB   . VAL A 1 10  ? 14.368  0.598   -8.604  1.00 0.00 ? 10  VAL A HB   5  
ATOM 6185  H HG11 . VAL A 1 10  ? 14.635  0.857   -5.625  1.00 0.00 ? 10  VAL A HG11 5  
ATOM 6186  H HG12 . VAL A 1 10  ? 13.167  0.765   -6.600  1.00 0.00 ? 10  VAL A HG12 5  
ATOM 6187  H HG13 . VAL A 1 10  ? 14.177  -0.665  -6.388  1.00 0.00 ? 10  VAL A HG13 5  
ATOM 6188  H HG21 . VAL A 1 10  ? 15.832  2.529   -8.639  1.00 0.00 ? 10  VAL A HG21 5  
ATOM 6189  H HG22 . VAL A 1 10  ? 14.434  2.854   -7.615  1.00 0.00 ? 10  VAL A HG22 5  
ATOM 6190  H HG23 . VAL A 1 10  ? 15.992  2.471   -6.884  1.00 0.00 ? 10  VAL A HG23 5  
ATOM 6191  N N    . ASP A 1 11  ? 15.562  -2.093  -8.984  1.00 0.00 ? 11  ASP A N    5  
ATOM 6192  C CA   . ASP A 1 11  ? 15.174  -3.494  -9.094  1.00 0.00 ? 11  ASP A CA   5  
ATOM 6193  C C    . ASP A 1 11  ? 16.334  -4.339  -9.611  1.00 0.00 ? 11  ASP A C    5  
ATOM 6194  O O    . ASP A 1 11  ? 16.153  -5.195  -10.478 1.00 0.00 ? 11  ASP A O    5  
ATOM 6195  C CB   . ASP A 1 11  ? 13.967  -3.640  -10.021 1.00 0.00 ? 11  ASP A CB   5  
ATOM 6196  C CG   . ASP A 1 11  ? 12.719  -2.993  -9.454  1.00 0.00 ? 11  ASP A CG   5  
ATOM 6197  O OD1  . ASP A 1 11  ? 12.781  -1.798  -9.097  1.00 0.00 ? 11  ASP A OD1  5  
ATOM 6198  O OD2  . ASP A 1 11  ? 11.681  -3.681  -9.366  1.00 0.00 ? 11  ASP A OD2  5  
ATOM 6199  H H    . ASP A 1 11  ? 15.601  -1.542  -9.794  1.00 0.00 ? 11  ASP A H    5  
ATOM 6200  H HA   . ASP A 1 11  ? 14.903  -3.842  -8.109  1.00 0.00 ? 11  ASP A HA   5  
ATOM 6201  H HB2  . ASP A 1 11  ? 14.191  -3.174  -10.970 1.00 0.00 ? 11  ASP A HB2  5  
ATOM 6202  H HB3  . ASP A 1 11  ? 13.767  -4.690  -10.179 1.00 0.00 ? 11  ASP A HB3  5  
ATOM 6203  N N    . ASP A 1 12  ? 17.524  -4.093  -9.075  1.00 0.00 ? 12  ASP A N    5  
ATOM 6204  C CA   . ASP A 1 12  ? 18.714  -4.831  -9.482  1.00 0.00 ? 12  ASP A CA   5  
ATOM 6205  C C    . ASP A 1 12  ? 19.475  -5.349  -8.266  1.00 0.00 ? 12  ASP A C    5  
ATOM 6206  O O    . ASP A 1 12  ? 20.705  -5.384  -8.260  1.00 0.00 ? 12  ASP A O    5  
ATOM 6207  C CB   . ASP A 1 12  ? 19.626  -3.943  -10.330 1.00 0.00 ? 12  ASP A CB   5  
ATOM 6208  C CG   . ASP A 1 12  ? 20.440  -4.738  -11.332 1.00 0.00 ? 12  ASP A CG   5  
ATOM 6209  O OD1  . ASP A 1 12  ? 19.934  -4.981  -12.448 1.00 0.00 ? 12  ASP A OD1  5  
ATOM 6210  O OD2  . ASP A 1 12  ? 21.583  -5.116  -11.001 1.00 0.00 ? 12  ASP A OD2  5  
ATOM 6211  H H    . ASP A 1 12  ? 17.604  -3.398  -8.388  1.00 0.00 ? 12  ASP A H    5  
ATOM 6212  H HA   . ASP A 1 12  ? 18.394  -5.674  -10.077 1.00 0.00 ? 12  ASP A HA   5  
ATOM 6213  H HB2  . ASP A 1 12  ? 19.022  -3.229  -10.870 1.00 0.00 ? 12  ASP A HB2  5  
ATOM 6214  H HB3  . ASP A 1 12  ? 20.307  -3.413  -9.679  1.00 0.00 ? 12  ASP A HB3  5  
ATOM 6215  N N    . MET A 1 13  ? 18.734  -5.750  -7.238  1.00 0.00 ? 13  MET A N    5  
ATOM 6216  C CA   . MET A 1 13  ? 19.339  -6.267  -6.016  1.00 0.00 ? 13  MET A CA   5  
ATOM 6217  C C    . MET A 1 13  ? 18.320  -7.048  -5.192  1.00 0.00 ? 13  MET A C    5  
ATOM 6218  O O    . MET A 1 13  ? 17.119  -6.788  -5.265  1.00 0.00 ? 13  MET A O    5  
ATOM 6219  C CB   . MET A 1 13  ? 19.914  -5.120  -5.182  1.00 0.00 ? 13  MET A CB   5  
ATOM 6220  C CG   . MET A 1 13  ? 21.000  -5.558  -4.212  1.00 0.00 ? 13  MET A CG   5  
ATOM 6221  S SD   . MET A 1 13  ? 21.673  -4.186  -3.256  1.00 0.00 ? 13  MET A SD   5  
ATOM 6222  C CE   . MET A 1 13  ? 22.928  -3.575  -4.379  1.00 0.00 ? 13  MET A CE   5  
ATOM 6223  H H    . MET A 1 13  ? 17.757  -5.698  -7.302  1.00 0.00 ? 13  MET A H    5  
ATOM 6224  H HA   . MET A 1 13  ? 20.142  -6.931  -6.299  1.00 0.00 ? 13  MET A HA   5  
ATOM 6225  H HB2  . MET A 1 13  ? 20.334  -4.381  -5.848  1.00 0.00 ? 13  MET A HB2  5  
ATOM 6226  H HB3  . MET A 1 13  ? 19.116  -4.668  -4.613  1.00 0.00 ? 13  MET A HB3  5  
ATOM 6227  H HG2  . MET A 1 13  ? 20.583  -6.283  -3.529  1.00 0.00 ? 13  MET A HG2  5  
ATOM 6228  H HG3  . MET A 1 13  ? 21.801  -6.016  -4.774  1.00 0.00 ? 13  MET A HG3  5  
ATOM 6229  H HE1  . MET A 1 13  ? 23.470  -2.768  -3.909  1.00 0.00 ? 13  MET A HE1  5  
ATOM 6230  H HE2  . MET A 1 13  ? 23.613  -4.374  -4.622  1.00 0.00 ? 13  MET A HE2  5  
ATOM 6231  H HE3  . MET A 1 13  ? 22.458  -3.215  -5.282  1.00 0.00 ? 13  MET A HE3  5  
ATOM 6232  N N    . ASP A 1 14  ? 18.807  -8.005  -4.411  1.00 0.00 ? 14  ASP A N    5  
ATOM 6233  C CA   . ASP A 1 14  ? 17.939  -8.824  -3.573  1.00 0.00 ? 14  ASP A CA   5  
ATOM 6234  C C    . ASP A 1 14  ? 18.093  -8.451  -2.102  1.00 0.00 ? 14  ASP A C    5  
ATOM 6235  O O    . ASP A 1 14  ? 19.195  -8.489  -1.553  1.00 0.00 ? 14  ASP A O    5  
ATOM 6236  C CB   . ASP A 1 14  ? 18.254  -10.308 -3.772  1.00 0.00 ? 14  ASP A CB   5  
ATOM 6237  C CG   . ASP A 1 14  ? 19.737  -10.565 -3.955  1.00 0.00 ? 14  ASP A CG   5  
ATOM 6238  O OD1  . ASP A 1 14  ? 20.535  -10.014 -3.169  1.00 0.00 ? 14  ASP A OD1  5  
ATOM 6239  O OD2  . ASP A 1 14  ? 20.098  -11.317 -4.884  1.00 0.00 ? 14  ASP A OD2  5  
ATOM 6240  H H    . ASP A 1 14  ? 19.775  -8.165  -4.396  1.00 0.00 ? 14  ASP A H    5  
ATOM 6241  H HA   . ASP A 1 14  ? 16.918  -8.639  -3.873  1.00 0.00 ? 14  ASP A HA   5  
ATOM 6242  H HB2  . ASP A 1 14  ? 17.916  -10.860 -2.907  1.00 0.00 ? 14  ASP A HB2  5  
ATOM 6243  H HB3  . ASP A 1 14  ? 17.733  -10.665 -4.648  1.00 0.00 ? 14  ASP A HB3  5  
ATOM 6244  N N    . THR A 1 15  ? 16.982  -8.090  -1.468  1.00 0.00 ? 15  THR A N    5  
ATOM 6245  C CA   . THR A 1 15  ? 16.994  -7.708  -0.062  1.00 0.00 ? 15  THR A CA   5  
ATOM 6246  C C    . THR A 1 15  ? 15.637  -7.955  0.587   1.00 0.00 ? 15  THR A C    5  
ATOM 6247  O O    . THR A 1 15  ? 14.610  -7.983  -0.092  1.00 0.00 ? 15  THR A O    5  
ATOM 6248  C CB   . THR A 1 15  ? 17.371  -6.225  0.114   1.00 0.00 ? 15  THR A CB   5  
ATOM 6249  O OG1  . THR A 1 15  ? 16.504  -5.401  -0.673  1.00 0.00 ? 15  THR A OG1  5  
ATOM 6250  C CG2  . THR A 1 15  ? 18.817  -5.982  -0.294  1.00 0.00 ? 15  THR A CG2  5  
ATOM 6251  H H    . THR A 1 15  ? 16.134  -8.079  -1.960  1.00 0.00 ? 15  THR A H    5  
ATOM 6252  H HA   . THR A 1 15  ? 17.737  -8.309  0.441   1.00 0.00 ? 15  THR A HA   5  
ATOM 6253  H HB   . THR A 1 15  ? 17.258  -5.961  1.156   1.00 0.00 ? 15  THR A HB   5  
ATOM 6254  H HG1  . THR A 1 15  ? 16.952  -4.580  -0.890  1.00 0.00 ? 15  THR A HG1  5  
ATOM 6255  H HG21 . THR A 1 15  ? 18.940  -6.218  -1.340  1.00 0.00 ? 15  THR A HG21 5  
ATOM 6256  H HG22 . THR A 1 15  ? 19.467  -6.610  0.297   1.00 0.00 ? 15  THR A HG22 5  
ATOM 6257  H HG23 . THR A 1 15  ? 19.068  -4.946  -0.127  1.00 0.00 ? 15  THR A HG23 5  
ATOM 6258  N N    . SER A 1 16  ? 15.639  -8.133  1.904   1.00 0.00 ? 16  SER A N    5  
ATOM 6259  C CA   . SER A 1 16  ? 14.407  -8.381  2.644   1.00 0.00 ? 16  SER A CA   5  
ATOM 6260  C C    . SER A 1 16  ? 13.632  -7.085  2.858   1.00 0.00 ? 16  SER A C    5  
ATOM 6261  O O    . SER A 1 16  ? 12.440  -7.005  2.560   1.00 0.00 ? 16  SER A O    5  
ATOM 6262  C CB   . SER A 1 16  ? 14.720  -9.030  3.993   1.00 0.00 ? 16  SER A CB   5  
ATOM 6263  O OG   . SER A 1 16  ? 15.589  -8.217  4.761   1.00 0.00 ? 16  SER A OG   5  
ATOM 6264  H H    . SER A 1 16  ? 16.490  -8.099  2.389   1.00 0.00 ? 16  SER A H    5  
ATOM 6265  H HA   . SER A 1 16  ? 13.800  -9.057  2.060   1.00 0.00 ? 16  SER A HA   5  
ATOM 6266  H HB2  . SER A 1 16  ? 13.802  -9.174  4.542   1.00 0.00 ? 16  SER A HB2  5  
ATOM 6267  H HB3  . SER A 1 16  ? 15.194  -9.987  3.828   1.00 0.00 ? 16  SER A HB3  5  
ATOM 6268  H HG   . SER A 1 16  ? 16.379  -8.715  4.986   1.00 0.00 ? 16  SER A HG   5  
ATOM 6269  N N    . ASP A 1 17  ? 14.317  -6.072  3.376   1.00 0.00 ? 17  ASP A N    5  
ATOM 6270  C CA   . ASP A 1 17  ? 13.694  -4.778  3.630   1.00 0.00 ? 17  ASP A CA   5  
ATOM 6271  C C    . ASP A 1 17  ? 13.098  -4.201  2.350   1.00 0.00 ? 17  ASP A C    5  
ATOM 6272  O O    . ASP A 1 17  ? 13.821  -3.725  1.475   1.00 0.00 ? 17  ASP A O    5  
ATOM 6273  C CB   . ASP A 1 17  ? 14.716  -3.802  4.216   1.00 0.00 ? 17  ASP A CB   5  
ATOM 6274  C CG   . ASP A 1 17  ? 14.082  -2.503  4.672   1.00 0.00 ? 17  ASP A CG   5  
ATOM 6275  O OD1  . ASP A 1 17  ? 13.012  -2.145  4.136   1.00 0.00 ? 17  ASP A OD1  5  
ATOM 6276  O OD2  . ASP A 1 17  ? 14.654  -1.845  5.565   1.00 0.00 ? 17  ASP A OD2  5  
ATOM 6277  H H    . ASP A 1 17  ? 15.265  -6.197  3.593   1.00 0.00 ? 17  ASP A H    5  
ATOM 6278  H HA   . ASP A 1 17  ? 12.901  -4.926  4.347   1.00 0.00 ? 17  ASP A HA   5  
ATOM 6279  H HB2  . ASP A 1 17  ? 15.199  -4.263  5.066   1.00 0.00 ? 17  ASP A HB2  5  
ATOM 6280  H HB3  . ASP A 1 17  ? 15.459  -3.575  3.465   1.00 0.00 ? 17  ASP A HB3  5  
ATOM 6281  N N    . THR A 1 18  ? 11.773  -4.248  2.247   1.00 0.00 ? 18  THR A N    5  
ATOM 6282  C CA   . THR A 1 18  ? 11.079  -3.733  1.074   1.00 0.00 ? 18  THR A CA   5  
ATOM 6283  C C    . THR A 1 18  ? 9.639   -3.361  1.406   1.00 0.00 ? 18  THR A C    5  
ATOM 6284  O O    . THR A 1 18  ? 8.918   -4.136  2.034   1.00 0.00 ? 18  THR A O    5  
ATOM 6285  C CB   . THR A 1 18  ? 11.080  -4.760  -0.075  1.00 0.00 ? 18  THR A CB   5  
ATOM 6286  O OG1  . THR A 1 18  ? 12.424  -5.132  -0.398  1.00 0.00 ? 18  THR A OG1  5  
ATOM 6287  C CG2  . THR A 1 18  ? 10.395  -4.191  -1.309  1.00 0.00 ? 18  THR A CG2  5  
ATOM 6288  H H    . THR A 1 18  ? 11.251  -4.640  2.978   1.00 0.00 ? 18  THR A H    5  
ATOM 6289  H HA   . THR A 1 18  ? 11.601  -2.849  0.739   1.00 0.00 ? 18  THR A HA   5  
ATOM 6290  H HB   . THR A 1 18  ? 10.539  -5.638  0.247   1.00 0.00 ? 18  THR A HB   5  
ATOM 6291  H HG1  . THR A 1 18  ? 12.447  -6.056  -0.659  1.00 0.00 ? 18  THR A HG1  5  
ATOM 6292  H HG21 . THR A 1 18  ? 10.192  -4.989  -2.008  1.00 0.00 ? 18  THR A HG21 5  
ATOM 6293  H HG22 . THR A 1 18  ? 11.040  -3.461  -1.774  1.00 0.00 ? 18  THR A HG22 5  
ATOM 6294  H HG23 . THR A 1 18  ? 9.467   -3.721  -1.020  1.00 0.00 ? 18  THR A HG23 5  
ATOM 6295  N N    . GLN A 1 19  ? 9.226   -2.172  0.980   1.00 0.00 ? 19  GLN A N    5  
ATOM 6296  C CA   . GLN A 1 19  ? 7.871   -1.698  1.234   1.00 0.00 ? 19  GLN A CA   5  
ATOM 6297  C C    . GLN A 1 19  ? 7.011   -1.812  -0.021  1.00 0.00 ? 19  GLN A C    5  
ATOM 6298  O O    . GLN A 1 19  ? 7.409   -1.374  -1.100  1.00 0.00 ? 19  GLN A O    5  
ATOM 6299  C CB   . GLN A 1 19  ? 7.897   -0.247  1.717   1.00 0.00 ? 19  GLN A CB   5  
ATOM 6300  C CG   . GLN A 1 19  ? 8.302   -0.099  3.175   1.00 0.00 ? 19  GLN A CG   5  
ATOM 6301  C CD   . GLN A 1 19  ? 8.214   1.334   3.662   1.00 0.00 ? 19  GLN A CD   5  
ATOM 6302  O OE1  . GLN A 1 19  ? 8.523   2.272   2.927   1.00 0.00 ? 19  GLN A OE1  5  
ATOM 6303  N NE2  . GLN A 1 19  ? 7.790   1.511   4.908   1.00 0.00 ? 19  GLN A NE2  5  
ATOM 6304  H H    . GLN A 1 19  ? 9.848   -1.599  0.485   1.00 0.00 ? 19  GLN A H    5  
ATOM 6305  H HA   . GLN A 1 19  ? 7.442   -2.317  2.007   1.00 0.00 ? 19  GLN A HA   5  
ATOM 6306  H HB2  . GLN A 1 19  ? 8.598   0.309   1.113   1.00 0.00 ? 19  GLN A HB2  5  
ATOM 6307  H HB3  . GLN A 1 19  ? 6.912   0.179   1.595   1.00 0.00 ? 19  GLN A HB3  5  
ATOM 6308  H HG2  . GLN A 1 19  ? 7.648   -0.709  3.781   1.00 0.00 ? 19  GLN A HG2  5  
ATOM 6309  H HG3  . GLN A 1 19  ? 9.320   -0.441  3.289   1.00 0.00 ? 19  GLN A HG3  5  
ATOM 6310  H HE21 . GLN A 1 19  ? 7.562   0.717   5.436   1.00 0.00 ? 19  GLN A HE21 5  
ATOM 6311  H HE22 . GLN A 1 19  ? 7.725   2.427   5.249   1.00 0.00 ? 19  GLN A HE22 5  
ATOM 6312  N N    . TRP A 1 20  ? 5.831   -2.404  0.129   1.00 0.00 ? 20  TRP A N    5  
ATOM 6313  C CA   . TRP A 1 20  ? 4.915   -2.577  -0.992  1.00 0.00 ? 20  TRP A CA   5  
ATOM 6314  C C    . TRP A 1 20  ? 3.846   -1.489  -0.994  1.00 0.00 ? 20  TRP A C    5  
ATOM 6315  O O    . TRP A 1 20  ? 3.142   -1.295  -0.004  1.00 0.00 ? 20  TRP A O    5  
ATOM 6316  C CB   . TRP A 1 20  ? 4.256   -3.956  -0.931  1.00 0.00 ? 20  TRP A CB   5  
ATOM 6317  C CG   . TRP A 1 20  ? 5.227   -5.086  -1.097  1.00 0.00 ? 20  TRP A CG   5  
ATOM 6318  C CD1  . TRP A 1 20  ? 5.880   -5.757  -0.103  1.00 0.00 ? 20  TRP A CD1  5  
ATOM 6319  C CD2  . TRP A 1 20  ? 5.655   -5.674  -2.330  1.00 0.00 ? 20  TRP A CD2  5  
ATOM 6320  N NE1  . TRP A 1 20  ? 6.689   -6.728  -0.644  1.00 0.00 ? 20  TRP A NE1  5  
ATOM 6321  C CE2  . TRP A 1 20  ? 6.568   -6.698  -2.008  1.00 0.00 ? 20  TRP A CE2  5  
ATOM 6322  C CE3  . TRP A 1 20  ? 5.355   -5.437  -3.674  1.00 0.00 ? 20  TRP A CE3  5  
ATOM 6323  C CZ2  . TRP A 1 20  ? 7.182   -7.480  -2.982  1.00 0.00 ? 20  TRP A CZ2  5  
ATOM 6324  C CZ3  . TRP A 1 20  ? 5.966   -6.215  -4.640  1.00 0.00 ? 20  TRP A CZ3  5  
ATOM 6325  C CH2  . TRP A 1 20  ? 6.870   -7.226  -4.290  1.00 0.00 ? 20  TRP A CH2  5  
ATOM 6326  H H    . TRP A 1 20  ? 5.570   -2.733  1.015   1.00 0.00 ? 20  TRP A H    5  
ATOM 6327  H HA   . TRP A 1 20  ? 5.490   -2.502  -1.903  1.00 0.00 ? 20  TRP A HA   5  
ATOM 6328  H HB2  . TRP A 1 20  ? 3.768   -4.073  0.024   1.00 0.00 ? 20  TRP A HB2  5  
ATOM 6329  H HB3  . TRP A 1 20  ? 3.520   -4.030  -1.719  1.00 0.00 ? 20  TRP A HB3  5  
ATOM 6330  H HD1  . TRP A 1 20  ? 5.769   -5.545  0.949   1.00 0.00 ? 20  TRP A HD1  5  
ATOM 6331  H HE1  . TRP A 1 20  ? 7.258   -7.343  -0.135  1.00 0.00 ? 20  TRP A HE1  5  
ATOM 6332  H HE3  . TRP A 1 20  ? 4.661   -4.662  -3.963  1.00 0.00 ? 20  TRP A HE3  5  
ATOM 6333  H HZ2  . TRP A 1 20  ? 7.881   -8.264  -2.729  1.00 0.00 ? 20  TRP A HZ2  5  
ATOM 6334  H HZ3  . TRP A 1 20  ? 5.747   -6.046  -5.684  1.00 0.00 ? 20  TRP A HZ3  5  
ATOM 6335  H HH2  . TRP A 1 20  ? 7.323   -7.809  -5.078  1.00 0.00 ? 20  TRP A HH2  5  
ATOM 6336  N N    . GLY A 1 21  ? 3.731   -0.781  -2.114  1.00 0.00 ? 21  GLY A N    5  
ATOM 6337  C CA   . GLY A 1 21  ? 2.745   0.278   -2.223  1.00 0.00 ? 21  GLY A CA   5  
ATOM 6338  C C    . GLY A 1 21  ? 1.583   -0.101  -3.120  1.00 0.00 ? 21  GLY A C    5  
ATOM 6339  O O    . GLY A 1 21  ? 1.704   -0.992  -3.961  1.00 0.00 ? 21  GLY A O    5  
ATOM 6340  H H    . GLY A 1 21  ? 4.320   -0.980  -2.872  1.00 0.00 ? 21  GLY A H    5  
ATOM 6341  H HA2  . GLY A 1 21  ? 2.367   0.506   -1.238  1.00 0.00 ? 21  GLY A HA2  5  
ATOM 6342  H HA3  . GLY A 1 21  ? 3.223   1.159   -2.627  1.00 0.00 ? 21  GLY A HA3  5  
ATOM 6343  N N    . TRP A 1 22  ? 0.454   0.575   -2.939  1.00 0.00 ? 22  TRP A N    5  
ATOM 6344  C CA   . TRP A 1 22  ? -0.736  0.302   -3.738  1.00 0.00 ? 22  TRP A CA   5  
ATOM 6345  C C    . TRP A 1 22  ? -1.028  1.456   -4.690  1.00 0.00 ? 22  TRP A C    5  
ATOM 6346  O O    . TRP A 1 22  ? -0.550  2.573   -4.492  1.00 0.00 ? 22  TRP A O    5  
ATOM 6347  C CB   . TRP A 1 22  ? -1.940  0.057   -2.828  1.00 0.00 ? 22  TRP A CB   5  
ATOM 6348  C CG   . TRP A 1 22  ? -2.084  -1.373  -2.404  1.00 0.00 ? 22  TRP A CG   5  
ATOM 6349  C CD1  . TRP A 1 22  ? -1.361  -2.019  -1.442  1.00 0.00 ? 22  TRP A CD1  5  
ATOM 6350  C CD2  . TRP A 1 22  ? -3.005  -2.335  -2.930  1.00 0.00 ? 22  TRP A CD2  5  
ATOM 6351  N NE1  . TRP A 1 22  ? -1.778  -3.325  -1.338  1.00 0.00 ? 22  TRP A NE1  5  
ATOM 6352  C CE2  . TRP A 1 22  ? -2.786  -3.543  -2.240  1.00 0.00 ? 22  TRP A CE2  5  
ATOM 6353  C CE3  . TRP A 1 22  ? -3.995  -2.293  -3.916  1.00 0.00 ? 22  TRP A CE3  5  
ATOM 6354  C CZ2  . TRP A 1 22  ? -3.520  -4.696  -2.506  1.00 0.00 ? 22  TRP A CZ2  5  
ATOM 6355  C CZ3  . TRP A 1 22  ? -4.722  -3.438  -4.179  1.00 0.00 ? 22  TRP A CZ3  5  
ATOM 6356  C CH2  . TRP A 1 22  ? -4.483  -4.626  -3.476  1.00 0.00 ? 22  TRP A CH2  5  
ATOM 6357  H H    . TRP A 1 22  ? 0.419   1.274   -2.253  1.00 0.00 ? 22  TRP A H    5  
ATOM 6358  H HA   . TRP A 1 22  ? -0.547  -0.589  -4.318  1.00 0.00 ? 22  TRP A HA   5  
ATOM 6359  H HB2  . TRP A 1 22  ? -1.840  0.660   -1.938  1.00 0.00 ? 22  TRP A HB2  5  
ATOM 6360  H HB3  . TRP A 1 22  ? -2.841  0.342   -3.352  1.00 0.00 ? 22  TRP A HB3  5  
ATOM 6361  H HD1  . TRP A 1 22  ? -0.579  -1.559  -0.858  1.00 0.00 ? 22  TRP A HD1  5  
ATOM 6362  H HE1  . TRP A 1 22  ? -1.413  -3.990  -0.717  1.00 0.00 ? 22  TRP A HE1  5  
ATOM 6363  H HE3  . TRP A 1 22  ? -4.194  -1.386  -4.468  1.00 0.00 ? 22  TRP A HE3  5  
ATOM 6364  H HZ2  . TRP A 1 22  ? -3.347  -5.619  -1.972  1.00 0.00 ? 22  TRP A HZ2  5  
ATOM 6365  H HZ3  . TRP A 1 22  ? -5.491  -3.424  -4.937  1.00 0.00 ? 22  TRP A HZ3  5  
ATOM 6366  H HH2  . TRP A 1 22  ? -5.074  -5.496  -3.714  1.00 0.00 ? 22  TRP A HH2  5  
ATOM 6367  N N    . PHE A 1 23  ? -1.817  1.180   -5.723  1.00 0.00 ? 23  PHE A N    5  
ATOM 6368  C CA   . PHE A 1 23  ? -2.173  2.196   -6.707  1.00 0.00 ? 23  PHE A CA   5  
ATOM 6369  C C    . PHE A 1 23  ? -3.481  1.841   -7.407  1.00 0.00 ? 23  PHE A C    5  
ATOM 6370  O O    . PHE A 1 23  ? -3.897  0.682   -7.419  1.00 0.00 ? 23  PHE A O    5  
ATOM 6371  C CB   . PHE A 1 23  ? -1.054  2.350   -7.740  1.00 0.00 ? 23  PHE A CB   5  
ATOM 6372  C CG   . PHE A 1 23  ? 0.292   2.615   -7.130  1.00 0.00 ? 23  PHE A CG   5  
ATOM 6373  C CD1  . PHE A 1 23  ? 1.067   1.572   -6.648  1.00 0.00 ? 23  PHE A CD1  5  
ATOM 6374  C CD2  . PHE A 1 23  ? 0.784   3.907   -7.040  1.00 0.00 ? 23  PHE A CD2  5  
ATOM 6375  C CE1  . PHE A 1 23  ? 2.306   1.814   -6.085  1.00 0.00 ? 23  PHE A CE1  5  
ATOM 6376  C CE2  . PHE A 1 23  ? 2.023   4.155   -6.479  1.00 0.00 ? 23  PHE A CE2  5  
ATOM 6377  C CZ   . PHE A 1 23  ? 2.785   3.106   -6.002  1.00 0.00 ? 23  PHE A CZ   5  
ATOM 6378  H H    . PHE A 1 23  ? -2.168  0.270   -5.827  1.00 0.00 ? 23  PHE A H    5  
ATOM 6379  H HA   . PHE A 1 23  ? -2.300  3.131   -6.184  1.00 0.00 ? 23  PHE A HA   5  
ATOM 6380  H HB2  . PHE A 1 23  ? -0.982  1.442   -8.320  1.00 0.00 ? 23  PHE A HB2  5  
ATOM 6381  H HB3  . PHE A 1 23  ? -1.291  3.174   -8.396  1.00 0.00 ? 23  PHE A HB3  5  
ATOM 6382  H HD1  . PHE A 1 23  ? 0.694   0.561   -6.713  1.00 0.00 ? 23  PHE A HD1  5  
ATOM 6383  H HD2  . PHE A 1 23  ? 0.189   4.728   -7.413  1.00 0.00 ? 23  PHE A HD2  5  
ATOM 6384  H HE1  . PHE A 1 23  ? 2.900   0.992   -5.714  1.00 0.00 ? 23  PHE A HE1  5  
ATOM 6385  H HE2  . PHE A 1 23  ? 2.395   5.167   -6.416  1.00 0.00 ? 23  PHE A HE2  5  
ATOM 6386  H HZ   . PHE A 1 23  ? 3.753   3.298   -5.563  1.00 0.00 ? 23  PHE A HZ   5  
ATOM 6387  N N    . TYR A 1 24  ? -4.126  2.846   -7.988  1.00 0.00 ? 24  TYR A N    5  
ATOM 6388  C CA   . TYR A 1 24  ? -5.389  2.642   -8.687  1.00 0.00 ? 24  TYR A CA   5  
ATOM 6389  C C    . TYR A 1 24  ? -5.496  3.563   -9.899  1.00 0.00 ? 24  TYR A C    5  
ATOM 6390  O O    . TYR A 1 24  ? -5.368  4.782   -9.781  1.00 0.00 ? 24  TYR A O    5  
ATOM 6391  C CB   . TYR A 1 24  ? -6.566  2.888   -7.741  1.00 0.00 ? 24  TYR A CB   5  
ATOM 6392  C CG   . TYR A 1 24  ? -6.863  4.353   -7.512  1.00 0.00 ? 24  TYR A CG   5  
ATOM 6393  C CD1  . TYR A 1 24  ? -7.669  5.064   -8.391  1.00 0.00 ? 24  TYR A CD1  5  
ATOM 6394  C CD2  . TYR A 1 24  ? -6.338  5.025   -6.415  1.00 0.00 ? 24  TYR A CD2  5  
ATOM 6395  C CE1  . TYR A 1 24  ? -7.942  6.403   -8.186  1.00 0.00 ? 24  TYR A CE1  5  
ATOM 6396  C CE2  . TYR A 1 24  ? -6.607  6.363   -6.201  1.00 0.00 ? 24  TYR A CE2  5  
ATOM 6397  C CZ   . TYR A 1 24  ? -7.409  7.047   -7.090  1.00 0.00 ? 24  TYR A CZ   5  
ATOM 6398  O OH   . TYR A 1 24  ? -7.680  8.380   -6.881  1.00 0.00 ? 24  TYR A OH   5  
ATOM 6399  H H    . TYR A 1 24  ? -3.745  3.748   -7.944  1.00 0.00 ? 24  TYR A H    5  
ATOM 6400  H HA   . TYR A 1 24  ? -5.419  1.617   -9.024  1.00 0.00 ? 24  TYR A HA   5  
ATOM 6401  H HB2  . TYR A 1 24  ? -7.452  2.431   -8.153  1.00 0.00 ? 24  TYR A HB2  5  
ATOM 6402  H HB3  . TYR A 1 24  ? -6.348  2.440   -6.783  1.00 0.00 ? 24  TYR A HB3  5  
ATOM 6403  H HD1  . TYR A 1 24  ? -8.085  4.556   -9.249  1.00 0.00 ? 24  TYR A HD1  5  
ATOM 6404  H HD2  . TYR A 1 24  ? -5.710  4.486   -5.720  1.00 0.00 ? 24  TYR A HD2  5  
ATOM 6405  H HE1  . TYR A 1 24  ? -8.571  6.939   -8.882  1.00 0.00 ? 24  TYR A HE1  5  
ATOM 6406  H HE2  . TYR A 1 24  ? -6.190  6.868   -5.342  1.00 0.00 ? 24  TYR A HE2  5  
ATOM 6407  H HH   . TYR A 1 24  ? -6.970  8.912   -7.247  1.00 0.00 ? 24  TYR A HH   5  
ATOM 6408  N N    . LEU A 1 25  ? -5.731  2.970   -11.064 1.00 0.00 ? 25  LEU A N    5  
ATOM 6409  C CA   . LEU A 1 25  ? -5.856  3.736   -12.300 1.00 0.00 ? 25  LEU A CA   5  
ATOM 6410  C C    . LEU A 1 25  ? -6.802  4.918   -12.115 1.00 0.00 ? 25  LEU A C    5  
ATOM 6411  O O    . LEU A 1 25  ? -7.829  4.805   -11.447 1.00 0.00 ? 25  LEU A O    5  
ATOM 6412  C CB   . LEU A 1 25  ? -6.359  2.837   -13.431 1.00 0.00 ? 25  LEU A CB   5  
ATOM 6413  C CG   . LEU A 1 25  ? -6.761  3.547   -14.724 1.00 0.00 ? 25  LEU A CG   5  
ATOM 6414  C CD1  . LEU A 1 25  ? -5.550  4.197   -15.375 1.00 0.00 ? 25  LEU A CD1  5  
ATOM 6415  C CD2  . LEU A 1 25  ? -7.425  2.571   -15.684 1.00 0.00 ? 25  LEU A CD2  5  
ATOM 6416  H H    . LEU A 1 25  ? -5.822  1.996   -11.096 1.00 0.00 ? 25  LEU A H    5  
ATOM 6417  H HA   . LEU A 1 25  ? -4.877  4.111   -12.558 1.00 0.00 ? 25  LEU A HA   5  
ATOM 6418  H HB2  . LEU A 1 25  ? -5.575  2.135   -13.669 1.00 0.00 ? 25  LEU A HB2  5  
ATOM 6419  H HB3  . LEU A 1 25  ? -7.223  2.299   -13.065 1.00 0.00 ? 25  LEU A HB3  5  
ATOM 6420  H HG   . LEU A 1 25  ? -7.474  4.327   -14.493 1.00 0.00 ? 25  LEU A HG   5  
ATOM 6421  H HD11 . LEU A 1 25  ? -4.774  3.459   -15.509 1.00 0.00 ? 25  LEU A HD11 5  
ATOM 6422  H HD12 . LEU A 1 25  ? -5.185  4.992   -14.742 1.00 0.00 ? 25  LEU A HD12 5  
ATOM 6423  H HD13 . LEU A 1 25  ? -5.832  4.603   -16.335 1.00 0.00 ? 25  LEU A HD13 5  
ATOM 6424  H HD21 . LEU A 1 25  ? -7.490  3.019   -16.665 1.00 0.00 ? 25  LEU A HD21 5  
ATOM 6425  H HD22 . LEU A 1 25  ? -8.419  2.336   -15.330 1.00 0.00 ? 25  LEU A HD22 5  
ATOM 6426  H HD23 . LEU A 1 25  ? -6.839  1.665   -15.740 1.00 0.00 ? 25  LEU A HD23 5  
ATOM 6427  N N    . ALA A 1 26  ? -6.449  6.051   -12.713 1.00 0.00 ? 26  ALA A N    5  
ATOM 6428  C CA   . ALA A 1 26  ? -7.268  7.253   -12.618 1.00 0.00 ? 26  ALA A CA   5  
ATOM 6429  C C    . ALA A 1 26  ? -7.931  7.572   -13.954 1.00 0.00 ? 26  ALA A C    5  
ATOM 6430  O O    . ALA A 1 26  ? -7.685  6.900   -14.955 1.00 0.00 ? 26  ALA A O    5  
ATOM 6431  C CB   . ALA A 1 26  ? -6.426  8.430   -12.150 1.00 0.00 ? 26  ALA A CB   5  
ATOM 6432  H H    . ALA A 1 26  ? -5.618  6.079   -13.232 1.00 0.00 ? 26  ALA A H    5  
ATOM 6433  H HA   . ALA A 1 26  ? -8.036  7.075   -11.879 1.00 0.00 ? 26  ALA A HA   5  
ATOM 6434  H HB1  . ALA A 1 26  ? -6.481  9.224   -12.881 1.00 0.00 ? 26  ALA A HB1  5  
ATOM 6435  H HB2  . ALA A 1 26  ? -6.800  8.786   -11.202 1.00 0.00 ? 26  ALA A HB2  5  
ATOM 6436  H HB3  . ALA A 1 26  ? -5.399  8.115   -12.037 1.00 0.00 ? 26  ALA A HB3  5  
ATOM 6437  N N    . GLU A 1 27  ? -8.773  8.601   -13.960 1.00 0.00 ? 27  GLU A N    5  
ATOM 6438  C CA   . GLU A 1 27  ? -9.473  9.007   -15.173 1.00 0.00 ? 27  GLU A CA   5  
ATOM 6439  C C    . GLU A 1 27  ? -8.535  9.752   -16.119 1.00 0.00 ? 27  GLU A C    5  
ATOM 6440  O O    . GLU A 1 27  ? -8.821  9.896   -17.308 1.00 0.00 ? 27  GLU A O    5  
ATOM 6441  C CB   . GLU A 1 27  ? -10.672 9.891   -14.825 1.00 0.00 ? 27  GLU A CB   5  
ATOM 6442  C CG   . GLU A 1 27  ? -10.291 11.189  -14.134 1.00 0.00 ? 27  GLU A CG   5  
ATOM 6443  C CD   . GLU A 1 27  ? -11.452 11.816  -13.387 1.00 0.00 ? 27  GLU A CD   5  
ATOM 6444  O OE1  . GLU A 1 27  ? -12.322 12.423  -14.045 1.00 0.00 ? 27  GLU A OE1  5  
ATOM 6445  O OE2  . GLU A 1 27  ? -11.491 11.698  -12.144 1.00 0.00 ? 27  GLU A OE2  5  
ATOM 6446  H H    . GLU A 1 27  ? -8.928  9.097   -13.130 1.00 0.00 ? 27  GLU A H    5  
ATOM 6447  H HA   . GLU A 1 27  ? -9.827  8.114   -15.666 1.00 0.00 ? 27  GLU A HA   5  
ATOM 6448  H HB2  . GLU A 1 27  ? -11.202 10.133  -15.735 1.00 0.00 ? 27  GLU A HB2  5  
ATOM 6449  H HB3  . GLU A 1 27  ? -11.332 9.340   -14.171 1.00 0.00 ? 27  GLU A HB3  5  
ATOM 6450  H HG2  . GLU A 1 27  ? -9.497  10.988  -13.430 1.00 0.00 ? 27  GLU A HG2  5  
ATOM 6451  H HG3  . GLU A 1 27  ? -9.941  11.890  -14.878 1.00 0.00 ? 27  GLU A HG3  5  
ATOM 6452  N N    . CYS A 1 28  ? -7.415  10.223  -15.581 1.00 0.00 ? 28  CYS A N    5  
ATOM 6453  C CA   . CYS A 1 28  ? -6.435  10.955  -16.376 1.00 0.00 ? 28  CYS A CA   5  
ATOM 6454  C C    . CYS A 1 28  ? -5.589  9.999   -17.210 1.00 0.00 ? 28  CYS A C    5  
ATOM 6455  O O    . CYS A 1 28  ? -4.695  10.422  -17.943 1.00 0.00 ? 28  CYS A O    5  
ATOM 6456  C CB   . CYS A 1 28  ? -5.534  11.792  -15.467 1.00 0.00 ? 28  CYS A CB   5  
ATOM 6457  S SG   . CYS A 1 28  ? -6.211  13.415  -15.049 1.00 0.00 ? 28  CYS A SG   5  
ATOM 6458  H H    . CYS A 1 28  ? -7.243  10.076  -14.628 1.00 0.00 ? 28  CYS A H    5  
ATOM 6459  H HA   . CYS A 1 28  ? -6.973  11.613  -17.041 1.00 0.00 ? 28  CYS A HA   5  
ATOM 6460  H HB2  . CYS A 1 28  ? -5.370  11.257  -14.543 1.00 0.00 ? 28  CYS A HB2  5  
ATOM 6461  H HB3  . CYS A 1 28  ? -4.585  11.947  -15.958 1.00 0.00 ? 28  CYS A HB3  5  
ATOM 6462  H HG   . CYS A 1 28  ? -7.504  13.405  -15.336 1.00 0.00 ? 28  CYS A HG   5  
ATOM 6463  N N    . GLY A 1 29  ? -5.876  8.706   -17.093 1.00 0.00 ? 29  GLY A N    5  
ATOM 6464  C CA   . GLY A 1 29  ? -5.131  7.709   -17.840 1.00 0.00 ? 29  GLY A CA   5  
ATOM 6465  C C    . GLY A 1 29  ? -4.035  7.065   -17.015 1.00 0.00 ? 29  GLY A C    5  
ATOM 6466  O O    . GLY A 1 29  ? -3.864  5.846   -17.039 1.00 0.00 ? 29  GLY A O    5  
ATOM 6467  H H    . GLY A 1 29  ? -6.599  8.426   -16.493 1.00 0.00 ? 29  GLY A H    5  
ATOM 6468  H HA2  . GLY A 1 29  ? -5.813  6.942   -18.175 1.00 0.00 ? 29  GLY A HA2  5  
ATOM 6469  H HA3  . GLY A 1 29  ? -4.685  8.183   -18.703 1.00 0.00 ? 29  GLY A HA3  5  
ATOM 6470  N N    . LYS A 1 30  ? -3.288  7.885   -16.284 1.00 0.00 ? 30  LYS A N    5  
ATOM 6471  C CA   . LYS A 1 30  ? -2.201  7.390   -15.447 1.00 0.00 ? 30  LYS A CA   5  
ATOM 6472  C C    . LYS A 1 30  ? -2.732  6.881   -14.111 1.00 0.00 ? 30  LYS A C    5  
ATOM 6473  O O    . LYS A 1 30  ? -3.909  7.051   -13.795 1.00 0.00 ? 30  LYS A O    5  
ATOM 6474  C CB   . LYS A 1 30  ? -1.168  8.493   -15.211 1.00 0.00 ? 30  LYS A CB   5  
ATOM 6475  C CG   . LYS A 1 30  ? -0.370  8.856   -16.452 1.00 0.00 ? 30  LYS A CG   5  
ATOM 6476  C CD   . LYS A 1 30  ? 0.504   10.076  -16.216 1.00 0.00 ? 30  LYS A CD   5  
ATOM 6477  C CE   . LYS A 1 30  ? 1.600   10.188  -17.265 1.00 0.00 ? 30  LYS A CE   5  
ATOM 6478  N NZ   . LYS A 1 30  ? 1.158   10.983  -18.444 1.00 0.00 ? 30  LYS A NZ   5  
ATOM 6479  H H    . LYS A 1 30  ? -3.473  8.848   -16.306 1.00 0.00 ? 30  LYS A H    5  
ATOM 6480  H HA   . LYS A 1 30  ? -1.728  6.571   -15.968 1.00 0.00 ? 30  LYS A HA   5  
ATOM 6481  H HB2  . LYS A 1 30  ? -1.678  9.380   -14.865 1.00 0.00 ? 30  LYS A HB2  5  
ATOM 6482  H HB3  . LYS A 1 30  ? -0.477  8.165   -14.448 1.00 0.00 ? 30  LYS A HB3  5  
ATOM 6483  H HG2  . LYS A 1 30  ? 0.260   8.021   -16.721 1.00 0.00 ? 30  LYS A HG2  5  
ATOM 6484  H HG3  . LYS A 1 30  ? -1.056  9.067   -17.260 1.00 0.00 ? 30  LYS A HG3  5  
ATOM 6485  H HD2  . LYS A 1 30  ? -0.110  10.963  -16.257 1.00 0.00 ? 30  LYS A HD2  5  
ATOM 6486  H HD3  . LYS A 1 30  ? 0.961   9.997   -15.239 1.00 0.00 ? 30  LYS A HD3  5  
ATOM 6487  H HE2  . LYS A 1 30  ? 2.459   10.666  -16.821 1.00 0.00 ? 30  LYS A HE2  5  
ATOM 6488  H HE3  . LYS A 1 30  ? 1.869   9.194   -17.592 1.00 0.00 ? 30  LYS A HE3  5  
ATOM 6489  H HZ1  . LYS A 1 30  ? 1.422   10.494  -19.324 1.00 0.00 ? 30  LYS A HZ1  5  
ATOM 6490  H HZ2  . LYS A 1 30  ? 1.611   11.919  -18.433 1.00 0.00 ? 30  LYS A HZ2  5  
ATOM 6491  H HZ3  . LYS A 1 30  ? 0.126   11.108  -18.426 1.00 0.00 ? 30  LYS A HZ3  5  
ATOM 6492  N N    . TRP A 1 31  ? -1.856  6.258   -13.330 1.00 0.00 ? 31  TRP A N    5  
ATOM 6493  C CA   . TRP A 1 31  ? -2.237  5.726   -12.027 1.00 0.00 ? 31  TRP A CA   5  
ATOM 6494  C C    . TRP A 1 31  ? -1.869  6.699   -10.913 1.00 0.00 ? 31  TRP A C    5  
ATOM 6495  O O    . TRP A 1 31  ? -0.897  7.447   -11.025 1.00 0.00 ? 31  TRP A O    5  
ATOM 6496  C CB   . TRP A 1 31  ? -1.560  4.376   -11.786 1.00 0.00 ? 31  TRP A CB   5  
ATOM 6497  C CG   . TRP A 1 31  ? -1.870  3.359   -12.843 1.00 0.00 ? 31  TRP A CG   5  
ATOM 6498  C CD1  . TRP A 1 31  ? -1.530  3.421   -14.164 1.00 0.00 ? 31  TRP A CD1  5  
ATOM 6499  C CD2  . TRP A 1 31  ? -2.583  2.130   -12.667 1.00 0.00 ? 31  TRP A CD2  5  
ATOM 6500  N NE1  . TRP A 1 31  ? -1.989  2.304   -14.821 1.00 0.00 ? 31  TRP A NE1  5  
ATOM 6501  C CE2  . TRP A 1 31  ? -2.638  1.497   -13.924 1.00 0.00 ? 31  TRP A CE2  5  
ATOM 6502  C CE3  . TRP A 1 31  ? -3.179  1.502   -11.570 1.00 0.00 ? 31  TRP A CE3  5  
ATOM 6503  C CZ2  . TRP A 1 31  ? -3.266  0.268   -14.111 1.00 0.00 ? 31  TRP A CZ2  5  
ATOM 6504  C CZ3  . TRP A 1 31  ? -3.802  0.283   -11.757 1.00 0.00 ? 31  TRP A CZ3  5  
ATOM 6505  C CH2  . TRP A 1 31  ? -3.841  -0.324  -13.020 1.00 0.00 ? 31  TRP A CH2  5  
ATOM 6506  H H    . TRP A 1 31  ? -0.931  6.153   -13.638 1.00 0.00 ? 31  TRP A H    5  
ATOM 6507  H HA   . TRP A 1 31  ? -3.308  5.586   -12.027 1.00 0.00 ? 31  TRP A HA   5  
ATOM 6508  H HB2  . TRP A 1 31  ? -0.489  4.516   -11.763 1.00 0.00 ? 31  TRP A HB2  5  
ATOM 6509  H HB3  . TRP A 1 31  ? -1.889  3.981   -10.836 1.00 0.00 ? 31  TRP A HB3  5  
ATOM 6510  H HD1  . TRP A 1 31  ? -0.983  4.235   -14.614 1.00 0.00 ? 31  TRP A HD1  5  
ATOM 6511  H HE1  . TRP A 1 31  ? -1.870  2.116   -15.775 1.00 0.00 ? 31  TRP A HE1  5  
ATOM 6512  H HE3  . TRP A 1 31  ? -3.159  1.955   -10.589 1.00 0.00 ? 31  TRP A HE3  5  
ATOM 6513  H HZ2  . TRP A 1 31  ? -3.304  -0.213  -15.078 1.00 0.00 ? 31  TRP A HZ2  5  
ATOM 6514  H HZ3  . TRP A 1 31  ? -4.268  -0.217  -10.921 1.00 0.00 ? 31  TRP A HZ3  5  
ATOM 6515  H HH2  . TRP A 1 31  ? -4.338  -1.276  -13.120 1.00 0.00 ? 31  TRP A HH2  5  
ATOM 6516  N N    . HIS A 1 32  ? -2.650  6.685   -9.838  1.00 0.00 ? 32  HIS A N    5  
ATOM 6517  C CA   . HIS A 1 32  ? -2.404  7.567   -8.702  1.00 0.00 ? 32  HIS A CA   5  
ATOM 6518  C C    . HIS A 1 32  ? -2.299  6.768   -7.407  1.00 0.00 ? 32  HIS A C    5  
ATOM 6519  O O    . HIS A 1 32  ? -3.179  5.971   -7.085  1.00 0.00 ? 32  HIS A O    5  
ATOM 6520  C CB   . HIS A 1 32  ? -3.521  8.605   -8.585  1.00 0.00 ? 32  HIS A CB   5  
ATOM 6521  C CG   . HIS A 1 32  ? -3.343  9.781   -9.496  1.00 0.00 ? 32  HIS A CG   5  
ATOM 6522  N ND1  . HIS A 1 32  ? -2.135  10.423  -9.669  1.00 0.00 ? 32  HIS A ND1  5  
ATOM 6523  C CD2  . HIS A 1 32  ? -4.229  10.429  -10.288 1.00 0.00 ? 32  HIS A CD2  5  
ATOM 6524  C CE1  . HIS A 1 32  ? -2.286  11.416  -10.527 1.00 0.00 ? 32  HIS A CE1  5  
ATOM 6525  N NE2  . HIS A 1 32  ? -3.548  11.441  -10.918 1.00 0.00 ? 32  HIS A NE2  5  
ATOM 6526  H H    . HIS A 1 32  ? -3.410  6.067   -9.807  1.00 0.00 ? 32  HIS A H    5  
ATOM 6527  H HA   . HIS A 1 32  ? -1.468  8.076   -8.874  1.00 0.00 ? 32  HIS A HA   5  
ATOM 6528  H HB2  . HIS A 1 32  ? -4.464  8.139   -8.827  1.00 0.00 ? 32  HIS A HB2  5  
ATOM 6529  H HB3  . HIS A 1 32  ? -3.556  8.974   -7.570  1.00 0.00 ? 32  HIS A HB3  5  
ATOM 6530  H HD1  . HIS A 1 32  ? -1.293  10.187  -9.228  1.00 0.00 ? 32  HIS A HD1  5  
ATOM 6531  H HD2  . HIS A 1 32  ? -5.278  10.194  -10.404 1.00 0.00 ? 32  HIS A HD2  5  
ATOM 6532  H HE1  . HIS A 1 32  ? -1.511  12.093  -10.854 1.00 0.00 ? 32  HIS A HE1  5  
ATOM 6533  N N    . MET A 1 33  ? -1.216  6.987   -6.668  1.00 0.00 ? 33  MET A N    5  
ATOM 6534  C CA   . MET A 1 33  ? -0.996  6.288   -5.408  1.00 0.00 ? 33  MET A CA   5  
ATOM 6535  C C    . MET A 1 33  ? -2.170  6.499   -4.457  1.00 0.00 ? 33  MET A C    5  
ATOM 6536  O O    . MET A 1 33  ? -2.727  7.594   -4.376  1.00 0.00 ? 33  MET A O    5  
ATOM 6537  C CB   . MET A 1 33  ? 0.300   6.769   -4.752  1.00 0.00 ? 33  MET A CB   5  
ATOM 6538  C CG   . MET A 1 33  ? 0.539   6.176   -3.373  1.00 0.00 ? 33  MET A CG   5  
ATOM 6539  S SD   . MET A 1 33  ? 1.667   7.169   -2.376  1.00 0.00 ? 33  MET A SD   5  
ATOM 6540  C CE   . MET A 1 33  ? 2.033   6.030   -1.044  1.00 0.00 ? 33  MET A CE   5  
ATOM 6541  H H    . MET A 1 33  ? -0.549  7.636   -6.978  1.00 0.00 ? 33  MET A H    5  
ATOM 6542  H HA   . MET A 1 33  ? -0.909  5.234   -5.625  1.00 0.00 ? 33  MET A HA   5  
ATOM 6543  H HB2  . MET A 1 33  ? 1.132   6.499   -5.386  1.00 0.00 ? 33  MET A HB2  5  
ATOM 6544  H HB3  . MET A 1 33  ? 0.264   7.844   -4.656  1.00 0.00 ? 33  MET A HB3  5  
ATOM 6545  H HG2  . MET A 1 33  ? -0.406  6.104   -2.857  1.00 0.00 ? 33  MET A HG2  5  
ATOM 6546  H HG3  . MET A 1 33  ? 0.959   5.188   -3.490  1.00 0.00 ? 33  MET A HG3  5  
ATOM 6547  H HE1  . MET A 1 33  ? 1.121   5.556   -0.714  1.00 0.00 ? 33  MET A HE1  5  
ATOM 6548  H HE2  . MET A 1 33  ? 2.725   5.278   -1.393  1.00 0.00 ? 33  MET A HE2  5  
ATOM 6549  H HE3  . MET A 1 33  ? 2.476   6.572   -0.220  1.00 0.00 ? 33  MET A HE3  5  
ATOM 6550  N N    . PHE A 1 34  ? -2.541  5.445   -3.739  1.00 0.00 ? 34  PHE A N    5  
ATOM 6551  C CA   . PHE A 1 34  ? -3.650  5.515   -2.794  1.00 0.00 ? 34  PHE A CA   5  
ATOM 6552  C C    . PHE A 1 34  ? -3.393  6.581   -1.733  1.00 0.00 ? 34  PHE A C    5  
ATOM 6553  O O    . PHE A 1 34  ? -2.286  6.694   -1.207  1.00 0.00 ? 34  PHE A O    5  
ATOM 6554  C CB   . PHE A 1 34  ? -3.865  4.156   -2.125  1.00 0.00 ? 34  PHE A CB   5  
ATOM 6555  C CG   . PHE A 1 34  ? -4.775  3.245   -2.898  1.00 0.00 ? 34  PHE A CG   5  
ATOM 6556  C CD1  . PHE A 1 34  ? -6.148  3.297   -2.714  1.00 0.00 ? 34  PHE A CD1  5  
ATOM 6557  C CD2  . PHE A 1 34  ? -4.259  2.337   -3.809  1.00 0.00 ? 34  PHE A CD2  5  
ATOM 6558  C CE1  . PHE A 1 34  ? -6.988  2.459   -3.424  1.00 0.00 ? 34  PHE A CE1  5  
ATOM 6559  C CE2  . PHE A 1 34  ? -5.094  1.498   -4.522  1.00 0.00 ? 34  PHE A CE2  5  
ATOM 6560  C CZ   . PHE A 1 34  ? -6.461  1.560   -4.329  1.00 0.00 ? 34  PHE A CZ   5  
ATOM 6561  H H    . PHE A 1 34  ? -2.058  4.598   -3.847  1.00 0.00 ? 34  PHE A H    5  
ATOM 6562  H HA   . PHE A 1 34  ? -4.538  5.780   -3.346  1.00 0.00 ? 34  PHE A HA   5  
ATOM 6563  H HB2  . PHE A 1 34  ? -2.912  3.659   -2.020  1.00 0.00 ? 34  PHE A HB2  5  
ATOM 6564  H HB3  . PHE A 1 34  ? -4.297  4.308   -1.148  1.00 0.00 ? 34  PHE A HB3  5  
ATOM 6565  H HD1  . PHE A 1 34  ? -6.562  4.001   -2.007  1.00 0.00 ? 34  PHE A HD1  5  
ATOM 6566  H HD2  . PHE A 1 34  ? -3.190  2.289   -3.961  1.00 0.00 ? 34  PHE A HD2  5  
ATOM 6567  H HE1  . PHE A 1 34  ? -8.056  2.510   -3.272  1.00 0.00 ? 34  PHE A HE1  5  
ATOM 6568  H HE2  . PHE A 1 34  ? -4.678  0.795   -5.229  1.00 0.00 ? 34  PHE A HE2  5  
ATOM 6569  H HZ   . PHE A 1 34  ? -7.115  0.904   -4.885  1.00 0.00 ? 34  PHE A HZ   5  
ATOM 6570  N N    . GLN A 1 35  ? -4.425  7.361   -1.425  1.00 0.00 ? 35  GLN A N    5  
ATOM 6571  C CA   . GLN A 1 35  ? -4.311  8.419   -0.428  1.00 0.00 ? 35  GLN A CA   5  
ATOM 6572  C C    . GLN A 1 35  ? -5.655  8.682   0.243   1.00 0.00 ? 35  GLN A C    5  
ATOM 6573  O O    . GLN A 1 35  ? -6.719  8.406   -0.313  1.00 0.00 ? 35  GLN A O    5  
ATOM 6574  C CB   . GLN A 1 35  ? -3.791  9.704   -1.075  1.00 0.00 ? 35  GLN A CB   5  
ATOM 6575  C CG   . GLN A 1 35  ? -2.303  9.669   -1.386  1.00 0.00 ? 35  GLN A CG   5  
ATOM 6576  C CD   . GLN A 1 35  ? -1.840  10.890  -2.157  1.00 0.00 ? 35  GLN A CD   5  
ATOM 6577  O OE1  . GLN A 1 35  ? -2.646  11.610  -2.745  1.00 0.00 ? 35  GLN A OE1  5  
ATOM 6578  N NE2  . GLN A 1 35  ? -0.533  11.129  -2.157  1.00 0.00 ? 35  GLN A NE2  5  
ATOM 6579  H H    . GLN A 1 35  ? -5.281  7.222   -1.879  1.00 0.00 ? 35  GLN A H    5  
ATOM 6580  H HA   . GLN A 1 35  ? -3.606  8.093   0.322   1.00 0.00 ? 35  GLN A HA   5  
ATOM 6581  H HB2  . GLN A 1 35  ? -4.326  9.871   -1.997  1.00 0.00 ? 35  GLN A HB2  5  
ATOM 6582  H HB3  . GLN A 1 35  ? -3.977  10.531  -0.405  1.00 0.00 ? 35  GLN A HB3  5  
ATOM 6583  H HG2  . GLN A 1 35  ? -1.755  9.620   -0.457  1.00 0.00 ? 35  GLN A HG2  5  
ATOM 6584  H HG3  . GLN A 1 35  ? -2.092  8.788   -1.974  1.00 0.00 ? 35  GLN A HG3  5  
ATOM 6585  H HE21 . GLN A 1 35  ? 0.050   10.511  -1.668  1.00 0.00 ? 35  GLN A HE21 5  
ATOM 6586  H HE22 . GLN A 1 35  ? -0.206  11.910  -2.648  1.00 0.00 ? 35  GLN A HE22 5  
ATOM 6587  N N    . PRO A 1 36  ? -5.609  9.227   1.467   1.00 0.00 ? 36  PRO A N    5  
ATOM 6588  C CA   . PRO A 1 36  ? -6.815  9.539   2.241   1.00 0.00 ? 36  PRO A CA   5  
ATOM 6589  C C    . PRO A 1 36  ? -7.601  10.702  1.645   1.00 0.00 ? 36  PRO A C    5  
ATOM 6590  O O    . PRO A 1 36  ? -7.068  11.797  1.466   1.00 0.00 ? 36  PRO A O    5  
ATOM 6591  C CB   . PRO A 1 36  ? -6.265  9.916   3.619   1.00 0.00 ? 36  PRO A CB   5  
ATOM 6592  C CG   . PRO A 1 36  ? -4.878  10.390  3.356   1.00 0.00 ? 36  PRO A CG   5  
ATOM 6593  C CD   . PRO A 1 36  ? -4.377  9.582   2.191   1.00 0.00 ? 36  PRO A CD   5  
ATOM 6594  H HA   . PRO A 1 36  ? -7.461  8.678   2.332   1.00 0.00 ? 36  PRO A HA   5  
ATOM 6595  H HB2  . PRO A 1 36  ? -6.875  10.696  4.052   1.00 0.00 ? 36  PRO A HB2  5  
ATOM 6596  H HB3  . PRO A 1 36  ? -6.270  9.048   4.261   1.00 0.00 ? 36  PRO A HB3  5  
ATOM 6597  H HG2  . PRO A 1 36  ? -4.890  11.440  3.106   1.00 0.00 ? 36  PRO A HG2  5  
ATOM 6598  H HG3  . PRO A 1 36  ? -4.260  10.217  4.225   1.00 0.00 ? 36  PRO A HG3  5  
ATOM 6599  H HD2  . PRO A 1 36  ? -3.724  10.178  1.571   1.00 0.00 ? 36  PRO A HD2  5  
ATOM 6600  H HD3  . PRO A 1 36  ? -3.866  8.696   2.538   1.00 0.00 ? 36  PRO A HD3  5  
ATOM 6601  N N    . ASP A 1 37  ? -8.871  10.457  1.340   1.00 0.00 ? 37  ASP A N    5  
ATOM 6602  C CA   . ASP A 1 37  ? -9.731  11.485  0.765   1.00 0.00 ? 37  ASP A CA   5  
ATOM 6603  C C    . ASP A 1 37  ? -9.612  12.791  1.545   1.00 0.00 ? 37  ASP A C    5  
ATOM 6604  O O    . ASP A 1 37  ? -9.058  13.774  1.051   1.00 0.00 ? 37  ASP A O    5  
ATOM 6605  C CB   . ASP A 1 37  ? -11.186 11.014  0.754   1.00 0.00 ? 37  ASP A CB   5  
ATOM 6606  C CG   . ASP A 1 37  ? -11.985 11.632  -0.377  1.00 0.00 ? 37  ASP A CG   5  
ATOM 6607  O OD1  . ASP A 1 37  ? -12.416 12.795  -0.232  1.00 0.00 ? 37  ASP A OD1  5  
ATOM 6608  O OD2  . ASP A 1 37  ? -12.181 10.952  -1.406  1.00 0.00 ? 37  ASP A OD2  5  
ATOM 6609  H H    . ASP A 1 37  ? -9.238  9.564   1.505   1.00 0.00 ? 37  ASP A H    5  
ATOM 6610  H HA   . ASP A 1 37  ? -9.410  11.656  -0.251  1.00 0.00 ? 37  ASP A HA   5  
ATOM 6611  H HB2  . ASP A 1 37  ? -11.209 9.940   0.641   1.00 0.00 ? 37  ASP A HB2  5  
ATOM 6612  H HB3  . ASP A 1 37  ? -11.652 11.284  1.690   1.00 0.00 ? 37  ASP A HB3  5  
ATOM 6613  N N    . THR A 1 38  ? -10.137 12.795  2.766   1.00 0.00 ? 38  THR A N    5  
ATOM 6614  C CA   . THR A 1 38  ? -10.092 13.980  3.613   1.00 0.00 ? 38  THR A CA   5  
ATOM 6615  C C    . THR A 1 38  ? -10.152 13.604  5.089   1.00 0.00 ? 38  THR A C    5  
ATOM 6616  O O    . THR A 1 38  ? -10.278 12.430  5.435   1.00 0.00 ? 38  THR A O    5  
ATOM 6617  C CB   . THR A 1 38  ? -11.250 14.944  3.293   1.00 0.00 ? 38  THR A CB   5  
ATOM 6618  O OG1  . THR A 1 38  ? -12.496 14.239  3.321   1.00 0.00 ? 38  THR A OG1  5  
ATOM 6619  C CG2  . THR A 1 38  ? -11.057 15.588  1.928   1.00 0.00 ? 38  THR A CG2  5  
ATOM 6620  H H    . THR A 1 38  ? -10.565 11.981  3.104   1.00 0.00 ? 38  THR A H    5  
ATOM 6621  H HA   . THR A 1 38  ? -9.161  14.493  3.420   1.00 0.00 ? 38  THR A HA   5  
ATOM 6622  H HB   . THR A 1 38  ? -11.269 15.722  4.043   1.00 0.00 ? 38  THR A HB   5  
ATOM 6623  H HG1  . THR A 1 38  ? -12.535 13.627  2.581   1.00 0.00 ? 38  THR A HG1  5  
ATOM 6624  H HG21 . THR A 1 38  ? -11.344 14.890  1.156   1.00 0.00 ? 38  THR A HG21 5  
ATOM 6625  H HG22 . THR A 1 38  ? -10.019 15.858  1.802   1.00 0.00 ? 38  THR A HG22 5  
ATOM 6626  H HG23 . THR A 1 38  ? -11.670 16.474  1.859   1.00 0.00 ? 38  THR A HG23 5  
ATOM 6627  N N    . ASN A 1 39  ? -10.063 14.608  5.955   1.00 0.00 ? 39  ASN A N    5  
ATOM 6628  C CA   . ASN A 1 39  ? -10.107 14.382  7.395   1.00 0.00 ? 39  ASN A CA   5  
ATOM 6629  C C    . ASN A 1 39  ? -11.347 13.581  7.782   1.00 0.00 ? 39  ASN A C    5  
ATOM 6630  O O    . ASN A 1 39  ? -11.249 12.542  8.434   1.00 0.00 ? 39  ASN A O    5  
ATOM 6631  C CB   . ASN A 1 39  ? -10.095 15.716  8.143   1.00 0.00 ? 39  ASN A CB   5  
ATOM 6632  C CG   . ASN A 1 39  ? -8.735  16.386  8.108   1.00 0.00 ? 39  ASN A CG   5  
ATOM 6633  O OD1  . ASN A 1 39  ? -8.510  17.320  7.337   1.00 0.00 ? 39  ASN A OD1  5  
ATOM 6634  N ND2  . ASN A 1 39  ? -7.819  15.911  8.944   1.00 0.00 ? 39  ASN A ND2  5  
ATOM 6635  H H    . ASN A 1 39  ? -9.963  15.523  5.618   1.00 0.00 ? 39  ASN A H    5  
ATOM 6636  H HA   . ASN A 1 39  ? -9.229  13.817  7.669   1.00 0.00 ? 39  ASN A HA   5  
ATOM 6637  H HB2  . ASN A 1 39  ? -10.814 16.383  7.690   1.00 0.00 ? 39  ASN A HB2  5  
ATOM 6638  H HB3  . ASN A 1 39  ? -10.366 15.547  9.174   1.00 0.00 ? 39  ASN A HB3  5  
ATOM 6639  H HD21 . ASN A 1 39  ? -8.069  15.165  9.529   1.00 0.00 ? 39  ASN A HD21 5  
ATOM 6640  H HD22 . ASN A 1 39  ? -6.931  16.326  8.942   1.00 0.00 ? 39  ASN A HD22 5  
ATOM 6641  N N    . SER A 1 40  ? -12.513 14.073  7.374   1.00 0.00 ? 40  SER A N    5  
ATOM 6642  C CA   . SER A 1 40  ? -13.773 13.405  7.680   1.00 0.00 ? 40  SER A CA   5  
ATOM 6643  C C    . SER A 1 40  ? -13.836 12.033  7.016   1.00 0.00 ? 40  SER A C    5  
ATOM 6644  O O    . SER A 1 40  ? -13.594 11.901  5.817   1.00 0.00 ? 40  SER A O    5  
ATOM 6645  C CB   . SER A 1 40  ? -14.954 14.262  7.219   1.00 0.00 ? 40  SER A CB   5  
ATOM 6646  O OG   . SER A 1 40  ? -16.154 13.861  7.856   1.00 0.00 ? 40  SER A OG   5  
ATOM 6647  H H    . SER A 1 40  ? -12.526 14.905  6.857   1.00 0.00 ? 40  SER A H    5  
ATOM 6648  H HA   . SER A 1 40  ? -13.829 13.277  8.751   1.00 0.00 ? 40  SER A HA   5  
ATOM 6649  H HB2  . SER A 1 40  ? -14.760 15.296  7.460   1.00 0.00 ? 40  SER A HB2  5  
ATOM 6650  H HB3  . SER A 1 40  ? -15.074 14.158  6.150   1.00 0.00 ? 40  SER A HB3  5  
ATOM 6651  H HG   . SER A 1 40  ? -16.777 14.591  7.854   1.00 0.00 ? 40  SER A HG   5  
ATOM 6652  N N    . GLN A 1 41  ? -14.163 11.015  7.805   1.00 0.00 ? 41  GLN A N    5  
ATOM 6653  C CA   . GLN A 1 41  ? -14.258 9.653   7.295   1.00 0.00 ? 41  GLN A CA   5  
ATOM 6654  C C    . GLN A 1 41  ? -13.187 9.391   6.240   1.00 0.00 ? 41  GLN A C    5  
ATOM 6655  O O    . GLN A 1 41  ? -13.449 8.749   5.222   1.00 0.00 ? 41  GLN A O    5  
ATOM 6656  C CB   . GLN A 1 41  ? -15.646 9.403   6.702   1.00 0.00 ? 41  GLN A CB   5  
ATOM 6657  C CG   . GLN A 1 41  ? -16.669 8.936   7.725   1.00 0.00 ? 41  GLN A CG   5  
ATOM 6658  C CD   . GLN A 1 41  ? -16.448 7.500   8.159   1.00 0.00 ? 41  GLN A CD   5  
ATOM 6659  O OE1  . GLN A 1 41  ? -16.997 6.570   7.569   1.00 0.00 ? 41  GLN A OE1  5  
ATOM 6660  N NE2  . GLN A 1 41  ? -15.640 7.313   9.196   1.00 0.00 ? 41  GLN A NE2  5  
ATOM 6661  H H    . GLN A 1 41  ? -14.345 11.184  8.753   1.00 0.00 ? 41  GLN A H    5  
ATOM 6662  H HA   . GLN A 1 41  ? -14.103 8.977   8.122   1.00 0.00 ? 41  GLN A HA   5  
ATOM 6663  H HB2  . GLN A 1 41  ? -16.005 10.319  6.257   1.00 0.00 ? 41  GLN A HB2  5  
ATOM 6664  H HB3  . GLN A 1 41  ? -15.566 8.646   5.935   1.00 0.00 ? 41  GLN A HB3  5  
ATOM 6665  H HG2  . GLN A 1 41  ? -16.605 9.572   8.596   1.00 0.00 ? 41  GLN A HG2  5  
ATOM 6666  H HG3  . GLN A 1 41  ? -17.655 9.019   7.292   1.00 0.00 ? 41  GLN A HG3  5  
ATOM 6667  H HE21 . GLN A 1 41  ? -15.239 8.102   9.619   1.00 0.00 ? 41  GLN A HE21 5  
ATOM 6668  H HE22 . GLN A 1 41  ? -15.480 6.395   9.498   1.00 0.00 ? 41  GLN A HE22 5  
ATOM 6669  N N    . CYS A 1 42  ? -11.983 9.892   6.491   1.00 0.00 ? 42  CYS A N    5  
ATOM 6670  C CA   . CYS A 1 42  ? -10.872 9.713   5.562   1.00 0.00 ? 42  CYS A CA   5  
ATOM 6671  C C    . CYS A 1 42  ? -10.872 8.304   4.980   1.00 0.00 ? 42  CYS A C    5  
ATOM 6672  O O    . CYS A 1 42  ? -11.135 7.330   5.685   1.00 0.00 ? 42  CYS A O    5  
ATOM 6673  C CB   . CYS A 1 42  ? -9.542  9.988   6.265   1.00 0.00 ? 42  CYS A CB   5  
ATOM 6674  S SG   . CYS A 1 42  ? -8.994  8.653   7.355   1.00 0.00 ? 42  CYS A SG   5  
ATOM 6675  H H    . CYS A 1 42  ? -11.836 10.394  7.319   1.00 0.00 ? 42  CYS A H    5  
ATOM 6676  H HA   . CYS A 1 42  ? -10.997 10.422  4.757   1.00 0.00 ? 42  CYS A HA   5  
ATOM 6677  H HB2  . CYS A 1 42  ? -8.775  10.140  5.521   1.00 0.00 ? 42  CYS A HB2  5  
ATOM 6678  H HB3  . CYS A 1 42  ? -9.638  10.883  6.862   1.00 0.00 ? 42  CYS A HB3  5  
ATOM 6679  H HG   . CYS A 1 42  ? -9.381  8.947   8.587   1.00 0.00 ? 42  CYS A HG   5  
ATOM 6680  N N    . SER A 1 43  ? -10.576 8.202   3.688   1.00 0.00 ? 43  SER A N    5  
ATOM 6681  C CA   . SER A 1 43  ? -10.547 6.912   3.009   1.00 0.00 ? 43  SER A CA   5  
ATOM 6682  C C    . SER A 1 43  ? -9.382  6.062   3.508   1.00 0.00 ? 43  SER A C    5  
ATOM 6683  O O    . SER A 1 43  ? -8.621  6.482   4.380   1.00 0.00 ? 43  SER A O    5  
ATOM 6684  C CB   . SER A 1 43  ? -10.436 7.111   1.496   1.00 0.00 ? 43  SER A CB   5  
ATOM 6685  O OG   . SER A 1 43  ? -11.035 6.034   0.796   1.00 0.00 ? 43  SER A OG   5  
ATOM 6686  H H    . SER A 1 43  ? -10.375 9.016   3.179   1.00 0.00 ? 43  SER A H    5  
ATOM 6687  H HA   . SER A 1 43  ? -11.472 6.400   3.230   1.00 0.00 ? 43  SER A HA   5  
ATOM 6688  H HB2  . SER A 1 43  ? -10.936 8.026   1.218   1.00 0.00 ? 43  SER A HB2  5  
ATOM 6689  H HB3  . SER A 1 43  ? -9.394  7.170   1.219   1.00 0.00 ? 43  SER A HB3  5  
ATOM 6690  H HG   . SER A 1 43  ? -10.362 5.560   0.301   1.00 0.00 ? 43  SER A HG   5  
ATOM 6691  N N    . VAL A 1 44  ? -9.251  4.863   2.949   1.00 0.00 ? 44  VAL A N    5  
ATOM 6692  C CA   . VAL A 1 44  ? -8.179  3.953   3.335   1.00 0.00 ? 44  VAL A CA   5  
ATOM 6693  C C    . VAL A 1 44  ? -6.891  4.270   2.583   1.00 0.00 ? 44  VAL A C    5  
ATOM 6694  O O    . VAL A 1 44  ? -6.880  4.346   1.355   1.00 0.00 ? 44  VAL A O    5  
ATOM 6695  C CB   . VAL A 1 44  ? -8.567  2.486   3.071   1.00 0.00 ? 44  VAL A CB   5  
ATOM 6696  C CG1  . VAL A 1 44  ? -9.666  2.044   4.026   1.00 0.00 ? 44  VAL A CG1  5  
ATOM 6697  C CG2  . VAL A 1 44  ? -8.999  2.301   1.625   1.00 0.00 ? 44  VAL A CG2  5  
ATOM 6698  H H    . VAL A 1 44  ? -9.889  4.585   2.259   1.00 0.00 ? 44  VAL A H    5  
ATOM 6699  H HA   . VAL A 1 44  ? -8.005  4.073   4.395   1.00 0.00 ? 44  VAL A HA   5  
ATOM 6700  H HB   . VAL A 1 44  ? -7.698  1.868   3.247   1.00 0.00 ? 44  VAL A HB   5  
ATOM 6701  H HG11 . VAL A 1 44  ? -9.222  1.643   4.925   1.00 0.00 ? 44  VAL A HG11 5  
ATOM 6702  H HG12 . VAL A 1 44  ? -10.288 2.891   4.276   1.00 0.00 ? 44  VAL A HG12 5  
ATOM 6703  H HG13 . VAL A 1 44  ? -10.268 1.283   3.552   1.00 0.00 ? 44  VAL A HG13 5  
ATOM 6704  H HG21 . VAL A 1 44  ? -9.051  3.265   1.140   1.00 0.00 ? 44  VAL A HG21 5  
ATOM 6705  H HG22 . VAL A 1 44  ? -8.282  1.678   1.111   1.00 0.00 ? 44  VAL A HG22 5  
ATOM 6706  H HG23 . VAL A 1 44  ? -9.970  1.830   1.596   1.00 0.00 ? 44  VAL A HG23 5  
ATOM 6707  N N    . SER A 1 45  ? -5.807  4.453   3.330   1.00 0.00 ? 45  SER A N    5  
ATOM 6708  C CA   . SER A 1 45  ? -4.513  4.765   2.734   1.00 0.00 ? 45  SER A CA   5  
ATOM 6709  C C    . SER A 1 45  ? -3.820  3.497   2.244   1.00 0.00 ? 45  SER A C    5  
ATOM 6710  O O    . SER A 1 45  ? -4.112  2.397   2.712   1.00 0.00 ? 45  SER A O    5  
ATOM 6711  C CB   . SER A 1 45  ? -3.622  5.487   3.747   1.00 0.00 ? 45  SER A CB   5  
ATOM 6712  O OG   . SER A 1 45  ? -3.996  6.848   3.877   1.00 0.00 ? 45  SER A OG   5  
ATOM 6713  H H    . SER A 1 45  ? -5.879  4.379   4.305   1.00 0.00 ? 45  SER A H    5  
ATOM 6714  H HA   . SER A 1 45  ? -4.685  5.417   1.890   1.00 0.00 ? 45  SER A HA   5  
ATOM 6715  H HB2  . SER A 1 45  ? -3.715  5.007   4.710   1.00 0.00 ? 45  SER A HB2  5  
ATOM 6716  H HB3  . SER A 1 45  ? -2.594  5.438   3.418   1.00 0.00 ? 45  SER A HB3  5  
ATOM 6717  H HG   . SER A 1 45  ? -4.691  6.928   4.534   1.00 0.00 ? 45  SER A HG   5  
ATOM 6718  N N    . SER A 1 46  ? -2.902  3.660   1.297   1.00 0.00 ? 46  SER A N    5  
ATOM 6719  C CA   . SER A 1 46  ? -2.169  2.529   0.740   1.00 0.00 ? 46  SER A CA   5  
ATOM 6720  C C    . SER A 1 46  ? -1.901  1.475   1.809   1.00 0.00 ? 46  SER A C    5  
ATOM 6721  O O    . SER A 1 46  ? -1.963  0.275   1.542   1.00 0.00 ? 46  SER A O    5  
ATOM 6722  C CB   . SER A 1 46  ? -0.848  3.001   0.130   1.00 0.00 ? 46  SER A CB   5  
ATOM 6723  O OG   . SER A 1 46  ? -0.106  3.775   1.056   1.00 0.00 ? 46  SER A OG   5  
ATOM 6724  H H    . SER A 1 46  ? -2.714  4.563   0.965   1.00 0.00 ? 46  SER A H    5  
ATOM 6725  H HA   . SER A 1 46  ? -2.778  2.091   -0.037  1.00 0.00 ? 46  SER A HA   5  
ATOM 6726  H HB2  . SER A 1 46  ? -0.260  2.142   -0.156  1.00 0.00 ? 46  SER A HB2  5  
ATOM 6727  H HB3  . SER A 1 46  ? -1.053  3.604   -0.744  1.00 0.00 ? 46  SER A HB3  5  
ATOM 6728  H HG   . SER A 1 46  ? 0.730   4.032   0.661   1.00 0.00 ? 46  SER A HG   5  
ATOM 6729  N N    . GLU A 1 47  ? -1.603  1.933   3.021   1.00 0.00 ? 47  GLU A N    5  
ATOM 6730  C CA   . GLU A 1 47  ? -1.325  1.029   4.131   1.00 0.00 ? 47  GLU A CA   5  
ATOM 6731  C C    . GLU A 1 47  ? -2.527  0.134   4.419   1.00 0.00 ? 47  GLU A C    5  
ATOM 6732  O O    . GLU A 1 47  ? -2.422  -1.092  4.388   1.00 0.00 ? 47  GLU A O    5  
ATOM 6733  C CB   . GLU A 1 47  ? -0.955  1.825   5.385   1.00 0.00 ? 47  GLU A CB   5  
ATOM 6734  C CG   . GLU A 1 47  ? -0.001  1.091   6.313   1.00 0.00 ? 47  GLU A CG   5  
ATOM 6735  C CD   . GLU A 1 47  ? 0.578   1.993   7.385   1.00 0.00 ? 47  GLU A CD   5  
ATOM 6736  O OE1  . GLU A 1 47  ? -0.115  2.237   8.395   1.00 0.00 ? 47  GLU A OE1  5  
ATOM 6737  O OE2  . GLU A 1 47  ? 1.726   2.454   7.214   1.00 0.00 ? 47  GLU A OE2  5  
ATOM 6738  H H    . GLU A 1 47  ? -1.570  2.901   3.172   1.00 0.00 ? 47  GLU A H    5  
ATOM 6739  H HA   . GLU A 1 47  ? -0.488  0.408   3.851   1.00 0.00 ? 47  GLU A HA   5  
ATOM 6740  H HB2  . GLU A 1 47  ? -0.491  2.753   5.085   1.00 0.00 ? 47  GLU A HB2  5  
ATOM 6741  H HB3  . GLU A 1 47  ? -1.858  2.047   5.934   1.00 0.00 ? 47  GLU A HB3  5  
ATOM 6742  H HG2  . GLU A 1 47  ? -0.535  0.284   6.792   1.00 0.00 ? 47  GLU A HG2  5  
ATOM 6743  H HG3  . GLU A 1 47  ? 0.810   0.686   5.726   1.00 0.00 ? 47  GLU A HG3  5  
ATOM 6744  N N    . ASP A 1 48  ? -3.666  0.757   4.700   1.00 0.00 ? 48  ASP A N    5  
ATOM 6745  C CA   . ASP A 1 48  ? -4.889  0.018   4.993   1.00 0.00 ? 48  ASP A CA   5  
ATOM 6746  C C    . ASP A 1 48  ? -5.109  -1.096  3.973   1.00 0.00 ? 48  ASP A C    5  
ATOM 6747  O O    . ASP A 1 48  ? -5.068  -2.278  4.313   1.00 0.00 ? 48  ASP A O    5  
ATOM 6748  C CB   . ASP A 1 48  ? -6.091  0.963   5.002   1.00 0.00 ? 48  ASP A CB   5  
ATOM 6749  C CG   . ASP A 1 48  ? -6.341  1.570   6.369   1.00 0.00 ? 48  ASP A CG   5  
ATOM 6750  O OD1  . ASP A 1 48  ? -5.463  2.313   6.857   1.00 0.00 ? 48  ASP A OD1  5  
ATOM 6751  O OD2  . ASP A 1 48  ? -7.413  1.302   6.949   1.00 0.00 ? 48  ASP A OD2  5  
ATOM 6752  H H    . ASP A 1 48  ? -3.686  1.737   4.709   1.00 0.00 ? 48  ASP A H    5  
ATOM 6753  H HA   . ASP A 1 48  ? -4.783  -0.424  5.972   1.00 0.00 ? 48  ASP A HA   5  
ATOM 6754  H HB2  . ASP A 1 48  ? -5.916  1.765   4.299   1.00 0.00 ? 48  ASP A HB2  5  
ATOM 6755  H HB3  . ASP A 1 48  ? -6.973  0.415   4.704   1.00 0.00 ? 48  ASP A HB3  5  
ATOM 6756  N N    . ILE A 1 49  ? -5.342  -0.709  2.724   1.00 0.00 ? 49  ILE A N    5  
ATOM 6757  C CA   . ILE A 1 49  ? -5.568  -1.674  1.656   1.00 0.00 ? 49  ILE A CA   5  
ATOM 6758  C C    . ILE A 1 49  ? -4.589  -2.840  1.752   1.00 0.00 ? 49  ILE A C    5  
ATOM 6759  O O    . ILE A 1 49  ? -4.996  -3.999  1.827   1.00 0.00 ? 49  ILE A O    5  
ATOM 6760  C CB   . ILE A 1 49  ? -5.435  -1.020  0.268   1.00 0.00 ? 49  ILE A CB   5  
ATOM 6761  C CG1  . ILE A 1 49  ? -6.388  0.171   0.148   1.00 0.00 ? 49  ILE A CG1  5  
ATOM 6762  C CG2  . ILE A 1 49  ? -5.712  -2.039  -0.827  1.00 0.00 ? 49  ILE A CG2  5  
ATOM 6763  C CD1  . ILE A 1 49  ? -5.777  1.481   0.593   1.00 0.00 ? 49  ILE A CD1  5  
ATOM 6764  H H    . ILE A 1 49  ? -5.362  0.248   2.515   1.00 0.00 ? 49  ILE A H    5  
ATOM 6765  H HA   . ILE A 1 49  ? -6.575  -2.054  1.757   1.00 0.00 ? 49  ILE A HA   5  
ATOM 6766  H HB   . ILE A 1 49  ? -4.420  -0.672  0.154   1.00 0.00 ? 49  ILE A HB   5  
ATOM 6767  H HG12 . ILE A 1 49  ? -6.690  0.280   -0.882  1.00 0.00 ? 49  ILE A HG12 5  
ATOM 6768  H HG13 . ILE A 1 49  ? -7.261  -0.013  0.757   1.00 0.00 ? 49  ILE A HG13 5  
ATOM 6769  H HG21 . ILE A 1 49  ? -6.768  -2.045  -1.055  1.00 0.00 ? 49  ILE A HG21 5  
ATOM 6770  H HG22 . ILE A 1 49  ? -5.155  -1.775  -1.714  1.00 0.00 ? 49  ILE A HG22 5  
ATOM 6771  H HG23 . ILE A 1 49  ? -5.410  -3.020  -0.491  1.00 0.00 ? 49  ILE A HG23 5  
ATOM 6772  H HD11 . ILE A 1 49  ? -6.130  1.725   1.584   1.00 0.00 ? 49  ILE A HD11 5  
ATOM 6773  H HD12 . ILE A 1 49  ? -4.701  1.392   0.604   1.00 0.00 ? 49  ILE A HD12 5  
ATOM 6774  H HD13 . ILE A 1 49  ? -6.066  2.264   -0.093  1.00 0.00 ? 49  ILE A HD13 5  
ATOM 6775  N N    . GLU A 1 50  ? -3.298  -2.523  1.751   1.00 0.00 ? 50  GLU A N    5  
ATOM 6776  C CA   . GLU A 1 50  ? -2.262  -3.545  1.839   1.00 0.00 ? 50  GLU A CA   5  
ATOM 6777  C C    . GLU A 1 50  ? -2.478  -4.435  3.060   1.00 0.00 ? 50  GLU A C    5  
ATOM 6778  O O    . GLU A 1 50  ? -2.365  -5.658  2.978   1.00 0.00 ? 50  GLU A O    5  
ATOM 6779  C CB   . GLU A 1 50  ? -0.878  -2.895  1.906   1.00 0.00 ? 50  GLU A CB   5  
ATOM 6780  C CG   . GLU A 1 50  ? 0.234   -3.867  2.263   1.00 0.00 ? 50  GLU A CG   5  
ATOM 6781  C CD   . GLU A 1 50  ? 1.495   -3.165  2.727   1.00 0.00 ? 50  GLU A CD   5  
ATOM 6782  O OE1  . GLU A 1 50  ? 1.395   -2.294  3.618   1.00 0.00 ? 50  GLU A OE1  5  
ATOM 6783  O OE2  . GLU A 1 50  ? 2.581   -3.485  2.201   1.00 0.00 ? 50  GLU A OE2  5  
ATOM 6784  H H    . GLU A 1 50  ? -3.037  -1.581  1.689   1.00 0.00 ? 50  GLU A H    5  
ATOM 6785  H HA   . GLU A 1 50  ? -2.320  -4.154  0.950   1.00 0.00 ? 50  GLU A HA   5  
ATOM 6786  H HB2  . GLU A 1 50  ? -0.652  -2.458  0.945   1.00 0.00 ? 50  GLU A HB2  5  
ATOM 6787  H HB3  . GLU A 1 50  ? -0.897  -2.113  2.651   1.00 0.00 ? 50  GLU A HB3  5  
ATOM 6788  H HG2  . GLU A 1 50  ? -0.111  -4.514  3.055   1.00 0.00 ? 50  GLU A HG2  5  
ATOM 6789  H HG3  . GLU A 1 50  ? 0.470   -4.460  1.391   1.00 0.00 ? 50  GLU A HG3  5  
ATOM 6790  N N    . LYS A 1 51  ? -2.787  -3.811  4.191   1.00 0.00 ? 51  LYS A N    5  
ATOM 6791  C CA   . LYS A 1 51  ? -3.020  -4.544  5.430   1.00 0.00 ? 51  LYS A CA   5  
ATOM 6792  C C    . LYS A 1 51  ? -4.138  -5.567  5.256   1.00 0.00 ? 51  LYS A C    5  
ATOM 6793  O O    . LYS A 1 51  ? -4.141  -6.614  5.903   1.00 0.00 ? 51  LYS A O    5  
ATOM 6794  C CB   . LYS A 1 51  ? -3.372  -3.576  6.561   1.00 0.00 ? 51  LYS A CB   5  
ATOM 6795  C CG   . LYS A 1 51  ? -2.180  -2.795  7.088   1.00 0.00 ? 51  LYS A CG   5  
ATOM 6796  C CD   . LYS A 1 51  ? -2.528  -2.035  8.356   1.00 0.00 ? 51  LYS A CD   5  
ATOM 6797  C CE   . LYS A 1 51  ? -2.275  -2.877  9.598   1.00 0.00 ? 51  LYS A CE   5  
ATOM 6798  N NZ   . LYS A 1 51  ? -2.270  -2.051  10.837  1.00 0.00 ? 51  LYS A NZ   5  
ATOM 6799  H H    . LYS A 1 51  ? -2.862  -2.834  4.193   1.00 0.00 ? 51  LYS A H    5  
ATOM 6800  H HA   . LYS A 1 51  ? -2.108  -5.064  5.684   1.00 0.00 ? 51  LYS A HA   5  
ATOM 6801  H HB2  . LYS A 1 51  ? -4.107  -2.871  6.200   1.00 0.00 ? 51  LYS A HB2  5  
ATOM 6802  H HB3  . LYS A 1 51  ? -3.798  -4.138  7.381   1.00 0.00 ? 51  LYS A HB3  5  
ATOM 6803  H HG2  . LYS A 1 51  ? -1.377  -3.484  7.302   1.00 0.00 ? 51  LYS A HG2  5  
ATOM 6804  H HG3  . LYS A 1 51  ? -1.861  -2.091  6.332   1.00 0.00 ? 51  LYS A HG3  5  
ATOM 6805  H HD2  . LYS A 1 51  ? -1.920  -1.144  8.410   1.00 0.00 ? 51  LYS A HD2  5  
ATOM 6806  H HD3  . LYS A 1 51  ? -3.572  -1.759  8.326   1.00 0.00 ? 51  LYS A HD3  5  
ATOM 6807  H HE2  . LYS A 1 51  ? -3.052  -3.622  9.675   1.00 0.00 ? 51  LYS A HE2  5  
ATOM 6808  H HE3  . LYS A 1 51  ? -1.317  -3.365  9.496   1.00 0.00 ? 51  LYS A HE3  5  
ATOM 6809  H HZ1  . LYS A 1 51  ? -3.245  -1.808  11.108  1.00 0.00 ? 51  LYS A HZ1  5  
ATOM 6810  H HZ2  . LYS A 1 51  ? -1.738  -1.172  10.678  1.00 0.00 ? 51  LYS A HZ2  5  
ATOM 6811  H HZ3  . LYS A 1 51  ? -1.826  -2.578  11.616  1.00 0.00 ? 51  LYS A HZ3  5  
ATOM 6812  N N    . SER A 1 52  ? -5.084  -5.258  4.376   1.00 0.00 ? 52  SER A N    5  
ATOM 6813  C CA   . SER A 1 52  ? -6.209  -6.150  4.118   1.00 0.00 ? 52  SER A CA   5  
ATOM 6814  C C    . SER A 1 52  ? -5.779  -7.329  3.251   1.00 0.00 ? 52  SER A C    5  
ATOM 6815  O O    . SER A 1 52  ? -5.822  -8.481  3.684   1.00 0.00 ? 52  SER A O    5  
ATOM 6816  C CB   . SER A 1 52  ? -7.346  -5.387  3.434   1.00 0.00 ? 52  SER A CB   5  
ATOM 6817  O OG   . SER A 1 52  ? -8.533  -6.160  3.405   1.00 0.00 ? 52  SER A OG   5  
ATOM 6818  H H    . SER A 1 52  ? -5.026  -4.408  3.890   1.00 0.00 ? 52  SER A H    5  
ATOM 6819  H HA   . SER A 1 52  ? -6.559  -6.525  5.068   1.00 0.00 ? 52  SER A HA   5  
ATOM 6820  H HB2  . SER A 1 52  ? -7.538  -4.473  3.975   1.00 0.00 ? 52  SER A HB2  5  
ATOM 6821  H HB3  . SER A 1 52  ? -7.058  -5.152  2.419   1.00 0.00 ? 52  SER A HB3  5  
ATOM 6822  H HG   . SER A 1 52  ? -9.292  -5.578  3.316   1.00 0.00 ? 52  SER A HG   5  
ATOM 6823  N N    . PHE A 1 53  ? -5.365  -7.033  2.023   1.00 0.00 ? 53  PHE A N    5  
ATOM 6824  C CA   . PHE A 1 53  ? -4.928  -8.068  1.093   1.00 0.00 ? 53  PHE A CA   5  
ATOM 6825  C C    . PHE A 1 53  ? -3.987  -9.054  1.780   1.00 0.00 ? 53  PHE A C    5  
ATOM 6826  O O    . PHE A 1 53  ? -3.870  -10.208 1.369   1.00 0.00 ? 53  PHE A O    5  
ATOM 6827  C CB   . PHE A 1 53  ? -4.232  -7.438  -0.115  1.00 0.00 ? 53  PHE A CB   5  
ATOM 6828  C CG   . PHE A 1 53  ? -3.680  -8.445  -1.082  1.00 0.00 ? 53  PHE A CG   5  
ATOM 6829  C CD1  . PHE A 1 53  ? -2.560  -9.194  -0.758  1.00 0.00 ? 53  PHE A CD1  5  
ATOM 6830  C CD2  . PHE A 1 53  ? -4.281  -8.644  -2.314  1.00 0.00 ? 53  PHE A CD2  5  
ATOM 6831  C CE1  . PHE A 1 53  ? -2.049  -10.121 -1.646  1.00 0.00 ? 53  PHE A CE1  5  
ATOM 6832  C CE2  . PHE A 1 53  ? -3.775  -9.570  -3.207  1.00 0.00 ? 53  PHE A CE2  5  
ATOM 6833  C CZ   . PHE A 1 53  ? -2.658  -10.311 -2.872  1.00 0.00 ? 53  PHE A CZ   5  
ATOM 6834  H H    . PHE A 1 53  ? -5.354  -6.096  1.735   1.00 0.00 ? 53  PHE A H    5  
ATOM 6835  H HA   . PHE A 1 53  ? -5.804  -8.601  0.756   1.00 0.00 ? 53  PHE A HA   5  
ATOM 6836  H HB2  . PHE A 1 53  ? -4.940  -6.821  -0.647  1.00 0.00 ? 53  PHE A HB2  5  
ATOM 6837  H HB3  . PHE A 1 53  ? -3.414  -6.824  0.231   1.00 0.00 ? 53  PHE A HB3  5  
ATOM 6838  H HD1  . PHE A 1 53  ? -2.083  -9.048  0.200   1.00 0.00 ? 53  PHE A HD1  5  
ATOM 6839  H HD2  . PHE A 1 53  ? -5.155  -8.065  -2.577  1.00 0.00 ? 53  PHE A HD2  5  
ATOM 6840  H HE1  . PHE A 1 53  ? -1.176  -10.699 -1.382  1.00 0.00 ? 53  PHE A HE1  5  
ATOM 6841  H HE2  . PHE A 1 53  ? -4.253  -9.716  -4.164  1.00 0.00 ? 53  PHE A HE2  5  
ATOM 6842  H HZ   . PHE A 1 53  ? -2.260  -11.034 -3.568  1.00 0.00 ? 53  PHE A HZ   5  
ATOM 6843  N N    . LYS A 1 54  ? -3.315  -8.589  2.828   1.00 0.00 ? 54  LYS A N    5  
ATOM 6844  C CA   . LYS A 1 54  ? -2.384  -9.427  3.573   1.00 0.00 ? 54  LYS A CA   5  
ATOM 6845  C C    . LYS A 1 54  ? -3.055  -10.722 4.020   1.00 0.00 ? 54  LYS A C    5  
ATOM 6846  O O    . LYS A 1 54  ? -2.534  -11.814 3.793   1.00 0.00 ? 54  LYS A O    5  
ATOM 6847  C CB   . LYS A 1 54  ? -1.848  -8.671  4.792   1.00 0.00 ? 54  LYS A CB   5  
ATOM 6848  C CG   . LYS A 1 54  ? -0.629  -7.817  4.489   1.00 0.00 ? 54  LYS A CG   5  
ATOM 6849  C CD   . LYS A 1 54  ? 0.661   -8.585  4.717   1.00 0.00 ? 54  LYS A CD   5  
ATOM 6850  C CE   . LYS A 1 54  ? 0.925   -8.805  6.199   1.00 0.00 ? 54  LYS A CE   5  
ATOM 6851  N NZ   . LYS A 1 54  ? 2.347   -9.162  6.462   1.00 0.00 ? 54  LYS A NZ   5  
ATOM 6852  H H    . LYS A 1 54  ? -3.450  -7.659  3.108   1.00 0.00 ? 54  LYS A H    5  
ATOM 6853  H HA   . LYS A 1 54  ? -1.560  -9.670  2.920   1.00 0.00 ? 54  LYS A HA   5  
ATOM 6854  H HB2  . LYS A 1 54  ? -2.628  -8.028  5.172   1.00 0.00 ? 54  LYS A HB2  5  
ATOM 6855  H HB3  . LYS A 1 54  ? -1.579  -9.387  5.555   1.00 0.00 ? 54  LYS A HB3  5  
ATOM 6856  H HG2  . LYS A 1 54  ? -0.670  -7.500  3.458   1.00 0.00 ? 54  LYS A HG2  5  
ATOM 6857  H HG3  . LYS A 1 54  ? -0.640  -6.949  5.135   1.00 0.00 ? 54  LYS A HG3  5  
ATOM 6858  H HD2  . LYS A 1 54  ? 0.589   -9.546  4.230   1.00 0.00 ? 54  LYS A HD2  5  
ATOM 6859  H HD3  . LYS A 1 54  ? 1.483   -8.026  4.293   1.00 0.00 ? 54  LYS A HD3  5  
ATOM 6860  H HE2  . LYS A 1 54  ? 0.686   -7.898  6.732   1.00 0.00 ? 54  LYS A HE2  5  
ATOM 6861  H HE3  . LYS A 1 54  ? 0.291   -9.606  6.549   1.00 0.00 ? 54  LYS A HE3  5  
ATOM 6862  H HZ1  . LYS A 1 54  ? 2.429   -9.648  7.378   1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 6863  H HZ2  . LYS A 1 54  ? 2.932   -8.303  6.485   1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 6864  H HZ3  . LYS A 1 54  ? 2.702   -9.792  5.715   1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 6865  N N    . THR A 1 55  ? -4.215  -10.593 4.657   1.00 0.00 ? 55  THR A N    5  
ATOM 6866  C CA   . THR A 1 55  ? -4.958  -11.752 5.135   1.00 0.00 ? 55  THR A CA   5  
ATOM 6867  C C    . THR A 1 55  ? -5.852  -12.323 4.040   1.00 0.00 ? 55  THR A C    5  
ATOM 6868  O O    . THR A 1 55  ? -5.987  -13.538 3.907   1.00 0.00 ? 55  THR A O    5  
ATOM 6869  C CB   . THR A 1 55  ? -5.825  -11.399 6.357   1.00 0.00 ? 55  THR A CB   5  
ATOM 6870  O OG1  . THR A 1 55  ? -6.060  -12.570 7.147   1.00 0.00 ? 55  THR A OG1  5  
ATOM 6871  C CG2  . THR A 1 55  ? -7.154  -10.799 5.923   1.00 0.00 ? 55  THR A CG2  5  
ATOM 6872  H H    . THR A 1 55  ? -4.579  -9.696  4.808   1.00 0.00 ? 55  THR A H    5  
ATOM 6873  H HA   . THR A 1 55  ? -4.243  -12.506 5.432   1.00 0.00 ? 55  THR A HA   5  
ATOM 6874  H HB   . THR A 1 55  ? -5.297  -10.671 6.956   1.00 0.00 ? 55  THR A HB   5  
ATOM 6875  H HG1  . THR A 1 55  ? -6.875  -12.990 6.861   1.00 0.00 ? 55  THR A HG1  5  
ATOM 6876  H HG21 . THR A 1 55  ? -6.975  -10.007 5.211   1.00 0.00 ? 55  THR A HG21 5  
ATOM 6877  H HG22 . THR A 1 55  ? -7.667  -10.399 6.785   1.00 0.00 ? 55  THR A HG22 5  
ATOM 6878  H HG23 . THR A 1 55  ? -7.761  -11.564 5.465   1.00 0.00 ? 55  THR A HG23 5  
ATOM 6879  N N    . ASN A 1 56  ? -6.459  -11.437 3.257   1.00 0.00 ? 56  ASN A N    5  
ATOM 6880  C CA   . ASN A 1 56  ? -7.341  -11.853 2.172   1.00 0.00 ? 56  ASN A CA   5  
ATOM 6881  C C    . ASN A 1 56  ? -6.857  -11.300 0.835   1.00 0.00 ? 56  ASN A C    5  
ATOM 6882  O O    . ASN A 1 56  ? -7.348  -10.285 0.341   1.00 0.00 ? 56  ASN A O    5  
ATOM 6883  C CB   . ASN A 1 56  ? -8.772  -11.386 2.442   1.00 0.00 ? 56  ASN A CB   5  
ATOM 6884  C CG   . ASN A 1 56  ? -8.923  -9.882  2.316   1.00 0.00 ? 56  ASN A CG   5  
ATOM 6885  O OD1  . ASN A 1 56  ? -8.030  -9.123  2.695   1.00 0.00 ? 56  ASN A OD1  5  
ATOM 6886  N ND2  . ASN A 1 56  ? -10.057 -9.444  1.781   1.00 0.00 ? 56  ASN A ND2  5  
ATOM 6887  H H    . ASN A 1 56  ? -6.311  -10.481 3.412   1.00 0.00 ? 56  ASN A H    5  
ATOM 6888  H HA   . ASN A 1 56  ? -7.326  -12.932 2.129   1.00 0.00 ? 56  ASN A HA   5  
ATOM 6889  H HB2  . ASN A 1 56  ? -9.438  -11.856 1.733   1.00 0.00 ? 56  ASN A HB2  5  
ATOM 6890  H HB3  . ASN A 1 56  ? -9.056  -11.675 3.443   1.00 0.00 ? 56  ASN A HB3  5  
ATOM 6891  H HD21 . ASN A 1 56  ? -10.723 -10.106 1.502   1.00 0.00 ? 56  ASN A HD21 5  
ATOM 6892  H HD22 . ASN A 1 56  ? -10.180 -8.477  1.686   1.00 0.00 ? 56  ASN A HD22 5  
ATOM 6893  N N    . PRO A 1 57  ? -5.870  -11.982 0.235   1.00 0.00 ? 57  PRO A N    5  
ATOM 6894  C CA   . PRO A 1 57  ? -5.299  -11.578 -1.054  1.00 0.00 ? 57  PRO A CA   5  
ATOM 6895  C C    . PRO A 1 57  ? -6.274  -11.779 -2.209  1.00 0.00 ? 57  PRO A C    5  
ATOM 6896  O O    . PRO A 1 57  ? -6.135  -11.162 -3.265  1.00 0.00 ? 57  PRO A O    5  
ATOM 6897  C CB   . PRO A 1 57  ? -4.088  -12.501 -1.209  1.00 0.00 ? 57  PRO A CB   5  
ATOM 6898  C CG   . PRO A 1 57  ? -4.418  -13.701 -0.391  1.00 0.00 ? 57  PRO A CG   5  
ATOM 6899  C CD   . PRO A 1 57  ? -5.237  -13.200 0.767   1.00 0.00 ? 57  PRO A CD   5  
ATOM 6900  H HA   . PRO A 1 57  ? -4.970  -10.549 -1.037  1.00 0.00 ? 57  PRO A HA   5  
ATOM 6901  H HB2  . PRO A 1 57  ? -3.958  -12.756 -2.252  1.00 0.00 ? 57  PRO A HB2  5  
ATOM 6902  H HB3  . PRO A 1 57  ? -3.202  -12.004 -0.842  1.00 0.00 ? 57  PRO A HB3  5  
ATOM 6903  H HG2  . PRO A 1 57  ? -4.990  -14.401 -0.980  1.00 0.00 ? 57  PRO A HG2  5  
ATOM 6904  H HG3  . PRO A 1 57  ? -3.509  -14.163 -0.034  1.00 0.00 ? 57  PRO A HG3  5  
ATOM 6905  H HD2  . PRO A 1 57  ? -5.981  -13.931 1.047   1.00 0.00 ? 57  PRO A HD2  5  
ATOM 6906  H HD3  . PRO A 1 57  ? -4.599  -12.967 1.607   1.00 0.00 ? 57  PRO A HD3  5  
ATOM 6907  N N    . CYS A 1 58  ? -7.260  -12.645 -2.000  1.00 0.00 ? 58  CYS A N    5  
ATOM 6908  C CA   . CYS A 1 58  ? -8.258  -12.927 -3.025  1.00 0.00 ? 58  CYS A CA   5  
ATOM 6909  C C    . CYS A 1 58  ? -9.657  -12.561 -2.538  1.00 0.00 ? 58  CYS A C    5  
ATOM 6910  O O    . CYS A 1 58  ? -10.637 -13.222 -2.879  1.00 0.00 ? 58  CYS A O    5  
ATOM 6911  C CB   . CYS A 1 58  ? -8.213  -14.405 -3.418  1.00 0.00 ? 58  CYS A CB   5  
ATOM 6912  S SG   . CYS A 1 58  ? -8.785  -14.740 -5.100  1.00 0.00 ? 58  CYS A SG   5  
ATOM 6913  H H    . CYS A 1 58  ? -7.318  -13.105 -1.137  1.00 0.00 ? 58  CYS A H    5  
ATOM 6914  H HA   . CYS A 1 58  ? -8.023  -12.326 -3.891  1.00 0.00 ? 58  CYS A HA   5  
ATOM 6915  H HB2  . CYS A 1 58  ? -7.195  -14.759 -3.341  1.00 0.00 ? 58  CYS A HB2  5  
ATOM 6916  H HB3  . CYS A 1 58  ? -8.835  -14.969 -2.739  1.00 0.00 ? 58  CYS A HB3  5  
ATOM 6917  H HG   . CYS A 1 58  ? -7.854  -14.314 -5.940  1.00 0.00 ? 58  CYS A HG   5  
ATOM 6918  N N    . GLY A 1 59  ? -9.740  -11.503 -1.737  1.00 0.00 ? 59  GLY A N    5  
ATOM 6919  C CA   . GLY A 1 59  ? -11.022 -11.068 -1.214  1.00 0.00 ? 59  GLY A CA   5  
ATOM 6920  C C    . GLY A 1 59  ? -11.404 -9.682  -1.694  1.00 0.00 ? 59  GLY A C    5  
ATOM 6921  O O    . GLY A 1 59  ? -11.299 -9.378  -2.882  1.00 0.00 ? 59  GLY A O    5  
ATOM 6922  H H    . GLY A 1 59  ? -8.925  -11.014 -1.499  1.00 0.00 ? 59  GLY A H    5  
ATOM 6923  H HA2  . GLY A 1 59  ? -11.782 -11.768 -1.526  1.00 0.00 ? 59  GLY A HA2  5  
ATOM 6924  H HA3  . GLY A 1 59  ? -10.974 -11.062 -0.135  1.00 0.00 ? 59  GLY A HA3  5  
ATOM 6925  N N    . SER A 1 60  ? -11.850 -8.839  -0.768  1.00 0.00 ? 60  SER A N    5  
ATOM 6926  C CA   . SER A 1 60  ? -12.255 -7.479  -1.104  1.00 0.00 ? 60  SER A CA   5  
ATOM 6927  C C    . SER A 1 60  ? -12.354 -6.616  0.150   1.00 0.00 ? 60  SER A C    5  
ATOM 6928  O O    . SER A 1 60  ? -12.696 -7.105  1.228   1.00 0.00 ? 60  SER A O    5  
ATOM 6929  C CB   . SER A 1 60  ? -13.598 -7.490  -1.836  1.00 0.00 ? 60  SER A CB   5  
ATOM 6930  O OG   . SER A 1 60  ? -14.523 -8.348  -1.192  1.00 0.00 ? 60  SER A OG   5  
ATOM 6931  H H    . SER A 1 60  ? -11.911 -9.141  0.163   1.00 0.00 ? 60  SER A H    5  
ATOM 6932  H HA   . SER A 1 60  ? -11.502 -7.061  -1.756  1.00 0.00 ? 60  SER A HA   5  
ATOM 6933  H HB2  . SER A 1 60  ? -14.004 -6.490  -1.853  1.00 0.00 ? 60  SER A HB2  5  
ATOM 6934  H HB3  . SER A 1 60  ? -13.450 -7.835  -2.849  1.00 0.00 ? 60  SER A HB3  5  
ATOM 6935  H HG   . SER A 1 60  ? -15.412 -8.146  -1.494  1.00 0.00 ? 60  SER A HG   5  
ATOM 6936  N N    . ILE A 1 61  ? -12.052 -5.331  0.002   1.00 0.00 ? 61  ILE A N    5  
ATOM 6937  C CA   . ILE A 1 61  ? -12.107 -4.399  1.122   1.00 0.00 ? 61  ILE A CA   5  
ATOM 6938  C C    . ILE A 1 61  ? -13.189 -3.346  0.908   1.00 0.00 ? 61  ILE A C    5  
ATOM 6939  O O    . ILE A 1 61  ? -13.107 -2.536  -0.015  1.00 0.00 ? 61  ILE A O    5  
ATOM 6940  C CB   . ILE A 1 61  ? -10.755 -3.694  1.334   1.00 0.00 ? 61  ILE A CB   5  
ATOM 6941  C CG1  . ILE A 1 61  ? -10.833 -2.745  2.533   1.00 0.00 ? 61  ILE A CG1  5  
ATOM 6942  C CG2  . ILE A 1 61  ? -10.349 -2.937  0.079   1.00 0.00 ? 61  ILE A CG2  5  
ATOM 6943  C CD1  . ILE A 1 61  ? -9.489  -2.193  2.955   1.00 0.00 ? 61  ILE A CD1  5  
ATOM 6944  H H    . ILE A 1 61  ? -11.786 -5.001  -0.881  1.00 0.00 ? 61  ILE A H    5  
ATOM 6945  H HA   . ILE A 1 61  ? -12.340 -4.964  2.013   1.00 0.00 ? 61  ILE A HA   5  
ATOM 6946  H HB   . ILE A 1 61  ? -10.007 -4.447  1.529   1.00 0.00 ? 61  ILE A HB   5  
ATOM 6947  H HG12 . ILE A 1 61  ? -11.469 -1.911  2.283   1.00 0.00 ? 61  ILE A HG12 5  
ATOM 6948  H HG13 . ILE A 1 61  ? -11.254 -3.275  3.375   1.00 0.00 ? 61  ILE A HG13 5  
ATOM 6949  H HG21 . ILE A 1 61  ? -10.959 -2.051  -0.021  1.00 0.00 ? 61  ILE A HG21 5  
ATOM 6950  H HG22 . ILE A 1 61  ? -9.310  -2.652  0.151   1.00 0.00 ? 61  ILE A HG22 5  
ATOM 6951  H HG23 . ILE A 1 61  ? -10.490 -3.570  -0.785  1.00 0.00 ? 61  ILE A HG23 5  
ATOM 6952  H HD11 . ILE A 1 61  ? -9.617  -1.198  3.354   1.00 0.00 ? 61  ILE A HD11 5  
ATOM 6953  H HD12 . ILE A 1 61  ? -9.058  -2.833  3.711   1.00 0.00 ? 61  ILE A HD12 5  
ATOM 6954  H HD13 . ILE A 1 61  ? -8.831  -2.155  2.099   1.00 0.00 ? 61  ILE A HD13 5  
ATOM 6955  N N    . SER A 1 62  ? -14.202 -3.364  1.768   1.00 0.00 ? 62  SER A N    5  
ATOM 6956  C CA   . SER A 1 62  ? -15.303 -2.411  1.672   1.00 0.00 ? 62  SER A CA   5  
ATOM 6957  C C    . SER A 1 62  ? -15.125 -1.274  2.673   1.00 0.00 ? 62  SER A C    5  
ATOM 6958  O O    . SER A 1 62  ? -15.157 -1.488  3.885   1.00 0.00 ? 62  SER A O    5  
ATOM 6959  C CB   . SER A 1 62  ? -16.638 -3.117  1.915   1.00 0.00 ? 62  SER A CB   5  
ATOM 6960  O OG   . SER A 1 62  ? -16.700 -3.653  3.225   1.00 0.00 ? 62  SER A OG   5  
ATOM 6961  H H    . SER A 1 62  ? -14.211 -4.035  2.482   1.00 0.00 ? 62  SER A H    5  
ATOM 6962  H HA   . SER A 1 62  ? -15.299 -2.000  0.673   1.00 0.00 ? 62  SER A HA   5  
ATOM 6963  H HB2  . SER A 1 62  ? -17.444 -2.409  1.791   1.00 0.00 ? 62  SER A HB2  5  
ATOM 6964  H HB3  . SER A 1 62  ? -16.752 -3.921  1.203   1.00 0.00 ? 62  SER A HB3  5  
ATOM 6965  H HG   . SER A 1 62  ? -17.593 -3.955  3.406   1.00 0.00 ? 62  SER A HG   5  
ATOM 6966  N N    . PHE A 1 63  ? -14.938 -0.064  2.157   1.00 0.00 ? 63  PHE A N    5  
ATOM 6967  C CA   . PHE A 1 63  ? -14.755 1.109   3.004   1.00 0.00 ? 63  PHE A CA   5  
ATOM 6968  C C    . PHE A 1 63  ? -15.643 2.260   2.540   1.00 0.00 ? 63  PHE A C    5  
ATOM 6969  O O    . PHE A 1 63  ? -16.112 2.278   1.401   1.00 0.00 ? 63  PHE A O    5  
ATOM 6970  C CB   . PHE A 1 63  ? -13.289 1.546   2.996   1.00 0.00 ? 63  PHE A CB   5  
ATOM 6971  C CG   . PHE A 1 63  ? -12.833 2.092   1.672   1.00 0.00 ? 63  PHE A CG   5  
ATOM 6972  C CD1  . PHE A 1 63  ? -13.045 3.422   1.347   1.00 0.00 ? 63  PHE A CD1  5  
ATOM 6973  C CD2  . PHE A 1 63  ? -12.194 1.275   0.754   1.00 0.00 ? 63  PHE A CD2  5  
ATOM 6974  C CE1  . PHE A 1 63  ? -12.627 3.926   0.129   1.00 0.00 ? 63  PHE A CE1  5  
ATOM 6975  C CE2  . PHE A 1 63  ? -11.774 1.773   -0.465  1.00 0.00 ? 63  PHE A CE2  5  
ATOM 6976  C CZ   . PHE A 1 63  ? -11.990 3.101   -0.777  1.00 0.00 ? 63  PHE A CZ   5  
ATOM 6977  H H    . PHE A 1 63  ? -14.923 0.043   1.182   1.00 0.00 ? 63  PHE A H    5  
ATOM 6978  H HA   . PHE A 1 63  ? -15.035 0.837   4.010   1.00 0.00 ? 63  PHE A HA   5  
ATOM 6979  H HB2  . PHE A 1 63  ? -13.146 2.316   3.738   1.00 0.00 ? 63  PHE A HB2  5  
ATOM 6980  H HB3  . PHE A 1 63  ? -12.666 0.698   3.238   1.00 0.00 ? 63  PHE A HB3  5  
ATOM 6981  H HD1  . PHE A 1 63  ? -13.542 4.068   2.055   1.00 0.00 ? 63  PHE A HD1  5  
ATOM 6982  H HD2  . PHE A 1 63  ? -12.023 0.235   0.998   1.00 0.00 ? 63  PHE A HD2  5  
ATOM 6983  H HE1  . PHE A 1 63  ? -12.798 4.965   -0.112  1.00 0.00 ? 63  PHE A HE1  5  
ATOM 6984  H HE2  . PHE A 1 63  ? -11.276 1.125   -1.171  1.00 0.00 ? 63  PHE A HE2  5  
ATOM 6985  H HZ   . PHE A 1 63  ? -11.664 3.493   -1.729  1.00 0.00 ? 63  PHE A HZ   5  
ATOM 6986  N N    . THR A 1 64  ? -15.871 3.220   3.431   1.00 0.00 ? 64  THR A N    5  
ATOM 6987  C CA   . THR A 1 64  ? -16.704 4.373   3.115   1.00 0.00 ? 64  THR A CA   5  
ATOM 6988  C C    . THR A 1 64  ? -15.993 5.676   3.464   1.00 0.00 ? 64  THR A C    5  
ATOM 6989  O O    . THR A 1 64  ? -15.104 5.703   4.315   1.00 0.00 ? 64  THR A O    5  
ATOM 6990  C CB   . THR A 1 64  ? -18.048 4.318   3.866   1.00 0.00 ? 64  THR A CB   5  
ATOM 6991  O OG1  . THR A 1 64  ? -17.821 4.088   5.261   1.00 0.00 ? 64  THR A OG1  5  
ATOM 6992  C CG2  . THR A 1 64  ? -18.937 3.220   3.304   1.00 0.00 ? 64  THR A CG2  5  
ATOM 6993  H H    . THR A 1 64  ? -15.470 3.148   4.322   1.00 0.00 ? 64  THR A H    5  
ATOM 6994  H HA   . THR A 1 64  ? -16.907 4.357   2.055   1.00 0.00 ? 64  THR A HA   5  
ATOM 6995  H HB   . THR A 1 64  ? -18.551 5.267   3.743   1.00 0.00 ? 64  THR A HB   5  
ATOM 6996  H HG1  . THR A 1 64  ? -18.388 4.666   5.777   1.00 0.00 ? 64  THR A HG1  5  
ATOM 6997  H HG21 . THR A 1 64  ? -19.695 2.963   4.029   1.00 0.00 ? 64  THR A HG21 5  
ATOM 6998  H HG22 . THR A 1 64  ? -18.338 2.348   3.085   1.00 0.00 ? 64  THR A HG22 5  
ATOM 6999  H HG23 . THR A 1 64  ? -19.410 3.568   2.398   1.00 0.00 ? 64  THR A HG23 5  
ATOM 7000  N N    . THR A 1 65  ? -16.392 6.758   2.801   1.00 0.00 ? 65  THR A N    5  
ATOM 7001  C CA   . THR A 1 65  ? -15.792 8.064   3.040   1.00 0.00 ? 65  THR A CA   5  
ATOM 7002  C C    . THR A 1 65  ? -16.843 9.168   2.992   1.00 0.00 ? 65  THR A C    5  
ATOM 7003  O O    . THR A 1 65  ? -18.037 8.897   2.865   1.00 0.00 ? 65  THR A O    5  
ATOM 7004  C CB   . THR A 1 65  ? -14.691 8.375   2.009   1.00 0.00 ? 65  THR A CB   5  
ATOM 7005  O OG1  . THR A 1 65  ? -15.201 8.205   0.681   1.00 0.00 ? 65  THR A OG1  5  
ATOM 7006  C CG2  . THR A 1 65  ? -13.486 7.469   2.214   1.00 0.00 ? 65  THR A CG2  5  
ATOM 7007  H H    . THR A 1 65  ? -17.105 6.673   2.134   1.00 0.00 ? 65  THR A H    5  
ATOM 7008  H HA   . THR A 1 65  ? -15.343 8.050   4.022   1.00 0.00 ? 65  THR A HA   5  
ATOM 7009  H HB   . THR A 1 65  ? -14.378 9.401   2.137   1.00 0.00 ? 65  THR A HB   5  
ATOM 7010  H HG1  . THR A 1 65  ? -14.477 8.248   0.052   1.00 0.00 ? 65  THR A HG1  5  
ATOM 7011  H HG21 . THR A 1 65  ? -13.076 7.192   1.255   1.00 0.00 ? 65  THR A HG21 5  
ATOM 7012  H HG22 . THR A 1 65  ? -13.791 6.580   2.746   1.00 0.00 ? 65  THR A HG22 5  
ATOM 7013  H HG23 . THR A 1 65  ? -12.737 7.992   2.789   1.00 0.00 ? 65  THR A HG23 5  
ATOM 7014  N N    . SER A 1 66  ? -16.391 10.414  3.095   1.00 0.00 ? 66  SER A N    5  
ATOM 7015  C CA   . SER A 1 66  ? -17.293 11.559  3.067   1.00 0.00 ? 66  SER A CA   5  
ATOM 7016  C C    . SER A 1 66  ? -18.485 11.289  2.154   1.00 0.00 ? 66  SER A C    5  
ATOM 7017  O O    . SER A 1 66  ? -18.389 11.416  0.934   1.00 0.00 ? 66  SER A O    5  
ATOM 7018  C CB   . SER A 1 66  ? -16.549 12.810  2.596   1.00 0.00 ? 66  SER A CB   5  
ATOM 7019  O OG   . SER A 1 66  ? -15.601 13.233  3.561   1.00 0.00 ? 66  SER A OG   5  
ATOM 7020  H H    . SER A 1 66  ? -15.428 10.566  3.195   1.00 0.00 ? 66  SER A H    5  
ATOM 7021  H HA   . SER A 1 66  ? -17.653 11.722  4.072   1.00 0.00 ? 66  SER A HA   5  
ATOM 7022  H HB2  . SER A 1 66  ? -16.033 12.593  1.673   1.00 0.00 ? 66  SER A HB2  5  
ATOM 7023  H HB3  . SER A 1 66  ? -17.259 13.607  2.432   1.00 0.00 ? 66  SER A HB3  5  
ATOM 7024  H HG   . SER A 1 66  ? -15.484 14.184  3.499   1.00 0.00 ? 66  SER A HG   5  
ATOM 7025  N N    . LYS A 1 67  ? -19.610 10.916  2.756   1.00 0.00 ? 67  LYS A N    5  
ATOM 7026  C CA   . LYS A 1 67  ? -20.823 10.628  2.000   1.00 0.00 ? 67  LYS A CA   5  
ATOM 7027  C C    . LYS A 1 67  ? -20.492 9.933   0.683   1.00 0.00 ? 67  LYS A C    5  
ATOM 7028  O O    . LYS A 1 67  ? -20.979 10.327  -0.378  1.00 0.00 ? 67  LYS A O    5  
ATOM 7029  C CB   . LYS A 1 67  ? -21.597 11.920  1.727   1.00 0.00 ? 67  LYS A CB   5  
ATOM 7030  C CG   . LYS A 1 67  ? -20.871 12.879  0.799   1.00 0.00 ? 67  LYS A CG   5  
ATOM 7031  C CD   . LYS A 1 67  ? -21.846 13.685  -0.043  1.00 0.00 ? 67  LYS A CD   5  
ATOM 7032  C CE   . LYS A 1 67  ? -21.281 13.975  -1.425  1.00 0.00 ? 67  LYS A CE   5  
ATOM 7033  N NZ   . LYS A 1 67  ? -20.353 15.140  -1.413  1.00 0.00 ? 67  LYS A NZ   5  
ATOM 7034  H H    . LYS A 1 67  ? -19.625 10.832  3.733   1.00 0.00 ? 67  LYS A H    5  
ATOM 7035  H HA   . LYS A 1 67  ? -21.437 9.970   2.596   1.00 0.00 ? 67  LYS A HA   5  
ATOM 7036  H HB2  . LYS A 1 67  ? -22.547 11.669  1.279   1.00 0.00 ? 67  LYS A HB2  5  
ATOM 7037  H HB3  . LYS A 1 67  ? -21.773 12.425  2.666   1.00 0.00 ? 67  LYS A HB3  5  
ATOM 7038  H HG2  . LYS A 1 67  ? -20.276 13.558  1.391   1.00 0.00 ? 67  LYS A HG2  5  
ATOM 7039  H HG3  . LYS A 1 67  ? -20.226 12.312  0.143   1.00 0.00 ? 67  LYS A HG3  5  
ATOM 7040  H HD2  . LYS A 1 67  ? -22.763 13.126  -0.151  1.00 0.00 ? 67  LYS A HD2  5  
ATOM 7041  H HD3  . LYS A 1 67  ? -22.050 14.622  0.456   1.00 0.00 ? 67  LYS A HD3  5  
ATOM 7042  H HE2  . LYS A 1 67  ? -20.746 13.104  -1.771  1.00 0.00 ? 67  LYS A HE2  5  
ATOM 7043  H HE3  . LYS A 1 67  ? -22.100 14.185  -2.097  1.00 0.00 ? 67  LYS A HE3  5  
ATOM 7044  H HZ1  . LYS A 1 67  ? -19.375 14.819  -1.563  1.00 0.00 ? 67  LYS A HZ1  5  
ATOM 7045  H HZ2  . LYS A 1 67  ? -20.408 15.630  -0.497  1.00 0.00 ? 67  LYS A HZ2  5  
ATOM 7046  H HZ3  . LYS A 1 67  ? -20.607 15.808  -2.168  1.00 0.00 ? 67  LYS A HZ3  5  
ATOM 7047  N N    . PHE A 1 68  ? -19.662 8.898   0.758   1.00 0.00 ? 68  PHE A N    5  
ATOM 7048  C CA   . PHE A 1 68  ? -19.267 8.148   -0.429  1.00 0.00 ? 68  PHE A CA   5  
ATOM 7049  C C    . PHE A 1 68  ? -18.994 6.687   -0.083  1.00 0.00 ? 68  PHE A C    5  
ATOM 7050  O O    . PHE A 1 68  ? -18.824 6.336   1.084   1.00 0.00 ? 68  PHE A O    5  
ATOM 7051  C CB   . PHE A 1 68  ? -18.023 8.774   -1.063  1.00 0.00 ? 68  PHE A CB   5  
ATOM 7052  C CG   . PHE A 1 68  ? -18.285 10.104  -1.710  1.00 0.00 ? 68  PHE A CG   5  
ATOM 7053  C CD1  . PHE A 1 68  ? -19.407 10.296  -2.500  1.00 0.00 ? 68  PHE A CD1  5  
ATOM 7054  C CD2  . PHE A 1 68  ? -17.409 11.163  -1.527  1.00 0.00 ? 68  PHE A CD2  5  
ATOM 7055  C CE1  . PHE A 1 68  ? -19.650 11.519  -3.097  1.00 0.00 ? 68  PHE A CE1  5  
ATOM 7056  C CE2  . PHE A 1 68  ? -17.647 12.388  -2.122  1.00 0.00 ? 68  PHE A CE2  5  
ATOM 7057  C CZ   . PHE A 1 68  ? -18.770 12.566  -2.906  1.00 0.00 ? 68  PHE A CZ   5  
ATOM 7058  H H    . PHE A 1 68  ? -19.307 8.632   1.632   1.00 0.00 ? 68  PHE A H    5  
ATOM 7059  H HA   . PHE A 1 68  ? -20.081 8.192   -1.135  1.00 0.00 ? 68  PHE A HA   5  
ATOM 7060  H HB2  . PHE A 1 68  ? -17.273 8.919   -0.300  1.00 0.00 ? 68  PHE A HB2  5  
ATOM 7061  H HB3  . PHE A 1 68  ? -17.638 8.106   -1.818  1.00 0.00 ? 68  PHE A HB3  5  
ATOM 7062  H HD1  . PHE A 1 68  ? -20.097 9.478   -2.648  1.00 0.00 ? 68  PHE A HD1  5  
ATOM 7063  H HD2  . PHE A 1 68  ? -16.531 11.024  -0.913  1.00 0.00 ? 68  PHE A HD2  5  
ATOM 7064  H HE1  . PHE A 1 68  ? -20.528 11.656  -3.709  1.00 0.00 ? 68  PHE A HE1  5  
ATOM 7065  H HE2  . PHE A 1 68  ? -16.957 13.204  -1.971  1.00 0.00 ? 68  PHE A HE2  5  
ATOM 7066  H HZ   . PHE A 1 68  ? -18.957 13.522  -3.372  1.00 0.00 ? 68  PHE A HZ   5  
ATOM 7067  N N    . SER A 1 69  ? -18.956 5.840   -1.107  1.00 0.00 ? 69  SER A N    5  
ATOM 7068  C CA   . SER A 1 69  ? -18.709 4.416   -0.912  1.00 0.00 ? 69  SER A CA   5  
ATOM 7069  C C    . SER A 1 69  ? -17.721 3.889   -1.948  1.00 0.00 ? 69  SER A C    5  
ATOM 7070  O O    . SER A 1 69  ? -17.700 4.347   -3.091  1.00 0.00 ? 69  SER A O    5  
ATOM 7071  C CB   . SER A 1 69  ? -20.020 3.633   -0.997  1.00 0.00 ? 69  SER A CB   5  
ATOM 7072  O OG   . SER A 1 69  ? -20.786 3.791   0.185   1.00 0.00 ? 69  SER A OG   5  
ATOM 7073  H H    . SER A 1 69  ? -19.100 6.181   -2.014  1.00 0.00 ? 69  SER A H    5  
ATOM 7074  H HA   . SER A 1 69  ? -18.284 4.285   0.072   1.00 0.00 ? 69  SER A HA   5  
ATOM 7075  H HB2  . SER A 1 69  ? -20.597 3.992   -1.836  1.00 0.00 ? 69  SER A HB2  5  
ATOM 7076  H HB3  . SER A 1 69  ? -19.802 2.584   -1.133  1.00 0.00 ? 69  SER A HB3  5  
ATOM 7077  H HG   . SER A 1 69  ? -20.828 2.954   0.654   1.00 0.00 ? 69  SER A HG   5  
ATOM 7078  N N    . TYR A 1 70  ? -16.904 2.925   -1.540  1.00 0.00 ? 70  TYR A N    5  
ATOM 7079  C CA   . TYR A 1 70  ? -15.911 2.336   -2.432  1.00 0.00 ? 70  TYR A CA   5  
ATOM 7080  C C    . TYR A 1 70  ? -15.600 0.899   -2.027  1.00 0.00 ? 70  TYR A C    5  
ATOM 7081  O O    . TYR A 1 70  ? -15.455 0.591   -0.844  1.00 0.00 ? 70  TYR A O    5  
ATOM 7082  C CB   . TYR A 1 70  ? -14.628 3.170   -2.422  1.00 0.00 ? 70  TYR A CB   5  
ATOM 7083  C CG   . TYR A 1 70  ? -14.821 4.583   -2.923  1.00 0.00 ? 70  TYR A CG   5  
ATOM 7084  C CD1  . TYR A 1 70  ? -14.863 4.859   -4.284  1.00 0.00 ? 70  TYR A CD1  5  
ATOM 7085  C CD2  . TYR A 1 70  ? -14.962 5.643   -2.036  1.00 0.00 ? 70  TYR A CD2  5  
ATOM 7086  C CE1  . TYR A 1 70  ? -15.038 6.149   -4.747  1.00 0.00 ? 70  TYR A CE1  5  
ATOM 7087  C CE2  . TYR A 1 70  ? -15.138 6.936   -2.490  1.00 0.00 ? 70  TYR A CE2  5  
ATOM 7088  C CZ   . TYR A 1 70  ? -15.175 7.184   -3.846  1.00 0.00 ? 70  TYR A CZ   5  
ATOM 7089  O OH   . TYR A 1 70  ? -15.351 8.470   -4.303  1.00 0.00 ? 70  TYR A OH   5  
ATOM 7090  H H    . TYR A 1 70  ? -16.968 2.602   -0.618  1.00 0.00 ? 70  TYR A H    5  
ATOM 7091  H HA   . TYR A 1 70  ? -16.321 2.337   -3.431  1.00 0.00 ? 70  TYR A HA   5  
ATOM 7092  H HB2  . TYR A 1 70  ? -14.251 3.226   -1.412  1.00 0.00 ? 70  TYR A HB2  5  
ATOM 7093  H HB3  . TYR A 1 70  ? -13.892 2.692   -3.051  1.00 0.00 ? 70  TYR A HB3  5  
ATOM 7094  H HD1  . TYR A 1 70  ? -14.755 4.046   -4.988  1.00 0.00 ? 70  TYR A HD1  5  
ATOM 7095  H HD2  . TYR A 1 70  ? -14.932 5.446   -0.974  1.00 0.00 ? 70  TYR A HD2  5  
ATOM 7096  H HE1  . TYR A 1 70  ? -15.067 6.343   -5.809  1.00 0.00 ? 70  TYR A HE1  5  
ATOM 7097  H HE2  . TYR A 1 70  ? -15.246 7.747   -1.784  1.00 0.00 ? 70  TYR A HE2  5  
ATOM 7098  H HH   . TYR A 1 70  ? -14.606 9.011   -4.031  1.00 0.00 ? 70  TYR A HH   5  
ATOM 7099  N N    . LYS A 1 71  ? -15.497 0.021   -3.019  1.00 0.00 ? 71  LYS A N    5  
ATOM 7100  C CA   . LYS A 1 71  ? -15.201 -1.385  -2.770  1.00 0.00 ? 71  LYS A CA   5  
ATOM 7101  C C    . LYS A 1 71  ? -14.050 -1.863  -3.650  1.00 0.00 ? 71  LYS A C    5  
ATOM 7102  O O    . LYS A 1 71  ? -14.217 -2.055  -4.855  1.00 0.00 ? 71  LYS A O    5  
ATOM 7103  C CB   . LYS A 1 71  ? -16.443 -2.242  -3.025  1.00 0.00 ? 71  LYS A CB   5  
ATOM 7104  C CG   . LYS A 1 71  ? -16.146 -3.728  -3.125  1.00 0.00 ? 71  LYS A CG   5  
ATOM 7105  C CD   . LYS A 1 71  ? -17.367 -4.565  -2.782  1.00 0.00 ? 71  LYS A CD   5  
ATOM 7106  C CE   . LYS A 1 71  ? -17.366 -5.887  -3.533  1.00 0.00 ? 71  LYS A CE   5  
ATOM 7107  N NZ   . LYS A 1 71  ? -18.557 -6.716  -3.200  1.00 0.00 ? 71  LYS A NZ   5  
ATOM 7108  H H    . LYS A 1 71  ? -15.623 0.327   -3.942  1.00 0.00 ? 71  LYS A H    5  
ATOM 7109  H HA   . LYS A 1 71  ? -14.911 -1.484  -1.735  1.00 0.00 ? 71  LYS A HA   5  
ATOM 7110  H HB2  . LYS A 1 71  ? -17.143 -2.089  -2.217  1.00 0.00 ? 71  LYS A HB2  5  
ATOM 7111  H HB3  . LYS A 1 71  ? -16.900 -1.925  -3.951  1.00 0.00 ? 71  LYS A HB3  5  
ATOM 7112  H HG2  . LYS A 1 71  ? -15.838 -3.958  -4.134  1.00 0.00 ? 71  LYS A HG2  5  
ATOM 7113  H HG3  . LYS A 1 71  ? -15.348 -3.973  -2.438  1.00 0.00 ? 71  LYS A HG3  5  
ATOM 7114  H HD2  . LYS A 1 71  ? -17.368 -4.767  -1.721  1.00 0.00 ? 71  LYS A HD2  5  
ATOM 7115  H HD3  . LYS A 1 71  ? -18.257 -4.011  -3.045  1.00 0.00 ? 71  LYS A HD3  5  
ATOM 7116  H HE2  . LYS A 1 71  ? -17.365 -5.684  -4.593  1.00 0.00 ? 71  LYS A HE2  5  
ATOM 7117  H HE3  . LYS A 1 71  ? -16.472 -6.434  -3.271  1.00 0.00 ? 71  LYS A HE3  5  
ATOM 7118  H HZ1  . LYS A 1 71  ? -18.402 -7.700  -3.497  1.00 0.00 ? 71  LYS A HZ1  5  
ATOM 7119  H HZ2  . LYS A 1 71  ? -19.397 -6.347  -3.689  1.00 0.00 ? 71  LYS A HZ2  5  
ATOM 7120  H HZ3  . LYS A 1 71  ? -18.730 -6.697  -2.175  1.00 0.00 ? 71  LYS A HZ3  5  
ATOM 7121  N N    . ILE A 1 72  ? -12.885 -2.054  -3.041  1.00 0.00 ? 72  ILE A N    5  
ATOM 7122  C CA   . ILE A 1 72  ? -11.709 -2.512  -3.770  1.00 0.00 ? 72  ILE A CA   5  
ATOM 7123  C C    . ILE A 1 72  ? -11.575 -4.029  -3.700  1.00 0.00 ? 72  ILE A C    5  
ATOM 7124  O O    . ILE A 1 72  ? -11.057 -4.573  -2.725  1.00 0.00 ? 72  ILE A O    5  
ATOM 7125  C CB   . ILE A 1 72  ? -10.421 -1.869  -3.222  1.00 0.00 ? 72  ILE A CB   5  
ATOM 7126  C CG1  . ILE A 1 72  ? -10.471 -0.349  -3.394  1.00 0.00 ? 72  ILE A CG1  5  
ATOM 7127  C CG2  . ILE A 1 72  ? -9.201  -2.447  -3.922  1.00 0.00 ? 72  ILE A CG2  5  
ATOM 7128  C CD1  . ILE A 1 72  ? -9.398  0.382   -2.618  1.00 0.00 ? 72  ILE A CD1  5  
ATOM 7129  H H    . ILE A 1 72  ? -12.815 -1.883  -2.079  1.00 0.00 ? 72  ILE A H    5  
ATOM 7130  H HA   . ILE A 1 72  ? -11.822 -2.218  -4.804  1.00 0.00 ? 72  ILE A HA   5  
ATOM 7131  H HB   . ILE A 1 72  ? -10.348 -2.102  -2.171  1.00 0.00 ? 72  ILE A HB   5  
ATOM 7132  H HG12 . ILE A 1 72  ? -10.346 -0.107  -4.438  1.00 0.00 ? 72  ILE A HG12 5  
ATOM 7133  H HG13 . ILE A 1 72  ? -11.431 0.013   -3.057  1.00 0.00 ? 72  ILE A HG13 5  
ATOM 7134  H HG21 . ILE A 1 72  ? -8.470  -2.745  -3.184  1.00 0.00 ? 72  ILE A HG21 5  
ATOM 7135  H HG22 . ILE A 1 72  ? -9.494  -3.308  -4.504  1.00 0.00 ? 72  ILE A HG22 5  
ATOM 7136  H HG23 . ILE A 1 72  ? -8.772  -1.701  -4.574  1.00 0.00 ? 72  ILE A HG23 5  
ATOM 7137  H HD11 . ILE A 1 72  ? -8.440  0.224   -3.090  1.00 0.00 ? 72  ILE A HD11 5  
ATOM 7138  H HD12 . ILE A 1 72  ? -9.623  1.438   -2.600  1.00 0.00 ? 72  ILE A HD12 5  
ATOM 7139  H HD13 . ILE A 1 72  ? -9.366  0.004   -1.606  1.00 0.00 ? 72  ILE A HD13 5  
ATOM 7140  N N    . ASP A 1 73  ? -12.045 -4.707  -4.741  1.00 0.00 ? 73  ASP A N    5  
ATOM 7141  C CA   . ASP A 1 73  ? -11.976 -6.163  -4.800  1.00 0.00 ? 73  ASP A CA   5  
ATOM 7142  C C    . ASP A 1 73  ? -10.591 -6.623  -5.242  1.00 0.00 ? 73  ASP A C    5  
ATOM 7143  O O    . ASP A 1 73  ? -10.184 -6.397  -6.382  1.00 0.00 ? 73  ASP A O    5  
ATOM 7144  C CB   . ASP A 1 73  ? -13.037 -6.707  -5.758  1.00 0.00 ? 73  ASP A CB   5  
ATOM 7145  C CG   . ASP A 1 73  ? -14.439 -6.599  -5.191  1.00 0.00 ? 73  ASP A CG   5  
ATOM 7146  O OD1  . ASP A 1 73  ? -14.874 -7.543  -4.498  1.00 0.00 ? 73  ASP A OD1  5  
ATOM 7147  O OD2  . ASP A 1 73  ? -15.101 -5.569  -5.438  1.00 0.00 ? 73  ASP A OD2  5  
ATOM 7148  H H    . ASP A 1 73  ? -12.448 -4.217  -5.489  1.00 0.00 ? 73  ASP A H    5  
ATOM 7149  H HA   . ASP A 1 73  ? -12.169 -6.544  -3.809  1.00 0.00 ? 73  ASP A HA   5  
ATOM 7150  H HB2  . ASP A 1 73  ? -13.000 -6.148  -6.682  1.00 0.00 ? 73  ASP A HB2  5  
ATOM 7151  H HB3  . ASP A 1 73  ? -12.830 -7.747  -5.962  1.00 0.00 ? 73  ASP A HB3  5  
ATOM 7152  N N    . PHE A 1 74  ? -9.870  -7.270  -4.332  1.00 0.00 ? 74  PHE A N    5  
ATOM 7153  C CA   . PHE A 1 74  ? -8.529  -7.761  -4.627  1.00 0.00 ? 74  PHE A CA   5  
ATOM 7154  C C    . PHE A 1 74  ? -8.581  -8.937  -5.599  1.00 0.00 ? 74  PHE A C    5  
ATOM 7155  O O    . PHE A 1 74  ? -7.861  -8.965  -6.596  1.00 0.00 ? 74  PHE A O    5  
ATOM 7156  C CB   . PHE A 1 74  ? -7.822  -8.182  -3.337  1.00 0.00 ? 74  PHE A CB   5  
ATOM 7157  C CG   . PHE A 1 74  ? -7.706  -7.075  -2.329  1.00 0.00 ? 74  PHE A CG   5  
ATOM 7158  C CD1  . PHE A 1 74  ? -7.308  -5.806  -2.716  1.00 0.00 ? 74  PHE A CD1  5  
ATOM 7159  C CD2  . PHE A 1 74  ? -7.996  -7.304  -0.993  1.00 0.00 ? 74  PHE A CD2  5  
ATOM 7160  C CE1  . PHE A 1 74  ? -7.200  -4.786  -1.789  1.00 0.00 ? 74  PHE A CE1  5  
ATOM 7161  C CE2  . PHE A 1 74  ? -7.891  -6.288  -0.062  1.00 0.00 ? 74  PHE A CE2  5  
ATOM 7162  C CZ   . PHE A 1 74  ? -7.493  -5.027  -0.461  1.00 0.00 ? 74  PHE A CZ   5  
ATOM 7163  H H    . PHE A 1 74  ? -10.249 -7.421  -3.441  1.00 0.00 ? 74  PHE A H    5  
ATOM 7164  H HA   . PHE A 1 74  ? -7.975  -6.956  -5.085  1.00 0.00 ? 74  PHE A HA   5  
ATOM 7165  H HB2  . PHE A 1 74  ? -8.372  -8.990  -2.880  1.00 0.00 ? 74  PHE A HB2  5  
ATOM 7166  H HB3  . PHE A 1 74  ? -6.825  -8.521  -3.576  1.00 0.00 ? 74  PHE A HB3  5  
ATOM 7167  H HD1  . PHE A 1 74  ? -7.080  -5.615  -3.754  1.00 0.00 ? 74  PHE A HD1  5  
ATOM 7168  H HD2  . PHE A 1 74  ? -8.308  -8.291  -0.680  1.00 0.00 ? 74  PHE A HD2  5  
ATOM 7169  H HE1  . PHE A 1 74  ? -6.889  -3.801  -2.104  1.00 0.00 ? 74  PHE A HE1  5  
ATOM 7170  H HE2  . PHE A 1 74  ? -8.121  -6.480  0.975   1.00 0.00 ? 74  PHE A HE2  5  
ATOM 7171  H HZ   . PHE A 1 74  ? -7.410  -4.232  0.265   1.00 0.00 ? 74  PHE A HZ   5  
ATOM 7172  N N    . ALA A 1 75  ? -9.439  -9.907  -5.299  1.00 0.00 ? 75  ALA A N    5  
ATOM 7173  C CA   . ALA A 1 75  ? -9.588  -11.084 -6.145  1.00 0.00 ? 75  ALA A CA   5  
ATOM 7174  C C    . ALA A 1 75  ? -9.812  -10.689 -7.600  1.00 0.00 ? 75  ALA A C    5  
ATOM 7175  O O    . ALA A 1 75  ? -9.342  -11.365 -8.515  1.00 0.00 ? 75  ALA A O    5  
ATOM 7176  C CB   . ALA A 1 75  ? -10.736 -11.950 -5.648  1.00 0.00 ? 75  ALA A CB   5  
ATOM 7177  H H    . ALA A 1 75  ? -9.987  -9.827  -4.490  1.00 0.00 ? 75  ALA A H    5  
ATOM 7178  H HA   . ALA A 1 75  ? -8.677  -11.662 -6.075  1.00 0.00 ? 75  ALA A HA   5  
ATOM 7179  H HB1  . ALA A 1 75  ? -10.536 -12.984 -5.888  1.00 0.00 ? 75  ALA A HB1  5  
ATOM 7180  H HB2  . ALA A 1 75  ? -10.832 -11.840 -4.578  1.00 0.00 ? 75  ALA A HB2  5  
ATOM 7181  H HB3  . ALA A 1 75  ? -11.653 -11.640 -6.126  1.00 0.00 ? 75  ALA A HB3  5  
ATOM 7182  N N    . GLU A 1 76  ? -10.534 -9.592  -7.807  1.00 0.00 ? 76  GLU A N    5  
ATOM 7183  C CA   . GLU A 1 76  ? -10.821 -9.110  -9.152  1.00 0.00 ? 76  GLU A CA   5  
ATOM 7184  C C    . GLU A 1 76  ? -9.810  -8.049  -9.577  1.00 0.00 ? 76  GLU A C    5  
ATOM 7185  O O    . GLU A 1 76  ? -9.845  -7.560  -10.706 1.00 0.00 ? 76  GLU A O    5  
ATOM 7186  C CB   . GLU A 1 76  ? -12.238 -8.536  -9.221  1.00 0.00 ? 76  GLU A CB   5  
ATOM 7187  C CG   . GLU A 1 76  ? -13.325 -9.567  -8.965  1.00 0.00 ? 76  GLU A CG   5  
ATOM 7188  C CD   . GLU A 1 76  ? -13.722 -10.320 -10.220 1.00 0.00 ? 76  GLU A CD   5  
ATOM 7189  O OE1  . GLU A 1 76  ? -13.551 -9.765  -11.325 1.00 0.00 ? 76  GLU A OE1  5  
ATOM 7190  O OE2  . GLU A 1 76  ? -14.204 -11.466 -10.096 1.00 0.00 ? 76  GLU A OE2  5  
ATOM 7191  H H    . GLU A 1 76  ? -10.882 -9.096  -7.036  1.00 0.00 ? 76  GLU A H    5  
ATOM 7192  H HA   . GLU A 1 76  ? -10.750 -9.949  -9.828  1.00 0.00 ? 76  GLU A HA   5  
ATOM 7193  H HB2  . GLU A 1 76  ? -12.333 -7.753  -8.484  1.00 0.00 ? 76  GLU A HB2  5  
ATOM 7194  H HB3  . GLU A 1 76  ? -12.396 -8.115  -10.203 1.00 0.00 ? 76  GLU A HB3  5  
ATOM 7195  H HG2  . GLU A 1 76  ? -12.965 -10.277 -8.236  1.00 0.00 ? 76  GLU A HG2  5  
ATOM 7196  H HG3  . GLU A 1 76  ? -14.197 -9.063  -8.574  1.00 0.00 ? 76  GLU A HG3  5  
ATOM 7197  N N    . MET A 1 77  ? -8.911  -7.697  -8.664  1.00 0.00 ? 77  MET A N    5  
ATOM 7198  C CA   . MET A 1 77  ? -7.890  -6.695  -8.944  1.00 0.00 ? 77  MET A CA   5  
ATOM 7199  C C    . MET A 1 77  ? -8.502  -5.466  -9.609  1.00 0.00 ? 77  MET A C    5  
ATOM 7200  O O    . MET A 1 77  ? -8.053  -5.033  -10.670 1.00 0.00 ? 77  MET A O    5  
ATOM 7201  C CB   . MET A 1 77  ? -6.799  -7.283  -9.841  1.00 0.00 ? 77  MET A CB   5  
ATOM 7202  C CG   . MET A 1 77  ? -5.700  -7.998  -9.071  1.00 0.00 ? 77  MET A CG   5  
ATOM 7203  S SD   . MET A 1 77  ? -4.374  -6.887  -8.562  1.00 0.00 ? 77  MET A SD   5  
ATOM 7204  C CE   . MET A 1 77  ? -4.829  -6.575  -6.858  1.00 0.00 ? 77  MET A CE   5  
ATOM 7205  H H    . MET A 1 77  ? -8.934  -8.122  -7.781  1.00 0.00 ? 77  MET A H    5  
ATOM 7206  H HA   . MET A 1 77  ? -7.450  -6.399  -8.004  1.00 0.00 ? 77  MET A HA   5  
ATOM 7207  H HB2  . MET A 1 77  ? -7.251  -7.990  -10.520 1.00 0.00 ? 77  MET A HB2  5  
ATOM 7208  H HB3  . MET A 1 77  ? -6.348  -6.485  -10.411 1.00 0.00 ? 77  MET A HB3  5  
ATOM 7209  H HG2  . MET A 1 77  ? -6.130  -8.449  -8.190  1.00 0.00 ? 77  MET A HG2  5  
ATOM 7210  H HG3  . MET A 1 77  ? -5.283  -8.770  -9.701  1.00 0.00 ? 77  MET A HG3  5  
ATOM 7211  H HE1  . MET A 1 77  ? -5.875  -6.805  -6.717  1.00 0.00 ? 77  MET A HE1  5  
ATOM 7212  H HE2  . MET A 1 77  ? -4.233  -7.196  -6.207  1.00 0.00 ? 77  MET A HE2  5  
ATOM 7213  H HE3  . MET A 1 77  ? -4.655  -5.535  -6.624  1.00 0.00 ? 77  MET A HE3  5  
ATOM 7214  N N    . LYS A 1 78  ? -9.530  -4.908  -8.978  1.00 0.00 ? 78  LYS A N    5  
ATOM 7215  C CA   . LYS A 1 78  ? -10.204 -3.728  -9.506  1.00 0.00 ? 78  LYS A CA   5  
ATOM 7216  C C    . LYS A 1 78  ? -10.949 -2.986  -8.402  1.00 0.00 ? 78  LYS A C    5  
ATOM 7217  O O    . LYS A 1 78  ? -11.427 -3.596  -7.446  1.00 0.00 ? 78  LYS A O    5  
ATOM 7218  C CB   . LYS A 1 78  ? -11.179 -4.127  -10.616 1.00 0.00 ? 78  LYS A CB   5  
ATOM 7219  C CG   . LYS A 1 78  ? -12.363 -4.941  -10.121 1.00 0.00 ? 78  LYS A CG   5  
ATOM 7220  C CD   . LYS A 1 78  ? -13.023 -5.710  -11.253 1.00 0.00 ? 78  LYS A CD   5  
ATOM 7221  C CE   . LYS A 1 78  ? -13.861 -4.796  -12.134 1.00 0.00 ? 78  LYS A CE   5  
ATOM 7222  N NZ   . LYS A 1 78  ? -14.173 -5.424  -13.448 1.00 0.00 ? 78  LYS A NZ   5  
ATOM 7223  H H    . LYS A 1 78  ? -9.842  -5.299  -8.134  1.00 0.00 ? 78  LYS A H    5  
ATOM 7224  H HA   . LYS A 1 78  ? -9.451  -3.073  -9.919  1.00 0.00 ? 78  LYS A HA   5  
ATOM 7225  H HB2  . LYS A 1 78  ? -11.557 -3.231  -11.086 1.00 0.00 ? 78  LYS A HB2  5  
ATOM 7226  H HB3  . LYS A 1 78  ? -10.649 -4.713  -11.352 1.00 0.00 ? 78  LYS A HB3  5  
ATOM 7227  H HG2  . LYS A 1 78  ? -12.019 -5.643  -9.376  1.00 0.00 ? 78  LYS A HG2  5  
ATOM 7228  H HG3  . LYS A 1 78  ? -13.089 -4.272  -9.681  1.00 0.00 ? 78  LYS A HG3  5  
ATOM 7229  H HD2  . LYS A 1 78  ? -12.256 -6.170  -11.859 1.00 0.00 ? 78  LYS A HD2  5  
ATOM 7230  H HD3  . LYS A 1 78  ? -13.660 -6.475  -10.833 1.00 0.00 ? 78  LYS A HD3  5  
ATOM 7231  H HE2  . LYS A 1 78  ? -14.785 -4.573  -11.623 1.00 0.00 ? 78  LYS A HE2  5  
ATOM 7232  H HE3  . LYS A 1 78  ? -13.314 -3.880  -12.303 1.00 0.00 ? 78  LYS A HE3  5  
ATOM 7233  H HZ1  . LYS A 1 78  ? -14.887 -4.860  -13.952 1.00 0.00 ? 78  LYS A HZ1  5  
ATOM 7234  H HZ2  . LYS A 1 78  ? -14.543 -6.385  -13.305 1.00 0.00 ? 78  LYS A HZ2  5  
ATOM 7235  H HZ3  . LYS A 1 78  ? -13.313 -5.478  -14.031 1.00 0.00 ? 78  LYS A HZ3  5  
ATOM 7236  N N    . GLN A 1 79  ? -11.045 -1.668  -8.541  1.00 0.00 ? 79  GLN A N    5  
ATOM 7237  C CA   . GLN A 1 79  ? -11.734 -0.844  -7.554  1.00 0.00 ? 79  GLN A CA   5  
ATOM 7238  C C    . GLN A 1 79  ? -13.181 -0.596  -7.966  1.00 0.00 ? 79  GLN A C    5  
ATOM 7239  O O    . GLN A 1 79  ? -13.454 0.218   -8.848  1.00 0.00 ? 79  GLN A O    5  
ATOM 7240  C CB   . GLN A 1 79  ? -11.006 0.490   -7.375  1.00 0.00 ? 79  GLN A CB   5  
ATOM 7241  C CG   . GLN A 1 79  ? -11.790 1.506   -6.560  1.00 0.00 ? 79  GLN A CG   5  
ATOM 7242  C CD   . GLN A 1 79  ? -10.992 2.762   -6.270  1.00 0.00 ? 79  GLN A CD   5  
ATOM 7243  O OE1  . GLN A 1 79  ? -9.761  2.739   -6.256  1.00 0.00 ? 79  GLN A OE1  5  
ATOM 7244  N NE2  . GLN A 1 79  ? -11.691 3.866   -6.035  1.00 0.00 ? 79  GLN A NE2  5  
ATOM 7245  H H    . GLN A 1 79  ? -10.643 -1.239  -9.324  1.00 0.00 ? 79  GLN A H    5  
ATOM 7246  H HA   . GLN A 1 79  ? -11.726 -1.376  -6.615  1.00 0.00 ? 79  GLN A HA   5  
ATOM 7247  H HB2  . GLN A 1 79  ? -10.065 0.309   -6.876  1.00 0.00 ? 79  GLN A HB2  5  
ATOM 7248  H HB3  . GLN A 1 79  ? -10.812 0.914   -8.349  1.00 0.00 ? 79  GLN A HB3  5  
ATOM 7249  H HG2  . GLN A 1 79  ? -12.678 1.782   -7.110  1.00 0.00 ? 79  GLN A HG2  5  
ATOM 7250  H HG3  . GLN A 1 79  ? -12.076 1.053   -5.622  1.00 0.00 ? 79  GLN A HG3  5  
ATOM 7251  H HE21 . GLN A 1 79  ? -12.669 3.809   -6.062  1.00 0.00 ? 79  GLN A HE21 5  
ATOM 7252  H HE22 . GLN A 1 79  ? -11.201 4.692   -5.844  1.00 0.00 ? 79  GLN A HE22 5  
ATOM 7253  N N    . MET A 1 80  ? -14.104 -1.303  -7.323  1.00 0.00 ? 80  MET A N    5  
ATOM 7254  C CA   . MET A 1 80  ? -15.524 -1.158  -7.623  1.00 0.00 ? 80  MET A CA   5  
ATOM 7255  C C    . MET A 1 80  ? -16.090 0.102   -6.977  1.00 0.00 ? 80  MET A C    5  
ATOM 7256  O O    . MET A 1 80  ? -16.169 0.201   -5.754  1.00 0.00 ? 80  MET A O    5  
ATOM 7257  C CB   . MET A 1 80  ? -16.297 -2.386  -7.138  1.00 0.00 ? 80  MET A CB   5  
ATOM 7258  C CG   . MET A 1 80  ? -17.753 -2.398  -7.574  1.00 0.00 ? 80  MET A CG   5  
ATOM 7259  S SD   . MET A 1 80  ? -17.947 -2.693  -9.342  1.00 0.00 ? 80  MET A SD   5  
ATOM 7260  C CE   . MET A 1 80  ? -17.927 -4.484  -9.390  1.00 0.00 ? 80  MET A CE   5  
ATOM 7261  H H    . MET A 1 80  ? -13.824 -1.937  -6.630  1.00 0.00 ? 80  MET A H    5  
ATOM 7262  H HA   . MET A 1 80  ? -15.629 -1.078  -8.695  1.00 0.00 ? 80  MET A HA   5  
ATOM 7263  H HB2  . MET A 1 80  ? -15.820 -3.274  -7.527  1.00 0.00 ? 80  MET A HB2  5  
ATOM 7264  H HB3  . MET A 1 80  ? -16.267 -2.413  -6.059  1.00 0.00 ? 80  MET A HB3  5  
ATOM 7265  H HG2  . MET A 1 80  ? -18.270 -3.178  -7.035  1.00 0.00 ? 80  MET A HG2  5  
ATOM 7266  H HG3  . MET A 1 80  ? -18.194 -1.443  -7.332  1.00 0.00 ? 80  MET A HG3  5  
ATOM 7267  H HE1  . MET A 1 80  ? -18.750 -4.869  -8.807  1.00 0.00 ? 80  MET A HE1  5  
ATOM 7268  H HE2  . MET A 1 80  ? -18.024 -4.817  -10.413 1.00 0.00 ? 80  MET A HE2  5  
ATOM 7269  H HE3  . MET A 1 80  ? -16.995 -4.844  -8.980  1.00 0.00 ? 80  MET A HE3  5  
ATOM 7270  N N    . ASN A 1 81  ? -16.483 1.062   -7.808  1.00 0.00 ? 81  ASN A N    5  
ATOM 7271  C CA   . ASN A 1 81  ? -17.041 2.317   -7.316  1.00 0.00 ? 81  ASN A CA   5  
ATOM 7272  C C    . ASN A 1 81  ? -18.542 2.186   -7.075  1.00 0.00 ? 81  ASN A C    5  
ATOM 7273  O O    . ASN A 1 81  ? -19.254 1.550   -7.853  1.00 0.00 ? 81  ASN A O    5  
ATOM 7274  C CB   . ASN A 1 81  ? -16.770 3.445   -8.314  1.00 0.00 ? 81  ASN A CB   5  
ATOM 7275  C CG   . ASN A 1 81  ? -16.696 4.803   -7.643  1.00 0.00 ? 81  ASN A CG   5  
ATOM 7276  O OD1  . ASN A 1 81  ? -16.611 4.900   -6.419  1.00 0.00 ? 81  ASN A OD1  5  
ATOM 7277  N ND2  . ASN A 1 81  ? -16.727 5.861   -8.446  1.00 0.00 ? 81  ASN A ND2  5  
ATOM 7278  H H    . ASN A 1 81  ? -16.395 0.924   -8.774  1.00 0.00 ? 81  ASN A H    5  
ATOM 7279  H HA   . ASN A 1 81  ? -16.556 2.551   -6.381  1.00 0.00 ? 81  ASN A HA   5  
ATOM 7280  H HB2  . ASN A 1 81  ? -15.829 3.259   -8.811  1.00 0.00 ? 81  ASN A HB2  5  
ATOM 7281  H HB3  . ASN A 1 81  ? -17.562 3.468   -9.047  1.00 0.00 ? 81  ASN A HB3  5  
ATOM 7282  H HD21 . ASN A 1 81  ? -16.796 5.708   -9.411  1.00 0.00 ? 81  ASN A HD21 5  
ATOM 7283  H HD22 . ASN A 1 81  ? -16.680 6.751   -8.039  1.00 0.00 ? 81  ASN A HD22 5  
ATOM 7284  N N    . LEU A 1 82  ? -19.016 2.793   -5.992  1.00 0.00 ? 82  LEU A N    5  
ATOM 7285  C CA   . LEU A 1 82  ? -20.433 2.746   -5.647  1.00 0.00 ? 82  LEU A CA   5  
ATOM 7286  C C    . LEU A 1 82  ? -21.060 4.134   -5.730  1.00 0.00 ? 82  LEU A C    5  
ATOM 7287  O O    . LEU A 1 82  ? -22.118 4.315   -6.334  1.00 0.00 ? 82  LEU A O    5  
ATOM 7288  C CB   . LEU A 1 82  ? -20.617 2.174   -4.241  1.00 0.00 ? 82  LEU A CB   5  
ATOM 7289  C CG   . LEU A 1 82  ? -19.980 0.808   -3.983  1.00 0.00 ? 82  LEU A CG   5  
ATOM 7290  C CD1  . LEU A 1 82  ? -20.643 -0.260  -4.839  1.00 0.00 ? 82  LEU A CD1  5  
ATOM 7291  C CD2  . LEU A 1 82  ? -18.483 0.858   -4.254  1.00 0.00 ? 82  LEU A CD2  5  
ATOM 7292  H H    . LEU A 1 82  ? -18.400 3.284   -5.411  1.00 0.00 ? 82  LEU A H    5  
ATOM 7293  H HA   . LEU A 1 82  ? -20.925 2.099   -6.358  1.00 0.00 ? 82  LEU A HA   5  
ATOM 7294  H HB2  . LEU A 1 82  ? -20.189 2.875   -3.540  1.00 0.00 ? 82  LEU A HB2  5  
ATOM 7295  H HB3  . LEU A 1 82  ? -21.678 2.086   -4.057  1.00 0.00 ? 82  LEU A HB3  5  
ATOM 7296  H HG   . LEU A 1 82  ? -20.124 0.541   -2.945  1.00 0.00 ? 82  LEU A HG   5  
ATOM 7297  H HD11 . LEU A 1 82  ? -21.542 -0.605  -4.351  1.00 0.00 ? 82  LEU A HD11 5  
ATOM 7298  H HD12 . LEU A 1 82  ? -19.964 -1.089  -4.970  1.00 0.00 ? 82  LEU A HD12 5  
ATOM 7299  H HD13 . LEU A 1 82  ? -20.893 0.156   -5.804  1.00 0.00 ? 82  LEU A HD13 5  
ATOM 7300  H HD21 . LEU A 1 82  ? -17.969 0.218   -3.551  1.00 0.00 ? 82  LEU A HD21 5  
ATOM 7301  H HD22 . LEU A 1 82  ? -18.130 1.873   -4.141  1.00 0.00 ? 82  LEU A HD22 5  
ATOM 7302  H HD23 . LEU A 1 82  ? -18.288 0.518   -5.260  1.00 0.00 ? 82  LEU A HD23 5  
ATOM 7303  N N    . THR A 1 83  ? -20.398 5.114   -5.122  1.00 0.00 ? 83  THR A N    5  
ATOM 7304  C CA   . THR A 1 83  ? -20.890 6.486   -5.127  1.00 0.00 ? 83  THR A CA   5  
ATOM 7305  C C    . THR A 1 83  ? -21.478 6.854   -6.485  1.00 0.00 ? 83  THR A C    5  
ATOM 7306  O O    . THR A 1 83  ? -22.533 7.483   -6.567  1.00 0.00 ? 83  THR A O    5  
ATOM 7307  C CB   . THR A 1 83  ? -19.771 7.485   -4.777  1.00 0.00 ? 83  THR A CB   5  
ATOM 7308  O OG1  . THR A 1 83  ? -20.194 8.820   -5.076  1.00 0.00 ? 83  THR A OG1  5  
ATOM 7309  C CG2  . THR A 1 83  ? -18.499 7.166   -5.549  1.00 0.00 ? 83  THR A CG2  5  
ATOM 7310  H H    . THR A 1 83  ? -19.561 4.907   -4.657  1.00 0.00 ? 83  THR A H    5  
ATOM 7311  H HA   . THR A 1 83  ? -21.663 6.566   -4.377  1.00 0.00 ? 83  THR A HA   5  
ATOM 7312  H HB   . THR A 1 83  ? -19.560 7.410   -3.720  1.00 0.00 ? 83  THR A HB   5  
ATOM 7313  H HG1  . THR A 1 83  ? -19.427 9.362   -5.274  1.00 0.00 ? 83  THR A HG1  5  
ATOM 7314  H HG21 . THR A 1 83  ? -17.647 7.562   -5.019  1.00 0.00 ? 83  THR A HG21 5  
ATOM 7315  H HG22 . THR A 1 83  ? -18.553 7.612   -6.531  1.00 0.00 ? 83  THR A HG22 5  
ATOM 7316  H HG23 . THR A 1 83  ? -18.397 6.095   -5.646  1.00 0.00 ? 83  THR A HG23 5  
ATOM 7317  N N    . THR A 1 84  ? -20.788 6.458   -7.550  1.00 0.00 ? 84  THR A N    5  
ATOM 7318  C CA   . THR A 1 84  ? -21.241 6.747   -8.905  1.00 0.00 ? 84  THR A CA   5  
ATOM 7319  C C    . THR A 1 84  ? -21.553 5.463   -9.665  1.00 0.00 ? 84  THR A C    5  
ATOM 7320  O O    . THR A 1 84  ? -22.336 5.467   -10.615 1.00 0.00 ? 84  THR A O    5  
ATOM 7321  C CB   . THR A 1 84  ? -20.189 7.553   -9.690  1.00 0.00 ? 84  THR A CB   5  
ATOM 7322  O OG1  . THR A 1 84  ? -19.078 6.714   -10.023 1.00 0.00 ? 84  THR A OG1  5  
ATOM 7323  C CG2  . THR A 1 84  ? -19.706 8.746   -8.879  1.00 0.00 ? 84  THR A CG2  5  
ATOM 7324  H H    . THR A 1 84  ? -19.954 5.961   -7.420  1.00 0.00 ? 84  THR A H    5  
ATOM 7325  H HA   . THR A 1 84  ? -22.141 7.340   -8.836  1.00 0.00 ? 84  THR A HA   5  
ATOM 7326  H HB   . THR A 1 84  ? -20.643 7.916   -10.601 1.00 0.00 ? 84  THR A HB   5  
ATOM 7327  H HG1  . THR A 1 84  ? -18.731 6.309   -9.224  1.00 0.00 ? 84  THR A HG1  5  
ATOM 7328  H HG21 . THR A 1 84  ? -18.648 8.888   -9.044  1.00 0.00 ? 84  THR A HG21 5  
ATOM 7329  H HG22 . THR A 1 84  ? -19.886 8.564   -7.830  1.00 0.00 ? 84  THR A HG22 5  
ATOM 7330  H HG23 . THR A 1 84  ? -20.241 9.631   -9.188  1.00 0.00 ? 84  THR A HG23 5  
ATOM 7331  N N    . GLY A 1 85  ? -20.935 4.365   -9.242  1.00 0.00 ? 85  GLY A N    5  
ATOM 7332  C CA   . GLY A 1 85  ? -21.160 3.088   -9.895  1.00 0.00 ? 85  GLY A CA   5  
ATOM 7333  C C    . GLY A 1 85  ? -20.176 2.830   -11.019 1.00 0.00 ? 85  GLY A C    5  
ATOM 7334  O O    . GLY A 1 85  ? -20.429 2.008   -11.899 1.00 0.00 ? 85  GLY A O    5  
ATOM 7335  H H    . GLY A 1 85  ? -20.321 4.421   -8.480  1.00 0.00 ? 85  GLY A H    5  
ATOM 7336  H HA2  . GLY A 1 85  ? -21.069 2.300   -9.162  1.00 0.00 ? 85  GLY A HA2  5  
ATOM 7337  H HA3  . GLY A 1 85  ? -22.162 3.075   -10.299 1.00 0.00 ? 85  GLY A HA3  5  
ATOM 7338  N N    . LYS A 1 86  ? -19.051 3.536   -10.991 1.00 0.00 ? 86  LYS A N    5  
ATOM 7339  C CA   . LYS A 1 86  ? -18.025 3.381   -12.015 1.00 0.00 ? 86  LYS A CA   5  
ATOM 7340  C C    . LYS A 1 86  ? -17.053 2.264   -11.647 1.00 0.00 ? 86  LYS A C    5  
ATOM 7341  O O    . LYS A 1 86  ? -17.079 1.751   -10.529 1.00 0.00 ? 86  LYS A O    5  
ATOM 7342  C CB   . LYS A 1 86  ? -17.261 4.693   -12.205 1.00 0.00 ? 86  LYS A CB   5  
ATOM 7343  C CG   . LYS A 1 86  ? -18.025 5.731   -13.009 1.00 0.00 ? 86  LYS A CG   5  
ATOM 7344  C CD   . LYS A 1 86  ? -17.981 5.425   -14.497 1.00 0.00 ? 86  LYS A CD   5  
ATOM 7345  C CE   . LYS A 1 86  ? -16.741 6.014   -15.151 1.00 0.00 ? 86  LYS A CE   5  
ATOM 7346  N NZ   . LYS A 1 86  ? -16.558 5.518   -16.543 1.00 0.00 ? 86  LYS A NZ   5  
ATOM 7347  H H    . LYS A 1 86  ? -18.906 4.177   -10.263 1.00 0.00 ? 86  LYS A H    5  
ATOM 7348  H HA   . LYS A 1 86  ? -18.516 3.123   -12.941 1.00 0.00 ? 86  LYS A HA   5  
ATOM 7349  H HB2  . LYS A 1 86  ? -17.042 5.112   -11.234 1.00 0.00 ? 86  LYS A HB2  5  
ATOM 7350  H HB3  . LYS A 1 86  ? -16.332 4.485   -12.716 1.00 0.00 ? 86  LYS A HB3  5  
ATOM 7351  H HG2  . LYS A 1 86  ? -19.055 5.738   -12.685 1.00 0.00 ? 86  LYS A HG2  5  
ATOM 7352  H HG3  . LYS A 1 86  ? -17.584 6.702   -12.837 1.00 0.00 ? 86  LYS A HG3  5  
ATOM 7353  H HD2  . LYS A 1 86  ? -17.974 4.354   -14.636 1.00 0.00 ? 86  LYS A HD2  5  
ATOM 7354  H HD3  . LYS A 1 86  ? -18.859 5.845   -14.968 1.00 0.00 ? 86  LYS A HD3  5  
ATOM 7355  H HE2  . LYS A 1 86  ? -16.836 7.089   -15.171 1.00 0.00 ? 86  LYS A HE2  5  
ATOM 7356  H HE3  . LYS A 1 86  ? -15.877 5.741   -14.564 1.00 0.00 ? 86  LYS A HE3  5  
ATOM 7357  H HZ1  . LYS A 1 86  ? -16.775 4.501   -16.591 1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 7358  H HZ2  . LYS A 1 86  ? -15.576 5.666   -16.849 1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 7359  H HZ3  . LYS A 1 86  ? -17.193 6.027   -17.190 1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 7360  N N    . GLN A 1 87  ? -16.197 1.894   -12.594 1.00 0.00 ? 87  GLN A N    5  
ATOM 7361  C CA   . GLN A 1 87  ? -15.217 0.839   -12.367 1.00 0.00 ? 87  GLN A CA   5  
ATOM 7362  C C    . GLN A 1 87  ? -13.800 1.351   -12.608 1.00 0.00 ? 87  GLN A C    5  
ATOM 7363  O O    . GLN A 1 87  ? -13.593 2.300   -13.364 1.00 0.00 ? 87  GLN A O    5  
ATOM 7364  C CB   . GLN A 1 87  ? -15.502 -0.355  -13.279 1.00 0.00 ? 87  GLN A CB   5  
ATOM 7365  C CG   . GLN A 1 87  ? -15.591 0.011   -14.752 1.00 0.00 ? 87  GLN A CG   5  
ATOM 7366  C CD   . GLN A 1 87  ? -16.882 0.727   -15.098 1.00 0.00 ? 87  GLN A CD   5  
ATOM 7367  O OE1  . GLN A 1 87  ? -17.916 0.505   -14.467 1.00 0.00 ? 87  GLN A OE1  5  
ATOM 7368  N NE2  . GLN A 1 87  ? -16.829 1.591   -16.105 1.00 0.00 ? 87  GLN A NE2  5  
ATOM 7369  H H    . GLN A 1 87  ? -16.225 2.341   -13.465 1.00 0.00 ? 87  GLN A H    5  
ATOM 7370  H HA   . GLN A 1 87  ? -15.302 0.523   -11.339 1.00 0.00 ? 87  GLN A HA   5  
ATOM 7371  H HB2  . GLN A 1 87  ? -14.712 -1.082  -13.159 1.00 0.00 ? 87  GLN A HB2  5  
ATOM 7372  H HB3  . GLN A 1 87  ? -16.440 -0.802  -12.985 1.00 0.00 ? 87  GLN A HB3  5  
ATOM 7373  H HG2  . GLN A 1 87  ? -14.762 0.658   -15.000 1.00 0.00 ? 87  GLN A HG2  5  
ATOM 7374  H HG3  . GLN A 1 87  ? -15.529 -0.893  -15.339 1.00 0.00 ? 87  GLN A HG3  5  
ATOM 7375  H HE21 . GLN A 1 87  ? -15.971 1.715   -16.563 1.00 0.00 ? 87  GLN A HE21 5  
ATOM 7376  H HE22 . GLN A 1 87  ? -17.649 2.066   -16.350 1.00 0.00 ? 87  GLN A HE22 5  
ATOM 7377  N N    . ARG A 1 88  ? -12.829 0.716   -11.960 1.00 0.00 ? 88  ARG A N    5  
ATOM 7378  C CA   . ARG A 1 88  ? -11.432 1.108   -12.102 1.00 0.00 ? 88  ARG A CA   5  
ATOM 7379  C C    . ARG A 1 88  ? -10.504 -0.065  -11.799 1.00 0.00 ? 88  ARG A C    5  
ATOM 7380  O O    . ARG A 1 88  ? -10.906 -1.040  -11.163 1.00 0.00 ? 88  ARG A O    5  
ATOM 7381  C CB   . ARG A 1 88  ? -11.112 2.280   -11.171 1.00 0.00 ? 88  ARG A CB   5  
ATOM 7382  C CG   . ARG A 1 88  ? -11.924 3.530   -11.465 1.00 0.00 ? 88  ARG A CG   5  
ATOM 7383  C CD   . ARG A 1 88  ? -11.345 4.748   -10.763 1.00 0.00 ? 88  ARG A CD   5  
ATOM 7384  N NE   . ARG A 1 88  ? -11.887 4.914   -9.417  1.00 0.00 ? 88  ARG A NE   5  
ATOM 7385  C CZ   . ARG A 1 88  ? -11.745 6.022   -8.698  1.00 0.00 ? 88  ARG A CZ   5  
ATOM 7386  N NH1  . ARG A 1 88  ? -11.081 7.057   -9.194  1.00 0.00 ? 88  ARG A NH1  5  
ATOM 7387  N NH2  . ARG A 1 88  ? -12.267 6.096   -7.481  1.00 0.00 ? 88  ARG A NH2  5  
ATOM 7388  H H    . ARG A 1 88  ? -13.057 -0.034  -11.371 1.00 0.00 ? 88  ARG A H    5  
ATOM 7389  H HA   . ARG A 1 88  ? -11.277 1.420   -13.124 1.00 0.00 ? 88  ARG A HA   5  
ATOM 7390  H HB2  . ARG A 1 88  ? -11.310 1.980   -10.153 1.00 0.00 ? 88  ARG A HB2  5  
ATOM 7391  H HB3  . ARG A 1 88  ? -10.065 2.525   -11.269 1.00 0.00 ? 88  ARG A HB3  5  
ATOM 7392  H HG2  . ARG A 1 88  ? -11.922 3.708   -12.530 1.00 0.00 ? 88  ARG A HG2  5  
ATOM 7393  H HG3  . ARG A 1 88  ? -12.938 3.378   -11.125 1.00 0.00 ? 88  ARG A HG3  5  
ATOM 7394  H HD2  . ARG A 1 88  ? -10.273 4.634   -10.697 1.00 0.00 ? 88  ARG A HD2  5  
ATOM 7395  H HD3  . ARG A 1 88  ? -11.577 5.627   -11.345 1.00 0.00 ? 88  ARG A HD3  5  
ATOM 7396  H HE   . ARG A 1 88  ? -12.381 4.161   -9.031  1.00 0.00 ? 88  ARG A HE   5  
ATOM 7397  H HH11 . ARG A 1 88  ? -10.687 7.004   -10.112 1.00 0.00 ? 88  ARG A HH11 5  
ATOM 7398  H HH12 . ARG A 1 88  ? -10.976 7.891   -8.651  1.00 0.00 ? 88  ARG A HH12 5  
ATOM 7399  H HH21 . ARG A 1 88  ? -12.769 5.318   -7.104  1.00 0.00 ? 88  ARG A HH21 5  
ATOM 7400  H HH22 . ARG A 1 88  ? -12.160 6.930   -6.941  1.00 0.00 ? 88  ARG A HH22 5  
ATOM 7401  N N    . LEU A 1 89  ? -9.262  0.037   -12.257 1.00 0.00 ? 89  LEU A N    5  
ATOM 7402  C CA   . LEU A 1 89  ? -8.276  -1.015  -12.036 1.00 0.00 ? 89  LEU A CA   5  
ATOM 7403  C C    . LEU A 1 89  ? -7.325  -0.641  -10.903 1.00 0.00 ? 89  LEU A C    5  
ATOM 7404  O O    . LEU A 1 89  ? -7.132  0.538   -10.606 1.00 0.00 ? 89  LEU A O    5  
ATOM 7405  C CB   . LEU A 1 89  ? -7.483  -1.276  -13.317 1.00 0.00 ? 89  LEU A CB   5  
ATOM 7406  C CG   . LEU A 1 89  ? -8.184  -2.124  -14.380 1.00 0.00 ? 89  LEU A CG   5  
ATOM 7407  C CD1  . LEU A 1 89  ? -8.724  -3.407  -13.767 1.00 0.00 ? 89  LEU A CD1  5  
ATOM 7408  C CD2  . LEU A 1 89  ? -9.303  -1.333  -15.040 1.00 0.00 ? 89  LEU A CD2  5  
ATOM 7409  H H    . LEU A 1 89  ? -9.000  0.838   -12.757 1.00 0.00 ? 89  LEU A H    5  
ATOM 7410  H HA   . LEU A 1 89  ? -8.807  -1.914  -11.762 1.00 0.00 ? 89  LEU A HA   5  
ATOM 7411  H HB2  . LEU A 1 89  ? -7.246  -0.321  -13.760 1.00 0.00 ? 89  LEU A HB2  5  
ATOM 7412  H HB3  . LEU A 1 89  ? -6.567  -1.780  -13.042 1.00 0.00 ? 89  LEU A HB3  5  
ATOM 7413  H HG   . LEU A 1 89  ? -7.469  -2.395  -15.144 1.00 0.00 ? 89  LEU A HG   5  
ATOM 7414  H HD11 . LEU A 1 89  ? -9.778  -3.292  -13.562 1.00 0.00 ? 89  LEU A HD11 5  
ATOM 7415  H HD12 . LEU A 1 89  ? -8.199  -3.616  -12.847 1.00 0.00 ? 89  LEU A HD12 5  
ATOM 7416  H HD13 . LEU A 1 89  ? -8.579  -4.225  -14.458 1.00 0.00 ? 89  LEU A HD13 5  
ATOM 7417  H HD21 . LEU A 1 89  ? -10.249 -1.817  -14.845 1.00 0.00 ? 89  LEU A HD21 5  
ATOM 7418  H HD22 . LEU A 1 89  ? -9.134  -1.291  -16.107 1.00 0.00 ? 89  LEU A HD22 5  
ATOM 7419  H HD23 . LEU A 1 89  ? -9.321  -0.331  -14.639 1.00 0.00 ? 89  LEU A HD23 5  
ATOM 7420  N N    . ILE A 1 90  ? -6.734  -1.652  -10.276 1.00 0.00 ? 90  ILE A N    5  
ATOM 7421  C CA   . ILE A 1 90  ? -5.801  -1.429  -9.179  1.00 0.00 ? 90  ILE A CA   5  
ATOM 7422  C C    . ILE A 1 90  ? -4.520  -2.233  -9.374  1.00 0.00 ? 90  ILE A C    5  
ATOM 7423  O O    . ILE A 1 90  ? -4.501  -3.225  -10.104 1.00 0.00 ? 90  ILE A O    5  
ATOM 7424  C CB   . ILE A 1 90  ? -6.427  -1.804  -7.822  1.00 0.00 ? 90  ILE A CB   5  
ATOM 7425  C CG1  . ILE A 1 90  ? -7.008  -3.218  -7.877  1.00 0.00 ? 90  ILE A CG1  5  
ATOM 7426  C CG2  . ILE A 1 90  ? -7.502  -0.798  -7.440  1.00 0.00 ? 90  ILE A CG2  5  
ATOM 7427  C CD1  . ILE A 1 90  ? -7.655  -3.656  -6.582  1.00 0.00 ? 90  ILE A CD1  5  
ATOM 7428  H H    . ILE A 1 90  ? -6.929  -2.570  -10.559 1.00 0.00 ? 90  ILE A H    5  
ATOM 7429  H HA   . ILE A 1 90  ? -5.554  -0.377  -9.160  1.00 0.00 ? 90  ILE A HA   5  
ATOM 7430  H HB   . ILE A 1 90  ? -5.652  -1.769  -7.072  1.00 0.00 ? 90  ILE A HB   5  
ATOM 7431  H HG12 . ILE A 1 90  ? -7.757  -3.263  -8.653  1.00 0.00 ? 90  ILE A HG12 5  
ATOM 7432  H HG13 . ILE A 1 90  ? -6.216  -3.916  -8.107  1.00 0.00 ? 90  ILE A HG13 5  
ATOM 7433  H HG21 . ILE A 1 90  ? -7.412  0.080   -8.063  1.00 0.00 ? 90  ILE A HG21 5  
ATOM 7434  H HG22 . ILE A 1 90  ? -8.476  -1.241  -7.582  1.00 0.00 ? 90  ILE A HG22 5  
ATOM 7435  H HG23 . ILE A 1 90  ? -7.381  -0.518  -6.404  1.00 0.00 ? 90  ILE A HG23 5  
ATOM 7436  H HD11 . ILE A 1 90  ? -7.124  -4.510  -6.185  1.00 0.00 ? 90  ILE A HD11 5  
ATOM 7437  H HD12 . ILE A 1 90  ? -7.620  -2.846  -5.869  1.00 0.00 ? 90  ILE A HD12 5  
ATOM 7438  H HD13 . ILE A 1 90  ? -8.684  -3.929  -6.768  1.00 0.00 ? 90  ILE A HD13 5  
ATOM 7439  N N    . LYS A 1 91  ? -3.450  -1.801  -8.715  1.00 0.00 ? 91  LYS A N    5  
ATOM 7440  C CA   . LYS A 1 91  ? -2.164  -2.481  -8.813  1.00 0.00 ? 91  LYS A CA   5  
ATOM 7441  C C    . LYS A 1 91  ? -1.376  -2.342  -7.514  1.00 0.00 ? 91  LYS A C    5  
ATOM 7442  O O    . LYS A 1 91  ? -1.550  -1.376  -6.771  1.00 0.00 ? 91  LYS A O    5  
ATOM 7443  C CB   . LYS A 1 91  ? -1.351  -1.914  -9.978  1.00 0.00 ? 91  LYS A CB   5  
ATOM 7444  C CG   . LYS A 1 91  ? -1.013  -0.441  -9.825  1.00 0.00 ? 91  LYS A CG   5  
ATOM 7445  C CD   . LYS A 1 91  ? -0.454  0.140   -11.113 1.00 0.00 ? 91  LYS A CD   5  
ATOM 7446  C CE   . LYS A 1 91  ? 1.044   -0.096  -11.227 1.00 0.00 ? 91  LYS A CE   5  
ATOM 7447  N NZ   . LYS A 1 91  ? 1.353   -1.392  -11.891 1.00 0.00 ? 91  LYS A NZ   5  
ATOM 7448  H H    . LYS A 1 91  ? -3.528  -1.004  -8.149  1.00 0.00 ? 91  LYS A H    5  
ATOM 7449  H HA   . LYS A 1 91  ? -2.355  -3.528  -8.994  1.00 0.00 ? 91  LYS A HA   5  
ATOM 7450  H HB2  . LYS A 1 91  ? -0.427  -2.468  -10.060 1.00 0.00 ? 91  LYS A HB2  5  
ATOM 7451  H HB3  . LYS A 1 91  ? -1.917  -2.039  -10.891 1.00 0.00 ? 91  LYS A HB3  5  
ATOM 7452  H HG2  . LYS A 1 91  ? -1.909  0.099   -9.558  1.00 0.00 ? 91  LYS A HG2  5  
ATOM 7453  H HG3  . LYS A 1 91  ? -0.276  -0.330  -9.041  1.00 0.00 ? 91  LYS A HG3  5  
ATOM 7454  H HD2  . LYS A 1 91  ? -0.946  -0.329  -11.952 1.00 0.00 ? 91  LYS A HD2  5  
ATOM 7455  H HD3  . LYS A 1 91  ? -0.645  1.204   -11.130 1.00 0.00 ? 91  LYS A HD3  5  
ATOM 7456  H HE2  . LYS A 1 91  ? 1.479   0.707   -11.803 1.00 0.00 ? 91  LYS A HE2  5  
ATOM 7457  H HE3  . LYS A 1 91  ? 1.471   -0.099  -10.235 1.00 0.00 ? 91  LYS A HE3  5  
ATOM 7458  H HZ1  . LYS A 1 91  ? 0.691   -1.557  -12.677 1.00 0.00 ? 91  LYS A HZ1  5  
ATOM 7459  H HZ2  . LYS A 1 91  ? 1.265   -2.173  -11.210 1.00 0.00 ? 91  LYS A HZ2  5  
ATOM 7460  H HZ3  . LYS A 1 91  ? 2.323   -1.380  -12.266 1.00 0.00 ? 91  LYS A HZ3  5  
ATOM 7461  N N    . ARG A 1 92  ? -0.508  -3.313  -7.248  1.00 0.00 ? 92  ARG A N    5  
ATOM 7462  C CA   . ARG A 1 92  ? 0.308   -3.298  -6.039  1.00 0.00 ? 92  ARG A CA   5  
ATOM 7463  C C    . ARG A 1 92  ? 1.794   -3.313  -6.386  1.00 0.00 ? 92  ARG A C    5  
ATOM 7464  O O    . ARG A 1 92  ? 2.333   -4.337  -6.804  1.00 0.00 ? 92  ARG A O    5  
ATOM 7465  C CB   . ARG A 1 92  ? -0.033  -4.499  -5.154  1.00 0.00 ? 92  ARG A CB   5  
ATOM 7466  C CG   . ARG A 1 92  ? 0.625   -4.453  -3.785  1.00 0.00 ? 92  ARG A CG   5  
ATOM 7467  C CD   . ARG A 1 92  ? -0.171  -5.241  -2.757  1.00 0.00 ? 92  ARG A CD   5  
ATOM 7468  N NE   . ARG A 1 92  ? 0.237   -6.643  -2.707  1.00 0.00 ? 92  ARG A NE   5  
ATOM 7469  C CZ   . ARG A 1 92  ? 1.369   -7.059  -2.150  1.00 0.00 ? 92  ARG A CZ   5  
ATOM 7470  N NH1  . ARG A 1 92  ? 2.201   -6.186  -1.599  1.00 0.00 ? 92  ARG A NH1  5  
ATOM 7471  N NH2  . ARG A 1 92  ? 1.671   -8.351  -2.143  1.00 0.00 ? 92  ARG A NH2  5  
ATOM 7472  H H    . ARG A 1 92  ? -0.414  -4.057  -7.879  1.00 0.00 ? 92  ARG A H    5  
ATOM 7473  H HA   . ARG A 1 92  ? 0.085   -2.390  -5.500  1.00 0.00 ? 92  ARG A HA   5  
ATOM 7474  H HB2  . ARG A 1 92  ? -1.103  -4.536  -5.014  1.00 0.00 ? 92  ARG A HB2  5  
ATOM 7475  H HB3  . ARG A 1 92  ? 0.288   -5.401  -5.654  1.00 0.00 ? 92  ARG A HB3  5  
ATOM 7476  H HG2  . ARG A 1 92  ? 1.617   -4.875  -3.858  1.00 0.00 ? 92  ARG A HG2  5  
ATOM 7477  H HG3  . ARG A 1 92  ? 0.693   -3.424  -3.464  1.00 0.00 ? 92  ARG A HG3  5  
ATOM 7478  H HD2  . ARG A 1 92  ? -0.018  -4.797  -1.785  1.00 0.00 ? 92  ARG A HD2  5  
ATOM 7479  H HD3  . ARG A 1 92  ? -1.218  -5.190  -3.016  1.00 0.00 ? 92  ARG A HD3  5  
ATOM 7480  H HE   . ARG A 1 92  ? -0.362  -7.305  -3.108  1.00 0.00 ? 92  ARG A HE   5  
ATOM 7481  H HH11 . ARG A 1 92  ? 1.976   -5.212  -1.601  1.00 0.00 ? 92  ARG A HH11 5  
ATOM 7482  H HH12 . ARG A 1 92  ? 3.052   -6.502  -1.179  1.00 0.00 ? 92  ARG A HH12 5  
ATOM 7483  H HH21 . ARG A 1 92  ? 1.046   -9.012  -2.557  1.00 0.00 ? 92  ARG A HH21 5  
ATOM 7484  H HH22 . ARG A 1 92  ? 2.523   -8.663  -1.724  1.00 0.00 ? 92  ARG A HH22 5  
ATOM 7485  N N    . ALA A 1 93  ? 2.449   -2.171  -6.208  1.00 0.00 ? 93  ALA A N    5  
ATOM 7486  C CA   . ALA A 1 93  ? 3.872   -2.053  -6.500  1.00 0.00 ? 93  ALA A CA   5  
ATOM 7487  C C    . ALA A 1 93  ? 4.609   -1.351  -5.364  1.00 0.00 ? 93  ALA A C    5  
ATOM 7488  O O    . ALA A 1 93  ? 4.041   -0.546  -4.627  1.00 0.00 ? 93  ALA A O    5  
ATOM 7489  C CB   . ALA A 1 93  ? 4.082   -1.306  -7.809  1.00 0.00 ? 93  ALA A CB   5  
ATOM 7490  H H    . ALA A 1 93  ? 1.963   -1.389  -5.872  1.00 0.00 ? 93  ALA A H    5  
ATOM 7491  H HA   . ALA A 1 93  ? 4.273   -3.049  -6.615  1.00 0.00 ? 93  ALA A HA   5  
ATOM 7492  H HB1  . ALA A 1 93  ? 5.026   -1.601  -8.243  1.00 0.00 ? 93  ALA A HB1  5  
ATOM 7493  H HB2  . ALA A 1 93  ? 3.280   -1.544  -8.492  1.00 0.00 ? 93  ALA A HB2  5  
ATOM 7494  H HB3  . ALA A 1 93  ? 4.089   -0.243  -7.619  1.00 0.00 ? 93  ALA A HB3  5  
ATOM 7495  N N    . PRO A 1 94  ? 5.905   -1.664  -5.217  1.00 0.00 ? 94  PRO A N    5  
ATOM 7496  C CA   . PRO A 1 94  ? 6.748   -1.074  -4.173  1.00 0.00 ? 94  PRO A CA   5  
ATOM 7497  C C    . PRO A 1 94  ? 7.031   0.403   -4.422  1.00 0.00 ? 94  PRO A C    5  
ATOM 7498  O O    . PRO A 1 94  ? 7.155   0.837   -5.567  1.00 0.00 ? 94  PRO A O    5  
ATOM 7499  C CB   . PRO A 1 94  ? 8.041   -1.889  -4.259  1.00 0.00 ? 94  PRO A CB   5  
ATOM 7500  C CG   . PRO A 1 94  ? 8.080   -2.391  -5.661  1.00 0.00 ? 94  PRO A CG   5  
ATOM 7501  C CD   . PRO A 1 94  ? 6.648   -2.616  -6.060  1.00 0.00 ? 94  PRO A CD   5  
ATOM 7502  H HA   . PRO A 1 94  ? 6.309   -1.196  -3.193  1.00 0.00 ? 94  PRO A HA   5  
ATOM 7503  H HB2  . PRO A 1 94  ? 8.886   -1.251  -4.043  1.00 0.00 ? 94  PRO A HB2  5  
ATOM 7504  H HB3  . PRO A 1 94  ? 8.006   -2.702  -3.549  1.00 0.00 ? 94  PRO A HB3  5  
ATOM 7505  H HG2  . PRO A 1 94  ? 8.537   -1.653  -6.303  1.00 0.00 ? 94  PRO A HG2  5  
ATOM 7506  H HG3  . PRO A 1 94  ? 8.631   -3.319  -5.703  1.00 0.00 ? 94  PRO A HG3  5  
ATOM 7507  H HD2  . PRO A 1 94  ? 6.509   -2.394  -7.107  1.00 0.00 ? 94  PRO A HD2  5  
ATOM 7508  H HD3  . PRO A 1 94  ? 6.351   -3.632  -5.845  1.00 0.00 ? 94  PRO A HD3  5  
ATOM 7509  N N    . PHE A 1 95  ? 7.133   1.171   -3.342  1.00 0.00 ? 95  PHE A N    5  
ATOM 7510  C CA   . PHE A 1 95  ? 7.402   2.601   -3.443  1.00 0.00 ? 95  PHE A CA   5  
ATOM 7511  C C    . PHE A 1 95  ? 8.765   2.854   -4.081  1.00 0.00 ? 95  PHE A C    5  
ATOM 7512  O O    . PHE A 1 95  ? 9.778   2.309   -3.643  1.00 0.00 ? 95  PHE A O    5  
ATOM 7513  C CB   . PHE A 1 95  ? 7.344   3.252   -2.060  1.00 0.00 ? 95  PHE A CB   5  
ATOM 7514  C CG   . PHE A 1 95  ? 6.099   2.916   -1.291  1.00 0.00 ? 95  PHE A CG   5  
ATOM 7515  C CD1  . PHE A 1 95  ? 4.848   3.214   -1.808  1.00 0.00 ? 95  PHE A CD1  5  
ATOM 7516  C CD2  . PHE A 1 95  ? 6.178   2.302   -0.051  1.00 0.00 ? 95  PHE A CD2  5  
ATOM 7517  C CE1  . PHE A 1 95  ? 3.700   2.907   -1.101  1.00 0.00 ? 95  PHE A CE1  5  
ATOM 7518  C CE2  . PHE A 1 95  ? 5.034   1.992   0.659   1.00 0.00 ? 95  PHE A CE2  5  
ATOM 7519  C CZ   . PHE A 1 95  ? 3.793   2.294   0.133   1.00 0.00 ? 95  PHE A CZ   5  
ATOM 7520  H H    . PHE A 1 95  ? 7.024   0.767   -2.455  1.00 0.00 ? 95  PHE A H    5  
ATOM 7521  H HA   . PHE A 1 95  ? 6.638   3.037   -4.069  1.00 0.00 ? 95  PHE A HA   5  
ATOM 7522  H HB2  . PHE A 1 95  ? 8.192   2.921   -1.479  1.00 0.00 ? 95  PHE A HB2  5  
ATOM 7523  H HB3  . PHE A 1 95  ? 7.387   4.324   -2.173  1.00 0.00 ? 95  PHE A HB3  5  
ATOM 7524  H HD1  . PHE A 1 95  ? 4.773   3.692   -2.773  1.00 0.00 ? 95  PHE A HD1  5  
ATOM 7525  H HD2  . PHE A 1 95  ? 7.149   2.065   0.361   1.00 0.00 ? 95  PHE A HD2  5  
ATOM 7526  H HE1  . PHE A 1 95  ? 2.732   3.144   -1.515  1.00 0.00 ? 95  PHE A HE1  5  
ATOM 7527  H HE2  . PHE A 1 95  ? 5.111   1.512   1.624   1.00 0.00 ? 95  PHE A HE2  5  
ATOM 7528  H HZ   . PHE A 1 95  ? 2.898   2.053   0.687   1.00 0.00 ? 95  PHE A HZ   5  
ATOM 7529  N N    . SER A 1 96  ? 8.781   3.685   -5.118  1.00 0.00 ? 96  SER A N    5  
ATOM 7530  C CA   . SER A 1 96  ? 10.018  4.008   -5.820  1.00 0.00 ? 96  SER A CA   5  
ATOM 7531  C C    . SER A 1 96  ? 10.777  5.118   -5.100  1.00 0.00 ? 96  SER A C    5  
ATOM 7532  O O    . SER A 1 96  ? 10.646  6.295   -5.438  1.00 0.00 ? 96  SER A O    5  
ATOM 7533  C CB   . SER A 1 96  ? 9.717   4.431   -7.259  1.00 0.00 ? 96  SER A CB   5  
ATOM 7534  O OG   . SER A 1 96  ? 10.869  4.973   -7.883  1.00 0.00 ? 96  SER A OG   5  
ATOM 7535  H H    . SER A 1 96  ? 7.940   4.088   -5.421  1.00 0.00 ? 96  SER A H    5  
ATOM 7536  H HA   . SER A 1 96  ? 10.632  3.120   -5.835  1.00 0.00 ? 96  SER A HA   5  
ATOM 7537  H HB2  . SER A 1 96  ? 9.389   3.571   -7.823  1.00 0.00 ? 96  SER A HB2  5  
ATOM 7538  H HB3  . SER A 1 96  ? 8.938   5.179   -7.256  1.00 0.00 ? 96  SER A HB3  5  
ATOM 7539  H HG   . SER A 1 96  ? 11.404  4.261   -8.241  1.00 0.00 ? 96  SER A HG   5  
ATOM 7540  N N    . SER A 1 97  ? 11.570  4.735   -4.104  1.00 0.00 ? 97  SER A N    5  
ATOM 7541  C CA   . SER A 1 97  ? 12.347  5.698   -3.333  1.00 0.00 ? 97  SER A CA   5  
ATOM 7542  C C    . SER A 1 97  ? 13.841  5.514   -3.582  1.00 0.00 ? 97  SER A C    5  
ATOM 7543  O O    . SER A 1 97  ? 14.262  4.544   -4.211  1.00 0.00 ? 97  SER A O    5  
ATOM 7544  C CB   . SER A 1 97  ? 12.046  5.549   -1.840  1.00 0.00 ? 97  SER A CB   5  
ATOM 7545  O OG   . SER A 1 97  ? 12.493  4.297   -1.352  1.00 0.00 ? 97  SER A OG   5  
ATOM 7546  H H    . SER A 1 97  ? 11.631  3.783   -3.882  1.00 0.00 ? 97  SER A H    5  
ATOM 7547  H HA   . SER A 1 97  ? 12.060  6.688   -3.653  1.00 0.00 ? 97  SER A HA   5  
ATOM 7548  H HB2  . SER A 1 97  ? 12.547  6.335   -1.295  1.00 0.00 ? 97  SER A HB2  5  
ATOM 7549  H HB3  . SER A 1 97  ? 10.980  5.624   -1.682  1.00 0.00 ? 97  SER A HB3  5  
ATOM 7550  H HG   . SER A 1 97  ? 11.737  3.729   -1.185  1.00 0.00 ? 97  SER A HG   5  
ATOM 7551  N N    . GLY A 1 98  ? 14.639  6.454   -3.083  1.00 0.00 ? 98  GLY A N    5  
ATOM 7552  C CA   . GLY A 1 98  ? 16.077  6.378   -3.262  1.00 0.00 ? 98  GLY A CA   5  
ATOM 7553  C C    . GLY A 1 98  ? 16.678  5.148   -2.612  1.00 0.00 ? 98  GLY A C    5  
ATOM 7554  O O    . GLY A 1 98  ? 16.045  4.480   -1.793  1.00 0.00 ? 98  GLY A O    5  
ATOM 7555  H H    . GLY A 1 98  ? 14.247  7.205   -2.590  1.00 0.00 ? 98  GLY A H    5  
ATOM 7556  H HA2  . GLY A 1 98  ? 16.297  6.358   -4.319  1.00 0.00 ? 98  GLY A HA2  5  
ATOM 7557  H HA3  . GLY A 1 98  ? 16.529  7.258   -2.827  1.00 0.00 ? 98  GLY A HA3  5  
ATOM 7558  N N    . PRO A 1 99  ? 17.929  4.831   -2.979  1.00 0.00 ? 99  PRO A N    5  
ATOM 7559  C CA   . PRO A 1 99  ? 18.642  3.670   -2.438  1.00 0.00 ? 99  PRO A CA   5  
ATOM 7560  C C    . PRO A 1 99  ? 19.014  3.850   -0.970  1.00 0.00 ? 99  PRO A C    5  
ATOM 7561  O O    . PRO A 1 99  ? 19.427  2.902   -0.304  1.00 0.00 ? 99  PRO A O    5  
ATOM 7562  C CB   . PRO A 1 99  ? 19.902  3.594   -3.303  1.00 0.00 ? 99  PRO A CB   5  
ATOM 7563  C CG   . PRO A 1 99  ? 20.114  4.987   -3.788  1.00 0.00 ? 99  PRO A CG   5  
ATOM 7564  C CD   . PRO A 1 99  ? 18.742  5.582   -3.949  1.00 0.00 ? 99  PRO A CD   5  
ATOM 7565  H HA   . PRO A 1 99  ? 18.068  2.763   -2.554  1.00 0.00 ? 99  PRO A HA   5  
ATOM 7566  H HB2  . PRO A 1 99  ? 20.734  3.253   -2.703  1.00 0.00 ? 99  PRO A HB2  5  
ATOM 7567  H HB3  . PRO A 1 99  ? 19.740  2.912   -4.123  1.00 0.00 ? 99  PRO A HB3  5  
ATOM 7568  H HG2  . PRO A 1 99  ? 20.682  5.547   -3.060  1.00 0.00 ? 99  PRO A HG2  5  
ATOM 7569  H HG3  . PRO A 1 99  ? 20.629  4.971   -4.737  1.00 0.00 ? 99  PRO A HG3  5  
ATOM 7570  H HD2  . PRO A 1 99  ? 18.757  6.635   -3.708  1.00 0.00 ? 99  PRO A HD2  5  
ATOM 7571  H HD3  . PRO A 1 99  ? 18.381  5.429   -4.955  1.00 0.00 ? 99  PRO A HD3  5  
ATOM 7572  N N    . SER A 1 100 ? 18.864  5.074   -0.472  1.00 0.00 ? 100 SER A N    5  
ATOM 7573  C CA   . SER A 1 100 ? 19.187  5.379   0.917   1.00 0.00 ? 100 SER A CA   5  
ATOM 7574  C C    . SER A 1 100 ? 18.251  6.449   1.470   1.00 0.00 ? 100 SER A C    5  
ATOM 7575  O O    . SER A 1 100 ? 17.487  7.066   0.727   1.00 0.00 ? 100 SER A O    5  
ATOM 7576  C CB   . SER A 1 100 ? 20.639  5.844   1.034   1.00 0.00 ? 100 SER A CB   5  
ATOM 7577  O OG   . SER A 1 100 ? 21.106  5.730   2.367   1.00 0.00 ? 100 SER A OG   5  
ATOM 7578  H H    . SER A 1 100 ? 18.530  5.789   -1.054  1.00 0.00 ? 100 SER A H    5  
ATOM 7579  H HA   . SER A 1 100 ? 19.060  4.474   1.493   1.00 0.00 ? 100 SER A HA   5  
ATOM 7580  H HB2  . SER A 1 100 ? 21.262  5.237   0.395   1.00 0.00 ? 100 SER A HB2  5  
ATOM 7581  H HB3  . SER A 1 100 ? 20.709  6.878   0.729   1.00 0.00 ? 100 SER A HB3  5  
ATOM 7582  H HG   . SER A 1 100 ? 21.316  4.812   2.556   1.00 0.00 ? 100 SER A HG   5  
ATOM 7583  N N    . SER A 1 101 ? 18.318  6.665   2.780   1.00 0.00 ? 101 SER A N    5  
ATOM 7584  C CA   . SER A 1 101 ? 17.474  7.658   3.435   1.00 0.00 ? 101 SER A CA   5  
ATOM 7585  C C    . SER A 1 101 ? 18.299  8.862   3.880   1.00 0.00 ? 101 SER A C    5  
ATOM 7586  O O    . SER A 1 101 ? 17.928  10.009  3.633   1.00 0.00 ? 101 SER A O    5  
ATOM 7587  C CB   . SER A 1 101 ? 16.763  7.039   4.639   1.00 0.00 ? 101 SER A CB   5  
ATOM 7588  O OG   . SER A 1 101 ? 15.855  7.958   5.223   1.00 0.00 ? 101 SER A OG   5  
ATOM 7589  H H    . SER A 1 101 ? 18.947  6.141   3.319   1.00 0.00 ? 101 SER A H    5  
ATOM 7590  H HA   . SER A 1 101 ? 16.735  7.988   2.721   1.00 0.00 ? 101 SER A HA   5  
ATOM 7591  H HB2  . SER A 1 101 ? 16.216  6.165   4.321   1.00 0.00 ? 101 SER A HB2  5  
ATOM 7592  H HB3  . SER A 1 101 ? 17.496  6.756   5.381   1.00 0.00 ? 101 SER A HB3  5  
ATOM 7593  H HG   . SER A 1 101 ? 15.378  8.420   4.530   1.00 0.00 ? 101 SER A HG   5  
ATOM 7594  N N    . GLY A 1 102 ? 19.422  8.592   4.539   1.00 0.00 ? 102 GLY A N    5  
ATOM 7595  C CA   . GLY A 1 102 ? 20.282  9.661   5.009   1.00 0.00 ? 102 GLY A CA   5  
ATOM 7596  C C    . GLY A 1 102 ? 20.034  10.009  6.463   1.00 0.00 ? 102 GLY A C    5  
ATOM 7597  O O    . GLY A 1 102 ? 19.099  9.497   7.080   1.00 0.00 ? 102 GLY A O    5  
ATOM 7598  H H    . GLY A 1 102 ? 19.668  7.658   4.707   1.00 0.00 ? 102 GLY A H    5  
ATOM 7599  H HA2  . GLY A 1 102 ? 21.312  9.358   4.893   1.00 0.00 ? 102 GLY A HA2  5  
ATOM 7600  H HA3  . GLY A 1 102 ? 20.106  10.540  4.406   1.00 0.00 ? 102 GLY A HA3  5  
ATOM 7601  N N    . GLY A 1 1   ? 13.821  12.762  -9.847  1.00 0.00 ? 1   GLY A N    6  
ATOM 7602  C CA   . GLY A 1 1   ? 13.509  13.460  -11.080 1.00 0.00 ? 1   GLY A CA   6  
ATOM 7603  C C    . GLY A 1 1   ? 14.479  13.126  -12.196 1.00 0.00 ? 1   GLY A C    6  
ATOM 7604  O O    . GLY A 1 1   ? 15.516  13.773  -12.342 1.00 0.00 ? 1   GLY A O    6  
ATOM 7605  H H1   . GLY A 1 1   ? 14.748  12.515  -9.646  1.00 0.00 ? 1   GLY A H1   6  
ATOM 7606  H HA2  . GLY A 1 1   ? 12.511  13.190  -11.392 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 7607  H HA3  . GLY A 1 1   ? 13.543  14.524  -10.897 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 7608  N N    . SER A 1 2   ? 14.143  12.111  -12.986 1.00 0.00 ? 2   SER A N    6  
ATOM 7609  C CA   . SER A 1 2   ? 14.995  11.688  -14.091 1.00 0.00 ? 2   SER A CA   6  
ATOM 7610  C C    . SER A 1 2   ? 14.200  10.876  -15.110 1.00 0.00 ? 2   SER A C    6  
ATOM 7611  O O    . SER A 1 2   ? 13.756  9.764   -14.824 1.00 0.00 ? 2   SER A O    6  
ATOM 7612  C CB   . SER A 1 2   ? 16.171  10.860  -13.569 1.00 0.00 ? 2   SER A CB   6  
ATOM 7613  O OG   . SER A 1 2   ? 16.924  11.589  -12.615 1.00 0.00 ? 2   SER A OG   6  
ATOM 7614  H H    . SER A 1 2   ? 13.303  11.633  -12.819 1.00 0.00 ? 2   SER A H    6  
ATOM 7615  H HA   . SER A 1 2   ? 15.376  12.575  -14.574 1.00 0.00 ? 2   SER A HA   6  
ATOM 7616  H HB2  . SER A 1 2   ? 15.796  9.961   -13.104 1.00 0.00 ? 2   SER A HB2  6  
ATOM 7617  H HB3  . SER A 1 2   ? 16.816  10.596  -14.394 1.00 0.00 ? 2   SER A HB3  6  
ATOM 7618  H HG   . SER A 1 2   ? 17.375  10.978  -12.028 1.00 0.00 ? 2   SER A HG   6  
ATOM 7619  N N    . SER A 1 3   ? 14.024  11.442  -16.300 1.00 0.00 ? 3   SER A N    6  
ATOM 7620  C CA   . SER A 1 3   ? 13.280  10.774  -17.361 1.00 0.00 ? 3   SER A CA   6  
ATOM 7621  C C    . SER A 1 3   ? 14.226  10.209  -18.416 1.00 0.00 ? 3   SER A C    6  
ATOM 7622  O O    . SER A 1 3   ? 13.970  10.313  -19.615 1.00 0.00 ? 3   SER A O    6  
ATOM 7623  C CB   . SER A 1 3   ? 12.294  11.747  -18.012 1.00 0.00 ? 3   SER A CB   6  
ATOM 7624  O OG   . SER A 1 3   ? 12.968  12.671  -18.849 1.00 0.00 ? 3   SER A OG   6  
ATOM 7625  H H    . SER A 1 3   ? 14.402  12.331  -16.467 1.00 0.00 ? 3   SER A H    6  
ATOM 7626  H HA   . SER A 1 3   ? 12.728  9.959   -16.917 1.00 0.00 ? 3   SER A HA   6  
ATOM 7627  H HB2  . SER A 1 3   ? 11.584  11.192  -18.606 1.00 0.00 ? 3   SER A HB2  6  
ATOM 7628  H HB3  . SER A 1 3   ? 11.770  12.293  -17.241 1.00 0.00 ? 3   SER A HB3  6  
ATOM 7629  H HG   . SER A 1 3   ? 13.386  13.346  -18.310 1.00 0.00 ? 3   SER A HG   6  
ATOM 7630  N N    . GLY A 1 4   ? 15.322  9.611   -17.960 1.00 0.00 ? 4   GLY A N    6  
ATOM 7631  C CA   . GLY A 1 4   ? 16.291  9.038   -18.876 1.00 0.00 ? 4   GLY A CA   6  
ATOM 7632  C C    . GLY A 1 4   ? 17.301  8.153   -18.173 1.00 0.00 ? 4   GLY A C    6  
ATOM 7633  O O    . GLY A 1 4   ? 18.471  8.514   -18.048 1.00 0.00 ? 4   GLY A O    6  
ATOM 7634  H H    . GLY A 1 4   ? 15.474  9.558   -16.993 1.00 0.00 ? 4   GLY A H    6  
ATOM 7635  H HA2  . GLY A 1 4   ? 15.767  8.452   -19.616 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 7636  H HA3  . GLY A 1 4   ? 16.817  9.840   -19.373 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 7637  N N    . SER A 1 5   ? 16.848  6.992   -17.711 1.00 0.00 ? 5   SER A N    6  
ATOM 7638  C CA   . SER A 1 5   ? 17.720  6.055   -17.012 1.00 0.00 ? 5   SER A CA   6  
ATOM 7639  C C    . SER A 1 5   ? 17.406  4.617   -17.415 1.00 0.00 ? 5   SER A C    6  
ATOM 7640  O O    . SER A 1 5   ? 16.294  4.132   -17.208 1.00 0.00 ? 5   SER A O    6  
ATOM 7641  C CB   . SER A 1 5   ? 17.568  6.217   -15.498 1.00 0.00 ? 5   SER A CB   6  
ATOM 7642  O OG   . SER A 1 5   ? 18.630  5.581   -14.808 1.00 0.00 ? 5   SER A OG   6  
ATOM 7643  H H    . SER A 1 5   ? 15.905  6.761   -17.842 1.00 0.00 ? 5   SER A H    6  
ATOM 7644  H HA   . SER A 1 5   ? 18.739  6.280   -17.289 1.00 0.00 ? 5   SER A HA   6  
ATOM 7645  H HB2  . SER A 1 5   ? 17.571  7.267   -15.249 1.00 0.00 ? 5   SER A HB2  6  
ATOM 7646  H HB3  . SER A 1 5   ? 16.634  5.775   -15.183 1.00 0.00 ? 5   SER A HB3  6  
ATOM 7647  H HG   . SER A 1 5   ? 19.008  4.896   -15.364 1.00 0.00 ? 5   SER A HG   6  
ATOM 7648  N N    . SER A 1 6   ? 18.396  3.942   -17.991 1.00 0.00 ? 6   SER A N    6  
ATOM 7649  C CA   . SER A 1 6   ? 18.226  2.561   -18.427 1.00 0.00 ? 6   SER A CA   6  
ATOM 7650  C C    . SER A 1 6   ? 19.382  1.691   -17.941 1.00 0.00 ? 6   SER A C    6  
ATOM 7651  O O    . SER A 1 6   ? 20.537  2.114   -17.951 1.00 0.00 ? 6   SER A O    6  
ATOM 7652  C CB   . SER A 1 6   ? 18.128  2.493   -19.952 1.00 0.00 ? 6   SER A CB   6  
ATOM 7653  O OG   . SER A 1 6   ? 19.311  2.982   -20.561 1.00 0.00 ? 6   SER A OG   6  
ATOM 7654  H H    . SER A 1 6   ? 19.260  4.384   -18.128 1.00 0.00 ? 6   SER A H    6  
ATOM 7655  H HA   . SER A 1 6   ? 17.307  2.189   -17.999 1.00 0.00 ? 6   SER A HA   6  
ATOM 7656  H HB2  . SER A 1 6   ? 17.978  1.469   -20.256 1.00 0.00 ? 6   SER A HB2  6  
ATOM 7657  H HB3  . SER A 1 6   ? 17.292  3.093   -20.283 1.00 0.00 ? 6   SER A HB3  6  
ATOM 7658  H HG   . SER A 1 6   ? 19.779  2.255   -20.979 1.00 0.00 ? 6   SER A HG   6  
ATOM 7659  N N    . GLY A 1 7   ? 19.060  0.473   -17.516 1.00 0.00 ? 7   GLY A N    6  
ATOM 7660  C CA   . GLY A 1 7   ? 20.082  -0.437  -17.032 1.00 0.00 ? 7   GLY A CA   6  
ATOM 7661  C C    . GLY A 1 7   ? 19.712  -1.891  -17.248 1.00 0.00 ? 7   GLY A C    6  
ATOM 7662  O O    . GLY A 1 7   ? 19.240  -2.266  -18.321 1.00 0.00 ? 7   GLY A O    6  
ATOM 7663  H H    . GLY A 1 7   ? 18.122  0.190   -17.531 1.00 0.00 ? 7   GLY A H    6  
ATOM 7664  H HA2  . GLY A 1 7   ? 21.007  -0.231  -17.549 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 7665  H HA3  . GLY A 1 7   ? 20.227  -0.268  -15.975 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 7666  N N    . ASN A 1 8   ? 19.928  -2.713  -16.226 1.00 0.00 ? 8   ASN A N    6  
ATOM 7667  C CA   . ASN A 1 8   ? 19.616  -4.135  -16.310 1.00 0.00 ? 8   ASN A CA   6  
ATOM 7668  C C    . ASN A 1 8   ? 18.452  -4.492  -15.392 1.00 0.00 ? 8   ASN A C    6  
ATOM 7669  O O    . ASN A 1 8   ? 18.223  -3.831  -14.379 1.00 0.00 ? 8   ASN A O    6  
ATOM 7670  C CB   . ASN A 1 8   ? 20.845  -4.971  -15.943 1.00 0.00 ? 8   ASN A CB   6  
ATOM 7671  C CG   . ASN A 1 8   ? 21.891  -4.973  -17.041 1.00 0.00 ? 8   ASN A CG   6  
ATOM 7672  O OD1  . ASN A 1 8   ? 21.646  -4.495  -18.149 1.00 0.00 ? 8   ASN A OD1  6  
ATOM 7673  N ND2  . ASN A 1 8   ? 23.066  -5.513  -16.737 1.00 0.00 ? 8   ASN A ND2  6  
ATOM 7674  H H    . ASN A 1 8   ? 20.307  -2.355  -15.396 1.00 0.00 ? 8   ASN A H    6  
ATOM 7675  H HA   . ASN A 1 8   ? 19.336  -4.353  -17.330 1.00 0.00 ? 8   ASN A HA   6  
ATOM 7676  H HB2  . ASN A 1 8   ? 21.292  -4.567  -15.047 1.00 0.00 ? 8   ASN A HB2  6  
ATOM 7677  H HB3  . ASN A 1 8   ? 20.539  -5.989  -15.760 1.00 0.00 ? 8   ASN A HB3  6  
ATOM 7678  H HD21 . ASN A 1 8   ? 23.190  -5.875  -15.835 1.00 0.00 ? 8   ASN A HD21 6  
ATOM 7679  H HD22 . ASN A 1 8   ? 23.761  -5.527  -17.428 1.00 0.00 ? 8   ASN A HD22 6  
ATOM 7680  N N    . GLU A 1 9   ? 17.721  -5.542  -15.753 1.00 0.00 ? 9   GLU A N    6  
ATOM 7681  C CA   . GLU A 1 9   ? 16.580  -5.986  -14.961 1.00 0.00 ? 9   GLU A CA   6  
ATOM 7682  C C    . GLU A 1 9   ? 17.020  -6.407  -13.562 1.00 0.00 ? 9   GLU A C    6  
ATOM 7683  O O    . GLU A 1 9   ? 18.113  -6.942  -13.377 1.00 0.00 ? 9   GLU A O    6  
ATOM 7684  C CB   . GLU A 1 9   ? 15.870  -7.150  -15.656 1.00 0.00 ? 9   GLU A CB   6  
ATOM 7685  C CG   . GLU A 1 9   ? 16.704  -8.417  -15.726 1.00 0.00 ? 9   GLU A CG   6  
ATOM 7686  C CD   . GLU A 1 9   ? 15.856  -9.673  -15.769 1.00 0.00 ? 9   GLU A CD   6  
ATOM 7687  O OE1  . GLU A 1 9   ? 14.885  -9.707  -16.554 1.00 0.00 ? 9   GLU A OE1  6  
ATOM 7688  O OE2  . GLU A 1 9   ? 16.163  -10.622 -15.018 1.00 0.00 ? 9   GLU A OE2  6  
ATOM 7689  H H    . GLU A 1 9   ? 17.953  -6.029  -16.571 1.00 0.00 ? 9   GLU A H    6  
ATOM 7690  H HA   . GLU A 1 9   ? 15.893  -5.158  -14.874 1.00 0.00 ? 9   GLU A HA   6  
ATOM 7691  H HB2  . GLU A 1 9   ? 14.959  -7.372  -15.120 1.00 0.00 ? 9   GLU A HB2  6  
ATOM 7692  H HB3  . GLU A 1 9   ? 15.620  -6.852  -16.664 1.00 0.00 ? 9   GLU A HB3  6  
ATOM 7693  H HG2  . GLU A 1 9   ? 17.314  -8.383  -16.617 1.00 0.00 ? 9   GLU A HG2  6  
ATOM 7694  H HG3  . GLU A 1 9   ? 17.343  -8.462  -14.856 1.00 0.00 ? 9   GLU A HG3  6  
ATOM 7695  N N    . VAL A 1 10  ? 16.160  -6.162  -12.578 1.00 0.00 ? 10  VAL A N    6  
ATOM 7696  C CA   . VAL A 1 10  ? 16.458  -6.516  -11.195 1.00 0.00 ? 10  VAL A CA   6  
ATOM 7697  C C    . VAL A 1 10  ? 16.715  -8.012  -11.054 1.00 0.00 ? 10  VAL A C    6  
ATOM 7698  O O    . VAL A 1 10  ? 16.025  -8.831  -11.662 1.00 0.00 ? 10  VAL A O    6  
ATOM 7699  C CB   . VAL A 1 10  ? 15.310  -6.112  -10.252 1.00 0.00 ? 10  VAL A CB   6  
ATOM 7700  C CG1  . VAL A 1 10  ? 15.091  -4.607  -10.291 1.00 0.00 ? 10  VAL A CG1  6  
ATOM 7701  C CG2  . VAL A 1 10  ? 14.034  -6.854  -10.619 1.00 0.00 ? 10  VAL A CG2  6  
ATOM 7702  H H    . VAL A 1 10  ? 15.304  -5.733  -12.787 1.00 0.00 ? 10  VAL A H    6  
ATOM 7703  H HA   . VAL A 1 10  ? 17.347  -5.978  -10.897 1.00 0.00 ? 10  VAL A HA   6  
ATOM 7704  H HB   . VAL A 1 10  ? 15.584  -6.388  -9.245  1.00 0.00 ? 10  VAL A HB   6  
ATOM 7705  H HG11 . VAL A 1 10  ? 14.255  -4.349  -9.657  1.00 0.00 ? 10  VAL A HG11 6  
ATOM 7706  H HG12 . VAL A 1 10  ? 15.980  -4.105  -9.939  1.00 0.00 ? 10  VAL A HG12 6  
ATOM 7707  H HG13 . VAL A 1 10  ? 14.881  -4.300  -11.305 1.00 0.00 ? 10  VAL A HG13 6  
ATOM 7708  H HG21 . VAL A 1 10  ? 14.157  -7.327  -11.582 1.00 0.00 ? 10  VAL A HG21 6  
ATOM 7709  H HG22 . VAL A 1 10  ? 13.827  -7.608  -9.872  1.00 0.00 ? 10  VAL A HG22 6  
ATOM 7710  H HG23 . VAL A 1 10  ? 13.211  -6.157  -10.663 1.00 0.00 ? 10  VAL A HG23 6  
ATOM 7711  N N    . ASP A 1 11  ? 17.712  -8.362  -10.249 1.00 0.00 ? 11  ASP A N    6  
ATOM 7712  C CA   . ASP A 1 11  ? 18.060  -9.760  -10.026 1.00 0.00 ? 11  ASP A CA   6  
ATOM 7713  C C    . ASP A 1 11  ? 17.626  -10.213 -8.635  1.00 0.00 ? 11  ASP A C    6  
ATOM 7714  O O    . ASP A 1 11  ? 17.225  -9.399  -7.803  1.00 0.00 ? 11  ASP A O    6  
ATOM 7715  C CB   . ASP A 1 11  ? 19.566  -9.967  -10.196 1.00 0.00 ? 11  ASP A CB   6  
ATOM 7716  C CG   . ASP A 1 11  ? 19.938  -11.430 -10.327 1.00 0.00 ? 11  ASP A CG   6  
ATOM 7717  O OD1  . ASP A 1 11  ? 19.337  -12.122 -11.175 1.00 0.00 ? 11  ASP A OD1  6  
ATOM 7718  O OD2  . ASP A 1 11  ? 20.830  -11.885 -9.580  1.00 0.00 ? 11  ASP A OD2  6  
ATOM 7719  H H    . ASP A 1 11  ? 18.226  -7.662  -9.792  1.00 0.00 ? 11  ASP A H    6  
ATOM 7720  H HA   . ASP A 1 11  ? 17.539  -10.353 -10.762 1.00 0.00 ? 11  ASP A HA   6  
ATOM 7721  H HB2  . ASP A 1 11  ? 19.895  -9.450  -11.086 1.00 0.00 ? 11  ASP A HB2  6  
ATOM 7722  H HB3  . ASP A 1 11  ? 20.078  -9.558  -9.337  1.00 0.00 ? 11  ASP A HB3  6  
ATOM 7723  N N    . ASP A 1 12  ? 17.709  -11.516 -8.390  1.00 0.00 ? 12  ASP A N    6  
ATOM 7724  C CA   . ASP A 1 12  ? 17.325  -12.078 -7.100  1.00 0.00 ? 12  ASP A CA   6  
ATOM 7725  C C    . ASP A 1 12  ? 18.483  -12.007 -6.111  1.00 0.00 ? 12  ASP A C    6  
ATOM 7726  O O    . ASP A 1 12  ? 19.283  -12.938 -6.009  1.00 0.00 ? 12  ASP A O    6  
ATOM 7727  C CB   . ASP A 1 12  ? 16.867  -13.528 -7.267  1.00 0.00 ? 12  ASP A CB   6  
ATOM 7728  C CG   . ASP A 1 12  ? 16.343  -14.122 -5.975  1.00 0.00 ? 12  ASP A CG   6  
ATOM 7729  O OD1  . ASP A 1 12  ? 17.106  -14.159 -4.987  1.00 0.00 ? 12  ASP A OD1  6  
ATOM 7730  O OD2  . ASP A 1 12  ? 15.170  -14.550 -5.951  1.00 0.00 ? 12  ASP A OD2  6  
ATOM 7731  H H    . ASP A 1 12  ? 18.036  -12.115 -9.094  1.00 0.00 ? 12  ASP A H    6  
ATOM 7732  H HA   . ASP A 1 12  ? 16.503  -11.493 -6.715  1.00 0.00 ? 12  ASP A HA   6  
ATOM 7733  H HB2  . ASP A 1 12  ? 16.079  -13.567 -8.005  1.00 0.00 ? 12  ASP A HB2  6  
ATOM 7734  H HB3  . ASP A 1 12  ? 17.701  -14.125 -7.605  1.00 0.00 ? 12  ASP A HB3  6  
ATOM 7735  N N    . MET A 1 13  ? 18.568  -10.898 -5.384  1.00 0.00 ? 13  MET A N    6  
ATOM 7736  C CA   . MET A 1 13  ? 19.629  -10.707 -4.402  1.00 0.00 ? 13  MET A CA   6  
ATOM 7737  C C    . MET A 1 13  ? 19.051  -10.308 -3.048  1.00 0.00 ? 13  MET A C    6  
ATOM 7738  O O    . MET A 1 13  ? 17.834  -10.231 -2.880  1.00 0.00 ? 13  MET A O    6  
ATOM 7739  C CB   . MET A 1 13  ? 20.613  -9.639  -4.884  1.00 0.00 ? 13  MET A CB   6  
ATOM 7740  C CG   . MET A 1 13  ? 21.761  -10.198 -5.709  1.00 0.00 ? 13  MET A CG   6  
ATOM 7741  S SD   . MET A 1 13  ? 23.166  -10.697 -4.695  1.00 0.00 ? 13  MET A SD   6  
ATOM 7742  C CE   . MET A 1 13  ? 23.252  -12.446 -5.074  1.00 0.00 ? 13  MET A CE   6  
ATOM 7743  H H    . MET A 1 13  ? 17.901  -10.191 -5.510  1.00 0.00 ? 13  MET A H    6  
ATOM 7744  H HA   . MET A 1 13  ? 20.153  -11.644 -4.295  1.00 0.00 ? 13  MET A HA   6  
ATOM 7745  H HB2  . MET A 1 13  ? 20.079  -8.922  -5.490  1.00 0.00 ? 13  MET A HB2  6  
ATOM 7746  H HB3  . MET A 1 13  ? 21.029  -9.134  -4.025  1.00 0.00 ? 13  MET A HB3  6  
ATOM 7747  H HG2  . MET A 1 13  ? 21.407  -11.059 -6.257  1.00 0.00 ? 13  MET A HG2  6  
ATOM 7748  H HG3  . MET A 1 13  ? 22.087  -9.440  -6.406  1.00 0.00 ? 13  MET A HG3  6  
ATOM 7749  H HE1  . MET A 1 13  ? 22.307  -12.774 -5.480  1.00 0.00 ? 13  MET A HE1  6  
ATOM 7750  H HE2  . MET A 1 13  ? 24.035  -12.618 -5.798  1.00 0.00 ? 13  MET A HE2  6  
ATOM 7751  H HE3  . MET A 1 13  ? 23.468  -12.999 -4.171  1.00 0.00 ? 13  MET A HE3  6  
ATOM 7752  N N    . ASP A 1 14  ? 19.931  -10.056 -2.085  1.00 0.00 ? 14  ASP A N    6  
ATOM 7753  C CA   . ASP A 1 14  ? 19.508  -9.664  -0.746  1.00 0.00 ? 14  ASP A CA   6  
ATOM 7754  C C    . ASP A 1 14  ? 18.645  -8.407  -0.794  1.00 0.00 ? 14  ASP A C    6  
ATOM 7755  O O    . ASP A 1 14  ? 19.112  -7.335  -1.181  1.00 0.00 ? 14  ASP A O    6  
ATOM 7756  C CB   . ASP A 1 14  ? 20.726  -9.428  0.148   1.00 0.00 ? 14  ASP A CB   6  
ATOM 7757  C CG   . ASP A 1 14  ? 21.496  -10.704 0.428   1.00 0.00 ? 14  ASP A CG   6  
ATOM 7758  O OD1  . ASP A 1 14  ? 20.888  -11.660 0.954   1.00 0.00 ? 14  ASP A OD1  6  
ATOM 7759  O OD2  . ASP A 1 14  ? 22.705  -10.746 0.120   1.00 0.00 ? 14  ASP A OD2  6  
ATOM 7760  H H    . ASP A 1 14  ? 20.889  -10.134 -2.281  1.00 0.00 ? 14  ASP A H    6  
ATOM 7761  H HA   . ASP A 1 14  ? 18.922  -10.472 -0.334  1.00 0.00 ? 14  ASP A HA   6  
ATOM 7762  H HB2  . ASP A 1 14  ? 21.391  -8.728  -0.338  1.00 0.00 ? 14  ASP A HB2  6  
ATOM 7763  H HB3  . ASP A 1 14  ? 20.399  -9.012  1.090   1.00 0.00 ? 14  ASP A HB3  6  
ATOM 7764  N N    . THR A 1 15  ? 17.383  -8.546  -0.401  1.00 0.00 ? 15  THR A N    6  
ATOM 7765  C CA   . THR A 1 15  ? 16.454  -7.423  -0.401  1.00 0.00 ? 15  THR A CA   6  
ATOM 7766  C C    . THR A 1 15  ? 16.287  -6.848  1.000   1.00 0.00 ? 15  THR A C    6  
ATOM 7767  O O    . THR A 1 15  ? 15.949  -7.567  1.941   1.00 0.00 ? 15  THR A O    6  
ATOM 7768  C CB   . THR A 1 15  ? 15.073  -7.837  -0.942  1.00 0.00 ? 15  THR A CB   6  
ATOM 7769  O OG1  . THR A 1 15  ? 14.461  -8.779  -0.054  1.00 0.00 ? 15  THR A OG1  6  
ATOM 7770  C CG2  . THR A 1 15  ? 15.196  -8.448  -2.330  1.00 0.00 ? 15  THR A CG2  6  
ATOM 7771  H H    . THR A 1 15  ? 17.070  -9.426  -0.104  1.00 0.00 ? 15  THR A H    6  
ATOM 7772  H HA   . THR A 1 15  ? 16.857  -6.658  -1.049  1.00 0.00 ? 15  THR A HA   6  
ATOM 7773  H HB   . THR A 1 15  ? 14.449  -6.957  -1.006  1.00 0.00 ? 15  THR A HB   6  
ATOM 7774  H HG1  . THR A 1 15  ? 14.299  -8.360  0.795   1.00 0.00 ? 15  THR A HG1  6  
ATOM 7775  H HG21 . THR A 1 15  ? 16.235  -8.467  -2.624  1.00 0.00 ? 15  THR A HG21 6  
ATOM 7776  H HG22 . THR A 1 15  ? 14.632  -7.855  -3.035  1.00 0.00 ? 15  THR A HG22 6  
ATOM 7777  H HG23 . THR A 1 15  ? 14.808  -9.455  -2.316  1.00 0.00 ? 15  THR A HG23 6  
ATOM 7778  N N    . SER A 1 16  ? 16.525  -5.547  1.133   1.00 0.00 ? 16  SER A N    6  
ATOM 7779  C CA   . SER A 1 16  ? 16.403  -4.875  2.422   1.00 0.00 ? 16  SER A CA   6  
ATOM 7780  C C    . SER A 1 16  ? 15.009  -4.280  2.595   1.00 0.00 ? 16  SER A C    6  
ATOM 7781  O O    . SER A 1 16  ? 14.194  -4.302  1.672   1.00 0.00 ? 16  SER A O    6  
ATOM 7782  C CB   . SER A 1 16  ? 17.459  -3.775  2.549   1.00 0.00 ? 16  SER A CB   6  
ATOM 7783  O OG   . SER A 1 16  ? 17.575  -3.333  3.890   1.00 0.00 ? 16  SER A OG   6  
ATOM 7784  H H    . SER A 1 16  ? 16.791  -5.027  0.346   1.00 0.00 ? 16  SER A H    6  
ATOM 7785  H HA   . SER A 1 16  ? 16.567  -5.610  3.196   1.00 0.00 ? 16  SER A HA   6  
ATOM 7786  H HB2  . SER A 1 16  ? 18.414  -4.157  2.224   1.00 0.00 ? 16  SER A HB2  6  
ATOM 7787  H HB3  . SER A 1 16  ? 17.177  -2.936  1.929   1.00 0.00 ? 16  SER A HB3  6  
ATOM 7788  H HG   . SER A 1 16  ? 17.325  -2.408  3.945   1.00 0.00 ? 16  SER A HG   6  
ATOM 7789  N N    . ASP A 1 17  ? 14.743  -3.749  3.783   1.00 0.00 ? 17  ASP A N    6  
ATOM 7790  C CA   . ASP A 1 17  ? 13.448  -3.147  4.078   1.00 0.00 ? 17  ASP A CA   6  
ATOM 7791  C C    . ASP A 1 17  ? 12.937  -2.345  2.886   1.00 0.00 ? 17  ASP A C    6  
ATOM 7792  O O    . ASP A 1 17  ? 13.381  -1.222  2.642   1.00 0.00 ? 17  ASP A O    6  
ATOM 7793  C CB   . ASP A 1 17  ? 13.550  -2.245  5.309   1.00 0.00 ? 17  ASP A CB   6  
ATOM 7794  C CG   . ASP A 1 17  ? 12.239  -2.146  6.065   1.00 0.00 ? 17  ASP A CG   6  
ATOM 7795  O OD1  . ASP A 1 17  ? 11.179  -2.381  5.448   1.00 0.00 ? 17  ASP A OD1  6  
ATOM 7796  O OD2  . ASP A 1 17  ? 12.274  -1.836  7.274   1.00 0.00 ? 17  ASP A OD2  6  
ATOM 7797  H H    . ASP A 1 17  ? 15.434  -3.762  4.478   1.00 0.00 ? 17  ASP A H    6  
ATOM 7798  H HA   . ASP A 1 17  ? 12.750  -3.944  4.285   1.00 0.00 ? 17  ASP A HA   6  
ATOM 7799  H HB2  . ASP A 1 17  ? 14.300  -2.642  5.978   1.00 0.00 ? 17  ASP A HB2  6  
ATOM 7800  H HB3  . ASP A 1 17  ? 13.841  -1.253  4.997   1.00 0.00 ? 17  ASP A HB3  6  
ATOM 7801  N N    . THR A 1 18  ? 12.001  -2.928  2.144   1.00 0.00 ? 18  THR A N    6  
ATOM 7802  C CA   . THR A 1 18  ? 11.431  -2.269  0.975   1.00 0.00 ? 18  THR A CA   6  
ATOM 7803  C C    . THR A 1 18  ? 9.965   -1.917  1.203   1.00 0.00 ? 18  THR A C    6  
ATOM 7804  O O    . THR A 1 18  ? 9.154   -2.782  1.534   1.00 0.00 ? 18  THR A O    6  
ATOM 7805  C CB   . THR A 1 18  ? 11.545  -3.154  -0.280  1.00 0.00 ? 18  THR A CB   6  
ATOM 7806  O OG1  . THR A 1 18  ? 12.920  -3.293  -0.658  1.00 0.00 ? 18  THR A OG1  6  
ATOM 7807  C CG2  . THR A 1 18  ? 10.754  -2.559  -1.436  1.00 0.00 ? 18  THR A CG2  6  
ATOM 7808  H H    . THR A 1 18  ? 11.687  -3.824  2.389   1.00 0.00 ? 18  THR A H    6  
ATOM 7809  H HA   . THR A 1 18  ? 11.987  -1.360  0.801   1.00 0.00 ? 18  THR A HA   6  
ATOM 7810  H HB   . THR A 1 18  ? 11.142  -4.131  -0.052  1.00 0.00 ? 18  THR A HB   6  
ATOM 7811  H HG1  . THR A 1 18  ? 13.343  -3.943  -0.092  1.00 0.00 ? 18  THR A HG1  6  
ATOM 7812  H HG21 . THR A 1 18  ? 11.121  -2.962  -2.368  1.00 0.00 ? 18  THR A HG21 6  
ATOM 7813  H HG22 . THR A 1 18  ? 10.870  -1.486  -1.436  1.00 0.00 ? 18  THR A HG22 6  
ATOM 7814  H HG23 . THR A 1 18  ? 9.710   -2.809  -1.323  1.00 0.00 ? 18  THR A HG23 6  
ATOM 7815  N N    . GLN A 1 19  ? 9.633   -0.643  1.023   1.00 0.00 ? 19  GLN A N    6  
ATOM 7816  C CA   . GLN A 1 19  ? 8.263   -0.178  1.209   1.00 0.00 ? 19  GLN A CA   6  
ATOM 7817  C C    . GLN A 1 19  ? 7.386   -0.582  0.029   1.00 0.00 ? 19  GLN A C    6  
ATOM 7818  O O    . GLN A 1 19  ? 7.763   -0.399  -1.129  1.00 0.00 ? 19  GLN A O    6  
ATOM 7819  C CB   . GLN A 1 19  ? 8.238   1.342   1.382   1.00 0.00 ? 19  GLN A CB   6  
ATOM 7820  C CG   . GLN A 1 19  ? 8.708   2.102   0.152   1.00 0.00 ? 19  GLN A CG   6  
ATOM 7821  C CD   . GLN A 1 19  ? 8.744   3.602   0.372   1.00 0.00 ? 19  GLN A CD   6  
ATOM 7822  O OE1  . GLN A 1 19  ? 7.765   4.199   0.820   1.00 0.00 ? 19  GLN A OE1  6  
ATOM 7823  N NE2  . GLN A 1 19  ? 9.877   4.219   0.057   1.00 0.00 ? 19  GLN A NE2  6  
ATOM 7824  H H    . GLN A 1 19  ? 10.324  -0.001  0.759   1.00 0.00 ? 19  GLN A H    6  
ATOM 7825  H HA   . GLN A 1 19  ? 7.876   -0.639  2.104   1.00 0.00 ? 19  GLN A HA   6  
ATOM 7826  H HB2  . GLN A 1 19  ? 7.227   1.650   1.604   1.00 0.00 ? 19  GLN A HB2  6  
ATOM 7827  H HB3  . GLN A 1 19  ? 8.878   1.609   2.210   1.00 0.00 ? 19  GLN A HB3  6  
ATOM 7828  H HG2  . GLN A 1 19  ? 9.703   1.768   -0.103  1.00 0.00 ? 19  GLN A HG2  6  
ATOM 7829  H HG3  . GLN A 1 19  ? 8.037   1.888   -0.666  1.00 0.00 ? 19  GLN A HG3  6  
ATOM 7830  H HE21 . GLN A 1 19  ? 10.615  3.679   -0.296  1.00 0.00 ? 19  GLN A HE21 6  
ATOM 7831  H HE22 . GLN A 1 19  ? 9.928   5.188   0.188   1.00 0.00 ? 19  GLN A HE22 6  
ATOM 7832  N N    . TRP A 1 20  ? 6.215   -1.132  0.330   1.00 0.00 ? 20  TRP A N    6  
ATOM 7833  C CA   . TRP A 1 20  ? 5.284   -1.562  -0.707  1.00 0.00 ? 20  TRP A CA   6  
ATOM 7834  C C    . TRP A 1 20  ? 4.083   -0.627  -0.783  1.00 0.00 ? 20  TRP A C    6  
ATOM 7835  O O    . TRP A 1 20  ? 3.346   -0.467  0.190   1.00 0.00 ? 20  TRP A O    6  
ATOM 7836  C CB   . TRP A 1 20  ? 4.816   -2.993  -0.438  1.00 0.00 ? 20  TRP A CB   6  
ATOM 7837  C CG   . TRP A 1 20  ? 5.916   -4.006  -0.532  1.00 0.00 ? 20  TRP A CG   6  
ATOM 7838  C CD1  . TRP A 1 20  ? 6.709   -4.452  0.487   1.00 0.00 ? 20  TRP A CD1  6  
ATOM 7839  C CD2  . TRP A 1 20  ? 6.346   -4.698  -1.709  1.00 0.00 ? 20  TRP A CD2  6  
ATOM 7840  N NE1  . TRP A 1 20  ? 7.606   -5.379  0.014   1.00 0.00 ? 20  TRP A NE1  6  
ATOM 7841  C CE2  . TRP A 1 20  ? 7.404   -5.548  -1.330  1.00 0.00 ? 20  TRP A CE2  6  
ATOM 7842  C CE3  . TRP A 1 20  ? 5.940   -4.684  -3.046  1.00 0.00 ? 20  TRP A CE3  6  
ATOM 7843  C CZ2  . TRP A 1 20  ? 8.059   -6.373  -2.241  1.00 0.00 ? 20  TRP A CZ2  6  
ATOM 7844  C CZ3  . TRP A 1 20  ? 6.591   -5.503  -3.949  1.00 0.00 ? 20  TRP A CZ3  6  
ATOM 7845  C CH2  . TRP A 1 20  ? 7.640   -6.339  -3.543  1.00 0.00 ? 20  TRP A CH2  6  
ATOM 7846  H H    . TRP A 1 20  ? 5.971   -1.251  1.271   1.00 0.00 ? 20  TRP A H    6  
ATOM 7847  H HA   . TRP A 1 20  ? 5.806   -1.536  -1.652  1.00 0.00 ? 20  TRP A HA   6  
ATOM 7848  H HB2  . TRP A 1 20  ? 4.396   -3.048  0.555   1.00 0.00 ? 20  TRP A HB2  6  
ATOM 7849  H HB3  . TRP A 1 20  ? 4.056   -3.257  -1.161  1.00 0.00 ? 20  TRP A HB3  6  
ATOM 7850  H HD1  . TRP A 1 20  ? 6.632   -4.114  1.509   1.00 0.00 ? 20  TRP A HD1  6  
ATOM 7851  H HE1  . TRP A 1 20  ? 8.280   -5.844  0.553   1.00 0.00 ? 20  TRP A HE1  6  
ATOM 7852  H HE3  . TRP A 1 20  ? 5.134   -4.047  -3.378  1.00 0.00 ? 20  TRP A HE3  6  
ATOM 7853  H HZ2  . TRP A 1 20  ? 8.868   -7.023  -1.943  1.00 0.00 ? 20  TRP A HZ2  6  
ATOM 7854  H HZ3  . TRP A 1 20  ? 6.292   -5.505  -4.987  1.00 0.00 ? 20  TRP A HZ3  6  
ATOM 7855  H HH2  . TRP A 1 20  ? 8.120   -6.961  -4.282  1.00 0.00 ? 20  TRP A HH2  6  
ATOM 7856  N N    . GLY A 1 21  ? 3.890   -0.010  -1.945  1.00 0.00 ? 21  GLY A N    6  
ATOM 7857  C CA   . GLY A 1 21  ? 2.776   0.903   -2.125  1.00 0.00 ? 21  GLY A CA   6  
ATOM 7858  C C    . GLY A 1 21  ? 1.706   0.338   -3.038  1.00 0.00 ? 21  GLY A C    6  
ATOM 7859  O O    . GLY A 1 21  ? 1.899   -0.708  -3.658  1.00 0.00 ? 21  GLY A O    6  
ATOM 7860  H H    . GLY A 1 21  ? 4.510   -0.175  -2.686  1.00 0.00 ? 21  GLY A H    6  
ATOM 7861  H HA2  . GLY A 1 21  ? 2.338   1.113   -1.161  1.00 0.00 ? 21  GLY A HA2  6  
ATOM 7862  H HA3  . GLY A 1 21  ? 3.146   1.825   -2.549  1.00 0.00 ? 21  GLY A HA3  6  
ATOM 7863  N N    . TRP A 1 22  ? 0.576   1.030   -3.121  1.00 0.00 ? 22  TRP A N    6  
ATOM 7864  C CA   . TRP A 1 22  ? -0.529  0.591   -3.965  1.00 0.00 ? 22  TRP A CA   6  
ATOM 7865  C C    . TRP A 1 22  ? -0.911  1.672   -4.969  1.00 0.00 ? 22  TRP A C    6  
ATOM 7866  O O    . TRP A 1 22  ? -0.723  2.862   -4.717  1.00 0.00 ? 22  TRP A O    6  
ATOM 7867  C CB   . TRP A 1 22  ? -1.740  0.226   -3.105  1.00 0.00 ? 22  TRP A CB   6  
ATOM 7868  C CG   . TRP A 1 22  ? -1.761  -1.214  -2.689  1.00 0.00 ? 22  TRP A CG   6  
ATOM 7869  C CD1  . TRP A 1 22  ? -0.980  -1.803  -1.736  1.00 0.00 ? 22  TRP A CD1  6  
ATOM 7870  C CD2  . TRP A 1 22  ? -2.604  -2.246  -3.213  1.00 0.00 ? 22  TRP A CD2  6  
ATOM 7871  N NE1  . TRP A 1 22  ? -1.286  -3.139  -1.637  1.00 0.00 ? 22  TRP A NE1  6  
ATOM 7872  C CE2  . TRP A 1 22  ? -2.280  -3.435  -2.532  1.00 0.00 ? 22  TRP A CE2  6  
ATOM 7873  C CE3  . TRP A 1 22  ? -3.603  -2.280  -4.190  1.00 0.00 ? 22  TRP A CE3  6  
ATOM 7874  C CZ2  . TRP A 1 22  ? -2.919  -4.643  -2.799  1.00 0.00 ? 22  TRP A CZ2  6  
ATOM 7875  C CZ3  . TRP A 1 22  ? -4.235  -3.480  -4.454  1.00 0.00 ? 22  TRP A CZ3  6  
ATOM 7876  C CH2  . TRP A 1 22  ? -3.892  -4.648  -3.761  1.00 0.00 ? 22  TRP A CH2  6  
ATOM 7877  H H    . TRP A 1 22  ? 0.482   1.857   -2.602  1.00 0.00 ? 22  TRP A H    6  
ATOM 7878  H HA   . TRP A 1 22  ? -0.205  -0.287  -4.504  1.00 0.00 ? 22  TRP A HA   6  
ATOM 7879  H HB2  . TRP A 1 22  ? -1.735  0.831   -2.210  1.00 0.00 ? 22  TRP A HB2  6  
ATOM 7880  H HB3  . TRP A 1 22  ? -2.643  0.425   -3.664  1.00 0.00 ? 22  TRP A HB3  6  
ATOM 7881  H HD1  . TRP A 1 22  ? -0.233  -1.284  -1.156  1.00 0.00 ? 22  TRP A HD1  6  
ATOM 7882  H HE1  . TRP A 1 22  ? -0.862  -3.776  -1.024  1.00 0.00 ? 22  TRP A HE1  6  
ATOM 7883  H HE3  . TRP A 1 22  ? -3.881  -1.390  -4.735  1.00 0.00 ? 22  TRP A HE3  6  
ATOM 7884  H HZ2  . TRP A 1 22  ? -2.666  -5.552  -2.273  1.00 0.00 ? 22  TRP A HZ2  6  
ATOM 7885  H HZ3  . TRP A 1 22  ? -5.009  -3.525  -5.207  1.00 0.00 ? 22  TRP A HZ3  6  
ATOM 7886  H HH2  . TRP A 1 22  ? -4.412  -5.562  -4.000  1.00 0.00 ? 22  TRP A HH2  6  
ATOM 7887  N N    . PHE A 1 23  ? -1.449  1.251   -6.109  1.00 0.00 ? 23  PHE A N    6  
ATOM 7888  C CA   . PHE A 1 23  ? -1.857  2.185   -7.153  1.00 0.00 ? 23  PHE A CA   6  
ATOM 7889  C C    . PHE A 1 23  ? -3.154  1.729   -7.814  1.00 0.00 ? 23  PHE A C    6  
ATOM 7890  O O    . PHE A 1 23  ? -3.474  0.540   -7.824  1.00 0.00 ? 23  PHE A O    6  
ATOM 7891  C CB   . PHE A 1 23  ? -0.755  2.320   -8.205  1.00 0.00 ? 23  PHE A CB   6  
ATOM 7892  C CG   . PHE A 1 23  ? 0.554   2.800   -7.645  1.00 0.00 ? 23  PHE A CG   6  
ATOM 7893  C CD1  . PHE A 1 23  ? 1.315   1.981   -6.828  1.00 0.00 ? 23  PHE A CD1  6  
ATOM 7894  C CD2  . PHE A 1 23  ? 1.022   4.071   -7.937  1.00 0.00 ? 23  PHE A CD2  6  
ATOM 7895  C CE1  . PHE A 1 23  ? 2.519   2.421   -6.310  1.00 0.00 ? 23  PHE A CE1  6  
ATOM 7896  C CE2  . PHE A 1 23  ? 2.226   4.517   -7.423  1.00 0.00 ? 23  PHE A CE2  6  
ATOM 7897  C CZ   . PHE A 1 23  ? 2.975   3.690   -6.609  1.00 0.00 ? 23  PHE A CZ   6  
ATOM 7898  H H    . PHE A 1 23  ? -1.574  0.290   -6.253  1.00 0.00 ? 23  PHE A H    6  
ATOM 7899  H HA   . PHE A 1 23  ? -2.021  3.146   -6.690  1.00 0.00 ? 23  PHE A HA   6  
ATOM 7900  H HB2  . PHE A 1 23  ? -0.585  1.357   -8.664  1.00 0.00 ? 23  PHE A HB2  6  
ATOM 7901  H HB3  . PHE A 1 23  ? -1.072  3.023   -8.960  1.00 0.00 ? 23  PHE A HB3  6  
ATOM 7902  H HD1  . PHE A 1 23  ? 0.960   0.988   -6.594  1.00 0.00 ? 23  PHE A HD1  6  
ATOM 7903  H HD2  . PHE A 1 23  ? 0.436   4.719   -8.574  1.00 0.00 ? 23  PHE A HD2  6  
ATOM 7904  H HE1  . PHE A 1 23  ? 3.103   1.772   -5.675  1.00 0.00 ? 23  PHE A HE1  6  
ATOM 7905  H HE2  . PHE A 1 23  ? 2.579   5.509   -7.659  1.00 0.00 ? 23  PHE A HE2  6  
ATOM 7906  H HZ   . PHE A 1 23  ? 3.915   4.036   -6.206  1.00 0.00 ? 23  PHE A HZ   6  
ATOM 7907  N N    . TYR A 1 24  ? -3.898  2.682   -8.364  1.00 0.00 ? 24  TYR A N    6  
ATOM 7908  C CA   . TYR A 1 24  ? -5.162  2.380   -9.025  1.00 0.00 ? 24  TYR A CA   6  
ATOM 7909  C C    . TYR A 1 24  ? -5.295  3.161   -10.329 1.00 0.00 ? 24  TYR A C    6  
ATOM 7910  O O    . TYR A 1 24  ? -5.195  4.389   -10.344 1.00 0.00 ? 24  TYR A O    6  
ATOM 7911  C CB   . TYR A 1 24  ? -6.335  2.707   -8.100  1.00 0.00 ? 24  TYR A CB   6  
ATOM 7912  C CG   . TYR A 1 24  ? -6.521  4.188   -7.857  1.00 0.00 ? 24  TYR A CG   6  
ATOM 7913  C CD1  . TYR A 1 24  ? -7.331  4.952   -8.688  1.00 0.00 ? 24  TYR A CD1  6  
ATOM 7914  C CD2  . TYR A 1 24  ? -5.888  4.822   -6.795  1.00 0.00 ? 24  TYR A CD2  6  
ATOM 7915  C CE1  . TYR A 1 24  ? -7.503  6.305   -8.470  1.00 0.00 ? 24  TYR A CE1  6  
ATOM 7916  C CE2  . TYR A 1 24  ? -6.055  6.175   -6.569  1.00 0.00 ? 24  TYR A CE2  6  
ATOM 7917  C CZ   . TYR A 1 24  ? -6.863  6.912   -7.409  1.00 0.00 ? 24  TYR A CZ   6  
ATOM 7918  O OH   . TYR A 1 24  ? -7.033  8.259   -7.188  1.00 0.00 ? 24  TYR A OH   6  
ATOM 7919  H H    . TYR A 1 24  ? -3.590  3.612   -8.323  1.00 0.00 ? 24  TYR A H    6  
ATOM 7920  H HA   . TYR A 1 24  ? -5.175  1.324   -9.248  1.00 0.00 ? 24  TYR A HA   6  
ATOM 7921  H HB2  . TYR A 1 24  ? -7.246  2.326   -8.537  1.00 0.00 ? 24  TYR A HB2  6  
ATOM 7922  H HB3  . TYR A 1 24  ? -6.174  2.231   -7.144  1.00 0.00 ? 24  TYR A HB3  6  
ATOM 7923  H HD1  . TYR A 1 24  ? -7.831  4.473   -9.518  1.00 0.00 ? 24  TYR A HD1  6  
ATOM 7924  H HD2  . TYR A 1 24  ? -5.256  4.242   -6.139  1.00 0.00 ? 24  TYR A HD2  6  
ATOM 7925  H HE1  . TYR A 1 24  ? -8.136  6.882   -9.128  1.00 0.00 ? 24  TYR A HE1  6  
ATOM 7926  H HE2  . TYR A 1 24  ? -5.555  6.650   -5.738  1.00 0.00 ? 24  TYR A HE2  6  
ATOM 7927  H HH   . TYR A 1 24  ? -6.229  8.726   -7.427  1.00 0.00 ? 24  TYR A HH   6  
ATOM 7928  N N    . LEU A 1 25  ? -5.521  2.440   -11.421 1.00 0.00 ? 25  LEU A N    6  
ATOM 7929  C CA   . LEU A 1 25  ? -5.669  3.063   -12.732 1.00 0.00 ? 25  LEU A CA   6  
ATOM 7930  C C    . LEU A 1 25  ? -6.677  4.207   -12.680 1.00 0.00 ? 25  LEU A C    6  
ATOM 7931  O O    . LEU A 1 25  ? -7.569  4.224   -11.832 1.00 0.00 ? 25  LEU A O    6  
ATOM 7932  C CB   . LEU A 1 25  ? -6.111  2.026   -13.765 1.00 0.00 ? 25  LEU A CB   6  
ATOM 7933  C CG   . LEU A 1 25  ? -6.506  2.571   -15.138 1.00 0.00 ? 25  LEU A CG   6  
ATOM 7934  C CD1  . LEU A 1 25  ? -5.285  3.107   -15.870 1.00 0.00 ? 25  LEU A CD1  6  
ATOM 7935  C CD2  . LEU A 1 25  ? -7.193  1.493   -15.963 1.00 0.00 ? 25  LEU A CD2  6  
ATOM 7936  H H    . LEU A 1 25  ? -5.591  1.466   -11.346 1.00 0.00 ? 25  LEU A H    6  
ATOM 7937  H HA   . LEU A 1 25  ? -4.707  3.460   -13.021 1.00 0.00 ? 25  LEU A HA   6  
ATOM 7938  H HB2  . LEU A 1 25  ? -5.297  1.332   -13.906 1.00 0.00 ? 25  LEU A HB2  6  
ATOM 7939  H HB3  . LEU A 1 25  ? -6.964  1.499   -13.360 1.00 0.00 ? 25  LEU A HB3  6  
ATOM 7940  H HG   . LEU A 1 25  ? -7.201  3.388   -15.008 1.00 0.00 ? 25  LEU A HG   6  
ATOM 7941  H HD11 . LEU A 1 25  ? -4.674  3.674   -15.184 1.00 0.00 ? 25  LEU A HD11 6  
ATOM 7942  H HD12 . LEU A 1 25  ? -5.603  3.745   -16.681 1.00 0.00 ? 25  LEU A HD12 6  
ATOM 7943  H HD13 . LEU A 1 25  ? -4.712  2.281   -16.266 1.00 0.00 ? 25  LEU A HD13 6  
ATOM 7944  H HD21 . LEU A 1 25  ? -8.197  1.811   -16.205 1.00 0.00 ? 25  LEU A HD21 6  
ATOM 7945  H HD22 . LEU A 1 25  ? -7.234  0.575   -15.394 1.00 0.00 ? 25  LEU A HD22 6  
ATOM 7946  H HD23 . LEU A 1 25  ? -6.638  1.327   -16.874 1.00 0.00 ? 25  LEU A HD23 6  
ATOM 7947  N N    . ALA A 1 26  ? -6.530  5.161   -13.595 1.00 0.00 ? 26  ALA A N    6  
ATOM 7948  C CA   . ALA A 1 26  ? -7.430  6.306   -13.656 1.00 0.00 ? 26  ALA A CA   6  
ATOM 7949  C C    . ALA A 1 26  ? -8.170  6.352   -14.988 1.00 0.00 ? 26  ALA A C    6  
ATOM 7950  O O    . ALA A 1 26  ? -7.629  5.961   -16.022 1.00 0.00 ? 26  ALA A O    6  
ATOM 7951  C CB   . ALA A 1 26  ? -6.656  7.597   -13.434 1.00 0.00 ? 26  ALA A CB   6  
ATOM 7952  H H    . ALA A 1 26  ? -5.800  5.091   -14.244 1.00 0.00 ? 26  ALA A H    6  
ATOM 7953  H HA   . ALA A 1 26  ? -8.151  6.206   -12.858 1.00 0.00 ? 26  ALA A HA   6  
ATOM 7954  H HB1  . ALA A 1 26  ? -7.328  8.360   -13.070 1.00 0.00 ? 26  ALA A HB1  6  
ATOM 7955  H HB2  . ALA A 1 26  ? -5.875  7.429   -12.709 1.00 0.00 ? 26  ALA A HB2  6  
ATOM 7956  H HB3  . ALA A 1 26  ? -6.218  7.918   -14.368 1.00 0.00 ? 26  ALA A HB3  6  
ATOM 7957  N N    . GLU A 1 27  ? -9.409  6.832   -14.956 1.00 0.00 ? 27  GLU A N    6  
ATOM 7958  C CA   . GLU A 1 27  ? -10.223 6.927   -16.162 1.00 0.00 ? 27  GLU A CA   6  
ATOM 7959  C C    . GLU A 1 27  ? -9.456  7.625   -17.282 1.00 0.00 ? 27  GLU A C    6  
ATOM 7960  O O    . GLU A 1 27  ? -9.614  7.292   -18.457 1.00 0.00 ? 27  GLU A O    6  
ATOM 7961  C CB   . GLU A 1 27  ? -11.521 7.683   -15.870 1.00 0.00 ? 27  GLU A CB   6  
ATOM 7962  C CG   . GLU A 1 27  ? -12.424 6.978   -14.873 1.00 0.00 ? 27  GLU A CG   6  
ATOM 7963  C CD   . GLU A 1 27  ? -12.797 5.576   -15.314 1.00 0.00 ? 27  GLU A CD   6  
ATOM 7964  O OE1  . GLU A 1 27  ? -13.323 5.428   -16.437 1.00 0.00 ? 27  GLU A OE1  6  
ATOM 7965  O OE2  . GLU A 1 27  ? -12.564 4.627   -14.536 1.00 0.00 ? 27  GLU A OE2  6  
ATOM 7966  H H    . GLU A 1 27  ? -9.785  7.128   -14.101 1.00 0.00 ? 27  GLU A H    6  
ATOM 7967  H HA   . GLU A 1 27  ? -10.465 5.924   -16.478 1.00 0.00 ? 27  GLU A HA   6  
ATOM 7968  H HB2  . GLU A 1 27  ? -11.274 8.658   -15.475 1.00 0.00 ? 27  GLU A HB2  6  
ATOM 7969  H HB3  . GLU A 1 27  ? -12.066 7.806   -16.794 1.00 0.00 ? 27  GLU A HB3  6  
ATOM 7970  H HG2  . GLU A 1 27  ? -11.913 6.916   -13.924 1.00 0.00 ? 27  GLU A HG2  6  
ATOM 7971  H HG3  . GLU A 1 27  ? -13.330 7.555   -14.756 1.00 0.00 ? 27  GLU A HG3  6  
ATOM 7972  N N    . CYS A 1 28  ? -8.626  8.592   -16.909 1.00 0.00 ? 28  CYS A N    6  
ATOM 7973  C CA   . CYS A 1 28  ? -7.835  9.338   -17.881 1.00 0.00 ? 28  CYS A CA   6  
ATOM 7974  C C    . CYS A 1 28  ? -6.788  8.441   -18.534 1.00 0.00 ? 28  CYS A C    6  
ATOM 7975  O O    . CYS A 1 28  ? -6.359  8.689   -19.660 1.00 0.00 ? 28  CYS A O    6  
ATOM 7976  C CB   . CYS A 1 28  ? -7.154  10.531  -17.208 1.00 0.00 ? 28  CYS A CB   6  
ATOM 7977  S SG   . CYS A 1 28  ? -8.303  11.735  -16.502 1.00 0.00 ? 28  CYS A SG   6  
ATOM 7978  H H    . CYS A 1 28  ? -8.543  8.811   -15.957 1.00 0.00 ? 28  CYS A H    6  
ATOM 7979  H HA   . CYS A 1 28  ? -8.506  9.701   -18.644 1.00 0.00 ? 28  CYS A HA   6  
ATOM 7980  H HB2  . CYS A 1 28  ? -6.523  10.172  -16.409 1.00 0.00 ? 28  CYS A HB2  6  
ATOM 7981  H HB3  . CYS A 1 28  ? -6.544  11.045  -17.936 1.00 0.00 ? 28  CYS A HB3  6  
ATOM 7982  H HG   . CYS A 1 28  ? -8.789  12.467  -17.493 1.00 0.00 ? 28  CYS A HG   6  
ATOM 7983  N N    . GLY A 1 29  ? -6.380  7.398   -17.817 1.00 0.00 ? 29  GLY A N    6  
ATOM 7984  C CA   . GLY A 1 29  ? -5.386  6.481   -18.342 1.00 0.00 ? 29  GLY A CA   6  
ATOM 7985  C C    . GLY A 1 29  ? -4.200  6.318   -17.412 1.00 0.00 ? 29  GLY A C    6  
ATOM 7986  O O    . GLY A 1 29  ? -3.691  5.212   -17.230 1.00 0.00 ? 29  GLY A O    6  
ATOM 7987  H H    . GLY A 1 29  ? -6.758  7.251   -16.924 1.00 0.00 ? 29  GLY A H    6  
ATOM 7988  H HA2  . GLY A 1 29  ? -5.846  5.517   -18.494 1.00 0.00 ? 29  GLY A HA2  6  
ATOM 7989  H HA3  . GLY A 1 29  ? -5.034  6.855   -19.292 1.00 0.00 ? 29  GLY A HA3  6  
ATOM 7990  N N    . LYS A 1 30  ? -3.756  7.423   -16.821 1.00 0.00 ? 30  LYS A N    6  
ATOM 7991  C CA   . LYS A 1 30  ? -2.623  7.399   -15.905 1.00 0.00 ? 30  LYS A CA   6  
ATOM 7992  C C    . LYS A 1 30  ? -3.046  6.898   -14.528 1.00 0.00 ? 30  LYS A C    6  
ATOM 7993  O O    . LYS A 1 30  ? -4.063  7.331   -13.986 1.00 0.00 ? 30  LYS A O    6  
ATOM 7994  C CB   . LYS A 1 30  ? -2.008  8.795   -15.785 1.00 0.00 ? 30  LYS A CB   6  
ATOM 7995  C CG   . LYS A 1 30  ? -0.978  9.100   -16.859 1.00 0.00 ? 30  LYS A CG   6  
ATOM 7996  C CD   . LYS A 1 30  ? 0.420   8.697   -16.422 1.00 0.00 ? 30  LYS A CD   6  
ATOM 7997  C CE   . LYS A 1 30  ? 0.694   7.230   -16.716 1.00 0.00 ? 30  LYS A CE   6  
ATOM 7998  N NZ   . LYS A 1 30  ? 2.137   6.978   -16.986 1.00 0.00 ? 30  LYS A NZ   6  
ATOM 7999  H H    . LYS A 1 30  ? -4.204  8.276   -17.006 1.00 0.00 ? 30  LYS A H    6  
ATOM 8000  H HA   . LYS A 1 30  ? -1.884  6.723   -16.308 1.00 0.00 ? 30  LYS A HA   6  
ATOM 8001  H HB2  . LYS A 1 30  ? -2.797  9.530   -15.853 1.00 0.00 ? 30  LYS A HB2  6  
ATOM 8002  H HB3  . LYS A 1 30  ? -1.528  8.882   -14.821 1.00 0.00 ? 30  LYS A HB3  6  
ATOM 8003  H HG2  . LYS A 1 30  ? -1.234  8.556   -17.756 1.00 0.00 ? 30  LYS A HG2  6  
ATOM 8004  H HG3  . LYS A 1 30  ? -0.989  10.161  -17.064 1.00 0.00 ? 30  LYS A HG3  6  
ATOM 8005  H HD2  . LYS A 1 30  ? 1.142   9.299   -16.952 1.00 0.00 ? 30  LYS A HD2  6  
ATOM 8006  H HD3  . LYS A 1 30  ? 0.519   8.866   -15.359 1.00 0.00 ? 30  LYS A HD3  6  
ATOM 8007  H HE2  . LYS A 1 30  ? 0.389   6.642   -15.864 1.00 0.00 ? 30  LYS A HE2  6  
ATOM 8008  H HE3  . LYS A 1 30  ? 0.119   6.936   -17.581 1.00 0.00 ? 30  LYS A HE3  6  
ATOM 8009  H HZ1  . LYS A 1 30  ? 2.366   7.229   -17.969 1.00 0.00 ? 30  LYS A HZ1  6  
ATOM 8010  H HZ2  . LYS A 1 30  ? 2.359   5.974   -16.836 1.00 0.00 ? 30  LYS A HZ2  6  
ATOM 8011  H HZ3  . LYS A 1 30  ? 2.725   7.551   -16.347 1.00 0.00 ? 30  LYS A HZ3  6  
ATOM 8012  N N    . TRP A 1 31  ? -2.260  5.987   -13.967 1.00 0.00 ? 31  TRP A N    6  
ATOM 8013  C CA   . TRP A 1 31  ? -2.554  5.429   -12.651 1.00 0.00 ? 31  TRP A CA   6  
ATOM 8014  C C    . TRP A 1 31  ? -2.242  6.437   -11.551 1.00 0.00 ? 31  TRP A C    6  
ATOM 8015  O O    . TRP A 1 31  ? -1.337  7.262   -11.689 1.00 0.00 ? 31  TRP A O    6  
ATOM 8016  C CB   . TRP A 1 31  ? -1.752  4.146   -12.428 1.00 0.00 ? 31  TRP A CB   6  
ATOM 8017  C CG   . TRP A 1 31  ? -2.072  3.066   -13.416 1.00 0.00 ? 31  TRP A CG   6  
ATOM 8018  C CD1  . TRP A 1 31  ? -1.928  3.128   -14.773 1.00 0.00 ? 31  TRP A CD1  6  
ATOM 8019  C CD2  . TRP A 1 31  ? -2.591  1.764   -13.125 1.00 0.00 ? 31  TRP A CD2  6  
ATOM 8020  N NE1  . TRP A 1 31  ? -2.326  1.943   -15.342 1.00 0.00 ? 31  TRP A NE1  6  
ATOM 8021  C CE2  . TRP A 1 31  ? -2.737  1.089   -14.353 1.00 0.00 ? 31  TRP A CE2  6  
ATOM 8022  C CE3  . TRP A 1 31  ? -2.946  1.102   -11.946 1.00 0.00 ? 31  TRP A CE3  6  
ATOM 8023  C CZ2  . TRP A 1 31  ? -3.222  -0.213  -14.433 1.00 0.00 ? 31  TRP A CZ2  6  
ATOM 8024  C CZ3  . TRP A 1 31  ? -3.428  -0.191  -12.028 1.00 0.00 ? 31  TRP A CZ3  6  
ATOM 8025  C CH2  . TRP A 1 31  ? -3.562  -0.837  -13.263 1.00 0.00 ? 31  TRP A CH2  6  
ATOM 8026  H H    . TRP A 1 31  ? -1.463  5.681   -14.448 1.00 0.00 ? 31  TRP A H    6  
ATOM 8027  H HA   . TRP A 1 31  ? -3.608  5.194   -12.620 1.00 0.00 ? 31  TRP A HA   6  
ATOM 8028  H HB2  . TRP A 1 31  ? -0.699  4.369   -12.507 1.00 0.00 ? 31  TRP A HB2  6  
ATOM 8029  H HB3  . TRP A 1 31  ? -1.963  3.767   -11.438 1.00 0.00 ? 31  TRP A HB3  6  
ATOM 8030  H HD1  . TRP A 1 31  ? -1.556  3.989   -15.306 1.00 0.00 ? 31  TRP A HD1  6  
ATOM 8031  H HE1  . TRP A 1 31  ? -2.316  1.741   -16.302 1.00 0.00 ? 31  TRP A HE1  6  
ATOM 8032  H HE3  . TRP A 1 31  ? -2.849  1.584   -10.985 1.00 0.00 ? 31  TRP A HE3  6  
ATOM 8033  H HZ2  . TRP A 1 31  ? -3.331  -0.726  -15.378 1.00 0.00 ? 31  TRP A HZ2  6  
ATOM 8034  H HZ3  . TRP A 1 31  ? -3.707  -0.718  -11.127 1.00 0.00 ? 31  TRP A HZ3  6  
ATOM 8035  H HH2  . TRP A 1 31  ? -3.943  -1.847  -13.279 1.00 0.00 ? 31  TRP A HH2  6  
ATOM 8036  N N    . HIS A 1 32  ? -2.995  6.366   -10.458 1.00 0.00 ? 32  HIS A N    6  
ATOM 8037  C CA   . HIS A 1 32  ? -2.797  7.273   -9.332  1.00 0.00 ? 32  HIS A CA   6  
ATOM 8038  C C    . HIS A 1 32  ? -2.658  6.496   -8.027  1.00 0.00 ? 32  HIS A C    6  
ATOM 8039  O O    . HIS A 1 32  ? -3.503  5.666   -7.694  1.00 0.00 ? 32  HIS A O    6  
ATOM 8040  C CB   . HIS A 1 32  ? -3.963  8.257   -9.232  1.00 0.00 ? 32  HIS A CB   6  
ATOM 8041  C CG   . HIS A 1 32  ? -4.141  9.101   -10.457 1.00 0.00 ? 32  HIS A CG   6  
ATOM 8042  N ND1  . HIS A 1 32  ? -3.117  9.831   -11.024 1.00 0.00 ? 32  HIS A ND1  6  
ATOM 8043  C CD2  . HIS A 1 32  ? -5.232  9.327   -11.224 1.00 0.00 ? 32  HIS A CD2  6  
ATOM 8044  C CE1  . HIS A 1 32  ? -3.572  10.471  -12.086 1.00 0.00 ? 32  HIS A CE1  6  
ATOM 8045  N NE2  . HIS A 1 32  ? -4.853  10.182  -12.230 1.00 0.00 ? 32  HIS A NE2  6  
ATOM 8046  H H    . HIS A 1 32  ? -3.700  5.687   -10.407 1.00 0.00 ? 32  HIS A H    6  
ATOM 8047  H HA   . HIS A 1 32  ? -1.886  7.824   -9.507  1.00 0.00 ? 32  HIS A HA   6  
ATOM 8048  H HB2  . HIS A 1 32  ? -4.878  7.706   -9.073  1.00 0.00 ? 32  HIS A HB2  6  
ATOM 8049  H HB3  . HIS A 1 32  ? -3.796  8.918   -8.394  1.00 0.00 ? 32  HIS A HB3  6  
ATOM 8050  H HD1  . HIS A 1 32  ? -2.196  9.874   -10.695 1.00 0.00 ? 32  HIS A HD1  6  
ATOM 8051  H HD2  . HIS A 1 32  ? -6.220  8.913   -11.074 1.00 0.00 ? 32  HIS A HD2  6  
ATOM 8052  H HE1  . HIS A 1 32  ? -2.995  11.119  -12.728 1.00 0.00 ? 32  HIS A HE1  6  
ATOM 8053  N N    . MET A 1 33  ? -1.586  6.771   -7.291  1.00 0.00 ? 33  MET A N    6  
ATOM 8054  C CA   . MET A 1 33  ? -1.337  6.097   -6.022  1.00 0.00 ? 33  MET A CA   6  
ATOM 8055  C C    . MET A 1 33  ? -2.448  6.397   -5.021  1.00 0.00 ? 33  MET A C    6  
ATOM 8056  O O    . MET A 1 33  ? -2.973  7.510   -4.975  1.00 0.00 ? 33  MET A O    6  
ATOM 8057  C CB   . MET A 1 33  ? 0.014   6.530   -5.447  1.00 0.00 ? 33  MET A CB   6  
ATOM 8058  C CG   . MET A 1 33  ? 0.649   5.489   -4.540  1.00 0.00 ? 33  MET A CG   6  
ATOM 8059  S SD   . MET A 1 33  ? 2.234   6.026   -3.869  1.00 0.00 ? 33  MET A SD   6  
ATOM 8060  C CE   . MET A 1 33  ? 1.761   6.478   -2.202  1.00 0.00 ? 33  MET A CE   6  
ATOM 8061  H H    . MET A 1 33  ? -0.946  7.443   -7.609  1.00 0.00 ? 33  MET A H    6  
ATOM 8062  H HA   . MET A 1 33  ? -1.314  5.035   -6.210  1.00 0.00 ? 33  MET A HA   6  
ATOM 8063  H HB2  . MET A 1 33  ? 0.692   6.727   -6.263  1.00 0.00 ? 33  MET A HB2  6  
ATOM 8064  H HB3  . MET A 1 33  ? -0.124  7.436   -4.877  1.00 0.00 ? 33  MET A HB3  6  
ATOM 8065  H HG2  . MET A 1 33  ? -0.023  5.288   -3.718  1.00 0.00 ? 33  MET A HG2  6  
ATOM 8066  H HG3  . MET A 1 33  ? 0.802   4.583   -5.107  1.00 0.00 ? 33  MET A HG3  6  
ATOM 8067  H HE1  . MET A 1 33  ? 2.001   5.669   -1.528  1.00 0.00 ? 33  MET A HE1  6  
ATOM 8068  H HE2  . MET A 1 33  ? 2.298   7.366   -1.904  1.00 0.00 ? 33  MET A HE2  6  
ATOM 8069  H HE3  . MET A 1 33  ? 0.698   6.670   -2.169  1.00 0.00 ? 33  MET A HE3  6  
ATOM 8070  N N    . PHE A 1 34  ? -2.803  5.397   -4.221  1.00 0.00 ? 34  PHE A N    6  
ATOM 8071  C CA   . PHE A 1 34  ? -3.853  5.553   -3.221  1.00 0.00 ? 34  PHE A CA   6  
ATOM 8072  C C    . PHE A 1 34  ? -3.546  6.721   -2.288  1.00 0.00 ? 34  PHE A C    6  
ATOM 8073  O O    . PHE A 1 34  ? -2.425  7.228   -2.260  1.00 0.00 ? 34  PHE A O    6  
ATOM 8074  C CB   . PHE A 1 34  ? -4.010  4.266   -2.410  1.00 0.00 ? 34  PHE A CB   6  
ATOM 8075  C CG   . PHE A 1 34  ? -4.744  3.180   -3.143  1.00 0.00 ? 34  PHE A CG   6  
ATOM 8076  C CD1  . PHE A 1 34  ? -4.059  2.280   -3.943  1.00 0.00 ? 34  PHE A CD1  6  
ATOM 8077  C CD2  . PHE A 1 34  ? -6.120  3.061   -3.033  1.00 0.00 ? 34  PHE A CD2  6  
ATOM 8078  C CE1  . PHE A 1 34  ? -4.732  1.280   -4.620  1.00 0.00 ? 34  PHE A CE1  6  
ATOM 8079  C CE2  . PHE A 1 34  ? -6.799  2.062   -3.707  1.00 0.00 ? 34  PHE A CE2  6  
ATOM 8080  C CZ   . PHE A 1 34  ? -6.104  1.172   -4.502  1.00 0.00 ? 34  PHE A CZ   6  
ATOM 8081  H H    . PHE A 1 34  ? -2.347  4.533   -4.305  1.00 0.00 ? 34  PHE A H    6  
ATOM 8082  H HA   . PHE A 1 34  ? -4.776  5.756   -3.741  1.00 0.00 ? 34  PHE A HA   6  
ATOM 8083  H HB2  . PHE A 1 34  ? -3.031  3.888   -2.154  1.00 0.00 ? 34  PHE A HB2  6  
ATOM 8084  H HB3  . PHE A 1 34  ? -4.555  4.484   -1.504  1.00 0.00 ? 34  PHE A HB3  6  
ATOM 8085  H HD1  . PHE A 1 34  ? -2.985  2.364   -4.036  1.00 0.00 ? 34  PHE A HD1  6  
ATOM 8086  H HD2  . PHE A 1 34  ? -6.665  3.757   -2.413  1.00 0.00 ? 34  PHE A HD2  6  
ATOM 8087  H HE1  . PHE A 1 34  ? -4.185  0.586   -5.240  1.00 0.00 ? 34  PHE A HE1  6  
ATOM 8088  H HE2  . PHE A 1 34  ? -7.871  1.980   -3.614  1.00 0.00 ? 34  PHE A HE2  6  
ATOM 8089  H HZ   . PHE A 1 34  ? -6.631  0.391   -5.029  1.00 0.00 ? 34  PHE A HZ   6  
ATOM 8090  N N    . GLN A 1 35  ? -4.552  7.143   -1.528  1.00 0.00 ? 35  GLN A N    6  
ATOM 8091  C CA   . GLN A 1 35  ? -4.390  8.252   -0.596  1.00 0.00 ? 35  GLN A CA   6  
ATOM 8092  C C    . GLN A 1 35  ? -5.624  8.405   0.287   1.00 0.00 ? 35  GLN A C    6  
ATOM 8093  O O    . GLN A 1 35  ? -6.755  8.168   -0.138  1.00 0.00 ? 35  GLN A O    6  
ATOM 8094  C CB   . GLN A 1 35  ? -4.129  9.553   -1.357  1.00 0.00 ? 35  GLN A CB   6  
ATOM 8095  C CG   . GLN A 1 35  ? -5.166  9.849   -2.429  1.00 0.00 ? 35  GLN A CG   6  
ATOM 8096  C CD   . GLN A 1 35  ? -4.599  10.651  -3.584  1.00 0.00 ? 35  GLN A CD   6  
ATOM 8097  O OE1  . GLN A 1 35  ? -5.173  11.659  -3.995  1.00 0.00 ? 35  GLN A OE1  6  
ATOM 8098  N NE2  . GLN A 1 35  ? -3.465  10.206  -4.114  1.00 0.00 ? 35  GLN A NE2  6  
ATOM 8099  H H    . GLN A 1 35  ? -5.422  6.699   -1.597  1.00 0.00 ? 35  GLN A H    6  
ATOM 8100  H HA   . GLN A 1 35  ? -3.539  8.036   0.032   1.00 0.00 ? 35  GLN A HA   6  
ATOM 8101  H HB2  . GLN A 1 35  ? -4.125  10.373  -0.655  1.00 0.00 ? 35  GLN A HB2  6  
ATOM 8102  H HB3  . GLN A 1 35  ? -3.161  9.491   -1.831  1.00 0.00 ? 35  GLN A HB3  6  
ATOM 8103  H HG2  . GLN A 1 35  ? -5.545  8.913   -2.813  1.00 0.00 ? 35  GLN A HG2  6  
ATOM 8104  H HG3  . GLN A 1 35  ? -5.975  10.408  -1.984  1.00 0.00 ? 35  GLN A HG3  6  
ATOM 8105  H HE21 . GLN A 1 35  ? -3.065  9.395   -3.735  1.00 0.00 ? 35  GLN A HE21 6  
ATOM 8106  H HE22 . GLN A 1 35  ? -3.077  10.704  -4.862  1.00 0.00 ? 35  GLN A HE22 6  
ATOM 8107  N N    . PRO A 1 36  ? -5.405  8.811   1.547   1.00 0.00 ? 36  PRO A N    6  
ATOM 8108  C CA   . PRO A 1 36  ? -6.487  9.005   2.516   1.00 0.00 ? 36  PRO A CA   6  
ATOM 8109  C C    . PRO A 1 36  ? -7.361  10.207  2.177   1.00 0.00 ? 36  PRO A C    6  
ATOM 8110  O O    . PRO A 1 36  ? -6.865  11.238  1.722   1.00 0.00 ? 36  PRO A O    6  
ATOM 8111  C CB   . PRO A 1 36  ? -5.745  9.237   3.835   1.00 0.00 ? 36  PRO A CB   6  
ATOM 8112  C CG   . PRO A 1 36  ? -4.415  9.772   3.431   1.00 0.00 ? 36  PRO A CG   6  
ATOM 8113  C CD   . PRO A 1 36  ? -4.083  9.112   2.122   1.00 0.00 ? 36  PRO A CD   6  
ATOM 8114  H HA   . PRO A 1 36  ? -7.107  8.124   2.600   1.00 0.00 ? 36  PRO A HA   6  
ATOM 8115  H HB2  . PRO A 1 36  ? -6.292  9.949   4.438   1.00 0.00 ? 36  PRO A HB2  6  
ATOM 8116  H HB3  . PRO A 1 36  ? -5.650  8.303   4.368   1.00 0.00 ? 36  PRO A HB3  6  
ATOM 8117  H HG2  . PRO A 1 36  ? -4.471  10.843  3.308   1.00 0.00 ? 36  PRO A HG2  6  
ATOM 8118  H HG3  . PRO A 1 36  ? -3.676  9.517   4.177   1.00 0.00 ? 36  PRO A HG3  6  
ATOM 8119  H HD2  . PRO A 1 36  ? -3.532  9.790   1.486   1.00 0.00 ? 36  PRO A HD2  6  
ATOM 8120  H HD3  . PRO A 1 36  ? -3.520  8.206   2.288   1.00 0.00 ? 36  PRO A HD3  6  
ATOM 8121  N N    . ASP A 1 37  ? -8.663  10.069  2.402   1.00 0.00 ? 37  ASP A N    6  
ATOM 8122  C CA   . ASP A 1 37  ? -9.606  11.146  2.122   1.00 0.00 ? 37  ASP A CA   6  
ATOM 8123  C C    . ASP A 1 37  ? -9.695  12.111  3.300   1.00 0.00 ? 37  ASP A C    6  
ATOM 8124  O O    . ASP A 1 37  ? -8.972  11.971  4.288   1.00 0.00 ? 37  ASP A O    6  
ATOM 8125  C CB   . ASP A 1 37  ? -10.989 10.573  1.810   1.00 0.00 ? 37  ASP A CB   6  
ATOM 8126  C CG   . ASP A 1 37  ? -11.780 11.453  0.862   1.00 0.00 ? 37  ASP A CG   6  
ATOM 8127  O OD1  . ASP A 1 37  ? -11.464 11.458  -0.346  1.00 0.00 ? 37  ASP A OD1  6  
ATOM 8128  O OD2  . ASP A 1 37  ? -12.715 12.136  1.328   1.00 0.00 ? 37  ASP A OD2  6  
ATOM 8129  H H    . ASP A 1 37  ? -8.998  9.223   2.767   1.00 0.00 ? 37  ASP A H    6  
ATOM 8130  H HA   . ASP A 1 37  ? -9.246  11.685  1.258   1.00 0.00 ? 37  ASP A HA   6  
ATOM 8131  H HB2  . ASP A 1 37  ? -10.874 9.599   1.356   1.00 0.00 ? 37  ASP A HB2  6  
ATOM 8132  H HB3  . ASP A 1 37  ? -11.546 10.473  2.730   1.00 0.00 ? 37  ASP A HB3  6  
ATOM 8133  N N    . THR A 1 38  ? -10.586 13.092  3.189   1.00 0.00 ? 38  THR A N    6  
ATOM 8134  C CA   . THR A 1 38  ? -10.768 14.081  4.244   1.00 0.00 ? 38  THR A CA   6  
ATOM 8135  C C    . THR A 1 38  ? -10.615 13.450  5.623   1.00 0.00 ? 38  THR A C    6  
ATOM 8136  O O    . THR A 1 38  ? -10.832 12.251  5.794   1.00 0.00 ? 38  THR A O    6  
ATOM 8137  C CB   . THR A 1 38  ? -12.151 14.753  4.150   1.00 0.00 ? 38  THR A CB   6  
ATOM 8138  O OG1  . THR A 1 38  ? -12.405 15.164  2.802   1.00 0.00 ? 38  THR A OG1  6  
ATOM 8139  C CG2  . THR A 1 38  ? -12.231 15.958  5.076   1.00 0.00 ? 38  THR A CG2  6  
ATOM 8140  H H    . THR A 1 38  ? -11.132 13.150  2.378   1.00 0.00 ? 38  THR A H    6  
ATOM 8141  H HA   . THR A 1 38  ? -10.011 14.843  4.121   1.00 0.00 ? 38  THR A HA   6  
ATOM 8142  H HB   . THR A 1 38  ? -12.903 14.038  4.449   1.00 0.00 ? 38  THR A HB   6  
ATOM 8143  H HG1  . THR A 1 38  ? -13.233 15.649  2.766   1.00 0.00 ? 38  THR A HG1  6  
ATOM 8144  H HG21 . THR A 1 38  ? -11.239 16.354  5.238   1.00 0.00 ? 38  THR A HG21 6  
ATOM 8145  H HG22 . THR A 1 38  ? -12.657 15.657  6.022   1.00 0.00 ? 38  THR A HG22 6  
ATOM 8146  H HG23 . THR A 1 38  ? -12.852 16.717  4.626   1.00 0.00 ? 38  THR A HG23 6  
ATOM 8147  N N    . ASN A 1 39  ? -10.240 14.265  6.603   1.00 0.00 ? 39  ASN A N    6  
ATOM 8148  C CA   . ASN A 1 39  ? -10.058 13.785  7.969   1.00 0.00 ? 39  ASN A CA   6  
ATOM 8149  C C    . ASN A 1 39  ? -11.280 12.999  8.436   1.00 0.00 ? 39  ASN A C    6  
ATOM 8150  O O    . ASN A 1 39  ? -11.152 11.931  9.034   1.00 0.00 ? 39  ASN A O    6  
ATOM 8151  C CB   . ASN A 1 39  ? -9.801  14.960  8.914   1.00 0.00 ? 39  ASN A CB   6  
ATOM 8152  C CG   . ASN A 1 39  ? -8.332  15.329  8.992   1.00 0.00 ? 39  ASN A CG   6  
ATOM 8153  O OD1  . ASN A 1 39  ? -7.530  14.907  8.158   1.00 0.00 ? 39  ASN A OD1  6  
ATOM 8154  N ND2  . ASN A 1 39  ? -7.973  16.120  9.996   1.00 0.00 ? 39  ASN A ND2  6  
ATOM 8155  H H    . ASN A 1 39  ? -10.082 15.211  6.405   1.00 0.00 ? 39  ASN A H    6  
ATOM 8156  H HA   . ASN A 1 39  ? -9.199  13.131  7.978   1.00 0.00 ? 39  ASN A HA   6  
ATOM 8157  H HB2  . ASN A 1 39  ? -10.350 15.822  8.565   1.00 0.00 ? 39  ASN A HB2  6  
ATOM 8158  H HB3  . ASN A 1 39  ? -10.141 14.698  9.905   1.00 0.00 ? 39  ASN A HB3  6  
ATOM 8159  H HD21 . ASN A 1 39  ? -8.666  16.417  10.622  1.00 0.00 ? 39  ASN A HD21 6  
ATOM 8160  H HD22 . ASN A 1 39  ? -7.029  16.374  10.069  1.00 0.00 ? 39  ASN A HD22 6  
ATOM 8161  N N    . SER A 1 40  ? -12.464 13.536  8.159   1.00 0.00 ? 40  SER A N    6  
ATOM 8162  C CA   . SER A 1 40  ? -13.709 12.888  8.554   1.00 0.00 ? 40  SER A CA   6  
ATOM 8163  C C    . SER A 1 40  ? -13.769 11.459  8.023   1.00 0.00 ? 40  SER A C    6  
ATOM 8164  O O    . SER A 1 40  ? -13.907 11.239  6.820   1.00 0.00 ? 40  SER A O    6  
ATOM 8165  C CB   . SER A 1 40  ? -14.909 13.686  8.041   1.00 0.00 ? 40  SER A CB   6  
ATOM 8166  O OG   . SER A 1 40  ? -14.932 13.719  6.625   1.00 0.00 ? 40  SER A OG   6  
ATOM 8167  H H    . SER A 1 40  ? -12.500 14.391  7.680   1.00 0.00 ? 40  SER A H    6  
ATOM 8168  H HA   . SER A 1 40  ? -13.740 12.860  9.633   1.00 0.00 ? 40  SER A HA   6  
ATOM 8169  H HB2  . SER A 1 40  ? -15.820 13.226  8.393   1.00 0.00 ? 40  SER A HB2  6  
ATOM 8170  H HB3  . SER A 1 40  ? -14.850 14.698  8.413   1.00 0.00 ? 40  SER A HB3  6  
ATOM 8171  H HG   . SER A 1 40  ? -15.807 13.480  6.313   1.00 0.00 ? 40  SER A HG   6  
ATOM 8172  N N    . GLN A 1 41  ? -13.664 10.492  8.929   1.00 0.00 ? 41  GLN A N    6  
ATOM 8173  C CA   . GLN A 1 41  ? -13.706 9.084   8.552   1.00 0.00 ? 41  GLN A CA   6  
ATOM 8174  C C    . GLN A 1 41  ? -13.038 8.863   7.199   1.00 0.00 ? 41  GLN A C    6  
ATOM 8175  O O    . GLN A 1 41  ? -13.618 8.248   6.304   1.00 0.00 ? 41  GLN A O    6  
ATOM 8176  C CB   . GLN A 1 41  ? -15.152 8.589   8.508   1.00 0.00 ? 41  GLN A CB   6  
ATOM 8177  C CG   . GLN A 1 41  ? -16.027 9.354   7.528   1.00 0.00 ? 41  GLN A CG   6  
ATOM 8178  C CD   . GLN A 1 41  ? -17.501 9.039   7.692   1.00 0.00 ? 41  GLN A CD   6  
ATOM 8179  O OE1  . GLN A 1 41  ? -17.873 8.118   8.419   1.00 0.00 ? 41  GLN A OE1  6  
ATOM 8180  N NE2  . GLN A 1 41  ? -18.349 9.805   7.016   1.00 0.00 ? 41  GLN A NE2  6  
ATOM 8181  H H    . GLN A 1 41  ? -13.556 10.732  9.873   1.00 0.00 ? 41  GLN A H    6  
ATOM 8182  H HA   . GLN A 1 41  ? -13.166 8.525   9.301   1.00 0.00 ? 41  GLN A HA   6  
ATOM 8183  H HB2  . GLN A 1 41  ? -15.155 7.548   8.224   1.00 0.00 ? 41  GLN A HB2  6  
ATOM 8184  H HB3  . GLN A 1 41  ? -15.584 8.687   9.493   1.00 0.00 ? 41  GLN A HB3  6  
ATOM 8185  H HG2  . GLN A 1 41  ? -15.882 10.412  7.685   1.00 0.00 ? 41  GLN A HG2  6  
ATOM 8186  H HG3  . GLN A 1 41  ? -15.729 9.096   6.522   1.00 0.00 ? 41  GLN A HG3  6  
ATOM 8187  H HE21 . GLN A 1 41  ? -17.981 10.520  6.455   1.00 0.00 ? 41  GLN A HE21 6  
ATOM 8188  H HE22 . GLN A 1 41  ? -19.307 9.623   7.103   1.00 0.00 ? 41  GLN A HE22 6  
ATOM 8189  N N    . CYS A 1 42  ? -11.818 9.369   7.057   1.00 0.00 ? 42  CYS A N    6  
ATOM 8190  C CA   . CYS A 1 42  ? -11.072 9.227   5.812   1.00 0.00 ? 42  CYS A CA   6  
ATOM 8191  C C    . CYS A 1 42  ? -11.162 7.800   5.284   1.00 0.00 ? 42  CYS A C    6  
ATOM 8192  O O    . CYS A 1 42  ? -11.613 6.895   5.985   1.00 0.00 ? 42  CYS A O    6  
ATOM 8193  C CB   . CYS A 1 42  ? -9.608  9.615   6.024   1.00 0.00 ? 42  CYS A CB   6  
ATOM 8194  S SG   . CYS A 1 42  ? -8.682  8.461   7.064   1.00 0.00 ? 42  CYS A SG   6  
ATOM 8195  H H    . CYS A 1 42  ? -11.409 9.849   7.807   1.00 0.00 ? 42  CYS A H    6  
ATOM 8196  H HA   . CYS A 1 42  ? -11.511 9.895   5.086   1.00 0.00 ? 42  CYS A HA   6  
ATOM 8197  H HB2  . CYS A 1 42  ? -9.113  9.661   5.065   1.00 0.00 ? 42  CYS A HB2  6  
ATOM 8198  H HB3  . CYS A 1 42  ? -9.565  10.588  6.490   1.00 0.00 ? 42  CYS A HB3  6  
ATOM 8199  H HG   . CYS A 1 42  ? -7.987  7.662   6.269   1.00 0.00 ? 42  CYS A HG   6  
ATOM 8200  N N    . SER A 1 43  ? -10.730 7.606   4.041   1.00 0.00 ? 43  SER A N    6  
ATOM 8201  C CA   . SER A 1 43  ? -10.767 6.289   3.416   1.00 0.00 ? 43  SER A CA   6  
ATOM 8202  C C    . SER A 1 43  ? -9.523  5.482   3.776   1.00 0.00 ? 43  SER A C    6  
ATOM 8203  O O    . SER A 1 43  ? -8.680  5.931   4.553   1.00 0.00 ? 43  SER A O    6  
ATOM 8204  C CB   . SER A 1 43  ? -10.879 6.425   1.897   1.00 0.00 ? 43  SER A CB   6  
ATOM 8205  O OG   . SER A 1 43  ? -9.705  6.998   1.348   1.00 0.00 ? 43  SER A OG   6  
ATOM 8206  H H    . SER A 1 43  ? -10.381 8.367   3.532   1.00 0.00 ? 43  SER A H    6  
ATOM 8207  H HA   . SER A 1 43  ? -11.638 5.769   3.788   1.00 0.00 ? 43  SER A HA   6  
ATOM 8208  H HB2  . SER A 1 43  ? -11.026 5.449   1.460   1.00 0.00 ? 43  SER A HB2  6  
ATOM 8209  H HB3  . SER A 1 43  ? -11.721 7.057   1.656   1.00 0.00 ? 43  SER A HB3  6  
ATOM 8210  H HG   . SER A 1 43  ? -9.945  7.698   0.737   1.00 0.00 ? 43  SER A HG   6  
ATOM 8211  N N    . VAL A 1 44  ? -9.414  4.287   3.204   1.00 0.00 ? 44  VAL A N    6  
ATOM 8212  C CA   . VAL A 1 44  ? -8.273  3.416   3.462   1.00 0.00 ? 44  VAL A CA   6  
ATOM 8213  C C    . VAL A 1 44  ? -7.070  3.823   2.619   1.00 0.00 ? 44  VAL A C    6  
ATOM 8214  O O    . VAL A 1 44  ? -7.161  3.918   1.395   1.00 0.00 ? 44  VAL A O    6  
ATOM 8215  C CB   . VAL A 1 44  ? -8.615  1.943   3.173   1.00 0.00 ? 44  VAL A CB   6  
ATOM 8216  C CG1  . VAL A 1 44  ? -9.687  1.445   4.130   1.00 0.00 ? 44  VAL A CG1  6  
ATOM 8217  C CG2  . VAL A 1 44  ? -9.059  1.773   1.728   1.00 0.00 ? 44  VAL A CG2  6  
ATOM 8218  H H    . VAL A 1 44  ? -10.118 3.984   2.594   1.00 0.00 ? 44  VAL A H    6  
ATOM 8219  H HA   . VAL A 1 44  ? -8.015  3.506   4.508   1.00 0.00 ? 44  VAL A HA   6  
ATOM 8220  H HB   . VAL A 1 44  ? -7.724  1.351   3.326   1.00 0.00 ? 44  VAL A HB   6  
ATOM 8221  H HG11 . VAL A 1 44  ? -10.504 1.019   3.566   1.00 0.00 ? 44  VAL A HG11 6  
ATOM 8222  H HG12 . VAL A 1 44  ? -9.267  0.692   4.781   1.00 0.00 ? 44  VAL A HG12 6  
ATOM 8223  H HG13 . VAL A 1 44  ? -10.052 2.271   4.723   1.00 0.00 ? 44  VAL A HG13 6  
ATOM 8224  H HG21 . VAL A 1 44  ? -9.858  1.049   1.680   1.00 0.00 ? 44  VAL A HG21 6  
ATOM 8225  H HG22 . VAL A 1 44  ? -9.409  2.721   1.344   1.00 0.00 ? 44  VAL A HG22 6  
ATOM 8226  H HG23 . VAL A 1 44  ? -8.226  1.430   1.133   1.00 0.00 ? 44  VAL A HG23 6  
ATOM 8227  N N    . SER A 1 45  ? -5.943  4.061   3.282   1.00 0.00 ? 45  SER A N    6  
ATOM 8228  C CA   . SER A 1 45  ? -4.721  4.461   2.594   1.00 0.00 ? 45  SER A CA   6  
ATOM 8229  C C    . SER A 1 45  ? -4.005  3.247   2.010   1.00 0.00 ? 45  SER A C    6  
ATOM 8230  O O    . SER A 1 45  ? -4.322  2.106   2.343   1.00 0.00 ? 45  SER A O    6  
ATOM 8231  C CB   . SER A 1 45  ? -3.790  5.204   3.554   1.00 0.00 ? 45  SER A CB   6  
ATOM 8232  O OG   . SER A 1 45  ? -4.443  6.320   4.135   1.00 0.00 ? 45  SER A OG   6  
ATOM 8233  H H    . SER A 1 45  ? -5.934  3.968   4.258   1.00 0.00 ? 45  SER A H    6  
ATOM 8234  H HA   . SER A 1 45  ? -4.997  5.124   1.787   1.00 0.00 ? 45  SER A HA   6  
ATOM 8235  H HB2  . SER A 1 45  ? -3.479  4.534   4.340   1.00 0.00 ? 45  SER A HB2  6  
ATOM 8236  H HB3  . SER A 1 45  ? -2.922  5.552   3.012   1.00 0.00 ? 45  SER A HB3  6  
ATOM 8237  H HG   . SER A 1 45  ? -5.389  6.163   4.155   1.00 0.00 ? 45  SER A HG   6  
ATOM 8238  N N    . SER A 1 46  ? -3.035  3.503   1.137   1.00 0.00 ? 46  SER A N    6  
ATOM 8239  C CA   . SER A 1 46  ? -2.275  2.433   0.503   1.00 0.00 ? 46  SER A CA   6  
ATOM 8240  C C    . SER A 1 46  ? -1.895  1.361   1.520   1.00 0.00 ? 46  SER A C    6  
ATOM 8241  O O    . SER A 1 46  ? -1.855  0.173   1.200   1.00 0.00 ? 46  SER A O    6  
ATOM 8242  C CB   . SER A 1 46  ? -1.015  2.995   -0.158  1.00 0.00 ? 46  SER A CB   6  
ATOM 8243  O OG   . SER A 1 46  ? -0.252  3.754   0.764   1.00 0.00 ? 46  SER A OG   6  
ATOM 8244  H H    . SER A 1 46  ? -2.829  4.435   0.912   1.00 0.00 ? 46  SER A H    6  
ATOM 8245  H HA   . SER A 1 46  ? -2.901  1.986   -0.256  1.00 0.00 ? 46  SER A HA   6  
ATOM 8246  H HB2  . SER A 1 46  ? -0.409  2.180   -0.523  1.00 0.00 ? 46  SER A HB2  6  
ATOM 8247  H HB3  . SER A 1 46  ? -1.299  3.632   -0.983  1.00 0.00 ? 46  SER A HB3  6  
ATOM 8248  H HG   . SER A 1 46  ? 0.190   4.470   0.301   1.00 0.00 ? 46  SER A HG   6  
ATOM 8249  N N    . GLU A 1 47  ? -1.616  1.790   2.747   1.00 0.00 ? 47  GLU A N    6  
ATOM 8250  C CA   . GLU A 1 47  ? -1.237  0.868   3.811   1.00 0.00 ? 47  GLU A CA   6  
ATOM 8251  C C    . GLU A 1 47  ? -2.419  -0.009  4.216   1.00 0.00 ? 47  GLU A C    6  
ATOM 8252  O O    . GLU A 1 47  ? -2.371  -1.232  4.086   1.00 0.00 ? 47  GLU A O    6  
ATOM 8253  C CB   . GLU A 1 47  ? -0.721  1.640   5.026   1.00 0.00 ? 47  GLU A CB   6  
ATOM 8254  C CG   . GLU A 1 47  ? 0.209   0.829   5.913   1.00 0.00 ? 47  GLU A CG   6  
ATOM 8255  C CD   . GLU A 1 47  ? 0.156   1.262   7.365   1.00 0.00 ? 47  GLU A CD   6  
ATOM 8256  O OE1  . GLU A 1 47  ? 0.242   2.481   7.623   1.00 0.00 ? 47  GLU A OE1  6  
ATOM 8257  O OE2  . GLU A 1 47  ? 0.028   0.384   8.243   1.00 0.00 ? 47  GLU A OE2  6  
ATOM 8258  H H    . GLU A 1 47  ? -1.665  2.750   2.941   1.00 0.00 ? 47  GLU A H    6  
ATOM 8259  H HA   . GLU A 1 47  ? -0.447  0.235   3.436   1.00 0.00 ? 47  GLU A HA   6  
ATOM 8260  H HB2  . GLU A 1 47  ? -0.186  2.513   4.682   1.00 0.00 ? 47  GLU A HB2  6  
ATOM 8261  H HB3  . GLU A 1 47  ? -1.564  1.958   5.621   1.00 0.00 ? 47  GLU A HB3  6  
ATOM 8262  H HG2  . GLU A 1 47  ? -0.074  -0.211  5.853   1.00 0.00 ? 47  GLU A HG2  6  
ATOM 8263  H HG3  . GLU A 1 47  ? 1.221   0.946   5.554   1.00 0.00 ? 47  GLU A HG3  6  
ATOM 8264  N N    . ASP A 1 48  ? -3.477  0.625   4.709   1.00 0.00 ? 48  ASP A N    6  
ATOM 8265  C CA   . ASP A 1 48  ? -4.671  -0.095  5.134   1.00 0.00 ? 48  ASP A CA   6  
ATOM 8266  C C    . ASP A 1 48  ? -5.058  -1.158  4.110   1.00 0.00 ? 48  ASP A C    6  
ATOM 8267  O O    . ASP A 1 48  ? -5.423  -2.277  4.470   1.00 0.00 ? 48  ASP A O    6  
ATOM 8268  C CB   . ASP A 1 48  ? -5.833  0.877   5.340   1.00 0.00 ? 48  ASP A CB   6  
ATOM 8269  C CG   . ASP A 1 48  ? -5.574  1.858   6.467   1.00 0.00 ? 48  ASP A CG   6  
ATOM 8270  O OD1  . ASP A 1 48  ? -4.535  2.551   6.423   1.00 0.00 ? 48  ASP A OD1  6  
ATOM 8271  O OD2  . ASP A 1 48  ? -6.409  1.935   7.391   1.00 0.00 ? 48  ASP A OD2  6  
ATOM 8272  H H    . ASP A 1 48  ? -3.454  1.602   4.788   1.00 0.00 ? 48  ASP A H    6  
ATOM 8273  H HA   . ASP A 1 48  ? -4.450  -0.581  6.072   1.00 0.00 ? 48  ASP A HA   6  
ATOM 8274  H HB2  . ASP A 1 48  ? -5.992  1.437   4.430   1.00 0.00 ? 48  ASP A HB2  6  
ATOM 8275  H HB3  . ASP A 1 48  ? -6.726  0.317   5.574   1.00 0.00 ? 48  ASP A HB3  6  
ATOM 8276  N N    . ILE A 1 49  ? -4.975  -0.800  2.833   1.00 0.00 ? 49  ILE A N    6  
ATOM 8277  C CA   . ILE A 1 49  ? -5.316  -1.723  1.757   1.00 0.00 ? 49  ILE A CA   6  
ATOM 8278  C C    . ILE A 1 49  ? -4.337  -2.891  1.705   1.00 0.00 ? 49  ILE A C    6  
ATOM 8279  O O    . ILE A 1 49  ? -4.719  -4.042  1.914   1.00 0.00 ? 49  ILE A O    6  
ATOM 8280  C CB   . ILE A 1 49  ? -5.326  -1.014  0.390   1.00 0.00 ? 49  ILE A CB   6  
ATOM 8281  C CG1  . ILE A 1 49  ? -6.365  0.109   0.381   1.00 0.00 ? 49  ILE A CG1  6  
ATOM 8282  C CG2  . ILE A 1 49  ? -5.610  -2.013  -0.722  1.00 0.00 ? 49  ILE A CG2  6  
ATOM 8283  C CD1  . ILE A 1 49  ? -6.001  1.262   -0.529  1.00 0.00 ? 49  ILE A CD1  6  
ATOM 8284  H H    . ILE A 1 49  ? -4.678  0.106   2.609   1.00 0.00 ? 49  ILE A H    6  
ATOM 8285  H HA   . ILE A 1 49  ? -6.308  -2.106  1.949   1.00 0.00 ? 49  ILE A HA   6  
ATOM 8286  H HB   . ILE A 1 49  ? -4.348  -0.592  0.221   1.00 0.00 ? 49  ILE A HB   6  
ATOM 8287  H HG12 . ILE A 1 49  ? -7.312  -0.287  0.050   1.00 0.00 ? 49  ILE A HG12 6  
ATOM 8288  H HG13 . ILE A 1 49  ? -6.472  0.498   1.383   1.00 0.00 ? 49  ILE A HG13 6  
ATOM 8289  H HG21 . ILE A 1 49  ? -5.034  -2.911  -0.554  1.00 0.00 ? 49  ILE A HG21 6  
ATOM 8290  H HG22 . ILE A 1 49  ? -6.661  -2.257  -0.727  1.00 0.00 ? 49  ILE A HG22 6  
ATOM 8291  H HG23 . ILE A 1 49  ? -5.335  -1.582  -1.673  1.00 0.00 ? 49  ILE A HG23 6  
ATOM 8292  H HD11 . ILE A 1 49  ? -6.835  1.487   -1.177  1.00 0.00 ? 49  ILE A HD11 6  
ATOM 8293  H HD12 . ILE A 1 49  ? -5.761  2.129   0.067   1.00 0.00 ? 49  ILE A HD12 6  
ATOM 8294  H HD13 . ILE A 1 49  ? -5.144  0.989   -1.129  1.00 0.00 ? 49  ILE A HD13 6  
ATOM 8295  N N    . GLU A 1 50  ? -3.074  -2.586  1.425   1.00 0.00 ? 50  GLU A N    6  
ATOM 8296  C CA   . GLU A 1 50  ? -2.041  -3.611  1.346   1.00 0.00 ? 50  GLU A CA   6  
ATOM 8297  C C    . GLU A 1 50  ? -2.220  -4.650  2.450   1.00 0.00 ? 50  GLU A C    6  
ATOM 8298  O O    . GLU A 1 50  ? -2.080  -5.851  2.216   1.00 0.00 ? 50  GLU A O    6  
ATOM 8299  C CB   . GLU A 1 50  ? -0.652  -2.976  1.449   1.00 0.00 ? 50  GLU A CB   6  
ATOM 8300  C CG   . GLU A 1 50  ? 0.485   -3.972  1.297   1.00 0.00 ? 50  GLU A CG   6  
ATOM 8301  C CD   . GLU A 1 50  ? 0.654   -4.856  2.518   1.00 0.00 ? 50  GLU A CD   6  
ATOM 8302  O OE1  . GLU A 1 50  ? 0.221   -4.443  3.614   1.00 0.00 ? 50  GLU A OE1  6  
ATOM 8303  O OE2  . GLU A 1 50  ? 1.220   -5.960  2.376   1.00 0.00 ? 50  GLU A OE2  6  
ATOM 8304  H H    . GLU A 1 50  ? -2.832  -1.649  1.268   1.00 0.00 ? 50  GLU A H    6  
ATOM 8305  H HA   . GLU A 1 50  ? -2.132  -4.101  0.389   1.00 0.00 ? 50  GLU A HA   6  
ATOM 8306  H HB2  . GLU A 1 50  ? -0.554  -2.228  0.677   1.00 0.00 ? 50  GLU A HB2  6  
ATOM 8307  H HB3  . GLU A 1 50  ? -0.558  -2.500  2.414   1.00 0.00 ? 50  GLU A HB3  6  
ATOM 8308  H HG2  . GLU A 1 50  ? 0.284   -4.601  0.442   1.00 0.00 ? 50  GLU A HG2  6  
ATOM 8309  H HG3  . GLU A 1 50  ? 1.404   -3.428  1.134   1.00 0.00 ? 50  GLU A HG3  6  
ATOM 8310  N N    . LYS A 1 51  ? -2.529  -4.179  3.653   1.00 0.00 ? 51  LYS A N    6  
ATOM 8311  C CA   . LYS A 1 51  ? -2.728  -5.065  4.794   1.00 0.00 ? 51  LYS A CA   6  
ATOM 8312  C C    . LYS A 1 51  ? -3.923  -5.986  4.565   1.00 0.00 ? 51  LYS A C    6  
ATOM 8313  O O    . LYS A 1 51  ? -3.814  -7.205  4.702   1.00 0.00 ? 51  LYS A O    6  
ATOM 8314  C CB   . LYS A 1 51  ? -2.939  -4.247  6.070   1.00 0.00 ? 51  LYS A CB   6  
ATOM 8315  C CG   . LYS A 1 51  ? -1.644  -3.777  6.712   1.00 0.00 ? 51  LYS A CG   6  
ATOM 8316  C CD   . LYS A 1 51  ? -1.855  -2.518  7.535   1.00 0.00 ? 51  LYS A CD   6  
ATOM 8317  C CE   . LYS A 1 51  ? -2.340  -2.844  8.939   1.00 0.00 ? 51  LYS A CE   6  
ATOM 8318  N NZ   . LYS A 1 51  ? -1.246  -3.385  9.792   1.00 0.00 ? 51  LYS A NZ   6  
ATOM 8319  H H    . LYS A 1 51  ? -2.627  -3.211  3.777   1.00 0.00 ? 51  LYS A H    6  
ATOM 8320  H HA   . LYS A 1 51  ? -1.840  -5.668  4.905   1.00 0.00 ? 51  LYS A HA   6  
ATOM 8321  H HB2  . LYS A 1 51  ? -3.534  -3.378  5.833   1.00 0.00 ? 51  LYS A HB2  6  
ATOM 8322  H HB3  . LYS A 1 51  ? -3.472  -4.853  6.788   1.00 0.00 ? 51  LYS A HB3  6  
ATOM 8323  H HG2  . LYS A 1 51  ? -1.269  -4.558  7.357   1.00 0.00 ? 51  LYS A HG2  6  
ATOM 8324  H HG3  . LYS A 1 51  ? -0.922  -3.572  5.934   1.00 0.00 ? 51  LYS A HG3  6  
ATOM 8325  H HD2  . LYS A 1 51  ? -0.919  -1.983  7.605   1.00 0.00 ? 51  LYS A HD2  6  
ATOM 8326  H HD3  . LYS A 1 51  ? -2.591  -1.897  7.044   1.00 0.00 ? 51  LYS A HD3  6  
ATOM 8327  H HE2  . LYS A 1 51  ? -2.726  -1.944  9.391   1.00 0.00 ? 51  LYS A HE2  6  
ATOM 8328  H HE3  . LYS A 1 51  ? -3.129  -3.579  8.871   1.00 0.00 ? 51  LYS A HE3  6  
ATOM 8329  H HZ1  . LYS A 1 51  ? -1.487  -4.343  10.118  1.00 0.00 ? 51  LYS A HZ1  6  
ATOM 8330  H HZ2  . LYS A 1 51  ? -1.104  -2.774  10.622  1.00 0.00 ? 51  LYS A HZ2  6  
ATOM 8331  H HZ3  . LYS A 1 51  ? -0.359  -3.428  9.251   1.00 0.00 ? 51  LYS A HZ3  6  
ATOM 8332  N N    . SER A 1 52  ? -5.061  -5.396  4.216   1.00 0.00 ? 52  SER A N    6  
ATOM 8333  C CA   . SER A 1 52  ? -6.276  -6.164  3.970   1.00 0.00 ? 52  SER A CA   6  
ATOM 8334  C C    . SER A 1 52  ? -6.035  -7.242  2.918   1.00 0.00 ? 52  SER A C    6  
ATOM 8335  O O    . SER A 1 52  ? -6.557  -8.352  3.018   1.00 0.00 ? 52  SER A O    6  
ATOM 8336  C CB   . SER A 1 52  ? -7.407  -5.238  3.518   1.00 0.00 ? 52  SER A CB   6  
ATOM 8337  O OG   . SER A 1 52  ? -8.650  -5.918  3.509   1.00 0.00 ? 52  SER A OG   6  
ATOM 8338  H H    . SER A 1 52  ? -5.085  -4.420  4.123   1.00 0.00 ? 52  SER A H    6  
ATOM 8339  H HA   . SER A 1 52  ? -6.561  -6.639  4.897   1.00 0.00 ? 52  SER A HA   6  
ATOM 8340  H HB2  . SER A 1 52  ? -7.475  -4.399  4.194   1.00 0.00 ? 52  SER A HB2  6  
ATOM 8341  H HB3  . SER A 1 52  ? -7.199  -4.880  2.520   1.00 0.00 ? 52  SER A HB3  6  
ATOM 8342  H HG   . SER A 1 52  ? -8.498  -6.863  3.438   1.00 0.00 ? 52  SER A HG   6  
ATOM 8343  N N    . PHE A 1 53  ? -5.239  -6.906  1.908   1.00 0.00 ? 53  PHE A N    6  
ATOM 8344  C CA   . PHE A 1 53  ? -4.927  -7.843  0.836   1.00 0.00 ? 53  PHE A CA   6  
ATOM 8345  C C    . PHE A 1 53  ? -4.154  -9.045  1.371   1.00 0.00 ? 53  PHE A C    6  
ATOM 8346  O O    . PHE A 1 53  ? -4.390  -10.182 0.963   1.00 0.00 ? 53  PHE A O    6  
ATOM 8347  C CB   . PHE A 1 53  ? -4.117  -7.148  -0.260  1.00 0.00 ? 53  PHE A CB   6  
ATOM 8348  C CG   . PHE A 1 53  ? -3.585  -8.089  -1.302  1.00 0.00 ? 53  PHE A CG   6  
ATOM 8349  C CD1  . PHE A 1 53  ? -4.355  -8.433  -2.402  1.00 0.00 ? 53  PHE A CD1  6  
ATOM 8350  C CD2  . PHE A 1 53  ? -2.316  -8.632  -1.182  1.00 0.00 ? 53  PHE A CD2  6  
ATOM 8351  C CE1  . PHE A 1 53  ? -3.869  -9.299  -3.363  1.00 0.00 ? 53  PHE A CE1  6  
ATOM 8352  C CE2  . PHE A 1 53  ? -1.824  -9.498  -2.140  1.00 0.00 ? 53  PHE A CE2  6  
ATOM 8353  C CZ   . PHE A 1 53  ? -2.602  -9.833  -3.231  1.00 0.00 ? 53  PHE A CZ   6  
ATOM 8354  H H    . PHE A 1 53  ? -4.852  -6.005  1.884   1.00 0.00 ? 53  PHE A H    6  
ATOM 8355  H HA   . PHE A 1 53  ? -5.860  -8.188  0.417   1.00 0.00 ? 53  PHE A HA   6  
ATOM 8356  H HB2  . PHE A 1 53  ? -4.744  -6.423  -0.757  1.00 0.00 ? 53  PHE A HB2  6  
ATOM 8357  H HB3  . PHE A 1 53  ? -3.277  -6.641  0.191   1.00 0.00 ? 53  PHE A HB3  6  
ATOM 8358  H HD1  . PHE A 1 53  ? -5.347  -8.015  -2.505  1.00 0.00 ? 53  PHE A HD1  6  
ATOM 8359  H HD2  . PHE A 1 53  ? -1.707  -8.372  -0.328  1.00 0.00 ? 53  PHE A HD2  6  
ATOM 8360  H HE1  . PHE A 1 53  ? -4.480  -9.558  -4.215  1.00 0.00 ? 53  PHE A HE1  6  
ATOM 8361  H HE2  . PHE A 1 53  ? -0.833  -9.914  -2.034  1.00 0.00 ? 53  PHE A HE2  6  
ATOM 8362  H HZ   . PHE A 1 53  ? -2.220  -10.509 -3.981  1.00 0.00 ? 53  PHE A HZ   6  
ATOM 8363  N N    . LYS A 1 54  ? -3.228  -8.784  2.287   1.00 0.00 ? 54  LYS A N    6  
ATOM 8364  C CA   . LYS A 1 54  ? -2.418  -9.842  2.880   1.00 0.00 ? 54  LYS A CA   6  
ATOM 8365  C C    . LYS A 1 54  ? -3.300  -10.961 3.426   1.00 0.00 ? 54  LYS A C    6  
ATOM 8366  O O    . LYS A 1 54  ? -3.252  -12.094 2.947   1.00 0.00 ? 54  LYS A O    6  
ATOM 8367  C CB   . LYS A 1 54  ? -1.544  -9.275  4.001   1.00 0.00 ? 54  LYS A CB   6  
ATOM 8368  C CG   . LYS A 1 54  ? -0.448  -8.347  3.507   1.00 0.00 ? 54  LYS A CG   6  
ATOM 8369  C CD   . LYS A 1 54  ? 0.763   -8.374  4.425   1.00 0.00 ? 54  LYS A CD   6  
ATOM 8370  C CE   . LYS A 1 54  ? 1.610   -9.616  4.194   1.00 0.00 ? 54  LYS A CE   6  
ATOM 8371  N NZ   . LYS A 1 54  ? 1.094   -10.789 4.952   1.00 0.00 ? 54  LYS A NZ   6  
ATOM 8372  H H    . LYS A 1 54  ? -3.085  -7.857  2.572   1.00 0.00 ? 54  LYS A H    6  
ATOM 8373  H HA   . LYS A 1 54  ? -1.782  -10.246 2.108   1.00 0.00 ? 54  LYS A HA   6  
ATOM 8374  H HB2  . LYS A 1 54  ? -2.170  -8.725  4.687   1.00 0.00 ? 54  LYS A HB2  6  
ATOM 8375  H HB3  . LYS A 1 54  ? -1.080  -10.096 4.529   1.00 0.00 ? 54  LYS A HB3  6  
ATOM 8376  H HG2  . LYS A 1 54  ? -0.143  -8.658  2.519   1.00 0.00 ? 54  LYS A HG2  6  
ATOM 8377  H HG3  . LYS A 1 54  ? -0.834  -7.339  3.465   1.00 0.00 ? 54  LYS A HG3  6  
ATOM 8378  H HD2  . LYS A 1 54  ? 1.367   -7.499  4.236   1.00 0.00 ? 54  LYS A HD2  6  
ATOM 8379  H HD3  . LYS A 1 54  ? 0.425   -8.366  5.452   1.00 0.00 ? 54  LYS A HD3  6  
ATOM 8380  H HE2  . LYS A 1 54  ? 1.605   -9.848  3.140   1.00 0.00 ? 54  LYS A HE2  6  
ATOM 8381  H HE3  . LYS A 1 54  ? 2.622   -9.409  4.511   1.00 0.00 ? 54  LYS A HE3  6  
ATOM 8382  H HZ1  . LYS A 1 54  ? 0.504   -10.469 5.746   1.00 0.00 ? 54  LYS A HZ1  6  
ATOM 8383  H HZ2  . LYS A 1 54  ? 1.886   -11.349 5.327   1.00 0.00 ? 54  LYS A HZ2  6  
ATOM 8384  H HZ3  . LYS A 1 54  ? 0.520   -11.393 4.329   1.00 0.00 ? 54  LYS A HZ3  6  
ATOM 8385  N N    . THR A 1 55  ? -4.108  -10.635 4.431   1.00 0.00 ? 55  THR A N    6  
ATOM 8386  C CA   . THR A 1 55  ? -5.001  -11.612 5.041   1.00 0.00 ? 55  THR A CA   6  
ATOM 8387  C C    . THR A 1 55  ? -6.026  -12.124 4.035   1.00 0.00 ? 55  THR A C    6  
ATOM 8388  O O    . THR A 1 55  ? -6.247  -13.328 3.919   1.00 0.00 ? 55  THR A O    6  
ATOM 8389  C CB   . THR A 1 55  ? -5.741  -11.016 6.253   1.00 0.00 ? 55  THR A CB   6  
ATOM 8390  O OG1  . THR A 1 55  ? -6.632  -11.989 6.810   1.00 0.00 ? 55  THR A OG1  6  
ATOM 8391  C CG2  . THR A 1 55  ? -6.524  -9.775  5.853   1.00 0.00 ? 55  THR A CG2  6  
ATOM 8392  H H    . THR A 1 55  ? -4.101  -9.715  4.769   1.00 0.00 ? 55  THR A H    6  
ATOM 8393  H HA   . THR A 1 55  ? -4.402  -12.443 5.384   1.00 0.00 ? 55  THR A HA   6  
ATOM 8394  H HB   . THR A 1 55  ? -5.011  -10.738 7.000   1.00 0.00 ? 55  THR A HB   6  
ATOM 8395  H HG1  . THR A 1 55  ? -6.236  -12.861 6.742   1.00 0.00 ? 55  THR A HG1  6  
ATOM 8396  H HG21 . THR A 1 55  ? -7.508  -10.063 5.514   1.00 0.00 ? 55  THR A HG21 6  
ATOM 8397  H HG22 . THR A 1 55  ? -6.004  -9.263  5.056   1.00 0.00 ? 55  THR A HG22 6  
ATOM 8398  H HG23 . THR A 1 55  ? -6.615  -9.117  6.704   1.00 0.00 ? 55  THR A HG23 6  
ATOM 8399  N N    . ASN A 1 56  ? -6.648  -11.200 3.310   1.00 0.00 ? 56  ASN A N    6  
ATOM 8400  C CA   . ASN A 1 56  ? -7.650  -11.559 2.313   1.00 0.00 ? 56  ASN A CA   6  
ATOM 8401  C C    . ASN A 1 56  ? -7.207  -11.131 0.917   1.00 0.00 ? 56  ASN A C    6  
ATOM 8402  O O    . ASN A 1 56  ? -7.569  -10.063 0.423   1.00 0.00 ? 56  ASN A O    6  
ATOM 8403  C CB   . ASN A 1 56  ? -8.994  -10.911 2.654   1.00 0.00 ? 56  ASN A CB   6  
ATOM 8404  C CG   . ASN A 1 56  ? -9.799  -11.734 3.640   1.00 0.00 ? 56  ASN A CG   6  
ATOM 8405  O OD1  . ASN A 1 56  ? -9.261  -12.254 4.617   1.00 0.00 ? 56  ASN A OD1  6  
ATOM 8406  N ND2  . ASN A 1 56  ? -11.097 -11.857 3.387   1.00 0.00 ? 56  ASN A ND2  6  
ATOM 8407  H H    . ASN A 1 56  ? -6.429  -10.255 3.448   1.00 0.00 ? 56  ASN A H    6  
ATOM 8408  H HA   . ASN A 1 56  ? -7.764  -12.632 2.329   1.00 0.00 ? 56  ASN A HA   6  
ATOM 8409  H HB2  . ASN A 1 56  ? -8.817  -9.937  3.088   1.00 0.00 ? 56  ASN A HB2  6  
ATOM 8410  H HB3  . ASN A 1 56  ? -9.572  -10.797 1.750   1.00 0.00 ? 56  ASN A HB3  6  
ATOM 8411  H HD21 . ASN A 1 56  ? -11.457 -11.416 2.589   1.00 0.00 ? 56  ASN A HD21 6  
ATOM 8412  H HD22 . ASN A 1 56  ? -11.642 -12.384 4.008   1.00 0.00 ? 56  ASN A HD22 6  
ATOM 8413  N N    . PRO A 1 57  ? -6.403  -11.984 0.265   1.00 0.00 ? 57  PRO A N    6  
ATOM 8414  C CA   . PRO A 1 57  ? -5.893  -11.717 -1.083  1.00 0.00 ? 57  PRO A CA   6  
ATOM 8415  C C    . PRO A 1 57  ? -6.989  -11.787 -2.142  1.00 0.00 ? 57  PRO A C    6  
ATOM 8416  O O    . PRO A 1 57  ? -6.770  -11.426 -3.299  1.00 0.00 ? 57  PRO A O    6  
ATOM 8417  C CB   . PRO A 1 57  ? -4.867  -12.832 -1.302  1.00 0.00 ? 57  PRO A CB   6  
ATOM 8418  C CG   . PRO A 1 57  ? -5.313  -13.937 -0.407  1.00 0.00 ? 57  PRO A CG   6  
ATOM 8419  C CD   . PRO A 1 57  ? -5.930  -13.275 0.793   1.00 0.00 ? 57  PRO A CD   6  
ATOM 8420  H HA   . PRO A 1 57  ? -5.401  -10.757 -1.139  1.00 0.00 ? 57  PRO A HA   6  
ATOM 8421  H HB2  . PRO A 1 57  ? -4.876  -13.135 -2.340  1.00 0.00 ? 57  PRO A HB2  6  
ATOM 8422  H HB3  . PRO A 1 57  ? -3.883  -12.479 -1.032  1.00 0.00 ? 57  PRO A HB3  6  
ATOM 8423  H HG2  . PRO A 1 57  ? -6.042  -14.549 -0.915  1.00 0.00 ? 57  PRO A HG2  6  
ATOM 8424  H HG3  . PRO A 1 57  ? -4.463  -14.533 -0.110  1.00 0.00 ? 57  PRO A HG3  6  
ATOM 8425  H HD2  . PRO A 1 57  ? -6.755  -13.864 1.166   1.00 0.00 ? 57  PRO A HD2  6  
ATOM 8426  H HD3  . PRO A 1 57  ? -5.190  -13.127 1.565   1.00 0.00 ? 57  PRO A HD3  6  
ATOM 8427  N N    . CYS A 1 58  ? -8.166  -12.251 -1.738  1.00 0.00 ? 58  CYS A N    6  
ATOM 8428  C CA   . CYS A 1 58  ? -9.296  -12.368 -2.653  1.00 0.00 ? 58  CYS A CA   6  
ATOM 8429  C C    . CYS A 1 58  ? -10.494 -11.574 -2.141  1.00 0.00 ? 58  CYS A C    6  
ATOM 8430  O O    . CYS A 1 58  ? -11.378 -11.200 -2.910  1.00 0.00 ? 58  CYS A O    6  
ATOM 8431  C CB   . CYS A 1 58  ? -9.683  -13.836 -2.834  1.00 0.00 ? 58  CYS A CB   6  
ATOM 8432  S SG   . CYS A 1 58  ? -10.172 -14.665 -1.304  1.00 0.00 ? 58  CYS A SG   6  
ATOM 8433  H H    . CYS A 1 58  ? -8.278  -12.522 -0.803  1.00 0.00 ? 58  CYS A H    6  
ATOM 8434  H HA   . CYS A 1 58  ? -8.993  -11.963 -3.606  1.00 0.00 ? 58  CYS A HA   6  
ATOM 8435  H HB2  . CYS A 1 58  ? -10.513 -13.900 -3.522  1.00 0.00 ? 58  CYS A HB2  6  
ATOM 8436  H HB3  . CYS A 1 58  ? -8.841  -14.373 -3.247  1.00 0.00 ? 58  CYS A HB3  6  
ATOM 8437  H HG   . CYS A 1 58  ? -11.082 -13.913 -0.705  1.00 0.00 ? 58  CYS A HG   6  
ATOM 8438  N N    . GLY A 1 59  ? -10.516 -11.321 -0.836  1.00 0.00 ? 59  GLY A N    6  
ATOM 8439  C CA   . GLY A 1 59  ? -11.611 -10.575 -0.243  1.00 0.00 ? 59  GLY A CA   6  
ATOM 8440  C C    . GLY A 1 59  ? -11.589 -9.109  -0.630  1.00 0.00 ? 59  GLY A C    6  
ATOM 8441  O O    . GLY A 1 59  ? -10.655 -8.646  -1.285  1.00 0.00 ? 59  GLY A O    6  
ATOM 8442  H H    . GLY A 1 59  ? -9.783  -11.644 -0.271  1.00 0.00 ? 59  GLY A H    6  
ATOM 8443  H HA2  . GLY A 1 59  ? -12.545 -11.008 -0.568  1.00 0.00 ? 59  GLY A HA2  6  
ATOM 8444  H HA3  . GLY A 1 59  ? -11.544 -10.652 0.832   1.00 0.00 ? 59  GLY A HA3  6  
ATOM 8445  N N    . SER A 1 60  ? -12.621 -8.377  -0.224  1.00 0.00 ? 60  SER A N    6  
ATOM 8446  C CA   . SER A 1 60  ? -12.720 -6.956  -0.537  1.00 0.00 ? 60  SER A CA   6  
ATOM 8447  C C    . SER A 1 60  ? -12.911 -6.132  0.733   1.00 0.00 ? 60  SER A C    6  
ATOM 8448  O O    . SER A 1 60  ? -13.440 -6.624  1.731   1.00 0.00 ? 60  SER A O    6  
ATOM 8449  C CB   . SER A 1 60  ? -13.880 -6.703  -1.501  1.00 0.00 ? 60  SER A CB   6  
ATOM 8450  O OG   . SER A 1 60  ? -14.111 -7.831  -2.328  1.00 0.00 ? 60  SER A OG   6  
ATOM 8451  H H    . SER A 1 60  ? -13.335 -8.803  0.295   1.00 0.00 ? 60  SER A H    6  
ATOM 8452  H HA   . SER A 1 60  ? -11.797 -6.656  -1.011  1.00 0.00 ? 60  SER A HA   6  
ATOM 8453  H HB2  . SER A 1 60  ? -14.777 -6.497  -0.936  1.00 0.00 ? 60  SER A HB2  6  
ATOM 8454  H HB3  . SER A 1 60  ? -13.646 -5.854  -2.127  1.00 0.00 ? 60  SER A HB3  6  
ATOM 8455  H HG   . SER A 1 60  ? -15.042 -8.064  -2.299  1.00 0.00 ? 60  SER A HG   6  
ATOM 8456  N N    . ILE A 1 61  ? -12.477 -4.877  0.688   1.00 0.00 ? 61  ILE A N    6  
ATOM 8457  C CA   . ILE A 1 61  ? -12.601 -3.985  1.834   1.00 0.00 ? 61  ILE A CA   6  
ATOM 8458  C C    . ILE A 1 61  ? -13.691 -2.944  1.604   1.00 0.00 ? 61  ILE A C    6  
ATOM 8459  O O    . ILE A 1 61  ? -13.515 -2.006  0.827   1.00 0.00 ? 61  ILE A O    6  
ATOM 8460  C CB   . ILE A 1 61  ? -11.273 -3.264  2.132   1.00 0.00 ? 61  ILE A CB   6  
ATOM 8461  C CG1  . ILE A 1 61  ? -11.360 -2.522  3.467   1.00 0.00 ? 61  ILE A CG1  6  
ATOM 8462  C CG2  . ILE A 1 61  ? -10.929 -2.301  1.006   1.00 0.00 ? 61  ILE A CG2  6  
ATOM 8463  C CD1  . ILE A 1 61  ? -10.009 -2.169  4.051   1.00 0.00 ? 61  ILE A CD1  6  
ATOM 8464  H H    . ILE A 1 61  ? -12.064 -4.543  -0.135  1.00 0.00 ? 61  ILE A H    6  
ATOM 8465  H HA   . ILE A 1 61  ? -12.865 -4.583  2.695   1.00 0.00 ? 61  ILE A HA   6  
ATOM 8466  H HB   . ILE A 1 61  ? -10.492 -4.006  2.191   1.00 0.00 ? 61  ILE A HB   6  
ATOM 8467  H HG12 . ILE A 1 61  ? -11.909 -1.604  3.327   1.00 0.00 ? 61  ILE A HG12 6  
ATOM 8468  H HG13 . ILE A 1 61  ? -11.880 -3.142  4.183   1.00 0.00 ? 61  ILE A HG13 6  
ATOM 8469  H HG21 . ILE A 1 61  ? -11.465 -2.586  0.113   1.00 0.00 ? 61  ILE A HG21 6  
ATOM 8470  H HG22 . ILE A 1 61  ? -11.211 -1.299  1.291   1.00 0.00 ? 61  ILE A HG22 6  
ATOM 8471  H HG23 . ILE A 1 61  ? -9.867  -2.336  0.815   1.00 0.00 ? 61  ILE A HG23 6  
ATOM 8472  H HD11 . ILE A 1 61  ? -9.232  -2.453  3.358   1.00 0.00 ? 61  ILE A HD11 6  
ATOM 8473  H HD12 . ILE A 1 61  ? -9.961  -1.106  4.233   1.00 0.00 ? 61  ILE A HD12 6  
ATOM 8474  H HD13 . ILE A 1 61  ? -9.871  -2.699  4.983   1.00 0.00 ? 61  ILE A HD13 6  
ATOM 8475  N N    . SER A 1 62  ? -14.819 -3.115  2.288   1.00 0.00 ? 62  SER A N    6  
ATOM 8476  C CA   . SER A 1 62  ? -15.939 -2.191  2.157   1.00 0.00 ? 62  SER A CA   6  
ATOM 8477  C C    . SER A 1 62  ? -15.834 -1.062  3.178   1.00 0.00 ? 62  SER A C    6  
ATOM 8478  O O    . SER A 1 62  ? -15.883 -1.294  4.386   1.00 0.00 ? 62  SER A O    6  
ATOM 8479  C CB   . SER A 1 62  ? -17.264 -2.934  2.337   1.00 0.00 ? 62  SER A CB   6  
ATOM 8480  O OG   . SER A 1 62  ? -17.496 -3.241  3.701   1.00 0.00 ? 62  SER A OG   6  
ATOM 8481  H H    . SER A 1 62  ? -14.899 -3.882  2.892   1.00 0.00 ? 62  SER A H    6  
ATOM 8482  H HA   . SER A 1 62  ? -15.906 -1.767  1.165   1.00 0.00 ? 62  SER A HA   6  
ATOM 8483  H HB2  . SER A 1 62  ? -18.073 -2.316  1.978   1.00 0.00 ? 62  SER A HB2  6  
ATOM 8484  H HB3  . SER A 1 62  ? -17.236 -3.855  1.773   1.00 0.00 ? 62  SER A HB3  6  
ATOM 8485  H HG   . SER A 1 62  ? -17.815 -4.143  3.777   1.00 0.00 ? 62  SER A HG   6  
ATOM 8486  N N    . PHE A 1 63  ? -15.690 0.163   2.683   1.00 0.00 ? 63  PHE A N    6  
ATOM 8487  C CA   . PHE A 1 63  ? -15.576 1.330   3.550   1.00 0.00 ? 63  PHE A CA   6  
ATOM 8488  C C    . PHE A 1 63  ? -16.486 2.456   3.068   1.00 0.00 ? 63  PHE A C    6  
ATOM 8489  O O    . PHE A 1 63  ? -17.086 2.370   1.996   1.00 0.00 ? 63  PHE A O    6  
ATOM 8490  C CB   . PHE A 1 63  ? -14.126 1.816   3.600   1.00 0.00 ? 63  PHE A CB   6  
ATOM 8491  C CG   . PHE A 1 63  ? -13.583 2.222   2.260   1.00 0.00 ? 63  PHE A CG   6  
ATOM 8492  C CD1  . PHE A 1 63  ? -13.758 3.514   1.790   1.00 0.00 ? 63  PHE A CD1  6  
ATOM 8493  C CD2  . PHE A 1 63  ? -12.899 1.313   1.470   1.00 0.00 ? 63  PHE A CD2  6  
ATOM 8494  C CE1  . PHE A 1 63  ? -13.260 3.890   0.557   1.00 0.00 ? 63  PHE A CE1  6  
ATOM 8495  C CE2  . PHE A 1 63  ? -12.398 1.683   0.236   1.00 0.00 ? 63  PHE A CE2  6  
ATOM 8496  C CZ   . PHE A 1 63  ? -12.578 2.974   -0.220  1.00 0.00 ? 63  PHE A CZ   6  
ATOM 8497  H H    . PHE A 1 63  ? -15.658 0.285   1.710   1.00 0.00 ? 63  PHE A H    6  
ATOM 8498  H HA   . PHE A 1 63  ? -15.883 1.036   4.542   1.00 0.00 ? 63  PHE A HA   6  
ATOM 8499  H HB2  . PHE A 1 63  ? -14.063 2.671   4.256   1.00 0.00 ? 63  PHE A HB2  6  
ATOM 8500  H HB3  . PHE A 1 63  ? -13.502 1.024   3.986   1.00 0.00 ? 63  PHE A HB3  6  
ATOM 8501  H HD1  . PHE A 1 63  ? -14.290 4.232   2.397   1.00 0.00 ? 63  PHE A HD1  6  
ATOM 8502  H HD2  . PHE A 1 63  ? -12.757 0.302   1.827   1.00 0.00 ? 63  PHE A HD2  6  
ATOM 8503  H HE1  . PHE A 1 63  ? -13.402 4.900   0.202   1.00 0.00 ? 63  PHE A HE1  6  
ATOM 8504  H HE2  . PHE A 1 63  ? -11.866 0.964   -0.369  1.00 0.00 ? 63  PHE A HE2  6  
ATOM 8505  H HZ   . PHE A 1 63  ? -12.189 3.266   -1.184  1.00 0.00 ? 63  PHE A HZ   6  
ATOM 8506  N N    . THR A 1 64  ? -16.583 3.514   3.868   1.00 0.00 ? 64  THR A N    6  
ATOM 8507  C CA   . THR A 1 64  ? -17.419 4.657   3.525   1.00 0.00 ? 64  THR A CA   6  
ATOM 8508  C C    . THR A 1 64  ? -16.798 5.960   4.017   1.00 0.00 ? 64  THR A C    6  
ATOM 8509  O O    . THR A 1 64  ? -16.282 6.032   5.132   1.00 0.00 ? 64  THR A O    6  
ATOM 8510  C CB   . THR A 1 64  ? -18.833 4.518   4.121   1.00 0.00 ? 64  THR A CB   6  
ATOM 8511  O OG1  . THR A 1 64  ? -18.750 4.333   5.539   1.00 0.00 ? 64  THR A OG1  6  
ATOM 8512  C CG2  . THR A 1 64  ? -19.572 3.346   3.494   1.00 0.00 ? 64  THR A CG2  6  
ATOM 8513  H H    . THR A 1 64  ? -16.080 3.524   4.709   1.00 0.00 ? 64  THR A H    6  
ATOM 8514  H HA   . THR A 1 64  ? -17.508 4.695   2.449   1.00 0.00 ? 64  THR A HA   6  
ATOM 8515  H HB   . THR A 1 64  ? -19.384 5.424   3.916   1.00 0.00 ? 64  THR A HB   6  
ATOM 8516  H HG1  . THR A 1 64  ? -18.253 3.533   5.729   1.00 0.00 ? 64  THR A HG1  6  
ATOM 8517  H HG21 . THR A 1 64  ? -19.817 3.582   2.469   1.00 0.00 ? 64  THR A HG21 6  
ATOM 8518  H HG22 . THR A 1 64  ? -20.480 3.156   4.046   1.00 0.00 ? 64  THR A HG22 6  
ATOM 8519  H HG23 . THR A 1 64  ? -18.944 2.469   3.521   1.00 0.00 ? 64  THR A HG23 6  
ATOM 8520  N N    . THR A 1 65  ? -16.852 6.989   3.177   1.00 0.00 ? 65  THR A N    6  
ATOM 8521  C CA   . THR A 1 65  ? -16.295 8.290   3.526   1.00 0.00 ? 65  THR A CA   6  
ATOM 8522  C C    . THR A 1 65  ? -16.587 9.322   2.443   1.00 0.00 ? 65  THR A C    6  
ATOM 8523  O O    . THR A 1 65  ? -16.402 9.059   1.255   1.00 0.00 ? 65  THR A O    6  
ATOM 8524  C CB   . THR A 1 65  ? -14.772 8.208   3.744   1.00 0.00 ? 65  THR A CB   6  
ATOM 8525  O OG1  . THR A 1 65  ? -14.275 9.469   4.207   1.00 0.00 ? 65  THR A OG1  6  
ATOM 8526  C CG2  . THR A 1 65  ? -14.061 7.820   2.456   1.00 0.00 ? 65  THR A CG2  6  
ATOM 8527  H H    . THR A 1 65  ? -17.277 6.870   2.302   1.00 0.00 ? 65  THR A H    6  
ATOM 8528  H HA   . THR A 1 65  ? -16.753 8.612   4.450   1.00 0.00 ? 65  THR A HA   6  
ATOM 8529  H HB   . THR A 1 65  ? -14.570 7.454   4.491   1.00 0.00 ? 65  THR A HB   6  
ATOM 8530  H HG1  . THR A 1 65  ? -14.796 10.179  3.824   1.00 0.00 ? 65  THR A HG1  6  
ATOM 8531  H HG21 . THR A 1 65  ? -13.423 8.631   2.138   1.00 0.00 ? 65  THR A HG21 6  
ATOM 8532  H HG22 . THR A 1 65  ? -14.793 7.615   1.689   1.00 0.00 ? 65  THR A HG22 6  
ATOM 8533  H HG23 . THR A 1 65  ? -13.463 6.938   2.628   1.00 0.00 ? 65  THR A HG23 6  
ATOM 8534  N N    . SER A 1 66  ? -17.044 10.498  2.861   1.00 0.00 ? 66  SER A N    6  
ATOM 8535  C CA   . SER A 1 66  ? -17.365 11.570  1.926   1.00 0.00 ? 66  SER A CA   6  
ATOM 8536  C C    . SER A 1 66  ? -18.677 11.284  1.202   1.00 0.00 ? 66  SER A C    6  
ATOM 8537  O O    . SER A 1 66  ? -18.732 11.271  -0.028  1.00 0.00 ? 66  SER A O    6  
ATOM 8538  C CB   . SER A 1 66  ? -16.236 11.743  0.909   1.00 0.00 ? 66  SER A CB   6  
ATOM 8539  O OG   . SER A 1 66  ? -16.164 13.082  0.450   1.00 0.00 ? 66  SER A OG   6  
ATOM 8540  H H    . SER A 1 66  ? -17.171 10.648  3.822   1.00 0.00 ? 66  SER A H    6  
ATOM 8541  H HA   . SER A 1 66  ? -17.472 12.483  2.492   1.00 0.00 ? 66  SER A HA   6  
ATOM 8542  H HB2  . SER A 1 66  ? -15.296 11.483  1.371   1.00 0.00 ? 66  SER A HB2  6  
ATOM 8543  H HB3  . SER A 1 66  ? -16.414 11.094  0.064   1.00 0.00 ? 66  SER A HB3  6  
ATOM 8544  H HG   . SER A 1 66  ? -15.763 13.100  -0.422  1.00 0.00 ? 66  SER A HG   6  
ATOM 8545  N N    . LYS A 1 67  ? -19.734 11.055  1.974   1.00 0.00 ? 67  LYS A N    6  
ATOM 8546  C CA   . LYS A 1 67  ? -21.048 10.770  1.410   1.00 0.00 ? 67  LYS A CA   6  
ATOM 8547  C C    . LYS A 1 67  ? -20.923 9.968   0.118   1.00 0.00 ? 67  LYS A C    6  
ATOM 8548  O O    . LYS A 1 67  ? -21.711 10.142  -0.811  1.00 0.00 ? 67  LYS A O    6  
ATOM 8549  C CB   . LYS A 1 67  ? -21.804 12.073  1.142   1.00 0.00 ? 67  LYS A CB   6  
ATOM 8550  C CG   . LYS A 1 67  ? -21.246 12.872  -0.023  1.00 0.00 ? 67  LYS A CG   6  
ATOM 8551  C CD   . LYS A 1 67  ? -21.768 14.299  -0.022  1.00 0.00 ? 67  LYS A CD   6  
ATOM 8552  C CE   . LYS A 1 67  ? -23.042 14.427  -0.844  1.00 0.00 ? 67  LYS A CE   6  
ATOM 8553  N NZ   . LYS A 1 67  ? -23.824 15.637  -0.469  1.00 0.00 ? 67  LYS A NZ   6  
ATOM 8554  H H    . LYS A 1 67  ? -19.628 11.079  2.949   1.00 0.00 ? 67  LYS A H    6  
ATOM 8555  H HA   . LYS A 1 67  ? -21.599 10.185  2.130   1.00 0.00 ? 67  LYS A HA   6  
ATOM 8556  H HB2  . LYS A 1 67  ? -22.837 11.839  0.928   1.00 0.00 ? 67  LYS A HB2  6  
ATOM 8557  H HB3  . LYS A 1 67  ? -21.760 12.690  2.028   1.00 0.00 ? 67  LYS A HB3  6  
ATOM 8558  H HG2  . LYS A 1 67  ? -20.169 12.894  0.051   1.00 0.00 ? 67  LYS A HG2  6  
ATOM 8559  H HG3  . LYS A 1 67  ? -21.535 12.393  -0.948  1.00 0.00 ? 67  LYS A HG3  6  
ATOM 8560  H HD2  . LYS A 1 67  ? -21.978 14.596  0.995   1.00 0.00 ? 67  LYS A HD2  6  
ATOM 8561  H HD3  . LYS A 1 67  ? -21.013 14.950  -0.440  1.00 0.00 ? 67  LYS A HD3  6  
ATOM 8562  H HE2  . LYS A 1 67  ? -22.776 14.490  -1.888  1.00 0.00 ? 67  LYS A HE2  6  
ATOM 8563  H HE3  . LYS A 1 67  ? -23.650 13.549  -0.679  1.00 0.00 ? 67  LYS A HE3  6  
ATOM 8564  H HZ1  . LYS A 1 67  ? -24.104 15.585  0.532   1.00 0.00 ? 67  LYS A HZ1  6  
ATOM 8565  H HZ2  . LYS A 1 67  ? -24.682 15.703  -1.054  1.00 0.00 ? 67  LYS A HZ2  6  
ATOM 8566  H HZ3  . LYS A 1 67  ? -23.252 16.492  -0.614  1.00 0.00 ? 67  LYS A HZ3  6  
ATOM 8567  N N    . PHE A 1 68  ? -19.928 9.088   0.067   1.00 0.00 ? 68  PHE A N    6  
ATOM 8568  C CA   . PHE A 1 68  ? -19.700 8.259   -1.110  1.00 0.00 ? 68  PHE A CA   6  
ATOM 8569  C C    . PHE A 1 68  ? -19.053 6.932   -0.724  1.00 0.00 ? 68  PHE A C    6  
ATOM 8570  O O    . PHE A 1 68  ? -17.953 6.903   -0.173  1.00 0.00 ? 68  PHE A O    6  
ATOM 8571  C CB   . PHE A 1 68  ? -18.815 8.997   -2.117  1.00 0.00 ? 68  PHE A CB   6  
ATOM 8572  C CG   . PHE A 1 68  ? -19.465 10.216  -2.705  1.00 0.00 ? 68  PHE A CG   6  
ATOM 8573  C CD1  . PHE A 1 68  ? -20.722 10.137  -3.283  1.00 0.00 ? 68  PHE A CD1  6  
ATOM 8574  C CD2  . PHE A 1 68  ? -18.820 11.442  -2.679  1.00 0.00 ? 68  PHE A CD2  6  
ATOM 8575  C CE1  . PHE A 1 68  ? -21.322 11.257  -3.826  1.00 0.00 ? 68  PHE A CE1  6  
ATOM 8576  C CE2  . PHE A 1 68  ? -19.415 12.566  -3.220  1.00 0.00 ? 68  PHE A CE2  6  
ATOM 8577  C CZ   . PHE A 1 68  ? -20.668 12.474  -3.793  1.00 0.00 ? 68  PHE A CZ   6  
ATOM 8578  H H    . PHE A 1 68  ? -19.332 8.995   0.841   1.00 0.00 ? 68  PHE A H    6  
ATOM 8579  H HA   . PHE A 1 68  ? -20.658 8.059   -1.564  1.00 0.00 ? 68  PHE A HA   6  
ATOM 8580  H HB2  . PHE A 1 68  ? -17.907 9.310   -1.624  1.00 0.00 ? 68  PHE A HB2  6  
ATOM 8581  H HB3  . PHE A 1 68  ? -18.568 8.327   -2.927  1.00 0.00 ? 68  PHE A HB3  6  
ATOM 8582  H HD1  . PHE A 1 68  ? -21.235 9.187   -3.309  1.00 0.00 ? 68  PHE A HD1  6  
ATOM 8583  H HD2  . PHE A 1 68  ? -17.839 11.516  -2.230  1.00 0.00 ? 68  PHE A HD2  6  
ATOM 8584  H HE1  . PHE A 1 68  ? -22.301 11.183  -4.274  1.00 0.00 ? 68  PHE A HE1  6  
ATOM 8585  H HE2  . PHE A 1 68  ? -18.901 13.516  -3.192  1.00 0.00 ? 68  PHE A HE2  6  
ATOM 8586  H HZ   . PHE A 1 68  ? -21.135 13.351  -4.217  1.00 0.00 ? 68  PHE A HZ   6  
ATOM 8587  N N    . SER A 1 69  ? -19.745 5.835   -1.017  1.00 0.00 ? 69  SER A N    6  
ATOM 8588  C CA   . SER A 1 69  ? -19.240 4.505   -0.697  1.00 0.00 ? 69  SER A CA   6  
ATOM 8589  C C    . SER A 1 69  ? -18.225 4.044   -1.738  1.00 0.00 ? 69  SER A C    6  
ATOM 8590  O O    . SER A 1 69  ? -18.216 4.528   -2.870  1.00 0.00 ? 69  SER A O    6  
ATOM 8591  C CB   . SER A 1 69  ? -20.395 3.505   -0.616  1.00 0.00 ? 69  SER A CB   6  
ATOM 8592  O OG   . SER A 1 69  ? -21.212 3.758   0.514   1.00 0.00 ? 69  SER A OG   6  
ATOM 8593  H H    . SER A 1 69  ? -20.616 5.924   -1.457  1.00 0.00 ? 69  SER A H    6  
ATOM 8594  H HA   . SER A 1 69  ? -18.753 4.558   0.265   1.00 0.00 ? 69  SER A HA   6  
ATOM 8595  H HB2  . SER A 1 69  ? -21.000 3.584   -1.507  1.00 0.00 ? 69  SER A HB2  6  
ATOM 8596  H HB3  . SER A 1 69  ? -19.996 2.504   -0.540  1.00 0.00 ? 69  SER A HB3  6  
ATOM 8597  H HG   . SER A 1 69  ? -21.930 3.122   0.539   1.00 0.00 ? 69  SER A HG   6  
ATOM 8598  N N    . TYR A 1 70  ? -17.371 3.105   -1.347  1.00 0.00 ? 70  TYR A N    6  
ATOM 8599  C CA   . TYR A 1 70  ? -16.349 2.579   -2.244  1.00 0.00 ? 70  TYR A CA   6  
ATOM 8600  C C    . TYR A 1 70  ? -15.953 1.160   -1.847  1.00 0.00 ? 70  TYR A C    6  
ATOM 8601  O O    . TYR A 1 70  ? -15.772 0.860   -0.667  1.00 0.00 ? 70  TYR A O    6  
ATOM 8602  C CB   . TYR A 1 70  ? -15.117 3.486   -2.235  1.00 0.00 ? 70  TYR A CB   6  
ATOM 8603  C CG   . TYR A 1 70  ? -15.361 4.846   -2.849  1.00 0.00 ? 70  TYR A CG   6  
ATOM 8604  C CD1  . TYR A 1 70  ? -15.675 4.975   -4.196  1.00 0.00 ? 70  TYR A CD1  6  
ATOM 8605  C CD2  . TYR A 1 70  ? -15.279 6.001   -2.082  1.00 0.00 ? 70  TYR A CD2  6  
ATOM 8606  C CE1  . TYR A 1 70  ? -15.898 6.216   -4.762  1.00 0.00 ? 70  TYR A CE1  6  
ATOM 8607  C CE2  . TYR A 1 70  ? -15.502 7.246   -2.638  1.00 0.00 ? 70  TYR A CE2  6  
ATOM 8608  C CZ   . TYR A 1 70  ? -15.811 7.348   -3.978  1.00 0.00 ? 70  TYR A CZ   6  
ATOM 8609  O OH   . TYR A 1 70  ? -16.034 8.585   -4.538  1.00 0.00 ? 70  TYR A OH   6  
ATOM 8610  H H    . TYR A 1 70  ? -17.427 2.758   -0.432  1.00 0.00 ? 70  TYR A H    6  
ATOM 8611  H HA   . TYR A 1 70  ? -16.762 2.560   -3.242  1.00 0.00 ? 70  TYR A HA   6  
ATOM 8612  H HB2  . TYR A 1 70  ? -14.796 3.636   -1.216  1.00 0.00 ? 70  TYR A HB2  6  
ATOM 8613  H HB3  . TYR A 1 70  ? -14.323 3.008   -2.790  1.00 0.00 ? 70  TYR A HB3  6  
ATOM 8614  H HD1  . TYR A 1 70  ? -15.743 4.086   -4.807  1.00 0.00 ? 70  TYR A HD1  6  
ATOM 8615  H HD2  . TYR A 1 70  ? -15.037 5.918   -1.032  1.00 0.00 ? 70  TYR A HD2  6  
ATOM 8616  H HE1  . TYR A 1 70  ? -16.140 6.296   -5.811  1.00 0.00 ? 70  TYR A HE1  6  
ATOM 8617  H HE2  . TYR A 1 70  ? -15.434 8.132   -2.025  1.00 0.00 ? 70  TYR A HE2  6  
ATOM 8618  H HH   . TYR A 1 70  ? -16.155 8.491   -5.485  1.00 0.00 ? 70  TYR A HH   6  
ATOM 8619  N N    . LYS A 1 71  ? -15.819 0.290   -2.842  1.00 0.00 ? 71  LYS A N    6  
ATOM 8620  C CA   . LYS A 1 71  ? -15.443 -1.098  -2.600  1.00 0.00 ? 71  LYS A CA   6  
ATOM 8621  C C    . LYS A 1 71  ? -14.237 -1.490  -3.448  1.00 0.00 ? 71  LYS A C    6  
ATOM 8622  O O    . LYS A 1 71  ? -14.245 -1.325  -4.668  1.00 0.00 ? 71  LYS A O    6  
ATOM 8623  C CB   . LYS A 1 71  ? -16.619 -2.027  -2.907  1.00 0.00 ? 71  LYS A CB   6  
ATOM 8624  C CG   . LYS A 1 71  ? -16.267 -3.502  -2.821  1.00 0.00 ? 71  LYS A CG   6  
ATOM 8625  C CD   . LYS A 1 71  ? -17.475 -4.381  -3.102  1.00 0.00 ? 71  LYS A CD   6  
ATOM 8626  C CE   . LYS A 1 71  ? -17.369 -5.719  -2.385  1.00 0.00 ? 71  LYS A CE   6  
ATOM 8627  N NZ   . LYS A 1 71  ? -18.199 -6.767  -3.041  1.00 0.00 ? 71  LYS A NZ   6  
ATOM 8628  H H    . LYS A 1 71  ? -15.977 0.589   -3.763  1.00 0.00 ? 71  LYS A H    6  
ATOM 8629  H HA   . LYS A 1 71  ? -15.182 -1.194  -1.558  1.00 0.00 ? 71  LYS A HA   6  
ATOM 8630  H HB2  . LYS A 1 71  ? -17.414 -1.827  -2.204  1.00 0.00 ? 71  LYS A HB2  6  
ATOM 8631  H HB3  . LYS A 1 71  ? -16.974 -1.821  -3.907  1.00 0.00 ? 71  LYS A HB3  6  
ATOM 8632  H HG2  . LYS A 1 71  ? -15.499 -3.723  -3.547  1.00 0.00 ? 71  LYS A HG2  6  
ATOM 8633  H HG3  . LYS A 1 71  ? -15.899 -3.718  -1.828  1.00 0.00 ? 71  LYS A HG3  6  
ATOM 8634  H HD2  . LYS A 1 71  ? -18.365 -3.874  -2.763  1.00 0.00 ? 71  LYS A HD2  6  
ATOM 8635  H HD3  . LYS A 1 71  ? -17.541 -4.557  -4.166  1.00 0.00 ? 71  LYS A HD3  6  
ATOM 8636  H HE2  . LYS A 1 71  ? -16.337 -6.034  -2.389  1.00 0.00 ? 71  LYS A HE2  6  
ATOM 8637  H HE3  . LYS A 1 71  ? -17.703 -5.593  -1.366  1.00 0.00 ? 71  LYS A HE3  6  
ATOM 8638  H HZ1  . LYS A 1 71  ? -18.644 -6.384  -3.900  1.00 0.00 ? 71  LYS A HZ1  6  
ATOM 8639  H HZ2  . LYS A 1 71  ? -18.945 -7.090  -2.393  1.00 0.00 ? 71  LYS A HZ2  6  
ATOM 8640  H HZ3  . LYS A 1 71  ? -17.606 -7.580  -3.304  1.00 0.00 ? 71  LYS A HZ3  6  
ATOM 8641  N N    . ILE A 1 72  ? -13.204 -2.010  -2.794  1.00 0.00 ? 72  ILE A N    6  
ATOM 8642  C CA   . ILE A 1 72  ? -11.992 -2.427  -3.488  1.00 0.00 ? 72  ILE A CA   6  
ATOM 8643  C C    . ILE A 1 72  ? -11.823 -3.942  -3.435  1.00 0.00 ? 72  ILE A C    6  
ATOM 8644  O O    . ILE A 1 72  ? -11.563 -4.511  -2.375  1.00 0.00 ? 72  ILE A O    6  
ATOM 8645  C CB   . ILE A 1 72  ? -10.741 -1.760  -2.888  1.00 0.00 ? 72  ILE A CB   6  
ATOM 8646  C CG1  . ILE A 1 72  ? -10.818 -0.241  -3.052  1.00 0.00 ? 72  ILE A CG1  6  
ATOM 8647  C CG2  . ILE A 1 72  ? -9.482  -2.307  -3.546  1.00 0.00 ? 72  ILE A CG2  6  
ATOM 8648  C CD1  . ILE A 1 72  ? -9.707  0.500   -2.342  1.00 0.00 ? 72  ILE A CD1  6  
ATOM 8649  H H    . ILE A 1 72  ? -13.258 -2.115  -1.821  1.00 0.00 ? 72  ILE A H    6  
ATOM 8650  H HA   . ILE A 1 72  ? -12.079 -2.122  -4.521  1.00 0.00 ? 72  ILE A HA   6  
ATOM 8651  H HB   . ILE A 1 72  ? -10.702 -2.000  -1.836  1.00 0.00 ? 72  ILE A HB   6  
ATOM 8652  H HG12 . ILE A 1 72  ? -10.762 0.005   -4.101  1.00 0.00 ? 72  ILE A HG12 6  
ATOM 8653  H HG13 . ILE A 1 72  ? -11.759 0.109   -2.654  1.00 0.00 ? 72  ILE A HG13 6  
ATOM 8654  H HG21 . ILE A 1 72  ? -8.779  -2.606  -2.783  1.00 0.00 ? 72  ILE A HG21 6  
ATOM 8655  H HG22 . ILE A 1 72  ? -9.737  -3.162  -4.154  1.00 0.00 ? 72  ILE A HG22 6  
ATOM 8656  H HG23 . ILE A 1 72  ? -9.039  -1.542  -4.165  1.00 0.00 ? 72  ILE A HG23 6  
ATOM 8657  H HD11 . ILE A 1 72  ? -8.769  0.309   -2.842  1.00 0.00 ? 72  ILE A HD11 6  
ATOM 8658  H HD12 . ILE A 1 72  ? -9.914  1.559   -2.355  1.00 0.00 ? 72  ILE A HD12 6  
ATOM 8659  H HD13 . ILE A 1 72  ? -9.644  0.159   -1.318  1.00 0.00 ? 72  ILE A HD13 6  
ATOM 8660  N N    . ASP A 1 73  ? -11.970 -4.589  -4.586  1.00 0.00 ? 73  ASP A N    6  
ATOM 8661  C CA   . ASP A 1 73  ? -11.830 -6.038  -4.672  1.00 0.00 ? 73  ASP A CA   6  
ATOM 8662  C C    . ASP A 1 73  ? -10.389 -6.427  -4.986  1.00 0.00 ? 73  ASP A C    6  
ATOM 8663  O O    . ASP A 1 73  ? -9.754  -5.843  -5.864  1.00 0.00 ? 73  ASP A O    6  
ATOM 8664  C CB   . ASP A 1 73  ? -12.768 -6.600  -5.741  1.00 0.00 ? 73  ASP A CB   6  
ATOM 8665  C CG   . ASP A 1 73  ? -14.228 -6.352  -5.419  1.00 0.00 ? 73  ASP A CG   6  
ATOM 8666  O OD1  . ASP A 1 73  ? -14.581 -6.357  -4.221  1.00 0.00 ? 73  ASP A OD1  6  
ATOM 8667  O OD2  . ASP A 1 73  ? -15.019 -6.153  -6.365  1.00 0.00 ? 73  ASP A OD2  6  
ATOM 8668  H H    . ASP A 1 73  ? -12.177 -4.080  -5.397  1.00 0.00 ? 73  ASP A H    6  
ATOM 8669  H HA   . ASP A 1 73  ? -12.102 -6.455  -3.713  1.00 0.00 ? 73  ASP A HA   6  
ATOM 8670  H HB2  . ASP A 1 73  ? -12.543 -6.132  -6.689  1.00 0.00 ? 73  ASP A HB2  6  
ATOM 8671  H HB3  . ASP A 1 73  ? -12.611 -7.665  -5.824  1.00 0.00 ? 73  ASP A HB3  6  
ATOM 8672  N N    . PHE A 1 74  ? -9.877  -7.417  -4.261  1.00 0.00 ? 74  PHE A N    6  
ATOM 8673  C CA   . PHE A 1 74  ? -8.510  -7.883  -4.461  1.00 0.00 ? 74  PHE A CA   6  
ATOM 8674  C C    . PHE A 1 74  ? -8.461  -8.995  -5.504  1.00 0.00 ? 74  PHE A C    6  
ATOM 8675  O O    . PHE A 1 74  ? -7.630  -8.973  -6.412  1.00 0.00 ? 74  PHE A O    6  
ATOM 8676  C CB   . PHE A 1 74  ? -7.921  -8.382  -3.140  1.00 0.00 ? 74  PHE A CB   6  
ATOM 8677  C CG   . PHE A 1 74  ? -7.627  -7.282  -2.161  1.00 0.00 ? 74  PHE A CG   6  
ATOM 8678  C CD1  . PHE A 1 74  ? -6.970  -6.132  -2.567  1.00 0.00 ? 74  PHE A CD1  6  
ATOM 8679  C CD2  . PHE A 1 74  ? -8.009  -7.397  -0.834  1.00 0.00 ? 74  PHE A CD2  6  
ATOM 8680  C CE1  . PHE A 1 74  ? -6.698  -5.118  -1.668  1.00 0.00 ? 74  PHE A CE1  6  
ATOM 8681  C CE2  . PHE A 1 74  ? -7.740  -6.386  0.070   1.00 0.00 ? 74  PHE A CE2  6  
ATOM 8682  C CZ   . PHE A 1 74  ? -7.084  -5.245  -0.348  1.00 0.00 ? 74  PHE A CZ   6  
ATOM 8683  H H    . PHE A 1 74  ? -10.433 -7.844  -3.575  1.00 0.00 ? 74  PHE A H    6  
ATOM 8684  H HA   . PHE A 1 74  ? -7.925  -7.048  -4.813  1.00 0.00 ? 74  PHE A HA   6  
ATOM 8685  H HB2  . PHE A 1 74  ? -8.621  -9.060  -2.675  1.00 0.00 ? 74  PHE A HB2  6  
ATOM 8686  H HB3  . PHE A 1 74  ? -6.998  -8.905  -3.340  1.00 0.00 ? 74  PHE A HB3  6  
ATOM 8687  H HD1  . PHE A 1 74  ? -6.668  -6.030  -3.599  1.00 0.00 ? 74  PHE A HD1  6  
ATOM 8688  H HD2  . PHE A 1 74  ? -8.523  -8.289  -0.505  1.00 0.00 ? 74  PHE A HD2  6  
ATOM 8689  H HE1  . PHE A 1 74  ? -6.185  -4.227  -1.998  1.00 0.00 ? 74  PHE A HE1  6  
ATOM 8690  H HE2  . PHE A 1 74  ? -8.044  -6.489  1.101   1.00 0.00 ? 74  PHE A HE2  6  
ATOM 8691  H HZ   . PHE A 1 74  ? -6.872  -4.454  0.356   1.00 0.00 ? 74  PHE A HZ   6  
ATOM 8692  N N    . ALA A 1 75  ? -9.358  -9.966  -5.368  1.00 0.00 ? 75  ALA A N    6  
ATOM 8693  C CA   . ALA A 1 75  ? -9.419  -11.086 -6.299  1.00 0.00 ? 75  ALA A CA   6  
ATOM 8694  C C    . ALA A 1 75  ? -9.454  -10.597 -7.744  1.00 0.00 ? 75  ALA A C    6  
ATOM 8695  O O    . ALA A 1 75  ? -8.603  -10.966 -8.553  1.00 0.00 ? 75  ALA A O    6  
ATOM 8696  C CB   . ALA A 1 75  ? -10.635 -11.952 -6.004  1.00 0.00 ? 75  ALA A CB   6  
ATOM 8697  H H    . ALA A 1 75  ? -9.995  -9.927  -4.624  1.00 0.00 ? 75  ALA A H    6  
ATOM 8698  H HA   . ALA A 1 75  ? -8.534  -11.689 -6.155  1.00 0.00 ? 75  ALA A HA   6  
ATOM 8699  H HB1  . ALA A 1 75  ? -10.358 -12.994 -6.071  1.00 0.00 ? 75  ALA A HB1  6  
ATOM 8700  H HB2  . ALA A 1 75  ? -10.995 -11.739 -5.009  1.00 0.00 ? 75  ALA A HB2  6  
ATOM 8701  H HB3  . ALA A 1 75  ? -11.412 -11.739 -6.722  1.00 0.00 ? 75  ALA A HB3  6  
ATOM 8702  N N    . GLU A 1 76  ? -10.443 -9.767  -8.059  1.00 0.00 ? 76  GLU A N    6  
ATOM 8703  C CA   . GLU A 1 76  ? -10.588 -9.231  -9.408  1.00 0.00 ? 76  GLU A CA   6  
ATOM 8704  C C    . GLU A 1 76  ? -9.499  -8.203  -9.704  1.00 0.00 ? 76  GLU A C    6  
ATOM 8705  O O    . GLU A 1 76  ? -9.401  -7.692  -10.819 1.00 0.00 ? 76  GLU A O    6  
ATOM 8706  C CB   . GLU A 1 76  ? -11.968 -8.593  -9.581  1.00 0.00 ? 76  GLU A CB   6  
ATOM 8707  C CG   . GLU A 1 76  ? -13.080 -9.601  -9.811  1.00 0.00 ? 76  GLU A CG   6  
ATOM 8708  C CD   . GLU A 1 76  ? -14.362 -8.955  -10.299 1.00 0.00 ? 76  GLU A CD   6  
ATOM 8709  O OE1  . GLU A 1 76  ? -14.715 -7.873  -9.785  1.00 0.00 ? 76  GLU A OE1  6  
ATOM 8710  O OE2  . GLU A 1 76  ? -15.012 -9.532  -11.197 1.00 0.00 ? 76  GLU A OE2  6  
ATOM 8711  H H    . GLU A 1 76  ? -11.090 -9.511  -7.370  1.00 0.00 ? 76  GLU A H    6  
ATOM 8712  H HA   . GLU A 1 76  ? -10.491 -10.051 -10.103 1.00 0.00 ? 76  GLU A HA   6  
ATOM 8713  H HB2  . GLU A 1 76  ? -12.202 -8.024  -8.693  1.00 0.00 ? 76  GLU A HB2  6  
ATOM 8714  H HB3  . GLU A 1 76  ? -11.937 -7.923  -10.428 1.00 0.00 ? 76  GLU A HB3  6  
ATOM 8715  H HG2  . GLU A 1 76  ? -12.752 -10.318 -10.549 1.00 0.00 ? 76  GLU A HG2  6  
ATOM 8716  H HG3  . GLU A 1 76  ? -13.284 -10.112 -8.881  1.00 0.00 ? 76  GLU A HG3  6  
ATOM 8717  N N    . MET A 1 77  ? -8.685  -7.906  -8.697  1.00 0.00 ? 77  MET A N    6  
ATOM 8718  C CA   . MET A 1 77  ? -7.603  -6.940  -8.849  1.00 0.00 ? 77  MET A CA   6  
ATOM 8719  C C    . MET A 1 77  ? -8.117  -5.639  -9.457  1.00 0.00 ? 77  MET A C    6  
ATOM 8720  O O    . MET A 1 77  ? -7.537  -5.112  -10.406 1.00 0.00 ? 77  MET A O    6  
ATOM 8721  C CB   . MET A 1 77  ? -6.491  -7.521  -9.726  1.00 0.00 ? 77  MET A CB   6  
ATOM 8722  C CG   . MET A 1 77  ? -5.420  -8.257  -8.939  1.00 0.00 ? 77  MET A CG   6  
ATOM 8723  S SD   . MET A 1 77  ? -4.075  -7.176  -8.416  1.00 0.00 ? 77  MET A SD   6  
ATOM 8724  C CE   . MET A 1 77  ? -4.487  -6.932  -6.690  1.00 0.00 ? 77  MET A CE   6  
ATOM 8725  H H    . MET A 1 77  ? -8.813  -8.346  -7.831  1.00 0.00 ? 77  MET A H    6  
ATOM 8726  H HA   . MET A 1 77  ? -7.204  -6.732  -7.868  1.00 0.00 ? 77  MET A HA   6  
ATOM 8727  H HB2  . MET A 1 77  ? -6.929  -8.212  -10.430 1.00 0.00 ? 77  MET A HB2  6  
ATOM 8728  H HB3  . MET A 1 77  ? -6.019  -6.716  -10.269 1.00 0.00 ? 77  MET A HB3  6  
ATOM 8729  H HG2  . MET A 1 77  ? -5.872  -8.694  -8.061  1.00 0.00 ? 77  MET A HG2  6  
ATOM 8730  H HG3  . MET A 1 77  ? -5.012  -9.042  -9.559  1.00 0.00 ? 77  MET A HG3  6  
ATOM 8731  H HE1  . MET A 1 77  ? -3.607  -7.085  -6.084  1.00 0.00 ? 77  MET A HE1  6  
ATOM 8732  H HE2  . MET A 1 77  ? -4.853  -5.926  -6.546  1.00 0.00 ? 77  MET A HE2  6  
ATOM 8733  H HE3  . MET A 1 77  ? -5.251  -7.639  -6.400  1.00 0.00 ? 77  MET A HE3  6  
ATOM 8734  N N    . LYS A 1 78  ? -9.210  -5.124  -8.903  1.00 0.00 ? 78  LYS A N    6  
ATOM 8735  C CA   . LYS A 1 78  ? -9.803  -3.884  -9.389  1.00 0.00 ? 78  LYS A CA   6  
ATOM 8736  C C    . LYS A 1 78  ? -10.625 -3.208  -8.296  1.00 0.00 ? 78  LYS A C    6  
ATOM 8737  O O    . LYS A 1 78  ? -11.004 -3.843  -7.312  1.00 0.00 ? 78  LYS A O    6  
ATOM 8738  C CB   . LYS A 1 78  ? -10.686 -4.160  -10.608 1.00 0.00 ? 78  LYS A CB   6  
ATOM 8739  C CG   . LYS A 1 78  ? -11.941 -4.951  -10.284 1.00 0.00 ? 78  LYS A CG   6  
ATOM 8740  C CD   . LYS A 1 78  ? -12.543 -5.578  -11.530 1.00 0.00 ? 78  LYS A CD   6  
ATOM 8741  C CE   . LYS A 1 78  ? -13.156 -4.527  -12.442 1.00 0.00 ? 78  LYS A CE   6  
ATOM 8742  N NZ   . LYS A 1 78  ? -13.437 -5.067  -13.801 1.00 0.00 ? 78  LYS A NZ   6  
ATOM 8743  H H    . LYS A 1 78  ? -9.628  -5.590  -8.148  1.00 0.00 ? 78  LYS A H    6  
ATOM 8744  H HA   . LYS A 1 78  ? -9.000  -3.223  -9.679  1.00 0.00 ? 78  LYS A HA   6  
ATOM 8745  H HB2  . LYS A 1 78  ? -10.982 -3.217  -11.044 1.00 0.00 ? 78  LYS A HB2  6  
ATOM 8746  H HB3  . LYS A 1 78  ? -10.112 -4.717  -11.334 1.00 0.00 ? 78  LYS A HB3  6  
ATOM 8747  H HG2  . LYS A 1 78  ? -11.691 -5.735  -9.584  1.00 0.00 ? 78  LYS A HG2  6  
ATOM 8748  H HG3  . LYS A 1 78  ? -12.669 -4.287  -9.838  1.00 0.00 ? 78  LYS A HG3  6  
ATOM 8749  H HD2  . LYS A 1 78  ? -11.767 -6.099  -12.071 1.00 0.00 ? 78  LYS A HD2  6  
ATOM 8750  H HD3  . LYS A 1 78  ? -13.312 -6.278  -11.235 1.00 0.00 ? 78  LYS A HD3  6  
ATOM 8751  H HE2  . LYS A 1 78  ? -14.079 -4.182  -12.003 1.00 0.00 ? 78  LYS A HE2  6  
ATOM 8752  H HE3  . LYS A 1 78  ? -12.468 -3.699  -12.529 1.00 0.00 ? 78  LYS A HE3  6  
ATOM 8753  H HZ1  . LYS A 1 78  ? -12.796 -5.859  -14.010 1.00 0.00 ? 78  LYS A HZ1  6  
ATOM 8754  H HZ2  . LYS A 1 78  ? -13.299 -4.326  -14.517 1.00 0.00 ? 78  LYS A HZ2  6  
ATOM 8755  H HZ3  . LYS A 1 78  ? -14.419 -5.407  -13.855 1.00 0.00 ? 78  LYS A HZ3  6  
ATOM 8756  N N    . GLN A 1 79  ? -10.896 -1.920  -8.476  1.00 0.00 ? 79  GLN A N    6  
ATOM 8757  C CA   . GLN A 1 79  ? -11.674 -1.160  -7.504  1.00 0.00 ? 79  GLN A CA   6  
ATOM 8758  C C    . GLN A 1 79  ? -13.123 -1.017  -7.958  1.00 0.00 ? 79  GLN A C    6  
ATOM 8759  O O    . GLN A 1 79  ? -13.396 -0.485  -9.034  1.00 0.00 ? 79  GLN A O    6  
ATOM 8760  C CB   . GLN A 1 79  ? -11.055 0.222   -7.293  1.00 0.00 ? 79  GLN A CB   6  
ATOM 8761  C CG   . GLN A 1 79  ? -11.989 1.210   -6.613  1.00 0.00 ? 79  GLN A CG   6  
ATOM 8762  C CD   . GLN A 1 79  ? -11.485 2.638   -6.690  1.00 0.00 ? 79  GLN A CD   6  
ATOM 8763  O OE1  . GLN A 1 79  ? -10.377 2.893   -7.162  1.00 0.00 ? 79  GLN A OE1  6  
ATOM 8764  N NE2  . GLN A 1 79  ? -12.298 3.579   -6.224  1.00 0.00 ? 79  GLN A NE2  6  
ATOM 8765  H H    . GLN A 1 79  ? -10.566 -1.470  -9.281  1.00 0.00 ? 79  GLN A H    6  
ATOM 8766  H HA   . GLN A 1 79  ? -11.654 -1.700  -6.570  1.00 0.00 ? 79  GLN A HA   6  
ATOM 8767  H HB2  . GLN A 1 79  ? -10.170 0.118   -6.683  1.00 0.00 ? 79  GLN A HB2  6  
ATOM 8768  H HB3  . GLN A 1 79  ? -10.774 0.629   -8.253  1.00 0.00 ? 79  GLN A HB3  6  
ATOM 8769  H HG2  . GLN A 1 79  ? -12.955 1.160   -7.093  1.00 0.00 ? 79  GLN A HG2  6  
ATOM 8770  H HG3  . GLN A 1 79  ? -12.090 0.934   -5.574  1.00 0.00 ? 79  GLN A HG3  6  
ATOM 8771  H HE21 . GLN A 1 79  ? -13.166 3.302   -5.861  1.00 0.00 ? 79  GLN A HE21 6  
ATOM 8772  H HE22 . GLN A 1 79  ? -11.997 4.510   -6.260  1.00 0.00 ? 79  GLN A HE22 6  
ATOM 8773  N N    . MET A 1 80  ? -14.047 -1.497  -7.132  1.00 0.00 ? 80  MET A N    6  
ATOM 8774  C CA   . MET A 1 80  ? -15.468 -1.422  -7.449  1.00 0.00 ? 80  MET A CA   6  
ATOM 8775  C C    . MET A 1 80  ? -16.098 -0.179  -6.829  1.00 0.00 ? 80  MET A C    6  
ATOM 8776  O O    . MET A 1 80  ? -16.142 -0.038  -5.607  1.00 0.00 ? 80  MET A O    6  
ATOM 8777  C CB   . MET A 1 80  ? -16.190 -2.676  -6.954  1.00 0.00 ? 80  MET A CB   6  
ATOM 8778  C CG   . MET A 1 80  ? -17.672 -2.698  -7.293  1.00 0.00 ? 80  MET A CG   6  
ATOM 8779  S SD   . MET A 1 80  ? -17.991 -3.259  -8.977  1.00 0.00 ? 80  MET A SD   6  
ATOM 8780  C CE   . MET A 1 80  ? -17.651 -5.011  -8.820  1.00 0.00 ? 80  MET A CE   6  
ATOM 8781  H H    . MET A 1 80  ? -13.767 -1.911  -6.289  1.00 0.00 ? 80  MET A H    6  
ATOM 8782  H HA   . MET A 1 80  ? -15.565 -1.362  -8.523  1.00 0.00 ? 80  MET A HA   6  
ATOM 8783  H HB2  . MET A 1 80  ? -15.728 -3.544  -7.400  1.00 0.00 ? 80  MET A HB2  6  
ATOM 8784  H HB3  . MET A 1 80  ? -16.088 -2.736  -5.880  1.00 0.00 ? 80  MET A HB3  6  
ATOM 8785  H HG2  . MET A 1 80  ? -18.175 -3.363  -6.607  1.00 0.00 ? 80  MET A HG2  6  
ATOM 8786  H HG3  . MET A 1 80  ? -18.067 -1.700  -7.179  1.00 0.00 ? 80  MET A HG3  6  
ATOM 8787  H HE1  . MET A 1 80  ? -16.769 -5.259  -9.391  1.00 0.00 ? 80  MET A HE1  6  
ATOM 8788  H HE2  . MET A 1 80  ? -17.488 -5.254  -7.781  1.00 0.00 ? 80  MET A HE2  6  
ATOM 8789  H HE3  . MET A 1 80  ? -18.493 -5.575  -9.194  1.00 0.00 ? 80  MET A HE3  6  
ATOM 8790  N N    . ASN A 1 81  ? -16.585 0.719   -7.679  1.00 0.00 ? 81  ASN A N    6  
ATOM 8791  C CA   . ASN A 1 81  ? -17.213 1.951   -7.212  1.00 0.00 ? 81  ASN A CA   6  
ATOM 8792  C C    . ASN A 1 81  ? -18.701 1.738   -6.951  1.00 0.00 ? 81  ASN A C    6  
ATOM 8793  O O    . ASN A 1 81  ? -19.363 0.972   -7.653  1.00 0.00 ? 81  ASN A O    6  
ATOM 8794  C CB   . ASN A 1 81  ? -17.019 3.067   -8.241  1.00 0.00 ? 81  ASN A CB   6  
ATOM 8795  C CG   . ASN A 1 81  ? -15.745 3.856   -8.005  1.00 0.00 ? 81  ASN A CG   6  
ATOM 8796  O OD1  . ASN A 1 81  ? -14.671 3.282   -7.827  1.00 0.00 ? 81  ASN A OD1  6  
ATOM 8797  N ND2  . ASN A 1 81  ? -15.861 5.178   -8.001  1.00 0.00 ? 81  ASN A ND2  6  
ATOM 8798  H H    . ASN A 1 81  ? -16.521 0.551   -8.642  1.00 0.00 ? 81  ASN A H    6  
ATOM 8799  H HA   . ASN A 1 81  ? -16.734 2.237   -6.288  1.00 0.00 ? 81  ASN A HA   6  
ATOM 8800  H HB2  . ASN A 1 81  ? -16.973 2.634   -9.229  1.00 0.00 ? 81  ASN A HB2  6  
ATOM 8801  H HB3  . ASN A 1 81  ? -17.856 3.746   -8.188  1.00 0.00 ? 81  ASN A HB3  6  
ATOM 8802  H HD21 . ASN A 1 81  ? -16.748 5.566   -8.149  1.00 0.00 ? 81  ASN A HD21 6  
ATOM 8803  H HD22 . ASN A 1 81  ? -15.053 5.713   -7.852  1.00 0.00 ? 81  ASN A HD22 6  
ATOM 8804  N N    . LEU A 1 82  ? -19.221 2.420   -5.936  1.00 0.00 ? 82  LEU A N    6  
ATOM 8805  C CA   . LEU A 1 82  ? -20.631 2.307   -5.581  1.00 0.00 ? 82  LEU A CA   6  
ATOM 8806  C C    . LEU A 1 82  ? -21.354 3.634   -5.792  1.00 0.00 ? 82  LEU A C    6  
ATOM 8807  O O    . LEU A 1 82  ? -22.506 3.664   -6.226  1.00 0.00 ? 82  LEU A O    6  
ATOM 8808  C CB   . LEU A 1 82  ? -20.777 1.859   -4.126  1.00 0.00 ? 82  LEU A CB   6  
ATOM 8809  C CG   . LEU A 1 82  ? -20.107 0.534   -3.761  1.00 0.00 ? 82  LEU A CG   6  
ATOM 8810  C CD1  . LEU A 1 82  ? -20.820 -0.628  -4.435  1.00 0.00 ? 82  LEU A CD1  6  
ATOM 8811  C CD2  . LEU A 1 82  ? -18.635 0.556   -4.149  1.00 0.00 ? 82  LEU A CD2  6  
ATOM 8812  H H    . LEU A 1 82  ? -18.643 3.014   -5.413  1.00 0.00 ? 82  LEU A H    6  
ATOM 8813  H HA   . LEU A 1 82  ? -21.076 1.563   -6.225  1.00 0.00 ? 82  LEU A HA   6  
ATOM 8814  H HB2  . LEU A 1 82  ? -20.351 2.628   -3.500  1.00 0.00 ? 82  LEU A HB2  6  
ATOM 8815  H HB3  . LEU A 1 82  ? -21.832 1.767   -3.913  1.00 0.00 ? 82  LEU A HB3  6  
ATOM 8816  H HG   . LEU A 1 82  ? -20.170 0.388   -2.692  1.00 0.00 ? 82  LEU A HG   6  
ATOM 8817  H HD11 . LEU A 1 82  ? -21.751 -0.823  -3.926  1.00 0.00 ? 82  LEU A HD11 6  
ATOM 8818  H HD12 . LEU A 1 82  ? -20.195 -1.508  -4.392  1.00 0.00 ? 82  LEU A HD12 6  
ATOM 8819  H HD13 . LEU A 1 82  ? -21.018 -0.378  -5.467  1.00 0.00 ? 82  LEU A HD13 6  
ATOM 8820  H HD21 . LEU A 1 82  ? -18.524 0.189   -5.158  1.00 0.00 ? 82  LEU A HD21 6  
ATOM 8821  H HD22 . LEU A 1 82  ? -18.076 -0.075  -3.473  1.00 0.00 ? 82  LEU A HD22 6  
ATOM 8822  H HD23 . LEU A 1 82  ? -18.262 1.567   -4.089  1.00 0.00 ? 82  LEU A HD23 6  
ATOM 8823  N N    . THR A 1 83  ? -20.668 4.731   -5.483  1.00 0.00 ? 83  THR A N    6  
ATOM 8824  C CA   . THR A 1 83  ? -21.244 6.060   -5.639  1.00 0.00 ? 83  THR A CA   6  
ATOM 8825  C C    . THR A 1 83  ? -21.606 6.336   -7.094  1.00 0.00 ? 83  THR A C    6  
ATOM 8826  O O    . THR A 1 83  ? -22.722 6.760   -7.398  1.00 0.00 ? 83  THR A O    6  
ATOM 8827  C CB   . THR A 1 83  ? -20.275 7.153   -5.147  1.00 0.00 ? 83  THR A CB   6  
ATOM 8828  O OG1  . THR A 1 83  ? -20.832 8.449   -5.395  1.00 0.00 ? 83  THR A OG1  6  
ATOM 8829  C CG2  . THR A 1 83  ? -18.927 7.033   -5.842  1.00 0.00 ? 83  THR A CG2  6  
ATOM 8830  H H    . THR A 1 83  ? -19.754 4.641   -5.141  1.00 0.00 ? 83  THR A H    6  
ATOM 8831  H HA   . THR A 1 83  ? -22.141 6.108   -5.039  1.00 0.00 ? 83  THR A HA   6  
ATOM 8832  H HB   . THR A 1 83  ? -20.127 7.030   -4.084  1.00 0.00 ? 83  THR A HB   6  
ATOM 8833  H HG1  . THR A 1 83  ? -21.742 8.355   -5.688  1.00 0.00 ? 83  THR A HG1  6  
ATOM 8834  H HG21 . THR A 1 83  ? -18.624 5.997   -5.865  1.00 0.00 ? 83  THR A HG21 6  
ATOM 8835  H HG22 . THR A 1 83  ? -18.192 7.612   -5.304  1.00 0.00 ? 83  THR A HG22 6  
ATOM 8836  H HG23 . THR A 1 83  ? -19.010 7.405   -6.852  1.00 0.00 ? 83  THR A HG23 6  
ATOM 8837  N N    . THR A 1 84  ? -20.657 6.091   -7.992  1.00 0.00 ? 84  THR A N    6  
ATOM 8838  C CA   . THR A 1 84  ? -20.876 6.313   -9.415  1.00 0.00 ? 84  THR A CA   6  
ATOM 8839  C C    . THR A 1 84  ? -20.984 4.992   -10.168 1.00 0.00 ? 84  THR A C    6  
ATOM 8840  O O    . THR A 1 84  ? -21.612 4.916   -11.223 1.00 0.00 ? 84  THR A O    6  
ATOM 8841  C CB   . THR A 1 84  ? -19.742 7.152   -10.034 1.00 0.00 ? 84  THR A CB   6  
ATOM 8842  O OG1  . THR A 1 84  ? -18.532 6.386   -10.075 1.00 0.00 ? 84  THR A OG1  6  
ATOM 8843  C CG2  . THR A 1 84  ? -19.514 8.427   -9.236  1.00 0.00 ? 84  THR A CG2  6  
ATOM 8844  H H    . THR A 1 84  ? -19.788 5.754   -7.688  1.00 0.00 ? 84  THR A H    6  
ATOM 8845  H HA   . THR A 1 84  ? -21.802 6.858   -9.529  1.00 0.00 ? 84  THR A HA   6  
ATOM 8846  H HB   . THR A 1 84  ? -20.023 7.421   -11.042 1.00 0.00 ? 84  THR A HB   6  
ATOM 8847  H HG1  . THR A 1 84  ? -17.890 6.832   -10.633 1.00 0.00 ? 84  THR A HG1  6  
ATOM 8848  H HG21 . THR A 1 84  ? -20.262 8.505   -8.461  1.00 0.00 ? 84  THR A HG21 6  
ATOM 8849  H HG22 . THR A 1 84  ? -19.585 9.280   -9.893  1.00 0.00 ? 84  THR A HG22 6  
ATOM 8850  H HG23 . THR A 1 84  ? -18.533 8.399   -8.786  1.00 0.00 ? 84  THR A HG23 6  
ATOM 8851  N N    . GLY A 1 85  ? -20.367 3.950   -9.617  1.00 0.00 ? 85  GLY A N    6  
ATOM 8852  C CA   . GLY A 1 85  ? -20.407 2.645   -10.250 1.00 0.00 ? 85  GLY A CA   6  
ATOM 8853  C C    . GLY A 1 85  ? -19.342 2.485   -11.317 1.00 0.00 ? 85  GLY A C    6  
ATOM 8854  O O    . GLY A 1 85  ? -19.471 1.652   -12.214 1.00 0.00 ? 85  GLY A O    6  
ATOM 8855  H H    . GLY A 1 85  ? -19.881 4.069   -8.774  1.00 0.00 ? 85  GLY A H    6  
ATOM 8856  H HA2  . GLY A 1 85  ? -20.262 1.886   -9.495  1.00 0.00 ? 85  GLY A HA2  6  
ATOM 8857  H HA3  . GLY A 1 85  ? -21.378 2.507   -10.703 1.00 0.00 ? 85  GLY A HA3  6  
ATOM 8858  N N    . LYS A 1 86  ? -18.287 3.287   -11.222 1.00 0.00 ? 86  LYS A N    6  
ATOM 8859  C CA   . LYS A 1 86  ? -17.195 3.233   -12.187 1.00 0.00 ? 86  LYS A CA   6  
ATOM 8860  C C    . LYS A 1 86  ? -16.292 2.033   -11.919 1.00 0.00 ? 86  LYS A C    6  
ATOM 8861  O O    . LYS A 1 86  ? -16.459 1.330   -10.923 1.00 0.00 ? 86  LYS A O    6  
ATOM 8862  C CB   . LYS A 1 86  ? -16.376 4.524   -12.134 1.00 0.00 ? 86  LYS A CB   6  
ATOM 8863  C CG   . LYS A 1 86  ? -17.105 5.731   -12.699 1.00 0.00 ? 86  LYS A CG   6  
ATOM 8864  C CD   . LYS A 1 86  ? -17.050 5.756   -14.217 1.00 0.00 ? 86  LYS A CD   6  
ATOM 8865  C CE   . LYS A 1 86  ? -17.689 7.018   -14.777 1.00 0.00 ? 86  LYS A CE   6  
ATOM 8866  N NZ   . LYS A 1 86  ? -17.334 7.232   -16.207 1.00 0.00 ? 86  LYS A NZ   6  
ATOM 8867  H H    . LYS A 1 86  ? -18.241 3.931   -10.485 1.00 0.00 ? 86  LYS A H    6  
ATOM 8868  H HA   . LYS A 1 86  ? -17.627 3.130   -13.171 1.00 0.00 ? 86  LYS A HA   6  
ATOM 8869  H HB2  . LYS A 1 86  ? -16.120 4.732   -11.106 1.00 0.00 ? 86  LYS A HB2  6  
ATOM 8870  H HB3  . LYS A 1 86  ? -15.466 4.383   -12.701 1.00 0.00 ? 86  LYS A HB3  6  
ATOM 8871  H HG2  . LYS A 1 86  ? -18.139 5.693   -12.388 1.00 0.00 ? 86  LYS A HG2  6  
ATOM 8872  H HG3  . LYS A 1 86  ? -16.645 6.630   -12.315 1.00 0.00 ? 86  LYS A HG3  6  
ATOM 8873  H HD2  . LYS A 1 86  ? -16.018 5.719   -14.532 1.00 0.00 ? 86  LYS A HD2  6  
ATOM 8874  H HD3  . LYS A 1 86  ? -17.577 4.895   -14.602 1.00 0.00 ? 86  LYS A HD3  6  
ATOM 8875  H HE2  . LYS A 1 86  ? -18.761 6.933   -14.690 1.00 0.00 ? 86  LYS A HE2  6  
ATOM 8876  H HE3  . LYS A 1 86  ? -17.347 7.865   -14.200 1.00 0.00 ? 86  LYS A HE3  6  
ATOM 8877  H HZ1  . LYS A 1 86  ? -16.322 7.044   -16.356 1.00 0.00 ? 86  LYS A HZ1  6  
ATOM 8878  H HZ2  . LYS A 1 86  ? -17.537 8.214   -16.483 1.00 0.00 ? 86  LYS A HZ2  6  
ATOM 8879  H HZ3  . LYS A 1 86  ? -17.887 6.592   -16.812 1.00 0.00 ? 86  LYS A HZ3  6  
ATOM 8880  N N    . GLN A 1 87  ? -15.334 1.808   -12.813 1.00 0.00 ? 87  GLN A N    6  
ATOM 8881  C CA   . GLN A 1 87  ? -14.404 0.694   -12.670 1.00 0.00 ? 87  GLN A CA   6  
ATOM 8882  C C    . GLN A 1 87  ? -12.976 1.136   -12.973 1.00 0.00 ? 87  GLN A C    6  
ATOM 8883  O O    . GLN A 1 87  ? -12.739 1.919   -13.892 1.00 0.00 ? 87  GLN A O    6  
ATOM 8884  C CB   . GLN A 1 87  ? -14.803 -0.453  -13.600 1.00 0.00 ? 87  GLN A CB   6  
ATOM 8885  C CG   . GLN A 1 87  ? -14.589 -0.145  -15.073 1.00 0.00 ? 87  GLN A CG   6  
ATOM 8886  C CD   . GLN A 1 87  ? -15.475 -0.978  -15.978 1.00 0.00 ? 87  GLN A CD   6  
ATOM 8887  O OE1  . GLN A 1 87  ? -16.337 -1.722  -15.509 1.00 0.00 ? 87  GLN A OE1  6  
ATOM 8888  N NE2  . GLN A 1 87  ? -15.267 -0.858  -17.284 1.00 0.00 ? 87  GLN A NE2  6  
ATOM 8889  H H    . GLN A 1 87  ? -15.251 2.404   -13.585 1.00 0.00 ? 87  GLN A H    6  
ATOM 8890  H HA   . GLN A 1 87  ? -14.452 0.351   -11.648 1.00 0.00 ? 87  GLN A HA   6  
ATOM 8891  H HB2  . GLN A 1 87  ? -14.219 -1.325  -13.348 1.00 0.00 ? 87  GLN A HB2  6  
ATOM 8892  H HB3  . GLN A 1 87  ? -15.850 -0.675  -13.449 1.00 0.00 ? 87  GLN A HB3  6  
ATOM 8893  H HG2  . GLN A 1 87  ? -14.806 0.899   -15.245 1.00 0.00 ? 87  GLN A HG2  6  
ATOM 8894  H HG3  . GLN A 1 87  ? -13.557 -0.343  -15.322 1.00 0.00 ? 87  GLN A HG3  6  
ATOM 8895  H HE21 . GLN A 1 87  ? -14.562 -0.247  -17.586 1.00 0.00 ? 87  GLN A HE21 6  
ATOM 8896  H HE22 . GLN A 1 87  ? -15.825 -1.386  -17.892 1.00 0.00 ? 87  GLN A HE22 6  
ATOM 8897  N N    . ARG A 1 88  ? -12.027 0.628   -12.193 1.00 0.00 ? 88  ARG A N    6  
ATOM 8898  C CA   . ARG A 1 88  ? -10.622 0.971   -12.376 1.00 0.00 ? 88  ARG A CA   6  
ATOM 8899  C C    . ARG A 1 88  ? -9.718  -0.140  -11.850 1.00 0.00 ? 88  ARG A C    6  
ATOM 8900  O O    . ARG A 1 88  ? -9.925  -0.656  -10.751 1.00 0.00 ? 88  ARG A O    6  
ATOM 8901  C CB   . ARG A 1 88  ? -10.299 2.286   -11.665 1.00 0.00 ? 88  ARG A CB   6  
ATOM 8902  C CG   . ARG A 1 88  ? -11.193 3.441   -12.084 1.00 0.00 ? 88  ARG A CG   6  
ATOM 8903  C CD   . ARG A 1 88  ? -10.804 4.731   -11.380 1.00 0.00 ? 88  ARG A CD   6  
ATOM 8904  N NE   . ARG A 1 88  ? -11.697 5.835   -11.725 1.00 0.00 ? 88  ARG A NE   6  
ATOM 8905  C CZ   . ARG A 1 88  ? -11.574 7.062   -11.232 1.00 0.00 ? 88  ARG A CZ   6  
ATOM 8906  N NH1  . ARG A 1 88  ? -10.600 7.341   -10.376 1.00 0.00 ? 88  ARG A NH1  6  
ATOM 8907  N NH2  . ARG A 1 88  ? -12.425 8.012   -11.595 1.00 0.00 ? 88  ARG A NH2  6  
ATOM 8908  H H    . ARG A 1 88  ? -12.278 0.008   -11.476 1.00 0.00 ? 88  ARG A H    6  
ATOM 8909  H HA   . ARG A 1 88  ? -10.445 1.092   -13.435 1.00 0.00 ? 88  ARG A HA   6  
ATOM 8910  H HB2  . ARG A 1 88  ? -10.410 2.143   -10.600 1.00 0.00 ? 88  ARG A HB2  6  
ATOM 8911  H HB3  . ARG A 1 88  ? -9.276  2.555   -11.879 1.00 0.00 ? 88  ARG A HB3  6  
ATOM 8912  H HG2  . ARG A 1 88  ? -11.103 3.586   -13.151 1.00 0.00 ? 88  ARG A HG2  6  
ATOM 8913  H HG3  . ARG A 1 88  ? -12.216 3.200   -11.837 1.00 0.00 ? 88  ARG A HG3  6  
ATOM 8914  H HD2  . ARG A 1 88  ? -10.845 4.569   -10.313 1.00 0.00 ? 88  ARG A HD2  6  
ATOM 8915  H HD3  . ARG A 1 88  ? -9.797  4.992   -11.666 1.00 0.00 ? 88  ARG A HD3  6  
ATOM 8916  H HE   . ARG A 1 88  ? -12.423 5.650   -12.356 1.00 0.00 ? 88  ARG A HE   6  
ATOM 8917  H HH11 . ARG A 1 88  ? -9.956  6.627   -10.102 1.00 0.00 ? 88  ARG A HH11 6  
ATOM 8918  H HH12 . ARG A 1 88  ? -10.509 8.267   -10.007 1.00 0.00 ? 88  ARG A HH12 6  
ATOM 8919  H HH21 . ARG A 1 88  ? -13.161 7.805   -12.240 1.00 0.00 ? 88  ARG A HH21 6  
ATOM 8920  H HH22 . ARG A 1 88  ? -12.332 8.935   -11.223 1.00 0.00 ? 88  ARG A HH22 6  
ATOM 8921  N N    . LEU A 1 89  ? -8.715  -0.503  -12.642 1.00 0.00 ? 89  LEU A N    6  
ATOM 8922  C CA   . LEU A 1 89  ? -7.778  -1.554  -12.257 1.00 0.00 ? 89  LEU A CA   6  
ATOM 8923  C C    . LEU A 1 89  ? -6.874  -1.087  -11.121 1.00 0.00 ? 89  LEU A C    6  
ATOM 8924  O O    . LEU A 1 89  ? -6.802  0.105   -10.821 1.00 0.00 ? 89  LEU A O    6  
ATOM 8925  C CB   . LEU A 1 89  ? -6.931  -1.974  -13.459 1.00 0.00 ? 89  LEU A CB   6  
ATOM 8926  C CG   . LEU A 1 89  ? -7.501  -3.101  -14.321 1.00 0.00 ? 89  LEU A CG   6  
ATOM 8927  C CD1  . LEU A 1 89  ? -8.991  -2.896  -14.550 1.00 0.00 ? 89  LEU A CD1  6  
ATOM 8928  C CD2  . LEU A 1 89  ? -6.762  -3.184  -15.648 1.00 0.00 ? 89  LEU A CD2  6  
ATOM 8929  H H    . LEU A 1 89  ? -8.600  -0.056  -13.506 1.00 0.00 ? 89  LEU A H    6  
ATOM 8930  H HA   . LEU A 1 89  ? -8.353  -2.402  -11.917 1.00 0.00 ? 89  LEU A HA   6  
ATOM 8931  H HB2  . LEU A 1 89  ? -6.800  -1.109  -14.090 1.00 0.00 ? 89  LEU A HB2  6  
ATOM 8932  H HB3  . LEU A 1 89  ? -5.968  -2.296  -13.087 1.00 0.00 ? 89  LEU A HB3  6  
ATOM 8933  H HG   . LEU A 1 89  ? -7.370  -4.042  -13.805 1.00 0.00 ? 89  LEU A HG   6  
ATOM 8934  H HD11 . LEU A 1 89  ? -9.305  -3.467  -15.410 1.00 0.00 ? 89  LEU A HD11 6  
ATOM 8935  H HD12 . LEU A 1 89  ? -9.187  -1.848  -14.723 1.00 0.00 ? 89  LEU A HD12 6  
ATOM 8936  H HD13 . LEU A 1 89  ? -9.538  -3.225  -13.679 1.00 0.00 ? 89  LEU A HD13 6  
ATOM 8937  H HD21 . LEU A 1 89  ? -6.506  -2.188  -15.980 1.00 0.00 ? 89  LEU A HD21 6  
ATOM 8938  H HD22 . LEU A 1 89  ? -7.396  -3.656  -16.385 1.00 0.00 ? 89  LEU A HD22 6  
ATOM 8939  H HD23 . LEU A 1 89  ? -5.860  -3.765  -15.522 1.00 0.00 ? 89  LEU A HD23 6  
ATOM 8940  N N    . ILE A 1 90  ? -6.184  -2.033  -10.494 1.00 0.00 ? 90  ILE A N    6  
ATOM 8941  C CA   . ILE A 1 90  ? -5.281  -1.718  -9.393  1.00 0.00 ? 90  ILE A CA   6  
ATOM 8942  C C    . ILE A 1 90  ? -3.981  -2.508  -9.505  1.00 0.00 ? 90  ILE A C    6  
ATOM 8943  O O    . ILE A 1 90  ? -3.888  -3.467  -10.272 1.00 0.00 ? 90  ILE A O    6  
ATOM 8944  C CB   . ILE A 1 90  ? -5.932  -2.013  -8.029  1.00 0.00 ? 90  ILE A CB   6  
ATOM 8945  C CG1  . ILE A 1 90  ? -6.433  -3.458  -7.980  1.00 0.00 ? 90  ILE A CG1  6  
ATOM 8946  C CG2  . ILE A 1 90  ? -7.073  -1.042  -7.766  1.00 0.00 ? 90  ILE A CG2  6  
ATOM 8947  C CD1  . ILE A 1 90  ? -7.102  -3.821  -6.673  1.00 0.00 ? 90  ILE A CD1  6  
ATOM 8948  H H    . ILE A 1 90  ? -6.283  -2.966  -10.778 1.00 0.00 ? 90  ILE A H    6  
ATOM 8949  H HA   . ILE A 1 90  ? -5.054  -0.663  -9.441  1.00 0.00 ? 90  ILE A HA   6  
ATOM 8950  H HB   . ILE A 1 90  ? -5.187  -1.872  -7.262  1.00 0.00 ? 90  ILE A HB   6  
ATOM 8951  H HG12 . ILE A 1 90  ? -7.149  -3.611  -8.772  1.00 0.00 ? 90  ILE A HG12 6  
ATOM 8952  H HG13 . ILE A 1 90  ? -5.596  -4.126  -8.123  1.00 0.00 ? 90  ILE A HG13 6  
ATOM 8953  H HG21 . ILE A 1 90  ? -7.926  -1.315  -8.371  1.00 0.00 ? 90  ILE A HG21 6  
ATOM 8954  H HG22 . ILE A 1 90  ? -7.346  -1.082  -6.722  1.00 0.00 ? 90  ILE A HG22 6  
ATOM 8955  H HG23 . ILE A 1 90  ? -6.759  -0.040  -8.019  1.00 0.00 ? 90  ILE A HG23 6  
ATOM 8956  H HD11 . ILE A 1 90  ? -6.552  -4.619  -6.196  1.00 0.00 ? 90  ILE A HD11 6  
ATOM 8957  H HD12 . ILE A 1 90  ? -7.122  -2.958  -6.026  1.00 0.00 ? 90  ILE A HD12 6  
ATOM 8958  H HD13 . ILE A 1 90  ? -8.114  -4.149  -6.866  1.00 0.00 ? 90  ILE A HD13 6  
ATOM 8959  N N    . LYS A 1 91  ? -2.980  -2.100  -8.734  1.00 0.00 ? 91  LYS A N    6  
ATOM 8960  C CA   . LYS A 1 91  ? -1.685  -2.770  -8.742  1.00 0.00 ? 91  LYS A CA   6  
ATOM 8961  C C    . LYS A 1 91  ? -0.907  -2.467  -7.465  1.00 0.00 ? 91  LYS A C    6  
ATOM 8962  O O    . LYS A 1 91  ? -1.040  -1.388  -6.888  1.00 0.00 ? 91  LYS A O    6  
ATOM 8963  C CB   . LYS A 1 91  ? -0.871  -2.336  -9.963  1.00 0.00 ? 91  LYS A CB   6  
ATOM 8964  C CG   . LYS A 1 91  ? -0.504  -0.862  -9.957  1.00 0.00 ? 91  LYS A CG   6  
ATOM 8965  C CD   . LYS A 1 91  ? 0.490   -0.530  -11.057 1.00 0.00 ? 91  LYS A CD   6  
ATOM 8966  C CE   . LYS A 1 91  ? 1.293   0.718   -10.725 1.00 0.00 ? 91  LYS A CE   6  
ATOM 8967  N NZ   . LYS A 1 91  ? 2.381   0.956   -11.713 1.00 0.00 ? 91  LYS A NZ   6  
ATOM 8968  H H    . LYS A 1 91  ? -3.115  -1.329  -8.143  1.00 0.00 ? 91  LYS A H    6  
ATOM 8969  H HA   . LYS A 1 91  ? -1.862  -3.834  -8.798  1.00 0.00 ? 91  LYS A HA   6  
ATOM 8970  H HB2  . LYS A 1 91  ? 0.042   -2.913  -9.995  1.00 0.00 ? 91  LYS A HB2  6  
ATOM 8971  H HB3  . LYS A 1 91  ? -1.446  -2.539  -10.855 1.00 0.00 ? 91  LYS A HB3  6  
ATOM 8972  H HG2  . LYS A 1 91  ? -1.399  -0.277  -10.107 1.00 0.00 ? 91  LYS A HG2  6  
ATOM 8973  H HG3  . LYS A 1 91  ? -0.065  -0.614  -9.001  1.00 0.00 ? 91  LYS A HG3  6  
ATOM 8974  H HD2  . LYS A 1 91  ? 1.169   -1.360  -11.180 1.00 0.00 ? 91  LYS A HD2  6  
ATOM 8975  H HD3  . LYS A 1 91  ? -0.050  -0.365  -11.980 1.00 0.00 ? 91  LYS A HD3  6  
ATOM 8976  H HE2  . LYS A 1 91  ? 0.629   1.568   -10.721 1.00 0.00 ? 91  LYS A HE2  6  
ATOM 8977  H HE3  . LYS A 1 91  ? 1.729   0.598   -9.744  1.00 0.00 ? 91  LYS A HE3  6  
ATOM 8978  H HZ1  . LYS A 1 91  ? 2.596   0.078   -12.226 1.00 0.00 ? 91  LYS A HZ1  6  
ATOM 8979  H HZ2  . LYS A 1 91  ? 3.242   1.279   -11.226 1.00 0.00 ? 91  LYS A HZ2  6  
ATOM 8980  H HZ3  . LYS A 1 91  ? 2.090   1.683   -12.397 1.00 0.00 ? 91  LYS A HZ3  6  
ATOM 8981  N N    . ARG A 1 92  ? -0.095  -3.426  -7.031  1.00 0.00 ? 92  ARG A N    6  
ATOM 8982  C CA   . ARG A 1 92  ? 0.705   -3.260  -5.823  1.00 0.00 ? 92  ARG A CA   6  
ATOM 8983  C C    . ARG A 1 92  ? 2.188   -3.150  -6.163  1.00 0.00 ? 92  ARG A C    6  
ATOM 8984  O O    . ARG A 1 92  ? 2.793   -4.098  -6.663  1.00 0.00 ? 92  ARG A O    6  
ATOM 8985  C CB   . ARG A 1 92  ? 0.475   -4.435  -4.870  1.00 0.00 ? 92  ARG A CB   6  
ATOM 8986  C CG   . ARG A 1 92  ? 1.206   -4.295  -3.545  1.00 0.00 ? 92  ARG A CG   6  
ATOM 8987  C CD   . ARG A 1 92  ? 0.598   -5.190  -2.476  1.00 0.00 ? 92  ARG A CD   6  
ATOM 8988  N NE   . ARG A 1 92  ? 1.145   -6.544  -2.520  1.00 0.00 ? 92  ARG A NE   6  
ATOM 8989  C CZ   . ARG A 1 92  ? 2.413   -6.833  -2.248  1.00 0.00 ? 92  ARG A CZ   6  
ATOM 8990  N NH1  . ARG A 1 92  ? 3.259   -5.869  -1.913  1.00 0.00 ? 92  ARG A NH1  6  
ATOM 8991  N NH2  . ARG A 1 92  ? 2.835   -8.090  -2.309  1.00 0.00 ? 92  ARG A NH2  6  
ATOM 8992  H H    . ARG A 1 92  ? -0.032  -4.264  -7.535  1.00 0.00 ? 92  ARG A H    6  
ATOM 8993  H HA   . ARG A 1 92  ? 0.389   -2.348  -5.339  1.00 0.00 ? 92  ARG A HA   6  
ATOM 8994  H HB2  . ARG A 1 92  ? -0.582  -4.517  -4.666  1.00 0.00 ? 92  ARG A HB2  6  
ATOM 8995  H HB3  . ARG A 1 92  ? 0.813   -5.342  -5.348  1.00 0.00 ? 92  ARG A HB3  6  
ATOM 8996  H HG2  . ARG A 1 92  ? 2.241   -4.571  -3.684  1.00 0.00 ? 92  ARG A HG2  6  
ATOM 8997  H HG3  . ARG A 1 92  ? 1.146   -3.268  -3.218  1.00 0.00 ? 92  ARG A HG3  6  
ATOM 8998  H HD2  . ARG A 1 92  ? 0.803   -4.761  -1.507  1.00 0.00 ? 92  ARG A HD2  6  
ATOM 8999  H HD3  . ARG A 1 92  ? -0.469  -5.238  -2.631  1.00 0.00 ? 92  ARG A HD3  6  
ATOM 9000  H HE   . ARG A 1 92  ? 0.537   -7.271  -2.765  1.00 0.00 ? 92  ARG A HE   6  
ATOM 9001  H HH11 . ARG A 1 92  ? 2.943   -4.922  -1.865  1.00 0.00 ? 92  ARG A HH11 6  
ATOM 9002  H HH12 . ARG A 1 92  ? 4.213   -6.090  -1.708  1.00 0.00 ? 92  ARG A HH12 6  
ATOM 9003  H HH21 . ARG A 1 92  ? 2.200   -8.819  -2.561  1.00 0.00 ? 92  ARG A HH21 6  
ATOM 9004  H HH22 . ARG A 1 92  ? 3.789   -8.307  -2.104  1.00 0.00 ? 92  ARG A HH22 6  
ATOM 9005  N N    . ALA A 1 93  ? 2.767   -1.985  -5.889  1.00 0.00 ? 93  ALA A N    6  
ATOM 9006  C CA   . ALA A 1 93  ? 4.179   -1.751  -6.165  1.00 0.00 ? 93  ALA A CA   6  
ATOM 9007  C C    . ALA A 1 93  ? 4.795   -0.821  -5.125  1.00 0.00 ? 93  ALA A C    6  
ATOM 9008  O O    . ALA A 1 93  ? 4.111   -0.009  -4.502  1.00 0.00 ? 93  ALA A O    6  
ATOM 9009  C CB   . ALA A 1 93  ? 4.356   -1.174  -7.562  1.00 0.00 ? 93  ALA A CB   6  
ATOM 9010  H H    . ALA A 1 93  ? 2.232   -1.267  -5.491  1.00 0.00 ? 93  ALA A H    6  
ATOM 9011  H HA   . ALA A 1 93  ? 4.689   -2.703  -6.128  1.00 0.00 ? 93  ALA A HA   6  
ATOM 9012  H HB1  . ALA A 1 93  ? 4.079   -1.918  -8.295  1.00 0.00 ? 93  ALA A HB1  6  
ATOM 9013  H HB2  . ALA A 1 93  ? 3.725   -0.305  -7.675  1.00 0.00 ? 93  ALA A HB2  6  
ATOM 9014  H HB3  . ALA A 1 93  ? 5.388   -0.893  -7.707  1.00 0.00 ? 93  ALA A HB3  6  
ATOM 9015  N N    . PRO A 1 94  ? 6.116   -0.941  -4.931  1.00 0.00 ? 94  PRO A N    6  
ATOM 9016  C CA   . PRO A 1 94  ? 6.853   -0.118  -3.966  1.00 0.00 ? 94  PRO A CA   6  
ATOM 9017  C C    . PRO A 1 94  ? 6.950   1.339   -4.402  1.00 0.00 ? 94  PRO A C    6  
ATOM 9018  O O    . PRO A 1 94  ? 7.060   1.636   -5.592  1.00 0.00 ? 94  PRO A O    6  
ATOM 9019  C CB   . PRO A 1 94  ? 8.241   -0.762  -3.939  1.00 0.00 ? 94  PRO A CB   6  
ATOM 9020  C CG   . PRO A 1 94  ? 8.376   -1.429  -5.264  1.00 0.00 ? 94  PRO A CG   6  
ATOM 9021  C CD   . PRO A 1 94  ? 6.994   -1.888  -5.639  1.00 0.00 ? 94  PRO A CD   6  
ATOM 9022  H HA   . PRO A 1 94  ? 6.410   -0.170  -2.982  1.00 0.00 ? 94  PRO A HA   6  
ATOM 9023  H HB2  . PRO A 1 94  ? 8.993   0.003   -3.802  1.00 0.00 ? 94  PRO A HB2  6  
ATOM 9024  H HB3  . PRO A 1 94  ? 8.295   -1.475  -3.130  1.00 0.00 ? 94  PRO A HB3  6  
ATOM 9025  H HG2  . PRO A 1 94  ? 8.749   -0.726  -5.993  1.00 0.00 ? 94  PRO A HG2  6  
ATOM 9026  H HG3  . PRO A 1 94  ? 9.042   -2.276  -5.182  1.00 0.00 ? 94  PRO A HG3  6  
ATOM 9027  H HD2  . PRO A 1 94  ? 6.851   -1.821  -6.707  1.00 0.00 ? 94  PRO A HD2  6  
ATOM 9028  H HD3  . PRO A 1 94  ? 6.826   -2.898  -5.296  1.00 0.00 ? 94  PRO A HD3  6  
ATOM 9029  N N    . PHE A 1 95  ? 6.909   2.247   -3.432  1.00 0.00 ? 95  PHE A N    6  
ATOM 9030  C CA   . PHE A 1 95  ? 6.992   3.674   -3.716  1.00 0.00 ? 95  PHE A CA   6  
ATOM 9031  C C    . PHE A 1 95  ? 8.068   3.960   -4.760  1.00 0.00 ? 95  PHE A C    6  
ATOM 9032  O O    . PHE A 1 95  ? 7.838   4.697   -5.718  1.00 0.00 ? 95  PHE A O    6  
ATOM 9033  C CB   . PHE A 1 95  ? 7.290   4.455   -2.434  1.00 0.00 ? 95  PHE A CB   6  
ATOM 9034  C CG   . PHE A 1 95  ? 6.074   4.708   -1.590  1.00 0.00 ? 95  PHE A CG   6  
ATOM 9035  C CD1  . PHE A 1 95  ? 5.472   3.674   -0.891  1.00 0.00 ? 95  PHE A CD1  6  
ATOM 9036  C CD2  . PHE A 1 95  ? 5.533   5.980   -1.495  1.00 0.00 ? 95  PHE A CD2  6  
ATOM 9037  C CE1  . PHE A 1 95  ? 4.353   3.904   -0.113  1.00 0.00 ? 95  PHE A CE1  6  
ATOM 9038  C CE2  . PHE A 1 95  ? 4.415   6.216   -0.718  1.00 0.00 ? 95  PHE A CE2  6  
ATOM 9039  C CZ   . PHE A 1 95  ? 3.823   5.176   -0.027  1.00 0.00 ? 95  PHE A CZ   6  
ATOM 9040  H H    . PHE A 1 95  ? 6.820   1.948   -2.502  1.00 0.00 ? 95  PHE A H    6  
ATOM 9041  H HA   . PHE A 1 95  ? 6.037   3.990   -4.105  1.00 0.00 ? 95  PHE A HA   6  
ATOM 9042  H HB2  . PHE A 1 95  ? 7.997   3.897   -1.838  1.00 0.00 ? 95  PHE A HB2  6  
ATOM 9043  H HB3  . PHE A 1 95  ? 7.720   5.410   -2.695  1.00 0.00 ? 95  PHE A HB3  6  
ATOM 9044  H HD1  . PHE A 1 95  ? 5.886   2.677   -0.958  1.00 0.00 ? 95  PHE A HD1  6  
ATOM 9045  H HD2  . PHE A 1 95  ? 5.994   6.794   -2.035  1.00 0.00 ? 95  PHE A HD2  6  
ATOM 9046  H HE1  . PHE A 1 95  ? 3.893   3.088   0.426   1.00 0.00 ? 95  PHE A HE1  6  
ATOM 9047  H HE2  . PHE A 1 95  ? 4.002   7.211   -0.653  1.00 0.00 ? 95  PHE A HE2  6  
ATOM 9048  H HZ   . PHE A 1 95  ? 2.949   5.358   0.581   1.00 0.00 ? 95  PHE A HZ   6  
ATOM 9049  N N    . SER A 1 96  ? 9.243   3.370   -4.567  1.00 0.00 ? 96  SER A N    6  
ATOM 9050  C CA   . SER A 1 96  ? 10.356  3.563   -5.488  1.00 0.00 ? 96  SER A CA   6  
ATOM 9051  C C    . SER A 1 96  ? 10.083  2.874   -6.822  1.00 0.00 ? 96  SER A C    6  
ATOM 9052  O O    . SER A 1 96  ? 9.688   1.709   -6.863  1.00 0.00 ? 96  SER A O    6  
ATOM 9053  C CB   . SER A 1 96  ? 11.651  3.023   -4.878  1.00 0.00 ? 96  SER A CB   6  
ATOM 9054  O OG   . SER A 1 96  ? 12.787  3.590   -5.508  1.00 0.00 ? 96  SER A OG   6  
ATOM 9055  H H    . SER A 1 96  ? 9.365   2.793   -3.784  1.00 0.00 ? 96  SER A H    6  
ATOM 9056  H HA   . SER A 1 96  ? 10.464  4.624   -5.660  1.00 0.00 ? 96  SER A HA   6  
ATOM 9057  H HB2  . SER A 1 96  ? 11.679  3.264   -3.827  1.00 0.00 ? 96  SER A HB2  6  
ATOM 9058  H HB3  . SER A 1 96  ? 11.683  1.950   -5.002  1.00 0.00 ? 96  SER A HB3  6  
ATOM 9059  H HG   . SER A 1 96  ? 12.703  4.546   -5.518  1.00 0.00 ? 96  SER A HG   6  
ATOM 9060  N N    . SER A 1 97  ? 10.297  3.604   -7.912  1.00 0.00 ? 97  SER A N    6  
ATOM 9061  C CA   . SER A 1 97  ? 10.070  3.066   -9.249  1.00 0.00 ? 97  SER A CA   6  
ATOM 9062  C C    . SER A 1 97  ? 10.961  1.855   -9.505  1.00 0.00 ? 97  SER A C    6  
ATOM 9063  O O    . SER A 1 97  ? 10.515  0.846   -10.050 1.00 0.00 ? 97  SER A O    6  
ATOM 9064  C CB   . SER A 1 97  ? 10.334  4.141   -10.305 1.00 0.00 ? 97  SER A CB   6  
ATOM 9065  O OG   . SER A 1 97  ? 9.183   4.939   -10.520 1.00 0.00 ? 97  SER A OG   6  
ATOM 9066  H H    . SER A 1 97  ? 10.612  4.527   -7.815  1.00 0.00 ? 97  SER A H    6  
ATOM 9067  H HA   . SER A 1 97  ? 9.037   2.758   -9.311  1.00 0.00 ? 97  SER A HA   6  
ATOM 9068  H HB2  . SER A 1 97  ? 11.141  4.776   -9.975  1.00 0.00 ? 97  SER A HB2  6  
ATOM 9069  H HB3  . SER A 1 97  ? 10.608  3.666   -11.237 1.00 0.00 ? 97  SER A HB3  6  
ATOM 9070  H HG   . SER A 1 97  ? 8.397   4.433   -10.301 1.00 0.00 ? 97  SER A HG   6  
ATOM 9071  N N    . GLY A 1 98  ? 12.226  1.963   -9.108  1.00 0.00 ? 98  GLY A N    6  
ATOM 9072  C CA   . GLY A 1 98  ? 13.161  0.871   -9.303  1.00 0.00 ? 98  GLY A CA   6  
ATOM 9073  C C    . GLY A 1 98  ? 13.942  0.545   -8.045  1.00 0.00 ? 98  GLY A C    6  
ATOM 9074  O O    . GLY A 1 98  ? 13.494  0.800   -6.927  1.00 0.00 ? 98  GLY A O    6  
ATOM 9075  H H    . GLY A 1 98  ? 12.526  2.792   -8.679  1.00 0.00 ? 98  GLY A H    6  
ATOM 9076  H HA2  . GLY A 1 98  ? 12.613  -0.007  -9.611  1.00 0.00 ? 98  GLY A HA2  6  
ATOM 9077  H HA3  . GLY A 1 98  ? 13.856  1.142   -10.083 1.00 0.00 ? 98  GLY A HA3  6  
ATOM 9078  N N    . PRO A 1 99  ? 15.139  -0.034  -8.220  1.00 0.00 ? 99  PRO A N    6  
ATOM 9079  C CA   . PRO A 1 99  ? 16.008  -0.409  -7.101  1.00 0.00 ? 99  PRO A CA   6  
ATOM 9080  C C    . PRO A 1 99  ? 16.591  0.806   -6.388  1.00 0.00 ? 99  PRO A C    6  
ATOM 9081  O O    . PRO A 1 99  ? 17.141  0.690   -5.293  1.00 0.00 ? 99  PRO A O    6  
ATOM 9082  C CB   . PRO A 1 99  ? 17.120  -1.219  -7.772  1.00 0.00 ? 99  PRO A CB   6  
ATOM 9083  C CG   . PRO A 1 99  ? 17.154  -0.725  -9.177  1.00 0.00 ? 99  PRO A CG   6  
ATOM 9084  C CD   . PRO A 1 99  ? 15.736  -0.367  -9.525  1.00 0.00 ? 99  PRO A CD   6  
ATOM 9085  H HA   . PRO A 1 99  ? 15.489  -1.030  -6.386  1.00 0.00 ? 99  PRO A HA   6  
ATOM 9086  H HB2  . PRO A 1 99  ? 18.058  -1.038  -7.266  1.00 0.00 ? 99  PRO A HB2  6  
ATOM 9087  H HB3  . PRO A 1 99  ? 16.880  -2.271  -7.730  1.00 0.00 ? 99  PRO A HB3  6  
ATOM 9088  H HG2  . PRO A 1 99  ? 17.788  0.146   -9.245  1.00 0.00 ? 99  PRO A HG2  6  
ATOM 9089  H HG3  . PRO A 1 99  ? 17.514  -1.505  -9.832  1.00 0.00 ? 99  PRO A HG3  6  
ATOM 9090  H HD2  . PRO A 1 99  ? 15.714  0.485   -10.188 1.00 0.00 ? 99  PRO A HD2  6  
ATOM 9091  H HD3  . PRO A 1 99  ? 15.233  -1.210  -9.974  1.00 0.00 ? 99  PRO A HD3  6  
ATOM 9092  N N    . SER A 1 100 ? 16.467  1.971   -7.015  1.00 0.00 ? 100 SER A N    6  
ATOM 9093  C CA   . SER A 1 100 ? 16.984  3.208   -6.441  1.00 0.00 ? 100 SER A CA   6  
ATOM 9094  C C    . SER A 1 100 ? 16.083  4.388   -6.790  1.00 0.00 ? 100 SER A C    6  
ATOM 9095  O O    . SER A 1 100 ? 15.183  4.271   -7.622  1.00 0.00 ? 100 SER A O    6  
ATOM 9096  C CB   . SER A 1 100 ? 18.406  3.472   -6.942  1.00 0.00 ? 100 SER A CB   6  
ATOM 9097  O OG   . SER A 1 100 ? 19.055  4.445   -6.143  1.00 0.00 ? 100 SER A OG   6  
ATOM 9098  H H    . SER A 1 100 ? 16.018  1.999   -7.886  1.00 0.00 ? 100 SER A H    6  
ATOM 9099  H HA   . SER A 1 100 ? 17.006  3.091   -5.368  1.00 0.00 ? 100 SER A HA   6  
ATOM 9100  H HB2  . SER A 1 100 ? 18.974  2.555   -6.904  1.00 0.00 ? 100 SER A HB2  6  
ATOM 9101  H HB3  . SER A 1 100 ? 18.365  3.828   -7.961  1.00 0.00 ? 100 SER A HB3  6  
ATOM 9102  H HG   . SER A 1 100 ? 19.939  4.142   -5.924  1.00 0.00 ? 100 SER A HG   6  
ATOM 9103  N N    . SER A 1 101 ? 16.331  5.524   -6.147  1.00 0.00 ? 101 SER A N    6  
ATOM 9104  C CA   . SER A 1 101 ? 15.540  6.726   -6.385  1.00 0.00 ? 101 SER A CA   6  
ATOM 9105  C C    . SER A 1 101 ? 16.224  7.633   -7.403  1.00 0.00 ? 101 SER A C    6  
ATOM 9106  O O    . SER A 1 101 ? 15.622  8.030   -8.401  1.00 0.00 ? 101 SER A O    6  
ATOM 9107  C CB   . SER A 1 101 ? 15.320  7.485   -5.075  1.00 0.00 ? 101 SER A CB   6  
ATOM 9108  O OG   . SER A 1 101 ? 14.579  8.674   -5.293  1.00 0.00 ? 101 SER A OG   6  
ATOM 9109  H H    . SER A 1 101 ? 17.062  5.554   -5.495  1.00 0.00 ? 101 SER A H    6  
ATOM 9110  H HA   . SER A 1 101 ? 14.582  6.420   -6.779  1.00 0.00 ? 101 SER A HA   6  
ATOM 9111  H HB2  . SER A 1 101 ? 14.776  6.858   -4.386  1.00 0.00 ? 101 SER A HB2  6  
ATOM 9112  H HB3  . SER A 1 101 ? 16.277  7.745   -4.648  1.00 0.00 ? 101 SER A HB3  6  
ATOM 9113  H HG   . SER A 1 101 ? 13.730  8.608   -4.851  1.00 0.00 ? 101 SER A HG   6  
ATOM 9114  N N    . GLY A 1 102 ? 17.486  7.959   -7.143  1.00 0.00 ? 102 GLY A N    6  
ATOM 9115  C CA   . GLY A 1 102 ? 18.232  8.817   -8.045  1.00 0.00 ? 102 GLY A CA   6  
ATOM 9116  C C    . GLY A 1 102 ? 18.692  8.087   -9.292  1.00 0.00 ? 102 GLY A C    6  
ATOM 9117  O O    . GLY A 1 102 ? 19.014  8.713   -10.302 1.00 0.00 ? 102 GLY A O    6  
ATOM 9118  H H    . GLY A 1 102 ? 17.915  7.613   -6.332  1.00 0.00 ? 102 GLY A H    6  
ATOM 9119  H HA2  . GLY A 1 102 ? 17.605  9.646   -8.336  1.00 0.00 ? 102 GLY A HA2  6  
ATOM 9120  H HA3  . GLY A 1 102 ? 19.099  9.199   -7.525  1.00 0.00 ? 102 GLY A HA3  6  
ATOM 9121  N N    . GLY A 1 1   ? 17.663  29.340  -2.403  1.00 0.00 ? 1   GLY A N    7  
ATOM 9122  C CA   . GLY A 1 1   ? 18.783  28.888  -3.208  1.00 0.00 ? 1   GLY A CA   7  
ATOM 9123  C C    . GLY A 1 1   ? 19.066  27.410  -3.028  1.00 0.00 ? 1   GLY A C    7  
ATOM 9124  O O    . GLY A 1 1   ? 19.654  27.001  -2.027  1.00 0.00 ? 1   GLY A O    7  
ATOM 9125  H H1   . GLY A 1 1   ? 16.784  28.919  -2.509  1.00 0.00 ? 1   GLY A H1   7  
ATOM 9126  H HA2  . GLY A 1 1   ? 18.565  29.079  -4.248  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 9127  H HA3  . GLY A 1 1   ? 19.663  29.448  -2.926  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 9128  N N    . SER A 1 2   ? 18.647  26.606  -4.000  1.00 0.00 ? 2   SER A N    7  
ATOM 9129  C CA   . SER A 1 2   ? 18.854  25.164  -3.943  1.00 0.00 ? 2   SER A CA   7  
ATOM 9130  C C    . SER A 1 2   ? 20.267  24.837  -3.469  1.00 0.00 ? 2   SER A C    7  
ATOM 9131  O O    . SER A 1 2   ? 20.453  24.130  -2.479  1.00 0.00 ? 2   SER A O    7  
ATOM 9132  C CB   . SER A 1 2   ? 18.607  24.537  -5.316  1.00 0.00 ? 2   SER A CB   7  
ATOM 9133  O OG   . SER A 1 2   ? 17.261  24.716  -5.724  1.00 0.00 ? 2   SER A OG   7  
ATOM 9134  H H    . SER A 1 2   ? 18.184  26.993  -4.773  1.00 0.00 ? 2   SER A H    7  
ATOM 9135  H HA   . SER A 1 2   ? 18.146  24.755  -3.237  1.00 0.00 ? 2   SER A HA   7  
ATOM 9136  H HB2  . SER A 1 2   ? 19.255  25.001  -6.043  1.00 0.00 ? 2   SER A HB2  7  
ATOM 9137  H HB3  . SER A 1 2   ? 18.818  23.478  -5.269  1.00 0.00 ? 2   SER A HB3  7  
ATOM 9138  H HG   . SER A 1 2   ? 16.906  25.509  -5.316  1.00 0.00 ? 2   SER A HG   7  
ATOM 9139  N N    . SER A 1 3   ? 21.259  25.357  -4.184  1.00 0.00 ? 3   SER A N    7  
ATOM 9140  C CA   . SER A 1 3   ? 22.656  25.118  -3.840  1.00 0.00 ? 3   SER A CA   7  
ATOM 9141  C C    . SER A 1 3   ? 22.895  23.643  -3.531  1.00 0.00 ? 3   SER A C    7  
ATOM 9142  O O    . SER A 1 3   ? 23.604  23.302  -2.586  1.00 0.00 ? 3   SER A O    7  
ATOM 9143  C CB   . SER A 1 3   ? 23.061  25.974  -2.639  1.00 0.00 ? 3   SER A CB   7  
ATOM 9144  O OG   . SER A 1 3   ? 22.413  25.535  -1.458  1.00 0.00 ? 3   SER A OG   7  
ATOM 9145  H H    . SER A 1 3   ? 21.047  25.912  -4.963  1.00 0.00 ? 3   SER A H    7  
ATOM 9146  H HA   . SER A 1 3   ? 23.260  25.397  -4.691  1.00 0.00 ? 3   SER A HA   7  
ATOM 9147  H HB2  . SER A 1 3   ? 24.129  25.906  -2.495  1.00 0.00 ? 3   SER A HB2  7  
ATOM 9148  H HB3  . SER A 1 3   ? 22.787  27.002  -2.825  1.00 0.00 ? 3   SER A HB3  7  
ATOM 9149  H HG   . SER A 1 3   ? 23.043  25.520  -0.733  1.00 0.00 ? 3   SER A HG   7  
ATOM 9150  N N    . GLY A 1 4   ? 22.295  22.771  -4.337  1.00 0.00 ? 4   GLY A N    7  
ATOM 9151  C CA   . GLY A 1 4   ? 22.454  21.343  -4.134  1.00 0.00 ? 4   GLY A CA   7  
ATOM 9152  C C    . GLY A 1 4   ? 23.610  20.769  -4.929  1.00 0.00 ? 4   GLY A C    7  
ATOM 9153  O O    . GLY A 1 4   ? 23.561  20.715  -6.158  1.00 0.00 ? 4   GLY A O    7  
ATOM 9154  H H    . GLY A 1 4   ? 21.741  23.101  -5.075  1.00 0.00 ? 4   GLY A H    7  
ATOM 9155  H HA2  . GLY A 1 4   ? 22.624  21.156  -3.084  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 9156  H HA3  . GLY A 1 4   ? 21.543  20.845  -4.435  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 9157  N N    . SER A 1 5   ? 24.654  20.341  -4.227  1.00 0.00 ? 5   SER A N    7  
ATOM 9158  C CA   . SER A 1 5   ? 25.830  19.773  -4.875  1.00 0.00 ? 5   SER A CA   7  
ATOM 9159  C C    . SER A 1 5   ? 25.778  18.248  -4.857  1.00 0.00 ? 5   SER A C    7  
ATOM 9160  O O    . SER A 1 5   ? 26.150  17.615  -3.869  1.00 0.00 ? 5   SER A O    7  
ATOM 9161  C CB   . SER A 1 5   ? 27.105  20.259  -4.183  1.00 0.00 ? 5   SER A CB   7  
ATOM 9162  O OG   . SER A 1 5   ? 27.215  21.671  -4.250  1.00 0.00 ? 5   SER A OG   7  
ATOM 9163  H H    . SER A 1 5   ? 24.633  20.410  -3.249  1.00 0.00 ? 5   SER A H    7  
ATOM 9164  H HA   . SER A 1 5   ? 25.837  20.109  -5.901  1.00 0.00 ? 5   SER A HA   7  
ATOM 9165  H HB2  . SER A 1 5   ? 27.084  19.961  -3.145  1.00 0.00 ? 5   SER A HB2  7  
ATOM 9166  H HB3  . SER A 1 5   ? 27.964  19.819  -4.667  1.00 0.00 ? 5   SER A HB3  7  
ATOM 9167  H HG   . SER A 1 5   ? 28.108  21.910  -4.507  1.00 0.00 ? 5   SER A HG   7  
ATOM 9168  N N    . SER A 1 6   ? 25.314  17.665  -5.957  1.00 0.00 ? 6   SER A N    7  
ATOM 9169  C CA   . SER A 1 6   ? 25.209  16.215  -6.067  1.00 0.00 ? 6   SER A CA   7  
ATOM 9170  C C    . SER A 1 6   ? 26.255  15.666  -7.032  1.00 0.00 ? 6   SER A C    7  
ATOM 9171  O O    . SER A 1 6   ? 26.905  16.420  -7.756  1.00 0.00 ? 6   SER A O    7  
ATOM 9172  C CB   . SER A 1 6   ? 23.808  15.818  -6.537  1.00 0.00 ? 6   SER A CB   7  
ATOM 9173  O OG   . SER A 1 6   ? 23.492  16.432  -7.775  1.00 0.00 ? 6   SER A OG   7  
ATOM 9174  H H    . SER A 1 6   ? 25.033  18.224  -6.712  1.00 0.00 ? 6   SER A H    7  
ATOM 9175  H HA   . SER A 1 6   ? 25.383  15.794  -5.088  1.00 0.00 ? 6   SER A HA   7  
ATOM 9176  H HB2  . SER A 1 6   ? 23.761  14.747  -6.658  1.00 0.00 ? 6   SER A HB2  7  
ATOM 9177  H HB3  . SER A 1 6   ? 23.082  16.129  -5.799  1.00 0.00 ? 6   SER A HB3  7  
ATOM 9178  H HG   . SER A 1 6   ? 22.925  17.191  -7.621  1.00 0.00 ? 6   SER A HG   7  
ATOM 9179  N N    . GLY A 1 7   ? 26.413  14.346  -7.037  1.00 0.00 ? 7   GLY A N    7  
ATOM 9180  C CA   . GLY A 1 7   ? 27.382  13.717  -7.916  1.00 0.00 ? 7   GLY A CA   7  
ATOM 9181  C C    . GLY A 1 7   ? 27.604  12.256  -7.582  1.00 0.00 ? 7   GLY A C    7  
ATOM 9182  O O    . GLY A 1 7   ? 28.742  11.812  -7.435  1.00 0.00 ? 7   GLY A O    7  
ATOM 9183  H H    . GLY A 1 7   ? 25.867  13.794  -6.438  1.00 0.00 ? 7   GLY A H    7  
ATOM 9184  H HA2  . GLY A 1 7   ? 27.031  13.795  -8.934  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 9185  H HA3  . GLY A 1 7   ? 28.322  14.241  -7.829  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 9186  N N    . ASN A 1 8   ? 26.514  11.505  -7.461  1.00 0.00 ? 8   ASN A N    7  
ATOM 9187  C CA   . ASN A 1 8   ? 26.595  10.085  -7.140  1.00 0.00 ? 8   ASN A CA   7  
ATOM 9188  C C    . ASN A 1 8   ? 25.665  9.271   -8.035  1.00 0.00 ? 8   ASN A C    7  
ATOM 9189  O O    . ASN A 1 8   ? 24.443  9.376   -7.934  1.00 0.00 ? 8   ASN A O    7  
ATOM 9190  C CB   . ASN A 1 8   ? 26.241  9.852   -5.670  1.00 0.00 ? 8   ASN A CB   7  
ATOM 9191  C CG   . ASN A 1 8   ? 27.440  10.006  -4.755  1.00 0.00 ? 8   ASN A CG   7  
ATOM 9192  O OD1  . ASN A 1 8   ? 28.482  10.521  -5.161  1.00 0.00 ? 8   ASN A OD1  7  
ATOM 9193  N ND2  . ASN A 1 8   ? 27.297  9.560   -3.513  1.00 0.00 ? 8   ASN A ND2  7  
ATOM 9194  H H    . ASN A 1 8   ? 25.633  11.916  -7.590  1.00 0.00 ? 8   ASN A H    7  
ATOM 9195  H HA   . ASN A 1 8   ? 27.611  9.764   -7.312  1.00 0.00 ? 8   ASN A HA   7  
ATOM 9196  H HB2  . ASN A 1 8   ? 25.488  10.566  -5.370  1.00 0.00 ? 8   ASN A HB2  7  
ATOM 9197  H HB3  . ASN A 1 8   ? 25.849  8.852   -5.555  1.00 0.00 ? 8   ASN A HB3  7  
ATOM 9198  H HD21 . ASN A 1 8   ? 26.438  9.161   -3.259  1.00 0.00 ? 8   ASN A HD21 7  
ATOM 9199  H HD22 . ASN A 1 8   ? 28.056  9.648   -2.899  1.00 0.00 ? 8   ASN A HD22 7  
ATOM 9200  N N    . GLU A 1 9   ? 26.252  8.461   -8.909  1.00 0.00 ? 9   GLU A N    7  
ATOM 9201  C CA   . GLU A 1 9   ? 25.475  7.630   -9.821  1.00 0.00 ? 9   GLU A CA   7  
ATOM 9202  C C    . GLU A 1 9   ? 24.685  6.573   -9.055  1.00 0.00 ? 9   GLU A C    7  
ATOM 9203  O O    . GLU A 1 9   ? 25.213  5.914   -8.159  1.00 0.00 ? 9   GLU A O    7  
ATOM 9204  C CB   . GLU A 1 9   ? 26.396  6.954   -10.840 1.00 0.00 ? 9   GLU A CB   7  
ATOM 9205  C CG   . GLU A 1 9   ? 25.662  6.401   -12.050 1.00 0.00 ? 9   GLU A CG   7  
ATOM 9206  C CD   . GLU A 1 9   ? 25.352  7.467   -13.083 1.00 0.00 ? 9   GLU A CD   7  
ATOM 9207  O OE1  . GLU A 1 9   ? 26.151  8.418   -13.212 1.00 0.00 ? 9   GLU A OE1  7  
ATOM 9208  O OE2  . GLU A 1 9   ? 24.311  7.350   -13.762 1.00 0.00 ? 9   GLU A OE2  7  
ATOM 9209  H H    . GLU A 1 9   ? 27.231  8.421   -8.942  1.00 0.00 ? 9   GLU A H    7  
ATOM 9210  H HA   . GLU A 1 9   ? 24.783  8.271   -10.346 1.00 0.00 ? 9   GLU A HA   7  
ATOM 9211  H HB2  . GLU A 1 9   ? 27.123  7.675   -11.184 1.00 0.00 ? 9   GLU A HB2  7  
ATOM 9212  H HB3  . GLU A 1 9   ? 26.912  6.139   -10.355 1.00 0.00 ? 9   GLU A HB3  7  
ATOM 9213  H HG2  . GLU A 1 9   ? 26.276  5.642   -12.512 1.00 0.00 ? 9   GLU A HG2  7  
ATOM 9214  H HG3  . GLU A 1 9   ? 24.733  5.959   -11.721 1.00 0.00 ? 9   GLU A HG3  7  
ATOM 9215  N N    . VAL A 1 10  ? 23.414  6.418   -9.413  1.00 0.00 ? 10  VAL A N    7  
ATOM 9216  C CA   . VAL A 1 10  ? 22.549  5.443   -8.761  1.00 0.00 ? 10  VAL A CA   7  
ATOM 9217  C C    . VAL A 1 10  ? 22.093  4.369   -9.742  1.00 0.00 ? 10  VAL A C    7  
ATOM 9218  O O    . VAL A 1 10  ? 21.471  4.669   -10.761 1.00 0.00 ? 10  VAL A O    7  
ATOM 9219  C CB   . VAL A 1 10  ? 21.310  6.116   -8.142  1.00 0.00 ? 10  VAL A CB   7  
ATOM 9220  C CG1  . VAL A 1 10  ? 21.725  7.139   -7.095  1.00 0.00 ? 10  VAL A CG1  7  
ATOM 9221  C CG2  . VAL A 1 10  ? 20.460  6.764   -9.224  1.00 0.00 ? 10  VAL A CG2  7  
ATOM 9222  H H    . VAL A 1 10  ? 23.050  6.973   -10.135 1.00 0.00 ? 10  VAL A H    7  
ATOM 9223  H HA   . VAL A 1 10  ? 23.113  4.975   -7.967  1.00 0.00 ? 10  VAL A HA   7  
ATOM 9224  H HB   . VAL A 1 10  ? 20.717  5.356   -7.655  1.00 0.00 ? 10  VAL A HB   7  
ATOM 9225  H HG11 . VAL A 1 10  ? 22.714  7.508   -7.325  1.00 0.00 ? 10  VAL A HG11 7  
ATOM 9226  H HG12 . VAL A 1 10  ? 21.023  7.960   -7.096  1.00 0.00 ? 10  VAL A HG12 7  
ATOM 9227  H HG13 . VAL A 1 10  ? 21.733  6.673   -6.121  1.00 0.00 ? 10  VAL A HG13 7  
ATOM 9228  H HG21 . VAL A 1 10  ? 19.754  7.442   -8.768  1.00 0.00 ? 10  VAL A HG21 7  
ATOM 9229  H HG22 . VAL A 1 10  ? 21.097  7.310   -9.904  1.00 0.00 ? 10  VAL A HG22 7  
ATOM 9230  H HG23 . VAL A 1 10  ? 19.925  5.999   -9.768  1.00 0.00 ? 10  VAL A HG23 7  
ATOM 9231  N N    . ASP A 1 11  ? 22.407  3.117   -9.429  1.00 0.00 ? 11  ASP A N    7  
ATOM 9232  C CA   . ASP A 1 11  ? 22.028  1.997   -10.282 1.00 0.00 ? 11  ASP A CA   7  
ATOM 9233  C C    . ASP A 1 11  ? 22.183  0.672   -9.542  1.00 0.00 ? 11  ASP A C    7  
ATOM 9234  O O    . ASP A 1 11  ? 23.168  0.457   -8.835  1.00 0.00 ? 11  ASP A O    7  
ATOM 9235  C CB   . ASP A 1 11  ? 22.878  1.987   -11.554 1.00 0.00 ? 11  ASP A CB   7  
ATOM 9236  C CG   . ASP A 1 11  ? 24.350  1.771   -11.265 1.00 0.00 ? 11  ASP A CG   7  
ATOM 9237  O OD1  . ASP A 1 11  ? 24.695  0.709   -10.706 1.00 0.00 ? 11  ASP A OD1  7  
ATOM 9238  O OD2  . ASP A 1 11  ? 25.158  2.664   -11.597 1.00 0.00 ? 11  ASP A OD2  7  
ATOM 9239  H H    . ASP A 1 11  ? 22.904  2.941   -8.602  1.00 0.00 ? 11  ASP A H    7  
ATOM 9240  H HA   . ASP A 1 11  ? 20.991  2.123   -10.554 1.00 0.00 ? 11  ASP A HA   7  
ATOM 9241  H HB2  . ASP A 1 11  ? 22.537  1.192   -12.201 1.00 0.00 ? 11  ASP A HB2  7  
ATOM 9242  H HB3  . ASP A 1 11  ? 22.764  2.933   -12.062 1.00 0.00 ? 11  ASP A HB3  7  
ATOM 9243  N N    . ASP A 1 12  ? 21.205  -0.211  -9.708  1.00 0.00 ? 12  ASP A N    7  
ATOM 9244  C CA   . ASP A 1 12  ? 21.233  -1.515  -9.055  1.00 0.00 ? 12  ASP A CA   7  
ATOM 9245  C C    . ASP A 1 12  ? 20.256  -2.478  -9.723  1.00 0.00 ? 12  ASP A C    7  
ATOM 9246  O O    . ASP A 1 12  ? 19.517  -2.097  -10.631 1.00 0.00 ? 12  ASP A O    7  
ATOM 9247  C CB   . ASP A 1 12  ? 20.894  -1.373  -7.571  1.00 0.00 ? 12  ASP A CB   7  
ATOM 9248  C CG   . ASP A 1 12  ? 22.030  -0.762  -6.774  1.00 0.00 ? 12  ASP A CG   7  
ATOM 9249  O OD1  . ASP A 1 12  ? 23.138  -1.337  -6.784  1.00 0.00 ? 12  ASP A OD1  7  
ATOM 9250  O OD2  . ASP A 1 12  ? 21.810  0.291   -6.138  1.00 0.00 ? 12  ASP A OD2  7  
ATOM 9251  H H    . ASP A 1 12  ? 20.446  0.019   -10.284 1.00 0.00 ? 12  ASP A H    7  
ATOM 9252  H HA   . ASP A 1 12  ? 22.232  -1.912  -9.151  1.00 0.00 ? 12  ASP A HA   7  
ATOM 9253  H HB2  . ASP A 1 12  ? 20.024  -0.741  -7.465  1.00 0.00 ? 12  ASP A HB2  7  
ATOM 9254  H HB3  . ASP A 1 12  ? 20.676  -2.349  -7.163  1.00 0.00 ? 12  ASP A HB3  7  
ATOM 9255  N N    . MET A 1 13  ? 20.259  -3.726  -9.268  1.00 0.00 ? 13  MET A N    7  
ATOM 9256  C CA   . MET A 1 13  ? 19.373  -4.743  -9.822  1.00 0.00 ? 13  MET A CA   7  
ATOM 9257  C C    . MET A 1 13  ? 18.388  -5.239  -8.767  1.00 0.00 ? 13  MET A C    7  
ATOM 9258  O O    . MET A 1 13  ? 17.203  -5.419  -9.047  1.00 0.00 ? 13  MET A O    7  
ATOM 9259  C CB   . MET A 1 13  ? 20.187  -5.918  -10.367 1.00 0.00 ? 13  MET A CB   7  
ATOM 9260  C CG   . MET A 1 13  ? 19.364  -6.901  -11.183 1.00 0.00 ? 13  MET A CG   7  
ATOM 9261  S SD   . MET A 1 13  ? 18.735  -6.181  -12.711 1.00 0.00 ? 13  MET A SD   7  
ATOM 9262  C CE   . MET A 1 13  ? 20.209  -6.204  -13.728 1.00 0.00 ? 13  MET A CE   7  
ATOM 9263  H H    . MET A 1 13  ? 20.871  -3.970  -8.542  1.00 0.00 ? 13  MET A H    7  
ATOM 9264  H HA   . MET A 1 13  ? 18.819  -4.294  -10.632 1.00 0.00 ? 13  MET A HA   7  
ATOM 9265  H HB2  . MET A 1 13  ? 20.976  -5.532  -10.997 1.00 0.00 ? 13  MET A HB2  7  
ATOM 9266  H HB3  . MET A 1 13  ? 20.628  -6.451  -9.538  1.00 0.00 ? 13  MET A HB3  7  
ATOM 9267  H HG2  . MET A 1 13  ? 19.983  -7.751  -11.431 1.00 0.00 ? 13  MET A HG2  7  
ATOM 9268  H HG3  . MET A 1 13  ? 18.528  -7.231  -10.585 1.00 0.00 ? 13  MET A HG3  7  
ATOM 9269  H HE1  . MET A 1 13  ? 20.747  -5.276  -13.604 1.00 0.00 ? 13  MET A HE1  7  
ATOM 9270  H HE2  . MET A 1 13  ? 20.839  -7.029  -13.430 1.00 0.00 ? 13  MET A HE2  7  
ATOM 9271  H HE3  . MET A 1 13  ? 19.929  -6.321  -14.765 1.00 0.00 ? 13  MET A HE3  7  
ATOM 9272  N N    . ASP A 1 14  ? 18.886  -5.456  -7.555  1.00 0.00 ? 14  ASP A N    7  
ATOM 9273  C CA   . ASP A 1 14  ? 18.050  -5.930  -6.459  1.00 0.00 ? 14  ASP A CA   7  
ATOM 9274  C C    . ASP A 1 14  ? 18.510  -5.339  -5.130  1.00 0.00 ? 14  ASP A C    7  
ATOM 9275  O O    . ASP A 1 14  ? 19.704  -5.311  -4.830  1.00 0.00 ? 14  ASP A O    7  
ATOM 9276  C CB   . ASP A 1 14  ? 18.080  -7.458  -6.389  1.00 0.00 ? 14  ASP A CB   7  
ATOM 9277  C CG   . ASP A 1 14  ? 19.477  -8.018  -6.573  1.00 0.00 ? 14  ASP A CG   7  
ATOM 9278  O OD1  . ASP A 1 14  ? 20.362  -7.683  -5.759  1.00 0.00 ? 14  ASP A OD1  7  
ATOM 9279  O OD2  . ASP A 1 14  ? 19.684  -8.792  -7.531  1.00 0.00 ? 14  ASP A OD2  7  
ATOM 9280  H H    . ASP A 1 14  ? 19.840  -5.294  -7.394  1.00 0.00 ? 14  ASP A H    7  
ATOM 9281  H HA   . ASP A 1 14  ? 17.038  -5.608  -6.650  1.00 0.00 ? 14  ASP A HA   7  
ATOM 9282  H HB2  . ASP A 1 14  ? 17.709  -7.775  -5.425  1.00 0.00 ? 14  ASP A HB2  7  
ATOM 9283  H HB3  . ASP A 1 14  ? 17.445  -7.860  -7.165  1.00 0.00 ? 14  ASP A HB3  7  
ATOM 9284  N N    . THR A 1 15  ? 17.554  -4.867  -4.335  1.00 0.00 ? 15  THR A N    7  
ATOM 9285  C CA   . THR A 1 15  ? 17.861  -4.274  -3.040  1.00 0.00 ? 15  THR A CA   7  
ATOM 9286  C C    . THR A 1 15  ? 16.991  -4.875  -1.941  1.00 0.00 ? 15  THR A C    7  
ATOM 9287  O O    . THR A 1 15  ? 15.833  -5.220  -2.172  1.00 0.00 ? 15  THR A O    7  
ATOM 9288  C CB   . THR A 1 15  ? 17.662  -2.747  -3.059  1.00 0.00 ? 15  THR A CB   7  
ATOM 9289  O OG1  . THR A 1 15  ? 16.347  -2.430  -3.529  1.00 0.00 ? 15  THR A OG1  7  
ATOM 9290  C CG2  . THR A 1 15  ? 18.698  -2.077  -3.948  1.00 0.00 ? 15  THR A CG2  7  
ATOM 9291  H H    . THR A 1 15  ? 16.621  -4.918  -4.629  1.00 0.00 ? 15  THR A H    7  
ATOM 9292  H HA   . THR A 1 15  ? 18.898  -4.478  -2.817  1.00 0.00 ? 15  THR A HA   7  
ATOM 9293  H HB   . THR A 1 15  ? 17.776  -2.371  -2.052  1.00 0.00 ? 15  THR A HB   7  
ATOM 9294  H HG1  . THR A 1 15  ? 16.315  -1.508  -3.794  1.00 0.00 ? 15  THR A HG1  7  
ATOM 9295  H HG21 . THR A 1 15  ? 19.672  -2.496  -3.744  1.00 0.00 ? 15  THR A HG21 7  
ATOM 9296  H HG22 . THR A 1 15  ? 18.713  -1.016  -3.748  1.00 0.00 ? 15  THR A HG22 7  
ATOM 9297  H HG23 . THR A 1 15  ? 18.445  -2.244  -4.984  1.00 0.00 ? 15  THR A HG23 7  
ATOM 9298  N N    . SER A 1 16  ? 17.558  -4.995  -0.744  1.00 0.00 ? 16  SER A N    7  
ATOM 9299  C CA   . SER A 1 16  ? 16.834  -5.557  0.390   1.00 0.00 ? 16  SER A CA   7  
ATOM 9300  C C    . SER A 1 16  ? 15.656  -4.669  0.778   1.00 0.00 ? 16  SER A C    7  
ATOM 9301  O O    . SER A 1 16  ? 14.517  -5.128  0.855   1.00 0.00 ? 16  SER A O    7  
ATOM 9302  C CB   . SER A 1 16  ? 17.773  -5.729  1.586   1.00 0.00 ? 16  SER A CB   7  
ATOM 9303  O OG   . SER A 1 16  ? 18.858  -6.582  1.265   1.00 0.00 ? 16  SER A OG   7  
ATOM 9304  H H    . SER A 1 16  ? 18.485  -4.702  -0.623  1.00 0.00 ? 16  SER A H    7  
ATOM 9305  H HA   . SER A 1 16  ? 16.458  -6.526  0.097   1.00 0.00 ? 16  SER A HA   7  
ATOM 9306  H HB2  . SER A 1 16  ? 18.163  -4.765  1.876   1.00 0.00 ? 16  SER A HB2  7  
ATOM 9307  H HB3  . SER A 1 16  ? 17.225  -6.159  2.412   1.00 0.00 ? 16  SER A HB3  7  
ATOM 9308  H HG   . SER A 1 16  ? 19.232  -6.320  0.420   1.00 0.00 ? 16  SER A HG   7  
ATOM 9309  N N    . ASP A 1 17  ? 15.940  -3.394  1.020   1.00 0.00 ? 17  ASP A N    7  
ATOM 9310  C CA   . ASP A 1 17  ? 14.905  -2.439  1.398   1.00 0.00 ? 17  ASP A CA   7  
ATOM 9311  C C    . ASP A 1 17  ? 14.004  -2.115  0.211   1.00 0.00 ? 17  ASP A C    7  
ATOM 9312  O O    . ASP A 1 17  ? 14.393  -1.379  -0.696  1.00 0.00 ? 17  ASP A O    7  
ATOM 9313  C CB   . ASP A 1 17  ? 15.538  -1.155  1.939   1.00 0.00 ? 17  ASP A CB   7  
ATOM 9314  C CG   . ASP A 1 17  ? 16.476  -1.417  3.100   1.00 0.00 ? 17  ASP A CG   7  
ATOM 9315  O OD1  . ASP A 1 17  ? 16.013  -1.957  4.127   1.00 0.00 ? 17  ASP A OD1  7  
ATOM 9316  O OD2  . ASP A 1 17  ? 17.673  -1.083  2.983   1.00 0.00 ? 17  ASP A OD2  7  
ATOM 9317  H H    . ASP A 1 17  ? 16.868  -3.087  0.942   1.00 0.00 ? 17  ASP A H    7  
ATOM 9318  H HA   . ASP A 1 17  ? 14.307  -2.889  2.176   1.00 0.00 ? 17  ASP A HA   7  
ATOM 9319  H HB2  . ASP A 1 17  ? 16.099  -0.678  1.148   1.00 0.00 ? 17  ASP A HB2  7  
ATOM 9320  H HB3  . ASP A 1 17  ? 14.756  -0.489  2.273   1.00 0.00 ? 17  ASP A HB3  7  
ATOM 9321  N N    . THR A 1 18  ? 12.796  -2.671  0.223   1.00 0.00 ? 18  THR A N    7  
ATOM 9322  C CA   . THR A 1 18  ? 11.840  -2.443  -0.854  1.00 0.00 ? 18  THR A CA   7  
ATOM 9323  C C    . THR A 1 18  ? 10.423  -2.298  -0.309  1.00 0.00 ? 18  THR A C    7  
ATOM 9324  O O    . THR A 1 18  ? 9.818   -3.272  0.139   1.00 0.00 ? 18  THR A O    7  
ATOM 9325  C CB   . THR A 1 18  ? 11.867  -3.591  -1.881  1.00 0.00 ? 18  THR A CB   7  
ATOM 9326  O OG1  . THR A 1 18  ? 13.206  -3.803  -2.342  1.00 0.00 ? 18  THR A OG1  7  
ATOM 9327  C CG2  . THR A 1 18  ? 10.962  -3.280  -3.064  1.00 0.00 ? 18  THR A CG2  7  
ATOM 9328  H H    . THR A 1 18  ? 12.543  -3.247  0.974   1.00 0.00 ? 18  THR A H    7  
ATOM 9329  H HA   . THR A 1 18  ? 12.117  -1.529  -1.358  1.00 0.00 ? 18  THR A HA   7  
ATOM 9330  H HB   . THR A 1 18  ? 11.512  -4.492  -1.402  1.00 0.00 ? 18  THR A HB   7  
ATOM 9331  H HG1  . THR A 1 18  ? 13.827  -3.521  -1.665  1.00 0.00 ? 18  THR A HG1  7  
ATOM 9332  H HG21 . THR A 1 18  ? 9.939   -3.508  -2.803  1.00 0.00 ? 18  THR A HG21 7  
ATOM 9333  H HG22 . THR A 1 18  ? 11.260  -3.879  -3.912  1.00 0.00 ? 18  THR A HG22 7  
ATOM 9334  H HG23 . THR A 1 18  ? 11.045  -2.234  -3.314  1.00 0.00 ? 18  THR A HG23 7  
ATOM 9335  N N    . GLN A 1 19  ? 9.900   -1.077  -0.352  1.00 0.00 ? 19  GLN A N    7  
ATOM 9336  C CA   . GLN A 1 19  ? 8.554   -0.806  0.138   1.00 0.00 ? 19  GLN A CA   7  
ATOM 9337  C C    . GLN A 1 19  ? 7.517   -1.065  -0.950  1.00 0.00 ? 19  GLN A C    7  
ATOM 9338  O O    . GLN A 1 19  ? 7.653   -0.589  -2.077  1.00 0.00 ? 19  GLN A O    7  
ATOM 9339  C CB   . GLN A 1 19  ? 8.448   0.640   0.626   1.00 0.00 ? 19  GLN A CB   7  
ATOM 9340  C CG   . GLN A 1 19  ? 9.186   0.898   1.930   1.00 0.00 ? 19  GLN A CG   7  
ATOM 9341  C CD   . GLN A 1 19  ? 9.576   2.353   2.102   1.00 0.00 ? 19  GLN A CD   7  
ATOM 9342  O OE1  . GLN A 1 19  ? 9.036   3.055   2.957   1.00 0.00 ? 19  GLN A OE1  7  
ATOM 9343  N NE2  . GLN A 1 19  ? 10.519  2.813   1.288   1.00 0.00 ? 19  GLN A NE2  7  
ATOM 9344  H H    . GLN A 1 19  ? 10.432  -0.342  -0.720  1.00 0.00 ? 19  GLN A H    7  
ATOM 9345  H HA   . GLN A 1 19  ? 8.362   -1.471  0.966   1.00 0.00 ? 19  GLN A HA   7  
ATOM 9346  H HB2  . GLN A 1 19  ? 8.856   1.294   -0.130  1.00 0.00 ? 19  GLN A HB2  7  
ATOM 9347  H HB3  . GLN A 1 19  ? 7.405   0.881   0.775   1.00 0.00 ? 19  GLN A HB3  7  
ATOM 9348  H HG2  . GLN A 1 19  ? 8.548   0.613   2.753   1.00 0.00 ? 19  GLN A HG2  7  
ATOM 9349  H HG3  . GLN A 1 19  ? 10.083  0.295   1.945   1.00 0.00 ? 19  GLN A HG3  7  
ATOM 9350  H HE21 . GLN A 1 19  ? 10.904  2.196   0.630   1.00 0.00 ? 19  GLN A HE21 7  
ATOM 9351  H HE22 . GLN A 1 19  ? 10.790  3.750   1.377   1.00 0.00 ? 19  GLN A HE22 7  
ATOM 9352  N N    . TRP A 1 20  ? 6.482   -1.822  -0.604  1.00 0.00 ? 20  TRP A N    7  
ATOM 9353  C CA   . TRP A 1 20  ? 5.421   -2.145  -1.552  1.00 0.00 ? 20  TRP A CA   7  
ATOM 9354  C C    . TRP A 1 20  ? 4.275   -1.144  -1.449  1.00 0.00 ? 20  TRP A C    7  
ATOM 9355  O O    . TRP A 1 20  ? 3.669   -0.988  -0.390  1.00 0.00 ? 20  TRP A O    7  
ATOM 9356  C CB   . TRP A 1 20  ? 4.901   -3.562  -1.304  1.00 0.00 ? 20  TRP A CB   7  
ATOM 9357  C CG   . TRP A 1 20  ? 5.930   -4.624  -1.548  1.00 0.00 ? 20  TRP A CG   7  
ATOM 9358  C CD1  . TRP A 1 20  ? 6.774   -5.174  -0.626  1.00 0.00 ? 20  TRP A CD1  7  
ATOM 9359  C CD2  . TRP A 1 20  ? 6.224   -5.261  -2.796  1.00 0.00 ? 20  TRP A CD2  7  
ATOM 9360  N NE1  . TRP A 1 20  ? 7.576   -6.115  -1.226  1.00 0.00 ? 20  TRP A NE1  7  
ATOM 9361  C CE2  . TRP A 1 20  ? 7.257   -6.188  -2.557  1.00 0.00 ? 20  TRP A CE2  7  
ATOM 9362  C CE3  . TRP A 1 20  ? 5.714   -5.141  -4.091  1.00 0.00 ? 20  TRP A CE3  7  
ATOM 9363  C CZ2  . TRP A 1 20  ? 7.788   -6.987  -3.566  1.00 0.00 ? 20  TRP A CZ2  7  
ATOM 9364  C CZ3  . TRP A 1 20  ? 6.242   -5.934  -5.091  1.00 0.00 ? 20  TRP A CZ3  7  
ATOM 9365  C CH2  . TRP A 1 20  ? 7.270   -6.848  -4.824  1.00 0.00 ? 20  TRP A CH2  7  
ATOM 9366  H H    . TRP A 1 20  ? 6.429   -2.172  0.310   1.00 0.00 ? 20  TRP A H    7  
ATOM 9367  H HA   . TRP A 1 20  ? 5.839   -2.094  -2.546  1.00 0.00 ? 20  TRP A HA   7  
ATOM 9368  H HB2  . TRP A 1 20  ? 4.574   -3.644  -0.278  1.00 0.00 ? 20  TRP A HB2  7  
ATOM 9369  H HB3  . TRP A 1 20  ? 4.064   -3.750  -1.961  1.00 0.00 ? 20  TRP A HB3  7  
ATOM 9370  H HD1  . TRP A 1 20  ? 6.799   -4.899  0.417   1.00 0.00 ? 20  TRP A HD1  7  
ATOM 9371  H HE1  . TRP A 1 20  ? 8.263   -6.649  -0.774  1.00 0.00 ? 20  TRP A HE1  7  
ATOM 9372  H HE3  . TRP A 1 20  ? 4.922   -4.442  -4.317  1.00 0.00 ? 20  TRP A HE3  7  
ATOM 9373  H HZ2  . TRP A 1 20  ? 8.580   -7.697  -3.376  1.00 0.00 ? 20  TRP A HZ2  7  
ATOM 9374  H HZ3  . TRP A 1 20  ? 5.861   -5.855  -6.099  1.00 0.00 ? 20  TRP A HZ3  7  
ATOM 9375  H HH2  . TRP A 1 20  ? 7.652   -7.448  -5.636  1.00 0.00 ? 20  TRP A HH2  7  
ATOM 9376  N N    . GLY A 1 21  ? 3.984   -0.468  -2.556  1.00 0.00 ? 21  GLY A N    7  
ATOM 9377  C CA   . GLY A 1 21  ? 2.911   0.509   -2.568  1.00 0.00 ? 21  GLY A CA   7  
ATOM 9378  C C    . GLY A 1 21  ? 1.701   0.032   -3.345  1.00 0.00 ? 21  GLY A C    7  
ATOM 9379  O O    . GLY A 1 21  ? 1.766   -0.973  -4.052  1.00 0.00 ? 21  GLY A O    7  
ATOM 9380  H H    . GLY A 1 21  ? 4.502   -0.634  -3.371  1.00 0.00 ? 21  GLY A H    7  
ATOM 9381  H HA2  . GLY A 1 21  ? 2.615   0.714   -1.550  1.00 0.00 ? 21  GLY A HA2  7  
ATOM 9382  H HA3  . GLY A 1 21  ? 3.276   1.422   -3.016  1.00 0.00 ? 21  GLY A HA3  7  
ATOM 9383  N N    . TRP A 1 22  ? 0.593   0.753   -3.213  1.00 0.00 ? 22  TRP A N    7  
ATOM 9384  C CA   . TRP A 1 22  ? -0.638  0.396   -3.908  1.00 0.00 ? 22  TRP A CA   7  
ATOM 9385  C C    . TRP A 1 22  ? -1.096  1.529   -4.821  1.00 0.00 ? 22  TRP A C    7  
ATOM 9386  O O    . TRP A 1 22  ? -1.195  2.680   -4.395  1.00 0.00 ? 22  TRP A O    7  
ATOM 9387  C CB   . TRP A 1 22  ? -1.738  0.060   -2.900  1.00 0.00 ? 22  TRP A CB   7  
ATOM 9388  C CG   . TRP A 1 22  ? -1.791  -1.394  -2.541  1.00 0.00 ? 22  TRP A CG   7  
ATOM 9389  C CD1  . TRP A 1 22  ? -1.088  -2.019  -1.550  1.00 0.00 ? 22  TRP A CD1  7  
ATOM 9390  C CD2  . TRP A 1 22  ? -2.587  -2.404  -3.169  1.00 0.00 ? 22  TRP A CD2  7  
ATOM 9391  N NE1  . TRP A 1 22  ? -1.399  -3.357  -1.526  1.00 0.00 ? 22  TRP A NE1  7  
ATOM 9392  C CE2  . TRP A 1 22  ? -2.317  -3.618  -2.508  1.00 0.00 ? 22  TRP A CE2  7  
ATOM 9393  C CE3  . TRP A 1 22  ? -3.503  -2.401  -4.224  1.00 0.00 ? 22  TRP A CE3  7  
ATOM 9394  C CZ2  . TRP A 1 22  ? -2.930  -4.815  -2.871  1.00 0.00 ? 22  TRP A CZ2  7  
ATOM 9395  C CZ3  . TRP A 1 22  ? -4.110  -3.589  -4.583  1.00 0.00 ? 22  TRP A CZ3  7  
ATOM 9396  C CH2  . TRP A 1 22  ? -3.823  -4.782  -3.907  1.00 0.00 ? 22  TRP A CH2  7  
ATOM 9397  H H    . TRP A 1 22  ? 0.604   1.545   -2.635  1.00 0.00 ? 22  TRP A H    7  
ATOM 9398  H HA   . TRP A 1 22  ? -0.436  -0.477  -4.511  1.00 0.00 ? 22  TRP A HA   7  
ATOM 9399  H HB2  . TRP A 1 22  ? -1.571  0.622   -1.994  1.00 0.00 ? 22  TRP A HB2  7  
ATOM 9400  H HB3  . TRP A 1 22  ? -2.696  0.336   -3.318  1.00 0.00 ? 22  TRP A HB3  7  
ATOM 9401  H HD1  . TRP A 1 22  ? -0.391  -1.522  -0.893  1.00 0.00 ? 22  TRP A HD1  7  
ATOM 9402  H HE1  . TRP A 1 22  ? -1.025  -4.016  -0.904  1.00 0.00 ? 22  TRP A HE1  7  
ATOM 9403  H HE3  . TRP A 1 22  ? -3.738  -1.491  -4.757  1.00 0.00 ? 22  TRP A HE3  7  
ATOM 9404  H HZ2  . TRP A 1 22  ? -2.719  -5.743  -2.359  1.00 0.00 ? 22  TRP A HZ2  7  
ATOM 9405  H HZ3  . TRP A 1 22  ? -4.821  -3.606  -5.397  1.00 0.00 ? 22  TRP A HZ3  7  
ATOM 9406  H HH2  . TRP A 1 22  ? -4.320  -5.687  -4.221  1.00 0.00 ? 22  TRP A HH2  7  
ATOM 9407  N N    . PHE A 1 23  ? -1.375  1.196   -6.076  1.00 0.00 ? 23  PHE A N    7  
ATOM 9408  C CA   . PHE A 1 23  ? -1.822  2.186   -7.049  1.00 0.00 ? 23  PHE A CA   7  
ATOM 9409  C C    . PHE A 1 23  ? -3.165  1.786   -7.655  1.00 0.00 ? 23  PHE A C    7  
ATOM 9410  O O    . PHE A 1 23  ? -3.457  0.601   -7.815  1.00 0.00 ? 23  PHE A O    7  
ATOM 9411  C CB   . PHE A 1 23  ? -0.780  2.351   -8.156  1.00 0.00 ? 23  PHE A CB   7  
ATOM 9412  C CG   . PHE A 1 23  ? 0.553   2.833   -7.658  1.00 0.00 ? 23  PHE A CG   7  
ATOM 9413  C CD1  . PHE A 1 23  ? 1.383   1.990   -6.936  1.00 0.00 ? 23  PHE A CD1  7  
ATOM 9414  C CD2  . PHE A 1 23  ? 0.976   4.128   -7.912  1.00 0.00 ? 23  PHE A CD2  7  
ATOM 9415  C CE1  . PHE A 1 23  ? 2.609   2.431   -6.476  1.00 0.00 ? 23  PHE A CE1  7  
ATOM 9416  C CE2  . PHE A 1 23  ? 2.201   4.574   -7.454  1.00 0.00 ? 23  PHE A CE2  7  
ATOM 9417  C CZ   . PHE A 1 23  ? 3.019   3.724   -6.736  1.00 0.00 ? 23  PHE A CZ   7  
ATOM 9418  H H    . PHE A 1 23  ? -1.277  0.261   -6.356  1.00 0.00 ? 23  PHE A H    7  
ATOM 9419  H HA   . PHE A 1 23  ? -1.939  3.126   -6.533  1.00 0.00 ? 23  PHE A HA   7  
ATOM 9420  H HB2  . PHE A 1 23  ? -0.627  1.399   -8.643  1.00 0.00 ? 23  PHE A HB2  7  
ATOM 9421  H HB3  . PHE A 1 23  ? -1.143  3.066   -8.879  1.00 0.00 ? 23  PHE A HB3  7  
ATOM 9422  H HD1  . PHE A 1 23  ? 1.065   0.978   -6.733  1.00 0.00 ? 23  PHE A HD1  7  
ATOM 9423  H HD2  . PHE A 1 23  ? 0.336   4.794   -8.474  1.00 0.00 ? 23  PHE A HD2  7  
ATOM 9424  H HE1  . PHE A 1 23  ? 3.248   1.765   -5.915  1.00 0.00 ? 23  PHE A HE1  7  
ATOM 9425  H HE2  . PHE A 1 23  ? 2.518   5.586   -7.659  1.00 0.00 ? 23  PHE A HE2  7  
ATOM 9426  H HZ   . PHE A 1 23  ? 3.977   4.071   -6.377  1.00 0.00 ? 23  PHE A HZ   7  
ATOM 9427  N N    . TYR A 1 24  ? -3.977  2.783   -7.988  1.00 0.00 ? 24  TYR A N    7  
ATOM 9428  C CA   . TYR A 1 24  ? -5.290  2.536   -8.573  1.00 0.00 ? 24  TYR A CA   7  
ATOM 9429  C C    . TYR A 1 24  ? -5.478  3.350   -9.850  1.00 0.00 ? 24  TYR A C    7  
ATOM 9430  O O    . TYR A 1 24  ? -5.225  4.555   -9.876  1.00 0.00 ? 24  TYR A O    7  
ATOM 9431  C CB   . TYR A 1 24  ? -6.391  2.879   -7.569  1.00 0.00 ? 24  TYR A CB   7  
ATOM 9432  C CG   . TYR A 1 24  ? -6.580  4.365   -7.361  1.00 0.00 ? 24  TYR A CG   7  
ATOM 9433  C CD1  . TYR A 1 24  ? -5.862  5.047   -6.387  1.00 0.00 ? 24  TYR A CD1  7  
ATOM 9434  C CD2  . TYR A 1 24  ? -7.478  5.086   -8.139  1.00 0.00 ? 24  TYR A CD2  7  
ATOM 9435  C CE1  . TYR A 1 24  ? -6.032  6.405   -6.193  1.00 0.00 ? 24  TYR A CE1  7  
ATOM 9436  C CE2  . TYR A 1 24  ? -7.653  6.444   -7.954  1.00 0.00 ? 24  TYR A CE2  7  
ATOM 9437  C CZ   . TYR A 1 24  ? -6.928  7.099   -6.980  1.00 0.00 ? 24  TYR A CZ   7  
ATOM 9438  O OH   . TYR A 1 24  ? -7.101  8.451   -6.791  1.00 0.00 ? 24  TYR A OH   7  
ATOM 9439  H H    . TYR A 1 24  ? -3.688  3.707   -7.836  1.00 0.00 ? 24  TYR A H    7  
ATOM 9440  H HA   . TYR A 1 24  ? -5.352  1.486   -8.816  1.00 0.00 ? 24  TYR A HA   7  
ATOM 9441  H HB2  . TYR A 1 24  ? -7.327  2.472   -7.918  1.00 0.00 ? 24  TYR A HB2  7  
ATOM 9442  H HB3  . TYR A 1 24  ? -6.147  2.439   -6.613  1.00 0.00 ? 24  TYR A HB3  7  
ATOM 9443  H HD1  . TYR A 1 24  ? -5.161  4.501   -5.772  1.00 0.00 ? 24  TYR A HD1  7  
ATOM 9444  H HD2  . TYR A 1 24  ? -8.044  4.570   -8.901  1.00 0.00 ? 24  TYR A HD2  7  
ATOM 9445  H HE1  . TYR A 1 24  ? -5.465  6.918   -5.431  1.00 0.00 ? 24  TYR A HE1  7  
ATOM 9446  H HE2  . TYR A 1 24  ? -8.355  6.987   -8.569  1.00 0.00 ? 24  TYR A HE2  7  
ATOM 9447  H HH   . TYR A 1 24  ? -6.258  8.854   -6.574  1.00 0.00 ? 24  TYR A HH   7  
ATOM 9448  N N    . LEU A 1 25  ? -5.926  2.682   -10.907 1.00 0.00 ? 25  LEU A N    7  
ATOM 9449  C CA   . LEU A 1 25  ? -6.151  3.342   -12.189 1.00 0.00 ? 25  LEU A CA   7  
ATOM 9450  C C    . LEU A 1 25  ? -7.385  4.237   -12.132 1.00 0.00 ? 25  LEU A C    7  
ATOM 9451  O O    . LEU A 1 25  ? -8.481  3.779   -11.811 1.00 0.00 ? 25  LEU A O    7  
ATOM 9452  C CB   . LEU A 1 25  ? -6.313  2.301   -13.299 1.00 0.00 ? 25  LEU A CB   7  
ATOM 9453  C CG   . LEU A 1 25  ? -6.411  2.849   -14.723 1.00 0.00 ? 25  LEU A CG   7  
ATOM 9454  C CD1  . LEU A 1 25  ? -5.841  1.851   -15.719 1.00 0.00 ? 25  LEU A CD1  7  
ATOM 9455  C CD2  . LEU A 1 25  ? -7.855  3.183   -15.067 1.00 0.00 ? 25  LEU A CD2  7  
ATOM 9456  H H    . LEU A 1 25  ? -6.111  1.724   -10.825 1.00 0.00 ? 25  LEU A H    7  
ATOM 9457  H HA   . LEU A 1 25  ? -5.287  3.953   -12.403 1.00 0.00 ? 25  LEU A HA   7  
ATOM 9458  H HB2  . LEU A 1 25  ? -5.462  1.639   -13.257 1.00 0.00 ? 25  LEU A HB2  7  
ATOM 9459  H HB3  . LEU A 1 25  ? -7.214  1.740   -13.096 1.00 0.00 ? 25  LEU A HB3  7  
ATOM 9460  H HG   . LEU A 1 25  ? -5.830  3.758   -14.793 1.00 0.00 ? 25  LEU A HG   7  
ATOM 9461  H HD11 . LEU A 1 25  ? -6.471  1.816   -16.594 1.00 0.00 ? 25  LEU A HD11 7  
ATOM 9462  H HD12 . LEU A 1 25  ? -5.800  0.872   -15.264 1.00 0.00 ? 25  LEU A HD12 7  
ATOM 9463  H HD13 . LEU A 1 25  ? -4.844  2.156   -16.004 1.00 0.00 ? 25  LEU A HD13 7  
ATOM 9464  H HD21 . LEU A 1 25  ? -8.315  3.691   -14.233 1.00 0.00 ? 25  LEU A HD21 7  
ATOM 9465  H HD22 . LEU A 1 25  ? -8.395  2.271   -15.276 1.00 0.00 ? 25  LEU A HD22 7  
ATOM 9466  H HD23 . LEU A 1 25  ? -7.879  3.823   -15.937 1.00 0.00 ? 25  LEU A HD23 7  
ATOM 9467  N N    . ALA A 1 26  ? -7.198  5.514   -12.448 1.00 0.00 ? 26  ALA A N    7  
ATOM 9468  C CA   . ALA A 1 26  ? -8.296  6.472   -12.436 1.00 0.00 ? 26  ALA A CA   7  
ATOM 9469  C C    . ALA A 1 26  ? -9.162  6.329   -13.683 1.00 0.00 ? 26  ALA A C    7  
ATOM 9470  O O    . ALA A 1 26  ? -8.708  5.826   -14.710 1.00 0.00 ? 26  ALA A O    7  
ATOM 9471  C CB   . ALA A 1 26  ? -7.758  7.891   -12.326 1.00 0.00 ? 26  ALA A CB   7  
ATOM 9472  H H    . ALA A 1 26  ? -6.300  5.819   -12.695 1.00 0.00 ? 26  ALA A H    7  
ATOM 9473  H HA   . ALA A 1 26  ? -8.903  6.275   -11.564 1.00 0.00 ? 26  ALA A HA   7  
ATOM 9474  H HB1  . ALA A 1 26  ? -8.467  8.503   -11.787 1.00 0.00 ? 26  ALA A HB1  7  
ATOM 9475  H HB2  . ALA A 1 26  ? -6.817  7.879   -11.796 1.00 0.00 ? 26  ALA A HB2  7  
ATOM 9476  H HB3  . ALA A 1 26  ? -7.609  8.298   -13.315 1.00 0.00 ? 26  ALA A HB3  7  
ATOM 9477  N N    . GLU A 1 27  ? -10.411 6.774   -13.585 1.00 0.00 ? 27  GLU A N    7  
ATOM 9478  C CA   . GLU A 1 27  ? -11.341 6.693   -14.706 1.00 0.00 ? 27  GLU A CA   7  
ATOM 9479  C C    . GLU A 1 27  ? -10.745 7.338   -15.954 1.00 0.00 ? 27  GLU A C    7  
ATOM 9480  O O    . GLU A 1 27  ? -10.969 6.874   -17.072 1.00 0.00 ? 27  GLU A O    7  
ATOM 9481  C CB   . GLU A 1 27  ? -12.664 7.373   -14.349 1.00 0.00 ? 27  GLU A CB   7  
ATOM 9482  C CG   . GLU A 1 27  ? -12.533 8.864   -14.093 1.00 0.00 ? 27  GLU A CG   7  
ATOM 9483  C CD   . GLU A 1 27  ? -13.813 9.480   -13.560 1.00 0.00 ? 27  GLU A CD   7  
ATOM 9484  O OE1  . GLU A 1 27  ? -14.903 9.031   -13.974 1.00 0.00 ? 27  GLU A OE1  7  
ATOM 9485  O OE2  . GLU A 1 27  ? -13.724 10.409  -12.731 1.00 0.00 ? 27  GLU A OE2  7  
ATOM 9486  H H    . GLU A 1 27  ? -10.715 7.165   -12.739 1.00 0.00 ? 27  GLU A H    7  
ATOM 9487  H HA   . GLU A 1 27  ? -11.526 5.649   -14.908 1.00 0.00 ? 27  GLU A HA   7  
ATOM 9488  H HB2  . GLU A 1 27  ? -13.360 7.227   -15.162 1.00 0.00 ? 27  GLU A HB2  7  
ATOM 9489  H HB3  . GLU A 1 27  ? -13.064 6.910   -13.459 1.00 0.00 ? 27  GLU A HB3  7  
ATOM 9490  H HG2  . GLU A 1 27  ? -11.747 9.025   -13.370 1.00 0.00 ? 27  GLU A HG2  7  
ATOM 9491  H HG3  . GLU A 1 27  ? -12.274 9.355   -15.020 1.00 0.00 ? 27  GLU A HG3  7  
ATOM 9492  N N    . CYS A 1 28  ? -9.987  8.410   -15.754 1.00 0.00 ? 28  CYS A N    7  
ATOM 9493  C CA   . CYS A 1 28  ? -9.360  9.121   -16.863 1.00 0.00 ? 28  CYS A CA   7  
ATOM 9494  C C    . CYS A 1 28  ? -8.316  8.245   -17.548 1.00 0.00 ? 28  CYS A C    7  
ATOM 9495  O O    . CYS A 1 28  ? -8.115  8.333   -18.759 1.00 0.00 ? 28  CYS A O    7  
ATOM 9496  C CB   . CYS A 1 28  ? -8.712  10.414  -16.366 1.00 0.00 ? 28  CYS A CB   7  
ATOM 9497  S SG   . CYS A 1 28  ? -9.850  11.814  -16.255 1.00 0.00 ? 28  CYS A SG   7  
ATOM 9498  H H    . CYS A 1 28  ? -9.845  8.733   -14.839 1.00 0.00 ? 28  CYS A H    7  
ATOM 9499  H HA   . CYS A 1 28  ? -10.131 9.366   -17.577 1.00 0.00 ? 28  CYS A HA   7  
ATOM 9500  H HB2  . CYS A 1 28  ? -8.301  10.247  -15.381 1.00 0.00 ? 28  CYS A HB2  7  
ATOM 9501  H HB3  . CYS A 1 28  ? -7.914  10.690  -17.039 1.00 0.00 ? 28  CYS A HB3  7  
ATOM 9502  H HG   . CYS A 1 28  ? -9.971  12.340  -17.465 1.00 0.00 ? 28  CYS A HG   7  
ATOM 9503  N N    . GLY A 1 29  ? -7.651  7.402   -16.764 1.00 0.00 ? 29  GLY A N    7  
ATOM 9504  C CA   . GLY A 1 29  ? -6.634  6.524   -17.313 1.00 0.00 ? 29  GLY A CA   7  
ATOM 9505  C C    . GLY A 1 29  ? -5.261  6.789   -16.727 1.00 0.00 ? 29  GLY A C    7  
ATOM 9506  O O    . GLY A 1 29  ? -4.248  6.646   -17.411 1.00 0.00 ? 29  GLY A O    7  
ATOM 9507  H H    . GLY A 1 29  ? -7.853  7.375   -15.806 1.00 0.00 ? 29  GLY A H    7  
ATOM 9508  H HA2  . GLY A 1 29  ? -6.909  5.500   -17.109 1.00 0.00 ? 29  GLY A HA2  7  
ATOM 9509  H HA3  . GLY A 1 29  ? -6.590  6.668   -18.383 1.00 0.00 ? 29  GLY A HA3  7  
ATOM 9510  N N    . LYS A 1 30  ? -5.227  7.180   -15.458 1.00 0.00 ? 30  LYS A N    7  
ATOM 9511  C CA   . LYS A 1 30  ? -3.969  7.467   -14.779 1.00 0.00 ? 30  LYS A CA   7  
ATOM 9512  C C    . LYS A 1 30  ? -3.915  6.777   -13.420 1.00 0.00 ? 30  LYS A C    7  
ATOM 9513  O O    . LYS A 1 30  ? -4.784  6.985   -12.573 1.00 0.00 ? 30  LYS A O    7  
ATOM 9514  C CB   . LYS A 1 30  ? -3.794  8.977   -14.604 1.00 0.00 ? 30  LYS A CB   7  
ATOM 9515  C CG   . LYS A 1 30  ? -3.814  9.748   -15.913 1.00 0.00 ? 30  LYS A CG   7  
ATOM 9516  C CD   . LYS A 1 30  ? -2.526  9.554   -16.695 1.00 0.00 ? 30  LYS A CD   7  
ATOM 9517  C CE   . LYS A 1 30  ? -1.397  10.401  -16.128 1.00 0.00 ? 30  LYS A CE   7  
ATOM 9518  N NZ   . LYS A 1 30  ? -0.313  10.620  -17.125 1.00 0.00 ? 30  LYS A NZ   7  
ATOM 9519  H H    . LYS A 1 30  ? -6.069  7.276   -14.965 1.00 0.00 ? 30  LYS A H    7  
ATOM 9520  H HA   . LYS A 1 30  ? -3.166  7.089   -15.394 1.00 0.00 ? 30  LYS A HA   7  
ATOM 9521  H HB2  . LYS A 1 30  ? -4.591  9.350   -13.978 1.00 0.00 ? 30  LYS A HB2  7  
ATOM 9522  H HB3  . LYS A 1 30  ? -2.848  9.163   -14.116 1.00 0.00 ? 30  LYS A HB3  7  
ATOM 9523  H HG2  . LYS A 1 30  ? -4.642  9.399   -16.512 1.00 0.00 ? 30  LYS A HG2  7  
ATOM 9524  H HG3  . LYS A 1 30  ? -3.940  10.800  -15.699 1.00 0.00 ? 30  LYS A HG3  7  
ATOM 9525  H HD2  . LYS A 1 30  ? -2.239  8.514   -16.646 1.00 0.00 ? 30  LYS A HD2  7  
ATOM 9526  H HD3  . LYS A 1 30  ? -2.694  9.835   -17.724 1.00 0.00 ? 30  LYS A HD3  7  
ATOM 9527  H HE2  . LYS A 1 30  ? -1.798  11.358  -15.829 1.00 0.00 ? 30  LYS A HE2  7  
ATOM 9528  H HE3  . LYS A 1 30  ? -0.985  9.898   -15.266 1.00 0.00 ? 30  LYS A HE3  7  
ATOM 9529  H HZ1  . LYS A 1 30  ? 0.596   10.759  -16.640 1.00 0.00 ? 30  LYS A HZ1  7  
ATOM 9530  H HZ2  . LYS A 1 30  ? -0.520  11.463  -17.698 1.00 0.00 ? 30  LYS A HZ2  7  
ATOM 9531  H HZ3  . LYS A 1 30  ? -0.235  9.796   -17.755 1.00 0.00 ? 30  LYS A HZ3  7  
ATOM 9532  N N    . TRP A 1 31  ? -2.889  5.959   -13.217 1.00 0.00 ? 31  TRP A N    7  
ATOM 9533  C CA   . TRP A 1 31  ? -2.721  5.240   -11.959 1.00 0.00 ? 31  TRP A CA   7  
ATOM 9534  C C    . TRP A 1 31  ? -2.166  6.160   -10.877 1.00 0.00 ? 31  TRP A C    7  
ATOM 9535  O O    . TRP A 1 31  ? -1.005  6.569   -10.931 1.00 0.00 ? 31  TRP A O    7  
ATOM 9536  C CB   . TRP A 1 31  ? -1.791  4.041   -12.153 1.00 0.00 ? 31  TRP A CB   7  
ATOM 9537  C CG   . TRP A 1 31  ? -2.279  3.073   -13.188 1.00 0.00 ? 31  TRP A CG   7  
ATOM 9538  C CD1  . TRP A 1 31  ? -2.208  3.218   -14.544 1.00 0.00 ? 31  TRP A CD1  7  
ATOM 9539  C CD2  . TRP A 1 31  ? -2.914  1.812   -12.951 1.00 0.00 ? 31  TRP A CD2  7  
ATOM 9540  N NE1  . TRP A 1 31  ? -2.761  2.124   -15.164 1.00 0.00 ? 31  TRP A NE1  7  
ATOM 9541  C CE2  . TRP A 1 31  ? -3.200  1.246   -14.208 1.00 0.00 ? 31  TRP A CE2  7  
ATOM 9542  C CE3  . TRP A 1 31  ? -3.266  1.105   -11.798 1.00 0.00 ? 31  TRP A CE3  7  
ATOM 9543  C CZ2  . TRP A 1 31  ? -3.823  0.008   -14.343 1.00 0.00 ? 31  TRP A CZ2  7  
ATOM 9544  C CZ3  . TRP A 1 31  ? -3.885  -0.123  -11.933 1.00 0.00 ? 31  TRP A CZ3  7  
ATOM 9545  C CH2  . TRP A 1 31  ? -4.157  -0.662  -13.198 1.00 0.00 ? 31  TRP A CH2  7  
ATOM 9546  H H    . TRP A 1 31  ? -2.228  5.835   -13.931 1.00 0.00 ? 31  TRP A H    7  
ATOM 9547  H HA   . TRP A 1 31  ? -3.692  4.885   -11.650 1.00 0.00 ? 31  TRP A HA   7  
ATOM 9548  H HB2  . TRP A 1 31  ? -0.818  4.394   -12.459 1.00 0.00 ? 31  TRP A HB2  7  
ATOM 9549  H HB3  . TRP A 1 31  ? -1.700  3.511   -11.216 1.00 0.00 ? 31  TRP A HB3  7  
ATOM 9550  H HD1  . TRP A 1 31  ? -1.780  4.075   -15.043 1.00 0.00 ? 31  TRP A HD1  7  
ATOM 9551  H HE1  . TRP A 1 31  ? -2.828  1.992   -16.133 1.00 0.00 ? 31  TRP A HE1  7  
ATOM 9552  H HE3  . TRP A 1 31  ? -3.064  1.504   -10.815 1.00 0.00 ? 31  TRP A HE3  7  
ATOM 9553  H HZ2  . TRP A 1 31  ? -4.039  -0.421  -15.310 1.00 0.00 ? 31  TRP A HZ2  7  
ATOM 9554  H HZ3  . TRP A 1 31  ? -4.165  -0.684  -11.053 1.00 0.00 ? 31  TRP A HZ3  7  
ATOM 9555  H HH2  . TRP A 1 31  ? -4.642  -1.624  -13.256 1.00 0.00 ? 31  TRP A HH2  7  
ATOM 9556  N N    . HIS A 1 32  ? -3.001  6.482   -9.894  1.00 0.00 ? 32  HIS A N    7  
ATOM 9557  C CA   . HIS A 1 32  ? -2.592  7.353   -8.798  1.00 0.00 ? 32  HIS A CA   7  
ATOM 9558  C C    . HIS A 1 32  ? -2.430  6.559   -7.505  1.00 0.00 ? 32  HIS A C    7  
ATOM 9559  O O    . HIS A 1 32  ? -3.324  5.814   -7.107  1.00 0.00 ? 32  HIS A O    7  
ATOM 9560  C CB   . HIS A 1 32  ? -3.615  8.471   -8.599  1.00 0.00 ? 32  HIS A CB   7  
ATOM 9561  C CG   . HIS A 1 32  ? -3.735  9.390   -9.775  1.00 0.00 ? 32  HIS A CG   7  
ATOM 9562  N ND1  . HIS A 1 32  ? -2.669  10.098  -10.289 1.00 0.00 ? 32  HIS A ND1  7  
ATOM 9563  C CD2  . HIS A 1 32  ? -4.804  9.714   -10.540 1.00 0.00 ? 32  HIS A CD2  7  
ATOM 9564  C CE1  . HIS A 1 32  ? -3.077  10.818  -11.319 1.00 0.00 ? 32  HIS A CE1  7  
ATOM 9565  N NE2  . HIS A 1 32  ? -4.369  10.603  -11.492 1.00 0.00 ? 32  HIS A NE2  7  
ATOM 9566  H H    . HIS A 1 32  ? -3.913  6.125   -9.906  1.00 0.00 ? 32  HIS A H    7  
ATOM 9567  H HA   . HIS A 1 32  ? -1.640  7.790   -9.059  1.00 0.00 ? 32  HIS A HA   7  
ATOM 9568  H HB2  . HIS A 1 32  ? -4.586  8.034   -8.420  1.00 0.00 ? 32  HIS A HB2  7  
ATOM 9569  H HB3  . HIS A 1 32  ? -3.329  9.064   -7.742  1.00 0.00 ? 32  HIS A HB3  7  
ATOM 9570  H HD1  . HIS A 1 32  ? -1.751  10.076  -9.949  1.00 0.00 ? 32  HIS A HD1  7  
ATOM 9571  H HD2  . HIS A 1 32  ? -5.812  9.342   -10.424 1.00 0.00 ? 32  HIS A HD2  7  
ATOM 9572  H HE1  . HIS A 1 32  ? -2.460  11.472  -11.917 1.00 0.00 ? 32  HIS A HE1  7  
ATOM 9573  N N    . MET A 1 33  ? -1.282  6.725   -6.855  1.00 0.00 ? 33  MET A N    7  
ATOM 9574  C CA   . MET A 1 33  ? -1.004  6.024   -5.607  1.00 0.00 ? 33  MET A CA   7  
ATOM 9575  C C    . MET A 1 33  ? -2.066  6.338   -4.558  1.00 0.00 ? 33  MET A C    7  
ATOM 9576  O O    . MET A 1 33  ? -2.705  7.389   -4.603  1.00 0.00 ? 33  MET A O    7  
ATOM 9577  C CB   . MET A 1 33  ? 0.380   6.408   -5.079  1.00 0.00 ? 33  MET A CB   7  
ATOM 9578  C CG   . MET A 1 33  ? 0.955   5.404   -4.093  1.00 0.00 ? 33  MET A CG   7  
ATOM 9579  S SD   . MET A 1 33  ? 2.735   5.586   -3.875  1.00 0.00 ? 33  MET A SD   7  
ATOM 9580  C CE   . MET A 1 33  ? 2.858   5.594   -2.088  1.00 0.00 ? 33  MET A CE   7  
ATOM 9581  H H    . MET A 1 33  ? -0.607  7.333   -7.223  1.00 0.00 ? 33  MET A H    7  
ATOM 9582  H HA   . MET A 1 33  ? -1.019  4.964   -5.812  1.00 0.00 ? 33  MET A HA   7  
ATOM 9583  H HB2  . MET A 1 33  ? 1.060   6.491   -5.914  1.00 0.00 ? 33  MET A HB2  7  
ATOM 9584  H HB3  . MET A 1 33  ? 0.311   7.366   -4.585  1.00 0.00 ? 33  MET A HB3  7  
ATOM 9585  H HG2  . MET A 1 33  ? 0.474   5.544   -3.136  1.00 0.00 ? 33  MET A HG2  7  
ATOM 9586  H HG3  . MET A 1 33  ? 0.750   4.408   -4.455  1.00 0.00 ? 33  MET A HG3  7  
ATOM 9587  H HE1  . MET A 1 33  ? 3.368   6.491   -1.766  1.00 0.00 ? 33  MET A HE1  7  
ATOM 9588  H HE2  . MET A 1 33  ? 1.868   5.569   -1.659  1.00 0.00 ? 33  MET A HE2  7  
ATOM 9589  H HE3  . MET A 1 33  ? 3.415   4.727   -1.762  1.00 0.00 ? 33  MET A HE3  7  
ATOM 9590  N N    . PHE A 1 34  ? -2.250  5.419   -3.616  1.00 0.00 ? 34  PHE A N    7  
ATOM 9591  C CA   . PHE A 1 34  ? -3.236  5.598   -2.557  1.00 0.00 ? 34  PHE A CA   7  
ATOM 9592  C C    . PHE A 1 34  ? -2.742  6.599   -1.517  1.00 0.00 ? 34  PHE A C    7  
ATOM 9593  O O    . PHE A 1 34  ? -1.700  6.399   -0.894  1.00 0.00 ? 34  PHE A O    7  
ATOM 9594  C CB   . PHE A 1 34  ? -3.543  4.258   -1.885  1.00 0.00 ? 34  PHE A CB   7  
ATOM 9595  C CG   . PHE A 1 34  ? -4.628  3.478   -2.571  1.00 0.00 ? 34  PHE A CG   7  
ATOM 9596  C CD1  . PHE A 1 34  ? -5.963  3.767   -2.336  1.00 0.00 ? 34  PHE A CD1  7  
ATOM 9597  C CD2  . PHE A 1 34  ? -4.314  2.456   -3.452  1.00 0.00 ? 34  PHE A CD2  7  
ATOM 9598  C CE1  . PHE A 1 34  ? -6.962  3.051   -2.966  1.00 0.00 ? 34  PHE A CE1  7  
ATOM 9599  C CE2  . PHE A 1 34  ? -5.309  1.736   -4.085  1.00 0.00 ? 34  PHE A CE2  7  
ATOM 9600  C CZ   . PHE A 1 34  ? -6.636  2.034   -3.842  1.00 0.00 ? 34  PHE A CZ   7  
ATOM 9601  H H    . PHE A 1 34  ? -1.710  4.601   -3.634  1.00 0.00 ? 34  PHE A H    7  
ATOM 9602  H HA   . PHE A 1 34  ? -4.139  5.980   -3.007  1.00 0.00 ? 34  PHE A HA   7  
ATOM 9603  H HB2  . PHE A 1 34  ? -2.650  3.651   -1.883  1.00 0.00 ? 34  PHE A HB2  7  
ATOM 9604  H HB3  . PHE A 1 34  ? -3.855  4.437   -0.867  1.00 0.00 ? 34  PHE A HB3  7  
ATOM 9605  H HD1  . PHE A 1 34  ? -6.220  4.562   -1.652  1.00 0.00 ? 34  PHE A HD1  7  
ATOM 9606  H HD2  . PHE A 1 34  ? -3.275  2.221   -3.643  1.00 0.00 ? 34  PHE A HD2  7  
ATOM 9607  H HE1  . PHE A 1 34  ? -7.999  3.286   -2.774  1.00 0.00 ? 34  PHE A HE1  7  
ATOM 9608  H HE2  . PHE A 1 34  ? -5.050  0.942   -4.770  1.00 0.00 ? 34  PHE A HE2  7  
ATOM 9609  H HZ   . PHE A 1 34  ? -7.415  1.473   -4.335  1.00 0.00 ? 34  PHE A HZ   7  
ATOM 9610  N N    . GLN A 1 35  ? -3.499  7.677   -1.336  1.00 0.00 ? 35  GLN A N    7  
ATOM 9611  C CA   . GLN A 1 35  ? -3.137  8.710   -0.373  1.00 0.00 ? 35  GLN A CA   7  
ATOM 9612  C C    . GLN A 1 35  ? -4.325  9.067   0.515   1.00 0.00 ? 35  GLN A C    7  
ATOM 9613  O O    . GLN A 1 35  ? -5.480  9.034   0.090   1.00 0.00 ? 35  GLN A O    7  
ATOM 9614  C CB   . GLN A 1 35  ? -2.634  9.960   -1.098  1.00 0.00 ? 35  GLN A CB   7  
ATOM 9615  C CG   . GLN A 1 35  ? -1.193  9.850   -1.570  1.00 0.00 ? 35  GLN A CG   7  
ATOM 9616  C CD   . GLN A 1 35  ? -0.199  9.885   -0.426  1.00 0.00 ? 35  GLN A CD   7  
ATOM 9617  O OE1  . GLN A 1 35  ? -0.305  9.114   0.527   1.00 0.00 ? 35  GLN A OE1  7  
ATOM 9618  N NE2  . GLN A 1 35  ? 0.774   10.784  -0.515  1.00 0.00 ? 35  GLN A NE2  7  
ATOM 9619  H H    . GLN A 1 35  ? -4.318  7.780   -1.862  1.00 0.00 ? 35  GLN A H    7  
ATOM 9620  H HA   . GLN A 1 35  ? -2.344  8.322   0.248   1.00 0.00 ? 35  GLN A HA   7  
ATOM 9621  H HB2  . GLN A 1 35  ? -3.260  10.138  -1.959  1.00 0.00 ? 35  GLN A HB2  7  
ATOM 9622  H HB3  . GLN A 1 35  ? -2.707  10.804  -0.428  1.00 0.00 ? 35  GLN A HB3  7  
ATOM 9623  H HG2  . GLN A 1 35  ? -1.072  8.918   -2.102  1.00 0.00 ? 35  GLN A HG2  7  
ATOM 9624  H HG3  . GLN A 1 35  ? -0.983  10.673  -2.237  1.00 0.00 ? 35  GLN A HG3  7  
ATOM 9625  H HE21 . GLN A 1 35  ? 0.795   11.367  -1.303  1.00 0.00 ? 35  GLN A HE21 7  
ATOM 9626  H HE22 . GLN A 1 35  ? 1.430   10.829  0.211   1.00 0.00 ? 35  GLN A HE22 7  
ATOM 9627  N N    . PRO A 1 36  ? -4.038  9.416   1.777   1.00 0.00 ? 36  PRO A N    7  
ATOM 9628  C CA   . PRO A 1 36  ? -5.069  9.786   2.751   1.00 0.00 ? 36  PRO A CA   7  
ATOM 9629  C C    . PRO A 1 36  ? -5.720  11.126  2.425   1.00 0.00 ? 36  PRO A C    7  
ATOM 9630  O O    . PRO A 1 36  ? -5.060  12.166  2.432   1.00 0.00 ? 36  PRO A O    7  
ATOM 9631  C CB   . PRO A 1 36  ? -4.298  9.873   4.070   1.00 0.00 ? 36  PRO A CB   7  
ATOM 9632  C CG   . PRO A 1 36  ? -2.894  10.172  3.669   1.00 0.00 ? 36  PRO A CG   7  
ATOM 9633  C CD   . PRO A 1 36  ? -2.683  9.477   2.352   1.00 0.00 ? 36  PRO A CD   7  
ATOM 9634  H HA   . PRO A 1 36  ? -5.833  9.026   2.828   1.00 0.00 ? 36  PRO A HA   7  
ATOM 9635  H HB2  . PRO A 1 36  ? -4.711  10.663  4.680   1.00 0.00 ? 36  PRO A HB2  7  
ATOM 9636  H HB3  . PRO A 1 36  ? -4.366  8.932   4.594   1.00 0.00 ? 36  PRO A HB3  7  
ATOM 9637  H HG2  . PRO A 1 36  ? -2.764  11.238  3.556   1.00 0.00 ? 36  PRO A HG2  7  
ATOM 9638  H HG3  . PRO A 1 36  ? -2.211  9.785   4.410   1.00 0.00 ? 36  PRO A HG3  7  
ATOM 9639  H HD2  . PRO A 1 36  ? -2.023  10.055  1.722   1.00 0.00 ? 36  PRO A HD2  7  
ATOM 9640  H HD3  . PRO A 1 36  ? -2.287  8.485   2.508   1.00 0.00 ? 36  PRO A HD3  7  
ATOM 9641  N N    . ASP A 1 37  ? -7.017  11.095  2.140   1.00 0.00 ? 37  ASP A N    7  
ATOM 9642  C CA   . ASP A 1 37  ? -7.758  12.308  1.813   1.00 0.00 ? 37  ASP A CA   7  
ATOM 9643  C C    . ASP A 1 37  ? -8.045  13.124  3.069   1.00 0.00 ? 37  ASP A C    7  
ATOM 9644  O O    . ASP A 1 37  ? -8.012  12.602  4.184   1.00 0.00 ? 37  ASP A O    7  
ATOM 9645  C CB   . ASP A 1 37  ? -9.068  11.956  1.108   1.00 0.00 ? 37  ASP A CB   7  
ATOM 9646  C CG   . ASP A 1 37  ? -9.569  13.080  0.222   1.00 0.00 ? 37  ASP A CG   7  
ATOM 9647  O OD1  . ASP A 1 37  ? -10.131 14.056  0.762   1.00 0.00 ? 37  ASP A OD1  7  
ATOM 9648  O OD2  . ASP A 1 37  ? -9.399  12.985  -1.012  1.00 0.00 ? 37  ASP A OD2  7  
ATOM 9649  H H    . ASP A 1 37  ? -7.488  10.235  2.151   1.00 0.00 ? 37  ASP A H    7  
ATOM 9650  H HA   . ASP A 1 37  ? -7.148  12.899  1.147   1.00 0.00 ? 37  ASP A HA   7  
ATOM 9651  H HB2  . ASP A 1 37  ? -8.916  11.081  0.494   1.00 0.00 ? 37  ASP A HB2  7  
ATOM 9652  H HB3  . ASP A 1 37  ? -9.823  11.743  1.850   1.00 0.00 ? 37  ASP A HB3  7  
ATOM 9653  N N    . THR A 1 38  ? -8.327  14.410  2.882   1.00 0.00 ? 38  THR A N    7  
ATOM 9654  C CA   . THR A 1 38  ? -8.618  15.300  3.999   1.00 0.00 ? 38  THR A CA   7  
ATOM 9655  C C    . THR A 1 38  ? -9.615  14.665  4.962   1.00 0.00 ? 38  THR A C    7  
ATOM 9656  O O    . THR A 1 38  ? -10.271 13.678  4.630   1.00 0.00 ? 38  THR A O    7  
ATOM 9657  C CB   . THR A 1 38  ? -9.180  16.649  3.512   1.00 0.00 ? 38  THR A CB   7  
ATOM 9658  O OG1  . THR A 1 38  ? -9.296  17.557  4.612   1.00 0.00 ? 38  THR A OG1  7  
ATOM 9659  C CG2  . THR A 1 38  ? -10.539 16.463  2.855   1.00 0.00 ? 38  THR A CG2  7  
ATOM 9660  H H    . THR A 1 38  ? -8.339  14.768  1.970   1.00 0.00 ? 38  THR A H    7  
ATOM 9661  H HA   . THR A 1 38  ? -7.694  15.487  4.526   1.00 0.00 ? 38  THR A HA   7  
ATOM 9662  H HB   . THR A 1 38  ? -8.498  17.063  2.783   1.00 0.00 ? 38  THR A HB   7  
ATOM 9663  H HG1  . THR A 1 38  ? -9.964  18.217  4.413   1.00 0.00 ? 38  THR A HG1  7  
ATOM 9664  H HG21 . THR A 1 38  ? -11.179 15.888  3.508   1.00 0.00 ? 38  THR A HG21 7  
ATOM 9665  H HG22 . THR A 1 38  ? -10.418 15.941  1.918   1.00 0.00 ? 38  THR A HG22 7  
ATOM 9666  H HG23 . THR A 1 38  ? -10.986 17.429  2.674   1.00 0.00 ? 38  THR A HG23 7  
ATOM 9667  N N    . ASN A 1 39  ? -9.725  15.239  6.156   1.00 0.00 ? 39  ASN A N    7  
ATOM 9668  C CA   . ASN A 1 39  ? -10.643 14.728  7.168   1.00 0.00 ? 39  ASN A CA   7  
ATOM 9669  C C    . ASN A 1 39  ? -12.047 14.563  6.594   1.00 0.00 ? 39  ASN A C    7  
ATOM 9670  O O    . ASN A 1 39  ? -12.669 13.511  6.739   1.00 0.00 ? 39  ASN A O    7  
ATOM 9671  C CB   . ASN A 1 39  ? -10.680 15.669  8.374   1.00 0.00 ? 39  ASN A CB   7  
ATOM 9672  C CG   . ASN A 1 39  ? -9.376  15.668  9.148   1.00 0.00 ? 39  ASN A CG   7  
ATOM 9673  O OD1  . ASN A 1 39  ? -8.551  14.767  8.995   1.00 0.00 ? 39  ASN A OD1  7  
ATOM 9674  N ND2  . ASN A 1 39  ? -9.184  16.681  9.984   1.00 0.00 ? 39  ASN A ND2  7  
ATOM 9675  H H    . ASN A 1 39  ? -9.175  16.023  6.362   1.00 0.00 ? 39  ASN A H    7  
ATOM 9676  H HA   . ASN A 1 39  ? -10.281 13.762  7.486   1.00 0.00 ? 39  ASN A HA   7  
ATOM 9677  H HB2  . ASN A 1 39  ? -10.872 16.675  8.032   1.00 0.00 ? 39  ASN A HB2  7  
ATOM 9678  H HB3  . ASN A 1 39  ? -11.473 15.361  9.039   1.00 0.00 ? 39  ASN A HB3  7  
ATOM 9679  H HD21 . ASN A 1 39  ? -9.884  17.363  10.054  1.00 0.00 ? 39  ASN A HD21 7  
ATOM 9680  H HD22 . ASN A 1 39  ? -8.349  16.706  10.496  1.00 0.00 ? 39  ASN A HD22 7  
ATOM 9681  N N    . SER A 1 40  ? -12.541 15.611  5.941   1.00 0.00 ? 40  SER A N    7  
ATOM 9682  C CA   . SER A 1 40  ? -13.872 15.584  5.348   1.00 0.00 ? 40  SER A CA   7  
ATOM 9683  C C    . SER A 1 40  ? -14.149 14.233  4.694   1.00 0.00 ? 40  SER A C    7  
ATOM 9684  O O    . SER A 1 40  ? -15.070 13.519  5.088   1.00 0.00 ? 40  SER A O    7  
ATOM 9685  C CB   . SER A 1 40  ? -14.016 16.702  4.314   1.00 0.00 ? 40  SER A CB   7  
ATOM 9686  O OG   . SER A 1 40  ? -15.333 16.749  3.793   1.00 0.00 ? 40  SER A OG   7  
ATOM 9687  H H    . SER A 1 40  ? -11.996 16.422  5.859   1.00 0.00 ? 40  SER A H    7  
ATOM 9688  H HA   . SER A 1 40  ? -14.591 15.741  6.139   1.00 0.00 ? 40  SER A HA   7  
ATOM 9689  H HB2  . SER A 1 40  ? -13.792 17.650  4.780   1.00 0.00 ? 40  SER A HB2  7  
ATOM 9690  H HB3  . SER A 1 40  ? -13.326 16.528  3.501   1.00 0.00 ? 40  SER A HB3  7  
ATOM 9691  H HG   . SER A 1 40  ? -15.734 15.879  3.857   1.00 0.00 ? 40  SER A HG   7  
ATOM 9692  N N    . GLN A 1 41  ? -13.343 13.892  3.694   1.00 0.00 ? 41  GLN A N    7  
ATOM 9693  C CA   . GLN A 1 41  ? -13.501 12.627  2.984   1.00 0.00 ? 41  GLN A CA   7  
ATOM 9694  C C    . GLN A 1 41  ? -12.351 11.678  3.302   1.00 0.00 ? 41  GLN A C    7  
ATOM 9695  O O    . GLN A 1 41  ? -11.877 10.947  2.430   1.00 0.00 ? 41  GLN A O    7  
ATOM 9696  C CB   . GLN A 1 41  ? -13.575 12.871  1.476   1.00 0.00 ? 41  GLN A CB   7  
ATOM 9697  C CG   . GLN A 1 41  ? -14.145 11.696  0.698   1.00 0.00 ? 41  GLN A CG   7  
ATOM 9698  C CD   . GLN A 1 41  ? -13.732 11.706  -0.761  1.00 0.00 ? 41  GLN A CD   7  
ATOM 9699  O OE1  . GLN A 1 41  ? -12.807 12.420  -1.151  1.00 0.00 ? 41  GLN A OE1  7  
ATOM 9700  N NE2  . GLN A 1 41  ? -14.416 10.912  -1.576  1.00 0.00 ? 41  GLN A NE2  7  
ATOM 9701  H H    . GLN A 1 41  ? -12.627 14.504  3.426   1.00 0.00 ? 41  GLN A H    7  
ATOM 9702  H HA   . GLN A 1 41  ? -14.425 12.176  3.313   1.00 0.00 ? 41  GLN A HA   7  
ATOM 9703  H HB2  . GLN A 1 41  ? -14.199 13.733  1.293   1.00 0.00 ? 41  GLN A HB2  7  
ATOM 9704  H HB3  . GLN A 1 41  ? -12.580 13.070  1.106   1.00 0.00 ? 41  GLN A HB3  7  
ATOM 9705  H HG2  . GLN A 1 41  ? -13.796 10.778  1.148   1.00 0.00 ? 41  GLN A HG2  7  
ATOM 9706  H HG3  . GLN A 1 41  ? -15.223 11.734  0.752   1.00 0.00 ? 41  GLN A HG3  7  
ATOM 9707  H HE21 . GLN A 1 41  ? -15.141 10.372  -1.195  1.00 0.00 ? 41  GLN A HE21 7  
ATOM 9708  H HE22 . GLN A 1 41  ? -14.171 10.900  -2.524  1.00 0.00 ? 41  GLN A HE22 7  
ATOM 9709  N N    . CYS A 1 42  ? -11.906 11.693  4.553   1.00 0.00 ? 42  CYS A N    7  
ATOM 9710  C CA   . CYS A 1 42  ? -10.810 10.834  4.986   1.00 0.00 ? 42  CYS A CA   7  
ATOM 9711  C C    . CYS A 1 42  ? -10.897 9.464   4.320   1.00 0.00 ? 42  CYS A C    7  
ATOM 9712  O O    . CYS A 1 42  ? -11.855 8.721   4.530   1.00 0.00 ? 42  CYS A O    7  
ATOM 9713  C CB   . CYS A 1 42  ? -10.827 10.676  6.507   1.00 0.00 ? 42  CYS A CB   7  
ATOM 9714  S SG   . CYS A 1 42  ? -12.334 9.913   7.153   1.00 0.00 ? 42  CYS A SG   7  
ATOM 9715  H H    . CYS A 1 42  ? -12.324 12.297  5.203   1.00 0.00 ? 42  CYS A H    7  
ATOM 9716  H HA   . CYS A 1 42  ? -9.884  11.305  4.692   1.00 0.00 ? 42  CYS A HA   7  
ATOM 9717  H HB2  . CYS A 1 42  ? -9.993  10.060  6.807   1.00 0.00 ? 42  CYS A HB2  7  
ATOM 9718  H HB3  . CYS A 1 42  ? -10.729 11.650  6.963   1.00 0.00 ? 42  CYS A HB3  7  
ATOM 9719  H HG   . CYS A 1 42  ? -13.334 10.239  6.349   1.00 0.00 ? 42  CYS A HG   7  
ATOM 9720  N N    . SER A 1 43  ? -9.891  9.139   3.515   1.00 0.00 ? 43  SER A N    7  
ATOM 9721  C CA   . SER A 1 43  ? -9.856  7.861   2.813   1.00 0.00 ? 43  SER A CA   7  
ATOM 9722  C C    . SER A 1 43  ? -8.829  6.924   3.441   1.00 0.00 ? 43  SER A C    7  
ATOM 9723  O O    . SER A 1 43  ? -8.146  7.285   4.399   1.00 0.00 ? 43  SER A O    7  
ATOM 9724  C CB   . SER A 1 43  ? -9.529  8.076   1.334   1.00 0.00 ? 43  SER A CB   7  
ATOM 9725  O OG   . SER A 1 43  ? -8.165  8.416   1.157   1.00 0.00 ? 43  SER A OG   7  
ATOM 9726  H H    . SER A 1 43  ? -9.155  9.774   3.388   1.00 0.00 ? 43  SER A H    7  
ATOM 9727  H HA   . SER A 1 43  ? -10.835 7.411   2.894   1.00 0.00 ? 43  SER A HA   7  
ATOM 9728  H HB2  . SER A 1 43  ? -9.735  7.169   0.786   1.00 0.00 ? 43  SER A HB2  7  
ATOM 9729  H HB3  . SER A 1 43  ? -10.141 8.878   0.946   1.00 0.00 ? 43  SER A HB3  7  
ATOM 9730  H HG   . SER A 1 43  ? -7.687  7.657   0.816   1.00 0.00 ? 43  SER A HG   7  
ATOM 9731  N N    . VAL A 1 44  ? -8.727  5.717   2.894   1.00 0.00 ? 44  VAL A N    7  
ATOM 9732  C CA   . VAL A 1 44  ? -7.783  4.726   3.399   1.00 0.00 ? 44  VAL A CA   7  
ATOM 9733  C C    . VAL A 1 44  ? -6.417  4.883   2.741   1.00 0.00 ? 44  VAL A C    7  
ATOM 9734  O O    . VAL A 1 44  ? -6.319  5.082   1.530   1.00 0.00 ? 44  VAL A O    7  
ATOM 9735  C CB   . VAL A 1 44  ? -8.293  3.293   3.161   1.00 0.00 ? 44  VAL A CB   7  
ATOM 9736  C CG1  . VAL A 1 44  ? -9.605  3.064   3.896   1.00 0.00 ? 44  VAL A CG1  7  
ATOM 9737  C CG2  . VAL A 1 44  ? -8.454  3.025   1.672   1.00 0.00 ? 44  VAL A CG2  7  
ATOM 9738  H H    . VAL A 1 44  ? -9.298  5.487   2.132   1.00 0.00 ? 44  VAL A H    7  
ATOM 9739  H HA   . VAL A 1 44  ? -7.679  4.877   4.463   1.00 0.00 ? 44  VAL A HA   7  
ATOM 9740  H HB   . VAL A 1 44  ? -7.562  2.602   3.553   1.00 0.00 ? 44  VAL A HB   7  
ATOM 9741  H HG11 . VAL A 1 44  ? -10.342 2.679   3.206   1.00 0.00 ? 44  VAL A HG11 7  
ATOM 9742  H HG12 . VAL A 1 44  ? -9.452  2.352   4.694   1.00 0.00 ? 44  VAL A HG12 7  
ATOM 9743  H HG13 . VAL A 1 44  ? -9.954  3.999   4.309   1.00 0.00 ? 44  VAL A HG13 7  
ATOM 9744  H HG21 . VAL A 1 44  ? -8.899  2.052   1.528   1.00 0.00 ? 44  VAL A HG21 7  
ATOM 9745  H HG22 . VAL A 1 44  ? -9.091  3.780   1.236   1.00 0.00 ? 44  VAL A HG22 7  
ATOM 9746  H HG23 . VAL A 1 44  ? -7.485  3.052   1.194   1.00 0.00 ? 44  VAL A HG23 7  
ATOM 9747  N N    . SER A 1 45  ? -5.364  4.792   3.547   1.00 0.00 ? 45  SER A N    7  
ATOM 9748  C CA   . SER A 1 45  ? -4.002  4.927   3.044   1.00 0.00 ? 45  SER A CA   7  
ATOM 9749  C C    . SER A 1 45  ? -3.489  3.597   2.502   1.00 0.00 ? 45  SER A C    7  
ATOM 9750  O O    . SER A 1 45  ? -4.013  2.534   2.835   1.00 0.00 ? 45  SER A O    7  
ATOM 9751  C CB   . SER A 1 45  ? -3.075  5.432   4.151   1.00 0.00 ? 45  SER A CB   7  
ATOM 9752  O OG   . SER A 1 45  ? -3.635  6.552   4.815   1.00 0.00 ? 45  SER A OG   7  
ATOM 9753  H H    . SER A 1 45  ? -5.507  4.633   4.503   1.00 0.00 ? 45  SER A H    7  
ATOM 9754  H HA   . SER A 1 45  ? -4.016  5.649   2.241   1.00 0.00 ? 45  SER A HA   7  
ATOM 9755  H HB2  . SER A 1 45  ? -2.916  4.644   4.871   1.00 0.00 ? 45  SER A HB2  7  
ATOM 9756  H HB3  . SER A 1 45  ? -2.127  5.721   3.719   1.00 0.00 ? 45  SER A HB3  7  
ATOM 9757  H HG   . SER A 1 45  ? -3.644  6.391   5.761   1.00 0.00 ? 45  SER A HG   7  
ATOM 9758  N N    . SER A 1 46  ? -2.459  3.664   1.663   1.00 0.00 ? 46  SER A N    7  
ATOM 9759  C CA   . SER A 1 46  ? -1.876  2.466   1.071   1.00 0.00 ? 46  SER A CA   7  
ATOM 9760  C C    . SER A 1 46  ? -1.712  1.368   2.117   1.00 0.00 ? 46  SER A C    7  
ATOM 9761  O O    . SER A 1 46  ? -1.745  0.181   1.795   1.00 0.00 ? 46  SER A O    7  
ATOM 9762  C CB   . SER A 1 46  ? -0.521  2.792   0.440   1.00 0.00 ? 46  SER A CB   7  
ATOM 9763  O OG   . SER A 1 46  ? 0.366   3.349   1.394   1.00 0.00 ? 46  SER A OG   7  
ATOM 9764  H H    . SER A 1 46  ? -2.085  4.541   1.436   1.00 0.00 ? 46  SER A H    7  
ATOM 9765  H HA   . SER A 1 46  ? -2.548  2.117   0.301   1.00 0.00 ? 46  SER A HA   7  
ATOM 9766  H HB2  . SER A 1 46  ? -0.084  1.887   0.045   1.00 0.00 ? 46  SER A HB2  7  
ATOM 9767  H HB3  . SER A 1 46  ? -0.662  3.503   -0.362  1.00 0.00 ? 46  SER A HB3  7  
ATOM 9768  H HG   . SER A 1 46  ? 1.265   3.304   1.061   1.00 0.00 ? 46  SER A HG   7  
ATOM 9769  N N    . GLU A 1 47  ? -1.535  1.774   3.370   1.00 0.00 ? 47  GLU A N    7  
ATOM 9770  C CA   . GLU A 1 47  ? -1.365  0.825   4.463   1.00 0.00 ? 47  GLU A CA   7  
ATOM 9771  C C    . GLU A 1 47  ? -2.619  -0.025  4.646   1.00 0.00 ? 47  GLU A C    7  
ATOM 9772  O O    . GLU A 1 47  ? -2.620  -1.221  4.351   1.00 0.00 ? 47  GLU A O    7  
ATOM 9773  C CB   . GLU A 1 47  ? -1.042  1.563   5.764   1.00 0.00 ? 47  GLU A CB   7  
ATOM 9774  C CG   . GLU A 1 47  ? -0.541  0.653   6.873   1.00 0.00 ? 47  GLU A CG   7  
ATOM 9775  C CD   . GLU A 1 47  ? -0.020  1.424   8.070   1.00 0.00 ? 47  GLU A CD   7  
ATOM 9776  O OE1  . GLU A 1 47  ? -0.835  2.071   8.760   1.00 0.00 ? 47  GLU A OE1  7  
ATOM 9777  O OE2  . GLU A 1 47  ? 1.204   1.380   8.316   1.00 0.00 ? 47  GLU A OE2  7  
ATOM 9778  H H    . GLU A 1 47  ? -1.518  2.735   3.564   1.00 0.00 ? 47  GLU A H    7  
ATOM 9779  H HA   . GLU A 1 47  ? -0.538  0.177   4.214   1.00 0.00 ? 47  GLU A HA   7  
ATOM 9780  H HB2  . GLU A 1 47  ? -0.284  2.305   5.564   1.00 0.00 ? 47  GLU A HB2  7  
ATOM 9781  H HB3  . GLU A 1 47  ? -1.936  2.060   6.112   1.00 0.00 ? 47  GLU A HB3  7  
ATOM 9782  H HG2  . GLU A 1 47  ? -1.354  0.021   7.198   1.00 0.00 ? 47  GLU A HG2  7  
ATOM 9783  H HG3  . GLU A 1 47  ? 0.258   0.039   6.483   1.00 0.00 ? 47  GLU A HG3  7  
ATOM 9784  N N    . ASP A 1 48  ? -3.684  0.600   5.134   1.00 0.00 ? 48  ASP A N    7  
ATOM 9785  C CA   . ASP A 1 48  ? -4.946  -0.098  5.356   1.00 0.00 ? 48  ASP A CA   7  
ATOM 9786  C C    . ASP A 1 48  ? -5.197  -1.129  4.259   1.00 0.00 ? 48  ASP A C    7  
ATOM 9787  O O    . ASP A 1 48  ? -5.357  -2.317  4.537   1.00 0.00 ? 48  ASP A O    7  
ATOM 9788  C CB   . ASP A 1 48  ? -6.103  0.900   5.409   1.00 0.00 ? 48  ASP A CB   7  
ATOM 9789  C CG   . ASP A 1 48  ? -7.238  0.424   6.294   1.00 0.00 ? 48  ASP A CG   7  
ATOM 9790  O OD1  . ASP A 1 48  ? -7.469  -0.801  6.354   1.00 0.00 ? 48  ASP A OD1  7  
ATOM 9791  O OD2  . ASP A 1 48  ? -7.895  1.277   6.927   1.00 0.00 ? 48  ASP A OD2  7  
ATOM 9792  H H    . ASP A 1 48  ? -3.621  1.554   5.350   1.00 0.00 ? 48  ASP A H    7  
ATOM 9793  H HA   . ASP A 1 48  ? -4.879  -0.609  6.304   1.00 0.00 ? 48  ASP A HA   7  
ATOM 9794  H HB2  . ASP A 1 48  ? -5.740  1.842   5.796   1.00 0.00 ? 48  ASP A HB2  7  
ATOM 9795  H HB3  . ASP A 1 48  ? -6.487  1.050   4.411   1.00 0.00 ? 48  ASP A HB3  7  
ATOM 9796  N N    . ILE A 1 49  ? -5.230  -0.664  3.015   1.00 0.00 ? 49  ILE A N    7  
ATOM 9797  C CA   . ILE A 1 49  ? -5.462  -1.546  1.877   1.00 0.00 ? 49  ILE A CA   7  
ATOM 9798  C C    . ILE A 1 49  ? -4.525  -2.749  1.915   1.00 0.00 ? 49  ILE A C    7  
ATOM 9799  O O    . ILE A 1 49  ? -4.971  -3.891  2.016   1.00 0.00 ? 49  ILE A O    7  
ATOM 9800  C CB   . ILE A 1 49  ? -5.272  -0.803  0.542   1.00 0.00 ? 49  ILE A CB   7  
ATOM 9801  C CG1  . ILE A 1 49  ? -6.219  0.397   0.461   1.00 0.00 ? 49  ILE A CG1  7  
ATOM 9802  C CG2  . ILE A 1 49  ? -5.505  -1.748  -0.628  1.00 0.00 ? 49  ILE A CG2  7  
ATOM 9803  C CD1  . ILE A 1 49  ? -5.691  1.526   -0.395  1.00 0.00 ? 49  ILE A CD1  7  
ATOM 9804  H H    . ILE A 1 49  ? -5.096  0.293   2.858   1.00 0.00 ? 49  ILE A H    7  
ATOM 9805  H HA   . ILE A 1 49  ? -6.483  -1.896  1.930   1.00 0.00 ? 49  ILE A HA   7  
ATOM 9806  H HB   . ILE A 1 49  ? -4.253  -0.452  0.492   1.00 0.00 ? 49  ILE A HB   7  
ATOM 9807  H HG12 . ILE A 1 49  ? -7.160  0.077   0.044   1.00 0.00 ? 49  ILE A HG12 7  
ATOM 9808  H HG13 . ILE A 1 49  ? -6.383  0.783   1.457   1.00 0.00 ? 49  ILE A HG13 7  
ATOM 9809  H HG21 . ILE A 1 49  ? -6.274  -1.343  -1.269  1.00 0.00 ? 49  ILE A HG21 7  
ATOM 9810  H HG22 . ILE A 1 49  ? -4.590  -1.858  -1.189  1.00 0.00 ? 49  ILE A HG22 7  
ATOM 9811  H HG23 . ILE A 1 49  ? -5.818  -2.712  -0.255  1.00 0.00 ? 49  ILE A HG23 7  
ATOM 9812  H HD11 . ILE A 1 49  ? -5.859  2.468   0.107   1.00 0.00 ? 49  ILE A HD11 7  
ATOM 9813  H HD12 . ILE A 1 49  ? -4.633  1.389   -0.561  1.00 0.00 ? 49  ILE A HD12 7  
ATOM 9814  H HD13 . ILE A 1 49  ? -6.206  1.529   -1.345  1.00 0.00 ? 49  ILE A HD13 7  
ATOM 9815  N N    . GLU A 1 50  ? -3.225  -2.483  1.834   1.00 0.00 ? 50  GLU A N    7  
ATOM 9816  C CA   . GLU A 1 50  ? -2.226  -3.544  1.859   1.00 0.00 ? 50  GLU A CA   7  
ATOM 9817  C C    . GLU A 1 50  ? -2.525  -4.547  2.971   1.00 0.00 ? 50  GLU A C    7  
ATOM 9818  O O    . GLU A 1 50  ? -2.436  -5.758  2.771   1.00 0.00 ? 50  GLU A O    7  
ATOM 9819  C CB   . GLU A 1 50  ? -0.828  -2.954  2.052   1.00 0.00 ? 50  GLU A CB   7  
ATOM 9820  C CG   . GLU A 1 50  ? 0.273   -4.001  2.100   1.00 0.00 ? 50  GLU A CG   7  
ATOM 9821  C CD   . GLU A 1 50  ? 1.630   -3.405  2.421   1.00 0.00 ? 50  GLU A CD   7  
ATOM 9822  O OE1  . GLU A 1 50  ? 2.006   -2.404  1.777   1.00 0.00 ? 50  GLU A OE1  7  
ATOM 9823  O OE2  . GLU A 1 50  ? 2.316   -3.942  3.316   1.00 0.00 ? 50  GLU A OE2  7  
ATOM 9824  H H    . GLU A 1 50  ? -2.932  -1.551  1.754   1.00 0.00 ? 50  GLU A H    7  
ATOM 9825  H HA   . GLU A 1 50  ? -2.263  -4.057  0.910   1.00 0.00 ? 50  GLU A HA   7  
ATOM 9826  H HB2  . GLU A 1 50  ? -0.619  -2.279  1.236   1.00 0.00 ? 50  GLU A HB2  7  
ATOM 9827  H HB3  . GLU A 1 50  ? -0.809  -2.401  2.979   1.00 0.00 ? 50  GLU A HB3  7  
ATOM 9828  H HG2  . GLU A 1 50  ? 0.028   -4.728  2.859   1.00 0.00 ? 50  GLU A HG2  7  
ATOM 9829  H HG3  . GLU A 1 50  ? 0.329   -4.490  1.139   1.00 0.00 ? 50  GLU A HG3  7  
ATOM 9830  N N    . LYS A 1 51  ? -2.880  -4.032  4.143   1.00 0.00 ? 51  LYS A N    7  
ATOM 9831  C CA   . LYS A 1 51  ? -3.194  -4.879  5.288   1.00 0.00 ? 51  LYS A CA   7  
ATOM 9832  C C    . LYS A 1 51  ? -4.351  -5.819  4.968   1.00 0.00 ? 51  LYS A C    7  
ATOM 9833  O O    . LYS A 1 51  ? -4.283  -7.018  5.240   1.00 0.00 ? 51  LYS A O    7  
ATOM 9834  C CB   . LYS A 1 51  ? -3.542  -4.019  6.505   1.00 0.00 ? 51  LYS A CB   7  
ATOM 9835  C CG   . LYS A 1 51  ? -3.194  -4.673  7.831   1.00 0.00 ? 51  LYS A CG   7  
ATOM 9836  C CD   . LYS A 1 51  ? -3.594  -3.797  9.006   1.00 0.00 ? 51  LYS A CD   7  
ATOM 9837  C CE   . LYS A 1 51  ? -3.559  -4.570  10.315  1.00 0.00 ? 51  LYS A CE   7  
ATOM 9838  N NZ   . LYS A 1 51  ? -3.427  -3.665  11.491  1.00 0.00 ? 51  LYS A NZ   7  
ATOM 9839  H H    . LYS A 1 51  ? -2.934  -3.058  4.241   1.00 0.00 ? 51  LYS A H    7  
ATOM 9840  H HA   . LYS A 1 51  ? -2.318  -5.469  5.513   1.00 0.00 ? 51  LYS A HA   7  
ATOM 9841  H HB2  . LYS A 1 51  ? -3.005  -3.085  6.436   1.00 0.00 ? 51  LYS A HB2  7  
ATOM 9842  H HB3  . LYS A 1 51  ? -4.604  -3.817  6.495   1.00 0.00 ? 51  LYS A HB3  7  
ATOM 9843  H HG2  . LYS A 1 51  ? -3.715  -5.616  7.905   1.00 0.00 ? 51  LYS A HG2  7  
ATOM 9844  H HG3  . LYS A 1 51  ? -2.128  -4.845  7.868   1.00 0.00 ? 51  LYS A HG3  7  
ATOM 9845  H HD2  . LYS A 1 51  ? -2.909  -2.965  9.074   1.00 0.00 ? 51  LYS A HD2  7  
ATOM 9846  H HD3  . LYS A 1 51  ? -4.597  -3.427  8.843   1.00 0.00 ? 51  LYS A HD3  7  
ATOM 9847  H HE2  . LYS A 1 51  ? -4.472  -5.136  10.409  1.00 0.00 ? 51  LYS A HE2  7  
ATOM 9848  H HE3  . LYS A 1 51  ? -2.717  -5.246  10.296  1.00 0.00 ? 51  LYS A HE3  7  
ATOM 9849  H HZ1  . LYS A 1 51  ? -3.802  -4.129  12.342  1.00 0.00 ? 51  LYS A HZ1  7  
ATOM 9850  H HZ2  . LYS A 1 51  ? -3.958  -2.786  11.326  1.00 0.00 ? 51  LYS A HZ2  7  
ATOM 9851  H HZ3  . LYS A 1 51  ? -2.427  -3.428  11.650  1.00 0.00 ? 51  LYS A HZ3  7  
ATOM 9852  N N    . SER A 1 52  ? -5.413  -5.268  4.388   1.00 0.00 ? 52  SER A N    7  
ATOM 9853  C CA   . SER A 1 52  ? -6.586  -6.057  4.033   1.00 0.00 ? 52  SER A CA   7  
ATOM 9854  C C    . SER A 1 52  ? -6.248  -7.076  2.949   1.00 0.00 ? 52  SER A C    7  
ATOM 9855  O O    . SER A 1 52  ? -6.806  -8.173  2.917   1.00 0.00 ? 52  SER A O    7  
ATOM 9856  C CB   . SER A 1 52  ? -7.717  -5.144  3.556   1.00 0.00 ? 52  SER A CB   7  
ATOM 9857  O OG   . SER A 1 52  ? -8.157  -4.290  4.598   1.00 0.00 ? 52  SER A OG   7  
ATOM 9858  H H    . SER A 1 52  ? -5.407  -4.307  4.197   1.00 0.00 ? 52  SER A H    7  
ATOM 9859  H HA   . SER A 1 52  ? -6.911  -6.585  4.918   1.00 0.00 ? 52  SER A HA   7  
ATOM 9860  H HB2  . SER A 1 52  ? -7.364  -4.537  2.735   1.00 0.00 ? 52  SER A HB2  7  
ATOM 9861  H HB3  . SER A 1 52  ? -8.549  -5.748  3.225   1.00 0.00 ? 52  SER A HB3  7  
ATOM 9862  H HG   . SER A 1 52  ? -9.101  -4.139  4.511   1.00 0.00 ? 52  SER A HG   7  
ATOM 9863  N N    . PHE A 1 53  ? -5.331  -6.705  2.063   1.00 0.00 ? 53  PHE A N    7  
ATOM 9864  C CA   . PHE A 1 53  ? -4.918  -7.585  0.976   1.00 0.00 ? 53  PHE A CA   7  
ATOM 9865  C C    . PHE A 1 53  ? -4.014  -8.700  1.492   1.00 0.00 ? 53  PHE A C    7  
ATOM 9866  O O    . PHE A 1 53  ? -4.057  -9.828  1.001   1.00 0.00 ? 53  PHE A O    7  
ATOM 9867  C CB   . PHE A 1 53  ? -4.192  -6.785  -0.108  1.00 0.00 ? 53  PHE A CB   7  
ATOM 9868  C CG   . PHE A 1 53  ? -3.453  -7.645  -1.094  1.00 0.00 ? 53  PHE A CG   7  
ATOM 9869  C CD1  . PHE A 1 53  ? -2.232  -8.209  -0.763  1.00 0.00 ? 53  PHE A CD1  7  
ATOM 9870  C CD2  . PHE A 1 53  ? -3.981  -7.890  -2.352  1.00 0.00 ? 53  PHE A CD2  7  
ATOM 9871  C CE1  . PHE A 1 53  ? -1.550  -9.000  -1.668  1.00 0.00 ? 53  PHE A CE1  7  
ATOM 9872  C CE2  . PHE A 1 53  ? -3.304  -8.680  -3.261  1.00 0.00 ? 53  PHE A CE2  7  
ATOM 9873  C CZ   . PHE A 1 53  ? -2.087  -9.237  -2.919  1.00 0.00 ? 53  PHE A CZ   7  
ATOM 9874  H H    . PHE A 1 53  ? -4.922  -5.817  2.141   1.00 0.00 ? 53  PHE A H    7  
ATOM 9875  H HA   . PHE A 1 53  ? -5.807  -8.026  0.551   1.00 0.00 ? 53  PHE A HA   7  
ATOM 9876  H HB2  . PHE A 1 53  ? -4.913  -6.198  -0.656  1.00 0.00 ? 53  PHE A HB2  7  
ATOM 9877  H HB3  . PHE A 1 53  ? -3.477  -6.125  0.359   1.00 0.00 ? 53  PHE A HB3  7  
ATOM 9878  H HD1  . PHE A 1 53  ? -1.811  -8.026  0.215   1.00 0.00 ? 53  PHE A HD1  7  
ATOM 9879  H HD2  . PHE A 1 53  ? -4.933  -7.454  -2.621  1.00 0.00 ? 53  PHE A HD2  7  
ATOM 9880  H HE1  . PHE A 1 53  ? -0.599  -9.434  -1.398  1.00 0.00 ? 53  PHE A HE1  7  
ATOM 9881  H HE2  . PHE A 1 53  ? -3.727  -8.863  -4.238  1.00 0.00 ? 53  PHE A HE2  7  
ATOM 9882  H HZ   . PHE A 1 53  ? -1.556  -9.854  -3.628  1.00 0.00 ? 53  PHE A HZ   7  
ATOM 9883  N N    . LYS A 1 54  ? -3.194  -8.376  2.487   1.00 0.00 ? 54  LYS A N    7  
ATOM 9884  C CA   . LYS A 1 54  ? -2.279  -9.349  3.072   1.00 0.00 ? 54  LYS A CA   7  
ATOM 9885  C C    . LYS A 1 54  ? -3.045  -10.525 3.670   1.00 0.00 ? 54  LYS A C    7  
ATOM 9886  O O    . LYS A 1 54  ? -2.805  -11.680 3.316   1.00 0.00 ? 54  LYS A O    7  
ATOM 9887  C CB   . LYS A 1 54  ? -1.419  -8.686  4.150   1.00 0.00 ? 54  LYS A CB   7  
ATOM 9888  C CG   . LYS A 1 54  ? -0.157  -8.037  3.608   1.00 0.00 ? 54  LYS A CG   7  
ATOM 9889  C CD   . LYS A 1 54  ? 0.307   -6.892  4.493   1.00 0.00 ? 54  LYS A CD   7  
ATOM 9890  C CE   . LYS A 1 54  ? 1.115   -7.396  5.678   1.00 0.00 ? 54  LYS A CE   7  
ATOM 9891  N NZ   . LYS A 1 54  ? 0.241   -7.795  6.816   1.00 0.00 ? 54  LYS A NZ   7  
ATOM 9892  H H    . LYS A 1 54  ? -3.206  -7.460  2.836   1.00 0.00 ? 54  LYS A H    7  
ATOM 9893  H HA   . LYS A 1 54  ? -1.637  -9.715  2.286   1.00 0.00 ? 54  LYS A HA   7  
ATOM 9894  H HB2  . LYS A 1 54  ? -2.005  -7.925  4.644   1.00 0.00 ? 54  LYS A HB2  7  
ATOM 9895  H HB3  . LYS A 1 54  ? -1.131  -9.434  4.875   1.00 0.00 ? 54  LYS A HB3  7  
ATOM 9896  H HG2  . LYS A 1 54  ? 0.626   -8.780  3.559   1.00 0.00 ? 54  LYS A HG2  7  
ATOM 9897  H HG3  . LYS A 1 54  ? -0.356  -7.656  2.616   1.00 0.00 ? 54  LYS A HG3  7  
ATOM 9898  H HD2  . LYS A 1 54  ? 0.923   -6.225  3.909   1.00 0.00 ? 54  LYS A HD2  7  
ATOM 9899  H HD3  . LYS A 1 54  ? -0.559  -6.359  4.859   1.00 0.00 ? 54  LYS A HD3  7  
ATOM 9900  H HE2  . LYS A 1 54  ? 1.695   -8.251  5.365   1.00 0.00 ? 54  LYS A HE2  7  
ATOM 9901  H HE3  . LYS A 1 54  ? 1.780   -6.610  6.004   1.00 0.00 ? 54  LYS A HE3  7  
ATOM 9902  H HZ1  . LYS A 1 54  ? 0.777   -8.378  7.491   1.00 0.00 ? 54  LYS A HZ1  7  
ATOM 9903  H HZ2  . LYS A 1 54  ? -0.570  -8.345  6.468   1.00 0.00 ? 54  LYS A HZ2  7  
ATOM 9904  H HZ3  . LYS A 1 54  ? -0.113  -6.950  7.309   1.00 0.00 ? 54  LYS A HZ3  7  
ATOM 9905  N N    . THR A 1 55  ? -3.968  -10.224 4.578   1.00 0.00 ? 55  THR A N    7  
ATOM 9906  C CA   . THR A 1 55  ? -4.768  -11.256 5.225   1.00 0.00 ? 55  THR A CA   7  
ATOM 9907  C C    . THR A 1 55  ? -5.460  -12.141 4.195   1.00 0.00 ? 55  THR A C    7  
ATOM 9908  O O    . THR A 1 55  ? -5.615  -13.344 4.401   1.00 0.00 ? 55  THR A O    7  
ATOM 9909  C CB   . THR A 1 55  ? -5.832  -10.642 6.154   1.00 0.00 ? 55  THR A CB   7  
ATOM 9910  O OG1  . THR A 1 55  ? -6.558  -11.680 6.822   1.00 0.00 ? 55  THR A OG1  7  
ATOM 9911  C CG2  . THR A 1 55  ? -6.797  -9.767  5.368   1.00 0.00 ? 55  THR A CG2  7  
ATOM 9912  H H    . THR A 1 55  ? -4.112  -9.285  4.819   1.00 0.00 ? 55  THR A H    7  
ATOM 9913  H HA   . THR A 1 55  ? -4.107  -11.866 5.823   1.00 0.00 ? 55  THR A HA   7  
ATOM 9914  H HB   . THR A 1 55  ? -5.334  -10.029 6.892   1.00 0.00 ? 55  THR A HB   7  
ATOM 9915  H HG1  . THR A 1 55  ? -7.117  -12.138 6.189   1.00 0.00 ? 55  THR A HG1  7  
ATOM 9916  H HG21 . THR A 1 55  ? -6.251  -8.965  4.894   1.00 0.00 ? 55  THR A HG21 7  
ATOM 9917  H HG22 . THR A 1 55  ? -7.535  -9.353  6.038   1.00 0.00 ? 55  THR A HG22 7  
ATOM 9918  H HG23 . THR A 1 55  ? -7.289  -10.362 4.614   1.00 0.00 ? 55  THR A HG23 7  
ATOM 9919  N N    . ASN A 1 56  ? -5.874  -11.538 3.085   1.00 0.00 ? 56  ASN A N    7  
ATOM 9920  C CA   . ASN A 1 56  ? -6.549  -12.273 2.022   1.00 0.00 ? 56  ASN A CA   7  
ATOM 9921  C C    . ASN A 1 56  ? -6.300  -11.620 0.666   1.00 0.00 ? 56  ASN A C    7  
ATOM 9922  O O    . ASN A 1 56  ? -6.867  -10.577 0.337   1.00 0.00 ? 56  ASN A O    7  
ATOM 9923  C CB   . ASN A 1 56  ? -8.053  -12.344 2.298   1.00 0.00 ? 56  ASN A CB   7  
ATOM 9924  C CG   . ASN A 1 56  ? -8.690  -13.589 1.713   1.00 0.00 ? 56  ASN A CG   7  
ATOM 9925  O OD1  . ASN A 1 56  ? -8.054  -14.639 1.618   1.00 0.00 ? 56  ASN A OD1  7  
ATOM 9926  N ND2  . ASN A 1 56  ? -9.952  -13.477 1.317   1.00 0.00 ? 56  ASN A ND2  7  
ATOM 9927  H H    . ASN A 1 56  ? -5.722  -10.576 2.979   1.00 0.00 ? 56  ASN A H    7  
ATOM 9928  H HA   . ASN A 1 56  ? -6.148  -13.275 2.005   1.00 0.00 ? 56  ASN A HA   7  
ATOM 9929  H HB2  . ASN A 1 56  ? -8.217  -12.347 3.366   1.00 0.00 ? 56  ASN A HB2  7  
ATOM 9930  H HB3  . ASN A 1 56  ? -8.533  -11.478 1.867   1.00 0.00 ? 56  ASN A HB3  7  
ATOM 9931  H HD21 . ASN A 1 56  ? -10.396 -12.609 1.423   1.00 0.00 ? 56  ASN A HD21 7  
ATOM 9932  H HD22 . ASN A 1 56  ? -10.389 -14.267 0.935   1.00 0.00 ? 56  ASN A HD22 7  
ATOM 9933  N N    . PRO A 1 57  ? -5.431  -12.246 -0.142  1.00 0.00 ? 57  PRO A N    7  
ATOM 9934  C CA   . PRO A 1 57  ? -5.088  -11.744 -1.476  1.00 0.00 ? 57  PRO A CA   7  
ATOM 9935  C C    . PRO A 1 57  ? -6.246  -11.873 -2.459  1.00 0.00 ? 57  PRO A C    7  
ATOM 9936  O O    . PRO A 1 57  ? -6.261  -11.219 -3.503  1.00 0.00 ? 57  PRO A O    7  
ATOM 9937  C CB   . PRO A 1 57  ? -3.922  -12.640 -1.902  1.00 0.00 ? 57  PRO A CB   7  
ATOM 9938  C CG   . PRO A 1 57  ? -4.109  -13.900 -1.129  1.00 0.00 ? 57  PRO A CG   7  
ATOM 9939  C CD   . PRO A 1 57  ? -4.718  -13.492 0.185   1.00 0.00 ? 57  PRO A CD   7  
ATOM 9940  H HA   . PRO A 1 57  ? -4.759  -10.716 -1.440  1.00 0.00 ? 57  PRO A HA   7  
ATOM 9941  H HB2  . PRO A 1 57  ? -3.973  -12.818 -2.967  1.00 0.00 ? 57  PRO A HB2  7  
ATOM 9942  H HB3  . PRO A 1 57  ? -2.986  -12.161 -1.655  1.00 0.00 ? 57  PRO A HB3  7  
ATOM 9943  H HG2  . PRO A 1 57  ? -4.775  -14.562 -1.661  1.00 0.00 ? 57  PRO A HG2  7  
ATOM 9944  H HG3  . PRO A 1 57  ? -3.154  -14.376 -0.966  1.00 0.00 ? 57  PRO A HG3  7  
ATOM 9945  H HD2  . PRO A 1 57  ? -5.405  -14.249 0.534   1.00 0.00 ? 57  PRO A HD2  7  
ATOM 9946  H HD3  . PRO A 1 57  ? -3.946  -13.313 0.919   1.00 0.00 ? 57  PRO A HD3  7  
ATOM 9947  N N    . CYS A 1 58  ? -7.213  -12.718 -2.120  1.00 0.00 ? 58  CYS A N    7  
ATOM 9948  C CA   . CYS A 1 58  ? -8.375  -12.932 -2.975  1.00 0.00 ? 58  CYS A CA   7  
ATOM 9949  C C    . CYS A 1 58  ? -9.652  -12.467 -2.282  1.00 0.00 ? 58  CYS A C    7  
ATOM 9950  O O    . CYS A 1 58  ? -10.692 -13.119 -2.371  1.00 0.00 ? 58  CYS A O    7  
ATOM 9951  C CB   . CYS A 1 58  ? -8.494  -14.410 -3.349  1.00 0.00 ? 58  CYS A CB   7  
ATOM 9952  S SG   . CYS A 1 58  ? -8.766  -15.510 -1.940  1.00 0.00 ? 58  CYS A SG   7  
ATOM 9953  H H    . CYS A 1 58  ? -7.144  -13.211 -1.276  1.00 0.00 ? 58  CYS A H    7  
ATOM 9954  H HA   . CYS A 1 58  ? -8.236  -12.352 -3.874  1.00 0.00 ? 58  CYS A HA   7  
ATOM 9955  H HB2  . CYS A 1 58  ? -9.324  -14.537 -4.029  1.00 0.00 ? 58  CYS A HB2  7  
ATOM 9956  H HB3  . CYS A 1 58  ? -7.584  -14.723 -3.841  1.00 0.00 ? 58  CYS A HB3  7  
ATOM 9957  H HG   . CYS A 1 58  ? -7.589  -15.771 -1.392  1.00 0.00 ? 58  CYS A HG   7  
ATOM 9958  N N    . GLY A 1 59  ? -9.565  -11.335 -1.590  1.00 0.00 ? 59  GLY A N    7  
ATOM 9959  C CA   . GLY A 1 59  ? -10.720 -10.802 -0.891  1.00 0.00 ? 59  GLY A CA   7  
ATOM 9960  C C    . GLY A 1 59  ? -11.113 -9.424  -1.385  1.00 0.00 ? 59  GLY A C    7  
ATOM 9961  O O    . GLY A 1 59  ? -10.867 -9.079  -2.541  1.00 0.00 ? 59  GLY A O    7  
ATOM 9962  H H    . GLY A 1 59  ? -8.710  -10.857 -1.555  1.00 0.00 ? 59  GLY A H    7  
ATOM 9963  H HA2  . GLY A 1 59  ? -11.553 -11.475 -1.030  1.00 0.00 ? 59  GLY A HA2  7  
ATOM 9964  H HA3  . GLY A 1 59  ? -10.492 -10.742 0.163   1.00 0.00 ? 59  GLY A HA3  7  
ATOM 9965  N N    . SER A 1 60  ? -11.726 -8.636  -0.509  1.00 0.00 ? 60  SER A N    7  
ATOM 9966  C CA   . SER A 1 60  ? -12.159 -7.289  -0.864  1.00 0.00 ? 60  SER A CA   7  
ATOM 9967  C C    . SER A 1 60  ? -12.264 -6.407  0.376   1.00 0.00 ? 60  SER A C    7  
ATOM 9968  O O    . SER A 1 60  ? -12.666 -6.867  1.446   1.00 0.00 ? 60  SER A O    7  
ATOM 9969  C CB   . SER A 1 60  ? -13.508 -7.338  -1.585  1.00 0.00 ? 60  SER A CB   7  
ATOM 9970  O OG   . SER A 1 60  ? -14.427 -8.163  -0.892  1.00 0.00 ? 60  SER A OG   7  
ATOM 9971  H H    . SER A 1 60  ? -11.894 -8.968  0.398   1.00 0.00 ? 60  SER A H    7  
ATOM 9972  H HA   . SER A 1 60  ? -11.420 -6.868  -1.529  1.00 0.00 ? 60  SER A HA   7  
ATOM 9973  H HB2  . SER A 1 60  ? -13.915 -6.340  -1.649  1.00 0.00 ? 60  SER A HB2  7  
ATOM 9974  H HB3  . SER A 1 60  ? -13.366 -7.733  -2.581  1.00 0.00 ? 60  SER A HB3  7  
ATOM 9975  H HG   . SER A 1 60  ? -14.094 -9.064  -0.867  1.00 0.00 ? 60  SER A HG   7  
ATOM 9976  N N    . ILE A 1 61  ? -11.901 -5.138  0.225   1.00 0.00 ? 61  ILE A N    7  
ATOM 9977  C CA   . ILE A 1 61  ? -11.955 -4.191  1.331   1.00 0.00 ? 61  ILE A CA   7  
ATOM 9978  C C    . ILE A 1 61  ? -13.090 -3.191  1.144   1.00 0.00 ? 61  ILE A C    7  
ATOM 9979  O O    . ILE A 1 61  ? -12.966 -2.230  0.385   1.00 0.00 ? 61  ILE A O    7  
ATOM 9980  C CB   . ILE A 1 61  ? -10.628 -3.423  1.480   1.00 0.00 ? 61  ILE A CB   7  
ATOM 9981  C CG1  . ILE A 1 61  ? -10.662 -2.541  2.730   1.00 0.00 ? 61  ILE A CG1  7  
ATOM 9982  C CG2  . ILE A 1 61  ? -10.361 -2.583  0.240   1.00 0.00 ? 61  ILE A CG2  7  
ATOM 9983  C CD1  . ILE A 1 61  ? -9.338  -1.877  3.037   1.00 0.00 ? 61  ILE A CD1  7  
ATOM 9984  H H    . ILE A 1 61  ? -11.589 -4.832  -0.652  1.00 0.00 ? 61  ILE A H    7  
ATOM 9985  H HA   . ILE A 1 61  ? -12.128 -4.750  2.240   1.00 0.00 ? 61  ILE A HA   7  
ATOM 9986  H HB   . ILE A 1 61  ? -9.830  -4.142  1.577   1.00 0.00 ? 61  ILE A HB   7  
ATOM 9987  H HG12 . ILE A 1 61  ? -11.398 -1.765  2.596   1.00 0.00 ? 61  ILE A HG12 7  
ATOM 9988  H HG13 . ILE A 1 61  ? -10.935 -3.148  3.582   1.00 0.00 ? 61  ILE A HG13 7  
ATOM 9989  H HG21 . ILE A 1 61  ? -10.596 -1.549  0.448   1.00 0.00 ? 61  ILE A HG21 7  
ATOM 9990  H HG22 . ILE A 1 61  ? -9.320  -2.666  -0.033  1.00 0.00 ? 61  ILE A HG22 7  
ATOM 9991  H HG23 . ILE A 1 61  ? -10.976 -2.935  -0.574  1.00 0.00 ? 61  ILE A HG23 7  
ATOM 9992  H HD11 . ILE A 1 61  ? -8.531  -2.559  2.811   1.00 0.00 ? 61  ILE A HD11 7  
ATOM 9993  H HD12 . ILE A 1 61  ? -9.235  -0.985  2.438   1.00 0.00 ? 61  ILE A HD12 7  
ATOM 9994  H HD13 . ILE A 1 61  ? -9.302  -1.613  4.084   1.00 0.00 ? 61  ILE A HD13 7  
ATOM 9995  N N    . SER A 1 62  ? -14.197 -3.423  1.842   1.00 0.00 ? 62  SER A N    7  
ATOM 9996  C CA   . SER A 1 62  ? -15.357 -2.543  1.752   1.00 0.00 ? 62  SER A CA   7  
ATOM 9997  C C    . SER A 1 62  ? -15.224 -1.368  2.715   1.00 0.00 ? 62  SER A C    7  
ATOM 9998  O O    . SER A 1 62  ? -15.149 -1.552  3.930   1.00 0.00 ? 62  SER A O    7  
ATOM 9999  C CB   . SER A 1 62  ? -16.639 -3.322  2.053   1.00 0.00 ? 62  SER A CB   7  
ATOM 10000 O OG   . SER A 1 62  ? -16.730 -3.641  3.431   1.00 0.00 ? 62  SER A OG   7  
ATOM 10001 H H    . SER A 1 62  ? -14.235 -4.206  2.431   1.00 0.00 ? 62  SER A H    7  
ATOM 10002 H HA   . SER A 1 62  ? -15.406 -2.163  0.742   1.00 0.00 ? 62  SER A HA   7  
ATOM 10003 H HB2  . SER A 1 62  ? -17.494 -2.724  1.777   1.00 0.00 ? 62  SER A HB2  7  
ATOM 10004 H HB3  . SER A 1 62  ? -16.642 -4.240  1.482   1.00 0.00 ? 62  SER A HB3  7  
ATOM 10005 H HG   . SER A 1 62  ? -17.540 -3.273  3.792   1.00 0.00 ? 62  SER A HG   7  
ATOM 10006 N N    . PHE A 1 63  ? -15.195 -0.159  2.164   1.00 0.00 ? 63  PHE A N    7  
ATOM 10007 C CA   . PHE A 1 63  ? -15.070 1.047   2.973   1.00 0.00 ? 63  PHE A CA   7  
ATOM 10008 C C    . PHE A 1 63  ? -15.854 2.201   2.354   1.00 0.00 ? 63  PHE A C    7  
ATOM 10009 O O    . PHE A 1 63  ? -15.781 2.441   1.148   1.00 0.00 ? 63  PHE A O    7  
ATOM 10010 C CB   . PHE A 1 63  ? -13.597 1.438   3.120   1.00 0.00 ? 63  PHE A CB   7  
ATOM 10011 C CG   . PHE A 1 63  ? -13.027 2.097   1.897   1.00 0.00 ? 63  PHE A CG   7  
ATOM 10012 C CD1  . PHE A 1 63  ? -13.247 3.443   1.654   1.00 0.00 ? 63  PHE A CD1  7  
ATOM 10013 C CD2  . PHE A 1 63  ? -12.270 1.371   0.992   1.00 0.00 ? 63  PHE A CD2  7  
ATOM 10014 C CE1  . PHE A 1 63  ? -12.724 4.052   0.529   1.00 0.00 ? 63  PHE A CE1  7  
ATOM 10015 C CE2  . PHE A 1 63  ? -11.744 1.975   -0.135  1.00 0.00 ? 63  PHE A CE2  7  
ATOM 10016 C CZ   . PHE A 1 63  ? -11.970 3.318   -0.366  1.00 0.00 ? 63  PHE A CZ   7  
ATOM 10017 H H    . PHE A 1 63  ? -15.258 -0.077  1.189   1.00 0.00 ? 63  PHE A H    7  
ATOM 10018 H HA   . PHE A 1 63  ? -15.476 0.834   3.949   1.00 0.00 ? 63  PHE A HA   7  
ATOM 10019 H HB2  . PHE A 1 63  ? -13.496 2.126   3.946   1.00 0.00 ? 63  PHE A HB2  7  
ATOM 10020 H HB3  . PHE A 1 63  ? -13.016 0.551   3.323   1.00 0.00 ? 63  PHE A HB3  7  
ATOM 10021 H HD1  . PHE A 1 63  ? -13.835 4.020   2.353   1.00 0.00 ? 63  PHE A HD1  7  
ATOM 10022 H HD2  . PHE A 1 63  ? -12.092 0.320   1.172   1.00 0.00 ? 63  PHE A HD2  7  
ATOM 10023 H HE1  . PHE A 1 63  ? -12.902 5.102   0.350   1.00 0.00 ? 63  PHE A HE1  7  
ATOM 10024 H HE2  . PHE A 1 63  ? -11.155 1.398   -0.832  1.00 0.00 ? 63  PHE A HE2  7  
ATOM 10025 H HZ   . PHE A 1 63  ? -11.560 3.791   -1.246  1.00 0.00 ? 63  PHE A HZ   7  
ATOM 10026 N N    . THR A 1 64  ? -16.606 2.912   3.188   1.00 0.00 ? 64  THR A N    7  
ATOM 10027 C CA   . THR A 1 64  ? -17.405 4.039   2.725   1.00 0.00 ? 64  THR A CA   7  
ATOM 10028 C C    . THR A 1 64  ? -16.927 5.346   3.348   1.00 0.00 ? 64  THR A C    7  
ATOM 10029 O O    . THR A 1 64  ? -16.781 5.448   4.566   1.00 0.00 ? 64  THR A O    7  
ATOM 10030 C CB   . THR A 1 64  ? -18.897 3.842   3.053   1.00 0.00 ? 64  THR A CB   7  
ATOM 10031 O OG1  . THR A 1 64  ? -19.083 3.785   4.472   1.00 0.00 ? 64  THR A OG1  7  
ATOM 10032 C CG2  . THR A 1 64  ? -19.428 2.567   2.416   1.00 0.00 ? 64  THR A CG2  7  
ATOM 10033 H H    . THR A 1 64  ? -16.622 2.672   4.138   1.00 0.00 ? 64  THR A H    7  
ATOM 10034 H HA   . THR A 1 64  ? -17.300 4.104   1.651   1.00 0.00 ? 64  THR A HA   7  
ATOM 10035 H HB   . THR A 1 64  ? -19.451 4.682   2.659   1.00 0.00 ? 64  THR A HB   7  
ATOM 10036 H HG1  . THR A 1 64  ? -18.300 3.411   4.883   1.00 0.00 ? 64  THR A HG1  7  
ATOM 10037 H HG21 . THR A 1 64  ? -19.259 2.601   1.349   1.00 0.00 ? 64  THR A HG21 7  
ATOM 10038 H HG22 . THR A 1 64  ? -20.487 2.482   2.610   1.00 0.00 ? 64  THR A HG22 7  
ATOM 10039 H HG23 . THR A 1 64  ? -18.915 1.715   2.834   1.00 0.00 ? 64  THR A HG23 7  
ATOM 10040 N N    . THR A 1 65  ? -16.685 6.345   2.504   1.00 0.00 ? 65  THR A N    7  
ATOM 10041 C CA   . THR A 1 65  ? -16.223 7.645   2.972   1.00 0.00 ? 65  THR A CA   7  
ATOM 10042 C C    . THR A 1 65  ? -17.380 8.631   3.088   1.00 0.00 ? 65  THR A C    7  
ATOM 10043 O O    . THR A 1 65  ? -18.539 8.268   2.887   1.00 0.00 ? 65  THR A O    7  
ATOM 10044 C CB   . THR A 1 65  ? -15.155 8.234   2.032   1.00 0.00 ? 65  THR A CB   7  
ATOM 10045 O OG1  . THR A 1 65  ? -15.533 8.022   0.667   1.00 0.00 ? 65  THR A OG1  7  
ATOM 10046 C CG2  . THR A 1 65  ? -13.797 7.599   2.291   1.00 0.00 ? 65  THR A CG2  7  
ATOM 10047 H H    . THR A 1 65  ? -16.820 6.201   1.544   1.00 0.00 ? 65  THR A H    7  
ATOM 10048 H HA   . THR A 1 65  ? -15.779 7.510   3.948   1.00 0.00 ? 65  THR A HA   7  
ATOM 10049 H HB   . THR A 1 65  ? -15.080 9.296   2.216   1.00 0.00 ? 65  THR A HB   7  
ATOM 10050 H HG1  . THR A 1 65  ? -16.490 7.962   0.606   1.00 0.00 ? 65  THR A HG1  7  
ATOM 10051 H HG21 . THR A 1 65  ? -13.450 7.111   1.391   1.00 0.00 ? 65  THR A HG21 7  
ATOM 10052 H HG22 . THR A 1 65  ? -13.885 6.871   3.084   1.00 0.00 ? 65  THR A HG22 7  
ATOM 10053 H HG23 . THR A 1 65  ? -13.092 8.363   2.580   1.00 0.00 ? 65  THR A HG23 7  
ATOM 10054 N N    . SER A 1 66  ? -17.058 9.879   3.413   1.00 0.00 ? 66  SER A N    7  
ATOM 10055 C CA   . SER A 1 66  ? -18.072 10.916  3.558   1.00 0.00 ? 66  SER A CA   7  
ATOM 10056 C C    . SER A 1 66  ? -19.106 10.827  2.440   1.00 0.00 ? 66  SER A C    7  
ATOM 10057 O O    . SER A 1 66  ? -18.774 10.944  1.260   1.00 0.00 ? 66  SER A O    7  
ATOM 10058 C CB   . SER A 1 66  ? -17.420 12.300  3.556   1.00 0.00 ? 66  SER A CB   7  
ATOM 10059 O OG   . SER A 1 66  ? -18.391 13.322  3.408   1.00 0.00 ? 66  SER A OG   7  
ATOM 10060 H H    . SER A 1 66  ? -16.116 10.106  3.560   1.00 0.00 ? 66  SER A H    7  
ATOM 10061 H HA   . SER A 1 66  ? -18.569 10.764  4.505   1.00 0.00 ? 66  SER A HA   7  
ATOM 10062 H HB2  . SER A 1 66  ? -16.896 12.450  4.487   1.00 0.00 ? 66  SER A HB2  7  
ATOM 10063 H HB3  . SER A 1 66  ? -16.720 12.364  2.735   1.00 0.00 ? 66  SER A HB3  7  
ATOM 10064 H HG   . SER A 1 66  ? -19.193 13.071  3.874   1.00 0.00 ? 66  SER A HG   7  
ATOM 10065 N N    . LYS A 1 67  ? -20.362 10.617  2.819   1.00 0.00 ? 67  LYS A N    7  
ATOM 10066 C CA   . LYS A 1 67  ? -21.447 10.513  1.850   1.00 0.00 ? 67  LYS A CA   7  
ATOM 10067 C C    . LYS A 1 67  ? -20.964 9.854   0.562   1.00 0.00 ? 67  LYS A C    7  
ATOM 10068 O O    . LYS A 1 67  ? -21.440 10.176  -0.528  1.00 0.00 ? 67  LYS A O    7  
ATOM 10069 C CB   . LYS A 1 67  ? -22.020 11.898  1.544   1.00 0.00 ? 67  LYS A CB   7  
ATOM 10070 C CG   . LYS A 1 67  ? -21.006 12.857  0.944   1.00 0.00 ? 67  LYS A CG   7  
ATOM 10071 C CD   . LYS A 1 67  ? -21.432 14.304  1.126   1.00 0.00 ? 67  LYS A CD   7  
ATOM 10072 C CE   . LYS A 1 67  ? -22.436 14.727  0.066   1.00 0.00 ? 67  LYS A CE   7  
ATOM 10073 N NZ   . LYS A 1 67  ? -23.839 14.487  0.503   1.00 0.00 ? 67  LYS A NZ   7  
ATOM 10074 H H    . LYS A 1 67  ? -20.565 10.532  3.774   1.00 0.00 ? 67  LYS A H    7  
ATOM 10075 H HA   . LYS A 1 67  ? -22.222 9.900   2.285   1.00 0.00 ? 67  LYS A HA   7  
ATOM 10076 H HB2  . LYS A 1 67  ? -22.838 11.790  0.847   1.00 0.00 ? 67  LYS A HB2  7  
ATOM 10077 H HB3  . LYS A 1 67  ? -22.394 12.330  2.461   1.00 0.00 ? 67  LYS A HB3  7  
ATOM 10078 H HG2  . LYS A 1 67  ? -20.053 12.710  1.430   1.00 0.00 ? 67  LYS A HG2  7  
ATOM 10079 H HG3  . LYS A 1 67  ? -20.910 12.650  -0.112  1.00 0.00 ? 67  LYS A HG3  7  
ATOM 10080 H HD2  . LYS A 1 67  ? -21.885 14.418  2.100   1.00 0.00 ? 67  LYS A HD2  7  
ATOM 10081 H HD3  . LYS A 1 67  ? -20.559 14.938  1.057   1.00 0.00 ? 67  LYS A HD3  7  
ATOM 10082 H HE2  . LYS A 1 67  ? -22.306 15.780  -0.135  1.00 0.00 ? 67  LYS A HE2  7  
ATOM 10083 H HE3  . LYS A 1 67  ? -22.248 14.163  -0.836  1.00 0.00 ? 67  LYS A HE3  7  
ATOM 10084 H HZ1  . LYS A 1 67  ? -23.869 14.319  1.529   1.00 0.00 ? 67  LYS A HZ1  7  
ATOM 10085 H HZ2  . LYS A 1 67  ? -24.228 13.656  0.016   1.00 0.00 ? 67  LYS A HZ2  7  
ATOM 10086 H HZ3  . LYS A 1 67  ? -24.430 15.314  0.281   1.00 0.00 ? 67  LYS A HZ3  7  
ATOM 10087 N N    . PHE A 1 68  ? -20.018 8.931   0.693   1.00 0.00 ? 68  PHE A N    7  
ATOM 10088 C CA   . PHE A 1 68  ? -19.471 8.227   -0.461  1.00 0.00 ? 68  PHE A CA   7  
ATOM 10089 C C    . PHE A 1 68  ? -19.184 6.767   -0.122  1.00 0.00 ? 68  PHE A C    7  
ATOM 10090 O O    . PHE A 1 68  ? -19.092 6.397   1.048   1.00 0.00 ? 68  PHE A O    7  
ATOM 10091 C CB   . PHE A 1 68  ? -18.190 8.911   -0.943  1.00 0.00 ? 68  PHE A CB   7  
ATOM 10092 C CG   . PHE A 1 68  ? -18.424 9.930   -2.022  1.00 0.00 ? 68  PHE A CG   7  
ATOM 10093 C CD1  . PHE A 1 68  ? -19.145 11.084  -1.758  1.00 0.00 ? 68  PHE A CD1  7  
ATOM 10094 C CD2  . PHE A 1 68  ? -17.924 9.734   -3.299  1.00 0.00 ? 68  PHE A CD2  7  
ATOM 10095 C CE1  . PHE A 1 68  ? -19.362 12.024  -2.749  1.00 0.00 ? 68  PHE A CE1  7  
ATOM 10096 C CE2  . PHE A 1 68  ? -18.138 10.670  -4.293  1.00 0.00 ? 68  PHE A CE2  7  
ATOM 10097 C CZ   . PHE A 1 68  ? -18.859 11.816  -4.018  1.00 0.00 ? 68  PHE A CZ   7  
ATOM 10098 H H    . PHE A 1 68  ? -19.678 8.718   1.588   1.00 0.00 ? 68  PHE A H    7  
ATOM 10099 H HA   . PHE A 1 68  ? -20.207 8.263   -1.250  1.00 0.00 ? 68  PHE A HA   7  
ATOM 10100 H HB2  . PHE A 1 68  ? -17.723 9.413   -0.109  1.00 0.00 ? 68  PHE A HB2  7  
ATOM 10101 H HB3  . PHE A 1 68  ? -17.516 8.164   -1.332  1.00 0.00 ? 68  PHE A HB3  7  
ATOM 10102 H HD1  . PHE A 1 68  ? -19.540 11.247  -0.765  1.00 0.00 ? 68  PHE A HD1  7  
ATOM 10103 H HD2  . PHE A 1 68  ? -17.362 8.838   -3.516  1.00 0.00 ? 68  PHE A HD2  7  
ATOM 10104 H HE1  . PHE A 1 68  ? -19.926 12.918  -2.530  1.00 0.00 ? 68  PHE A HE1  7  
ATOM 10105 H HE2  . PHE A 1 68  ? -17.743 10.505  -5.284  1.00 0.00 ? 68  PHE A HE2  7  
ATOM 10106 H HZ   . PHE A 1 68  ? -19.026 12.549  -4.792  1.00 0.00 ? 68  PHE A HZ   7  
ATOM 10107 N N    . SER A 1 69  ? -19.045 5.942   -1.155  1.00 0.00 ? 69  SER A N    7  
ATOM 10108 C CA   . SER A 1 69  ? -18.774 4.522   -0.968  1.00 0.00 ? 69  SER A CA   7  
ATOM 10109 C C    . SER A 1 69  ? -17.682 4.047   -1.923  1.00 0.00 ? 69  SER A C    7  
ATOM 10110 O O    . SER A 1 69  ? -17.561 4.545   -3.042  1.00 0.00 ? 69  SER A O    7  
ATOM 10111 C CB   . SER A 1 69  ? -20.048 3.704   -1.185  1.00 0.00 ? 69  SER A CB   7  
ATOM 10112 O OG   . SER A 1 69  ? -20.899 3.775   -0.054  1.00 0.00 ? 69  SER A OG   7  
ATOM 10113 H H    . SER A 1 69  ? -19.130 6.297   -2.065  1.00 0.00 ? 69  SER A H    7  
ATOM 10114 H HA   . SER A 1 69  ? -18.434 4.380   0.047   1.00 0.00 ? 69  SER A HA   7  
ATOM 10115 H HB2  . SER A 1 69  ? -20.578 4.088   -2.044  1.00 0.00 ? 69  SER A HB2  7  
ATOM 10116 H HB3  . SER A 1 69  ? -19.784 2.671   -1.358  1.00 0.00 ? 69  SER A HB3  7  
ATOM 10117 H HG   . SER A 1 69  ? -21.267 2.907   0.125   1.00 0.00 ? 69  SER A HG   7  
ATOM 10118 N N    . TYR A 1 70  ? -16.890 3.080   -1.472  1.00 0.00 ? 70  TYR A N    7  
ATOM 10119 C CA   . TYR A 1 70  ? -15.807 2.539   -2.284  1.00 0.00 ? 70  TYR A CA   7  
ATOM 10120 C C    . TYR A 1 70  ? -15.475 1.110   -1.866  1.00 0.00 ? 70  TYR A C    7  
ATOM 10121 O O    . TYR A 1 70  ? -15.310 0.818   -0.681  1.00 0.00 ? 70  TYR A O    7  
ATOM 10122 C CB   . TYR A 1 70  ? -14.562 3.419   -2.163  1.00 0.00 ? 70  TYR A CB   7  
ATOM 10123 C CG   . TYR A 1 70  ? -14.743 4.806   -2.738  1.00 0.00 ? 70  TYR A CG   7  
ATOM 10124 C CD1  . TYR A 1 70  ? -14.679 5.026   -4.108  1.00 0.00 ? 70  TYR A CD1  7  
ATOM 10125 C CD2  . TYR A 1 70  ? -14.979 5.897   -1.910  1.00 0.00 ? 70  TYR A CD2  7  
ATOM 10126 C CE1  . TYR A 1 70  ? -14.843 6.291   -4.637  1.00 0.00 ? 70  TYR A CE1  7  
ATOM 10127 C CE2  . TYR A 1 70  ? -15.146 7.166   -2.430  1.00 0.00 ? 70  TYR A CE2  7  
ATOM 10128 C CZ   . TYR A 1 70  ? -15.076 7.358   -3.794  1.00 0.00 ? 70  TYR A CZ   7  
ATOM 10129 O OH   . TYR A 1 70  ? -15.241 8.620   -4.318  1.00 0.00 ? 70  TYR A OH   7  
ATOM 10130 H H    . TYR A 1 70  ? -17.036 2.723   -0.571  1.00 0.00 ? 70  TYR A H    7  
ATOM 10131 H HA   . TYR A 1 70  ? -16.134 2.535   -3.313  1.00 0.00 ? 70  TYR A HA   7  
ATOM 10132 H HB2  . TYR A 1 70  ? -14.303 3.524   -1.121  1.00 0.00 ? 70  TYR A HB2  7  
ATOM 10133 H HB3  . TYR A 1 70  ? -13.744 2.947   -2.686  1.00 0.00 ? 70  TYR A HB3  7  
ATOM 10134 H HD1  . TYR A 1 70  ? -14.496 4.188   -4.765  1.00 0.00 ? 70  TYR A HD1  7  
ATOM 10135 H HD2  . TYR A 1 70  ? -15.033 5.743   -0.842  1.00 0.00 ? 70  TYR A HD2  7  
ATOM 10136 H HE1  . TYR A 1 70  ? -14.789 6.442   -5.705  1.00 0.00 ? 70  TYR A HE1  7  
ATOM 10137 H HE2  . TYR A 1 70  ? -15.328 8.001   -1.771  1.00 0.00 ? 70  TYR A HE2  7  
ATOM 10138 H HH   . TYR A 1 70  ? -15.310 9.256   -3.602  1.00 0.00 ? 70  TYR A HH   7  
ATOM 10139 N N    . LYS A 1 71  ? -15.379 0.220   -2.849  1.00 0.00 ? 71  LYS A N    7  
ATOM 10140 C CA   . LYS A 1 71  ? -15.065 -1.179  -2.587  1.00 0.00 ? 71  LYS A CA   7  
ATOM 10141 C C    . LYS A 1 71  ? -13.915 -1.653  -3.471  1.00 0.00 ? 71  LYS A C    7  
ATOM 10142 O O    . LYS A 1 71  ? -14.094 -1.884  -4.667  1.00 0.00 ? 71  LYS A O    7  
ATOM 10143 C CB   . LYS A 1 71  ? -16.299 -2.053  -2.824  1.00 0.00 ? 71  LYS A CB   7  
ATOM 10144 C CG   . LYS A 1 71  ? -15.988 -3.538  -2.892  1.00 0.00 ? 71  LYS A CG   7  
ATOM 10145 C CD   . LYS A 1 71  ? -17.210 -4.379  -2.562  1.00 0.00 ? 71  LYS A CD   7  
ATOM 10146 C CE   . LYS A 1 71  ? -17.183 -5.713  -3.292  1.00 0.00 ? 71  LYS A CE   7  
ATOM 10147 N NZ   . LYS A 1 71  ? -18.350 -6.565  -2.934  1.00 0.00 ? 71  LYS A NZ   7  
ATOM 10148 H H    . LYS A 1 71  ? -15.521 0.513   -3.774  1.00 0.00 ? 71  LYS A H    7  
ATOM 10149 H HA   . LYS A 1 71  ? -14.767 -1.265  -1.553  1.00 0.00 ? 71  LYS A HA   7  
ATOM 10150 H HB2  . LYS A 1 71  ? -17.001 -1.889  -2.020  1.00 0.00 ? 71  LYS A HB2  7  
ATOM 10151 H HB3  . LYS A 1 71  ? -16.758 -1.760  -3.758  1.00 0.00 ? 71  LYS A HB3  7  
ATOM 10152 H HG2  . LYS A 1 71  ? -15.656 -3.782  -3.890  1.00 0.00 ? 71  LYS A HG2  7  
ATOM 10153 H HG3  . LYS A 1 71  ? -15.204 -3.765  -2.184  1.00 0.00 ? 71  LYS A HG3  7  
ATOM 10154 H HD2  . LYS A 1 71  ? -17.232 -4.564  -1.498  1.00 0.00 ? 71  LYS A HD2  7  
ATOM 10155 H HD3  . LYS A 1 71  ? -18.099 -3.837  -2.853  1.00 0.00 ? 71  LYS A HD3  7  
ATOM 10156 H HE2  . LYS A 1 71  ? -17.197 -5.527  -4.355  1.00 0.00 ? 71  LYS A HE2  7  
ATOM 10157 H HE3  . LYS A 1 71  ? -16.274 -6.233  -3.029  1.00 0.00 ? 71  LYS A HE3  7  
ATOM 10158 H HZ1  . LYS A 1 71  ? -19.169 -6.316  -3.525  1.00 0.00 ? 71  LYS A HZ1  7  
ATOM 10159 H HZ2  . LYS A 1 71  ? -18.603 -6.424  -1.935  1.00 0.00 ? 71  LYS A HZ2  7  
ATOM 10160 H HZ3  . LYS A 1 71  ? -18.120 -7.568  -3.084  1.00 0.00 ? 71  LYS A HZ3  7  
ATOM 10161 N N    . ILE A 1 72  ? -12.737 -1.798  -2.874  1.00 0.00 ? 72  ILE A N    7  
ATOM 10162 C CA   . ILE A 1 72  ? -11.560 -2.248  -3.606  1.00 0.00 ? 72  ILE A CA   7  
ATOM 10163 C C    . ILE A 1 72  ? -11.407 -3.763  -3.524  1.00 0.00 ? 72  ILE A C    7  
ATOM 10164 O O    . ILE A 1 72  ? -10.874 -4.291  -2.548  1.00 0.00 ? 72  ILE A O    7  
ATOM 10165 C CB   . ILE A 1 72  ? -10.277 -1.583  -3.073  1.00 0.00 ? 72  ILE A CB   7  
ATOM 10166 C CG1  . ILE A 1 72  ? -10.318 -0.074  -3.321  1.00 0.00 ? 72  ILE A CG1  7  
ATOM 10167 C CG2  . ILE A 1 72  ? -9.050  -2.200  -3.727  1.00 0.00 ? 72  ILE A CG2  7  
ATOM 10168 C CD1  . ILE A 1 72  ? -9.139  0.667   -2.729  1.00 0.00 ? 72  ILE A CD1  7  
ATOM 10169 H H    . ILE A 1 72  ? -12.658 -1.599  -1.918  1.00 0.00 ? 72  ILE A H    7  
ATOM 10170 H HA   . ILE A 1 72  ? -11.685 -1.965  -4.642  1.00 0.00 ? 72  ILE A HA   7  
ATOM 10171 H HB   . ILE A 1 72  ? -10.219 -1.765  -2.011  1.00 0.00 ? 72  ILE A HB   7  
ATOM 10172 H HG12 . ILE A 1 72  ? -10.326 0.110   -4.383  1.00 0.00 ? 72  ILE A HG12 7  
ATOM 10173 H HG13 . ILE A 1 72  ? -11.219 0.331   -2.883  1.00 0.00 ? 72  ILE A HG13 7  
ATOM 10174 H HG21 . ILE A 1 72  ? -9.362  -2.906  -4.483  1.00 0.00 ? 72  ILE A HG21 7  
ATOM 10175 H HG22 . ILE A 1 72  ? -8.458  -1.422  -4.186  1.00 0.00 ? 72  ILE A HG22 7  
ATOM 10176 H HG23 . ILE A 1 72  ? -8.461  -2.709  -2.980  1.00 0.00 ? 72  ILE A HG23 7  
ATOM 10177 H HD11 . ILE A 1 72  ? -8.233  0.111   -2.917  1.00 0.00 ? 72  ILE A HD11 7  
ATOM 10178 H HD12 . ILE A 1 72  ? -9.063  1.644   -3.183  1.00 0.00 ? 72  ILE A HD12 7  
ATOM 10179 H HD13 . ILE A 1 72  ? -9.280  0.775   -1.663  1.00 0.00 ? 72  ILE A HD13 7  
ATOM 10180 N N    . ASP A 1 73  ? -11.876 -4.456  -4.555  1.00 0.00 ? 73  ASP A N    7  
ATOM 10181 C CA   . ASP A 1 73  ? -11.788 -5.911  -4.602  1.00 0.00 ? 73  ASP A CA   7  
ATOM 10182 C C    . ASP A 1 73  ? -10.385 -6.359  -4.998  1.00 0.00 ? 73  ASP A C    7  
ATOM 10183 O O    . ASP A 1 73  ? -9.922  -6.079  -6.104  1.00 0.00 ? 73  ASP A O    7  
ATOM 10184 C CB   . ASP A 1 73  ? -12.814 -6.474  -5.587  1.00 0.00 ? 73  ASP A CB   7  
ATOM 10185 C CG   . ASP A 1 73  ? -14.227 -6.433  -5.039  1.00 0.00 ? 73  ASP A CG   7  
ATOM 10186 O OD1  . ASP A 1 73  ? -14.889 -5.384  -5.185  1.00 0.00 ? 73  ASP A OD1  7  
ATOM 10187 O OD2  . ASP A 1 73  ? -14.670 -7.449  -4.463  1.00 0.00 ? 73  ASP A OD2  7  
ATOM 10188 H H    . ASP A 1 73  ? -12.290 -3.978  -5.304  1.00 0.00 ? 73  ASP A H    7  
ATOM 10189 H HA   . ASP A 1 73  ? -12.007 -6.288  -3.614  1.00 0.00 ? 73  ASP A HA   7  
ATOM 10190 H HB2  . ASP A 1 73  ? -12.784 -5.894  -6.498  1.00 0.00 ? 73  ASP A HB2  7  
ATOM 10191 H HB3  . ASP A 1 73  ? -12.563 -7.500  -5.811  1.00 0.00 ? 73  ASP A HB3  7  
ATOM 10192 N N    . PHE A 1 74  ? -9.712  -7.054  -4.087  1.00 0.00 ? 74  PHE A N    7  
ATOM 10193 C CA   . PHE A 1 74  ? -8.360  -7.539  -4.340  1.00 0.00 ? 74  PHE A CA   7  
ATOM 10194 C C    . PHE A 1 74  ? -8.379  -8.731  -5.292  1.00 0.00 ? 74  PHE A C    7  
ATOM 10195 O O    . PHE A 1 74  ? -7.645  -8.763  -6.279  1.00 0.00 ? 74  PHE A O    7  
ATOM 10196 C CB   . PHE A 1 74  ? -7.681  -7.931  -3.026  1.00 0.00 ? 74  PHE A CB   7  
ATOM 10197 C CG   . PHE A 1 74  ? -7.570  -6.797  -2.048  1.00 0.00 ? 74  PHE A CG   7  
ATOM 10198 C CD1  . PHE A 1 74  ? -7.243  -5.522  -2.479  1.00 0.00 ? 74  PHE A CD1  7  
ATOM 10199 C CD2  . PHE A 1 74  ? -7.793  -7.007  -0.696  1.00 0.00 ? 74  PHE A CD2  7  
ATOM 10200 C CE1  . PHE A 1 74  ? -7.139  -4.477  -1.580  1.00 0.00 ? 74  PHE A CE1  7  
ATOM 10201 C CE2  . PHE A 1 74  ? -7.691  -5.965  0.207   1.00 0.00 ? 74  PHE A CE2  7  
ATOM 10202 C CZ   . PHE A 1 74  ? -7.364  -4.699  -0.236  1.00 0.00 ? 74  PHE A CZ   7  
ATOM 10203 H H    . PHE A 1 74  ? -10.135 -7.245  -3.223  1.00 0.00 ? 74  PHE A H    7  
ATOM 10204 H HA   . PHE A 1 74  ? -7.802  -6.737  -4.799  1.00 0.00 ? 74  PHE A HA   7  
ATOM 10205 H HB2  . PHE A 1 74  ? -8.250  -8.719  -2.557  1.00 0.00 ? 74  PHE A HB2  7  
ATOM 10206 H HB3  . PHE A 1 74  ? -6.685  -8.288  -3.237  1.00 0.00 ? 74  PHE A HB3  7  
ATOM 10207 H HD1  . PHE A 1 74  ? -7.068  -5.346  -3.530  1.00 0.00 ? 74  PHE A HD1  7  
ATOM 10208 H HD2  . PHE A 1 74  ? -8.049  -7.998  -0.349  1.00 0.00 ? 74  PHE A HD2  7  
ATOM 10209 H HE1  . PHE A 1 74  ? -6.884  -3.487  -1.929  1.00 0.00 ? 74  PHE A HE1  7  
ATOM 10210 H HE2  . PHE A 1 74  ? -7.868  -6.143  1.258   1.00 0.00 ? 74  PHE A HE2  7  
ATOM 10211 H HZ   . PHE A 1 74  ? -7.283  -3.884  0.469   1.00 0.00 ? 74  PHE A HZ   7  
ATOM 10212 N N    . ALA A 1 75  ? -9.224  -9.711  -4.986  1.00 0.00 ? 75  ALA A N    7  
ATOM 10213 C CA   . ALA A 1 75  ? -9.341  -10.905 -5.814  1.00 0.00 ? 75  ALA A CA   7  
ATOM 10214 C C    . ALA A 1 75  ? -9.457  -10.541 -7.290  1.00 0.00 ? 75  ALA A C    7  
ATOM 10215 O O    . ALA A 1 75  ? -8.702  -11.042 -8.123  1.00 0.00 ? 75  ALA A O    7  
ATOM 10216 C CB   . ALA A 1 75  ? -10.539 -11.734 -5.377  1.00 0.00 ? 75  ALA A CB   7  
ATOM 10217 H H    . ALA A 1 75  ? -9.783  -9.627  -4.186  1.00 0.00 ? 75  ALA A H    7  
ATOM 10218 H HA   . ALA A 1 75  ? -8.450  -11.500 -5.669  1.00 0.00 ? 75  ALA A HA   7  
ATOM 10219 H HB1  . ALA A 1 75  ? -11.427 -11.374 -5.878  1.00 0.00 ? 75  ALA A HB1  7  
ATOM 10220 H HB2  . ALA A 1 75  ? -10.374 -12.769 -5.637  1.00 0.00 ? 75  ALA A HB2  7  
ATOM 10221 H HB3  . ALA A 1 75  ? -10.668 -11.647 -4.309  1.00 0.00 ? 75  ALA A HB3  7  
ATOM 10222 N N    . GLU A 1 76  ? -10.407 -9.666  -7.606  1.00 0.00 ? 76  GLU A N    7  
ATOM 10223 C CA   . GLU A 1 76  ? -10.621 -9.237  -8.983  1.00 0.00 ? 76  GLU A CA   7  
ATOM 10224 C C    . GLU A 1 76  ? -9.542  -8.249  -9.420  1.00 0.00 ? 76  GLU A C    7  
ATOM 10225 O O    . GLU A 1 76  ? -9.482  -7.854  -10.584 1.00 0.00 ? 76  GLU A O    7  
ATOM 10226 C CB   . GLU A 1 76  ? -12.003 -8.598  -9.133  1.00 0.00 ? 76  GLU A CB   7  
ATOM 10227 C CG   . GLU A 1 76  ? -13.150 -9.562  -8.878  1.00 0.00 ? 76  GLU A CG   7  
ATOM 10228 C CD   . GLU A 1 76  ? -13.452 -10.438 -10.078 1.00 0.00 ? 76  GLU A CD   7  
ATOM 10229 O OE1  . GLU A 1 76  ? -12.552 -11.193 -10.502 1.00 0.00 ? 76  GLU A OE1  7  
ATOM 10230 O OE2  . GLU A 1 76  ? -14.588 -10.369 -10.593 1.00 0.00 ? 76  GLU A OE2  7  
ATOM 10231 H H    . GLU A 1 76  ? -10.977 -9.301  -6.898  1.00 0.00 ? 76  GLU A H    7  
ATOM 10232 H HA   . GLU A 1 76  ? -10.568 -10.111 -9.615  1.00 0.00 ? 76  GLU A HA   7  
ATOM 10233 H HB2  . GLU A 1 76  ? -12.086 -7.779  -8.433  1.00 0.00 ? 76  GLU A HB2  7  
ATOM 10234 H HB3  . GLU A 1 76  ? -12.101 -8.212  -10.137 1.00 0.00 ? 76  GLU A HB3  7  
ATOM 10235 H HG2  . GLU A 1 76  ? -12.891 -10.197 -8.044  1.00 0.00 ? 76  GLU A HG2  7  
ATOM 10236 H HG3  . GLU A 1 76  ? -14.035 -8.992  -8.635  1.00 0.00 ? 76  GLU A HG3  7  
ATOM 10237 N N    . MET A 1 77  ? -8.693  -7.855  -8.477  1.00 0.00 ? 77  MET A N    7  
ATOM 10238 C CA   . MET A 1 77  ? -7.616  -6.914  -8.763  1.00 0.00 ? 77  MET A CA   7  
ATOM 10239 C C    . MET A 1 77  ? -8.157  -5.661  -9.444  1.00 0.00 ? 77  MET A C    7  
ATOM 10240 O O    . MET A 1 77  ? -7.675  -5.260  -10.504 1.00 0.00 ? 77  MET A O    7  
ATOM 10241 C CB   . MET A 1 77  ? -6.557  -7.573  -9.648  1.00 0.00 ? 77  MET A CB   7  
ATOM 10242 C CG   . MET A 1 77  ? -5.455  -8.266  -8.864  1.00 0.00 ? 77  MET A CG   7  
ATOM 10243 S SD   . MET A 1 77  ? -4.134  -7.139  -8.378  1.00 0.00 ? 77  MET A SD   7  
ATOM 10244 C CE   . MET A 1 77  ? -4.476  -6.949  -6.630  1.00 0.00 ? 77  MET A CE   7  
ATOM 10245 H H    . MET A 1 77  ? -8.792  -8.205  -7.566  1.00 0.00 ? 77  MET A H    7  
ATOM 10246 H HA   . MET A 1 77  ? -7.164  -6.633  -7.824  1.00 0.00 ? 77  MET A HA   7  
ATOM 10247 H HB2  . MET A 1 77  ? -7.037  -8.307  -10.278 1.00 0.00 ? 77  MET A HB2  7  
ATOM 10248 H HB3  . MET A 1 77  ? -6.104  -6.816  -10.272 1.00 0.00 ? 77  MET A HB3  7  
ATOM 10249 H HG2  . MET A 1 77  ? -5.883  -8.700  -7.973  1.00 0.00 ? 77  MET A HG2  7  
ATOM 10250 H HG3  . MET A 1 77  ? -5.034  -9.050  -9.476  1.00 0.00 ? 77  MET A HG3  7  
ATOM 10251 H HE1  . MET A 1 77  ? -5.416  -6.433  -6.502  1.00 0.00 ? 77  MET A HE1  7  
ATOM 10252 H HE2  . MET A 1 77  ? -4.534  -7.923  -6.167  1.00 0.00 ? 77  MET A HE2  7  
ATOM 10253 H HE3  . MET A 1 77  ? -3.684  -6.376  -6.169  1.00 0.00 ? 77  MET A HE3  7  
ATOM 10254 N N    . LYS A 1 78  ? -9.160  -5.044  -8.829  1.00 0.00 ? 78  LYS A N    7  
ATOM 10255 C CA   . LYS A 1 78  ? -9.766  -3.835  -9.374  1.00 0.00 ? 78  LYS A CA   7  
ATOM 10256 C C    . LYS A 1 78  ? -10.543 -3.083  -8.299  1.00 0.00 ? 78  LYS A C    7  
ATOM 10257 O O    . LYS A 1 78  ? -10.982 -3.673  -7.312  1.00 0.00 ? 78  LYS A O    7  
ATOM 10258 C CB   . LYS A 1 78  ? -10.696 -4.187  -10.538 1.00 0.00 ? 78  LYS A CB   7  
ATOM 10259 C CG   . LYS A 1 78  ? -11.746 -5.226  -10.186 1.00 0.00 ? 78  LYS A CG   7  
ATOM 10260 C CD   . LYS A 1 78  ? -12.994 -5.068  -11.038 1.00 0.00 ? 78  LYS A CD   7  
ATOM 10261 C CE   . LYS A 1 78  ? -13.705 -6.398  -11.237 1.00 0.00 ? 78  LYS A CE   7  
ATOM 10262 N NZ   . LYS A 1 78  ? -15.123 -6.212  -11.652 1.00 0.00 ? 78  LYS A NZ   7  
ATOM 10263 H H    . LYS A 1 78  ? -9.502  -5.412  -7.986  1.00 0.00 ? 78  LYS A H    7  
ATOM 10264 H HA   . LYS A 1 78  ? -8.972  -3.201  -9.738  1.00 0.00 ? 78  LYS A HA   7  
ATOM 10265 H HB2  . LYS A 1 78  ? -11.202 -3.289  -10.863 1.00 0.00 ? 78  LYS A HB2  7  
ATOM 10266 H HB3  . LYS A 1 78  ? -10.101 -4.570  -11.355 1.00 0.00 ? 78  LYS A HB3  7  
ATOM 10267 H HG2  . LYS A 1 78  ? -11.334 -6.211  -10.349 1.00 0.00 ? 78  LYS A HG2  7  
ATOM 10268 H HG3  . LYS A 1 78  ? -12.015 -5.114  -9.145  1.00 0.00 ? 78  LYS A HG3  7  
ATOM 10269 H HD2  . LYS A 1 78  ? -13.669 -4.382  -10.548 1.00 0.00 ? 78  LYS A HD2  7  
ATOM 10270 H HD3  . LYS A 1 78  ? -12.713 -4.672  -12.003 1.00 0.00 ? 78  LYS A HD3  7  
ATOM 10271 H HE2  . LYS A 1 78  ? -13.186 -6.958  -11.999 1.00 0.00 ? 78  LYS A HE2  7  
ATOM 10272 H HE3  . LYS A 1 78  ? -13.680 -6.947  -10.307 1.00 0.00 ? 78  LYS A HE3  7  
ATOM 10273 H HZ1  . LYS A 1 78  ? -15.426 -7.005  -12.253 1.00 0.00 ? 78  LYS A HZ1  7  
ATOM 10274 H HZ2  . LYS A 1 78  ? -15.226 -5.327  -12.188 1.00 0.00 ? 78  LYS A HZ2  7  
ATOM 10275 H HZ3  . LYS A 1 78  ? -15.739 -6.172  -10.815 1.00 0.00 ? 78  LYS A HZ3  7  
ATOM 10276 N N    . GLN A 1 79  ? -10.710 -1.780  -8.498  1.00 0.00 ? 79  GLN A N    7  
ATOM 10277 C CA   . GLN A 1 79  ? -11.435 -0.948  -7.545  1.00 0.00 ? 79  GLN A CA   7  
ATOM 10278 C C    . GLN A 1 79  ? -12.878 -0.740  -7.991  1.00 0.00 ? 79  GLN A C    7  
ATOM 10279 O O    . GLN A 1 79  ? -13.135 -0.142  -9.035  1.00 0.00 ? 79  GLN A O    7  
ATOM 10280 C CB   . GLN A 1 79  ? -10.739 0.404   -7.383  1.00 0.00 ? 79  GLN A CB   7  
ATOM 10281 C CG   . GLN A 1 79  ? -11.609 1.461   -6.723  1.00 0.00 ? 79  GLN A CG   7  
ATOM 10282 C CD   . GLN A 1 79  ? -10.800 2.605   -6.143  1.00 0.00 ? 79  GLN A CD   7  
ATOM 10283 O OE1  . GLN A 1 79  ? -9.688  2.407   -5.652  1.00 0.00 ? 79  GLN A OE1  7  
ATOM 10284 N NE2  . GLN A 1 79  ? -11.355 3.810   -6.196  1.00 0.00 ? 79  GLN A NE2  7  
ATOM 10285 H H    . GLN A 1 79  ? -10.336 -1.368  -9.304  1.00 0.00 ? 79  GLN A H    7  
ATOM 10286 H HA   . GLN A 1 79  ? -11.435 -1.458  -6.593  1.00 0.00 ? 79  GLN A HA   7  
ATOM 10287 H HB2  . GLN A 1 79  ? -9.853  0.270   -6.780  1.00 0.00 ? 79  GLN A HB2  7  
ATOM 10288 H HB3  . GLN A 1 79  ? -10.449 0.766   -8.358  1.00 0.00 ? 79  GLN A HB3  7  
ATOM 10289 H HG2  . GLN A 1 79  ? -12.290 1.861   -7.460  1.00 0.00 ? 79  GLN A HG2  7  
ATOM 10290 H HG3  . GLN A 1 79  ? -12.173 0.998   -5.926  1.00 0.00 ? 79  GLN A HG3  7  
ATOM 10291 H HE21 . GLN A 1 79  ? -12.245 3.892   -6.600  1.00 0.00 ? 79  GLN A HE21 7  
ATOM 10292 H HE22 . GLN A 1 79  ? -10.855 4.567   -5.828  1.00 0.00 ? 79  GLN A HE22 7  
ATOM 10293 N N    . MET A 1 80  ? -13.817 -1.239  -7.193  1.00 0.00 ? 80  MET A N    7  
ATOM 10294 C CA   . MET A 1 80  ? -15.235 -1.106  -7.506  1.00 0.00 ? 80  MET A CA   7  
ATOM 10295 C C    . MET A 1 80  ? -15.814 0.158   -6.880  1.00 0.00 ? 80  MET A C    7  
ATOM 10296 O O    . MET A 1 80  ? -15.927 0.262   -5.659  1.00 0.00 ? 80  MET A O    7  
ATOM 10297 C CB   . MET A 1 80  ? -16.005 -2.333  -7.013  1.00 0.00 ? 80  MET A CB   7  
ATOM 10298 C CG   . MET A 1 80  ? -17.462 -2.350  -7.444  1.00 0.00 ? 80  MET A CG   7  
ATOM 10299 S SD   . MET A 1 80  ? -17.667 -2.783  -9.183  1.00 0.00 ? 80  MET A SD   7  
ATOM 10300 C CE   . MET A 1 80  ? -17.285 -4.533  -9.143  1.00 0.00 ? 80  MET A CE   7  
ATOM 10301 H H    . MET A 1 80  ? -13.550 -1.706  -6.374  1.00 0.00 ? 80  MET A H    7  
ATOM 10302 H HA   . MET A 1 80  ? -15.332 -1.040  -8.579  1.00 0.00 ? 80  MET A HA   7  
ATOM 10303 H HB2  . MET A 1 80  ? -15.527 -3.222  -7.397  1.00 0.00 ? 80  MET A HB2  7  
ATOM 10304 H HB3  . MET A 1 80  ? -15.971 -2.354  -5.934  1.00 0.00 ? 80  MET A HB3  7  
ATOM 10305 H HG2  . MET A 1 80  ? -17.994 -3.073  -6.844  1.00 0.00 ? 80  MET A HG2  7  
ATOM 10306 H HG3  . MET A 1 80  ? -17.883 -1.369  -7.280  1.00 0.00 ? 80  MET A HG3  7  
ATOM 10307 H HE1  . MET A 1 80  ? -17.811 -5.034  -9.942  1.00 0.00 ? 80  MET A HE1  7  
ATOM 10308 H HE2  . MET A 1 80  ? -16.222 -4.672  -9.268  1.00 0.00 ? 80  MET A HE2  7  
ATOM 10309 H HE3  . MET A 1 80  ? -17.594 -4.946  -8.193  1.00 0.00 ? 80  MET A HE3  7  
ATOM 10310 N N    . ASN A 1 81  ? -16.179 1.117   -7.724  1.00 0.00 ? 81  ASN A N    7  
ATOM 10311 C CA   . ASN A 1 81  ? -16.746 2.376   -7.253  1.00 0.00 ? 81  ASN A CA   7  
ATOM 10312 C C    . ASN A 1 81  ? -18.239 2.229   -6.974  1.00 0.00 ? 81  ASN A C    7  
ATOM 10313 O O    . ASN A 1 81  ? -18.959 1.564   -7.721  1.00 0.00 ? 81  ASN A O    7  
ATOM 10314 C CB   . ASN A 1 81  ? -16.514 3.482   -8.284  1.00 0.00 ? 81  ASN A CB   7  
ATOM 10315 C CG   . ASN A 1 81  ? -16.395 4.852   -7.645  1.00 0.00 ? 81  ASN A CG   7  
ATOM 10316 O OD1  . ASN A 1 81  ? -16.270 4.972   -6.426  1.00 0.00 ? 81  ASN A OD1  7  
ATOM 10317 N ND2  . ASN A 1 81  ? -16.433 5.894   -8.468  1.00 0.00 ? 81  ASN A ND2  7  
ATOM 10318 H H    . ASN A 1 81  ? -16.064 0.977   -8.687  1.00 0.00 ? 81  ASN A H    7  
ATOM 10319 H HA   . ASN A 1 81  ? -16.245 2.641   -6.334  1.00 0.00 ? 81  ASN A HA   7  
ATOM 10320 H HB2  . ASN A 1 81  ? -15.601 3.277   -8.823  1.00 0.00 ? 81  ASN A HB2  7  
ATOM 10321 H HB3  . ASN A 1 81  ? -17.342 3.499   -8.978  1.00 0.00 ? 81  ASN A HB3  7  
ATOM 10322 H HD21 . ASN A 1 81  ? -16.535 5.723   -9.428  1.00 0.00 ? 81  ASN A HD21 7  
ATOM 10323 H HD22 . ASN A 1 81  ? -16.358 6.791   -8.082  1.00 0.00 ? 81  ASN A HD22 7  
ATOM 10324 N N    . LEU A 1 82  ? -18.698 2.854   -5.896  1.00 0.00 ? 82  LEU A N    7  
ATOM 10325 C CA   . LEU A 1 82  ? -20.106 2.795   -5.519  1.00 0.00 ? 82  LEU A CA   7  
ATOM 10326 C C    . LEU A 1 82  ? -20.748 4.177   -5.589  1.00 0.00 ? 82  LEU A C    7  
ATOM 10327 O O    . LEU A 1 82  ? -21.877 4.327   -6.057  1.00 0.00 ? 82  LEU A O    7  
ATOM 10328 C CB   . LEU A 1 82  ? -20.252 2.223   -4.107  1.00 0.00 ? 82  LEU A CB   7  
ATOM 10329 C CG   . LEU A 1 82  ? -19.674 0.825   -3.886  1.00 0.00 ? 82  LEU A CG   7  
ATOM 10330 C CD1  . LEU A 1 82  ? -20.450 -0.207  -4.689  1.00 0.00 ? 82  LEU A CD1  7  
ATOM 10331 C CD2  . LEU A 1 82  ? -18.199 0.794   -4.258  1.00 0.00 ? 82  LEU A CD2  7  
ATOM 10332 H H    . LEU A 1 82  ? -18.077 3.368   -5.340  1.00 0.00 ? 82  LEU A H    7  
ATOM 10333 H HA   . LEU A 1 82  ? -20.609 2.142   -6.216  1.00 0.00 ? 82  LEU A HA   7  
ATOM 10334 H HB2  . LEU A 1 82  ? -19.758 2.897   -3.425  1.00 0.00 ? 82  LEU A HB2  7  
ATOM 10335 H HB3  . LEU A 1 82  ? -21.307 2.187   -3.874  1.00 0.00 ? 82  LEU A HB3  7  
ATOM 10336 H HG   . LEU A 1 82  ? -19.761 0.568   -2.839  1.00 0.00 ? 82  LEU A HG   7  
ATOM 10337 H HD11 . LEU A 1 82  ? -20.781 0.234   -5.617  1.00 0.00 ? 82  LEU A HD11 7  
ATOM 10338 H HD12 . LEU A 1 82  ? -21.307 -0.535  -4.120  1.00 0.00 ? 82  LEU A HD12 7  
ATOM 10339 H HD13 . LEU A 1 82  ? -19.813 -1.053  -4.899  1.00 0.00 ? 82  LEU A HD13 7  
ATOM 10340 H HD21 . LEU A 1 82  ? -18.093 0.470   -5.283  1.00 0.00 ? 82  LEU A HD21 7  
ATOM 10341 H HD22 . LEU A 1 82  ? -17.678 0.105   -3.608  1.00 0.00 ? 82  LEU A HD22 7  
ATOM 10342 H HD23 . LEU A 1 82  ? -17.778 1.782   -4.147  1.00 0.00 ? 82  LEU A HD23 7  
ATOM 10343 N N    . THR A 1 83  ? -20.019 5.186   -5.122  1.00 0.00 ? 83  THR A N    7  
ATOM 10344 C CA   . THR A 1 83  ? -20.516 6.556   -5.133  1.00 0.00 ? 83  THR A CA   7  
ATOM 10345 C C    . THR A 1 83  ? -21.195 6.885   -6.457  1.00 0.00 ? 83  THR A C    7  
ATOM 10346 O O    . THR A 1 83  ? -22.251 7.518   -6.486  1.00 0.00 ? 83  THR A O    7  
ATOM 10347 C CB   . THR A 1 83  ? -19.381 7.568   -4.886  1.00 0.00 ? 83  THR A CB   7  
ATOM 10348 O OG1  . THR A 1 83  ? -19.847 8.898   -5.135  1.00 0.00 ? 83  THR A OG1  7  
ATOM 10349 C CG2  . THR A 1 83  ? -18.186 7.269   -5.780  1.00 0.00 ? 83  THR A CG2  7  
ATOM 10350 H H    . THR A 1 83  ? -19.127 5.003   -4.761  1.00 0.00 ? 83  THR A H    7  
ATOM 10351 H HA   . THR A 1 83  ? -21.238 6.656   -4.335  1.00 0.00 ? 83  THR A HA   7  
ATOM 10352 H HB   . THR A 1 83  ? -19.068 7.491   -3.855  1.00 0.00 ? 83  THR A HB   7  
ATOM 10353 H HG1  . THR A 1 83  ? -19.973 9.023   -6.079  1.00 0.00 ? 83  THR A HG1  7  
ATOM 10354 H HG21 . THR A 1 83  ? -18.008 6.204   -5.799  1.00 0.00 ? 83  THR A HG21 7  
ATOM 10355 H HG22 . THR A 1 83  ? -17.313 7.773   -5.395  1.00 0.00 ? 83  THR A HG22 7  
ATOM 10356 H HG23 . THR A 1 83  ? -18.391 7.617   -6.781  1.00 0.00 ? 83  THR A HG23 7  
ATOM 10357 N N    . THR A 1 84  ? -20.584 6.450   -7.555  1.00 0.00 ? 84  THR A N    7  
ATOM 10358 C CA   . THR A 1 84  ? -21.129 6.698   -8.883  1.00 0.00 ? 84  THR A CA   7  
ATOM 10359 C C    . THR A 1 84  ? -21.448 5.391   -9.599  1.00 0.00 ? 84  THR A C    7  
ATOM 10360 O O    . THR A 1 84  ? -22.304 5.348   -10.482 1.00 0.00 ? 84  THR A O    7  
ATOM 10361 C CB   . THR A 1 84  ? -20.153 7.518   -9.747  1.00 0.00 ? 84  THR A CB   7  
ATOM 10362 O OG1  . THR A 1 84  ? -18.942 6.783   -9.951  1.00 0.00 ? 84  THR A OG1  7  
ATOM 10363 C CG2  . THR A 1 84  ? -19.837 8.853   -9.088  1.00 0.00 ? 84  THR A CG2  7  
ATOM 10364 H H    . THR A 1 84  ? -19.745 5.951   -7.467  1.00 0.00 ? 84  THR A H    7  
ATOM 10365 H HA   . THR A 1 84  ? -22.041 7.266   -8.768  1.00 0.00 ? 84  THR A HA   7  
ATOM 10366 H HB   . THR A 1 84  ? -20.616 7.708   -10.705 1.00 0.00 ? 84  THR A HB   7  
ATOM 10367 H HG1  . THR A 1 84  ? -19.021 6.248   -10.745 1.00 0.00 ? 84  THR A HG1  7  
ATOM 10368 H HG21 . THR A 1 84  ? -20.674 9.524   -9.215  1.00 0.00 ? 84  THR A HG21 7  
ATOM 10369 H HG22 . THR A 1 84  ? -18.958 9.281   -9.546  1.00 0.00 ? 84  THR A HG22 7  
ATOM 10370 H HG23 . THR A 1 84  ? -19.656 8.699   -8.035  1.00 0.00 ? 84  THR A HG23 7  
ATOM 10371 N N    . GLY A 1 85  ? -20.754 4.325   -9.213  1.00 0.00 ? 85  GLY A N    7  
ATOM 10372 C CA   . GLY A 1 85  ? -20.979 3.030   -9.829  1.00 0.00 ? 85  GLY A CA   7  
ATOM 10373 C C    . GLY A 1 85  ? -19.993 2.739   -10.943 1.00 0.00 ? 85  GLY A C    7  
ATOM 10374 O O    . GLY A 1 85  ? -20.194 1.819   -11.736 1.00 0.00 ? 85  GLY A O    7  
ATOM 10375 H H    . GLY A 1 85  ? -20.083 4.418   -8.504  1.00 0.00 ? 85  GLY A H    7  
ATOM 10376 H HA2  . GLY A 1 85  ? -20.889 2.264   -9.073  1.00 0.00 ? 85  GLY A HA2  7  
ATOM 10377 H HA3  . GLY A 1 85  ? -21.980 3.006   -10.234 1.00 0.00 ? 85  GLY A HA3  7  
ATOM 10378 N N    . LYS A 1 86  ? -18.924 3.526   -11.006 1.00 0.00 ? 86  LYS A N    7  
ATOM 10379 C CA   . LYS A 1 86  ? -17.903 3.349   -12.031 1.00 0.00 ? 86  LYS A CA   7  
ATOM 10380 C C    . LYS A 1 86  ? -17.011 2.154   -11.711 1.00 0.00 ? 86  LYS A C    7  
ATOM 10381 O O    . LYS A 1 86  ? -17.083 1.590   -10.620 1.00 0.00 ? 86  LYS A O    7  
ATOM 10382 C CB   . LYS A 1 86  ? -17.052 4.615   -12.156 1.00 0.00 ? 86  LYS A CB   7  
ATOM 10383 C CG   . LYS A 1 86  ? -17.711 5.714   -12.970 1.00 0.00 ? 86  LYS A CG   7  
ATOM 10384 C CD   . LYS A 1 86  ? -17.445 5.543   -14.457 1.00 0.00 ? 86  LYS A CD   7  
ATOM 10385 C CE   . LYS A 1 86  ? -16.149 6.223   -14.872 1.00 0.00 ? 86  LYS A CE   7  
ATOM 10386 N NZ   . LYS A 1 86  ? -15.679 5.754   -16.205 1.00 0.00 ? 86  LYS A NZ   7  
ATOM 10387 H H    . LYS A 1 86  ? -18.819 4.243   -10.345 1.00 0.00 ? 86  LYS A H    7  
ATOM 10388 H HA   . LYS A 1 86  ? -18.403 3.169   -12.971 1.00 0.00 ? 86  LYS A HA   7  
ATOM 10389 H HB2  . LYS A 1 86  ? -16.853 4.999   -11.166 1.00 0.00 ? 86  LYS A HB2  7  
ATOM 10390 H HB3  . LYS A 1 86  ? -16.114 4.359   -12.628 1.00 0.00 ? 86  LYS A HB3  7  
ATOM 10391 H HG2  . LYS A 1 86  ? -18.778 5.685   -12.801 1.00 0.00 ? 86  LYS A HG2  7  
ATOM 10392 H HG3  . LYS A 1 86  ? -17.321 6.670   -12.651 1.00 0.00 ? 86  LYS A HG3  7  
ATOM 10393 H HD2  . LYS A 1 86  ? -17.374 4.490   -14.682 1.00 0.00 ? 86  LYS A HD2  7  
ATOM 10394 H HD3  . LYS A 1 86  ? -18.263 5.978   -15.013 1.00 0.00 ? 86  LYS A HD3  7  
ATOM 10395 H HE2  . LYS A 1 86  ? -16.313 7.288   -14.912 1.00 0.00 ? 86  LYS A HE2  7  
ATOM 10396 H HE3  . LYS A 1 86  ? -15.390 6.003   -14.135 1.00 0.00 ? 86  LYS A HE3  7  
ATOM 10397 H HZ1  . LYS A 1 86  ? -15.096 4.899   -16.098 1.00 0.00 ? 86  LYS A HZ1  7  
ATOM 10398 H HZ2  . LYS A 1 86  ? -15.109 6.493   -16.663 1.00 0.00 ? 86  LYS A HZ2  7  
ATOM 10399 H HZ3  . LYS A 1 86  ? -16.493 5.531   -16.813 1.00 0.00 ? 86  LYS A HZ3  7  
ATOM 10400 N N    . GLN A 1 87  ? -16.172 1.774   -12.670 1.00 0.00 ? 87  GLN A N    7  
ATOM 10401 C CA   . GLN A 1 87  ? -15.266 0.646   -12.488 1.00 0.00 ? 87  GLN A CA   7  
ATOM 10402 C C    . GLN A 1 87  ? -13.819 1.068   -12.715 1.00 0.00 ? 87  GLN A C    7  
ATOM 10403 O O    . GLN A 1 87  ? -13.495 1.694   -13.725 1.00 0.00 ? 87  GLN A O    7  
ATOM 10404 C CB   . GLN A 1 87  ? -15.635 -0.490  -13.444 1.00 0.00 ? 87  GLN A CB   7  
ATOM 10405 C CG   . GLN A 1 87  ? -16.962 -1.154  -13.116 1.00 0.00 ? 87  GLN A CG   7  
ATOM 10406 C CD   . GLN A 1 87  ? -18.147 -0.239  -13.355 1.00 0.00 ? 87  GLN A CD   7  
ATOM 10407 O OE1  . GLN A 1 87  ? -18.078 0.688   -14.162 1.00 0.00 ? 87  GLN A OE1  7  
ATOM 10408 N NE2  . GLN A 1 87  ? -19.245 -0.496  -12.652 1.00 0.00 ? 87  GLN A NE2  7  
ATOM 10409 H H    . GLN A 1 87  ? -16.162 2.264   -13.518 1.00 0.00 ? 87  GLN A H    7  
ATOM 10410 H HA   . GLN A 1 87  ? -15.371 0.297   -11.472 1.00 0.00 ? 87  GLN A HA   7  
ATOM 10411 H HB2  . GLN A 1 87  ? -15.692 -0.096  -14.447 1.00 0.00 ? 87  GLN A HB2  7  
ATOM 10412 H HB3  . GLN A 1 87  ? -14.861 -1.243  -13.404 1.00 0.00 ? 87  GLN A HB3  7  
ATOM 10413 H HG2  . GLN A 1 87  ? -17.074 -2.032  -13.736 1.00 0.00 ? 87  GLN A HG2  7  
ATOM 10414 H HG3  . GLN A 1 87  ? -16.956 -1.448  -12.076 1.00 0.00 ? 87  GLN A HG3  7  
ATOM 10415 H HE21 . GLN A 1 87  ? -19.227 -1.250  -12.026 1.00 0.00 ? 87  GLN A HE21 7  
ATOM 10416 H HE22 . GLN A 1 87  ? -20.025 0.080   -12.786 1.00 0.00 ? 87  GLN A HE22 7  
ATOM 10417 N N    . ARG A 1 88  ? -12.951 0.722   -11.770 1.00 0.00 ? 88  ARG A N    7  
ATOM 10418 C CA   . ARG A 1 88  ? -11.538 1.067   -11.867 1.00 0.00 ? 88  ARG A CA   7  
ATOM 10419 C C    . ARG A 1 88  ? -10.661 -0.143  -11.557 1.00 0.00 ? 88  ARG A C    7  
ATOM 10420 O O    . ARG A 1 88  ? -11.101 -1.093  -10.909 1.00 0.00 ? 88  ARG A O    7  
ATOM 10421 C CB   . ARG A 1 88  ? -11.203 2.211   -10.908 1.00 0.00 ? 88  ARG A CB   7  
ATOM 10422 C CG   . ARG A 1 88  ? -11.932 3.506   -11.228 1.00 0.00 ? 88  ARG A CG   7  
ATOM 10423 C CD   . ARG A 1 88  ? -11.577 4.605   -10.239 1.00 0.00 ? 88  ARG A CD   7  
ATOM 10424 N NE   . ARG A 1 88  ? -12.587 5.658   -10.204 1.00 0.00 ? 88  ARG A NE   7  
ATOM 10425 C CZ   . ARG A 1 88  ? -12.347 6.893   -9.777  1.00 0.00 ? 88  ARG A CZ   7  
ATOM 10426 N NH1  . ARG A 1 88  ? -11.137 7.227   -9.352  1.00 0.00 ? 88  ARG A NH1  7  
ATOM 10427 N NH2  . ARG A 1 88  ? -13.319 7.797   -9.776  1.00 0.00 ? 88  ARG A NH2  7  
ATOM 10428 H H    . ARG A 1 88  ? -13.269 0.224   -10.988 1.00 0.00 ? 88  ARG A H    7  
ATOM 10429 H HA   . ARG A 1 88  ? -11.343 1.388   -12.879 1.00 0.00 ? 88  ARG A HA   7  
ATOM 10430 H HB2  . ARG A 1 88  ? -11.467 1.914   -9.904  1.00 0.00 ? 88  ARG A HB2  7  
ATOM 10431 H HB3  . ARG A 1 88  ? -10.141 2.402   -10.951 1.00 0.00 ? 88  ARG A HB3  7  
ATOM 10432 H HG2  . ARG A 1 88  ? -11.656 3.828   -12.221 1.00 0.00 ? 88  ARG A HG2  7  
ATOM 10433 H HG3  . ARG A 1 88  ? -12.997 3.328   -11.188 1.00 0.00 ? 88  ARG A HG3  7  
ATOM 10434 H HD2  . ARG A 1 88  ? -11.490 4.170   -9.254  1.00 0.00 ? 88  ARG A HD2  7  
ATOM 10435 H HD3  . ARG A 1 88  ? -10.629 5.036   -10.526 1.00 0.00 ? 88  ARG A HD3  7  
ATOM 10436 H HE   . ARG A 1 88  ? -13.489 5.433   -10.514 1.00 0.00 ? 88  ARG A HE   7  
ATOM 10437 H HH11 . ARG A 1 88  ? -10.402 6.549   -9.352  1.00 0.00 ? 88  ARG A HH11 7  
ATOM 10438 H HH12 . ARG A 1 88  ? -10.958 8.158   -9.032  1.00 0.00 ? 88  ARG A HH12 7  
ATOM 10439 H HH21 . ARG A 1 88  ? -14.232 7.549   -10.097 1.00 0.00 ? 88  ARG A HH21 7  
ATOM 10440 H HH22 . ARG A 1 88  ? -13.137 8.726   -9.455  1.00 0.00 ? 88  ARG A HH22 7  
ATOM 10441 N N    . LEU A 1 89  ? -9.418  -0.101  -12.025 1.00 0.00 ? 89  LEU A N    7  
ATOM 10442 C CA   . LEU A 1 89  ? -8.478  -1.194  -11.798 1.00 0.00 ? 89  LEU A CA   7  
ATOM 10443 C C    . LEU A 1 89  ? -7.443  -0.813  -10.745 1.00 0.00 ? 89  LEU A C    7  
ATOM 10444 O O    . LEU A 1 89  ? -7.243  0.367   -10.456 1.00 0.00 ? 89  LEU A O    7  
ATOM 10445 C CB   . LEU A 1 89  ? -7.778  -1.569  -13.105 1.00 0.00 ? 89  LEU A CB   7  
ATOM 10446 C CG   . LEU A 1 89  ? -8.609  -2.372  -14.106 1.00 0.00 ? 89  LEU A CG   7  
ATOM 10447 C CD1  . LEU A 1 89  ? -9.175  -3.622  -13.449 1.00 0.00 ? 89  LEU A CD1  7  
ATOM 10448 C CD2  . LEU A 1 89  ? -9.729  -1.515  -14.679 1.00 0.00 ? 89  LEU A CD2  7  
ATOM 10449 H H    . LEU A 1 89  ? -9.124  0.682   -12.534 1.00 0.00 ? 89  LEU A H    7  
ATOM 10450 H HA   . LEU A 1 89  ? -9.039  -2.045  -11.443 1.00 0.00 ? 89  LEU A HA   7  
ATOM 10451 H HB2  . LEU A 1 89  ? -7.470  -0.655  -13.590 1.00 0.00 ? 89  LEU A HB2  7  
ATOM 10452 H HB3  . LEU A 1 89  ? -6.904  -2.154  -12.855 1.00 0.00 ? 89  LEU A HB3  7  
ATOM 10453 H HG   . LEU A 1 89  ? -7.974  -2.684  -14.924 1.00 0.00 ? 89  LEU A HG   7  
ATOM 10454 H HD11 . LEU A 1 89  ? -9.050  -4.465  -14.111 1.00 0.00 ? 89  LEU A HD11 7  
ATOM 10455 H HD12 . LEU A 1 89  ? -10.226 -3.477  -13.245 1.00 0.00 ? 89  LEU A HD12 7  
ATOM 10456 H HD13 . LEU A 1 89  ? -8.652  -3.809  -12.523 1.00 0.00 ? 89  LEU A HD13 7  
ATOM 10457 H HD21 . LEU A 1 89  ? -9.309  -0.621  -15.116 1.00 0.00 ? 89  LEU A HD21 7  
ATOM 10458 H HD22 . LEU A 1 89  ? -10.413 -1.242  -13.888 1.00 0.00 ? 89  LEU A HD22 7  
ATOM 10459 H HD23 . LEU A 1 89  ? -10.258 -2.073  -15.437 1.00 0.00 ? 89  LEU A HD23 7  
ATOM 10460 N N    . ILE A 1 90  ? -6.788  -1.819  -10.176 1.00 0.00 ? 90  ILE A N    7  
ATOM 10461 C CA   . ILE A 1 90  ? -5.771  -1.588  -9.157  1.00 0.00 ? 90  ILE A CA   7  
ATOM 10462 C C    . ILE A 1 90  ? -4.516  -2.407  -9.437  1.00 0.00 ? 90  ILE A C    7  
ATOM 10463 O O    . ILE A 1 90  ? -4.495  -3.241  -10.343 1.00 0.00 ? 90  ILE A O    7  
ATOM 10464 C CB   . ILE A 1 90  ? -6.294  -1.937  -7.751  1.00 0.00 ? 90  ILE A CB   7  
ATOM 10465 C CG1  . ILE A 1 90  ? -6.701  -3.410  -7.685  1.00 0.00 ? 90  ILE A CG1  7  
ATOM 10466 C CG2  . ILE A 1 90  ? -7.468  -1.040  -7.385  1.00 0.00 ? 90  ILE A CG2  7  
ATOM 10467 C CD1  . ILE A 1 90  ? -7.474  -3.768  -6.435  1.00 0.00 ? 90  ILE A CD1  7  
ATOM 10468 H H    . ILE A 1 90  ? -6.992  -2.737  -10.448 1.00 0.00 ? 90  ILE A H    7  
ATOM 10469 H HA   . ILE A 1 90  ? -5.515  -0.539  -9.174  1.00 0.00 ? 90  ILE A HA   7  
ATOM 10470 H HB   . ILE A 1 90  ? -5.501  -1.757  -7.041  1.00 0.00 ? 90  ILE A HB   7  
ATOM 10471 H HG12 . ILE A 1 90  ? -7.321  -3.644  -8.536  1.00 0.00 ? 90  ILE A HG12 7  
ATOM 10472 H HG13 . ILE A 1 90  ? -5.811  -4.023  -7.713  1.00 0.00 ? 90  ILE A HG13 7  
ATOM 10473 H HG21 . ILE A 1 90  ? -7.284  -0.040  -7.748  1.00 0.00 ? 90  ILE A HG21 7  
ATOM 10474 H HG22 . ILE A 1 90  ? -8.369  -1.426  -7.837  1.00 0.00 ? 90  ILE A HG22 7  
ATOM 10475 H HG23 . ILE A 1 90  ? -7.584  -1.018  -6.312  1.00 0.00 ? 90  ILE A HG23 7  
ATOM 10476 H HD11 . ILE A 1 90  ? -7.931  -4.739  -6.559  1.00 0.00 ? 90  ILE A HD11 7  
ATOM 10477 H HD12 . ILE A 1 90  ? -6.803  -3.790  -5.590  1.00 0.00 ? 90  ILE A HD12 7  
ATOM 10478 H HD13 . ILE A 1 90  ? -8.244  -3.029  -6.264  1.00 0.00 ? 90  ILE A HD13 7  
ATOM 10479 N N    . LYS A 1 91  ? -3.471  -2.166  -8.653  1.00 0.00 ? 91  LYS A N    7  
ATOM 10480 C CA   . LYS A 1 91  ? -2.211  -2.882  -8.814  1.00 0.00 ? 91  LYS A CA   7  
ATOM 10481 C C    . LYS A 1 91  ? -1.299  -2.655  -7.613  1.00 0.00 ? 91  LYS A C    7  
ATOM 10482 O O    . LYS A 1 91  ? -1.398  -1.635  -6.931  1.00 0.00 ? 91  LYS A O    7  
ATOM 10483 C CB   . LYS A 1 91  ? -1.506  -2.435  -10.096 1.00 0.00 ? 91  LYS A CB   7  
ATOM 10484 C CG   . LYS A 1 91  ? -0.984  -1.009  -10.037 1.00 0.00 ? 91  LYS A CG   7  
ATOM 10485 C CD   . LYS A 1 91  ? -0.187  -0.656  -11.281 1.00 0.00 ? 91  LYS A CD   7  
ATOM 10486 C CE   . LYS A 1 91  ? 0.573   0.650   -11.104 1.00 0.00 ? 91  LYS A CE   7  
ATOM 10487 N NZ   . LYS A 1 91  ? 1.708   0.765   -12.061 1.00 0.00 ? 91  LYS A NZ   7  
ATOM 10488 H H    . LYS A 1 91  ? -3.549  -1.489  -7.948  1.00 0.00 ? 91  LYS A H    7  
ATOM 10489 H HA   . LYS A 1 91  ? -2.436  -3.936  -8.886  1.00 0.00 ? 91  LYS A HA   7  
ATOM 10490 H HB2  . LYS A 1 91  ? -0.671  -3.094  -10.283 1.00 0.00 ? 91  LYS A HB2  7  
ATOM 10491 H HB3  . LYS A 1 91  ? -2.202  -2.507  -10.920 1.00 0.00 ? 91  LYS A HB3  7  
ATOM 10492 H HG2  . LYS A 1 91  ? -1.821  -0.332  -9.954  1.00 0.00 ? 91  LYS A HG2  7  
ATOM 10493 H HG3  . LYS A 1 91  ? -0.346  -0.905  -9.170  1.00 0.00 ? 91  LYS A HG3  7  
ATOM 10494 H HD2  . LYS A 1 91  ? 0.521   -1.446  -11.482 1.00 0.00 ? 91  LYS A HD2  7  
ATOM 10495 H HD3  . LYS A 1 91  ? -0.865  -0.556  -12.117 1.00 0.00 ? 91  LYS A HD3  7  
ATOM 10496 H HE2  . LYS A 1 91  ? -0.107  1.472   -11.265 1.00 0.00 ? 91  LYS A HE2  7  
ATOM 10497 H HE3  . LYS A 1 91  ? 0.958   0.693   -10.096 1.00 0.00 ? 91  LYS A HE3  7  
ATOM 10498 H HZ1  . LYS A 1 91  ? 2.117   -0.173  -12.244 1.00 0.00 ? 91  LYS A HZ1  7  
ATOM 10499 H HZ2  . LYS A 1 91  ? 2.447   1.381   -11.666 1.00 0.00 ? 91  LYS A HZ2  7  
ATOM 10500 H HZ3  . LYS A 1 91  ? 1.378   1.170   -12.960 1.00 0.00 ? 91  LYS A HZ3  7  
ATOM 10501 N N    . ARG A 1 92  ? -0.410  -3.611  -7.361  1.00 0.00 ? 92  ARG A N    7  
ATOM 10502 C CA   . ARG A 1 92  ? 0.520   -3.513  -6.243  1.00 0.00 ? 92  ARG A CA   7  
ATOM 10503 C C    . ARG A 1 92  ? 1.955   -3.368  -6.740  1.00 0.00 ? 92  ARG A C    7  
ATOM 10504 O O    . ARG A 1 92  ? 2.536   -4.313  -7.273  1.00 0.00 ? 92  ARG A O    7  
ATOM 10505 C CB   . ARG A 1 92  ? 0.402   -4.747  -5.345  1.00 0.00 ? 92  ARG A CB   7  
ATOM 10506 C CG   . ARG A 1 92  ? 1.354   -4.731  -4.160  1.00 0.00 ? 92  ARG A CG   7  
ATOM 10507 C CD   . ARG A 1 92  ? 0.801   -5.531  -2.991  1.00 0.00 ? 92  ARG A CD   7  
ATOM 10508 N NE   . ARG A 1 92  ? 0.910   -6.971  -3.214  1.00 0.00 ? 92  ARG A NE   7  
ATOM 10509 C CZ   . ARG A 1 92  ? 2.058   -7.637  -3.164  1.00 0.00 ? 92  ARG A CZ   7  
ATOM 10510 N NH1  . ARG A 1 92  ? 3.189   -6.998  -2.900  1.00 0.00 ? 92  ARG A NH1  7  
ATOM 10511 N NH2  . ARG A 1 92  ? 2.076   -8.947  -3.377  1.00 0.00 ? 92  ARG A NH2  7  
ATOM 10512 H H    . ARG A 1 92  ? -0.380  -4.400  -7.941  1.00 0.00 ? 92  ARG A H    7  
ATOM 10513 H HA   . ARG A 1 92  ? 0.260   -2.636  -5.670  1.00 0.00 ? 92  ARG A HA   7  
ATOM 10514 H HB2  . ARG A 1 92  ? -0.608  -4.807  -4.967  1.00 0.00 ? 92  ARG A HB2  7  
ATOM 10515 H HB3  . ARG A 1 92  ? 0.610   -5.627  -5.935  1.00 0.00 ? 92  ARG A HB3  7  
ATOM 10516 H HG2  . ARG A 1 92  ? 2.297   -5.160  -4.462  1.00 0.00 ? 92  ARG A HG2  7  
ATOM 10517 H HG3  . ARG A 1 92  ? 1.505   -3.709  -3.846  1.00 0.00 ? 92  ARG A HG3  7  
ATOM 10518 H HD2  . ARG A 1 92  ? 1.354   -5.272  -2.101  1.00 0.00 ? 92  ARG A HD2  7  
ATOM 10519 H HD3  . ARG A 1 92  ? -0.239  -5.275  -2.856  1.00 0.00 ? 92  ARG A HD3  7  
ATOM 10520 H HE   . ARG A 1 92  ? 0.086   -7.463  -3.410  1.00 0.00 ? 92  ARG A HE   7  
ATOM 10521 H HH11 . ARG A 1 92  ? 3.178   -6.011  -2.738  1.00 0.00 ? 92  ARG A HH11 7  
ATOM 10522 H HH12 . ARG A 1 92  ? 4.052   -7.502  -2.862  1.00 0.00 ? 92  ARG A HH12 7  
ATOM 10523 H HH21 . ARG A 1 92  ? 1.225   -9.433  -3.576  1.00 0.00 ? 92  ARG A HH21 7  
ATOM 10524 H HH22 . ARG A 1 92  ? 2.940   -9.448  -3.339  1.00 0.00 ? 92  ARG A HH22 7  
ATOM 10525 N N    . ALA A 1 93  ? 2.520   -2.179  -6.562  1.00 0.00 ? 93  ALA A N    7  
ATOM 10526 C CA   . ALA A 1 93  ? 3.887   -1.910  -6.991  1.00 0.00 ? 93  ALA A CA   7  
ATOM 10527 C C    . ALA A 1 93  ? 4.622   -1.044  -5.974  1.00 0.00 ? 93  ALA A C    7  
ATOM 10528 O O    . ALA A 1 93  ? 4.028   -0.213  -5.286  1.00 0.00 ? 93  ALA A O    7  
ATOM 10529 C CB   . ALA A 1 93  ? 3.889   -1.240  -8.357  1.00 0.00 ? 93  ALA A CB   7  
ATOM 10530 H H    . ALA A 1 93  ? 2.006   -1.465  -6.131  1.00 0.00 ? 93  ALA A H    7  
ATOM 10531 H HA   . ALA A 1 93  ? 4.401   -2.857  -7.081  1.00 0.00 ? 93  ALA A HA   7  
ATOM 10532 H HB1  . ALA A 1 93  ? 3.764   -0.174  -8.234  1.00 0.00 ? 93  ALA A HB1  7  
ATOM 10533 H HB2  . ALA A 1 93  ? 4.828   -1.438  -8.853  1.00 0.00 ? 93  ALA A HB2  7  
ATOM 10534 H HB3  . ALA A 1 93  ? 3.078   -1.632  -8.951  1.00 0.00 ? 93  ALA A HB3  7  
ATOM 10535 N N    . PRO A 1 94  ? 5.945   -1.242  -5.872  1.00 0.00 ? 94  PRO A N    7  
ATOM 10536 C CA   . PRO A 1 94  ? 6.789   -0.488  -4.941  1.00 0.00 ? 94  PRO A CA   7  
ATOM 10537 C C    . PRO A 1 94  ? 6.940   0.973   -5.348  1.00 0.00 ? 94  PRO A C    7  
ATOM 10538 O O    . PRO A 1 94  ? 6.785   1.321   -6.519  1.00 0.00 ? 94  PRO A O    7  
ATOM 10539 C CB   . PRO A 1 94  ? 8.137   -1.208  -5.022  1.00 0.00 ? 94  PRO A CB   7  
ATOM 10540 C CG   . PRO A 1 94  ? 8.146   -1.845  -6.369  1.00 0.00 ? 94  PRO A CG   7  
ATOM 10541 C CD   . PRO A 1 94  ? 6.718   -2.217  -6.660  1.00 0.00 ? 94  PRO A CD   7  
ATOM 10542 H HA   . PRO A 1 94  ? 6.411   -0.542  -3.930  1.00 0.00 ? 94  PRO A HA   7  
ATOM 10543 H HB2  . PRO A 1 94  ? 8.938   -0.490  -4.919  1.00 0.00 ? 94  PRO A HB2  7  
ATOM 10544 H HB3  . PRO A 1 94  ? 8.204   -1.945  -4.237  1.00 0.00 ? 94  PRO A HB3  7  
ATOM 10545 H HG2  . PRO A 1 94  ? 8.509   -1.144  -7.105  1.00 0.00 ? 94  PRO A HG2  7  
ATOM 10546 H HG3  . PRO A 1 94  ? 8.766   -2.729  -6.352  1.00 0.00 ? 94  PRO A HG3  7  
ATOM 10547 H HD2  . PRO A 1 94  ? 6.509   -2.113  -7.715  1.00 0.00 ? 94  PRO A HD2  7  
ATOM 10548 H HD3  . PRO A 1 94  ? 6.516   -3.225  -6.331  1.00 0.00 ? 94  PRO A HD3  7  
ATOM 10549 N N    . PHE A 1 95  ? 7.243   1.826   -4.374  1.00 0.00 ? 95  PHE A N    7  
ATOM 10550 C CA   . PHE A 1 95  ? 7.414   3.251   -4.632  1.00 0.00 ? 95  PHE A CA   7  
ATOM 10551 C C    . PHE A 1 95  ? 8.218   3.480   -5.908  1.00 0.00 ? 95  PHE A C    7  
ATOM 10552 O O    . PHE A 1 95  ? 8.892   2.575   -6.401  1.00 0.00 ? 95  PHE A O    7  
ATOM 10553 C CB   . PHE A 1 95  ? 8.111   3.924   -3.448  1.00 0.00 ? 95  PHE A CB   7  
ATOM 10554 C CG   . PHE A 1 95  ? 7.164   4.386   -2.378  1.00 0.00 ? 95  PHE A CG   7  
ATOM 10555 C CD1  . PHE A 1 95  ? 6.372   3.477   -1.696  1.00 0.00 ? 95  PHE A CD1  7  
ATOM 10556 C CD2  . PHE A 1 95  ? 7.065   5.730   -2.055  1.00 0.00 ? 95  PHE A CD2  7  
ATOM 10557 C CE1  . PHE A 1 95  ? 5.500   3.899   -0.710  1.00 0.00 ? 95  PHE A CE1  7  
ATOM 10558 C CE2  . PHE A 1 95  ? 6.195   6.158   -1.071  1.00 0.00 ? 95  PHE A CE2  7  
ATOM 10559 C CZ   . PHE A 1 95  ? 5.410   5.241   -0.398  1.00 0.00 ? 95  PHE A CZ   7  
ATOM 10560 H H    . PHE A 1 95  ? 7.353   1.488   -3.461  1.00 0.00 ? 95  PHE A H    7  
ATOM 10561 H HA   . PHE A 1 95  ? 6.434   3.685   -4.756  1.00 0.00 ? 95  PHE A HA   7  
ATOM 10562 H HB2  . PHE A 1 95  ? 8.801   3.225   -3.000  1.00 0.00 ? 95  PHE A HB2  7  
ATOM 10563 H HB3  . PHE A 1 95  ? 8.658   4.785   -3.804  1.00 0.00 ? 95  PHE A HB3  7  
ATOM 10564 H HD1  . PHE A 1 95  ? 6.441   2.426   -1.939  1.00 0.00 ? 95  PHE A HD1  7  
ATOM 10565 H HD2  . PHE A 1 95  ? 7.677   6.448   -2.581  1.00 0.00 ? 95  PHE A HD2  7  
ATOM 10566 H HE1  . PHE A 1 95  ? 4.888   3.180   -0.186  1.00 0.00 ? 95  PHE A HE1  7  
ATOM 10567 H HE2  . PHE A 1 95  ? 6.126   7.208   -0.829  1.00 0.00 ? 95  PHE A HE2  7  
ATOM 10568 H HZ   . PHE A 1 95  ? 4.730   5.573   0.372   1.00 0.00 ? 95  PHE A HZ   7  
ATOM 10569 N N    . SER A 1 96  ? 8.142   4.697   -6.438  1.00 0.00 ? 96  SER A N    7  
ATOM 10570 C CA   . SER A 1 96  ? 8.859   5.045   -7.659  1.00 0.00 ? 96  SER A CA   7  
ATOM 10571 C C    . SER A 1 96  ? 10.316  5.379   -7.357  1.00 0.00 ? 96  SER A C    7  
ATOM 10572 O O    . SER A 1 96  ? 10.699  6.547   -7.303  1.00 0.00 ? 96  SER A O    7  
ATOM 10573 C CB   . SER A 1 96  ? 8.185   6.231   -8.351  1.00 0.00 ? 96  SER A CB   7  
ATOM 10574 O OG   . SER A 1 96  ? 7.194   5.794   -9.264  1.00 0.00 ? 96  SER A OG   7  
ATOM 10575 H H    . SER A 1 96  ? 7.588   5.375   -5.998  1.00 0.00 ? 96  SER A H    7  
ATOM 10576 H HA   . SER A 1 96  ? 8.826   4.190   -8.318  1.00 0.00 ? 96  SER A HA   7  
ATOM 10577 H HB2  . SER A 1 96  ? 7.719   6.861   -7.608  1.00 0.00 ? 96  SER A HB2  7  
ATOM 10578 H HB3  . SER A 1 96  ? 8.929   6.800   -8.890  1.00 0.00 ? 96  SER A HB3  7  
ATOM 10579 H HG   . SER A 1 96  ? 7.539   5.841   -10.159 1.00 0.00 ? 96  SER A HG   7  
ATOM 10580 N N    . SER A 1 97  ? 11.126  4.342   -7.161  1.00 0.00 ? 97  SER A N    7  
ATOM 10581 C CA   . SER A 1 97  ? 12.541  4.524   -6.861  1.00 0.00 ? 97  SER A CA   7  
ATOM 10582 C C    . SER A 1 97  ? 13.102  5.735   -7.599  1.00 0.00 ? 97  SER A C    7  
ATOM 10583 O O    . SER A 1 97  ? 12.721  6.015   -8.735  1.00 0.00 ? 97  SER A O    7  
ATOM 10584 C CB   . SER A 1 97  ? 13.330  3.270   -7.241  1.00 0.00 ? 97  SER A CB   7  
ATOM 10585 O OG   . SER A 1 97  ? 14.670  3.353   -6.786  1.00 0.00 ? 97  SER A OG   7  
ATOM 10586 H H    . SER A 1 97  ? 10.761  3.434   -7.218  1.00 0.00 ? 97  SER A H    7  
ATOM 10587 H HA   . SER A 1 97  ? 12.635  4.690   -5.798  1.00 0.00 ? 97  SER A HA   7  
ATOM 10588 H HB2  . SER A 1 97  ? 12.864  2.405   -6.795  1.00 0.00 ? 97  SER A HB2  7  
ATOM 10589 H HB3  . SER A 1 97  ? 13.334  3.163   -8.316  1.00 0.00 ? 97  SER A HB3  7  
ATOM 10590 H HG   . SER A 1 97  ? 14.732  2.978   -5.904  1.00 0.00 ? 97  SER A HG   7  
ATOM 10591 N N    . GLY A 1 98  ? 14.011  6.452   -6.944  1.00 0.00 ? 98  GLY A N    7  
ATOM 10592 C CA   . GLY A 1 98  ? 14.610  7.625   -7.553  1.00 0.00 ? 98  GLY A CA   7  
ATOM 10593 C C    . GLY A 1 98  ? 14.970  8.687   -6.533  1.00 0.00 ? 98  GLY A C    7  
ATOM 10594 O O    . GLY A 1 98  ? 14.823  8.495   -5.326  1.00 0.00 ? 98  GLY A O    7  
ATOM 10595 H H    . GLY A 1 98  ? 14.276  6.182   -6.040  1.00 0.00 ? 98  GLY A H    7  
ATOM 10596 H HA2  . GLY A 1 98  ? 15.505  7.327   -8.078  1.00 0.00 ? 98  GLY A HA2  7  
ATOM 10597 H HA3  . GLY A 1 98  ? 13.912  8.045   -8.262  1.00 0.00 ? 98  GLY A HA3  7  
ATOM 10598 N N    . PRO A 1 99  ? 15.455  9.840   -7.020  1.00 0.00 ? 99  PRO A N    7  
ATOM 10599 C CA   . PRO A 1 99  ? 15.848  10.959  -6.158  1.00 0.00 ? 99  PRO A CA   7  
ATOM 10600 C C    . PRO A 1 99  ? 14.649  11.629  -5.496  1.00 0.00 ? 99  PRO A C    7  
ATOM 10601 O O    . PRO A 1 99  ? 14.807  12.508  -4.648  1.00 0.00 ? 99  PRO A O    7  
ATOM 10602 C CB   . PRO A 1 99  ? 16.534  11.927  -7.126  1.00 0.00 ? 99  PRO A CB   7  
ATOM 10603 C CG   . PRO A 1 99  ? 15.943  11.615  -8.457  1.00 0.00 ? 99  PRO A CG   7  
ATOM 10604 C CD   . PRO A 1 99  ? 15.656  10.139  -8.447  1.00 0.00 ? 99  PRO A CD   7  
ATOM 10605 H HA   . PRO A 1 99  ? 16.550  10.648  -5.399  1.00 0.00 ? 99  PRO A HA   7  
ATOM 10606 H HB2  . PRO A 1 99  ? 16.326  12.945  -6.829  1.00 0.00 ? 99  PRO A HB2  7  
ATOM 10607 H HB3  . PRO A 1 99  ? 17.600  11.754  -7.117  1.00 0.00 ? 99  PRO A HB3  7  
ATOM 10608 H HG2  . PRO A 1 99  ? 15.029  12.173  -8.593  1.00 0.00 ? 99  PRO A HG2  7  
ATOM 10609 H HG3  . PRO A 1 99  ? 16.650  11.854  -9.238  1.00 0.00 ? 99  PRO A HG3  7  
ATOM 10610 H HD2  . PRO A 1 99  ? 14.763  9.924   -9.016  1.00 0.00 ? 99  PRO A HD2  7  
ATOM 10611 H HD3  . PRO A 1 99  ? 16.498  9.588   -8.841  1.00 0.00 ? 99  PRO A HD3  7  
ATOM 10612 N N    . SER A 1 100 ? 13.450  11.209  -5.888  1.00 0.00 ? 100 SER A N    7  
ATOM 10613 C CA   . SER A 1 100 ? 12.224  11.772  -5.334  1.00 0.00 ? 100 SER A CA   7  
ATOM 10614 C C    . SER A 1 100 ? 11.969  11.239  -3.927  1.00 0.00 ? 100 SER A C    7  
ATOM 10615 O O    . SER A 1 100 ? 11.098  10.395  -3.720  1.00 0.00 ? 100 SER A O    7  
ATOM 10616 C CB   . SER A 1 100 ? 11.034  11.445  -6.239  1.00 0.00 ? 100 SER A CB   7  
ATOM 10617 O OG   . SER A 1 100 ? 10.766  10.054  -6.246  1.00 0.00 ? 100 SER A OG   7  
ATOM 10618 H H    . SER A 1 100 ? 13.389  10.506  -6.568  1.00 0.00 ? 100 SER A H    7  
ATOM 10619 H HA   . SER A 1 100 ? 12.344  12.844  -5.285  1.00 0.00 ? 100 SER A HA   7  
ATOM 10620 H HB2  . SER A 1 100 ? 10.159  11.967  -5.881  1.00 0.00 ? 100 SER A HB2  7  
ATOM 10621 H HB3  . SER A 1 100 ? 11.255  11.763  -7.248  1.00 0.00 ? 100 SER A HB3  7  
ATOM 10622 H HG   . SER A 1 100 ? 11.087  9.661   -5.431  1.00 0.00 ? 100 SER A HG   7  
ATOM 10623 N N    . SER A 1 101 ? 12.736  11.740  -2.964  1.00 0.00 ? 101 SER A N    7  
ATOM 10624 C CA   . SER A 1 101 ? 12.597  11.313  -1.577  1.00 0.00 ? 101 SER A CA   7  
ATOM 10625 C C    . SER A 1 101 ? 12.344  9.811   -1.494  1.00 0.00 ? 101 SER A C    7  
ATOM 10626 O O    . SER A 1 101 ? 11.423  9.362   -0.814  1.00 0.00 ? 101 SER A O    7  
ATOM 10627 C CB   . SER A 1 101 ? 11.455  12.072  -0.899  1.00 0.00 ? 101 SER A CB   7  
ATOM 10628 O OG   . SER A 1 101 ? 11.588  12.042  0.511   1.00 0.00 ? 101 SER A OG   7  
ATOM 10629 H H    . SER A 1 101 ? 13.413  12.411  -3.193  1.00 0.00 ? 101 SER A H    7  
ATOM 10630 H HA   . SER A 1 101 ? 13.521  11.539  -1.066  1.00 0.00 ? 101 SER A HA   7  
ATOM 10631 H HB2  . SER A 1 101 ? 11.465  13.100  -1.227  1.00 0.00 ? 101 SER A HB2  7  
ATOM 10632 H HB3  . SER A 1 101 ? 10.513  11.617  -1.170  1.00 0.00 ? 101 SER A HB3  7  
ATOM 10633 H HG   . SER A 1 101 ? 10.920  11.462  0.884   1.00 0.00 ? 101 SER A HG   7  
ATOM 10634 N N    . GLY A 1 102 ? 13.171  9.038   -2.192  1.00 0.00 ? 102 GLY A N    7  
ATOM 10635 C CA   . GLY A 1 102 ? 13.022  7.595   -2.184  1.00 0.00 ? 102 GLY A CA   7  
ATOM 10636 C C    . GLY A 1 102 ? 11.650  7.152   -2.654  1.00 0.00 ? 102 GLY A C    7  
ATOM 10637 O O    . GLY A 1 102 ? 11.179  6.076   -2.286  1.00 0.00 ? 102 GLY A O    7  
ATOM 10638 H H    . GLY A 1 102 ? 13.889  9.452   -2.716  1.00 0.00 ? 102 GLY A H    7  
ATOM 10639 H HA2  . GLY A 1 102 ? 13.770  7.163   -2.832  1.00 0.00 ? 102 GLY A HA2  7  
ATOM 10640 H HA3  . GLY A 1 102 ? 13.179  7.233   -1.179  1.00 0.00 ? 102 GLY A HA3  7  
ATOM 10641 N N    . GLY A 1 1   ? 14.675  22.489  -3.720  1.00 0.00 ? 1   GLY A N    8  
ATOM 10642 C CA   . GLY A 1 1   ? 15.092  21.167  -4.151  1.00 0.00 ? 1   GLY A CA   8  
ATOM 10643 C C    . GLY A 1 1   ? 15.127  21.034  -5.661  1.00 0.00 ? 1   GLY A C    8  
ATOM 10644 O O    . GLY A 1 1   ? 15.155  22.034  -6.378  1.00 0.00 ? 1   GLY A O    8  
ATOM 10645 H H1   . GLY A 1 1   ? 14.390  23.151  -4.384  1.00 0.00 ? 1   GLY A H1   8  
ATOM 10646 H HA2  . GLY A 1 1   ? 16.078  20.967  -3.759  1.00 0.00 ? 1   GLY A HA2  8  
ATOM 10647 H HA3  . GLY A 1 1   ? 14.402  20.437  -3.753  1.00 0.00 ? 1   GLY A HA3  8  
ATOM 10648 N N    . SER A 1 2   ? 15.128  19.796  -6.144  1.00 0.00 ? 2   SER A N    8  
ATOM 10649 C CA   . SER A 1 2   ? 15.167  19.535  -7.578  1.00 0.00 ? 2   SER A CA   8  
ATOM 10650 C C    . SER A 1 2   ? 13.778  19.186  -8.104  1.00 0.00 ? 2   SER A C    8  
ATOM 10651 O O    . SER A 1 2   ? 13.407  18.014  -8.181  1.00 0.00 ? 2   SER A O    8  
ATOM 10652 C CB   . SER A 1 2   ? 16.142  18.397  -7.885  1.00 0.00 ? 2   SER A CB   8  
ATOM 10653 O OG   . SER A 1 2   ? 16.456  18.353  -9.266  1.00 0.00 ? 2   SER A OG   8  
ATOM 10654 H H    . SER A 1 2   ? 15.106  19.040  -5.520  1.00 0.00 ? 2   SER A H    8  
ATOM 10655 H HA   . SER A 1 2   ? 15.509  20.433  -8.069  1.00 0.00 ? 2   SER A HA   8  
ATOM 10656 H HB2  . SER A 1 2   ? 17.052  18.545  -7.326  1.00 0.00 ? 2   SER A HB2  8  
ATOM 10657 H HB3  . SER A 1 2   ? 15.693  17.456  -7.600  1.00 0.00 ? 2   SER A HB3  8  
ATOM 10658 H HG   . SER A 1 2   ? 15.864  18.936  -9.748  1.00 0.00 ? 2   SER A HG   8  
ATOM 10659 N N    . SER A 1 3   ? 13.014  20.212  -8.465  1.00 0.00 ? 3   SER A N    8  
ATOM 10660 C CA   . SER A 1 3   ? 11.664  20.015  -8.980  1.00 0.00 ? 3   SER A CA   8  
ATOM 10661 C C    . SER A 1 3   ? 11.654  18.972  -10.093 1.00 0.00 ? 3   SER A C    8  
ATOM 10662 O O    . SER A 1 3   ? 12.642  18.797  -10.805 1.00 0.00 ? 3   SER A O    8  
ATOM 10663 C CB   . SER A 1 3   ? 11.096  21.337  -9.500  1.00 0.00 ? 3   SER A CB   8  
ATOM 10664 O OG   . SER A 1 3   ? 10.645  22.153  -8.433  1.00 0.00 ? 3   SER A OG   8  
ATOM 10665 H H    . SER A 1 3   ? 13.365  21.123  -8.380  1.00 0.00 ? 3   SER A H    8  
ATOM 10666 H HA   . SER A 1 3   ? 11.046  19.663  -8.167  1.00 0.00 ? 3   SER A HA   8  
ATOM 10667 H HB2  . SER A 1 3   ? 11.863  21.867  -10.043 1.00 0.00 ? 3   SER A HB2  8  
ATOM 10668 H HB3  . SER A 1 3   ? 10.263  21.134  -10.158 1.00 0.00 ? 3   SER A HB3  8  
ATOM 10669 H HG   . SER A 1 3   ? 11.049  21.859  -7.612  1.00 0.00 ? 3   SER A HG   8  
ATOM 10670 N N    . GLY A 1 4   ? 10.527  18.280  -10.237 1.00 0.00 ? 4   GLY A N    8  
ATOM 10671 C CA   . GLY A 1 4   ? 10.408  17.262  -11.265 1.00 0.00 ? 4   GLY A CA   8  
ATOM 10672 C C    . GLY A 1 4   ? 10.539  15.858  -10.708 1.00 0.00 ? 4   GLY A C    8  
ATOM 10673 O O    . GLY A 1 4   ? 9.623   15.353  -10.058 1.00 0.00 ? 4   GLY A O    8  
ATOM 10674 H H    . GLY A 1 4   ? 9.771   18.462  -9.641  1.00 0.00 ? 4   GLY A H    8  
ATOM 10675 H HA2  . GLY A 1 4   ? 9.446   17.360  -11.744 1.00 0.00 ? 4   GLY A HA2  8  
ATOM 10676 H HA3  . GLY A 1 4   ? 11.183  17.418  -12.001 1.00 0.00 ? 4   GLY A HA3  8  
ATOM 10677 N N    . SER A 1 5   ? 11.679  15.225  -10.965 1.00 0.00 ? 5   SER A N    8  
ATOM 10678 C CA   . SER A 1 5   ? 11.923  13.868  -10.489 1.00 0.00 ? 5   SER A CA   8  
ATOM 10679 C C    . SER A 1 5   ? 13.357  13.718  -9.989  1.00 0.00 ? 5   SER A C    8  
ATOM 10680 O O    . SER A 1 5   ? 14.155  14.652  -10.068 1.00 0.00 ? 5   SER A O    8  
ATOM 10681 C CB   . SER A 1 5   ? 11.652  12.857  -11.605 1.00 0.00 ? 5   SER A CB   8  
ATOM 10682 O OG   . SER A 1 5   ? 11.476  11.553  -11.080 1.00 0.00 ? 5   SER A OG   8  
ATOM 10683 H H    . SER A 1 5   ? 12.371  15.680  -11.489 1.00 0.00 ? 5   SER A H    8  
ATOM 10684 H HA   . SER A 1 5   ? 11.247  13.677  -9.670  1.00 0.00 ? 5   SER A HA   8  
ATOM 10685 H HB2  . SER A 1 5   ? 10.756  13.142  -12.136 1.00 0.00 ? 5   SER A HB2  8  
ATOM 10686 H HB3  . SER A 1 5   ? 12.488  12.847  -12.289 1.00 0.00 ? 5   SER A HB3  8  
ATOM 10687 H HG   . SER A 1 5   ? 10.701  11.149  -11.478 1.00 0.00 ? 5   SER A HG   8  
ATOM 10688 N N    . SER A 1 6   ? 13.677  12.535  -9.475  1.00 0.00 ? 6   SER A N    8  
ATOM 10689 C CA   . SER A 1 6   ? 15.013  12.262  -8.958  1.00 0.00 ? 6   SER A CA   8  
ATOM 10690 C C    . SER A 1 6   ? 15.602  11.013  -9.607  1.00 0.00 ? 6   SER A C    8  
ATOM 10691 O O    . SER A 1 6   ? 15.146  9.897   -9.360  1.00 0.00 ? 6   SER A O    8  
ATOM 10692 C CB   . SER A 1 6   ? 14.969  12.088  -7.439  1.00 0.00 ? 6   SER A CB   8  
ATOM 10693 O OG   . SER A 1 6   ? 14.972  13.344  -6.781  1.00 0.00 ? 6   SER A OG   8  
ATOM 10694 H H    . SER A 1 6   ? 12.997  11.830  -9.440  1.00 0.00 ? 6   SER A H    8  
ATOM 10695 H HA   . SER A 1 6   ? 15.640  13.108  -9.197  1.00 0.00 ? 6   SER A HA   8  
ATOM 10696 H HB2  . SER A 1 6   ? 14.072  11.554  -7.165  1.00 0.00 ? 6   SER A HB2  8  
ATOM 10697 H HB3  . SER A 1 6   ? 15.834  11.526  -7.119  1.00 0.00 ? 6   SER A HB3  8  
ATOM 10698 H HG   . SER A 1 6   ? 14.735  14.033  -7.406  1.00 0.00 ? 6   SER A HG   8  
ATOM 10699 N N    . GLY A 1 7   ? 16.619  11.211  -10.440 1.00 0.00 ? 7   GLY A N    8  
ATOM 10700 C CA   . GLY A 1 7   ? 17.255  10.093  -11.113 1.00 0.00 ? 7   GLY A CA   8  
ATOM 10701 C C    . GLY A 1 7   ? 18.252  9.373   -10.226 1.00 0.00 ? 7   GLY A C    8  
ATOM 10702 O O    . GLY A 1 7   ? 17.917  8.377   -9.586  1.00 0.00 ? 7   GLY A O    8  
ATOM 10703 H H    . GLY A 1 7   ? 16.941  12.123  -10.599 1.00 0.00 ? 7   GLY A H    8  
ATOM 10704 H HA2  . GLY A 1 7   ? 16.493  9.393   -11.423 1.00 0.00 ? 7   GLY A HA2  8  
ATOM 10705 H HA3  . GLY A 1 7   ? 17.770  10.460  -11.989 1.00 0.00 ? 7   GLY A HA3  8  
ATOM 10706 N N    . ASN A 1 8   ? 19.481  9.877   -10.189 1.00 0.00 ? 8   ASN A N    8  
ATOM 10707 C CA   . ASN A 1 8   ? 20.530  9.274   -9.376  1.00 0.00 ? 8   ASN A CA   8  
ATOM 10708 C C    . ASN A 1 8   ? 19.963  8.743   -8.063  1.00 0.00 ? 8   ASN A C    8  
ATOM 10709 O O    . ASN A 1 8   ? 18.983  9.273   -7.540  1.00 0.00 ? 8   ASN A O    8  
ATOM 10710 C CB   . ASN A 1 8   ? 21.634  10.294  -9.092  1.00 0.00 ? 8   ASN A CB   8  
ATOM 10711 C CG   . ASN A 1 8   ? 22.616  10.418  -10.241 1.00 0.00 ? 8   ASN A CG   8  
ATOM 10712 O OD1  . ASN A 1 8   ? 22.623  11.416  -10.962 1.00 0.00 ? 8   ASN A OD1  8  
ATOM 10713 N ND2  . ASN A 1 8   ? 23.453  9.402   -10.417 1.00 0.00 ? 8   ASN A ND2  8  
ATOM 10714 H H    . ASN A 1 8   ? 19.687  10.674  -10.722 1.00 0.00 ? 8   ASN A H    8  
ATOM 10715 H HA   . ASN A 1 8   ? 20.949  8.450   -9.933  1.00 0.00 ? 8   ASN A HA   8  
ATOM 10716 H HB2  . ASN A 1 8   ? 21.186  11.263  -8.922  1.00 0.00 ? 8   ASN A HB2  8  
ATOM 10717 H HB3  . ASN A 1 8   ? 22.177  9.993   -8.209  1.00 0.00 ? 8   ASN A HB3  8  
ATOM 10718 H HD21 . ASN A 1 8   ? 23.390  8.639   -9.804  1.00 0.00 ? 8   ASN A HD21 8  
ATOM 10719 H HD22 . ASN A 1 8   ? 24.098  9.456   -11.152 1.00 0.00 ? 8   ASN A HD22 8  
ATOM 10720 N N    . GLU A 1 9   ? 20.588  7.694   -7.536  1.00 0.00 ? 9   GLU A N    8  
ATOM 10721 C CA   . GLU A 1 9   ? 20.145  7.092   -6.284  1.00 0.00 ? 9   GLU A CA   8  
ATOM 10722 C C    . GLU A 1 9   ? 19.994  8.150   -5.195  1.00 0.00 ? 9   GLU A C    8  
ATOM 10723 O O    . GLU A 1 9   ? 20.650  9.191   -5.230  1.00 0.00 ? 9   GLU A O    8  
ATOM 10724 C CB   . GLU A 1 9   ? 21.134  6.016   -5.832  1.00 0.00 ? 9   GLU A CB   8  
ATOM 10725 C CG   . GLU A 1 9   ? 22.477  6.571   -5.389  1.00 0.00 ? 9   GLU A CG   8  
ATOM 10726 C CD   . GLU A 1 9   ? 23.392  6.885   -6.558  1.00 0.00 ? 9   GLU A CD   8  
ATOM 10727 O OE1  . GLU A 1 9   ? 23.497  6.040   -7.472  1.00 0.00 ? 9   GLU A OE1  8  
ATOM 10728 O OE2  . GLU A 1 9   ? 24.003  7.973   -6.558  1.00 0.00 ? 9   GLU A OE2  8  
ATOM 10729 H H    . GLU A 1 9   ? 21.363  7.317   -8.000  1.00 0.00 ? 9   GLU A H    8  
ATOM 10730 H HA   . GLU A 1 9   ? 19.183  6.634   -6.458  1.00 0.00 ? 9   GLU A HA   8  
ATOM 10731 H HB2  . GLU A 1 9   ? 20.702  5.472   -5.005  1.00 0.00 ? 9   GLU A HB2  8  
ATOM 10732 H HB3  . GLU A 1 9   ? 21.303  5.333   -6.651  1.00 0.00 ? 9   GLU A HB3  8  
ATOM 10733 H HG2  . GLU A 1 9   ? 22.311  7.480   -4.830  1.00 0.00 ? 9   GLU A HG2  8  
ATOM 10734 H HG3  . GLU A 1 9   ? 22.963  5.843   -4.756  1.00 0.00 ? 9   GLU A HG3  8  
ATOM 10735 N N    . VAL A 1 10  ? 19.124  7.876   -4.228  1.00 0.00 ? 10  VAL A N    8  
ATOM 10736 C CA   . VAL A 1 10  ? 18.887  8.803   -3.127  1.00 0.00 ? 10  VAL A CA   8  
ATOM 10737 C C    . VAL A 1 10  ? 20.108  8.904   -2.221  1.00 0.00 ? 10  VAL A C    8  
ATOM 10738 O O    . VAL A 1 10  ? 20.343  9.935   -1.590  1.00 0.00 ? 10  VAL A O    8  
ATOM 10739 C CB   . VAL A 1 10  ? 17.670  8.375   -2.286  1.00 0.00 ? 10  VAL A CB   8  
ATOM 10740 C CG1  . VAL A 1 10  ? 17.866  6.968   -1.741  1.00 0.00 ? 10  VAL A CG1  8  
ATOM 10741 C CG2  . VAL A 1 10  ? 17.430  9.365   -1.156  1.00 0.00 ? 10  VAL A CG2  8  
ATOM 10742 H H    . VAL A 1 10  ? 18.631  7.030   -4.254  1.00 0.00 ? 10  VAL A H    8  
ATOM 10743 H HA   . VAL A 1 10  ? 18.682  9.776   -3.549  1.00 0.00 ? 10  VAL A HA   8  
ATOM 10744 H HB   . VAL A 1 10  ? 16.799  8.371   -2.924  1.00 0.00 ? 10  VAL A HB   8  
ATOM 10745 H HG11 . VAL A 1 10  ? 18.648  6.473   -2.297  1.00 0.00 ? 10  VAL A HG11 8  
ATOM 10746 H HG12 . VAL A 1 10  ? 18.142  7.021   -0.698  1.00 0.00 ? 10  VAL A HG12 8  
ATOM 10747 H HG13 . VAL A 1 10  ? 16.945  6.412   -1.842  1.00 0.00 ? 10  VAL A HG13 8  
ATOM 10748 H HG21 . VAL A 1 10  ? 16.371  9.424   -0.949  1.00 0.00 ? 10  VAL A HG21 8  
ATOM 10749 H HG22 . VAL A 1 10  ? 17.952  9.034   -0.270  1.00 0.00 ? 10  VAL A HG22 8  
ATOM 10750 H HG23 . VAL A 1 10  ? 17.795  10.339  -1.446  1.00 0.00 ? 10  VAL A HG23 8  
ATOM 10751 N N    . ASP A 1 11  ? 20.883  7.827   -2.160  1.00 0.00 ? 11  ASP A N    8  
ATOM 10752 C CA   . ASP A 1 11  ? 22.083  7.794   -1.331  1.00 0.00 ? 11  ASP A CA   8  
ATOM 10753 C C    . ASP A 1 11  ? 22.974  6.615   -1.711  1.00 0.00 ? 11  ASP A C    8  
ATOM 10754 O O    . ASP A 1 11  ? 22.626  5.817   -2.581  1.00 0.00 ? 11  ASP A O    8  
ATOM 10755 C CB   . ASP A 1 11  ? 21.704  7.707   0.148   1.00 0.00 ? 11  ASP A CB   8  
ATOM 10756 C CG   . ASP A 1 11  ? 22.755  8.323   1.052   1.00 0.00 ? 11  ASP A CG   8  
ATOM 10757 O OD1  . ASP A 1 11  ? 22.678  9.543   1.305   1.00 0.00 ? 11  ASP A OD1  8  
ATOM 10758 O OD2  . ASP A 1 11  ? 23.654  7.584   1.505   1.00 0.00 ? 11  ASP A OD2  8  
ATOM 10759 H H    . ASP A 1 11  ? 20.644  7.035   -2.686  1.00 0.00 ? 11  ASP A H    8  
ATOM 10760 H HA   . ASP A 1 11  ? 22.628  8.710   -1.500  1.00 0.00 ? 11  ASP A HA   8  
ATOM 10761 H HB2  . ASP A 1 11  ? 20.771  8.229   0.305   1.00 0.00 ? 11  ASP A HB2  8  
ATOM 10762 H HB3  . ASP A 1 11  ? 21.583  6.670   0.422   1.00 0.00 ? 11  ASP A HB3  8  
ATOM 10763 N N    . ASP A 1 12  ? 24.124  6.514   -1.054  1.00 0.00 ? 12  ASP A N    8  
ATOM 10764 C CA   . ASP A 1 12  ? 25.065  5.433   -1.322  1.00 0.00 ? 12  ASP A CA   8  
ATOM 10765 C C    . ASP A 1 12  ? 25.215  4.528   -0.104  1.00 0.00 ? 12  ASP A C    8  
ATOM 10766 O O    . ASP A 1 12  ? 26.323  4.126   0.251   1.00 0.00 ? 12  ASP A O    8  
ATOM 10767 C CB   . ASP A 1 12  ? 26.427  6.002   -1.721  1.00 0.00 ? 12  ASP A CB   8  
ATOM 10768 C CG   . ASP A 1 12  ? 26.505  6.336   -3.198  1.00 0.00 ? 12  ASP A CG   8  
ATOM 10769 O OD1  . ASP A 1 12  ? 25.830  7.295   -3.626  1.00 0.00 ? 12  ASP A OD1  8  
ATOM 10770 O OD2  . ASP A 1 12  ? 27.243  5.638   -3.926  1.00 0.00 ? 12  ASP A OD2  8  
ATOM 10771 H H    . ASP A 1 12  ? 24.345  7.182   -0.371  1.00 0.00 ? 12  ASP A H    8  
ATOM 10772 H HA   . ASP A 1 12  ? 24.675  4.849   -2.143  1.00 0.00 ? 12  ASP A HA   8  
ATOM 10773 H HB2  . ASP A 1 12  ? 26.613  6.904   -1.157  1.00 0.00 ? 12  ASP A HB2  8  
ATOM 10774 H HB3  . ASP A 1 12  ? 27.194  5.276   -1.494  1.00 0.00 ? 12  ASP A HB3  8  
ATOM 10775 N N    . MET A 1 13  ? 24.092  4.212   0.534   1.00 0.00 ? 13  MET A N    8  
ATOM 10776 C CA   . MET A 1 13  ? 24.100  3.354   1.713   1.00 0.00 ? 13  MET A CA   8  
ATOM 10777 C C    . MET A 1 13  ? 23.279  2.091   1.471   1.00 0.00 ? 13  MET A C    8  
ATOM 10778 O O    . MET A 1 13  ? 22.134  2.159   1.025   1.00 0.00 ? 13  MET A O    8  
ATOM 10779 C CB   . MET A 1 13  ? 23.549  4.110   2.924   1.00 0.00 ? 13  MET A CB   8  
ATOM 10780 C CG   . MET A 1 13  ? 23.780  3.393   4.244   1.00 0.00 ? 13  MET A CG   8  
ATOM 10781 S SD   . MET A 1 13  ? 22.659  3.951   5.542   1.00 0.00 ? 13  MET A SD   8  
ATOM 10782 C CE   . MET A 1 13  ? 22.272  2.398   6.346   1.00 0.00 ? 13  MET A CE   8  
ATOM 10783 H H    . MET A 1 13  ? 23.239  4.563   0.204   1.00 0.00 ? 13  MET A H    8  
ATOM 10784 H HA   . MET A 1 13  ? 25.123  3.072   1.911   1.00 0.00 ? 13  MET A HA   8  
ATOM 10785 H HB2  . MET A 1 13  ? 24.025  5.078   2.976   1.00 0.00 ? 13  MET A HB2  8  
ATOM 10786 H HB3  . MET A 1 13  ? 22.485  4.247   2.795   1.00 0.00 ? 13  MET A HB3  8  
ATOM 10787 H HG2  . MET A 1 13  ? 23.634  2.334   4.095   1.00 0.00 ? 13  MET A HG2  8  
ATOM 10788 H HG3  . MET A 1 13  ? 24.796  3.574   4.562   1.00 0.00 ? 13  MET A HG3  8  
ATOM 10789 H HE1  . MET A 1 13  ? 21.369  1.987   5.920   1.00 0.00 ? 13  MET A HE1  8  
ATOM 10790 H HE2  . MET A 1 13  ? 23.087  1.704   6.199   1.00 0.00 ? 13  MET A HE2  8  
ATOM 10791 H HE3  . MET A 1 13  ? 22.127  2.566   7.403   1.00 0.00 ? 13  MET A HE3  8  
ATOM 10792 N N    . ASP A 1 14  ? 23.872  0.940   1.768   1.00 0.00 ? 14  ASP A N    8  
ATOM 10793 C CA   . ASP A 1 14  ? 23.196  -0.339  1.584   1.00 0.00 ? 14  ASP A CA   8  
ATOM 10794 C C    . ASP A 1 14  ? 21.986  -0.452  2.507   1.00 0.00 ? 14  ASP A C    8  
ATOM 10795 O O    . ASP A 1 14  ? 22.109  -0.333  3.727   1.00 0.00 ? 14  ASP A O    8  
ATOM 10796 C CB   . ASP A 1 14  ? 24.163  -1.495  1.846   1.00 0.00 ? 14  ASP A CB   8  
ATOM 10797 C CG   . ASP A 1 14  ? 25.449  -1.363  1.055   1.00 0.00 ? 14  ASP A CG   8  
ATOM 10798 O OD1  . ASP A 1 14  ? 26.328  -0.584  1.477   1.00 0.00 ? 14  ASP A OD1  8  
ATOM 10799 O OD2  . ASP A 1 14  ? 25.577  -2.040  0.012   1.00 0.00 ? 14  ASP A OD2  8  
ATOM 10800 H H    . ASP A 1 14  ? 24.787  0.950   2.121   1.00 0.00 ? 14  ASP A H    8  
ATOM 10801 H HA   . ASP A 1 14  ? 22.857  -0.390  0.560   1.00 0.00 ? 14  ASP A HA   8  
ATOM 10802 H HB2  . ASP A 1 14  ? 24.410  -1.517  2.898   1.00 0.00 ? 14  ASP A HB2  8  
ATOM 10803 H HB3  . ASP A 1 14  ? 23.686  -2.424  1.572   1.00 0.00 ? 14  ASP A HB3  8  
ATOM 10804 N N    . THR A 1 15  ? 20.817  -0.682  1.918   1.00 0.00 ? 15  THR A N    8  
ATOM 10805 C CA   . THR A 1 15  ? 19.586  -0.809  2.686   1.00 0.00 ? 15  THR A CA   8  
ATOM 10806 C C    . THR A 1 15  ? 18.755  -1.993  2.203   1.00 0.00 ? 15  THR A C    8  
ATOM 10807 O O    . THR A 1 15  ? 18.794  -2.351  1.026   1.00 0.00 ? 15  THR A O    8  
ATOM 10808 C CB   . THR A 1 15  ? 18.734  0.471   2.597   1.00 0.00 ? 15  THR A CB   8  
ATOM 10809 O OG1  . THR A 1 15  ? 18.570  0.857   1.228   1.00 0.00 ? 15  THR A OG1  8  
ATOM 10810 C CG2  . THR A 1 15  ? 19.381  1.607   3.375   1.00 0.00 ? 15  THR A CG2  8  
ATOM 10811 H H    . THR A 1 15  ? 20.784  -0.768  0.942   1.00 0.00 ? 15  THR A H    8  
ATOM 10812 H HA   . THR A 1 15  ? 19.853  -0.968  3.721   1.00 0.00 ? 15  THR A HA   8  
ATOM 10813 H HB   . THR A 1 15  ? 17.762  0.269   3.025   1.00 0.00 ? 15  THR A HB   8  
ATOM 10814 H HG1  . THR A 1 15  ? 19.429  0.889   0.800   1.00 0.00 ? 15  THR A HG1  8  
ATOM 10815 H HG21 . THR A 1 15  ? 18.857  2.528   3.170   1.00 0.00 ? 15  THR A HG21 8  
ATOM 10816 H HG22 . THR A 1 15  ? 20.414  1.705   3.076   1.00 0.00 ? 15  THR A HG22 8  
ATOM 10817 H HG23 . THR A 1 15  ? 19.331  1.392   4.432   1.00 0.00 ? 15  THR A HG23 8  
ATOM 10818 N N    . SER A 1 16  ? 18.004  -2.596  3.118   1.00 0.00 ? 16  SER A N    8  
ATOM 10819 C CA   . SER A 1 16  ? 17.166  -3.742  2.785   1.00 0.00 ? 16  SER A CA   8  
ATOM 10820 C C    . SER A 1 16  ? 15.722  -3.503  3.215   1.00 0.00 ? 16  SER A C    8  
ATOM 10821 O O    . SER A 1 16  ? 15.073  -4.389  3.770   1.00 0.00 ? 16  SER A O    8  
ATOM 10822 C CB   . SER A 1 16  ? 17.706  -5.007  3.455   1.00 0.00 ? 16  SER A CB   8  
ATOM 10823 O OG   . SER A 1 16  ? 16.974  -6.151  3.051   1.00 0.00 ? 16  SER A OG   8  
ATOM 10824 H H    . SER A 1 16  ? 18.016  -2.264  4.040   1.00 0.00 ? 16  SER A H    8  
ATOM 10825 H HA   . SER A 1 16  ? 17.194  -3.873  1.714   1.00 0.00 ? 16  SER A HA   8  
ATOM 10826 H HB2  . SER A 1 16  ? 18.742  -5.143  3.182   1.00 0.00 ? 16  SER A HB2  8  
ATOM 10827 H HB3  . SER A 1 16  ? 17.628  -4.905  4.528   1.00 0.00 ? 16  SER A HB3  8  
ATOM 10828 H HG   . SER A 1 16  ? 17.297  -6.454  2.199   1.00 0.00 ? 16  SER A HG   8  
ATOM 10829 N N    . ASP A 1 17  ? 15.226  -2.298  2.954   1.00 0.00 ? 17  ASP A N    8  
ATOM 10830 C CA   . ASP A 1 17  ? 13.859  -1.940  3.313   1.00 0.00 ? 17  ASP A CA   8  
ATOM 10831 C C    . ASP A 1 17  ? 13.008  -1.729  2.064   1.00 0.00 ? 17  ASP A C    8  
ATOM 10832 O O    . ASP A 1 17  ? 12.977  -0.636  1.498   1.00 0.00 ? 17  ASP A O    8  
ATOM 10833 C CB   . ASP A 1 17  ? 13.848  -0.675  4.172   1.00 0.00 ? 17  ASP A CB   8  
ATOM 10834 C CG   . ASP A 1 17  ? 14.882  0.339   3.723   1.00 0.00 ? 17  ASP A CG   8  
ATOM 10835 O OD1  . ASP A 1 17  ? 15.202  0.364   2.516   1.00 0.00 ? 17  ASP A OD1  8  
ATOM 10836 O OD2  . ASP A 1 17  ? 15.371  1.107   4.578   1.00 0.00 ? 17  ASP A OD2  8  
ATOM 10837 H H    . ASP A 1 17  ? 15.794  -1.634  2.509   1.00 0.00 ? 17  ASP A H    8  
ATOM 10838 H HA   . ASP A 1 17  ? 13.441  -2.756  3.883   1.00 0.00 ? 17  ASP A HA   8  
ATOM 10839 H HB2  . ASP A 1 17  ? 12.872  -0.216  4.114   1.00 0.00 ? 17  ASP A HB2  8  
ATOM 10840 H HB3  . ASP A 1 17  ? 14.055  -0.943  5.198   1.00 0.00 ? 17  ASP A HB3  8  
ATOM 10841 N N    . THR A 1 18  ? 12.318  -2.783  1.639   1.00 0.00 ? 18  THR A N    8  
ATOM 10842 C CA   . THR A 1 18  ? 11.468  -2.713  0.457   1.00 0.00 ? 18  THR A CA   8  
ATOM 10843 C C    . THR A 1 18  ? 10.015  -2.459  0.838   1.00 0.00 ? 18  THR A C    8  
ATOM 10844 O O    . THR A 1 18  ? 9.306   -3.372  1.261   1.00 0.00 ? 18  THR A O    8  
ATOM 10845 C CB   . THR A 1 18  ? 11.550  -4.010  -0.371  1.00 0.00 ? 18  THR A CB   8  
ATOM 10846 O OG1  . THR A 1 18  ? 12.920  -4.345  -0.622  1.00 0.00 ? 18  THR A OG1  8  
ATOM 10847 C CG2  . THR A 1 18  ? 10.810  -3.857  -1.691  1.00 0.00 ? 18  THR A CG2  8  
ATOM 10848 H H    . THR A 1 18  ? 12.383  -3.626  2.133   1.00 0.00 ? 18  THR A H    8  
ATOM 10849 H HA   . THR A 1 18  ? 11.818  -1.896  -0.158  1.00 0.00 ? 18  THR A HA   8  
ATOM 10850 H HB   . THR A 1 18  ? 11.090  -4.809  0.193   1.00 0.00 ? 18  THR A HB   8  
ATOM 10851 H HG1  . THR A 1 18  ? 13.283  -3.742  -1.275  1.00 0.00 ? 18  THR A HG1  8  
ATOM 10852 H HG21 . THR A 1 18  ? 11.519  -3.879  -2.506  1.00 0.00 ? 18  THR A HG21 8  
ATOM 10853 H HG22 . THR A 1 18  ? 10.280  -2.917  -1.700  1.00 0.00 ? 18  THR A HG22 8  
ATOM 10854 H HG23 . THR A 1 18  ? 10.107  -4.668  -1.804  1.00 0.00 ? 18  THR A HG23 8  
ATOM 10855 N N    . GLN A 1 19  ? 9.577   -1.213  0.686   1.00 0.00 ? 19  GLN A N    8  
ATOM 10856 C CA   . GLN A 1 19  ? 8.207   -0.839  1.016   1.00 0.00 ? 19  GLN A CA   8  
ATOM 10857 C C    . GLN A 1 19  ? 7.274   -1.097  -0.163  1.00 0.00 ? 19  GLN A C    8  
ATOM 10858 O O    . GLN A 1 19  ? 7.506   -0.607  -1.268  1.00 0.00 ? 19  GLN A O    8  
ATOM 10859 C CB   . GLN A 1 19  ? 8.141   0.634   1.422   1.00 0.00 ? 19  GLN A CB   8  
ATOM 10860 C CG   . GLN A 1 19  ? 8.901   0.947   2.700   1.00 0.00 ? 19  GLN A CG   8  
ATOM 10861 C CD   . GLN A 1 19  ? 9.379   2.385   2.757   1.00 0.00 ? 19  GLN A CD   8  
ATOM 10862 O OE1  . GLN A 1 19  ? 8.582   3.320   2.671   1.00 0.00 ? 19  GLN A OE1  8  
ATOM 10863 N NE2  . GLN A 1 19  ? 10.686  2.570   2.904   1.00 0.00 ? 19  GLN A NE2  8  
ATOM 10864 H H    . GLN A 1 19  ? 10.190  -0.529  0.346   1.00 0.00 ? 19  GLN A H    8  
ATOM 10865 H HA   . GLN A 1 19  ? 7.889   -1.447  1.849   1.00 0.00 ? 19  GLN A HA   8  
ATOM 10866 H HB2  . GLN A 1 19  ? 8.556   1.233   0.625   1.00 0.00 ? 19  GLN A HB2  8  
ATOM 10867 H HB3  . GLN A 1 19  ? 7.107   0.909   1.567   1.00 0.00 ? 19  GLN A HB3  8  
ATOM 10868 H HG2  . GLN A 1 19  ? 8.252   0.767   3.544   1.00 0.00 ? 19  GLN A HG2  8  
ATOM 10869 H HG3  . GLN A 1 19  ? 9.760   0.295   2.762   1.00 0.00 ? 19  GLN A HG3  8  
ATOM 10870 H HE21 . GLN A 1 19  ? 11.260  1.778   2.965   1.00 0.00 ? 19  GLN A HE21 8  
ATOM 10871 H HE22 . GLN A 1 19  ? 11.022  3.488   2.943   1.00 0.00 ? 19  GLN A HE22 8  
ATOM 10872 N N    . TRP A 1 20  ? 6.221   -1.868  0.080   1.00 0.00 ? 20  TRP A N    8  
ATOM 10873 C CA   . TRP A 1 20  ? 5.253   -2.190  -0.963  1.00 0.00 ? 20  TRP A CA   8  
ATOM 10874 C C    . TRP A 1 20  ? 4.080   -1.216  -0.937  1.00 0.00 ? 20  TRP A C    8  
ATOM 10875 O O    . TRP A 1 20  ? 3.325   -1.164  0.033   1.00 0.00 ? 20  TRP A O    8  
ATOM 10876 C CB   . TRP A 1 20  ? 4.746   -3.623  -0.791  1.00 0.00 ? 20  TRP A CB   8  
ATOM 10877 C CG   . TRP A 1 20  ? 5.811   -4.658  -0.992  1.00 0.00 ? 20  TRP A CG   8  
ATOM 10878 C CD1  . TRP A 1 20  ? 6.679   -5.135  -0.052  1.00 0.00 ? 20  TRP A CD1  8  
ATOM 10879 C CD2  . TRP A 1 20  ? 6.121   -5.343  -2.211  1.00 0.00 ? 20  TRP A CD2  8  
ATOM 10880 N NE1  . TRP A 1 20  ? 7.510   -6.074  -0.612  1.00 0.00 ? 20  TRP A NE1  8  
ATOM 10881 C CE2  . TRP A 1 20  ? 7.187   -6.221  -1.936  1.00 0.00 ? 20  TRP A CE2  8  
ATOM 10882 C CE3  . TRP A 1 20  ? 5.600   -5.301  -3.507  1.00 0.00 ? 20  TRP A CE3  8  
ATOM 10883 C CZ2  . TRP A 1 20  ? 7.741   -7.047  -2.910  1.00 0.00 ? 20  TRP A CZ2  8  
ATOM 10884 C CZ3  . TRP A 1 20  ? 6.151   -6.121  -4.473  1.00 0.00 ? 20  TRP A CZ3  8  
ATOM 10885 C CH2  . TRP A 1 20  ? 7.212   -6.985  -4.170  1.00 0.00 ? 20  TRP A CH2  8  
ATOM 10886 H H    . TRP A 1 20  ? 6.090   -2.229  0.982   1.00 0.00 ? 20  TRP A H    8  
ATOM 10887 H HA   . TRP A 1 20  ? 5.754   -2.107  -1.916  1.00 0.00 ? 20  TRP A HA   8  
ATOM 10888 H HB2  . TRP A 1 20  ? 4.350   -3.741  0.207   1.00 0.00 ? 20  TRP A HB2  8  
ATOM 10889 H HB3  . TRP A 1 20  ? 3.960   -3.807  -1.509  1.00 0.00 ? 20  TRP A HB3  8  
ATOM 10890 H HD1  . TRP A 1 20  ? 6.698   -4.810  0.977   1.00 0.00 ? 20  TRP A HD1  8  
ATOM 10891 H HE1  . TRP A 1 20  ? 8.218   -6.562  -0.140  1.00 0.00 ? 20  TRP A HE1  8  
ATOM 10892 H HE3  . TRP A 1 20  ? 4.783   -4.642  -3.760  1.00 0.00 ? 20  TRP A HE3  8  
ATOM 10893 H HZ2  . TRP A 1 20  ? 8.559   -7.718  -2.692  1.00 0.00 ? 20  TRP A HZ2  8  
ATOM 10894 H HZ3  . TRP A 1 20  ? 5.762   -6.102  -5.480  1.00 0.00 ? 20  TRP A HZ3  8  
ATOM 10895 H HH2  . TRP A 1 20  ? 7.612   -7.608  -4.956  1.00 0.00 ? 20  TRP A HH2  8  
ATOM 10896 N N    . GLY A 1 21  ? 3.933   -0.445  -2.010  1.00 0.00 ? 21  GLY A N    8  
ATOM 10897 C CA   . GLY A 1 21  ? 2.849   0.517   -2.089  1.00 0.00 ? 21  GLY A CA   8  
ATOM 10898 C C    . GLY A 1 21  ? 1.742   0.068   -3.022  1.00 0.00 ? 21  GLY A C    8  
ATOM 10899 O O    . GLY A 1 21  ? 1.947   -0.808  -3.862  1.00 0.00 ? 21  GLY A O    8  
ATOM 10900 H H    . GLY A 1 21  ? 4.565   -0.530  -2.754  1.00 0.00 ? 21  GLY A H    8  
ATOM 10901 H HA2  . GLY A 1 21  ? 2.437   0.661   -1.102  1.00 0.00 ? 21  GLY A HA2  8  
ATOM 10902 H HA3  . GLY A 1 21  ? 3.244   1.458   -2.445  1.00 0.00 ? 21  GLY A HA3  8  
ATOM 10903 N N    . TRP A 1 22  ? 0.567   0.667   -2.874  1.00 0.00 ? 22  TRP A N    8  
ATOM 10904 C CA   . TRP A 1 22  ? -0.578  0.322   -3.710  1.00 0.00 ? 22  TRP A CA   8  
ATOM 10905 C C    . TRP A 1 22  ? -0.909  1.455   -4.675  1.00 0.00 ? 22  TRP A C    8  
ATOM 10906 O O    . TRP A 1 22  ? -0.725  2.630   -4.355  1.00 0.00 ? 22  TRP A O    8  
ATOM 10907 C CB   . TRP A 1 22  ? -1.795  0.006   -2.838  1.00 0.00 ? 22  TRP A CB   8  
ATOM 10908 C CG   . TRP A 1 22  ? -1.910  -1.445  -2.482  1.00 0.00 ? 22  TRP A CG   8  
ATOM 10909 C CD1  . TRP A 1 22  ? -1.321  -2.079  -1.425  1.00 0.00 ? 22  TRP A CD1  8  
ATOM 10910 C CD2  . TRP A 1 22  ? -2.658  -2.443  -3.185  1.00 0.00 ? 22  TRP A CD2  8  
ATOM 10911 N NE1  . TRP A 1 22  ? -1.658  -3.411  -1.429  1.00 0.00 ? 22  TRP A NE1  8  
ATOM 10912 C CE2  . TRP A 1 22  ? -2.479  -3.659  -2.497  1.00 0.00 ? 22  TRP A CE2  8  
ATOM 10913 C CE3  . TRP A 1 22  ? -3.465  -2.427  -4.326  1.00 0.00 ? 22  TRP A CE3  8  
ATOM 10914 C CZ2  . TRP A 1 22  ? -3.075  -4.846  -2.916  1.00 0.00 ? 22  TRP A CZ2  8  
ATOM 10915 C CZ3  . TRP A 1 22  ? -4.055  -3.606  -4.740  1.00 0.00 ? 22  TRP A CZ3  8  
ATOM 10916 C CH2  . TRP A 1 22  ? -3.859  -4.801  -4.036  1.00 0.00 ? 22  TRP A CH2  8  
ATOM 10917 H H    . TRP A 1 22  ? 0.465   1.359   -2.186  1.00 0.00 ? 22  TRP A H    8  
ATOM 10918 H HA   . TRP A 1 22  ? -0.317  -0.557  -4.280  1.00 0.00 ? 22  TRP A HA   8  
ATOM 10919 H HB2  . TRP A 1 22  ? -1.729  0.571   -1.920  1.00 0.00 ? 22  TRP A HB2  8  
ATOM 10920 H HB3  . TRP A 1 22  ? -2.692  0.292   -3.369  1.00 0.00 ? 22  TRP A HB3  8  
ATOM 10921 H HD1  . TRP A 1 22  ? -0.684  -1.592  -0.703  1.00 0.00 ? 22  TRP A HD1  8  
ATOM 10922 H HE1  . TRP A 1 22  ? -1.361  -4.074  -0.771  1.00 0.00 ? 22  TRP A HE1  8  
ATOM 10923 H HE3  . TRP A 1 22  ? -3.628  -1.516  -4.882  1.00 0.00 ? 22  TRP A HE3  8  
ATOM 10924 H HZ2  . TRP A 1 22  ? -2.934  -5.775  -2.383  1.00 0.00 ? 22  TRP A HZ2  8  
ATOM 10925 H HZ3  . TRP A 1 22  ? -4.682  -3.613  -5.620  1.00 0.00 ? 22  TRP A HZ3  8  
ATOM 10926 H HH2  . TRP A 1 22  ? -4.340  -5.698  -4.396  1.00 0.00 ? 22  TRP A HH2  8  
ATOM 10927 N N    . PHE A 1 23  ? -1.397  1.095   -5.857  1.00 0.00 ? 23  PHE A N    8  
ATOM 10928 C CA   . PHE A 1 23  ? -1.753  2.083   -6.870  1.00 0.00 ? 23  PHE A CA   8  
ATOM 10929 C C    . PHE A 1 23  ? -3.134  1.793   -7.451  1.00 0.00 ? 23  PHE A C    8  
ATOM 10930 O O    . PHE A 1 23  ? -3.552  0.638   -7.539  1.00 0.00 ? 23  PHE A O    8  
ATOM 10931 C CB   . PHE A 1 23  ? -0.709  2.097   -7.988  1.00 0.00 ? 23  PHE A CB   8  
ATOM 10932 C CG   . PHE A 1 23  ? 0.694   2.311   -7.496  1.00 0.00 ? 23  PHE A CG   8  
ATOM 10933 C CD1  . PHE A 1 23  ? 1.387   1.287   -6.871  1.00 0.00 ? 23  PHE A CD1  8  
ATOM 10934 C CD2  . PHE A 1 23  ? 1.319   3.537   -7.658  1.00 0.00 ? 23  PHE A CD2  8  
ATOM 10935 C CE1  . PHE A 1 23  ? 2.678   1.482   -6.417  1.00 0.00 ? 23  PHE A CE1  8  
ATOM 10936 C CE2  . PHE A 1 23  ? 2.610   3.738   -7.206  1.00 0.00 ? 23  PHE A CE2  8  
ATOM 10937 C CZ   . PHE A 1 23  ? 3.290   2.709   -6.586  1.00 0.00 ? 23  PHE A CZ   8  
ATOM 10938 H H    . PHE A 1 23  ? -1.521  0.143   -6.054  1.00 0.00 ? 23  PHE A H    8  
ATOM 10939 H HA   . PHE A 1 23  ? -1.772  3.051   -6.395  1.00 0.00 ? 23  PHE A HA   8  
ATOM 10940 H HB2  . PHE A 1 23  ? -0.736  1.151   -8.508  1.00 0.00 ? 23  PHE A HB2  8  
ATOM 10941 H HB3  . PHE A 1 23  ? -0.944  2.890   -8.681  1.00 0.00 ? 23  PHE A HB3  8  
ATOM 10942 H HD1  . PHE A 1 23  ? 0.910   0.327   -6.739  1.00 0.00 ? 23  PHE A HD1  8  
ATOM 10943 H HD2  . PHE A 1 23  ? 0.788   4.343   -8.145  1.00 0.00 ? 23  PHE A HD2  8  
ATOM 10944 H HE1  . PHE A 1 23  ? 3.208   0.676   -5.932  1.00 0.00 ? 23  PHE A HE1  8  
ATOM 10945 H HE2  . PHE A 1 23  ? 3.085   4.698   -7.340  1.00 0.00 ? 23  PHE A HE2  8  
ATOM 10946 H HZ   . PHE A 1 23  ? 4.298   2.864   -6.231  1.00 0.00 ? 23  PHE A HZ   8  
ATOM 10947 N N    . TYR A 1 24  ? -3.836  2.848   -7.846  1.00 0.00 ? 24  TYR A N    8  
ATOM 10948 C CA   . TYR A 1 24  ? -5.171  2.709   -8.416  1.00 0.00 ? 24  TYR A CA   8  
ATOM 10949 C C    . TYR A 1 24  ? -5.287  3.482   -9.727  1.00 0.00 ? 24  TYR A C    8  
ATOM 10950 O O    . TYR A 1 24  ? -4.971  4.671   -9.790  1.00 0.00 ? 24  TYR A O    8  
ATOM 10951 C CB   . TYR A 1 24  ? -6.226  3.201   -7.425  1.00 0.00 ? 24  TYR A CB   8  
ATOM 10952 C CG   . TYR A 1 24  ? -6.281  4.707   -7.298  1.00 0.00 ? 24  TYR A CG   8  
ATOM 10953 C CD1  . TYR A 1 24  ? -7.010  5.474   -8.199  1.00 0.00 ? 24  TYR A CD1  8  
ATOM 10954 C CD2  . TYR A 1 24  ? -5.605  5.362   -6.276  1.00 0.00 ? 24  TYR A CD2  8  
ATOM 10955 C CE1  . TYR A 1 24  ? -7.062  6.850   -8.086  1.00 0.00 ? 24  TYR A CE1  8  
ATOM 10956 C CE2  . TYR A 1 24  ? -5.653  6.738   -6.155  1.00 0.00 ? 24  TYR A CE2  8  
ATOM 10957 C CZ   . TYR A 1 24  ? -6.382  7.477   -7.063  1.00 0.00 ? 24  TYR A CZ   8  
ATOM 10958 O OH   . TYR A 1 24  ? -6.433  8.847   -6.947  1.00 0.00 ? 24  TYR A OH   8  
ATOM 10959 H H    . TYR A 1 24  ? -3.449  3.744   -7.751  1.00 0.00 ? 24  TYR A H    8  
ATOM 10960 H HA   . TYR A 1 24  ? -5.339  1.660   -8.614  1.00 0.00 ? 24  TYR A HA   8  
ATOM 10961 H HB2  . TYR A 1 24  ? -7.198  2.861   -7.746  1.00 0.00 ? 24  TYR A HB2  8  
ATOM 10962 H HB3  . TYR A 1 24  ? -6.011  2.793   -6.448  1.00 0.00 ? 24  TYR A HB3  8  
ATOM 10963 H HD1  . TYR A 1 24  ? -7.541  4.979   -8.999  1.00 0.00 ? 24  TYR A HD1  8  
ATOM 10964 H HD2  . TYR A 1 24  ? -5.035  4.781   -5.566  1.00 0.00 ? 24  TYR A HD2  8  
ATOM 10965 H HE1  . TYR A 1 24  ? -7.633  7.429   -8.797  1.00 0.00 ? 24  TYR A HE1  8  
ATOM 10966 H HE2  . TYR A 1 24  ? -5.121  7.230   -5.354  1.00 0.00 ? 24  TYR A HE2  8  
ATOM 10967 H HH   . TYR A 1 24  ? -7.344  9.124   -6.824  1.00 0.00 ? 24  TYR A HH   8  
ATOM 10968 N N    . LEU A 1 25  ? -5.744  2.799   -10.770 1.00 0.00 ? 25  LEU A N    8  
ATOM 10969 C CA   . LEU A 1 25  ? -5.904  3.420   -12.080 1.00 0.00 ? 25  LEU A CA   8  
ATOM 10970 C C    . LEU A 1 25  ? -6.928  4.549   -12.026 1.00 0.00 ? 25  LEU A C    8  
ATOM 10971 O O    . LEU A 1 25  ? -7.817  4.553   -11.176 1.00 0.00 ? 25  LEU A O    8  
ATOM 10972 C CB   . LEU A 1 25  ? -6.333  2.375   -13.113 1.00 0.00 ? 25  LEU A CB   8  
ATOM 10973 C CG   . LEU A 1 25  ? -6.540  2.887   -14.539 1.00 0.00 ? 25  LEU A CG   8  
ATOM 10974 C CD1  . LEU A 1 25  ? -5.212  3.290   -15.159 1.00 0.00 ? 25  LEU A CD1  8  
ATOM 10975 C CD2  . LEU A 1 25  ? -7.230  1.830   -15.389 1.00 0.00 ? 25  LEU A CD2  8  
ATOM 10976 H H    . LEU A 1 25  ? -5.980  1.854   -10.658 1.00 0.00 ? 25  LEU A H    8  
ATOM 10977 H HA   . LEU A 1 25  ? -4.949  3.830   -12.371 1.00 0.00 ? 25  LEU A HA   8  
ATOM 10978 H HB2  . LEU A 1 25  ? -5.574  1.609   -13.143 1.00 0.00 ? 25  LEU A HB2  8  
ATOM 10979 H HB3  . LEU A 1 25  ? -7.265  1.943   -12.777 1.00 0.00 ? 25  LEU A HB3  8  
ATOM 10980 H HG   . LEU A 1 25  ? -7.174  3.762   -14.512 1.00 0.00 ? 25  LEU A HG   8  
ATOM 10981 H HD11 . LEU A 1 25  ? -4.841  4.179   -14.672 1.00 0.00 ? 25  LEU A HD11 8  
ATOM 10982 H HD12 . LEU A 1 25  ? -5.351  3.488   -16.212 1.00 0.00 ? 25  LEU A HD12 8  
ATOM 10983 H HD13 . LEU A 1 25  ? -4.499  2.487   -15.036 1.00 0.00 ? 25  LEU A HD13 8  
ATOM 10984 H HD21 . LEU A 1 25  ? -7.087  0.858   -14.941 1.00 0.00 ? 25  LEU A HD21 8  
ATOM 10985 H HD22 . LEU A 1 25  ? -6.805  1.834   -16.383 1.00 0.00 ? 25  LEU A HD22 8  
ATOM 10986 H HD23 . LEU A 1 25  ? -8.286  2.048   -15.448 1.00 0.00 ? 25  LEU A HD23 8  
ATOM 10987 N N    . ALA A 1 26  ? -6.798  5.503   -12.942 1.00 0.00 ? 26  ALA A N    8  
ATOM 10988 C CA   . ALA A 1 26  ? -7.715  6.635   -13.001 1.00 0.00 ? 26  ALA A CA   8  
ATOM 10989 C C    . ALA A 1 26  ? -8.522  6.621   -14.295 1.00 0.00 ? 26  ALA A C    8  
ATOM 10990 O O    . ALA A 1 26  ? -8.168  5.930   -15.250 1.00 0.00 ? 26  ALA A O    8  
ATOM 10991 C CB   . ALA A 1 26  ? -6.948  7.943   -12.870 1.00 0.00 ? 26  ALA A CB   8  
ATOM 10992 H H    . ALA A 1 26  ? -6.069  5.444   -13.594 1.00 0.00 ? 26  ALA A H    8  
ATOM 10993 H HA   . ALA A 1 26  ? -8.394  6.559   -12.164 1.00 0.00 ? 26  ALA A HA   8  
ATOM 10994 H HB1  . ALA A 1 26  ? -6.496  7.997   -11.890 1.00 0.00 ? 26  ALA A HB1  8  
ATOM 10995 H HB2  . ALA A 1 26  ? -6.177  7.985   -13.625 1.00 0.00 ? 26  ALA A HB2  8  
ATOM 10996 H HB3  . ALA A 1 26  ? -7.626  8.772   -13.000 1.00 0.00 ? 26  ALA A HB3  8  
ATOM 10997 N N    . GLU A 1 27  ? -9.607  7.388   -14.318 1.00 0.00 ? 27  GLU A N    8  
ATOM 10998 C CA   . GLU A 1 27  ? -10.465 7.461   -15.495 1.00 0.00 ? 27  GLU A CA   8  
ATOM 10999 C C    . GLU A 1 27  ? -9.650  7.792   -16.742 1.00 0.00 ? 27  GLU A C    8  
ATOM 11000 O O    . GLU A 1 27  ? -9.818  7.168   -17.791 1.00 0.00 ? 27  GLU A O    8  
ATOM 11001 C CB   . GLU A 1 27  ? -11.558 8.512   -15.293 1.00 0.00 ? 27  GLU A CB   8  
ATOM 11002 C CG   . GLU A 1 27  ? -12.365 8.800   -16.548 1.00 0.00 ? 27  GLU A CG   8  
ATOM 11003 C CD   . GLU A 1 27  ? -11.740 9.882   -17.407 1.00 0.00 ? 27  GLU A CD   8  
ATOM 11004 O OE1  . GLU A 1 27  ? -10.844 9.555   -18.213 1.00 0.00 ? 27  GLU A OE1  8  
ATOM 11005 O OE2  . GLU A 1 27  ? -12.147 11.055  -17.273 1.00 0.00 ? 27  GLU A OE2  8  
ATOM 11006 H H    . GLU A 1 27  ? -9.837  7.916   -13.526 1.00 0.00 ? 27  GLU A H    8  
ATOM 11007 H HA   . GLU A 1 27  ? -10.928 6.495   -15.629 1.00 0.00 ? 27  GLU A HA   8  
ATOM 11008 H HB2  . GLU A 1 27  ? -12.235 8.166   -14.526 1.00 0.00 ? 27  GLU A HB2  8  
ATOM 11009 H HB3  . GLU A 1 27  ? -11.099 9.433   -14.966 1.00 0.00 ? 27  GLU A HB3  8  
ATOM 11010 H HG2  . GLU A 1 27  ? -12.436 7.895   -17.131 1.00 0.00 ? 27  GLU A HG2  8  
ATOM 11011 H HG3  . GLU A 1 27  ? -13.356 9.119   -16.258 1.00 0.00 ? 27  GLU A HG3  8  
ATOM 11012 N N    . CYS A 1 28  ? -8.768  8.778   -16.621 1.00 0.00 ? 28  CYS A N    8  
ATOM 11013 C CA   . CYS A 1 28  ? -7.928  9.195   -17.738 1.00 0.00 ? 28  CYS A CA   8  
ATOM 11014 C C    . CYS A 1 28  ? -7.056  8.041   -18.222 1.00 0.00 ? 28  CYS A C    8  
ATOM 11015 O O    . CYS A 1 28  ? -6.732  7.948   -19.405 1.00 0.00 ? 28  CYS A O    8  
ATOM 11016 C CB   . CYS A 1 28  ? -7.049  10.377  -17.328 1.00 0.00 ? 28  CYS A CB   8  
ATOM 11017 S SG   . CYS A 1 28  ? -7.859  11.987  -17.479 1.00 0.00 ? 28  CYS A SG   8  
ATOM 11018 H H    . CYS A 1 28  ? -8.680  9.238   -15.759 1.00 0.00 ? 28  CYS A H    8  
ATOM 11019 H HA   . CYS A 1 28  ? -8.577  9.502   -18.543 1.00 0.00 ? 28  CYS A HA   8  
ATOM 11020 H HB2  . CYS A 1 28  ? -6.752  10.255  -16.297 1.00 0.00 ? 28  CYS A HB2  8  
ATOM 11021 H HB3  . CYS A 1 28  ? -6.166  10.392  -17.950 1.00 0.00 ? 28  CYS A HB3  8  
ATOM 11022 H HG   . CYS A 1 28  ? -6.926  12.891  -17.735 1.00 0.00 ? 28  CYS A HG   8  
ATOM 11023 N N    . GLY A 1 29  ? -6.678  7.163   -17.297 1.00 0.00 ? 29  GLY A N    8  
ATOM 11024 C CA   . GLY A 1 29  ? -5.845  6.028   -17.649 1.00 0.00 ? 29  GLY A CA   8  
ATOM 11025 C C    . GLY A 1 29  ? -4.459  6.115   -17.041 1.00 0.00 ? 29  GLY A C    8  
ATOM 11026 O O    . GLY A 1 29  ? -3.465  5.800   -17.695 1.00 0.00 ? 29  GLY A O    8  
ATOM 11027 H H    . GLY A 1 29  ? -6.966  7.288   -16.369 1.00 0.00 ? 29  GLY A H    8  
ATOM 11028 H HA2  . GLY A 1 29  ? -6.323  5.124   -17.303 1.00 0.00 ? 29  GLY A HA2  8  
ATOM 11029 H HA3  . GLY A 1 29  ? -5.751  5.985   -18.724 1.00 0.00 ? 29  GLY A HA3  8  
ATOM 11030 N N    . LYS A 1 30  ? -4.392  6.544   -15.785 1.00 0.00 ? 30  LYS A N    8  
ATOM 11031 C CA   . LYS A 1 30  ? -3.118  6.672   -15.087 1.00 0.00 ? 30  LYS A CA   8  
ATOM 11032 C C    . LYS A 1 30  ? -3.195  6.050   -13.696 1.00 0.00 ? 30  LYS A C    8  
ATOM 11033 O O    . LYS A 1 30  ? -4.185  6.219   -12.985 1.00 0.00 ? 30  LYS A O    8  
ATOM 11034 C CB   . LYS A 1 30  ? -2.719  8.145   -14.977 1.00 0.00 ? 30  LYS A CB   8  
ATOM 11035 C CG   . LYS A 1 30  ? -1.876  8.635   -16.142 1.00 0.00 ? 30  LYS A CG   8  
ATOM 11036 C CD   . LYS A 1 30  ? -0.391  8.490   -15.854 1.00 0.00 ? 30  LYS A CD   8  
ATOM 11037 C CE   . LYS A 1 30  ? 0.141   7.147   -16.331 1.00 0.00 ? 30  LYS A CE   8  
ATOM 11038 N NZ   . LYS A 1 30  ? 1.595   6.995   -16.051 1.00 0.00 ? 30  LYS A NZ   8  
ATOM 11039 H H    . LYS A 1 30  ? -5.220  6.779   -15.316 1.00 0.00 ? 30  LYS A H    8  
ATOM 11040 H HA   . LYS A 1 30  ? -2.370  6.147   -15.662 1.00 0.00 ? 30  LYS A HA   8  
ATOM 11041 H HB2  . LYS A 1 30  ? -3.616  8.746   -14.931 1.00 0.00 ? 30  LYS A HB2  8  
ATOM 11042 H HB3  . LYS A 1 30  ? -2.155  8.286   -14.067 1.00 0.00 ? 30  LYS A HB3  8  
ATOM 11043 H HG2  . LYS A 1 30  ? -2.120  8.056   -17.020 1.00 0.00 ? 30  LYS A HG2  8  
ATOM 11044 H HG3  . LYS A 1 30  ? -2.098  9.677   -16.322 1.00 0.00 ? 30  LYS A HG3  8  
ATOM 11045 H HD2  . LYS A 1 30  ? 0.145   9.277   -16.364 1.00 0.00 ? 30  LYS A HD2  8  
ATOM 11046 H HD3  . LYS A 1 30  ? -0.229  8.574   -14.789 1.00 0.00 ? 30  LYS A HD3  8  
ATOM 11047 H HE2  . LYS A 1 30  ? -0.399  6.361   -15.825 1.00 0.00 ? 30  LYS A HE2  8  
ATOM 11048 H HE3  . LYS A 1 30  ? -0.022  7.068   -17.396 1.00 0.00 ? 30  LYS A HE3  8  
ATOM 11049 H HZ1  . LYS A 1 30  ? 2.099   7.872   -16.293 1.00 0.00 ? 30  LYS A HZ1  8  
ATOM 11050 H HZ2  . LYS A 1 30  ? 1.988   6.215   -16.615 1.00 0.00 ? 30  LYS A HZ2  8  
ATOM 11051 H HZ3  . LYS A 1 30  ? 1.745   6.789   -15.043 1.00 0.00 ? 30  LYS A HZ3  8  
ATOM 11052 N N    . TRP A 1 31  ? -2.145  5.333   -13.316 1.00 0.00 ? 31  TRP A N    8  
ATOM 11053 C CA   . TRP A 1 31  ? -2.093  4.687   -12.009 1.00 0.00 ? 31  TRP A CA   8  
ATOM 11054 C C    . TRP A 1 31  ? -1.641  5.670   -10.934 1.00 0.00 ? 31  TRP A C    8  
ATOM 11055 O O    . TRP A 1 31  ? -0.501  6.133   -10.943 1.00 0.00 ? 31  TRP A O    8  
ATOM 11056 C CB   . TRP A 1 31  ? -1.149  3.485   -12.048 1.00 0.00 ? 31  TRP A CB   8  
ATOM 11057 C CG   . TRP A 1 31  ? -1.567  2.432   -13.029 1.00 0.00 ? 31  TRP A CG   8  
ATOM 11058 C CD1  . TRP A 1 31  ? -1.315  2.417   -14.371 1.00 0.00 ? 31  TRP A CD1  8  
ATOM 11059 C CD2  . TRP A 1 31  ? -2.313  1.243   -12.745 1.00 0.00 ? 31  TRP A CD2  8  
ATOM 11060 N NE1  . TRP A 1 31  ? -1.859  1.290   -14.939 1.00 0.00 ? 31  TRP A NE1  8  
ATOM 11061 C CE2  . TRP A 1 31  ? -2.476  0.553   -13.962 1.00 0.00 ? 31  TRP A CE2  8  
ATOM 11062 C CE3  . TRP A 1 31  ? -2.857  0.694   -11.581 1.00 0.00 ? 31  TRP A CE3  8  
ATOM 11063 C CZ2  . TRP A 1 31  ? -3.161  -0.656  -14.046 1.00 0.00 ? 31  TRP A CZ2  8  
ATOM 11064 C CZ3  . TRP A 1 31  ? -3.536  -0.506  -11.666 1.00 0.00 ? 31  TRP A CZ3  8  
ATOM 11065 C CH2  . TRP A 1 31  ? -3.683  -1.171  -12.891 1.00 0.00 ? 31  TRP A CH2  8  
ATOM 11066 H H    . TRP A 1 31  ? -1.385  5.234   -13.928 1.00 0.00 ? 31  TRP A H    8  
ATOM 11067 H HA   . TRP A 1 31  ? -3.089  4.344   -11.770 1.00 0.00 ? 31  TRP A HA   8  
ATOM 11068 H HB2  . TRP A 1 31  ? -0.160  3.820   -12.320 1.00 0.00 ? 31  TRP A HB2  8  
ATOM 11069 H HB3  . TRP A 1 31  ? -1.114  3.032   -11.067 1.00 0.00 ? 31  TRP A HB3  8  
ATOM 11070 H HD1  . TRP A 1 31  ? -0.769  3.185   -14.896 1.00 0.00 ? 31  TRP A HD1  8  
ATOM 11071 H HE1  . TRP A 1 31  ? -1.812  1.052   -15.889 1.00 0.00 ? 31  TRP A HE1  8  
ATOM 11072 H HE3  . TRP A 1 31  ? -2.754  1.191   -10.628 1.00 0.00 ? 31  TRP A HE3  8  
ATOM 11073 H HZ2  . TRP A 1 31  ? -3.282  -1.181  -14.982 1.00 0.00 ? 31  TRP A HZ2  8  
ATOM 11074 H HZ3  . TRP A 1 31  ? -3.964  -0.946  -10.777 1.00 0.00 ? 31  TRP A HZ3  8  
ATOM 11075 H HH2  . TRP A 1 31  ? -4.222  -2.106  -12.910 1.00 0.00 ? 31  TRP A HH2  8  
ATOM 11076 N N    . HIS A 1 32  ? -2.542  5.983   -10.008 1.00 0.00 ? 32  HIS A N    8  
ATOM 11077 C CA   . HIS A 1 32  ? -2.235  6.910   -8.925  1.00 0.00 ? 32  HIS A CA   8  
ATOM 11078 C C    . HIS A 1 32  ? -1.979  6.159   -7.622  1.00 0.00 ? 32  HIS A C    8  
ATOM 11079 O O    . HIS A 1 32  ? -2.871  5.499   -7.090  1.00 0.00 ? 32  HIS A O    8  
ATOM 11080 C CB   . HIS A 1 32  ? -3.381  7.905   -8.737  1.00 0.00 ? 32  HIS A CB   8  
ATOM 11081 C CG   . HIS A 1 32  ? -3.368  9.028   -9.728  1.00 0.00 ? 32  HIS A CG   8  
ATOM 11082 N ND1  . HIS A 1 32  ? -2.228  9.734   -10.051 1.00 0.00 ? 32  HIS A ND1  8  
ATOM 11083 C CD2  . HIS A 1 32  ? -4.364  9.565   -10.471 1.00 0.00 ? 32  HIS A CD2  8  
ATOM 11084 C CE1  . HIS A 1 32  ? -2.524  10.658  -10.948 1.00 0.00 ? 32  HIS A CE1  8  
ATOM 11085 N NE2  . HIS A 1 32  ? -3.814  10.576  -11.220 1.00 0.00 ? 32  HIS A NE2  8  
ATOM 11086 H H    . HIS A 1 32  ? -3.435  5.581   -10.054 1.00 0.00 ? 32  HIS A H    8  
ATOM 11087 H HA   . HIS A 1 32  ? -1.341  7.451   -9.196  1.00 0.00 ? 32  HIS A HA   8  
ATOM 11088 H HB2  . HIS A 1 32  ? -4.321  7.385   -8.839  1.00 0.00 ? 32  HIS A HB2  8  
ATOM 11089 H HB3  . HIS A 1 32  ? -3.317  8.335   -7.747  1.00 0.00 ? 32  HIS A HB3  8  
ATOM 11090 H HD1  . HIS A 1 32  ? -1.336  9.582   -9.677  1.00 0.00 ? 32  HIS A HD1  8  
ATOM 11091 H HD2  . HIS A 1 32  ? -5.400  9.256   -10.473 1.00 0.00 ? 32  HIS A HD2  8  
ATOM 11092 H HE1  . HIS A 1 32  ? -1.830  11.360  -11.385 1.00 0.00 ? 32  HIS A HE1  8  
ATOM 11093 N N    . MET A 1 33  ? -0.755  6.263   -7.115  1.00 0.00 ? 33  MET A N    8  
ATOM 11094 C CA   . MET A 1 33  ? -0.383  5.593   -5.875  1.00 0.00 ? 33  MET A CA   8  
ATOM 11095 C C    . MET A 1 33  ? -1.365  5.932   -4.758  1.00 0.00 ? 33  MET A C    8  
ATOM 11096 O O    . MET A 1 33  ? -1.447  7.079   -4.317  1.00 0.00 ? 33  MET A O    8  
ATOM 11097 C CB   . MET A 1 33  ? 1.036   5.991   -5.461  1.00 0.00 ? 33  MET A CB   8  
ATOM 11098 C CG   . MET A 1 33  ? 1.526   5.281   -4.209  1.00 0.00 ? 33  MET A CG   8  
ATOM 11099 S SD   . MET A 1 33  ? 3.313   5.395   -4.001  1.00 0.00 ? 33  MET A SD   8  
ATOM 11100 C CE   . MET A 1 33  ? 3.541   4.437   -2.505  1.00 0.00 ? 33  MET A CE   8  
ATOM 11101 H H    . MET A 1 33  ? -0.086  6.804   -7.586  1.00 0.00 ? 33  MET A H    8  
ATOM 11102 H HA   . MET A 1 33  ? -0.411  4.529   -6.052  1.00 0.00 ? 33  MET A HA   8  
ATOM 11103 H HB2  . MET A 1 33  ? 1.712   5.758   -6.269  1.00 0.00 ? 33  MET A HB2  8  
ATOM 11104 H HB3  . MET A 1 33  ? 1.059   7.055   -5.277  1.00 0.00 ? 33  MET A HB3  8  
ATOM 11105 H HG2  . MET A 1 33  ? 1.049   5.726   -3.349  1.00 0.00 ? 33  MET A HG2  8  
ATOM 11106 H HG3  . MET A 1 33  ? 1.249   4.239   -4.273  1.00 0.00 ? 33  MET A HG3  8  
ATOM 11107 H HE1  . MET A 1 33  ? 4.432   4.773   -1.995  1.00 0.00 ? 33  MET A HE1  8  
ATOM 11108 H HE2  . MET A 1 33  ? 2.685   4.570   -1.859  1.00 0.00 ? 33  MET A HE2  8  
ATOM 11109 H HE3  . MET A 1 33  ? 3.643   3.392   -2.758  1.00 0.00 ? 33  MET A HE3  8  
ATOM 11110 N N    . PHE A 1 34  ? -2.107  4.928   -4.304  1.00 0.00 ? 34  PHE A N    8  
ATOM 11111 C CA   . PHE A 1 34  ? -3.085  5.121   -3.239  1.00 0.00 ? 34  PHE A CA   8  
ATOM 11112 C C    . PHE A 1 34  ? -2.595  6.158   -2.232  1.00 0.00 ? 34  PHE A C    8  
ATOM 11113 O O    . PHE A 1 34  ? -1.485  6.056   -1.711  1.00 0.00 ? 34  PHE A O    8  
ATOM 11114 C CB   . PHE A 1 34  ? -3.363  3.795   -2.527  1.00 0.00 ? 34  PHE A CB   8  
ATOM 11115 C CG   . PHE A 1 34  ? -4.482  3.007   -3.146  1.00 0.00 ? 34  PHE A CG   8  
ATOM 11116 C CD1  . PHE A 1 34  ? -5.793  3.206   -2.744  1.00 0.00 ? 34  PHE A CD1  8  
ATOM 11117 C CD2  . PHE A 1 34  ? -4.222  2.066   -4.129  1.00 0.00 ? 34  PHE A CD2  8  
ATOM 11118 C CE1  . PHE A 1 34  ? -6.823  2.481   -3.311  1.00 0.00 ? 34  PHE A CE1  8  
ATOM 11119 C CE2  . PHE A 1 34  ? -5.249  1.338   -4.700  1.00 0.00 ? 34  PHE A CE2  8  
ATOM 11120 C CZ   . PHE A 1 34  ? -6.552  1.547   -4.291  1.00 0.00 ? 34  PHE A CZ   8  
ATOM 11121 H H    . PHE A 1 34  ? -1.995  4.036   -4.695  1.00 0.00 ? 34  PHE A H    8  
ATOM 11122 H HA   . PHE A 1 34  ? -3.998  5.477   -3.689  1.00 0.00 ? 34  PHE A HA   8  
ATOM 11123 H HB2  . PHE A 1 34  ? -2.473  3.186   -2.556  1.00 0.00 ? 34  PHE A HB2  8  
ATOM 11124 H HB3  . PHE A 1 34  ? -3.625  3.995   -1.499  1.00 0.00 ? 34  PHE A HB3  8  
ATOM 11125 H HD1  . PHE A 1 34  ? -6.007  3.938   -1.978  1.00 0.00 ? 34  PHE A HD1  8  
ATOM 11126 H HD2  . PHE A 1 34  ? -3.203  1.902   -4.450  1.00 0.00 ? 34  PHE A HD2  8  
ATOM 11127 H HE1  . PHE A 1 34  ? -7.841  2.646   -2.989  1.00 0.00 ? 34  PHE A HE1  8  
ATOM 11128 H HE2  . PHE A 1 34  ? -5.033  0.608   -5.466  1.00 0.00 ? 34  PHE A HE2  8  
ATOM 11129 H HZ   . PHE A 1 34  ? -7.355  0.978   -4.735  1.00 0.00 ? 34  PHE A HZ   8  
ATOM 11130 N N    . GLN A 1 35  ? -3.432  7.156   -1.966  1.00 0.00 ? 35  GLN A N    8  
ATOM 11131 C CA   . GLN A 1 35  ? -3.084  8.213   -1.023  1.00 0.00 ? 35  GLN A CA   8  
ATOM 11132 C C    . GLN A 1 35  ? -4.325  8.733   -0.307  1.00 0.00 ? 35  GLN A C    8  
ATOM 11133 O O    . GLN A 1 35  ? -5.442  8.671   -0.822  1.00 0.00 ? 35  GLN A O    8  
ATOM 11134 C CB   . GLN A 1 35  ? -2.380  9.361   -1.749  1.00 0.00 ? 35  GLN A CB   8  
ATOM 11135 C CG   . GLN A 1 35  ? -0.875  9.181   -1.856  1.00 0.00 ? 35  GLN A CG   8  
ATOM 11136 C CD   . GLN A 1 35  ? -0.264  10.022  -2.960  1.00 0.00 ? 35  GLN A CD   8  
ATOM 11137 O OE1  . GLN A 1 35  ? -0.925  10.885  -3.537  1.00 0.00 ? 35  GLN A OE1  8  
ATOM 11138 N NE2  . GLN A 1 35  ? 1.006   9.773   -3.260  1.00 0.00 ? 35  GLN A NE2  8  
ATOM 11139 H H    . GLN A 1 35  ? -4.302  7.182   -2.413  1.00 0.00 ? 35  GLN A H    8  
ATOM 11140 H HA   . GLN A 1 35  ? -2.410  7.795   -0.291  1.00 0.00 ? 35  GLN A HA   8  
ATOM 11141 H HB2  . GLN A 1 35  ? -2.784  9.442   -2.747  1.00 0.00 ? 35  GLN A HB2  8  
ATOM 11142 H HB3  . GLN A 1 35  ? -2.574  10.280  -1.216  1.00 0.00 ? 35  GLN A HB3  8  
ATOM 11143 H HG2  . GLN A 1 35  ? -0.423  9.465   -0.917  1.00 0.00 ? 35  GLN A HG2  8  
ATOM 11144 H HG3  . GLN A 1 35  ? -0.663  8.141   -2.056  1.00 0.00 ? 35  GLN A HG3  8  
ATOM 11145 H HE21 . GLN A 1 35  ? 1.470   9.070   -2.759  1.00 0.00 ? 35  GLN A HE21 8  
ATOM 11146 H HE22 . GLN A 1 35  ? 1.425   10.301  -3.970  1.00 0.00 ? 35  GLN A HE22 8  
ATOM 11147 N N    . PRO A 1 36  ? -4.129  9.259   0.912   1.00 0.00 ? 36  PRO A N    8  
ATOM 11148 C CA   . PRO A 1 36  ? -5.222  9.801   1.726   1.00 0.00 ? 36  PRO A CA   8  
ATOM 11149 C C    . PRO A 1 36  ? -5.786  11.095  1.151   1.00 0.00 ? 36  PRO A C    8  
ATOM 11150 O O    . PRO A 1 36  ? -5.130  12.137  1.182   1.00 0.00 ? 36  PRO A O    8  
ATOM 11151 C CB   . PRO A 1 36  ? -4.559  10.062  3.081   1.00 0.00 ? 36  PRO A CB   8  
ATOM 11152 C CG   . PRO A 1 36  ? -3.116  10.255  2.765   1.00 0.00 ? 36  PRO A CG   8  
ATOM 11153 C CD   . PRO A 1 36  ? -2.826  9.365   1.589   1.00 0.00 ? 36  PRO A CD   8  
ATOM 11154 H HA   . PRO A 1 36  ? -6.020  9.083   1.846   1.00 0.00 ? 36  PRO A HA   8  
ATOM 11155 H HB2  . PRO A 1 36  ? -4.988  10.946  3.530   1.00 0.00 ? 36  PRO A HB2  8  
ATOM 11156 H HB3  . PRO A 1 36  ? -4.710  9.212   3.729   1.00 0.00 ? 36  PRO A HB3  8  
ATOM 11157 H HG2  . PRO A 1 36  ? -2.931  11.288  2.509   1.00 0.00 ? 36  PRO A HG2  8  
ATOM 11158 H HG3  . PRO A 1 36  ? -2.513  9.964   3.613   1.00 0.00 ? 36  PRO A HG3  8  
ATOM 11159 H HD2  . PRO A 1 36  ? -2.091  9.822   0.942   1.00 0.00 ? 36  PRO A HD2  8  
ATOM 11160 H HD3  . PRO A 1 36  ? -2.486  8.396   1.923   1.00 0.00 ? 36  PRO A HD3  8  
ATOM 11161 N N    . ASP A 1 37  ? -7.004  11.023  0.627   1.00 0.00 ? 37  ASP A N    8  
ATOM 11162 C CA   . ASP A 1 37  ? -7.658  12.190  0.046   1.00 0.00 ? 37  ASP A CA   8  
ATOM 11163 C C    . ASP A 1 37  ? -7.827  13.292  1.087   1.00 0.00 ? 37  ASP A C    8  
ATOM 11164 O O    . ASP A 1 37  ? -7.736  13.045  2.290   1.00 0.00 ? 37  ASP A O    8  
ATOM 11165 C CB   . ASP A 1 37  ? -9.020  11.804  -0.533  1.00 0.00 ? 37  ASP A CB   8  
ATOM 11166 C CG   . ASP A 1 37  ? -9.748  12.987  -1.139  1.00 0.00 ? 37  ASP A CG   8  
ATOM 11167 O OD1  . ASP A 1 37  ? -9.492  13.299  -2.321  1.00 0.00 ? 37  ASP A OD1  8  
ATOM 11168 O OD2  . ASP A 1 37  ? -10.574 13.601  -0.432  1.00 0.00 ? 37  ASP A OD2  8  
ATOM 11169 H H    . ASP A 1 37  ? -7.476  10.164  0.631   1.00 0.00 ? 37  ASP A H    8  
ATOM 11170 H HA   . ASP A 1 37  ? -7.030  12.559  -0.751  1.00 0.00 ? 37  ASP A HA   8  
ATOM 11171 H HB2  . ASP A 1 37  ? -8.879  11.059  -1.302  1.00 0.00 ? 37  ASP A HB2  8  
ATOM 11172 H HB3  . ASP A 1 37  ? -9.634  11.391  0.254   1.00 0.00 ? 37  ASP A HB3  8  
ATOM 11173 N N    . THR A 1 38  ? -8.074  14.511  0.616   1.00 0.00 ? 38  THR A N    8  
ATOM 11174 C CA   . THR A 1 38  ? -8.254  15.652  1.506   1.00 0.00 ? 38  THR A CA   8  
ATOM 11175 C C    . THR A 1 38  ? -9.028  15.256  2.758   1.00 0.00 ? 38  THR A C    8  
ATOM 11176 O O    . THR A 1 38  ? -9.790  14.290  2.748   1.00 0.00 ? 38  THR A O    8  
ATOM 11177 C CB   . THR A 1 38  ? -8.995  16.803  0.800   1.00 0.00 ? 38  THR A CB   8  
ATOM 11178 O OG1  . THR A 1 38  ? -10.222 16.323  0.237   1.00 0.00 ? 38  THR A OG1  8  
ATOM 11179 C CG2  . THR A 1 38  ? -8.133  17.411  -0.295  1.00 0.00 ? 38  THR A CG2  8  
ATOM 11180 H H    . THR A 1 38  ? -8.135  14.645  -0.352  1.00 0.00 ? 38  THR A H    8  
ATOM 11181 H HA   . THR A 1 38  ? -7.276  16.006  1.796   1.00 0.00 ? 38  THR A HA   8  
ATOM 11182 H HB   . THR A 1 38  ? -9.218  17.568  1.530   1.00 0.00 ? 38  THR A HB   8  
ATOM 11183 H HG1  . THR A 1 38  ? -10.927 16.415  0.882   1.00 0.00 ? 38  THR A HG1  8  
ATOM 11184 H HG21 . THR A 1 38  ? -7.135  17.579  0.084   1.00 0.00 ? 38  THR A HG21 8  
ATOM 11185 H HG22 . THR A 1 38  ? -8.561  18.351  -0.611  1.00 0.00 ? 38  THR A HG22 8  
ATOM 11186 H HG23 . THR A 1 38  ? -8.088  16.735  -1.135  1.00 0.00 ? 38  THR A HG23 8  
ATOM 11187 N N    . ASN A 1 39  ? -8.829  16.009  3.834   1.00 0.00 ? 39  ASN A N    8  
ATOM 11188 C CA   . ASN A 1 39  ? -9.509  15.736  5.095   1.00 0.00 ? 39  ASN A CA   8  
ATOM 11189 C C    . ASN A 1 39  ? -11.013 15.597  4.882   1.00 0.00 ? 39  ASN A C    8  
ATOM 11190 O O    . ASN A 1 39  ? -11.650 14.707  5.446   1.00 0.00 ? 39  ASN A O    8  
ATOM 11191 C CB   . ASN A 1 39  ? -9.227  16.853  6.103   1.00 0.00 ? 39  ASN A CB   8  
ATOM 11192 C CG   . ASN A 1 39  ? -10.131 16.777  7.318   1.00 0.00 ? 39  ASN A CG   8  
ATOM 11193 O OD1  . ASN A 1 39  ? -9.722  16.313  8.382   1.00 0.00 ? 39  ASN A OD1  8  
ATOM 11194 N ND2  . ASN A 1 39  ? -11.369 17.233  7.163   1.00 0.00 ? 39  ASN A ND2  8  
ATOM 11195 H H    . ASN A 1 39  ? -8.209  16.767  3.780   1.00 0.00 ? 39  ASN A H    8  
ATOM 11196 H HA   . ASN A 1 39  ? -9.124  14.806  5.484   1.00 0.00 ? 39  ASN A HA   8  
ATOM 11197 H HB2  . ASN A 1 39  ? -8.202  16.777  6.436   1.00 0.00 ? 39  ASN A HB2  8  
ATOM 11198 H HB3  . ASN A 1 39  ? -9.376  17.809  5.624   1.00 0.00 ? 39  ASN A HB3  8  
ATOM 11199 H HD21 . ASN A 1 39  ? -11.625 17.588  6.286   1.00 0.00 ? 39  ASN A HD21 8  
ATOM 11200 H HD22 . ASN A 1 39  ? -11.974 17.197  7.933   1.00 0.00 ? 39  ASN A HD22 8  
ATOM 11201 N N    . SER A 1 40  ? -11.575 16.482  4.065   1.00 0.00 ? 40  SER A N    8  
ATOM 11202 C CA   . SER A 1 40  ? -13.004 16.460  3.780   1.00 0.00 ? 40  SER A CA   8  
ATOM 11203 C C    . SER A 1 40  ? -13.447 15.071  3.330   1.00 0.00 ? 40  SER A C    8  
ATOM 11204 O O    . SER A 1 40  ? -14.336 14.467  3.930   1.00 0.00 ? 40  SER A O    8  
ATOM 11205 C CB   . SER A 1 40  ? -13.347 17.491  2.703   1.00 0.00 ? 40  SER A CB   8  
ATOM 11206 O OG   . SER A 1 40  ? -14.686 17.937  2.832   1.00 0.00 ? 40  SER A OG   8  
ATOM 11207 H H    . SER A 1 40  ? -11.014 17.168  3.646   1.00 0.00 ? 40  SER A H    8  
ATOM 11208 H HA   . SER A 1 40  ? -13.528 16.714  4.689   1.00 0.00 ? 40  SER A HA   8  
ATOM 11209 H HB2  . SER A 1 40  ? -12.687 18.339  2.797   1.00 0.00 ? 40  SER A HB2  8  
ATOM 11210 H HB3  . SER A 1 40  ? -13.222 17.043  1.727   1.00 0.00 ? 40  SER A HB3  8  
ATOM 11211 H HG   . SER A 1 40  ? -15.251 17.195  3.058   1.00 0.00 ? 40  SER A HG   8  
ATOM 11212 N N    . GLN A 1 41  ? -12.821 14.572  2.269   1.00 0.00 ? 41  GLN A N    8  
ATOM 11213 C CA   . GLN A 1 41  ? -13.150 13.254  1.738   1.00 0.00 ? 41  GLN A CA   8  
ATOM 11214 C C    . GLN A 1 41  ? -12.002 12.276  1.958   1.00 0.00 ? 41  GLN A C    8  
ATOM 11215 O O    . GLN A 1 41  ? -11.672 11.481  1.077   1.00 0.00 ? 41  GLN A O    8  
ATOM 11216 C CB   . GLN A 1 41  ? -13.475 13.350  0.246   1.00 0.00 ? 41  GLN A CB   8  
ATOM 11217 C CG   . GLN A 1 41  ? -14.934 13.667  -0.040  1.00 0.00 ? 41  GLN A CG   8  
ATOM 11218 C CD   . GLN A 1 41  ? -15.239 15.149  0.061   1.00 0.00 ? 41  GLN A CD   8  
ATOM 11219 O OE1  . GLN A 1 41  ? -14.455 15.988  -0.383  1.00 0.00 ? 41  GLN A OE1  8  
ATOM 11220 N NE2  . GLN A 1 41  ? -16.384 15.479  0.648   1.00 0.00 ? 41  GLN A NE2  8  
ATOM 11221 H H    . GLN A 1 41  ? -12.121 15.102  1.834   1.00 0.00 ? 41  GLN A H    8  
ATOM 11222 H HA   . GLN A 1 41  ? -14.020 12.893  2.264   1.00 0.00 ? 41  GLN A HA   8  
ATOM 11223 H HB2  . GLN A 1 41  ? -12.867 14.126  -0.194  1.00 0.00 ? 41  GLN A HB2  8  
ATOM 11224 H HB3  . GLN A 1 41  ? -13.236 12.407  -0.223  1.00 0.00 ? 41  GLN A HB3  8  
ATOM 11225 H HG2  . GLN A 1 41  ? -15.173 13.334  -1.039  1.00 0.00 ? 41  GLN A HG2  8  
ATOM 11226 H HG3  . GLN A 1 41  ? -15.550 13.138  0.672   1.00 0.00 ? 41  GLN A HG3  8  
ATOM 11227 H HE21 . GLN A 1 41  ? -16.959 14.757  0.979   1.00 0.00 ? 41  GLN A HE21 8  
ATOM 11228 H HE22 . GLN A 1 41  ? -16.606 16.429  0.727   1.00 0.00 ? 41  GLN A HE22 8  
ATOM 11229 N N    . CYS A 1 42  ? -11.396 12.338  3.139   1.00 0.00 ? 42  CYS A N    8  
ATOM 11230 C CA   . CYS A 1 42  ? -10.283 11.458  3.475   1.00 0.00 ? 42  CYS A CA   8  
ATOM 11231 C C    . CYS A 1 42  ? -10.610 10.010  3.125   1.00 0.00 ? 42  CYS A C    8  
ATOM 11232 O O    . CYS A 1 42  ? -11.585 9.445   3.620   1.00 0.00 ? 42  CYS A O    8  
ATOM 11233 C CB   . CYS A 1 42  ? -9.947  11.571  4.963   1.00 0.00 ? 42  CYS A CB   8  
ATOM 11234 S SG   . CYS A 1 42  ? -11.156 10.786  6.055   1.00 0.00 ? 42  CYS A SG   8  
ATOM 11235 H H    . CYS A 1 42  ? -11.704 12.992  3.801   1.00 0.00 ? 42  CYS A H    8  
ATOM 11236 H HA   . CYS A 1 42  ? -9.427  11.771  2.897   1.00 0.00 ? 42  CYS A HA   8  
ATOM 11237 H HB2  . CYS A 1 42  ? -8.990  11.105  5.145   1.00 0.00 ? 42  CYS A HB2  8  
ATOM 11238 H HB3  . CYS A 1 42  ? -9.889  12.615  5.232   1.00 0.00 ? 42  CYS A HB3  8  
ATOM 11239 H HG   . CYS A 1 42  ? -11.974 11.726  6.501   1.00 0.00 ? 42  CYS A HG   8  
ATOM 11240 N N    . SER A 1 43  ? -9.789  9.415   2.265   1.00 0.00 ? 43  SER A N    8  
ATOM 11241 C CA   . SER A 1 43  ? -9.994  8.034   1.843   1.00 0.00 ? 43  SER A CA   8  
ATOM 11242 C C    . SER A 1 43  ? -8.928  7.120   2.440   1.00 0.00 ? 43  SER A C    8  
ATOM 11243 O O    . SER A 1 43  ? -8.019  7.577   3.132   1.00 0.00 ? 43  SER A O    8  
ATOM 11244 C CB   . SER A 1 43  ? -9.970  7.936   0.316   1.00 0.00 ? 43  SER A CB   8  
ATOM 11245 O OG   . SER A 1 43  ? -11.189 8.393   -0.244  1.00 0.00 ? 43  SER A OG   8  
ATOM 11246 H H    . SER A 1 43  ? -9.029  9.918   1.904   1.00 0.00 ? 43  SER A H    8  
ATOM 11247 H HA   . SER A 1 43  ? -10.963 7.719   2.200   1.00 0.00 ? 43  SER A HA   8  
ATOM 11248 H HB2  . SER A 1 43  ? -9.162  8.541   -0.068  1.00 0.00 ? 43  SER A HB2  8  
ATOM 11249 H HB3  . SER A 1 43  ? -9.818  6.906   0.027   1.00 0.00 ? 43  SER A HB3  8  
ATOM 11250 H HG   . SER A 1 43  ? -11.219 8.163   -1.175  1.00 0.00 ? 43  SER A HG   8  
ATOM 11251 N N    . VAL A 1 44  ? -9.048  5.825   2.165   1.00 0.00 ? 44  VAL A N    8  
ATOM 11252 C CA   . VAL A 1 44  ? -8.095  4.845   2.673   1.00 0.00 ? 44  VAL A CA   8  
ATOM 11253 C C    . VAL A 1 44  ? -6.779  4.908   1.906   1.00 0.00 ? 44  VAL A C    8  
ATOM 11254 O O    . VAL A 1 44  ? -6.762  4.847   0.676   1.00 0.00 ? 44  VAL A O    8  
ATOM 11255 C CB   . VAL A 1 44  ? -8.660  3.414   2.584   1.00 0.00 ? 44  VAL A CB   8  
ATOM 11256 C CG1  . VAL A 1 44  ? -9.877  3.264   3.483   1.00 0.00 ? 44  VAL A CG1  8  
ATOM 11257 C CG2  . VAL A 1 44  ? -9.004  3.067   1.144   1.00 0.00 ? 44  VAL A CG2  8  
ATOM 11258 H H    . VAL A 1 44  ? -9.794  5.521   1.607   1.00 0.00 ? 44  VAL A H    8  
ATOM 11259 H HA   . VAL A 1 44  ? -7.906  5.070   3.713   1.00 0.00 ? 44  VAL A HA   8  
ATOM 11260 H HB   . VAL A 1 44  ? -7.900  2.727   2.926   1.00 0.00 ? 44  VAL A HB   8  
ATOM 11261 H HG11 . VAL A 1 44  ? -10.435 4.189   3.491   1.00 0.00 ? 44  VAL A HG11 8  
ATOM 11262 H HG12 . VAL A 1 44  ? -10.504 2.467   3.111   1.00 0.00 ? 44  VAL A HG12 8  
ATOM 11263 H HG13 . VAL A 1 44  ? -9.556  3.031   4.488   1.00 0.00 ? 44  VAL A HG13 8  
ATOM 11264 H HG21 . VAL A 1 44  ? -8.094  2.967   0.571   1.00 0.00 ? 44  VAL A HG21 8  
ATOM 11265 H HG22 . VAL A 1 44  ? -9.549  2.134   1.119   1.00 0.00 ? 44  VAL A HG22 8  
ATOM 11266 H HG23 . VAL A 1 44  ? -9.613  3.851   0.720   1.00 0.00 ? 44  VAL A HG23 8  
ATOM 11267 N N    . SER A 1 45  ? -5.678  5.031   2.640   1.00 0.00 ? 45  SER A N    8  
ATOM 11268 C CA   . SER A 1 45  ? -4.356  5.107   2.028   1.00 0.00 ? 45  SER A CA   8  
ATOM 11269 C C    . SER A 1 45  ? -3.805  3.711   1.751   1.00 0.00 ? 45  SER A C    8  
ATOM 11270 O O    . SER A 1 45  ? -4.305  2.718   2.280   1.00 0.00 ? 45  SER A O    8  
ATOM 11271 C CB   . SER A 1 45  ? -3.394  5.876   2.935   1.00 0.00 ? 45  SER A CB   8  
ATOM 11272 O OG   . SER A 1 45  ? -3.883  7.178   3.210   1.00 0.00 ? 45  SER A OG   8  
ATOM 11273 H H    . SER A 1 45  ? -5.757  5.075   3.616   1.00 0.00 ? 45  SER A H    8  
ATOM 11274 H HA   . SER A 1 45  ? -4.454  5.635   1.091   1.00 0.00 ? 45  SER A HA   8  
ATOM 11275 H HB2  . SER A 1 45  ? -3.279  5.344   3.867   1.00 0.00 ? 45  SER A HB2  8  
ATOM 11276 H HB3  . SER A 1 45  ? -2.434  5.960   2.447   1.00 0.00 ? 45  SER A HB3  8  
ATOM 11277 H HG   . SER A 1 45  ? -4.621  7.120   3.821   1.00 0.00 ? 45  SER A HG   8  
ATOM 11278 N N    . SER A 1 46  ? -2.772  3.644   0.917   1.00 0.00 ? 46  SER A N    8  
ATOM 11279 C CA   . SER A 1 46  ? -2.155  2.371   0.566   1.00 0.00 ? 46  SER A CA   8  
ATOM 11280 C C    . SER A 1 46  ? -2.082  1.449   1.779   1.00 0.00 ? 46  SER A C    8  
ATOM 11281 O O    . SER A 1 46  ? -2.381  0.259   1.686   1.00 0.00 ? 46  SER A O    8  
ATOM 11282 C CB   . SER A 1 46  ? -0.752  2.599   0.000   1.00 0.00 ? 46  SER A CB   8  
ATOM 11283 O OG   . SER A 1 46  ? 0.068   3.286   0.930   1.00 0.00 ? 46  SER A OG   8  
ATOM 11284 H H    . SER A 1 46  ? -2.419  4.471   0.528   1.00 0.00 ? 46  SER A H    8  
ATOM 11285 H HA   . SER A 1 46  ? -2.767  1.903   -0.191  1.00 0.00 ? 46  SER A HA   8  
ATOM 11286 H HB2  . SER A 1 46  ? -0.298  1.646   -0.227  1.00 0.00 ? 46  SER A HB2  8  
ATOM 11287 H HB3  . SER A 1 46  ? -0.823  3.188   -0.903  1.00 0.00 ? 46  SER A HB3  8  
ATOM 11288 H HG   . SER A 1 46  ? 0.987   3.052   0.781   1.00 0.00 ? 46  SER A HG   8  
ATOM 11289 N N    . GLU A 1 47  ? -1.683  2.009   2.917   1.00 0.00 ? 47  GLU A N    8  
ATOM 11290 C CA   . GLU A 1 47  ? -1.570  1.237   4.149   1.00 0.00 ? 47  GLU A CA   8  
ATOM 11291 C C    . GLU A 1 47  ? -2.762  0.299   4.314   1.00 0.00 ? 47  GLU A C    8  
ATOM 11292 O O    . GLU A 1 47  ? -2.600  -0.919  4.400   1.00 0.00 ? 47  GLU A O    8  
ATOM 11293 C CB   . GLU A 1 47  ? -1.473  2.173   5.356   1.00 0.00 ? 47  GLU A CB   8  
ATOM 11294 C CG   . GLU A 1 47  ? -0.962  1.491   6.614   1.00 0.00 ? 47  GLU A CG   8  
ATOM 11295 C CD   . GLU A 1 47  ? -0.824  2.449   7.781   1.00 0.00 ? 47  GLU A CD   8  
ATOM 11296 O OE1  . GLU A 1 47  ? -1.853  3.004   8.220   1.00 0.00 ? 47  GLU A OE1  8  
ATOM 11297 O OE2  . GLU A 1 47  ? 0.315   2.645   8.256   1.00 0.00 ? 47  GLU A OE2  8  
ATOM 11298 H H    . GLU A 1 47  ? -1.459  2.963   2.928   1.00 0.00 ? 47  GLU A H    8  
ATOM 11299 H HA   . GLU A 1 47  ? -0.668  0.647   4.089   1.00 0.00 ? 47  GLU A HA   8  
ATOM 11300 H HB2  . GLU A 1 47  ? -0.803  2.985   5.114   1.00 0.00 ? 47  GLU A HB2  8  
ATOM 11301 H HB3  . GLU A 1 47  ? -2.453  2.576   5.563   1.00 0.00 ? 47  GLU A HB3  8  
ATOM 11302 H HG2  . GLU A 1 47  ? -1.654  0.709   6.891   1.00 0.00 ? 47  GLU A HG2  8  
ATOM 11303 H HG3  . GLU A 1 47  ? 0.005   1.058   6.407   1.00 0.00 ? 47  GLU A HG3  8  
ATOM 11304 N N    . ASP A 1 48  ? -3.958  0.874   4.358   1.00 0.00 ? 48  ASP A N    8  
ATOM 11305 C CA   . ASP A 1 48  ? -5.178  0.090   4.512   1.00 0.00 ? 48  ASP A CA   8  
ATOM 11306 C C    . ASP A 1 48  ? -5.301  -0.949  3.402   1.00 0.00 ? 48  ASP A C    8  
ATOM 11307 O O    . ASP A 1 48  ? -5.321  -2.152  3.664   1.00 0.00 ? 48  ASP A O    8  
ATOM 11308 C CB   . ASP A 1 48  ? -6.403  1.006   4.508   1.00 0.00 ? 48  ASP A CB   8  
ATOM 11309 C CG   . ASP A 1 48  ? -7.591  0.388   5.218   1.00 0.00 ? 48  ASP A CG   8  
ATOM 11310 O OD1  . ASP A 1 48  ? -8.154  -0.593  4.688   1.00 0.00 ? 48  ASP A OD1  8  
ATOM 11311 O OD2  . ASP A 1 48  ? -7.959  0.885   6.303   1.00 0.00 ? 48  ASP A OD2  8  
ATOM 11312 H H    . ASP A 1 48  ? -4.023  1.849   4.284   1.00 0.00 ? 48  ASP A H    8  
ATOM 11313 H HA   . ASP A 1 48  ? -5.126  -0.421  5.462   1.00 0.00 ? 48  ASP A HA   8  
ATOM 11314 H HB2  . ASP A 1 48  ? -6.153  1.933   5.004   1.00 0.00 ? 48  ASP A HB2  8  
ATOM 11315 H HB3  . ASP A 1 48  ? -6.685  1.214   3.486   1.00 0.00 ? 48  ASP A HB3  8  
ATOM 11316 N N    . ILE A 1 49  ? -5.383  -0.477  2.163   1.00 0.00 ? 49  ILE A N    8  
ATOM 11317 C CA   . ILE A 1 49  ? -5.503  -1.365  1.014   1.00 0.00 ? 49  ILE A CA   8  
ATOM 11318 C C    . ILE A 1 49  ? -4.558  -2.555  1.137   1.00 0.00 ? 49  ILE A C    8  
ATOM 11319 O O    . ILE A 1 49  ? -4.919  -3.683  0.805   1.00 0.00 ? 49  ILE A O    8  
ATOM 11320 C CB   . ILE A 1 49  ? -5.208  -0.624  -0.304  1.00 0.00 ? 49  ILE A CB   8  
ATOM 11321 C CG1  . ILE A 1 49  ? -6.279  0.437   -0.569  1.00 0.00 ? 49  ILE A CG1  8  
ATOM 11322 C CG2  . ILE A 1 49  ? -5.133  -1.609  -1.461  1.00 0.00 ? 49  ILE A CG2  8  
ATOM 11323 C CD1  . ILE A 1 49  ? -5.941  1.794   0.008   1.00 0.00 ? 49  ILE A CD1  8  
ATOM 11324 H H    . ILE A 1 49  ? -5.361  0.492   2.018   1.00 0.00 ? 49  ILE A H    8  
ATOM 11325 H HA   . ILE A 1 49  ? -6.520  -1.728  0.979   1.00 0.00 ? 49  ILE A HA   8  
ATOM 11326 H HB   . ILE A 1 49  ? -4.248  -0.140  -0.212  1.00 0.00 ? 49  ILE A HB   8  
ATOM 11327 H HG12 . ILE A 1 49  ? -6.407  0.552   -1.633  1.00 0.00 ? 49  ILE A HG12 8  
ATOM 11328 H HG13 . ILE A 1 49  ? -7.212  0.112   -0.132  1.00 0.00 ? 49  ILE A HG13 8  
ATOM 11329 H HG21 . ILE A 1 49  ? -4.478  -2.426  -1.196  1.00 0.00 ? 49  ILE A HG21 8  
ATOM 11330 H HG22 . ILE A 1 49  ? -6.120  -1.994  -1.670  1.00 0.00 ? 49  ILE A HG22 8  
ATOM 11331 H HG23 . ILE A 1 49  ? -4.748  -1.108  -2.336  1.00 0.00 ? 49  ILE A HG23 8  
ATOM 11332 H HD11 . ILE A 1 49  ? -4.873  1.946   -0.030  1.00 0.00 ? 49  ILE A HD11 8  
ATOM 11333 H HD12 . ILE A 1 49  ? -6.436  2.563   -0.565  1.00 0.00 ? 49  ILE A HD12 8  
ATOM 11334 H HD13 . ILE A 1 49  ? -6.274  1.841   1.036   1.00 0.00 ? 49  ILE A HD13 8  
ATOM 11335 N N    . GLU A 1 50  ? -3.346  -2.294  1.618   1.00 0.00 ? 50  GLU A N    8  
ATOM 11336 C CA   . GLU A 1 50  ? -2.349  -3.345  1.787   1.00 0.00 ? 50  GLU A CA   8  
ATOM 11337 C C    . GLU A 1 50  ? -2.737  -4.285  2.924   1.00 0.00 ? 50  GLU A C    8  
ATOM 11338 O O    . GLU A 1 50  ? -3.053  -5.454  2.700   1.00 0.00 ? 50  GLU A O    8  
ATOM 11339 C CB   . GLU A 1 50  ? -0.974  -2.734  2.061   1.00 0.00 ? 50  GLU A CB   8  
ATOM 11340 C CG   . GLU A 1 50  ? 0.120   -3.768  2.273   1.00 0.00 ? 50  GLU A CG   8  
ATOM 11341 C CD   . GLU A 1 50  ? 0.303   -4.678  1.074   1.00 0.00 ? 50  GLU A CD   8  
ATOM 11342 O OE1  . GLU A 1 50  ? 1.016   -4.278  0.130   1.00 0.00 ? 50  GLU A OE1  8  
ATOM 11343 O OE2  . GLU A 1 50  ? -0.267  -5.789  1.080   1.00 0.00 ? 50  GLU A OE2  8  
ATOM 11344 H H    . GLU A 1 50  ? -3.118  -1.374  1.866   1.00 0.00 ? 50  GLU A H    8  
ATOM 11345 H HA   . GLU A 1 50  ? -2.305  -3.910  0.868   1.00 0.00 ? 50  GLU A HA   8  
ATOM 11346 H HB2  . GLU A 1 50  ? -0.695  -2.112  1.223   1.00 0.00 ? 50  GLU A HB2  8  
ATOM 11347 H HB3  . GLU A 1 50  ? -1.036  -2.120  2.948   1.00 0.00 ? 50  GLU A HB3  8  
ATOM 11348 H HG2  . GLU A 1 50  ? 1.051   -3.255  2.462   1.00 0.00 ? 50  GLU A HG2  8  
ATOM 11349 H HG3  . GLU A 1 50  ? -0.136  -4.373  3.131   1.00 0.00 ? 50  GLU A HG3  8  
ATOM 11350 N N    . LYS A 1 51  ? -2.710  -3.767  4.148   1.00 0.00 ? 51  LYS A N    8  
ATOM 11351 C CA   . LYS A 1 51  ? -3.058  -4.557  5.322   1.00 0.00 ? 51  LYS A CA   8  
ATOM 11352 C C    . LYS A 1 51  ? -4.265  -5.447  5.041   1.00 0.00 ? 51  LYS A C    8  
ATOM 11353 O O    . LYS A 1 51  ? -4.335  -6.581  5.514   1.00 0.00 ? 51  LYS A O    8  
ATOM 11354 C CB   . LYS A 1 51  ? -3.353  -3.640  6.511   1.00 0.00 ? 51  LYS A CB   8  
ATOM 11355 C CG   . LYS A 1 51  ? -4.818  -3.259  6.635   1.00 0.00 ? 51  LYS A CG   8  
ATOM 11356 C CD   . LYS A 1 51  ? -5.086  -2.484  7.915   1.00 0.00 ? 51  LYS A CD   8  
ATOM 11357 C CE   . LYS A 1 51  ? -6.495  -1.911  7.935   1.00 0.00 ? 51  LYS A CE   8  
ATOM 11358 N NZ   . LYS A 1 51  ? -7.527  -2.981  8.012   1.00 0.00 ? 51  LYS A NZ   8  
ATOM 11359 H H    . LYS A 1 51  ? -2.449  -2.828  4.263   1.00 0.00 ? 51  LYS A H    8  
ATOM 11360 H HA   . LYS A 1 51  ? -2.212  -5.184  5.563   1.00 0.00 ? 51  LYS A HA   8  
ATOM 11361 H HB2  . LYS A 1 51  ? -3.054  -4.141  7.420   1.00 0.00 ? 51  LYS A HB2  8  
ATOM 11362 H HB3  . LYS A 1 51  ? -2.775  -2.733  6.403   1.00 0.00 ? 51  LYS A HB3  8  
ATOM 11363 H HG2  . LYS A 1 51  ? -5.094  -2.644  5.791   1.00 0.00 ? 51  LYS A HG2  8  
ATOM 11364 H HG3  . LYS A 1 51  ? -5.416  -4.159  6.639   1.00 0.00 ? 51  LYS A HG3  8  
ATOM 11365 H HD2  . LYS A 1 51  ? -4.967  -3.147  8.759   1.00 0.00 ? 51  LYS A HD2  8  
ATOM 11366 H HD3  . LYS A 1 51  ? -4.375  -1.673  7.990   1.00 0.00 ? 51  LYS A HD3  8  
ATOM 11367 H HE2  . LYS A 1 51  ? -6.594  -1.265  8.794   1.00 0.00 ? 51  LYS A HE2  8  
ATOM 11368 H HE3  . LYS A 1 51  ? -6.649  -1.337  7.034   1.00 0.00 ? 51  LYS A HE3  8  
ATOM 11369 H HZ1  . LYS A 1 51  ? -8.189  -2.897  7.213   1.00 0.00 ? 51  LYS A HZ1  8  
ATOM 11370 H HZ2  . LYS A 1 51  ? -8.062  -2.899  8.899   1.00 0.00 ? 51  LYS A HZ2  8  
ATOM 11371 H HZ3  . LYS A 1 51  ? -7.076  -3.917  7.977   1.00 0.00 ? 51  LYS A HZ3  8  
ATOM 11372 N N    . SER A 1 52  ? -5.211  -4.926  4.266   1.00 0.00 ? 52  SER A N    8  
ATOM 11373 C CA   . SER A 1 52  ? -6.416  -5.672  3.924   1.00 0.00 ? 52  SER A CA   8  
ATOM 11374 C C    . SER A 1 52  ? -6.090  -6.826  2.981   1.00 0.00 ? 52  SER A C    8  
ATOM 11375 O O    . SER A 1 52  ? -6.428  -7.979  3.252   1.00 0.00 ? 52  SER A O    8  
ATOM 11376 C CB   . SER A 1 52  ? -7.448  -4.746  3.278   1.00 0.00 ? 52  SER A CB   8  
ATOM 11377 O OG   . SER A 1 52  ? -8.712  -5.381  3.181   1.00 0.00 ? 52  SER A OG   8  
ATOM 11378 H H    . SER A 1 52  ? -5.097  -4.016  3.919   1.00 0.00 ? 52  SER A H    8  
ATOM 11379 H HA   . SER A 1 52  ? -6.827  -6.075  4.838   1.00 0.00 ? 52  SER A HA   8  
ATOM 11380 H HB2  . SER A 1 52  ? -7.552  -3.854  3.877   1.00 0.00 ? 52  SER A HB2  8  
ATOM 11381 H HB3  . SER A 1 52  ? -7.116  -4.478  2.286   1.00 0.00 ? 52  SER A HB3  8  
ATOM 11382 H HG   . SER A 1 52  ? -9.407  -4.731  3.306   1.00 0.00 ? 52  SER A HG   8  
ATOM 11383 N N    . PHE A 1 53  ? -5.432  -6.507  1.871   1.00 0.00 ? 53  PHE A N    8  
ATOM 11384 C CA   . PHE A 1 53  ? -5.061  -7.516  0.886   1.00 0.00 ? 53  PHE A CA   8  
ATOM 11385 C C    . PHE A 1 53  ? -4.341  -8.687  1.550   1.00 0.00 ? 53  PHE A C    8  
ATOM 11386 O O    . PHE A 1 53  ? -4.620  -9.849  1.256   1.00 0.00 ? 53  PHE A O    8  
ATOM 11387 C CB   . PHE A 1 53  ? -4.168  -6.901  -0.194  1.00 0.00 ? 53  PHE A CB   8  
ATOM 11388 C CG   . PHE A 1 53  ? -3.568  -7.915  -1.125  1.00 0.00 ? 53  PHE A CG   8  
ATOM 11389 C CD1  . PHE A 1 53  ? -2.365  -8.531  -0.817  1.00 0.00 ? 53  PHE A CD1  8  
ATOM 11390 C CD2  . PHE A 1 53  ? -4.206  -8.253  -2.307  1.00 0.00 ? 53  PHE A CD2  8  
ATOM 11391 C CE1  . PHE A 1 53  ? -1.811  -9.464  -1.673  1.00 0.00 ? 53  PHE A CE1  8  
ATOM 11392 C CE2  . PHE A 1 53  ? -3.656  -9.185  -3.167  1.00 0.00 ? 53  PHE A CE2  8  
ATOM 11393 C CZ   . PHE A 1 53  ? -2.457  -9.793  -2.848  1.00 0.00 ? 53  PHE A CZ   8  
ATOM 11394 H H    . PHE A 1 53  ? -5.190  -5.571  1.711   1.00 0.00 ? 53  PHE A H    8  
ATOM 11395 H HA   . PHE A 1 53  ? -5.967  -7.880  0.427   1.00 0.00 ? 53  PHE A HA   8  
ATOM 11396 H HB2  . PHE A 1 53  ? -4.753  -6.213  -0.786  1.00 0.00 ? 53  PHE A HB2  8  
ATOM 11397 H HB3  . PHE A 1 53  ? -3.360  -6.365  0.280   1.00 0.00 ? 53  PHE A HB3  8  
ATOM 11398 H HD1  . PHE A 1 53  ? -1.859  -8.277  0.102   1.00 0.00 ? 53  PHE A HD1  8  
ATOM 11399 H HD2  . PHE A 1 53  ? -5.145  -7.778  -2.557  1.00 0.00 ? 53  PHE A HD2  8  
ATOM 11400 H HE1  . PHE A 1 53  ? -0.873  -9.938  -1.422  1.00 0.00 ? 53  PHE A HE1  8  
ATOM 11401 H HE2  . PHE A 1 53  ? -4.165  -9.440  -4.085  1.00 0.00 ? 53  PHE A HE2  8  
ATOM 11402 H HZ   . PHE A 1 53  ? -2.026  -10.521 -3.519  1.00 0.00 ? 53  PHE A HZ   8  
ATOM 11403 N N    . LYS A 1 54  ? -3.414  -8.371  2.448   1.00 0.00 ? 54  LYS A N    8  
ATOM 11404 C CA   . LYS A 1 54  ? -2.654  -9.394  3.156   1.00 0.00 ? 54  LYS A CA   8  
ATOM 11405 C C    . LYS A 1 54  ? -3.583  -10.444 3.757   1.00 0.00 ? 54  LYS A C    8  
ATOM 11406 O O    . LYS A 1 54  ? -3.470  -11.633 3.458   1.00 0.00 ? 54  LYS A O    8  
ATOM 11407 C CB   . LYS A 1 54  ? -1.806  -8.757  4.259   1.00 0.00 ? 54  LYS A CB   8  
ATOM 11408 C CG   . LYS A 1 54  ? -0.689  -7.871  3.733   1.00 0.00 ? 54  LYS A CG   8  
ATOM 11409 C CD   . LYS A 1 54  ? 0.488   -7.830  4.692   1.00 0.00 ? 54  LYS A CD   8  
ATOM 11410 C CE   . LYS A 1 54  ? 1.348   -9.079  4.574   1.00 0.00 ? 54  LYS A CE   8  
ATOM 11411 N NZ   . LYS A 1 54  ? 0.863   -10.172 5.462   1.00 0.00 ? 54  LYS A NZ   8  
ATOM 11412 H H    . LYS A 1 54  ? -3.237  -7.425  2.639   1.00 0.00 ? 54  LYS A H    8  
ATOM 11413 H HA   . LYS A 1 54  ? -2.000  -9.874  2.443   1.00 0.00 ? 54  LYS A HA   8  
ATOM 11414 H HB2  . LYS A 1 54  ? -2.447  -8.157  4.888   1.00 0.00 ? 54  LYS A HB2  8  
ATOM 11415 H HB3  . LYS A 1 54  ? -1.363  -9.542  4.855   1.00 0.00 ? 54  LYS A HB3  8  
ATOM 11416 H HG2  . LYS A 1 54  ? -0.352  -8.259  2.783   1.00 0.00 ? 54  LYS A HG2  8  
ATOM 11417 H HG3  . LYS A 1 54  ? -1.070  -6.868  3.600   1.00 0.00 ? 54  LYS A HG3  8  
ATOM 11418 H HD2  . LYS A 1 54  ? 1.096   -6.966  4.466   1.00 0.00 ? 54  LYS A HD2  8  
ATOM 11419 H HD3  . LYS A 1 54  ? 0.115   -7.754  5.704   1.00 0.00 ? 54  LYS A HD3  8  
ATOM 11420 H HE2  . LYS A 1 54  ? 1.324   -9.421  3.551   1.00 0.00 ? 54  LYS A HE2  8  
ATOM 11421 H HE3  . LYS A 1 54  ? 2.363   -8.829  4.846   1.00 0.00 ? 54  LYS A HE3  8  
ATOM 11422 H HZ1  . LYS A 1 54  ? 0.230   -9.785  6.191   1.00 0.00 ? 54  LYS A HZ1  8  
ATOM 11423 H HZ2  . LYS A 1 54  ? 1.668   -10.635 5.930   1.00 0.00 ? 54  LYS A HZ2  8  
ATOM 11424 H HZ3  . LYS A 1 54  ? 0.344   -10.880 4.907   1.00 0.00 ? 54  LYS A HZ3  8  
ATOM 11425 N N    . THR A 1 55  ? -4.504  -9.997  4.605   1.00 0.00 ? 55  THR A N    8  
ATOM 11426 C CA   . THR A 1 55  ? -5.453  -10.897 5.247   1.00 0.00 ? 55  THR A CA   8  
ATOM 11427 C C    . THR A 1 55  ? -6.056  -11.869 4.241   1.00 0.00 ? 55  THR A C    8  
ATOM 11428 O O    . THR A 1 55  ? -6.140  -13.070 4.496   1.00 0.00 ? 55  THR A O    8  
ATOM 11429 C CB   . THR A 1 55  ? -6.589  -10.118 5.936   1.00 0.00 ? 55  THR A CB   8  
ATOM 11430 O OG1  . THR A 1 55  ? -6.049  -9.238  6.928   1.00 0.00 ? 55  THR A OG1  8  
ATOM 11431 C CG2  . THR A 1 55  ? -7.584  -11.070 6.583   1.00 0.00 ? 55  THR A CG2  8  
ATOM 11432 H H    . THR A 1 55  ? -4.544  -9.038  4.803   1.00 0.00 ? 55  THR A H    8  
ATOM 11433 H HA   . THR A 1 55  ? -4.921  -11.459 6.002   1.00 0.00 ? 55  THR A HA   8  
ATOM 11434 H HB   . THR A 1 55  ? -7.107  -9.532  5.190   1.00 0.00 ? 55  THR A HB   8  
ATOM 11435 H HG1  . THR A 1 55  ? -6.052  -9.677  7.782   1.00 0.00 ? 55  THR A HG1  8  
ATOM 11436 H HG21 . THR A 1 55  ? -8.259  -10.511 7.213   1.00 0.00 ? 55  THR A HG21 8  
ATOM 11437 H HG22 . THR A 1 55  ? -7.051  -11.795 7.179   1.00 0.00 ? 55  THR A HG22 8  
ATOM 11438 H HG23 . THR A 1 55  ? -8.146  -11.578 5.815   1.00 0.00 ? 55  THR A HG23 8  
ATOM 11439 N N    . ASN A 1 56  ? -6.475  -11.343 3.094   1.00 0.00 ? 56  ASN A N    8  
ATOM 11440 C CA   . ASN A 1 56  ? -7.071  -12.166 2.048   1.00 0.00 ? 56  ASN A CA   8  
ATOM 11441 C C    . ASN A 1 56  ? -6.734  -11.616 0.665   1.00 0.00 ? 56  ASN A C    8  
ATOM 11442 O O    . ASN A 1 56  ? -7.284  -10.609 0.219   1.00 0.00 ? 56  ASN A O    8  
ATOM 11443 C CB   . ASN A 1 56  ? -8.589  -12.233 2.226   1.00 0.00 ? 56  ASN A CB   8  
ATOM 11444 C CG   . ASN A 1 56  ? -9.177  -13.526 1.694   1.00 0.00 ? 56  ASN A CG   8  
ATOM 11445 O OD1  . ASN A 1 56  ? -8.565  -14.589 1.800   1.00 0.00 ? 56  ASN A OD1  8  
ATOM 11446 N ND2  . ASN A 1 56  ? -10.370 -13.440 1.117   1.00 0.00 ? 56  ASN A ND2  8  
ATOM 11447 H H    . ASN A 1 56  ? -6.382  -10.378 2.949   1.00 0.00 ? 56  ASN A H    8  
ATOM 11448 H HA   . ASN A 1 56  ? -6.663  -13.161 2.136   1.00 0.00 ? 56  ASN A HA   8  
ATOM 11449 H HB2  . ASN A 1 56  ? -8.826  -12.158 3.278   1.00 0.00 ? 56  ASN A HB2  8  
ATOM 11450 H HB3  . ASN A 1 56  ? -9.045  -11.408 1.700   1.00 0.00 ? 56  ASN A HB3  8  
ATOM 11451 H HD21 . ASN A 1 56  ? -10.799 -12.559 1.068   1.00 0.00 ? 56  ASN A HD21 8  
ATOM 11452 H HD22 . ASN A 1 56  ? -10.774 -14.260 0.765   1.00 0.00 ? 56  ASN A HD22 8  
ATOM 11453 N N    . PRO A 1 57  ? -5.809  -12.292 -0.031  1.00 0.00 ? 57  PRO A N    8  
ATOM 11454 C CA   . PRO A 1 57  ? -5.378  -11.891 -1.373  1.00 0.00 ? 57  PRO A CA   8  
ATOM 11455 C C    . PRO A 1 57  ? -6.465  -12.108 -2.420  1.00 0.00 ? 57  PRO A C    8  
ATOM 11456 O O    . PRO A 1 57  ? -6.374  -11.600 -3.538  1.00 0.00 ? 57  PRO A O    8  
ATOM 11457 C CB   . PRO A 1 57  ? -4.180  -12.804 -1.649  1.00 0.00 ? 57  PRO A CB   8  
ATOM 11458 C CG   . PRO A 1 57  ? -4.412  -14.002 -0.795  1.00 0.00 ? 57  PRO A CG   8  
ATOM 11459 C CD   . PRO A 1 57  ? -5.112  -13.502 0.439   1.00 0.00 ? 57  PRO A CD   8  
ATOM 11460 H HA   . PRO A 1 57  ? -5.059  -10.859 -1.396  1.00 0.00 ? 57  PRO A HA   8  
ATOM 11461 H HB2  . PRO A 1 57  ? -4.157  -13.064 -2.698  1.00 0.00 ? 57  PRO A HB2  8  
ATOM 11462 H HB3  . PRO A 1 57  ? -3.267  -12.297 -1.378  1.00 0.00 ? 57  PRO A HB3  8  
ATOM 11463 H HG2  . PRO A 1 57  ? -5.036  -14.711 -1.318  1.00 0.00 ? 57  PRO A HG2  8  
ATOM 11464 H HG3  . PRO A 1 57  ? -3.467  -14.454 -0.532  1.00 0.00 ? 57  PRO A HG3  8  
ATOM 11465 H HD2  . PRO A 1 57  ? -5.816  -14.238 0.798   1.00 0.00 ? 57  PRO A HD2  8  
ATOM 11466 H HD3  . PRO A 1 57  ? -4.393  -13.258 1.207   1.00 0.00 ? 57  PRO A HD3  8  
ATOM 11467 N N    . CYS A 1 58  ? -7.493  -12.864 -2.051  1.00 0.00 ? 58  CYS A N    8  
ATOM 11468 C CA   . CYS A 1 58  ? -8.598  -13.149 -2.959  1.00 0.00 ? 58  CYS A CA   8  
ATOM 11469 C C    . CYS A 1 58  ? -9.922  -12.672 -2.369  1.00 0.00 ? 58  CYS A C    8  
ATOM 11470 O O    . CYS A 1 58  ? -10.940 -13.356 -2.471  1.00 0.00 ? 58  CYS A O    8  
ATOM 11471 C CB   . CYS A 1 58  ? -8.668  -14.647 -3.257  1.00 0.00 ? 58  CYS A CB   8  
ATOM 11472 S SG   . CYS A 1 58  ? -8.993  -15.674 -1.805  1.00 0.00 ? 58  CYS A SG   8  
ATOM 11473 H H    . CYS A 1 58  ? -7.509  -13.241 -1.146  1.00 0.00 ? 58  CYS A H    8  
ATOM 11474 H HA   . CYS A 1 58  ? -8.416  -12.615 -3.879  1.00 0.00 ? 58  CYS A HA   8  
ATOM 11475 H HB2  . CYS A 1 58  ? -9.459  -14.828 -3.970  1.00 0.00 ? 58  CYS A HB2  8  
ATOM 11476 H HB3  . CYS A 1 58  ? -7.729  -14.966 -3.683  1.00 0.00 ? 58  CYS A HB3  8  
ATOM 11477 H HG   . CYS A 1 58  ? -8.201  -16.733 -1.868  1.00 0.00 ? 58  CYS A HG   8  
ATOM 11478 N N    . GLY A 1 59  ? -9.900  -11.495 -1.751  1.00 0.00 ? 59  GLY A N    8  
ATOM 11479 C CA   . GLY A 1 59  ? -11.104 -10.949 -1.153  1.00 0.00 ? 59  GLY A CA   8  
ATOM 11480 C C    . GLY A 1 59  ? -11.357 -9.513  -1.568  1.00 0.00 ? 59  GLY A C    8  
ATOM 11481 O O    . GLY A 1 59  ? -10.758 -9.021  -2.525  1.00 0.00 ? 59  GLY A O    8  
ATOM 11482 H H    . GLY A 1 59  ? -9.059  -10.994 -1.701  1.00 0.00 ? 59  GLY A H    8  
ATOM 11483 H HA2  . GLY A 1 59  ? -11.947 -11.553 -1.451  1.00 0.00 ? 59  GLY A HA2  8  
ATOM 11484 H HA3  . GLY A 1 59  ? -11.007 -10.989 -0.078  1.00 0.00 ? 59  GLY A HA3  8  
ATOM 11485 N N    . SER A 1 60  ? -12.248 -8.839  -0.848  1.00 0.00 ? 60  SER A N    8  
ATOM 11486 C CA   . SER A 1 60  ? -12.583 -7.452  -1.150  1.00 0.00 ? 60  SER A CA   8  
ATOM 11487 C C    . SER A 1 60  ? -12.581 -6.604  0.118   1.00 0.00 ? 60  SER A C    8  
ATOM 11488 O O    . SER A 1 60  ? -12.883 -7.095  1.206   1.00 0.00 ? 60  SER A O    8  
ATOM 11489 C CB   . SER A 1 60  ? -13.953 -7.373  -1.828  1.00 0.00 ? 60  SER A CB   8  
ATOM 11490 O OG   . SER A 1 60  ? -14.921 -8.117  -1.109  1.00 0.00 ? 60  SER A OG   8  
ATOM 11491 H H    . SER A 1 60  ? -12.692 -9.286  -0.097  1.00 0.00 ? 60  SER A H    8  
ATOM 11492 H HA   . SER A 1 60  ? -11.833 -7.070  -1.826  1.00 0.00 ? 60  SER A HA   8  
ATOM 11493 H HB2  . SER A 1 60  ? -14.269 -6.342  -1.874  1.00 0.00 ? 60  SER A HB2  8  
ATOM 11494 H HB3  . SER A 1 60  ? -13.879 -7.772  -2.829  1.00 0.00 ? 60  SER A HB3  8  
ATOM 11495 H HG   . SER A 1 60  ? -15.121 -7.669  -0.284  1.00 0.00 ? 60  SER A HG   8  
ATOM 11496 N N    . ILE A 1 61  ? -12.239 -5.329  -0.031  1.00 0.00 ? 61  ILE A N    8  
ATOM 11497 C CA   . ILE A 1 61  ? -12.198 -4.412  1.101   1.00 0.00 ? 61  ILE A CA   8  
ATOM 11498 C C    . ILE A 1 61  ? -13.322 -3.384  1.016   1.00 0.00 ? 61  ILE A C    8  
ATOM 11499 O O    . ILE A 1 61  ? -13.285 -2.476  0.187   1.00 0.00 ? 61  ILE A O    8  
ATOM 11500 C CB   . ILE A 1 61  ? -10.848 -3.674  1.180   1.00 0.00 ? 61  ILE A CB   8  
ATOM 11501 C CG1  . ILE A 1 61  ? -10.905 -2.574  2.241   1.00 0.00 ? 61  ILE A CG1  8  
ATOM 11502 C CG2  . ILE A 1 61  ? -10.483 -3.091  -0.177  1.00 0.00 ? 61  ILE A CG2  8  
ATOM 11503 C CD1  . ILE A 1 61  ? -9.555  -1.969  2.557   1.00 0.00 ? 61  ILE A CD1  8  
ATOM 11504 H H    . ILE A 1 61  ? -12.009 -4.997  -0.924  1.00 0.00 ? 61  ILE A H    8  
ATOM 11505 H HA   . ILE A 1 61  ? -12.322 -4.992  2.004   1.00 0.00 ? 61  ILE A HA   8  
ATOM 11506 H HB   . ILE A 1 61  ? -10.088 -4.390  1.453   1.00 0.00 ? 61  ILE A HB   8  
ATOM 11507 H HG12 . ILE A 1 61  ? -11.549 -1.781  1.895   1.00 0.00 ? 61  ILE A HG12 8  
ATOM 11508 H HG13 . ILE A 1 61  ? -11.307 -2.986  3.155   1.00 0.00 ? 61  ILE A HG13 8  
ATOM 11509 H HG21 . ILE A 1 61  ? -11.376 -2.984  -0.775  1.00 0.00 ? 61  ILE A HG21 8  
ATOM 11510 H HG22 . ILE A 1 61  ? -10.025 -2.123  -0.041  1.00 0.00 ? 61  ILE A HG22 8  
ATOM 11511 H HG23 . ILE A 1 61  ? -9.791  -3.750  -0.679  1.00 0.00 ? 61  ILE A HG23 8  
ATOM 11512 H HD11 . ILE A 1 61  ? -9.691  -0.995  3.003   1.00 0.00 ? 61  ILE A HD11 8  
ATOM 11513 H HD12 . ILE A 1 61  ? -9.025  -2.611  3.245   1.00 0.00 ? 61  ILE A HD12 8  
ATOM 11514 H HD13 . ILE A 1 61  ? -8.983  -1.870  1.646   1.00 0.00 ? 61  ILE A HD13 8  
ATOM 11515 N N    . SER A 1 62  ? -14.319 -3.533  1.882   1.00 0.00 ? 62  SER A N    8  
ATOM 11516 C CA   . SER A 1 62  ? -15.455 -2.620  1.905   1.00 0.00 ? 62  SER A CA   8  
ATOM 11517 C C    . SER A 1 62  ? -15.275 -1.556  2.984   1.00 0.00 ? 62  SER A C    8  
ATOM 11518 O O    . SER A 1 62  ? -15.283 -1.858  4.177   1.00 0.00 ? 62  SER A O    8  
ATOM 11519 C CB   . SER A 1 62  ? -16.753 -3.392  2.146   1.00 0.00 ? 62  SER A CB   8  
ATOM 11520 O OG   . SER A 1 62  ? -16.709 -4.091  3.378   1.00 0.00 ? 62  SER A OG   8  
ATOM 11521 H H    . SER A 1 62  ? -14.291 -4.278  2.520   1.00 0.00 ? 62  SER A H    8  
ATOM 11522 H HA   . SER A 1 62  ? -15.509 -2.134  0.942   1.00 0.00 ? 62  SER A HA   8  
ATOM 11523 H HB2  . SER A 1 62  ? -17.582 -2.701  2.168   1.00 0.00 ? 62  SER A HB2  8  
ATOM 11524 H HB3  . SER A 1 62  ? -16.899 -4.104  1.347   1.00 0.00 ? 62  SER A HB3  8  
ATOM 11525 H HG   . SER A 1 62  ? -15.933 -4.655  3.399   1.00 0.00 ? 62  SER A HG   8  
ATOM 11526 N N    . PHE A 1 63  ? -15.113 -0.309  2.555   1.00 0.00 ? 63  PHE A N    8  
ATOM 11527 C CA   . PHE A 1 63  ? -14.930 0.801   3.482   1.00 0.00 ? 63  PHE A CA   8  
ATOM 11528 C C    . PHE A 1 63  ? -15.821 1.980   3.103   1.00 0.00 ? 63  PHE A C    8  
ATOM 11529 O O    . PHE A 1 63  ? -16.159 2.168   1.934   1.00 0.00 ? 63  PHE A O    8  
ATOM 11530 C CB   . PHE A 1 63  ? -13.464 1.241   3.502   1.00 0.00 ? 63  PHE A CB   8  
ATOM 11531 C CG   . PHE A 1 63  ? -13.010 1.871   2.216   1.00 0.00 ? 63  PHE A CG   8  
ATOM 11532 C CD1  . PHE A 1 63  ? -13.366 3.173   1.903   1.00 0.00 ? 63  PHE A CD1  8  
ATOM 11533 C CD2  . PHE A 1 63  ? -12.228 1.161   1.320   1.00 0.00 ? 63  PHE A CD2  8  
ATOM 11534 C CE1  . PHE A 1 63  ? -12.951 3.754   0.720   1.00 0.00 ? 63  PHE A CE1  8  
ATOM 11535 C CE2  . PHE A 1 63  ? -11.809 1.737   0.135   1.00 0.00 ? 63  PHE A CE2  8  
ATOM 11536 C CZ   . PHE A 1 63  ? -12.170 3.036   -0.164  1.00 0.00 ? 63  PHE A CZ   8  
ATOM 11537 H H    . PHE A 1 63  ? -15.116 -0.131  1.590   1.00 0.00 ? 63  PHE A H    8  
ATOM 11538 H HA   . PHE A 1 63  ? -15.207 0.458   4.467   1.00 0.00 ? 63  PHE A HA   8  
ATOM 11539 H HB2  . PHE A 1 63  ? -13.323 1.963   4.292   1.00 0.00 ? 63  PHE A HB2  8  
ATOM 11540 H HB3  . PHE A 1 63  ? -12.840 0.381   3.690   1.00 0.00 ? 63  PHE A HB3  8  
ATOM 11541 H HD1  . PHE A 1 63  ? -13.976 3.737   2.594   1.00 0.00 ? 63  PHE A HD1  8  
ATOM 11542 H HD2  . PHE A 1 63  ? -11.944 0.144   1.554   1.00 0.00 ? 63  PHE A HD2  8  
ATOM 11543 H HE1  . PHE A 1 63  ? -13.234 4.770   0.488   1.00 0.00 ? 63  PHE A HE1  8  
ATOM 11544 H HE2  . PHE A 1 63  ? -11.198 1.172   -0.554  1.00 0.00 ? 63  PHE A HE2  8  
ATOM 11545 H HZ   . PHE A 1 63  ? -11.844 3.487   -1.089  1.00 0.00 ? 63  PHE A HZ   8  
ATOM 11546 N N    . THR A 1 64  ? -16.201 2.773   4.100   1.00 0.00 ? 64  THR A N