data_2DLH
# 
_entry.id   2DLH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DLH         
RCSB  RCSB025554   
WWPDB D_1000025554 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso002001101.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DLH 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-18 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Seimiya, K.'                                            1 
'Hayashi, F.'                                            2 
'Yoshida, M.'                                            3 
'Yokoyama, S.'                                           4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Seimiya, K.'  1 
primary 'Hayashi, F.'  2 
primary 'Yoshida, M.'  3 
primary 'Yokoyama, S.' 4 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Receptor-type tyrosine-protein phosphatase delta' 
_entity.formula_weight             12933.229 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.1.3.48 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'fn3, Fibronectin type-III' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein-tyrosine phosphatase delta, R-PTP-delta' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTI
GNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTI
GNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso002001101.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   PRO n 
1 9   VAL n 
1 10  LEU n 
1 11  THR n 
1 12  GLN n 
1 13  THR n 
1 14  SER n 
1 15  GLU n 
1 16  GLN n 
1 17  ALA n 
1 18  PRO n 
1 19  SER n 
1 20  SER n 
1 21  ALA n 
1 22  PRO n 
1 23  ARG n 
1 24  ASP n 
1 25  VAL n 
1 26  GLN n 
1 27  ALA n 
1 28  ARG n 
1 29  MET n 
1 30  LEU n 
1 31  SER n 
1 32  SER n 
1 33  THR n 
1 34  THR n 
1 35  ILE n 
1 36  LEU n 
1 37  VAL n 
1 38  GLN n 
1 39  TRP n 
1 40  LYS n 
1 41  GLU n 
1 42  PRO n 
1 43  GLU n 
1 44  GLU n 
1 45  PRO n 
1 46  ASN n 
1 47  GLY n 
1 48  GLN n 
1 49  ILE n 
1 50  GLN n 
1 51  GLY n 
1 52  TYR n 
1 53  ARG n 
1 54  VAL n 
1 55  TYR n 
1 56  TYR n 
1 57  THR n 
1 58  MET n 
1 59  ASP n 
1 60  PRO n 
1 61  THR n 
1 62  GLN n 
1 63  HIS n 
1 64  VAL n 
1 65  ASN n 
1 66  ASN n 
1 67  TRP n 
1 68  MET n 
1 69  LYS n 
1 70  HIS n 
1 71  ASN n 
1 72  VAL n 
1 73  ALA n 
1 74  ASP n 
1 75  SER n 
1 76  GLN n 
1 77  ILE n 
1 78  THR n 
1 79  THR n 
1 80  ILE n 
1 81  GLY n 
1 82  ASN n 
1 83  LEU n 
1 84  VAL n 
1 85  PRO n 
1 86  GLN n 
1 87  LYS n 
1 88  THR n 
1 89  TYR n 
1 90  SER n 
1 91  VAL n 
1 92  LYS n 
1 93  VAL n 
1 94  LEU n 
1 95  ALA n 
1 96  PHE n 
1 97  THR n 
1 98  SER n 
1 99  ILE n 
1 100 GLY n 
1 101 ASP n 
1 102 GLY n 
1 103 PRO n 
1 104 LEU n 
1 105 SER n 
1 106 SER n 
1 107 ASP n 
1 108 ILE n 
1 109 GLN n 
1 110 VAL n 
1 111 ILE n 
1 112 THR n 
1 113 GLN n 
1 114 THR n 
1 115 GLY n 
1 116 SER n 
1 117 GLY n 
1 118 PRO n 
1 119 SER n 
1 120 SER n 
1 121 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PTPRD 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell free synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050302-29 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTPRD_HUMAN 
_struct_ref.pdbx_db_accession          P23468 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           405 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DLH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 115 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P23468 
_struct_ref_seq.db_align_beg                  405 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  514 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DLH GLY A 1   ? UNP P23468 ? ? 'CLONING ARTIFACT' 1   1  
1 2DLH SER A 2   ? UNP P23468 ? ? 'CLONING ARTIFACT' 2   2  
1 2DLH SER A 3   ? UNP P23468 ? ? 'CLONING ARTIFACT' 3   3  
1 2DLH GLY A 4   ? UNP P23468 ? ? 'CLONING ARTIFACT' 4   4  
1 2DLH SER A 5   ? UNP P23468 ? ? 'CLONING ARTIFACT' 5   5  
1 2DLH SER A 6   ? UNP P23468 ? ? 'CLONING ARTIFACT' 6   6  
1 2DLH GLY A 7   ? UNP P23468 ? ? 'CLONING ARTIFACT' 7   7  
1 2DLH SER A 116 ? UNP P23468 ? ? 'CLONING ARTIFACT' 116 8  
1 2DLH GLY A 117 ? UNP P23468 ? ? 'CLONING ARTIFACT' 117 9  
1 2DLH PRO A 118 ? UNP P23468 ? ? 'CLONING ARTIFACT' 118 10 
1 2DLH SER A 119 ? UNP P23468 ? ? 'CLONING ARTIFACT' 119 11 
1 2DLH SER A 120 ? UNP P23468 ? ? 'CLONING ARTIFACT' 120 12 
1 2DLH GLY A 121 ? UNP P23468 ? ? 'CLONING ARTIFACT' 121 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1.33mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 
1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 800 ? 
2 INOVA Varian 900 ? 
# 
_pdbx_nmr_ensemble.entry_id                                      2DLH 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DLH 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9742   'Kobayashi, N.' 4 
'structure solution' CYANA   2.1      'Guntert, P.'   5 
refinement           CYANA   2.1      'Guntert, P.'   6 
# 
_exptl.entry_id          2DLH 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DLH 
_struct.title                     
'Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta' 
_struct.pdbx_descriptor           'Receptor-type tyrosine-protein phosphatase delta (E.C.3.1.3.48)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DLH 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;Protein-tyrosine phosphatase delta, R-PTP-delta, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 23  ? ALA A 27  ? ARG A 23  ALA A 27  
A 2 VAL A 37  ? LYS A 40  ? VAL A 37  LYS A 40  
A 3 ILE A 77  ? THR A 78  ? ILE A 77  THR A 78  
B 1 ILE A 49  ? TYR A 55  ? ILE A 49  TYR A 55  
B 2 THR A 88  ? THR A 97  ? THR A 88  THR A 97  
B 3 ILE A 108 ? ILE A 111 ? ILE A 108 ILE A 111 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 23 ? N ARG A 23 O LYS A 40  ? O LYS A 40  
A 2 3 N VAL A 37 ? N VAL A 37 O THR A 78  ? O THR A 78  
B 1 2 N TYR A 55 ? N TYR A 55 O LYS A 92  ? O LYS A 92  
B 2 3 N TYR A 89 ? N TYR A 89 O VAL A 110 ? O VAL A 110 
# 
_database_PDB_matrix.entry_id          2DLH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DLH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 14.495  22.676  18.564  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 15.183  23.933  18.338  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 15.388  24.224  16.864  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 16.439  24.726  16.464  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 15.011  21.859  18.728  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 14.604  24.732  18.774  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 16.147  23.894  18.822  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 14.383  23.907  16.055  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 14.460  24.133  14.616  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 13.741  25.422  14.228  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 12.753  25.806  14.854  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 13.853  22.950  13.860  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 12.437  22.999  13.887  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 13.570  23.510  16.433  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 15.503  24.223  14.350  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 14.181  22.976  12.832  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 14.178  22.027  14.319  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 12.086  22.109  13.964  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 14.245  26.084  13.192  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 13.653  27.333  12.723  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 12.635  27.070  11.618  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 12.936  26.406  10.626  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 14.744  28.278  12.214  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 14.180  29.451  11.654  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 15.034  25.727  12.735  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 13.149  27.796  13.559  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 15.386  28.558  13.035  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 15.326  27.774  11.455  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 14.867  30.110  11.534  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 11.427  27.594  11.798  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 10.382  27.406  10.808  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 9.211   28.346  11.017  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 8.678   28.907  10.058  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 11.244  28.114  12.608  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 10.797  27.576  9.826   1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 10.026  26.389  10.868  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 8.808   28.518  12.272  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 7.688   29.393  12.602  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 8.175   30.660  13.297  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 8.057   30.797  14.515  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 6.687   28.659  13.496  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 6.103   27.562  12.815  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 9.272   28.043  12.992  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 7.199   29.667  11.679  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 7.195   28.292  14.375  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 5.905   29.343  13.792  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 5.211   27.421  13.141  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 8.723   31.584  12.514  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 9.233   32.838  13.053  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 8.087   33.767  13.444  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 7.987   34.200  14.591  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 10.138  33.529  12.031  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 9.786   33.160  10.709  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 8.789   31.415  11.551  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 9.811   32.609  13.937  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 10.040  34.598  12.131  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 11.164  33.242  12.211  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 10.581  32.965  10.207  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 7.224   34.070  12.478  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 6.096   34.945  12.738  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 4.923   34.669  11.819  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 4.934   33.724  11.030  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 7.354   33.696  11.582  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 5.778   34.809  13.762  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 6.411   35.969  12.604  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . PRO A 1 8   ? 3.880   35.508  11.915  1.00 0.00 ? 8   PRO A N    1  
ATOM 67    C CA   . PRO A 1 8   ? 2.675   35.369  11.093  1.00 0.00 ? 8   PRO A CA   1  
ATOM 68    C C    . PRO A 1 8   ? 2.932   35.699  9.627   1.00 0.00 ? 8   PRO A C    1  
ATOM 69    O O    . PRO A 1 8   ? 3.898   36.386  9.295   1.00 0.00 ? 8   PRO A O    1  
ATOM 70    C CB   . PRO A 1 8   ? 1.707   36.383  11.708  1.00 0.00 ? 8   PRO A CB   1  
ATOM 71    C CG   . PRO A 1 8   ? 2.584   37.401  12.353  1.00 0.00 ? 8   PRO A CG   1  
ATOM 72    C CD   . PRO A 1 8   ? 3.799   36.656  12.833  1.00 0.00 ? 8   PRO A CD   1  
ATOM 73    H HA   . PRO A 1 8   ? 2.255   34.376  11.169  1.00 0.00 ? 8   PRO A HA   1  
ATOM 74    H HB2  . PRO A 1 8   ? 1.097   36.821  10.930  1.00 0.00 ? 8   PRO A HB2  1  
ATOM 75    H HB3  . PRO A 1 8   ? 1.077   35.890  12.434  1.00 0.00 ? 8   PRO A HB3  1  
ATOM 76    H HG2  . PRO A 1 8   ? 2.866   38.152  11.630  1.00 0.00 ? 8   PRO A HG2  1  
ATOM 77    H HG3  . PRO A 1 8   ? 2.069   37.854  13.186  1.00 0.00 ? 8   PRO A HG3  1  
ATOM 78    H HD2  . PRO A 1 8   ? 4.679   37.277  12.752  1.00 0.00 ? 8   PRO A HD2  1  
ATOM 79    H HD3  . PRO A 1 8   ? 3.661   36.325  13.852  1.00 0.00 ? 8   PRO A HD3  1  
ATOM 80    N N    . VAL A 1 9   ? 2.060   35.207  8.752   1.00 0.00 ? 9   VAL A N    1  
ATOM 81    C CA   . VAL A 1 9   ? 2.192   35.452  7.321   1.00 0.00 ? 9   VAL A CA   1  
ATOM 82    C C    . VAL A 1 9   ? 3.522   34.926  6.794   1.00 0.00 ? 9   VAL A C    1  
ATOM 83    O O    . VAL A 1 9   ? 4.441   35.697  6.516   1.00 0.00 ? 9   VAL A O    1  
ATOM 84    C CB   . VAL A 1 9   ? 2.081   36.953  6.996   1.00 0.00 ? 9   VAL A CB   1  
ATOM 85    C CG1  . VAL A 1 9   ? 2.043   37.173  5.491   1.00 0.00 ? 9   VAL A CG1  1  
ATOM 86    C CG2  . VAL A 1 9   ? 0.852   37.553  7.661   1.00 0.00 ? 9   VAL A CG2  1  
ATOM 87    H H    . VAL A 1 9   ? 1.309   34.667  9.078   1.00 0.00 ? 9   VAL A H    1  
ATOM 88    H HA   . VAL A 1 9   ? 1.386   34.936  6.819   1.00 0.00 ? 9   VAL A HA   1  
ATOM 89    H HB   . VAL A 1 9   ? 2.955   37.452  7.388   1.00 0.00 ? 9   VAL A HB   1  
ATOM 90    H HG11 . VAL A 1 9   ? 1.313   37.934  5.257   1.00 0.00 ? 9   VAL A HG11 1  
ATOM 91    H HG12 . VAL A 1 9   ? 3.016   37.489  5.148   1.00 0.00 ? 9   VAL A HG12 1  
ATOM 92    H HG13 . VAL A 1 9   ? 1.769   36.250  5.001   1.00 0.00 ? 9   VAL A HG13 1  
ATOM 93    H HG21 . VAL A 1 9   ? 1.123   37.950  8.629   1.00 0.00 ? 9   VAL A HG21 1  
ATOM 94    H HG22 . VAL A 1 9   ? 0.458   38.347  7.044   1.00 0.00 ? 9   VAL A HG22 1  
ATOM 95    H HG23 . VAL A 1 9   ? 0.099   36.788  7.785   1.00 0.00 ? 9   VAL A HG23 1  
ATOM 96    N N    . LEU A 1 10  ? 3.618   33.608  6.657   1.00 0.00 ? 10  LEU A N    1  
ATOM 97    C CA   . LEU A 1 10  ? 4.836   32.977  6.161   1.00 0.00 ? 10  LEU A CA   1  
ATOM 98    C C    . LEU A 1 10  ? 4.881   33.002  4.637   1.00 0.00 ? 10  LEU A C    1  
ATOM 99    O O    . LEU A 1 10  ? 3.927   33.426  3.983   1.00 0.00 ? 10  LEU A O    1  
ATOM 100   C CB   . LEU A 1 10  ? 4.927   31.534  6.662   1.00 0.00 ? 10  LEU A CB   1  
ATOM 101   C CG   . LEU A 1 10  ? 5.142   31.359  8.166   1.00 0.00 ? 10  LEU A CG   1  
ATOM 102   C CD1  . LEU A 1 10  ? 4.386   30.141  8.675   1.00 0.00 ? 10  LEU A CD1  1  
ATOM 103   C CD2  . LEU A 1 10  ? 6.625   31.239  8.483   1.00 0.00 ? 10  LEU A CD2  1  
ATOM 104   H H    . LEU A 1 10  ? 2.852   33.045  6.894   1.00 0.00 ? 10  LEU A H    1  
ATOM 105   H HA   . LEU A 1 10  ? 5.677   33.536  6.543   1.00 0.00 ? 10  LEU A HA   1  
ATOM 106   H HB2  . LEU A 1 10  ? 4.007   31.035  6.399   1.00 0.00 ? 10  LEU A HB2  1  
ATOM 107   H HB3  . LEU A 1 10  ? 5.752   31.059  6.151   1.00 0.00 ? 10  LEU A HB3  1  
ATOM 108   H HG   . LEU A 1 10  ? 4.757   32.228  8.682   1.00 0.00 ? 10  LEU A HG   1  
ATOM 109   H HD11 . LEU A 1 10  ? 4.853   29.244  8.297   1.00 0.00 ? 10  LEU A HD11 1  
ATOM 110   H HD12 . LEU A 1 10  ? 3.363   30.184  8.333   1.00 0.00 ? 10  LEU A HD12 1  
ATOM 111   H HD13 . LEU A 1 10  ? 4.404   30.130  9.754   1.00 0.00 ? 10  LEU A HD13 1  
ATOM 112   H HD21 . LEU A 1 10  ? 7.192   31.825  7.774   1.00 0.00 ? 10  LEU A HD21 1  
ATOM 113   H HD22 . LEU A 1 10  ? 6.925   30.203  8.416   1.00 0.00 ? 10  LEU A HD22 1  
ATOM 114   H HD23 . LEU A 1 10  ? 6.811   31.604  9.482   1.00 0.00 ? 10  LEU A HD23 1  
ATOM 115   N N    . THR A 1 11  ? 5.995   32.541  4.075   1.00 0.00 ? 11  THR A N    1  
ATOM 116   C CA   . THR A 1 11  ? 6.163   32.509  2.627   1.00 0.00 ? 11  THR A CA   1  
ATOM 117   C C    . THR A 1 11  ? 5.172   31.549  1.979   1.00 0.00 ? 11  THR A C    1  
ATOM 118   O O    . THR A 1 11  ? 4.745   31.758  0.845   1.00 0.00 ? 11  THR A O    1  
ATOM 119   C CB   . THR A 1 11  ? 7.594   32.092  2.239   1.00 0.00 ? 11  THR A CB   1  
ATOM 120   O OG1  . THR A 1 11  ? 7.732   32.089  0.813   1.00 0.00 ? 11  THR A OG1  1  
ATOM 121   C CG2  . THR A 1 11  ? 7.924   30.712  2.788   1.00 0.00 ? 11  THR A CG2  1  
ATOM 122   H H    . THR A 1 11  ? 6.719   32.217  4.649   1.00 0.00 ? 11  THR A H    1  
ATOM 123   H HA   . THR A 1 11  ? 5.985   33.505  2.249   1.00 0.00 ? 11  THR A HA   1  
ATOM 124   H HB   . THR A 1 11  ? 8.288   32.806  2.658   1.00 0.00 ? 11  THR A HB   1  
ATOM 125   H HG1  . THR A 1 11  ? 7.802   32.993  0.496   1.00 0.00 ? 11  THR A HG1  1  
ATOM 126   H HG21 . THR A 1 11  ? 7.176   30.425  3.511   1.00 0.00 ? 11  THR A HG21 1  
ATOM 127   H HG22 . THR A 1 11  ? 8.894   30.738  3.264   1.00 0.00 ? 11  THR A HG22 1  
ATOM 128   H HG23 . THR A 1 11  ? 7.938   29.997  1.981   1.00 0.00 ? 11  THR A HG23 1  
ATOM 129   N N    . GLN A 1 12  ? 4.812   30.498  2.708   1.00 0.00 ? 12  GLN A N    1  
ATOM 130   C CA   . GLN A 1 12  ? 3.871   29.506  2.202   1.00 0.00 ? 12  GLN A CA   1  
ATOM 131   C C    . GLN A 1 12  ? 3.218   28.740  3.349   1.00 0.00 ? 12  GLN A C    1  
ATOM 132   O O    . GLN A 1 12  ? 3.902   28.192  4.214   1.00 0.00 ? 12  GLN A O    1  
ATOM 133   C CB   . GLN A 1 12  ? 4.580   28.530  1.261   1.00 0.00 ? 12  GLN A CB   1  
ATOM 134   C CG   . GLN A 1 12  ? 5.708   27.756  1.925   1.00 0.00 ? 12  GLN A CG   1  
ATOM 135   C CD   . GLN A 1 12  ? 6.543   26.973  0.932   1.00 0.00 ? 12  GLN A CD   1  
ATOM 136   O OE1  . GLN A 1 12  ? 6.670   25.753  1.035   1.00 0.00 ? 12  GLN A OE1  1  
ATOM 137   N NE2  . GLN A 1 12  ? 7.119   27.674  -0.039  1.00 0.00 ? 12  GLN A NE2  1  
ATOM 138   H H    . GLN A 1 12  ? 5.187   30.386  3.606   1.00 0.00 ? 12  GLN A H    1  
ATOM 139   H HA   . GLN A 1 12  ? 3.102   30.028  1.652   1.00 0.00 ? 12  GLN A HA   1  
ATOM 140   H HB2  . GLN A 1 12  ? 3.858   27.821  0.885   1.00 0.00 ? 12  GLN A HB2  1  
ATOM 141   H HB3  . GLN A 1 12  ? 4.994   29.085  0.432   1.00 0.00 ? 12  GLN A HB3  1  
ATOM 142   H HG2  . GLN A 1 12  ? 6.351   28.454  2.441   1.00 0.00 ? 12  GLN A HG2  1  
ATOM 143   H HG3  . GLN A 1 12  ? 5.282   27.066  2.639   1.00 0.00 ? 12  GLN A HG3  1  
ATOM 144   H HE21 . GLN A 1 12  ? 6.976   28.643  -0.057  1.00 0.00 ? 12  GLN A HE21 1  
ATOM 145   H HE22 . GLN A 1 12  ? 7.665   27.193  -0.695  1.00 0.00 ? 12  GLN A HE22 1  
ATOM 146   N N    . THR A 1 13  ? 1.889   28.706  3.350   1.00 0.00 ? 13  THR A N    1  
ATOM 147   C CA   . THR A 1 13  ? 1.143   28.010  4.392   1.00 0.00 ? 13  THR A CA   1  
ATOM 148   C C    . THR A 1 13  ? -0.251  27.628  3.908   1.00 0.00 ? 13  THR A C    1  
ATOM 149   O O    . THR A 1 13  ? -1.231  28.310  4.211   1.00 0.00 ? 13  THR A O    1  
ATOM 150   C CB   . THR A 1 13  ? 1.017   28.870  5.662   1.00 0.00 ? 13  THR A CB   1  
ATOM 151   O OG1  . THR A 1 13  ? 1.070   30.259  5.321   1.00 0.00 ? 13  THR A OG1  1  
ATOM 152   C CG2  . THR A 1 13  ? 2.126   28.543  6.650   1.00 0.00 ? 13  THR A CG2  1  
ATOM 153   H H    . THR A 1 13  ? 1.399   29.161  2.634   1.00 0.00 ? 13  THR A H    1  
ATOM 154   H HA   . THR A 1 13  ? 1.685   27.109  4.644   1.00 0.00 ? 13  THR A HA   1  
ATOM 155   H HB   . THR A 1 13  ? 0.065   28.657  6.129   1.00 0.00 ? 13  THR A HB   1  
ATOM 156   H HG1  . THR A 1 13  ? 1.956   30.483  5.028   1.00 0.00 ? 13  THR A HG1  1  
ATOM 157   H HG21 . THR A 1 13  ? 2.964   29.202  6.482   1.00 0.00 ? 13  THR A HG21 1  
ATOM 158   H HG22 . THR A 1 13  ? 2.440   27.518  6.513   1.00 0.00 ? 13  THR A HG22 1  
ATOM 159   H HG23 . THR A 1 13  ? 1.761   28.675  7.658   1.00 0.00 ? 13  THR A HG23 1  
ATOM 160   N N    . SER A 1 14  ? -0.334  26.536  3.155   1.00 0.00 ? 14  SER A N    1  
ATOM 161   C CA   . SER A 1 14  ? -1.609  26.066  2.628   1.00 0.00 ? 14  SER A CA   1  
ATOM 162   C C    . SER A 1 14  ? -1.596  24.552  2.444   1.00 0.00 ? 14  SER A C    1  
ATOM 163   O O    . SER A 1 14  ? -0.871  24.025  1.600   1.00 0.00 ? 14  SER A O    1  
ATOM 164   C CB   . SER A 1 14  ? -1.916  26.751  1.294   1.00 0.00 ? 14  SER A CB   1  
ATOM 165   O OG   . SER A 1 14  ? -1.553  28.120  1.328   1.00 0.00 ? 14  SER A OG   1  
ATOM 166   H H    . SER A 1 14  ? 0.483   26.036  2.949   1.00 0.00 ? 14  SER A H    1  
ATOM 167   H HA   . SER A 1 14  ? -2.378  26.324  3.340   1.00 0.00 ? 14  SER A HA   1  
ATOM 168   H HB2  . SER A 1 14  ? -1.362  26.264  0.506   1.00 0.00 ? 14  SER A HB2  1  
ATOM 169   H HB3  . SER A 1 14  ? -2.975  26.675  1.089   1.00 0.00 ? 14  SER A HB3  1  
ATOM 170   H HG   . SER A 1 14  ? -0.643  28.218  1.039   1.00 0.00 ? 14  SER A HG   1  
ATOM 171   N N    . GLU A 1 15  ? -2.405  23.858  3.240   1.00 0.00 ? 15  GLU A N    1  
ATOM 172   C CA   . GLU A 1 15  ? -2.486  22.405  3.165   1.00 0.00 ? 15  GLU A CA   1  
ATOM 173   C C    . GLU A 1 15  ? -3.530  21.970  2.142   1.00 0.00 ? 15  GLU A C    1  
ATOM 174   O O    . GLU A 1 15  ? -4.697  22.350  2.231   1.00 0.00 ? 15  GLU A O    1  
ATOM 175   C CB   . GLU A 1 15  ? -2.826  21.820  4.538   1.00 0.00 ? 15  GLU A CB   1  
ATOM 176   C CG   . GLU A 1 15  ? -1.798  22.143  5.609   1.00 0.00 ? 15  GLU A CG   1  
ATOM 177   C CD   . GLU A 1 15  ? -2.065  23.471  6.291   1.00 0.00 ? 15  GLU A CD   1  
ATOM 178   O OE1  . GLU A 1 15  ? -3.248  23.854  6.404   1.00 0.00 ? 15  GLU A OE1  1  
ATOM 179   O OE2  . GLU A 1 15  ? -1.090  24.128  6.711   1.00 0.00 ? 15  GLU A OE2  1  
ATOM 180   H H    . GLU A 1 15  ? -2.959  24.336  3.892   1.00 0.00 ? 15  GLU A H    1  
ATOM 181   H HA   . GLU A 1 15  ? -1.520  22.033  2.856   1.00 0.00 ? 15  GLU A HA   1  
ATOM 182   H HB2  . GLU A 1 15  ? -3.782  22.209  4.855   1.00 0.00 ? 15  GLU A HB2  1  
ATOM 183   H HB3  . GLU A 1 15  ? -2.897  20.745  4.450   1.00 0.00 ? 15  GLU A HB3  1  
ATOM 184   H HG2  . GLU A 1 15  ? -1.817  21.364  6.355   1.00 0.00 ? 15  GLU A HG2  1  
ATOM 185   H HG3  . GLU A 1 15  ? -0.820  22.180  5.152   1.00 0.00 ? 15  GLU A HG3  1  
ATOM 186   N N    . GLN A 1 16  ? -3.101  21.170  1.170   1.00 0.00 ? 16  GLN A N    1  
ATOM 187   C CA   . GLN A 1 16  ? -3.999  20.683  0.129   1.00 0.00 ? 16  GLN A CA   1  
ATOM 188   C C    . GLN A 1 16  ? -4.064  19.160  0.135   1.00 0.00 ? 16  GLN A C    1  
ATOM 189   O O    . GLN A 1 16  ? -3.441  18.505  0.969   1.00 0.00 ? 16  GLN A O    1  
ATOM 190   C CB   . GLN A 1 16  ? -3.540  21.182  -1.242  1.00 0.00 ? 16  GLN A CB   1  
ATOM 191   C CG   . GLN A 1 16  ? -4.390  22.314  -1.795  1.00 0.00 ? 16  GLN A CG   1  
ATOM 192   C CD   . GLN A 1 16  ? -3.877  22.835  -3.123  1.00 0.00 ? 16  GLN A CD   1  
ATOM 193   O OE1  . GLN A 1 16  ? -2.690  22.719  -3.432  1.00 0.00 ? 16  GLN A OE1  1  
ATOM 194   N NE2  . GLN A 1 16  ? -4.770  23.414  -3.917  1.00 0.00 ? 16  GLN A NE2  1  
ATOM 195   H H    . GLN A 1 16  ? -2.160  20.901  1.154   1.00 0.00 ? 16  GLN A H    1  
ATOM 196   H HA   . GLN A 1 16  ? -4.984  21.075  0.332   1.00 0.00 ? 16  GLN A HA   1  
ATOM 197   H HB2  . GLN A 1 16  ? -2.521  21.530  -1.163  1.00 0.00 ? 16  GLN A HB2  1  
ATOM 198   H HB3  . GLN A 1 16  ? -3.577  20.359  -1.941  1.00 0.00 ? 16  GLN A HB3  1  
ATOM 199   H HG2  . GLN A 1 16  ? -5.400  21.956  -1.933  1.00 0.00 ? 16  GLN A HG2  1  
ATOM 200   H HG3  . GLN A 1 16  ? -4.392  23.126  -1.083  1.00 0.00 ? 16  GLN A HG3  1  
ATOM 201   H HE21 . GLN A 1 16  ? -5.697  23.472  -3.604  1.00 0.00 ? 16  GLN A HE21 1  
ATOM 202   H HE22 . GLN A 1 16  ? -4.466  23.760  -4.781  1.00 0.00 ? 16  GLN A HE22 1  
ATOM 203   N N    . ALA A 1 17  ? -4.825  18.602  -0.802  1.00 0.00 ? 17  ALA A N    1  
ATOM 204   C CA   . ALA A 1 17  ? -4.971  17.156  -0.907  1.00 0.00 ? 17  ALA A CA   1  
ATOM 205   C C    . ALA A 1 17  ? -3.640  16.494  -1.250  1.00 0.00 ? 17  ALA A C    1  
ATOM 206   O O    . ALA A 1 17  ? -2.717  17.127  -1.762  1.00 0.00 ? 17  ALA A O    1  
ATOM 207   C CB   . ALA A 1 17  ? -6.022  16.805  -1.949  1.00 0.00 ? 17  ALA A CB   1  
ATOM 208   H H    . ALA A 1 17  ? -5.297  19.178  -1.440  1.00 0.00 ? 17  ALA A H    1  
ATOM 209   H HA   . ALA A 1 17  ? -5.309  16.785  0.050   1.00 0.00 ? 17  ALA A HA   1  
ATOM 210   H HB1  . ALA A 1 17  ? -5.730  15.901  -2.462  1.00 0.00 ? 17  ALA A HB1  1  
ATOM 211   H HB2  . ALA A 1 17  ? -6.974  16.653  -1.462  1.00 0.00 ? 17  ALA A HB2  1  
ATOM 212   H HB3  . ALA A 1 17  ? -6.106  17.612  -2.661  1.00 0.00 ? 17  ALA A HB3  1  
ATOM 213   N N    . PRO A 1 18  ? -3.537  15.188  -0.963  1.00 0.00 ? 18  PRO A N    1  
ATOM 214   C CA   . PRO A 1 18  ? -2.325  14.410  -1.233  1.00 0.00 ? 18  PRO A CA   1  
ATOM 215   C C    . PRO A 1 18  ? -2.091  14.200  -2.725  1.00 0.00 ? 18  PRO A C    1  
ATOM 216   O O    . PRO A 1 18  ? -2.937  13.643  -3.423  1.00 0.00 ? 18  PRO A O    1  
ATOM 217   C CB   . PRO A 1 18  ? -2.598  13.073  -0.542  1.00 0.00 ? 18  PRO A CB   1  
ATOM 218   C CG   . PRO A 1 18  ? -4.084  12.963  -0.503  1.00 0.00 ? 18  PRO A CG   1  
ATOM 219   C CD   . PRO A 1 18  ? -4.598  14.368  -0.353  1.00 0.00 ? 18  PRO A CD   1  
ATOM 220   H HA   . PRO A 1 18  ? -1.452  14.872  -0.794  1.00 0.00 ? 18  PRO A HA   1  
ATOM 221   H HB2  . PRO A 1 18  ? -2.157  12.270  -1.117  1.00 0.00 ? 18  PRO A HB2  1  
ATOM 222   H HB3  . PRO A 1 18  ? -2.177  13.084  0.453   1.00 0.00 ? 18  PRO A HB3  1  
ATOM 223   H HG2  . PRO A 1 18  ? -4.444  12.529  -1.423  1.00 0.00 ? 18  PRO A HG2  1  
ATOM 224   H HG3  . PRO A 1 18  ? -4.386  12.361  0.342   1.00 0.00 ? 18  PRO A HG3  1  
ATOM 225   H HD2  . PRO A 1 18  ? -5.531  14.487  -0.883  1.00 0.00 ? 18  PRO A HD2  1  
ATOM 226   H HD3  . PRO A 1 18  ? -4.723  14.614  0.692   1.00 0.00 ? 18  PRO A HD3  1  
ATOM 227   N N    . SER A 1 19  ? -0.937  14.652  -3.208  1.00 0.00 ? 19  SER A N    1  
ATOM 228   C CA   . SER A 1 19  ? -0.594  14.516  -4.618  1.00 0.00 ? 19  SER A CA   1  
ATOM 229   C C    . SER A 1 19  ? 0.554   13.528  -4.806  1.00 0.00 ? 19  SER A C    1  
ATOM 230   O O    . SER A 1 19  ? 1.457   13.753  -5.612  1.00 0.00 ? 19  SER A O    1  
ATOM 231   C CB   . SER A 1 19  ? -0.210  15.877  -5.205  1.00 0.00 ? 19  SER A CB   1  
ATOM 232   O OG   . SER A 1 19  ? -0.210  15.840  -6.621  1.00 0.00 ? 19  SER A OG   1  
ATOM 233   H H    . SER A 1 19  ? -0.303  15.089  -2.601  1.00 0.00 ? 19  SER A H    1  
ATOM 234   H HA   . SER A 1 19  ? -1.464  14.142  -5.137  1.00 0.00 ? 19  SER A HA   1  
ATOM 235   H HB2  . SER A 1 19  ? -0.920  16.620  -4.876  1.00 0.00 ? 19  SER A HB2  1  
ATOM 236   H HB3  . SER A 1 19  ? 0.778   16.147  -4.863  1.00 0.00 ? 19  SER A HB3  1  
ATOM 237   H HG   . SER A 1 19  ? -0.380  16.720  -6.965  1.00 0.00 ? 19  SER A HG   1  
ATOM 238   N N    . SER A 1 20  ? 0.510   12.433  -4.054  1.00 0.00 ? 20  SER A N    1  
ATOM 239   C CA   . SER A 1 20  ? 1.547   11.410  -4.135  1.00 0.00 ? 20  SER A CA   1  
ATOM 240   C C    . SER A 1 20  ? 0.991   10.041  -3.755  1.00 0.00 ? 20  SER A C    1  
ATOM 241   O O    . SER A 1 20  ? 0.370   9.880   -2.704  1.00 0.00 ? 20  SER A O    1  
ATOM 242   C CB   . SER A 1 20  ? 2.718   11.769  -3.217  1.00 0.00 ? 20  SER A CB   1  
ATOM 243   O OG   . SER A 1 20  ? 3.328   10.604  -2.689  1.00 0.00 ? 20  SER A OG   1  
ATOM 244   H H    . SER A 1 20  ? -0.235  12.310  -3.431  1.00 0.00 ? 20  SER A H    1  
ATOM 245   H HA   . SER A 1 20  ? 1.899   11.373  -5.155  1.00 0.00 ? 20  SER A HA   1  
ATOM 246   H HB2  . SER A 1 20  ? 3.455   12.323  -3.779  1.00 0.00 ? 20  SER A HB2  1  
ATOM 247   H HB3  . SER A 1 20  ? 2.358   12.376  -2.399  1.00 0.00 ? 20  SER A HB3  1  
ATOM 248   H HG   . SER A 1 20  ? 2.766   10.229  -2.007  1.00 0.00 ? 20  SER A HG   1  
ATOM 249   N N    . ALA A 1 21  ? 1.219   9.057   -4.619  1.00 0.00 ? 21  ALA A N    1  
ATOM 250   C CA   . ALA A 1 21  ? 0.742   7.701   -4.374  1.00 0.00 ? 21  ALA A CA   1  
ATOM 251   C C    . ALA A 1 21  ? 1.508   7.048   -3.228  1.00 0.00 ? 21  ALA A C    1  
ATOM 252   O O    . ALA A 1 21  ? 2.645   7.411   -2.924  1.00 0.00 ? 21  ALA A O    1  
ATOM 253   C CB   . ALA A 1 21  ? 0.864   6.863   -5.638  1.00 0.00 ? 21  ALA A CB   1  
ATOM 254   H H    . ALA A 1 21  ? 1.719   9.247   -5.439  1.00 0.00 ? 21  ALA A H    1  
ATOM 255   H HA   . ALA A 1 21  ? -0.304  7.757   -4.108  1.00 0.00 ? 21  ALA A HA   1  
ATOM 256   H HB1  . ALA A 1 21  ? 1.797   6.318   -5.620  1.00 0.00 ? 21  ALA A HB1  1  
ATOM 257   H HB2  . ALA A 1 21  ? 0.040   6.167   -5.690  1.00 0.00 ? 21  ALA A HB2  1  
ATOM 258   H HB3  . ALA A 1 21  ? 0.843   7.511   -6.502  1.00 0.00 ? 21  ALA A HB3  1  
ATOM 259   N N    . PRO A 1 22  ? 0.873   6.063   -2.577  1.00 0.00 ? 22  PRO A N    1  
ATOM 260   C CA   . PRO A 1 22  ? 1.477   5.338   -1.455  1.00 0.00 ? 22  PRO A CA   1  
ATOM 261   C C    . PRO A 1 22  ? 2.626   4.439   -1.895  1.00 0.00 ? 22  PRO A C    1  
ATOM 262   O O    . PRO A 1 22  ? 2.617   3.903   -3.004  1.00 0.00 ? 22  PRO A O    1  
ATOM 263   C CB   . PRO A 1 22  ? 0.318   4.498   -0.911  1.00 0.00 ? 22  PRO A CB   1  
ATOM 264   C CG   . PRO A 1 22  ? -0.598  4.321   -2.071  1.00 0.00 ? 22  PRO A CG   1  
ATOM 265   C CD   . PRO A 1 22  ? -0.483  5.579   -2.886  1.00 0.00 ? 22  PRO A CD   1  
ATOM 266   H HA   . PRO A 1 22  ? 1.825   6.015   -0.687  1.00 0.00 ? 22  PRO A HA   1  
ATOM 267   H HB2  . PRO A 1 22  ? 0.695   3.550   -0.554  1.00 0.00 ? 22  PRO A HB2  1  
ATOM 268   H HB3  . PRO A 1 22  ? -0.165  5.026   -0.102  1.00 0.00 ? 22  PRO A HB3  1  
ATOM 269   H HG2  . PRO A 1 22  ? -0.291  3.466   -2.655  1.00 0.00 ? 22  PRO A HG2  1  
ATOM 270   H HG3  . PRO A 1 22  ? -1.612  4.193   -1.721  1.00 0.00 ? 22  PRO A HG3  1  
ATOM 271   H HD2  . PRO A 1 22  ? -0.583  5.357   -3.939  1.00 0.00 ? 22  PRO A HD2  1  
ATOM 272   H HD3  . PRO A 1 22  ? -1.227  6.298   -2.578  1.00 0.00 ? 22  PRO A HD3  1  
ATOM 273   N N    . ARG A 1 23  ? 3.614   4.278   -1.022  1.00 0.00 ? 23  ARG A N    1  
ATOM 274   C CA   . ARG A 1 23  ? 4.771   3.444   -1.322  1.00 0.00 ? 23  ARG A CA   1  
ATOM 275   C C    . ARG A 1 23  ? 4.811   2.220   -0.411  1.00 0.00 ? 23  ARG A C    1  
ATOM 276   O O    . ARG A 1 23  ? 3.967   2.063   0.472   1.00 0.00 ? 23  ARG A O    1  
ATOM 277   C CB   . ARG A 1 23  ? 6.062   4.249   -1.168  1.00 0.00 ? 23  ARG A CB   1  
ATOM 278   C CG   . ARG A 1 23  ? 5.999   5.629   -1.804  1.00 0.00 ? 23  ARG A CG   1  
ATOM 279   C CD   . ARG A 1 23  ? 7.357   6.313   -1.785  1.00 0.00 ? 23  ARG A CD   1  
ATOM 280   N NE   . ARG A 1 23  ? 8.290   5.703   -2.729  1.00 0.00 ? 23  ARG A NE   1  
ATOM 281   C CZ   . ARG A 1 23  ? 9.540   6.118   -2.898  1.00 0.00 ? 23  ARG A CZ   1  
ATOM 282   N NH1  . ARG A 1 23  ? 10.005  7.140   -2.191  1.00 0.00 ? 23  ARG A NH1  1  
ATOM 283   N NH2  . ARG A 1 23  ? 10.329  5.512   -3.776  1.00 0.00 ? 23  ARG A NH2  1  
ATOM 284   H H    . ARG A 1 23  ? 3.564   4.731   -0.154  1.00 0.00 ? 23  ARG A H    1  
ATOM 285   H HA   . ARG A 1 23  ? 4.685   3.112   -2.345  1.00 0.00 ? 23  ARG A HA   1  
ATOM 286   H HB2  . ARG A 1 23  ? 6.272   4.372   -0.115  1.00 0.00 ? 23  ARG A HB2  1  
ATOM 287   H HB3  . ARG A 1 23  ? 6.871   3.702   -1.626  1.00 0.00 ? 23  ARG A HB3  1  
ATOM 288   H HG2  . ARG A 1 23  ? 5.673   5.527   -2.828  1.00 0.00 ? 23  ARG A HG2  1  
ATOM 289   H HG3  . ARG A 1 23  ? 5.292   6.235   -1.257  1.00 0.00 ? 23  ARG A HG3  1  
ATOM 290   H HD2  . ARG A 1 23  ? 7.224   7.353   -2.046  1.00 0.00 ? 23  ARG A HD2  1  
ATOM 291   H HD3  . ARG A 1 23  ? 7.768   6.241   -0.789  1.00 0.00 ? 23  ARG A HD3  1  
ATOM 292   H HE   . ARG A 1 23  ? 7.968   4.947   -3.262  1.00 0.00 ? 23  ARG A HE   1  
ATOM 293   H HH11 . ARG A 1 23  ? 9.413   7.597   -1.528  1.00 0.00 ? 23  ARG A HH11 1  
ATOM 294   H HH12 . ARG A 1 23  ? 10.947  7.450   -2.320  1.00 0.00 ? 23  ARG A HH12 1  
ATOM 295   H HH21 . ARG A 1 23  ? 9.982   4.742   -4.311  1.00 0.00 ? 23  ARG A HH21 1  
ATOM 296   H HH22 . ARG A 1 23  ? 11.269  5.826   -3.904  1.00 0.00 ? 23  ARG A HH22 1  
ATOM 297   N N    . ASP A 1 24  ? 5.795   1.355   -0.631  1.00 0.00 ? 24  ASP A N    1  
ATOM 298   C CA   . ASP A 1 24  ? 5.945   0.146   0.170   1.00 0.00 ? 24  ASP A CA   1  
ATOM 299   C C    . ASP A 1 24  ? 4.669   -0.689  0.135   1.00 0.00 ? 24  ASP A C    1  
ATOM 300   O O    . ASP A 1 24  ? 4.394   -1.459  1.056   1.00 0.00 ? 24  ASP A O    1  
ATOM 301   C CB   . ASP A 1 24  ? 6.295   0.507   1.615   1.00 0.00 ? 24  ASP A CB   1  
ATOM 302   C CG   . ASP A 1 24  ? 7.039   -0.608  2.325   1.00 0.00 ? 24  ASP A CG   1  
ATOM 303   O OD1  . ASP A 1 24  ? 8.268   -0.716  2.133   1.00 0.00 ? 24  ASP A OD1  1  
ATOM 304   O OD2  . ASP A 1 24  ? 6.391   -1.371  3.071   1.00 0.00 ? 24  ASP A OD2  1  
ATOM 305   H H    . ASP A 1 24  ? 6.437   1.536   -1.350  1.00 0.00 ? 24  ASP A H    1  
ATOM 306   H HA   . ASP A 1 24  ? 6.751   -0.433  -0.253  1.00 0.00 ? 24  ASP A HA   1  
ATOM 307   H HB2  . ASP A 1 24  ? 6.918   1.389   1.618   1.00 0.00 ? 24  ASP A HB2  1  
ATOM 308   H HB3  . ASP A 1 24  ? 5.384   0.711   2.158   1.00 0.00 ? 24  ASP A HB3  1  
ATOM 309   N N    . VAL A 1 25  ? 3.893   -0.533  -0.933  1.00 0.00 ? 25  VAL A N    1  
ATOM 310   C CA   . VAL A 1 25  ? 2.647   -1.274  -1.087  1.00 0.00 ? 25  VAL A CA   1  
ATOM 311   C C    . VAL A 1 25  ? 2.907   -2.689  -1.589  1.00 0.00 ? 25  VAL A C    1  
ATOM 312   O O    . VAL A 1 25  ? 3.213   -2.895  -2.764  1.00 0.00 ? 25  VAL A O    1  
ATOM 313   C CB   . VAL A 1 25  ? 1.690   -0.562  -2.061  1.00 0.00 ? 25  VAL A CB   1  
ATOM 314   C CG1  . VAL A 1 25  ? 0.347   -1.277  -2.108  1.00 0.00 ? 25  VAL A CG1  1  
ATOM 315   C CG2  . VAL A 1 25  ? 1.514   0.896   -1.666  1.00 0.00 ? 25  VAL A CG2  1  
ATOM 316   H H    . VAL A 1 25  ? 4.167   0.094   -1.634  1.00 0.00 ? 25  VAL A H    1  
ATOM 317   H HA   . VAL A 1 25  ? 2.168   -1.327  -0.120  1.00 0.00 ? 25  VAL A HA   1  
ATOM 318   H HB   . VAL A 1 25  ? 2.124   -0.596  -3.050  1.00 0.00 ? 25  VAL A HB   1  
ATOM 319   H HG11 . VAL A 1 25  ? -0.022  -1.413  -1.102  1.00 0.00 ? 25  VAL A HG11 1  
ATOM 320   H HG12 . VAL A 1 25  ? -0.357  -0.686  -2.674  1.00 0.00 ? 25  VAL A HG12 1  
ATOM 321   H HG13 . VAL A 1 25  ? 0.468   -2.241  -2.579  1.00 0.00 ? 25  VAL A HG13 1  
ATOM 322   H HG21 . VAL A 1 25  ? 2.482   1.362   -1.576  1.00 0.00 ? 25  VAL A HG21 1  
ATOM 323   H HG22 . VAL A 1 25  ? 0.938   1.408   -2.424  1.00 0.00 ? 25  VAL A HG22 1  
ATOM 324   H HG23 . VAL A 1 25  ? 0.995   0.952   -0.721  1.00 0.00 ? 25  VAL A HG23 1  
ATOM 325   N N    . GLN A 1 26  ? 2.783   -3.662  -0.692  1.00 0.00 ? 26  GLN A N    1  
ATOM 326   C CA   . GLN A 1 26  ? 3.006   -5.059  -1.045  1.00 0.00 ? 26  GLN A CA   1  
ATOM 327   C C    . GLN A 1 26  ? 2.059   -5.972  -0.273  1.00 0.00 ? 26  GLN A C    1  
ATOM 328   O O    . GLN A 1 26  ? 1.753   -5.723  0.892   1.00 0.00 ? 26  GLN A O    1  
ATOM 329   C CB   . GLN A 1 26  ? 4.457   -5.454  -0.764  1.00 0.00 ? 26  GLN A CB   1  
ATOM 330   C CG   . GLN A 1 26  ? 5.468   -4.681  -1.594  1.00 0.00 ? 26  GLN A CG   1  
ATOM 331   C CD   . GLN A 1 26  ? 6.901   -4.982  -1.197  1.00 0.00 ? 26  GLN A CD   1  
ATOM 332   O OE1  . GLN A 1 26  ? 7.542   -4.197  -0.498  1.00 0.00 ? 26  GLN A OE1  1  
ATOM 333   N NE2  . GLN A 1 26  ? 7.411   -6.124  -1.643  1.00 0.00 ? 26  GLN A NE2  1  
ATOM 334   H H    . GLN A 1 26  ? 2.538   -3.435  0.228   1.00 0.00 ? 26  GLN A H    1  
ATOM 335   H HA   . GLN A 1 26  ? 2.811   -5.170  -2.101  1.00 0.00 ? 26  GLN A HA   1  
ATOM 336   H HB2  . GLN A 1 26  ? 4.670   -5.278  0.280   1.00 0.00 ? 26  GLN A HB2  1  
ATOM 337   H HB3  . GLN A 1 26  ? 4.578   -6.505  -0.975  1.00 0.00 ? 26  GLN A HB3  1  
ATOM 338   H HG2  . GLN A 1 26  ? 5.337   -4.942  -2.634  1.00 0.00 ? 26  GLN A HG2  1  
ATOM 339   H HG3  . GLN A 1 26  ? 5.289   -3.624  -1.464  1.00 0.00 ? 26  GLN A HG3  1  
ATOM 340   H HE21 . GLN A 1 26  ? 6.841   -6.700  -2.196  1.00 0.00 ? 26  GLN A HE21 1  
ATOM 341   H HE22 . GLN A 1 26  ? 8.335   -6.343  -1.402  1.00 0.00 ? 26  GLN A HE22 1  
ATOM 342   N N    . ALA A 1 27  ? 1.599   -7.032  -0.931  1.00 0.00 ? 27  ALA A N    1  
ATOM 343   C CA   . ALA A 1 27  ? 0.688   -7.984  -0.306  1.00 0.00 ? 27  ALA A CA   1  
ATOM 344   C C    . ALA A 1 27  ? 1.357   -9.341  -0.122  1.00 0.00 ? 27  ALA A C    1  
ATOM 345   O O    . ALA A 1 27  ? 1.806   -9.959  -1.088  1.00 0.00 ? 27  ALA A O    1  
ATOM 346   C CB   . ALA A 1 27  ? -0.579  -8.124  -1.135  1.00 0.00 ? 27  ALA A CB   1  
ATOM 347   H H    . ALA A 1 27  ? 1.880   -7.177  -1.859  1.00 0.00 ? 27  ALA A H    1  
ATOM 348   H HA   . ALA A 1 27  ? 0.414   -7.594  0.664   1.00 0.00 ? 27  ALA A HA   1  
ATOM 349   H HB1  . ALA A 1 27  ? -0.370  -8.718  -2.013  1.00 0.00 ? 27  ALA A HB1  1  
ATOM 350   H HB2  . ALA A 1 27  ? -1.343  -8.608  -0.546  1.00 0.00 ? 27  ALA A HB2  1  
ATOM 351   H HB3  . ALA A 1 27  ? -0.922  -7.146  -1.437  1.00 0.00 ? 27  ALA A HB3  1  
ATOM 352   N N    . ARG A 1 28  ? 1.419   -9.802  1.123   1.00 0.00 ? 28  ARG A N    1  
ATOM 353   C CA   . ARG A 1 28  ? 2.033   -11.087 1.434   1.00 0.00 ? 28  ARG A CA   1  
ATOM 354   C C    . ARG A 1 28  ? 1.013   -12.046 2.037   1.00 0.00 ? 28  ARG A C    1  
ATOM 355   O O    . ARG A 1 28  ? 0.356   -11.726 3.027   1.00 0.00 ? 28  ARG A O    1  
ATOM 356   C CB   . ARG A 1 28  ? 3.204   -10.896 2.399   1.00 0.00 ? 28  ARG A CB   1  
ATOM 357   C CG   . ARG A 1 28  ? 2.839   -10.118 3.653   1.00 0.00 ? 28  ARG A CG   1  
ATOM 358   C CD   . ARG A 1 28  ? 4.060   -9.855  4.520   1.00 0.00 ? 28  ARG A CD   1  
ATOM 359   N NE   . ARG A 1 28  ? 3.695   -9.549  5.901   1.00 0.00 ? 28  ARG A NE   1  
ATOM 360   C CZ   . ARG A 1 28  ? 4.571   -9.494  6.898   1.00 0.00 ? 28  ARG A CZ   1  
ATOM 361   N NH1  . ARG A 1 28  ? 5.856   -9.724  6.669   1.00 0.00 ? 28  ARG A NH1  1  
ATOM 362   N NH2  . ARG A 1 28  ? 4.162   -9.211  8.128   1.00 0.00 ? 28  ARG A NH2  1  
ATOM 363   H H    . ARG A 1 28  ? 1.043   -9.264  1.851   1.00 0.00 ? 28  ARG A H    1  
ATOM 364   H HA   . ARG A 1 28  ? 2.404   -11.508 0.511   1.00 0.00 ? 28  ARG A HA   1  
ATOM 365   H HB2  . ARG A 1 28  ? 3.571   -11.867 2.698   1.00 0.00 ? 28  ARG A HB2  1  
ATOM 366   H HB3  . ARG A 1 28  ? 3.993   -10.364 1.889   1.00 0.00 ? 28  ARG A HB3  1  
ATOM 367   H HG2  . ARG A 1 28  ? 2.404   -9.173  3.365   1.00 0.00 ? 28  ARG A HG2  1  
ATOM 368   H HG3  . ARG A 1 28  ? 2.121   -10.690 4.222   1.00 0.00 ? 28  ARG A HG3  1  
ATOM 369   H HD2  . ARG A 1 28  ? 4.689   -10.732 4.511   1.00 0.00 ? 28  ARG A HD2  1  
ATOM 370   H HD3  . ARG A 1 28  ? 4.603   -9.018  4.107   1.00 0.00 ? 28  ARG A HD3  1  
ATOM 371   H HE   . ARG A 1 28  ? 2.750   -9.377  6.093   1.00 0.00 ? 28  ARG A HE   1  
ATOM 372   H HH11 . ARG A 1 28  ? 6.168   -9.937  5.742   1.00 0.00 ? 28  ARG A HH11 1  
ATOM 373   H HH12 . ARG A 1 28  ? 6.514   -9.681  7.421   1.00 0.00 ? 28  ARG A HH12 1  
ATOM 374   H HH21 . ARG A 1 28  ? 3.194   -9.037  8.305   1.00 0.00 ? 28  ARG A HH21 1  
ATOM 375   H HH22 . ARG A 1 28  ? 4.822   -9.170  8.877   1.00 0.00 ? 28  ARG A HH22 1  
ATOM 376   N N    . MET A 1 29  ? 0.885   -13.224 1.435   1.00 0.00 ? 29  MET A N    1  
ATOM 377   C CA   . MET A 1 29  ? -0.055  -14.229 1.914   1.00 0.00 ? 29  MET A CA   1  
ATOM 378   C C    . MET A 1 29  ? 0.434   -14.855 3.215   1.00 0.00 ? 29  MET A C    1  
ATOM 379   O O    . MET A 1 29  ? 1.622   -15.144 3.369   1.00 0.00 ? 29  MET A O    1  
ATOM 380   C CB   . MET A 1 29  ? -0.256  -15.316 0.855   1.00 0.00 ? 29  MET A CB   1  
ATOM 381   C CG   . MET A 1 29  ? -1.573  -15.198 0.105   1.00 0.00 ? 29  MET A CG   1  
ATOM 382   S SD   . MET A 1 29  ? -3.005  -15.458 1.169   1.00 0.00 ? 29  MET A SD   1  
ATOM 383   C CE   . MET A 1 29  ? -3.841  -16.778 0.296   1.00 0.00 ? 29  MET A CE   1  
ATOM 384   H H    . MET A 1 29  ? 1.437   -13.422 0.649   1.00 0.00 ? 29  MET A H    1  
ATOM 385   H HA   . MET A 1 29  ? -1.000  -13.739 2.097   1.00 0.00 ? 29  MET A HA   1  
ATOM 386   H HB2  . MET A 1 29  ? 0.548   -15.257 0.138   1.00 0.00 ? 29  MET A HB2  1  
ATOM 387   H HB3  . MET A 1 29  ? -0.228  -16.282 1.337   1.00 0.00 ? 29  MET A HB3  1  
ATOM 388   H HG2  . MET A 1 29  ? -1.638  -14.211 -0.328  1.00 0.00 ? 29  MET A HG2  1  
ATOM 389   H HG3  . MET A 1 29  ? -1.589  -15.935 -0.684  1.00 0.00 ? 29  MET A HG3  1  
ATOM 390   H HE1  . MET A 1 29  ? -3.111  -17.404 -0.197  1.00 0.00 ? 29  MET A HE1  1  
ATOM 391   H HE2  . MET A 1 29  ? -4.408  -17.371 0.998   1.00 0.00 ? 29  MET A HE2  1  
ATOM 392   H HE3  . MET A 1 29  ? -4.509  -16.356 -0.442  1.00 0.00 ? 29  MET A HE3  1  
ATOM 393   N N    . LEU A 1 30  ? -0.486  -15.063 4.150   1.00 0.00 ? 30  LEU A N    1  
ATOM 394   C CA   . LEU A 1 30  ? -0.147  -15.655 5.440   1.00 0.00 ? 30  LEU A CA   1  
ATOM 395   C C    . LEU A 1 30  ? -0.875  -16.981 5.638   1.00 0.00 ? 30  LEU A C    1  
ATOM 396   O O    . LEU A 1 30  ? -0.380  -17.874 6.325   1.00 0.00 ? 30  LEU A O    1  
ATOM 397   C CB   . LEU A 1 30  ? -0.502  -14.691 6.574   1.00 0.00 ? 30  LEU A CB   1  
ATOM 398   C CG   . LEU A 1 30  ? 0.030   -13.265 6.433   1.00 0.00 ? 30  LEU A CG   1  
ATOM 399   C CD1  . LEU A 1 30  ? -0.461  -12.396 7.581   1.00 0.00 ? 30  LEU A CD1  1  
ATOM 400   C CD2  . LEU A 1 30  ? 1.551   -13.265 6.374   1.00 0.00 ? 30  LEU A CD2  1  
ATOM 401   H H    . LEU A 1 30  ? -1.416  -14.812 3.970   1.00 0.00 ? 30  LEU A H    1  
ATOM 402   H HA   . LEU A 1 30  ? 0.917   -15.837 5.451   1.00 0.00 ? 30  LEU A HA   1  
ATOM 403   H HB2  . LEU A 1 30  ? -1.578  -14.638 6.639   1.00 0.00 ? 30  LEU A HB2  1  
ATOM 404   H HB3  . LEU A 1 30  ? -0.107  -15.103 7.491   1.00 0.00 ? 30  LEU A HB3  1  
ATOM 405   H HG   . LEU A 1 30  ? -0.341  -12.838 5.511   1.00 0.00 ? 30  LEU A HG   1  
ATOM 406   H HD11 . LEU A 1 30  ? -1.323  -11.831 7.261   1.00 0.00 ? 30  LEU A HD11 1  
ATOM 407   H HD12 . LEU A 1 30  ? 0.324   -11.718 7.880   1.00 0.00 ? 30  LEU A HD12 1  
ATOM 408   H HD13 . LEU A 1 30  ? -0.731  -13.024 8.417   1.00 0.00 ? 30  LEU A HD13 1  
ATOM 409   H HD21 . LEU A 1 30  ? 1.942   -12.681 7.194   1.00 0.00 ? 30  LEU A HD21 1  
ATOM 410   H HD22 . LEU A 1 30  ? 1.875   -12.834 5.438   1.00 0.00 ? 30  LEU A HD22 1  
ATOM 411   H HD23 . LEU A 1 30  ? 1.913   -14.280 6.449   1.00 0.00 ? 30  LEU A HD23 1  
ATOM 412   N N    . SER A 1 31  ? -2.050  -17.102 5.029   1.00 0.00 ? 31  SER A N    1  
ATOM 413   C CA   . SER A 1 31  ? -2.846  -18.318 5.140   1.00 0.00 ? 31  SER A CA   1  
ATOM 414   C C    . SER A 1 31  ? -3.463  -18.689 3.794   1.00 0.00 ? 31  SER A C    1  
ATOM 415   O O    . SER A 1 31  ? -3.119  -18.113 2.762   1.00 0.00 ? 31  SER A O    1  
ATOM 416   C CB   . SER A 1 31  ? -3.948  -18.139 6.186   1.00 0.00 ? 31  SER A CB   1  
ATOM 417   O OG   . SER A 1 31  ? -3.962  -19.219 7.104   1.00 0.00 ? 31  SER A OG   1  
ATOM 418   H H    . SER A 1 31  ? -2.391  -16.355 4.495   1.00 0.00 ? 31  SER A H    1  
ATOM 419   H HA   . SER A 1 31  ? -2.191  -19.117 5.454   1.00 0.00 ? 31  SER A HA   1  
ATOM 420   H HB2  . SER A 1 31  ? -3.778  -17.222 6.730   1.00 0.00 ? 31  SER A HB2  1  
ATOM 421   H HB3  . SER A 1 31  ? -4.907  -18.091 5.690   1.00 0.00 ? 31  SER A HB3  1  
ATOM 422   H HG   . SER A 1 31  ? -3.383  -19.018 7.843   1.00 0.00 ? 31  SER A HG   1  
ATOM 423   N N    . SER A 1 32  ? -4.376  -19.655 3.814   1.00 0.00 ? 32  SER A N    1  
ATOM 424   C CA   . SER A 1 32  ? -5.038  -20.106 2.596   1.00 0.00 ? 32  SER A CA   1  
ATOM 425   C C    . SER A 1 32  ? -6.110  -19.111 2.161   1.00 0.00 ? 32  SER A C    1  
ATOM 426   O O    . SER A 1 32  ? -6.464  -19.038 0.983   1.00 0.00 ? 32  SER A O    1  
ATOM 427   C CB   . SER A 1 32  ? -5.664  -21.486 2.812   1.00 0.00 ? 32  SER A CB   1  
ATOM 428   O OG   . SER A 1 32  ? -4.680  -22.443 3.162   1.00 0.00 ? 32  SER A OG   1  
ATOM 429   H H    . SER A 1 32  ? -4.607  -20.076 4.669   1.00 0.00 ? 32  SER A H    1  
ATOM 430   H HA   . SER A 1 32  ? -4.291  -20.177 1.820   1.00 0.00 ? 32  SER A HA   1  
ATOM 431   H HB2  . SER A 1 32  ? -6.391  -21.428 3.607   1.00 0.00 ? 32  SER A HB2  1  
ATOM 432   H HB3  . SER A 1 32  ? -6.150  -21.804 1.901   1.00 0.00 ? 32  SER A HB3  1  
ATOM 433   H HG   . SER A 1 32  ? -5.084  -23.143 3.681   1.00 0.00 ? 32  SER A HG   1  
ATOM 434   N N    . THR A 1 33  ? -6.624  -18.347 3.119   1.00 0.00 ? 33  THR A N    1  
ATOM 435   C CA   . THR A 1 33  ? -7.656  -17.358 2.836   1.00 0.00 ? 33  THR A CA   1  
ATOM 436   C C    . THR A 1 33  ? -7.446  -16.093 3.661   1.00 0.00 ? 33  THR A C    1  
ATOM 437   O O    . THR A 1 33  ? -8.405  -15.423 4.047   1.00 0.00 ? 33  THR A O    1  
ATOM 438   C CB   . THR A 1 33  ? -9.063  -17.916 3.123   1.00 0.00 ? 33  THR A CB   1  
ATOM 439   O OG1  . THR A 1 33  ? -9.082  -18.563 4.400   1.00 0.00 ? 33  THR A OG1  1  
ATOM 440   C CG2  . THR A 1 33  ? -9.485  -18.900 2.043   1.00 0.00 ? 33  THR A CG2  1  
ATOM 441   H H    . THR A 1 33  ? -6.301  -18.453 4.038   1.00 0.00 ? 33  THR A H    1  
ATOM 442   H HA   . THR A 1 33  ? -7.597  -17.105 1.788   1.00 0.00 ? 33  THR A HA   1  
ATOM 443   H HB   . THR A 1 33  ? -9.764  -17.094 3.134   1.00 0.00 ? 33  THR A HB   1  
ATOM 444   H HG1  . THR A 1 33  ? -8.724  -19.451 4.315   1.00 0.00 ? 33  THR A HG1  1  
ATOM 445   H HG21 . THR A 1 33  ? -9.137  -18.550 1.082   1.00 0.00 ? 33  THR A HG21 1  
ATOM 446   H HG22 . THR A 1 33  ? -10.561 -18.980 2.030   1.00 0.00 ? 33  THR A HG22 1  
ATOM 447   H HG23 . THR A 1 33  ? -9.054  -19.868 2.251   1.00 0.00 ? 33  THR A HG23 1  
ATOM 448   N N    . THR A 1 34  ? -6.184  -15.770 3.930   1.00 0.00 ? 34  THR A N    1  
ATOM 449   C CA   . THR A 1 34  ? -5.848  -14.586 4.709   1.00 0.00 ? 34  THR A CA   1  
ATOM 450   C C    . THR A 1 34  ? -4.629  -13.875 4.132   1.00 0.00 ? 34  THR A C    1  
ATOM 451   O O    . THR A 1 34  ? -3.544  -14.451 4.051   1.00 0.00 ? 34  THR A O    1  
ATOM 452   C CB   . THR A 1 34  ? -5.570  -14.943 6.182   1.00 0.00 ? 34  THR A CB   1  
ATOM 453   O OG1  . THR A 1 34  ? -6.112  -16.233 6.484   1.00 0.00 ? 34  THR A OG1  1  
ATOM 454   C CG2  . THR A 1 34  ? -6.173  -13.902 7.114   1.00 0.00 ? 34  THR A CG2  1  
ATOM 455   H H    . THR A 1 34  ? -5.463  -16.343 3.595   1.00 0.00 ? 34  THR A H    1  
ATOM 456   H HA   . THR A 1 34  ? -6.693  -13.914 4.677   1.00 0.00 ? 34  THR A HA   1  
ATOM 457   H HB   . THR A 1 34  ? -4.501  -14.965 6.336   1.00 0.00 ? 34  THR A HB   1  
ATOM 458   H HG1  . THR A 1 34  ? -7.018  -16.281 6.166   1.00 0.00 ? 34  THR A HG1  1  
ATOM 459   H HG21 . THR A 1 34  ? -5.460  -13.107 7.277   1.00 0.00 ? 34  THR A HG21 1  
ATOM 460   H HG22 . THR A 1 34  ? -6.419  -14.365 8.058   1.00 0.00 ? 34  THR A HG22 1  
ATOM 461   H HG23 . THR A 1 34  ? -7.068  -13.495 6.668   1.00 0.00 ? 34  THR A HG23 1  
ATOM 462   N N    . ILE A 1 35  ? -4.815  -12.621 3.733   1.00 0.00 ? 35  ILE A N    1  
ATOM 463   C CA   . ILE A 1 35  ? -3.729  -11.832 3.165   1.00 0.00 ? 35  ILE A CA   1  
ATOM 464   C C    . ILE A 1 35  ? -3.343  -10.682 4.089   1.00 0.00 ? 35  ILE A C    1  
ATOM 465   O O    . ILE A 1 35  ? -3.961  -10.476 5.134   1.00 0.00 ? 35  ILE A O    1  
ATOM 466   C CB   . ILE A 1 35  ? -4.109  -11.262 1.786   1.00 0.00 ? 35  ILE A CB   1  
ATOM 467   C CG1  . ILE A 1 35  ? -5.303  -10.313 1.914   1.00 0.00 ? 35  ILE A CG1  1  
ATOM 468   C CG2  . ILE A 1 35  ? -4.423  -12.390 0.814   1.00 0.00 ? 35  ILE A CG2  1  
ATOM 469   C CD1  . ILE A 1 35  ? -5.615  -9.560  0.639   1.00 0.00 ? 35  ILE A CD1  1  
ATOM 470   H H    . ILE A 1 35  ? -5.702  -12.218 3.824   1.00 0.00 ? 35  ILE A H    1  
ATOM 471   H HA   . ILE A 1 35  ? -2.874  -12.482 3.041   1.00 0.00 ? 35  ILE A HA   1  
ATOM 472   H HB   . ILE A 1 35  ? -3.262  -10.713 1.401   1.00 0.00 ? 35  ILE A HB   1  
ATOM 473   H HG12 . ILE A 1 35  ? -6.178  -10.881 2.186   1.00 0.00 ? 35  ILE A HG12 1  
ATOM 474   H HG13 . ILE A 1 35  ? -5.095  -9.587  2.687   1.00 0.00 ? 35  ILE A HG13 1  
ATOM 475   H HG21 . ILE A 1 35  ? -4.979  -13.161 1.327   1.00 0.00 ? 35  ILE A HG21 1  
ATOM 476   H HG22 . ILE A 1 35  ? -5.014  -12.006 -0.004  1.00 0.00 ? 35  ILE A HG22 1  
ATOM 477   H HG23 . ILE A 1 35  ? -3.503  -12.802 0.432   1.00 0.00 ? 35  ILE A HG23 1  
ATOM 478   H HD11 . ILE A 1 35  ? -4.971  -9.910  -0.154  1.00 0.00 ? 35  ILE A HD11 1  
ATOM 479   H HD12 . ILE A 1 35  ? -6.646  -9.725  0.367   1.00 0.00 ? 35  ILE A HD12 1  
ATOM 480   H HD13 . ILE A 1 35  ? -5.450  -8.504  0.796   1.00 0.00 ? 35  ILE A HD13 1  
ATOM 481   N N    . LEU A 1 36  ? -2.317  -9.934  3.698   1.00 0.00 ? 36  LEU A N    1  
ATOM 482   C CA   . LEU A 1 36  ? -1.848  -8.803  4.490   1.00 0.00 ? 36  LEU A CA   1  
ATOM 483   C C    . LEU A 1 36  ? -1.355  -7.675  3.590   1.00 0.00 ? 36  LEU A C    1  
ATOM 484   O O    . LEU A 1 36  ? -0.450  -7.864  2.778   1.00 0.00 ? 36  LEU A O    1  
ATOM 485   C CB   . LEU A 1 36  ? -0.727  -9.244  5.433   1.00 0.00 ? 36  LEU A CB   1  
ATOM 486   C CG   . LEU A 1 36  ? -0.423  -8.305  6.601   1.00 0.00 ? 36  LEU A CG   1  
ATOM 487   C CD1  . LEU A 1 36  ? 0.180   -9.077  7.764   1.00 0.00 ? 36  LEU A CD1  1  
ATOM 488   C CD2  . LEU A 1 36  ? 0.511   -7.188  6.157   1.00 0.00 ? 36  LEU A CD2  1  
ATOM 489   H H    . LEU A 1 36  ? -1.863  -10.148 2.857   1.00 0.00 ? 36  LEU A H    1  
ATOM 490   H HA   . LEU A 1 36  ? -2.680  -8.442  5.077   1.00 0.00 ? 36  LEU A HA   1  
ATOM 491   H HB2  . LEU A 1 36  ? -1.000  -10.204 5.844   1.00 0.00 ? 36  LEU A HB2  1  
ATOM 492   H HB3  . LEU A 1 36  ? 0.174   -9.349  4.847   1.00 0.00 ? 36  LEU A HB3  1  
ATOM 493   H HG   . LEU A 1 36  ? -1.346  -7.855  6.942   1.00 0.00 ? 36  LEU A HG   1  
ATOM 494   H HD11 . LEU A 1 36  ? -0.607  -9.560  8.321   1.00 0.00 ? 36  LEU A HD11 1  
ATOM 495   H HD12 . LEU A 1 36  ? 0.713   -8.395  8.410   1.00 0.00 ? 36  LEU A HD12 1  
ATOM 496   H HD13 . LEU A 1 36  ? 0.864   -9.822  7.385   1.00 0.00 ? 36  LEU A HD13 1  
ATOM 497   H HD21 . LEU A 1 36  ? -0.073  -6.336  5.840   1.00 0.00 ? 36  LEU A HD21 1  
ATOM 498   H HD22 . LEU A 1 36  ? 1.118   -7.533  5.333   1.00 0.00 ? 36  LEU A HD22 1  
ATOM 499   H HD23 . LEU A 1 36  ? 1.147   -6.903  6.981   1.00 0.00 ? 36  LEU A HD23 1  
ATOM 500   N N    . VAL A 1 37  ? -1.957  -6.499  3.741   1.00 0.00 ? 37  VAL A N    1  
ATOM 501   C CA   . VAL A 1 37  ? -1.578  -5.338  2.944   1.00 0.00 ? 37  VAL A CA   1  
ATOM 502   C C    . VAL A 1 37  ? -0.927  -4.266  3.811   1.00 0.00 ? 37  VAL A C    1  
ATOM 503   O O    . VAL A 1 37  ? -1.549  -3.737  4.731   1.00 0.00 ? 37  VAL A O    1  
ATOM 504   C CB   . VAL A 1 37  ? -2.795  -4.730  2.223   1.00 0.00 ? 37  VAL A CB   1  
ATOM 505   C CG1  . VAL A 1 37  ? -2.355  -3.645  1.253   1.00 0.00 ? 37  VAL A CG1  1  
ATOM 506   C CG2  . VAL A 1 37  ? -3.583  -5.814  1.502   1.00 0.00 ? 37  VAL A CG2  1  
ATOM 507   H H    . VAL A 1 37  ? -2.673  -6.410  4.405   1.00 0.00 ? 37  VAL A H    1  
ATOM 508   H HA   . VAL A 1 37  ? -0.869  -5.663  2.196   1.00 0.00 ? 37  VAL A HA   1  
ATOM 509   H HB   . VAL A 1 37  ? -3.440  -4.280  2.964   1.00 0.00 ? 37  VAL A HB   1  
ATOM 510   H HG11 . VAL A 1 37  ? -1.410  -3.234  1.578   1.00 0.00 ? 37  VAL A HG11 1  
ATOM 511   H HG12 . VAL A 1 37  ? -2.244  -4.068  0.265   1.00 0.00 ? 37  VAL A HG12 1  
ATOM 512   H HG13 . VAL A 1 37  ? -3.098  -2.861  1.229   1.00 0.00 ? 37  VAL A HG13 1  
ATOM 513   H HG21 . VAL A 1 37  ? -4.409  -6.130  2.120   1.00 0.00 ? 37  VAL A HG21 1  
ATOM 514   H HG22 . VAL A 1 37  ? -3.962  -5.424  0.568   1.00 0.00 ? 37  VAL A HG22 1  
ATOM 515   H HG23 . VAL A 1 37  ? -2.937  -6.657  1.302   1.00 0.00 ? 37  VAL A HG23 1  
ATOM 516   N N    . GLN A 1 38  ? 0.329   -3.951  3.508   1.00 0.00 ? 38  GLN A N    1  
ATOM 517   C CA   . GLN A 1 38  ? 1.065   -2.941  4.261   1.00 0.00 ? 38  GLN A CA   1  
ATOM 518   C C    . GLN A 1 38  ? 1.727   -1.939  3.321   1.00 0.00 ? 38  GLN A C    1  
ATOM 519   O O    . GLN A 1 38  ? 2.265   -2.313  2.280   1.00 0.00 ? 38  GLN A O    1  
ATOM 520   C CB   . GLN A 1 38  ? 2.121   -3.604  5.147   1.00 0.00 ? 38  GLN A CB   1  
ATOM 521   C CG   . GLN A 1 38  ? 3.082   -4.499  4.381   1.00 0.00 ? 38  GLN A CG   1  
ATOM 522   C CD   . GLN A 1 38  ? 4.460   -4.547  5.010   1.00 0.00 ? 38  GLN A CD   1  
ATOM 523   O OE1  . GLN A 1 38  ? 5.474   -4.448  4.318   1.00 0.00 ? 38  GLN A OE1  1  
ATOM 524   N NE2  . GLN A 1 38  ? 4.505   -4.699  6.329   1.00 0.00 ? 38  GLN A NE2  1  
ATOM 525   H H    . GLN A 1 38  ? 0.771   -4.408  2.764   1.00 0.00 ? 38  GLN A H    1  
ATOM 526   H HA   . GLN A 1 38  ? 0.359   -2.417  4.887   1.00 0.00 ? 38  GLN A HA   1  
ATOM 527   H HB2  . GLN A 1 38  ? 2.694   -2.833  5.640   1.00 0.00 ? 38  GLN A HB2  1  
ATOM 528   H HB3  . GLN A 1 38  ? 1.622   -4.203  5.894   1.00 0.00 ? 38  GLN A HB3  1  
ATOM 529   H HG2  . GLN A 1 38  ? 2.679   -5.501  4.358   1.00 0.00 ? 38  GLN A HG2  1  
ATOM 530   H HG3  . GLN A 1 38  ? 3.175   -4.126  3.372   1.00 0.00 ? 38  GLN A HG3  1  
ATOM 531   H HE21 . GLN A 1 38  ? 3.657   -4.771  6.815   1.00 0.00 ? 38  GLN A HE21 1  
ATOM 532   H HE22 . GLN A 1 38  ? 5.383   -4.733  6.760   1.00 0.00 ? 38  GLN A HE22 1  
ATOM 533   N N    . TRP A 1 39  ? 1.684   -0.665  3.697   1.00 0.00 ? 39  TRP A N    1  
ATOM 534   C CA   . TRP A 1 39  ? 2.280   0.391   2.888   1.00 0.00 ? 39  TRP A CA   1  
ATOM 535   C C    . TRP A 1 39  ? 2.769   1.539   3.765   1.00 0.00 ? 39  TRP A C    1  
ATOM 536   O O    . TRP A 1 39  ? 2.570   1.532   4.981   1.00 0.00 ? 39  TRP A O    1  
ATOM 537   C CB   . TRP A 1 39  ? 1.270   0.909   1.863   1.00 0.00 ? 39  TRP A CB   1  
ATOM 538   C CG   . TRP A 1 39  ? 0.048   1.511   2.488   1.00 0.00 ? 39  TRP A CG   1  
ATOM 539   C CD1  . TRP A 1 39  ? -0.114  2.808   2.885   1.00 0.00 ? 39  TRP A CD1  1  
ATOM 540   C CD2  . TRP A 1 39  ? -1.180  0.842   2.788   1.00 0.00 ? 39  TRP A CD2  1  
ATOM 541   N NE1  . TRP A 1 39  ? -1.371  2.984   3.414   1.00 0.00 ? 39  TRP A NE1  1  
ATOM 542   C CE2  . TRP A 1 39  ? -2.044  1.792   3.364   1.00 0.00 ? 39  TRP A CE2  1  
ATOM 543   C CE3  . TRP A 1 39  ? -1.636  -0.470  2.624   1.00 0.00 ? 39  TRP A CE3  1  
ATOM 544   C CZ2  . TRP A 1 39  ? -3.335  1.472   3.777   1.00 0.00 ? 39  TRP A CZ2  1  
ATOM 545   C CZ3  . TRP A 1 39  ? -2.917  -0.786  3.035   1.00 0.00 ? 39  TRP A CZ3  1  
ATOM 546   C CH2  . TRP A 1 39  ? -3.755  0.181   3.605   1.00 0.00 ? 39  TRP A CH2  1  
ATOM 547   H H    . TRP A 1 39  ? 1.241   -0.431  4.540   1.00 0.00 ? 39  TRP A H    1  
ATOM 548   H HA   . TRP A 1 39  ? 3.126   -0.031  2.365   1.00 0.00 ? 39  TRP A HA   1  
ATOM 549   H HB2  . TRP A 1 39  ? 1.741   1.665   1.254   1.00 0.00 ? 39  TRP A HB2  1  
ATOM 550   H HB3  . TRP A 1 39  ? 0.954   0.089   1.234   1.00 0.00 ? 39  TRP A HB3  1  
ATOM 551   H HD1  . TRP A 1 39  ? 0.642   3.572   2.792   1.00 0.00 ? 39  TRP A HD1  1  
ATOM 552   H HE1  . TRP A 1 39  ? -1.727  3.827   3.766   1.00 0.00 ? 39  TRP A HE1  1  
ATOM 553   H HE3  . TRP A 1 39  ? -1.005  -1.230  2.186   1.00 0.00 ? 39  TRP A HE3  1  
ATOM 554   H HZ2  . TRP A 1 39  ? -3.993  2.206   4.219   1.00 0.00 ? 39  TRP A HZ2  1  
ATOM 555   H HZ3  . TRP A 1 39  ? -3.286  -1.795  2.916   1.00 0.00 ? 39  TRP A HZ3  1  
ATOM 556   H HH2  . TRP A 1 39  ? -4.747  -0.111  3.912   1.00 0.00 ? 39  TRP A HH2  1  
ATOM 557   N N    . LYS A 1 40  ? 3.408   2.523   3.142   1.00 0.00 ? 40  LYS A N    1  
ATOM 558   C CA   . LYS A 1 40  ? 3.923   3.679   3.865   1.00 0.00 ? 40  LYS A CA   1  
ATOM 559   C C    . LYS A 1 40  ? 3.200   4.954   3.440   1.00 0.00 ? 40  LYS A C    1  
ATOM 560   O O    . LYS A 1 40  ? 2.484   4.966   2.440   1.00 0.00 ? 40  LYS A O    1  
ATOM 561   C CB   . LYS A 1 40  ? 5.427   3.829   3.625   1.00 0.00 ? 40  LYS A CB   1  
ATOM 562   C CG   . LYS A 1 40  ? 6.278   3.401   4.808   1.00 0.00 ? 40  LYS A CG   1  
ATOM 563   C CD   . LYS A 1 40  ? 7.629   4.096   4.804   1.00 0.00 ? 40  LYS A CD   1  
ATOM 564   C CE   . LYS A 1 40  ? 8.071   4.462   6.212   1.00 0.00 ? 40  LYS A CE   1  
ATOM 565   N NZ   . LYS A 1 40  ? 9.251   5.370   6.204   1.00 0.00 ? 40  LYS A NZ   1  
ATOM 566   H H    . LYS A 1 40  ? 3.535   2.471   2.171   1.00 0.00 ? 40  LYS A H    1  
ATOM 567   H HA   . LYS A 1 40  ? 3.749   3.516   4.918   1.00 0.00 ? 40  LYS A HA   1  
ATOM 568   H HB2  . LYS A 1 40  ? 5.704   3.228   2.772   1.00 0.00 ? 40  LYS A HB2  1  
ATOM 569   H HB3  . LYS A 1 40  ? 5.643   4.865   3.409   1.00 0.00 ? 40  LYS A HB3  1  
ATOM 570   H HG2  . LYS A 1 40  ? 5.759   3.650   5.721   1.00 0.00 ? 40  LYS A HG2  1  
ATOM 571   H HG3  . LYS A 1 40  ? 6.433   2.332   4.759   1.00 0.00 ? 40  LYS A HG3  1  
ATOM 572   H HD2  . LYS A 1 40  ? 8.363   3.435   4.368   1.00 0.00 ? 40  LYS A HD2  1  
ATOM 573   H HD3  . LYS A 1 40  ? 7.557   4.998   4.212   1.00 0.00 ? 40  LYS A HD3  1  
ATOM 574   H HE2  . LYS A 1 40  ? 7.253   4.953   6.717   1.00 0.00 ? 40  LYS A HE2  1  
ATOM 575   H HE3  . LYS A 1 40  ? 8.328   3.556   6.741   1.00 0.00 ? 40  LYS A HE3  1  
ATOM 576   H HZ1  . LYS A 1 40  ? 9.281   5.909   5.314   1.00 0.00 ? 40  LYS A HZ1  1  
ATOM 577   H HZ2  . LYS A 1 40  ? 10.128  4.818   6.291   1.00 0.00 ? 40  LYS A HZ2  1  
ATOM 578   H HZ3  . LYS A 1 40  ? 9.193   6.039   6.999   1.00 0.00 ? 40  LYS A HZ3  1  
ATOM 579   N N    . GLU A 1 41  ? 3.395   6.022   4.206   1.00 0.00 ? 41  GLU A N    1  
ATOM 580   C CA   . GLU A 1 41  ? 2.761   7.301   3.906   1.00 0.00 ? 41  GLU A CA   1  
ATOM 581   C C    . GLU A 1 41  ? 3.325   7.900   2.621   1.00 0.00 ? 41  GLU A C    1  
ATOM 582   O O    . GLU A 1 41  ? 4.414   7.546   2.167   1.00 0.00 ? 41  GLU A O    1  
ATOM 583   C CB   . GLU A 1 41  ? 2.958   8.278   5.067   1.00 0.00 ? 41  GLU A CB   1  
ATOM 584   C CG   . GLU A 1 41  ? 1.866   8.200   6.120   1.00 0.00 ? 41  GLU A CG   1  
ATOM 585   C CD   . GLU A 1 41  ? 2.406   8.318   7.532   1.00 0.00 ? 41  GLU A CD   1  
ATOM 586   O OE1  . GLU A 1 41  ? 3.313   9.148   7.754   1.00 0.00 ? 41  GLU A OE1  1  
ATOM 587   O OE2  . GLU A 1 41  ? 1.923   7.578   8.415   1.00 0.00 ? 41  GLU A OE2  1  
ATOM 588   H H    . GLU A 1 41  ? 3.976   5.950   4.991   1.00 0.00 ? 41  GLU A H    1  
ATOM 589   H HA   . GLU A 1 41  ? 1.705   7.125   3.772   1.00 0.00 ? 41  GLU A HA   1  
ATOM 590   H HB2  . GLU A 1 41  ? 3.904   8.067   5.542   1.00 0.00 ? 41  GLU A HB2  1  
ATOM 591   H HB3  . GLU A 1 41  ? 2.980   9.284   4.675   1.00 0.00 ? 41  GLU A HB3  1  
ATOM 592   H HG2  . GLU A 1 41  ? 1.164   9.003   5.953   1.00 0.00 ? 41  GLU A HG2  1  
ATOM 593   H HG3  . GLU A 1 41  ? 1.357   7.252   6.024   1.00 0.00 ? 41  GLU A HG3  1  
ATOM 594   N N    . PRO A 1 42  ? 2.569   8.831   2.021   1.00 0.00 ? 42  PRO A N    1  
ATOM 595   C CA   . PRO A 1 42  ? 2.973   9.500   0.780   1.00 0.00 ? 42  PRO A CA   1  
ATOM 596   C C    . PRO A 1 42  ? 4.147   10.450  0.990   1.00 0.00 ? 42  PRO A C    1  
ATOM 597   O O    . PRO A 1 42  ? 4.529   10.739  2.123   1.00 0.00 ? 42  PRO A O    1  
ATOM 598   C CB   . PRO A 1 42  ? 1.721   10.281  0.374   1.00 0.00 ? 42  PRO A CB   1  
ATOM 599   C CG   . PRO A 1 42  ? 0.985   10.507  1.649   1.00 0.00 ? 42  PRO A CG   1  
ATOM 600   C CD   . PRO A 1 42  ? 1.261   9.303   2.506   1.00 0.00 ? 42  PRO A CD   1  
ATOM 601   H HA   . PRO A 1 42  ? 3.221   8.786   0.008   1.00 0.00 ? 42  PRO A HA   1  
ATOM 602   H HB2  . PRO A 1 42  ? 2.009   11.214  -0.088  1.00 0.00 ? 42  PRO A HB2  1  
ATOM 603   H HB3  . PRO A 1 42  ? 1.137   9.695   -0.320  1.00 0.00 ? 42  PRO A HB3  1  
ATOM 604   H HG2  . PRO A 1 42  ? 1.351   11.402  2.130   1.00 0.00 ? 42  PRO A HG2  1  
ATOM 605   H HG3  . PRO A 1 42  ? -0.073  10.591  1.452   1.00 0.00 ? 42  PRO A HG3  1  
ATOM 606   H HD2  . PRO A 1 42  ? 1.315   9.585   3.547   1.00 0.00 ? 42  PRO A HD2  1  
ATOM 607   H HD3  . PRO A 1 42  ? 0.501   8.550   2.356   1.00 0.00 ? 42  PRO A HD3  1  
ATOM 608   N N    . GLU A 1 43  ? 4.718   10.931  -0.111  1.00 0.00 ? 43  GLU A N    1  
ATOM 609   C CA   . GLU A 1 43  ? 5.850   11.848  -0.046  1.00 0.00 ? 43  GLU A CA   1  
ATOM 610   C C    . GLU A 1 43  ? 5.374   13.298  -0.010  1.00 0.00 ? 43  GLU A C    1  
ATOM 611   O O    . GLU A 1 43  ? 6.066   14.175  0.506   1.00 0.00 ? 43  GLU A O    1  
ATOM 612   C CB   . GLU A 1 43  ? 6.777   11.633  -1.244  1.00 0.00 ? 43  GLU A CB   1  
ATOM 613   C CG   . GLU A 1 43  ? 6.065   11.698  -2.585  1.00 0.00 ? 43  GLU A CG   1  
ATOM 614   C CD   . GLU A 1 43  ? 6.925   12.311  -3.673  1.00 0.00 ? 43  GLU A CD   1  
ATOM 615   O OE1  . GLU A 1 43  ? 8.037   11.795  -3.909  1.00 0.00 ? 43  GLU A OE1  1  
ATOM 616   O OE2  . GLU A 1 43  ? 6.486   13.305  -4.288  1.00 0.00 ? 43  GLU A OE2  1  
ATOM 617   H H    . GLU A 1 43  ? 4.369   10.663  -0.987  1.00 0.00 ? 43  GLU A H    1  
ATOM 618   H HA   . GLU A 1 43  ? 6.395   11.638  0.861   1.00 0.00 ? 43  GLU A HA   1  
ATOM 619   H HB2  . GLU A 1 43  ? 7.545   12.393  -1.230  1.00 0.00 ? 43  GLU A HB2  1  
ATOM 620   H HB3  . GLU A 1 43  ? 7.243   10.664  -1.154  1.00 0.00 ? 43  GLU A HB3  1  
ATOM 621   H HG2  . GLU A 1 43  ? 5.794   10.697  -2.882  1.00 0.00 ? 43  GLU A HG2  1  
ATOM 622   H HG3  . GLU A 1 43  ? 5.170   12.294  -2.474  1.00 0.00 ? 43  GLU A HG3  1  
ATOM 623   N N    . GLU A 1 44  ? 4.189   13.539  -0.561  1.00 0.00 ? 44  GLU A N    1  
ATOM 624   C CA   . GLU A 1 44  ? 3.622   14.882  -0.593  1.00 0.00 ? 44  GLU A CA   1  
ATOM 625   C C    . GLU A 1 44  ? 2.235   14.903  0.043   1.00 0.00 ? 44  GLU A C    1  
ATOM 626   O O    . GLU A 1 44  ? 1.214   15.008  -0.638  1.00 0.00 ? 44  GLU A O    1  
ATOM 627   C CB   . GLU A 1 44  ? 3.542   15.392  -2.033  1.00 0.00 ? 44  GLU A CB   1  
ATOM 628   C CG   . GLU A 1 44  ? 4.896   15.509  -2.713  1.00 0.00 ? 44  GLU A CG   1  
ATOM 629   C CD   . GLU A 1 44  ? 5.174   16.910  -3.224  1.00 0.00 ? 44  GLU A CD   1  
ATOM 630   O OE1  . GLU A 1 44  ? 5.002   17.870  -2.444  1.00 0.00 ? 44  GLU A OE1  1  
ATOM 631   O OE2  . GLU A 1 44  ? 5.563   17.046  -4.403  1.00 0.00 ? 44  GLU A OE2  1  
ATOM 632   H H    . GLU A 1 44  ? 3.685   12.798  -0.956  1.00 0.00 ? 44  GLU A H    1  
ATOM 633   H HA   . GLU A 1 44  ? 4.274   15.531  -0.027  1.00 0.00 ? 44  GLU A HA   1  
ATOM 634   H HB2  . GLU A 1 44  ? 2.930   14.715  -2.609  1.00 0.00 ? 44  GLU A HB2  1  
ATOM 635   H HB3  . GLU A 1 44  ? 3.080   16.368  -2.031  1.00 0.00 ? 44  GLU A HB3  1  
ATOM 636   H HG2  . GLU A 1 44  ? 5.665   15.242  -2.004  1.00 0.00 ? 44  GLU A HG2  1  
ATOM 637   H HG3  . GLU A 1 44  ? 4.926   14.825  -3.548  1.00 0.00 ? 44  GLU A HG3  1  
ATOM 638   N N    . PRO A 1 45  ? 2.195   14.800  1.379   1.00 0.00 ? 45  PRO A N    1  
ATOM 639   C CA   . PRO A 1 45  ? 0.941   14.803  2.137   1.00 0.00 ? 45  PRO A CA   1  
ATOM 640   C C    . PRO A 1 45  ? 0.173   16.112  1.981   1.00 0.00 ? 45  PRO A C    1  
ATOM 641   O O    . PRO A 1 45  ? -1.003  16.113  1.622   1.00 0.00 ? 45  PRO A O    1  
ATOM 642   C CB   . PRO A 1 45  ? 1.400   14.622  3.586   1.00 0.00 ? 45  PRO A CB   1  
ATOM 643   C CG   . PRO A 1 45  ? 2.831   15.036  3.584   1.00 0.00 ? 45  PRO A CG   1  
ATOM 644   C CD   . PRO A 1 45  ? 3.373   14.671  2.254   1.00 0.00 ? 45  PRO A CD   1  
ATOM 645   H HA   . PRO A 1 45  ? 0.303   13.978  1.854   1.00 0.00 ? 45  PRO A HA   1  
ATOM 646   H HB2  . PRO A 1 45  ? 0.806   15.249  4.236   1.00 0.00 ? 45  PRO A HB2  1  
ATOM 647   H HB3  . PRO A 1 45  ? 1.290   13.587  3.875   1.00 0.00 ? 45  PRO A HB3  1  
ATOM 648   H HG2  . PRO A 1 45  ? 2.906   16.098  3.767   1.00 0.00 ? 45  PRO A HG2  1  
ATOM 649   H HG3  . PRO A 1 45  ? 3.374   14.484  4.337   1.00 0.00 ? 45  PRO A HG3  1  
ATOM 650   H HD2  . PRO A 1 45  ? 4.116   15.417  2.012   1.00 0.00 ? 45  PRO A HD2  1  
ATOM 651   H HD3  . PRO A 1 45  ? 3.795   13.680  2.188   1.00 0.00 ? 45  PRO A HD3  1  
ATOM 652   N N    . ASN A 1 46  ? 0.848   17.223  2.254   1.00 0.00 ? 46  ASN A N    1  
ATOM 653   C CA   . ASN A 1 46  ? 0.229   18.539  2.144   1.00 0.00 ? 46  ASN A CA   1  
ATOM 654   C C    . ASN A 1 46  ? -0.920  18.685  3.139   1.00 0.00 ? 46  ASN A C    1  
ATOM 655   O O    . ASN A 1 46  ? -1.888  19.400  2.883   1.00 0.00 ? 46  ASN A O    1  
ATOM 656   C CB   . ASN A 1 46  ? -0.283  18.769  0.720   1.00 0.00 ? 46  ASN A CB   1  
ATOM 657   C CG   . ASN A 1 46  ? 0.716   18.325  -0.331  1.00 0.00 ? 46  ASN A CG   1  
ATOM 658   O OD1  . ASN A 1 46  ? 1.884   18.714  -0.297  1.00 0.00 ? 46  ASN A OD1  1  
ATOM 659   N ND2  . ASN A 1 46  ? 0.261   17.507  -1.273  1.00 0.00 ? 46  ASN A ND2  1  
ATOM 660   H H    . ASN A 1 46  ? 1.784   17.158  2.536   1.00 0.00 ? 46  ASN A H    1  
ATOM 661   H HA   . ASN A 1 46  ? 0.981   19.280  2.370   1.00 0.00 ? 46  ASN A HA   1  
ATOM 662   H HB2  . ASN A 1 46  ? -1.196  18.209  0.578   1.00 0.00 ? 46  ASN A HB2  1  
ATOM 663   H HB3  . ASN A 1 46  ? -0.483  19.820  0.580   1.00 0.00 ? 46  ASN A HB3  1  
ATOM 664   H HD21 . ASN A 1 46  ? -0.681  17.240  -1.237  1.00 0.00 ? 46  ASN A HD21 1  
ATOM 665   H HD22 . ASN A 1 46  ? 0.886   17.205  -1.965  1.00 0.00 ? 46  ASN A HD22 1  
ATOM 666   N N    . GLY A 1 47  ? -0.803  18.003  4.273   1.00 0.00 ? 47  GLY A N    1  
ATOM 667   C CA   . GLY A 1 47  ? -1.837  18.070  5.289   1.00 0.00 ? 47  GLY A CA   1  
ATOM 668   C C    . GLY A 1 47  ? -1.872  16.832  6.163   1.00 0.00 ? 47  GLY A C    1  
ATOM 669   O O    . GLY A 1 47  ? -1.236  15.826  5.851   1.00 0.00 ? 47  GLY A O    1  
ATOM 670   H H    . GLY A 1 47  ? -0.008  17.449  4.422   1.00 0.00 ? 47  GLY A H    1  
ATOM 671   H HA2  . GLY A 1 47  ? -1.658  18.934  5.912   1.00 0.00 ? 47  GLY A HA2  1  
ATOM 672   H HA3  . GLY A 1 47  ? -2.795  18.181  4.804   1.00 0.00 ? 47  GLY A HA3  1  
ATOM 673   N N    . GLN A 1 48  ? -2.618  16.906  7.261   1.00 0.00 ? 48  GLN A N    1  
ATOM 674   C CA   . GLN A 1 48  ? -2.731  15.783  8.184   1.00 0.00 ? 48  GLN A CA   1  
ATOM 675   C C    . GLN A 1 48  ? -3.573  14.664  7.579   1.00 0.00 ? 48  GLN A C    1  
ATOM 676   O O    . GLN A 1 48  ? -4.764  14.840  7.322   1.00 0.00 ? 48  GLN A O    1  
ATOM 677   C CB   . GLN A 1 48  ? -3.347  16.242  9.507   1.00 0.00 ? 48  GLN A CB   1  
ATOM 678   C CG   . GLN A 1 48  ? -2.442  16.023  10.708  1.00 0.00 ? 48  GLN A CG   1  
ATOM 679   C CD   . GLN A 1 48  ? -2.828  16.885  11.895  1.00 0.00 ? 48  GLN A CD   1  
ATOM 680   O OE1  . GLN A 1 48  ? -3.721  17.728  11.800  1.00 0.00 ? 48  GLN A OE1  1  
ATOM 681   N NE2  . GLN A 1 48  ? -2.156  16.676  13.021  1.00 0.00 ? 48  GLN A NE2  1  
ATOM 682   H H    . GLN A 1 48  ? -3.101  17.735  7.455   1.00 0.00 ? 48  GLN A H    1  
ATOM 683   H HA   . GLN A 1 48  ? -1.736  15.407  8.372   1.00 0.00 ? 48  GLN A HA   1  
ATOM 684   H HB2  . GLN A 1 48  ? -3.572  17.296  9.439   1.00 0.00 ? 48  GLN A HB2  1  
ATOM 685   H HB3  . GLN A 1 48  ? -4.264  15.697  9.671   1.00 0.00 ? 48  GLN A HB3  1  
ATOM 686   H HG2  . GLN A 1 48  ? -2.500  14.986  11.002  1.00 0.00 ? 48  GLN A HG2  1  
ATOM 687   H HG3  . GLN A 1 48  ? -1.427  16.260  10.425  1.00 0.00 ? 48  GLN A HG3  1  
ATOM 688   H HE21 . GLN A 1 48  ? -1.458  15.988  13.022  1.00 0.00 ? 48  GLN A HE21 1  
ATOM 689   H HE22 . GLN A 1 48  ? -2.385  17.219  13.803  1.00 0.00 ? 48  GLN A HE22 1  
ATOM 690   N N    . ILE A 1 49  ? -2.945  13.514  7.354   1.00 0.00 ? 49  ILE A N    1  
ATOM 691   C CA   . ILE A 1 49  ? -3.637  12.367  6.779   1.00 0.00 ? 49  ILE A CA   1  
ATOM 692   C C    . ILE A 1 49  ? -4.694  11.827  7.737   1.00 0.00 ? 49  ILE A C    1  
ATOM 693   O O    . ILE A 1 49  ? -4.410  11.561  8.904   1.00 0.00 ? 49  ILE A O    1  
ATOM 694   C CB   . ILE A 1 49  ? -2.654  11.235  6.428   1.00 0.00 ? 49  ILE A CB   1  
ATOM 695   C CG1  . ILE A 1 49  ? -1.599  11.735  5.438   1.00 0.00 ? 49  ILE A CG1  1  
ATOM 696   C CG2  . ILE A 1 49  ? -3.403  10.043  5.853   1.00 0.00 ? 49  ILE A CG2  1  
ATOM 697   C CD1  . ILE A 1 49  ? -2.173  12.141  4.098   1.00 0.00 ? 49  ILE A CD1  1  
ATOM 698   H H    . ILE A 1 49  ? -1.996  13.436  7.580   1.00 0.00 ? 49  ILE A H    1  
ATOM 699   H HA   . ILE A 1 49  ? -4.122  12.692  5.870   1.00 0.00 ? 49  ILE A HA   1  
ATOM 700   H HB   . ILE A 1 49  ? -2.164  10.919  7.335   1.00 0.00 ? 49  ILE A HB   1  
ATOM 701   H HG12 . ILE A 1 49  ? -1.099  12.594  5.858   1.00 0.00 ? 49  ILE A HG12 1  
ATOM 702   H HG13 . ILE A 1 49  ? -0.876  10.951  5.268   1.00 0.00 ? 49  ILE A HG13 1  
ATOM 703   H HG21 . ILE A 1 49  ? -4.317  10.381  5.389   1.00 0.00 ? 49  ILE A HG21 1  
ATOM 704   H HG22 . ILE A 1 49  ? -2.786  9.551   5.115   1.00 0.00 ? 49  ILE A HG22 1  
ATOM 705   H HG23 . ILE A 1 49  ? -3.638  9.349   6.646   1.00 0.00 ? 49  ILE A HG23 1  
ATOM 706   H HD11 . ILE A 1 49  ? -1.686  11.580  3.314   1.00 0.00 ? 49  ILE A HD11 1  
ATOM 707   H HD12 . ILE A 1 49  ? -3.233  11.938  4.082   1.00 0.00 ? 49  ILE A HD12 1  
ATOM 708   H HD13 . ILE A 1 49  ? -2.006  13.197  3.940   1.00 0.00 ? 49  ILE A HD13 1  
ATOM 709   N N    . GLN A 1 50  ? -5.914  11.666  7.233   1.00 0.00 ? 50  GLN A N    1  
ATOM 710   C CA   . GLN A 1 50  ? -7.013  11.157  8.044   1.00 0.00 ? 50  GLN A CA   1  
ATOM 711   C C    . GLN A 1 50  ? -7.136  9.643   7.904   1.00 0.00 ? 50  GLN A C    1  
ATOM 712   O O    . GLN A 1 50  ? -7.636  8.966   8.802   1.00 0.00 ? 50  GLN A O    1  
ATOM 713   C CB   . GLN A 1 50  ? -8.327  11.826  7.637   1.00 0.00 ? 50  GLN A CB   1  
ATOM 714   C CG   . GLN A 1 50  ? -8.304  13.341  7.768   1.00 0.00 ? 50  GLN A CG   1  
ATOM 715   C CD   . GLN A 1 50  ? -8.338  13.802  9.212   1.00 0.00 ? 50  GLN A CD   1  
ATOM 716   O OE1  . GLN A 1 50  ? -9.034  13.222  10.045  1.00 0.00 ? 50  GLN A OE1  1  
ATOM 717   N NE2  . GLN A 1 50  ? -7.584  14.853  9.515   1.00 0.00 ? 50  GLN A NE2  1  
ATOM 718   H H    . GLN A 1 50  ? -6.078  11.897  6.295   1.00 0.00 ? 50  GLN A H    1  
ATOM 719   H HA   . GLN A 1 50  ? -6.803  11.395  9.075   1.00 0.00 ? 50  GLN A HA   1  
ATOM 720   H HB2  . GLN A 1 50  ? -8.541  11.579  6.608   1.00 0.00 ? 50  GLN A HB2  1  
ATOM 721   H HB3  . GLN A 1 50  ? -9.120  11.446  8.263   1.00 0.00 ? 50  GLN A HB3  1  
ATOM 722   H HG2  . GLN A 1 50  ? -7.402  13.716  7.308   1.00 0.00 ? 50  GLN A HG2  1  
ATOM 723   H HG3  . GLN A 1 50  ? -9.164  13.747  7.255   1.00 0.00 ? 50  GLN A HG3  1  
ATOM 724   H HE21 . GLN A 1 50  ? -7.056  15.265  8.799   1.00 0.00 ? 50  GLN A HE21 1  
ATOM 725   H HE22 . GLN A 1 50  ? -7.587  15.173  10.441  1.00 0.00 ? 50  GLN A HE22 1  
ATOM 726   N N    . GLY A 1 51  ? -6.676  9.118   6.772   1.00 0.00 ? 51  GLY A N    1  
ATOM 727   C CA   . GLY A 1 51  ? -6.745  7.688   6.536   1.00 0.00 ? 51  GLY A CA   1  
ATOM 728   C C    . GLY A 1 51  ? -6.406  7.319   5.105   1.00 0.00 ? 51  GLY A C    1  
ATOM 729   O O    . GLY A 1 51  ? -5.743  8.082   4.402   1.00 0.00 ? 51  GLY A O    1  
ATOM 730   H H    . GLY A 1 51  ? -6.288  9.707   6.092   1.00 0.00 ? 51  GLY A H    1  
ATOM 731   H HA2  . GLY A 1 51  ? -6.052  7.192   7.199   1.00 0.00 ? 51  GLY A HA2  1  
ATOM 732   H HA3  . GLY A 1 51  ? -7.745  7.346   6.757   1.00 0.00 ? 51  GLY A HA3  1  
ATOM 733   N N    . TYR A 1 52  ? -6.861  6.149   4.675   1.00 0.00 ? 52  TYR A N    1  
ATOM 734   C CA   . TYR A 1 52  ? -6.599  5.679   3.319   1.00 0.00 ? 52  TYR A CA   1  
ATOM 735   C C    . TYR A 1 52  ? -7.757  4.830   2.804   1.00 0.00 ? 52  TYR A C    1  
ATOM 736   O O    . TYR A 1 52  ? -8.709  4.551   3.532   1.00 0.00 ? 52  TYR A O    1  
ATOM 737   C CB   . TYR A 1 52  ? -5.301  4.869   3.280   1.00 0.00 ? 52  TYR A CB   1  
ATOM 738   C CG   . TYR A 1 52  ? -4.132  5.564   3.940   1.00 0.00 ? 52  TYR A CG   1  
ATOM 739   C CD1  . TYR A 1 52  ? -3.905  5.438   5.306   1.00 0.00 ? 52  TYR A CD1  1  
ATOM 740   C CD2  . TYR A 1 52  ? -3.257  6.348   3.200   1.00 0.00 ? 52  TYR A CD2  1  
ATOM 741   C CE1  . TYR A 1 52  ? -2.839  6.072   5.913   1.00 0.00 ? 52  TYR A CE1  1  
ATOM 742   C CE2  . TYR A 1 52  ? -2.187  6.984   3.799   1.00 0.00 ? 52  TYR A CE2  1  
ATOM 743   C CZ   . TYR A 1 52  ? -1.983  6.844   5.156   1.00 0.00 ? 52  TYR A CZ   1  
ATOM 744   O OH   . TYR A 1 52  ? -0.919  7.477   5.757   1.00 0.00 ? 52  TYR A OH   1  
ATOM 745   H H    . TYR A 1 52  ? -7.384  5.585   5.283   1.00 0.00 ? 52  TYR A H    1  
ATOM 746   H HA   . TYR A 1 52  ? -6.490  6.545   2.684   1.00 0.00 ? 52  TYR A HA   1  
ATOM 747   H HB2  . TYR A 1 52  ? -5.457  3.929   3.786   1.00 0.00 ? 52  TYR A HB2  1  
ATOM 748   H HB3  . TYR A 1 52  ? -5.036  4.677   2.251   1.00 0.00 ? 52  TYR A HB3  1  
ATOM 749   H HD1  . TYR A 1 52  ? -4.578  4.832   5.895   1.00 0.00 ? 52  TYR A HD1  1  
ATOM 750   H HD2  . TYR A 1 52  ? -3.421  6.457   2.138   1.00 0.00 ? 52  TYR A HD2  1  
ATOM 751   H HE1  . TYR A 1 52  ? -2.678  5.962   6.976   1.00 0.00 ? 52  TYR A HE1  1  
ATOM 752   H HE2  . TYR A 1 52  ? -1.518  7.590   3.206   1.00 0.00 ? 52  TYR A HE2  1  
ATOM 753   H HH   . TYR A 1 52  ? -1.158  8.387   5.953   1.00 0.00 ? 52  TYR A HH   1  
ATOM 754   N N    . ARG A 1 53  ? -7.668  4.425   1.540   1.00 0.00 ? 53  ARG A N    1  
ATOM 755   C CA   . ARG A 1 53  ? -8.708  3.608   0.925   1.00 0.00 ? 53  ARG A CA   1  
ATOM 756   C C    . ARG A 1 53  ? -8.097  2.455   0.135   1.00 0.00 ? 53  ARG A C    1  
ATOM 757   O O    . ARG A 1 53  ? -7.138  2.641   -0.615  1.00 0.00 ? 53  ARG A O    1  
ATOM 758   C CB   . ARG A 1 53  ? -9.581  4.465   0.006   1.00 0.00 ? 53  ARG A CB   1  
ATOM 759   C CG   . ARG A 1 53  ? -10.859 3.774   -0.438  1.00 0.00 ? 53  ARG A CG   1  
ATOM 760   C CD   . ARG A 1 53  ? -11.888 4.775   -0.940  1.00 0.00 ? 53  ARG A CD   1  
ATOM 761   N NE   . ARG A 1 53  ? -12.601 5.423   0.157   1.00 0.00 ? 53  ARG A NE   1  
ATOM 762   C CZ   . ARG A 1 53  ? -13.772 6.034   0.014   1.00 0.00 ? 53  ARG A CZ   1  
ATOM 763   N NH1  . ARG A 1 53  ? -14.359 6.079   -1.174  1.00 0.00 ? 53  ARG A NH1  1  
ATOM 764   N NH2  . ARG A 1 53  ? -14.358 6.600   1.060   1.00 0.00 ? 53  ARG A NH2  1  
ATOM 765   H H    . ARG A 1 53  ? -6.884  4.680   1.010   1.00 0.00 ? 53  ARG A H    1  
ATOM 766   H HA   . ARG A 1 53  ? -9.323  3.203   1.715   1.00 0.00 ? 53  ARG A HA   1  
ATOM 767   H HB2  . ARG A 1 53  ? -9.851  5.372   0.528   1.00 0.00 ? 53  ARG A HB2  1  
ATOM 768   H HB3  . ARG A 1 53  ? -9.010  4.723   -0.874  1.00 0.00 ? 53  ARG A HB3  1  
ATOM 769   H HG2  . ARG A 1 53  ? -10.624 3.085   -1.237  1.00 0.00 ? 53  ARG A HG2  1  
ATOM 770   H HG3  . ARG A 1 53  ? -11.273 3.232   0.398   1.00 0.00 ? 53  ARG A HG3  1  
ATOM 771   H HD2  . ARG A 1 53  ? -11.382 5.530   -1.524  1.00 0.00 ? 53  ARG A HD2  1  
ATOM 772   H HD3  . ARG A 1 53  ? -12.601 4.255   -1.563  1.00 0.00 ? 53  ARG A HD3  1  
ATOM 773   H HE   . ARG A 1 53  ? -12.186 5.401   1.044   1.00 0.00 ? 53  ARG A HE   1  
ATOM 774   H HH11 . ARG A 1 53  ? -13.919 5.653   -1.964  1.00 0.00 ? 53  ARG A HH11 1  
ATOM 775   H HH12 . ARG A 1 53  ? -15.240 6.539   -1.279  1.00 0.00 ? 53  ARG A HH12 1  
ATOM 776   H HH21 . ARG A 1 53  ? -13.920 6.567   1.959   1.00 0.00 ? 53  ARG A HH21 1  
ATOM 777   H HH22 . ARG A 1 53  ? -15.240 7.060   0.952   1.00 0.00 ? 53  ARG A HH22 1  
ATOM 778   N N    . VAL A 1 54  ? -8.659  1.263   0.308   1.00 0.00 ? 54  VAL A N    1  
ATOM 779   C CA   . VAL A 1 54  ? -8.172  0.080   -0.390  1.00 0.00 ? 54  VAL A CA   1  
ATOM 780   C C    . VAL A 1 54  ? -9.227  -0.472  -1.342  1.00 0.00 ? 54  VAL A C    1  
ATOM 781   O O    . VAL A 1 54  ? -10.426 -0.365  -1.085  1.00 0.00 ? 54  VAL A O    1  
ATOM 782   C CB   . VAL A 1 54  ? -7.762  -1.027  0.602   1.00 0.00 ? 54  VAL A CB   1  
ATOM 783   C CG1  . VAL A 1 54  ? -7.125  -2.194  -0.136  1.00 0.00 ? 54  VAL A CG1  1  
ATOM 784   C CG2  . VAL A 1 54  ? -6.819  -0.473  1.658   1.00 0.00 ? 54  VAL A CG2  1  
ATOM 785   H H    . VAL A 1 54  ? -9.421  1.178   0.918   1.00 0.00 ? 54  VAL A H    1  
ATOM 786   H HA   . VAL A 1 54  ? -7.299  0.364   -0.959  1.00 0.00 ? 54  VAL A HA   1  
ATOM 787   H HB   . VAL A 1 54  ? -8.652  -1.385  1.097   1.00 0.00 ? 54  VAL A HB   1  
ATOM 788   H HG11 . VAL A 1 54  ? -6.797  -2.935  0.579   1.00 0.00 ? 54  VAL A HG11 1  
ATOM 789   H HG12 . VAL A 1 54  ? -7.846  -2.635  -0.807  1.00 0.00 ? 54  VAL A HG12 1  
ATOM 790   H HG13 . VAL A 1 54  ? -6.274  -1.842  -0.701  1.00 0.00 ? 54  VAL A HG13 1  
ATOM 791   H HG21 . VAL A 1 54  ? -6.153  -1.254  1.990   1.00 0.00 ? 54  VAL A HG21 1  
ATOM 792   H HG22 . VAL A 1 54  ? -6.241  0.337   1.236   1.00 0.00 ? 54  VAL A HG22 1  
ATOM 793   H HG23 . VAL A 1 54  ? -7.391  -0.107  2.496   1.00 0.00 ? 54  VAL A HG23 1  
ATOM 794   N N    . TYR A 1 55  ? -8.773  -1.061  -2.442  1.00 0.00 ? 55  TYR A N    1  
ATOM 795   C CA   . TYR A 1 55  ? -9.677  -1.628  -3.435  1.00 0.00 ? 55  TYR A CA   1  
ATOM 796   C C    . TYR A 1 55  ? -9.255  -3.045  -3.812  1.00 0.00 ? 55  TYR A C    1  
ATOM 797   O O    . TYR A 1 55  ? -8.176  -3.256  -4.366  1.00 0.00 ? 55  TYR A O    1  
ATOM 798   C CB   . TYR A 1 55  ? -9.715  -0.746  -4.684  1.00 0.00 ? 55  TYR A CB   1  
ATOM 799   C CG   . TYR A 1 55  ? -9.965  0.716   -4.386  1.00 0.00 ? 55  TYR A CG   1  
ATOM 800   C CD1  . TYR A 1 55  ? -8.926  1.553   -3.999  1.00 0.00 ? 55  TYR A CD1  1  
ATOM 801   C CD2  . TYR A 1 55  ? -11.239 1.258   -4.491  1.00 0.00 ? 55  TYR A CD2  1  
ATOM 802   C CE1  . TYR A 1 55  ? -9.149  2.888   -3.725  1.00 0.00 ? 55  TYR A CE1  1  
ATOM 803   C CE2  . TYR A 1 55  ? -11.472 2.593   -4.221  1.00 0.00 ? 55  TYR A CE2  1  
ATOM 804   C CZ   . TYR A 1 55  ? -10.424 3.404   -3.838  1.00 0.00 ? 55  TYR A CZ   1  
ATOM 805   O OH   . TYR A 1 55  ? -10.650 4.734   -3.566  1.00 0.00 ? 55  TYR A OH   1  
ATOM 806   H H    . TYR A 1 55  ? -7.806  -1.116  -2.591  1.00 0.00 ? 55  TYR A H    1  
ATOM 807   H HA   . TYR A 1 55  ? -10.666 -1.663  -3.001  1.00 0.00 ? 55  TYR A HA   1  
ATOM 808   H HB2  . TYR A 1 55  ? -8.771  -0.822  -5.198  1.00 0.00 ? 55  TYR A HB2  1  
ATOM 809   H HB3  . TYR A 1 55  ? -10.504 -1.091  -5.336  1.00 0.00 ? 55  TYR A HB3  1  
ATOM 810   H HD1  . TYR A 1 55  ? -7.929  1.146   -3.913  1.00 0.00 ? 55  TYR A HD1  1  
ATOM 811   H HD2  . TYR A 1 55  ? -12.058 0.621   -4.792  1.00 0.00 ? 55  TYR A HD2  1  
ATOM 812   H HE1  . TYR A 1 55  ? -8.329  3.524   -3.425  1.00 0.00 ? 55  TYR A HE1  1  
ATOM 813   H HE2  . TYR A 1 55  ? -12.469 2.997   -4.308  1.00 0.00 ? 55  TYR A HE2  1  
ATOM 814   H HH   . TYR A 1 55  ? -11.499 4.995   -3.932  1.00 0.00 ? 55  TYR A HH   1  
ATOM 815   N N    . TYR A 1 56  ? -10.113 -4.012  -3.508  1.00 0.00 ? 56  TYR A N    1  
ATOM 816   C CA   . TYR A 1 56  ? -9.830  -5.409  -3.812  1.00 0.00 ? 56  TYR A CA   1  
ATOM 817   C C    . TYR A 1 56  ? -11.108 -6.157  -4.180  1.00 0.00 ? 56  TYR A C    1  
ATOM 818   O O    . TYR A 1 56  ? -12.115 -6.073  -3.476  1.00 0.00 ? 56  TYR A O    1  
ATOM 819   C CB   . TYR A 1 56  ? -9.155  -6.087  -2.618  1.00 0.00 ? 56  TYR A CB   1  
ATOM 820   C CG   . TYR A 1 56  ? -10.072 -6.276  -1.432  1.00 0.00 ? 56  TYR A CG   1  
ATOM 821   C CD1  . TYR A 1 56  ? -10.370 -5.219  -0.581  1.00 0.00 ? 56  TYR A CD1  1  
ATOM 822   C CD2  . TYR A 1 56  ? -10.643 -7.515  -1.161  1.00 0.00 ? 56  TYR A CD2  1  
ATOM 823   C CE1  . TYR A 1 56  ? -11.207 -5.388  0.504   1.00 0.00 ? 56  TYR A CE1  1  
ATOM 824   C CE2  . TYR A 1 56  ? -11.483 -7.693  -0.079  1.00 0.00 ? 56  TYR A CE2  1  
ATOM 825   C CZ   . TYR A 1 56  ? -11.761 -6.627  0.751   1.00 0.00 ? 56  TYR A CZ   1  
ATOM 826   O OH   . TYR A 1 56  ? -12.597 -6.800  1.830   1.00 0.00 ? 56  TYR A OH   1  
ATOM 827   H H    . TYR A 1 56  ? -10.957 -3.780  -3.066  1.00 0.00 ? 56  TYR A H    1  
ATOM 828   H HA   . TYR A 1 56  ? -9.156  -5.435  -4.656  1.00 0.00 ? 56  TYR A HA   1  
ATOM 829   H HB2  . TYR A 1 56  ? -8.797  -7.058  -2.919  1.00 0.00 ? 56  TYR A HB2  1  
ATOM 830   H HB3  . TYR A 1 56  ? -8.317  -5.484  -2.297  1.00 0.00 ? 56  TYR A HB3  1  
ATOM 831   H HD1  . TYR A 1 56  ? -9.935  -4.249  -0.779  1.00 0.00 ? 56  TYR A HD1  1  
ATOM 832   H HD2  . TYR A 1 56  ? -10.422 -8.348  -1.814  1.00 0.00 ? 56  TYR A HD2  1  
ATOM 833   H HE1  . TYR A 1 56  ? -11.427 -4.554  1.153   1.00 0.00 ? 56  TYR A HE1  1  
ATOM 834   H HE2  . TYR A 1 56  ? -11.916 -8.663  0.115   1.00 0.00 ? 56  TYR A HE2  1  
ATOM 835   H HH   . TYR A 1 56  ? -12.951 -7.694  1.821   1.00 0.00 ? 56  TYR A HH   1  
ATOM 836   N N    . THR A 1 57  ? -11.059 -6.890  -5.287  1.00 0.00 ? 57  THR A N    1  
ATOM 837   C CA   . THR A 1 57  ? -12.210 -7.653  -5.750  1.00 0.00 ? 57  THR A CA   1  
ATOM 838   C C    . THR A 1 57  ? -11.789 -8.751  -6.721  1.00 0.00 ? 57  THR A C    1  
ATOM 839   O O    . THR A 1 57  ? -10.868 -8.569  -7.516  1.00 0.00 ? 57  THR A O    1  
ATOM 840   C CB   . THR A 1 57  ? -13.246 -6.745  -6.439  1.00 0.00 ? 57  THR A CB   1  
ATOM 841   O OG1  . THR A 1 57  ? -14.458 -7.471  -6.672  1.00 0.00 ? 57  THR A OG1  1  
ATOM 842   C CG2  . THR A 1 57  ? -12.707 -6.212  -7.758  1.00 0.00 ? 57  THR A CG2  1  
ATOM 843   H H    . THR A 1 57  ? -10.228 -6.917  -5.805  1.00 0.00 ? 57  THR A H    1  
ATOM 844   H HA   . THR A 1 57  ? -12.678 -8.107  -4.888  1.00 0.00 ? 57  THR A HA   1  
ATOM 845   H HB   . THR A 1 57  ? -13.457 -5.907  -5.790  1.00 0.00 ? 57  THR A HB   1  
ATOM 846   H HG1  . THR A 1 57  ? -15.170 -6.854  -6.860  1.00 0.00 ? 57  THR A HG1  1  
ATOM 847   H HG21 . THR A 1 57  ? -12.518 -7.038  -8.429  1.00 0.00 ? 57  THR A HG21 1  
ATOM 848   H HG22 . THR A 1 57  ? -11.788 -5.674  -7.581  1.00 0.00 ? 57  THR A HG22 1  
ATOM 849   H HG23 . THR A 1 57  ? -13.433 -5.548  -8.202  1.00 0.00 ? 57  THR A HG23 1  
ATOM 850   N N    . MET A 1 58  ? -12.471 -9.890  -6.650  1.00 0.00 ? 58  MET A N    1  
ATOM 851   C CA   . MET A 1 58  ? -12.168 -11.017 -7.525  1.00 0.00 ? 58  MET A CA   1  
ATOM 852   C C    . MET A 1 58  ? -12.459 -10.668 -8.981  1.00 0.00 ? 58  MET A C    1  
ATOM 853   O O    . MET A 1 58  ? -11.886 -11.259 -9.897  1.00 0.00 ? 58  MET A O    1  
ATOM 854   C CB   . MET A 1 58  ? -12.979 -12.246 -7.109  1.00 0.00 ? 58  MET A CB   1  
ATOM 855   C CG   . MET A 1 58  ? -14.465 -11.968 -6.954  1.00 0.00 ? 58  MET A CG   1  
ATOM 856   S SD   . MET A 1 58  ? -15.436 -13.474 -6.758  1.00 0.00 ? 58  MET A SD   1  
ATOM 857   C CE   . MET A 1 58  ? -14.440 -14.366 -5.566  1.00 0.00 ? 58  MET A CE   1  
ATOM 858   H H    . MET A 1 58  ? -13.195 -9.975  -5.995  1.00 0.00 ? 58  MET A H    1  
ATOM 859   H HA   . MET A 1 58  ? -11.115 -11.240 -7.424  1.00 0.00 ? 58  MET A HA   1  
ATOM 860   H HB2  . MET A 1 58  ? -12.854 -13.014 -7.857  1.00 0.00 ? 58  MET A HB2  1  
ATOM 861   H HB3  . MET A 1 58  ? -12.603 -12.608 -6.164  1.00 0.00 ? 58  MET A HB3  1  
ATOM 862   H HG2  . MET A 1 58  ? -14.613 -11.345 -6.085  1.00 0.00 ? 58  MET A HG2  1  
ATOM 863   H HG3  . MET A 1 58  ? -14.813 -11.444 -7.833  1.00 0.00 ? 58  MET A HG3  1  
ATOM 864   H HE1  . MET A 1 58  ? -13.455 -14.536 -5.975  1.00 0.00 ? 58  MET A HE1  1  
ATOM 865   H HE2  . MET A 1 58  ? -14.359 -13.785 -4.659  1.00 0.00 ? 58  MET A HE2  1  
ATOM 866   H HE3  . MET A 1 58  ? -14.908 -15.315 -5.345  1.00 0.00 ? 58  MET A HE3  1  
ATOM 867   N N    . ASP A 1 59  ? -13.352 -9.708  -9.187  1.00 0.00 ? 59  ASP A N    1  
ATOM 868   C CA   . ASP A 1 59  ? -13.719 -9.281  -10.532 1.00 0.00 ? 59  ASP A CA   1  
ATOM 869   C C    . ASP A 1 59  ? -13.254 -7.852  -10.795 1.00 0.00 ? 59  ASP A C    1  
ATOM 870   O O    . ASP A 1 59  ? -14.041 -6.905  -10.788 1.00 0.00 ? 59  ASP A O    1  
ATOM 871   C CB   . ASP A 1 59  ? -15.234 -9.381  -10.727 1.00 0.00 ? 59  ASP A CB   1  
ATOM 872   C CG   . ASP A 1 59  ? -15.726 -10.814 -10.705 1.00 0.00 ? 59  ASP A CG   1  
ATOM 873   O OD1  . ASP A 1 59  ? -15.073 -11.676 -11.330 1.00 0.00 ? 59  ASP A OD1  1  
ATOM 874   O OD2  . ASP A 1 59  ? -16.766 -11.074 -10.064 1.00 0.00 ? 59  ASP A OD2  1  
ATOM 875   H H    . ASP A 1 59  ? -13.775 -9.274  -8.416  1.00 0.00 ? 59  ASP A H    1  
ATOM 876   H HA   . ASP A 1 59  ? -13.232 -9.939  -11.234 1.00 0.00 ? 59  ASP A HA   1  
ATOM 877   H HB2  . ASP A 1 59  ? -15.728 -8.837  -9.935  1.00 0.00 ? 59  ASP A HB2  1  
ATOM 878   H HB3  . ASP A 1 59  ? -15.497 -8.942  -11.678 1.00 0.00 ? 59  ASP A HB3  1  
ATOM 879   N N    . PRO A 1 60  ? -11.943 -7.690  -11.031 1.00 0.00 ? 60  PRO A N    1  
ATOM 880   C CA   . PRO A 1 60  ? -11.343 -6.380  -11.298 1.00 0.00 ? 60  PRO A CA   1  
ATOM 881   C C    . PRO A 1 60  ? -11.755 -5.821  -12.656 1.00 0.00 ? 60  PRO A C    1  
ATOM 882   O O    . PRO A 1 60  ? -11.473 -4.665  -12.976 1.00 0.00 ? 60  PRO A O    1  
ATOM 883   C CB   . PRO A 1 60  ? -9.839  -6.667  -11.274 1.00 0.00 ? 60  PRO A CB   1  
ATOM 884   C CG   . PRO A 1 60  ? -9.723  -8.110  -11.622 1.00 0.00 ? 60  PRO A CG   1  
ATOM 885   C CD   . PRO A 1 60  ? -10.947 -8.774  -11.053 1.00 0.00 ? 60  PRO A CD   1  
ATOM 886   H HA   . PRO A 1 60  ? -11.588 -5.665  -10.526 1.00 0.00 ? 60  PRO A HA   1  
ATOM 887   H HB2  . PRO A 1 60  ? -9.339  -6.042  -12.000 1.00 0.00 ? 60  PRO A HB2  1  
ATOM 888   H HB3  . PRO A 1 60  ? -9.448  -6.467  -10.287 1.00 0.00 ? 60  PRO A HB3  1  
ATOM 889   H HG2  . PRO A 1 60  ? -9.698  -8.227  -12.695 1.00 0.00 ? 60  PRO A HG2  1  
ATOM 890   H HG3  . PRO A 1 60  ? -8.832  -8.525  -11.177 1.00 0.00 ? 60  PRO A HG3  1  
ATOM 891   H HD2  . PRO A 1 60  ? -11.270 -9.582  -11.692 1.00 0.00 ? 60  PRO A HD2  1  
ATOM 892   H HD3  . PRO A 1 60  ? -10.750 -9.136  -10.054 1.00 0.00 ? 60  PRO A HD3  1  
ATOM 893   N N    . THR A 1 61  ? -12.428 -6.647  -13.452 1.00 0.00 ? 61  THR A N    1  
ATOM 894   C CA   . THR A 1 61  ? -12.879 -6.234  -14.776 1.00 0.00 ? 61  THR A CA   1  
ATOM 895   C C    . THR A 1 61  ? -13.833 -5.049  -14.687 1.00 0.00 ? 61  THR A C    1  
ATOM 896   O O    . THR A 1 61  ? -14.047 -4.338  -15.668 1.00 0.00 ? 61  THR A O    1  
ATOM 897   C CB   . THR A 1 61  ? -13.580 -7.389  -15.514 1.00 0.00 ? 61  THR A CB   1  
ATOM 898   O OG1  . THR A 1 61  ? -13.992 -6.959  -16.817 1.00 0.00 ? 61  THR A OG1  1  
ATOM 899   C CG2  . THR A 1 61  ? -14.789 -7.878  -14.731 1.00 0.00 ? 61  THR A CG2  1  
ATOM 900   H H    . THR A 1 61  ? -12.622 -7.555  -13.142 1.00 0.00 ? 61  THR A H    1  
ATOM 901   H HA   . THR A 1 61  ? -12.010 -5.943  -15.348 1.00 0.00 ? 61  THR A HA   1  
ATOM 902   H HB   . THR A 1 61  ? -12.881 -8.207  -15.618 1.00 0.00 ? 61  THR A HB   1  
ATOM 903   H HG1  . THR A 1 61  ? -13.342 -6.347  -17.172 1.00 0.00 ? 61  THR A HG1  1  
ATOM 904   H HG21 . THR A 1 61  ? -15.660 -7.309  -15.020 1.00 0.00 ? 61  THR A HG21 1  
ATOM 905   H HG22 . THR A 1 61  ? -14.608 -7.750  -13.674 1.00 0.00 ? 61  THR A HG22 1  
ATOM 906   H HG23 . THR A 1 61  ? -14.956 -8.923  -14.944 1.00 0.00 ? 61  THR A HG23 1  
ATOM 907   N N    . GLN A 1 62  ? -14.403 -4.842  -13.504 1.00 0.00 ? 62  GLN A N    1  
ATOM 908   C CA   . GLN A 1 62  ? -15.335 -3.741  -13.288 1.00 0.00 ? 62  GLN A CA   1  
ATOM 909   C C    . GLN A 1 62  ? -14.604 -2.498  -12.792 1.00 0.00 ? 62  GLN A C    1  
ATOM 910   O O    . GLN A 1 62  ? -13.410 -2.545  -12.494 1.00 0.00 ? 62  GLN A O    1  
ATOM 911   C CB   . GLN A 1 62  ? -16.414 -4.149  -12.283 1.00 0.00 ? 62  GLN A CB   1  
ATOM 912   C CG   . GLN A 1 62  ? -16.956 -5.550  -12.507 1.00 0.00 ? 62  GLN A CG   1  
ATOM 913   C CD   . GLN A 1 62  ? -18.450 -5.644  -12.268 1.00 0.00 ? 62  GLN A CD   1  
ATOM 914   O OE1  . GLN A 1 62  ? -19.242 -4.997  -12.954 1.00 0.00 ? 62  GLN A OE1  1  
ATOM 915   N NE2  . GLN A 1 62  ? -18.844 -6.452  -11.291 1.00 0.00 ? 62  GLN A NE2  1  
ATOM 916   H H    . GLN A 1 62  ? -14.192 -5.443  -12.759 1.00 0.00 ? 62  GLN A H    1  
ATOM 917   H HA   . GLN A 1 62  ? -15.804 -3.514  -14.233 1.00 0.00 ? 62  GLN A HA   1  
ATOM 918   H HB2  . GLN A 1 62  ? -15.998 -4.101  -11.288 1.00 0.00 ? 62  GLN A HB2  1  
ATOM 919   H HB3  . GLN A 1 62  ? -17.237 -3.452  -12.354 1.00 0.00 ? 62  GLN A HB3  1  
ATOM 920   H HG2  . GLN A 1 62  ? -16.751 -5.844  -13.527 1.00 0.00 ? 62  GLN A HG2  1  
ATOM 921   H HG3  . GLN A 1 62  ? -16.455 -6.228  -11.832 1.00 0.00 ? 62  GLN A HG3  1  
ATOM 922   H HE21 . GLN A 1 62  ? -18.157 -6.935  -10.785 1.00 0.00 ? 62  GLN A HE21 1  
ATOM 923   H HE22 . GLN A 1 62  ? -19.804 -6.531  -11.114 1.00 0.00 ? 62  GLN A HE22 1  
ATOM 924   N N    . HIS A 1 63  ? -15.328 -1.387  -12.705 1.00 0.00 ? 63  HIS A N    1  
ATOM 925   C CA   . HIS A 1 63  ? -14.748 -0.130  -12.243 1.00 0.00 ? 63  HIS A CA   1  
ATOM 926   C C    . HIS A 1 63  ? -14.411 -0.201  -10.757 1.00 0.00 ? 63  HIS A C    1  
ATOM 927   O O    . HIS A 1 63  ? -15.124 -0.832  -9.977  1.00 0.00 ? 63  HIS A O    1  
ATOM 928   C CB   . HIS A 1 63  ? -15.711 1.027   -12.505 1.00 0.00 ? 63  HIS A CB   1  
ATOM 929   C CG   . HIS A 1 63  ? -15.025 2.333   -12.760 1.00 0.00 ? 63  HIS A CG   1  
ATOM 930   N ND1  . HIS A 1 63  ? -14.408 3.065   -11.767 1.00 0.00 ? 63  HIS A ND1  1  
ATOM 931   C CD2  . HIS A 1 63  ? -14.857 3.037   -13.905 1.00 0.00 ? 63  HIS A CD2  1  
ATOM 932   C CE1  . HIS A 1 63  ? -13.892 4.163   -12.290 1.00 0.00 ? 63  HIS A CE1  1  
ATOM 933   N NE2  . HIS A 1 63  ? -14.150 4.171   -13.585 1.00 0.00 ? 63  HIS A NE2  1  
ATOM 934   H H    . HIS A 1 63  ? -16.275 -1.413  -12.956 1.00 0.00 ? 63  HIS A H    1  
ATOM 935   H HA   . HIS A 1 63  ? -13.838 0.038   -12.798 1.00 0.00 ? 63  HIS A HA   1  
ATOM 936   H HB2  . HIS A 1 63  ? -16.316 0.796   -13.370 1.00 0.00 ? 63  HIS A HB2  1  
ATOM 937   H HB3  . HIS A 1 63  ? -16.356 1.152   -11.647 1.00 0.00 ? 63  HIS A HB3  1  
ATOM 938   H HD2  . HIS A 1 63  ? -15.213 2.760   -14.886 1.00 0.00 ? 63  HIS A HD2  1  
ATOM 939   H HE1  . HIS A 1 63  ? -13.350 4.926   -11.751 1.00 0.00 ? 63  HIS A HE1  1  
ATOM 940   H HE2  . HIS A 1 63  ? -13.955 4.911   -14.195 1.00 0.00 ? 63  HIS A HE2  1  
ATOM 941   N N    . VAL A 1 64  ? -13.318 0.450   -10.371 1.00 0.00 ? 64  VAL A N    1  
ATOM 942   C CA   . VAL A 1 64  ? -12.887 0.461   -8.979  1.00 0.00 ? 64  VAL A CA   1  
ATOM 943   C C    . VAL A 1 64  ? -13.990 0.982   -8.065  1.00 0.00 ? 64  VAL A C    1  
ATOM 944   O O    . VAL A 1 64  ? -14.025 0.668   -6.876  1.00 0.00 ? 64  VAL A O    1  
ATOM 945   C CB   . VAL A 1 64  ? -11.627 1.328   -8.788  1.00 0.00 ? 64  VAL A CB   1  
ATOM 946   C CG1  . VAL A 1 64  ? -10.399 0.612   -9.330  1.00 0.00 ? 64  VAL A CG1  1  
ATOM 947   C CG2  . VAL A 1 64  ? -11.806 2.681   -9.461  1.00 0.00 ? 64  VAL A CG2  1  
ATOM 948   H H    . VAL A 1 64  ? -12.790 0.935   -11.040 1.00 0.00 ? 64  VAL A H    1  
ATOM 949   H HA   . VAL A 1 64  ? -12.646 -0.552  -8.695  1.00 0.00 ? 64  VAL A HA   1  
ATOM 950   H HB   . VAL A 1 64  ? -11.484 1.492   -7.731  1.00 0.00 ? 64  VAL A HB   1  
ATOM 951   H HG11 . VAL A 1 64  ? -10.530 0.421   -10.385 1.00 0.00 ? 64  VAL A HG11 1  
ATOM 952   H HG12 . VAL A 1 64  ? -9.527  1.231   -9.180  1.00 0.00 ? 64  VAL A HG12 1  
ATOM 953   H HG13 . VAL A 1 64  ? -10.270 -0.324  -8.808  1.00 0.00 ? 64  VAL A HG13 1  
ATOM 954   H HG21 . VAL A 1 64  ? -11.583 3.467   -8.754  1.00 0.00 ? 64  VAL A HG21 1  
ATOM 955   H HG22 . VAL A 1 64  ? -11.134 2.756   -10.304 1.00 0.00 ? 64  VAL A HG22 1  
ATOM 956   H HG23 . VAL A 1 64  ? -12.825 2.782   -9.804  1.00 0.00 ? 64  VAL A HG23 1  
ATOM 957   N N    . ASN A 1 65  ? -14.892 1.778   -8.630  1.00 0.00 ? 65  ASN A N    1  
ATOM 958   C CA   . ASN A 1 65  ? -15.998 2.342   -7.866  1.00 0.00 ? 65  ASN A CA   1  
ATOM 959   C C    . ASN A 1 65  ? -17.020 1.266   -7.511  1.00 0.00 ? 65  ASN A C    1  
ATOM 960   O O    . ASN A 1 65  ? -17.817 1.433   -6.589  1.00 0.00 ? 65  ASN A O    1  
ATOM 961   C CB   . ASN A 1 65  ? -16.676 3.462   -8.660  1.00 0.00 ? 65  ASN A CB   1  
ATOM 962   C CG   . ASN A 1 65  ? -16.984 4.674   -7.802  1.00 0.00 ? 65  ASN A CG   1  
ATOM 963   O OD1  . ASN A 1 65  ? -17.735 4.585   -6.831  1.00 0.00 ? 65  ASN A OD1  1  
ATOM 964   N ND2  . ASN A 1 65  ? -16.406 5.815   -8.160  1.00 0.00 ? 65  ASN A ND2  1  
ATOM 965   H H    . ASN A 1 65  ? -14.811 1.993   -9.583  1.00 0.00 ? 65  ASN A H    1  
ATOM 966   H HA   . ASN A 1 65  ? -15.595 2.754   -6.953  1.00 0.00 ? 65  ASN A HA   1  
ATOM 967   H HB2  . ASN A 1 65  ? -16.023 3.770   -9.464  1.00 0.00 ? 65  ASN A HB2  1  
ATOM 968   H HB3  . ASN A 1 65  ? -17.601 3.091   -9.075  1.00 0.00 ? 65  ASN A HB3  1  
ATOM 969   H HD21 . ASN A 1 65  ? -15.821 5.810   -8.947  1.00 0.00 ? 65  ASN A HD21 1  
ATOM 970   H HD22 . ASN A 1 65  ? -16.588 6.614   -7.623  1.00 0.00 ? 65  ASN A HD22 1  
ATOM 971   N N    . ASN A 1 66  ? -16.987 0.162   -8.250  1.00 0.00 ? 66  ASN A N    1  
ATOM 972   C CA   . ASN A 1 66  ? -17.910 -0.943  -8.014  1.00 0.00 ? 66  ASN A CA   1  
ATOM 973   C C    . ASN A 1 66  ? -17.244 -2.041  -7.190  1.00 0.00 ? 66  ASN A C    1  
ATOM 974   O O    . ASN A 1 66  ? -17.920 -2.879  -6.592  1.00 0.00 ? 66  ASN A O    1  
ATOM 975   C CB   . ASN A 1 66  ? -18.403 -1.516  -9.344  1.00 0.00 ? 66  ASN A CB   1  
ATOM 976   C CG   . ASN A 1 66  ? -19.558 -2.483  -9.164  1.00 0.00 ? 66  ASN A CG   1  
ATOM 977   O OD1  . ASN A 1 66  ? -19.357 -3.654  -8.846  1.00 0.00 ? 66  ASN A OD1  1  
ATOM 978   N ND2  . ASN A 1 66  ? -20.775 -1.994  -9.367  1.00 0.00 ? 66  ASN A ND2  1  
ATOM 979   H H    . ASN A 1 66  ? -16.329 0.088   -8.972  1.00 0.00 ? 66  ASN A H    1  
ATOM 980   H HA   . ASN A 1 66  ? -18.755 -0.557  -7.463  1.00 0.00 ? 66  ASN A HA   1  
ATOM 981   H HB2  . ASN A 1 66  ? -18.734 -0.705  -9.977  1.00 0.00 ? 66  ASN A HB2  1  
ATOM 982   H HB3  . ASN A 1 66  ? -17.592 -2.038  -9.828  1.00 0.00 ? 66  ASN A HB3  1  
ATOM 983   H HD21 . ASN A 1 66  ? -20.860 -1.050  -9.619  1.00 0.00 ? 66  ASN A HD21 1  
ATOM 984   H HD22 . ASN A 1 66  ? -21.540 -2.597  -9.257  1.00 0.00 ? 66  ASN A HD22 1  
ATOM 985   N N    . TRP A 1 67  ? -15.916 -2.030  -7.163  1.00 0.00 ? 67  TRP A N    1  
ATOM 986   C CA   . TRP A 1 67  ? -15.159 -3.024  -6.412  1.00 0.00 ? 67  TRP A CA   1  
ATOM 987   C C    . TRP A 1 67  ? -15.657 -3.115  -4.973  1.00 0.00 ? 67  TRP A C    1  
ATOM 988   O O    . TRP A 1 67  ? -16.443 -2.282  -4.525  1.00 0.00 ? 67  TRP A O    1  
ATOM 989   C CB   . TRP A 1 67  ? -13.669 -2.678  -6.427  1.00 0.00 ? 67  TRP A CB   1  
ATOM 990   C CG   . TRP A 1 67  ? -13.012 -2.943  -7.748  1.00 0.00 ? 67  TRP A CG   1  
ATOM 991   C CD1  . TRP A 1 67  ? -13.629 -3.071  -8.960  1.00 0.00 ? 67  TRP A CD1  1  
ATOM 992   C CD2  . TRP A 1 67  ? -11.611 -3.115  -7.990  1.00 0.00 ? 67  TRP A CD2  1  
ATOM 993   N NE1  . TRP A 1 67  ? -12.696 -3.311  -9.939  1.00 0.00 ? 67  TRP A NE1  1  
ATOM 994   C CE2  . TRP A 1 67  ? -11.451 -3.342  -9.370  1.00 0.00 ? 67  TRP A CE2  1  
ATOM 995   C CE3  . TRP A 1 67  ? -10.476 -3.097  -7.174  1.00 0.00 ? 67  TRP A CE3  1  
ATOM 996   C CZ2  . TRP A 1 67  ? -10.202 -3.551  -9.950  1.00 0.00 ? 67  TRP A CZ2  1  
ATOM 997   C CZ3  . TRP A 1 67  ? -9.238  -3.304  -7.751  1.00 0.00 ? 67  TRP A CZ3  1  
ATOM 998   C CH2  . TRP A 1 67  ? -9.108  -3.528  -9.128  1.00 0.00 ? 67  TRP A CH2  1  
ATOM 999   H H    . TRP A 1 67  ? -15.433 -1.336  -7.659  1.00 0.00 ? 67  TRP A H    1  
ATOM 1000  H HA   . TRP A 1 67  ? -15.303 -3.980  -6.892  1.00 0.00 ? 67  TRP A HA   1  
ATOM 1001  H HB2  . TRP A 1 67  ? -13.546 -1.631  -6.198  1.00 0.00 ? 67  TRP A HB2  1  
ATOM 1002  H HB3  . TRP A 1 67  ? -13.163 -3.270  -5.678  1.00 0.00 ? 67  TRP A HB3  1  
ATOM 1003  H HD1  . TRP A 1 67  ? -14.695 -2.994  -9.110  1.00 0.00 ? 67  TRP A HD1  1  
ATOM 1004  H HE1  . TRP A 1 67  ? -12.892 -3.438  -10.892 1.00 0.00 ? 67  TRP A HE1  1  
ATOM 1005  H HE3  . TRP A 1 67  ? -10.556 -2.926  -6.110  1.00 0.00 ? 67  TRP A HE3  1  
ATOM 1006  H HZ2  . TRP A 1 67  ? -10.086 -3.724  -11.010 1.00 0.00 ? 67  TRP A HZ2  1  
ATOM 1007  H HZ3  . TRP A 1 67  ? -8.349  -3.294  -7.136  1.00 0.00 ? 67  TRP A HZ3  1  
ATOM 1008  H HH2  . TRP A 1 67  ? -8.122  -3.685  -9.535  1.00 0.00 ? 67  TRP A HH2  1  
ATOM 1009  N N    . MET A 1 68  ? -15.194 -4.133  -4.255  1.00 0.00 ? 68  MET A N    1  
ATOM 1010  C CA   . MET A 1 68  ? -15.592 -4.331  -2.866  1.00 0.00 ? 68  MET A CA   1  
ATOM 1011  C C    . MET A 1 68  ? -15.101 -3.184  -1.990  1.00 0.00 ? 68  MET A C    1  
ATOM 1012  O O    . MET A 1 68  ? -15.828 -2.690  -1.128  1.00 0.00 ? 68  MET A O    1  
ATOM 1013  C CB   . MET A 1 68  ? -15.045 -5.659  -2.341  1.00 0.00 ? 68  MET A CB   1  
ATOM 1014  C CG   . MET A 1 68  ? -16.129 -6.654  -1.957  1.00 0.00 ? 68  MET A CG   1  
ATOM 1015  S SD   . MET A 1 68  ? -15.719 -8.345  -2.428  1.00 0.00 ? 68  MET A SD   1  
ATOM 1016  C CE   . MET A 1 68  ? -14.414 -8.716  -1.258  1.00 0.00 ? 68  MET A CE   1  
ATOM 1017  H H    . MET A 1 68  ? -14.569 -4.765  -4.667  1.00 0.00 ? 68  MET A H    1  
ATOM 1018  H HA   . MET A 1 68  ? -16.671 -4.359  -2.832  1.00 0.00 ? 68  MET A HA   1  
ATOM 1019  H HB2  . MET A 1 68  ? -14.429 -6.109  -3.106  1.00 0.00 ? 68  MET A HB2  1  
ATOM 1020  H HB3  . MET A 1 68  ? -14.439 -5.467  -1.468  1.00 0.00 ? 68  MET A HB3  1  
ATOM 1021  H HG2  . MET A 1 68  ? -16.269 -6.618  -0.887  1.00 0.00 ? 68  MET A HG2  1  
ATOM 1022  H HG3  . MET A 1 68  ? -17.047 -6.371  -2.447  1.00 0.00 ? 68  MET A HG3  1  
ATOM 1023  H HE1  . MET A 1 68  ? -14.154 -7.820  -0.713  1.00 0.00 ? 68  MET A HE1  1  
ATOM 1024  H HE2  . MET A 1 68  ? -14.754 -9.472  -0.566  1.00 0.00 ? 68  MET A HE2  1  
ATOM 1025  H HE3  . MET A 1 68  ? -13.545 -9.078  -1.790  1.00 0.00 ? 68  MET A HE3  1  
ATOM 1026  N N    . LYS A 1 69  ? -13.861 -2.762  -2.216  1.00 0.00 ? 69  LYS A N    1  
ATOM 1027  C CA   . LYS A 1 69  ? -13.271 -1.672  -1.448  1.00 0.00 ? 69  LYS A CA   1  
ATOM 1028  C C    . LYS A 1 69  ? -13.144 -2.050  0.023   1.00 0.00 ? 69  LYS A C    1  
ATOM 1029  O O    . LYS A 1 69  ? -13.830 -2.951  0.505   1.00 0.00 ? 69  LYS A O    1  
ATOM 1030  C CB   . LYS A 1 69  ? -14.118 -0.405  -1.590  1.00 0.00 ? 69  LYS A CB   1  
ATOM 1031  C CG   . LYS A 1 69  ? -14.471 -0.066  -3.028  1.00 0.00 ? 69  LYS A CG   1  
ATOM 1032  C CD   . LYS A 1 69  ? -15.497 1.052   -3.102  1.00 0.00 ? 69  LYS A CD   1  
ATOM 1033  C CE   . LYS A 1 69  ? -15.365 1.845   -4.393  1.00 0.00 ? 69  LYS A CE   1  
ATOM 1034  N NZ   . LYS A 1 69  ? -15.891 3.231   -4.249  1.00 0.00 ? 69  LYS A NZ   1  
ATOM 1035  H H    . LYS A 1 69  ? -13.329 -3.195  -2.917  1.00 0.00 ? 69  LYS A H    1  
ATOM 1036  H HA   . LYS A 1 69  ? -12.286 -1.482  -1.846  1.00 0.00 ? 69  LYS A HA   1  
ATOM 1037  H HB2  . LYS A 1 69  ? -15.037 -0.537  -1.037  1.00 0.00 ? 69  LYS A HB2  1  
ATOM 1038  H HB3  . LYS A 1 69  ? -13.573 0.427   -1.169  1.00 0.00 ? 69  LYS A HB3  1  
ATOM 1039  H HG2  . LYS A 1 69  ? -13.575 0.247   -3.544  1.00 0.00 ? 69  LYS A HG2  1  
ATOM 1040  H HG3  . LYS A 1 69  ? -14.875 -0.946  -3.507  1.00 0.00 ? 69  LYS A HG3  1  
ATOM 1041  H HD2  . LYS A 1 69  ? -16.487 0.624   -3.055  1.00 0.00 ? 69  LYS A HD2  1  
ATOM 1042  H HD3  . LYS A 1 69  ? -15.350 1.719   -2.263  1.00 0.00 ? 69  LYS A HD3  1  
ATOM 1043  H HE2  . LYS A 1 69  ? -14.322 1.893   -4.667  1.00 0.00 ? 69  LYS A HE2  1  
ATOM 1044  H HE3  . LYS A 1 69  ? -15.918 1.338   -5.170  1.00 0.00 ? 69  LYS A HE3  1  
ATOM 1045  H HZ1  . LYS A 1 69  ? -16.597 3.423   -4.989  1.00 0.00 ? 69  LYS A HZ1  1  
ATOM 1046  H HZ2  . LYS A 1 69  ? -15.116 3.919   -4.338  1.00 0.00 ? 69  LYS A HZ2  1  
ATOM 1047  H HZ3  . LYS A 1 69  ? -16.340 3.349   -3.319  1.00 0.00 ? 69  LYS A HZ3  1  
ATOM 1048  N N    . HIS A 1 70  ? -12.263 -1.352  0.735   1.00 0.00 ? 70  HIS A N    1  
ATOM 1049  C CA   . HIS A 1 70  ? -12.047 -1.614  2.154   1.00 0.00 ? 70  HIS A CA   1  
ATOM 1050  C C    . HIS A 1 70  ? -12.041 -0.313  2.951   1.00 0.00 ? 70  HIS A C    1  
ATOM 1051  O O    . HIS A 1 70  ? -12.297 0.760   2.407   1.00 0.00 ? 70  HIS A O    1  
ATOM 1052  C CB   . HIS A 1 70  ? -10.730 -2.360  2.362   1.00 0.00 ? 70  HIS A CB   1  
ATOM 1053  C CG   . HIS A 1 70  ? -10.802 -3.422  3.416   1.00 0.00 ? 70  HIS A CG   1  
ATOM 1054  N ND1  . HIS A 1 70  ? -9.782  -3.665  4.311   1.00 0.00 ? 70  HIS A ND1  1  
ATOM 1055  C CD2  . HIS A 1 70  ? -11.784 -4.305  3.717   1.00 0.00 ? 70  HIS A CD2  1  
ATOM 1056  C CE1  . HIS A 1 70  ? -10.131 -4.654  5.115   1.00 0.00 ? 70  HIS A CE1  1  
ATOM 1057  N NE2  . HIS A 1 70  ? -11.341 -5.059  4.776   1.00 0.00 ? 70  HIS A NE2  1  
ATOM 1058  H H    . HIS A 1 70  ? -11.746 -0.646  0.295   1.00 0.00 ? 70  HIS A H    1  
ATOM 1059  H HA   . HIS A 1 70  ? -12.861 -2.232  2.504   1.00 0.00 ? 70  HIS A HA   1  
ATOM 1060  H HB2  . HIS A 1 70  ? -10.441 -2.834  1.435   1.00 0.00 ? 70  HIS A HB2  1  
ATOM 1061  H HB3  . HIS A 1 70  ? -9.966  -1.654  2.653   1.00 0.00 ? 70  HIS A HB3  1  
ATOM 1062  H HD1  . HIS A 1 70  ? -8.928  -3.187  4.349   1.00 0.00 ? 70  HIS A HD1  1  
ATOM 1063  H HD2  . HIS A 1 70  ? -12.737 -4.399  3.217   1.00 0.00 ? 70  HIS A HD2  1  
ATOM 1064  H HE1  . HIS A 1 70  ? -9.530  -5.061  5.915   1.00 0.00 ? 70  HIS A HE1  1  
ATOM 1065  N N    . ASN A 1 71  ? -11.746 -0.418  4.242   1.00 0.00 ? 71  ASN A N    1  
ATOM 1066  C CA   . ASN A 1 71  ? -11.707 0.751   5.115   1.00 0.00 ? 71  ASN A CA   1  
ATOM 1067  C C    . ASN A 1 71  ? -10.366 0.846   5.836   1.00 0.00 ? 71  ASN A C    1  
ATOM 1068  O O    . ASN A 1 71  ? -9.736  -0.168  6.135   1.00 0.00 ? 71  ASN A O    1  
ATOM 1069  C CB   . ASN A 1 71  ? -12.845 0.688   6.136   1.00 0.00 ? 71  ASN A CB   1  
ATOM 1070  C CG   . ASN A 1 71  ? -13.849 1.809   5.951   1.00 0.00 ? 71  ASN A CG   1  
ATOM 1071  O OD1  . ASN A 1 71  ? -14.957 1.589   5.459   1.00 0.00 ? 71  ASN A OD1  1  
ATOM 1072  N ND2  . ASN A 1 71  ? -13.467 3.018   6.345   1.00 0.00 ? 71  ASN A ND2  1  
ATOM 1073  H H    . ASN A 1 71  ? -11.551 -1.302  4.618   1.00 0.00 ? 71  ASN A H    1  
ATOM 1074  H HA   . ASN A 1 71  ? -11.835 1.628   4.499   1.00 0.00 ? 71  ASN A HA   1  
ATOM 1075  H HB2  . ASN A 1 71  ? -13.363 -0.254  6.032   1.00 0.00 ? 71  ASN A HB2  1  
ATOM 1076  H HB3  . ASN A 1 71  ? -12.432 0.760   7.131   1.00 0.00 ? 71  ASN A HB3  1  
ATOM 1077  H HD21 . ASN A 1 71  ? -12.571 3.118   6.728   1.00 0.00 ? 71  ASN A HD21 1  
ATOM 1078  H HD22 . ASN A 1 71  ? -14.098 3.760   6.237   1.00 0.00 ? 71  ASN A HD22 1  
ATOM 1079  N N    . VAL A 1 72  ? -9.935  2.073   6.113   1.00 0.00 ? 72  VAL A N    1  
ATOM 1080  C CA   . VAL A 1 72  ? -8.671  2.303   6.800   1.00 0.00 ? 72  VAL A CA   1  
ATOM 1081  C C    . VAL A 1 72  ? -8.730  3.564   7.655   1.00 0.00 ? 72  VAL A C    1  
ATOM 1082  O O    . VAL A 1 72  ? -9.364  4.550   7.280   1.00 0.00 ? 72  VAL A O    1  
ATOM 1083  C CB   . VAL A 1 72  ? -7.504  2.426   5.803   1.00 0.00 ? 72  VAL A CB   1  
ATOM 1084  C CG1  . VAL A 1 72  ? -6.200  2.699   6.537   1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1085  C CG2  . VAL A 1 72  ? -7.394  1.168   4.955   1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1086  H H    . VAL A 1 72  ? -10.483 2.842   5.850   1.00 0.00 ? 72  VAL A H    1  
ATOM 1087  H HA   . VAL A 1 72  ? -8.480  1.454   7.442   1.00 0.00 ? 72  VAL A HA   1  
ATOM 1088  H HB   . VAL A 1 72  ? -7.704  3.260   5.148   1.00 0.00 ? 72  VAL A HB   1  
ATOM 1089  H HG11 . VAL A 1 72  ? -6.081  3.764   6.674   1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1090  H HG12 . VAL A 1 72  ? -6.220  2.211   7.501   1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1091  H HG13 . VAL A 1 72  ? -5.373  2.316   5.957   1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1092  H HG21 . VAL A 1 72  ? -8.312  1.024   4.406   1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1093  H HG22 . VAL A 1 72  ? -6.572  1.271   4.261   1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1094  H HG23 . VAL A 1 72  ? -7.218  0.315   5.594   1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1095  N N    . ALA A 1 73  ? -8.064  3.526   8.804   1.00 0.00 ? 73  ALA A N    1  
ATOM 1096  C CA   . ALA A 1 73  ? -8.039  4.667   9.710   1.00 0.00 ? 73  ALA A CA   1  
ATOM 1097  C C    . ALA A 1 73  ? -6.615  4.986   10.153  1.00 0.00 ? 73  ALA A C    1  
ATOM 1098  O O    . ALA A 1 73  ? -6.271  4.839   11.326  1.00 0.00 ? 73  ALA A O    1  
ATOM 1099  C CB   . ALA A 1 73  ? -8.922  4.400   10.920  1.00 0.00 ? 73  ALA A CB   1  
ATOM 1100  H H    . ALA A 1 73  ? -7.578  2.712   9.048   1.00 0.00 ? 73  ALA A H    1  
ATOM 1101  H HA   . ALA A 1 73  ? -8.441  5.520   9.184   1.00 0.00 ? 73  ALA A HA   1  
ATOM 1102  H HB1  . ALA A 1 73  ? -8.764  5.173   11.658  1.00 0.00 ? 73  ALA A HB1  1  
ATOM 1103  H HB2  . ALA A 1 73  ? -9.958  4.397   10.616  1.00 0.00 ? 73  ALA A HB2  1  
ATOM 1104  H HB3  . ALA A 1 73  ? -8.669  3.439   11.346  1.00 0.00 ? 73  ALA A HB3  1  
ATOM 1105  N N    . ASP A 1 74  ? -5.790  5.422   9.207   1.00 0.00 ? 74  ASP A N    1  
ATOM 1106  C CA   . ASP A 1 74  ? -4.403  5.762   9.498   1.00 0.00 ? 74  ASP A CA   1  
ATOM 1107  C C    . ASP A 1 74  ? -3.706  4.618   10.229  1.00 0.00 ? 74  ASP A C    1  
ATOM 1108  O O    . ASP A 1 74  ? -3.205  4.791   11.340  1.00 0.00 ? 74  ASP A O    1  
ATOM 1109  C CB   . ASP A 1 74  ? -4.334  7.037   10.340  1.00 0.00 ? 74  ASP A CB   1  
ATOM 1110  C CG   . ASP A 1 74  ? -2.953  7.662   10.334  1.00 0.00 ? 74  ASP A CG   1  
ATOM 1111  O OD1  . ASP A 1 74  ? -2.256  7.548   9.303   1.00 0.00 ? 74  ASP A OD1  1  
ATOM 1112  O OD2  . ASP A 1 74  ? -2.568  8.262   11.359  1.00 0.00 ? 74  ASP A OD2  1  
ATOM 1113  H H    . ASP A 1 74  ? -6.123  5.518   8.289   1.00 0.00 ? 74  ASP A H    1  
ATOM 1114  H HA   . ASP A 1 74  ? -3.899  5.933   8.560   1.00 0.00 ? 74  ASP A HA   1  
ATOM 1115  H HB2  . ASP A 1 74  ? -5.036  7.758   9.948   1.00 0.00 ? 74  ASP A HB2  1  
ATOM 1116  H HB3  . ASP A 1 74  ? -4.599  6.802   11.361  1.00 0.00 ? 74  ASP A HB3  1  
ATOM 1117  N N    . SER A 1 75  ? -3.677  3.449   9.597   1.00 0.00 ? 75  SER A N    1  
ATOM 1118  C CA   . SER A 1 75  ? -3.045  2.276   10.187  1.00 0.00 ? 75  SER A CA   1  
ATOM 1119  C C    . SER A 1 75  ? -1.855  1.819   9.350   1.00 0.00 ? 75  SER A C    1  
ATOM 1120  O O    . SER A 1 75  ? -0.929  1.189   9.860   1.00 0.00 ? 75  SER A O    1  
ATOM 1121  C CB   . SER A 1 75  ? -4.058  1.136   10.318  1.00 0.00 ? 75  SER A CB   1  
ATOM 1122  O OG   . SER A 1 75  ? -4.145  0.682   11.657  1.00 0.00 ? 75  SER A OG   1  
ATOM 1123  H H    . SER A 1 75  ? -4.093  3.375   8.712   1.00 0.00 ? 75  SER A H    1  
ATOM 1124  H HA   . SER A 1 75  ? -2.695  2.548   11.171  1.00 0.00 ? 75  SER A HA   1  
ATOM 1125  H HB2  . SER A 1 75  ? -5.030  1.484   10.004  1.00 0.00 ? 75  SER A HB2  1  
ATOM 1126  H HB3  . SER A 1 75  ? -3.751  0.312   9.690   1.00 0.00 ? 75  SER A HB3  1  
ATOM 1127  H HG   . SER A 1 75  ? -5.048  0.418   11.848  1.00 0.00 ? 75  SER A HG   1  
ATOM 1128  N N    . GLN A 1 76  ? -1.887  2.143   8.061   1.00 0.00 ? 76  GLN A N    1  
ATOM 1129  C CA   . GLN A 1 76  ? -0.811  1.767   7.152   1.00 0.00 ? 76  GLN A CA   1  
ATOM 1130  C C    . GLN A 1 76  ? -0.686  0.250   7.056   1.00 0.00 ? 76  GLN A C    1  
ATOM 1131  O O    . GLN A 1 76  ? 0.347   -0.272  6.633   1.00 0.00 ? 76  GLN A O    1  
ATOM 1132  C CB   . GLN A 1 76  ? 0.514   2.372   7.618   1.00 0.00 ? 76  GLN A CB   1  
ATOM 1133  C CG   . GLN A 1 76  ? 0.895   3.644   6.878   1.00 0.00 ? 76  GLN A CG   1  
ATOM 1134  C CD   . GLN A 1 76  ? 1.916   4.474   7.632   1.00 0.00 ? 76  GLN A CD   1  
ATOM 1135  O OE1  . GLN A 1 76  ? 2.076   4.330   8.844   1.00 0.00 ? 76  GLN A OE1  1  
ATOM 1136  N NE2  . GLN A 1 76  ? 2.613   5.348   6.916   1.00 0.00 ? 76  GLN A NE2  1  
ATOM 1137  H H    . GLN A 1 76  ? -2.652  2.646   7.714   1.00 0.00 ? 76  GLN A H    1  
ATOM 1138  H HA   . GLN A 1 76  ? -1.052  2.157   6.175   1.00 0.00 ? 76  GLN A HA   1  
ATOM 1139  H HB2  . GLN A 1 76  ? 0.442   2.600   8.671   1.00 0.00 ? 76  GLN A HB2  1  
ATOM 1140  H HB3  . GLN A 1 76  ? 1.300   1.646   7.468   1.00 0.00 ? 76  GLN A HB3  1  
ATOM 1141  H HG2  . GLN A 1 76  ? 1.310   3.378   5.917   1.00 0.00 ? 76  GLN A HG2  1  
ATOM 1142  H HG3  . GLN A 1 76  ? 0.005   4.240   6.732   1.00 0.00 ? 76  GLN A HG3  1  
ATOM 1143  H HE21 . GLN A 1 76  ? 2.430   5.409   5.955   1.00 0.00 ? 76  GLN A HE21 1  
ATOM 1144  H HE22 . GLN A 1 76  ? 3.279   5.898   7.377   1.00 0.00 ? 76  GLN A HE22 1  
ATOM 1145  N N    . ILE A 1 77  ? -1.741  -0.453  7.453   1.00 0.00 ? 77  ILE A N    1  
ATOM 1146  C CA   . ILE A 1 77  ? -1.748  -1.909  7.412   1.00 0.00 ? 77  ILE A CA   1  
ATOM 1147  C C    . ILE A 1 77  ? -3.162  -2.458  7.577   1.00 0.00 ? 77  ILE A C    1  
ATOM 1148  O O    . ILE A 1 77  ? -3.918  -2.007  8.437   1.00 0.00 ? 77  ILE A O    1  
ATOM 1149  C CB   . ILE A 1 77  ? -0.847  -2.509  8.507   1.00 0.00 ? 77  ILE A CB   1  
ATOM 1150  C CG1  . ILE A 1 77  ? -0.700  -4.018  8.308   1.00 0.00 ? 77  ILE A CG1  1  
ATOM 1151  C CG2  . ILE A 1 77  ? -1.413  -2.203  9.885   1.00 0.00 ? 77  ILE A CG2  1  
ATOM 1152  C CD1  . ILE A 1 77  ? 0.360   -4.644  9.188   1.00 0.00 ? 77  ILE A CD1  1  
ATOM 1153  H H    . ILE A 1 77  ? -2.535  0.020   7.780   1.00 0.00 ? 77  ILE A H    1  
ATOM 1154  H HA   . ILE A 1 77  ? -1.365  -2.217  6.449   1.00 0.00 ? 77  ILE A HA   1  
ATOM 1155  H HB   . ILE A 1 77  ? 0.127   -2.047  8.433   1.00 0.00 ? 77  ILE A HB   1  
ATOM 1156  H HG12 . ILE A 1 77  ? -1.640  -4.498  8.530   1.00 0.00 ? 77  ILE A HG12 1  
ATOM 1157  H HG13 . ILE A 1 77  ? -0.436  -4.215  7.279   1.00 0.00 ? 77  ILE A HG13 1  
ATOM 1158  H HG21 . ILE A 1 77  ? -2.303  -2.793  10.048  1.00 0.00 ? 77  ILE A HG21 1  
ATOM 1159  H HG22 . ILE A 1 77  ? -0.678  -2.446  10.638  1.00 0.00 ? 77  ILE A HG22 1  
ATOM 1160  H HG23 . ILE A 1 77  ? -1.659  -1.154  9.948   1.00 0.00 ? 77  ILE A HG23 1  
ATOM 1161  H HD11 . ILE A 1 77  ? 1.299   -4.135  9.038   1.00 0.00 ? 77  ILE A HD11 1  
ATOM 1162  H HD12 . ILE A 1 77  ? 0.064   -4.560  10.223  1.00 0.00 ? 77  ILE A HD12 1  
ATOM 1163  H HD13 . ILE A 1 77  ? 0.471   -5.688  8.930   1.00 0.00 ? 77  ILE A HD13 1  
ATOM 1164  N N    . THR A 1 78  ? -3.513  -3.435  6.746   1.00 0.00 ? 78  THR A N    1  
ATOM 1165  C CA   . THR A 1 78  ? -4.835  -4.046  6.800   1.00 0.00 ? 78  THR A CA   1  
ATOM 1166  C C    . THR A 1 78  ? -4.778  -5.516  6.404   1.00 0.00 ? 78  THR A C    1  
ATOM 1167  O O    . THR A 1 78  ? -4.099  -5.887  5.446   1.00 0.00 ? 78  THR A O    1  
ATOM 1168  C CB   . THR A 1 78  ? -5.829  -3.315  5.877   1.00 0.00 ? 78  THR A CB   1  
ATOM 1169  O OG1  . THR A 1 78  ? -7.157  -3.801  6.104   1.00 0.00 ? 78  THR A OG1  1  
ATOM 1170  C CG2  . THR A 1 78  ? -5.455  -3.512  4.415   1.00 0.00 ? 78  THR A CG2  1  
ATOM 1171  H H    . THR A 1 78  ? -2.867  -3.751  6.081   1.00 0.00 ? 78  THR A H    1  
ATOM 1172  H HA   . THR A 1 78  ? -5.197  -3.969  7.815   1.00 0.00 ? 78  THR A HA   1  
ATOM 1173  H HB   . THR A 1 78  ? -5.797  -2.259  6.102   1.00 0.00 ? 78  THR A HB   1  
ATOM 1174  H HG1  . THR A 1 78  ? -7.232  -4.115  7.009   1.00 0.00 ? 78  THR A HG1  1  
ATOM 1175  H HG21 . THR A 1 78  ? -6.156  -2.979  3.790   1.00 0.00 ? 78  THR A HG21 1  
ATOM 1176  H HG22 . THR A 1 78  ? -5.485  -4.564  4.175   1.00 0.00 ? 78  THR A HG22 1  
ATOM 1177  H HG23 . THR A 1 78  ? -4.460  -3.131  4.245   1.00 0.00 ? 78  THR A HG23 1  
ATOM 1178  N N    . THR A 1 79  ? -5.497  -6.352  7.147   1.00 0.00 ? 79  THR A N    1  
ATOM 1179  C CA   . THR A 1 79  ? -5.527  -7.784  6.874   1.00 0.00 ? 79  THR A CA   1  
ATOM 1180  C C    . THR A 1 79  ? -6.896  -8.217  6.359   1.00 0.00 ? 79  THR A C    1  
ATOM 1181  O O    . THR A 1 79  ? -7.903  -8.075  7.053   1.00 0.00 ? 79  THR A O    1  
ATOM 1182  C CB   . THR A 1 79  ? -5.181  -8.604  8.131   1.00 0.00 ? 79  THR A CB   1  
ATOM 1183  O OG1  . THR A 1 79  ? -5.846  -8.052  9.273   1.00 0.00 ? 79  THR A OG1  1  
ATOM 1184  C CG2  . THR A 1 79  ? -3.679  -8.620  8.371   1.00 0.00 ? 79  THR A CG2  1  
ATOM 1185  H H    . THR A 1 79  ? -6.017  -5.997  7.897   1.00 0.00 ? 79  THR A H    1  
ATOM 1186  H HA   . THR A 1 79  ? -4.785  -7.995  6.117   1.00 0.00 ? 79  THR A HA   1  
ATOM 1187  H HB   . THR A 1 79  ? -5.520  -9.619  7.984   1.00 0.00 ? 79  THR A HB   1  
ATOM 1188  H HG1  . THR A 1 79  ? -6.359  -8.738  9.708   1.00 0.00 ? 79  THR A HG1  1  
ATOM 1189  H HG21 . THR A 1 79  ? -3.244  -7.709  7.987   1.00 0.00 ? 79  THR A HG21 1  
ATOM 1190  H HG22 . THR A 1 79  ? -3.244  -9.469  7.865   1.00 0.00 ? 79  THR A HG22 1  
ATOM 1191  H HG23 . THR A 1 79  ? -3.485  -8.693  9.430   1.00 0.00 ? 79  THR A HG23 1  
ATOM 1192  N N    . ILE A 1 80  ? -6.924  -8.743  5.139   1.00 0.00 ? 80  ILE A N    1  
ATOM 1193  C CA   . ILE A 1 80  ? -8.170  -9.198  4.534   1.00 0.00 ? 80  ILE A CA   1  
ATOM 1194  C C    . ILE A 1 80  ? -8.240  -10.721 4.498   1.00 0.00 ? 80  ILE A C    1  
ATOM 1195  O O    . ILE A 1 80  ? -7.234  -11.394 4.278   1.00 0.00 ? 80  ILE A O    1  
ATOM 1196  C CB   . ILE A 1 80  ? -8.331  -8.654  3.102   1.00 0.00 ? 80  ILE A CB   1  
ATOM 1197  C CG1  . ILE A 1 80  ? -8.302  -7.124  3.108   1.00 0.00 ? 80  ILE A CG1  1  
ATOM 1198  C CG2  . ILE A 1 80  ? -9.625  -9.162  2.485   1.00 0.00 ? 80  ILE A CG2  1  
ATOM 1199  C CD1  . ILE A 1 80  ? -8.234  -6.516  1.724   1.00 0.00 ? 80  ILE A CD1  1  
ATOM 1200  H H    . ILE A 1 80  ? -6.089  -8.828  4.636   1.00 0.00 ? 80  ILE A H    1  
ATOM 1201  H HA   . ILE A 1 80  ? -8.988  -8.824  5.133   1.00 0.00 ? 80  ILE A HA   1  
ATOM 1202  H HB   . ILE A 1 80  ? -7.508  -9.020  2.507   1.00 0.00 ? 80  ILE A HB   1  
ATOM 1203  H HG12 . ILE A 1 80  ? -9.194  -6.755  3.589   1.00 0.00 ? 80  ILE A HG12 1  
ATOM 1204  H HG13 . ILE A 1 80  ? -7.435  -6.790  3.660   1.00 0.00 ? 80  ILE A HG13 1  
ATOM 1205  H HG21 . ILE A 1 80  ? -9.712  -8.790  1.475   1.00 0.00 ? 80  ILE A HG21 1  
ATOM 1206  H HG22 . ILE A 1 80  ? -9.617  -10.241 2.470   1.00 0.00 ? 80  ILE A HG22 1  
ATOM 1207  H HG23 . ILE A 1 80  ? -10.464 -8.816  3.070   1.00 0.00 ? 80  ILE A HG23 1  
ATOM 1208  H HD11 . ILE A 1 80  ? -7.225  -6.190  1.523   1.00 0.00 ? 80  ILE A HD11 1  
ATOM 1209  H HD12 . ILE A 1 80  ? -8.530  -7.251  0.992   1.00 0.00 ? 80  ILE A HD12 1  
ATOM 1210  H HD13 . ILE A 1 80  ? -8.902  -5.668  1.672   1.00 0.00 ? 80  ILE A HD13 1  
ATOM 1211  N N    . GLY A 1 81  ? -9.437  -11.258 4.715   1.00 0.00 ? 81  GLY A N    1  
ATOM 1212  C CA   . GLY A 1 81  ? -9.617  -12.697 4.702   1.00 0.00 ? 81  GLY A CA   1  
ATOM 1213  C C    . GLY A 1 81  ? -10.962 -13.109 4.136   1.00 0.00 ? 81  GLY A C    1  
ATOM 1214  O O    . GLY A 1 81  ? -11.650 -12.306 3.508   1.00 0.00 ? 81  GLY A O    1  
ATOM 1215  H H    . GLY A 1 81  ? -10.203 -10.672 4.886   1.00 0.00 ? 81  GLY A H    1  
ATOM 1216  H HA2  . GLY A 1 81  ? -8.836  -13.142 4.103   1.00 0.00 ? 81  GLY A HA2  1  
ATOM 1217  H HA3  . GLY A 1 81  ? -9.537  -13.068 5.714   1.00 0.00 ? 81  GLY A HA3  1  
ATOM 1218  N N    . ASN A 1 82  ? -11.336 -14.364 4.357   1.00 0.00 ? 82  ASN A N    1  
ATOM 1219  C CA   . ASN A 1 82  ? -12.607 -14.881 3.862   1.00 0.00 ? 82  ASN A CA   1  
ATOM 1220  C C    . ASN A 1 82  ? -12.646 -14.862 2.338   1.00 0.00 ? 82  ASN A C    1  
ATOM 1221  O O    . ASN A 1 82  ? -13.679 -14.566 1.735   1.00 0.00 ? 82  ASN A O    1  
ATOM 1222  C CB   . ASN A 1 82  ? -13.770 -14.060 4.424   1.00 0.00 ? 82  ASN A CB   1  
ATOM 1223  C CG   . ASN A 1 82  ? -15.067 -14.842 4.458   1.00 0.00 ? 82  ASN A CG   1  
ATOM 1224  O OD1  . ASN A 1 82  ? -15.176 -15.855 5.148   1.00 0.00 ? 82  ASN A OD1  1  
ATOM 1225  N ND2  . ASN A 1 82  ? -16.060 -14.373 3.711   1.00 0.00 ? 82  ASN A ND2  1  
ATOM 1226  H H    . ASN A 1 82  ? -10.744 -14.958 4.865   1.00 0.00 ? 82  ASN A H    1  
ATOM 1227  H HA   . ASN A 1 82  ? -12.704 -15.902 4.201   1.00 0.00 ? 82  ASN A HA   1  
ATOM 1228  H HB2  . ASN A 1 82  ? -13.530 -13.751 5.432   1.00 0.00 ? 82  ASN A HB2  1  
ATOM 1229  H HB3  . ASN A 1 82  ? -13.914 -13.184 3.808   1.00 0.00 ? 82  ASN A HB3  1  
ATOM 1230  H HD21 . ASN A 1 82  ? -15.902 -13.561 3.186   1.00 0.00 ? 82  ASN A HD21 1  
ATOM 1231  H HD22 . ASN A 1 82  ? -16.911 -14.860 3.715   1.00 0.00 ? 82  ASN A HD22 1  
ATOM 1232  N N    . LEU A 1 83  ? -11.514 -15.181 1.719   1.00 0.00 ? 83  LEU A N    1  
ATOM 1233  C CA   . LEU A 1 83  ? -11.418 -15.201 0.264   1.00 0.00 ? 83  LEU A CA   1  
ATOM 1234  C C    . LEU A 1 83  ? -11.348 -16.633 -0.258  1.00 0.00 ? 83  LEU A C    1  
ATOM 1235  O O    . LEU A 1 83  ? -11.552 -17.588 0.491   1.00 0.00 ? 83  LEU A O    1  
ATOM 1236  C CB   . LEU A 1 83  ? -10.187 -14.418 -0.197  1.00 0.00 ? 83  LEU A CB   1  
ATOM 1237  C CG   . LEU A 1 83  ? -9.862  -13.151 0.595   1.00 0.00 ? 83  LEU A CG   1  
ATOM 1238  C CD1  . LEU A 1 83  ? -8.489  -12.620 0.214   1.00 0.00 ? 83  LEU A CD1  1  
ATOM 1239  C CD2  . LEU A 1 83  ? -10.930 -12.090 0.363   1.00 0.00 ? 83  LEU A CD2  1  
ATOM 1240  H H    . LEU A 1 83  ? -10.725 -15.408 2.252   1.00 0.00 ? 83  LEU A H    1  
ATOM 1241  H HA   . LEU A 1 83  ? -12.304 -14.728 -0.134  1.00 0.00 ? 83  LEU A HA   1  
ATOM 1242  H HB2  . LEU A 1 83  ? -9.333  -15.076 -0.131  1.00 0.00 ? 83  LEU A HB2  1  
ATOM 1243  H HB3  . LEU A 1 83  ? -10.342 -14.135 -1.229  1.00 0.00 ? 83  LEU A HB3  1  
ATOM 1244  H HG   . LEU A 1 83  ? -9.849  -13.387 1.650   1.00 0.00 ? 83  LEU A HG   1  
ATOM 1245  H HD11 . LEU A 1 83  ? -7.791  -13.441 0.151   1.00 0.00 ? 83  LEU A HD11 1  
ATOM 1246  H HD12 . LEU A 1 83  ? -8.154  -11.919 0.964   1.00 0.00 ? 83  LEU A HD12 1  
ATOM 1247  H HD13 . LEU A 1 83  ? -8.548  -12.123 -0.743  1.00 0.00 ? 83  LEU A HD13 1  
ATOM 1248  H HD21 . LEU A 1 83  ? -11.821 -12.556 -0.032  1.00 0.00 ? 83  LEU A HD21 1  
ATOM 1249  H HD22 . LEU A 1 83  ? -10.563 -11.360 -0.345  1.00 0.00 ? 83  LEU A HD22 1  
ATOM 1250  H HD23 . LEU A 1 83  ? -11.161 -11.603 1.297   1.00 0.00 ? 83  LEU A HD23 1  
ATOM 1251  N N    . VAL A 1 84  ? -11.057 -16.774 -1.547  1.00 0.00 ? 84  VAL A N    1  
ATOM 1252  C CA   . VAL A 1 84  ? -10.957 -18.090 -2.169  1.00 0.00 ? 84  VAL A CA   1  
ATOM 1253  C C    . VAL A 1 84  ? -9.541  -18.356 -2.667  1.00 0.00 ? 84  VAL A C    1  
ATOM 1254  O O    . VAL A 1 84  ? -8.917  -17.517 -3.318  1.00 0.00 ? 84  VAL A O    1  
ATOM 1255  C CB   . VAL A 1 84  ? -11.940 -18.230 -3.347  1.00 0.00 ? 84  VAL A CB   1  
ATOM 1256  C CG1  . VAL A 1 84  ? -11.685 -17.149 -4.385  1.00 0.00 ? 84  VAL A CG1  1  
ATOM 1257  C CG2  . VAL A 1 84  ? -11.831 -19.615 -3.968  1.00 0.00 ? 84  VAL A CG2  1  
ATOM 1258  H H    . VAL A 1 84  ? -10.905 -15.975 -2.093  1.00 0.00 ? 84  VAL A H    1  
ATOM 1259  H HA   . VAL A 1 84  ? -11.211 -18.831 -1.424  1.00 0.00 ? 84  VAL A HA   1  
ATOM 1260  H HB   . VAL A 1 84  ? -12.943 -18.106 -2.969  1.00 0.00 ? 84  VAL A HB   1  
ATOM 1261  H HG11 . VAL A 1 84  ? -12.458 -17.185 -5.139  1.00 0.00 ? 84  VAL A HG11 1  
ATOM 1262  H HG12 . VAL A 1 84  ? -11.693 -16.180 -3.907  1.00 0.00 ? 84  VAL A HG12 1  
ATOM 1263  H HG13 . VAL A 1 84  ? -10.724 -17.314 -4.849  1.00 0.00 ? 84  VAL A HG13 1  
ATOM 1264  H HG21 . VAL A 1 84  ? -12.160 -20.356 -3.255  1.00 0.00 ? 84  VAL A HG21 1  
ATOM 1265  H HG22 . VAL A 1 84  ? -12.452 -19.663 -4.851  1.00 0.00 ? 84  VAL A HG22 1  
ATOM 1266  H HG23 . VAL A 1 84  ? -10.804 -19.808 -4.240  1.00 0.00 ? 84  VAL A HG23 1  
ATOM 1267  N N    . PRO A 1 85  ? -9.019  -19.552 -2.356  1.00 0.00 ? 85  PRO A N    1  
ATOM 1268  C CA   . PRO A 1 85  ? -7.671  -19.957 -2.763  1.00 0.00 ? 85  PRO A CA   1  
ATOM 1269  C C    . PRO A 1 85  ? -7.566  -20.192 -4.266  1.00 0.00 ? 85  PRO A C    1  
ATOM 1270  O O    . PRO A 1 85  ? -8.571  -20.420 -4.939  1.00 0.00 ? 85  PRO A O    1  
ATOM 1271  C CB   . PRO A 1 85  ? -7.448  -21.265 -2.000  1.00 0.00 ? 85  PRO A CB   1  
ATOM 1272  C CG   . PRO A 1 85  ? -8.816  -21.800 -1.757  1.00 0.00 ? 85  PRO A CG   1  
ATOM 1273  C CD   . PRO A 1 85  ? -9.706  -20.600 -1.582  1.00 0.00 ? 85  PRO A CD   1  
ATOM 1274  H HA   . PRO A 1 85  ? -6.929  -19.231 -2.461  1.00 0.00 ? 85  PRO A HA   1  
ATOM 1275  H HB2  . PRO A 1 85  ? -6.859  -21.941 -2.604  1.00 0.00 ? 85  PRO A HB2  1  
ATOM 1276  H HB3  . PRO A 1 85  ? -6.934  -21.062 -1.073  1.00 0.00 ? 85  PRO A HB3  1  
ATOM 1277  H HG2  . PRO A 1 85  ? -9.138  -22.385 -2.606  1.00 0.00 ? 85  PRO A HG2  1  
ATOM 1278  H HG3  . PRO A 1 85  ? -8.821  -22.404 -0.862  1.00 0.00 ? 85  PRO A HG3  1  
ATOM 1279  H HD2  . PRO A 1 85  ? -10.688 -20.796 -1.986  1.00 0.00 ? 85  PRO A HD2  1  
ATOM 1280  H HD3  . PRO A 1 85  ? -9.772  -20.328 -0.540  1.00 0.00 ? 85  PRO A HD3  1  
ATOM 1281  N N    . GLN A 1 86  ? -6.344  -20.137 -4.786  1.00 0.00 ? 86  GLN A N    1  
ATOM 1282  C CA   . GLN A 1 86  ? -6.108  -20.345 -6.209  1.00 0.00 ? 86  GLN A CA   1  
ATOM 1283  C C    . GLN A 1 86  ? -6.975  -19.410 -7.046  1.00 0.00 ? 86  GLN A C    1  
ATOM 1284  O O    . GLN A 1 86  ? -7.688  -19.848 -7.950  1.00 0.00 ? 86  GLN A O    1  
ATOM 1285  C CB   . GLN A 1 86  ? -6.394  -21.799 -6.589  1.00 0.00 ? 86  GLN A CB   1  
ATOM 1286  C CG   . GLN A 1 86  ? -5.769  -22.809 -5.640  1.00 0.00 ? 86  GLN A CG   1  
ATOM 1287  C CD   . GLN A 1 86  ? -5.697  -24.201 -6.234  1.00 0.00 ? 86  GLN A CD   1  
ATOM 1288  O OE1  . GLN A 1 86  ? -6.641  -24.985 -6.128  1.00 0.00 ? 86  GLN A OE1  1  
ATOM 1289  N NE2  . GLN A 1 86  ? -4.572  -24.518 -6.865  1.00 0.00 ? 86  GLN A NE2  1  
ATOM 1290  H H    . GLN A 1 86  ? -5.582  -19.952 -4.197  1.00 0.00 ? 86  GLN A H    1  
ATOM 1291  H HA   . GLN A 1 86  ? -5.070  -20.128 -6.409  1.00 0.00 ? 86  GLN A HA   1  
ATOM 1292  H HB2  . GLN A 1 86  ? -7.462  -21.955 -6.593  1.00 0.00 ? 86  GLN A HB2  1  
ATOM 1293  H HB3  . GLN A 1 86  ? -6.007  -21.982 -7.580  1.00 0.00 ? 86  GLN A HB3  1  
ATOM 1294  H HG2  . GLN A 1 86  ? -4.768  -22.485 -5.398  1.00 0.00 ? 86  GLN A HG2  1  
ATOM 1295  H HG3  . GLN A 1 86  ? -6.361  -22.849 -4.737  1.00 0.00 ? 86  GLN A HG3  1  
ATOM 1296  H HE21 . GLN A 1 86  ? -3.861  -23.843 -6.911  1.00 0.00 ? 86  GLN A HE21 1  
ATOM 1297  H HE22 . GLN A 1 86  ? -4.497  -25.412 -7.259  1.00 0.00 ? 86  GLN A HE22 1  
ATOM 1298  N N    . LYS A 1 87  ? -6.911  -18.119 -6.739  1.00 0.00 ? 87  LYS A N    1  
ATOM 1299  C CA   . LYS A 1 87  ? -7.689  -17.119 -7.463  1.00 0.00 ? 87  LYS A CA   1  
ATOM 1300  C C    . LYS A 1 87  ? -7.000  -15.759 -7.421  1.00 0.00 ? 87  LYS A C    1  
ATOM 1301  O O    . LYS A 1 87  ? -6.688  -15.241 -6.349  1.00 0.00 ? 87  LYS A O    1  
ATOM 1302  C CB   . LYS A 1 87  ? -9.094  -17.010 -6.869  1.00 0.00 ? 87  LYS A CB   1  
ATOM 1303  C CG   . LYS A 1 87  ? -9.978  -18.207 -7.174  1.00 0.00 ? 87  LYS A CG   1  
ATOM 1304  C CD   . LYS A 1 87  ? -10.179 -18.385 -8.669  1.00 0.00 ? 87  LYS A CD   1  
ATOM 1305  C CE   . LYS A 1 87  ? -11.656 -18.411 -9.034  1.00 0.00 ? 87  LYS A CE   1  
ATOM 1306  N NZ   . LYS A 1 87  ? -11.885 -17.995 -10.446 1.00 0.00 ? 87  LYS A NZ   1  
ATOM 1307  H H    . LYS A 1 87  ? -6.324  -17.830 -6.009  1.00 0.00 ? 87  LYS A H    1  
ATOM 1308  H HA   . LYS A 1 87  ? -7.765  -17.439 -8.490  1.00 0.00 ? 87  LYS A HA   1  
ATOM 1309  H HB2  . LYS A 1 87  ? -9.012  -16.913 -5.797  1.00 0.00 ? 87  LYS A HB2  1  
ATOM 1310  H HB3  . LYS A 1 87  ? -9.571  -16.125 -7.266  1.00 0.00 ? 87  LYS A HB3  1  
ATOM 1311  H HG2  . LYS A 1 87  ? -9.515  -19.096 -6.775  1.00 0.00 ? 87  LYS A HG2  1  
ATOM 1312  H HG3  . LYS A 1 87  ? -10.942 -18.060 -6.706  1.00 0.00 ? 87  LYS A HG3  1  
ATOM 1313  H HD2  . LYS A 1 87  ? -9.706  -17.565 -9.188  1.00 0.00 ? 87  LYS A HD2  1  
ATOM 1314  H HD3  . LYS A 1 87  ? -9.725  -19.318 -8.975  1.00 0.00 ? 87  LYS A HD3  1  
ATOM 1315  H HE2  . LYS A 1 87  ? -12.030 -19.414 -8.898  1.00 0.00 ? 87  LYS A HE2  1  
ATOM 1316  H HE3  . LYS A 1 87  ? -12.186 -17.737 -8.378  1.00 0.00 ? 87  LYS A HE3  1  
ATOM 1317  H HZ1  . LYS A 1 87  ? -11.039 -18.194 -11.019 1.00 0.00 ? 87  LYS A HZ1  1  
ATOM 1318  H HZ2  . LYS A 1 87  ? -12.086 -16.975 -10.490 1.00 0.00 ? 87  LYS A HZ2  1  
ATOM 1319  H HZ3  . LYS A 1 87  ? -12.691 -18.515 -10.845 1.00 0.00 ? 87  LYS A HZ3  1  
ATOM 1320  N N    . THR A 1 88  ? -6.765  -15.183 -8.597  1.00 0.00 ? 88  THR A N    1  
ATOM 1321  C CA   . THR A 1 88  ? -6.115  -13.883 -8.694  1.00 0.00 ? 88  THR A CA   1  
ATOM 1322  C C    . THR A 1 88  ? -6.970  -12.791 -8.062  1.00 0.00 ? 88  THR A C    1  
ATOM 1323  O O    . THR A 1 88  ? -8.173  -12.709 -8.312  1.00 0.00 ? 88  THR A O    1  
ATOM 1324  C CB   . THR A 1 88  ? -5.825  -13.509 -10.160 1.00 0.00 ? 88  THR A CB   1  
ATOM 1325  O OG1  . THR A 1 88  ? -4.968  -14.489 -10.756 1.00 0.00 ? 88  THR A OG1  1  
ATOM 1326  C CG2  . THR A 1 88  ? -5.174  -12.137 -10.250 1.00 0.00 ? 88  THR A CG2  1  
ATOM 1327  H H    . THR A 1 88  ? -7.037  -15.646 -9.416  1.00 0.00 ? 88  THR A H    1  
ATOM 1328  H HA   . THR A 1 88  ? -5.173  -13.940 -8.167  1.00 0.00 ? 88  THR A HA   1  
ATOM 1329  H HB   . THR A 1 88  ? -6.760  -13.483 -10.701 1.00 0.00 ? 88  THR A HB   1  
ATOM 1330  H HG1  . THR A 1 88  ? -5.496  -15.112 -11.260 1.00 0.00 ? 88  THR A HG1  1  
ATOM 1331  H HG21 . THR A 1 88  ? -4.387  -12.062 -9.514  1.00 0.00 ? 88  THR A HG21 1  
ATOM 1332  H HG22 . THR A 1 88  ? -5.915  -11.373 -10.063 1.00 0.00 ? 88  THR A HG22 1  
ATOM 1333  H HG23 . THR A 1 88  ? -4.759  -12.000 -11.236 1.00 0.00 ? 88  THR A HG23 1  
ATOM 1334  N N    . TYR A 1 89  ? -6.342  -11.954 -7.244  1.00 0.00 ? 89  TYR A N    1  
ATOM 1335  C CA   . TYR A 1 89  ? -7.047  -10.867 -6.574  1.00 0.00 ? 89  TYR A CA   1  
ATOM 1336  C C    . TYR A 1 89  ? -6.298  -9.548  -6.741  1.00 0.00 ? 89  TYR A C    1  
ATOM 1337  O O    . TYR A 1 89  ? -5.085  -9.482  -6.546  1.00 0.00 ? 89  TYR A O    1  
ATOM 1338  C CB   . TYR A 1 89  ? -7.221  -11.184 -5.088  1.00 0.00 ? 89  TYR A CB   1  
ATOM 1339  C CG   . TYR A 1 89  ? -8.554  -11.813 -4.755  1.00 0.00 ? 89  TYR A CG   1  
ATOM 1340  C CD1  . TYR A 1 89  ? -9.674  -11.028 -4.510  1.00 0.00 ? 89  TYR A CD1  1  
ATOM 1341  C CD2  . TYR A 1 89  ? -8.696  -13.194 -4.686  1.00 0.00 ? 89  TYR A CD2  1  
ATOM 1342  C CE1  . TYR A 1 89  ? -10.895 -11.598 -4.205  1.00 0.00 ? 89  TYR A CE1  1  
ATOM 1343  C CE2  . TYR A 1 89  ? -9.913  -13.773 -4.382  1.00 0.00 ? 89  TYR A CE2  1  
ATOM 1344  C CZ   . TYR A 1 89  ? -11.009 -12.971 -4.143  1.00 0.00 ? 89  TYR A CZ   1  
ATOM 1345  O OH   . TYR A 1 89  ? -12.223 -13.544 -3.840  1.00 0.00 ? 89  TYR A OH   1  
ATOM 1346  H H    . TYR A 1 89  ? -5.383  -12.070 -7.084  1.00 0.00 ? 89  TYR A H    1  
ATOM 1347  H HA   . TYR A 1 89  ? -8.022  -10.774 -7.029  1.00 0.00 ? 89  TYR A HA   1  
ATOM 1348  H HB2  . TYR A 1 89  ? -6.446  -11.868 -4.779  1.00 0.00 ? 89  TYR A HB2  1  
ATOM 1349  H HB3  . TYR A 1 89  ? -7.134  -10.268 -4.520  1.00 0.00 ? 89  TYR A HB3  1  
ATOM 1350  H HD1  . TYR A 1 89  ? -9.582  -9.952  -4.561  1.00 0.00 ? 89  TYR A HD1  1  
ATOM 1351  H HD2  . TYR A 1 89  ? -7.835  -13.819 -4.874  1.00 0.00 ? 89  TYR A HD2  1  
ATOM 1352  H HE1  . TYR A 1 89  ? -11.753 -10.970 -4.017  1.00 0.00 ? 89  TYR A HE1  1  
ATOM 1353  H HE2  . TYR A 1 89  ? -10.003 -14.849 -4.334  1.00 0.00 ? 89  TYR A HE2  1  
ATOM 1354  H HH   . TYR A 1 89  ? -12.685 -12.995 -3.202  1.00 0.00 ? 89  TYR A HH   1  
ATOM 1355  N N    . SER A 1 90  ? -7.031  -8.500  -7.102  1.00 0.00 ? 90  SER A N    1  
ATOM 1356  C CA   . SER A 1 90  ? -6.439  -7.183  -7.298  1.00 0.00 ? 90  SER A CA   1  
ATOM 1357  C C    . SER A 1 90  ? -6.399  -6.404  -5.986  1.00 0.00 ? 90  SER A C    1  
ATOM 1358  O O    . SER A 1 90  ? -7.231  -6.611  -5.104  1.00 0.00 ? 90  SER A O    1  
ATOM 1359  C CB   . SER A 1 90  ? -7.226  -6.397  -8.348  1.00 0.00 ? 90  SER A CB   1  
ATOM 1360  O OG   . SER A 1 90  ? -7.386  -7.152  -9.537  1.00 0.00 ? 90  SER A OG   1  
ATOM 1361  H H    . SER A 1 90  ? -7.995  -8.617  -7.242  1.00 0.00 ? 90  SER A H    1  
ATOM 1362  H HA   . SER A 1 90  ? -5.427  -7.324  -7.650  1.00 0.00 ? 90  SER A HA   1  
ATOM 1363  H HB2  . SER A 1 90  ? -8.202  -6.155  -7.956  1.00 0.00 ? 90  SER A HB2  1  
ATOM 1364  H HB3  . SER A 1 90  ? -6.696  -5.485  -8.583  1.00 0.00 ? 90  SER A HB3  1  
ATOM 1365  H HG   . SER A 1 90  ? -6.675  -7.793  -9.606  1.00 0.00 ? 90  SER A HG   1  
ATOM 1366  N N    . VAL A 1 91  ? -5.425  -5.507  -5.867  1.00 0.00 ? 91  VAL A N    1  
ATOM 1367  C CA   . VAL A 1 91  ? -5.277  -4.696  -4.665  1.00 0.00 ? 91  VAL A CA   1  
ATOM 1368  C C    . VAL A 1 91  ? -4.757  -3.302  -5.004  1.00 0.00 ? 91  VAL A C    1  
ATOM 1369  O O    . VAL A 1 91  ? -3.795  -3.152  -5.756  1.00 0.00 ? 91  VAL A O    1  
ATOM 1370  C CB   . VAL A 1 91  ? -4.320  -5.358  -3.657  1.00 0.00 ? 91  VAL A CB   1  
ATOM 1371  C CG1  . VAL A 1 91  ? -4.295  -4.576  -2.351  1.00 0.00 ? 91  VAL A CG1  1  
ATOM 1372  C CG2  . VAL A 1 91  ? -4.719  -6.805  -3.413  1.00 0.00 ? 91  VAL A CG2  1  
ATOM 1373  H H    . VAL A 1 91  ? -4.792  -5.388  -6.606  1.00 0.00 ? 91  VAL A H    1  
ATOM 1374  H HA   . VAL A 1 91  ? -6.248  -4.605  -4.202  1.00 0.00 ? 91  VAL A HA   1  
ATOM 1375  H HB   . VAL A 1 91  ? -3.324  -5.346  -4.075  1.00 0.00 ? 91  VAL A HB   1  
ATOM 1376  H HG11 . VAL A 1 91  ? -3.851  -3.605  -2.521  1.00 0.00 ? 91  VAL A HG11 1  
ATOM 1377  H HG12 . VAL A 1 91  ? -5.304  -4.453  -1.986  1.00 0.00 ? 91  VAL A HG12 1  
ATOM 1378  H HG13 . VAL A 1 91  ? -3.710  -5.115  -1.621  1.00 0.00 ? 91  VAL A HG13 1  
ATOM 1379  H HG21 . VAL A 1 91  ? -4.385  -7.413  -4.241  1.00 0.00 ? 91  VAL A HG21 1  
ATOM 1380  H HG22 . VAL A 1 91  ? -4.262  -7.157  -2.500  1.00 0.00 ? 91  VAL A HG22 1  
ATOM 1381  H HG23 . VAL A 1 91  ? -5.794  -6.872  -3.328  1.00 0.00 ? 91  VAL A HG23 1  
ATOM 1382  N N    . LYS A 1 92  ? -5.402  -2.284  -4.443  1.00 0.00 ? 92  LYS A N    1  
ATOM 1383  C CA   . LYS A 1 92  ? -5.005  -0.902  -4.682  1.00 0.00 ? 92  LYS A CA   1  
ATOM 1384  C C    . LYS A 1 92  ? -5.023  -0.098  -3.386  1.00 0.00 ? 92  LYS A C    1  
ATOM 1385  O O    . LYS A 1 92  ? -5.736  -0.440  -2.442  1.00 0.00 ? 92  LYS A O    1  
ATOM 1386  C CB   . LYS A 1 92  ? -5.937  -0.253  -5.709  1.00 0.00 ? 92  LYS A CB   1  
ATOM 1387  C CG   . LYS A 1 92  ? -6.124  -1.081  -6.970  1.00 0.00 ? 92  LYS A CG   1  
ATOM 1388  C CD   . LYS A 1 92  ? -6.792  -0.277  -8.071  1.00 0.00 ? 92  LYS A CD   1  
ATOM 1389  C CE   . LYS A 1 92  ? -5.829  0.721   -8.697  1.00 0.00 ? 92  LYS A CE   1  
ATOM 1390  N NZ   . LYS A 1 92  ? -6.157  0.988   -10.125 1.00 0.00 ? 92  LYS A NZ   1  
ATOM 1391  H H    . LYS A 1 92  ? -6.163  -2.468  -3.853  1.00 0.00 ? 92  LYS A H    1  
ATOM 1392  H HA   . LYS A 1 92  ? -4.000  -0.908  -5.075  1.00 0.00 ? 92  LYS A HA   1  
ATOM 1393  H HB2  . LYS A 1 92  ? -6.905  -0.104  -5.256  1.00 0.00 ? 92  LYS A HB2  1  
ATOM 1394  H HB3  . LYS A 1 92  ? -5.529  0.707   -5.992  1.00 0.00 ? 92  LYS A HB3  1  
ATOM 1395  H HG2  . LYS A 1 92  ? -5.156  -1.413  -7.318  1.00 0.00 ? 92  LYS A HG2  1  
ATOM 1396  H HG3  . LYS A 1 92  ? -6.739  -1.939  -6.738  1.00 0.00 ? 92  LYS A HG3  1  
ATOM 1397  H HD2  . LYS A 1 92  ? -7.141  -0.952  -8.838  1.00 0.00 ? 92  LYS A HD2  1  
ATOM 1398  H HD3  . LYS A 1 92  ? -7.632  0.260   -7.654  1.00 0.00 ? 92  LYS A HD3  1  
ATOM 1399  H HE2  . LYS A 1 92  ? -5.882  1.646   -8.145  1.00 0.00 ? 92  LYS A HE2  1  
ATOM 1400  H HE3  . LYS A 1 92  ? -4.828  0.321   -8.634  1.00 0.00 ? 92  LYS A HE3  1  
ATOM 1401  H HZ1  . LYS A 1 92  ? -7.139  1.319   -10.209 1.00 0.00 ? 92  LYS A HZ1  1  
ATOM 1402  H HZ2  . LYS A 1 92  ? -6.047  0.119   -10.685 1.00 0.00 ? 92  LYS A HZ2  1  
ATOM 1403  H HZ3  . LYS A 1 92  ? -5.521  1.717   -10.506 1.00 0.00 ? 92  LYS A HZ3  1  
ATOM 1404  N N    . VAL A 1 93  ? -4.235  0.971   -3.347  1.00 0.00 ? 93  VAL A N    1  
ATOM 1405  C CA   . VAL A 1 93  ? -4.162  1.824   -2.168  1.00 0.00 ? 93  VAL A CA   1  
ATOM 1406  C C    . VAL A 1 93  ? -3.922  3.280   -2.556  1.00 0.00 ? 93  VAL A C    1  
ATOM 1407  O O    . VAL A 1 93  ? -3.249  3.566   -3.547  1.00 0.00 ? 93  VAL A O    1  
ATOM 1408  C CB   . VAL A 1 93  ? -3.043  1.369   -1.213  1.00 0.00 ? 93  VAL A CB   1  
ATOM 1409  C CG1  . VAL A 1 93  ? -3.047  2.207   0.056   1.00 0.00 ? 93  VAL A CG1  1  
ATOM 1410  C CG2  . VAL A 1 93  ? -3.192  -0.110  -0.885  1.00 0.00 ? 93  VAL A CG2  1  
ATOM 1411  H H    . VAL A 1 93  ? -3.691  1.192   -4.132  1.00 0.00 ? 93  VAL A H    1  
ATOM 1412  H HA   . VAL A 1 93  ? -5.104  1.752   -1.644  1.00 0.00 ? 93  VAL A HA   1  
ATOM 1413  H HB   . VAL A 1 93  ? -2.094  1.511   -1.709  1.00 0.00 ? 93  VAL A HB   1  
ATOM 1414  H HG11 . VAL A 1 93  ? -4.007  2.692   0.162   1.00 0.00 ? 93  VAL A HG11 1  
ATOM 1415  H HG12 . VAL A 1 93  ? -2.867  1.571   0.909   1.00 0.00 ? 93  VAL A HG12 1  
ATOM 1416  H HG13 . VAL A 1 93  ? -2.271  2.956   -0.006  1.00 0.00 ? 93  VAL A HG13 1  
ATOM 1417  H HG21 . VAL A 1 93  ? -4.133  -0.273  -0.381  1.00 0.00 ? 93  VAL A HG21 1  
ATOM 1418  H HG22 . VAL A 1 93  ? -3.169  -0.686  -1.799  1.00 0.00 ? 93  VAL A HG22 1  
ATOM 1419  H HG23 . VAL A 1 93  ? -2.381  -0.420  -0.244  1.00 0.00 ? 93  VAL A HG23 1  
ATOM 1420  N N    . LEU A 1 94  ? -4.477  4.195   -1.769  1.00 0.00 ? 94  LEU A N    1  
ATOM 1421  C CA   . LEU A 1 94  ? -4.324  5.622   -2.030  1.00 0.00 ? 94  LEU A CA   1  
ATOM 1422  C C    . LEU A 1 94  ? -4.364  6.420   -0.730  1.00 0.00 ? 94  LEU A C    1  
ATOM 1423  O O    . LEU A 1 94  ? -4.716  5.891   0.324   1.00 0.00 ? 94  LEU A O    1  
ATOM 1424  C CB   . LEU A 1 94  ? -5.424  6.109   -2.974  1.00 0.00 ? 94  LEU A CB   1  
ATOM 1425  C CG   . LEU A 1 94  ? -6.774  6.419   -2.329  1.00 0.00 ? 94  LEU A CG   1  
ATOM 1426  C CD1  . LEU A 1 94  ? -6.842  7.878   -1.907  1.00 0.00 ? 94  LEU A CD1  1  
ATOM 1427  C CD2  . LEU A 1 94  ? -7.912  6.085   -3.284  1.00 0.00 ? 94  LEU A CD2  1  
ATOM 1428  H H    . LEU A 1 94  ? -5.003  3.905   -0.995  1.00 0.00 ? 94  LEU A H    1  
ATOM 1429  H HA   . LEU A 1 94  ? -3.364  5.771   -2.501  1.00 0.00 ? 94  LEU A HA   1  
ATOM 1430  H HB2  . LEU A 1 94  ? -5.073  7.009   -3.454  1.00 0.00 ? 94  LEU A HB2  1  
ATOM 1431  H HB3  . LEU A 1 94  ? -5.581  5.343   -3.721  1.00 0.00 ? 94  LEU A HB3  1  
ATOM 1432  H HG   . LEU A 1 94  ? -6.891  5.811   -1.442  1.00 0.00 ? 94  LEU A HG   1  
ATOM 1433  H HD11 . LEU A 1 94  ? -7.847  8.247   -2.044  1.00 0.00 ? 94  LEU A HD11 1  
ATOM 1434  H HD12 . LEU A 1 94  ? -6.161  8.460   -2.510  1.00 0.00 ? 94  LEU A HD12 1  
ATOM 1435  H HD13 . LEU A 1 94  ? -6.565  7.966   -0.867  1.00 0.00 ? 94  LEU A HD13 1  
ATOM 1436  H HD21 . LEU A 1 94  ? -7.594  5.306   -3.961  1.00 0.00 ? 94  LEU A HD21 1  
ATOM 1437  H HD22 . LEU A 1 94  ? -8.179  6.967   -3.847  1.00 0.00 ? 94  LEU A HD22 1  
ATOM 1438  H HD23 . LEU A 1 94  ? -8.767  5.745   -2.719  1.00 0.00 ? 94  LEU A HD23 1  
ATOM 1439  N N    . ALA A 1 95  ? -4.002  7.695   -0.814  1.00 0.00 ? 95  ALA A N    1  
ATOM 1440  C CA   . ALA A 1 95  ? -4.000  8.568   0.354   1.00 0.00 ? 95  ALA A CA   1  
ATOM 1441  C C    . ALA A 1 95  ? -4.965  9.734   0.169   1.00 0.00 ? 95  ALA A C    1  
ATOM 1442  O O    . ALA A 1 95  ? -5.094  10.279  -0.927  1.00 0.00 ? 95  ALA A O    1  
ATOM 1443  C CB   . ALA A 1 95  ? -2.595  9.081   0.627   1.00 0.00 ? 95  ALA A CB   1  
ATOM 1444  H H    . ALA A 1 95  ? -3.730  8.059   -1.683  1.00 0.00 ? 95  ALA A H    1  
ATOM 1445  H HA   . ALA A 1 95  ? -4.317  7.984   1.207   1.00 0.00 ? 95  ALA A HA   1  
ATOM 1446  H HB1  . ALA A 1 95  ? -1.920  8.243   0.728   1.00 0.00 ? 95  ALA A HB1  1  
ATOM 1447  H HB2  . ALA A 1 95  ? -2.273  9.706   -0.194  1.00 0.00 ? 95  ALA A HB2  1  
ATOM 1448  H HB3  . ALA A 1 95  ? -2.594  9.658   1.540   1.00 0.00 ? 95  ALA A HB3  1  
ATOM 1449  N N    . PHE A 1 96  ? -5.643  10.112  1.248   1.00 0.00 ? 96  PHE A N    1  
ATOM 1450  C CA   . PHE A 1 96  ? -6.597  11.213  1.204   1.00 0.00 ? 96  PHE A CA   1  
ATOM 1451  C C    . PHE A 1 96  ? -6.559  12.018  2.501   1.00 0.00 ? 96  PHE A C    1  
ATOM 1452  O O    . PHE A 1 96  ? -6.337  11.469  3.580   1.00 0.00 ? 96  PHE A O    1  
ATOM 1453  C CB   . PHE A 1 96  ? -8.011  10.682  0.962   1.00 0.00 ? 96  PHE A CB   1  
ATOM 1454  C CG   . PHE A 1 96  ? -8.606  9.995   2.158   1.00 0.00 ? 96  PHE A CG   1  
ATOM 1455  C CD1  . PHE A 1 96  ? -9.307  10.717  3.112   1.00 0.00 ? 96  PHE A CD1  1  
ATOM 1456  C CD2  . PHE A 1 96  ? -8.466  8.627   2.331   1.00 0.00 ? 96  PHE A CD2  1  
ATOM 1457  C CE1  . PHE A 1 96  ? -9.855  10.089  4.213   1.00 0.00 ? 96  PHE A CE1  1  
ATOM 1458  C CE2  . PHE A 1 96  ? -9.013  7.993   3.430   1.00 0.00 ? 96  PHE A CE2  1  
ATOM 1459  C CZ   . PHE A 1 96  ? -9.708  8.724   4.373   1.00 0.00 ? 96  PHE A CZ   1  
ATOM 1460  H H    . PHE A 1 96  ? -5.496  9.639   2.094   1.00 0.00 ? 96  PHE A H    1  
ATOM 1461  H HA   . PHE A 1 96  ? -6.320  11.859  0.386   1.00 0.00 ? 96  PHE A HA   1  
ATOM 1462  H HB2  . PHE A 1 96  ? -8.658  11.504  0.697   1.00 0.00 ? 96  PHE A HB2  1  
ATOM 1463  H HB3  . PHE A 1 96  ? -7.987  9.972   0.149   1.00 0.00 ? 96  PHE A HB3  1  
ATOM 1464  H HD1  . PHE A 1 96  ? -9.423  11.785  2.987   1.00 0.00 ? 96  PHE A HD1  1  
ATOM 1465  H HD2  . PHE A 1 96  ? -7.922  8.054   1.594   1.00 0.00 ? 96  PHE A HD2  1  
ATOM 1466  H HE1  . PHE A 1 96  ? -10.398 10.665  4.948   1.00 0.00 ? 96  PHE A HE1  1  
ATOM 1467  H HE2  . PHE A 1 96  ? -8.896  6.927   3.552   1.00 0.00 ? 96  PHE A HE2  1  
ATOM 1468  H HZ   . PHE A 1 96  ? -10.137 8.231   5.233   1.00 0.00 ? 96  PHE A HZ   1  
ATOM 1469  N N    . THR A 1 97  ? -6.779  13.324  2.387   1.00 0.00 ? 97  THR A N    1  
ATOM 1470  C CA   . THR A 1 97  ? -6.768  14.205  3.547   1.00 0.00 ? 97  THR A CA   1  
ATOM 1471  C C    . THR A 1 97  ? -8.083  14.969  3.669   1.00 0.00 ? 97  THR A C    1  
ATOM 1472  O O    . THR A 1 97  ? -8.989  14.797  2.854   1.00 0.00 ? 97  THR A O    1  
ATOM 1473  C CB   . THR A 1 97  ? -5.606  15.214  3.477   1.00 0.00 ? 97  THR A CB   1  
ATOM 1474  O OG1  . THR A 1 97  ? -5.693  15.978  2.269   1.00 0.00 ? 97  THR A OG1  1  
ATOM 1475  C CG2  . THR A 1 97  ? -4.265  14.498  3.534   1.00 0.00 ? 97  THR A CG2  1  
ATOM 1476  H H    . THR A 1 97  ? -6.951  13.703  1.499   1.00 0.00 ? 97  THR A H    1  
ATOM 1477  H HA   . THR A 1 97  ? -6.635  13.595  4.428   1.00 0.00 ? 97  THR A HA   1  
ATOM 1478  H HB   . THR A 1 97  ? -5.678  15.882  4.323   1.00 0.00 ? 97  THR A HB   1  
ATOM 1479  H HG1  . THR A 1 97  ? -5.225  16.809  2.381   1.00 0.00 ? 97  THR A HG1  1  
ATOM 1480  H HG21 . THR A 1 97  ? -3.538  15.134  4.016   1.00 0.00 ? 97  THR A HG21 1  
ATOM 1481  H HG22 . THR A 1 97  ? -3.936  14.269  2.531   1.00 0.00 ? 97  THR A HG22 1  
ATOM 1482  H HG23 . THR A 1 97  ? -4.370  13.583  4.096   1.00 0.00 ? 97  THR A HG23 1  
ATOM 1483  N N    . SER A 1 98  ? -8.178  15.814  4.691   1.00 0.00 ? 98  SER A N    1  
ATOM 1484  C CA   . SER A 1 98  ? -9.383  16.603  4.921   1.00 0.00 ? 98  SER A CA   1  
ATOM 1485  C C    . SER A 1 98  ? -9.699  17.477  3.712   1.00 0.00 ? 98  SER A C    1  
ATOM 1486  O O    . SER A 1 98  ? -10.852 17.837  3.477   1.00 0.00 ? 98  SER A O    1  
ATOM 1487  C CB   . SER A 1 98  ? -9.216  17.476  6.166   1.00 0.00 ? 98  SER A CB   1  
ATOM 1488  O OG   . SER A 1 98  ? -10.462 17.999  6.593   1.00 0.00 ? 98  SER A OG   1  
ATOM 1489  H H    . SER A 1 98  ? -7.420  15.907  5.306   1.00 0.00 ? 98  SER A H    1  
ATOM 1490  H HA   . SER A 1 98  ? -10.201 15.917  5.079   1.00 0.00 ? 98  SER A HA   1  
ATOM 1491  H HB2  . SER A 1 98  ? -8.795  16.883  6.964   1.00 0.00 ? 98  SER A HB2  1  
ATOM 1492  H HB3  . SER A 1 98  ? -8.551  18.297  5.940   1.00 0.00 ? 98  SER A HB3  1  
ATOM 1493  H HG   . SER A 1 98  ? -10.473 18.059  7.550   1.00 0.00 ? 98  SER A HG   1  
ATOM 1494  N N    . ILE A 1 99  ? -8.665  17.814  2.947   1.00 0.00 ? 99  ILE A N    1  
ATOM 1495  C CA   . ILE A 1 99  ? -8.833  18.645  1.761   1.00 0.00 ? 99  ILE A CA   1  
ATOM 1496  C C    . ILE A 1 99  ? -9.523  17.873  0.642   1.00 0.00 ? 99  ILE A C    1  
ATOM 1497  O O    . ILE A 1 99  ? -10.577 18.277  0.152   1.00 0.00 ? 99  ILE A O    1  
ATOM 1498  C CB   . ILE A 1 99  ? -7.479  19.172  1.247   1.00 0.00 ? 99  ILE A CB   1  
ATOM 1499  C CG1  . ILE A 1 99  ? -6.776  19.981  2.338   1.00 0.00 ? 99  ILE A CG1  1  
ATOM 1500  C CG2  . ILE A 1 99  ? -7.680  20.016  -0.002  1.00 0.00 ? 99  ILE A CG2  1  
ATOM 1501  C CD1  . ILE A 1 99  ? -7.531  21.225  2.749   1.00 0.00 ? 99  ILE A CD1  1  
ATOM 1502  H H    . ILE A 1 99  ? -7.770  17.496  3.185   1.00 0.00 ? 99  ILE A H    1  
ATOM 1503  H HA   . ILE A 1 99  ? -9.446  19.492  2.031   1.00 0.00 ? 99  ILE A HA   1  
ATOM 1504  H HB   . ILE A 1 99  ? -6.865  18.323  0.984   1.00 0.00 ? 99  ILE A HB   1  
ATOM 1505  H HG12 . ILE A 1 99  ? -6.652  19.364  3.214   1.00 0.00 ? 99  ILE A HG12 1  
ATOM 1506  H HG13 . ILE A 1 99  ? -5.803  20.286  1.977   1.00 0.00 ? 99  ILE A HG13 1  
ATOM 1507  H HG21 . ILE A 1 99  ? -8.302  20.866  0.234   1.00 0.00 ? 99  ILE A HG21 1  
ATOM 1508  H HG22 . ILE A 1 99  ? -6.721  20.361  -0.359  1.00 0.00 ? 99  ILE A HG22 1  
ATOM 1509  H HG23 . ILE A 1 99  ? -8.157  19.421  -0.766  1.00 0.00 ? 99  ILE A HG23 1  
ATOM 1510  H HD11 . ILE A 1 99  ? -7.026  21.695  3.580   1.00 0.00 ? 99  ILE A HD11 1  
ATOM 1511  H HD12 . ILE A 1 99  ? -7.573  21.913  1.917   1.00 0.00 ? 99  ILE A HD12 1  
ATOM 1512  H HD13 . ILE A 1 99  ? -8.535  20.956  3.044   1.00 0.00 ? 99  ILE A HD13 1  
ATOM 1513  N N    . GLY A 1 100 ? -8.921  16.756  0.241   1.00 0.00 ? 100 GLY A N    1  
ATOM 1514  C CA   . GLY A 1 100 ? -9.494  15.944  -0.816  1.00 0.00 ? 100 GLY A CA   1  
ATOM 1515  C C    . GLY A 1 100 ? -8.883  14.558  -0.878  1.00 0.00 ? 100 GLY A C    1  
ATOM 1516  O O    . GLY A 1 100 ? -8.382  14.049  0.125   1.00 0.00 ? 100 GLY A O    1  
ATOM 1517  H H    . GLY A 1 100 ? -8.083  16.483  0.668   1.00 0.00 ? 100 GLY A H    1  
ATOM 1518  H HA2  . GLY A 1 100 ? -10.557 15.851  -0.649  1.00 0.00 ? 100 GLY A HA2  1  
ATOM 1519  H HA3  . GLY A 1 100 ? -9.331  16.439  -1.763  1.00 0.00 ? 100 GLY A HA3  1  
ATOM 1520  N N    . ASP A 1 101 ? -8.924  13.948  -2.057  1.00 0.00 ? 101 ASP A N    1  
ATOM 1521  C CA   . ASP A 1 101 ? -8.371  12.612  -2.246  1.00 0.00 ? 101 ASP A CA   1  
ATOM 1522  C C    . ASP A 1 101 ? -7.075  12.669  -3.049  1.00 0.00 ? 101 ASP A C    1  
ATOM 1523  O O    . ASP A 1 101 ? -6.767  13.679  -3.679  1.00 0.00 ? 101 ASP A O    1  
ATOM 1524  C CB   . ASP A 1 101 ? -9.385  11.711  -2.952  1.00 0.00 ? 101 ASP A CB   1  
ATOM 1525  C CG   . ASP A 1 101 ? -10.150 12.443  -4.037  1.00 0.00 ? 101 ASP A CG   1  
ATOM 1526  O OD1  . ASP A 1 101 ? -9.515  13.182  -4.818  1.00 0.00 ? 101 ASP A OD1  1  
ATOM 1527  O OD2  . ASP A 1 101 ? -11.386 12.275  -4.106  1.00 0.00 ? 101 ASP A OD2  1  
ATOM 1528  H H    . ASP A 1 101 ? -9.336  14.406  -2.819  1.00 0.00 ? 101 ASP A H    1  
ATOM 1529  H HA   . ASP A 1 101 ? -8.156  12.201  -1.271  1.00 0.00 ? 101 ASP A HA   1  
ATOM 1530  H HB2  . ASP A 1 101 ? -8.864  10.879  -3.404  1.00 0.00 ? 101 ASP A HB2  1  
ATOM 1531  H HB3  . ASP A 1 101 ? -10.092 11.337  -2.227  1.00 0.00 ? 101 ASP A HB3  1  
ATOM 1532  N N    . GLY A 1 102 ? -6.317  11.577  -3.020  1.00 0.00 ? 102 GLY A N    1  
ATOM 1533  C CA   . GLY A 1 102 ? -5.064  11.524  -3.749  1.00 0.00 ? 102 GLY A CA   1  
ATOM 1534  C C    . GLY A 1 102 ? -5.056  10.444  -4.812  1.00 0.00 ? 102 GLY A C    1  
ATOM 1535  O O    . GLY A 1 102 ? -5.957  9.607   -4.885  1.00 0.00 ? 102 GLY A O    1  
ATOM 1536  H H    . GLY A 1 102 ? -6.613  10.799  -2.500  1.00 0.00 ? 102 GLY A H    1  
ATOM 1537  H HA2  . GLY A 1 102 ? -4.893  12.480  -4.219  1.00 0.00 ? 102 GLY A HA2  1  
ATOM 1538  H HA3  . GLY A 1 102 ? -4.263  11.330  -3.050  1.00 0.00 ? 102 GLY A HA3  1  
ATOM 1539  N N    . PRO A 1 103 ? -4.019  10.454  -5.664  1.00 0.00 ? 103 PRO A N    1  
ATOM 1540  C CA   . PRO A 1 103 ? -3.875  9.475   -6.745  1.00 0.00 ? 103 PRO A CA   1  
ATOM 1541  C C    . PRO A 1 103 ? -3.559  8.077   -6.224  1.00 0.00 ? 103 PRO A C    1  
ATOM 1542  O O    . PRO A 1 103 ? -2.815  7.918   -5.255  1.00 0.00 ? 103 PRO A O    1  
ATOM 1543  C CB   . PRO A 1 103 ? -2.699  10.020  -7.561  1.00 0.00 ? 103 PRO A CB   1  
ATOM 1544  C CG   . PRO A 1 103 ? -1.910  10.833  -6.593  1.00 0.00 ? 103 PRO A CG   1  
ATOM 1545  C CD   . PRO A 1 103 ? -2.910  11.421  -5.636  1.00 0.00 ? 103 PRO A CD   1  
ATOM 1546  H HA   . PRO A 1 103 ? -4.758  9.436   -7.366  1.00 0.00 ? 103 PRO A HA   1  
ATOM 1547  H HB2  . PRO A 1 103 ? -2.118  9.197   -7.954  1.00 0.00 ? 103 PRO A HB2  1  
ATOM 1548  H HB3  . PRO A 1 103 ? -3.071  10.626  -8.374  1.00 0.00 ? 103 PRO A HB3  1  
ATOM 1549  H HG2  . PRO A 1 103 ? -1.213  10.200  -6.065  1.00 0.00 ? 103 PRO A HG2  1  
ATOM 1550  H HG3  . PRO A 1 103 ? -1.385  11.618  -7.116  1.00 0.00 ? 103 PRO A HG3  1  
ATOM 1551  H HD2  . PRO A 1 103 ? -2.486  11.494  -4.646  1.00 0.00 ? 103 PRO A HD2  1  
ATOM 1552  H HD3  . PRO A 1 103 ? -3.237  12.392  -5.981  1.00 0.00 ? 103 PRO A HD3  1  
ATOM 1553  N N    . LEU A 1 104 ? -4.127  7.067   -6.872  1.00 0.00 ? 104 LEU A N    1  
ATOM 1554  C CA   . LEU A 1 104 ? -3.906  5.681   -6.474  1.00 0.00 ? 104 LEU A CA   1  
ATOM 1555  C C    . LEU A 1 104 ? -2.471  5.254   -6.767  1.00 0.00 ? 104 LEU A C    1  
ATOM 1556  O O    . LEU A 1 104 ? -1.674  6.033   -7.288  1.00 0.00 ? 104 LEU A O    1  
ATOM 1557  C CB   . LEU A 1 104 ? -4.884  4.758   -7.202  1.00 0.00 ? 104 LEU A CB   1  
ATOM 1558  C CG   . LEU A 1 104 ? -6.365  4.964   -6.883  1.00 0.00 ? 104 LEU A CG   1  
ATOM 1559  C CD1  . LEU A 1 104 ? -7.179  5.056   -8.163  1.00 0.00 ? 104 LEU A CD1  1  
ATOM 1560  C CD2  . LEU A 1 104 ? -6.882  3.837   -6.000  1.00 0.00 ? 104 LEU A CD2  1  
ATOM 1561  H H    . LEU A 1 104 ? -4.710  7.256   -7.637  1.00 0.00 ? 104 LEU A H    1  
ATOM 1562  H HA   . LEU A 1 104 ? -4.079  5.610   -5.411  1.00 0.00 ? 104 LEU A HA   1  
ATOM 1563  H HB2  . LEU A 1 104 ? -4.751  4.906   -8.263  1.00 0.00 ? 104 LEU A HB2  1  
ATOM 1564  H HB3  . LEU A 1 104 ? -4.627  3.739   -6.947  1.00 0.00 ? 104 LEU A HB3  1  
ATOM 1565  H HG   . LEU A 1 104 ? -6.485  5.893   -6.343  1.00 0.00 ? 104 LEU A HG   1  
ATOM 1566  H HD11 . LEU A 1 104 ? -8.093  5.599   -7.971  1.00 0.00 ? 104 LEU A HD11 1  
ATOM 1567  H HD12 . LEU A 1 104 ? -7.418  4.061   -8.510  1.00 0.00 ? 104 LEU A HD12 1  
ATOM 1568  H HD13 . LEU A 1 104 ? -6.605  5.572   -8.919  1.00 0.00 ? 104 LEU A HD13 1  
ATOM 1569  H HD21 . LEU A 1 104 ? -7.886  4.066   -5.675  1.00 0.00 ? 104 LEU A HD21 1  
ATOM 1570  H HD22 . LEU A 1 104 ? -6.240  3.731   -5.137  1.00 0.00 ? 104 LEU A HD22 1  
ATOM 1571  H HD23 . LEU A 1 104 ? -6.886  2.914   -6.560  1.00 0.00 ? 104 LEU A HD23 1  
ATOM 1572  N N    . SER A 1 105 ? -2.150  4.008   -6.429  1.00 0.00 ? 105 SER A N    1  
ATOM 1573  C CA   . SER A 1 105 ? -0.810  3.477   -6.655  1.00 0.00 ? 105 SER A CA   1  
ATOM 1574  C C    . SER A 1 105 ? -0.812  2.468   -7.798  1.00 0.00 ? 105 SER A C    1  
ATOM 1575  O O    . SER A 1 105 ? -1.850  2.201   -8.404  1.00 0.00 ? 105 SER A O    1  
ATOM 1576  C CB   . SER A 1 105 ? -0.279  2.819   -5.380  1.00 0.00 ? 105 SER A CB   1  
ATOM 1577  O OG   . SER A 1 105 ? -0.336  1.406   -5.472  1.00 0.00 ? 105 SER A OG   1  
ATOM 1578  H H    . SER A 1 105 ? -2.829  3.435   -6.017  1.00 0.00 ? 105 SER A H    1  
ATOM 1579  H HA   . SER A 1 105 ? -0.167  4.302   -6.919  1.00 0.00 ? 105 SER A HA   1  
ATOM 1580  H HB2  . SER A 1 105 ? 0.747   3.116   -5.225  1.00 0.00 ? 105 SER A HB2  1  
ATOM 1581  H HB3  . SER A 1 105 ? -0.877  3.137   -4.537  1.00 0.00 ? 105 SER A HB3  1  
ATOM 1582  H HG   . SER A 1 105 ? -1.251  1.126   -5.548  1.00 0.00 ? 105 SER A HG   1  
ATOM 1583  N N    . SER A 1 106 ? 0.358   1.909   -8.089  1.00 0.00 ? 106 SER A N    1  
ATOM 1584  C CA   . SER A 1 106 ? 0.495   0.932   -9.162  1.00 0.00 ? 106 SER A CA   1  
ATOM 1585  C C    . SER A 1 106 ? -0.324  -0.320  -8.864  1.00 0.00 ? 106 SER A C    1  
ATOM 1586  O O    . SER A 1 106 ? -0.026  -1.062  -7.927  1.00 0.00 ? 106 SER A O    1  
ATOM 1587  C CB   . SER A 1 106 ? 1.965   0.559   -9.357  1.00 0.00 ? 106 SER A CB   1  
ATOM 1588  O OG   . SER A 1 106 ? 2.818   1.494   -8.719  1.00 0.00 ? 106 SER A OG   1  
ATOM 1589  H H    . SER A 1 106 ? 1.151   2.163   -7.569  1.00 0.00 ? 106 SER A H    1  
ATOM 1590  H HA   . SER A 1 106 ? 0.123   1.383   -10.070 1.00 0.00 ? 106 SER A HA   1  
ATOM 1591  H HB2  . SER A 1 106 ? 2.145   -0.419  -8.937  1.00 0.00 ? 106 SER A HB2  1  
ATOM 1592  H HB3  . SER A 1 106 ? 2.193   0.545   -10.414 1.00 0.00 ? 106 SER A HB3  1  
ATOM 1593  H HG   . SER A 1 106 ? 3.012   2.215   -9.322  1.00 0.00 ? 106 SER A HG   1  
ATOM 1594  N N    . ASP A 1 107 ? -1.357  -0.550  -9.666  1.00 0.00 ? 107 ASP A N    1  
ATOM 1595  C CA   . ASP A 1 107 ? -2.220  -1.711  -9.490  1.00 0.00 ? 107 ASP A CA   1  
ATOM 1596  C C    . ASP A 1 107 ? -1.396  -2.994  -9.423  1.00 0.00 ? 107 ASP A C    1  
ATOM 1597  O O    . ASP A 1 107 ? -0.624  -3.295  -10.333 1.00 0.00 ? 107 ASP A O    1  
ATOM 1598  C CB   . ASP A 1 107 ? -3.233  -1.800  -10.632 1.00 0.00 ? 107 ASP A CB   1  
ATOM 1599  C CG   . ASP A 1 107 ? -2.585  -1.637  -11.993 1.00 0.00 ? 107 ASP A CG   1  
ATOM 1600  O OD1  . ASP A 1 107 ? -2.412  -0.480  -12.432 1.00 0.00 ? 107 ASP A OD1  1  
ATOM 1601  O OD2  . ASP A 1 107 ? -2.254  -2.665  -12.621 1.00 0.00 ? 107 ASP A OD2  1  
ATOM 1602  H H    . ASP A 1 107 ? -1.544  0.078   -10.395 1.00 0.00 ? 107 ASP A H    1  
ATOM 1603  H HA   . ASP A 1 107 ? -2.752  -1.592  -8.558  1.00 0.00 ? 107 ASP A HA   1  
ATOM 1604  H HB2  . ASP A 1 107 ? -3.719  -2.764  -10.600 1.00 0.00 ? 107 ASP A HB2  1  
ATOM 1605  H HB3  . ASP A 1 107 ? -3.973  -1.024  -10.509 1.00 0.00 ? 107 ASP A HB3  1  
ATOM 1606  N N    . ILE A 1 108 ? -1.566  -3.744  -8.339  1.00 0.00 ? 108 ILE A N    1  
ATOM 1607  C CA   . ILE A 1 108 ? -0.838  -4.994  -8.154  1.00 0.00 ? 108 ILE A CA   1  
ATOM 1608  C C    . ILE A 1 108 ? -1.785  -6.189  -8.170  1.00 0.00 ? 108 ILE A C    1  
ATOM 1609  O O    . ILE A 1 108 ? -2.996  -6.034  -8.022  1.00 0.00 ? 108 ILE A O    1  
ATOM 1610  C CB   . ILE A 1 108 ? -0.048  -4.995  -6.833  1.00 0.00 ? 108 ILE A CB   1  
ATOM 1611  C CG1  . ILE A 1 108 ? -0.946  -4.549  -5.676  1.00 0.00 ? 108 ILE A CG1  1  
ATOM 1612  C CG2  . ILE A 1 108 ? 1.171   -4.092  -6.943  1.00 0.00 ? 108 ILE A CG2  1  
ATOM 1613  C CD1  . ILE A 1 108 ? -0.245  -4.538  -4.336  1.00 0.00 ? 108 ILE A CD1  1  
ATOM 1614  H H    . ILE A 1 108 ? -2.195  -3.451  -7.648  1.00 0.00 ? 108 ILE A H    1  
ATOM 1615  H HA   . ILE A 1 108 ? -0.135  -5.093  -8.970  1.00 0.00 ? 108 ILE A HA   1  
ATOM 1616  H HB   . ILE A 1 108 ? 0.294   -6.001  -6.645  1.00 0.00 ? 108 ILE A HB   1  
ATOM 1617  H HG12 . ILE A 1 108 ? -1.302  -3.549  -5.871  1.00 0.00 ? 108 ILE A HG12 1  
ATOM 1618  H HG13 . ILE A 1 108 ? -1.790  -5.220  -5.606  1.00 0.00 ? 108 ILE A HG13 1  
ATOM 1619  H HG21 . ILE A 1 108 ? 1.399   -3.921  -7.984  1.00 0.00 ? 108 ILE A HG21 1  
ATOM 1620  H HG22 . ILE A 1 108 ? 0.964   -3.148  -6.461  1.00 0.00 ? 108 ILE A HG22 1  
ATOM 1621  H HG23 . ILE A 1 108 ? 2.015   -4.565  -6.462  1.00 0.00 ? 108 ILE A HG23 1  
ATOM 1622  H HD11 . ILE A 1 108 ? 0.626   -3.902  -4.389  1.00 0.00 ? 108 ILE A HD11 1  
ATOM 1623  H HD12 . ILE A 1 108 ? -0.920  -4.166  -3.579  1.00 0.00 ? 108 ILE A HD12 1  
ATOM 1624  H HD13 . ILE A 1 108 ? 0.060   -5.544  -4.082  1.00 0.00 ? 108 ILE A HD13 1  
ATOM 1625  N N    . GLN A 1 109 ? -1.222  -7.380  -8.347  1.00 0.00 ? 109 GLN A N    1  
ATOM 1626  C CA   . GLN A 1 109 ? -2.017  -8.602  -8.380  1.00 0.00 ? 109 GLN A CA   1  
ATOM 1627  C C    . GLN A 1 109 ? -1.338  -9.715  -7.589  1.00 0.00 ? 109 GLN A C    1  
ATOM 1628  O O    . GLN A 1 109 ? -0.195  -10.079 -7.866  1.00 0.00 ? 109 GLN A O    1  
ATOM 1629  C CB   . GLN A 1 109 ? -2.242  -9.051  -9.825  1.00 0.00 ? 109 GLN A CB   1  
ATOM 1630  C CG   . GLN A 1 109 ? -2.873  -7.982  -10.703 1.00 0.00 ? 109 GLN A CG   1  
ATOM 1631  C CD   . GLN A 1 109 ? -4.265  -7.598  -10.245 1.00 0.00 ? 109 GLN A CD   1  
ATOM 1632  O OE1  . GLN A 1 109 ? -4.973  -8.398  -9.632  1.00 0.00 ? 109 GLN A OE1  1  
ATOM 1633  N NE2  . GLN A 1 109 ? -4.666  -6.367  -10.540 1.00 0.00 ? 109 GLN A NE2  1  
ATOM 1634  H H    . GLN A 1 109 ? -0.251  -7.438  -8.459  1.00 0.00 ? 109 GLN A H    1  
ATOM 1635  H HA   . GLN A 1 109 ? -2.974  -8.388  -7.928  1.00 0.00 ? 109 GLN A HA   1  
ATOM 1636  H HB2  . GLN A 1 109 ? -1.290  -9.326  -10.256 1.00 0.00 ? 109 GLN A HB2  1  
ATOM 1637  H HB3  . GLN A 1 109 ? -2.890  -9.914  -9.825  1.00 0.00 ? 109 GLN A HB3  1  
ATOM 1638  H HG2  . GLN A 1 109 ? -2.247  -7.102  -10.682 1.00 0.00 ? 109 GLN A HG2  1  
ATOM 1639  H HG3  . GLN A 1 109 ? -2.932  -8.356  -11.715 1.00 0.00 ? 109 GLN A HG3  1  
ATOM 1640  H HE21 . GLN A 1 109 ? -4.050  -5.785  -11.032 1.00 0.00 ? 109 GLN A HE21 1  
ATOM 1641  H HE22 . GLN A 1 109 ? -5.563  -6.092  -10.257 1.00 0.00 ? 109 GLN A HE22 1  
ATOM 1642  N N    . VAL A 1 110 ? -2.049  -10.252 -6.602  1.00 0.00 ? 110 VAL A N    1  
ATOM 1643  C CA   . VAL A 1 110 ? -1.514  -11.325 -5.771  1.00 0.00 ? 110 VAL A CA   1  
ATOM 1644  C C    . VAL A 1 110 ? -2.438  -12.538 -5.780  1.00 0.00 ? 110 VAL A C    1  
ATOM 1645  O O    . VAL A 1 110 ? -3.649  -12.410 -5.596  1.00 0.00 ? 110 VAL A O    1  
ATOM 1646  C CB   . VAL A 1 110 ? -1.310  -10.859 -4.318  1.00 0.00 ? 110 VAL A CB   1  
ATOM 1647  C CG1  . VAL A 1 110 ? -2.611  -10.322 -3.741  1.00 0.00 ? 110 VAL A CG1  1  
ATOM 1648  C CG2  . VAL A 1 110 ? -0.768  -11.996 -3.465  1.00 0.00 ? 110 VAL A CG2  1  
ATOM 1649  H H    . VAL A 1 110 ? -2.955  -9.920  -6.430  1.00 0.00 ? 110 VAL A H    1  
ATOM 1650  H HA   . VAL A 1 110 ? -0.554  -11.612 -6.174  1.00 0.00 ? 110 VAL A HA   1  
ATOM 1651  H HB   . VAL A 1 110 ? -0.584  -10.058 -4.317  1.00 0.00 ? 110 VAL A HB   1  
ATOM 1652  H HG11 . VAL A 1 110 ? -3.343  -11.115 -3.706  1.00 0.00 ? 110 VAL A HG11 1  
ATOM 1653  H HG12 . VAL A 1 110 ? -2.434  -9.948  -2.742  1.00 0.00 ? 110 VAL A HG12 1  
ATOM 1654  H HG13 . VAL A 1 110 ? -2.979  -9.521  -4.366  1.00 0.00 ? 110 VAL A HG13 1  
ATOM 1655  H HG21 . VAL A 1 110 ? -1.590  -12.586 -3.090  1.00 0.00 ? 110 VAL A HG21 1  
ATOM 1656  H HG22 . VAL A 1 110 ? -0.122  -12.619 -4.066  1.00 0.00 ? 110 VAL A HG22 1  
ATOM 1657  H HG23 . VAL A 1 110 ? -0.207  -11.590 -2.636  1.00 0.00 ? 110 VAL A HG23 1  
ATOM 1658  N N    . ILE A 1 111 ? -1.858  -13.714 -5.992  1.00 0.00 ? 111 ILE A N    1  
ATOM 1659  C CA   . ILE A 1 111 ? -2.629  -14.951 -6.022  1.00 0.00 ? 111 ILE A CA   1  
ATOM 1660  C C    . ILE A 1 111 ? -2.776  -15.540 -4.623  1.00 0.00 ? 111 ILE A C    1  
ATOM 1661  O O    . ILE A 1 111 ? -1.840  -15.514 -3.823  1.00 0.00 ? 111 ILE A O    1  
ATOM 1662  C CB   . ILE A 1 111 ? -1.976  -15.999 -6.942  1.00 0.00 ? 111 ILE A CB   1  
ATOM 1663  C CG1  . ILE A 1 111 ? -1.855  -15.454 -8.367  1.00 0.00 ? 111 ILE A CG1  1  
ATOM 1664  C CG2  . ILE A 1 111 ? -2.782  -17.289 -6.929  1.00 0.00 ? 111 ILE A CG2  1  
ATOM 1665  C CD1  . ILE A 1 111 ? -0.451  -15.524 -8.923  1.00 0.00 ? 111 ILE A CD1  1  
ATOM 1666  H H    . ILE A 1 111 ? -0.889  -13.751 -6.130  1.00 0.00 ? 111 ILE A H    1  
ATOM 1667  H HA   . ILE A 1 111 ? -3.611  -14.722 -6.410  1.00 0.00 ? 111 ILE A HA   1  
ATOM 1668  H HB   . ILE A 1 111 ? -0.989  -16.214 -6.562  1.00 0.00 ? 111 ILE A HB   1  
ATOM 1669  H HG12 . ILE A 1 111 ? -2.499  -16.022 -9.019  1.00 0.00 ? 111 ILE A HG12 1  
ATOM 1670  H HG13 . ILE A 1 111 ? -2.165  -14.418 -8.376  1.00 0.00 ? 111 ILE A HG13 1  
ATOM 1671  H HG21 . ILE A 1 111 ? -2.439  -17.919 -6.122  1.00 0.00 ? 111 ILE A HG21 1  
ATOM 1672  H HG22 . ILE A 1 111 ? -3.826  -17.060 -6.786  1.00 0.00 ? 111 ILE A HG22 1  
ATOM 1673  H HG23 . ILE A 1 111 ? -2.650  -17.806 -7.869  1.00 0.00 ? 111 ILE A HG23 1  
ATOM 1674  H HD11 . ILE A 1 111 ? -0.050  -14.526 -9.019  1.00 0.00 ? 111 ILE A HD11 1  
ATOM 1675  H HD12 . ILE A 1 111 ? 0.173   -16.102 -8.258  1.00 0.00 ? 111 ILE A HD12 1  
ATOM 1676  H HD13 . ILE A 1 111 ? -0.473  -15.996 -9.896  1.00 0.00 ? 111 ILE A HD13 1  
ATOM 1677  N N    . THR A 1 112 ? -3.959  -16.074 -4.333  1.00 0.00 ? 112 THR A N    1  
ATOM 1678  C CA   . THR A 1 112 ? -4.230  -16.672 -3.032  1.00 0.00 ? 112 THR A CA   1  
ATOM 1679  C C    . THR A 1 112 ? -3.634  -18.071 -2.935  1.00 0.00 ? 112 THR A C    1  
ATOM 1680  O O    . THR A 1 112 ? -4.269  -19.054 -3.316  1.00 0.00 ? 112 THR A O    1  
ATOM 1681  C CB   . THR A 1 112 ? -5.743  -16.749 -2.753  1.00 0.00 ? 112 THR A CB   1  
ATOM 1682  O OG1  . THR A 1 112 ? -6.451  -17.022 -3.968  1.00 0.00 ? 112 THR A OG1  1  
ATOM 1683  C CG2  . THR A 1 112 ? -6.249  -15.451 -2.146  1.00 0.00 ? 112 THR A CG2  1  
ATOM 1684  H H    . THR A 1 112 ? -4.666  -16.065 -5.012  1.00 0.00 ? 112 THR A H    1  
ATOM 1685  H HA   . THR A 1 112 ? -3.778  -16.044 -2.276  1.00 0.00 ? 112 THR A HA   1  
ATOM 1686  H HB   . THR A 1 112 ? -5.923  -17.553 -2.053  1.00 0.00 ? 112 THR A HB   1  
ATOM 1687  H HG1  . THR A 1 112 ? -7.182  -17.617 -3.786  1.00 0.00 ? 112 THR A HG1  1  
ATOM 1688  H HG21 . THR A 1 112 ? -5.533  -14.663 -2.330  1.00 0.00 ? 112 THR A HG21 1  
ATOM 1689  H HG22 . THR A 1 112 ? -6.379  -15.578 -1.081  1.00 0.00 ? 112 THR A HG22 1  
ATOM 1690  H HG23 . THR A 1 112 ? -7.195  -15.189 -2.595  1.00 0.00 ? 112 THR A HG23 1  
ATOM 1691  N N    . GLN A 1 113 ? -2.410  -18.154 -2.421  1.00 0.00 ? 113 GLN A N    1  
ATOM 1692  C CA   . GLN A 1 113 ? -1.730  -19.435 -2.274  1.00 0.00 ? 113 GLN A CA   1  
ATOM 1693  C C    . GLN A 1 113 ? -0.829  -19.434 -1.043  1.00 0.00 ? 113 GLN A C    1  
ATOM 1694  O O    . GLN A 1 113 ? -0.155  -18.445 -0.753  1.00 0.00 ? 113 GLN A O    1  
ATOM 1695  C CB   . GLN A 1 113 ? -0.904  -19.743 -3.524  1.00 0.00 ? 113 GLN A CB   1  
ATOM 1696  C CG   . GLN A 1 113 ? 0.367   -18.917 -3.634  1.00 0.00 ? 113 GLN A CG   1  
ATOM 1697  C CD   . GLN A 1 113 ? 0.924   -18.887 -5.044  1.00 0.00 ? 113 GLN A CD   1  
ATOM 1698  O OE1  . GLN A 1 113 ? 0.300   -19.387 -5.980  1.00 0.00 ? 113 GLN A OE1  1  
ATOM 1699  N NE2  . GLN A 1 113 ? 2.103   -18.299 -5.202  1.00 0.00 ? 113 GLN A NE2  1  
ATOM 1700  H H    . GLN A 1 113 ? -1.956  -17.335 -2.135  1.00 0.00 ? 113 GLN A H    1  
ATOM 1701  H HA   . GLN A 1 113 ? -2.483  -20.198 -2.153  1.00 0.00 ? 113 GLN A HA   1  
ATOM 1702  H HB2  . GLN A 1 113 ? -0.628  -20.788 -3.511  1.00 0.00 ? 113 GLN A HB2  1  
ATOM 1703  H HB3  . GLN A 1 113 ? -1.510  -19.551 -4.397  1.00 0.00 ? 113 GLN A HB3  1  
ATOM 1704  H HG2  . GLN A 1 113 ? 0.150   -17.904 -3.328  1.00 0.00 ? 113 GLN A HG2  1  
ATOM 1705  H HG3  . GLN A 1 113 ? 1.113   -19.338 -2.977  1.00 0.00 ? 113 GLN A HG3  1  
ATOM 1706  H HE21 . GLN A 1 113 ? 2.543   -17.923 -4.410  1.00 0.00 ? 113 GLN A HE21 1  
ATOM 1707  H HE22 . GLN A 1 113 ? 2.487   -18.266 -6.102  1.00 0.00 ? 113 GLN A HE22 1  
ATOM 1708  N N    . THR A 1 114 ? -0.822  -20.550 -0.319  1.00 0.00 ? 114 THR A N    1  
ATOM 1709  C CA   . THR A 1 114 ? -0.006  -20.678 0.881   1.00 0.00 ? 114 THR A CA   1  
ATOM 1710  C C    . THR A 1 114 ? 1.464   -20.880 0.528   1.00 0.00 ? 114 THR A C    1  
ATOM 1711  O O    . THR A 1 114 ? 1.789   -21.542 -0.456  1.00 0.00 ? 114 THR A O    1  
ATOM 1712  C CB   . THR A 1 114 ? -0.477  -21.852 1.759   1.00 0.00 ? 114 THR A CB   1  
ATOM 1713  O OG1  . THR A 1 114 ? -1.068  -22.868 0.940   1.00 0.00 ? 114 THR A OG1  1  
ATOM 1714  C CG2  . THR A 1 114 ? -1.485  -21.381 2.796   1.00 0.00 ? 114 THR A CG2  1  
ATOM 1715  H H    . THR A 1 114 ? -1.380  -21.303 -0.602  1.00 0.00 ? 114 THR A H    1  
ATOM 1716  H HA   . THR A 1 114 ? -0.107  -19.765 1.451   1.00 0.00 ? 114 THR A HA   1  
ATOM 1717  H HB   . THR A 1 114 ? 0.379   -22.266 2.271   1.00 0.00 ? 114 THR A HB   1  
ATOM 1718  H HG1  . THR A 1 114 ? -0.424  -23.177 0.299   1.00 0.00 ? 114 THR A HG1  1  
ATOM 1719  H HG21 . THR A 1 114 ? -2.484  -21.474 2.397   1.00 0.00 ? 114 THR A HG21 1  
ATOM 1720  H HG22 . THR A 1 114 ? -1.291  -20.348 3.045   1.00 0.00 ? 114 THR A HG22 1  
ATOM 1721  H HG23 . THR A 1 114 ? -1.395  -21.988 3.685   1.00 0.00 ? 114 THR A HG23 1  
ATOM 1722  N N    . GLY A 1 115 ? 2.346   -20.306 1.339   1.00 0.00 ? 115 GLY A N    1  
ATOM 1723  C CA   . GLY A 1 115 ? 3.772   -20.435 1.096   1.00 0.00 ? 115 GLY A CA   1  
ATOM 1724  C C    . GLY A 1 115 ? 4.528   -19.154 1.378   1.00 0.00 ? 115 GLY A C    1  
ATOM 1725  O O    . GLY A 1 115 ? 4.131   -18.079 0.929   1.00 0.00 ? 115 GLY A O    1  
ATOM 1726  H H    . GLY A 1 115 ? 2.029   -19.789 2.109   1.00 0.00 ? 115 GLY A H    1  
ATOM 1727  H HA2  . GLY A 1 115 ? 4.164   -21.219 1.726   1.00 0.00 ? 115 GLY A HA2  1  
ATOM 1728  H HA3  . GLY A 1 115 ? 3.924   -20.709 0.062   1.00 0.00 ? 115 GLY A HA3  1  
ATOM 1729  N N    . SER A 1 116 ? 5.619   -19.265 2.129   1.00 0.00 ? 116 SER A N    1  
ATOM 1730  C CA   . SER A 1 116 ? 6.429   -18.104 2.477   1.00 0.00 ? 116 SER A CA   1  
ATOM 1731  C C    . SER A 1 116 ? 7.905   -18.364 2.187   1.00 0.00 ? 116 SER A C    1  
ATOM 1732  O O    . SER A 1 116 ? 8.276   -19.439 1.716   1.00 0.00 ? 116 SER A O    1  
ATOM 1733  C CB   . SER A 1 116 ? 6.244   -17.749 3.954   1.00 0.00 ? 116 SER A CB   1  
ATOM 1734  O OG   . SER A 1 116 ? 7.273   -18.315 4.747   1.00 0.00 ? 116 SER A OG   1  
ATOM 1735  H H    . SER A 1 116 ? 5.884   -20.150 2.458   1.00 0.00 ? 116 SER A H    1  
ATOM 1736  H HA   . SER A 1 116 ? 6.097   -17.274 1.872   1.00 0.00 ? 116 SER A HA   1  
ATOM 1737  H HB2  . SER A 1 116 ? 6.265   -16.677 4.069   1.00 0.00 ? 116 SER A HB2  1  
ATOM 1738  H HB3  . SER A 1 116 ? 5.292   -18.130 4.295   1.00 0.00 ? 116 SER A HB3  1  
ATOM 1739  H HG   . SER A 1 116 ? 6.888   -18.749 5.511   1.00 0.00 ? 116 SER A HG   1  
ATOM 1740  N N    . GLY A 1 117 ? 8.741   -17.371 2.469   1.00 0.00 ? 117 GLY A N    1  
ATOM 1741  C CA   . GLY A 1 117 ? 10.167  -17.511 2.233   1.00 0.00 ? 117 GLY A CA   1  
ATOM 1742  C C    . GLY A 1 117 ? 10.601  -16.882 0.923   1.00 0.00 ? 117 GLY A C    1  
ATOM 1743  O O    . GLY A 1 117 ? 9.780   -16.539 0.072   1.00 0.00 ? 117 GLY A O    1  
ATOM 1744  H H    . GLY A 1 117 ? 8.389   -16.536 2.842   1.00 0.00 ? 117 GLY A H    1  
ATOM 1745  H HA2  . GLY A 1 117 ? 10.703  -17.039 3.042   1.00 0.00 ? 117 GLY A HA2  1  
ATOM 1746  H HA3  . GLY A 1 117 ? 10.415  -18.562 2.213   1.00 0.00 ? 117 GLY A HA3  1  
ATOM 1747  N N    . PRO A 1 118 ? 11.921  -16.722 0.749   1.00 0.00 ? 118 PRO A N    1  
ATOM 1748  C CA   . PRO A 1 118 ? 12.493  -16.128 -0.464  1.00 0.00 ? 118 PRO A CA   1  
ATOM 1749  C C    . PRO A 1 118 ? 12.343  -17.035 -1.680  1.00 0.00 ? 118 PRO A C    1  
ATOM 1750  O O    . PRO A 1 118 ? 12.645  -18.227 -1.618  1.00 0.00 ? 118 PRO A O    1  
ATOM 1751  C CB   . PRO A 1 118 ? 13.971  -15.950 -0.108  1.00 0.00 ? 118 PRO A CB   1  
ATOM 1752  C CG   . PRO A 1 118 ? 14.235  -16.975 0.939   1.00 0.00 ? 118 PRO A CG   1  
ATOM 1753  C CD   . PRO A 1 118 ? 12.957  -17.108 1.721   1.00 0.00 ? 118 PRO A CD   1  
ATOM 1754  H HA   . PRO A 1 118 ? 12.054  -15.165 -0.679  1.00 0.00 ? 118 PRO A HA   1  
ATOM 1755  H HB2  . PRO A 1 118 ? 14.578  -16.116 -0.987  1.00 0.00 ? 118 PRO A HB2  1  
ATOM 1756  H HB3  . PRO A 1 118 ? 14.137  -14.951 0.267   1.00 0.00 ? 118 PRO A HB3  1  
ATOM 1757  H HG2  . PRO A 1 118 ? 14.490  -17.916 0.475   1.00 0.00 ? 118 PRO A HG2  1  
ATOM 1758  H HG3  . PRO A 1 118 ? 15.036  -16.644 1.584   1.00 0.00 ? 118 PRO A HG3  1  
ATOM 1759  H HD2  . PRO A 1 118 ? 12.819  -18.127 2.047   1.00 0.00 ? 118 PRO A HD2  1  
ATOM 1760  H HD3  . PRO A 1 118 ? 12.961  -16.436 2.566   1.00 0.00 ? 118 PRO A HD3  1  
ATOM 1761  N N    . SER A 1 119 ? 11.876  -16.463 -2.785  1.00 0.00 ? 119 SER A N    1  
ATOM 1762  C CA   . SER A 1 119 ? 11.683  -17.222 -4.015  1.00 0.00 ? 119 SER A CA   1  
ATOM 1763  C C    . SER A 1 119 ? 13.015  -17.744 -4.546  1.00 0.00 ? 119 SER A C    1  
ATOM 1764  O O    . SER A 1 119 ? 14.031  -17.050 -4.494  1.00 0.00 ? 119 SER A O    1  
ATOM 1765  C CB   . SER A 1 119 ? 11.004  -16.353 -5.075  1.00 0.00 ? 119 SER A CB   1  
ATOM 1766  O OG   . SER A 1 119 ? 9.834   -15.742 -4.559  1.00 0.00 ? 119 SER A OG   1  
ATOM 1767  H H    . SER A 1 119 ? 11.653  -15.510 -2.772  1.00 0.00 ? 119 SER A H    1  
ATOM 1768  H HA   . SER A 1 119 ? 11.045  -18.064 -3.789  1.00 0.00 ? 119 SER A HA   1  
ATOM 1769  H HB2  . SER A 1 119 ? 11.687  -15.582 -5.396  1.00 0.00 ? 119 SER A HB2  1  
ATOM 1770  H HB3  . SER A 1 119 ? 10.731  -16.968 -5.920  1.00 0.00 ? 119 SER A HB3  1  
ATOM 1771  H HG   . SER A 1 119 ? 9.152   -16.407 -4.436  1.00 0.00 ? 119 SER A HG   1  
ATOM 1772  N N    . SER A 1 120 ? 13.002  -18.970 -5.059  1.00 0.00 ? 120 SER A N    1  
ATOM 1773  C CA   . SER A 1 120 ? 14.209  -19.587 -5.597  1.00 0.00 ? 120 SER A CA   1  
ATOM 1774  C C    . SER A 1 120 ? 14.049  -19.884 -7.085  1.00 0.00 ? 120 SER A C    1  
ATOM 1775  O O    . SER A 1 120 ? 12.945  -19.834 -7.625  1.00 0.00 ? 120 SER A O    1  
ATOM 1776  C CB   . SER A 1 120 ? 14.529  -20.876 -4.839  1.00 0.00 ? 120 SER A CB   1  
ATOM 1777  O OG   . SER A 1 120 ? 15.926  -21.030 -4.661  1.00 0.00 ? 120 SER A OG   1  
ATOM 1778  H H    . SER A 1 120 ? 12.160  -19.473 -5.073  1.00 0.00 ? 120 SER A H    1  
ATOM 1779  H HA   . SER A 1 120 ? 15.024  -18.890 -5.466  1.00 0.00 ? 120 SER A HA   1  
ATOM 1780  H HB2  . SER A 1 120 ? 14.056  -20.848 -3.869  1.00 0.00 ? 120 SER A HB2  1  
ATOM 1781  H HB3  . SER A 1 120 ? 14.154  -21.722 -5.398  1.00 0.00 ? 120 SER A HB3  1  
ATOM 1782  H HG   . SER A 1 120 ? 16.173  -20.723 -3.786  1.00 0.00 ? 120 SER A HG   1  
ATOM 1783  N N    . GLY A 1 121 ? 15.162  -20.194 -7.743  1.00 0.00 ? 121 GLY A N    1  
ATOM 1784  C CA   . GLY A 1 121 ? 15.126  -20.495 -9.161  1.00 0.00 ? 121 GLY A CA   1  
ATOM 1785  C C    . GLY A 1 121 ? 14.615  -19.332 -9.988  1.00 0.00 ? 121 GLY A C    1  
ATOM 1786  O O    . GLY A 1 121 ? 15.306  -18.326 -10.151 1.00 0.00 ? 121 GLY A O    1  
ATOM 1787  H H    . GLY A 1 121 ? 16.015  -20.219 -7.260  1.00 0.00 ? 121 GLY A H    1  
ATOM 1788  H HA2  . GLY A 1 121 ? 16.124  -20.746 -9.491  1.00 0.00 ? 121 GLY A HA2  1  
ATOM 1789  H HA3  . GLY A 1 121 ? 14.481  -21.346 -9.322  1.00 0.00 ? 121 GLY A HA3  1  
ATOM 1790  N N    . GLY A 1 1   ? 20.115  13.388  1.037   1.00 0.00 ? 1   GLY A N    2  
ATOM 1791  C CA   . GLY A 1 1   ? 20.058  14.308  2.159   1.00 0.00 ? 1   GLY A CA   2  
ATOM 1792  C C    . GLY A 1 1   ? 20.175  15.756  1.729   1.00 0.00 ? 1   GLY A C    2  
ATOM 1793  O O    . GLY A 1 1   ? 20.523  16.045  0.584   1.00 0.00 ? 1   GLY A O    2  
ATOM 1794  H H1   . GLY A 1 1   ? 19.832  12.457  1.155   1.00 0.00 ? 1   GLY A H1   2  
ATOM 1795  H HA2  . GLY A 1 1   ? 19.121  14.171  2.675   1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1796  H HA3  . GLY A 1 1   ? 20.867  14.080  2.838   1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1797  N N    . SER A 1 2   ? 19.880  16.670  2.648   1.00 0.00 ? 2   SER A N    2  
ATOM 1798  C CA   . SER A 1 2   ? 19.948  18.097  2.356   1.00 0.00 ? 2   SER A CA   2  
ATOM 1799  C C    . SER A 1 2   ? 19.000  18.464  1.219   1.00 0.00 ? 2   SER A C    2  
ATOM 1800  O O    . SER A 1 2   ? 18.322  17.604  0.657   1.00 0.00 ? 2   SER A O    2  
ATOM 1801  C CB   . SER A 1 2   ? 21.380  18.497  1.992   1.00 0.00 ? 2   SER A CB   2  
ATOM 1802  O OG   . SER A 1 2   ? 22.310  17.949  2.907   1.00 0.00 ? 2   SER A OG   2  
ATOM 1803  H H    . SER A 1 2   ? 19.608  16.378  3.543   1.00 0.00 ? 2   SER A H    2  
ATOM 1804  H HA   . SER A 1 2   ? 19.648  18.632  3.245   1.00 0.00 ? 2   SER A HA   2  
ATOM 1805  H HB2  . SER A 1 2   ? 21.610  18.136  1.002   1.00 0.00 ? 2   SER A HB2  2  
ATOM 1806  H HB3  . SER A 1 2   ? 21.464  19.575  2.011   1.00 0.00 ? 2   SER A HB3  2  
ATOM 1807  H HG   . SER A 1 2   ? 22.662  18.647  3.465   1.00 0.00 ? 2   SER A HG   2  
ATOM 1808  N N    . SER A 1 3   ? 18.959  19.750  0.881   1.00 0.00 ? 3   SER A N    2  
ATOM 1809  C CA   . SER A 1 3   ? 18.091  20.233  -0.186  1.00 0.00 ? 3   SER A CA   2  
ATOM 1810  C C    . SER A 1 3   ? 18.858  20.338  -1.502  1.00 0.00 ? 3   SER A C    2  
ATOM 1811  O O    . SER A 1 3   ? 20.088  20.334  -1.518  1.00 0.00 ? 3   SER A O    2  
ATOM 1812  C CB   . SER A 1 3   ? 17.502  21.596  0.184   1.00 0.00 ? 3   SER A CB   2  
ATOM 1813  O OG   . SER A 1 3   ? 18.517  22.499  0.588   1.00 0.00 ? 3   SER A OG   2  
ATOM 1814  H H    . SER A 1 3   ? 19.523  20.389  1.367   1.00 0.00 ? 3   SER A H    2  
ATOM 1815  H HA   . SER A 1 3   ? 17.287  19.524  -0.308  1.00 0.00 ? 3   SER A HA   2  
ATOM 1816  H HB2  . SER A 1 3   ? 16.990  22.008  -0.673  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1817  H HB3  . SER A 1 3   ? 16.802  21.471  0.997   1.00 0.00 ? 3   SER A HB3  2  
ATOM 1818  H HG   . SER A 1 3   ? 18.433  22.675  1.528   1.00 0.00 ? 3   SER A HG   2  
ATOM 1819  N N    . GLY A 1 4   ? 18.120  20.434  -2.603  1.00 0.00 ? 4   GLY A N    2  
ATOM 1820  C CA   . GLY A 1 4   ? 18.745  20.540  -3.909  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1821  C C    . GLY A 1 4   ? 18.185  21.685  -4.729  1.00 0.00 ? 4   GLY A C    2  
ATOM 1822  O O    . GLY A 1 4   ? 18.255  21.669  -5.958  1.00 0.00 ? 4   GLY A O    2  
ATOM 1823  H H    . GLY A 1 4   ? 17.142  20.434  -2.529  1.00 0.00 ? 4   GLY A H    2  
ATOM 1824  H HA2  . GLY A 1 4   ? 19.806  20.691  -3.776  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1825  H HA3  . GLY A 1 4   ? 18.586  19.616  -4.445  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1826  N N    . SER A 1 5   ? 17.626  22.680  -4.049  1.00 0.00 ? 5   SER A N    2  
ATOM 1827  C CA   . SER A 1 5   ? 17.047  23.836  -4.724  1.00 0.00 ? 5   SER A CA   2  
ATOM 1828  C C    . SER A 1 5   ? 17.060  25.059  -3.811  1.00 0.00 ? 5   SER A C    2  
ATOM 1829  O O    . SER A 1 5   ? 17.558  26.121  -4.186  1.00 0.00 ? 5   SER A O    2  
ATOM 1830  C CB   . SER A 1 5   ? 15.615  23.530  -5.165  1.00 0.00 ? 5   SER A CB   2  
ATOM 1831  O OG   . SER A 1 5   ? 14.899  22.856  -4.145  1.00 0.00 ? 5   SER A OG   2  
ATOM 1832  H H    . SER A 1 5   ? 17.601  22.635  -3.070  1.00 0.00 ? 5   SER A H    2  
ATOM 1833  H HA   . SER A 1 5   ? 17.647  24.045  -5.597  1.00 0.00 ? 5   SER A HA   2  
ATOM 1834  H HB2  . SER A 1 5   ? 15.106  24.454  -5.395  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1835  H HB3  . SER A 1 5   ? 15.639  22.903  -6.046  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1836  H HG   . SER A 1 5   ? 14.995  21.908  -4.259  1.00 0.00 ? 5   SER A HG   2  
ATOM 1837  N N    . SER A 1 6   ? 16.506  24.903  -2.615  1.00 0.00 ? 6   SER A N    2  
ATOM 1838  C CA   . SER A 1 6   ? 16.448  25.995  -1.650  1.00 0.00 ? 6   SER A CA   2  
ATOM 1839  C C    . SER A 1 6   ? 15.752  27.213  -2.248  1.00 0.00 ? 6   SER A C    2  
ATOM 1840  O O    . SER A 1 6   ? 16.397  28.095  -2.815  1.00 0.00 ? 6   SER A O    2  
ATOM 1841  C CB   . SER A 1 6   ? 17.858  26.373  -1.191  1.00 0.00 ? 6   SER A CB   2  
ATOM 1842  O OG   . SER A 1 6   ? 18.590  25.225  -0.797  1.00 0.00 ? 6   SER A OG   2  
ATOM 1843  H H    . SER A 1 6   ? 16.123  24.032  -2.374  1.00 0.00 ? 6   SER A H    2  
ATOM 1844  H HA   . SER A 1 6   ? 15.881  25.654  -0.796  1.00 0.00 ? 6   SER A HA   2  
ATOM 1845  H HB2  . SER A 1 6   ? 18.380  26.858  -2.002  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1846  H HB3  . SER A 1 6   ? 17.791  27.048  -0.351  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1847  H HG   . SER A 1 6   ? 17.997  24.588  -0.392  1.00 0.00 ? 6   SER A HG   2  
ATOM 1848  N N    . GLY A 1 7   ? 14.429  27.255  -2.120  1.00 0.00 ? 7   GLY A N    2  
ATOM 1849  C CA   . GLY A 1 7   ? 13.667  28.368  -2.653  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1850  C C    . GLY A 1 7   ? 12.207  28.315  -2.252  1.00 0.00 ? 7   GLY A C    2  
ATOM 1851  O O    . GLY A 1 7   ? 11.768  27.415  -1.535  1.00 0.00 ? 7   GLY A O    2  
ATOM 1852  H H    . GLY A 1 7   ? 13.968  26.523  -1.658  1.00 0.00 ? 7   GLY A H    2  
ATOM 1853  H HA2  . GLY A 1 7   ? 14.096  29.291  -2.290  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1854  H HA3  . GLY A 1 7   ? 13.733  28.351  -3.731  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1855  N N    . PRO A 1 8   ? 11.425  29.301  -2.717  1.00 0.00 ? 8   PRO A N    2  
ATOM 1856  C CA   . PRO A 1 8   ? 9.993   29.386  -2.415  1.00 0.00 ? 8   PRO A CA   2  
ATOM 1857  C C    . PRO A 1 8   ? 9.189   28.289  -3.105  1.00 0.00 ? 8   PRO A C    2  
ATOM 1858  O O    . PRO A 1 8   ? 9.732   27.499  -3.875  1.00 0.00 ? 8   PRO A O    2  
ATOM 1859  C CB   . PRO A 1 8   ? 9.595   30.761  -2.958  1.00 0.00 ? 8   PRO A CB   2  
ATOM 1860  C CG   . PRO A 1 8   ? 10.594  31.049  -4.025  1.00 0.00 ? 8   PRO A CG   2  
ATOM 1861  C CD   . PRO A 1 8   ? 11.878  30.407  -3.575  1.00 0.00 ? 8   PRO A CD   2  
ATOM 1862  H HA   . PRO A 1 8   ? 9.809   29.350  -1.351  1.00 0.00 ? 8   PRO A HA   2  
ATOM 1863  H HB2  . PRO A 1 8   ? 8.593   30.717  -3.355  1.00 0.00 ? 8   PRO A HB2  2  
ATOM 1864  H HB3  . PRO A 1 8   ? 9.645   31.493  -2.165  1.00 0.00 ? 8   PRO A HB3  2  
ATOM 1865  H HG2  . PRO A 1 8   ? 10.267  30.618  -4.960  1.00 0.00 ? 8   PRO A HG2  2  
ATOM 1866  H HG3  . PRO A 1 8   ? 10.725  32.116  -4.127  1.00 0.00 ? 8   PRO A HG3  2  
ATOM 1867  H HD2  . PRO A 1 8   ? 12.432  30.035  -4.425  1.00 0.00 ? 8   PRO A HD2  2  
ATOM 1868  H HD3  . PRO A 1 8   ? 12.474  31.111  -3.014  1.00 0.00 ? 8   PRO A HD3  2  
ATOM 1869  N N    . VAL A 1 9   ? 7.890   28.248  -2.822  1.00 0.00 ? 9   VAL A N    2  
ATOM 1870  C CA   . VAL A 1 9   ? 7.010   27.248  -3.416  1.00 0.00 ? 9   VAL A CA   2  
ATOM 1871  C C    . VAL A 1 9   ? 5.832   27.906  -4.125  1.00 0.00 ? 9   VAL A C    2  
ATOM 1872  O O    . VAL A 1 9   ? 5.573   29.097  -3.950  1.00 0.00 ? 9   VAL A O    2  
ATOM 1873  C CB   . VAL A 1 9   ? 6.475   26.269  -2.355  1.00 0.00 ? 9   VAL A CB   2  
ATOM 1874  C CG1  . VAL A 1 9   ? 7.623   25.570  -1.645  1.00 0.00 ? 9   VAL A CG1  2  
ATOM 1875  C CG2  . VAL A 1 9   ? 5.585   26.998  -1.359  1.00 0.00 ? 9   VAL A CG2  2  
ATOM 1876  H H    . VAL A 1 9   ? 7.514   28.905  -2.199  1.00 0.00 ? 9   VAL A H    2  
ATOM 1877  H HA   . VAL A 1 9   ? 7.585   26.685  -4.138  1.00 0.00 ? 9   VAL A HA   2  
ATOM 1878  H HB   . VAL A 1 9   ? 5.880   25.518  -2.854  1.00 0.00 ? 9   VAL A HB   2  
ATOM 1879  H HG11 . VAL A 1 9   ? 7.229   24.831  -0.963  1.00 0.00 ? 9   VAL A HG11 2  
ATOM 1880  H HG12 . VAL A 1 9   ? 8.258   25.087  -2.374  1.00 0.00 ? 9   VAL A HG12 2  
ATOM 1881  H HG13 . VAL A 1 9   ? 8.200   26.297  -1.091  1.00 0.00 ? 9   VAL A HG13 2  
ATOM 1882  H HG21 . VAL A 1 9   ? 5.462   26.389  -0.476  1.00 0.00 ? 9   VAL A HG21 2  
ATOM 1883  H HG22 . VAL A 1 9   ? 6.045   27.938  -1.087  1.00 0.00 ? 9   VAL A HG22 2  
ATOM 1884  H HG23 . VAL A 1 9   ? 4.620   27.185  -1.807  1.00 0.00 ? 9   VAL A HG23 2  
ATOM 1885  N N    . LEU A 1 10  ? 5.121   27.122  -4.930  1.00 0.00 ? 10  LEU A N    2  
ATOM 1886  C CA   . LEU A 1 10  ? 3.967   27.629  -5.666  1.00 0.00 ? 10  LEU A CA   2  
ATOM 1887  C C    . LEU A 1 10  ? 2.744   26.747  -5.436  1.00 0.00 ? 10  LEU A C    2  
ATOM 1888  O O    . LEU A 1 10  ? 2.856   25.525  -5.329  1.00 0.00 ? 10  LEU A O    2  
ATOM 1889  C CB   . LEU A 1 10  ? 4.283   27.699  -7.160  1.00 0.00 ? 10  LEU A CB   2  
ATOM 1890  C CG   . LEU A 1 10  ? 4.513   29.099  -7.732  1.00 0.00 ? 10  LEU A CG   2  
ATOM 1891  C CD1  . LEU A 1 10  ? 5.725   29.749  -7.082  1.00 0.00 ? 10  LEU A CD1  2  
ATOM 1892  C CD2  . LEU A 1 10  ? 4.687   29.036  -9.244  1.00 0.00 ? 10  LEU A CD2  2  
ATOM 1893  H H    . LEU A 1 10  ? 5.374   26.182  -5.028  1.00 0.00 ? 10  LEU A H    2  
ATOM 1894  H HA   . LEU A 1 10  ? 3.753   28.622  -5.304  1.00 0.00 ? 10  LEU A HA   2  
ATOM 1895  H HB2  . LEU A 1 10  ? 5.177   27.120  -7.337  1.00 0.00 ? 10  LEU A HB2  2  
ATOM 1896  H HB3  . LEU A 1 10  ? 3.456   27.255  -7.695  1.00 0.00 ? 10  LEU A HB3  2  
ATOM 1897  H HG   . LEU A 1 10  ? 3.651   29.714  -7.519  1.00 0.00 ? 10  LEU A HG   2  
ATOM 1898  H HD11 . LEU A 1 10  ? 6.398   30.104  -7.847  1.00 0.00 ? 10  LEU A HD11 2  
ATOM 1899  H HD12 . LEU A 1 10  ? 6.234   29.024  -6.465  1.00 0.00 ? 10  LEU A HD12 2  
ATOM 1900  H HD13 . LEU A 1 10  ? 5.403   30.579  -6.471  1.00 0.00 ? 10  LEU A HD13 2  
ATOM 1901  H HD21 . LEU A 1 10  ? 5.665   28.641  -9.477  1.00 0.00 ? 10  LEU A HD21 2  
ATOM 1902  H HD22 . LEU A 1 10  ? 4.591   30.029  -9.657  1.00 0.00 ? 10  LEU A HD22 2  
ATOM 1903  H HD23 . LEU A 1 10  ? 3.928   28.394  -9.665  1.00 0.00 ? 10  LEU A HD23 2  
ATOM 1904  N N    . THR A 1 11  ? 1.574   27.375  -5.361  1.00 0.00 ? 11  THR A N    2  
ATOM 1905  C CA   . THR A 1 11  ? 0.330   26.648  -5.143  1.00 0.00 ? 11  THR A CA   2  
ATOM 1906  C C    . THR A 1 11  ? 0.428   25.743  -3.921  1.00 0.00 ? 11  THR A C    2  
ATOM 1907  O O    . THR A 1 11  ? -0.091  24.628  -3.921  1.00 0.00 ? 11  THR A O    2  
ATOM 1908  C CB   . THR A 1 11  ? -0.044  25.795  -6.371  1.00 0.00 ? 11  THR A CB   2  
ATOM 1909  O OG1  . THR A 1 11  ? 0.328   26.477  -7.573  1.00 0.00 ? 11  THR A OG1  2  
ATOM 1910  C CG2  . THR A 1 11  ? -1.535  25.498  -6.389  1.00 0.00 ? 11  THR A CG2  2  
ATOM 1911  H H    . THR A 1 11  ? 1.549   28.350  -5.453  1.00 0.00 ? 11  THR A H    2  
ATOM 1912  H HA   . THR A 1 11  ? -0.456  27.372  -4.983  1.00 0.00 ? 11  THR A HA   2  
ATOM 1913  H HB   . THR A 1 11  ? 0.493   24.858  -6.316  1.00 0.00 ? 11  THR A HB   2  
ATOM 1914  H HG1  . THR A 1 11  ? 1.004   25.972  -8.032  1.00 0.00 ? 11  THR A HG1  2  
ATOM 1915  H HG21 . THR A 1 11  ? -1.766  24.754  -5.643  1.00 0.00 ? 11  THR A HG21 2  
ATOM 1916  H HG22 . THR A 1 11  ? -1.817  25.130  -7.365  1.00 0.00 ? 11  THR A HG22 2  
ATOM 1917  H HG23 . THR A 1 11  ? -2.085  26.403  -6.176  1.00 0.00 ? 11  THR A HG23 2  
ATOM 1918  N N    . GLN A 1 12  ? 1.093   26.234  -2.880  1.00 0.00 ? 12  GLN A N    2  
ATOM 1919  C CA   . GLN A 1 12  ? 1.256   25.468  -1.649  1.00 0.00 ? 12  GLN A CA   2  
ATOM 1920  C C    . GLN A 1 12  ? 1.198   26.381  -0.428  1.00 0.00 ? 12  GLN A C    2  
ATOM 1921  O O    . GLN A 1 12  ? 1.839   26.116  0.589   1.00 0.00 ? 12  GLN A O    2  
ATOM 1922  C CB   . GLN A 1 12  ? 2.584   24.708  -1.670  1.00 0.00 ? 12  GLN A CB   2  
ATOM 1923  C CG   . GLN A 1 12  ? 2.472   23.273  -1.181  1.00 0.00 ? 12  GLN A CG   2  
ATOM 1924  C CD   . GLN A 1 12  ? 3.820   22.656  -0.866  1.00 0.00 ? 12  GLN A CD   2  
ATOM 1925  O OE1  . GLN A 1 12  ? 4.253   21.711  -1.525  1.00 0.00 ? 12  GLN A OE1  2  
ATOM 1926  N NE2  . GLN A 1 12  ? 4.494   23.190  0.147   1.00 0.00 ? 12  GLN A NE2  2  
ATOM 1927  H H    . GLN A 1 12  ? 1.482   27.130  -2.939  1.00 0.00 ? 12  GLN A H    2  
ATOM 1928  H HA   . GLN A 1 12  ? 0.446   24.758  -1.591  1.00 0.00 ? 12  GLN A HA   2  
ATOM 1929  H HB2  . GLN A 1 12  ? 2.960   24.692  -2.682  1.00 0.00 ? 12  GLN A HB2  2  
ATOM 1930  H HB3  . GLN A 1 12  ? 3.292   25.226  -1.041  1.00 0.00 ? 12  GLN A HB3  2  
ATOM 1931  H HG2  . GLN A 1 12  ? 1.868   23.259  -0.284  1.00 0.00 ? 12  GLN A HG2  2  
ATOM 1932  H HG3  . GLN A 1 12  ? 1.990   22.681  -1.945  1.00 0.00 ? 12  GLN A HG3  2  
ATOM 1933  H HE21 . GLN A 1 12  ? 4.087   23.941  0.629   1.00 0.00 ? 12  GLN A HE21 2  
ATOM 1934  H HE22 . GLN A 1 12  ? 5.367   22.811  0.373   1.00 0.00 ? 12  GLN A HE22 2  
ATOM 1935  N N    . THR A 1 13  ? 0.427   27.457  -0.536  1.00 0.00 ? 13  THR A N    2  
ATOM 1936  C CA   . THR A 1 13  ? 0.286   28.410  0.558   1.00 0.00 ? 13  THR A CA   2  
ATOM 1937  C C    . THR A 1 13  ? -0.386  27.766  1.765   1.00 0.00 ? 13  THR A C    2  
ATOM 1938  O O    . THR A 1 13  ? -0.114  28.133  2.908   1.00 0.00 ? 13  THR A O    2  
ATOM 1939  C CB   . THR A 1 13  ? -0.530  29.644  0.127   1.00 0.00 ? 13  THR A CB   2  
ATOM 1940  O OG1  . THR A 1 13  ? -0.568  30.601  1.191   1.00 0.00 ? 13  THR A OG1  2  
ATOM 1941  C CG2  . THR A 1 13  ? -1.948  29.248  -0.257  1.00 0.00 ? 13  THR A CG2  2  
ATOM 1942  H H    . THR A 1 13  ? -0.059  27.614  -1.373  1.00 0.00 ? 13  THR A H    2  
ATOM 1943  H HA   . THR A 1 13  ? 1.274   28.739  0.841   1.00 0.00 ? 13  THR A HA   2  
ATOM 1944  H HB   . THR A 1 13  ? -0.052  30.091  -0.733  1.00 0.00 ? 13  THR A HB   2  
ATOM 1945  H HG1  . THR A 1 13  ? -1.076  31.368  0.914   1.00 0.00 ? 13  THR A HG1  2  
ATOM 1946  H HG21 . THR A 1 13  ? -2.399  30.041  -0.834  1.00 0.00 ? 13  THR A HG21 2  
ATOM 1947  H HG22 . THR A 1 13  ? -2.528  29.077  0.636   1.00 0.00 ? 13  THR A HG22 2  
ATOM 1948  H HG23 . THR A 1 13  ? -1.922  28.344  -0.847  1.00 0.00 ? 13  THR A HG23 2  
ATOM 1949  N N    . SER A 1 14  ? -1.265  26.803  1.503   1.00 0.00 ? 14  SER A N    2  
ATOM 1950  C CA   . SER A 1 14  ? -1.980  26.110  2.568   1.00 0.00 ? 14  SER A CA   2  
ATOM 1951  C C    . SER A 1 14  ? -1.983  24.604  2.329   1.00 0.00 ? 14  SER A C    2  
ATOM 1952  O O    . SER A 1 14  ? -1.602  24.134  1.258   1.00 0.00 ? 14  SER A O    2  
ATOM 1953  C CB   . SER A 1 14  ? -3.417  26.626  2.668   1.00 0.00 ? 14  SER A CB   2  
ATOM 1954  O OG   . SER A 1 14  ? -4.026  26.684  1.391   1.00 0.00 ? 14  SER A OG   2  
ATOM 1955  H H    . SER A 1 14  ? -1.439  26.555  0.570   1.00 0.00 ? 14  SER A H    2  
ATOM 1956  H HA   . SER A 1 14  ? -1.468  26.314  3.497   1.00 0.00 ? 14  SER A HA   2  
ATOM 1957  H HB2  . SER A 1 14  ? -3.991  25.964  3.298   1.00 0.00 ? 14  SER A HB2  2  
ATOM 1958  H HB3  . SER A 1 14  ? -3.411  27.618  3.097   1.00 0.00 ? 14  SER A HB3  2  
ATOM 1959  H HG   . SER A 1 14  ? -4.964  26.495  1.474   1.00 0.00 ? 14  SER A HG   2  
ATOM 1960  N N    . GLU A 1 15  ? -2.417  23.851  3.335   1.00 0.00 ? 15  GLU A N    2  
ATOM 1961  C CA   . GLU A 1 15  ? -2.470  22.397  3.236   1.00 0.00 ? 15  GLU A CA   2  
ATOM 1962  C C    . GLU A 1 15  ? -3.493  21.961  2.192   1.00 0.00 ? 15  GLU A C    2  
ATOM 1963  O O    . GLU A 1 15  ? -4.669  22.319  2.273   1.00 0.00 ? 15  GLU A O    2  
ATOM 1964  C CB   . GLU A 1 15  ? -2.814  21.783  4.593   1.00 0.00 ? 15  GLU A CB   2  
ATOM 1965  C CG   . GLU A 1 15  ? -1.787  22.076  5.673   1.00 0.00 ? 15  GLU A CG   2  
ATOM 1966  C CD   . GLU A 1 15  ? -2.069  23.371  6.408   1.00 0.00 ? 15  GLU A CD   2  
ATOM 1967  O OE1  . GLU A 1 15  ? -3.043  24.062  6.046   1.00 0.00 ? 15  GLU A OE1  2  
ATOM 1968  O OE2  . GLU A 1 15  ? -1.312  23.696  7.349   1.00 0.00 ? 15  GLU A OE2  2  
ATOM 1969  H H    . GLU A 1 15  ? -2.708  24.285  4.166   1.00 0.00 ? 15  GLU A H    2  
ATOM 1970  H HA   . GLU A 1 15  ? -1.494  22.051  2.931   1.00 0.00 ? 15  GLU A HA   2  
ATOM 1971  H HB2  . GLU A 1 15  ? -3.769  22.169  4.918   1.00 0.00 ? 15  GLU A HB2  2  
ATOM 1972  H HB3  . GLU A 1 15  ? -2.890  20.712  4.480   1.00 0.00 ? 15  GLU A HB3  2  
ATOM 1973  H HG2  . GLU A 1 15  ? -1.793  21.267  6.386   1.00 0.00 ? 15  GLU A HG2  2  
ATOM 1974  H HG3  . GLU A 1 15  ? -0.811  22.144  5.214   1.00 0.00 ? 15  GLU A HG3  2  
ATOM 1975  N N    . GLN A 1 16  ? -3.038  21.187  1.213   1.00 0.00 ? 16  GLN A N    2  
ATOM 1976  C CA   . GLN A 1 16  ? -3.915  20.703  0.152   1.00 0.00 ? 16  GLN A CA   2  
ATOM 1977  C C    . GLN A 1 16  ? -3.995  19.179  0.165   1.00 0.00 ? 16  GLN A C    2  
ATOM 1978  O O    . GLN A 1 16  ? -3.405  18.525  1.023   1.00 0.00 ? 16  GLN A O    2  
ATOM 1979  C CB   . GLN A 1 16  ? -3.418  21.188  -1.211  1.00 0.00 ? 16  GLN A CB   2  
ATOM 1980  C CG   . GLN A 1 16  ? -4.242  22.326  -1.790  1.00 0.00 ? 16  GLN A CG   2  
ATOM 1981  C CD   . GLN A 1 16  ? -3.959  23.653  -1.115  1.00 0.00 ? 16  GLN A CD   2  
ATOM 1982  O OE1  . GLN A 1 16  ? -4.776  24.154  -0.340  1.00 0.00 ? 16  GLN A OE1  2  
ATOM 1983  N NE2  . GLN A 1 16  ? -2.799  24.230  -1.405  1.00 0.00 ? 16  GLN A NE2  2  
ATOM 1984  H H    . GLN A 1 16  ? -2.092  20.935  1.201   1.00 0.00 ? 16  GLN A H    2  
ATOM 1985  H HA   . GLN A 1 16  ? -4.901  21.104  0.328   1.00 0.00 ? 16  GLN A HA   2  
ATOM 1986  H HB2  . GLN A 1 16  ? -2.397  21.525  -1.109  1.00 0.00 ? 16  GLN A HB2  2  
ATOM 1987  H HB3  . GLN A 1 16  ? -3.446  20.361  -1.906  1.00 0.00 ? 16  GLN A HB3  2  
ATOM 1988  H HG2  . GLN A 1 16  ? -4.015  22.419  -2.842  1.00 0.00 ? 16  GLN A HG2  2  
ATOM 1989  H HG3  . GLN A 1 16  ? -5.290  22.091  -1.669  1.00 0.00 ? 16  GLN A HG3  2  
ATOM 1990  H HE21 . GLN A 1 16  ? -2.200  23.773  -2.032  1.00 0.00 ? 16  GLN A HE21 2  
ATOM 1991  H HE22 . GLN A 1 16  ? -2.592  25.089  -0.985  1.00 0.00 ? 16  GLN A HE22 2  
ATOM 1992  N N    . ALA A 1 17  ? -4.731  18.623  -0.792  1.00 0.00 ? 17  ALA A N    2  
ATOM 1993  C CA   . ALA A 1 17  ? -4.887  17.176  -0.891  1.00 0.00 ? 17  ALA A CA   2  
ATOM 1994  C C    . ALA A 1 17  ? -3.565  16.505  -1.243  1.00 0.00 ? 17  ALA A C    2  
ATOM 1995  O O    . ALA A 1 17  ? -2.641  17.131  -1.763  1.00 0.00 ? 17  ALA A O    2  
ATOM 1996  C CB   . ALA A 1 17  ? -5.949  16.831  -1.923  1.00 0.00 ? 17  ALA A CB   2  
ATOM 1997  H H    . ALA A 1 17  ? -5.177  19.198  -1.447  1.00 0.00 ? 17  ALA A H    2  
ATOM 1998  H HA   . ALA A 1 17  ? -5.220  16.810  0.069   1.00 0.00 ? 17  ALA A HA   2  
ATOM 1999  H HB1  . ALA A 1 17  ? -5.666  15.924  -2.439  1.00 0.00 ? 17  ALA A HB1  2  
ATOM 2000  H HB2  . ALA A 1 17  ? -6.897  16.682  -1.428  1.00 0.00 ? 17  ALA A HB2  2  
ATOM 2001  H HB3  . ALA A 1 17  ? -6.036  17.638  -2.635  1.00 0.00 ? 17  ALA A HB3  2  
ATOM 2002  N N    . PRO A 1 18  ? -3.467  15.198  -0.955  1.00 0.00 ? 18  PRO A N    2  
ATOM 2003  C CA   . PRO A 1 18  ? -2.262  14.413  -1.233  1.00 0.00 ? 18  PRO A CA   2  
ATOM 2004  C C    . PRO A 1 18  ? -2.041  14.199  -2.727  1.00 0.00 ? 18  PRO A C    2  
ATOM 2005  O O    . PRO A 1 18  ? -2.896  13.644  -3.418  1.00 0.00 ? 18  PRO A O    2  
ATOM 2006  C CB   . PRO A 1 18  ? -2.539  13.078  -0.538  1.00 0.00 ? 18  PRO A CB   2  
ATOM 2007  C CG   . PRO A 1 18  ? -4.025  12.979  -0.488  1.00 0.00 ? 18  PRO A CG   2  
ATOM 2008  C CD   . PRO A 1 18  ? -4.529  14.387  -0.335  1.00 0.00 ? 18  PRO A CD   2  
ATOM 2009  H HA   . PRO A 1 18  ? -1.382  14.869  -0.802  1.00 0.00 ? 18  PRO A HA   2  
ATOM 2010  H HB2  . PRO A 1 18  ? -2.107  12.272  -1.114  1.00 0.00 ? 18  PRO A HB2  2  
ATOM 2011  H HB3  . PRO A 1 18  ? -2.111  13.089  0.454   1.00 0.00 ? 18  PRO A HB3  2  
ATOM 2012  H HG2  . PRO A 1 18  ? -4.395  12.545  -1.403  1.00 0.00 ? 18  PRO A HG2  2  
ATOM 2013  H HG3  . PRO A 1 18  ? -4.324  12.381  0.361   1.00 0.00 ? 18  PRO A HG3  2  
ATOM 2014  H HD2  . PRO A 1 18  ? -5.465  14.512  -0.859  1.00 0.00 ? 18  PRO A HD2  2  
ATOM 2015  H HD3  . PRO A 1 18  ? -4.643  14.637  0.710   1.00 0.00 ? 18  PRO A HD3  2  
ATOM 2016  N N    . SER A 1 19  ? -0.889  14.643  -3.220  1.00 0.00 ? 19  SER A N    2  
ATOM 2017  C CA   . SER A 1 19  ? -0.559  14.504  -4.634  1.00 0.00 ? 19  SER A CA   2  
ATOM 2018  C C    . SER A 1 19  ? 0.578   13.504  -4.829  1.00 0.00 ? 19  SER A C    2  
ATOM 2019  O O    . SER A 1 19  ? 1.462   13.707  -5.661  1.00 0.00 ? 19  SER A O    2  
ATOM 2020  C CB   . SER A 1 19  ? -0.167  15.860  -5.223  1.00 0.00 ? 19  SER A CB   2  
ATOM 2021  O OG   . SER A 1 19  ? -0.114  15.803  -6.639  1.00 0.00 ? 19  SER A OG   2  
ATOM 2022  H H    . SER A 1 19  ? -0.249  15.078  -2.619  1.00 0.00 ? 19  SER A H    2  
ATOM 2023  H HA   . SER A 1 19  ? -1.435  14.137  -5.145  1.00 0.00 ? 19  SER A HA   2  
ATOM 2024  H HB2  . SER A 1 19  ? -0.896  16.599  -4.932  1.00 0.00 ? 19  SER A HB2  2  
ATOM 2025  H HB3  . SER A 1 19  ? 0.806   16.144  -4.849  1.00 0.00 ? 19  SER A HB3  2  
ATOM 2026  H HG   . SER A 1 19  ? 0.803   15.810  -6.924  1.00 0.00 ? 19  SER A HG   2  
ATOM 2027  N N    . SER A 1 20  ? 0.547   12.425  -4.054  1.00 0.00 ? 20  SER A N    2  
ATOM 2028  C CA   . SER A 1 20  ? 1.575   11.394  -4.138  1.00 0.00 ? 20  SER A CA   2  
ATOM 2029  C C    . SER A 1 20  ? 1.017   10.034  -3.732  1.00 0.00 ? 20  SER A C    2  
ATOM 2030  O O    . SER A 1 20  ? 0.422   9.888   -2.663  1.00 0.00 ? 20  SER A O    2  
ATOM 2031  C CB   . SER A 1 20  ? 2.765   11.757  -3.246  1.00 0.00 ? 20  SER A CB   2  
ATOM 2032  O OG   . SER A 1 20  ? 3.977   11.260  -3.787  1.00 0.00 ? 20  SER A OG   2  
ATOM 2033  H H    . SER A 1 20  ? -0.184  12.319  -3.409  1.00 0.00 ? 20  SER A H    2  
ATOM 2034  H HA   . SER A 1 20  ? 1.909   11.341  -5.164  1.00 0.00 ? 20  SER A HA   2  
ATOM 2035  H HB2  . SER A 1 20  ? 2.834   12.831  -3.163  1.00 0.00 ? 20  SER A HB2  2  
ATOM 2036  H HB3  . SER A 1 20  ? 2.620   11.328  -2.265  1.00 0.00 ? 20  SER A HB3  2  
ATOM 2037  H HG   . SER A 1 20  ? 4.057   11.536  -4.702  1.00 0.00 ? 20  SER A HG   2  
ATOM 2038  N N    . ALA A 1 21  ? 1.212   9.039   -4.591  1.00 0.00 ? 21  ALA A N    2  
ATOM 2039  C CA   . ALA A 1 21  ? 0.730   7.691   -4.322  1.00 0.00 ? 21  ALA A CA   2  
ATOM 2040  C C    . ALA A 1 21  ? 1.517   7.042   -3.187  1.00 0.00 ? 21  ALA A C    2  
ATOM 2041  O O    . ALA A 1 21  ? 2.664   7.398   -2.912  1.00 0.00 ? 21  ALA A O    2  
ATOM 2042  C CB   . ALA A 1 21  ? 0.816   6.839   -5.580  1.00 0.00 ? 21  ALA A CB   2  
ATOM 2043  H H    . ALA A 1 21  ? 1.695   9.217   -5.426  1.00 0.00 ? 21  ALA A H    2  
ATOM 2044  H HA   . ALA A 1 21  ? -0.308  7.759   -4.033  1.00 0.00 ? 21  ALA A HA   2  
ATOM 2045  H HB1  . ALA A 1 21  ? -0.092  6.263   -5.687  1.00 0.00 ? 21  ALA A HB1  2  
ATOM 2046  H HB2  . ALA A 1 21  ? 0.939   7.480   -6.441  1.00 0.00 ? 21  ALA A HB2  2  
ATOM 2047  H HB3  . ALA A 1 21  ? 1.660   6.169   -5.504  1.00 0.00 ? 21  ALA A HB3  2  
ATOM 2048  N N    . PRO A 1 22  ? 0.889   6.069   -2.512  1.00 0.00 ? 22  PRO A N    2  
ATOM 2049  C CA   . PRO A 1 22  ? 1.512   5.351   -1.396  1.00 0.00 ? 22  PRO A CA   2  
ATOM 2050  C C    . PRO A 1 22  ? 2.644   4.438   -1.854  1.00 0.00 ? 22  PRO A C    2  
ATOM 2051  O O    . PRO A 1 22  ? 2.614   3.905   -2.963  1.00 0.00 ? 22  PRO A O    2  
ATOM 2052  C CB   . PRO A 1 22  ? 0.359   4.526   -0.817  1.00 0.00 ? 22  PRO A CB   2  
ATOM 2053  C CG   . PRO A 1 22  ? -0.585  4.344   -1.955  1.00 0.00 ? 22  PRO A CG   2  
ATOM 2054  C CD   . PRO A 1 22  ? -0.478  5.593   -2.786  1.00 0.00 ? 22  PRO A CD   2  
ATOM 2055  H HA   . PRO A 1 22  ? 1.883   6.033   -0.643  1.00 0.00 ? 22  PRO A HA   2  
ATOM 2056  H HB2  . PRO A 1 22  ? 0.737   3.578   -0.460  1.00 0.00 ? 22  PRO A HB2  2  
ATOM 2057  H HB3  . PRO A 1 22  ? -0.101  5.066   -0.004  1.00 0.00 ? 22  PRO A HB3  2  
ATOM 2058  H HG2  . PRO A 1 22  ? -0.297  3.482   -2.537  1.00 0.00 ? 22  PRO A HG2  2  
ATOM 2059  H HG3  . PRO A 1 22  ? -1.591  4.229   -1.581  1.00 0.00 ? 22  PRO A HG3  2  
ATOM 2060  H HD2  . PRO A 1 22  ? -0.603  5.362   -3.834  1.00 0.00 ? 22  PRO A HD2  2  
ATOM 2061  H HD3  . PRO A 1 22  ? -1.209  6.322   -2.469  1.00 0.00 ? 22  PRO A HD3  2  
ATOM 2062  N N    . ARG A 1 23  ? 3.640   4.261   -0.992  1.00 0.00 ? 23  ARG A N    2  
ATOM 2063  C CA   . ARG A 1 23  ? 4.782   3.412   -1.310  1.00 0.00 ? 23  ARG A CA   2  
ATOM 2064  C C    . ARG A 1 23  ? 4.837   2.204   -0.379  1.00 0.00 ? 23  ARG A C    2  
ATOM 2065  O O    . ARG A 1 23  ? 4.009   2.064   0.522   1.00 0.00 ? 23  ARG A O    2  
ATOM 2066  C CB   . ARG A 1 23  ? 6.083   4.210   -1.205  1.00 0.00 ? 23  ARG A CB   2  
ATOM 2067  C CG   . ARG A 1 23  ? 6.020   5.570   -1.880  1.00 0.00 ? 23  ARG A CG   2  
ATOM 2068  C CD   . ARG A 1 23  ? 7.345   5.931   -2.530  1.00 0.00 ? 23  ARG A CD   2  
ATOM 2069  N NE   . ARG A 1 23  ? 7.367   5.601   -3.951  1.00 0.00 ? 23  ARG A NE   2  
ATOM 2070  C CZ   . ARG A 1 23  ? 6.654   6.247   -4.868  1.00 0.00 ? 23  ARG A CZ   2  
ATOM 2071  N NH1  . ARG A 1 23  ? 5.866   7.252   -4.512  1.00 0.00 ? 23  ARG A NH1  2  
ATOM 2072  N NH2  . ARG A 1 23  ? 6.726   5.885   -6.142  1.00 0.00 ? 23  ARG A NH2  2  
ATOM 2073  H H    . ARG A 1 23  ? 3.608   4.713   -0.124  1.00 0.00 ? 23  ARG A H    2  
ATOM 2074  H HA   . ARG A 1 23  ? 4.666   3.064   -2.325  1.00 0.00 ? 23  ARG A HA   2  
ATOM 2075  H HB2  . ARG A 1 23  ? 6.315   4.361   -0.161  1.00 0.00 ? 23  ARG A HB2  2  
ATOM 2076  H HB3  . ARG A 1 23  ? 6.878   3.642   -1.662  1.00 0.00 ? 23  ARG A HB3  2  
ATOM 2077  H HG2  . ARG A 1 23  ? 5.252   5.549   -2.640  1.00 0.00 ? 23  ARG A HG2  2  
ATOM 2078  H HG3  . ARG A 1 23  ? 5.775   6.318   -1.140  1.00 0.00 ? 23  ARG A HG3  2  
ATOM 2079  H HD2  . ARG A 1 23  ? 7.510   6.993   -2.415  1.00 0.00 ? 23  ARG A HD2  2  
ATOM 2080  H HD3  . ARG A 1 23  ? 8.135   5.390   -2.031  1.00 0.00 ? 23  ARG A HD3  2  
ATOM 2081  H HE   . ARG A 1 23  ? 7.941   4.859   -4.237  1.00 0.00 ? 23  ARG A HE   2  
ATOM 2082  H HH11 . ARG A 1 23  ? 5.810   7.527   -3.552  1.00 0.00 ? 23  ARG A HH11 2  
ATOM 2083  H HH12 . ARG A 1 23  ? 5.332   7.738   -5.203  1.00 0.00 ? 23  ARG A HH12 2  
ATOM 2084  H HH21 . ARG A 1 23  ? 7.318   5.128   -6.415  1.00 0.00 ? 23  ARG A HH21 2  
ATOM 2085  H HH22 . ARG A 1 23  ? 6.188   6.371   -6.831  1.00 0.00 ? 23  ARG A HH22 2  
ATOM 2086  N N    . ASP A 1 24  ? 5.817   1.335   -0.604  1.00 0.00 ? 24  ASP A N    2  
ATOM 2087  C CA   . ASP A 1 24  ? 5.979   0.139   0.216   1.00 0.00 ? 24  ASP A CA   2  
ATOM 2088  C C    . ASP A 1 24  ? 4.703   -0.695  0.220   1.00 0.00 ? 24  ASP A C    2  
ATOM 2089  O O    . ASP A 1 24  ? 4.444   -1.448  1.159   1.00 0.00 ? 24  ASP A O    2  
ATOM 2090  C CB   . ASP A 1 24  ? 6.358   0.523   1.647   1.00 0.00 ? 24  ASP A CB   2  
ATOM 2091  C CG   . ASP A 1 24  ? 7.220   -0.526  2.321   1.00 0.00 ? 24  ASP A CG   2  
ATOM 2092  O OD1  . ASP A 1 24  ? 6.777   -1.691  2.407   1.00 0.00 ? 24  ASP A OD1  2  
ATOM 2093  O OD2  . ASP A 1 24  ? 8.336   -0.184  2.761   1.00 0.00 ? 24  ASP A OD2  2  
ATOM 2094  H H    . ASP A 1 24  ? 6.445   1.501   -1.336  1.00 0.00 ? 24  ASP A H    2  
ATOM 2095  H HA   . ASP A 1 24  ? 6.779   -0.448  -0.211  1.00 0.00 ? 24  ASP A HA   2  
ATOM 2096  H HB2  . ASP A 1 24  ? 6.903   1.455   1.632   1.00 0.00 ? 24  ASP A HB2  2  
ATOM 2097  H HB3  . ASP A 1 24  ? 5.456   0.650   2.228   1.00 0.00 ? 24  ASP A HB3  2  
ATOM 2098  N N    . VAL A 1 25  ? 3.908   -0.556  -0.836  1.00 0.00 ? 25  VAL A N    2  
ATOM 2099  C CA   . VAL A 1 25  ? 2.658   -1.297  -0.955  1.00 0.00 ? 25  VAL A CA   2  
ATOM 2100  C C    . VAL A 1 25  ? 2.902   -2.707  -1.483  1.00 0.00 ? 25  VAL A C    2  
ATOM 2101  O O    . VAL A 1 25  ? 3.134   -2.901  -2.675  1.00 0.00 ? 25  VAL A O    2  
ATOM 2102  C CB   . VAL A 1 25  ? 1.665   -0.578  -1.887  1.00 0.00 ? 25  VAL A CB   2  
ATOM 2103  C CG1  . VAL A 1 25  ? 0.382   -1.383  -2.026  1.00 0.00 ? 25  VAL A CG1  2  
ATOM 2104  C CG2  . VAL A 1 25  ? 1.371   0.823   -1.372  1.00 0.00 ? 25  VAL A CG2  2  
ATOM 2105  H H    . VAL A 1 25  ? 4.169   0.059   -1.554  1.00 0.00 ? 25  VAL A H    2  
ATOM 2106  H HA   . VAL A 1 25  ? 2.215   -1.363  0.028   1.00 0.00 ? 25  VAL A HA   2  
ATOM 2107  H HB   . VAL A 1 25  ? 2.117   -0.492  -2.865  1.00 0.00 ? 25  VAL A HB   2  
ATOM 2108  H HG11 . VAL A 1 25  ? -0.042  -1.553  -1.048  1.00 0.00 ? 25  VAL A HG11 2  
ATOM 2109  H HG12 . VAL A 1 25  ? -0.321  -0.838  -2.637  1.00 0.00 ? 25  VAL A HG12 2  
ATOM 2110  H HG13 . VAL A 1 25  ? 0.603   -2.334  -2.491  1.00 0.00 ? 25  VAL A HG13 2  
ATOM 2111  H HG21 . VAL A 1 25  ? 2.116   1.100   -0.641  1.00 0.00 ? 25  VAL A HG21 2  
ATOM 2112  H HG22 . VAL A 1 25  ? 1.399   1.523   -2.196  1.00 0.00 ? 25  VAL A HG22 2  
ATOM 2113  H HG23 . VAL A 1 25  ? 0.394   0.842   -0.917  1.00 0.00 ? 25  VAL A HG23 2  
ATOM 2114  N N    . GLN A 1 26  ? 2.849   -3.686  -0.586  1.00 0.00 ? 26  GLN A N    2  
ATOM 2115  C CA   . GLN A 1 26  ? 3.066   -5.078  -0.961  1.00 0.00 ? 26  GLN A CA   2  
ATOM 2116  C C    . GLN A 1 26  ? 2.128   -6.002  -0.191  1.00 0.00 ? 26  GLN A C    2  
ATOM 2117  O O    . GLN A 1 26  ? 1.863   -5.787  0.992   1.00 0.00 ? 26  GLN A O    2  
ATOM 2118  C CB   . GLN A 1 26  ? 4.521   -5.478  -0.702  1.00 0.00 ? 26  GLN A CB   2  
ATOM 2119  C CG   . GLN A 1 26  ? 5.524   -4.689  -1.529  1.00 0.00 ? 26  GLN A CG   2  
ATOM 2120  C CD   . GLN A 1 26  ? 6.959   -4.975  -1.131  1.00 0.00 ? 26  GLN A CD   2  
ATOM 2121  O OE1  . GLN A 1 26  ? 7.402   -6.124  -1.142  1.00 0.00 ? 26  GLN A OE1  2  
ATOM 2122  N NE2  . GLN A 1 26  ? 7.695   -3.927  -0.778  1.00 0.00 ? 26  GLN A NE2  2  
ATOM 2123  H H    . GLN A 1 26  ? 2.662   -3.467  0.351   1.00 0.00 ? 26  GLN A H    2  
ATOM 2124  H HA   . GLN A 1 26  ? 2.859   -5.174  -2.015  1.00 0.00 ? 26  GLN A HA   2  
ATOM 2125  H HB2  . GLN A 1 26  ? 4.744   -5.322  0.343   1.00 0.00 ? 26  GLN A HB2  2  
ATOM 2126  H HB3  . GLN A 1 26  ? 4.640   -6.526  -0.935  1.00 0.00 ? 26  GLN A HB3  2  
ATOM 2127  H HG2  . GLN A 1 26  ? 5.397   -4.950  -2.570  1.00 0.00 ? 26  GLN A HG2  2  
ATOM 2128  H HG3  . GLN A 1 26  ? 5.330   -3.636  -1.395  1.00 0.00 ? 26  GLN A HG3  2  
ATOM 2129  H HE21 . GLN A 1 26  ? 7.275   -3.042  -0.791  1.00 0.00 ? 26  GLN A HE21 2  
ATOM 2130  H HE22 . GLN A 1 26  ? 8.625   -4.084  -0.516  1.00 0.00 ? 26  GLN A HE22 2  
ATOM 2131  N N    . ALA A 1 27  ? 1.630   -7.030  -0.870  1.00 0.00 ? 27  ALA A N    2  
ATOM 2132  C CA   . ALA A 1 27  ? 0.722   -7.986  -0.249  1.00 0.00 ? 27  ALA A CA   2  
ATOM 2133  C C    . ALA A 1 27  ? 1.391   -9.347  -0.079  1.00 0.00 ? 27  ALA A C    2  
ATOM 2134  O O    . ALA A 1 27  ? 1.867   -9.941  -1.047  1.00 0.00 ? 27  ALA A O    2  
ATOM 2135  C CB   . ALA A 1 27  ? -0.549  -8.120  -1.073  1.00 0.00 ? 27  ALA A CB   2  
ATOM 2136  H H    . ALA A 1 27  ? 1.879   -7.148  -1.809  1.00 0.00 ? 27  ALA A H    2  
ATOM 2137  H HA   . ALA A 1 27  ? 0.452   -7.607  0.726   1.00 0.00 ? 27  ALA A HA   2  
ATOM 2138  H HB1  . ALA A 1 27  ? -0.322  -8.616  -2.006  1.00 0.00 ? 27  ALA A HB1  2  
ATOM 2139  H HB2  . ALA A 1 27  ? -1.275  -8.701  -0.524  1.00 0.00 ? 27  ALA A HB2  2  
ATOM 2140  H HB3  . ALA A 1 27  ? -0.952  -7.139  -1.275  1.00 0.00 ? 27  ALA A HB3  2  
ATOM 2141  N N    . ARG A 1 28  ? 1.424   -9.835  1.157   1.00 0.00 ? 28  ARG A N    2  
ATOM 2142  C CA   . ARG A 1 28  ? 2.036   -11.125 1.451   1.00 0.00 ? 28  ARG A CA   2  
ATOM 2143  C C    . ARG A 1 28  ? 1.010   -12.093 2.032   1.00 0.00 ? 28  ARG A C    2  
ATOM 2144  O O    . ARG A 1 28  ? 0.318   -11.776 2.999   1.00 0.00 ? 28  ARG A O    2  
ATOM 2145  C CB   . ARG A 1 28  ? 3.199   -10.950 2.431   1.00 0.00 ? 28  ARG A CB   2  
ATOM 2146  C CG   . ARG A 1 28  ? 2.868   -10.054 3.613   1.00 0.00 ? 28  ARG A CG   2  
ATOM 2147  C CD   . ARG A 1 28  ? 4.016   -10.001 4.609   1.00 0.00 ? 28  ARG A CD   2  
ATOM 2148  N NE   . ARG A 1 28  ? 5.235   -9.463  4.011   1.00 0.00 ? 28  ARG A NE   2  
ATOM 2149  C CZ   . ARG A 1 28  ? 6.440   -9.587  4.559   1.00 0.00 ? 28  ARG A CZ   2  
ATOM 2150  N NH1  . ARG A 1 28  ? 6.585   -10.228 5.710   1.00 0.00 ? 28  ARG A NH1  2  
ATOM 2151  N NH2  . ARG A 1 28  ? 7.502   -9.070  3.953   1.00 0.00 ? 28  ARG A NH2  2  
ATOM 2152  H H    . ARG A 1 28  ? 1.028   -9.316  1.887   1.00 0.00 ? 28  ARG A H    2  
ATOM 2153  H HA   . ARG A 1 28  ? 2.415   -11.533 0.526   1.00 0.00 ? 28  ARG A HA   2  
ATOM 2154  H HB2  . ARG A 1 28  ? 3.483   -11.920 2.811   1.00 0.00 ? 28  ARG A HB2  2  
ATOM 2155  H HB3  . ARG A 1 28  ? 4.035   -10.519 1.902   1.00 0.00 ? 28  ARG A HB3  2  
ATOM 2156  H HG2  . ARG A 1 28  ? 2.674   -9.054  3.252   1.00 0.00 ? 28  ARG A HG2  2  
ATOM 2157  H HG3  . ARG A 1 28  ? 1.989   -10.438 4.109   1.00 0.00 ? 28  ARG A HG3  2  
ATOM 2158  H HD2  . ARG A 1 28  ? 3.727   -9.373  5.439   1.00 0.00 ? 28  ARG A HD2  2  
ATOM 2159  H HD3  . ARG A 1 28  ? 4.212   -11.001 4.965   1.00 0.00 ? 28  ARG A HD3  2  
ATOM 2160  H HE   . ARG A 1 28  ? 5.152   -8.984  3.160   1.00 0.00 ? 28  ARG A HE   2  
ATOM 2161  H HH11 . ARG A 1 28  ? 5.786   -10.620 6.167   1.00 0.00 ? 28  ARG A HH11 2  
ATOM 2162  H HH12 . ARG A 1 28  ? 7.493   -10.323 6.120   1.00 0.00 ? 28  ARG A HH12 2  
ATOM 2163  H HH21 . ARG A 1 28  ? 7.396   -8.586  3.085   1.00 0.00 ? 28  ARG A HH21 2  
ATOM 2164  H HH22 . ARG A 1 28  ? 8.406   -9.165  4.366   1.00 0.00 ? 28  ARG A HH22 2  
ATOM 2165  N N    . MET A 1 29  ? 0.916   -13.277 1.435   1.00 0.00 ? 29  MET A N    2  
ATOM 2166  C CA   . MET A 1 29  ? -0.024  -14.292 1.892   1.00 0.00 ? 29  MET A CA   2  
ATOM 2167  C C    . MET A 1 29  ? 0.480   -14.967 3.165   1.00 0.00 ? 29  MET A C    2  
ATOM 2168  O O    . MET A 1 29  ? 1.661   -15.294 3.279   1.00 0.00 ? 29  MET A O    2  
ATOM 2169  C CB   . MET A 1 29  ? -0.250  -15.340 0.801   1.00 0.00 ? 29  MET A CB   2  
ATOM 2170  C CG   . MET A 1 29  ? -1.577  -15.188 0.077   1.00 0.00 ? 29  MET A CG   2  
ATOM 2171  S SD   . MET A 1 29  ? -2.993  -15.475 1.157   1.00 0.00 ? 29  MET A SD   2  
ATOM 2172  C CE   . MET A 1 29  ? -3.846  -16.771 0.261   1.00 0.00 ? 29  MET A CE   2  
ATOM 2173  H H    . MET A 1 29  ? 1.494   -13.474 0.668   1.00 0.00 ? 29  MET A H    2  
ATOM 2174  H HA   . MET A 1 29  ? -0.962  -13.802 2.106   1.00 0.00 ? 29  MET A HA   2  
ATOM 2175  H HB2  . MET A 1 29  ? 0.543   -15.260 0.073   1.00 0.00 ? 29  MET A HB2  2  
ATOM 2176  H HB3  . MET A 1 29  ? -0.219  -16.323 1.249   1.00 0.00 ? 29  MET A HB3  2  
ATOM 2177  H HG2  . MET A 1 29  ? -1.644  -14.187 -0.321  1.00 0.00 ? 29  MET A HG2  2  
ATOM 2178  H HG3  . MET A 1 29  ? -1.612  -15.900 -0.736  1.00 0.00 ? 29  MET A HG3  2  
ATOM 2179  H HE1  . MET A 1 29  ? -3.125  -17.374 -0.271  1.00 0.00 ? 29  MET A HE1  2  
ATOM 2180  H HE2  . MET A 1 29  ? -4.391  -17.390 0.958   1.00 0.00 ? 29  MET A HE2  2  
ATOM 2181  H HE3  . MET A 1 29  ? -4.534  -16.328 -0.443  1.00 0.00 ? 29  MET A HE3  2  
ATOM 2182  N N    . LEU A 1 30  ? -0.422  -15.171 4.118   1.00 0.00 ? 30  LEU A N    2  
ATOM 2183  C CA   . LEU A 1 30  ? -0.069  -15.806 5.383   1.00 0.00 ? 30  LEU A CA   2  
ATOM 2184  C C    . LEU A 1 30  ? -0.825  -17.119 5.562   1.00 0.00 ? 30  LEU A C    2  
ATOM 2185  O O    . LEU A 1 30  ? -0.344  -18.037 6.228   1.00 0.00 ? 30  LEU A O    2  
ATOM 2186  C CB   . LEU A 1 30  ? -0.372  -14.865 6.551   1.00 0.00 ? 30  LEU A CB   2  
ATOM 2187  C CG   . LEU A 1 30  ? 0.059   -13.409 6.368   1.00 0.00 ? 30  LEU A CG   2  
ATOM 2188  C CD1  . LEU A 1 30  ? -0.620  -12.520 7.398   1.00 0.00 ? 30  LEU A CD1  2  
ATOM 2189  C CD2  . LEU A 1 30  ? 1.573   -13.285 6.469   1.00 0.00 ? 30  LEU A CD2  2  
ATOM 2190  H H    . LEU A 1 30  ? -1.349  -14.888 3.969   1.00 0.00 ? 30  LEU A H    2  
ATOM 2191  H HA   . LEU A 1 30  ? 0.990   -16.014 5.364   1.00 0.00 ? 30  LEU A HA   2  
ATOM 2192  H HB2  . LEU A 1 30  ? -1.438  -14.876 6.716   1.00 0.00 ? 30  LEU A HB2  2  
ATOM 2193  H HB3  . LEU A 1 30  ? 0.130   -15.255 7.425   1.00 0.00 ? 30  LEU A HB3  2  
ATOM 2194  H HG   . LEU A 1 30  ? -0.242  -13.072 5.387   1.00 0.00 ? 30  LEU A HG   2  
ATOM 2195  H HD11 . LEU A 1 30  ? -0.992  -13.128 8.209   1.00 0.00 ? 30  LEU A HD11 2  
ATOM 2196  H HD12 . LEU A 1 30  ? -1.443  -11.996 6.935   1.00 0.00 ? 30  LEU A HD12 2  
ATOM 2197  H HD13 . LEU A 1 30  ? 0.093   -11.803 7.781   1.00 0.00 ? 30  LEU A HD13 2  
ATOM 2198  H HD21 . LEU A 1 30  ? 2.013   -14.271 6.506   1.00 0.00 ? 30  LEU A HD21 2  
ATOM 2199  H HD22 . LEU A 1 30  ? 1.830   -12.740 7.366   1.00 0.00 ? 30  LEU A HD22 2  
ATOM 2200  H HD23 . LEU A 1 30  ? 1.947   -12.756 5.606   1.00 0.00 ? 30  LEU A HD23 2  
ATOM 2201  N N    . SER A 1 31  ? -2.009  -17.201 4.965   1.00 0.00 ? 31  SER A N    2  
ATOM 2202  C CA   . SER A 1 31  ? -2.832  -18.401 5.060   1.00 0.00 ? 31  SER A CA   2  
ATOM 2203  C C    . SER A 1 31  ? -3.450  -18.744 3.708   1.00 0.00 ? 31  SER A C    2  
ATOM 2204  O O    . SER A 1 31  ? -3.087  -18.169 2.683   1.00 0.00 ? 31  SER A O    2  
ATOM 2205  C CB   . SER A 1 31  ? -3.934  -18.207 6.104   1.00 0.00 ? 31  SER A CB   2  
ATOM 2206  O OG   . SER A 1 31  ? -3.951  -19.277 7.033   1.00 0.00 ? 31  SER A OG   2  
ATOM 2207  H H    . SER A 1 31  ? -2.338  -16.435 4.449   1.00 0.00 ? 31  SER A H    2  
ATOM 2208  H HA   . SER A 1 31  ? -2.195  -19.216 5.370   1.00 0.00 ? 31  SER A HA   2  
ATOM 2209  H HB2  . SER A 1 31  ? -3.763  -17.285 6.637   1.00 0.00 ? 31  SER A HB2  2  
ATOM 2210  H HB3  . SER A 1 31  ? -4.892  -18.163 5.607   1.00 0.00 ? 31  SER A HB3  2  
ATOM 2211  H HG   . SER A 1 31  ? -3.050  -19.556 7.217   1.00 0.00 ? 31  SER A HG   2  
ATOM 2212  N N    . SER A 1 32  ? -4.387  -19.688 3.716   1.00 0.00 ? 32  SER A N    2  
ATOM 2213  C CA   . SER A 1 32  ? -5.053  -20.114 2.490   1.00 0.00 ? 32  SER A CA   2  
ATOM 2214  C C    . SER A 1 32  ? -6.137  -19.117 2.089   1.00 0.00 ? 32  SER A C    2  
ATOM 2215  O O    . SER A 1 32  ? -6.522  -19.036 0.922   1.00 0.00 ? 32  SER A O    2  
ATOM 2216  C CB   . SER A 1 32  ? -5.666  -21.503 2.673   1.00 0.00 ? 32  SER A CB   2  
ATOM 2217  O OG   . SER A 1 32  ? -6.294  -21.622 3.938   1.00 0.00 ? 32  SER A OG   2  
ATOM 2218  H H    . SER A 1 32  ? -4.632  -20.111 4.566   1.00 0.00 ? 32  SER A H    2  
ATOM 2219  H HA   . SER A 1 32  ? -4.312  -20.155 1.707   1.00 0.00 ? 32  SER A HA   2  
ATOM 2220  H HB2  . SER A 1 32  ? -6.399  -21.675 1.902   1.00 0.00 ? 32  SER A HB2  2  
ATOM 2221  H HB3  . SER A 1 32  ? -4.886  -22.248 2.601   1.00 0.00 ? 32  SER A HB3  2  
ATOM 2222  H HG   . SER A 1 32  ? -6.278  -22.539 4.220   1.00 0.00 ? 32  SER A HG   2  
ATOM 2223  N N    . THR A 1 33  ? -6.627  -18.359 3.066   1.00 0.00 ? 33  THR A N    2  
ATOM 2224  C CA   . THR A 1 33  ? -7.668  -17.369 2.816   1.00 0.00 ? 33  THR A CA   2  
ATOM 2225  C C    . THR A 1 33  ? -7.453  -16.121 3.665   1.00 0.00 ? 33  THR A C    2  
ATOM 2226  O O    . THR A 1 33  ? -8.411  -15.472 4.087   1.00 0.00 ? 33  THR A O    2  
ATOM 2227  C CB   . THR A 1 33  ? -9.069  -17.940 3.109   1.00 0.00 ? 33  THR A CB   2  
ATOM 2228  O OG1  . THR A 1 33  ? -9.098  -18.519 4.418   1.00 0.00 ? 33  THR A OG1  2  
ATOM 2229  C CG2  . THR A 1 33  ? -9.451  -18.989 2.076   1.00 0.00 ? 33  THR A CG2  2  
ATOM 2230  H H    . THR A 1 33  ? -6.281  -18.471 3.976   1.00 0.00 ? 33  THR A H    2  
ATOM 2231  H HA   . THR A 1 33  ? -7.624  -17.095 1.772   1.00 0.00 ? 33  THR A HA   2  
ATOM 2232  H HB   . THR A 1 33  ? -9.786  -17.133 3.065   1.00 0.00 ? 33  THR A HB   2  
ATOM 2233  H HG1  . THR A 1 33  ? -9.021  -17.826 5.077   1.00 0.00 ? 33  THR A HG1  2  
ATOM 2234  H HG21 . THR A 1 33  ? -9.073  -19.954 2.384   1.00 0.00 ? 33  THR A HG21 2  
ATOM 2235  H HG22 . THR A 1 33  ? -9.027  -18.724 1.119   1.00 0.00 ? 33  THR A HG22 2  
ATOM 2236  H HG23 . THR A 1 33  ? -10.526 -19.035 1.992   1.00 0.00 ? 33  THR A HG23 2  
ATOM 2237  N N    . THR A 1 34  ? -6.190  -15.788 3.911   1.00 0.00 ? 34  THR A N    2  
ATOM 2238  C CA   . THR A 1 34  ? -5.849  -14.617 4.710   1.00 0.00 ? 34  THR A CA   2  
ATOM 2239  C C    . THR A 1 34  ? -4.643  -13.889 4.130   1.00 0.00 ? 34  THR A C    2  
ATOM 2240  O O    . THR A 1 34  ? -3.553  -14.455 4.029   1.00 0.00 ? 34  THR A O    2  
ATOM 2241  C CB   . THR A 1 34  ? -5.550  -15.002 6.171   1.00 0.00 ? 34  THR A CB   2  
ATOM 2242  O OG1  . THR A 1 34  ? -6.087  -16.298 6.456   1.00 0.00 ? 34  THR A OG1  2  
ATOM 2243  C CG2  . THR A 1 34  ? -6.140  -13.981 7.131   1.00 0.00 ? 34  THR A CG2  2  
ATOM 2244  H H    . THR A 1 34  ? -5.471  -16.346 3.548   1.00 0.00 ? 34  THR A H    2  
ATOM 2245  H HA   . THR A 1 34  ? -6.699  -13.950 4.701   1.00 0.00 ? 34  THR A HA   2  
ATOM 2246  H HB   . THR A 1 34  ? -4.479  -15.027 6.308   1.00 0.00 ? 34  THR A HB   2  
ATOM 2247  H HG1  . THR A 1 34  ? -5.730  -16.617 7.289   1.00 0.00 ? 34  THR A HG1  2  
ATOM 2248  H HG21 . THR A 1 34  ? -5.396  -13.231 7.361   1.00 0.00 ? 34  THR A HG21 2  
ATOM 2249  H HG22 . THR A 1 34  ? -6.446  -14.475 8.041   1.00 0.00 ? 34  THR A HG22 2  
ATOM 2250  H HG23 . THR A 1 34  ? -6.996  -13.508 6.672   1.00 0.00 ? 34  THR A HG23 2  
ATOM 2251  N N    . ILE A 1 35  ? -4.842  -12.632 3.752   1.00 0.00 ? 35  ILE A N    2  
ATOM 2252  C CA   . ILE A 1 35  ? -3.769  -11.825 3.184   1.00 0.00 ? 35  ILE A CA   2  
ATOM 2253  C C    . ILE A 1 35  ? -3.414  -10.659 4.101   1.00 0.00 ? 35  ILE A C    2  
ATOM 2254  O O    . ILE A 1 35  ? -4.004  -10.492 5.169   1.00 0.00 ? 35  ILE A O    2  
ATOM 2255  C CB   . ILE A 1 35  ? -4.152  -11.274 1.797   1.00 0.00 ? 35  ILE A CB   2  
ATOM 2256  C CG1  . ILE A 1 35  ? -5.362  -10.346 1.908   1.00 0.00 ? 35  ILE A CG1  2  
ATOM 2257  C CG2  . ILE A 1 35  ? -4.440  -12.418 0.835   1.00 0.00 ? 35  ILE A CG2  2  
ATOM 2258  C CD1  . ILE A 1 35  ? -5.682  -9.614  0.623   1.00 0.00 ? 35  ILE A CD1  2  
ATOM 2259  H H    . ILE A 1 35  ? -5.733  -12.236 3.857   1.00 0.00 ? 35  ILE A H    2  
ATOM 2260  H HA   . ILE A 1 35  ? -2.900  -12.457 3.071   1.00 0.00 ? 35  ILE A HA   2  
ATOM 2261  H HB   . ILE A 1 35  ? -3.313  -10.716 1.412   1.00 0.00 ? 35  ILE A HB   2  
ATOM 2262  H HG12 . ILE A 1 35  ? -6.228  -10.927 2.182   1.00 0.00 ? 35  ILE A HG12 2  
ATOM 2263  H HG13 . ILE A 1 35  ? -5.171  -9.608  2.674   1.00 0.00 ? 35  ILE A HG13 2  
ATOM 2264  H HG21 . ILE A 1 35  ? -5.240  -12.133 0.168   1.00 0.00 ? 35  ILE A HG21 2  
ATOM 2265  H HG22 . ILE A 1 35  ? -3.554  -12.637 0.260   1.00 0.00 ? 35  ILE A HG22 2  
ATOM 2266  H HG23 . ILE A 1 35  ? -4.733  -13.294 1.394   1.00 0.00 ? 35  ILE A HG23 2  
ATOM 2267  H HD11 . ILE A 1 35  ? -6.675  -9.881  0.294   1.00 0.00 ? 35  ILE A HD11 2  
ATOM 2268  H HD12 . ILE A 1 35  ? -5.633  -8.549  0.794   1.00 0.00 ? 35  ILE A HD12 2  
ATOM 2269  H HD13 . ILE A 1 35  ? -4.964  -9.889  -0.136  1.00 0.00 ? 35  ILE A HD13 2  
ATOM 2270  N N    . LEU A 1 36  ? -2.447  -9.854  3.675   1.00 0.00 ? 36  LEU A N    2  
ATOM 2271  C CA   . LEU A 1 36  ? -2.013  -8.700  4.457   1.00 0.00 ? 36  LEU A CA   2  
ATOM 2272  C C    . LEU A 1 36  ? -1.435  -7.616  3.552   1.00 0.00 ? 36  LEU A C    2  
ATOM 2273  O O    . LEU A 1 36  ? -0.476  -7.854  2.816   1.00 0.00 ? 36  LEU A O    2  
ATOM 2274  C CB   . LEU A 1 36  ? -0.972  -9.125  5.494   1.00 0.00 ? 36  LEU A CB   2  
ATOM 2275  C CG   . LEU A 1 36  ? -0.118  -8.003  6.085   1.00 0.00 ? 36  LEU A CG   2  
ATOM 2276  C CD1  . LEU A 1 36  ? -1.000  -6.879  6.607   1.00 0.00 ? 36  LEU A CD1  2  
ATOM 2277  C CD2  . LEU A 1 36  ? 0.775   -8.541  7.194   1.00 0.00 ? 36  LEU A CD2  2  
ATOM 2278  H H    . LEU A 1 36  ? -2.014  -10.037 2.816   1.00 0.00 ? 36  LEU A H    2  
ATOM 2279  H HA   . LEU A 1 36  ? -2.877  -8.302  4.968   1.00 0.00 ? 36  LEU A HA   2  
ATOM 2280  H HB2  . LEU A 1 36  ? -1.491  -9.607  6.306   1.00 0.00 ? 36  LEU A HB2  2  
ATOM 2281  H HB3  . LEU A 1 36  ? -0.306  -9.835  5.022   1.00 0.00 ? 36  LEU A HB3  2  
ATOM 2282  H HG   . LEU A 1 36  ? 0.517   -7.595  5.311   1.00 0.00 ? 36  LEU A HG   2  
ATOM 2283  H HD11 . LEU A 1 36  ? -2.034  -7.186  6.567   1.00 0.00 ? 36  LEU A HD11 2  
ATOM 2284  H HD12 . LEU A 1 36  ? -0.861  -6.000  5.997   1.00 0.00 ? 36  LEU A HD12 2  
ATOM 2285  H HD13 . LEU A 1 36  ? -0.730  -6.655  7.629   1.00 0.00 ? 36  LEU A HD13 2  
ATOM 2286  H HD21 . LEU A 1 36  ? 1.368   -9.361  6.813   1.00 0.00 ? 36  LEU A HD21 2  
ATOM 2287  H HD22 . LEU A 1 36  ? 0.163   -8.889  8.012   1.00 0.00 ? 36  LEU A HD22 2  
ATOM 2288  H HD23 . LEU A 1 36  ? 1.429   -7.754  7.542   1.00 0.00 ? 36  LEU A HD23 2  
ATOM 2289  N N    . VAL A 1 37  ? -2.022  -6.426  3.615   1.00 0.00 ? 37  VAL A N    2  
ATOM 2290  C CA   . VAL A 1 37  ? -1.562  -5.304  2.806   1.00 0.00 ? 37  VAL A CA   2  
ATOM 2291  C C    . VAL A 1 37  ? -0.923  -4.224  3.672   1.00 0.00 ? 37  VAL A C    2  
ATOM 2292  O O    . VAL A 1 37  ? -1.575  -3.645  4.540   1.00 0.00 ? 37  VAL A O    2  
ATOM 2293  C CB   . VAL A 1 37  ? -2.720  -4.680  2.002   1.00 0.00 ? 37  VAL A CB   2  
ATOM 2294  C CG1  . VAL A 1 37  ? -2.192  -3.644  1.022   1.00 0.00 ? 37  VAL A CG1  2  
ATOM 2295  C CG2  . VAL A 1 37  ? -3.503  -5.762  1.273   1.00 0.00 ? 37  VAL A CG2  2  
ATOM 2296  H H    . VAL A 1 37  ? -2.780  -6.298  4.222   1.00 0.00 ? 37  VAL A H    2  
ATOM 2297  H HA   . VAL A 1 37  ? -0.826  -5.675  2.108   1.00 0.00 ? 37  VAL A HA   2  
ATOM 2298  H HB   . VAL A 1 37  ? -3.386  -4.187  2.693   1.00 0.00 ? 37  VAL A HB   2  
ATOM 2299  H HG11 . VAL A 1 37  ? -2.913  -2.846  0.921   1.00 0.00 ? 37  VAL A HG11 2  
ATOM 2300  H HG12 . VAL A 1 37  ? -1.259  -3.243  1.389   1.00 0.00 ? 37  VAL A HG12 2  
ATOM 2301  H HG13 . VAL A 1 37  ? -2.032  -4.106  0.059   1.00 0.00 ? 37  VAL A HG13 2  
ATOM 2302  H HG21 . VAL A 1 37  ? -4.000  -6.393  1.996   1.00 0.00 ? 37  VAL A HG21 2  
ATOM 2303  H HG22 . VAL A 1 37  ? -4.241  -5.303  0.631   1.00 0.00 ? 37  VAL A HG22 2  
ATOM 2304  H HG23 . VAL A 1 37  ? -2.828  -6.358  0.677   1.00 0.00 ? 37  VAL A HG23 2  
ATOM 2305  N N    . GLN A 1 38  ? 0.357   -3.961  3.430   1.00 0.00 ? 38  GLN A N    2  
ATOM 2306  C CA   . GLN A 1 38  ? 1.085   -2.950  4.189   1.00 0.00 ? 38  GLN A CA   2  
ATOM 2307  C C    . GLN A 1 38  ? 1.718   -1.921  3.260   1.00 0.00 ? 38  GLN A C    2  
ATOM 2308  O O    . GLN A 1 38  ? 2.196   -2.260  2.177   1.00 0.00 ? 38  GLN A O    2  
ATOM 2309  C CB   . GLN A 1 38  ? 2.164   -3.609  5.052   1.00 0.00 ? 38  GLN A CB   2  
ATOM 2310  C CG   . GLN A 1 38  ? 3.122   -4.486  4.261   1.00 0.00 ? 38  GLN A CG   2  
ATOM 2311  C CD   . GLN A 1 38  ? 4.484   -4.599  4.915   1.00 0.00 ? 38  GLN A CD   2  
ATOM 2312  O OE1  . GLN A 1 38  ? 5.515   -4.490  4.251   1.00 0.00 ? 38  GLN A OE1  2  
ATOM 2313  N NE2  . GLN A 1 38  ? 4.497   -4.817  6.225   1.00 0.00 ? 38  GLN A NE2  2  
ATOM 2314  H H    . GLN A 1 38  ? 0.822   -4.457  2.726   1.00 0.00 ? 38  GLN A H    2  
ATOM 2315  H HA   . GLN A 1 38  ? 0.379   -2.448  4.834   1.00 0.00 ? 38  GLN A HA   2  
ATOM 2316  H HB2  . GLN A 1 38  ? 2.738   -2.837  5.541   1.00 0.00 ? 38  GLN A HB2  2  
ATOM 2317  H HB3  . GLN A 1 38  ? 1.684   -4.222  5.801   1.00 0.00 ? 38  GLN A HB3  2  
ATOM 2318  H HG2  . GLN A 1 38  ? 2.697   -5.476  4.179   1.00 0.00 ? 38  GLN A HG2  2  
ATOM 2319  H HG3  . GLN A 1 38  ? 3.244   -4.065  3.274   1.00 0.00 ? 38  GLN A HG3  2  
ATOM 2320  H HE21 . GLN A 1 38  ? 3.637   -4.893  6.689   1.00 0.00 ? 38  GLN A HE21 2  
ATOM 2321  H HE22 . GLN A 1 38  ? 5.364   -4.894  6.672   1.00 0.00 ? 38  GLN A HE22 2  
ATOM 2322  N N    . TRP A 1 39  ? 1.718   -0.664  3.688   1.00 0.00 ? 39  TRP A N    2  
ATOM 2323  C CA   . TRP A 1 39  ? 2.292   0.415   2.894   1.00 0.00 ? 39  TRP A CA   2  
ATOM 2324  C C    . TRP A 1 39  ? 2.741   1.568   3.783   1.00 0.00 ? 39  TRP A C    2  
ATOM 2325  O O    . TRP A 1 39  ? 2.474   1.577   4.987   1.00 0.00 ? 39  TRP A O    2  
ATOM 2326  C CB   . TRP A 1 39  ? 1.277   0.913   1.864   1.00 0.00 ? 39  TRP A CB   2  
ATOM 2327  C CG   . TRP A 1 39  ? 0.055   1.522   2.481   1.00 0.00 ? 39  TRP A CG   2  
ATOM 2328  C CD1  . TRP A 1 39  ? -0.078  2.797   2.951   1.00 0.00 ? 39  TRP A CD1  2  
ATOM 2329  C CD2  . TRP A 1 39  ? -1.205  0.878   2.697   1.00 0.00 ? 39  TRP A CD2  2  
ATOM 2330  N NE1  . TRP A 1 39  ? -1.346  2.985   3.447   1.00 0.00 ? 39  TRP A NE1  2  
ATOM 2331  C CE2  . TRP A 1 39  ? -2.058  1.824   3.302   1.00 0.00 ? 39  TRP A CE2  2  
ATOM 2332  C CE3  . TRP A 1 39  ? -1.700  -0.403  2.438   1.00 0.00 ? 39  TRP A CE3  2  
ATOM 2333  C CZ2  . TRP A 1 39  ? -3.373  1.526   3.650   1.00 0.00 ? 39  TRP A CZ2  2  
ATOM 2334  C CZ3  . TRP A 1 39  ? -3.004  -0.698  2.785   1.00 0.00 ? 39  TRP A CZ3  2  
ATOM 2335  C CH2  . TRP A 1 39  ? -3.829  0.263   3.386   1.00 0.00 ? 39  TRP A CH2  2  
ATOM 2336  H H    . TRP A 1 39  ? 1.322   -0.456  4.561   1.00 0.00 ? 39  TRP A H    2  
ATOM 2337  H HA   . TRP A 1 39  ? 3.155   0.020   2.375   1.00 0.00 ? 39  TRP A HA   2  
ATOM 2338  H HB2  . TRP A 1 39  ? 1.744   1.662   1.241   1.00 0.00 ? 39  TRP A HB2  2  
ATOM 2339  H HB3  . TRP A 1 39  ? 0.963   0.083   1.248   1.00 0.00 ? 39  TRP A HB3  2  
ATOM 2340  H HD1  . TRP A 1 39  ? 0.707   3.537   2.931   1.00 0.00 ? 39  TRP A HD1  2  
ATOM 2341  H HE1  . TRP A 1 39  ? -1.686  3.817   3.838   1.00 0.00 ? 39  TRP A HE1  2  
ATOM 2342  H HE3  . TRP A 1 39  ? -1.079  -1.157  1.976   1.00 0.00 ? 39  TRP A HE3  2  
ATOM 2343  H HZ2  . TRP A 1 39  ? -4.021  2.255   4.113   1.00 0.00 ? 39  TRP A HZ2  2  
ATOM 2344  H HZ3  . TRP A 1 39  ? -3.402  -1.684  2.592   1.00 0.00 ? 39  TRP A HZ3  2  
ATOM 2345  H HH2  . TRP A 1 39  ? -4.841  -0.012  3.639   1.00 0.00 ? 39  TRP A HH2  2  
ATOM 2346  N N    . LYS A 1 40  ? 3.423   2.540   3.188   1.00 0.00 ? 40  LYS A N    2  
ATOM 2347  C CA   . LYS A 1 40  ? 3.905   3.700   3.926   1.00 0.00 ? 40  LYS A CA   2  
ATOM 2348  C C    . LYS A 1 40  ? 3.190   4.970   3.476   1.00 0.00 ? 40  LYS A C    2  
ATOM 2349  O O    . LYS A 1 40  ? 2.457   4.961   2.487   1.00 0.00 ? 40  LYS A O    2  
ATOM 2350  C CB   . LYS A 1 40  ? 5.417   3.859   3.734   1.00 0.00 ? 40  LYS A CB   2  
ATOM 2351  C CG   . LYS A 1 40  ? 6.242   3.056   4.725   1.00 0.00 ? 40  LYS A CG   2  
ATOM 2352  C CD   . LYS A 1 40  ? 7.688   2.935   4.276   1.00 0.00 ? 40  LYS A CD   2  
ATOM 2353  C CE   . LYS A 1 40  ? 8.646   3.475   5.326   1.00 0.00 ? 40  LYS A CE   2  
ATOM 2354  N NZ   . LYS A 1 40  ? 10.054  3.483   4.841   1.00 0.00 ? 40  LYS A NZ   2  
ATOM 2355  H H    . LYS A 1 40  ? 3.603   2.477   2.226   1.00 0.00 ? 40  LYS A H    2  
ATOM 2356  H HA   . LYS A 1 40  ? 3.700   3.538   4.973   1.00 0.00 ? 40  LYS A HA   2  
ATOM 2357  H HB2  . LYS A 1 40  ? 5.676   3.537   2.738   1.00 0.00 ? 40  LYS A HB2  2  
ATOM 2358  H HB3  . LYS A 1 40  ? 5.674   4.903   3.845   1.00 0.00 ? 40  LYS A HB3  2  
ATOM 2359  H HG2  . LYS A 1 40  ? 6.216   3.552   5.685   1.00 0.00 ? 40  LYS A HG2  2  
ATOM 2360  H HG3  . LYS A 1 40  ? 5.818   2.067   4.816   1.00 0.00 ? 40  LYS A HG3  2  
ATOM 2361  H HD2  . LYS A 1 40  ? 7.915   1.894   4.100   1.00 0.00 ? 40  LYS A HD2  2  
ATOM 2362  H HD3  . LYS A 1 40  ? 7.819   3.494   3.360   1.00 0.00 ? 40  LYS A HD3  2  
ATOM 2363  H HE2  . LYS A 1 40  ? 8.355   4.484   5.575   1.00 0.00 ? 40  LYS A HE2  2  
ATOM 2364  H HE3  . LYS A 1 40  ? 8.582   2.854   6.208   1.00 0.00 ? 40  LYS A HE3  2  
ATOM 2365  H HZ1  . LYS A 1 40  ? 10.084  3.750   3.836   1.00 0.00 ? 40  LYS A HZ1  2  
ATOM 2366  H HZ2  . LYS A 1 40  ? 10.475  2.540   4.950   1.00 0.00 ? 40  LYS A HZ2  2  
ATOM 2367  H HZ3  . LYS A 1 40  ? 10.617  4.167   5.387   1.00 0.00 ? 40  LYS A HZ3  2  
ATOM 2368  N N    . GLU A 1 41  ? 3.409   6.059   4.206   1.00 0.00 ? 41  GLU A N    2  
ATOM 2369  C CA   . GLU A 1 41  ? 2.785   7.335   3.879   1.00 0.00 ? 41  GLU A CA   2  
ATOM 2370  C C    . GLU A 1 41  ? 3.338   7.893   2.571   1.00 0.00 ? 41  GLU A C    2  
ATOM 2371  O O    . GLU A 1 41  ? 4.419   7.517   2.114   1.00 0.00 ? 41  GLU A O    2  
ATOM 2372  C CB   . GLU A 1 41  ? 3.009   8.341   5.010   1.00 0.00 ? 41  GLU A CB   2  
ATOM 2373  C CG   . GLU A 1 41  ? 1.833   8.456   5.965   1.00 0.00 ? 41  GLU A CG   2  
ATOM 2374  C CD   . GLU A 1 41  ? 2.249   8.907   7.352   1.00 0.00 ? 41  GLU A CD   2  
ATOM 2375  O OE1  . GLU A 1 41  ? 3.085   9.829   7.450   1.00 0.00 ? 41  GLU A OE1  2  
ATOM 2376  O OE2  . GLU A 1 41  ? 1.736   8.339   8.339   1.00 0.00 ? 41  GLU A OE2  2  
ATOM 2377  H H    . GLU A 1 41  ? 4.006   6.002   4.981   1.00 0.00 ? 41  GLU A H    2  
ATOM 2378  H HA   . GLU A 1 41  ? 1.726   7.166   3.764   1.00 0.00 ? 41  GLU A HA   2  
ATOM 2379  H HB2  . GLU A 1 41  ? 3.878   8.043   5.576   1.00 0.00 ? 41  GLU A HB2  2  
ATOM 2380  H HB3  . GLU A 1 41  ? 3.190   9.315   4.578   1.00 0.00 ? 41  GLU A HB3  2  
ATOM 2381  H HG2  . GLU A 1 41  ? 1.128   9.171   5.567   1.00 0.00 ? 41  GLU A HG2  2  
ATOM 2382  H HG3  . GLU A 1 41  ? 1.355   7.490   6.045   1.00 0.00 ? 41  GLU A HG3  2  
ATOM 2383  N N    . PRO A 1 42  ? 2.582   8.812   1.952   1.00 0.00 ? 42  PRO A N    2  
ATOM 2384  C CA   . PRO A 1 42  ? 2.975   9.441   0.689   1.00 0.00 ? 42  PRO A CA   2  
ATOM 2385  C C    . PRO A 1 42  ? 4.159   10.387  0.855   1.00 0.00 ? 42  PRO A C    2  
ATOM 2386  O O    . PRO A 1 42  ? 4.589   10.665  1.974   1.00 0.00 ? 42  PRO A O    2  
ATOM 2387  C CB   . PRO A 1 42  ? 1.723   10.218  0.275   1.00 0.00 ? 42  PRO A CB   2  
ATOM 2388  C CG   . PRO A 1 42  ? 1.006   10.488  1.552   1.00 0.00 ? 42  PRO A CG   2  
ATOM 2389  C CD   . PRO A 1 42  ? 1.283   9.308   2.440   1.00 0.00 ? 42  PRO A CD   2  
ATOM 2390  H HA   . PRO A 1 42  ? 3.209   8.704   -0.066  1.00 0.00 ? 42  PRO A HA   2  
ATOM 2391  H HB2  . PRO A 1 42  ? 2.013   11.136  -0.217  1.00 0.00 ? 42  PRO A HB2  2  
ATOM 2392  H HB3  . PRO A 1 42  ? 1.127   9.619   -0.394  1.00 0.00 ? 42  PRO A HB3  2  
ATOM 2393  H HG2  . PRO A 1 42  ? 1.383   11.393  2.002   1.00 0.00 ? 42  PRO A HG2  2  
ATOM 2394  H HG3  . PRO A 1 42  ? -0.055  10.575  1.365   1.00 0.00 ? 42  PRO A HG3  2  
ATOM 2395  H HD2  . PRO A 1 42  ? 1.352   9.618   3.472   1.00 0.00 ? 42  PRO A HD2  2  
ATOM 2396  H HD3  . PRO A 1 42  ? 0.516   8.556   2.321   1.00 0.00 ? 42  PRO A HD3  2  
ATOM 2397  N N    . GLU A 1 43  ? 4.680   10.879  -0.264  1.00 0.00 ? 43  GLU A N    2  
ATOM 2398  C CA   . GLU A 1 43  ? 5.816   11.794  -0.240  1.00 0.00 ? 43  GLU A CA   2  
ATOM 2399  C C    . GLU A 1 43  ? 5.344   13.244  -0.188  1.00 0.00 ? 43  GLU A C    2  
ATOM 2400  O O    . GLU A 1 43  ? 6.059   14.123  0.293   1.00 0.00 ? 43  GLU A O    2  
ATOM 2401  C CB   . GLU A 1 43  ? 6.700   11.577  -1.469  1.00 0.00 ? 43  GLU A CB   2  
ATOM 2402  C CG   . GLU A 1 43  ? 8.144   11.244  -1.130  1.00 0.00 ? 43  GLU A CG   2  
ATOM 2403  C CD   . GLU A 1 43  ? 9.118   11.732  -2.183  1.00 0.00 ? 43  GLU A CD   2  
ATOM 2404  O OE1  . GLU A 1 43  ? 9.139   11.149  -3.287  1.00 0.00 ? 43  GLU A OE1  2  
ATOM 2405  O OE2  . GLU A 1 43  ? 9.860   12.696  -1.903  1.00 0.00 ? 43  GLU A OE2  2  
ATOM 2406  H H    . GLU A 1 43  ? 4.294   10.620  -1.126  1.00 0.00 ? 43  GLU A H    2  
ATOM 2407  H HA   . GLU A 1 43  ? 6.392   11.583  0.649   1.00 0.00 ? 43  GLU A HA   2  
ATOM 2408  H HB2  . GLU A 1 43  ? 6.293   10.766  -2.053  1.00 0.00 ? 43  GLU A HB2  2  
ATOM 2409  H HB3  . GLU A 1 43  ? 6.692   12.476  -2.066  1.00 0.00 ? 43  GLU A HB3  2  
ATOM 2410  H HG2  . GLU A 1 43  ? 8.395   11.707  -0.187  1.00 0.00 ? 43  GLU A HG2  2  
ATOM 2411  H HG3  . GLU A 1 43  ? 8.241   10.172  -1.040  1.00 0.00 ? 43  GLU A HG3  2  
ATOM 2412  N N    . GLU A 1 44  ? 4.137   13.486  -0.687  1.00 0.00 ? 44  GLU A N    2  
ATOM 2413  C CA   . GLU A 1 44  ? 3.569   14.829  -0.699  1.00 0.00 ? 44  GLU A CA   2  
ATOM 2414  C C    . GLU A 1 44  ? 2.193   14.846  -0.043  1.00 0.00 ? 44  GLU A C    2  
ATOM 2415  O O    . GLU A 1 44  ? 1.162   14.954  -0.707  1.00 0.00 ? 44  GLU A O    2  
ATOM 2416  C CB   . GLU A 1 44  ? 3.470   15.352  -2.134  1.00 0.00 ? 44  GLU A CB   2  
ATOM 2417  C CG   . GLU A 1 44  ? 3.537   16.866  -2.237  1.00 0.00 ? 44  GLU A CG   2  
ATOM 2418  C CD   . GLU A 1 44  ? 4.924   17.365  -2.593  1.00 0.00 ? 44  GLU A CD   2  
ATOM 2419  O OE1  . GLU A 1 44  ? 5.910   16.798  -2.078  1.00 0.00 ? 44  GLU A OE1  2  
ATOM 2420  O OE2  . GLU A 1 44  ? 5.022   18.325  -3.387  1.00 0.00 ? 44  GLU A OE2  2  
ATOM 2421  H H    . GLU A 1 44  ? 3.614   12.744  -1.057  1.00 0.00 ? 44  GLU A H    2  
ATOM 2422  H HA   . GLU A 1 44  ? 4.230   15.473  -0.138  1.00 0.00 ? 44  GLU A HA   2  
ATOM 2423  H HB2  . GLU A 1 44  ? 4.279   14.936  -2.713  1.00 0.00 ? 44  GLU A HB2  2  
ATOM 2424  H HB3  . GLU A 1 44  ? 2.531   15.026  -2.557  1.00 0.00 ? 44  GLU A HB3  2  
ATOM 2425  H HG2  . GLU A 1 44  ? 2.846   17.194  -2.998  1.00 0.00 ? 44  GLU A HG2  2  
ATOM 2426  H HG3  . GLU A 1 44  ? 3.251   17.292  -1.286  1.00 0.00 ? 44  GLU A HG3  2  
ATOM 2427  N N    . PRO A 1 45  ? 2.173   14.734  1.293   1.00 0.00 ? 45  PRO A N    2  
ATOM 2428  C CA   . PRO A 1 45  ? 0.930   14.733  2.070   1.00 0.00 ? 45  PRO A CA   2  
ATOM 2429  C C    . PRO A 1 45  ? 0.157   16.040  1.929   1.00 0.00 ? 45  PRO A C    2  
ATOM 2430  O O    . PRO A 1 45  ? -1.027  16.040  1.596   1.00 0.00 ? 45  PRO A O    2  
ATOM 2431  C CB   . PRO A 1 45  ? 1.411   14.550  3.512   1.00 0.00 ? 45  PRO A CB   2  
ATOM 2432  C CG   . PRO A 1 45  ? 2.842   14.967  3.489   1.00 0.00 ? 45  PRO A CG   2  
ATOM 2433  C CD   . PRO A 1 45  ? 3.364   14.602  2.150   1.00 0.00 ? 45  PRO A CD   2  
ATOM 2434  H HA   . PRO A 1 45  ? 0.291   13.907  1.795   1.00 0.00 ? 45  PRO A HA   2  
ATOM 2435  H HB2  . PRO A 1 45  ? 0.828   15.176  4.171   1.00 0.00 ? 45  PRO A HB2  2  
ATOM 2436  H HB3  . PRO A 1 45  ? 1.306   13.516  3.802   1.00 0.00 ? 45  PRO A HB3  2  
ATOM 2437  H HG2  . PRO A 1 45  ? 2.918   16.028  3.668   1.00 0.00 ? 45  PRO A HG2  2  
ATOM 2438  H HG3  . PRO A 1 45  ? 3.396   14.418  4.237   1.00 0.00 ? 45  PRO A HG3  2  
ATOM 2439  H HD2  . PRO A 1 45  ? 4.104   15.349  1.901   1.00 0.00 ? 45  PRO A HD2  2  
ATOM 2440  H HD3  . PRO A 1 45  ? 3.785   13.611  2.073   1.00 0.00 ? 45  PRO A HD3  2  
ATOM 2441  N N    . ASN A 1 46  ? 0.836   17.154  2.185   1.00 0.00 ? 46  ASN A N    2  
ATOM 2442  C CA   . ASN A 1 46  ? 0.212   18.469  2.086   1.00 0.00 ? 46  ASN A CA   2  
ATOM 2443  C C    . ASN A 1 46  ? -0.912  18.615  3.106   1.00 0.00 ? 46  ASN A C    2  
ATOM 2444  O O    . ASN A 1 46  ? -1.844  19.395  2.911   1.00 0.00 ? 46  ASN A O    2  
ATOM 2445  C CB   . ASN A 1 46  ? -0.332  18.693  0.674   1.00 0.00 ? 46  ASN A CB   2  
ATOM 2446  C CG   . ASN A 1 46  ? 0.681   18.347  -0.399  1.00 0.00 ? 46  ASN A CG   2  
ATOM 2447  O OD1  . ASN A 1 46  ? 1.807   18.849  -0.391  1.00 0.00 ? 46  ASN A OD1  2  
ATOM 2448  N ND2  . ASN A 1 46  ? 0.289   17.484  -1.330  1.00 0.00 ? 46  ASN A ND2  2  
ATOM 2449  H H    . ASN A 1 46  ? 1.777   17.092  2.445   1.00 0.00 ? 46  ASN A H    2  
ATOM 2450  H HA   . ASN A 1 46  ? 0.969   19.212  2.293   1.00 0.00 ? 46  ASN A HA   2  
ATOM 2451  H HB2  . ASN A 1 46  ? -1.206  18.074  0.529   1.00 0.00 ? 46  ASN A HB2  2  
ATOM 2452  H HB3  . ASN A 1 46  ? -0.609  19.730  0.561   1.00 0.00 ? 46  ASN A HB3  2  
ATOM 2453  H HD21 . ASN A 1 46  ? -0.622  17.126  -1.272  1.00 0.00 ? 46  ASN A HD21 2  
ATOM 2454  H HD22 . ASN A 1 46  ? 0.924   17.243  -2.035  1.00 0.00 ? 46  ASN A HD22 2  
ATOM 2455  N N    . GLY A 1 47  ? -0.818  17.861  4.197   1.00 0.00 ? 47  GLY A N    2  
ATOM 2456  C CA   . GLY A 1 47  ? -1.833  17.921  5.232   1.00 0.00 ? 47  GLY A CA   2  
ATOM 2457  C C    . GLY A 1 47  ? -1.822  16.699  6.127   1.00 0.00 ? 47  GLY A C    2  
ATOM 2458  O O    . GLY A 1 47  ? -1.184  15.695  5.809   1.00 0.00 ? 47  GLY A O    2  
ATOM 2459  H H    . GLY A 1 47  ? -0.052  17.257  4.299   1.00 0.00 ? 47  GLY A H    2  
ATOM 2460  H HA2  . GLY A 1 47  ? -1.663  18.799  5.837   1.00 0.00 ? 47  GLY A HA2  2  
ATOM 2461  H HA3  . GLY A 1 47  ? -2.803  18.002  4.763   1.00 0.00 ? 47  GLY A HA3  2  
ATOM 2462  N N    . GLN A 1 48  ? -2.528  16.782  7.250   1.00 0.00 ? 48  GLN A N    2  
ATOM 2463  C CA   . GLN A 1 48  ? -2.594  15.674  8.195   1.00 0.00 ? 48  GLN A CA   2  
ATOM 2464  C C    . GLN A 1 48  ? -3.476  14.552  7.656   1.00 0.00 ? 48  GLN A C    2  
ATOM 2465  O O    . GLN A 1 48  ? -4.700  14.683  7.601   1.00 0.00 ? 48  GLN A O    2  
ATOM 2466  C CB   . GLN A 1 48  ? -3.130  16.156  9.543   1.00 0.00 ? 48  GLN A CB   2  
ATOM 2467  C CG   . GLN A 1 48  ? -2.086  16.152  10.650  1.00 0.00 ? 48  GLN A CG   2  
ATOM 2468  C CD   . GLN A 1 48  ? -2.377  17.173  11.730  1.00 0.00 ? 48  GLN A CD   2  
ATOM 2469  O OE1  . GLN A 1 48  ? -3.352  17.050  12.472  1.00 0.00 ? 48  GLN A OE1  2  
ATOM 2470  N NE2  . GLN A 1 48  ? -1.529  18.191  11.826  1.00 0.00 ? 48  GLN A NE2  2  
ATOM 2471  H H    . GLN A 1 48  ? -3.015  17.608  7.447   1.00 0.00 ? 48  GLN A H    2  
ATOM 2472  H HA   . GLN A 1 48  ? -1.593  15.293  8.330   1.00 0.00 ? 48  GLN A HA   2  
ATOM 2473  H HB2  . GLN A 1 48  ? -3.499  17.165  9.430   1.00 0.00 ? 48  GLN A HB2  2  
ATOM 2474  H HB3  . GLN A 1 48  ? -3.945  15.514  9.844   1.00 0.00 ? 48  GLN A HB3  2  
ATOM 2475  H HG2  . GLN A 1 48  ? -2.064  15.170  11.101  1.00 0.00 ? 48  GLN A HG2  2  
ATOM 2476  H HG3  . GLN A 1 48  ? -1.121  16.370  10.217  1.00 0.00 ? 48  GLN A HG3  2  
ATOM 2477  H HE21 . GLN A 1 48  ? -0.775  18.224  11.201  1.00 0.00 ? 48  GLN A HE21 2  
ATOM 2478  H HE22 . GLN A 1 48  ? -1.693  18.867  12.516  1.00 0.00 ? 48  GLN A HE22 2  
ATOM 2479  N N    . ILE A 1 49  ? -2.849  13.450  7.261   1.00 0.00 ? 49  ILE A N    2  
ATOM 2480  C CA   . ILE A 1 49  ? -3.577  12.305  6.728   1.00 0.00 ? 49  ILE A CA   2  
ATOM 2481  C C    . ILE A 1 49  ? -4.642  11.826  7.709   1.00 0.00 ? 49  ILE A C    2  
ATOM 2482  O O    . ILE A 1 49  ? -4.385  11.697  8.905   1.00 0.00 ? 49  ILE A O    2  
ATOM 2483  C CB   . ILE A 1 49  ? -2.629  11.135  6.405   1.00 0.00 ? 49  ILE A CB   2  
ATOM 2484  C CG1  . ILE A 1 49  ? -1.538  11.587  5.433   1.00 0.00 ? 49  ILE A CG1  2  
ATOM 2485  C CG2  . ILE A 1 49  ? -3.411  9.965   5.826   1.00 0.00 ? 49  ILE A CG2  2  
ATOM 2486  C CD1  . ILE A 1 49  ? -2.068  12.000  4.078   1.00 0.00 ? 49  ILE A CD1  2  
ATOM 2487  H H    . ILE A 1 49  ? -1.873  13.405  7.330   1.00 0.00 ? 49  ILE A H    2  
ATOM 2488  H HA   . ILE A 1 49  ? -4.060  12.615  5.812   1.00 0.00 ? 49  ILE A HA   2  
ATOM 2489  H HB   . ILE A 1 49  ? -2.169  10.809  7.326   1.00 0.00 ? 49  ILE A HB   2  
ATOM 2490  H HG12 . ILE A 1 49  ? -1.016  12.432  5.856   1.00 0.00 ? 49  ILE A HG12 2  
ATOM 2491  H HG13 . ILE A 1 49  ? -0.840  10.775  5.284   1.00 0.00 ? 49  ILE A HG13 2  
ATOM 2492  H HG21 . ILE A 1 49  ? -2.912  9.604   4.939   1.00 0.00 ? 49  ILE A HG21 2  
ATOM 2493  H HG22 . ILE A 1 49  ? -3.464  9.172   6.557   1.00 0.00 ? 49  ILE A HG22 2  
ATOM 2494  H HG23 . ILE A 1 49  ? -4.408  10.289  5.571   1.00 0.00 ? 49  ILE A HG23 2  
ATOM 2495  H HD11 . ILE A 1 49  ? -3.136  11.838  4.044   1.00 0.00 ? 49  ILE A HD11 2  
ATOM 2496  H HD12 . ILE A 1 49  ? -1.857  13.044  3.911   1.00 0.00 ? 49  ILE A HD12 2  
ATOM 2497  H HD13 . ILE A 1 49  ? -1.592  11.408  3.310   1.00 0.00 ? 49  ILE A HD13 2  
ATOM 2498  N N    . GLN A 1 50  ? -5.839  11.563  7.192   1.00 0.00 ? 50  GLN A N    2  
ATOM 2499  C CA   . GLN A 1 50  ? -6.943  11.097  8.023   1.00 0.00 ? 50  GLN A CA   2  
ATOM 2500  C C    . GLN A 1 50  ? -7.137  9.592   7.877   1.00 0.00 ? 50  GLN A C    2  
ATOM 2501  O O    . GLN A 1 50  ? -7.650  8.931   8.778   1.00 0.00 ? 50  GLN A O    2  
ATOM 2502  C CB   . GLN A 1 50  ? -8.233  11.828  7.649   1.00 0.00 ? 50  GLN A CB   2  
ATOM 2503  C CG   . GLN A 1 50  ? -8.127  13.341  7.750   1.00 0.00 ? 50  GLN A CG   2  
ATOM 2504  C CD   . GLN A 1 50  ? -8.045  13.827  9.183   1.00 0.00 ? 50  GLN A CD   2  
ATOM 2505  O OE1  . GLN A 1 50  ? -8.947  13.582  9.986   1.00 0.00 ? 50  GLN A OE1  2  
ATOM 2506  N NE2  . GLN A 1 50  ? -6.963  14.521  9.514   1.00 0.00 ? 50  GLN A NE2  2  
ATOM 2507  H H    . GLN A 1 50  ? -5.982  11.686  6.232   1.00 0.00 ? 50  GLN A H    2  
ATOM 2508  H HA   . GLN A 1 50  ? -6.700  11.318  9.052   1.00 0.00 ? 50  GLN A HA   2  
ATOM 2509  H HB2  . GLN A 1 50  ? -8.497  11.574  6.634   1.00 0.00 ? 50  GLN A HB2  2  
ATOM 2510  H HB3  . GLN A 1 50  ? -9.023  11.500  8.310   1.00 0.00 ? 50  GLN A HB3  2  
ATOM 2511  H HG2  . GLN A 1 50  ? -7.238  13.663  7.227   1.00 0.00 ? 50  GLN A HG2  2  
ATOM 2512  H HG3  . GLN A 1 50  ? -8.996  13.783  7.285   1.00 0.00 ? 50  GLN A HG3  2  
ATOM 2513  H HE21 . GLN A 1 50  ? -6.286  14.681  8.821   1.00 0.00 ? 50  GLN A HE21 2  
ATOM 2514  H HE22 . GLN A 1 50  ? -6.885  14.847  10.433  1.00 0.00 ? 50  GLN A HE22 2  
ATOM 2515  N N    . GLY A 1 51  ? -6.721  9.055   6.733   1.00 0.00 ? 51  GLY A N    2  
ATOM 2516  C CA   . GLY A 1 51  ? -6.859  7.631   6.489   1.00 0.00 ? 51  GLY A CA   2  
ATOM 2517  C C    . GLY A 1 51  ? -6.518  7.251   5.061   1.00 0.00 ? 51  GLY A C    2  
ATOM 2518  O O    . GLY A 1 51  ? -5.890  8.026   4.339   1.00 0.00 ? 51  GLY A O    2  
ATOM 2519  H H    . GLY A 1 51  ? -6.318  9.630   6.050   1.00 0.00 ? 51  GLY A H    2  
ATOM 2520  H HA2  . GLY A 1 51  ? -6.200  7.097   7.160   1.00 0.00 ? 51  GLY A HA2  2  
ATOM 2521  H HA3  . GLY A 1 51  ? -7.878  7.339   6.694   1.00 0.00 ? 51  GLY A HA3  2  
ATOM 2522  N N    . TYR A 1 52  ? -6.931  6.057   4.654   1.00 0.00 ? 52  TYR A N    2  
ATOM 2523  C CA   . TYR A 1 52  ? -6.663  5.574   3.304   1.00 0.00 ? 52  TYR A CA   2  
ATOM 2524  C C    . TYR A 1 52  ? -7.802  4.691   2.806   1.00 0.00 ? 52  TYR A C    2  
ATOM 2525  O O    . TYR A 1 52  ? -8.743  4.396   3.544   1.00 0.00 ? 52  TYR A O    2  
ATOM 2526  C CB   . TYR A 1 52  ? -5.347  4.797   3.271   1.00 0.00 ? 52  TYR A CB   2  
ATOM 2527  C CG   . TYR A 1 52  ? -4.200  5.517   3.944   1.00 0.00 ? 52  TYR A CG   2  
ATOM 2528  C CD1  . TYR A 1 52  ? -4.017  5.440   5.319   1.00 0.00 ? 52  TYR A CD1  2  
ATOM 2529  C CD2  . TYR A 1 52  ? -3.301  6.275   3.205   1.00 0.00 ? 52  TYR A CD2  2  
ATOM 2530  C CE1  . TYR A 1 52  ? -2.971  6.096   5.938   1.00 0.00 ? 52  TYR A CE1  2  
ATOM 2531  C CE2  . TYR A 1 52  ? -2.251  6.933   3.816   1.00 0.00 ? 52  TYR A CE2  2  
ATOM 2532  C CZ   . TYR A 1 52  ? -2.091  6.841   5.183   1.00 0.00 ? 52  TYR A CZ   2  
ATOM 2533  O OH   . TYR A 1 52  ? -1.047  7.497   5.794   1.00 0.00 ? 52  TYR A OH   2  
ATOM 2534  H H    . TYR A 1 52  ? -7.427  5.484   5.276   1.00 0.00 ? 52  TYR A H    2  
ATOM 2535  H HA   . TYR A 1 52  ? -6.579  6.434   2.655   1.00 0.00 ? 52  TYR A HA   2  
ATOM 2536  H HB2  . TYR A 1 52  ? -5.482  3.850   3.771   1.00 0.00 ? 52  TYR A HB2  2  
ATOM 2537  H HB3  . TYR A 1 52  ? -5.069  4.617   2.243   1.00 0.00 ? 52  TYR A HB3  2  
ATOM 2538  H HD1  . TYR A 1 52  ? -4.709  4.854   5.908   1.00 0.00 ? 52  TYR A HD1  2  
ATOM 2539  H HD2  . TYR A 1 52  ? -3.430  6.345   2.134   1.00 0.00 ? 52  TYR A HD2  2  
ATOM 2540  H HE1  . TYR A 1 52  ? -2.845  6.024   7.009   1.00 0.00 ? 52  TYR A HE1  2  
ATOM 2541  H HE2  . TYR A 1 52  ? -1.563  7.518   3.224   1.00 0.00 ? 52  TYR A HE2  2  
ATOM 2542  H HH   . TYR A 1 52  ? -1.112  8.438   5.615   1.00 0.00 ? 52  TYR A HH   2  
ATOM 2543  N N    . ARG A 1 53  ? -7.711  4.273   1.547   1.00 0.00 ? 53  ARG A N    2  
ATOM 2544  C CA   . ARG A 1 53  ? -8.733  3.423   0.948   1.00 0.00 ? 53  ARG A CA   2  
ATOM 2545  C C    . ARG A 1 53  ? -8.097  2.290   0.149   1.00 0.00 ? 53  ARG A C    2  
ATOM 2546  O O    . ARG A 1 53  ? -7.225  2.521   -0.690  1.00 0.00 ? 53  ARG A O    2  
ATOM 2547  C CB   . ARG A 1 53  ? -9.646  4.250   0.042   1.00 0.00 ? 53  ARG A CB   2  
ATOM 2548  C CG   . ARG A 1 53  ? -10.889 3.505   -0.413  1.00 0.00 ? 53  ARG A CG   2  
ATOM 2549  C CD   . ARG A 1 53  ? -11.959 4.460   -0.916  1.00 0.00 ? 53  ARG A CD   2  
ATOM 2550  N NE   . ARG A 1 53  ? -12.782 4.982   0.172   1.00 0.00 ? 53  ARG A NE   2  
ATOM 2551  C CZ   . ARG A 1 53  ? -13.743 4.286   0.766   1.00 0.00 ? 53  ARG A CZ   2  
ATOM 2552  N NH1  . ARG A 1 53  ? -14.001 3.043   0.381   1.00 0.00 ? 53  ARG A NH1  2  
ATOM 2553  N NH2  . ARG A 1 53  ? -14.448 4.830   1.750   1.00 0.00 ? 53  ARG A NH2  2  
ATOM 2554  H H    . ARG A 1 53  ? -6.937  4.542   1.009   1.00 0.00 ? 53  ARG A H    2  
ATOM 2555  H HA   . ARG A 1 53  ? -9.322  2.998   1.747   1.00 0.00 ? 53  ARG A HA   2  
ATOM 2556  H HB2  . ARG A 1 53  ? -9.961  5.135   0.578   1.00 0.00 ? 53  ARG A HB2  2  
ATOM 2557  H HB3  . ARG A 1 53  ? -9.090  4.549   -0.833  1.00 0.00 ? 53  ARG A HB3  2  
ATOM 2558  H HG2  . ARG A 1 53  ? -10.620 2.831   -1.213  1.00 0.00 ? 53  ARG A HG2  2  
ATOM 2559  H HG3  . ARG A 1 53  ? -11.284 2.941   0.419   1.00 0.00 ? 53  ARG A HG3  2  
ATOM 2560  H HD2  . ARG A 1 53  ? -11.480 5.287   -1.419  1.00 0.00 ? 53  ARG A HD2  2  
ATOM 2561  H HD3  . ARG A 1 53  ? -12.594 3.934   -1.614  1.00 0.00 ? 53  ARG A HD3  2  
ATOM 2562  H HE   . ARG A 1 53  ? -12.609 5.899   0.473   1.00 0.00 ? 53  ARG A HE   2  
ATOM 2563  H HH11 . ARG A 1 53  ? -13.471 2.630   -0.359  1.00 0.00 ? 53  ARG A HH11 2  
ATOM 2564  H HH12 . ARG A 1 53  ? -14.725 2.520   0.831   1.00 0.00 ? 53  ARG A HH12 2  
ATOM 2565  H HH21 . ARG A 1 53  ? -14.257 5.766   2.043   1.00 0.00 ? 53  ARG A HH21 2  
ATOM 2566  H HH22 . ARG A 1 53  ? -15.171 4.303   2.198   1.00 0.00 ? 53  ARG A HH22 2  
ATOM 2567  N N    . VAL A 1 54  ? -8.539  1.065   0.414   1.00 0.00 ? 54  VAL A N    2  
ATOM 2568  C CA   . VAL A 1 54  ? -8.015  -0.105  -0.281  1.00 0.00 ? 54  VAL A CA   2  
ATOM 2569  C C    . VAL A 1 54  ? -9.097  -0.780  -1.115  1.00 0.00 ? 54  VAL A C    2  
ATOM 2570  O O    . VAL A 1 54  ? -10.142 -1.174  -0.595  1.00 0.00 ? 54  VAL A O    2  
ATOM 2571  C CB   . VAL A 1 54  ? -7.431  -1.131  0.710   1.00 0.00 ? 54  VAL A CB   2  
ATOM 2572  C CG1  . VAL A 1 54  ? -6.877  -2.336  -0.035  1.00 0.00 ? 54  VAL A CG1  2  
ATOM 2573  C CG2  . VAL A 1 54  ? -6.357  -0.486  1.572   1.00 0.00 ? 54  VAL A CG2  2  
ATOM 2574  H H    . VAL A 1 54  ? -9.235  0.945   1.093   1.00 0.00 ? 54  VAL A H    2  
ATOM 2575  H HA   . VAL A 1 54  ? -7.222  0.224   -0.937  1.00 0.00 ? 54  VAL A HA   2  
ATOM 2576  H HB   . VAL A 1 54  ? -8.226  -1.470  1.355   1.00 0.00 ? 54  VAL A HB   2  
ATOM 2577  H HG11 . VAL A 1 54  ? -6.009  -2.712  0.486   1.00 0.00 ? 54  VAL A HG11 2  
ATOM 2578  H HG12 . VAL A 1 54  ? -7.631  -3.106  -0.086  1.00 0.00 ? 54  VAL A HG12 2  
ATOM 2579  H HG13 . VAL A 1 54  ? -6.594  -2.042  -1.035  1.00 0.00 ? 54  VAL A HG13 2  
ATOM 2580  H HG21 . VAL A 1 54  ? -5.676  -1.245  1.925   1.00 0.00 ? 54  VAL A HG21 2  
ATOM 2581  H HG22 . VAL A 1 54  ? -5.812  0.240   0.986   1.00 0.00 ? 54  VAL A HG22 2  
ATOM 2582  H HG23 . VAL A 1 54  ? -6.819  0.006   2.415   1.00 0.00 ? 54  VAL A HG23 2  
ATOM 2583  N N    . TYR A 1 55  ? -8.842  -0.910  -2.411  1.00 0.00 ? 55  TYR A N    2  
ATOM 2584  C CA   . TYR A 1 55  ? -9.795  -1.536  -3.320  1.00 0.00 ? 55  TYR A CA   2  
ATOM 2585  C C    . TYR A 1 55  ? -9.344  -2.944  -3.697  1.00 0.00 ? 55  TYR A C    2  
ATOM 2586  O O    . TYR A 1 55  ? -8.275  -3.132  -4.278  1.00 0.00 ? 55  TYR A O    2  
ATOM 2587  C CB   . TYR A 1 55  ? -9.963  -0.687  -4.581  1.00 0.00 ? 55  TYR A CB   2  
ATOM 2588  C CG   . TYR A 1 55  ? -10.148 0.786   -4.300  1.00 0.00 ? 55  TYR A CG   2  
ATOM 2589  C CD1  . TYR A 1 55  ? -9.053  1.618   -4.097  1.00 0.00 ? 55  TYR A CD1  2  
ATOM 2590  C CD2  . TYR A 1 55  ? -11.417 1.349   -4.233  1.00 0.00 ? 55  TYR A CD2  2  
ATOM 2591  C CE1  . TYR A 1 55  ? -9.217  2.965   -3.839  1.00 0.00 ? 55  TYR A CE1  2  
ATOM 2592  C CE2  . TYR A 1 55  ? -11.591 2.694   -3.976  1.00 0.00 ? 55  TYR A CE2  2  
ATOM 2593  C CZ   . TYR A 1 55  ? -10.488 3.498   -3.779  1.00 0.00 ? 55  TYR A CZ   2  
ATOM 2594  O OH   . TYR A 1 55  ? -10.656 4.840   -3.521  1.00 0.00 ? 55  TYR A OH   2  
ATOM 2595  H H    . TYR A 1 55  ? -7.993  -0.576  -2.768  1.00 0.00 ? 55  TYR A H    2  
ATOM 2596  H HA   . TYR A 1 55  ? -10.746 -1.599  -2.811  1.00 0.00 ? 55  TYR A HA   2  
ATOM 2597  H HB2  . TYR A 1 55  ? -9.087  -0.799  -5.202  1.00 0.00 ? 55  TYR A HB2  2  
ATOM 2598  H HB3  . TYR A 1 55  ? -10.830 -1.031  -5.126  1.00 0.00 ? 55  TYR A HB3  2  
ATOM 2599  H HD1  . TYR A 1 55  ? -8.059  1.197   -4.143  1.00 0.00 ? 55  TYR A HD1  2  
ATOM 2600  H HD2  . TYR A 1 55  ? -12.280 0.715   -4.387  1.00 0.00 ? 55  TYR A HD2  2  
ATOM 2601  H HE1  . TYR A 1 55  ? -8.354  3.595   -3.683  1.00 0.00 ? 55  TYR A HE1  2  
ATOM 2602  H HE2  . TYR A 1 55  ? -12.585 3.112   -3.930  1.00 0.00 ? 55  TYR A HE2  2  
ATOM 2603  H HH   . TYR A 1 55  ? -11.579 5.074   -3.639  1.00 0.00 ? 55  TYR A HH   2  
ATOM 2604  N N    . TYR A 1 56  ? -10.169 -3.931  -3.364  1.00 0.00 ? 56  TYR A N    2  
ATOM 2605  C CA   . TYR A 1 56  ? -9.857  -5.323  -3.666  1.00 0.00 ? 56  TYR A CA   2  
ATOM 2606  C C    . TYR A 1 56  ? -11.117 -6.093  -4.047  1.00 0.00 ? 56  TYR A C    2  
ATOM 2607  O O    . TYR A 1 56  ? -12.135 -6.026  -3.359  1.00 0.00 ? 56  TYR A O    2  
ATOM 2608  C CB   . TYR A 1 56  ? -9.182  -5.987  -2.464  1.00 0.00 ? 56  TYR A CB   2  
ATOM 2609  C CG   . TYR A 1 56  ? -10.120 -6.235  -1.304  1.00 0.00 ? 56  TYR A CG   2  
ATOM 2610  C CD1  . TYR A 1 56  ? -10.404 -5.226  -0.391  1.00 0.00 ? 56  TYR A CD1  2  
ATOM 2611  C CD2  . TYR A 1 56  ? -10.720 -7.475  -1.121  1.00 0.00 ? 56  TYR A CD2  2  
ATOM 2612  C CE1  . TYR A 1 56  ? -11.260 -5.447  0.671   1.00 0.00 ? 56  TYR A CE1  2  
ATOM 2613  C CE2  . TYR A 1 56  ? -11.577 -7.702  -0.062  1.00 0.00 ? 56  TYR A CE2  2  
ATOM 2614  C CZ   . TYR A 1 56  ? -11.844 -6.686  0.831   1.00 0.00 ? 56  TYR A CZ   2  
ATOM 2615  O OH   . TYR A 1 56  ? -12.697 -6.911  1.887   1.00 0.00 ? 56  TYR A OH   2  
ATOM 2616  H H    . TYR A 1 56  ? -11.007 -3.719  -2.903  1.00 0.00 ? 56  TYR A H    2  
ATOM 2617  H HA   . TYR A 1 56  ? -9.172  -5.336  -4.502  1.00 0.00 ? 56  TYR A HA   2  
ATOM 2618  H HB2  . TYR A 1 56  ? -8.776  -6.939  -2.769  1.00 0.00 ? 56  TYR A HB2  2  
ATOM 2619  H HB3  . TYR A 1 56  ? -8.380  -5.354  -2.115  1.00 0.00 ? 56  TYR A HB3  2  
ATOM 2620  H HD1  . TYR A 1 56  ? -9.947  -4.257  -0.518  1.00 0.00 ? 56  TYR A HD1  2  
ATOM 2621  H HD2  . TYR A 1 56  ? -10.508 -8.268  -1.822  1.00 0.00 ? 56  TYR A HD2  2  
ATOM 2622  H HE1  . TYR A 1 56  ? -11.471 -4.652  1.373   1.00 0.00 ? 56  TYR A HE1  2  
ATOM 2623  H HE2  . TYR A 1 56  ? -12.034 -8.674  0.063   1.00 0.00 ? 56  TYR A HE2  2  
ATOM 2624  H HH   . TYR A 1 56  ? -12.185 -7.113  2.675   1.00 0.00 ? 56  TYR A HH   2  
ATOM 2625  N N    . THR A 1 57  ? -11.040 -6.830  -5.152  1.00 0.00 ? 57  THR A N    2  
ATOM 2626  C CA   . THR A 1 57  ? -12.172 -7.615  -5.628  1.00 0.00 ? 57  THR A CA   2  
ATOM 2627  C C    . THR A 1 57  ? -11.719 -8.704  -6.593  1.00 0.00 ? 57  THR A C    2  
ATOM 2628  O O    . THR A 1 57  ? -10.757 -8.525  -7.338  1.00 0.00 ? 57  THR A O    2  
ATOM 2629  C CB   . THR A 1 57  ? -13.217 -6.725  -6.329  1.00 0.00 ? 57  THR A CB   2  
ATOM 2630  O OG1  . THR A 1 57  ? -14.415 -7.471  -6.568  1.00 0.00 ? 57  THR A OG1  2  
ATOM 2631  C CG2  . THR A 1 57  ? -12.676 -6.190  -7.646  1.00 0.00 ? 57  THR A CG2  2  
ATOM 2632  H H    . THR A 1 57  ? -10.201 -6.844  -5.659  1.00 0.00 ? 57  THR A H    2  
ATOM 2633  H HA   . THR A 1 57  ? -12.640 -8.077  -4.772  1.00 0.00 ? 57  THR A HA   2  
ATOM 2634  H HB   . THR A 1 57  ? -13.446 -5.888  -5.684  1.00 0.00 ? 57  THR A HB   2  
ATOM 2635  H HG1  . THR A 1 57  ? -15.178 -6.900  -6.452  1.00 0.00 ? 57  THR A HG1  2  
ATOM 2636  H HG21 . THR A 1 57  ? -12.440 -7.016  -8.300  1.00 0.00 ? 57  THR A HG21 2  
ATOM 2637  H HG22 . THR A 1 57  ? -11.784 -5.610  -7.459  1.00 0.00 ? 57  THR A HG22 2  
ATOM 2638  H HG23 . THR A 1 57  ? -13.421 -5.564  -8.113  1.00 0.00 ? 57  THR A HG23 2  
ATOM 2639  N N    . MET A 1 58  ? -12.421 -9.832  -6.576  1.00 0.00 ? 58  MET A N    2  
ATOM 2640  C CA   . MET A 1 58  ? -12.091 -10.951 -7.450  1.00 0.00 ? 58  MET A CA   2  
ATOM 2641  C C    . MET A 1 58  ? -12.319 -10.580 -8.913  1.00 0.00 ? 58  MET A C    2  
ATOM 2642  O O    . MET A 1 58  ? -11.701 -11.154 -9.811  1.00 0.00 ? 58  MET A O    2  
ATOM 2643  C CB   . MET A 1 58  ? -12.931 -12.177 -7.086  1.00 0.00 ? 58  MET A CB   2  
ATOM 2644  C CG   . MET A 1 58  ? -14.428 -11.912 -7.094  1.00 0.00 ? 58  MET A CG   2  
ATOM 2645  S SD   . MET A 1 58  ? -15.267 -12.631 -5.669  1.00 0.00 ? 58  MET A SD   2  
ATOM 2646  C CE   . MET A 1 58  ? -14.521 -14.259 -5.623  1.00 0.00 ? 58  MET A CE   2  
ATOM 2647  H H    . MET A 1 58  ? -13.178 -9.916  -5.958  1.00 0.00 ? 58  MET A H    2  
ATOM 2648  H HA   . MET A 1 58  ? -11.047 -11.186 -7.309  1.00 0.00 ? 58  MET A HA   2  
ATOM 2649  H HB2  . MET A 1 58  ? -12.723 -12.964 -7.795  1.00 0.00 ? 58  MET A HB2  2  
ATOM 2650  H HB3  . MET A 1 58  ? -12.652 -12.509 -6.098  1.00 0.00 ? 58  MET A HB3  2  
ATOM 2651  H HG2  . MET A 1 58  ? -14.592 -10.845 -7.089  1.00 0.00 ? 58  MET A HG2  2  
ATOM 2652  H HG3  . MET A 1 58  ? -14.850 -12.335 -7.994  1.00 0.00 ? 58  MET A HG3  2  
ATOM 2653  H HE1  . MET A 1 58  ? -13.480 -14.170 -5.351  1.00 0.00 ? 58  MET A HE1  2  
ATOM 2654  H HE2  . MET A 1 58  ? -15.033 -14.868 -4.893  1.00 0.00 ? 58  MET A HE2  2  
ATOM 2655  H HE3  . MET A 1 58  ? -14.601 -14.719 -6.597  1.00 0.00 ? 58  MET A HE3  2  
ATOM 2656  N N    . ASP A 1 59  ? -13.208 -9.621  -9.145  1.00 0.00 ? 59  ASP A N    2  
ATOM 2657  C CA   . ASP A 1 59  ? -13.516 -9.175  -10.498 1.00 0.00 ? 59  ASP A CA   2  
ATOM 2658  C C    . ASP A 1 59  ? -13.046 -7.740  -10.718 1.00 0.00 ? 59  ASP A C    2  
ATOM 2659  O O    . ASP A 1 59  ? -13.837 -6.797  -10.727 1.00 0.00 ? 59  ASP A O    2  
ATOM 2660  C CB   . ASP A 1 59  ? -15.018 -9.280  -10.764 1.00 0.00 ? 59  ASP A CB   2  
ATOM 2661  C CG   . ASP A 1 59  ? -15.586 -10.622 -10.352 1.00 0.00 ? 59  ASP A CG   2  
ATOM 2662  O OD1  . ASP A 1 59  ? -15.299 -11.625 -11.039 1.00 0.00 ? 59  ASP A OD1  2  
ATOM 2663  O OD2  . ASP A 1 59  ? -16.321 -10.672 -9.343  1.00 0.00 ? 59  ASP A OD2  2  
ATOM 2664  H H    . ASP A 1 59  ? -13.667 -9.203  -8.387  1.00 0.00 ? 59  ASP A H    2  
ATOM 2665  H HA   . ASP A 1 59  ? -12.992 -9.820  -11.188 1.00 0.00 ? 59  ASP A HA   2  
ATOM 2666  H HB2  . ASP A 1 59  ? -15.530 -8.506  -10.207 1.00 0.00 ? 59  ASP A HB2  2  
ATOM 2667  H HB3  . ASP A 1 59  ? -15.202 -9.138  -11.818 1.00 0.00 ? 59  ASP A HB3  2  
ATOM 2668  N N    . PRO A 1 60  ? -11.728 -7.569  -10.897 1.00 0.00 ? 60  PRO A N    2  
ATOM 2669  C CA   . PRO A 1 60  ? -11.123 -6.252  -11.118 1.00 0.00 ? 60  PRO A CA   2  
ATOM 2670  C C    . PRO A 1 60  ? -11.482 -5.671  -12.480 1.00 0.00 ? 60  PRO A C    2  
ATOM 2671  O O    . PRO A 1 60  ? -11.193 -4.509  -12.769 1.00 0.00 ? 60  PRO A O    2  
ATOM 2672  C CB   . PRO A 1 60  ? -9.620  -6.533  -11.036 1.00 0.00 ? 60  PRO A CB   2  
ATOM 2673  C CG   . PRO A 1 60  ? -9.483  -7.971  -11.404 1.00 0.00 ? 60  PRO A CG   2  
ATOM 2674  C CD   . PRO A 1 60  ? -10.725 -8.648  -10.898 1.00 0.00 ? 60  PRO A CD   2  
ATOM 2675  H HA   . PRO A 1 60  ? -11.402 -5.552  -10.344 1.00 0.00 ? 60  PRO A HA   2  
ATOM 2676  H HB2  . PRO A 1 60  ? -9.093  -5.895  -11.731 1.00 0.00 ? 60  PRO A HB2  2  
ATOM 2677  H HB3  . PRO A 1 60  ? -9.270  -6.349  -10.032 1.00 0.00 ? 60  PRO A HB3  2  
ATOM 2678  H HG2  . PRO A 1 60  ? -9.414  -8.070  -12.478 1.00 0.00 ? 60  PRO A HG2  2  
ATOM 2679  H HG3  . PRO A 1 60  ? -8.608  -8.390  -10.930 1.00 0.00 ? 60  PRO A HG3  2  
ATOM 2680  H HD2  . PRO A 1 60  ? -11.020 -9.447  -11.563 1.00 0.00 ? 60  PRO A HD2  2  
ATOM 2681  H HD3  . PRO A 1 60  ? -10.568 -9.027  -9.899  1.00 0.00 ? 60  PRO A HD3  2  
ATOM 2682  N N    . THR A 1 61  ? -12.117 -6.486  -13.318 1.00 0.00 ? 61  THR A N    2  
ATOM 2683  C CA   . THR A 1 61  ? -12.515 -6.052  -14.652 1.00 0.00 ? 61  THR A CA   2  
ATOM 2684  C C    . THR A 1 61  ? -13.560 -4.945  -14.580 1.00 0.00 ? 61  THR A C    2  
ATOM 2685  O O    . THR A 1 61  ? -13.821 -4.261  -15.569 1.00 0.00 ? 61  THR A O    2  
ATOM 2686  C CB   . THR A 1 61  ? -13.081 -7.223  -15.477 1.00 0.00 ? 61  THR A CB   2  
ATOM 2687  O OG1  . THR A 1 61  ? -13.554 -6.748  -16.742 1.00 0.00 ? 61  THR A OG1  2  
ATOM 2688  C CG2  . THR A 1 61  ? -14.216 -7.913  -14.733 1.00 0.00 ? 61  THR A CG2  2  
ATOM 2689  H H    . THR A 1 61  ? -12.320 -7.400  -13.031 1.00 0.00 ? 61  THR A H    2  
ATOM 2690  H HA   . THR A 1 61  ? -11.638 -5.675  -15.156 1.00 0.00 ? 61  THR A HA   2  
ATOM 2691  H HB   . THR A 1 61  ? -12.291 -7.942  -15.643 1.00 0.00 ? 61  THR A HB   2  
ATOM 2692  H HG1  . THR A 1 61  ? -14.017 -7.455  -17.197 1.00 0.00 ? 61  THR A HG1  2  
ATOM 2693  H HG21 . THR A 1 61  ? -14.672 -7.214  -14.046 1.00 0.00 ? 61  THR A HG21 2  
ATOM 2694  H HG22 . THR A 1 61  ? -13.826 -8.755  -14.182 1.00 0.00 ? 61  THR A HG22 2  
ATOM 2695  H HG23 . THR A 1 61  ? -14.955 -8.255  -15.441 1.00 0.00 ? 61  THR A HG23 2  
ATOM 2696  N N    . GLN A 1 62  ? -14.154 -4.772  -13.404 1.00 0.00 ? 62  GLN A N    2  
ATOM 2697  C CA   . GLN A 1 62  ? -15.170 -3.747  -13.205 1.00 0.00 ? 62  GLN A CA   2  
ATOM 2698  C C    . GLN A 1 62  ? -14.545 -2.453  -12.692 1.00 0.00 ? 62  GLN A C    2  
ATOM 2699  O O    . GLN A 1 62  ? -13.341 -2.390  -12.441 1.00 0.00 ? 62  GLN A O    2  
ATOM 2700  C CB   . GLN A 1 62  ? -16.235 -4.237  -12.220 1.00 0.00 ? 62  GLN A CB   2  
ATOM 2701  C CG   . GLN A 1 62  ? -16.680 -5.669  -12.469 1.00 0.00 ? 62  GLN A CG   2  
ATOM 2702  C CD   . GLN A 1 62  ? -18.188 -5.822  -12.456 1.00 0.00 ? 62  GLN A CD   2  
ATOM 2703  O OE1  . GLN A 1 62  ? -18.896 -5.169  -13.222 1.00 0.00 ? 62  GLN A OE1  2  
ATOM 2704  N NE2  . GLN A 1 62  ? -18.687 -6.689  -11.582 1.00 0.00 ? 62  GLN A NE2  2  
ATOM 2705  H H    . GLN A 1 62  ? -13.903 -5.350  -12.652 1.00 0.00 ? 62  GLN A H    2  
ATOM 2706  H HA   . GLN A 1 62  ? -15.638 -3.553  -14.158 1.00 0.00 ? 62  GLN A HA   2  
ATOM 2707  H HB2  . GLN A 1 62  ? -15.836 -4.174  -11.218 1.00 0.00 ? 62  GLN A HB2  2  
ATOM 2708  H HB3  . GLN A 1 62  ? -17.101 -3.595  -12.295 1.00 0.00 ? 62  GLN A HB3  2  
ATOM 2709  H HG2  . GLN A 1 62  ? -16.309 -5.985  -13.432 1.00 0.00 ? 62  GLN A HG2  2  
ATOM 2710  H HG3  . GLN A 1 62  ? -16.261 -6.301  -11.699 1.00 0.00 ? 62  GLN A HG3  2  
ATOM 2711  H HE21 . GLN A 1 62  ? -18.062 -7.173  -11.002 1.00 0.00 ? 62  GLN A HE21 2  
ATOM 2712  H HE22 . GLN A 1 62  ? -19.659 -6.807  -11.552 1.00 0.00 ? 62  GLN A HE22 2  
ATOM 2713  N N    . HIS A 1 63  ? -15.370 -1.422  -12.542 1.00 0.00 ? 63  HIS A N    2  
ATOM 2714  C CA   . HIS A 1 63  ? -14.898 -0.129  -12.060 1.00 0.00 ? 63  HIS A CA   2  
ATOM 2715  C C    . HIS A 1 63  ? -14.508 -0.208  -10.587 1.00 0.00 ? 63  HIS A C    2  
ATOM 2716  O O    . HIS A 1 63  ? -15.150 -0.901  -9.800  1.00 0.00 ? 63  HIS A O    2  
ATOM 2717  C CB   . HIS A 1 63  ? -15.977 0.938   -12.257 1.00 0.00 ? 63  HIS A CB   2  
ATOM 2718  C CG   . HIS A 1 63  ? -15.426 2.299   -12.550 1.00 0.00 ? 63  HIS A CG   2  
ATOM 2719  N ND1  . HIS A 1 63  ? -14.455 2.901   -11.777 1.00 0.00 ? 63  HIS A ND1  2  
ATOM 2720  C CD2  . HIS A 1 63  ? -15.713 3.177   -13.539 1.00 0.00 ? 63  HIS A CD2  2  
ATOM 2721  C CE1  . HIS A 1 63  ? -14.171 4.090   -12.277 1.00 0.00 ? 63  HIS A CE1  2  
ATOM 2722  N NE2  . HIS A 1 63  ? -14.921 4.281   -13.348 1.00 0.00 ? 63  HIS A NE2  2  
ATOM 2723  H H    . HIS A 1 63  ? -16.319 -1.533  -12.760 1.00 0.00 ? 63  HIS A H    2  
ATOM 2724  H HA   . HIS A 1 63  ? -14.027 0.141   -12.637 1.00 0.00 ? 63  HIS A HA   2  
ATOM 2725  H HB2  . HIS A 1 63  ? -16.609 0.652   -13.084 1.00 0.00 ? 63  HIS A HB2  2  
ATOM 2726  H HB3  . HIS A 1 63  ? -16.574 1.007   -11.359 1.00 0.00 ? 63  HIS A HB3  2  
ATOM 2727  H HD2  . HIS A 1 63  ? -16.434 3.035   -14.334 1.00 0.00 ? 63  HIS A HD2  2  
ATOM 2728  H HE1  . HIS A 1 63  ? -13.449 4.787   -11.881 1.00 0.00 ? 63  HIS A HE1  2  
ATOM 2729  H HE2  . HIS A 1 63  ? -14.972 5.115   -13.859 1.00 0.00 ? 63  HIS A HE2  2  
ATOM 2730  N N    . VAL A 1 64  ? -13.449 0.509   -10.222 1.00 0.00 ? 64  VAL A N    2  
ATOM 2731  C CA   . VAL A 1 64  ? -12.971 0.520   -8.844  1.00 0.00 ? 64  VAL A CA   2  
ATOM 2732  C C    . VAL A 1 64  ? -14.090 0.893   -7.878  1.00 0.00 ? 64  VAL A C    2  
ATOM 2733  O O    . VAL A 1 64  ? -14.154 0.385   -6.760  1.00 0.00 ? 64  VAL A O    2  
ATOM 2734  C CB   . VAL A 1 64  ? -11.802 1.506   -8.663  1.00 0.00 ? 64  VAL A CB   2  
ATOM 2735  C CG1  . VAL A 1 64  ? -10.523 0.930   -9.251  1.00 0.00 ? 64  VAL A CG1  2  
ATOM 2736  C CG2  . VAL A 1 64  ? -12.135 2.848   -9.298  1.00 0.00 ? 64  VAL A CG2  2  
ATOM 2737  H H    . VAL A 1 64  ? -12.977 1.042   -10.895 1.00 0.00 ? 64  VAL A H    2  
ATOM 2738  H HA   . VAL A 1 64  ? -12.619 -0.473  -8.605  1.00 0.00 ? 64  VAL A HA   2  
ATOM 2739  H HB   . VAL A 1 64  ? -11.649 1.659   -7.605  1.00 0.00 ? 64  VAL A HB   2  
ATOM 2740  H HG11 . VAL A 1 64  ? -9.718  1.047   -8.541  1.00 0.00 ? 64  VAL A HG11 2  
ATOM 2741  H HG12 . VAL A 1 64  ? -10.666 -0.117  -9.467  1.00 0.00 ? 64  VAL A HG12 2  
ATOM 2742  H HG13 . VAL A 1 64  ? -10.277 1.456   -10.161 1.00 0.00 ? 64  VAL A HG13 2  
ATOM 2743  H HG21 . VAL A 1 64  ? -11.362 3.561   -9.053  1.00 0.00 ? 64  VAL A HG21 2  
ATOM 2744  H HG22 . VAL A 1 64  ? -12.191 2.734   -10.371 1.00 0.00 ? 64  VAL A HG22 2  
ATOM 2745  H HG23 . VAL A 1 64  ? -13.084 3.199   -8.922  1.00 0.00 ? 64  VAL A HG23 2  
ATOM 2746  N N    . ASN A 1 65  ? -14.973 1.784   -8.319  1.00 0.00 ? 65  ASN A N    2  
ATOM 2747  C CA   . ASN A 1 65  ? -16.090 2.226   -7.494  1.00 0.00 ? 65  ASN A CA   2  
ATOM 2748  C C    . ASN A 1 65  ? -17.053 1.075   -7.218  1.00 0.00 ? 65  ASN A C    2  
ATOM 2749  O O    . ASN A 1 65  ? -17.801 1.098   -6.243  1.00 0.00 ? 65  ASN A O    2  
ATOM 2750  C CB   . ASN A 1 65  ? -16.835 3.375   -8.179  1.00 0.00 ? 65  ASN A CB   2  
ATOM 2751  C CG   . ASN A 1 65  ? -17.854 2.881   -9.189  1.00 0.00 ? 65  ASN A CG   2  
ATOM 2752  O OD1  . ASN A 1 65  ? -18.903 2.354   -8.822  1.00 0.00 ? 65  ASN A OD1  2  
ATOM 2753  N ND2  . ASN A 1 65  ? -17.546 3.052   -10.471 1.00 0.00 ? 65  ASN A ND2  2  
ATOM 2754  H H    . ASN A 1 65  ? -14.870 2.154   -9.221  1.00 0.00 ? 65  ASN A H    2  
ATOM 2755  H HA   . ASN A 1 65  ? -15.691 2.579   -6.555  1.00 0.00 ? 65  ASN A HA   2  
ATOM 2756  H HB2  . ASN A 1 65  ? -17.353 3.957   -7.431  1.00 0.00 ? 65  ASN A HB2  2  
ATOM 2757  H HB3  . ASN A 1 65  ? -16.122 4.004   -8.690  1.00 0.00 ? 65  ASN A HB3  2  
ATOM 2758  H HD21 . ASN A 1 65  ? -16.691 3.481   -10.689 1.00 0.00 ? 65  ASN A HD21 2  
ATOM 2759  H HD22 . ASN A 1 65  ? -18.187 2.744   -11.144 1.00 0.00 ? 65  ASN A HD22 2  
ATOM 2760  N N    . ASN A 1 66  ? -17.025 0.067   -8.085  1.00 0.00 ? 66  ASN A N    2  
ATOM 2761  C CA   . ASN A 1 66  ? -17.893 -1.095  -7.937  1.00 0.00 ? 66  ASN A CA   2  
ATOM 2762  C C    . ASN A 1 66  ? -17.222 -2.170  -7.086  1.00 0.00 ? 66  ASN A C    2  
ATOM 2763  O O    . ASN A 1 66  ? -17.894 -3.017  -6.497  1.00 0.00 ? 66  ASN A O    2  
ATOM 2764  C CB   . ASN A 1 66  ? -18.257 -1.666  -9.308  1.00 0.00 ? 66  ASN A CB   2  
ATOM 2765  C CG   . ASN A 1 66  ? -19.542 -1.075  -9.858  1.00 0.00 ? 66  ASN A CG   2  
ATOM 2766  O OD1  . ASN A 1 66  ? -20.136 -0.183  -9.253  1.00 0.00 ? 66  ASN A OD1  2  
ATOM 2767  N ND2  . ASN A 1 66  ? -19.977 -1.573  -11.009 1.00 0.00 ? 66  ASN A ND2  2  
ATOM 2768  H H    . ASN A 1 66  ? -16.406 0.106   -8.844  1.00 0.00 ? 66  ASN A H    2  
ATOM 2769  H HA   . ASN A 1 66  ? -18.797 -0.772  -7.439  1.00 0.00 ? 66  ASN A HA   2  
ATOM 2770  H HB2  . ASN A 1 66  ? -17.459 -1.451  -10.004 1.00 0.00 ? 66  ASN A HB2  2  
ATOM 2771  H HB3  . ASN A 1 66  ? -18.380 -2.735  -9.226  1.00 0.00 ? 66  ASN A HB3  2  
ATOM 2772  H HD21 . ASN A 1 66  ? -19.452 -2.284  -11.434 1.00 0.00 ? 66  ASN A HD21 2  
ATOM 2773  H HD22 . ASN A 1 66  ? -20.805 -1.210  -11.387 1.00 0.00 ? 66  ASN A HD22 2  
ATOM 2774  N N    . TRP A 1 67  ? -15.897 -2.129  -7.030  1.00 0.00 ? 67  TRP A N    2  
ATOM 2775  C CA   . TRP A 1 67  ? -15.134 -3.100  -6.253  1.00 0.00 ? 67  TRP A CA   2  
ATOM 2776  C C    . TRP A 1 67  ? -15.664 -3.190  -4.826  1.00 0.00 ? 67  TRP A C    2  
ATOM 2777  O O    . TRP A 1 67  ? -16.475 -2.369  -4.402  1.00 0.00 ? 67  TRP A O    2  
ATOM 2778  C CB   . TRP A 1 67  ? -13.653 -2.721  -6.238  1.00 0.00 ? 67  TRP A CB   2  
ATOM 2779  C CG   . TRP A 1 67  ? -12.972 -2.932  -7.557  1.00 0.00 ? 67  TRP A CG   2  
ATOM 2780  C CD1  . TRP A 1 67  ? -13.572 -3.057  -8.778  1.00 0.00 ? 67  TRP A CD1  2  
ATOM 2781  C CD2  . TRP A 1 67  ? -11.564 -3.043  -7.786  1.00 0.00 ? 67  TRP A CD2  2  
ATOM 2782  N NE1  . TRP A 1 67  ? -12.621 -3.240  -9.751  1.00 0.00 ? 67  TRP A NE1  2  
ATOM 2783  C CE2  . TRP A 1 67  ? -11.380 -3.235  -9.169  1.00 0.00 ? 67  TRP A CE2  2  
ATOM 2784  C CE3  . TRP A 1 67  ? -10.439 -2.998  -6.957  1.00 0.00 ? 67  TRP A CE3  2  
ATOM 2785  C CZ2  . TRP A 1 67  ? -10.118 -3.382  -9.739  1.00 0.00 ? 67  TRP A CZ2  2  
ATOM 2786  C CZ3  . TRP A 1 67  ? -9.188  -3.145  -7.525  1.00 0.00 ? 67  TRP A CZ3  2  
ATOM 2787  C CH2  . TRP A 1 67  ? -9.035  -3.333  -8.905  1.00 0.00 ? 67  TRP A CH2  2  
ATOM 2788  H H    . TRP A 1 67  ? -15.418 -1.429  -7.522  1.00 0.00 ? 67  TRP A H    2  
ATOM 2789  H HA   . TRP A 1 67  ? -15.246 -4.064  -6.727  1.00 0.00 ? 67  TRP A HA   2  
ATOM 2790  H HB2  . TRP A 1 67  ? -13.556 -1.678  -5.976  1.00 0.00 ? 67  TRP A HB2  2  
ATOM 2791  H HB3  . TRP A 1 67  ? -13.143 -3.323  -5.500  1.00 0.00 ? 67  TRP A HB3  2  
ATOM 2792  H HD1  . TRP A 1 67  ? -14.638 -3.018  -8.937  1.00 0.00 ? 67  TRP A HD1  2  
ATOM 2793  H HE1  . TRP A 1 67  ? -12.801 -3.354  -10.708 1.00 0.00 ? 67  TRP A HE1  2  
ATOM 2794  H HE3  . TRP A 1 67  ? -10.536 -2.853  -5.892  1.00 0.00 ? 67  TRP A HE3  2  
ATOM 2795  H HZ2  . TRP A 1 67  ? -9.985  -3.527  -10.801 1.00 0.00 ? 67  TRP A HZ2  2  
ATOM 2796  H HZ3  . TRP A 1 67  ? -8.307  -3.114  -6.900  1.00 0.00 ? 67  TRP A HZ3  2  
ATOM 2797  H HH2  . TRP A 1 67  ? -8.039  -3.444  -9.305  1.00 0.00 ? 67  TRP A HH2  2  
ATOM 2798  N N    . MET A 1 68  ? -15.199 -4.193  -4.089  1.00 0.00 ? 68  MET A N    2  
ATOM 2799  C CA   . MET A 1 68  ? -15.624 -4.390  -2.708  1.00 0.00 ? 68  MET A CA   2  
ATOM 2800  C C    . MET A 1 68  ? -15.158 -3.236  -1.826  1.00 0.00 ? 68  MET A C    2  
ATOM 2801  O O    . MET A 1 68  ? -15.906 -2.741  -0.985  1.00 0.00 ? 68  MET A O    2  
ATOM 2802  C CB   . MET A 1 68  ? -15.082 -5.713  -2.167  1.00 0.00 ? 68  MET A CB   2  
ATOM 2803  C CG   . MET A 1 68  ? -16.164 -6.654  -1.662  1.00 0.00 ? 68  MET A CG   2  
ATOM 2804  S SD   . MET A 1 68  ? -15.544 -8.314  -1.333  1.00 0.00 ? 68  MET A SD   2  
ATOM 2805  C CE   . MET A 1 68  ? -15.015 -8.808  -2.972  1.00 0.00 ? 68  MET A CE   2  
ATOM 2806  H H    . MET A 1 68  ? -14.552 -4.817  -4.482  1.00 0.00 ? 68  MET A H    2  
ATOM 2807  H HA   . MET A 1 68  ? -16.704 -4.422  -2.697  1.00 0.00 ? 68  MET A HA   2  
ATOM 2808  H HB2  . MET A 1 68  ? -14.539 -6.215  -2.954  1.00 0.00 ? 68  MET A HB2  2  
ATOM 2809  H HB3  . MET A 1 68  ? -14.406 -5.505  -1.350  1.00 0.00 ? 68  MET A HB3  2  
ATOM 2810  H HG2  . MET A 1 68  ? -16.573 -6.251  -0.747  1.00 0.00 ? 68  MET A HG2  2  
ATOM 2811  H HG3  . MET A 1 68  ? -16.943 -6.715  -2.406  1.00 0.00 ? 68  MET A HG3  2  
ATOM 2812  H HE1  . MET A 1 68  ? -15.239 -9.853  -3.122  1.00 0.00 ? 68  MET A HE1  2  
ATOM 2813  H HE2  . MET A 1 68  ? -15.537 -8.218  -3.712  1.00 0.00 ? 68  MET A HE2  2  
ATOM 2814  H HE3  . MET A 1 68  ? -13.950 -8.649  -3.069  1.00 0.00 ? 68  MET A HE3  2  
ATOM 2815  N N    . LYS A 1 69  ? -13.914 -2.812  -2.025  1.00 0.00 ? 69  LYS A N    2  
ATOM 2816  C CA   . LYS A 1 69  ? -13.345 -1.716  -1.248  1.00 0.00 ? 69  LYS A CA   2  
ATOM 2817  C C    . LYS A 1 69  ? -13.253 -2.086  0.229   1.00 0.00 ? 69  LYS A C    2  
ATOM 2818  O O    . LYS A 1 69  ? -13.941 -2.995  0.696   1.00 0.00 ? 69  LYS A O    2  
ATOM 2819  C CB   . LYS A 1 69  ? -14.193 -0.453  -1.415  1.00 0.00 ? 69  LYS A CB   2  
ATOM 2820  C CG   . LYS A 1 69  ? -14.589 -0.173  -2.854  1.00 0.00 ? 69  LYS A CG   2  
ATOM 2821  C CD   . LYS A 1 69  ? -14.853 1.307   -3.082  1.00 0.00 ? 69  LYS A CD   2  
ATOM 2822  C CE   . LYS A 1 69  ? -16.084 1.525   -3.948  1.00 0.00 ? 69  LYS A CE   2  
ATOM 2823  N NZ   . LYS A 1 69  ? -17.327 1.058   -3.273  1.00 0.00 ? 69  LYS A NZ   2  
ATOM 2824  H H    . LYS A 1 69  ? -13.364 -3.247  -2.710  1.00 0.00 ? 69  LYS A H    2  
ATOM 2825  H HA   . LYS A 1 69  ? -12.350 -1.526  -1.622  1.00 0.00 ? 69  LYS A HA   2  
ATOM 2826  H HB2  . LYS A 1 69  ? -15.094 -0.558  -0.830  1.00 0.00 ? 69  LYS A HB2  2  
ATOM 2827  H HB3  . LYS A 1 69  ? -13.631 0.395   -1.048  1.00 0.00 ? 69  LYS A HB3  2  
ATOM 2828  H HG2  . LYS A 1 69  ? -13.788 -0.489  -3.508  1.00 0.00 ? 69  LYS A HG2  2  
ATOM 2829  H HG3  . LYS A 1 69  ? -15.485 -0.730  -3.086  1.00 0.00 ? 69  LYS A HG3  2  
ATOM 2830  H HD2  . LYS A 1 69  ? -15.008 1.787   -2.128  1.00 0.00 ? 69  LYS A HD2  2  
ATOM 2831  H HD3  . LYS A 1 69  ? -13.995 1.745   -3.574  1.00 0.00 ? 69  LYS A HD3  2  
ATOM 2832  H HE2  . LYS A 1 69  ? -16.175 2.579   -4.161  1.00 0.00 ? 69  LYS A HE2  2  
ATOM 2833  H HE3  . LYS A 1 69  ? -15.960 0.980   -4.872  1.00 0.00 ? 69  LYS A HE3  2  
ATOM 2834  H HZ1  . LYS A 1 69  ? -18.038 1.818   -3.268  1.00 0.00 ? 69  LYS A HZ1  2  
ATOM 2835  H HZ2  . LYS A 1 69  ? -17.119 0.786   -2.291  1.00 0.00 ? 69  LYS A HZ2  2  
ATOM 2836  H HZ3  . LYS A 1 69  ? -17.718 0.234   -3.774  1.00 0.00 ? 69  LYS A HZ3  2  
ATOM 2837  N N    . HIS A 1 70  ? -12.398 -1.377  0.961   1.00 0.00 ? 70  HIS A N    2  
ATOM 2838  C CA   . HIS A 1 70  ? -12.218 -1.631  2.384   1.00 0.00 ? 70  HIS A CA   2  
ATOM 2839  C C    . HIS A 1 70  ? -12.194 -0.322  3.171   1.00 0.00 ? 70  HIS A C    2  
ATOM 2840  O O    . HIS A 1 70  ? -12.413 0.751   2.613   1.00 0.00 ? 70  HIS A O    2  
ATOM 2841  C CB   . HIS A 1 70  ? -10.924 -2.408  2.626   1.00 0.00 ? 70  HIS A CB   2  
ATOM 2842  C CG   . HIS A 1 70  ? -11.053 -3.478  3.665   1.00 0.00 ? 70  HIS A CG   2  
ATOM 2843  N ND1  . HIS A 1 70  ? -12.147 -4.313  3.754   1.00 0.00 ? 70  HIS A ND1  2  
ATOM 2844  C CD2  . HIS A 1 70  ? -10.216 -3.850  4.663   1.00 0.00 ? 70  HIS A CD2  2  
ATOM 2845  C CE1  . HIS A 1 70  ? -11.979 -5.150  4.762   1.00 0.00 ? 70  HIS A CE1  2  
ATOM 2846  N NE2  . HIS A 1 70  ? -10.815 -4.891  5.329   1.00 0.00 ? 70  HIS A NE2  2  
ATOM 2847  H H    . HIS A 1 70  ? -11.878 -0.667  0.531   1.00 0.00 ? 70  HIS A H    2  
ATOM 2848  H HA   . HIS A 1 70  ? -13.053 -2.224  2.725   1.00 0.00 ? 70  HIS A HA   2  
ATOM 2849  H HB2  . HIS A 1 70  ? -10.616 -2.877  1.703   1.00 0.00 ? 70  HIS A HB2  2  
ATOM 2850  H HB3  . HIS A 1 70  ? -10.154 -1.722  2.949   1.00 0.00 ? 70  HIS A HB3  2  
ATOM 2851  H HD1  . HIS A 1 70  ? -12.931 -4.293  3.166   1.00 0.00 ? 70  HIS A HD1  2  
ATOM 2852  H HD2  . HIS A 1 70  ? -9.256  -3.409  4.892   1.00 0.00 ? 70  HIS A HD2  2  
ATOM 2853  H HE1  . HIS A 1 70  ? -12.674 -5.918  5.069   1.00 0.00 ? 70  HIS A HE1  2  
ATOM 2854  N N    . ASN A 1 71  ? -11.927 -0.422  4.469   1.00 0.00 ? 71  ASN A N    2  
ATOM 2855  C CA   . ASN A 1 71  ? -11.876 0.752   5.332   1.00 0.00 ? 71  ASN A CA   2  
ATOM 2856  C C    . ASN A 1 71  ? -10.541 0.832   6.065   1.00 0.00 ? 71  ASN A C    2  
ATOM 2857  O O    . ASN A 1 71  ? -9.983  -0.188  6.471   1.00 0.00 ? 71  ASN A O    2  
ATOM 2858  C CB   . ASN A 1 71  ? -13.025 0.721   6.341   1.00 0.00 ? 71  ASN A CB   2  
ATOM 2859  C CG   . ASN A 1 71  ? -12.734 -0.189  7.519   1.00 0.00 ? 71  ASN A CG   2  
ATOM 2860  O OD1  . ASN A 1 71  ? -11.946 0.154   8.402   1.00 0.00 ? 71  ASN A OD1  2  
ATOM 2861  N ND2  . ASN A 1 71  ? -13.370 -1.355  7.538   1.00 0.00 ? 71  ASN A ND2  2  
ATOM 2862  H H    . ASN A 1 71  ? -11.761 -1.307  4.856   1.00 0.00 ? 71  ASN A H    2  
ATOM 2863  H HA   . ASN A 1 71  ? -11.982 1.627   4.706   1.00 0.00 ? 71  ASN A HA   2  
ATOM 2864  H HB2  . ASN A 1 71  ? -13.196 1.719   6.715   1.00 0.00 ? 71  ASN A HB2  2  
ATOM 2865  H HB3  . ASN A 1 71  ? -13.919 0.368   5.849   1.00 0.00 ? 71  ASN A HB3  2  
ATOM 2866  H HD21 . ASN A 1 71  ? -13.982 -1.560  6.802   1.00 0.00 ? 71  ASN A HD21 2  
ATOM 2867  H HD22 . ASN A 1 71  ? -13.200 -1.961  8.289   1.00 0.00 ? 71  ASN A HD22 2  
ATOM 2868  N N    . VAL A 1 72  ? -10.034 2.049   6.231   1.00 0.00 ? 72  VAL A N    2  
ATOM 2869  C CA   . VAL A 1 72  ? -8.766  2.261   6.919   1.00 0.00 ? 72  VAL A CA   2  
ATOM 2870  C C    . VAL A 1 72  ? -8.807  3.525   7.771   1.00 0.00 ? 72  VAL A C    2  
ATOM 2871  O O    . VAL A 1 72  ? -9.427  4.520   7.395   1.00 0.00 ? 72  VAL A O    2  
ATOM 2872  C CB   . VAL A 1 72  ? -7.597  2.367   5.919   1.00 0.00 ? 72  VAL A CB   2  
ATOM 2873  C CG1  . VAL A 1 72  ? -6.291  2.629   6.653   1.00 0.00 ? 72  VAL A CG1  2  
ATOM 2874  C CG2  . VAL A 1 72  ? -7.503  1.104   5.077   1.00 0.00 ? 72  VAL A CG2  2  
ATOM 2875  H H    . VAL A 1 72  ? -10.525 2.822   5.887   1.00 0.00 ? 72  VAL A H    2  
ATOM 2876  H HA   . VAL A 1 72  ? -8.587  1.411   7.561   1.00 0.00 ? 72  VAL A HA   2  
ATOM 2877  H HB   . VAL A 1 72  ? -7.789  3.202   5.261   1.00 0.00 ? 72  VAL A HB   2  
ATOM 2878  H HG11 . VAL A 1 72  ? -5.477  2.166   6.113   1.00 0.00 ? 72  VAL A HG11 2  
ATOM 2879  H HG12 . VAL A 1 72  ? -6.122  3.692   6.719   1.00 0.00 ? 72  VAL A HG12 2  
ATOM 2880  H HG13 . VAL A 1 72  ? -6.346  2.209   7.647   1.00 0.00 ? 72  VAL A HG13 2  
ATOM 2881  H HG21 . VAL A 1 72  ? -6.537  1.065   4.597   1.00 0.00 ? 72  VAL A HG21 2  
ATOM 2882  H HG22 . VAL A 1 72  ? -7.626  0.237   5.709   1.00 0.00 ? 72  VAL A HG22 2  
ATOM 2883  H HG23 . VAL A 1 72  ? -8.279  1.114   4.326   1.00 0.00 ? 72  VAL A HG23 2  
ATOM 2884  N N    . ALA A 1 73  ? -8.143  3.478   8.921   1.00 0.00 ? 73  ALA A N    2  
ATOM 2885  C CA   . ALA A 1 73  ? -8.102  4.620   9.826   1.00 0.00 ? 73  ALA A CA   2  
ATOM 2886  C C    . ALA A 1 73  ? -6.672  4.926   10.259  1.00 0.00 ? 73  ALA A C    2  
ATOM 2887  O O    . ALA A 1 73  ? -6.315  4.753   11.425  1.00 0.00 ? 73  ALA A O    2  
ATOM 2888  C CB   . ALA A 1 73  ? -8.980  4.362   11.042  1.00 0.00 ? 73  ALA A CB   2  
ATOM 2889  H H    . ALA A 1 73  ? -7.668  2.657   9.166   1.00 0.00 ? 73  ALA A H    2  
ATOM 2890  H HA   . ALA A 1 73  ? -8.499  5.477   9.301   1.00 0.00 ? 73  ALA A HA   2  
ATOM 2891  H HB1  . ALA A 1 73  ? -9.875  3.842   10.734  1.00 0.00 ? 73  ALA A HB1  2  
ATOM 2892  H HB2  . ALA A 1 73  ? -8.438  3.757   11.754  1.00 0.00 ? 73  ALA A HB2  2  
ATOM 2893  H HB3  . ALA A 1 73  ? -9.247  5.302   11.497  1.00 0.00 ? 73  ALA A HB3  2  
ATOM 2894  N N    . ASP A 1 74  ? -5.857  5.381   9.314   1.00 0.00 ? 74  ASP A N    2  
ATOM 2895  C CA   . ASP A 1 74  ? -4.465  5.710   9.598   1.00 0.00 ? 74  ASP A CA   2  
ATOM 2896  C C    . ASP A 1 74  ? -3.762  4.550   10.294  1.00 0.00 ? 74  ASP A C    2  
ATOM 2897  O O    . ASP A 1 74  ? -3.264  4.692   11.411  1.00 0.00 ? 74  ASP A O    2  
ATOM 2898  C CB   . ASP A 1 74  ? -4.384  6.967   10.465  1.00 0.00 ? 74  ASP A CB   2  
ATOM 2899  C CG   . ASP A 1 74  ? -3.036  7.656   10.363  1.00 0.00 ? 74  ASP A CG   2  
ATOM 2900  O OD1  . ASP A 1 74  ? -2.585  7.909   9.227   1.00 0.00 ? 74  ASP A OD1  2  
ATOM 2901  O OD2  . ASP A 1 74  ? -2.435  7.940   11.419  1.00 0.00 ? 74  ASP A OD2  2  
ATOM 2902  H H    . ASP A 1 74  ? -6.200  5.496   8.402   1.00 0.00 ? 74  ASP A H    2  
ATOM 2903  H HA   . ASP A 1 74  ? -3.971  5.901   8.656   1.00 0.00 ? 74  ASP A HA   2  
ATOM 2904  H HB2  . ASP A 1 74  ? -5.148  7.663   10.151  1.00 0.00 ? 74  ASP A HB2  2  
ATOM 2905  H HB3  . ASP A 1 74  ? -4.552  6.696   11.497  1.00 0.00 ? 74  ASP A HB3  2  
ATOM 2906  N N    . SER A 1 75  ? -3.727  3.399   9.628   1.00 0.00 ? 75  SER A N    2  
ATOM 2907  C CA   . SER A 1 75  ? -3.089  2.212   10.185  1.00 0.00 ? 75  SER A CA   2  
ATOM 2908  C C    . SER A 1 75  ? -1.897  1.786   9.333   1.00 0.00 ? 75  SER A C    2  
ATOM 2909  O O    . SER A 1 75  ? -0.966  1.150   9.827   1.00 0.00 ? 75  SER A O    2  
ATOM 2910  C CB   . SER A 1 75  ? -4.096  1.065   10.283  1.00 0.00 ? 75  SER A CB   2  
ATOM 2911  O OG   . SER A 1 75  ? -4.457  0.816   11.630  1.00 0.00 ? 75  SER A OG   2  
ATOM 2912  H H    . SER A 1 75  ? -4.142  3.349   8.740   1.00 0.00 ? 75  SER A H    2  
ATOM 2913  H HA   . SER A 1 75  ? -2.739  2.459   11.176  1.00 0.00 ? 75  SER A HA   2  
ATOM 2914  H HB2  . SER A 1 75  ? -4.986  1.322   9.727   1.00 0.00 ? 75  SER A HB2  2  
ATOM 2915  H HB3  . SER A 1 75  ? -3.658  0.169   9.868   1.00 0.00 ? 75  SER A HB3  2  
ATOM 2916  H HG   . SER A 1 75  ? -5.192  0.200   11.657  1.00 0.00 ? 75  SER A HG   2  
ATOM 2917  N N    . GLN A 1 76  ? -1.934  2.141   8.053   1.00 0.00 ? 76  GLN A N    2  
ATOM 2918  C CA   . GLN A 1 76  ? -0.858  1.795   7.133   1.00 0.00 ? 76  GLN A CA   2  
ATOM 2919  C C    . GLN A 1 76  ? -0.735  0.283   6.984   1.00 0.00 ? 76  GLN A C    2  
ATOM 2920  O O    . GLN A 1 76  ? 0.292   -0.225  6.530   1.00 0.00 ? 76  GLN A O    2  
ATOM 2921  C CB   . GLN A 1 76  ? 0.468   2.381   7.623   1.00 0.00 ? 76  GLN A CB   2  
ATOM 2922  C CG   . GLN A 1 76  ? 0.887   3.642   6.884   1.00 0.00 ? 76  GLN A CG   2  
ATOM 2923  C CD   . GLN A 1 76  ? 1.984   4.401   7.603   1.00 0.00 ? 76  GLN A CD   2  
ATOM 2924  O OE1  . GLN A 1 76  ? 2.258   4.157   8.778   1.00 0.00 ? 76  GLN A OE1  2  
ATOM 2925  N NE2  . GLN A 1 76  ? 2.619   5.331   6.899   1.00 0.00 ? 76  GLN A NE2  2  
ATOM 2926  H H    . GLN A 1 76  ? -2.705  2.647   7.720   1.00 0.00 ? 76  GLN A H    2  
ATOM 2927  H HA   . GLN A 1 76  ? -1.094  2.221   6.171   1.00 0.00 ? 76  GLN A HA   2  
ATOM 2928  H HB2  . GLN A 1 76  ? 0.379   2.616   8.673   1.00 0.00 ? 76  GLN A HB2  2  
ATOM 2929  H HB3  . GLN A 1 76  ? 1.244   1.640   7.494   1.00 0.00 ? 76  GLN A HB3  2  
ATOM 2930  H HG2  . GLN A 1 76  ? 1.242   3.367   5.903   1.00 0.00 ? 76  GLN A HG2  2  
ATOM 2931  H HG3  . GLN A 1 76  ? 0.025   4.286   6.786   1.00 0.00 ? 76  GLN A HG3  2  
ATOM 2932  H HE21 . GLN A 1 76  ? 2.345   5.473   5.967   1.00 0.00 ? 76  GLN A HE21 2  
ATOM 2933  H HE22 . GLN A 1 76  ? 3.331   5.838   7.339   1.00 0.00 ? 76  GLN A HE22 2  
ATOM 2934  N N    . ILE A 1 77  ? -1.788  -0.433  7.367   1.00 0.00 ? 77  ILE A N    2  
ATOM 2935  C CA   . ILE A 1 77  ? -1.797  -1.887  7.275   1.00 0.00 ? 77  ILE A CA   2  
ATOM 2936  C C    . ILE A 1 77  ? -3.209  -2.439  7.437   1.00 0.00 ? 77  ILE A C    2  
ATOM 2937  O O    . ILE A 1 77  ? -3.955  -2.017  8.322   1.00 0.00 ? 77  ILE A O    2  
ATOM 2938  C CB   . ILE A 1 77  ? -0.884  -2.525  8.338   1.00 0.00 ? 77  ILE A CB   2  
ATOM 2939  C CG1  . ILE A 1 77  ? -0.740  -4.026  8.084   1.00 0.00 ? 77  ILE A CG1  2  
ATOM 2940  C CG2  . ILE A 1 77  ? -1.436  -2.269  9.733   1.00 0.00 ? 77  ILE A CG2  2  
ATOM 2941  C CD1  . ILE A 1 77  ? 0.451   -4.646  8.782   1.00 0.00 ? 77  ILE A CD1  2  
ATOM 2942  H H    . ILE A 1 77  ? -2.575  0.029   7.721   1.00 0.00 ? 77  ILE A H    2  
ATOM 2943  H HA   . ILE A 1 77  ? -1.425  -2.161  6.298   1.00 0.00 ? 77  ILE A HA   2  
ATOM 2944  H HB   . ILE A 1 77  ? 0.088   -2.061  8.271   1.00 0.00 ? 77  ILE A HB   2  
ATOM 2945  H HG12 . ILE A 1 77  ? -1.626  -4.532  8.432   1.00 0.00 ? 77  ILE A HG12 2  
ATOM 2946  H HG13 . ILE A 1 77  ? -0.627  -4.195  7.022   1.00 0.00 ? 77  ILE A HG13 2  
ATOM 2947  H HG21 . ILE A 1 77  ? -1.886  -1.289  9.768   1.00 0.00 ? 77  ILE A HG21 2  
ATOM 2948  H HG22 . ILE A 1 77  ? -2.182  -3.015  9.967   1.00 0.00 ? 77  ILE A HG22 2  
ATOM 2949  H HG23 . ILE A 1 77  ? -0.634  -2.323  10.453  1.00 0.00 ? 77  ILE A HG23 2  
ATOM 2950  H HD11 . ILE A 1 77  ? 1.147   -3.870  9.065   1.00 0.00 ? 77  ILE A HD11 2  
ATOM 2951  H HD12 . ILE A 1 77  ? 0.119   -5.172  9.663   1.00 0.00 ? 77  ILE A HD12 2  
ATOM 2952  H HD13 . ILE A 1 77  ? 0.941   -5.340  8.111   1.00 0.00 ? 77  ILE A HD13 2  
ATOM 2953  N N    . THR A 1 78  ? -3.571  -3.387  6.577   1.00 0.00 ? 78  THR A N    2  
ATOM 2954  C CA   . THR A 1 78  ? -4.894  -3.997  6.625   1.00 0.00 ? 78  THR A CA   2  
ATOM 2955  C C    . THR A 1 78  ? -4.821  -5.489  6.320   1.00 0.00 ? 78  THR A C    2  
ATOM 2956  O O    . THR A 1 78  ? -4.039  -5.924  5.473   1.00 0.00 ? 78  THR A O    2  
ATOM 2957  C CB   . THR A 1 78  ? -5.858  -3.327  5.628   1.00 0.00 ? 78  THR A CB   2  
ATOM 2958  O OG1  . THR A 1 78  ? -7.187  -3.820  5.825   1.00 0.00 ? 78  THR A OG1  2  
ATOM 2959  C CG2  . THR A 1 78  ? -5.422  -3.589  4.194   1.00 0.00 ? 78  THR A CG2  2  
ATOM 2960  H H    . THR A 1 78  ? -2.932  -3.679  5.895   1.00 0.00 ? 78  THR A H    2  
ATOM 2961  H HA   . THR A 1 78  ? -5.288  -3.862  7.622   1.00 0.00 ? 78  THR A HA   2  
ATOM 2962  H HB   . THR A 1 78  ? -5.848  -2.261  5.802   1.00 0.00 ? 78  THR A HB   2  
ATOM 2963  H HG1  . THR A 1 78  ? -7.282  -4.671  5.390   1.00 0.00 ? 78  THR A HG1  2  
ATOM 2964  H HG21 . THR A 1 78  ? -5.360  -4.654  4.026   1.00 0.00 ? 78  THR A HG21 2  
ATOM 2965  H HG22 . THR A 1 78  ? -4.454  -3.140  4.024   1.00 0.00 ? 78  THR A HG22 2  
ATOM 2966  H HG23 . THR A 1 78  ? -6.144  -3.160  3.515   1.00 0.00 ? 78  THR A HG23 2  
ATOM 2967  N N    . THR A 1 79  ? -5.642  -6.271  7.015   1.00 0.00 ? 79  THR A N    2  
ATOM 2968  C CA   . THR A 1 79  ? -5.672  -7.714  6.818   1.00 0.00 ? 79  THR A CA   2  
ATOM 2969  C C    . THR A 1 79  ? -7.030  -8.172  6.302   1.00 0.00 ? 79  THR A C    2  
ATOM 2970  O O    . THR A 1 79  ? -8.050  -7.998  6.971   1.00 0.00 ? 79  THR A O    2  
ATOM 2971  C CB   . THR A 1 79  ? -5.352  -8.465  8.125   1.00 0.00 ? 79  THR A CB   2  
ATOM 2972  O OG1  . THR A 1 79  ? -5.920  -7.771  9.241   1.00 0.00 ? 79  THR A OG1  2  
ATOM 2973  C CG2  . THR A 1 79  ? -3.849  -8.601  8.319   1.00 0.00 ? 79  THR A CG2  2  
ATOM 2974  H H    . THR A 1 79  ? -6.242  -5.865  7.675   1.00 0.00 ? 79  THR A H    2  
ATOM 2975  H HA   . THR A 1 79  ? -4.916  -7.967  6.089   1.00 0.00 ? 79  THR A HA   2  
ATOM 2976  H HB   . THR A 1 79  ? -5.784  -9.454  8.069   1.00 0.00 ? 79  THR A HB   2  
ATOM 2977  H HG1  . THR A 1 79  ? -5.345  -7.043  9.491   1.00 0.00 ? 79  THR A HG1  2  
ATOM 2978  H HG21 . THR A 1 79  ? -3.431  -7.639  8.575   1.00 0.00 ? 79  THR A HG21 2  
ATOM 2979  H HG22 . THR A 1 79  ? -3.400  -8.957  7.403   1.00 0.00 ? 79  THR A HG22 2  
ATOM 2980  H HG23 . THR A 1 79  ? -3.651  -9.304  9.113   1.00 0.00 ? 79  THR A HG23 2  
ATOM 2981  N N    . ILE A 1 80  ? -7.039  -8.758  5.111   1.00 0.00 ? 80  ILE A N    2  
ATOM 2982  C CA   . ILE A 1 80  ? -8.272  -9.242  4.505   1.00 0.00 ? 80  ILE A CA   2  
ATOM 2983  C C    . ILE A 1 80  ? -8.303  -10.767 4.464   1.00 0.00 ? 80  ILE A C    2  
ATOM 2984  O O    . ILE A 1 80  ? -7.296  -11.411 4.178   1.00 0.00 ? 80  ILE A O    2  
ATOM 2985  C CB   . ILE A 1 80  ? -8.451  -8.698  3.076   1.00 0.00 ? 80  ILE A CB   2  
ATOM 2986  C CG1  . ILE A 1 80  ? -8.352  -7.171  3.072   1.00 0.00 ? 80  ILE A CG1  2  
ATOM 2987  C CG2  . ILE A 1 80  ? -9.786  -9.147  2.500   1.00 0.00 ? 80  ILE A CG2  2  
ATOM 2988  C CD1  . ILE A 1 80  ? -8.373  -6.568  1.685   1.00 0.00 ? 80  ILE A CD1  2  
ATOM 2989  H H    . ILE A 1 80  ? -6.194  -8.868  4.626   1.00 0.00 ? 80  ILE A H    2  
ATOM 2990  H HA   . ILE A 1 80  ? -9.099  -8.893  5.108   1.00 0.00 ? 80  ILE A HA   2  
ATOM 2991  H HB   . ILE A 1 80  ? -7.665  -9.104  2.459   1.00 0.00 ? 80  ILE A HB   2  
ATOM 2992  H HG12 . ILE A 1 80  ? -9.182  -6.761  3.625   1.00 0.00 ? 80  ILE A HG12 2  
ATOM 2993  H HG13 . ILE A 1 80  ? -7.427  -6.877  3.549   1.00 0.00 ? 80  ILE A HG13 2  
ATOM 2994  H HG21 . ILE A 1 80  ? -9.883  -10.218 2.611   1.00 0.00 ? 80  ILE A HG21 2  
ATOM 2995  H HG22 . ILE A 1 80  ? -10.590 -8.658  3.030   1.00 0.00 ? 80  ILE A HG22 2  
ATOM 2996  H HG23 . ILE A 1 80  ? -9.834  -8.889  1.453   1.00 0.00 ? 80  ILE A HG23 2  
ATOM 2997  H HD11 . ILE A 1 80  ? -7.410  -6.708  1.216   1.00 0.00 ? 80  ILE A HD11 2  
ATOM 2998  H HD12 . ILE A 1 80  ? -9.137  -7.049  1.094   1.00 0.00 ? 80  ILE A HD12 2  
ATOM 2999  H HD13 . ILE A 1 80  ? -8.585  -5.511  1.756   1.00 0.00 ? 80  ILE A HD13 2  
ATOM 3000  N N    . GLY A 1 81  ? -9.471  -11.337 4.751   1.00 0.00 ? 81  GLY A N    2  
ATOM 3001  C CA   . GLY A 1 81  ? -9.612  -12.782 4.739   1.00 0.00 ? 81  GLY A CA   2  
ATOM 3002  C C    . GLY A 1 81  ? -10.947 -13.229 4.175   1.00 0.00 ? 81  GLY A C    2  
ATOM 3003  O O    . GLY A 1 81  ? -11.656 -12.445 3.547   1.00 0.00 ? 81  GLY A O    2  
ATOM 3004  H H    . GLY A 1 81  ? -10.241 -10.773 4.972   1.00 0.00 ? 81  GLY A H    2  
ATOM 3005  H HA2  . GLY A 1 81  ? -8.820  -13.206 4.140   1.00 0.00 ? 81  GLY A HA2  2  
ATOM 3006  H HA3  . GLY A 1 81  ? -9.520  -13.148 5.750   1.00 0.00 ? 81  GLY A HA3  2  
ATOM 3007  N N    . ASN A 1 82  ? -11.289 -14.493 4.402   1.00 0.00 ? 82  ASN A N    2  
ATOM 3008  C CA   . ASN A 1 82  ? -12.546 -15.044 3.910   1.00 0.00 ? 82  ASN A CA   2  
ATOM 3009  C C    . ASN A 1 82  ? -12.585 -15.031 2.384   1.00 0.00 ? 82  ASN A C    2  
ATOM 3010  O O    . ASN A 1 82  ? -13.658 -14.963 1.781   1.00 0.00 ? 82  ASN A O    2  
ATOM 3011  C CB   . ASN A 1 82  ? -13.729 -14.250 4.469   1.00 0.00 ? 82  ASN A CB   2  
ATOM 3012  C CG   . ASN A 1 82  ? -15.041 -15.000 4.342   1.00 0.00 ? 82  ASN A CG   2  
ATOM 3013  O OD1  . ASN A 1 82  ? -15.082 -16.223 4.465   1.00 0.00 ? 82  ASN A OD1  2  
ATOM 3014  N ND2  . ASN A 1 82  ? -16.119 -14.266 4.093   1.00 0.00 ? 82  ASN A ND2  2  
ATOM 3015  H H    . ASN A 1 82  ? -10.681 -15.069 4.911   1.00 0.00 ? 82  ASN A H    2  
ATOM 3016  H HA   . ASN A 1 82  ? -12.616 -16.066 4.252   1.00 0.00 ? 82  ASN A HA   2  
ATOM 3017  H HB2  . ASN A 1 82  ? -13.553 -14.044 5.514   1.00 0.00 ? 82  ASN A HB2  2  
ATOM 3018  H HB3  . ASN A 1 82  ? -13.814 -13.317 3.931   1.00 0.00 ? 82  ASN A HB3  2  
ATOM 3019  H HD21 . ASN A 1 82  ? -16.010 -13.296 4.006   1.00 0.00 ? 82  ASN A HD21 2  
ATOM 3020  H HD22 . ASN A 1 82  ? -16.981 -14.725 4.006   1.00 0.00 ? 82  ASN A HD22 2  
ATOM 3021  N N    . LEU A 1 83  ? -11.412 -15.099 1.766   1.00 0.00 ? 83  LEU A N    2  
ATOM 3022  C CA   . LEU A 1 83  ? -11.311 -15.097 0.312   1.00 0.00 ? 83  LEU A CA   2  
ATOM 3023  C C    . LEU A 1 83  ? -11.255 -16.520 -0.233  1.00 0.00 ? 83  LEU A C    2  
ATOM 3024  O O    . LEU A 1 83  ? -11.381 -17.489 0.517   1.00 0.00 ? 83  LEU A O    2  
ATOM 3025  C CB   . LEU A 1 83  ? -10.071 -14.319 -0.132  1.00 0.00 ? 83  LEU A CB   2  
ATOM 3026  C CG   . LEU A 1 83  ? -9.761  -13.044 0.654   1.00 0.00 ? 83  LEU A CG   2  
ATOM 3027  C CD1  . LEU A 1 83  ? -8.368  -12.536 0.318   1.00 0.00 ? 83  LEU A CD1  2  
ATOM 3028  C CD2  . LEU A 1 83  ? -10.805 -11.975 0.369   1.00 0.00 ? 83  LEU A CD2  2  
ATOM 3029  H H    . LEU A 1 83  ? -10.591 -15.152 2.300   1.00 0.00 ? 83  LEU A H    2  
ATOM 3030  H HA   . LEU A 1 83  ? -12.192 -14.609 -0.080  1.00 0.00 ? 83  LEU A HA   2  
ATOM 3031  H HB2  . LEU A 1 83  ? -9.219  -14.977 -0.046  1.00 0.00 ? 83  LEU A HB2  2  
ATOM 3032  H HB3  . LEU A 1 83  ? -10.207 -14.045 -1.169  1.00 0.00 ? 83  LEU A HB3  2  
ATOM 3033  H HG   . LEU A 1 83  ? -9.787  -13.267 1.712   1.00 0.00 ? 83  LEU A HG   2  
ATOM 3034  H HD11 . LEU A 1 83  ? -8.345  -12.197 -0.706  1.00 0.00 ? 83  LEU A HD11 2  
ATOM 3035  H HD12 . LEU A 1 83  ? -7.652  -13.334 0.449   1.00 0.00 ? 83  LEU A HD12 2  
ATOM 3036  H HD13 . LEU A 1 83  ? -8.115  -11.716 0.975   1.00 0.00 ? 83  LEU A HD13 2  
ATOM 3037  H HD21 . LEU A 1 83  ? -10.889 -11.831 -0.698  1.00 0.00 ? 83  LEU A HD21 2  
ATOM 3038  H HD22 . LEU A 1 83  ? -10.504 -11.046 0.835   1.00 0.00 ? 83  LEU A HD22 2  
ATOM 3039  H HD23 . LEU A 1 83  ? -11.758 -12.287 0.768   1.00 0.00 ? 83  LEU A HD23 2  
ATOM 3040  N N    . VAL A 1 84  ? -11.060 -16.640 -1.542  1.00 0.00 ? 84  VAL A N    2  
ATOM 3041  C CA   . VAL A 1 84  ? -10.984 -17.946 -2.187  1.00 0.00 ? 84  VAL A CA   2  
ATOM 3042  C C    . VAL A 1 84  ? -9.575  -18.222 -2.703  1.00 0.00 ? 84  VAL A C    2  
ATOM 3043  O O    . VAL A 1 84  ? -8.947  -17.381 -3.345  1.00 0.00 ? 84  VAL A O    2  
ATOM 3044  C CB   . VAL A 1 84  ? -11.977 -18.053 -3.360  1.00 0.00 ? 84  VAL A CB   2  
ATOM 3045  C CG1  . VAL A 1 84  ? -11.717 -16.957 -4.381  1.00 0.00 ? 84  VAL A CG1  2  
ATOM 3046  C CG2  . VAL A 1 84  ? -11.892 -19.427 -4.006  1.00 0.00 ? 84  VAL A CG2  2  
ATOM 3047  H H    . VAL A 1 84  ? -10.967 -15.832 -2.088  1.00 0.00 ? 84  VAL A H    2  
ATOM 3048  H HA   . VAL A 1 84  ? -11.242 -18.696 -1.454  1.00 0.00 ? 84  VAL A HA   2  
ATOM 3049  H HB   . VAL A 1 84  ? -12.977 -17.922 -2.971  1.00 0.00 ? 84  VAL A HB   2  
ATOM 3050  H HG11 . VAL A 1 84  ? -11.715 -15.996 -3.886  1.00 0.00 ? 84  VAL A HG11 2  
ATOM 3051  H HG12 . VAL A 1 84  ? -10.760 -17.123 -4.853  1.00 0.00 ? 84  VAL A HG12 2  
ATOM 3052  H HG13 . VAL A 1 84  ? -12.495 -16.971 -5.130  1.00 0.00 ? 84  VAL A HG13 2  
ATOM 3053  H HG21 . VAL A 1 84  ? -12.522 -19.450 -4.882  1.00 0.00 ? 84  VAL A HG21 2  
ATOM 3054  H HG22 . VAL A 1 84  ? -10.869 -19.628 -4.291  1.00 0.00 ? 84  VAL A HG22 2  
ATOM 3055  H HG23 . VAL A 1 84  ? -12.224 -20.177 -3.304  1.00 0.00 ? 84  VAL A HG23 2  
ATOM 3056  N N    . PRO A 1 85  ? -9.066  -19.429 -2.416  1.00 0.00 ? 85  PRO A N    2  
ATOM 3057  C CA   . PRO A 1 85  ? -7.728  -19.845 -2.841  1.00 0.00 ? 85  PRO A CA   2  
ATOM 3058  C C    . PRO A 1 85  ? -7.638  -20.057 -4.348  1.00 0.00 ? 85  PRO A C    2  
ATOM 3059  O O    . PRO A 1 85  ? -8.653  -20.240 -5.020  1.00 0.00 ? 85  PRO A O    2  
ATOM 3060  C CB   . PRO A 1 85  ? -7.515  -21.169 -2.101  1.00 0.00 ? 85  PRO A CB   2  
ATOM 3061  C CG   . PRO A 1 85  ? -8.889  -21.690 -1.856  1.00 0.00 ? 85  PRO A CG   2  
ATOM 3062  C CD   . PRO A 1 85  ? -9.761  -20.482 -1.655  1.00 0.00 ? 85  PRO A CD   2  
ATOM 3063  H HA   . PRO A 1 85  ? -6.975  -19.135 -2.535  1.00 0.00 ? 85  PRO A HA   2  
ATOM 3064  H HB2  . PRO A 1 85  ? -6.940  -21.842 -2.722  1.00 0.00 ? 85  PRO A HB2  2  
ATOM 3065  H HB3  . PRO A 1 85  ? -6.991  -20.988 -1.175  1.00 0.00 ? 85  PRO A HB3  2  
ATOM 3066  H HG2  . PRO A 1 85  ? -9.225  -22.256 -2.712  1.00 0.00 ? 85  PRO A HG2  2  
ATOM 3067  H HG3  . PRO A 1 85  ? -8.893  -22.308 -0.971  1.00 0.00 ? 85  PRO A HG3  2  
ATOM 3068  H HD2  . PRO A 1 85  ? -10.748 -20.658 -2.052  1.00 0.00 ? 85  PRO A HD2  2  
ATOM 3069  H HD3  . PRO A 1 85  ? -9.814  -20.227 -0.606  1.00 0.00 ? 85  PRO A HD3  2  
ATOM 3070  N N    . GLN A 1 86  ? -6.417  -20.033 -4.875  1.00 0.00 ? 86  GLN A N    2  
ATOM 3071  C CA   . GLN A 1 86  ? -6.197  -20.222 -6.302  1.00 0.00 ? 86  GLN A CA   2  
ATOM 3072  C C    . GLN A 1 86  ? -7.072  -19.277 -7.118  1.00 0.00 ? 86  GLN A C    2  
ATOM 3073  O O    . GLN A 1 86  ? -7.810  -19.707 -8.007  1.00 0.00 ? 86  GLN A O    2  
ATOM 3074  C CB   . GLN A 1 86  ? -6.486  -21.672 -6.698  1.00 0.00 ? 86  GLN A CB   2  
ATOM 3075  C CG   . GLN A 1 86  ? -5.859  -22.693 -5.762  1.00 0.00 ? 86  GLN A CG   2  
ATOM 3076  C CD   . GLN A 1 86  ? -6.011  -24.116 -6.264  1.00 0.00 ? 86  GLN A CD   2  
ATOM 3077  O OE1  . GLN A 1 86  ? -7.125  -24.625 -6.391  1.00 0.00 ? 86  GLN A OE1  2  
ATOM 3078  N NE2  . GLN A 1 86  ? -4.890  -24.765 -6.554  1.00 0.00 ? 86  GLN A NE2  2  
ATOM 3079  H H    . GLN A 1 86  ? -5.647  -19.884 -4.288  1.00 0.00 ? 86  GLN A H    2  
ATOM 3080  H HA   . GLN A 1 86  ? -5.160  -20.002 -6.510  1.00 0.00 ? 86  GLN A HA   2  
ATOM 3081  H HB2  . GLN A 1 86  ? -7.555  -21.826 -6.700  1.00 0.00 ? 86  GLN A HB2  2  
ATOM 3082  H HB3  . GLN A 1 86  ? -6.104  -21.845 -7.693  1.00 0.00 ? 86  GLN A HB3  2  
ATOM 3083  H HG2  . GLN A 1 86  ? -4.807  -22.475 -5.663  1.00 0.00 ? 86  GLN A HG2  2  
ATOM 3084  H HG3  . GLN A 1 86  ? -6.333  -22.616 -4.795  1.00 0.00 ? 86  GLN A HG3  2  
ATOM 3085  H HE21 . GLN A 1 86  ? -4.038  -24.296 -6.427  1.00 0.00 ? 86  GLN A HE21 2  
ATOM 3086  H HE22 . GLN A 1 86  ? -4.960  -25.686 -6.879  1.00 0.00 ? 86  GLN A HE22 2  
ATOM 3087  N N    . LYS A 1 87  ? -6.985  -17.986 -6.813  1.00 0.00 ? 87  LYS A N    2  
ATOM 3088  C CA   . LYS A 1 87  ? -7.769  -16.979 -7.518  1.00 0.00 ? 87  LYS A CA   2  
ATOM 3089  C C    . LYS A 1 87  ? -7.069  -15.623 -7.481  1.00 0.00 ? 87  LYS A C    2  
ATOM 3090  O O    . LYS A 1 87  ? -6.736  -15.114 -6.411  1.00 0.00 ? 87  LYS A O    2  
ATOM 3091  C CB   . LYS A 1 87  ? -9.164  -16.863 -6.900  1.00 0.00 ? 87  LYS A CB   2  
ATOM 3092  C CG   . LYS A 1 87  ? -10.051 -18.067 -7.168  1.00 0.00 ? 87  LYS A CG   2  
ATOM 3093  C CD   . LYS A 1 87  ? -10.265 -18.279 -8.656  1.00 0.00 ? 87  LYS A CD   2  
ATOM 3094  C CE   . LYS A 1 87  ? -11.741 -18.227 -9.019  1.00 0.00 ? 87  LYS A CE   2  
ATOM 3095  N NZ   . LYS A 1 87  ? -11.959 -18.403 -10.482 1.00 0.00 ? 87  LYS A NZ   2  
ATOM 3096  H H    . LYS A 1 87  ? -6.380  -17.705 -6.095  1.00 0.00 ? 87  LYS A H    2  
ATOM 3097  H HA   . LYS A 1 87  ? -7.864  -17.293 -8.546  1.00 0.00 ? 87  LYS A HA   2  
ATOM 3098  H HB2  . LYS A 1 87  ? -9.063  -16.748 -5.831  1.00 0.00 ? 87  LYS A HB2  2  
ATOM 3099  H HB3  . LYS A 1 87  ? -9.650  -15.987 -7.302  1.00 0.00 ? 87  LYS A HB3  2  
ATOM 3100  H HG2  . LYS A 1 87  ? -9.581  -18.946 -6.754  1.00 0.00 ? 87  LYS A HG2  2  
ATOM 3101  H HG3  . LYS A 1 87  ? -11.007 -17.909 -6.694  1.00 0.00 ? 87  LYS A HG3  2  
ATOM 3102  H HD2  . LYS A 1 87  ? -9.745  -17.506 -9.201  1.00 0.00 ? 87  LYS A HD2  2  
ATOM 3103  H HD3  . LYS A 1 87  ? -9.869  -19.247 -8.934  1.00 0.00 ? 87  LYS A HD3  2  
ATOM 3104  H HE2  . LYS A 1 87  ? -12.257 -19.014 -8.491  1.00 0.00 ? 87  LYS A HE2  2  
ATOM 3105  H HE3  . LYS A 1 87  ? -12.138 -17.270 -8.718  1.00 0.00 ? 87  LYS A HE3  2  
ATOM 3106  H HZ1  . LYS A 1 87  ? -11.987 -19.416 -10.720 1.00 0.00 ? 87  LYS A HZ1  2  
ATOM 3107  H HZ2  . LYS A 1 87  ? -11.188 -17.955 -11.015 1.00 0.00 ? 87  LYS A HZ2  2  
ATOM 3108  H HZ3  . LYS A 1 87  ? -12.861 -17.967 -10.765 1.00 0.00 ? 87  LYS A HZ3  2  
ATOM 3109  N N    . THR A 1 88  ? -6.852  -15.042 -8.656  1.00 0.00 ? 88  THR A N    2  
ATOM 3110  C CA   . THR A 1 88  ? -6.194  -13.746 -8.757  1.00 0.00 ? 88  THR A CA   2  
ATOM 3111  C C    . THR A 1 88  ? -7.028  -12.652 -8.099  1.00 0.00 ? 88  THR A C    2  
ATOM 3112  O O    . THR A 1 88  ? -8.241  -12.579 -8.298  1.00 0.00 ? 88  THR A O    2  
ATOM 3113  C CB   . THR A 1 88  ? -5.933  -13.361 -10.227 1.00 0.00 ? 88  THR A CB   2  
ATOM 3114  O OG1  . THR A 1 88  ? -5.088  -14.337 -10.845 1.00 0.00 ? 88  THR A OG1  2  
ATOM 3115  C CG2  . THR A 1 88  ? -5.285  -11.987 -10.319 1.00 0.00 ? 88  THR A CG2  2  
ATOM 3116  H H    . THR A 1 88  ? -7.142  -15.497 -9.474  1.00 0.00 ? 88  THR A H    2  
ATOM 3117  H HA   . THR A 1 88  ? -5.242  -13.814 -8.251  1.00 0.00 ? 88  THR A HA   2  
ATOM 3118  H HB   . THR A 1 88  ? -6.880  -13.333 -10.749 1.00 0.00 ? 88  THR A HB   2  
ATOM 3119  H HG1  . THR A 1 88  ? -4.591  -13.925 -11.557 1.00 0.00 ? 88  THR A HG1  2  
ATOM 3120  H HG21 . THR A 1 88  ? -4.943  -11.819 -11.330 1.00 0.00 ? 88  THR A HG21 2  
ATOM 3121  H HG22 . THR A 1 88  ? -4.447  -11.939 -9.641  1.00 0.00 ? 88  THR A HG22 2  
ATOM 3122  H HG23 . THR A 1 88  ? -6.008  -11.231 -10.055 1.00 0.00 ? 88  THR A HG23 2  
ATOM 3123  N N    . TYR A 1 89  ? -6.370  -11.806 -7.313  1.00 0.00 ? 89  TYR A N    2  
ATOM 3124  C CA   . TYR A 1 89  ? -7.053  -10.717 -6.624  1.00 0.00 ? 89  TYR A CA   2  
ATOM 3125  C C    . TYR A 1 89  ? -6.302  -9.401  -6.807  1.00 0.00 ? 89  TYR A C    2  
ATOM 3126  O O    . TYR A 1 89  ? -5.085  -9.339  -6.633  1.00 0.00 ? 89  TYR A O    2  
ATOM 3127  C CB   . TYR A 1 89  ? -7.190  -11.036 -5.134  1.00 0.00 ? 89  TYR A CB   2  
ATOM 3128  C CG   . TYR A 1 89  ? -8.546  -11.586 -4.756  1.00 0.00 ? 89  TYR A CG   2  
ATOM 3129  C CD1  . TYR A 1 89  ? -9.641  -10.742 -4.608  1.00 0.00 ? 89  TYR A CD1  2  
ATOM 3130  C CD2  . TYR A 1 89  ? -8.734  -12.945 -4.544  1.00 0.00 ? 89  TYR A CD2  2  
ATOM 3131  C CE1  . TYR A 1 89  ? -10.884 -11.240 -4.261  1.00 0.00 ? 89  TYR A CE1  2  
ATOM 3132  C CE2  . TYR A 1 89  ? -9.972  -13.452 -4.198  1.00 0.00 ? 89  TYR A CE2  2  
ATOM 3133  C CZ   . TYR A 1 89  ? -11.043 -12.594 -4.058  1.00 0.00 ? 89  TYR A CZ   2  
ATOM 3134  O OH   . TYR A 1 89  ? -12.278 -13.095 -3.712  1.00 0.00 ? 89  TYR A OH   2  
ATOM 3135  H H    . TYR A 1 89  ? -5.404  -11.917 -7.194  1.00 0.00 ? 89  TYR A H    2  
ATOM 3136  H HA   . TYR A 1 89  ? -8.038  -10.619 -7.053  1.00 0.00 ? 89  TYR A HA   2  
ATOM 3137  H HB2  . TYR A 1 89  ? -6.447  -11.769 -4.861  1.00 0.00 ? 89  TYR A HB2  2  
ATOM 3138  H HB3  . TYR A 1 89  ? -7.025  -10.133 -4.563  1.00 0.00 ? 89  TYR A HB3  2  
ATOM 3139  H HD1  . TYR A 1 89  ? -9.514  -9.682  -4.767  1.00 0.00 ? 89  TYR A HD1  2  
ATOM 3140  H HD2  . TYR A 1 89  ? -7.892  -13.614 -4.655  1.00 0.00 ? 89  TYR A HD2  2  
ATOM 3141  H HE1  . TYR A 1 89  ? -11.724 -10.569 -4.150  1.00 0.00 ? 89  TYR A HE1  2  
ATOM 3142  H HE2  . TYR A 1 89  ? -10.097 -14.512 -4.038  1.00 0.00 ? 89  TYR A HE2  2  
ATOM 3143  H HH   . TYR A 1 89  ? -12.857 -12.371 -3.462  1.00 0.00 ? 89  TYR A HH   2  
ATOM 3144  N N    . SER A 1 90  ? -7.038  -8.352  -7.157  1.00 0.00 ? 90  SER A N    2  
ATOM 3145  C CA   . SER A 1 90  ? -6.443  -7.037  -7.368  1.00 0.00 ? 90  SER A CA   2  
ATOM 3146  C C    . SER A 1 90  ? -6.377  -6.255  -6.059  1.00 0.00 ? 90  SER A C    2  
ATOM 3147  O O    . SER A 1 90  ? -7.139  -6.516  -5.128  1.00 0.00 ? 90  SER A O    2  
ATOM 3148  C CB   . SER A 1 90  ? -7.245  -6.250  -8.406  1.00 0.00 ? 90  SER A CB   2  
ATOM 3149  O OG   . SER A 1 90  ? -6.882  -6.626  -9.722  1.00 0.00 ? 90  SER A OG   2  
ATOM 3150  H H    . SER A 1 90  ? -8.004  -8.464  -7.280  1.00 0.00 ? 90  SER A H    2  
ATOM 3151  H HA   . SER A 1 90  ? -5.438  -7.183  -7.737  1.00 0.00 ? 90  SER A HA   2  
ATOM 3152  H HB2  . SER A 1 90  ? -8.298  -6.446  -8.265  1.00 0.00 ? 90  SER A HB2  2  
ATOM 3153  H HB3  . SER A 1 90  ? -7.054  -5.194  -8.278  1.00 0.00 ? 90  SER A HB3  2  
ATOM 3154  H HG   . SER A 1 90  ? -7.103  -7.548  -9.865  1.00 0.00 ? 90  SER A HG   2  
ATOM 3155  N N    . VAL A 1 91  ? -5.458  -5.296  -5.995  1.00 0.00 ? 91  VAL A N    2  
ATOM 3156  C CA   . VAL A 1 91  ? -5.292  -4.475  -4.802  1.00 0.00 ? 91  VAL A CA   2  
ATOM 3157  C C    . VAL A 1 91  ? -4.793  -3.080  -5.160  1.00 0.00 ? 91  VAL A C    2  
ATOM 3158  O O    . VAL A 1 91  ? -3.791  -2.928  -5.860  1.00 0.00 ? 91  VAL A O    2  
ATOM 3159  C CB   . VAL A 1 91  ? -4.310  -5.121  -3.808  1.00 0.00 ? 91  VAL A CB   2  
ATOM 3160  C CG1  . VAL A 1 91  ? -4.127  -4.236  -2.585  1.00 0.00 ? 91  VAL A CG1  2  
ATOM 3161  C CG2  . VAL A 1 91  ? -4.793  -6.506  -3.406  1.00 0.00 ? 91  VAL A CG2  2  
ATOM 3162  H H    . VAL A 1 91  ? -4.880  -5.136  -6.770  1.00 0.00 ? 91  VAL A H    2  
ATOM 3163  H HA   . VAL A 1 91  ? -6.256  -4.388  -4.319  1.00 0.00 ? 91  VAL A HA   2  
ATOM 3164  H HB   . VAL A 1 91  ? -3.352  -5.224  -4.296  1.00 0.00 ? 91  VAL A HB   2  
ATOM 3165  H HG11 . VAL A 1 91  ? -5.078  -4.109  -2.088  1.00 0.00 ? 91  VAL A HG11 2  
ATOM 3166  H HG12 . VAL A 1 91  ? -3.422  -4.697  -1.908  1.00 0.00 ? 91  VAL A HG12 2  
ATOM 3167  H HG13 . VAL A 1 91  ? -3.752  -3.271  -2.893  1.00 0.00 ? 91  VAL A HG13 2  
ATOM 3168  H HG21 . VAL A 1 91  ? -4.743  -7.167  -4.259  1.00 0.00 ? 91  VAL A HG21 2  
ATOM 3169  H HG22 . VAL A 1 91  ? -4.166  -6.893  -2.615  1.00 0.00 ? 91  VAL A HG22 2  
ATOM 3170  H HG23 . VAL A 1 91  ? -5.814  -6.445  -3.058  1.00 0.00 ? 91  VAL A HG23 2  
ATOM 3171  N N    . LYS A 1 92  ? -5.496  -2.063  -4.675  1.00 0.00 ? 92  LYS A N    2  
ATOM 3172  C CA   . LYS A 1 92  ? -5.122  -0.678  -4.942  1.00 0.00 ? 92  LYS A CA   2  
ATOM 3173  C C    . LYS A 1 92  ? -5.261  0.175   -3.684  1.00 0.00 ? 92  LYS A C    2  
ATOM 3174  O O    . LYS A 1 92  ? -6.312  0.186   -3.042  1.00 0.00 ? 92  LYS A O    2  
ATOM 3175  C CB   . LYS A 1 92  ? -5.993  -0.101  -6.061  1.00 0.00 ? 92  LYS A CB   2  
ATOM 3176  C CG   . LYS A 1 92  ? -6.075  -0.991  -7.288  1.00 0.00 ? 92  LYS A CG   2  
ATOM 3177  C CD   . LYS A 1 92  ? -6.767  -0.287  -8.443  1.00 0.00 ? 92  LYS A CD   2  
ATOM 3178  C CE   . LYS A 1 92  ? -5.850  0.732   -9.103  1.00 0.00 ? 92  LYS A CE   2  
ATOM 3179  N NZ   . LYS A 1 92  ? -5.936  0.673   -10.589 1.00 0.00 ? 92  LYS A NZ   2  
ATOM 3180  H H    . LYS A 1 92  ? -6.285  -2.247  -4.123  1.00 0.00 ? 92  LYS A H    2  
ATOM 3181  H HA   . LYS A 1 92  ? -4.090  -0.667  -5.258  1.00 0.00 ? 92  LYS A HA   2  
ATOM 3182  H HB2  . LYS A 1 92  ? -6.992  0.050   -5.682  1.00 0.00 ? 92  LYS A HB2  2  
ATOM 3183  H HB3  . LYS A 1 92  ? -5.583  0.853   -6.361  1.00 0.00 ? 92  LYS A HB3  2  
ATOM 3184  H HG2  . LYS A 1 92  ? -5.076  -1.263  -7.593  1.00 0.00 ? 92  LYS A HG2  2  
ATOM 3185  H HG3  . LYS A 1 92  ? -6.632  -1.883  -7.036  1.00 0.00 ? 92  LYS A HG3  2  
ATOM 3186  H HD2  . LYS A 1 92  ? -7.059  -1.023  -9.178  1.00 0.00 ? 92  LYS A HD2  2  
ATOM 3187  H HD3  . LYS A 1 92  ? -7.645  0.221   -8.069  1.00 0.00 ? 92  LYS A HD3  2  
ATOM 3188  H HE2  . LYS A 1 92  ? -6.134  1.718   -8.774  1.00 0.00 ? 92  LYS A HE2  2  
ATOM 3189  H HE3  . LYS A 1 92  ? -4.834  0.530   -8.800  1.00 0.00 ? 92  LYS A HE3  2  
ATOM 3190  H HZ1  . LYS A 1 92  ? -4.985  0.758   -11.004 1.00 0.00 ? 92  LYS A HZ1  2  
ATOM 3191  H HZ2  . LYS A 1 92  ? -6.528  1.451   -10.944 1.00 0.00 ? 92  LYS A HZ2  2  
ATOM 3192  H HZ3  . LYS A 1 92  ? -6.353  -0.231  -10.887 1.00 0.00 ? 92  LYS A HZ3  2  
ATOM 3193  N N    . VAL A 1 93  ? -4.194  0.888   -3.339  1.00 0.00 ? 93  VAL A N    2  
ATOM 3194  C CA   . VAL A 1 93  ? -4.198  1.747   -2.160  1.00 0.00 ? 93  VAL A CA   2  
ATOM 3195  C C    . VAL A 1 93  ? -3.901  3.194   -2.532  1.00 0.00 ? 93  VAL A C    2  
ATOM 3196  O O    . VAL A 1 93  ? -3.165  3.464   -3.483  1.00 0.00 ? 93  VAL A O    2  
ATOM 3197  C CB   . VAL A 1 93  ? -3.165  1.274   -1.118  1.00 0.00 ? 93  VAL A CB   2  
ATOM 3198  C CG1  . VAL A 1 93  ? -3.306  2.066   0.172   1.00 0.00 ? 93  VAL A CG1  2  
ATOM 3199  C CG2  . VAL A 1 93  ? -3.318  -0.217  -0.857  1.00 0.00 ? 93  VAL A CG2  2  
ATOM 3200  H H    . VAL A 1 93  ? -3.387  0.838   -3.890  1.00 0.00 ? 93  VAL A H    2  
ATOM 3201  H HA   . VAL A 1 93  ? -5.179  1.694   -1.712  1.00 0.00 ? 93  VAL A HA   2  
ATOM 3202  H HB   . VAL A 1 93  ? -2.177  1.448   -1.516  1.00 0.00 ? 93  VAL A HB   2  
ATOM 3203  H HG11 . VAL A 1 93  ? -3.222  1.398   1.016   1.00 0.00 ? 93  VAL A HG11 2  
ATOM 3204  H HG12 . VAL A 1 93  ? -2.529  2.815   0.222   1.00 0.00 ? 93  VAL A HG12 2  
ATOM 3205  H HG13 . VAL A 1 93  ? -4.274  2.549   0.194   1.00 0.00 ? 93  VAL A HG13 2  
ATOM 3206  H HG21 . VAL A 1 93  ? -3.086  -0.426  0.177   1.00 0.00 ? 93  VAL A HG21 2  
ATOM 3207  H HG22 . VAL A 1 93  ? -4.335  -0.518  -1.064  1.00 0.00 ? 93  VAL A HG22 2  
ATOM 3208  H HG23 . VAL A 1 93  ? -2.643  -0.766  -1.496  1.00 0.00 ? 93  VAL A HG23 2  
ATOM 3209  N N    . LEU A 1 94  ? -4.477  4.124   -1.778  1.00 0.00 ? 94  LEU A N    2  
ATOM 3210  C CA   . LEU A 1 94  ? -4.274  5.547   -2.028  1.00 0.00 ? 94  LEU A CA   2  
ATOM 3211  C C    . LEU A 1 94  ? -4.331  6.341   -0.728  1.00 0.00 ? 94  LEU A C    2  
ATOM 3212  O O    . LEU A 1 94  ? -4.731  5.820   0.313   1.00 0.00 ? 94  LEU A O    2  
ATOM 3213  C CB   . LEU A 1 94  ? -5.328  6.068   -3.006  1.00 0.00 ? 94  LEU A CB   2  
ATOM 3214  C CG   . LEU A 1 94  ? -6.683  6.434   -2.400  1.00 0.00 ? 94  LEU A CG   2  
ATOM 3215  C CD1  . LEU A 1 94  ? -6.715  7.901   -2.006  1.00 0.00 ? 94  LEU A CD1  2  
ATOM 3216  C CD2  . LEU A 1 94  ? -7.806  6.116   -3.376  1.00 0.00 ? 94  LEU A CD2  2  
ATOM 3217  H H    . LEU A 1 94  ? -5.052  3.848   -1.035  1.00 0.00 ? 94  LEU A H    2  
ATOM 3218  H HA   . LEU A 1 94  ? -3.294  5.668   -2.468  1.00 0.00 ? 94  LEU A HA   2  
ATOM 3219  H HB2  . LEU A 1 94  ? -4.930  6.951   -3.480  1.00 0.00 ? 94  LEU A HB2  2  
ATOM 3220  H HB3  . LEU A 1 94  ? -5.492  5.304   -3.752  1.00 0.00 ? 94  LEU A HB3  2  
ATOM 3221  H HG   . LEU A 1 94  ? -6.840  5.845   -1.506  1.00 0.00 ? 94  LEU A HG   2  
ATOM 3222  H HD11 . LEU A 1 94  ? -6.423  8.004   -0.972  1.00 0.00 ? 94  LEU A HD11 2  
ATOM 3223  H HD12 . LEU A 1 94  ? -7.714  8.288   -2.138  1.00 0.00 ? 94  LEU A HD12 2  
ATOM 3224  H HD13 . LEU A 1 94  ? -6.029  8.456   -2.631  1.00 0.00 ? 94  LEU A HD13 2  
ATOM 3225  H HD21 . LEU A 1 94  ? -8.068  7.010   -3.925  1.00 0.00 ? 94  LEU A HD21 2  
ATOM 3226  H HD22 . LEU A 1 94  ? -8.669  5.765   -2.829  1.00 0.00 ? 94  LEU A HD22 2  
ATOM 3227  H HD23 . LEU A 1 94  ? -7.480  5.353   -4.066  1.00 0.00 ? 94  LEU A HD23 2  
ATOM 3228  N N    . ALA A 1 95  ? -3.931  7.607   -0.796  1.00 0.00 ? 95  ALA A N    2  
ATOM 3229  C CA   . ALA A 1 95  ? -3.942  8.476   0.374   1.00 0.00 ? 95  ALA A CA   2  
ATOM 3230  C C    . ALA A 1 95  ? -4.874  9.664   0.168   1.00 0.00 ? 95  ALA A C    2  
ATOM 3231  O O    . ALA A 1 95  ? -4.916  10.253  -0.913  1.00 0.00 ? 95  ALA A O    2  
ATOM 3232  C CB   . ALA A 1 95  ? -2.533  8.955   0.688   1.00 0.00 ? 95  ALA A CB   2  
ATOM 3233  H H    . ALA A 1 95  ? -3.623  7.965   -1.654  1.00 0.00 ? 95  ALA A H    2  
ATOM 3234  H HA   . ALA A 1 95  ? -4.295  7.897   1.216   1.00 0.00 ? 95  ALA A HA   2  
ATOM 3235  H HB1  . ALA A 1 95  ? -2.266  8.654   1.691   1.00 0.00 ? 95  ALA A HB1  2  
ATOM 3236  H HB2  . ALA A 1 95  ? -1.840  8.520   -0.016  1.00 0.00 ? 95  ALA A HB2  2  
ATOM 3237  H HB3  . ALA A 1 95  ? -2.495  10.032  0.613   1.00 0.00 ? 95  ALA A HB3  2  
ATOM 3238  N N    . PHE A 1 96  ? -5.620  10.014  1.210   1.00 0.00 ? 96  PHE A N    2  
ATOM 3239  C CA   . PHE A 1 96  ? -6.554  11.133  1.141   1.00 0.00 ? 96  PHE A CA   2  
ATOM 3240  C C    . PHE A 1 96  ? -6.554  11.921  2.448   1.00 0.00 ? 96  PHE A C    2  
ATOM 3241  O O    . PHE A 1 96  ? -6.374  11.356  3.528   1.00 0.00 ? 96  PHE A O    2  
ATOM 3242  C CB   . PHE A 1 96  ? -7.966  10.629  0.837   1.00 0.00 ? 96  PHE A CB   2  
ATOM 3243  C CG   . PHE A 1 96  ? -8.613  9.923   1.993   1.00 0.00 ? 96  PHE A CG   2  
ATOM 3244  C CD1  . PHE A 1 96  ? -9.332  10.634  2.942   1.00 0.00 ? 96  PHE A CD1  2  
ATOM 3245  C CD2  . PHE A 1 96  ? -8.504  8.549   2.133   1.00 0.00 ? 96  PHE A CD2  2  
ATOM 3246  C CE1  . PHE A 1 96  ? -9.929  9.988   4.007   1.00 0.00 ? 96  PHE A CE1  2  
ATOM 3247  C CE2  . PHE A 1 96  ? -9.100  7.898   3.196   1.00 0.00 ? 96  PHE A CE2  2  
ATOM 3248  C CZ   . PHE A 1 96  ? -9.812  8.618   4.134   1.00 0.00 ? 96  PHE A CZ   2  
ATOM 3249  H H    . PHE A 1 96  ? -5.542  9.508   2.046   1.00 0.00 ? 96  PHE A H    2  
ATOM 3250  H HA   . PHE A 1 96  ? -6.232  11.784  0.342   1.00 0.00 ? 96  PHE A HA   2  
ATOM 3251  H HB2  . PHE A 1 96  ? -8.589  11.467  0.568   1.00 0.00 ? 96  PHE A HB2  2  
ATOM 3252  H HB3  . PHE A 1 96  ? -7.921  9.938   0.007   1.00 0.00 ? 96  PHE A HB3  2  
ATOM 3253  H HD1  . PHE A 1 96  ? -9.423  11.707  2.842   1.00 0.00 ? 96  PHE A HD1  2  
ATOM 3254  H HD2  . PHE A 1 96  ? -7.947  7.984   1.401   1.00 0.00 ? 96  PHE A HD2  2  
ATOM 3255  H HE1  . PHE A 1 96  ? -10.486 10.554  4.739   1.00 0.00 ? 96  PHE A HE1  2  
ATOM 3256  H HE2  . PHE A 1 96  ? -9.008  6.826   3.295   1.00 0.00 ? 96  PHE A HE2  2  
ATOM 3257  H HZ   . PHE A 1 96  ? -10.280 8.112   4.966   1.00 0.00 ? 96  PHE A HZ   2  
ATOM 3258  N N    . THR A 1 97  ? -6.757  13.231  2.343   1.00 0.00 ? 97  THR A N    2  
ATOM 3259  C CA   . THR A 1 97  ? -6.780  14.098  3.513   1.00 0.00 ? 97  THR A CA   2  
ATOM 3260  C C    . THR A 1 97  ? -8.086  14.880  3.593   1.00 0.00 ? 97  THR A C    2  
ATOM 3261  O O    . THR A 1 97  ? -8.962  14.731  2.741   1.00 0.00 ? 97  THR A O    2  
ATOM 3262  C CB   . THR A 1 97  ? -5.601  15.089  3.502   1.00 0.00 ? 97  THR A CB   2  
ATOM 3263  O OG1  . THR A 1 97  ? -5.664  15.910  2.330   1.00 0.00 ? 97  THR A OG1  2  
ATOM 3264  C CG2  . THR A 1 97  ? -4.272  14.350  3.537   1.00 0.00 ? 97  THR A CG2  2  
ATOM 3265  H H    . THR A 1 97  ? -6.894  13.621  1.454   1.00 0.00 ? 97  THR A H    2  
ATOM 3266  H HA   . THR A 1 97  ? -6.691  13.475  4.391   1.00 0.00 ? 97  THR A HA   2  
ATOM 3267  H HB   . THR A 1 97  ? -5.670  15.719  4.376   1.00 0.00 ? 97  THR A HB   2  
ATOM 3268  H HG1  . THR A 1 97  ? -5.114  16.688  2.455   1.00 0.00 ? 97  THR A HG1  2  
ATOM 3269  H HG21 . THR A 1 97  ? -3.895  14.236  2.533   1.00 0.00 ? 97  THR A HG21 2  
ATOM 3270  H HG22 . THR A 1 97  ? -4.414  13.375  3.982   1.00 0.00 ? 97  THR A HG22 2  
ATOM 3271  H HG23 . THR A 1 97  ? -3.563  14.914  4.126   1.00 0.00 ? 97  THR A HG23 2  
ATOM 3272  N N    . SER A 1 98  ? -8.209  15.713  4.621   1.00 0.00 ? 98  SER A N    2  
ATOM 3273  C CA   . SER A 1 98  ? -9.410  16.518  4.813   1.00 0.00 ? 98  SER A CA   2  
ATOM 3274  C C    . SER A 1 98  ? -9.668  17.409  3.602   1.00 0.00 ? 98  SER A C    2  
ATOM 3275  O O    . SER A 1 98  ? -10.807 17.787  3.326   1.00 0.00 ? 98  SER A O    2  
ATOM 3276  C CB   . SER A 1 98  ? -9.279  17.375  6.074   1.00 0.00 ? 98  SER A CB   2  
ATOM 3277  O OG   . SER A 1 98  ? -8.807  18.674  5.759   1.00 0.00 ? 98  SER A OG   2  
ATOM 3278  H H    . SER A 1 98  ? -7.475  15.788  5.267   1.00 0.00 ? 98  SER A H    2  
ATOM 3279  H HA   . SER A 1 98  ? -10.245 15.842  4.932   1.00 0.00 ? 98  SER A HA   2  
ATOM 3280  H HB2  . SER A 1 98  ? -10.244 17.462  6.548   1.00 0.00 ? 98  SER A HB2  2  
ATOM 3281  H HB3  . SER A 1 98  ? -8.583  16.907  6.754   1.00 0.00 ? 98  SER A HB3  2  
ATOM 3282  H HG   . SER A 1 98  ? -7.928  18.612  5.378   1.00 0.00 ? 98  SER A HG   2  
ATOM 3283  N N    . ILE A 1 99  ? -8.601  17.742  2.883   1.00 0.00 ? 99  ILE A N    2  
ATOM 3284  C CA   . ILE A 1 99  ? -8.710  18.588  1.701   1.00 0.00 ? 99  ILE A CA   2  
ATOM 3285  C C    . ILE A 1 99  ? -9.384  17.844  0.553   1.00 0.00 ? 99  ILE A C    2  
ATOM 3286  O O    . ILE A 1 99  ? -10.423 18.267  0.050   1.00 0.00 ? 99  ILE A O    2  
ATOM 3287  C CB   . ILE A 1 99  ? -7.328  19.085  1.235   1.00 0.00 ? 99  ILE A CB   2  
ATOM 3288  C CG1  . ILE A 1 99  ? -6.640  19.868  2.355   1.00 0.00 ? 99  ILE A CG1  2  
ATOM 3289  C CG2  . ILE A 1 99  ? -7.468  19.945  -0.013  1.00 0.00 ? 99  ILE A CG2  2  
ATOM 3290  C CD1  . ILE A 1 99  ? -7.440  21.053  2.845   1.00 0.00 ? 99  ILE A CD1  2  
ATOM 3291  H H    . ILE A 1 99  ? -7.719  17.410  3.154   1.00 0.00 ? 99  ILE A H    2  
ATOM 3292  H HA   . ILE A 1 99  ? -9.311  19.447  1.961   1.00 0.00 ? 99  ILE A HA   2  
ATOM 3293  H HB   . ILE A 1 99  ? -6.727  18.224  0.983   1.00 0.00 ? 99  ILE A HB   2  
ATOM 3294  H HG12 . ILE A 1 99  ? -6.473  19.211  3.194   1.00 0.00 ? 99  ILE A HG12 2  
ATOM 3295  H HG13 . ILE A 1 99  ? -5.689  20.233  1.994   1.00 0.00 ? 99  ILE A HG13 2  
ATOM 3296  H HG21 . ILE A 1 99  ? -6.886  20.847  0.106   1.00 0.00 ? 99  ILE A HG21 2  
ATOM 3297  H HG22 . ILE A 1 99  ? -7.111  19.396  -0.870  1.00 0.00 ? 99  ILE A HG22 2  
ATOM 3298  H HG23 . ILE A 1 99  ? -8.507  20.203  -0.157  1.00 0.00 ? 99  ILE A HG23 2  
ATOM 3299  H HD11 . ILE A 1 99  ? -7.958  21.506  2.011   1.00 0.00 ? 99  ILE A HD11 2  
ATOM 3300  H HD12 . ILE A 1 99  ? -8.158  20.725  3.580   1.00 0.00 ? 99  ILE A HD12 2  
ATOM 3301  H HD13 . ILE A 1 99  ? -6.773  21.778  3.291   1.00 0.00 ? 99  ILE A HD13 2  
ATOM 3302  N N    . GLY A 1 100 ? -8.785  16.729  0.144   1.00 0.00 ? 100 GLY A N    2  
ATOM 3303  C CA   . GLY A 1 100 ? -9.343  15.942  -0.939  1.00 0.00 ? 100 GLY A CA   2  
ATOM 3304  C C    . GLY A 1 100 ? -8.775  14.538  -0.987  1.00 0.00 ? 100 GLY A C    2  
ATOM 3305  O O    . GLY A 1 100 ? -8.337  14.003  0.031   1.00 0.00 ? 100 GLY A O    2  
ATOM 3306  H H    . GLY A 1 100 ? -7.958  16.438  0.584   1.00 0.00 ? 100 GLY A H    2  
ATOM 3307  H HA2  . GLY A 1 100 ? -10.414 15.884  -0.814  1.00 0.00 ? 100 GLY A HA2  2  
ATOM 3308  H HA3  . GLY A 1 100 ? -9.127  16.437  -1.876  1.00 0.00 ? 100 GLY A HA3  2  
ATOM 3309  N N    . ASP A 1 101 ? -8.785  13.937  -2.173  1.00 0.00 ? 101 ASP A N    2  
ATOM 3310  C CA   . ASP A 1 101 ? -8.269  12.585  -2.349  1.00 0.00 ? 101 ASP A CA   2  
ATOM 3311  C C    . ASP A 1 101 ? -6.955  12.601  -3.124  1.00 0.00 ? 101 ASP A C    2  
ATOM 3312  O O    . ASP A 1 101 ? -6.642  13.570  -3.815  1.00 0.00 ? 101 ASP A O    2  
ATOM 3313  C CB   . ASP A 1 101 ? -9.294  11.715  -3.079  1.00 0.00 ? 101 ASP A CB   2  
ATOM 3314  C CG   . ASP A 1 101 ? -10.019 12.471  -4.176  1.00 0.00 ? 101 ASP A CG   2  
ATOM 3315  O OD1  . ASP A 1 101 ? -9.350  12.913  -5.133  1.00 0.00 ? 101 ASP A OD1  2  
ATOM 3316  O OD2  . ASP A 1 101 ? -11.254 12.621  -4.076  1.00 0.00 ? 101 ASP A OD2  2  
ATOM 3317  H H    . ASP A 1 101 ? -9.149  14.415  -2.947  1.00 0.00 ? 101 ASP A H    2  
ATOM 3318  H HA   . ASP A 1 101 ? -8.089  12.168  -1.369  1.00 0.00 ? 101 ASP A HA   2  
ATOM 3319  H HB2  . ASP A 1 101 ? -8.789  10.870  -3.523  1.00 0.00 ? 101 ASP A HB2  2  
ATOM 3320  H HB3  . ASP A 1 101 ? -10.026 11.359  -2.368  1.00 0.00 ? 101 ASP A HB3  2  
ATOM 3321  N N    . GLY A 1 102 ? -6.188  11.522  -3.002  1.00 0.00 ? 102 GLY A N    2  
ATOM 3322  C CA   . GLY A 1 102 ? -4.916  11.434  -3.695  1.00 0.00 ? 102 GLY A CA   2  
ATOM 3323  C C    . GLY A 1 102 ? -4.913  10.364  -4.770  1.00 0.00 ? 102 GLY A C    2  
ATOM 3324  O O    . GLY A 1 102 ? -5.820  9.535   -4.851  1.00 0.00 ? 102 GLY A O    2  
ATOM 3325  H H    . GLY A 1 102 ? -6.488  10.780  -2.437  1.00 0.00 ? 102 GLY A H    2  
ATOM 3326  H HA2  . GLY A 1 102 ? -4.700  12.389  -4.153  1.00 0.00 ? 102 GLY A HA2  2  
ATOM 3327  H HA3  . GLY A 1 102 ? -4.142  11.208  -2.977  1.00 0.00 ? 102 GLY A HA3  2  
ATOM 3328  N N    . PRO A 1 103 ? -3.876  10.376  -5.620  1.00 0.00 ? 103 PRO A N    2  
ATOM 3329  C CA   . PRO A 1 103 ? -3.737  9.405   -6.710  1.00 0.00 ? 103 PRO A CA   2  
ATOM 3330  C C    . PRO A 1 103 ? -3.429  8.002   -6.201  1.00 0.00 ? 103 PRO A C    2  
ATOM 3331  O O    . PRO A 1 103 ? -2.622  7.825   -5.287  1.00 0.00 ? 103 PRO A O    2  
ATOM 3332  C CB   . PRO A 1 103 ? -2.557  9.950   -7.519  1.00 0.00 ? 103 PRO A CB   2  
ATOM 3333  C CG   . PRO A 1 103 ? -1.764  10.751  -6.544  1.00 0.00 ? 103 PRO A CG   2  
ATOM 3334  C CD   . PRO A 1 103 ? -2.761  11.337  -5.582  1.00 0.00 ? 103 PRO A CD   2  
ATOM 3335  H HA   . PRO A 1 103 ? -4.619  9.377   -7.333  1.00 0.00 ? 103 PRO A HA   2  
ATOM 3336  H HB2  . PRO A 1 103 ? -1.980  9.129   -7.918  1.00 0.00 ? 103 PRO A HB2  2  
ATOM 3337  H HB3  . PRO A 1 103 ? -2.923  10.565  -8.328  1.00 0.00 ? 103 PRO A HB3  2  
ATOM 3338  H HG2  . PRO A 1 103 ? -1.071  10.109  -6.021  1.00 0.00 ? 103 PRO A HG2  2  
ATOM 3339  H HG3  . PRO A 1 103 ? -1.234  11.537  -7.058  1.00 0.00 ? 103 PRO A HG3  2  
ATOM 3340  H HD2  . PRO A 1 103 ? -2.338  11.397  -4.591  1.00 0.00 ? 103 PRO A HD2  2  
ATOM 3341  H HD3  . PRO A 1 103 ? -3.082  12.312  -5.919  1.00 0.00 ? 103 PRO A HD3  2  
ATOM 3342  N N    . LEU A 1 104 ? -4.077  7.007   -6.797  1.00 0.00 ? 104 LEU A N    2  
ATOM 3343  C CA   . LEU A 1 104 ? -3.872  5.617   -6.403  1.00 0.00 ? 104 LEU A CA   2  
ATOM 3344  C C    . LEU A 1 104 ? -2.444  5.172   -6.699  1.00 0.00 ? 104 LEU A C    2  
ATOM 3345  O O    . LEU A 1 104 ? -1.671  5.902   -7.321  1.00 0.00 ? 104 LEU A O    2  
ATOM 3346  C CB   . LEU A 1 104 ? -4.863  4.708   -7.135  1.00 0.00 ? 104 LEU A CB   2  
ATOM 3347  C CG   . LEU A 1 104 ? -6.330  4.855   -6.732  1.00 0.00 ? 104 LEU A CG   2  
ATOM 3348  C CD1  . LEU A 1 104 ? -7.207  5.021   -7.963  1.00 0.00 ? 104 LEU A CD1  2  
ATOM 3349  C CD2  . LEU A 1 104 ? -6.780  3.656   -5.911  1.00 0.00 ? 104 LEU A CD2  2  
ATOM 3350  H H    . LEU A 1 104 ? -4.707  7.210   -7.519  1.00 0.00 ? 104 LEU A H    2  
ATOM 3351  H HA   . LEU A 1 104 ? -4.046  5.544   -5.341  1.00 0.00 ? 104 LEU A HA   2  
ATOM 3352  H HB2  . LEU A 1 104 ? -4.787  4.919   -8.191  1.00 0.00 ? 104 LEU A HB2  2  
ATOM 3353  H HB3  . LEU A 1 104 ? -4.569  3.685   -6.950  1.00 0.00 ? 104 LEU A HB3  2  
ATOM 3354  H HG   . LEU A 1 104 ? -6.443  5.741   -6.121  1.00 0.00 ? 104 LEU A HG   2  
ATOM 3355  H HD11 . LEU A 1 104 ? -6.726  5.689   -8.661  1.00 0.00 ? 104 LEU A HD11 2  
ATOM 3356  H HD12 . LEU A 1 104 ? -8.163  5.431   -7.673  1.00 0.00 ? 104 LEU A HD12 2  
ATOM 3357  H HD13 . LEU A 1 104 ? -7.357  4.058   -8.430  1.00 0.00 ? 104 LEU A HD13 2  
ATOM 3358  H HD21 . LEU A 1 104 ? -7.855  3.559   -5.977  1.00 0.00 ? 104 LEU A HD21 2  
ATOM 3359  H HD22 . LEU A 1 104 ? -6.496  3.799   -4.879  1.00 0.00 ? 104 LEU A HD22 2  
ATOM 3360  H HD23 . LEU A 1 104 ? -6.313  2.761   -6.295  1.00 0.00 ? 104 LEU A HD23 2  
ATOM 3361  N N    . SER A 1 105 ? -2.100  3.968   -6.251  1.00 0.00 ? 105 SER A N    2  
ATOM 3362  C CA   . SER A 1 105 ? -0.762  3.426   -6.467  1.00 0.00 ? 105 SER A CA   2  
ATOM 3363  C C    . SER A 1 105 ? -0.752  2.460   -7.648  1.00 0.00 ? 105 SER A C    2  
ATOM 3364  O O    . SER A 1 105 ? -1.779  2.232   -8.287  1.00 0.00 ? 105 SER A O    2  
ATOM 3365  C CB   . SER A 1 105 ? -0.271  2.713   -5.206  1.00 0.00 ? 105 SER A CB   2  
ATOM 3366  O OG   . SER A 1 105 ? -1.312  1.967   -4.602  1.00 0.00 ? 105 SER A OG   2  
ATOM 3367  H H    . SER A 1 105 ? -2.760  3.434   -5.764  1.00 0.00 ? 105 SER A H    2  
ATOM 3368  H HA   . SER A 1 105 ? -0.102  4.252   -6.685  1.00 0.00 ? 105 SER A HA   2  
ATOM 3369  H HB2  . SER A 1 105 ? 0.534   2.041   -5.467  1.00 0.00 ? 105 SER A HB2  2  
ATOM 3370  H HB3  . SER A 1 105 ? 0.089   3.447   -4.499  1.00 0.00 ? 105 SER A HB3  2  
ATOM 3371  H HG   . SER A 1 105 ? -1.901  1.631   -5.282  1.00 0.00 ? 105 SER A HG   2  
ATOM 3372  N N    . SER A 1 106 ? 0.419   1.898   -7.934  1.00 0.00 ? 106 SER A N    2  
ATOM 3373  C CA   . SER A 1 106 ? 0.565   0.960   -9.040  1.00 0.00 ? 106 SER A CA   2  
ATOM 3374  C C    . SER A 1 106 ? -0.314  -0.269  -8.832  1.00 0.00 ? 106 SER A C    2  
ATOM 3375  O O    . SER A 1 106 ? -0.203  -0.961  -7.818  1.00 0.00 ? 106 SER A O    2  
ATOM 3376  C CB   . SER A 1 106 ? 2.028   0.535   -9.185  1.00 0.00 ? 106 SER A CB   2  
ATOM 3377  O OG   . SER A 1 106 ? 2.751   0.782   -7.992  1.00 0.00 ? 106 SER A OG   2  
ATOM 3378  H H    . SER A 1 106 ? 1.201   2.121   -7.387  1.00 0.00 ? 106 SER A H    2  
ATOM 3379  H HA   . SER A 1 106 ? 0.253   1.462   -9.943  1.00 0.00 ? 106 SER A HA   2  
ATOM 3380  H HB2  . SER A 1 106 ? 2.074   -0.520  -9.408  1.00 0.00 ? 106 SER A HB2  2  
ATOM 3381  H HB3  . SER A 1 106 ? 2.484   1.093   -9.990  1.00 0.00 ? 106 SER A HB3  2  
ATOM 3382  H HG   . SER A 1 106 ? 3.664   0.508   -8.109  1.00 0.00 ? 106 SER A HG   2  
ATOM 3383  N N    . ASP A 1 107 ? -1.187  -0.535  -9.796  1.00 0.00 ? 107 ASP A N    2  
ATOM 3384  C CA   . ASP A 1 107 ? -2.086  -1.681  -9.720  1.00 0.00 ? 107 ASP A CA   2  
ATOM 3385  C C    . ASP A 1 107 ? -1.306  -2.969  -9.476  1.00 0.00 ? 107 ASP A C    2  
ATOM 3386  O O    . ASP A 1 107 ? -0.578  -3.440  -10.351 1.00 0.00 ? 107 ASP A O    2  
ATOM 3387  C CB   . ASP A 1 107 ? -2.903  -1.800  -11.007 1.00 0.00 ? 107 ASP A CB   2  
ATOM 3388  C CG   . ASP A 1 107 ? -2.073  -1.534  -12.248 1.00 0.00 ? 107 ASP A CG   2  
ATOM 3389  O OD1  . ASP A 1 107 ? -1.970  -0.356  -12.650 1.00 0.00 ? 107 ASP A OD1  2  
ATOM 3390  O OD2  . ASP A 1 107 ? -1.527  -2.503  -12.815 1.00 0.00 ? 107 ASP A OD2  2  
ATOM 3391  H H    . ASP A 1 107 ? -1.227  0.054   -10.579 1.00 0.00 ? 107 ASP A H    2  
ATOM 3392  H HA   . ASP A 1 107 ? -2.759  -1.519  -8.892  1.00 0.00 ? 107 ASP A HA   2  
ATOM 3393  H HB2  . ASP A 1 107 ? -3.309  -2.800  -11.076 1.00 0.00 ? 107 ASP A HB2  2  
ATOM 3394  H HB3  . ASP A 1 107 ? -3.715  -1.089  -10.979 1.00 0.00 ? 107 ASP A HB3  2  
ATOM 3395  N N    . ILE A 1 108 ? -1.461  -3.532  -8.282  1.00 0.00 ? 108 ILE A N    2  
ATOM 3396  C CA   . ILE A 1 108 ? -0.771  -4.765  -7.925  1.00 0.00 ? 108 ILE A CA   2  
ATOM 3397  C C    . ILE A 1 108 ? -1.746  -5.933  -7.833  1.00 0.00 ? 108 ILE A C    2  
ATOM 3398  O O    . ILE A 1 108 ? -2.933  -5.744  -7.563  1.00 0.00 ? 108 ILE A O    2  
ATOM 3399  C CB   . ILE A 1 108 ? -0.028  -4.623  -6.583  1.00 0.00 ? 108 ILE A CB   2  
ATOM 3400  C CG1  . ILE A 1 108 ? -0.981  -4.123  -5.497  1.00 0.00 ? 108 ILE A CG1  2  
ATOM 3401  C CG2  . ILE A 1 108 ? 1.158   -3.682  -6.733  1.00 0.00 ? 108 ILE A CG2  2  
ATOM 3402  C CD1  . ILE A 1 108 ? -0.442  -4.297  -4.094  1.00 0.00 ? 108 ILE A CD1  2  
ATOM 3403  H H    . ILE A 1 108 ? -2.054  -3.108  -7.629  1.00 0.00 ? 108 ILE A H    2  
ATOM 3404  H HA   . ILE A 1 108 ? -0.046  -4.976  -8.696  1.00 0.00 ? 108 ILE A HA   2  
ATOM 3405  H HB   . ILE A 1 108 ? 0.350   -5.595  -6.303  1.00 0.00 ? 108 ILE A HB   2  
ATOM 3406  H HG12 . ILE A 1 108 ? -1.171  -3.072  -5.650  1.00 0.00 ? 108 ILE A HG12 2  
ATOM 3407  H HG13 . ILE A 1 108 ? -1.911  -4.668  -5.566  1.00 0.00 ? 108 ILE A HG13 2  
ATOM 3408  H HG21 . ILE A 1 108 ? 1.266   -3.401  -7.770  1.00 0.00 ? 108 ILE A HG21 2  
ATOM 3409  H HG22 . ILE A 1 108 ? 0.991   -2.798  -6.136  1.00 0.00 ? 108 ILE A HG22 2  
ATOM 3410  H HG23 . ILE A 1 108 ? 2.056   -4.177  -6.396  1.00 0.00 ? 108 ILE A HG23 2  
ATOM 3411  H HD11 . ILE A 1 108 ? 0.476   -3.739  -3.988  1.00 0.00 ? 108 ILE A HD11 2  
ATOM 3412  H HD12 . ILE A 1 108 ? -1.168  -3.935  -3.382  1.00 0.00 ? 108 ILE A HD12 2  
ATOM 3413  H HD13 . ILE A 1 108 ? -0.248  -5.344  -3.910  1.00 0.00 ? 108 ILE A HD13 2  
ATOM 3414  N N    . GLN A 1 109 ? -1.237  -7.140  -8.056  1.00 0.00 ? 109 GLN A N    2  
ATOM 3415  C CA   . GLN A 1 109 ? -2.063  -8.340  -7.997  1.00 0.00 ? 109 GLN A CA   2  
ATOM 3416  C C    . GLN A 1 109 ? -1.363  -9.446  -7.213  1.00 0.00 ? 109 GLN A C    2  
ATOM 3417  O O    . GLN A 1 109 ? -0.142  -9.590  -7.279  1.00 0.00 ? 109 GLN A O    2  
ATOM 3418  C CB   . GLN A 1 109 ? -2.392  -8.830  -9.408  1.00 0.00 ? 109 GLN A CB   2  
ATOM 3419  C CG   . GLN A 1 109 ? -3.509  -8.046  -10.079 1.00 0.00 ? 109 GLN A CG   2  
ATOM 3420  C CD   . GLN A 1 109 ? -3.156  -7.619  -11.489 1.00 0.00 ? 109 GLN A CD   2  
ATOM 3421  O OE1  . GLN A 1 109 ? -2.326  -8.242  -12.149 1.00 0.00 ? 109 GLN A OE1  2  
ATOM 3422  N NE2  . GLN A 1 109 ? -3.790  -6.551  -11.960 1.00 0.00 ? 109 GLN A NE2  2  
ATOM 3423  H H    . GLN A 1 109 ? -0.285  -7.226  -8.266  1.00 0.00 ? 109 GLN A H    2  
ATOM 3424  H HA   . GLN A 1 109 ? -2.983  -8.085  -7.491  1.00 0.00 ? 109 GLN A HA   2  
ATOM 3425  H HB2  . GLN A 1 109 ? -1.507  -8.748  -10.019 1.00 0.00 ? 109 GLN A HB2  2  
ATOM 3426  H HB3  . GLN A 1 109 ? -2.690  -9.866  -9.356  1.00 0.00 ? 109 GLN A HB3  2  
ATOM 3427  H HG2  . GLN A 1 109 ? -4.393  -8.666  -10.117 1.00 0.00 ? 109 GLN A HG2  2  
ATOM 3428  H HG3  . GLN A 1 109 ? -3.716  -7.163  -9.491  1.00 0.00 ? 109 GLN A HG3  2  
ATOM 3429  H HE21 . GLN A 1 109 ? -4.440  -6.104  -11.377 1.00 0.00 ? 109 GLN A HE21 2  
ATOM 3430  H HE22 . GLN A 1 109 ? -3.581  -6.252  -12.869 1.00 0.00 ? 109 GLN A HE22 2  
ATOM 3431  N N    . VAL A 1 110 ? -2.143  -10.223 -6.469  1.00 0.00 ? 110 VAL A N    2  
ATOM 3432  C CA   . VAL A 1 110 ? -1.598  -11.317 -5.673  1.00 0.00 ? 110 VAL A CA   2  
ATOM 3433  C C    . VAL A 1 110 ? -2.510  -12.537 -5.718  1.00 0.00 ? 110 VAL A C    2  
ATOM 3434  O O    . VAL A 1 110 ? -3.722  -12.425 -5.528  1.00 0.00 ? 110 VAL A O    2  
ATOM 3435  C CB   . VAL A 1 110 ? -1.393  -10.895 -4.206  1.00 0.00 ? 110 VAL A CB   2  
ATOM 3436  C CG1  . VAL A 1 110 ? -2.707  -10.422 -3.598  1.00 0.00 ? 110 VAL A CG1  2  
ATOM 3437  C CG2  . VAL A 1 110 ? -0.806  -12.042 -3.399  1.00 0.00 ? 110 VAL A CG2  2  
ATOM 3438  H H    . VAL A 1 110 ? -3.110  -10.060 -6.456  1.00 0.00 ? 110 VAL A H    2  
ATOM 3439  H HA   . VAL A 1 110 ? -0.637  -11.583 -6.087  1.00 0.00 ? 110 VAL A HA   2  
ATOM 3440  H HB   . VAL A 1 110 ? -0.695  -10.071 -4.183  1.00 0.00 ? 110 VAL A HB   2  
ATOM 3441  H HG11 . VAL A 1 110 ? -3.232  -9.806  -4.312  1.00 0.00 ? 110 VAL A HG11 2  
ATOM 3442  H HG12 . VAL A 1 110 ? -3.314  -11.278 -3.344  1.00 0.00 ? 110 VAL A HG12 2  
ATOM 3443  H HG13 . VAL A 1 110 ? -2.503  -9.848  -2.706  1.00 0.00 ? 110 VAL A HG13 2  
ATOM 3444  H HG21 . VAL A 1 110 ? -0.306  -11.648 -2.526  1.00 0.00 ? 110 VAL A HG21 2  
ATOM 3445  H HG22 . VAL A 1 110 ? -1.597  -12.708 -3.089  1.00 0.00 ? 110 VAL A HG22 2  
ATOM 3446  H HG23 . VAL A 1 110 ? -0.098  -12.585 -4.008  1.00 0.00 ? 110 VAL A HG23 2  
ATOM 3447  N N    . ILE A 1 111 ? -1.920  -13.701 -5.967  1.00 0.00 ? 111 ILE A N    2  
ATOM 3448  C CA   . ILE A 1 111 ? -2.680  -14.943 -6.034  1.00 0.00 ? 111 ILE A CA   2  
ATOM 3449  C C    . ILE A 1 111 ? -2.775  -15.605 -4.664  1.00 0.00 ? 111 ILE A C    2  
ATOM 3450  O O    . ILE A 1 111 ? -1.787  -15.696 -3.935  1.00 0.00 ? 111 ILE A O    2  
ATOM 3451  C CB   . ILE A 1 111 ? -2.049  -15.937 -7.028  1.00 0.00 ? 111 ILE A CB   2  
ATOM 3452  C CG1  . ILE A 1 111 ? -1.981  -15.319 -8.426  1.00 0.00 ? 111 ILE A CG1  2  
ATOM 3453  C CG2  . ILE A 1 111 ? -2.842  -17.234 -7.055  1.00 0.00 ? 111 ILE A CG2  2  
ATOM 3454  C CD1  . ILE A 1 111 ? -0.649  -15.525 -9.114  1.00 0.00 ? 111 ILE A CD1  2  
ATOM 3455  H H    . ILE A 1 111 ? -0.952  -13.725 -6.109  1.00 0.00 ? 111 ILE A H    2  
ATOM 3456  H HA   . ILE A 1 111 ? -3.677  -14.705 -6.378  1.00 0.00 ? 111 ILE A HA   2  
ATOM 3457  H HB   . ILE A 1 111 ? -1.048  -16.160 -6.692  1.00 0.00 ? 111 ILE A HB   2  
ATOM 3458  H HG12 . ILE A 1 111 ? -2.745  -15.760 -9.046  1.00 0.00 ? 111 ILE A HG12 2  
ATOM 3459  H HG13 . ILE A 1 111 ? -2.154  -14.255 -8.349  1.00 0.00 ? 111 ILE A HG13 2  
ATOM 3460  H HG21 . ILE A 1 111 ? -3.861  -17.040 -6.759  1.00 0.00 ? 111 ILE A HG21 2  
ATOM 3461  H HG22 . ILE A 1 111 ? -2.829  -17.642 -8.055  1.00 0.00 ? 111 ILE A HG22 2  
ATOM 3462  H HG23 . ILE A 1 111 ? -2.397  -17.943 -6.372  1.00 0.00 ? 111 ILE A HG23 2  
ATOM 3463  H HD11 . ILE A 1 111 ? -0.176  -14.569 -9.279  1.00 0.00 ? 111 ILE A HD11 2  
ATOM 3464  H HD12 . ILE A 1 111 ? -0.014  -16.140 -8.493  1.00 0.00 ? 111 ILE A HD12 2  
ATOM 3465  H HD13 . ILE A 1 111 ? -0.807  -16.015 -10.064 1.00 0.00 ? 111 ILE A HD13 2  
ATOM 3466  N N    . THR A 1 112 ? -3.973  -16.067 -4.317  1.00 0.00 ? 112 THR A N    2  
ATOM 3467  C CA   . THR A 1 112 ? -4.198  -16.721 -3.034  1.00 0.00 ? 112 THR A CA   2  
ATOM 3468  C C    . THR A 1 112 ? -3.567  -18.107 -3.006  1.00 0.00 ? 112 THR A C    2  
ATOM 3469  O O    . THR A 1 112 ? -4.191  -19.090 -3.407  1.00 0.00 ? 112 THR A O    2  
ATOM 3470  C CB   . THR A 1 112 ? -5.702  -16.845 -2.724  1.00 0.00 ? 112 THR A CB   2  
ATOM 3471  O OG1  . THR A 1 112 ? -6.413  -17.246 -3.900  1.00 0.00 ? 112 THR A OG1  2  
ATOM 3472  C CG2  . THR A 1 112 ? -6.260  -15.526 -2.213  1.00 0.00 ? 112 THR A CG2  2  
ATOM 3473  H H    . THR A 1 112 ? -4.722  -15.964 -4.940  1.00 0.00 ? 112 THR A H    2  
ATOM 3474  H HA   . THR A 1 112 ? -3.742  -16.113 -2.266  1.00 0.00 ? 112 THR A HA   2  
ATOM 3475  H HB   . THR A 1 112 ? -5.834  -17.596 -1.958  1.00 0.00 ? 112 THR A HB   2  
ATOM 3476  H HG1  . THR A 1 112 ? -6.647  -16.470 -4.414  1.00 0.00 ? 112 THR A HG1  2  
ATOM 3477  H HG21 . THR A 1 112 ? -7.205  -15.324 -2.696  1.00 0.00 ? 112 THR A HG21 2  
ATOM 3478  H HG22 . THR A 1 112 ? -5.564  -14.730 -2.433  1.00 0.00 ? 112 THR A HG22 2  
ATOM 3479  H HG23 . THR A 1 112 ? -6.409  -15.588 -1.145  1.00 0.00 ? 112 THR A HG23 2  
ATOM 3480  N N    . GLN A 1 113 ? -2.329  -18.181 -2.530  1.00 0.00 ? 113 GLN A N    2  
ATOM 3481  C CA   . GLN A 1 113 ? -1.615  -19.449 -2.450  1.00 0.00 ? 113 GLN A CA   2  
ATOM 3482  C C    . GLN A 1 113 ? -0.738  -19.504 -1.203  1.00 0.00 ? 113 GLN A C    2  
ATOM 3483  O O    . GLN A 1 113 ? -0.043  -18.539 -0.877  1.00 0.00 ? 113 GLN A O    2  
ATOM 3484  C CB   . GLN A 1 113 ? -0.757  -19.656 -3.700  1.00 0.00 ? 113 GLN A CB   2  
ATOM 3485  C CG   . GLN A 1 113 ? 0.493   -18.790 -3.730  1.00 0.00 ? 113 GLN A CG   2  
ATOM 3486  C CD   . GLN A 1 113 ? 1.269   -18.930 -5.025  1.00 0.00 ? 113 GLN A CD   2  
ATOM 3487  O OE1  . GLN A 1 113 ? 0.798   -19.550 -5.980  1.00 0.00 ? 113 GLN A OE1  2  
ATOM 3488  N NE2  . GLN A 1 113 ? 2.465   -18.355 -5.063  1.00 0.00 ? 113 GLN A NE2  2  
ATOM 3489  H H    . GLN A 1 113 ? -1.885  -17.362 -2.225  1.00 0.00 ? 113 GLN A H    2  
ATOM 3490  H HA   . GLN A 1 113 ? -2.348  -20.239 -2.393  1.00 0.00 ? 113 GLN A HA   2  
ATOM 3491  H HB2  . GLN A 1 113 ? -0.455  -20.691 -3.747  1.00 0.00 ? 113 GLN A HB2  2  
ATOM 3492  H HB3  . GLN A 1 113 ? -1.351  -19.423 -4.572  1.00 0.00 ? 113 GLN A HB3  2  
ATOM 3493  H HG2  . GLN A 1 113 ? 0.203   -17.756 -3.613  1.00 0.00 ? 113 GLN A HG2  2  
ATOM 3494  H HG3  . GLN A 1 113 ? 1.134   -19.079 -2.910  1.00 0.00 ? 113 GLN A HG3  2  
ATOM 3495  H HE21 . GLN A 1 113 ? 2.775   -17.880 -4.264  1.00 0.00 ? 113 GLN A HE21 2  
ATOM 3496  H HE22 . GLN A 1 113 ? 2.988   -18.431 -5.888  1.00 0.00 ? 113 GLN A HE22 2  
ATOM 3497  N N    . THR A 1 114 ? -0.776  -20.636 -0.507  1.00 0.00 ? 114 THR A N    2  
ATOM 3498  C CA   . THR A 1 114 ? 0.013   -20.814 0.705   1.00 0.00 ? 114 THR A CA   2  
ATOM 3499  C C    . THR A 1 114 ? 1.454   -21.185 0.373   1.00 0.00 ? 114 THR A C    2  
ATOM 3500  O O    . THR A 1 114 ? 2.388   -20.753 1.048   1.00 0.00 ? 114 THR A O    2  
ATOM 3501  C CB   . THR A 1 114 ? -0.590  -21.903 1.611   1.00 0.00 ? 114 THR A CB   2  
ATOM 3502  O OG1  . THR A 1 114 ? -0.867  -23.082 0.845   1.00 0.00 ? 114 THR A OG1  2  
ATOM 3503  C CG2  . THR A 1 114 ? -1.868  -21.412 2.274   1.00 0.00 ? 114 THR A CG2  2  
ATOM 3504  H H    . THR A 1 114 ? -1.349  -21.367 -0.818  1.00 0.00 ? 114 THR A H    2  
ATOM 3505  H HA   . THR A 1 114 ? 0.008   -19.881 1.247   1.00 0.00 ? 114 THR A HA   2  
ATOM 3506  H HB   . THR A 1 114 ? 0.127   -22.147 2.383   1.00 0.00 ? 114 THR A HB   2  
ATOM 3507  H HG1  . THR A 1 114 ? -0.060  -23.383 0.419   1.00 0.00 ? 114 THR A HG1  2  
ATOM 3508  H HG21 . THR A 1 114 ? -2.623  -22.181 2.217   1.00 0.00 ? 114 THR A HG21 2  
ATOM 3509  H HG22 . THR A 1 114 ? -2.219  -20.526 1.763   1.00 0.00 ? 114 THR A HG22 2  
ATOM 3510  H HG23 . THR A 1 114 ? -1.668  -21.176 3.308   1.00 0.00 ? 114 THR A HG23 2  
ATOM 3511  N N    . GLY A 1 115 ? 1.628   -21.988 -0.674  1.00 0.00 ? 115 GLY A N    2  
ATOM 3512  C CA   . GLY A 1 115 ? 2.959   -22.404 -1.076  1.00 0.00 ? 115 GLY A CA   2  
ATOM 3513  C C    . GLY A 1 115 ? 3.040   -22.736 -2.552  1.00 0.00 ? 115 GLY A C    2  
ATOM 3514  O O    . GLY A 1 115 ? 2.256   -22.228 -3.354  1.00 0.00 ? 115 GLY A O    2  
ATOM 3515  H H    . GLY A 1 115 ? 0.846   -22.302 -1.174  1.00 0.00 ? 115 GLY A H    2  
ATOM 3516  H HA2  . GLY A 1 115 ? 3.653   -21.606 -0.859  1.00 0.00 ? 115 GLY A HA2  2  
ATOM 3517  H HA3  . GLY A 1 115 ? 3.239   -23.277 -0.506  1.00 0.00 ? 115 GLY A HA3  2  
ATOM 3518  N N    . SER A 1 116 ? 3.991   -23.592 -2.914  1.00 0.00 ? 116 SER A N    2  
ATOM 3519  C CA   . SER A 1 116 ? 4.175   -23.988 -4.304  1.00 0.00 ? 116 SER A CA   2  
ATOM 3520  C C    . SER A 1 116 ? 3.245   -25.142 -4.668  1.00 0.00 ? 116 SER A C    2  
ATOM 3521  O O    . SER A 1 116 ? 2.549   -25.686 -3.813  1.00 0.00 ? 116 SER A O    2  
ATOM 3522  C CB   . SER A 1 116 ? 5.630   -24.391 -4.555  1.00 0.00 ? 116 SER A CB   2  
ATOM 3523  O OG   . SER A 1 116 ? 6.517   -23.346 -4.194  1.00 0.00 ? 116 SER A OG   2  
ATOM 3524  H H    . SER A 1 116 ? 4.584   -23.963 -2.228  1.00 0.00 ? 116 SER A H    2  
ATOM 3525  H HA   . SER A 1 116 ? 3.934   -23.138 -4.926  1.00 0.00 ? 116 SER A HA   2  
ATOM 3526  H HB2  . SER A 1 116 ? 5.864   -25.266 -3.967  1.00 0.00 ? 116 SER A HB2  2  
ATOM 3527  H HB3  . SER A 1 116 ? 5.763   -24.616 -5.603  1.00 0.00 ? 116 SER A HB3  2  
ATOM 3528  H HG   . SER A 1 116 ? 7.056   -23.626 -3.451  1.00 0.00 ? 116 SER A HG   2  
ATOM 3529  N N    . GLY A 1 117 ? 3.243   -25.512 -5.946  1.00 0.00 ? 117 GLY A N    2  
ATOM 3530  C CA   . GLY A 1 117 ? 2.396   -26.599 -6.401  1.00 0.00 ? 117 GLY A CA   2  
ATOM 3531  C C    . GLY A 1 117 ? 3.135   -27.570 -7.301  1.00 0.00 ? 117 GLY A C    2  
ATOM 3532  O O    . GLY A 1 117 ? 2.870   -27.663 -8.500  1.00 0.00 ? 117 GLY A O    2  
ATOM 3533  H H    . GLY A 1 117 ? 3.820   -25.042 -6.584  1.00 0.00 ? 117 GLY A H    2  
ATOM 3534  H HA2  . GLY A 1 117 ? 2.023   -27.135 -5.542  1.00 0.00 ? 117 GLY A HA2  2  
ATOM 3535  H HA3  . GLY A 1 117 ? 1.561   -26.185 -6.947  1.00 0.00 ? 117 GLY A HA3  2  
ATOM 3536  N N    . PRO A 1 118 ? 4.086   -28.316 -6.720  1.00 0.00 ? 118 PRO A N    2  
ATOM 3537  C CA   . PRO A 1 118 ? 4.885   -29.297 -7.459  1.00 0.00 ? 118 PRO A CA   2  
ATOM 3538  C C    . PRO A 1 118 ? 4.064   -30.507 -7.891  1.00 0.00 ? 118 PRO A C    2  
ATOM 3539  O O    . PRO A 1 118 ? 3.926   -31.475 -7.143  1.00 0.00 ? 118 PRO A O    2  
ATOM 3540  C CB   . PRO A 1 118 ? 5.959   -29.713 -6.451  1.00 0.00 ? 118 PRO A CB   2  
ATOM 3541  C CG   . PRO A 1 118 ? 5.347   -29.456 -5.118  1.00 0.00 ? 118 PRO A CG   2  
ATOM 3542  C CD   . PRO A 1 118 ? 4.454   -28.259 -5.295  1.00 0.00 ? 118 PRO A CD   2  
ATOM 3543  H HA   . PRO A 1 118 ? 5.353   -28.856 -8.325  1.00 0.00 ? 118 PRO A HA   2  
ATOM 3544  H HB2  . PRO A 1 118 ? 6.194   -30.759 -6.583  1.00 0.00 ? 118 PRO A HB2  2  
ATOM 3545  H HB3  . PRO A 1 118 ? 6.846   -29.117 -6.598  1.00 0.00 ? 118 PRO A HB3  2  
ATOM 3546  H HG2  . PRO A 1 118 ? 4.766   -30.313 -4.809  1.00 0.00 ? 118 PRO A HG2  2  
ATOM 3547  H HG3  . PRO A 1 118 ? 6.119   -29.244 -4.394  1.00 0.00 ? 118 PRO A HG3  2  
ATOM 3548  H HD2  . PRO A 1 118 ? 3.580   -28.343 -4.667  1.00 0.00 ? 118 PRO A HD2  2  
ATOM 3549  H HD3  . PRO A 1 118 ? 4.994   -27.350 -5.074  1.00 0.00 ? 118 PRO A HD3  2  
ATOM 3550  N N    . SER A 1 119 ? 3.516   -30.445 -9.101  1.00 0.00 ? 119 SER A N    2  
ATOM 3551  C CA   . SER A 1 119 ? 2.705   -31.534 -9.630  1.00 0.00 ? 119 SER A CA   2  
ATOM 3552  C C    . SER A 1 119 ? 3.300   -32.074 -10.927 1.00 0.00 ? 119 SER A C    2  
ATOM 3553  O O    . SER A 1 119 ? 4.368   -31.642 -11.360 1.00 0.00 ? 119 SER A O    2  
ATOM 3554  C CB   . SER A 1 119 ? 1.271   -31.060 -9.872  1.00 0.00 ? 119 SER A CB   2  
ATOM 3555  O OG   . SER A 1 119 ? 0.766   -30.366 -8.744  1.00 0.00 ? 119 SER A OG   2  
ATOM 3556  H H    . SER A 1 119 ? 3.662   -29.645 -9.650  1.00 0.00 ? 119 SER A H    2  
ATOM 3557  H HA   . SER A 1 119 ? 2.694   -32.327 -8.897  1.00 0.00 ? 119 SER A HA   2  
ATOM 3558  H HB2  . SER A 1 119 ? 1.253   -30.397 -10.725 1.00 0.00 ? 119 SER A HB2  2  
ATOM 3559  H HB3  . SER A 1 119 ? 0.640   -31.914 -10.069 1.00 0.00 ? 119 SER A HB3  2  
ATOM 3560  H HG   . SER A 1 119 ? 0.054   -30.874 -8.348  1.00 0.00 ? 119 SER A HG   2  
ATOM 3561  N N    . SER A 1 120 ? 2.599   -33.020 -11.545 1.00 0.00 ? 120 SER A N    2  
ATOM 3562  C CA   . SER A 1 120 ? 3.058   -33.624 -12.790 1.00 0.00 ? 120 SER A CA   2  
ATOM 3563  C C    . SER A 1 120 ? 4.396   -34.331 -12.591 1.00 0.00 ? 120 SER A C    2  
ATOM 3564  O O    . SER A 1 120 ? 4.992   -34.263 -11.516 1.00 0.00 ? 120 SER A O    2  
ATOM 3565  C CB   . SER A 1 120 ? 3.190   -32.556 -13.878 1.00 0.00 ? 120 SER A CB   2  
ATOM 3566  O OG   . SER A 1 120 ? 2.807   -33.068 -15.143 1.00 0.00 ? 120 SER A OG   2  
ATOM 3567  H H    . SER A 1 120 ? 1.754   -33.323 -11.149 1.00 0.00 ? 120 SER A H    2  
ATOM 3568  H HA   . SER A 1 120 ? 2.322   -34.351 -13.098 1.00 0.00 ? 120 SER A HA   2  
ATOM 3569  H HB2  . SER A 1 120 ? 2.556   -31.718 -13.636 1.00 0.00 ? 120 SER A HB2  2  
ATOM 3570  H HB3  . SER A 1 120 ? 4.218   -32.227 -13.934 1.00 0.00 ? 120 SER A HB3  2  
ATOM 3571  H HG   . SER A 1 120 ? 1.930   -32.749 -15.365 1.00 0.00 ? 120 SER A HG   2  
ATOM 3572  N N    . GLY A 1 121 ? 4.861   -35.010 -13.635 1.00 0.00 ? 121 GLY A N    2  
ATOM 3573  C CA   . GLY A 1 121 ? 6.123   -35.721 -13.555 1.00 0.00 ? 121 GLY A CA   2  
ATOM 3574  C C    . GLY A 1 121 ? 5.939   -37.222 -13.470 1.00 0.00 ? 121 GLY A C    2  
ATOM 3575  O O    . GLY A 1 121 ? 5.484   -37.854 -14.425 1.00 0.00 ? 121 GLY A O    2  
ATOM 3576  H H    . GLY A 1 121 ? 4.341   -35.028 -14.466 1.00 0.00 ? 121 GLY A H    2  
ATOM 3577  H HA2  . GLY A 1 121 ? 6.709   -35.489 -14.431 1.00 0.00 ? 121 GLY A HA2  2  
ATOM 3578  H HA3  . GLY A 1 121 ? 6.656   -35.385 -12.678 1.00 0.00 ? 121 GLY A HA3  2  
ATOM 3579  N N    . GLY A 1 1   ? 25.645  9.656   -0.997  1.00 0.00 ? 1   GLY A N    3  
ATOM 3580  C CA   . GLY A 1 1   ? 24.876  10.856  -0.722  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3581  C C    . GLY A 1 1   ? 23.397  10.670  -0.992  1.00 0.00 ? 1   GLY A C    3  
ATOM 3582  O O    . GLY A 1 1   ? 22.696  10.013  -0.222  1.00 0.00 ? 1   GLY A O    3  
ATOM 3583  H H1   . GLY A 1 1   ? 25.237  8.919   -1.501  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3584  H HA2  . GLY A 1 1   ? 25.012  11.126  0.313   1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3585  H HA3  . GLY A 1 1   ? 25.246  11.657  -1.344  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3586  N N    . SER A 1 2   ? 22.918  11.253  -2.087  1.00 0.00 ? 2   SER A N    3  
ATOM 3587  C CA   . SER A 1 2   ? 21.510  11.154  -2.453  1.00 0.00 ? 2   SER A CA   3  
ATOM 3588  C C    . SER A 1 2   ? 20.618  11.638  -1.314  1.00 0.00 ? 2   SER A C    3  
ATOM 3589  O O    . SER A 1 2   ? 19.638  10.984  -0.958  1.00 0.00 ? 2   SER A O    3  
ATOM 3590  C CB   . SER A 1 2   ? 21.156  9.710   -2.815  1.00 0.00 ? 2   SER A CB   3  
ATOM 3591  O OG   . SER A 1 2   ? 21.760  9.328   -4.039  1.00 0.00 ? 2   SER A OG   3  
ATOM 3592  H H    . SER A 1 2   ? 23.527  11.764  -2.661  1.00 0.00 ? 2   SER A H    3  
ATOM 3593  H HA   . SER A 1 2   ? 21.346  11.782  -3.316  1.00 0.00 ? 2   SER A HA   3  
ATOM 3594  H HB2  . SER A 1 2   ? 21.505  9.051   -2.035  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3595  H HB3  . SER A 1 2   ? 20.084  9.617   -2.911  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3596  H HG   . SER A 1 2   ? 22.037  8.411   -3.987  1.00 0.00 ? 2   SER A HG   3  
ATOM 3597  N N    . SER A 1 3   ? 20.964  12.790  -0.749  1.00 0.00 ? 3   SER A N    3  
ATOM 3598  C CA   . SER A 1 3   ? 20.197  13.362  0.351   1.00 0.00 ? 3   SER A CA   3  
ATOM 3599  C C    . SER A 1 3   ? 19.972  14.856  0.138   1.00 0.00 ? 3   SER A C    3  
ATOM 3600  O O    . SER A 1 3   ? 20.751  15.685  0.606   1.00 0.00 ? 3   SER A O    3  
ATOM 3601  C CB   . SER A 1 3   ? 20.919  13.129  1.680   1.00 0.00 ? 3   SER A CB   3  
ATOM 3602  O OG   . SER A 1 3   ? 22.249  12.686  1.467   1.00 0.00 ? 3   SER A OG   3  
ATOM 3603  H H    . SER A 1 3   ? 21.756  13.265  -1.078  1.00 0.00 ? 3   SER A H    3  
ATOM 3604  H HA   . SER A 1 3   ? 19.239  12.867  0.380   1.00 0.00 ? 3   SER A HA   3  
ATOM 3605  H HB2  . SER A 1 3   ? 20.944  14.051  2.240   1.00 0.00 ? 3   SER A HB2  3  
ATOM 3606  H HB3  . SER A 1 3   ? 20.388  12.377  2.247   1.00 0.00 ? 3   SER A HB3  3  
ATOM 3607  H HG   . SER A 1 3   ? 22.366  11.820  1.866   1.00 0.00 ? 3   SER A HG   3  
ATOM 3608  N N    . GLY A 1 4   ? 18.900  15.191  -0.574  1.00 0.00 ? 4   GLY A N    3  
ATOM 3609  C CA   . GLY A 1 4   ? 18.591  16.584  -0.838  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3610  C C    . GLY A 1 4   ? 19.599  17.237  -1.762  1.00 0.00 ? 4   GLY A C    3  
ATOM 3611  O O    . GLY A 1 4   ? 20.803  17.015  -1.635  1.00 0.00 ? 4   GLY A O    3  
ATOM 3612  H H    . GLY A 1 4   ? 18.315  14.487  -0.923  1.00 0.00 ? 4   GLY A H    3  
ATOM 3613  H HA2  . GLY A 1 4   ? 17.612  16.645  -1.289  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3614  H HA3  . GLY A 1 4   ? 18.578  17.121  0.099   1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3615  N N    . SER A 1 5   ? 19.107  18.043  -2.698  1.00 0.00 ? 5   SER A N    3  
ATOM 3616  C CA   . SER A 1 5   ? 19.975  18.726  -3.651  1.00 0.00 ? 5   SER A CA   3  
ATOM 3617  C C    . SER A 1 5   ? 19.229  19.861  -4.346  1.00 0.00 ? 5   SER A C    3  
ATOM 3618  O O    . SER A 1 5   ? 18.039  19.749  -4.643  1.00 0.00 ? 5   SER A O    3  
ATOM 3619  C CB   . SER A 1 5   ? 20.504  17.737  -4.691  1.00 0.00 ? 5   SER A CB   3  
ATOM 3620  O OG   . SER A 1 5   ? 21.742  18.170  -5.224  1.00 0.00 ? 5   SER A OG   3  
ATOM 3621  H H    . SER A 1 5   ? 18.138  18.180  -2.749  1.00 0.00 ? 5   SER A H    3  
ATOM 3622  H HA   . SER A 1 5   ? 20.808  19.140  -3.103  1.00 0.00 ? 5   SER A HA   3  
ATOM 3623  H HB2  . SER A 1 5   ? 20.643  16.771  -4.228  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3624  H HB3  . SER A 1 5   ? 19.788  17.650  -5.497  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3625  H HG   . SER A 1 5   ? 22.461  17.807  -4.700  1.00 0.00 ? 5   SER A HG   3  
ATOM 3626  N N    . SER A 1 6   ? 19.937  20.957  -4.602  1.00 0.00 ? 6   SER A N    3  
ATOM 3627  C CA   . SER A 1 6   ? 19.345  22.115  -5.259  1.00 0.00 ? 6   SER A CA   3  
ATOM 3628  C C    . SER A 1 6   ? 18.097  22.582  -4.513  1.00 0.00 ? 6   SER A C    3  
ATOM 3629  O O    . SER A 1 6   ? 17.791  22.094  -3.427  1.00 0.00 ? 6   SER A O    3  
ATOM 3630  C CB   . SER A 1 6   ? 18.991  21.781  -6.709  1.00 0.00 ? 6   SER A CB   3  
ATOM 3631  O OG   . SER A 1 6   ? 19.463  20.493  -7.065  1.00 0.00 ? 6   SER A OG   3  
ATOM 3632  H H    . SER A 1 6   ? 20.882  20.986  -4.340  1.00 0.00 ? 6   SER A H    3  
ATOM 3633  H HA   . SER A 1 6   ? 20.074  22.912  -5.249  1.00 0.00 ? 6   SER A HA   3  
ATOM 3634  H HB2  . SER A 1 6   ? 17.919  21.805  -6.831  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3635  H HB3  . SER A 1 6   ? 19.444  22.512  -7.364  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3636  H HG   . SER A 1 6   ? 19.957  20.549  -7.886  1.00 0.00 ? 6   SER A HG   3  
ATOM 3637  N N    . GLY A 1 7   ? 17.380  23.531  -5.108  1.00 0.00 ? 7   GLY A N    3  
ATOM 3638  C CA   . GLY A 1 7   ? 16.175  24.047  -4.488  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3639  C C    . GLY A 1 7   ? 15.192  24.600  -5.502  1.00 0.00 ? 7   GLY A C    3  
ATOM 3640  O O    . GLY A 1 7   ? 15.048  25.812  -5.662  1.00 0.00 ? 7   GLY A O    3  
ATOM 3641  H H    . GLY A 1 7   ? 17.672  23.882  -5.975  1.00 0.00 ? 7   GLY A H    3  
ATOM 3642  H HA2  . GLY A 1 7   ? 15.696  23.252  -3.937  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3643  H HA3  . GLY A 1 7   ? 16.445  24.835  -3.801  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3644  N N    . PRO A 1 8   ? 14.497  23.699  -6.212  1.00 0.00 ? 8   PRO A N    3  
ATOM 3645  C CA   . PRO A 1 8   ? 13.513  24.080  -7.228  1.00 0.00 ? 8   PRO A CA   3  
ATOM 3646  C C    . PRO A 1 8   ? 12.264  24.709  -6.620  1.00 0.00 ? 8   PRO A C    3  
ATOM 3647  O O    . PRO A 1 8   ? 11.839  24.338  -5.526  1.00 0.00 ? 8   PRO A O    3  
ATOM 3648  C CB   . PRO A 1 8   ? 13.166  22.750  -7.903  1.00 0.00 ? 8   PRO A CB   3  
ATOM 3649  C CG   . PRO A 1 8   ? 13.455  21.716  -6.870  1.00 0.00 ? 8   PRO A CG   3  
ATOM 3650  C CD   . PRO A 1 8   ? 14.618  22.238  -6.075  1.00 0.00 ? 8   PRO A CD   3  
ATOM 3651  H HA   . PRO A 1 8   ? 13.936  24.756  -7.957  1.00 0.00 ? 8   PRO A HA   3  
ATOM 3652  H HB2  . PRO A 1 8   ? 12.123  22.748  -8.186  1.00 0.00 ? 8   PRO A HB2  3  
ATOM 3653  H HB3  . PRO A 1 8   ? 13.783  22.616  -8.780  1.00 0.00 ? 8   PRO A HB3  3  
ATOM 3654  H HG2  . PRO A 1 8   ? 12.594  21.582  -6.234  1.00 0.00 ? 8   PRO A HG2  3  
ATOM 3655  H HG3  . PRO A 1 8   ? 13.716  20.782  -7.349  1.00 0.00 ? 8   PRO A HG3  3  
ATOM 3656  H HD2  . PRO A 1 8   ? 14.532  21.938  -5.040  1.00 0.00 ? 8   PRO A HD2  3  
ATOM 3657  H HD3  . PRO A 1 8   ? 15.550  21.888  -6.493  1.00 0.00 ? 8   PRO A HD3  3  
ATOM 3658  N N    . VAL A 1 9   ? 11.679  25.664  -7.335  1.00 0.00 ? 9   VAL A N    3  
ATOM 3659  C CA   . VAL A 1 9   ? 10.476  26.344  -6.866  1.00 0.00 ? 9   VAL A CA   3  
ATOM 3660  C C    . VAL A 1 9   ? 9.310   25.371  -6.738  1.00 0.00 ? 9   VAL A C    3  
ATOM 3661  O O    . VAL A 1 9   ? 9.132   24.485  -7.574  1.00 0.00 ? 9   VAL A O    3  
ATOM 3662  C CB   . VAL A 1 9   ? 10.075  27.489  -7.813  1.00 0.00 ? 9   VAL A CB   3  
ATOM 3663  C CG1  . VAL A 1 9   ? 9.690   26.943  -9.180  1.00 0.00 ? 9   VAL A CG1  3  
ATOM 3664  C CG2  . VAL A 1 9   ? 8.935   28.299  -7.215  1.00 0.00 ? 9   VAL A CG2  3  
ATOM 3665  H H    . VAL A 1 9   ? 12.064  25.917  -8.201  1.00 0.00 ? 9   VAL A H    3  
ATOM 3666  H HA   . VAL A 1 9   ? 10.691  26.766  -5.895  1.00 0.00 ? 9   VAL A HA   3  
ATOM 3667  H HB   . VAL A 1 9   ? 10.925  28.143  -7.939  1.00 0.00 ? 9   VAL A HB   3  
ATOM 3668  H HG11 . VAL A 1 9   ? 8.634   26.717  -9.193  1.00 0.00 ? 9   VAL A HG11 3  
ATOM 3669  H HG12 . VAL A 1 9   ? 9.912   27.678  -9.938  1.00 0.00 ? 9   VAL A HG12 3  
ATOM 3670  H HG13 . VAL A 1 9   ? 10.252  26.042  -9.379  1.00 0.00 ? 9   VAL A HG13 3  
ATOM 3671  H HG21 . VAL A 1 9   ? 9.256   28.737  -6.282  1.00 0.00 ? 9   VAL A HG21 3  
ATOM 3672  H HG22 . VAL A 1 9   ? 8.651   29.084  -7.901  1.00 0.00 ? 9   VAL A HG22 3  
ATOM 3673  H HG23 . VAL A 1 9   ? 8.087   27.653  -7.037  1.00 0.00 ? 9   VAL A HG23 3  
ATOM 3674  N N    . LEU A 1 10  ? 8.517   25.544  -5.686  1.00 0.00 ? 10  LEU A N    3  
ATOM 3675  C CA   . LEU A 1 10  ? 7.365   24.681  -5.447  1.00 0.00 ? 10  LEU A CA   3  
ATOM 3676  C C    . LEU A 1 10  ? 6.229   25.460  -4.791  1.00 0.00 ? 10  LEU A C    3  
ATOM 3677  O O    . LEU A 1 10  ? 6.454   26.488  -4.152  1.00 0.00 ? 10  LEU A O    3  
ATOM 3678  C CB   . LEU A 1 10  ? 7.764   23.497  -4.563  1.00 0.00 ? 10  LEU A CB   3  
ATOM 3679  C CG   . LEU A 1 10  ? 8.081   22.192  -5.294  1.00 0.00 ? 10  LEU A CG   3  
ATOM 3680  C CD1  . LEU A 1 10  ? 9.177   21.427  -4.569  1.00 0.00 ? 10  LEU A CD1  3  
ATOM 3681  C CD2  . LEU A 1 10  ? 6.830   21.336  -5.425  1.00 0.00 ? 10  LEU A CD2  3  
ATOM 3682  H H    . LEU A 1 10  ? 8.710   26.268  -5.054  1.00 0.00 ? 10  LEU A H    3  
ATOM 3683  H HA   . LEU A 1 10  ? 7.026   24.309  -6.402  1.00 0.00 ? 10  LEU A HA   3  
ATOM 3684  H HB2  . LEU A 1 10  ? 8.641   23.784  -4.002  1.00 0.00 ? 10  LEU A HB2  3  
ATOM 3685  H HB3  . LEU A 1 10  ? 6.948   23.306  -3.880  1.00 0.00 ? 10  LEU A HB3  3  
ATOM 3686  H HG   . LEU A 1 10  ? 8.437   22.420  -6.289  1.00 0.00 ? 10  LEU A HG   3  
ATOM 3687  H HD11 . LEU A 1 10  ? 8.944   21.373  -3.516  1.00 0.00 ? 10  LEU A HD11 3  
ATOM 3688  H HD12 . LEU A 1 10  ? 10.121  21.938  -4.701  1.00 0.00 ? 10  LEU A HD12 3  
ATOM 3689  H HD13 . LEU A 1 10  ? 9.249   20.430  -4.974  1.00 0.00 ? 10  LEU A HD13 3  
ATOM 3690  H HD21 . LEU A 1 10  ? 7.101   20.292  -5.370  1.00 0.00 ? 10  LEU A HD21 3  
ATOM 3691  H HD22 . LEU A 1 10  ? 6.356   21.535  -6.375  1.00 0.00 ? 10  LEU A HD22 3  
ATOM 3692  H HD23 . LEU A 1 10  ? 6.146   21.574  -4.624  1.00 0.00 ? 10  LEU A HD23 3  
ATOM 3693  N N    . THR A 1 11  ? 5.007   24.961  -4.952  1.00 0.00 ? 11  THR A N    3  
ATOM 3694  C CA   . THR A 1 11  ? 3.835   25.608  -4.375  1.00 0.00 ? 11  THR A CA   3  
ATOM 3695  C C    . THR A 1 11  ? 3.392   24.905  -3.098  1.00 0.00 ? 11  THR A C    3  
ATOM 3696  O O    . THR A 1 11  ? 2.965   23.750  -3.129  1.00 0.00 ? 11  THR A O    3  
ATOM 3697  C CB   . THR A 1 11  ? 2.660   25.630  -5.370  1.00 0.00 ? 11  THR A CB   3  
ATOM 3698  O OG1  . THR A 1 11  ? 3.080   25.116  -6.638  1.00 0.00 ? 11  THR A OG1  3  
ATOM 3699  C CG2  . THR A 1 11  ? 2.123   27.044  -5.542  1.00 0.00 ? 11  THR A CG2  3  
ATOM 3700  H H    . THR A 1 11  ? 4.892   24.137  -5.471  1.00 0.00 ? 11  THR A H    3  
ATOM 3701  H HA   . THR A 1 11  ? 4.101   26.629  -4.140  1.00 0.00 ? 11  THR A HA   3  
ATOM 3702  H HB   . THR A 1 11  ? 1.868   25.005  -4.982  1.00 0.00 ? 11  THR A HB   3  
ATOM 3703  H HG1  . THR A 1 11  ? 2.341   25.129  -7.251  1.00 0.00 ? 11  THR A HG1  3  
ATOM 3704  H HG21 . THR A 1 11  ? 2.064   27.526  -4.577  1.00 0.00 ? 11  THR A HG21 3  
ATOM 3705  H HG22 . THR A 1 11  ? 1.139   27.003  -5.986  1.00 0.00 ? 11  THR A HG22 3  
ATOM 3706  H HG23 . THR A 1 11  ? 2.786   27.604  -6.183  1.00 0.00 ? 11  THR A HG23 3  
ATOM 3707  N N    . GLN A 1 12  ? 3.495   25.608  -1.975  1.00 0.00 ? 12  GLN A N    3  
ATOM 3708  C CA   . GLN A 1 12  ? 3.104   25.050  -0.686  1.00 0.00 ? 12  GLN A CA   3  
ATOM 3709  C C    . GLN A 1 12  ? 2.124   25.972  0.031   1.00 0.00 ? 12  GLN A C    3  
ATOM 3710  O O    . GLN A 1 12  ? 2.208   26.162  1.246   1.00 0.00 ? 12  GLN A O    3  
ATOM 3711  C CB   . GLN A 1 12  ? 4.338   24.817  0.190   1.00 0.00 ? 12  GLN A CB   3  
ATOM 3712  C CG   . GLN A 1 12  ? 4.132   23.759  1.261   1.00 0.00 ? 12  GLN A CG   3  
ATOM 3713  C CD   . GLN A 1 12  ? 4.435   24.275  2.654   1.00 0.00 ? 12  GLN A CD   3  
ATOM 3714  O OE1  . GLN A 1 12  ? 5.596   24.443  3.028   1.00 0.00 ? 12  GLN A OE1  3  
ATOM 3715  N NE2  . GLN A 1 12  ? 3.389   24.529  3.432   1.00 0.00 ? 12  GLN A NE2  3  
ATOM 3716  H H    . GLN A 1 12  ? 3.843   26.522  -2.014  1.00 0.00 ? 12  GLN A H    3  
ATOM 3717  H HA   . GLN A 1 12  ? 2.619   24.102  -0.868  1.00 0.00 ? 12  GLN A HA   3  
ATOM 3718  H HB2  . GLN A 1 12  ? 5.158   24.507  -0.441  1.00 0.00 ? 12  GLN A HB2  3  
ATOM 3719  H HB3  . GLN A 1 12  ? 4.600   25.746  0.675   1.00 0.00 ? 12  GLN A HB3  3  
ATOM 3720  H HG2  . GLN A 1 12  ? 3.104   23.430  1.232   1.00 0.00 ? 12  GLN A HG2  3  
ATOM 3721  H HG3  . GLN A 1 12  ? 4.784   22.924  1.053   1.00 0.00 ? 12  GLN A HG3  3  
ATOM 3722  H HE21 . GLN A 1 12  ? 2.492   24.371  3.067   1.00 0.00 ? 12  GLN A HE21 3  
ATOM 3723  H HE22 . GLN A 1 12  ? 3.556   24.863  4.338   1.00 0.00 ? 12  GLN A HE22 3  
ATOM 3724  N N    . THR A 1 13  ? 1.194   26.544  -0.726  1.00 0.00 ? 13  THR A N    3  
ATOM 3725  C CA   . THR A 1 13  ? 0.198   27.447  -0.163  1.00 0.00 ? 13  THR A CA   3  
ATOM 3726  C C    . THR A 1 13  ? -0.859  26.680  0.624   1.00 0.00 ? 13  THR A C    3  
ATOM 3727  O O    . THR A 1 13  ? -1.733  26.037  0.043   1.00 0.00 ? 13  THR A O    3  
ATOM 3728  C CB   . THR A 1 13  ? -0.496  28.273  -1.262  1.00 0.00 ? 13  THR A CB   3  
ATOM 3729  O OG1  . THR A 1 13  ? -0.159  27.753  -2.553  1.00 0.00 ? 13  THR A OG1  3  
ATOM 3730  C CG2  . THR A 1 13  ? -0.087  29.737  -1.177  1.00 0.00 ? 13  THR A CG2  3  
ATOM 3731  H H    . THR A 1 13  ? 1.178   26.353  -1.687  1.00 0.00 ? 13  THR A H    3  
ATOM 3732  H HA   . THR A 1 13  ? 0.706   28.128  0.504   1.00 0.00 ? 13  THR A HA   3  
ATOM 3733  H HB   . THR A 1 13  ? -1.565  28.205  -1.122  1.00 0.00 ? 13  THR A HB   3  
ATOM 3734  H HG1  . THR A 1 13  ? -0.878  27.928  -3.165  1.00 0.00 ? 13  THR A HG1  3  
ATOM 3735  H HG21 . THR A 1 13  ? 0.792   29.900  -1.783  1.00 0.00 ? 13  THR A HG21 3  
ATOM 3736  H HG22 . THR A 1 13  ? 0.130   29.991  -0.151  1.00 0.00 ? 13  THR A HG22 3  
ATOM 3737  H HG23 . THR A 1 13  ? -0.893  30.356  -1.541  1.00 0.00 ? 13  THR A HG23 3  
ATOM 3738  N N    . SER A 1 14  ? -0.773  26.751  1.948   1.00 0.00 ? 14  SER A N    3  
ATOM 3739  C CA   . SER A 1 14  ? -1.720  26.061  2.814   1.00 0.00 ? 14  SER A CA   3  
ATOM 3740  C C    . SER A 1 14  ? -1.684  24.555  2.567   1.00 0.00 ? 14  SER A C    3  
ATOM 3741  O O    . SER A 1 14  ? -1.002  24.081  1.660   1.00 0.00 ? 14  SER A O    3  
ATOM 3742  C CB   . SER A 1 14  ? -3.136  26.592  2.584   1.00 0.00 ? 14  SER A CB   3  
ATOM 3743  O OG   . SER A 1 14  ? -3.917  26.492  3.761   1.00 0.00 ? 14  SER A OG   3  
ATOM 3744  H H    . SER A 1 14  ? -0.053  27.280  2.351   1.00 0.00 ? 14  SER A H    3  
ATOM 3745  H HA   . SER A 1 14  ? -1.436  26.253  3.838   1.00 0.00 ? 14  SER A HA   3  
ATOM 3746  H HB2  . SER A 1 14  ? -3.084  27.629  2.286   1.00 0.00 ? 14  SER A HB2  3  
ATOM 3747  H HB3  . SER A 1 14  ? -3.610  26.018  1.800   1.00 0.00 ? 14  SER A HB3  3  
ATOM 3748  H HG   . SER A 1 14  ? -4.846  26.580  3.539   1.00 0.00 ? 14  SER A HG   3  
ATOM 3749  N N    . GLU A 1 15  ? -2.423  23.810  3.384   1.00 0.00 ? 15  GLU A N    3  
ATOM 3750  C CA   . GLU A 1 15  ? -2.474  22.359  3.255   1.00 0.00 ? 15  GLU A CA   3  
ATOM 3751  C C    . GLU A 1 15  ? -3.516  21.941  2.222   1.00 0.00 ? 15  GLU A C    3  
ATOM 3752  O O    . GLU A 1 15  ? -4.690  22.295  2.331   1.00 0.00 ? 15  GLU A O    3  
ATOM 3753  C CB   . GLU A 1 15  ? -2.793  21.716  4.606   1.00 0.00 ? 15  GLU A CB   3  
ATOM 3754  C CG   . GLU A 1 15  ? -1.732  21.965  5.666   1.00 0.00 ? 15  GLU A CG   3  
ATOM 3755  C CD   . GLU A 1 15  ? -1.962  23.256  6.428   1.00 0.00 ? 15  GLU A CD   3  
ATOM 3756  O OE1  . GLU A 1 15  ? -2.753  23.241  7.395   1.00 0.00 ? 15  GLU A OE1  3  
ATOM 3757  O OE2  . GLU A 1 15  ? -1.350  24.279  6.059   1.00 0.00 ? 15  GLU A OE2  3  
ATOM 3758  H H    . GLU A 1 15  ? -2.944  24.247  4.089   1.00 0.00 ? 15  GLU A H    3  
ATOM 3759  H HA   . GLU A 1 15  ? -1.504  22.020  2.927   1.00 0.00 ? 15  GLU A HA   3  
ATOM 3760  H HB2  . GLU A 1 15  ? -3.733  22.111  4.967   1.00 0.00 ? 15  GLU A HB2  3  
ATOM 3761  H HB3  . GLU A 1 15  ? -2.891  20.649  4.470   1.00 0.00 ? 15  GLU A HB3  3  
ATOM 3762  H HG2  . GLU A 1 15  ? -1.741  21.145  6.366   1.00 0.00 ? 15  GLU A HG2  3  
ATOM 3763  H HG3  . GLU A 1 15  ? -0.767  22.016  5.184   1.00 0.00 ? 15  GLU A HG3  3  
ATOM 3764  N N    . GLN A 1 16  ? -3.078  21.187  1.219   1.00 0.00 ? 16  GLN A N    3  
ATOM 3765  C CA   . GLN A 1 16  ? -3.972  20.722  0.166   1.00 0.00 ? 16  GLN A CA   3  
ATOM 3766  C C    . GLN A 1 16  ? -4.058  19.200  0.158   1.00 0.00 ? 16  GLN A C    3  
ATOM 3767  O O    . GLN A 1 16  ? -3.455  18.530  0.995   1.00 0.00 ? 16  GLN A O    3  
ATOM 3768  C CB   . GLN A 1 16  ? -3.492  21.224  -1.198  1.00 0.00 ? 16  GLN A CB   3  
ATOM 3769  C CG   . GLN A 1 16  ? -4.321  22.374  -1.748  1.00 0.00 ? 16  GLN A CG   3  
ATOM 3770  C CD   . GLN A 1 16  ? -4.029  23.689  -1.050  1.00 0.00 ? 16  GLN A CD   3  
ATOM 3771  O OE1  . GLN A 1 16  ? -3.435  23.714  0.028   1.00 0.00 ? 16  GLN A OE1  3  
ATOM 3772  N NE2  . GLN A 1 16  ? -4.451  24.789  -1.661  1.00 0.00 ? 16  GLN A NE2  3  
ATOM 3773  H H    . GLN A 1 16  ? -2.131  20.938  1.187   1.00 0.00 ? 16  GLN A H    3  
ATOM 3774  H HA   . GLN A 1 16  ? -4.953  21.125  0.363   1.00 0.00 ? 16  GLN A HA   3  
ATOM 3775  H HB2  . GLN A 1 16  ? -2.469  21.556  -1.106  1.00 0.00 ? 16  GLN A HB2  3  
ATOM 3776  H HB3  . GLN A 1 16  ? -3.535  20.409  -1.903  1.00 0.00 ? 16  GLN A HB3  3  
ATOM 3777  H HG2  . GLN A 1 16  ? -4.102  22.488  -2.799  1.00 0.00 ? 16  GLN A HG2  3  
ATOM 3778  H HG3  . GLN A 1 16  ? -5.366  22.140  -1.622  1.00 0.00 ? 16  GLN A HG3  3  
ATOM 3779  H HE21 . GLN A 1 16  ? -4.920  24.692  -2.517  1.00 0.00 ? 16  GLN A HE21 3  
ATOM 3780  H HE22 . GLN A 1 16  ? -4.277  25.652  -1.232  1.00 0.00 ? 16  GLN A HE22 3  
ATOM 3781  N N    . ALA A 1 17  ? -4.815  18.660  -0.791  1.00 0.00 ? 17  ALA A N    3  
ATOM 3782  C CA   . ALA A 1 17  ? -4.979  17.216  -0.909  1.00 0.00 ? 17  ALA A CA   3  
ATOM 3783  C C    . ALA A 1 17  ? -3.665  16.543  -1.287  1.00 0.00 ? 17  ALA A C    3  
ATOM 3784  O O    . ALA A 1 17  ? -2.746  17.172  -1.812  1.00 0.00 ? 17  ALA A O    3  
ATOM 3785  C CB   . ALA A 1 17  ? -6.057  16.889  -1.933  1.00 0.00 ? 17  ALA A CB   3  
ATOM 3786  H H    . ALA A 1 17  ? -5.272  19.247  -1.430  1.00 0.00 ? 17  ALA A H    3  
ATOM 3787  H HA   . ALA A 1 17  ? -5.304  16.838  0.050   1.00 0.00 ? 17  ALA A HA   3  
ATOM 3788  H HB1  . ALA A 1 17  ? -6.148  17.708  -2.632  1.00 0.00 ? 17  ALA A HB1  3  
ATOM 3789  H HB2  . ALA A 1 17  ? -5.786  15.990  -2.466  1.00 0.00 ? 17  ALA A HB2  3  
ATOM 3790  H HB3  . ALA A 1 17  ? -7.000  16.739  -1.428  1.00 0.00 ? 17  ALA A HB3  3  
ATOM 3791  N N    . PRO A 1 18  ? -3.571  15.233  -1.016  1.00 0.00 ? 18  PRO A N    3  
ATOM 3792  C CA   . PRO A 1 18  ? -2.372  14.445  -1.320  1.00 0.00 ? 18  PRO A CA   3  
ATOM 3793  C C    . PRO A 1 18  ? -2.172  14.248  -2.819  1.00 0.00 ? 18  PRO A C    3  
ATOM 3794  O O    . PRO A 1 18  ? -3.040  13.709  -3.505  1.00 0.00 ? 18  PRO A O    3  
ATOM 3795  C CB   . PRO A 1 18  ? -2.648  13.102  -0.637  1.00 0.00 ? 18  PRO A CB   3  
ATOM 3796  C CG   . PRO A 1 18  ? -4.133  13.010  -0.568  1.00 0.00 ? 18  PRO A CG   3  
ATOM 3797  C CD   . PRO A 1 18  ? -4.628  14.418  -0.392  1.00 0.00 ? 18  PRO A CD   3  
ATOM 3798  H HA   . PRO A 1 18  ? -1.486  14.892  -0.895  1.00 0.00 ? 18  PRO A HA   3  
ATOM 3799  H HB2  . PRO A 1 18  ? -2.228  12.302  -1.229  1.00 0.00 ? 18  PRO A HB2  3  
ATOM 3800  H HB3  . PRO A 1 18  ? -2.206  13.098  0.348   1.00 0.00 ? 18  PRO A HB3  3  
ATOM 3801  H HG2  . PRO A 1 18  ? -4.517  12.588  -1.483  1.00 0.00 ? 18  PRO A HG2  3  
ATOM 3802  H HG3  . PRO A 1 18  ? -4.423  12.402  0.276   1.00 0.00 ? 18  PRO A HG3  3  
ATOM 3803  H HD2  . PRO A 1 18  ? -5.570  14.554  -0.902  1.00 0.00 ? 18  PRO A HD2  3  
ATOM 3804  H HD3  . PRO A 1 18  ? -4.727  14.655  0.657   1.00 0.00 ? 18  PRO A HD3  3  
ATOM 3805  N N    . SER A 1 19  ? -1.023  14.689  -3.320  1.00 0.00 ? 19  SER A N    3  
ATOM 3806  C CA   . SER A 1 19  ? -0.711  14.563  -4.739  1.00 0.00 ? 19  SER A CA   3  
ATOM 3807  C C    . SER A 1 19  ? 0.415   13.558  -4.961  1.00 0.00 ? 19  SER A C    3  
ATOM 3808  O O    . SER A 1 19  ? 1.291   13.765  -5.799  1.00 0.00 ? 19  SER A O    3  
ATOM 3809  C CB   . SER A 1 19  ? -0.314  15.924  -5.317  1.00 0.00 ? 19  SER A CB   3  
ATOM 3810  O OG   . SER A 1 19  ? -0.196  15.864  -6.727  1.00 0.00 ? 19  SER A OG   3  
ATOM 3811  H H    . SER A 1 19  ? -0.371  15.109  -2.722  1.00 0.00 ? 19  SER A H    3  
ATOM 3812  H HA   . SER A 1 19  ? -1.597  14.213  -5.244  1.00 0.00 ? 19  SER A HA   3  
ATOM 3813  H HB2  . SER A 1 19  ? -1.068  16.654  -5.063  1.00 0.00 ? 19  SER A HB2  3  
ATOM 3814  H HB3  . SER A 1 19  ? 0.634   16.226  -4.900  1.00 0.00 ? 19  SER A HB3  3  
ATOM 3815  H HG   . SER A 1 19  ? 0.714   16.042  -6.980  1.00 0.00 ? 19  SER A HG   3  
ATOM 3816  N N    . SER A 1 20  ? 0.380   12.466  -4.203  1.00 0.00 ? 20  SER A N    3  
ATOM 3817  C CA   . SER A 1 20  ? 1.398   11.427  -4.314  1.00 0.00 ? 20  SER A CA   3  
ATOM 3818  C C    . SER A 1 20  ? 0.846   10.075  -3.875  1.00 0.00 ? 20  SER A C    3  
ATOM 3819  O O    . SER A 1 20  ? 0.280   9.946   -2.790  1.00 0.00 ? 20  SER A O    3  
ATOM 3820  C CB   . SER A 1 20  ? 2.621   11.790  -3.468  1.00 0.00 ? 20  SER A CB   3  
ATOM 3821  O OG   . SER A 1 20  ? 3.758   12.012  -4.284  1.00 0.00 ? 20  SER A OG   3  
ATOM 3822  H H    . SER A 1 20  ? -0.344  12.357  -3.553  1.00 0.00 ? 20  SER A H    3  
ATOM 3823  H HA   . SER A 1 20  ? 1.696   11.362  -5.350  1.00 0.00 ? 20  SER A HA   3  
ATOM 3824  H HB2  . SER A 1 20  ? 2.414   12.690  -2.907  1.00 0.00 ? 20  SER A HB2  3  
ATOM 3825  H HB3  . SER A 1 20  ? 2.835   10.981  -2.784  1.00 0.00 ? 20  SER A HB3  3  
ATOM 3826  H HG   . SER A 1 20  ? 3.681   11.495  -5.087  1.00 0.00 ? 20  SER A HG   3  
ATOM 3827  N N    . ALA A 1 21  ? 1.013   9.069   -4.726  1.00 0.00 ? 21  ALA A N    3  
ATOM 3828  C CA   . ALA A 1 21  ? 0.532   7.727   -4.428  1.00 0.00 ? 21  ALA A CA   3  
ATOM 3829  C C    . ALA A 1 21  ? 1.352   7.085   -3.312  1.00 0.00 ? 21  ALA A C    3  
ATOM 3830  O O    . ALA A 1 21  ? 2.509   7.438   -3.078  1.00 0.00 ? 21  ALA A O    3  
ATOM 3831  C CB   . ALA A 1 21  ? 0.572   6.861   -5.678  1.00 0.00 ? 21  ALA A CB   3  
ATOM 3832  H H    . ALA A 1 21  ? 1.472   9.235   -5.577  1.00 0.00 ? 21  ALA A H    3  
ATOM 3833  H HA   . ALA A 1 21  ? -0.497  7.804   -4.106  1.00 0.00 ? 21  ALA A HA   3  
ATOM 3834  H HB1  . ALA A 1 21  ? -0.250  6.159   -5.655  1.00 0.00 ? 21  ALA A HB1  3  
ATOM 3835  H HB2  . ALA A 1 21  ? 0.487   7.489   -6.553  1.00 0.00 ? 21  ALA A HB2  3  
ATOM 3836  H HB3  . ALA A 1 21  ? 1.505   6.319   -5.712  1.00 0.00 ? 21  ALA A HB3  3  
ATOM 3837  N N    . PRO A 1 22  ? 0.742   6.122   -2.608  1.00 0.00 ? 22  PRO A N    3  
ATOM 3838  C CA   . PRO A 1 22  ? 1.398   5.412   -1.506  1.00 0.00 ? 22  PRO A CA   3  
ATOM 3839  C C    . PRO A 1 22  ? 2.510   4.489   -1.990  1.00 0.00 ? 22  PRO A C    3  
ATOM 3840  O O    . PRO A 1 22  ? 2.466   3.985   -3.113  1.00 0.00 ? 22  PRO A O    3  
ATOM 3841  C CB   . PRO A 1 22  ? 0.262   4.598   -0.881  1.00 0.00 ? 22  PRO A CB   3  
ATOM 3842  C CG   . PRO A 1 22  ? -0.720  4.411   -1.986  1.00 0.00 ? 22  PRO A CG   3  
ATOM 3843  C CD   . PRO A 1 22  ? -0.635  5.650   -2.832  1.00 0.00 ? 22  PRO A CD   3  
ATOM 3844  H HA   . PRO A 1 22  ? 1.795   6.098   -0.772  1.00 0.00 ? 22  PRO A HA   3  
ATOM 3845  H HB2  . PRO A 1 22  ? 0.645   3.652   -0.526  1.00 0.00 ? 22  PRO A HB2  3  
ATOM 3846  H HB3  . PRO A 1 22  ? -0.171  5.149   -0.058  1.00 0.00 ? 22  PRO A HB3  3  
ATOM 3847  H HG2  . PRO A 1 22  ? -0.456  3.540   -2.568  1.00 0.00 ? 22  PRO A HG2  3  
ATOM 3848  H HG3  . PRO A 1 22  ? -1.716  4.303   -1.579  1.00 0.00 ? 22  PRO A HG3  3  
ATOM 3849  H HD2  . PRO A 1 22  ? -0.795  5.410   -3.873  1.00 0.00 ? 22  PRO A HD2  3  
ATOM 3850  H HD3  . PRO A 1 22  ? -1.352  6.385   -2.498  1.00 0.00 ? 22  PRO A HD3  3  
ATOM 3851  N N    . ARG A 1 23  ? 3.506   4.270   -1.138  1.00 0.00 ? 23  ARG A N    3  
ATOM 3852  C CA   . ARG A 1 23  ? 4.630   3.408   -1.480  1.00 0.00 ? 23  ARG A CA   3  
ATOM 3853  C C    . ARG A 1 23  ? 4.708   2.215   -0.533  1.00 0.00 ? 23  ARG A C    3  
ATOM 3854  O O    . ARG A 1 23  ? 3.882   2.070   0.369   1.00 0.00 ? 23  ARG A O    3  
ATOM 3855  C CB   . ARG A 1 23  ? 5.939   4.198   -1.432  1.00 0.00 ? 23  ARG A CB   3  
ATOM 3856  C CG   . ARG A 1 23  ? 5.867   5.541   -2.139  1.00 0.00 ? 23  ARG A CG   3  
ATOM 3857  C CD   . ARG A 1 23  ? 7.197   5.906   -2.779  1.00 0.00 ? 23  ARG A CD   3  
ATOM 3858  N NE   . ARG A 1 23  ? 7.329   5.350   -4.123  1.00 0.00 ? 23  ARG A NE   3  
ATOM 3859  C CZ   . ARG A 1 23  ? 6.699   5.839   -5.185  1.00 0.00 ? 23  ARG A CZ   3  
ATOM 3860  N NH1  . ARG A 1 23  ? 5.897   6.888   -5.060  1.00 0.00 ? 23  ARG A NH1  3  
ATOM 3861  N NH2  . ARG A 1 23  ? 6.870   5.279   -6.376  1.00 0.00 ? 23  ARG A NH2  3  
ATOM 3862  H H    . ARG A 1 23  ? 3.484   4.700   -0.257  1.00 0.00 ? 23  ARG A H    3  
ATOM 3863  H HA   . ARG A 1 23  ? 4.475   3.046   -2.485  1.00 0.00 ? 23  ARG A HA   3  
ATOM 3864  H HB2  . ARG A 1 23  ? 6.203   4.373   -0.399  1.00 0.00 ? 23  ARG A HB2  3  
ATOM 3865  H HB3  . ARG A 1 23  ? 6.716   3.610   -1.897  1.00 0.00 ? 23  ARG A HB3  3  
ATOM 3866  H HG2  . ARG A 1 23  ? 5.112   5.491   -2.910  1.00 0.00 ? 23  ARG A HG2  3  
ATOM 3867  H HG3  . ARG A 1 23  ? 5.602   6.301   -1.419  1.00 0.00 ? 23  ARG A HG3  3  
ATOM 3868  H HD2  . ARG A 1 23  ? 7.270   6.981   -2.835  1.00 0.00 ? 23  ARG A HD2  3  
ATOM 3869  H HD3  . ARG A 1 23  ? 7.996   5.523   -2.161  1.00 0.00 ? 23  ARG A HD3  3  
ATOM 3870  H HE   . ARG A 1 23  ? 7.916   4.576   -4.239  1.00 0.00 ? 23  ARG A HE   3  
ATOM 3871  H HH11 . ARG A 1 23  ? 5.768   7.313   -4.165  1.00 0.00 ? 23  ARG A HH11 3  
ATOM 3872  H HH12 . ARG A 1 23  ? 5.425   7.255   -5.862  1.00 0.00 ? 23  ARG A HH12 3  
ATOM 3873  H HH21 . ARG A 1 23  ? 7.473   4.488   -6.474  1.00 0.00 ? 23  ARG A HH21 3  
ATOM 3874  H HH22 . ARG A 1 23  ? 6.395   5.647   -7.174  1.00 0.00 ? 23  ARG A HH22 3  
ATOM 3875  N N    . ASP A 1 24  ? 5.706   1.361   -0.744  1.00 0.00 ? 24  ASP A N    3  
ATOM 3876  C CA   . ASP A 1 24  ? 5.892   0.182   0.092   1.00 0.00 ? 24  ASP A CA   3  
ATOM 3877  C C    . ASP A 1 24  ? 4.631   -0.678  0.106   1.00 0.00 ? 24  ASP A C    3  
ATOM 3878  O O    . ASP A 1 24  ? 4.387   -1.423  1.055   1.00 0.00 ? 24  ASP A O    3  
ATOM 3879  C CB   . ASP A 1 24  ? 6.261   0.593   1.517   1.00 0.00 ? 24  ASP A CB   3  
ATOM 3880  C CG   . ASP A 1 24  ? 7.219   -0.384  2.171   1.00 0.00 ? 24  ASP A CG   3  
ATOM 3881  O OD1  . ASP A 1 24  ? 8.123   -0.885  1.472   1.00 0.00 ? 24  ASP A OD1  3  
ATOM 3882  O OD2  . ASP A 1 24  ? 7.064   -0.647  3.383   1.00 0.00 ? 24  ASP A OD2  3  
ATOM 3883  H H    . ASP A 1 24  ? 6.331   1.532   -1.479  1.00 0.00 ? 24  ASP A H    3  
ATOM 3884  H HA   . ASP A 1 24  ? 6.701   -0.396  -0.327  1.00 0.00 ? 24  ASP A HA   3  
ATOM 3885  H HB2  . ASP A 1 24  ? 6.728   1.566   1.494   1.00 0.00 ? 24  ASP A HB2  3  
ATOM 3886  H HB3  . ASP A 1 24  ? 5.363   0.643   2.115   1.00 0.00 ? 24  ASP A HB3  3  
ATOM 3887  N N    . VAL A 1 25  ? 3.833   -0.568  -0.950  1.00 0.00 ? 25  VAL A N    3  
ATOM 3888  C CA   . VAL A 1 25  ? 2.598   -1.335  -1.059  1.00 0.00 ? 25  VAL A CA   3  
ATOM 3889  C C    . VAL A 1 25  ? 2.870   -2.748  -1.559  1.00 0.00 ? 25  VAL A C    3  
ATOM 3890  O O    . VAL A 1 25  ? 3.144   -2.957  -2.740  1.00 0.00 ? 25  VAL A O    3  
ATOM 3891  C CB   . VAL A 1 25  ? 1.594   -0.651  -2.007  1.00 0.00 ? 25  VAL A CB   3  
ATOM 3892  C CG1  . VAL A 1 25  ? 0.249   -1.360  -1.962  1.00 0.00 ? 25  VAL A CG1  3  
ATOM 3893  C CG2  . VAL A 1 25  ? 1.444   0.821   -1.652  1.00 0.00 ? 25  VAL A CG2  3  
ATOM 3894  H H    . VAL A 1 25  ? 4.081   0.043   -1.674  1.00 0.00 ? 25  VAL A H    3  
ATOM 3895  H HA   . VAL A 1 25  ? 2.152   -1.389  -0.077  1.00 0.00 ? 25  VAL A HA   3  
ATOM 3896  H HB   . VAL A 1 25  ? 1.978   -0.719  -3.014  1.00 0.00 ? 25  VAL A HB   3  
ATOM 3897  H HG11 . VAL A 1 25  ? -0.031  -1.534  -0.935  1.00 0.00 ? 25  VAL A HG11 3  
ATOM 3898  H HG12 . VAL A 1 25  ? -0.497  -0.745  -2.442  1.00 0.00 ? 25  VAL A HG12 3  
ATOM 3899  H HG13 . VAL A 1 25  ? 0.323   -2.306  -2.479  1.00 0.00 ? 25  VAL A HG13 3  
ATOM 3900  H HG21 . VAL A 1 25  ? 1.837   1.426   -2.455  1.00 0.00 ? 25  VAL A HG21 3  
ATOM 3901  H HG22 . VAL A 1 25  ? 0.397   1.051   -1.508  1.00 0.00 ? 25  VAL A HG22 3  
ATOM 3902  H HG23 . VAL A 1 25  ? 1.987   1.029   -0.743  1.00 0.00 ? 25  VAL A HG23 3  
ATOM 3903  N N    . GLN A 1 26  ? 2.793   -3.715  -0.652  1.00 0.00 ? 26  GLN A N    3  
ATOM 3904  C CA   . GLN A 1 26  ? 3.033   -5.111  -1.001  1.00 0.00 ? 26  GLN A CA   3  
ATOM 3905  C C    . GLN A 1 26  ? 2.074   -6.032  -0.254  1.00 0.00 ? 26  GLN A C    3  
ATOM 3906  O O    . GLN A 1 26  ? 1.776   -5.813  0.920   1.00 0.00 ? 26  GLN A O    3  
ATOM 3907  C CB   . GLN A 1 26  ? 4.479   -5.498  -0.685  1.00 0.00 ? 26  GLN A CB   3  
ATOM 3908  C CG   . GLN A 1 26  ? 4.860   -5.288  0.771   1.00 0.00 ? 26  GLN A CG   3  
ATOM 3909  C CD   . GLN A 1 26  ? 6.334   -5.537  1.030   1.00 0.00 ? 26  GLN A CD   3  
ATOM 3910  O OE1  . GLN A 1 26  ? 6.866   -6.592  0.686   1.00 0.00 ? 26  GLN A OE1  3  
ATOM 3911  N NE2  . GLN A 1 26  ? 7.000   -4.565  1.640   1.00 0.00 ? 26  GLN A NE2  3  
ATOM 3912  H H    . GLN A 1 26  ? 2.572   -3.487  0.274   1.00 0.00 ? 26  GLN A H    3  
ATOM 3913  H HA   . GLN A 1 26  ? 2.864   -5.221  -2.061  1.00 0.00 ? 26  GLN A HA   3  
ATOM 3914  H HB2  . GLN A 1 26  ? 4.622   -6.540  -0.926  1.00 0.00 ? 26  GLN A HB2  3  
ATOM 3915  H HB3  . GLN A 1 26  ? 5.139   -4.901  -1.297  1.00 0.00 ? 26  GLN A HB3  3  
ATOM 3916  H HG2  . GLN A 1 26  ? 4.631   -4.270  1.048   1.00 0.00 ? 26  GLN A HG2  3  
ATOM 3917  H HG3  . GLN A 1 26  ? 4.283   -5.965  1.383   1.00 0.00 ? 26  GLN A HG3  3  
ATOM 3918  H HE21 . GLN A 1 26  ? 6.510   -3.753  1.888   1.00 0.00 ? 26  GLN A HE21 3  
ATOM 3919  H HE22 . GLN A 1 26  ? 7.953   -4.699  1.821   1.00 0.00 ? 26  GLN A HE22 3  
ATOM 3920  N N    . ALA A 1 27  ? 1.593   -7.062  -0.943  1.00 0.00 ? 27  ALA A N    3  
ATOM 3921  C CA   . ALA A 1 27  ? 0.669   -8.017  -0.342  1.00 0.00 ? 27  ALA A CA   3  
ATOM 3922  C C    . ALA A 1 27  ? 1.346   -9.362  -0.107  1.00 0.00 ? 27  ALA A C    3  
ATOM 3923  O O    . ALA A 1 27  ? 1.855   -9.983  -1.041  1.00 0.00 ? 27  ALA A O    3  
ATOM 3924  C CB   . ALA A 1 27  ? -0.559  -8.187  -1.225  1.00 0.00 ? 27  ALA A CB   3  
ATOM 3925  H H    . ALA A 1 27  ? 1.867   -7.183  -1.874  1.00 0.00 ? 27  ALA A H    3  
ATOM 3926  H HA   . ALA A 1 27  ? 0.345   -7.617  0.608   1.00 0.00 ? 27  ALA A HA   3  
ATOM 3927  H HB1  . ALA A 1 27  ? -1.203  -8.946  -0.802  1.00 0.00 ? 27  ALA A HB1  3  
ATOM 3928  H HB2  . ALA A 1 27  ? -1.094  -7.252  -1.284  1.00 0.00 ? 27  ALA A HB2  3  
ATOM 3929  H HB3  . ALA A 1 27  ? -0.251  -8.490  -2.214  1.00 0.00 ? 27  ALA A HB3  3  
ATOM 3930  N N    . ARG A 1 28  ? 1.347   -9.808  1.144   1.00 0.00 ? 28  ARG A N    3  
ATOM 3931  C CA   . ARG A 1 28  ? 1.962   -11.081 1.502   1.00 0.00 ? 28  ARG A CA   3  
ATOM 3932  C C    . ARG A 1 28  ? 0.931   -12.037 2.091   1.00 0.00 ? 28  ARG A C    3  
ATOM 3933  O O    . ARG A 1 28  ? 0.231   -11.701 3.046   1.00 0.00 ? 28  ARG A O    3  
ATOM 3934  C CB   . ARG A 1 28  ? 3.098   -10.857 2.502   1.00 0.00 ? 28  ARG A CB   3  
ATOM 3935  C CG   . ARG A 1 28  ? 2.721   -9.944  3.657   1.00 0.00 ? 28  ARG A CG   3  
ATOM 3936  C CD   . ARG A 1 28  ? 3.806   -9.917  4.724   1.00 0.00 ? 28  ARG A CD   3  
ATOM 3937  N NE   . ARG A 1 28  ? 4.869   -8.970  4.400   1.00 0.00 ? 28  ARG A NE   3  
ATOM 3938  C CZ   . ARG A 1 28  ? 6.049   -8.952  5.010   1.00 0.00 ? 28  ARG A CZ   3  
ATOM 3939  N NH1  . ARG A 1 28  ? 6.314   -9.827  5.970   1.00 0.00 ? 28  ARG A NH1  3  
ATOM 3940  N NH2  . ARG A 1 28  ? 6.965   -8.059  4.660   1.00 0.00 ? 28  ARG A NH2  3  
ATOM 3941  H H    . ARG A 1 28  ? 0.924   -9.268  1.845   1.00 0.00 ? 28  ARG A H    3  
ATOM 3942  H HA   . ARG A 1 28  ? 2.368   -11.517 0.602   1.00 0.00 ? 28  ARG A HA   3  
ATOM 3943  H HB2  . ARG A 1 28  ? 3.395   -11.813 2.911   1.00 0.00 ? 28  ARG A HB2  3  
ATOM 3944  H HB3  . ARG A 1 28  ? 3.938   -10.421 1.985   1.00 0.00 ? 28  ARG A HB3  3  
ATOM 3945  H HG2  . ARG A 1 28  ? 2.579   -8.942  3.279   1.00 0.00 ? 28  ARG A HG2  3  
ATOM 3946  H HG3  . ARG A 1 28  ? 1.802   -10.297 4.100   1.00 0.00 ? 28  ARG A HG3  3  
ATOM 3947  H HD2  . ARG A 1 28  ? 3.359   -9.635  5.665   1.00 0.00 ? 28  ARG A HD2  3  
ATOM 3948  H HD3  . ARG A 1 28  ? 4.231   -10.907 4.810   1.00 0.00 ? 28  ARG A HD3  3  
ATOM 3949  H HE   . ARG A 1 28  ? 4.693   -8.314  3.694   1.00 0.00 ? 28  ARG A HE   3  
ATOM 3950  H HH11 . ARG A 1 28  ? 5.626   -10.503 6.235   1.00 0.00 ? 28  ARG A HH11 3  
ATOM 3951  H HH12 . ARG A 1 28  ? 7.205   -9.814  6.427   1.00 0.00 ? 28  ARG A HH12 3  
ATOM 3952  H HH21 . ARG A 1 28  ? 6.767   -7.398  3.937   1.00 0.00 ? 28  ARG A HH21 3  
ATOM 3953  H HH22 . ARG A 1 28  ? 7.853   -8.047  5.120   1.00 0.00 ? 28  ARG A HH22 3  
ATOM 3954  N N    . MET A 1 29  ? 0.844   -13.232 1.515   1.00 0.00 ? 29  MET A N    3  
ATOM 3955  C CA   . MET A 1 29  ? -0.103  -14.238 1.983   1.00 0.00 ? 29  MET A CA   3  
ATOM 3956  C C    . MET A 1 29  ? 0.390   -14.890 3.271   1.00 0.00 ? 29  MET A C    3  
ATOM 3957  O O    . MET A 1 29  ? 1.571   -15.215 3.402   1.00 0.00 ? 29  MET A O    3  
ATOM 3958  C CB   . MET A 1 29  ? -0.319  -15.306 0.909   1.00 0.00 ? 29  MET A CB   3  
ATOM 3959  C CG   . MET A 1 29  ? -1.639  -15.165 0.170   1.00 0.00 ? 29  MET A CG   3  
ATOM 3960  S SD   . MET A 1 29  ? -3.066  -15.430 1.240   1.00 0.00 ? 29  MET A SD   3  
ATOM 3961  C CE   . MET A 1 29  ? -3.910  -16.743 0.361   1.00 0.00 ? 29  MET A CE   3  
ATOM 3962  H H    . MET A 1 29  ? 1.428   -13.443 0.756   1.00 0.00 ? 29  MET A H    3  
ATOM 3963  H HA   . MET A 1 29  ? -1.042  -13.743 2.180   1.00 0.00 ? 29  MET A HA   3  
ATOM 3964  H HB2  . MET A 1 29  ? 0.481   -15.240 0.187   1.00 0.00 ? 29  MET A HB2  3  
ATOM 3965  H HB3  . MET A 1 29  ? -0.294  -16.279 1.375   1.00 0.00 ? 29  MET A HB3  3  
ATOM 3966  H HG2  . MET A 1 29  ? -1.700  -14.171 -0.247  1.00 0.00 ? 29  MET A HG2  3  
ATOM 3967  H HG3  . MET A 1 29  ? -1.666  -15.890 -0.630  1.00 0.00 ? 29  MET A HG3  3  
ATOM 3968  H HE1  . MET A 1 29  ? -4.590  -16.314 -0.360  1.00 0.00 ? 29  MET A HE1  3  
ATOM 3969  H HE2  . MET A 1 29  ? -3.184  -17.359 -0.149  1.00 0.00 ? 29  MET A HE2  3  
ATOM 3970  H HE3  . MET A 1 29  ? -4.466  -17.347 1.063   1.00 0.00 ? 29  MET A HE3  3  
ATOM 3971  N N    . LEU A 1 30  ? -0.520  -15.077 4.221   1.00 0.00 ? 30  LEU A N    3  
ATOM 3972  C CA   . LEU A 1 30  ? -0.178  -15.690 5.499   1.00 0.00 ? 30  LEU A CA   3  
ATOM 3973  C C    . LEU A 1 30  ? -0.936  -16.998 5.696   1.00 0.00 ? 30  LEU A C    3  
ATOM 3974  O O    . LEU A 1 30  ? -0.462  -17.905 6.382   1.00 0.00 ? 30  LEU A O    3  
ATOM 3975  C CB   . LEU A 1 30  ? -0.490  -14.728 6.647   1.00 0.00 ? 30  LEU A CB   3  
ATOM 3976  C CG   . LEU A 1 30  ? -0.138  -13.260 6.407   1.00 0.00 ? 30  LEU A CG   3  
ATOM 3977  C CD1  . LEU A 1 30  ? -0.582  -12.405 7.585   1.00 0.00 ? 30  LEU A CD1  3  
ATOM 3978  C CD2  . LEU A 1 30  ? 1.356   -13.102 6.164   1.00 0.00 ? 30  LEU A CD2  3  
ATOM 3979  H H    . LEU A 1 30  ? -1.445  -14.797 4.058   1.00 0.00 ? 30  LEU A H    3  
ATOM 3980  H HA   . LEU A 1 30  ? 0.881   -15.899 5.493   1.00 0.00 ? 30  LEU A HA   3  
ATOM 3981  H HB2  . LEU A 1 30  ? -1.549  -14.786 6.848   1.00 0.00 ? 30  LEU A HB2  3  
ATOM 3982  H HB3  . LEU A 1 30  ? 0.059   -15.063 7.516   1.00 0.00 ? 30  LEU A HB3  3  
ATOM 3983  H HG   . LEU A 1 30  ? -0.659  -12.911 5.528   1.00 0.00 ? 30  LEU A HG   3  
ATOM 3984  H HD11 . LEU A 1 30  ? -0.899  -11.438 7.227   1.00 0.00 ? 30  LEU A HD11 3  
ATOM 3985  H HD12 . LEU A 1 30  ? 0.243   -12.283 8.271   1.00 0.00 ? 30  LEU A HD12 3  
ATOM 3986  H HD13 . LEU A 1 30  ? -1.403  -12.891 8.092   1.00 0.00 ? 30  LEU A HD13 3  
ATOM 3987  H HD21 . LEU A 1 30  ? 1.662   -12.104 6.442   1.00 0.00 ? 30  LEU A HD21 3  
ATOM 3988  H HD22 . LEU A 1 30  ? 1.569   -13.265 5.117   1.00 0.00 ? 30  LEU A HD22 3  
ATOM 3989  H HD23 . LEU A 1 30  ? 1.896   -13.824 6.759   1.00 0.00 ? 30  LEU A HD23 3  
ATOM 3990  N N    . SER A 1 31  ? -2.116  -17.091 5.090   1.00 0.00 ? 31  SER A N    3  
ATOM 3991  C CA   . SER A 1 31  ? -2.939  -18.288 5.199   1.00 0.00 ? 31  SER A CA   3  
ATOM 3992  C C    . SER A 1 31  ? -3.551  -18.653 3.850   1.00 0.00 ? 31  SER A C    3  
ATOM 3993  O O    . SER A 1 31  ? -3.182  -18.094 2.817   1.00 0.00 ? 31  SER A O    3  
ATOM 3994  C CB   . SER A 1 31  ? -4.048  -18.077 6.233   1.00 0.00 ? 31  SER A CB   3  
ATOM 3995  O OG   . SER A 1 31  ? -3.780  -16.946 7.043   1.00 0.00 ? 31  SER A OG   3  
ATOM 3996  H H    . SER A 1 31  ? -2.438  -16.335 4.556   1.00 0.00 ? 31  SER A H    3  
ATOM 3997  H HA   . SER A 1 31  ? -2.305  -19.099 5.525   1.00 0.00 ? 31  SER A HA   3  
ATOM 3998  H HB2  . SER A 1 31  ? -4.987  -17.925 5.724   1.00 0.00 ? 31  SER A HB2  3  
ATOM 3999  H HB3  . SER A 1 31  ? -4.119  -18.949 6.865   1.00 0.00 ? 31  SER A HB3  3  
ATOM 4000  H HG   . SER A 1 31  ? -3.005  -17.116 7.585   1.00 0.00 ? 31  SER A HG   3  
ATOM 4001  N N    . SER A 1 32  ? -4.488  -19.595 3.867   1.00 0.00 ? 32  SER A N    3  
ATOM 4002  C CA   . SER A 1 32  ? -5.148  -20.038 2.645   1.00 0.00 ? 32  SER A CA   3  
ATOM 4003  C C    . SER A 1 32  ? -6.228  -19.048 2.221   1.00 0.00 ? 32  SER A C    3  
ATOM 4004  O O    . SER A 1 32  ? -6.605  -18.986 1.050   1.00 0.00 ? 32  SER A O    3  
ATOM 4005  C CB   . SER A 1 32  ? -5.763  -21.425 2.846   1.00 0.00 ? 32  SER A CB   3  
ATOM 4006  O OG   . SER A 1 32  ? -6.419  -21.515 4.100   1.00 0.00 ? 32  SER A OG   3  
ATOM 4007  H H    . SER A 1 32  ? -4.739  -20.003 4.722   1.00 0.00 ? 32  SER A H    3  
ATOM 4008  H HA   . SER A 1 32  ? -4.401  -20.095 1.867   1.00 0.00 ? 32  SER A HA   3  
ATOM 4009  H HB2  . SER A 1 32  ? -6.481  -21.615 2.063   1.00 0.00 ? 32  SER A HB2  3  
ATOM 4010  H HB3  . SER A 1 32  ? -4.981  -22.171 2.808   1.00 0.00 ? 32  SER A HB3  3  
ATOM 4011  H HG   . SER A 1 32  ? -6.295  -22.396 4.463   1.00 0.00 ? 32  SER A HG   3  
ATOM 4012  N N    . THR A 1 33  ? -6.724  -18.275 3.181   1.00 0.00 ? 33  THR A N    3  
ATOM 4013  C CA   . THR A 1 33  ? -7.761  -17.288 2.910   1.00 0.00 ? 33  THR A CA   3  
ATOM 4014  C C    . THR A 1 33  ? -7.542  -16.020 3.728   1.00 0.00 ? 33  THR A C    3  
ATOM 4015  O O    . THR A 1 33  ? -8.497  -15.346 4.117   1.00 0.00 ? 33  THR A O    3  
ATOM 4016  C CB   . THR A 1 33  ? -9.162  -17.848 3.217   1.00 0.00 ? 33  THR A CB   3  
ATOM 4017  O OG1  . THR A 1 33  ? -9.172  -18.461 4.510   1.00 0.00 ? 33  THR A OG1  3  
ATOM 4018  C CG2  . THR A 1 33  ? -9.582  -18.862 2.165   1.00 0.00 ? 33  THR A CG2  3  
ATOM 4019  H H    . THR A 1 33  ? -6.382  -18.372 4.095   1.00 0.00 ? 33  THR A H    3  
ATOM 4020  H HA   . THR A 1 33  ? -7.717  -17.039 1.859   1.00 0.00 ? 33  THR A HA   3  
ATOM 4021  H HB   . THR A 1 33  ? -9.870  -17.030 3.209   1.00 0.00 ? 33  THR A HB   3  
ATOM 4022  H HG1  . THR A 1 33  ? -9.730  -17.951 5.103   1.00 0.00 ? 33  THR A HG1  3  
ATOM 4023  H HG21 . THR A 1 33  ? -9.215  -19.839 2.441   1.00 0.00 ? 33  THR A HG21 3  
ATOM 4024  H HG22 . THR A 1 33  ? -9.171  -18.580 1.207   1.00 0.00 ? 33  THR A HG22 3  
ATOM 4025  H HG23 . THR A 1 33  ? -10.660 -18.889 2.100   1.00 0.00 ? 33  THR A HG23 3  
ATOM 4026  N N    . THR A 1 34  ? -6.278  -15.699 3.986   1.00 0.00 ? 34  THR A N    3  
ATOM 4027  C CA   . THR A 1 34  ? -5.933  -14.513 4.760   1.00 0.00 ? 34  THR A CA   3  
ATOM 4028  C C    . THR A 1 34  ? -4.706  -13.817 4.180   1.00 0.00 ? 34  THR A C    3  
ATOM 4029  O O    . THR A 1 34  ? -3.626  -14.401 4.110   1.00 0.00 ? 34  THR A O    3  
ATOM 4030  C CB   . THR A 1 34  ? -5.663  -14.861 6.235   1.00 0.00 ? 34  THR A CB   3  
ATOM 4031  O OG1  . THR A 1 34  ? -6.204  -16.152 6.540   1.00 0.00 ? 34  THR A OG1  3  
ATOM 4032  C CG2  . THR A 1 34  ? -6.273  -13.819 7.158   1.00 0.00 ? 34  THR A CG2  3  
ATOM 4033  H H    . THR A 1 34  ? -5.561  -16.276 3.649   1.00 0.00 ? 34  THR A H    3  
ATOM 4034  H HA   . THR A 1 34  ? -6.773  -13.833 4.719   1.00 0.00 ? 34  THR A HA   3  
ATOM 4035  H HB   . THR A 1 34  ? -4.594  -14.881 6.394   1.00 0.00 ? 34  THR A HB   3  
ATOM 4036  H HG1  . THR A 1 34  ? -6.081  -16.338 7.474   1.00 0.00 ? 34  THR A HG1  3  
ATOM 4037  H HG21 . THR A 1 34  ? -7.225  -13.498 6.759   1.00 0.00 ? 34  THR A HG21 3  
ATOM 4038  H HG22 . THR A 1 34  ? -5.609  -12.970 7.233   1.00 0.00 ? 34  THR A HG22 3  
ATOM 4039  H HG23 . THR A 1 34  ? -6.420  -14.247 8.138   1.00 0.00 ? 34  THR A HG23 3  
ATOM 4040  N N    . ILE A 1 35  ? -4.880  -12.565 3.767   1.00 0.00 ? 35  ILE A N    3  
ATOM 4041  C CA   . ILE A 1 35  ? -3.787  -11.791 3.197   1.00 0.00 ? 35  ILE A CA   3  
ATOM 4042  C C    . ILE A 1 35  ? -3.397  -10.634 4.111   1.00 0.00 ? 35  ILE A C    3  
ATOM 4043  O O    . ILE A 1 35  ? -3.987  -10.443 5.175   1.00 0.00 ? 35  ILE A O    3  
ATOM 4044  C CB   . ILE A 1 35  ? -4.156  -11.232 1.810   1.00 0.00 ? 35  ILE A CB   3  
ATOM 4045  C CG1  . ILE A 1 35  ? -5.339  -10.266 1.924   1.00 0.00 ? 35  ILE A CG1  3  
ATOM 4046  C CG2  . ILE A 1 35  ? -4.484  -12.367 0.852   1.00 0.00 ? 35  ILE A CG2  3  
ATOM 4047  C CD1  . ILE A 1 35  ? -5.642  -9.528  0.638   1.00 0.00 ? 35  ILE A CD1  3  
ATOM 4048  H H    . ILE A 1 35  ? -5.767  -12.154 3.849   1.00 0.00 ? 35  ILE A H    3  
ATOM 4049  H HA   . ILE A 1 35  ? -2.937  -12.448 3.082   1.00 0.00 ? 35  ILE A HA   3  
ATOM 4050  H HB   . ILE A 1 35  ? -3.301  -10.699 1.421   1.00 0.00 ? 35  ILE A HB   3  
ATOM 4051  H HG12 . ILE A 1 35  ? -6.221  -10.819 2.205   1.00 0.00 ? 35  ILE A HG12 3  
ATOM 4052  H HG13 . ILE A 1 35  ? -5.120  -9.531  2.685   1.00 0.00 ? 35  ILE A HG13 3  
ATOM 4053  H HG21 . ILE A 1 35  ? -3.606  -12.610 0.270   1.00 0.00 ? 35  ILE A HG21 3  
ATOM 4054  H HG22 . ILE A 1 35  ? -4.793  -13.234 1.414   1.00 0.00 ? 35  ILE A HG22 3  
ATOM 4055  H HG23 . ILE A 1 35  ? -5.281  -12.062 0.190   1.00 0.00 ? 35  ILE A HG23 3  
ATOM 4056  H HD11 . ILE A 1 35  ? -4.967  -9.863  -0.137  1.00 0.00 ? 35  ILE A HD11 3  
ATOM 4057  H HD12 . ILE A 1 35  ? -6.660  -9.728  0.340   1.00 0.00 ? 35  ILE A HD12 3  
ATOM 4058  H HD13 . ILE A 1 35  ? -5.512  -8.467  0.793   1.00 0.00 ? 35  ILE A HD13 3  
ATOM 4059  N N    . LEU A 1 36  ? -2.401  -9.863  3.689   1.00 0.00 ? 36  LEU A N    3  
ATOM 4060  C CA   . LEU A 1 36  ? -1.933  -8.723  4.469   1.00 0.00 ? 36  LEU A CA   3  
ATOM 4061  C C    . LEU A 1 36  ? -1.423  -7.611  3.556   1.00 0.00 ? 36  LEU A C    3  
ATOM 4062  O O    . LEU A 1 36  ? -0.510  -7.819  2.757   1.00 0.00 ? 36  LEU A O    3  
ATOM 4063  C CB   . LEU A 1 36  ? -0.824  -9.157  5.429   1.00 0.00 ? 36  LEU A CB   3  
ATOM 4064  C CG   . LEU A 1 36  ? 0.057   -8.039  5.987   1.00 0.00 ? 36  LEU A CG   3  
ATOM 4065  C CD1  . LEU A 1 36  ? -0.798  -6.932  6.581   1.00 0.00 ? 36  LEU A CD1  3  
ATOM 4066  C CD2  . LEU A 1 36  ? 1.020   -8.589  7.029   1.00 0.00 ? 36  LEU A CD2  3  
ATOM 4067  H H    . LEU A 1 36  ? -1.969  -10.066 2.832   1.00 0.00 ? 36  LEU A H    3  
ATOM 4068  H HA   . LEU A 1 36  ? -2.767  -8.348  5.041   1.00 0.00 ? 36  LEU A HA   3  
ATOM 4069  H HB2  . LEU A 1 36  ? -1.287  -9.660  6.263   1.00 0.00 ? 36  LEU A HB2  3  
ATOM 4070  H HB3  . LEU A 1 36  ? -0.184  -9.853  4.902   1.00 0.00 ? 36  LEU A HB3  3  
ATOM 4071  H HG   . LEU A 1 36  ? 0.641   -7.614  5.183   1.00 0.00 ? 36  LEU A HG   3  
ATOM 4072  H HD11 . LEU A 1 36  ? -0.464  -6.717  7.585   1.00 0.00 ? 36  LEU A HD11 3  
ATOM 4073  H HD12 . LEU A 1 36  ? -1.831  -7.249  6.605   1.00 0.00 ? 36  LEU A HD12 3  
ATOM 4074  H HD13 . LEU A 1 36  ? -0.709  -6.042  5.974   1.00 0.00 ? 36  LEU A HD13 3  
ATOM 4075  H HD21 . LEU A 1 36  ? 0.462   -8.940  7.884   1.00 0.00 ? 36  LEU A HD21 3  
ATOM 4076  H HD22 . LEU A 1 36  ? 1.700   -7.808  7.340   1.00 0.00 ? 36  LEU A HD22 3  
ATOM 4077  H HD23 . LEU A 1 36  ? 1.582   -9.407  6.605   1.00 0.00 ? 36  LEU A HD23 3  
ATOM 4078  N N    . VAL A 1 37  ? -2.019  -6.429  3.682   1.00 0.00 ? 37  VAL A N    3  
ATOM 4079  C CA   . VAL A 1 37  ? -1.623  -5.284  2.872   1.00 0.00 ? 37  VAL A CA   3  
ATOM 4080  C C    . VAL A 1 37  ? -0.931  -4.222  3.720   1.00 0.00 ? 37  VAL A C    3  
ATOM 4081  O O    . VAL A 1 37  ? -1.525  -3.671  4.645   1.00 0.00 ? 37  VAL A O    3  
ATOM 4082  C CB   . VAL A 1 37  ? -2.837  -4.650  2.166   1.00 0.00 ? 37  VAL A CB   3  
ATOM 4083  C CG1  . VAL A 1 37  ? -2.385  -3.582  1.181   1.00 0.00 ? 37  VAL A CG1  3  
ATOM 4084  C CG2  . VAL A 1 37  ? -3.662  -5.718  1.464   1.00 0.00 ? 37  VAL A CG2  3  
ATOM 4085  H H    . VAL A 1 37  ? -2.740  -6.326  4.337   1.00 0.00 ? 37  VAL A H    3  
ATOM 4086  H HA   . VAL A 1 37  ? -0.934  -5.633  2.116   1.00 0.00 ? 37  VAL A HA   3  
ATOM 4087  H HB   . VAL A 1 37  ? -3.457  -4.180  2.914   1.00 0.00 ? 37  VAL A HB   3  
ATOM 4088  H HG11 . VAL A 1 37  ? -1.398  -3.238  1.454   1.00 0.00 ? 37  VAL A HG11 3  
ATOM 4089  H HG12 . VAL A 1 37  ? -2.360  -3.998  0.186   1.00 0.00 ? 37  VAL A HG12 3  
ATOM 4090  H HG13 . VAL A 1 37  ? -3.076  -2.753  1.209   1.00 0.00 ? 37  VAL A HG13 3  
ATOM 4091  H HG21 . VAL A 1 37  ? -4.348  -5.247  0.776   1.00 0.00 ? 37  VAL A HG21 3  
ATOM 4092  H HG22 . VAL A 1 37  ? -3.005  -6.383  0.921   1.00 0.00 ? 37  VAL A HG22 3  
ATOM 4093  H HG23 . VAL A 1 37  ? -4.219  -6.284  2.197   1.00 0.00 ? 37  VAL A HG23 3  
ATOM 4094  N N    . GLN A 1 38  ? 0.327   -3.944  3.397   1.00 0.00 ? 38  GLN A N    3  
ATOM 4095  C CA   . GLN A 1 38  ? 1.100   -2.948  4.131   1.00 0.00 ? 38  GLN A CA   3  
ATOM 4096  C C    . GLN A 1 38  ? 1.695   -1.913  3.182   1.00 0.00 ? 38  GLN A C    3  
ATOM 4097  O O    . GLN A 1 38  ? 2.153   -2.250  2.090   1.00 0.00 ? 38  GLN A O    3  
ATOM 4098  C CB   . GLN A 1 38  ? 2.215   -3.625  4.929   1.00 0.00 ? 38  GLN A CB   3  
ATOM 4099  C CG   . GLN A 1 38  ? 3.092   -4.543  4.094   1.00 0.00 ? 38  GLN A CG   3  
ATOM 4100  C CD   . GLN A 1 38  ? 4.486   -4.703  4.670   1.00 0.00 ? 38  GLN A CD   3  
ATOM 4101  O OE1  . GLN A 1 38  ? 5.480   -4.619  3.948   1.00 0.00 ? 38  GLN A OE1  3  
ATOM 4102  N NE2  . GLN A 1 38  ? 4.564   -4.935  5.973   1.00 0.00 ? 38  GLN A NE2  3  
ATOM 4103  H H    . GLN A 1 38  ? 0.746   -4.417  2.650   1.00 0.00 ? 38  GLN A H    3  
ATOM 4104  H HA   . GLN A 1 38  ? 0.431   -2.448  4.815   1.00 0.00 ? 38  GLN A HA   3  
ATOM 4105  H HB2  . GLN A 1 38  ? 2.844   -2.862  5.366   1.00 0.00 ? 38  GLN A HB2  3  
ATOM 4106  H HB3  . GLN A 1 38  ? 1.771   -4.210  5.721   1.00 0.00 ? 38  GLN A HB3  3  
ATOM 4107  H HG2  . GLN A 1 38  ? 2.627   -5.516  4.043   1.00 0.00 ? 38  GLN A HG2  3  
ATOM 4108  H HG3  . GLN A 1 38  ? 3.173   -4.133  3.097   1.00 0.00 ? 38  GLN A HG3  3  
ATOM 4109  H HE21 . GLN A 1 38  ? 3.729   -4.990  6.485   1.00 0.00 ? 38  GLN A HE21 3  
ATOM 4110  H HE22 . GLN A 1 38  ? 5.452   -5.043  6.372   1.00 0.00 ? 38  GLN A HE22 3  
ATOM 4111  N N    . TRP A 1 39  ? 1.684   -0.656  3.605   1.00 0.00 ? 39  TRP A N    3  
ATOM 4112  C CA   . TRP A 1 39  ? 2.223   0.430   2.791   1.00 0.00 ? 39  TRP A CA   3  
ATOM 4113  C C    . TRP A 1 39  ? 2.710   1.579   3.669   1.00 0.00 ? 39  TRP A C    3  
ATOM 4114  O O    . TRP A 1 39  ? 2.473   1.594   4.877   1.00 0.00 ? 39  TRP A O    3  
ATOM 4115  C CB   . TRP A 1 39  ? 1.163   0.934   1.811   1.00 0.00 ? 39  TRP A CB   3  
ATOM 4116  C CG   . TRP A 1 39  ? -0.031  1.539   2.485   1.00 0.00 ? 39  TRP A CG   3  
ATOM 4117  C CD1  . TRP A 1 39  ? -0.160  2.827   2.923   1.00 0.00 ? 39  TRP A CD1  3  
ATOM 4118  C CD2  . TRP A 1 39  ? -1.261  0.881   2.803   1.00 0.00 ? 39  TRP A CD2  3  
ATOM 4119  N NE1  . TRP A 1 39  ? -1.397  3.009   3.492   1.00 0.00 ? 39  TRP A NE1  3  
ATOM 4120  C CE2  . TRP A 1 39  ? -2.093  1.830   3.430   1.00 0.00 ? 39  TRP A CE2  3  
ATOM 4121  C CE3  . TRP A 1 39  ? -1.745  -0.417  2.615   1.00 0.00 ? 39  TRP A CE3  3  
ATOM 4122  C CZ2  . TRP A 1 39  ? -3.376  1.520   3.870   1.00 0.00 ? 39  TRP A CZ2  3  
ATOM 4123  C CZ3  . TRP A 1 39  ? -3.019  -0.724  3.053   1.00 0.00 ? 39  TRP A CZ3  3  
ATOM 4124  C CH2  . TRP A 1 39  ? -3.824  0.241   3.674   1.00 0.00 ? 39  TRP A CH2  3  
ATOM 4125  H H    . TRP A 1 39  ? 1.306   -0.449  4.486   1.00 0.00 ? 39  TRP A H    3  
ATOM 4126  H HA   . TRP A 1 39  ? 3.060   0.039   2.232   1.00 0.00 ? 39  TRP A HA   3  
ATOM 4127  H HB2  . TRP A 1 39  ? 1.600   1.685   1.171   1.00 0.00 ? 39  TRP A HB2  3  
ATOM 4128  H HB3  . TRP A 1 39  ? 0.820   0.106   1.206   1.00 0.00 ? 39  TRP A HB3  3  
ATOM 4129  H HD1  . TRP A 1 39  ? 0.608   3.580   2.829   1.00 0.00 ? 39  TRP A HD1  3  
ATOM 4130  H HE1  . TRP A 1 39  ? -1.728  3.846   3.878   1.00 0.00 ? 39  TRP A HE1  3  
ATOM 4131  H HE3  . TRP A 1 39  ? -1.140  -1.175  2.138   1.00 0.00 ? 39  TRP A HE3  3  
ATOM 4132  H HZ2  . TRP A 1 39  ? -4.009  2.252   4.350   1.00 0.00 ? 39  TRP A HZ2  3  
ATOM 4133  H HZ3  . TRP A 1 39  ? -3.409  -1.721  2.918   1.00 0.00 ? 39  TRP A HZ3  3  
ATOM 4134  H HH2  . TRP A 1 39  ? -4.811  -0.043  4.001   1.00 0.00 ? 39  TRP A HH2  3  
ATOM 4135  N N    . LYS A 1 40  ? 3.391   2.539   3.053   1.00 0.00 ? 40  LYS A N    3  
ATOM 4136  C CA   . LYS A 1 40  ? 3.909   3.693   3.778   1.00 0.00 ? 40  LYS A CA   3  
ATOM 4137  C C    . LYS A 1 40  ? 3.186   4.970   3.357   1.00 0.00 ? 40  LYS A C    3  
ATOM 4138  O O    . LYS A 1 40  ? 2.396   4.963   2.413   1.00 0.00 ? 40  LYS A O    3  
ATOM 4139  C CB   . LYS A 1 40  ? 5.413   3.841   3.533   1.00 0.00 ? 40  LYS A CB   3  
ATOM 4140  C CG   . LYS A 1 40  ? 6.270   3.210   4.617   1.00 0.00 ? 40  LYS A CG   3  
ATOM 4141  C CD   . LYS A 1 40  ? 7.729   3.611   4.477   1.00 0.00 ? 40  LYS A CD   3  
ATOM 4142  C CE   . LYS A 1 40  ? 8.511   3.320   5.748   1.00 0.00 ? 40  LYS A CE   3  
ATOM 4143  N NZ   . LYS A 1 40  ? 8.344   4.399   6.761   1.00 0.00 ? 40  LYS A NZ   3  
ATOM 4144  H H    . LYS A 1 40  ? 3.547   2.471   2.089   1.00 0.00 ? 40  LYS A H    3  
ATOM 4145  H HA   . LYS A 1 40  ? 3.738   3.529   4.831   1.00 0.00 ? 40  LYS A HA   3  
ATOM 4146  H HB2  . LYS A 1 40  ? 5.660   3.376   2.591   1.00 0.00 ? 40  LYS A HB2  3  
ATOM 4147  H HB3  . LYS A 1 40  ? 5.654   4.893   3.480   1.00 0.00 ? 40  LYS A HB3  3  
ATOM 4148  H HG2  . LYS A 1 40  ? 5.910   3.534   5.582   1.00 0.00 ? 40  LYS A HG2  3  
ATOM 4149  H HG3  . LYS A 1 40  ? 6.192   2.135   4.543   1.00 0.00 ? 40  LYS A HG3  3  
ATOM 4150  H HD2  . LYS A 1 40  ? 8.170   3.055   3.662   1.00 0.00 ? 40  LYS A HD2  3  
ATOM 4151  H HD3  . LYS A 1 40  ? 7.784   4.669   4.265   1.00 0.00 ? 40  LYS A HD3  3  
ATOM 4152  H HE2  . LYS A 1 40  ? 8.160   2.389   6.166   1.00 0.00 ? 40  LYS A HE2  3  
ATOM 4153  H HE3  . LYS A 1 40  ? 9.558   3.231   5.499   1.00 0.00 ? 40  LYS A HE3  3  
ATOM 4154  H HZ1  . LYS A 1 40  ? 8.602   5.318   6.349   1.00 0.00 ? 40  LYS A HZ1  3  
ATOM 4155  H HZ2  . LYS A 1 40  ? 8.956   4.216   7.583   1.00 0.00 ? 40  LYS A HZ2  3  
ATOM 4156  H HZ3  . LYS A 1 40  ? 7.355   4.440   7.081   1.00 0.00 ? 40  LYS A HZ3  3  
ATOM 4157  N N    . GLU A 1 41  ? 3.465   6.061   4.062   1.00 0.00 ? 41  GLU A N    3  
ATOM 4158  C CA   . GLU A 1 41  ? 2.842   7.344   3.758   1.00 0.00 ? 41  GLU A CA   3  
ATOM 4159  C C    . GLU A 1 41  ? 3.337   7.888   2.421   1.00 0.00 ? 41  GLU A C    3  
ATOM 4160  O O    . GLU A 1 41  ? 4.391   7.501   1.917   1.00 0.00 ? 41  GLU A O    3  
ATOM 4161  C CB   . GLU A 1 41  ? 3.134   8.355   4.871   1.00 0.00 ? 41  GLU A CB   3  
ATOM 4162  C CG   . GLU A 1 41  ? 1.934   8.656   5.751   1.00 0.00 ? 41  GLU A CG   3  
ATOM 4163  C CD   . GLU A 1 41  ? 2.005   10.032  6.385   1.00 0.00 ? 41  GLU A CD   3  
ATOM 4164  O OE1  . GLU A 1 41  ? 2.766   10.195  7.362   1.00 0.00 ? 41  GLU A OE1  3  
ATOM 4165  O OE2  . GLU A 1 41  ? 1.300   10.944  5.905   1.00 0.00 ? 41  GLU A OE2  3  
ATOM 4166  H H    . GLU A 1 41  ? 4.104   6.004   4.802   1.00 0.00 ? 41  GLU A H    3  
ATOM 4167  H HA   . GLU A 1 41  ? 1.775   7.189   3.699   1.00 0.00 ? 41  GLU A HA   3  
ATOM 4168  H HB2  . GLU A 1 41  ? 3.923   7.964   5.496   1.00 0.00 ? 41  GLU A HB2  3  
ATOM 4169  H HB3  . GLU A 1 41  ? 3.466   9.278   4.423   1.00 0.00 ? 41  GLU A HB3  3  
ATOM 4170  H HG2  . GLU A 1 41  ? 1.039   8.600   5.148   1.00 0.00 ? 41  GLU A HG2  3  
ATOM 4171  H HG3  . GLU A 1 41  ? 1.883   7.915   6.536   1.00 0.00 ? 41  GLU A HG3  3  
ATOM 4172  N N    . PRO A 1 42  ? 2.556   8.807   1.832   1.00 0.00 ? 42  PRO A N    3  
ATOM 4173  C CA   . PRO A 1 42  ? 2.894   9.423   0.545   1.00 0.00 ? 42  PRO A CA   3  
ATOM 4174  C C    . PRO A 1 42  ? 4.091   10.362  0.648   1.00 0.00 ? 42  PRO A C    3  
ATOM 4175  O O    . PRO A 1 42  ? 4.576   10.645  1.743   1.00 0.00 ? 42  PRO A O    3  
ATOM 4176  C CB   . PRO A 1 42  ? 1.629   10.207  0.184   1.00 0.00 ? 42  PRO A CB   3  
ATOM 4177  C CG   . PRO A 1 42  ? 0.974   10.491  1.493   1.00 0.00 ? 42  PRO A CG   3  
ATOM 4178  C CD   . PRO A 1 42  ? 1.286   9.315   2.377   1.00 0.00 ? 42  PRO A CD   3  
ATOM 4179  H HA   . PRO A 1 42  ? 3.087   8.679   -0.214  1.00 0.00 ? 42  PRO A HA   3  
ATOM 4180  H HB2  . PRO A 1 42  ? 1.901   11.118  -0.328  1.00 0.00 ? 42  PRO A HB2  3  
ATOM 4181  H HB3  . PRO A 1 42  ? 0.997   9.604   -0.450  1.00 0.00 ? 42  PRO A HB3  3  
ATOM 4182  H HG2  . PRO A 1 42  ? 1.380   11.397  1.917   1.00 0.00 ? 42  PRO A HG2  3  
ATOM 4183  H HG3  . PRO A 1 42  ? -0.093  10.583  1.356   1.00 0.00 ? 42  PRO A HG3  3  
ATOM 4184  H HD2  . PRO A 1 42  ? 1.406   9.634   3.401   1.00 0.00 ? 42  PRO A HD2  3  
ATOM 4185  H HD3  . PRO A 1 42  ? 0.509   8.569   2.300   1.00 0.00 ? 42  PRO A HD3  3  
ATOM 4186  N N    . GLU A 1 43  ? 4.562   10.841  -0.498  1.00 0.00 ? 43  GLU A N    3  
ATOM 4187  C CA   . GLU A 1 43  ? 5.703   11.749  -0.536  1.00 0.00 ? 43  GLU A CA   3  
ATOM 4188  C C    . GLU A 1 43  ? 5.244   13.202  -0.465  1.00 0.00 ? 43  GLU A C    3  
ATOM 4189  O O    . GLU A 1 43  ? 5.988   14.077  -0.021  1.00 0.00 ? 43  GLU A O    3  
ATOM 4190  C CB   . GLU A 1 43  ? 6.521   11.522  -1.808  1.00 0.00 ? 43  GLU A CB   3  
ATOM 4191  C CG   . GLU A 1 43  ? 7.987   11.218  -1.543  1.00 0.00 ? 43  GLU A CG   3  
ATOM 4192  C CD   . GLU A 1 43  ? 8.871   11.521  -2.737  1.00 0.00 ? 43  GLU A CD   3  
ATOM 4193  O OE1  . GLU A 1 43  ? 8.675   10.885  -3.794  1.00 0.00 ? 43  GLU A OE1  3  
ATOM 4194  O OE2  . GLU A 1 43  ? 9.757   12.391  -2.615  1.00 0.00 ? 43  GLU A OE2  3  
ATOM 4195  H H    . GLU A 1 43  ? 4.132   10.578  -1.339  1.00 0.00 ? 43  GLU A H    3  
ATOM 4196  H HA   . GLU A 1 43  ? 6.323   11.538  0.322   1.00 0.00 ? 43  GLU A HA   3  
ATOM 4197  H HB2  . GLU A 1 43  ? 6.096   10.692  -2.353  1.00 0.00 ? 43  GLU A HB2  3  
ATOM 4198  H HB3  . GLU A 1 43  ? 6.465   12.409  -2.420  1.00 0.00 ? 43  GLU A HB3  3  
ATOM 4199  H HG2  . GLU A 1 43  ? 8.320   11.817  -0.708  1.00 0.00 ? 43  GLU A HG2  3  
ATOM 4200  H HG3  . GLU A 1 43  ? 8.086   10.171  -1.295  1.00 0.00 ? 43  GLU A HG3  3  
ATOM 4201  N N    . GLU A 1 44  ? 4.016   13.451  -0.907  1.00 0.00 ? 44  GLU A N    3  
ATOM 4202  C CA   . GLU A 1 44  ? 3.458   14.799  -0.895  1.00 0.00 ? 44  GLU A CA   3  
ATOM 4203  C C    . GLU A 1 44  ? 2.091   14.817  -0.218  1.00 0.00 ? 44  GLU A C    3  
ATOM 4204  O O    . GLU A 1 44  ? 1.052   14.944  -0.867  1.00 0.00 ? 44  GLU A O    3  
ATOM 4205  C CB   . GLU A 1 44  ? 3.342   15.340  -2.321  1.00 0.00 ? 44  GLU A CB   3  
ATOM 4206  C CG   . GLU A 1 44  ? 4.530   16.183  -2.752  1.00 0.00 ? 44  GLU A CG   3  
ATOM 4207  C CD   . GLU A 1 44  ? 4.320   16.840  -4.102  1.00 0.00 ? 44  GLU A CD   3  
ATOM 4208  O OE1  . GLU A 1 44  ? 3.900   16.135  -5.044  1.00 0.00 ? 44  GLU A OE1  3  
ATOM 4209  O OE2  . GLU A 1 44  ? 4.576   18.056  -4.217  1.00 0.00 ? 44  GLU A OE2  3  
ATOM 4210  H H    . GLU A 1 44  ? 3.471   12.713  -1.247  1.00 0.00 ? 44  GLU A H    3  
ATOM 4211  H HA   . GLU A 1 44  ? 4.132   15.432  -0.334  1.00 0.00 ? 44  GLU A HA   3  
ATOM 4212  H HB2  . GLU A 1 44  ? 3.252   14.507  -3.003  1.00 0.00 ? 44  GLU A HB2  3  
ATOM 4213  H HB3  . GLU A 1 44  ? 2.453   15.948  -2.390  1.00 0.00 ? 44  GLU A HB3  3  
ATOM 4214  H HG2  . GLU A 1 44  ? 4.693   16.955  -2.014  1.00 0.00 ? 44  GLU A HG2  3  
ATOM 4215  H HG3  . GLU A 1 44  ? 5.404   15.550  -2.808  1.00 0.00 ? 44  GLU A HG3  3  
ATOM 4216  N N    . PRO A 1 45  ? 2.088   14.687  1.117   1.00 0.00 ? 45  PRO A N    3  
ATOM 4217  C CA   . PRO A 1 45  ? 0.857   14.685  1.909   1.00 0.00 ? 45  PRO A CA   3  
ATOM 4218  C C    . PRO A 1 45  ? 0.094   16.001  1.799   1.00 0.00 ? 45  PRO A C    3  
ATOM 4219  O O    . PRO A 1 45  ? -1.095  16.016  1.484   1.00 0.00 ? 45  PRO A O    3  
ATOM 4220  C CB   . PRO A 1 45  ? 1.357   14.474  3.341   1.00 0.00 ? 45  PRO A CB   3  
ATOM 4221  C CG   . PRO A 1 45  ? 2.789   14.879  3.305   1.00 0.00 ? 45  PRO A CG   3  
ATOM 4222  C CD   . PRO A 1 45  ? 3.291   14.533  1.954   1.00 0.00 ? 45  PRO A CD   3  
ATOM 4223  H HA   . PRO A 1 45  ? 0.206   13.869  1.631   1.00 0.00 ? 45  PRO A HA   3  
ATOM 4224  H HB2  . PRO A 1 45  ? 0.787   15.094  4.020   1.00 0.00 ? 45  PRO A HB2  3  
ATOM 4225  H HB3  . PRO A 1 45  ? 1.247   13.436  3.615   1.00 0.00 ? 45  PRO A HB3  3  
ATOM 4226  H HG2  . PRO A 1 45  ? 2.878   15.937  3.499   1.00 0.00 ? 45  PRO A HG2  3  
ATOM 4227  H HG3  . PRO A 1 45  ? 3.349   14.314  4.036   1.00 0.00 ? 45  PRO A HG3  3  
ATOM 4228  H HD2  . PRO A 1 45  ? 4.032   15.277  1.706   1.00 0.00 ? 45  PRO A HD2  3  
ATOM 4229  H HD3  . PRO A 1 45  ? 3.702   13.539  1.856   1.00 0.00 ? 45  PRO A HD3  3  
ATOM 4230  N N    . ASN A 1 46  ? 0.786   17.104  2.063   1.00 0.00 ? 46  ASN A N    3  
ATOM 4231  C CA   . ASN A 1 46  ? 0.174   18.426  1.994   1.00 0.00 ? 46  ASN A CA   3  
ATOM 4232  C C    . ASN A 1 46  ? -0.934  18.567  3.032   1.00 0.00 ? 46  ASN A C    3  
ATOM 4233  O O    . ASN A 1 46  ? -1.857  19.364  2.868   1.00 0.00 ? 46  ASN A O    3  
ATOM 4234  C CB   . ASN A 1 46  ? -0.391  18.677  0.594   1.00 0.00 ? 46  ASN A CB   3  
ATOM 4235  C CG   . ASN A 1 46  ? 0.607   18.342  -0.500  1.00 0.00 ? 46  ASN A CG   3  
ATOM 4236  O OD1  . ASN A 1 46  ? 1.732   18.844  -0.502  1.00 0.00 ? 46  ASN A OD1  3  
ATOM 4237  N ND2  . ASN A 1 46  ? 0.197   17.494  -1.436  1.00 0.00 ? 46  ASN A ND2  3  
ATOM 4238  H H    . ASN A 1 46  ? 1.732   17.028  2.310   1.00 0.00 ? 46  ASN A H    3  
ATOM 4239  H HA   . ASN A 1 46  ? 0.940   19.157  2.200   1.00 0.00 ? 46  ASN A HA   3  
ATOM 4240  H HB2  . ASN A 1 46  ? -1.269  18.064  0.451   1.00 0.00 ? 46  ASN A HB2  3  
ATOM 4241  H HB3  . ASN A 1 46  ? -0.663  19.717  0.503   1.00 0.00 ? 46  ASN A HB3  3  
ATOM 4242  H HD21 . ASN A 1 46  ? -0.713  17.135  -1.369  1.00 0.00 ? 46  ASN A HD21 3  
ATOM 4243  H HD22 . ASN A 1 46  ? 0.822   17.261  -2.153  1.00 0.00 ? 46  ASN A HD22 3  
ATOM 4244  N N    . GLY A 1 47  ? -0.836  17.787  4.105   1.00 0.00 ? 47  GLY A N    3  
ATOM 4245  C CA   . GLY A 1 47  ? -1.835  17.840  5.156   1.00 0.00 ? 47  GLY A CA   3  
ATOM 4246  C C    . GLY A 1 47  ? -1.810  16.612  6.043   1.00 0.00 ? 47  GLY A C    3  
ATOM 4247  O O    . GLY A 1 47  ? -1.148  15.623  5.726   1.00 0.00 ? 47  GLY A O    3  
ATOM 4248  H H    . GLY A 1 47  ? -0.077  17.170  4.182   1.00 0.00 ? 47  GLY A H    3  
ATOM 4249  H HA2  . GLY A 1 47  ? -1.654  18.714  5.765   1.00 0.00 ? 47  GLY A HA2  3  
ATOM 4250  H HA3  . GLY A 1 47  ? -2.812  17.924  4.704   1.00 0.00 ? 47  GLY A HA3  3  
ATOM 4251  N N    . GLN A 1 48  ? -2.530  16.674  7.158   1.00 0.00 ? 48  GLN A N    3  
ATOM 4252  C CA   . GLN A 1 48  ? -2.586  15.557  8.094   1.00 0.00 ? 48  GLN A CA   3  
ATOM 4253  C C    . GLN A 1 48  ? -3.447  14.425  7.542   1.00 0.00 ? 48  GLN A C    3  
ATOM 4254  O O    . GLN A 1 48  ? -4.651  14.590  7.342   1.00 0.00 ? 48  GLN A O    3  
ATOM 4255  C CB   . GLN A 1 48  ? -3.137  16.022  9.443   1.00 0.00 ? 48  GLN A CB   3  
ATOM 4256  C CG   . GLN A 1 48  ? -2.133  15.914  10.580  1.00 0.00 ? 48  GLN A CG   3  
ATOM 4257  C CD   . GLN A 1 48  ? -2.161  17.120  11.500  1.00 0.00 ? 48  GLN A CD   3  
ATOM 4258  O OE1  . GLN A 1 48  ? -1.701  18.203  11.135  1.00 0.00 ? 48  GLN A OE1  3  
ATOM 4259  N NE2  . GLN A 1 48  ? -2.703  16.940  12.698  1.00 0.00 ? 48  GLN A NE2  3  
ATOM 4260  H H    . GLN A 1 48  ? -3.036  17.489  7.356   1.00 0.00 ? 48  GLN A H    3  
ATOM 4261  H HA   . GLN A 1 48  ? -1.579  15.191  8.234   1.00 0.00 ? 48  GLN A HA   3  
ATOM 4262  H HB2  . GLN A 1 48  ? -3.442  17.054  9.357   1.00 0.00 ? 48  GLN A HB2  3  
ATOM 4263  H HB3  . GLN A 1 48  ? -3.998  15.419  9.693   1.00 0.00 ? 48  GLN A HB3  3  
ATOM 4264  H HG2  . GLN A 1 48  ? -2.361  15.033  11.162  1.00 0.00 ? 48  GLN A HG2  3  
ATOM 4265  H HG3  . GLN A 1 48  ? -1.142  15.822  10.161  1.00 0.00 ? 48  GLN A HG3  3  
ATOM 4266  H HE21 . GLN A 1 48  ? -3.049  16.048  12.920  1.00 0.00 ? 48  GLN A HE21 3  
ATOM 4267  H HE22 . GLN A 1 48  ? -2.734  17.701  13.312  1.00 0.00 ? 48  GLN A HE22 3  
ATOM 4268  N N    . ILE A 1 49  ? -2.822  13.279  7.298   1.00 0.00 ? 49  ILE A N    3  
ATOM 4269  C CA   . ILE A 1 49  ? -3.532  12.120  6.770   1.00 0.00 ? 49  ILE A CA   3  
ATOM 4270  C C    . ILE A 1 49  ? -4.521  11.568  7.792   1.00 0.00 ? 49  ILE A C    3  
ATOM 4271  O O    . ILE A 1 49  ? -4.132  11.150  8.881   1.00 0.00 ? 49  ILE A O    3  
ATOM 4272  C CB   . ILE A 1 49  ? -2.557  11.001  6.360   1.00 0.00 ? 49  ILE A CB   3  
ATOM 4273  C CG1  . ILE A 1 49  ? -1.574  11.513  5.306   1.00 0.00 ? 49  ILE A CG1  3  
ATOM 4274  C CG2  . ILE A 1 49  ? -3.324  9.796   5.836   1.00 0.00 ? 49  ILE A CG2  3  
ATOM 4275  C CD1  . ILE A 1 49  ? -2.235  11.907  4.003   1.00 0.00 ? 49  ILE A CD1  3  
ATOM 4276  H H    . ILE A 1 49  ? -1.863  13.209  7.478   1.00 0.00 ? 49  ILE A H    3  
ATOM 4277  H HA   . ILE A 1 49  ? -4.077  12.435  5.893   1.00 0.00 ? 49  ILE A HA   3  
ATOM 4278  H HB   . ILE A 1 49  ? -2.007  10.695  7.236   1.00 0.00 ? 49  ILE A HB   3  
ATOM 4279  H HG12 . ILE A 1 49  ? -1.062  12.381  5.691   1.00 0.00 ? 49  ILE A HG12 3  
ATOM 4280  H HG13 . ILE A 1 49  ? -0.851  10.739  5.091   1.00 0.00 ? 49  ILE A HG13 3  
ATOM 4281  H HG21 . ILE A 1 49  ? -3.181  8.960   6.505   1.00 0.00 ? 49  ILE A HG21 3  
ATOM 4282  H HG22 . ILE A 1 49  ? -4.375  10.036  5.779   1.00 0.00 ? 49  ILE A HG22 3  
ATOM 4283  H HG23 . ILE A 1 49  ? -2.960  9.536   4.854   1.00 0.00 ? 49  ILE A HG23 3  
ATOM 4284  H HD11 . ILE A 1 49  ? -2.093  12.962  3.830   1.00 0.00 ? 49  ILE A HD11 3  
ATOM 4285  H HD12 . ILE A 1 49  ? -1.796  11.344  3.192   1.00 0.00 ? 49  ILE A HD12 3  
ATOM 4286  H HD13 . ILE A 1 49  ? -3.293  11.691  4.058   1.00 0.00 ? 49  ILE A HD13 3  
ATOM 4287  N N    . GLN A 1 50  ? -5.799  11.569  7.432   1.00 0.00 ? 50  GLN A N    3  
ATOM 4288  C CA   . GLN A 1 50  ? -6.843  11.067  8.316   1.00 0.00 ? 50  GLN A CA   3  
ATOM 4289  C C    . GLN A 1 50  ? -7.018  9.562   8.155   1.00 0.00 ? 50  GLN A C    3  
ATOM 4290  O O    . GLN A 1 50  ? -7.474  8.877   9.069   1.00 0.00 ? 50  GLN A O    3  
ATOM 4291  C CB   . GLN A 1 50  ? -8.168  11.779  8.033   1.00 0.00 ? 50  GLN A CB   3  
ATOM 4292  C CG   . GLN A 1 50  ? -8.095  13.288  8.197   1.00 0.00 ? 50  GLN A CG   3  
ATOM 4293  C CD   . GLN A 1 50  ? -7.940  13.712  9.645   1.00 0.00 ? 50  GLN A CD   3  
ATOM 4294  O OE1  . GLN A 1 50  ? -8.612  13.185  10.532  1.00 0.00 ? 50  GLN A OE1  3  
ATOM 4295  N NE2  . GLN A 1 50  ? -7.049  14.664  9.891   1.00 0.00 ? 50  GLN A NE2  3  
ATOM 4296  H H    . GLN A 1 50  ? -6.047  11.917  6.549   1.00 0.00 ? 50  GLN A H    3  
ATOM 4297  H HA   . GLN A 1 50  ? -6.545  11.276  9.333   1.00 0.00 ? 50  GLN A HA   3  
ATOM 4298  H HB2  . GLN A 1 50  ? -8.468  11.563  7.019   1.00 0.00 ? 50  GLN A HB2  3  
ATOM 4299  H HB3  . GLN A 1 50  ? -8.919  11.401  8.711   1.00 0.00 ? 50  GLN A HB3  3  
ATOM 4300  H HG2  . GLN A 1 50  ? -7.249  13.659  7.639   1.00 0.00 ? 50  GLN A HG2  3  
ATOM 4301  H HG3  . GLN A 1 50  ? -9.003  13.724  7.806   1.00 0.00 ? 50  GLN A HG3  3  
ATOM 4302  H HE21 . GLN A 1 50  ? -6.551  15.038  9.134   1.00 0.00 ? 50  GLN A HE21 3  
ATOM 4303  H HE22 . GLN A 1 50  ? -6.929  14.956  10.818  1.00 0.00 ? 50  GLN A HE22 3  
ATOM 4304  N N    . GLY A 1 51  ? -6.648  9.051   6.984   1.00 0.00 ? 51  GLY A N    3  
ATOM 4305  C CA   . GLY A 1 51  ? -6.771  7.628   6.723   1.00 0.00 ? 51  GLY A CA   3  
ATOM 4306  C C    . GLY A 1 51  ? -6.464  7.273   5.282   1.00 0.00 ? 51  GLY A C    3  
ATOM 4307  O O    . GLY A 1 51  ? -5.849  8.059   4.560   1.00 0.00 ? 51  GLY A O    3  
ATOM 4308  H H    . GLY A 1 51  ? -6.289  9.644   6.291   1.00 0.00 ? 51  GLY A H    3  
ATOM 4309  H HA2  . GLY A 1 51  ? -6.088  7.095   7.368   1.00 0.00 ? 51  GLY A HA2  3  
ATOM 4310  H HA3  . GLY A 1 51  ? -7.780  7.318   6.951   1.00 0.00 ? 51  GLY A HA3  3  
ATOM 4311  N N    . TYR A 1 52  ? -6.891  6.088   4.861   1.00 0.00 ? 52  TYR A N    3  
ATOM 4312  C CA   . TYR A 1 52  ? -6.655  5.631   3.498   1.00 0.00 ? 52  TYR A CA   3  
ATOM 4313  C C    . TYR A 1 52  ? -7.812  4.766   3.005   1.00 0.00 ? 52  TYR A C    3  
ATOM 4314  O O    . TYR A 1 52  ? -8.765  4.505   3.742   1.00 0.00 ? 52  TYR A O    3  
ATOM 4315  C CB   . TYR A 1 52  ? -5.346  4.843   3.422   1.00 0.00 ? 52  TYR A CB   3  
ATOM 4316  C CG   . TYR A 1 52  ? -4.175  5.551   4.063   1.00 0.00 ? 52  TYR A CG   3  
ATOM 4317  C CD1  . TYR A 1 52  ? -3.952  5.466   5.432   1.00 0.00 ? 52  TYR A CD1  3  
ATOM 4318  C CD2  . TYR A 1 52  ? -3.292  6.305   3.302   1.00 0.00 ? 52  TYR A CD2  3  
ATOM 4319  C CE1  . TYR A 1 52  ? -2.884  6.112   6.023   1.00 0.00 ? 52  TYR A CE1  3  
ATOM 4320  C CE2  . TYR A 1 52  ? -2.220  6.954   3.885   1.00 0.00 ? 52  TYR A CE2  3  
ATOM 4321  C CZ   . TYR A 1 52  ? -2.020  6.854   5.245   1.00 0.00 ? 52  TYR A CZ   3  
ATOM 4322  O OH   . TYR A 1 52  ? -0.955  7.499   5.829   1.00 0.00 ? 52  TYR A OH   3  
ATOM 4323  H H    . TYR A 1 52  ? -7.376  5.507   5.484   1.00 0.00 ? 52  TYR A H    3  
ATOM 4324  H HA   . TYR A 1 52  ? -6.577  6.502   2.863   1.00 0.00 ? 52  TYR A HA   3  
ATOM 4325  H HB2  . TYR A 1 52  ? -5.475  3.896   3.922   1.00 0.00 ? 52  TYR A HB2  3  
ATOM 4326  H HB3  . TYR A 1 52  ? -5.100  4.666   2.385   1.00 0.00 ? 52  TYR A HB3  3  
ATOM 4327  H HD1  . TYR A 1 52  ? -4.631  4.884   6.040   1.00 0.00 ? 52  TYR A HD1  3  
ATOM 4328  H HD2  . TYR A 1 52  ? -3.451  6.382   2.235   1.00 0.00 ? 52  TYR A HD2  3  
ATOM 4329  H HE1  . TYR A 1 52  ? -2.727  6.034   7.089   1.00 0.00 ? 52  TYR A HE1  3  
ATOM 4330  H HE2  . TYR A 1 52  ? -1.544  7.535   3.275   1.00 0.00 ? 52  TYR A HE2  3  
ATOM 4331  H HH   . TYR A 1 52  ? -0.631  6.979   6.569   1.00 0.00 ? 52  TYR A HH   3  
ATOM 4332  N N    . ARG A 1 53  ? -7.721  4.324   1.756   1.00 0.00 ? 53  ARG A N    3  
ATOM 4333  C CA   . ARG A 1 53  ? -8.759  3.489   1.164   1.00 0.00 ? 53  ARG A CA   3  
ATOM 4334  C C    . ARG A 1 53  ? -8.146  2.374   0.321   1.00 0.00 ? 53  ARG A C    3  
ATOM 4335  O O    . ARG A 1 53  ? -7.231  2.608   -0.468  1.00 0.00 ? 53  ARG A O    3  
ATOM 4336  C CB   . ARG A 1 53  ? -9.696  4.337   0.300   1.00 0.00 ? 53  ARG A CB   3  
ATOM 4337  C CG   . ARG A 1 53  ? -10.584 5.272   1.104   1.00 0.00 ? 53  ARG A CG   3  
ATOM 4338  C CD   . ARG A 1 53  ? -11.245 6.314   0.215   1.00 0.00 ? 53  ARG A CD   3  
ATOM 4339  N NE   . ARG A 1 53  ? -12.086 7.232   0.979   1.00 0.00 ? 53  ARG A NE   3  
ATOM 4340  C CZ   . ARG A 1 53  ? -13.297 6.919   1.427   1.00 0.00 ? 53  ARG A CZ   3  
ATOM 4341  N NH1  . ARG A 1 53  ? -13.806 5.719   1.189   1.00 0.00 ? 53  ARG A NH1  3  
ATOM 4342  N NH2  . ARG A 1 53  ? -14.001 7.809   2.115   1.00 0.00 ? 53  ARG A NH2  3  
ATOM 4343  H H    . ARG A 1 53  ? -6.938  4.566   1.218   1.00 0.00 ? 53  ARG A H    3  
ATOM 4344  H HA   . ARG A 1 53  ? -9.328  3.045   1.967   1.00 0.00 ? 53  ARG A HA   3  
ATOM 4345  H HB2  . ARG A 1 53  ? -9.102  4.934   -0.375  1.00 0.00 ? 53  ARG A HB2  3  
ATOM 4346  H HB3  . ARG A 1 53  ? -10.330 3.680   -0.274  1.00 0.00 ? 53  ARG A HB3  3  
ATOM 4347  H HG2  . ARG A 1 53  ? -11.352 4.693   1.594   1.00 0.00 ? 53  ARG A HG2  3  
ATOM 4348  H HG3  . ARG A 1 53  ? -9.982  5.776   1.847   1.00 0.00 ? 53  ARG A HG3  3  
ATOM 4349  H HD2  . ARG A 1 53  ? -10.476 6.880   -0.287  1.00 0.00 ? 53  ARG A HD2  3  
ATOM 4350  H HD3  . ARG A 1 53  ? -11.855 5.807   -0.517  1.00 0.00 ? 53  ARG A HD3  3  
ATOM 4351  H HE   . ARG A 1 53  ? -11.729 8.124   1.167   1.00 0.00 ? 53  ARG A HE   3  
ATOM 4352  H HH11 . ARG A 1 53  ? -13.277 5.046   0.672   1.00 0.00 ? 53  ARG A HH11 3  
ATOM 4353  H HH12 . ARG A 1 53  ? -14.718 5.485   1.528   1.00 0.00 ? 53  ARG A HH12 3  
ATOM 4354  H HH21 . ARG A 1 53  ? -13.620 8.714   2.297   1.00 0.00 ? 53  ARG A HH21 3  
ATOM 4355  H HH22 . ARG A 1 53  ? -14.911 7.573   2.452   1.00 0.00 ? 53  ARG A HH22 3  
ATOM 4356  N N    . VAL A 1 54  ? -8.655  1.159   0.497   1.00 0.00 ? 54  VAL A N    3  
ATOM 4357  C CA   . VAL A 1 54  ? -8.159  0.006   -0.247  1.00 0.00 ? 54  VAL A CA   3  
ATOM 4358  C C    . VAL A 1 54  ? -9.237  -0.565  -1.160  1.00 0.00 ? 54  VAL A C    3  
ATOM 4359  O O    . VAL A 1 54  ? -10.420 -0.571  -0.814  1.00 0.00 ? 54  VAL A O    3  
ATOM 4360  C CB   . VAL A 1 54  ? -7.663  -1.103  0.700   1.00 0.00 ? 54  VAL A CB   3  
ATOM 4361  C CG1  . VAL A 1 54  ? -7.180  -2.307  -0.093  1.00 0.00 ? 54  VAL A CG1  3  
ATOM 4362  C CG2  . VAL A 1 54  ? -6.561  -0.574  1.608   1.00 0.00 ? 54  VAL A CG2  3  
ATOM 4363  H H    . VAL A 1 54  ? -9.383  1.033   1.140   1.00 0.00 ? 54  VAL A H    3  
ATOM 4364  H HA   . VAL A 1 54  ? -7.325  0.334   -0.851  1.00 0.00 ? 54  VAL A HA   3  
ATOM 4365  H HB   . VAL A 1 54  ? -8.492  -1.414  1.319   1.00 0.00 ? 54  VAL A HB   3  
ATOM 4366  H HG11 . VAL A 1 54  ? -6.304  -2.722  0.382   1.00 0.00 ? 54  VAL A HG11 3  
ATOM 4367  H HG12 . VAL A 1 54  ? -7.961  -3.053  -0.127  1.00 0.00 ? 54  VAL A HG12 3  
ATOM 4368  H HG13 . VAL A 1 54  ? -6.931  -1.998  -1.098  1.00 0.00 ? 54  VAL A HG13 3  
ATOM 4369  H HG21 . VAL A 1 54  ? -7.003  -0.133  2.489   1.00 0.00 ? 54  VAL A HG21 3  
ATOM 4370  H HG22 . VAL A 1 54  ? -5.913  -1.388  1.898   1.00 0.00 ? 54  VAL A HG22 3  
ATOM 4371  H HG23 . VAL A 1 54  ? -5.987  0.174   1.080   1.00 0.00 ? 54  VAL A HG23 3  
ATOM 4372  N N    . TYR A 1 55  ? -8.822  -1.046  -2.327  1.00 0.00 ? 55  TYR A N    3  
ATOM 4373  C CA   . TYR A 1 55  ? -9.753  -1.619  -3.291  1.00 0.00 ? 55  TYR A CA   3  
ATOM 4374  C C    . TYR A 1 55  ? -9.276  -2.990  -3.763  1.00 0.00 ? 55  TYR A C    3  
ATOM 4375  O O    . TYR A 1 55  ? -8.224  -3.111  -4.390  1.00 0.00 ? 55  TYR A O    3  
ATOM 4376  C CB   . TYR A 1 55  ? -9.918  -0.684  -4.491  1.00 0.00 ? 55  TYR A CB   3  
ATOM 4377  C CG   . TYR A 1 55  ? -10.158 0.758   -4.107  1.00 0.00 ? 55  TYR A CG   3  
ATOM 4378  C CD1  . TYR A 1 55  ? -9.099  1.601   -3.796  1.00 0.00 ? 55  TYR A CD1  3  
ATOM 4379  C CD2  . TYR A 1 55  ? -11.446 1.278   -4.055  1.00 0.00 ? 55  TYR A CD2  3  
ATOM 4380  C CE1  . TYR A 1 55  ? -9.316  2.920   -3.443  1.00 0.00 ? 55  TYR A CE1  3  
ATOM 4381  C CE2  . TYR A 1 55  ? -11.672 2.596   -3.704  1.00 0.00 ? 55  TYR A CE2  3  
ATOM 4382  C CZ   . TYR A 1 55  ? -10.603 3.412   -3.399  1.00 0.00 ? 55  TYR A CZ   3  
ATOM 4383  O OH   . TYR A 1 55  ? -10.823 4.725   -3.049  1.00 0.00 ? 55  TYR A OH   3  
ATOM 4384  H H    . TYR A 1 55  ? -7.868  -1.014  -2.546  1.00 0.00 ? 55  TYR A H    3  
ATOM 4385  H HA   . TYR A 1 55  ? -10.711 -1.732  -2.803  1.00 0.00 ? 55  TYR A HA   3  
ATOM 4386  H HB2  . TYR A 1 55  ? -9.022  -0.720  -5.093  1.00 0.00 ? 55  TYR A HB2  3  
ATOM 4387  H HB3  . TYR A 1 55  ? -10.758 -1.014  -5.085  1.00 0.00 ? 55  TYR A HB3  3  
ATOM 4388  H HD1  . TYR A 1 55  ? -8.092  1.213   -3.831  1.00 0.00 ? 55  TYR A HD1  3  
ATOM 4389  H HD2  . TYR A 1 55  ? -12.282 0.636   -4.294  1.00 0.00 ? 55  TYR A HD2  3  
ATOM 4390  H HE1  . TYR A 1 55  ? -8.478  3.560   -3.204  1.00 0.00 ? 55  TYR A HE1  3  
ATOM 4391  H HE2  . TYR A 1 55  ? -12.681 2.980   -3.669  1.00 0.00 ? 55  TYR A HE2  3  
ATOM 4392  H HH   . TYR A 1 55  ? -11.011 5.239   -3.838  1.00 0.00 ? 55  TYR A HH   3  
ATOM 4393  N N    . TYR A 1 56  ? -10.057 -4.018  -3.455  1.00 0.00 ? 56  TYR A N    3  
ATOM 4394  C CA   . TYR A 1 56  ? -9.715  -5.381  -3.843  1.00 0.00 ? 56  TYR A CA   3  
ATOM 4395  C C    . TYR A 1 56  ? -10.951 -6.140  -4.316  1.00 0.00 ? 56  TYR A C    3  
ATOM 4396  O O    . TYR A 1 56  ? -11.987 -6.141  -3.650  1.00 0.00 ? 56  TYR A O    3  
ATOM 4397  C CB   . TYR A 1 56  ? -9.067  -6.121  -2.672  1.00 0.00 ? 56  TYR A CB   3  
ATOM 4398  C CG   . TYR A 1 56  ? -10.005 -6.356  -1.510  1.00 0.00 ? 56  TYR A CG   3  
ATOM 4399  C CD1  . TYR A 1 56  ? -10.311 -5.333  -0.621  1.00 0.00 ? 56  TYR A CD1  3  
ATOM 4400  C CD2  . TYR A 1 56  ? -10.586 -7.600  -1.303  1.00 0.00 ? 56  TYR A CD2  3  
ATOM 4401  C CE1  . TYR A 1 56  ? -11.167 -5.544  0.444   1.00 0.00 ? 56  TYR A CE1  3  
ATOM 4402  C CE2  . TYR A 1 56  ? -11.445 -7.820  -0.242  1.00 0.00 ? 56  TYR A CE2  3  
ATOM 4403  C CZ   . TYR A 1 56  ? -11.732 -6.788  0.628   1.00 0.00 ? 56  TYR A CZ   3  
ATOM 4404  O OH   . TYR A 1 56  ? -12.586 -7.003  1.685   1.00 0.00 ? 56  TYR A OH   3  
ATOM 4405  H H    . TYR A 1 56  ? -10.884 -3.857  -2.952  1.00 0.00 ? 56  TYR A H    3  
ATOM 4406  H HA   . TYR A 1 56  ? -9.008  -5.326  -4.658  1.00 0.00 ? 56  TYR A HA   3  
ATOM 4407  H HB2  . TYR A 1 56  ? -8.715  -7.082  -3.013  1.00 0.00 ? 56  TYR A HB2  3  
ATOM 4408  H HB3  . TYR A 1 56  ? -8.228  -5.542  -2.310  1.00 0.00 ? 56  TYR A HB3  3  
ATOM 4409  H HD1  . TYR A 1 56  ? -9.866  -4.360  -0.769  1.00 0.00 ? 56  TYR A HD1  3  
ATOM 4410  H HD2  . TYR A 1 56  ? -10.360 -8.406  -1.987  1.00 0.00 ? 56  TYR A HD2  3  
ATOM 4411  H HE1  . TYR A 1 56  ? -11.392 -4.737  1.124   1.00 0.00 ? 56  TYR A HE1  3  
ATOM 4412  H HE2  . TYR A 1 56  ? -11.887 -8.794  -0.098  1.00 0.00 ? 56  TYR A HE2  3  
ATOM 4413  H HH   . TYR A 1 56  ? -13.428 -6.577  1.507   1.00 0.00 ? 56  TYR A HH   3  
ATOM 4414  N N    . THR A 1 57  ? -10.836 -6.785  -5.473  1.00 0.00 ? 57  THR A N    3  
ATOM 4415  C CA   . THR A 1 57  ? -11.943 -7.547  -6.036  1.00 0.00 ? 57  THR A CA   3  
ATOM 4416  C C    . THR A 1 57  ? -11.447 -8.552  -7.070  1.00 0.00 ? 57  THR A C    3  
ATOM 4417  O O    . THR A 1 57  ? -10.569 -8.248  -7.876  1.00 0.00 ? 57  THR A O    3  
ATOM 4418  C CB   . THR A 1 57  ? -12.984 -6.622  -6.694  1.00 0.00 ? 57  THR A CB   3  
ATOM 4419  O OG1  . THR A 1 57  ? -14.167 -7.365  -7.012  1.00 0.00 ? 57  THR A OG1  3  
ATOM 4420  C CG2  . THR A 1 57  ? -12.423 -5.988  -7.957  1.00 0.00 ? 57  THR A CG2  3  
ATOM 4421  H H    . THR A 1 57  ? -9.986  -6.745  -5.958  1.00 0.00 ? 57  THR A H    3  
ATOM 4422  H HA   . THR A 1 57  ? -12.425 -8.082  -5.230  1.00 0.00 ? 57  THR A HA   3  
ATOM 4423  H HB   . THR A 1 57  ? -13.239 -5.838  -5.996  1.00 0.00 ? 57  THR A HB   3  
ATOM 4424  H HG1  . THR A 1 57  ? -14.829 -6.772  -7.378  1.00 0.00 ? 57  THR A HG1  3  
ATOM 4425  H HG21 . THR A 1 57  ? -11.540 -5.416  -7.711  1.00 0.00 ? 57  THR A HG21 3  
ATOM 4426  H HG22 . THR A 1 57  ? -13.165 -5.333  -8.392  1.00 0.00 ? 57  THR A HG22 3  
ATOM 4427  H HG23 . THR A 1 57  ? -12.165 -6.760  -8.665  1.00 0.00 ? 57  THR A HG23 3  
ATOM 4428  N N    . MET A 1 58  ? -12.018 -9.752  -7.043  1.00 0.00 ? 58  MET A N    3  
ATOM 4429  C CA   . MET A 1 58  ? -11.636 -10.802 -7.979  1.00 0.00 ? 58  MET A CA   3  
ATOM 4430  C C    . MET A 1 58  ? -11.878 -10.361 -9.419  1.00 0.00 ? 58  MET A C    3  
ATOM 4431  O O    . MET A 1 58  ? -11.239 -10.859 -10.346 1.00 0.00 ? 58  MET A O    3  
ATOM 4432  C CB   . MET A 1 58  ? -12.417 -12.085 -7.689  1.00 0.00 ? 58  MET A CB   3  
ATOM 4433  C CG   . MET A 1 58  ? -13.915 -11.865 -7.543  1.00 0.00 ? 58  MET A CG   3  
ATOM 4434  S SD   . MET A 1 58  ? -14.534 -12.357 -5.922  1.00 0.00 ? 58  MET A SD   3  
ATOM 4435  C CE   . MET A 1 58  ? -13.932 -14.041 -5.827  1.00 0.00 ? 58  MET A CE   3  
ATOM 4436  H H    . MET A 1 58  ? -12.714 -9.936  -6.377  1.00 0.00 ? 58  MET A H    3  
ATOM 4437  H HA   . MET A 1 58  ? -10.582 -10.995 -7.847  1.00 0.00 ? 58  MET A HA   3  
ATOM 4438  H HB2  . MET A 1 58  ? -12.255 -12.782 -8.497  1.00 0.00 ? 58  MET A HB2  3  
ATOM 4439  H HB3  . MET A 1 58  ? -12.048 -12.518 -6.771  1.00 0.00 ? 58  MET A HB3  3  
ATOM 4440  H HG2  . MET A 1 58  ? -14.126 -10.816 -7.689  1.00 0.00 ? 58  MET A HG2  3  
ATOM 4441  H HG3  . MET A 1 58  ? -14.424 -12.443 -8.300  1.00 0.00 ? 58  MET A HG3  3  
ATOM 4442  H HE1  . MET A 1 58  ? -14.223 -14.579 -6.717  1.00 0.00 ? 58  MET A HE1  3  
ATOM 4443  H HE2  . MET A 1 58  ? -12.855 -14.033 -5.746  1.00 0.00 ? 58  MET A HE2  3  
ATOM 4444  H HE3  . MET A 1 58  ? -14.355 -14.526 -4.959  1.00 0.00 ? 58  MET A HE3  3  
ATOM 4445  N N    . ASP A 1 59  ? -12.804 -9.425  -9.599  1.00 0.00 ? 59  ASP A N    3  
ATOM 4446  C CA   . ASP A 1 59  ? -13.130 -8.916  -10.925 1.00 0.00 ? 59  ASP A CA   3  
ATOM 4447  C C    . ASP A 1 59  ? -12.740 -7.447  -11.055 1.00 0.00 ? 59  ASP A C    3  
ATOM 4448  O O    . ASP A 1 59  ? -13.584 -6.551  -11.024 1.00 0.00 ? 59  ASP A O    3  
ATOM 4449  C CB   . ASP A 1 59  ? -14.623 -9.088  -11.209 1.00 0.00 ? 59  ASP A CB   3  
ATOM 4450  C CG   . ASP A 1 59  ? -14.951 -10.456 -11.774 1.00 0.00 ? 59  ASP A CG   3  
ATOM 4451  O OD1  . ASP A 1 59  ? -15.186 -11.388 -10.976 1.00 0.00 ? 59  ASP A OD1  3  
ATOM 4452  O OD2  . ASP A 1 59  ? -14.973 -10.595 -13.014 1.00 0.00 ? 59  ASP A OD2  3  
ATOM 4453  H H    . ASP A 1 59  ? -13.279 -9.067  -8.820  1.00 0.00 ? 59  ASP A H    3  
ATOM 4454  H HA   . ASP A 1 59  ? -12.568 -9.488  -11.647 1.00 0.00 ? 59  ASP A HA   3  
ATOM 4455  H HB2  . ASP A 1 59  ? -15.174 -8.958  -10.288 1.00 0.00 ? 59  ASP A HB2  3  
ATOM 4456  H HB3  . ASP A 1 59  ? -14.936 -8.340  -11.921 1.00 0.00 ? 59  ASP A HB3  3  
ATOM 4457  N N    . PRO A 1 60  ? -11.432 -7.191  -11.202 1.00 0.00 ? 60  PRO A N    3  
ATOM 4458  C CA   . PRO A 1 60  ? -10.902 -5.831  -11.338 1.00 0.00 ? 60  PRO A CA   3  
ATOM 4459  C C    . PRO A 1 60  ? -11.276 -5.193  -12.672 1.00 0.00 ? 60  PRO A C    3  
ATOM 4460  O O    . PRO A 1 60  ? -11.050 -4.002  -12.888 1.00 0.00 ? 60  PRO A O    3  
ATOM 4461  C CB   . PRO A 1 60  ? -9.387  -6.032  -11.248 1.00 0.00 ? 60  PRO A CB   3  
ATOM 4462  C CG   . PRO A 1 60  ? -9.163  -7.435  -11.695 1.00 0.00 ? 60  PRO A CG   3  
ATOM 4463  C CD   . PRO A 1 60  ? -10.371 -8.210  -11.247 1.00 0.00 ? 60  PRO A CD   3  
ATOM 4464  H HA   . PRO A 1 60  ? -11.231 -5.194  -10.531 1.00 0.00 ? 60  PRO A HA   3  
ATOM 4465  H HB2  . PRO A 1 60  ? -8.889  -5.324  -11.896 1.00 0.00 ? 60  PRO A HB2  3  
ATOM 4466  H HB3  . PRO A 1 60  ? -9.061  -5.885  -10.228 1.00 0.00 ? 60  PRO A HB3  3  
ATOM 4467  H HG2  . PRO A 1 60  ? -9.073  -7.467  -12.770 1.00 0.00 ? 60  PRO A HG2  3  
ATOM 4468  H HG3  . PRO A 1 60  ? -8.270  -7.828  -11.231 1.00 0.00 ? 60  PRO A HG3  3  
ATOM 4469  H HD2  . PRO A 1 60  ? -10.609 -8.983  -11.962 1.00 0.00 ? 60  PRO A HD2  3  
ATOM 4470  H HD3  . PRO A 1 60  ? -10.204 -8.636  -10.269 1.00 0.00 ? 60  PRO A HD3  3  
ATOM 4471  N N    . THR A 1 61  ? -11.851 -5.993  -13.564 1.00 0.00 ? 61  THR A N    3  
ATOM 4472  C CA   . THR A 1 61  ? -12.257 -5.507  -14.876 1.00 0.00 ? 61  THR A CA   3  
ATOM 4473  C C    . THR A 1 61  ? -13.279 -4.384  -14.756 1.00 0.00 ? 61  THR A C    3  
ATOM 4474  O O    . THR A 1 61  ? -13.469 -3.602  -15.687 1.00 0.00 ? 61  THR A O    3  
ATOM 4475  C CB   . THR A 1 61  ? -12.853 -6.639  -15.736 1.00 0.00 ? 61  THR A CB   3  
ATOM 4476  O OG1  . THR A 1 61  ? -13.132 -6.158  -17.055 1.00 0.00 ? 61  THR A OG1  3  
ATOM 4477  C CG2  . THR A 1 61  ? -14.128 -7.180  -15.108 1.00 0.00 ? 61  THR A CG2  3  
ATOM 4478  H H    . THR A 1 61  ? -12.005 -6.934  -13.334 1.00 0.00 ? 61  THR A H    3  
ATOM 4479  H HA   . THR A 1 61  ? -11.377 -5.128  -15.379 1.00 0.00 ? 61  THR A HA   3  
ATOM 4480  H HB   . THR A 1 61  ? -12.131 -7.441  -15.798 1.00 0.00 ? 61  THR A HB   3  
ATOM 4481  H HG1  . THR A 1 61  ? -12.689 -6.716  -17.700 1.00 0.00 ? 61  THR A HG1  3  
ATOM 4482  H HG21 . THR A 1 61  ? -14.913 -6.443  -15.194 1.00 0.00 ? 61  THR A HG21 3  
ATOM 4483  H HG22 . THR A 1 61  ? -13.952 -7.397  -14.064 1.00 0.00 ? 61  THR A HG22 3  
ATOM 4484  H HG23 . THR A 1 61  ? -14.424 -8.084  -15.618 1.00 0.00 ? 61  THR A HG23 3  
ATOM 4485  N N    . GLN A 1 62  ? -13.937 -4.311  -13.603 1.00 0.00 ? 62  GLN A N    3  
ATOM 4486  C CA   . GLN A 1 62  ? -14.941 -3.281  -13.360 1.00 0.00 ? 62  GLN A CA   3  
ATOM 4487  C C    . GLN A 1 62  ? -14.307 -2.034  -12.754 1.00 0.00 ? 62  GLN A C    3  
ATOM 4488  O O    . GLN A 1 62  ? -13.132 -2.038  -12.385 1.00 0.00 ? 62  GLN A O    3  
ATOM 4489  C CB   . GLN A 1 62  ? -16.034 -3.814  -12.433 1.00 0.00 ? 62  GLN A CB   3  
ATOM 4490  C CG   . GLN A 1 62  ? -16.439 -5.249  -12.732 1.00 0.00 ? 62  GLN A CG   3  
ATOM 4491  C CD   . GLN A 1 62  ? -17.938 -5.461  -12.653 1.00 0.00 ? 62  GLN A CD   3  
ATOM 4492  O OE1  . GLN A 1 62  ? -18.708 -4.800  -13.349 1.00 0.00 ? 62  GLN A OE1  3  
ATOM 4493  N NE2  . GLN A 1 62  ? -18.360 -6.389  -11.802 1.00 0.00 ? 62  GLN A NE2  3  
ATOM 4494  H H    . GLN A 1 62  ? -13.740 -4.963  -12.898 1.00 0.00 ? 62  GLN A H    3  
ATOM 4495  H HA   . GLN A 1 62  ? -15.383 -3.020  -14.310 1.00 0.00 ? 62  GLN A HA   3  
ATOM 4496  H HB2  . GLN A 1 62  ? -15.681 -3.767  -11.414 1.00 0.00 ? 62  GLN A HB2  3  
ATOM 4497  H HB3  . GLN A 1 62  ? -16.908 -3.189  -12.531 1.00 0.00 ? 62  GLN A HB3  3  
ATOM 4498  H HG2  . GLN A 1 62  ? -16.107 -5.504  -13.727 1.00 0.00 ? 62  GLN A HG2  3  
ATOM 4499  H HG3  . GLN A 1 62  ? -15.959 -5.900  -12.016 1.00 0.00 ? 62  GLN A HG3  3  
ATOM 4500  H HE21 . GLN A 1 62  ? -17.689 -6.877  -11.278 1.00 0.00 ? 62  GLN A HE21 3  
ATOM 4501  H HE22 . GLN A 1 62  ? -19.324 -6.547  -11.730 1.00 0.00 ? 62  GLN A HE22 3  
ATOM 4502  N N    . HIS A 1 63  ? -15.091 -0.966  -12.653 1.00 0.00 ? 63  HIS A N    3  
ATOM 4503  C CA   . HIS A 1 63  ? -14.607 0.288   -12.090 1.00 0.00 ? 63  HIS A CA   3  
ATOM 4504  C C    . HIS A 1 63  ? -14.284 0.131   -10.607 1.00 0.00 ? 63  HIS A C    3  
ATOM 4505  O O    . HIS A 1 63  ? -14.979 -0.581  -9.881  1.00 0.00 ? 63  HIS A O    3  
ATOM 4506  C CB   . HIS A 1 63  ? -15.647 1.394   -12.282 1.00 0.00 ? 63  HIS A CB   3  
ATOM 4507  C CG   . HIS A 1 63  ? -15.047 2.749   -12.498 1.00 0.00 ? 63  HIS A CG   3  
ATOM 4508  N ND1  . HIS A 1 63  ? -14.063 3.275   -11.688 1.00 0.00 ? 63  HIS A ND1  3  
ATOM 4509  C CD2  . HIS A 1 63  ? -15.296 3.687   -13.441 1.00 0.00 ? 63  HIS A CD2  3  
ATOM 4510  C CE1  . HIS A 1 63  ? -13.735 4.478   -12.121 1.00 0.00 ? 63  HIS A CE1  3  
ATOM 4511  N NE2  . HIS A 1 63  ? -14.468 4.753   -13.185 1.00 0.00 ? 63  HIS A NE2  3  
ATOM 4512  H H    . HIS A 1 63  ? -16.019 -1.024  -12.963 1.00 0.00 ? 63  HIS A H    3  
ATOM 4513  H HA   . HIS A 1 63  ? -13.704 0.561   -12.615 1.00 0.00 ? 63  HIS A HA   3  
ATOM 4514  H HB2  . HIS A 1 63  ? -16.256 1.160   -13.143 1.00 0.00 ? 63  HIS A HB2  3  
ATOM 4515  H HB3  . HIS A 1 63  ? -16.276 1.444   -11.406 1.00 0.00 ? 63  HIS A HB3  3  
ATOM 4516  H HD2  . HIS A 1 63  ? -16.015 3.614   -14.247 1.00 0.00 ? 63  HIS A HD2  3  
ATOM 4517  H HE1  . HIS A 1 63  ? -12.992 5.128   -11.683 1.00 0.00 ? 63  HIS A HE1  3  
ATOM 4518  H HE2  . HIS A 1 63  ? -14.486 5.614   -13.652 1.00 0.00 ? 63  HIS A HE2  3  
ATOM 4519  N N    . VAL A 1 64  ? -13.224 0.800   -10.162 1.00 0.00 ? 64  VAL A N    3  
ATOM 4520  C CA   . VAL A 1 64  ? -12.809 0.734   -8.766  1.00 0.00 ? 64  VAL A CA   3  
ATOM 4521  C C    . VAL A 1 64  ? -13.942 1.154   -7.837  1.00 0.00 ? 64  VAL A C    3  
ATOM 4522  O O    . VAL A 1 64  ? -14.021 0.703   -6.694  1.00 0.00 ? 64  VAL A O    3  
ATOM 4523  C CB   . VAL A 1 64  ? -11.584 1.628   -8.502  1.00 0.00 ? 64  VAL A CB   3  
ATOM 4524  C CG1  . VAL A 1 64  ? -10.326 0.994   -9.076  1.00 0.00 ? 64  VAL A CG1  3  
ATOM 4525  C CG2  . VAL A 1 64  ? -11.803 3.017   -9.084  1.00 0.00 ? 64  VAL A CG2  3  
ATOM 4526  H H    . VAL A 1 64  ? -12.710 1.351   -10.789 1.00 0.00 ? 64  VAL A H    3  
ATOM 4527  H HA   . VAL A 1 64  ? -12.537 -0.289  -8.546  1.00 0.00 ? 64  VAL A HA   3  
ATOM 4528  H HB   . VAL A 1 64  ? -11.457 1.724   -7.434  1.00 0.00 ? 64  VAL A HB   3  
ATOM 4529  H HG11 . VAL A 1 64  ? -9.760  1.740   -9.613  1.00 0.00 ? 64  VAL A HG11 3  
ATOM 4530  H HG12 . VAL A 1 64  ? -9.726  0.593   -8.272  1.00 0.00 ? 64  VAL A HG12 3  
ATOM 4531  H HG13 . VAL A 1 64  ? -10.601 0.196   -9.751  1.00 0.00 ? 64  VAL A HG13 3  
ATOM 4532  H HG21 . VAL A 1 64  ? -11.621 3.759   -8.321  1.00 0.00 ? 64  VAL A HG21 3  
ATOM 4533  H HG22 . VAL A 1 64  ? -11.121 3.173   -9.908  1.00 0.00 ? 64  VAL A HG22 3  
ATOM 4534  H HG23 . VAL A 1 64  ? -12.820 3.104   -9.436  1.00 0.00 ? 64  VAL A HG23 3  
ATOM 4535  N N    . ASN A 1 65  ? -14.817 2.023   -8.333  1.00 0.00 ? 65  ASN A N    3  
ATOM 4536  C CA   . ASN A 1 65  ? -15.946 2.505   -7.546  1.00 0.00 ? 65  ASN A CA   3  
ATOM 4537  C C    . ASN A 1 65  ? -16.974 1.397   -7.334  1.00 0.00 ? 65  ASN A C    3  
ATOM 4538  O O    . ASN A 1 65  ? -17.896 1.538   -6.531  1.00 0.00 ? 65  ASN A O    3  
ATOM 4539  C CB   . ASN A 1 65  ? -16.604 3.700   -8.239  1.00 0.00 ? 65  ASN A CB   3  
ATOM 4540  C CG   . ASN A 1 65  ? -16.304 5.011   -7.538  1.00 0.00 ? 65  ASN A CG   3  
ATOM 4541  O OD1  . ASN A 1 65  ? -17.166 5.582   -6.868  1.00 0.00 ? 65  ASN A OD1  3  
ATOM 4542  N ND2  . ASN A 1 65  ? -15.077 5.496   -7.691  1.00 0.00 ? 65  ASN A ND2  3  
ATOM 4543  H H    . ASN A 1 65  ? -14.702 2.346   -9.251  1.00 0.00 ? 65  ASN A H    3  
ATOM 4544  H HA   . ASN A 1 65  ? -15.569 2.820   -6.585  1.00 0.00 ? 65  ASN A HA   3  
ATOM 4545  H HB2  . ASN A 1 65  ? -16.240 3.766   -9.254  1.00 0.00 ? 65  ASN A HB2  3  
ATOM 4546  H HB3  . ASN A 1 65  ? -17.674 3.557   -8.253  1.00 0.00 ? 65  ASN A HB3  3  
ATOM 4547  H HD21 . ASN A 1 65  ? -14.443 4.987   -8.239  1.00 0.00 ? 65  ASN A HD21 3  
ATOM 4548  H HD22 . ASN A 1 65  ? -14.856 6.342   -7.248  1.00 0.00 ? 65  ASN A HD22 3  
ATOM 4549  N N    . ASN A 1 66  ? -16.807 0.295   -8.058  1.00 0.00 ? 66  ASN A N    3  
ATOM 4550  C CA   . ASN A 1 66  ? -17.720 -0.837  -7.948  1.00 0.00 ? 66  ASN A CA   3  
ATOM 4551  C C    . ASN A 1 66  ? -17.075 -1.983  -7.175  1.00 0.00 ? 66  ASN A C    3  
ATOM 4552  O O    . ASN A 1 66  ? -17.763 -2.874  -6.678  1.00 0.00 ? 66  ASN A O    3  
ATOM 4553  C CB   . ASN A 1 66  ? -18.137 -1.318  -9.340  1.00 0.00 ? 66  ASN A CB   3  
ATOM 4554  C CG   . ASN A 1 66  ? -19.644 -1.348  -9.513  1.00 0.00 ? 66  ASN A CG   3  
ATOM 4555  O OD1  . ASN A 1 66  ? -20.303 -2.320  -9.143  1.00 0.00 ? 66  ASN A OD1  3  
ATOM 4556  N ND2  . ASN A 1 66  ? -20.196 -0.279  -10.076 1.00 0.00 ? 66  ASN A ND2  3  
ATOM 4557  H H    . ASN A 1 66  ? -16.053 0.242   -8.681  1.00 0.00 ? 66  ASN A H    3  
ATOM 4558  H HA   . ASN A 1 66  ? -18.597 -0.505  -7.414  1.00 0.00 ? 66  ASN A HA   3  
ATOM 4559  H HB2  . ASN A 1 66  ? -17.723 -0.652  -10.083 1.00 0.00 ? 66  ASN A HB2  3  
ATOM 4560  H HB3  . ASN A 1 66  ? -17.755 -2.314  -9.500  1.00 0.00 ? 66  ASN A HB3  3  
ATOM 4561  H HD21 . ASN A 1 66  ? -19.609 0.458   -10.345 1.00 0.00 ? 66  ASN A HD21 3  
ATOM 4562  H HD22 . ASN A 1 66  ? -21.168 -0.272  -10.199 1.00 0.00 ? 66  ASN A HD22 3  
ATOM 4563  N N    . TRP A 1 67  ? -15.752 -1.950  -7.075  1.00 0.00 ? 67  TRP A N    3  
ATOM 4564  C CA   . TRP A 1 67  ? -15.014 -2.986  -6.360  1.00 0.00 ? 67  TRP A CA   3  
ATOM 4565  C C    . TRP A 1 67  ? -15.555 -3.162  -4.946  1.00 0.00 ? 67  TRP A C    3  
ATOM 4566  O O    . TRP A 1 67  ? -16.416 -2.403  -4.503  1.00 0.00 ? 67  TRP A O    3  
ATOM 4567  C CB   . TRP A 1 67  ? -13.525 -2.638  -6.311  1.00 0.00 ? 67  TRP A CB   3  
ATOM 4568  C CG   . TRP A 1 67  ? -12.845 -2.749  -7.642  1.00 0.00 ? 67  TRP A CG   3  
ATOM 4569  C CD1  . TRP A 1 67  ? -13.445 -2.798  -8.869  1.00 0.00 ? 67  TRP A CD1  3  
ATOM 4570  C CD2  . TRP A 1 67  ? -11.435 -2.828  -7.881  1.00 0.00 ? 67  TRP A CD2  3  
ATOM 4571  N NE1  . TRP A 1 67  ? -12.494 -2.901  -9.854  1.00 0.00 ? 67  TRP A NE1  3  
ATOM 4572  C CE2  . TRP A 1 67  ? -11.252 -2.920  -9.273  1.00 0.00 ? 67  TRP A CE2  3  
ATOM 4573  C CE3  . TRP A 1 67  ? -10.310 -2.826  -7.052  1.00 0.00 ? 67  TRP A CE3  3  
ATOM 4574  C CZ2  . TRP A 1 67  ? -9.990  -3.013  -9.854  1.00 0.00 ? 67  TRP A CZ2  3  
ATOM 4575  C CZ3  . TRP A 1 67  ? -9.058  -2.917  -7.629  1.00 0.00 ? 67  TRP A CZ3  3  
ATOM 4576  C CH2  . TRP A 1 67  ? -8.906  -3.009  -9.019  1.00 0.00 ? 67  TRP A CH2  3  
ATOM 4577  H H    . TRP A 1 67  ? -15.258 -1.213  -7.491  1.00 0.00 ? 67  TRP A H    3  
ATOM 4578  H HA   . TRP A 1 67  ? -15.140 -3.914  -6.900  1.00 0.00 ? 67  TRP A HA   3  
ATOM 4579  H HB2  . TRP A 1 67  ? -13.409 -1.624  -5.962  1.00 0.00 ? 67  TRP A HB2  3  
ATOM 4580  H HB3  . TRP A 1 67  ? -13.029 -3.310  -5.625  1.00 0.00 ? 67  TRP A HB3  3  
ATOM 4581  H HD1  . TRP A 1 67  ? -14.512 -2.761  -9.024  1.00 0.00 ? 67  TRP A HD1  3  
ATOM 4582  H HE1  . TRP A 1 67  ? -12.675 -2.952  -10.816 1.00 0.00 ? 67  TRP A HE1  3  
ATOM 4583  H HE3  . TRP A 1 67  ? -10.406 -2.755  -5.978  1.00 0.00 ? 67  TRP A HE3  3  
ATOM 4584  H HZ2  . TRP A 1 67  ? -9.857  -3.082  -10.924 1.00 0.00 ? 67  TRP A HZ2  3  
ATOM 4585  H HZ3  . TRP A 1 67  ? -8.176  -2.917  -7.006  1.00 0.00 ? 67  TRP A HZ3  3  
ATOM 4586  H HH2  . TRP A 1 67  ? -7.909  -3.078  -9.427  1.00 0.00 ? 67  TRP A HH2  3  
ATOM 4587  N N    . MET A 1 68  ? -15.042 -4.166  -4.242  1.00 0.00 ? 68  MET A N    3  
ATOM 4588  C CA   . MET A 1 68  ? -15.475 -4.440  -2.876  1.00 0.00 ? 68  MET A CA   3  
ATOM 4589  C C    . MET A 1 68  ? -15.053 -3.313  -1.937  1.00 0.00 ? 68  MET A C    3  
ATOM 4590  O O    . MET A 1 68  ? -15.807 -2.919  -1.047  1.00 0.00 ? 68  MET A O    3  
ATOM 4591  C CB   . MET A 1 68  ? -14.892 -5.768  -2.391  1.00 0.00 ? 68  MET A CB   3  
ATOM 4592  C CG   . MET A 1 68  ? -15.948 -6.824  -2.100  1.00 0.00 ? 68  MET A CG   3  
ATOM 4593  S SD   . MET A 1 68  ? -15.471 -8.461  -2.686  1.00 0.00 ? 68  MET A SD   3  
ATOM 4594  C CE   . MET A 1 68  ? -14.185 -8.880  -1.512  1.00 0.00 ? 68  MET A CE   3  
ATOM 4595  H H    . MET A 1 68  ? -14.358 -4.737  -4.650  1.00 0.00 ? 68  MET A H    3  
ATOM 4596  H HA   . MET A 1 68  ? -16.552 -4.508  -2.876  1.00 0.00 ? 68  MET A HA   3  
ATOM 4597  H HB2  . MET A 1 68  ? -14.228 -6.155  -3.149  1.00 0.00 ? 68  MET A HB2  3  
ATOM 4598  H HB3  . MET A 1 68  ? -14.332 -5.594  -1.485  1.00 0.00 ? 68  MET A HB3  3  
ATOM 4599  H HG2  . MET A 1 68  ? -16.107 -6.872  -1.034  1.00 0.00 ? 68  MET A HG2  3  
ATOM 4600  H HG3  . MET A 1 68  ? -16.869 -6.537  -2.588  1.00 0.00 ? 68  MET A HG3  3  
ATOM 4601  H HE1  . MET A 1 68  ? -14.012 -8.041  -0.854  1.00 0.00 ? 68  MET A HE1  3  
ATOM 4602  H HE2  . MET A 1 68  ? -14.492 -9.736  -0.932  1.00 0.00 ? 68  MET A HE2  3  
ATOM 4603  H HE3  . MET A 1 68  ? -13.273 -9.112  -2.045  1.00 0.00 ? 68  MET A HE3  3  
ATOM 4604  N N    . LYS A 1 69  ? -13.845 -2.801  -2.140  1.00 0.00 ? 69  LYS A N    3  
ATOM 4605  C CA   . LYS A 1 69  ? -13.322 -1.721  -1.313  1.00 0.00 ? 69  LYS A CA   3  
ATOM 4606  C C    . LYS A 1 69  ? -13.162 -2.172  0.135   1.00 0.00 ? 69  LYS A C    3  
ATOM 4607  O O    . LYS A 1 69  ? -13.735 -3.181  0.549   1.00 0.00 ? 69  LYS A O    3  
ATOM 4608  C CB   . LYS A 1 69  ? -14.251 -0.506  -1.379  1.00 0.00 ? 69  LYS A CB   3  
ATOM 4609  C CG   . LYS A 1 69  ? -14.708 -0.165  -2.788  1.00 0.00 ? 69  LYS A CG   3  
ATOM 4610  C CD   . LYS A 1 69  ? -15.262 1.247   -2.868  1.00 0.00 ? 69  LYS A CD   3  
ATOM 4611  C CE   . LYS A 1 69  ? -15.007 1.870   -4.232  1.00 0.00 ? 69  LYS A CE   3  
ATOM 4612  N NZ   . LYS A 1 69  ? -15.096 3.355   -4.188  1.00 0.00 ? 69  LYS A NZ   3  
ATOM 4613  H H    . LYS A 1 69  ? -13.290 -3.158  -2.866  1.00 0.00 ? 69  LYS A H    3  
ATOM 4614  H HA   . LYS A 1 69  ? -12.353 -1.444  -1.701  1.00 0.00 ? 69  LYS A HA   3  
ATOM 4615  H HB2  . LYS A 1 69  ? -15.126 -0.703  -0.777  1.00 0.00 ? 69  LYS A HB2  3  
ATOM 4616  H HB3  . LYS A 1 69  ? -13.732 0.352   -0.975  1.00 0.00 ? 69  LYS A HB3  3  
ATOM 4617  H HG2  . LYS A 1 69  ? -13.866 -0.249  -3.459  1.00 0.00 ? 69  LYS A HG2  3  
ATOM 4618  H HG3  . LYS A 1 69  ? -15.478 -0.863  -3.084  1.00 0.00 ? 69  LYS A HG3  3  
ATOM 4619  H HD2  . LYS A 1 69  ? -16.328 1.216   -2.692  1.00 0.00 ? 69  LYS A HD2  3  
ATOM 4620  H HD3  . LYS A 1 69  ? -14.788 1.855   -2.110  1.00 0.00 ? 69  LYS A HD3  3  
ATOM 4621  H HE2  . LYS A 1 69  ? -14.020 1.586   -4.562  1.00 0.00 ? 69  LYS A HE2  3  
ATOM 4622  H HE3  . LYS A 1 69  ? -15.742 1.493   -4.928  1.00 0.00 ? 69  LYS A HE3  3  
ATOM 4623  H HZ1  . LYS A 1 69  ? -16.067 3.661   -4.403  1.00 0.00 ? 69  LYS A HZ1  3  
ATOM 4624  H HZ2  . LYS A 1 69  ? -14.451 3.772   -4.890  1.00 0.00 ? 69  LYS A HZ2  3  
ATOM 4625  H HZ3  . LYS A 1 69  ? -14.836 3.702   -3.244  1.00 0.00 ? 69  LYS A HZ3  3  
ATOM 4626  N N    . HIS A 1 70  ? -12.380 -1.418  0.901   1.00 0.00 ? 70  HIS A N    3  
ATOM 4627  C CA   . HIS A 1 70  ? -12.147 -1.741  2.306   1.00 0.00 ? 70  HIS A CA   3  
ATOM 4628  C C    . HIS A 1 70  ? -12.133 -0.476  3.158   1.00 0.00 ? 70  HIS A C    3  
ATOM 4629  O O    . HIS A 1 70  ? -12.401 0.618   2.666   1.00 0.00 ? 70  HIS A O    3  
ATOM 4630  C CB   . HIS A 1 70  ? -10.824 -2.492  2.465   1.00 0.00 ? 70  HIS A CB   3  
ATOM 4631  C CG   . HIS A 1 70  ? -10.882 -3.601  3.469   1.00 0.00 ? 70  HIS A CG   3  
ATOM 4632  N ND1  . HIS A 1 70  ? -11.947 -4.472  3.567   1.00 0.00 ? 70  HIS A ND1  3  
ATOM 4633  C CD2  . HIS A 1 70  ? -9.998  -3.982  4.420   1.00 0.00 ? 70  HIS A CD2  3  
ATOM 4634  C CE1  . HIS A 1 70  ? -11.716 -5.337  4.538   1.00 0.00 ? 70  HIS A CE1  3  
ATOM 4635  N NE2  . HIS A 1 70  ? -10.540 -5.062  5.070   1.00 0.00 ? 70  HIS A NE2  3  
ATOM 4636  H H    . HIS A 1 70  ? -11.952 -0.628  0.516   1.00 0.00 ? 70  HIS A H    3  
ATOM 4637  H HA   . HIS A 1 70  ? -12.953 -2.376  2.638   1.00 0.00 ? 70  HIS A HA   3  
ATOM 4638  H HB2  . HIS A 1 70  ? -10.544 -2.920  1.513   1.00 0.00 ? 70  HIS A HB2  3  
ATOM 4639  H HB3  . HIS A 1 70  ? -10.058 -1.797  2.781   1.00 0.00 ? 70  HIS A HB3  3  
ATOM 4640  H HD1  . HIS A 1 70  ? -12.753 -4.456  3.011   1.00 0.00 ? 70  HIS A HD1  3  
ATOM 4641  H HD2  . HIS A 1 70  ? -9.043  -3.521  4.630   1.00 0.00 ? 70  HIS A HD2  3  
ATOM 4642  H HE1  . HIS A 1 70  ? -12.376 -6.136  4.843   1.00 0.00 ? 70  HIS A HE1  3  
ATOM 4643  N N    . ASN A 1 71  ? -11.819 -0.635  4.440   1.00 0.00 ? 71  ASN A N    3  
ATOM 4644  C CA   . ASN A 1 71  ? -11.773 0.493   5.362   1.00 0.00 ? 71  ASN A CA   3  
ATOM 4645  C C    . ASN A 1 71  ? -10.401 0.602   6.020   1.00 0.00 ? 71  ASN A C    3  
ATOM 4646  O O    . ASN A 1 71  ? -9.703  -0.398  6.194   1.00 0.00 ? 71  ASN A O    3  
ATOM 4647  C CB   . ASN A 1 71  ? -12.856 0.348   6.434   1.00 0.00 ? 71  ASN A CB   3  
ATOM 4648  C CG   . ASN A 1 71  ? -12.863 -1.030  7.066   1.00 0.00 ? 71  ASN A CG   3  
ATOM 4649  O OD1  . ASN A 1 71  ? -11.893 -1.781  6.955   1.00 0.00 ? 71  ASN A OD1  3  
ATOM 4650  N ND2  . ASN A 1 71  ? -13.960 -1.370  7.733   1.00 0.00 ? 71  ASN A ND2  3  
ATOM 4651  H H    . ASN A 1 71  ? -11.616 -1.534  4.775   1.00 0.00 ? 71  ASN A H    3  
ATOM 4652  H HA   . ASN A 1 71  ? -11.959 1.392   4.795   1.00 0.00 ? 71  ASN A HA   3  
ATOM 4653  H HB2  . ASN A 1 71  ? -12.683 1.078   7.212   1.00 0.00 ? 71  ASN A HB2  3  
ATOM 4654  H HB3  . ASN A 1 71  ? -13.822 0.525   5.988   1.00 0.00 ? 71  ASN A HB3  3  
ATOM 4655  H HD21 . ASN A 1 71  ? -14.692 -0.721  7.780   1.00 0.00 ? 71  ASN A HD21 3  
ATOM 4656  H HD22 . ASN A 1 71  ? -13.990 -2.256  8.152   1.00 0.00 ? 71  ASN A HD22 3  
ATOM 4657  N N    . VAL A 1 72  ? -10.020 1.822   6.385   1.00 0.00 ? 72  VAL A N    3  
ATOM 4658  C CA   . VAL A 1 72  ? -8.732  2.062   7.025   1.00 0.00 ? 72  VAL A CA   3  
ATOM 4659  C C    . VAL A 1 72  ? -8.800  3.262   7.963   1.00 0.00 ? 72  VAL A C    3  
ATOM 4660  O O    . VAL A 1 72  ? -9.485  4.244   7.682   1.00 0.00 ? 72  VAL A O    3  
ATOM 4661  C CB   . VAL A 1 72  ? -7.623  2.299   5.984   1.00 0.00 ? 72  VAL A CB   3  
ATOM 4662  C CG1  . VAL A 1 72  ? -6.301  2.604   6.671   1.00 0.00 ? 72  VAL A CG1  3  
ATOM 4663  C CG2  . VAL A 1 72  ? -7.489  1.095   5.064   1.00 0.00 ? 72  VAL A CG2  3  
ATOM 4664  H H    . VAL A 1 72  ? -10.620 2.579   6.219   1.00 0.00 ? 72  VAL A H    3  
ATOM 4665  H HA   . VAL A 1 72  ? -8.476  1.183   7.599   1.00 0.00 ? 72  VAL A HA   3  
ATOM 4666  H HB   . VAL A 1 72  ? -7.897  3.155   5.383   1.00 0.00 ? 72  VAL A HB   3  
ATOM 4667  H HG11 . VAL A 1 72  ? -5.494  2.144   6.120   1.00 0.00 ? 72  VAL A HG11 3  
ATOM 4668  H HG12 . VAL A 1 72  ? -6.150  3.672   6.706   1.00 0.00 ? 72  VAL A HG12 3  
ATOM 4669  H HG13 . VAL A 1 72  ? -6.319  2.210   7.677   1.00 0.00 ? 72  VAL A HG13 3  
ATOM 4670  H HG21 . VAL A 1 72  ? -6.687  1.265   4.363   1.00 0.00 ? 72  VAL A HG21 3  
ATOM 4671  H HG22 . VAL A 1 72  ? -7.273  0.215   5.651   1.00 0.00 ? 72  VAL A HG22 3  
ATOM 4672  H HG23 . VAL A 1 72  ? -8.413  0.948   4.524   1.00 0.00 ? 72  VAL A HG23 3  
ATOM 4673  N N    . ALA A 1 73  ? -8.084  3.176   9.078   1.00 0.00 ? 73  ALA A N    3  
ATOM 4674  C CA   . ALA A 1 73  ? -8.059  4.255   10.056  1.00 0.00 ? 73  ALA A CA   3  
ATOM 4675  C C    . ALA A 1 73  ? -6.629  4.696   10.355  1.00 0.00 ? 73  ALA A C    3  
ATOM 4676  O O    . ALA A 1 73  ? -6.182  4.645   11.501  1.00 0.00 ? 73  ALA A O    3  
ATOM 4677  C CB   . ALA A 1 73  ? -8.759  3.824   11.336  1.00 0.00 ? 73  ALA A CB   3  
ATOM 4678  H H    . ALA A 1 73  ? -7.557  2.366   9.246   1.00 0.00 ? 73  ALA A H    3  
ATOM 4679  H HA   . ALA A 1 73  ? -8.603  5.094   9.643   1.00 0.00 ? 73  ALA A HA   3  
ATOM 4680  H HB1  . ALA A 1 73  ? -9.200  4.687   11.814  1.00 0.00 ? 73  ALA A HB1  3  
ATOM 4681  H HB2  . ALA A 1 73  ? -9.532  3.108   11.100  1.00 0.00 ? 73  ALA A HB2  3  
ATOM 4682  H HB3  . ALA A 1 73  ? -8.041  3.373   12.004  1.00 0.00 ? 73  ALA A HB3  3  
ATOM 4683  N N    . ASP A 1 74  ? -5.919  5.123   9.318   1.00 0.00 ? 74  ASP A N    3  
ATOM 4684  C CA   . ASP A 1 74  ? -4.540  5.571   9.468   1.00 0.00 ? 74  ASP A CA   3  
ATOM 4685  C C    . ASP A 1 74  ? -3.706  4.526   10.205  1.00 0.00 ? 74  ASP A C    3  
ATOM 4686  O O    . ASP A 1 74  ? -3.141  4.802   11.263  1.00 0.00 ? 74  ASP A O    3  
ATOM 4687  C CB   . ASP A 1 74  ? -4.492  6.902   10.222  1.00 0.00 ? 74  ASP A CB   3  
ATOM 4688  C CG   . ASP A 1 74  ? -3.233  7.691   9.925   1.00 0.00 ? 74  ASP A CG   3  
ATOM 4689  O OD1  . ASP A 1 74  ? -3.130  8.249   8.813   1.00 0.00 ? 74  ASP A OD1  3  
ATOM 4690  O OD2  . ASP A 1 74  ? -2.348  7.751   10.805  1.00 0.00 ? 74  ASP A OD2  3  
ATOM 4691  H H    . ASP A 1 74  ? -6.332  5.139   8.429   1.00 0.00 ? 74  ASP A H    3  
ATOM 4692  H HA   . ASP A 1 74  ? -4.126  5.712   8.481   1.00 0.00 ? 74  ASP A HA   3  
ATOM 4693  H HB2  . ASP A 1 74  ? -5.345  7.501   9.937   1.00 0.00 ? 74  ASP A HB2  3  
ATOM 4694  H HB3  . ASP A 1 74  ? -4.533  6.709   11.284  1.00 0.00 ? 74  ASP A HB3  3  
ATOM 4695  N N    . SER A 1 75  ? -3.636  3.326   9.637   1.00 0.00 ? 75  SER A N    3  
ATOM 4696  C CA   . SER A 1 75  ? -2.876  2.238   10.242  1.00 0.00 ? 75  SER A CA   3  
ATOM 4697  C C    . SER A 1 75  ? -1.714  1.824   9.344   1.00 0.00 ? 75  SER A C    3  
ATOM 4698  O O    . SER A 1 75  ? -0.742  1.228   9.807   1.00 0.00 ? 75  SER A O    3  
ATOM 4699  C CB   . SER A 1 75  ? -3.785  1.037   10.503  1.00 0.00 ? 75  SER A CB   3  
ATOM 4700  O OG   . SER A 1 75  ? -4.436  1.154   11.758  1.00 0.00 ? 75  SER A OG   3  
ATOM 4701  H H    . SER A 1 75  ? -4.109  3.168   8.794   1.00 0.00 ? 75  SER A H    3  
ATOM 4702  H HA   . SER A 1 75  ? -2.481  2.593   11.182  1.00 0.00 ? 75  SER A HA   3  
ATOM 4703  H HB2  . SER A 1 75  ? -4.534  0.979   9.728   1.00 0.00 ? 75  SER A HB2  3  
ATOM 4704  H HB3  . SER A 1 75  ? -3.194  0.133   10.501  1.00 0.00 ? 75  SER A HB3  3  
ATOM 4705  H HG   . SER A 1 75  ? -4.941  1.968   11.782  1.00 0.00 ? 75  SER A HG   3  
ATOM 4706  N N    . GLN A 1 76  ? -1.822  2.146   8.059   1.00 0.00 ? 76  GLN A N    3  
ATOM 4707  C CA   . GLN A 1 76  ? -0.780  1.806   7.096   1.00 0.00 ? 76  GLN A CA   3  
ATOM 4708  C C    . GLN A 1 76  ? -0.629  0.294   6.968   1.00 0.00 ? 76  GLN A C    3  
ATOM 4709  O O    . GLN A 1 76  ? 0.374   -0.197  6.453   1.00 0.00 ? 76  GLN A O    3  
ATOM 4710  C CB   . GLN A 1 76  ? 0.552   2.430   7.513   1.00 0.00 ? 76  GLN A CB   3  
ATOM 4711  C CG   . GLN A 1 76  ? 0.952   3.632   6.672   1.00 0.00 ? 76  GLN A CG   3  
ATOM 4712  C CD   . GLN A 1 76  ? 2.193   4.325   7.197   1.00 0.00 ? 76  GLN A CD   3  
ATOM 4713  O OE1  . GLN A 1 76  ? 2.155   5.502   7.560   1.00 0.00 ? 76  GLN A OE1  3  
ATOM 4714  N NE2  . GLN A 1 76  ? 3.304   3.599   7.241   1.00 0.00 ? 76  GLN A NE2  3  
ATOM 4715  H H    . GLN A 1 76  ? -2.622  2.621   7.751   1.00 0.00 ? 76  GLN A H    3  
ATOM 4716  H HA   . GLN A 1 76  ? -1.071  2.208   6.139   1.00 0.00 ? 76  GLN A HA   3  
ATOM 4717  H HB2  . GLN A 1 76  ? 0.481   2.748   8.543   1.00 0.00 ? 76  GLN A HB2  3  
ATOM 4718  H HB3  . GLN A 1 76  ? 1.328   1.683   7.428   1.00 0.00 ? 76  GLN A HB3  3  
ATOM 4719  H HG2  . GLN A 1 76  ? 1.144   3.299   5.663   1.00 0.00 ? 76  GLN A HG2  3  
ATOM 4720  H HG3  . GLN A 1 76  ? 0.136   4.339   6.668   1.00 0.00 ? 76  GLN A HG3  3  
ATOM 4721  H HE21 . GLN A 1 76  ? 3.260   2.668   6.934   1.00 0.00 ? 76  GLN A HE21 3  
ATOM 4722  H HE22 . GLN A 1 76  ? 4.120   4.023   7.575   1.00 0.00 ? 76  GLN A HE22 3  
ATOM 4723  N N    . ILE A 1 77  ? -1.633  -0.438  7.441   1.00 0.00 ? 77  ILE A N    3  
ATOM 4724  C CA   . ILE A 1 77  ? -1.611  -1.893  7.378   1.00 0.00 ? 77  ILE A CA   3  
ATOM 4725  C C    . ILE A 1 77  ? -2.994  -2.477  7.653   1.00 0.00 ? 77  ILE A C    3  
ATOM 4726  O O    . ILE A 1 77  ? -3.683  -2.057  8.582   1.00 0.00 ? 77  ILE A O    3  
ATOM 4727  C CB   . ILE A 1 77  ? -0.607  -2.485  8.385   1.00 0.00 ? 77  ILE A CB   3  
ATOM 4728  C CG1  . ILE A 1 77  ? -0.442  -3.989  8.149   1.00 0.00 ? 77  ILE A CG1  3  
ATOM 4729  C CG2  . ILE A 1 77  ? -1.066  -2.216  9.810   1.00 0.00 ? 77  ILE A CG2  3  
ATOM 4730  C CD1  . ILE A 1 77  ? 0.655   -4.614  8.982   1.00 0.00 ? 77  ILE A CD1  3  
ATOM 4731  H H    . ILE A 1 77  ? -2.406  0.012   7.840   1.00 0.00 ? 77  ILE A H    3  
ATOM 4732  H HA   . ILE A 1 77  ? -1.303  -2.180  6.383   1.00 0.00 ? 77  ILE A HA   3  
ATOM 4733  H HB   . ILE A 1 77  ? 0.344   -1.999  8.240   1.00 0.00 ? 77  ILE A HB   3  
ATOM 4734  H HG12 . ILE A 1 77  ? -1.366  -4.489  8.390   1.00 0.00 ? 77  ILE A HG12 3  
ATOM 4735  H HG13 . ILE A 1 77  ? -0.205  -4.157  7.108   1.00 0.00 ? 77  ILE A HG13 3  
ATOM 4736  H HG21 . ILE A 1 77  ? -1.469  -1.216  9.875   1.00 0.00 ? 77  ILE A HG21 3  
ATOM 4737  H HG22 . ILE A 1 77  ? -1.829  -2.928  10.084  1.00 0.00 ? 77  ILE A HG22 3  
ATOM 4738  H HG23 . ILE A 1 77  ? -0.226  -2.310  10.483  1.00 0.00 ? 77  ILE A HG23 3  
ATOM 4739  H HD11 . ILE A 1 77  ? 1.198   -3.838  9.504   1.00 0.00 ? 77  ILE A HD11 3  
ATOM 4740  H HD12 . ILE A 1 77  ? 0.221   -5.294  9.698   1.00 0.00 ? 77  ILE A HD12 3  
ATOM 4741  H HD13 . ILE A 1 77  ? 1.333   -5.155  8.338   1.00 0.00 ? 77  ILE A HD13 3  
ATOM 4742  N N    . THR A 1 78  ? -3.394  -3.449  6.838   1.00 0.00 ? 78  THR A N    3  
ATOM 4743  C CA   . THR A 1 78  ? -4.692  -4.090  6.993   1.00 0.00 ? 78  THR A CA   3  
ATOM 4744  C C    . THR A 1 78  ? -4.638  -5.552  6.566   1.00 0.00 ? 78  THR A C    3  
ATOM 4745  O O    . THR A 1 78  ? -3.881  -5.921  5.669   1.00 0.00 ? 78  THR A O    3  
ATOM 4746  C CB   . THR A 1 78  ? -5.777  -3.369  6.170   1.00 0.00 ? 78  THR A CB   3  
ATOM 4747  O OG1  . THR A 1 78  ? -7.060  -3.946  6.437   1.00 0.00 ? 78  THR A OG1  3  
ATOM 4748  C CG2  . THR A 1 78  ? -5.475  -3.455  4.682   1.00 0.00 ? 78  THR A CG2  3  
ATOM 4749  H H    . THR A 1 78  ? -2.799  -3.739  6.115   1.00 0.00 ? 78  THR A H    3  
ATOM 4750  H HA   . THR A 1 78  ? -4.967  -4.038  8.036   1.00 0.00 ? 78  THR A HA   3  
ATOM 4751  H HB   . THR A 1 78  ? -5.793  -2.327  6.459   1.00 0.00 ? 78  THR A HB   3  
ATOM 4752  H HG1  . THR A 1 78  ? -7.323  -3.741  7.337   1.00 0.00 ? 78  THR A HG1  3  
ATOM 4753  H HG21 . THR A 1 78  ? -5.826  -4.401  4.298   1.00 0.00 ? 78  THR A HG21 3  
ATOM 4754  H HG22 . THR A 1 78  ? -4.409  -3.375  4.526   1.00 0.00 ? 78  THR A HG22 3  
ATOM 4755  H HG23 . THR A 1 78  ? -5.976  -2.649  4.167   1.00 0.00 ? 78  THR A HG23 3  
ATOM 4756  N N    . THR A 1 79  ? -5.446  -6.384  7.217   1.00 0.00 ? 79  THR A N    3  
ATOM 4757  C CA   . THR A 1 79  ? -5.488  -7.807  6.906   1.00 0.00 ? 79  THR A CA   3  
ATOM 4758  C C    . THR A 1 79  ? -6.870  -8.221  6.411   1.00 0.00 ? 79  THR A C    3  
ATOM 4759  O O    . THR A 1 79  ? -7.858  -8.113  7.139   1.00 0.00 ? 79  THR A O    3  
ATOM 4760  C CB   . THR A 1 79  ? -5.119  -8.662  8.134   1.00 0.00 ? 79  THR A CB   3  
ATOM 4761  O OG1  . THR A 1 79  ? -5.725  -8.118  9.311   1.00 0.00 ? 79  THR A OG1  3  
ATOM 4762  C CG2  . THR A 1 79  ? -3.609  -8.722  8.316   1.00 0.00 ? 79  THR A CG2  3  
ATOM 4763  H H    . THR A 1 79  ? -6.026  -6.030  7.924   1.00 0.00 ? 79  THR A H    3  
ATOM 4764  H HA   . THR A 1 79  ? -4.765  -8.001  6.127   1.00 0.00 ? 79  THR A HA   3  
ATOM 4765  H HB   . THR A 1 79  ? -5.488  -9.666  7.979   1.00 0.00 ? 79  THR A HB   3  
ATOM 4766  H HG1  . THR A 1 79  ? -5.320  -8.507  10.090  1.00 0.00 ? 79  THR A HG1  3  
ATOM 4767  H HG21 . THR A 1 79  ? -3.380  -8.934  9.349   1.00 0.00 ? 79  THR A HG21 3  
ATOM 4768  H HG22 . THR A 1 79  ? -3.176  -7.772  8.039   1.00 0.00 ? 79  THR A HG22 3  
ATOM 4769  H HG23 . THR A 1 79  ? -3.202  -9.501  7.689   1.00 0.00 ? 79  THR A HG23 3  
ATOM 4770  N N    . ILE A 1 80  ? -6.932  -8.694  5.172   1.00 0.00 ? 80  ILE A N    3  
ATOM 4771  C CA   . ILE A 1 80  ? -8.193  -9.125  4.581   1.00 0.00 ? 80  ILE A CA   3  
ATOM 4772  C C    . ILE A 1 80  ? -8.288  -10.646 4.538   1.00 0.00 ? 80  ILE A C    3  
ATOM 4773  O O    . ILE A 1 80  ? -7.293  -11.335 4.319   1.00 0.00 ? 80  ILE A O    3  
ATOM 4774  C CB   . ILE A 1 80  ? -8.365  -8.570  3.154   1.00 0.00 ? 80  ILE A CB   3  
ATOM 4775  C CG1  . ILE A 1 80  ? -8.311  -7.041  3.168   1.00 0.00 ? 80  ILE A CG1  3  
ATOM 4776  C CG2  . ILE A 1 80  ? -9.676  -9.054  2.553   1.00 0.00 ? 80  ILE A CG2  3  
ATOM 4777  C CD1  . ILE A 1 80  ? -8.256  -6.426  1.787   1.00 0.00 ? 80  ILE A CD1  3  
ATOM 4778  H H    . ILE A 1 80  ? -6.110  -8.755  4.641   1.00 0.00 ? 80  ILE A H    3  
ATOM 4779  H HA   . ILE A 1 80  ? -8.996  -8.742  5.194   1.00 0.00 ? 80  ILE A HA   3  
ATOM 4780  H HB   . ILE A 1 80  ? -7.558  -8.946  2.546   1.00 0.00 ? 80  ILE A HB   3  
ATOM 4781  H HG12 . ILE A 1 80  ? -9.190  -6.660  3.665   1.00 0.00 ? 80  ILE A HG12 3  
ATOM 4782  H HG13 . ILE A 1 80  ? -7.431  -6.724  3.710   1.00 0.00 ? 80  ILE A HG13 3  
ATOM 4783  H HG21 . ILE A 1 80  ? -9.772  -8.675  1.547   1.00 0.00 ? 80  ILE A HG21 3  
ATOM 4784  H HG22 . ILE A 1 80  ? -9.685  -10.133 2.533   1.00 0.00 ? 80  ILE A HG22 3  
ATOM 4785  H HG23 . ILE A 1 80  ? -10.501 -8.698  3.152   1.00 0.00 ? 80  ILE A HG23 3  
ATOM 4786  H HD11 . ILE A 1 80  ? -8.917  -5.574  1.746   1.00 0.00 ? 80  ILE A HD11 3  
ATOM 4787  H HD12 . ILE A 1 80  ? -7.246  -6.110  1.574   1.00 0.00 ? 80  ILE A HD12 3  
ATOM 4788  H HD13 . ILE A 1 80  ? -8.566  -7.157  1.055   1.00 0.00 ? 80  ILE A HD13 3  
ATOM 4789  N N    . GLY A 1 81  ? -9.495  -11.164 4.746   1.00 0.00 ? 81  GLY A N    3  
ATOM 4790  C CA   . GLY A 1 81  ? -9.699  -12.601 4.724   1.00 0.00 ? 81  GLY A CA   3  
ATOM 4791  C C    . GLY A 1 81  ? -11.038 -12.988 4.129   1.00 0.00 ? 81  GLY A C    3  
ATOM 4792  O O    . GLY A 1 81  ? -11.695 -12.173 3.482   1.00 0.00 ? 81  GLY A O    3  
ATOM 4793  H H    . GLY A 1 81  ? -10.253 -10.566 4.915   1.00 0.00 ? 81  GLY A H    3  
ATOM 4794  H HA2  . GLY A 1 81  ? -8.913  -13.057 4.144   1.00 0.00 ? 81  GLY A HA2  3  
ATOM 4795  H HA3  . GLY A 1 81  ? -9.647  -12.975 5.737   1.00 0.00 ? 81  GLY A HA3  3  
ATOM 4796  N N    . ASN A 1 82  ? -11.442 -14.236 4.344   1.00 0.00 ? 82  ASN A N    3  
ATOM 4797  C CA   . ASN A 1 82  ? -12.711 -14.730 3.822   1.00 0.00 ? 82  ASN A CA   3  
ATOM 4798  C C    . ASN A 1 82  ? -12.712 -14.717 2.296   1.00 0.00 ? 82  ASN A C    3  
ATOM 4799  O O    . ASN A 1 82  ? -13.728 -14.418 1.667   1.00 0.00 ? 82  ASN A O    3  
ATOM 4800  C CB   . ASN A 1 82  ? -13.869 -13.882 4.351   1.00 0.00 ? 82  ASN A CB   3  
ATOM 4801  C CG   . ASN A 1 82  ? -15.220 -14.519 4.089   1.00 0.00 ? 82  ASN A CG   3  
ATOM 4802  O OD1  . ASN A 1 82  ? -15.387 -15.730 4.243   1.00 0.00 ? 82  ASN A OD1  3  
ATOM 4803  N ND2  . ASN A 1 82  ? -16.191 -13.706 3.690   1.00 0.00 ? 82  ASN A ND2  3  
ATOM 4804  H H    . ASN A 1 82  ? -10.874 -14.838 4.869   1.00 0.00 ? 82  ASN A H    3  
ATOM 4805  H HA   . ASN A 1 82  ? -12.836 -15.747 4.162   1.00 0.00 ? 82  ASN A HA   3  
ATOM 4806  H HB2  . ASN A 1 82  ? -13.754 -13.752 5.417   1.00 0.00 ? 82  ASN A HB2  3  
ATOM 4807  H HB3  . ASN A 1 82  ? -13.849 -12.914 3.871   1.00 0.00 ? 82  ASN A HB3  3  
ATOM 4808  H HD21 . ASN A 1 82  ? -15.985 -12.754 3.588   1.00 0.00 ? 82  ASN A HD21 3  
ATOM 4809  H HD22 . ASN A 1 82  ? -17.074 -14.094 3.515   1.00 0.00 ? 82  ASN A HD22 3  
ATOM 4810  N N    . LEU A 1 83  ? -11.567 -15.044 1.706   1.00 0.00 ? 83  LEU A N    3  
ATOM 4811  C CA   . LEU A 1 83  ? -11.436 -15.072 0.254   1.00 0.00 ? 83  LEU A CA   3  
ATOM 4812  C C    . LEU A 1 83  ? -11.363 -16.506 -0.260  1.00 0.00 ? 83  LEU A C    3  
ATOM 4813  O O    . LEU A 1 83  ? -11.504 -17.459 0.508   1.00 0.00 ? 83  LEU A O    3  
ATOM 4814  C CB   . LEU A 1 83  ? -10.188 -14.299 -0.180  1.00 0.00 ? 83  LEU A CB   3  
ATOM 4815  C CG   . LEU A 1 83  ? -9.877  -13.029 0.612   1.00 0.00 ? 83  LEU A CG   3  
ATOM 4816  C CD1  . LEU A 1 83  ? -8.497  -12.502 0.255   1.00 0.00 ? 83  LEU A CD1  3  
ATOM 4817  C CD2  . LEU A 1 83  ? -10.938 -11.968 0.359   1.00 0.00 ? 83  LEU A CD2  3  
ATOM 4818  H H    . LEU A 1 83  ? -10.792 -15.274 2.260   1.00 0.00 ? 83  LEU A H    3  
ATOM 4819  H HA   . LEU A 1 83  ? -12.308 -14.596 -0.167  1.00 0.00 ? 83  LEU A HA   3  
ATOM 4820  H HB2  . LEU A 1 83  ? -9.341  -14.961 -0.089  1.00 0.00 ? 83  LEU A HB2  3  
ATOM 4821  H HB3  . LEU A 1 83  ? -10.316 -14.022 -1.216  1.00 0.00 ? 83  LEU A HB3  3  
ATOM 4822  H HG   . LEU A 1 83  ? -9.881  -13.261 1.669   1.00 0.00 ? 83  LEU A HG   3  
ATOM 4823  H HD11 . LEU A 1 83  ? -7.790  -13.318 0.248   1.00 0.00 ? 83  LEU A HD11 3  
ATOM 4824  H HD12 . LEU A 1 83  ? -8.191  -11.767 0.985   1.00 0.00 ? 83  LEU A HD12 3  
ATOM 4825  H HD13 . LEU A 1 83  ? -8.528  -12.044 -0.724  1.00 0.00 ? 83  LEU A HD13 3  
ATOM 4826  H HD21 . LEU A 1 83  ? -11.896 -12.325 0.708   1.00 0.00 ? 83  LEU A HD21 3  
ATOM 4827  H HD22 . LEU A 1 83  ? -10.996 -11.764 -0.701  1.00 0.00 ? 83  LEU A HD22 3  
ATOM 4828  H HD23 . LEU A 1 83  ? -10.675 -11.063 0.886   1.00 0.00 ? 83  LEU A HD23 3  
ATOM 4829  N N    . VAL A 1 84  ? -11.138 -16.654 -1.560  1.00 0.00 ? 84  VAL A N    3  
ATOM 4830  C CA   . VAL A 1 84  ? -11.042 -17.972 -2.176  1.00 0.00 ? 84  VAL A CA   3  
ATOM 4831  C C    . VAL A 1 84  ? -9.621  -18.255 -2.654  1.00 0.00 ? 84  VAL A C    3  
ATOM 4832  O O    . VAL A 1 84  ? -8.981  -17.426 -3.300  1.00 0.00 ? 84  VAL A O    3  
ATOM 4833  C CB   . VAL A 1 84  ? -12.008 -18.106 -3.368  1.00 0.00 ? 84  VAL A CB   3  
ATOM 4834  C CG1  . VAL A 1 84  ? -11.729 -17.029 -4.405  1.00 0.00 ? 84  VAL A CG1  3  
ATOM 4835  C CG2  . VAL A 1 84  ? -11.901 -19.492 -3.985  1.00 0.00 ? 84  VAL A CG2  3  
ATOM 4836  H H    . VAL A 1 84  ? -11.032 -15.856 -2.121  1.00 0.00 ? 84  VAL A H    3  
ATOM 4837  H HA   . VAL A 1 84  ? -11.315 -18.708 -1.434  1.00 0.00 ? 84  VAL A HA   3  
ATOM 4838  H HB   . VAL A 1 84  ? -13.016 -17.973 -3.005  1.00 0.00 ? 84  VAL A HB   3  
ATOM 4839  H HG11 . VAL A 1 84  ? -10.761 -17.201 -4.851  1.00 0.00 ? 84  VAL A HG11 3  
ATOM 4840  H HG12 . VAL A 1 84  ? -12.490 -17.060 -5.171  1.00 0.00 ? 84  VAL A HG12 3  
ATOM 4841  H HG13 . VAL A 1 84  ? -11.738 -16.060 -3.928  1.00 0.00 ? 84  VAL A HG13 3  
ATOM 4842  H HG21 . VAL A 1 84  ? -12.245 -20.230 -3.275  1.00 0.00 ? 84  VAL A HG21 3  
ATOM 4843  H HG22 . VAL A 1 84  ? -12.514 -19.539 -4.875  1.00 0.00 ? 84  VAL A HG22 3  
ATOM 4844  H HG23 . VAL A 1 84  ? -10.873 -19.693 -4.246  1.00 0.00 ? 84  VAL A HG23 3  
ATOM 4845  N N    . PRO A 1 85  ? -9.115  -19.453 -2.328  1.00 0.00 ? 85  PRO A N    3  
ATOM 4846  C CA   . PRO A 1 85  ? -7.766  -19.872 -2.714  1.00 0.00 ? 85  PRO A CA   3  
ATOM 4847  C C    . PRO A 1 85  ? -7.640  -20.118 -4.213  1.00 0.00 ? 85  PRO A C    3  
ATOM 4848  O O    . PRO A 1 85  ? -8.640  -20.320 -4.903  1.00 0.00 ? 85  PRO A O    3  
ATOM 4849  C CB   . PRO A 1 85  ? -7.566  -21.179 -1.940  1.00 0.00 ? 85  PRO A CB   3  
ATOM 4850  C CG   . PRO A 1 85  ? -8.943  -21.701 -1.715  1.00 0.00 ? 85  PRO A CG   3  
ATOM 4851  C CD   . PRO A 1 85  ? -9.823  -20.491 -1.559  1.00 0.00 ? 85  PRO A CD   3  
ATOM 4852  H HA   . PRO A 1 85  ? -7.022  -19.153 -2.406  1.00 0.00 ? 85  PRO A HA   3  
ATOM 4853  H HB2  . PRO A 1 85  ? -6.975  -21.864 -2.533  1.00 0.00 ? 85  PRO A HB2  3  
ATOM 4854  H HB3  . PRO A 1 85  ? -7.063  -20.976 -1.007  1.00 0.00 ? 85  PRO A HB3  3  
ATOM 4855  H HG2  . PRO A 1 85  ? -9.258  -22.286 -2.566  1.00 0.00 ? 85  PRO A HG2  3  
ATOM 4856  H HG3  . PRO A 1 85  ? -8.967  -22.298 -0.816  1.00 0.00 ? 85  PRO A HG3  3  
ATOM 4857  H HD2  . PRO A 1 85  ? -10.801 -20.679 -1.975  1.00 0.00 ? 85  PRO A HD2  3  
ATOM 4858  H HD3  . PRO A 1 85  ? -9.901  -20.212 -0.519  1.00 0.00 ? 85  PRO A HD3  3  
ATOM 4859  N N    . GLN A 1 86  ? -6.409  -20.099 -4.712  1.00 0.00 ? 86  GLN A N    3  
ATOM 4860  C CA   . GLN A 1 86  ? -6.154  -20.319 -6.132  1.00 0.00 ? 86  GLN A CA   3  
ATOM 4861  C C    . GLN A 1 86  ? -7.019  -19.399 -6.987  1.00 0.00 ? 86  GLN A C    3  
ATOM 4862  O O    . GLN A 1 86  ? -7.739  -19.854 -7.876  1.00 0.00 ? 86  GLN A O    3  
ATOM 4863  C CB   . GLN A 1 86  ? -6.425  -21.778 -6.498  1.00 0.00 ? 86  GLN A CB   3  
ATOM 4864  C CG   . GLN A 1 86  ? -5.354  -22.739 -6.005  1.00 0.00 ? 86  GLN A CG   3  
ATOM 4865  C CD   . GLN A 1 86  ? -4.994  -23.790 -7.034  1.00 0.00 ? 86  GLN A CD   3  
ATOM 4866  O OE1  . GLN A 1 86  ? -4.370  -23.490 -8.053  1.00 0.00 ? 86  GLN A OE1  3  
ATOM 4867  N NE2  . GLN A 1 86  ? -5.384  -25.033 -6.774  1.00 0.00 ? 86  GLN A NE2  3  
ATOM 4868  H H    . GLN A 1 86  ? -5.652  -19.933 -4.111  1.00 0.00 ? 86  GLN A H    3  
ATOM 4869  H HA   . GLN A 1 86  ? -5.116  -20.095 -6.320  1.00 0.00 ? 86  GLN A HA   3  
ATOM 4870  H HB2  . GLN A 1 86  ? -7.370  -22.076 -6.071  1.00 0.00 ? 86  GLN A HB2  3  
ATOM 4871  H HB3  . GLN A 1 86  ? -6.483  -21.862 -7.574  1.00 0.00 ? 86  GLN A HB3  3  
ATOM 4872  H HG2  . GLN A 1 86  ? -4.465  -22.174 -5.764  1.00 0.00 ? 86  GLN A HG2  3  
ATOM 4873  H HG3  . GLN A 1 86  ? -5.716  -23.234 -5.115  1.00 0.00 ? 86  GLN A HG3  3  
ATOM 4874  H HE21 . GLN A 1 86  ? -5.879  -25.197 -5.943  1.00 0.00 ? 86  GLN A HE21 3  
ATOM 4875  H HE22 . GLN A 1 86  ? -5.165  -25.733 -7.423  1.00 0.00 ? 86  GLN A HE22 3  
ATOM 4876  N N    . LYS A 1 87  ? -6.943  -18.100 -6.713  1.00 0.00 ? 87  LYS A N    3  
ATOM 4877  C CA   . LYS A 1 87  ? -7.716  -17.115 -7.459  1.00 0.00 ? 87  LYS A CA   3  
ATOM 4878  C C    . LYS A 1 87  ? -7.025  -15.756 -7.444  1.00 0.00 ? 87  LYS A C    3  
ATOM 4879  O O    . LYS A 1 87  ? -6.714  -15.217 -6.379  1.00 0.00 ? 87  LYS A O    3  
ATOM 4880  C CB   . LYS A 1 87  ? -9.123  -16.989 -6.870  1.00 0.00 ? 87  LYS A CB   3  
ATOM 4881  C CG   . LYS A 1 87  ? -10.001 -18.203 -7.126  1.00 0.00 ? 87  LYS A CG   3  
ATOM 4882  C CD   . LYS A 1 87  ? -10.185 -18.454 -8.614  1.00 0.00 ? 87  LYS A CD   3  
ATOM 4883  C CE   . LYS A 1 87  ? -11.652 -18.419 -9.007  1.00 0.00 ? 87  LYS A CE   3  
ATOM 4884  N NZ   . LYS A 1 87  ? -11.831 -18.140 -10.459 1.00 0.00 ? 87  LYS A NZ   3  
ATOM 4885  H H    . LYS A 1 87  ? -6.350  -17.797 -5.993  1.00 0.00 ? 87  LYS A H    3  
ATOM 4886  H HA   . LYS A 1 87  ? -7.792  -17.455 -8.481  1.00 0.00 ? 87  LYS A HA   3  
ATOM 4887  H HB2  . LYS A 1 87  ? -9.043  -16.848 -5.802  1.00 0.00 ? 87  LYS A HB2  3  
ATOM 4888  H HB3  . LYS A 1 87  ? -9.606  -16.126 -7.303  1.00 0.00 ? 87  LYS A HB3  3  
ATOM 4889  H HG2  . LYS A 1 87  ? -9.537  -19.071 -6.680  1.00 0.00 ? 87  LYS A HG2  3  
ATOM 4890  H HG3  . LYS A 1 87  ? -10.969 -18.038 -6.676  1.00 0.00 ? 87  LYS A HG3  3  
ATOM 4891  H HD2  . LYS A 1 87  ? -9.656  -17.691 -9.166  1.00 0.00 ? 87  LYS A HD2  3  
ATOM 4892  H HD3  . LYS A 1 87  ? -9.778  -19.425 -8.859  1.00 0.00 ? 87  LYS A HD3  3  
ATOM 4893  H HE2  . LYS A 1 87  ? -12.096 -19.375 -8.777  1.00 0.00 ? 87  LYS A HE2  3  
ATOM 4894  H HE3  . LYS A 1 87  ? -12.146 -17.645 -8.437  1.00 0.00 ? 87  LYS A HE3  3  
ATOM 4895  H HZ1  . LYS A 1 87  ? -12.379 -18.904 -10.905 1.00 0.00 ? 87  LYS A HZ1  3  
ATOM 4896  H HZ2  . LYS A 1 87  ? -10.905 -18.074 -10.928 1.00 0.00 ? 87  LYS A HZ2  3  
ATOM 4897  H HZ3  . LYS A 1 87  ? -12.338 -17.241 -10.590 1.00 0.00 ? 87  LYS A HZ3  3  
ATOM 4898  N N    . THR A 1 88  ? -6.786  -15.203 -8.628  1.00 0.00 ? 88  THR A N    3  
ATOM 4899  C CA   . THR A 1 88  ? -6.132  -13.907 -8.752  1.00 0.00 ? 88  THR A CA   3  
ATOM 4900  C C    . THR A 1 88  ? -6.961  -12.808 -8.096  1.00 0.00 ? 88  THR A C    3  
ATOM 4901  O O    . THR A 1 88  ? -8.173  -12.726 -8.301  1.00 0.00 ? 88  THR A O    3  
ATOM 4902  C CB   . THR A 1 88  ? -5.886  -13.538 -10.226 1.00 0.00 ? 88  THR A CB   3  
ATOM 4903  O OG1  . THR A 1 88  ? -5.055  -14.527 -10.847 1.00 0.00 ? 88  THR A OG1  3  
ATOM 4904  C CG2  . THR A 1 88  ? -5.229  -12.172 -10.341 1.00 0.00 ? 88  THR A CG2  3  
ATOM 4905  H H    . THR A 1 88  ? -7.057  -15.681 -9.441  1.00 0.00 ? 88  THR A H    3  
ATOM 4906  H HA   . THR A 1 88  ? -5.174  -13.968 -8.253  1.00 0.00 ? 88  THR A HA   3  
ATOM 4907  H HB   . THR A 1 88  ? -6.838  -13.508 -10.738 1.00 0.00 ? 88  THR A HB   3  
ATOM 4908  H HG1  . THR A 1 88  ? -5.331  -14.650 -11.757 1.00 0.00 ? 88  THR A HG1  3  
ATOM 4909  H HG21 . THR A 1 88  ? -5.944  -11.458 -10.723 1.00 0.00 ? 88  THR A HG21 3  
ATOM 4910  H HG22 . THR A 1 88  ? -4.385  -12.232 -11.013 1.00 0.00 ? 88  THR A HG22 3  
ATOM 4911  H HG23 . THR A 1 88  ? -4.891  -11.854 -9.366  1.00 0.00 ? 88  THR A HG23 3  
ATOM 4912  N N    . TYR A 1 89  ? -6.301  -11.965 -7.309  1.00 0.00 ? 89  TYR A N    3  
ATOM 4913  C CA   . TYR A 1 89  ? -6.980  -10.873 -6.622  1.00 0.00 ? 89  TYR A CA   3  
ATOM 4914  C C    . TYR A 1 89  ? -6.211  -9.565  -6.788  1.00 0.00 ? 89  TYR A C    3  
ATOM 4915  O O    . TYR A 1 89  ? -5.002  -9.509  -6.556  1.00 0.00 ? 89  TYR A O    3  
ATOM 4916  C CB   . TYR A 1 89  ? -7.141  -11.198 -5.137  1.00 0.00 ? 89  TYR A CB   3  
ATOM 4917  C CG   . TYR A 1 89  ? -8.543  -11.618 -4.757  1.00 0.00 ? 89  TYR A CG   3  
ATOM 4918  C CD1  . TYR A 1 89  ? -9.559  -10.680 -4.620  1.00 0.00 ? 89  TYR A CD1  3  
ATOM 4919  C CD2  . TYR A 1 89  ? -8.853  -12.955 -4.537  1.00 0.00 ? 89  TYR A CD2  3  
ATOM 4920  C CE1  . TYR A 1 89  ? -10.840 -11.060 -4.273  1.00 0.00 ? 89  TYR A CE1  3  
ATOM 4921  C CE2  . TYR A 1 89  ? -10.132 -13.344 -4.192  1.00 0.00 ? 89  TYR A CE2  3  
ATOM 4922  C CZ   . TYR A 1 89  ? -11.122 -12.394 -4.060  1.00 0.00 ? 89  TYR A CZ   3  
ATOM 4923  O OH   . TYR A 1 89  ? -12.398 -12.777 -3.716  1.00 0.00 ? 89  TYR A OH   3  
ATOM 4924  H H    . TYR A 1 89  ? -5.337  -12.082 -7.185  1.00 0.00 ? 89  TYR A H    3  
ATOM 4925  H HA   . TYR A 1 89  ? -7.959  -10.759 -7.065  1.00 0.00 ? 89  TYR A HA   3  
ATOM 4926  H HB2  . TYR A 1 89  ? -6.472  -12.002 -4.877  1.00 0.00 ? 89  TYR A HB2  3  
ATOM 4927  H HB3  . TYR A 1 89  ? -6.888  -10.323 -4.554  1.00 0.00 ? 89  TYR A HB3  3  
ATOM 4928  H HD1  . TYR A 1 89  ? -9.334  -9.636  -4.788  1.00 0.00 ? 89  TYR A HD1  3  
ATOM 4929  H HD2  . TYR A 1 89  ? -8.074  -13.697 -4.640  1.00 0.00 ? 89  TYR A HD2  3  
ATOM 4930  H HE1  . TYR A 1 89  ? -11.616 -10.315 -4.171  1.00 0.00 ? 89  TYR A HE1  3  
ATOM 4931  H HE2  . TYR A 1 89  ? -10.353 -14.388 -4.024  1.00 0.00 ? 89  TYR A HE2  3  
ATOM 4932  H HH   . TYR A 1 89  ? -12.356 -13.553 -3.152  1.00 0.00 ? 89  TYR A HH   3  
ATOM 4933  N N    . SER A 1 90  ? -6.920  -8.516  -7.190  1.00 0.00 ? 90  SER A N    3  
ATOM 4934  C CA   . SER A 1 90  ? -6.304  -7.208  -7.391  1.00 0.00 ? 90  SER A CA   3  
ATOM 4935  C C    . SER A 1 90  ? -6.297  -6.407  -6.093  1.00 0.00 ? 90  SER A C    3  
ATOM 4936  O O    . SER A 1 90  ? -7.169  -6.576  -5.240  1.00 0.00 ? 90  SER A O    3  
ATOM 4937  C CB   . SER A 1 90  ? -7.049  -6.433  -8.479  1.00 0.00 ? 90  SER A CB   3  
ATOM 4938  O OG   . SER A 1 90  ? -6.293  -6.382  -9.676  1.00 0.00 ? 90  SER A OG   3  
ATOM 4939  H H    . SER A 1 90  ? -7.879  -8.623  -7.360  1.00 0.00 ? 90  SER A H    3  
ATOM 4940  H HA   . SER A 1 90  ? -5.284  -7.367  -7.707  1.00 0.00 ? 90  SER A HA   3  
ATOM 4941  H HB2  . SER A 1 90  ? -7.992  -6.917  -8.683  1.00 0.00 ? 90  SER A HB2  3  
ATOM 4942  H HB3  . SER A 1 90  ? -7.229  -5.423  -8.138  1.00 0.00 ? 90  SER A HB3  3  
ATOM 4943  H HG   . SER A 1 90  ? -6.888  -6.310  -10.427 1.00 0.00 ? 90  SER A HG   3  
ATOM 4944  N N    . VAL A 1 91  ? -5.307  -5.533  -5.951  1.00 0.00 ? 91  VAL A N    3  
ATOM 4945  C CA   . VAL A 1 91  ? -5.184  -4.703  -4.758  1.00 0.00 ? 91  VAL A CA   3  
ATOM 4946  C C    . VAL A 1 91  ? -4.796  -3.273  -5.119  1.00 0.00 ? 91  VAL A C    3  
ATOM 4947  O O    . VAL A 1 91  ? -4.032  -3.043  -6.056  1.00 0.00 ? 91  VAL A O    3  
ATOM 4948  C CB   . VAL A 1 91  ? -4.140  -5.275  -3.780  1.00 0.00 ? 91  VAL A CB   3  
ATOM 4949  C CG1  . VAL A 1 91  ? -4.005  -4.379  -2.558  1.00 0.00 ? 91  VAL A CG1  3  
ATOM 4950  C CG2  . VAL A 1 91  ? -4.512  -6.694  -3.375  1.00 0.00 ? 91  VAL A CG2  3  
ATOM 4951  H H    . VAL A 1 91  ? -4.642  -5.442  -6.666  1.00 0.00 ? 91  VAL A H    3  
ATOM 4952  H HA   . VAL A 1 91  ? -6.144  -4.690  -4.261  1.00 0.00 ? 91  VAL A HA   3  
ATOM 4953  H HB   . VAL A 1 91  ? -3.185  -5.306  -4.284  1.00 0.00 ? 91  VAL A HB   3  
ATOM 4954  H HG11 . VAL A 1 91  ? -4.987  -4.162  -2.161  1.00 0.00 ? 91  VAL A HG11 3  
ATOM 4955  H HG12 . VAL A 1 91  ? -3.415  -4.883  -1.807  1.00 0.00 ? 91  VAL A HG12 3  
ATOM 4956  H HG13 . VAL A 1 91  ? -3.521  -3.457  -2.840  1.00 0.00 ? 91  VAL A HG13 3  
ATOM 4957  H HG21 . VAL A 1 91  ? -4.398  -6.803  -2.307  1.00 0.00 ? 91  VAL A HG21 3  
ATOM 4958  H HG22 . VAL A 1 91  ? -5.539  -6.889  -3.647  1.00 0.00 ? 91  VAL A HG22 3  
ATOM 4959  H HG23 . VAL A 1 91  ? -3.866  -7.394  -3.880  1.00 0.00 ? 91  VAL A HG23 3  
ATOM 4960  N N    . LYS A 1 92  ? -5.329  -2.314  -4.370  1.00 0.00 ? 92  LYS A N    3  
ATOM 4961  C CA   . LYS A 1 92  ? -5.038  -0.906  -4.610  1.00 0.00 ? 92  LYS A CA   3  
ATOM 4962  C C    . LYS A 1 92  ? -5.072  -0.114  -3.305  1.00 0.00 ? 92  LYS A C    3  
ATOM 4963  O O    . LYS A 1 92  ? -5.799  -0.461  -2.376  1.00 0.00 ? 92  LYS A O    3  
ATOM 4964  C CB   . LYS A 1 92  ? -6.043  -0.318  -5.602  1.00 0.00 ? 92  LYS A CB   3  
ATOM 4965  C CG   . LYS A 1 92  ? -5.852  -0.811  -7.026  1.00 0.00 ? 92  LYS A CG   3  
ATOM 4966  C CD   . LYS A 1 92  ? -6.394  0.184   -8.038  1.00 0.00 ? 92  LYS A CD   3  
ATOM 4967  C CE   . LYS A 1 92  ? -5.276  0.989   -8.683  1.00 0.00 ? 92  LYS A CE   3  
ATOM 4968  N NZ   . LYS A 1 92  ? -4.342  1.551   -7.667  1.00 0.00 ? 92  LYS A NZ   3  
ATOM 4969  H H    . LYS A 1 92  ? -5.932  -2.561  -3.637  1.00 0.00 ? 92  LYS A H    3  
ATOM 4970  H HA   . LYS A 1 92  ? -4.046  -0.839  -5.032  1.00 0.00 ? 92  LYS A HA   3  
ATOM 4971  H HB2  . LYS A 1 92  ? -7.041  -0.579  -5.283  1.00 0.00 ? 92  LYS A HB2  3  
ATOM 4972  H HB3  . LYS A 1 92  ? -5.945  0.758   -5.601  1.00 0.00 ? 92  LYS A HB3  3  
ATOM 4973  H HG2  . LYS A 1 92  ? -4.798  -0.956  -7.209  1.00 0.00 ? 92  LYS A HG2  3  
ATOM 4974  H HG3  . LYS A 1 92  ? -6.372  -1.751  -7.144  1.00 0.00 ? 92  LYS A HG3  3  
ATOM 4975  H HD2  . LYS A 1 92  ? -6.925  -0.354  -8.810  1.00 0.00 ? 92  LYS A HD2  3  
ATOM 4976  H HD3  . LYS A 1 92  ? -7.071  0.861   -7.538  1.00 0.00 ? 92  LYS A HD3  3  
ATOM 4977  H HE2  . LYS A 1 92  ? -4.724  0.344   -9.349  1.00 0.00 ? 92  LYS A HE2  3  
ATOM 4978  H HE3  . LYS A 1 92  ? -5.712  1.800   -9.245  1.00 0.00 ? 92  LYS A HE3  3  
ATOM 4979  H HZ1  . LYS A 1 92  ? -3.632  0.839   -7.403  1.00 0.00 ? 92  LYS A HZ1  3  
ATOM 4980  H HZ2  . LYS A 1 92  ? -4.868  1.833   -6.815  1.00 0.00 ? 92  LYS A HZ2  3  
ATOM 4981  H HZ3  . LYS A 1 92  ? -3.854  2.386   -8.053  1.00 0.00 ? 92  LYS A HZ3  3  
ATOM 4982  N N    . VAL A 1 93  ? -4.281  0.953   -3.246  1.00 0.00 ? 93  VAL A N    3  
ATOM 4983  C CA   . VAL A 1 93  ? -4.224  1.795   -2.057  1.00 0.00 ? 93  VAL A CA   3  
ATOM 4984  C C    . VAL A 1 93  ? -3.966  3.252   -2.427  1.00 0.00 ? 93  VAL A C    3  
ATOM 4985  O O    . VAL A 1 93  ? -3.239  3.543   -3.377  1.00 0.00 ? 93  VAL A O    3  
ATOM 4986  C CB   . VAL A 1 93  ? -3.125  1.322   -1.087  1.00 0.00 ? 93  VAL A CB   3  
ATOM 4987  C CG1  . VAL A 1 93  ? -3.141  2.155   0.186   1.00 0.00 ? 93  VAL A CG1  3  
ATOM 4988  C CG2  . VAL A 1 93  ? -3.294  -0.155  -0.770  1.00 0.00 ? 93  VAL A CG2  3  
ATOM 4989  H H    . VAL A 1 93  ? -3.724  1.179   -4.019  1.00 0.00 ? 93  VAL A H    3  
ATOM 4990  H HA   . VAL A 1 93  ? -5.175  1.724   -1.552  1.00 0.00 ? 93  VAL A HA   3  
ATOM 4991  H HB   . VAL A 1 93  ? -2.166  1.459   -1.567  1.00 0.00 ? 93  VAL A HB   3  
ATOM 4992  H HG11 . VAL A 1 93  ? -2.302  2.834   0.183   1.00 0.00 ? 93  VAL A HG11 3  
ATOM 4993  H HG12 . VAL A 1 93  ? -4.062  2.717   0.237   1.00 0.00 ? 93  VAL A HG12 3  
ATOM 4994  H HG13 . VAL A 1 93  ? -3.070  1.501   1.044   1.00 0.00 ? 93  VAL A HG13 3  
ATOM 4995  H HG21 . VAL A 1 93  ? -3.267  -0.726  -1.688  1.00 0.00 ? 93  VAL A HG21 3  
ATOM 4996  H HG22 . VAL A 1 93  ? -2.492  -0.480  -0.122  1.00 0.00 ? 93  VAL A HG22 3  
ATOM 4997  H HG23 . VAL A 1 93  ? -4.241  -0.312  -0.277  1.00 0.00 ? 93  VAL A HG23 3  
ATOM 4998  N N    . LEU A 1 94  ? -4.569  4.164   -1.672  1.00 0.00 ? 94  LEU A N    3  
ATOM 4999  C CA   . LEU A 1 94  ? -4.405  5.593   -1.921  1.00 0.00 ? 94  LEU A CA   3  
ATOM 5000  C C    . LEU A 1 94  ? -4.426  6.378   -0.613  1.00 0.00 ? 94  LEU A C    3  
ATOM 5001  O O    . LEU A 1 94  ? -4.781  5.844   0.437   1.00 0.00 ? 94  LEU A O    3  
ATOM 5002  C CB   . LEU A 1 94  ? -5.509  6.097   -2.851  1.00 0.00 ? 94  LEU A CB   3  
ATOM 5003  C CG   . LEU A 1 94  ? -6.845  6.433   -2.187  1.00 0.00 ? 94  LEU A CG   3  
ATOM 5004  C CD1  . LEU A 1 94  ? -6.883  7.897   -1.774  1.00 0.00 ? 94  LEU A CD1  3  
ATOM 5005  C CD2  . LEU A 1 94  ? -8.001  6.111   -3.123  1.00 0.00 ? 94  LEU A CD2  3  
ATOM 5006  H H    . LEU A 1 94  ? -5.136  3.870   -0.930  1.00 0.00 ? 94  LEU A H    3  
ATOM 5007  H HA   . LEU A 1 94  ? -3.447  5.738   -2.399  1.00 0.00 ? 94  LEU A HA   3  
ATOM 5008  H HB2  . LEU A 1 94  ? -5.147  6.991   -3.337  1.00 0.00 ? 94  LEU A HB2  3  
ATOM 5009  H HB3  . LEU A 1 94  ? -5.689  5.334   -3.594  1.00 0.00 ? 94  LEU A HB3  3  
ATOM 5010  H HG   . LEU A 1 94  ? -6.957  5.832   -1.297  1.00 0.00 ? 94  LEU A HG   3  
ATOM 5011  H HD11 . LEU A 1 94  ? -6.123  8.442   -2.312  1.00 0.00 ? 94  LEU A HD11 3  
ATOM 5012  H HD12 . LEU A 1 94  ? -6.699  7.975   -0.713  1.00 0.00 ? 94  LEU A HD12 3  
ATOM 5013  H HD13 . LEU A 1 94  ? -7.854  8.309   -2.002  1.00 0.00 ? 94  LEU A HD13 3  
ATOM 5014  H HD21 . LEU A 1 94  ? -8.859  5.804   -2.543  1.00 0.00 ? 94  LEU A HD21 3  
ATOM 5015  H HD22 . LEU A 1 94  ? -7.712  5.311   -3.789  1.00 0.00 ? 94  LEU A HD22 3  
ATOM 5016  H HD23 . LEU A 1 94  ? -8.251  6.988   -3.701  1.00 0.00 ? 94  LEU A HD23 3  
ATOM 5017  N N    . ALA A 1 95  ? -4.047  7.649   -0.687  1.00 0.00 ? 95  ALA A N    3  
ATOM 5018  C CA   . ALA A 1 95  ? -4.028  8.510   0.489   1.00 0.00 ? 95  ALA A CA   3  
ATOM 5019  C C    . ALA A 1 95  ? -4.972  9.695   0.318   1.00 0.00 ? 95  ALA A C    3  
ATOM 5020  O O    . ALA A 1 95  ? -5.066  10.276  -0.763  1.00 0.00 ? 95  ALA A O    3  
ATOM 5021  C CB   . ALA A 1 95  ? -2.612  8.996   0.763   1.00 0.00 ? 95  ALA A CB   3  
ATOM 5022  H H    . ALA A 1 95  ? -3.777  8.018   -1.554  1.00 0.00 ? 95  ALA A H    3  
ATOM 5023  H HA   . ALA A 1 95  ? -4.351  7.923   1.337   1.00 0.00 ? 95  ALA A HA   3  
ATOM 5024  H HB1  . ALA A 1 95  ? -2.520  9.265   1.805   1.00 0.00 ? 95  ALA A HB1  3  
ATOM 5025  H HB2  . ALA A 1 95  ? -1.911  8.209   0.531   1.00 0.00 ? 95  ALA A HB2  3  
ATOM 5026  H HB3  . ALA A 1 95  ? -2.402  9.858   0.149   1.00 0.00 ? 95  ALA A HB3  3  
ATOM 5027  N N    . PHE A 1 96  ? -5.669  10.049  1.393   1.00 0.00 ? 96  PHE A N    3  
ATOM 5028  C CA   . PHE A 1 96  ? -6.608  11.165  1.361   1.00 0.00 ? 96  PHE A CA   3  
ATOM 5029  C C    . PHE A 1 96  ? -6.568  11.946  2.670   1.00 0.00 ? 96  PHE A C    3  
ATOM 5030  O O    . PHE A 1 96  ? -6.283  11.390  3.731   1.00 0.00 ? 96  PHE A O    3  
ATOM 5031  C CB   . PHE A 1 96  ? -8.028  10.656  1.100   1.00 0.00 ? 96  PHE A CB   3  
ATOM 5032  C CG   . PHE A 1 96  ? -8.643  9.963   2.282   1.00 0.00 ? 96  PHE A CG   3  
ATOM 5033  C CD1  . PHE A 1 96  ? -9.340  10.684  3.238   1.00 0.00 ? 96  PHE A CD1  3  
ATOM 5034  C CD2  . PHE A 1 96  ? -8.524  8.591   2.436   1.00 0.00 ? 96  PHE A CD2  3  
ATOM 5035  C CE1  . PHE A 1 96  ? -9.907  10.048  4.327   1.00 0.00 ? 96  PHE A CE1  3  
ATOM 5036  C CE2  . PHE A 1 96  ? -9.088  7.951   3.523   1.00 0.00 ? 96  PHE A CE2  3  
ATOM 5037  C CZ   . PHE A 1 96  ? -9.782  8.681   4.469   1.00 0.00 ? 96  PHE A CZ   3  
ATOM 5038  H H    . PHE A 1 96  ? -5.551  9.547   2.227   1.00 0.00 ? 96  PHE A H    3  
ATOM 5039  H HA   . PHE A 1 96  ? -6.316  11.820  0.555   1.00 0.00 ? 96  PHE A HA   3  
ATOM 5040  H HB2  . PHE A 1 96  ? -8.660  11.493  0.841   1.00 0.00 ? 96  PHE A HB2  3  
ATOM 5041  H HB3  . PHE A 1 96  ? -8.006  9.958   0.278   1.00 0.00 ? 96  PHE A HB3  3  
ATOM 5042  H HD1  . PHE A 1 96  ? -9.441  11.753  3.128   1.00 0.00 ? 96  PHE A HD1  3  
ATOM 5043  H HD2  . PHE A 1 96  ? -7.981  8.020   1.697   1.00 0.00 ? 96  PHE A HD2  3  
ATOM 5044  H HE1  . PHE A 1 96  ? -10.449 10.619  5.065   1.00 0.00 ? 96  PHE A HE1  3  
ATOM 5045  H HE2  . PHE A 1 96  ? -8.988  6.880   3.631   1.00 0.00 ? 96  PHE A HE2  3  
ATOM 5046  H HZ   . PHE A 1 96  ? -10.223 8.181   5.319   1.00 0.00 ? 96  PHE A HZ   3  
ATOM 5047  N N    . THR A 1 97  ? -6.856  13.242  2.588   1.00 0.00 ? 97  THR A N    3  
ATOM 5048  C CA   . THR A 1 97  ? -6.851  14.102  3.765   1.00 0.00 ? 97  THR A CA   3  
ATOM 5049  C C    . THR A 1 97  ? -8.134  14.921  3.853   1.00 0.00 ? 97  THR A C    3  
ATOM 5050  O O    . THR A 1 97  ? -9.030  14.780  3.020   1.00 0.00 ? 97  THR A O    3  
ATOM 5051  C CB   . THR A 1 97  ? -5.644  15.059  3.757   1.00 0.00 ? 97  THR A CB   3  
ATOM 5052  O OG1  . THR A 1 97  ? -5.798  16.033  2.717   1.00 0.00 ? 97  THR A OG1  3  
ATOM 5053  C CG2  . THR A 1 97  ? -4.347  14.292  3.552   1.00 0.00 ? 97  THR A CG2  3  
ATOM 5054  H H    . THR A 1 97  ? -7.075  13.627  1.714   1.00 0.00 ? 97  THR A H    3  
ATOM 5055  H HA   . THR A 1 97  ? -6.778  13.471  4.639   1.00 0.00 ? 97  THR A HA   3  
ATOM 5056  H HB   . THR A 1 97  ? -5.599  15.565  4.710   1.00 0.00 ? 97  THR A HB   3  
ATOM 5057  H HG1  . THR A 1 97  ? -6.352  15.673  2.022   1.00 0.00 ? 97  THR A HG1  3  
ATOM 5058  H HG21 . THR A 1 97  ? -4.217  14.074  2.502   1.00 0.00 ? 97  THR A HG21 3  
ATOM 5059  H HG22 . THR A 1 97  ? -4.383  13.367  4.110   1.00 0.00 ? 97  THR A HG22 3  
ATOM 5060  H HG23 . THR A 1 97  ? -3.517  14.889  3.899   1.00 0.00 ? 97  THR A HG23 3  
ATOM 5061  N N    . SER A 1 98  ? -8.215  15.777  4.866   1.00 0.00 ? 98  SER A N    3  
ATOM 5062  C CA   . SER A 1 98  ? -9.391  16.617  5.063   1.00 0.00 ? 98  SER A CA   3  
ATOM 5063  C C    . SER A 1 98  ? -9.661  17.473  3.831   1.00 0.00 ? 98  SER A C    3  
ATOM 5064  O O    . SER A 1 98  ? -10.798 17.868  3.572   1.00 0.00 ? 98  SER A O    3  
ATOM 5065  C CB   . SER A 1 98  ? -9.203  17.513  6.290   1.00 0.00 ? 98  SER A CB   3  
ATOM 5066  O OG   . SER A 1 98  ? -9.832  18.769  6.104   1.00 0.00 ? 98  SER A OG   3  
ATOM 5067  H H    . SER A 1 98  ? -7.469  15.843  5.497   1.00 0.00 ? 98  SER A H    3  
ATOM 5068  H HA   . SER A 1 98  ? -10.239 15.968  5.229   1.00 0.00 ? 98  SER A HA   3  
ATOM 5069  H HB2  . SER A 1 98  ? -9.636  17.031  7.153   1.00 0.00 ? 98  SER A HB2  3  
ATOM 5070  H HB3  . SER A 1 98  ? -8.149  17.672  6.457   1.00 0.00 ? 98  SER A HB3  3  
ATOM 5071  H HG   . SER A 1 98  ? -10.671 18.778  6.569   1.00 0.00 ? 98  SER A HG   3  
ATOM 5072  N N    . ILE A 1 99  ? -8.607  17.756  3.073   1.00 0.00 ? 99  ILE A N    3  
ATOM 5073  C CA   . ILE A 1 99  ? -8.728  18.566  1.866   1.00 0.00 ? 99  ILE A CA   3  
ATOM 5074  C C    . ILE A 1 99  ? -9.442  17.797  0.760   1.00 0.00 ? 99  ILE A C    3  
ATOM 5075  O O    . ILE A 1 99  ? -10.528 18.177  0.327   1.00 0.00 ? 99  ILE A O    3  
ATOM 5076  C CB   . ILE A 1 99  ? -7.351  19.022  1.353   1.00 0.00 ? 99  ILE A CB   3  
ATOM 5077  C CG1  . ILE A 1 99  ? -6.600  19.781  2.449   1.00 0.00 ? 99  ILE A CG1  3  
ATOM 5078  C CG2  . ILE A 1 99  ? -7.508  19.890  0.113   1.00 0.00 ? 99  ILE A CG2  3  
ATOM 5079  C CD1  . ILE A 1 99  ? -7.348  20.989  2.969   1.00 0.00 ? 99  ILE A CD1  3  
ATOM 5080  H H    . ILE A 1 99  ? -7.726  17.413  3.331   1.00 0.00 ? 99  ILE A H    3  
ATOM 5081  H HA   . ILE A 1 99  ? -9.309  19.444  2.112   1.00 0.00 ? 99  ILE A HA   3  
ATOM 5082  H HB   . ILE A 1 99  ? -6.784  18.145  1.080   1.00 0.00 ? 99  ILE A HB   3  
ATOM 5083  H HG12 . ILE A 1 99  ? -6.423  19.119  3.281   1.00 0.00 ? 99  ILE A HG12 3  
ATOM 5084  H HG13 . ILE A 1 99  ? -5.651  20.122  2.056   1.00 0.00 ? 99  ILE A HG13 3  
ATOM 5085  H HG21 . ILE A 1 99  ? -8.547  20.155  -0.012  1.00 0.00 ? 99  ILE A HG21 3  
ATOM 5086  H HG22 . ILE A 1 99  ? -6.920  20.789  0.226   1.00 0.00 ? 99  ILE A HG22 3  
ATOM 5087  H HG23 . ILE A 1 99  ? -7.168  19.344  -0.754  1.00 0.00 ? 99  ILE A HG23 3  
ATOM 5088  H HD11 . ILE A 1 99  ? -8.192  20.663  3.559   1.00 0.00 ? 99  ILE A HD11 3  
ATOM 5089  H HD12 . ILE A 1 99  ? -6.689  21.585  3.581   1.00 0.00 ? 99  ILE A HD12 3  
ATOM 5090  H HD13 . ILE A 1 99  ? -7.699  21.581  2.137   1.00 0.00 ? 99  ILE A HD13 3  
ATOM 5091  N N    . GLY A 1 100 ? -8.822  16.712  0.306   1.00 0.00 ? 100 GLY A N    3  
ATOM 5092  C CA   . GLY A 1 100 ? -9.413  15.905  -0.746  1.00 0.00 ? 100 GLY A CA   3  
ATOM 5093  C C    . GLY A 1 100 ? -8.773  14.536  -0.854  1.00 0.00 ? 100 GLY A C    3  
ATOM 5094  O O    . GLY A 1 100 ? -8.199  14.032  0.112   1.00 0.00 ? 100 GLY A O    3  
ATOM 5095  H H    . GLY A 1 100 ? -7.957  16.456  0.689   1.00 0.00 ? 100 GLY A H    3  
ATOM 5096  H HA2  . GLY A 1 100 ? -10.466 15.783  -0.542  1.00 0.00 ? 100 GLY A HA2  3  
ATOM 5097  H HA3  . GLY A 1 100 ? -9.296  16.420  -1.687  1.00 0.00 ? 100 GLY A HA3  3  
ATOM 5098  N N    . ASP A 1 101 ? -8.871  13.929  -2.032  1.00 0.00 ? 101 ASP A N    3  
ATOM 5099  C CA   . ASP A 1 101 ? -8.298  12.609  -2.265  1.00 0.00 ? 101 ASP A CA   3  
ATOM 5100  C C    . ASP A 1 101 ? -7.031  12.709  -3.110  1.00 0.00 ? 101 ASP A C    3  
ATOM 5101  O O    . ASP A 1 101 ? -6.771  13.734  -3.740  1.00 0.00 ? 101 ASP A O    3  
ATOM 5102  C CB   . ASP A 1 101 ? -9.317  11.701  -2.955  1.00 0.00 ? 101 ASP A CB   3  
ATOM 5103  C CG   . ASP A 1 101 ? -10.048 12.402  -4.083  1.00 0.00 ? 101 ASP A CG   3  
ATOM 5104  O OD1  . ASP A 1 101 ? -9.385  13.117  -4.865  1.00 0.00 ? 101 ASP A OD1  3  
ATOM 5105  O OD2  . ASP A 1 101 ? -11.280 12.236  -4.185  1.00 0.00 ? 101 ASP A OD2  3  
ATOM 5106  H H    . ASP A 1 101 ? -9.342  14.382  -2.765  1.00 0.00 ? 101 ASP A H    3  
ATOM 5107  H HA   . ASP A 1 101 ? -8.043  12.185  -1.306  1.00 0.00 ? 101 ASP A HA   3  
ATOM 5108  H HB2  . ASP A 1 101 ? -8.804  10.841  -3.362  1.00 0.00 ? 101 ASP A HB2  3  
ATOM 5109  H HB3  . ASP A 1 101 ? -10.044 11.371  -2.229  1.00 0.00 ? 101 ASP A HB3  3  
ATOM 5110  N N    . GLY A 1 102 ? -6.246  11.635  -3.120  1.00 0.00 ? 102 GLY A N    3  
ATOM 5111  C CA   . GLY A 1 102 ? -5.016  11.623  -3.889  1.00 0.00 ? 102 GLY A CA   3  
ATOM 5112  C C    . GLY A 1 102 ? -4.979  10.497  -4.904  1.00 0.00 ? 102 GLY A C    3  
ATOM 5113  O O    . GLY A 1 102 ? -5.881  9.662   -4.969  1.00 0.00 ? 102 GLY A O    3  
ATOM 5114  H H    . GLY A 1 102 ? -6.503  10.846  -2.597  1.00 0.00 ? 102 GLY A H    3  
ATOM 5115  H HA2  . GLY A 1 102 ? -4.918  12.565  -4.407  1.00 0.00 ? 102 GLY A HA2  3  
ATOM 5116  H HA3  . GLY A 1 102 ? -4.181  11.507  -3.211  1.00 0.00 ? 102 GLY A HA3  3  
ATOM 5117  N N    . PRO A 1 103 ? -3.917  10.468  -5.722  1.00 0.00 ? 103 PRO A N    3  
ATOM 5118  C CA   . PRO A 1 103 ? -3.742  9.443   -6.755  1.00 0.00 ? 103 PRO A CA   3  
ATOM 5119  C C    . PRO A 1 103 ? -3.449  8.069   -6.165  1.00 0.00 ? 103 PRO A C    3  
ATOM 5120  O O    . PRO A 1 103 ? -2.773  7.952   -5.141  1.00 0.00 ? 103 PRO A O    3  
ATOM 5121  C CB   . PRO A 1 103 ? -2.539  9.948   -7.556  1.00 0.00 ? 103 PRO A CB   3  
ATOM 5122  C CG   . PRO A 1 103 ? -1.779  10.799  -6.600  1.00 0.00 ? 103 PRO A CG   3  
ATOM 5123  C CD   . PRO A 1 103 ? -2.804  11.432  -5.701  1.00 0.00 ? 103 PRO A CD   3  
ATOM 5124  H HA   . PRO A 1 103 ? -4.606  9.379   -7.402  1.00 0.00 ? 103 PRO A HA   3  
ATOM 5125  H HB2  . PRO A 1 103 ? -1.949  9.108   -7.893  1.00 0.00 ? 103 PRO A HB2  3  
ATOM 5126  H HB3  . PRO A 1 103 ? -2.882  10.520  -8.406  1.00 0.00 ? 103 PRO A HB3  3  
ATOM 5127  H HG2  . PRO A 1 103 ? -1.101  10.190  -6.023  1.00 0.00 ? 103 PRO A HG2  3  
ATOM 5128  H HG3  . PRO A 1 103 ? -1.233  11.560  -7.139  1.00 0.00 ? 103 PRO A HG3  3  
ATOM 5129  H HD2  . PRO A 1 103 ? -2.411  11.547  -4.701  1.00 0.00 ? 103 PRO A HD2  3  
ATOM 5130  H HD3  . PRO A 1 103 ? -3.116  12.388  -6.097  1.00 0.00 ? 103 PRO A HD3  3  
ATOM 5131  N N    . LEU A 1 104 ? -3.959  7.029   -6.814  1.00 0.00 ? 104 LEU A N    3  
ATOM 5132  C CA   . LEU A 1 104 ? -3.751  5.661   -6.354  1.00 0.00 ? 104 LEU A CA   3  
ATOM 5133  C C    . LEU A 1 104 ? -2.357  5.166   -6.727  1.00 0.00 ? 104 LEU A C    3  
ATOM 5134  O O    . LEU A 1 104 ? -1.629  5.829   -7.466  1.00 0.00 ? 104 LEU A O    3  
ATOM 5135  C CB   . LEU A 1 104 ? -4.811  4.734   -6.952  1.00 0.00 ? 104 LEU A CB   3  
ATOM 5136  C CG   . LEU A 1 104 ? -6.267  5.134   -6.711  1.00 0.00 ? 104 LEU A CG   3  
ATOM 5137  C CD1  . LEU A 1 104 ? -6.966  5.424   -8.030  1.00 0.00 ? 104 LEU A CD1  3  
ATOM 5138  C CD2  . LEU A 1 104 ? -7.000  4.043   -5.944  1.00 0.00 ? 104 LEU A CD2  3  
ATOM 5139  H H    . LEU A 1 104 ? -4.487  7.184   -7.624  1.00 0.00 ? 104 LEU A H    3  
ATOM 5140  H HA   . LEU A 1 104 ? -3.845  5.656   -5.278  1.00 0.00 ? 104 LEU A HA   3  
ATOM 5141  H HB2  . LEU A 1 104 ? -4.651  4.693   -8.018  1.00 0.00 ? 104 LEU A HB2  3  
ATOM 5142  H HB3  . LEU A 1 104 ? -4.663  3.749   -6.530  1.00 0.00 ? 104 LEU A HB3  3  
ATOM 5143  H HG   . LEU A 1 104 ? -6.291  6.037   -6.115  1.00 0.00 ? 104 LEU A HG   3  
ATOM 5144  H HD11 . LEU A 1 104 ? -7.828  6.048   -7.851  1.00 0.00 ? 104 LEU A HD11 3  
ATOM 5145  H HD12 . LEU A 1 104 ? -7.281  4.496   -8.482  1.00 0.00 ? 104 LEU A HD12 3  
ATOM 5146  H HD13 . LEU A 1 104 ? -6.283  5.935   -8.694  1.00 0.00 ? 104 LEU A HD13 3  
ATOM 5147  H HD21 . LEU A 1 104 ? -6.884  3.102   -6.461  1.00 0.00 ? 104 LEU A HD21 3  
ATOM 5148  H HD22 . LEU A 1 104 ? -8.050  4.292   -5.881  1.00 0.00 ? 104 LEU A HD22 3  
ATOM 5149  H HD23 . LEU A 1 104 ? -6.588  3.962   -4.951  1.00 0.00 ? 104 LEU A HD23 3  
ATOM 5150  N N    . SER A 1 105 ? -1.992  3.995   -6.212  1.00 0.00 ? 105 SER A N    3  
ATOM 5151  C CA   . SER A 1 105 ? -0.685  3.413   -6.491  1.00 0.00 ? 105 SER A CA   3  
ATOM 5152  C C    . SER A 1 105 ? -0.743  2.507   -7.717  1.00 0.00 ? 105 SER A C    3  
ATOM 5153  O O    . SER A 1 105 ? -1.776  2.408   -8.380  1.00 0.00 ? 105 SER A O    3  
ATOM 5154  C CB   . SER A 1 105 ? -0.189  2.619   -5.279  1.00 0.00 ? 105 SER A CB   3  
ATOM 5155  O OG   . SER A 1 105 ? -1.184  1.724   -4.814  1.00 0.00 ? 105 SER A OG   3  
ATOM 5156  H H    . SER A 1 105 ? -2.617  3.514   -5.630  1.00 0.00 ? 105 SER A H    3  
ATOM 5157  H HA   . SER A 1 105 ? 0.003   4.221   -6.687  1.00 0.00 ? 105 SER A HA   3  
ATOM 5158  H HB2  . SER A 1 105 ? 0.686   2.053   -5.558  1.00 0.00 ? 105 SER A HB2  3  
ATOM 5159  H HB3  . SER A 1 105 ? 0.064   3.304   -4.483  1.00 0.00 ? 105 SER A HB3  3  
ATOM 5160  H HG   . SER A 1 105 ? -1.304  1.018   -5.452  1.00 0.00 ? 105 SER A HG   3  
ATOM 5161  N N    . SER A 1 106 ? 0.372   1.849   -8.013  1.00 0.00 ? 106 SER A N    3  
ATOM 5162  C CA   . SER A 1 106 ? 0.451   0.954   -9.162  1.00 0.00 ? 106 SER A CA   3  
ATOM 5163  C C    . SER A 1 106 ? -0.394  -0.297  -8.933  1.00 0.00 ? 106 SER A C    3  
ATOM 5164  O O    . SER A 1 106 ? -0.239  -0.988  -7.927  1.00 0.00 ? 106 SER A O    3  
ATOM 5165  C CB   . SER A 1 106 ? 1.905   0.561   -9.429  1.00 0.00 ? 106 SER A CB   3  
ATOM 5166  O OG   . SER A 1 106 ? 1.984   -0.464  -10.405 1.00 0.00 ? 106 SER A OG   3  
ATOM 5167  H H    . SER A 1 106 ? 1.162   1.969   -7.445  1.00 0.00 ? 106 SER A H    3  
ATOM 5168  H HA   . SER A 1 106 ? 0.066   1.482   -10.020 1.00 0.00 ? 106 SER A HA   3  
ATOM 5169  H HB2  . SER A 1 106 ? 2.448   1.422   -9.785  1.00 0.00 ? 106 SER A HB2  3  
ATOM 5170  H HB3  . SER A 1 106 ? 2.354   0.205   -8.513  1.00 0.00 ? 106 SER A HB3  3  
ATOM 5171  H HG   . SER A 1 106 ? 2.591   -0.199  -11.100 1.00 0.00 ? 106 SER A HG   3  
ATOM 5172  N N    . ASP A 1 107 ? -1.284  -0.582  -9.877  1.00 0.00 ? 107 ASP A N    3  
ATOM 5173  C CA   . ASP A 1 107 ? -2.152  -1.749  -9.782  1.00 0.00 ? 107 ASP A CA   3  
ATOM 5174  C C    . ASP A 1 107 ? -1.337  -3.012  -9.519  1.00 0.00 ? 107 ASP A C    3  
ATOM 5175  O O    . ASP A 1 107 ? -0.494  -3.397  -10.329 1.00 0.00 ? 107 ASP A O    3  
ATOM 5176  C CB   . ASP A 1 107 ? -2.968  -1.911  -11.065 1.00 0.00 ? 107 ASP A CB   3  
ATOM 5177  C CG   . ASP A 1 107 ? -3.738  -0.655  -11.424 1.00 0.00 ? 107 ASP A CG   3  
ATOM 5178  O OD1  . ASP A 1 107 ? -3.092  0.370   -11.729 1.00 0.00 ? 107 ASP A OD1  3  
ATOM 5179  O OD2  . ASP A 1 107 ? -4.985  -0.697  -11.402 1.00 0.00 ? 107 ASP A OD2  3  
ATOM 5180  H H    . ASP A 1 107 ? -1.358  0.009   -10.657 1.00 0.00 ? 107 ASP A H    3  
ATOM 5181  H HA   . ASP A 1 107 ? -2.827  -1.594  -8.954  1.00 0.00 ? 107 ASP A HA   3  
ATOM 5182  H HB2  . ASP A 1 107 ? -2.300  -2.146  -11.881 1.00 0.00 ? 107 ASP A HB2  3  
ATOM 5183  H HB3  . ASP A 1 107 ? -3.673  -2.719  -10.937 1.00 0.00 ? 107 ASP A HB3  3  
ATOM 5184  N N    . ILE A 1 108 ? -1.595  -3.650  -8.383  1.00 0.00 ? 108 ILE A N    3  
ATOM 5185  C CA   . ILE A 1 108 ? -0.885  -4.869  -8.015  1.00 0.00 ? 108 ILE A CA   3  
ATOM 5186  C C    . ILE A 1 108 ? -1.853  -6.035  -7.833  1.00 0.00 ? 108 ILE A C    3  
ATOM 5187  O O    . ILE A 1 108 ? -2.994  -5.846  -7.413  1.00 0.00 ? 108 ILE A O    3  
ATOM 5188  C CB   . ILE A 1 108 ? -0.077  -4.681  -6.717  1.00 0.00 ? 108 ILE A CB   3  
ATOM 5189  C CG1  . ILE A 1 108 ? -0.980  -4.157  -5.599  1.00 0.00 ? 108 ILE A CG1  3  
ATOM 5190  C CG2  . ILE A 1 108 ? 1.088   -3.730  -6.953  1.00 0.00 ? 108 ILE A CG2  3  
ATOM 5191  C CD1  . ILE A 1 108 ? -0.466  -4.468  -4.212  1.00 0.00 ? 108 ILE A CD1  3  
ATOM 5192  H H    . ILE A 1 108 ? -2.278  -3.294  -7.778  1.00 0.00 ? 108 ILE A H    3  
ATOM 5193  H HA   . ILE A 1 108 ? -0.197  -5.108  -8.812  1.00 0.00 ? 108 ILE A HA   3  
ATOM 5194  H HB   . ILE A 1 108 ? 0.325   -5.639  -6.427  1.00 0.00 ? 108 ILE A HB   3  
ATOM 5195  H HG12 . ILE A 1 108 ? -1.068  -3.086  -5.688  1.00 0.00 ? 108 ILE A HG12 3  
ATOM 5196  H HG13 . ILE A 1 108 ? -1.959  -4.604  -5.700  1.00 0.00 ? 108 ILE A HG13 3  
ATOM 5197  H HG21 . ILE A 1 108 ? 0.892   -3.132  -7.831  1.00 0.00 ? 108 ILE A HG21 3  
ATOM 5198  H HG22 . ILE A 1 108 ? 1.202   -3.084  -6.096  1.00 0.00 ? 108 ILE A HG22 3  
ATOM 5199  H HG23 . ILE A 1 108 ? 1.994   -4.299  -7.099  1.00 0.00 ? 108 ILE A HG23 3  
ATOM 5200  H HD11 . ILE A 1 108 ? -1.287  -4.446  -3.510  1.00 0.00 ? 108 ILE A HD11 3  
ATOM 5201  H HD12 . ILE A 1 108 ? -0.013  -5.447  -4.206  1.00 0.00 ? 108 ILE A HD12 3  
ATOM 5202  H HD13 . ILE A 1 108 ? 0.269   -3.728  -3.927  1.00 0.00 ? 108 ILE A HD13 3  
ATOM 5203  N N    . GLN A 1 109 ? -1.386  -7.238  -8.150  1.00 0.00 ? 109 GLN A N    3  
ATOM 5204  C CA   . GLN A 1 109 ? -2.209  -8.434  -8.019  1.00 0.00 ? 109 GLN A CA   3  
ATOM 5205  C C    . GLN A 1 109 ? -1.469  -9.523  -7.250  1.00 0.00 ? 109 GLN A C    3  
ATOM 5206  O O    . GLN A 1 109 ? -0.258  -9.686  -7.393  1.00 0.00 ? 109 GLN A O    3  
ATOM 5207  C CB   . GLN A 1 109 ? -2.612  -8.953  -9.400  1.00 0.00 ? 109 GLN A CB   3  
ATOM 5208  C CG   . GLN A 1 109 ? -3.827  -8.249  -9.985  1.00 0.00 ? 109 GLN A CG   3  
ATOM 5209  C CD   . GLN A 1 109 ? -3.708  -8.024  -11.479 1.00 0.00 ? 109 GLN A CD   3  
ATOM 5210  O OE1  . GLN A 1 109 ? -3.140  -8.845  -12.199 1.00 0.00 ? 109 GLN A OE1  3  
ATOM 5211  N NE2  . GLN A 1 109 ? -4.244  -6.905  -11.953 1.00 0.00 ? 109 GLN A NE2  3  
ATOM 5212  H H    . GLN A 1 109 ? -0.468  -7.324  -8.478  1.00 0.00 ? 109 GLN A H    3  
ATOM 5213  H HA   . GLN A 1 109 ? -3.100  -8.165  -7.471  1.00 0.00 ? 109 GLN A HA   3  
ATOM 5214  H HB2  . GLN A 1 109 ? -1.784  -8.819  -10.080 1.00 0.00 ? 109 GLN A HB2  3  
ATOM 5215  H HB3  . GLN A 1 109 ? -2.837  -10.007 -9.324  1.00 0.00 ? 109 GLN A HB3  3  
ATOM 5216  H HG2  . GLN A 1 109 ? -4.702  -8.853  -9.796  1.00 0.00 ? 109 GLN A HG2  3  
ATOM 5217  H HG3  . GLN A 1 109 ? -3.939  -7.291  -9.498  1.00 0.00 ? 109 GLN A HG3  3  
ATOM 5218  H HE21 . GLN A 1 109 ? -4.679  -6.297  -11.320 1.00 0.00 ? 109 GLN A HE21 3  
ATOM 5219  H HE22 . GLN A 1 109 ? -4.181  -6.734  -12.915 1.00 0.00 ? 109 GLN A HE22 3  
ATOM 5220  N N    . VAL A 1 110 ? -2.207  -10.269 -6.432  1.00 0.00 ? 110 VAL A N    3  
ATOM 5221  C CA   . VAL A 1 110 ? -1.621  -11.344 -5.640  1.00 0.00 ? 110 VAL A CA   3  
ATOM 5222  C C    . VAL A 1 110 ? -2.512  -12.580 -5.651  1.00 0.00 ? 110 VAL A C    3  
ATOM 5223  O O    . VAL A 1 110 ? -3.720  -12.491 -5.431  1.00 0.00 ? 110 VAL A O    3  
ATOM 5224  C CB   . VAL A 1 110 ? -1.388  -10.903 -4.183  1.00 0.00 ? 110 VAL A CB   3  
ATOM 5225  C CG1  . VAL A 1 110 ? -2.685  -10.404 -3.561  1.00 0.00 ? 110 VAL A CG1  3  
ATOM 5226  C CG2  . VAL A 1 110 ? -0.804  -12.048 -3.369  1.00 0.00 ? 110 VAL A CG2  3  
ATOM 5227  H H    . VAL A 1 110 ? -3.168  -10.092 -6.360  1.00 0.00 ? 110 VAL A H    3  
ATOM 5228  H HA   . VAL A 1 110 ? -0.664  -11.595 -6.075  1.00 0.00 ? 110 VAL A HA   3  
ATOM 5229  H HB   . VAL A 1 110 ? -0.679  -10.089 -4.182  1.00 0.00 ? 110 VAL A HB   3  
ATOM 5230  H HG11 . VAL A 1 110 ? -3.394  -11.217 -3.508  1.00 0.00 ? 110 VAL A HG11 3  
ATOM 5231  H HG12 . VAL A 1 110 ? -2.488  -10.030 -2.567  1.00 0.00 ? 110 VAL A HG12 3  
ATOM 5232  H HG13 . VAL A 1 110 ? -3.092  -9.611  -4.171  1.00 0.00 ? 110 VAL A HG13 3  
ATOM 5233  H HG21 . VAL A 1 110 ? -0.080  -12.579 -3.965  1.00 0.00 ? 110 VAL A HG21 3  
ATOM 5234  H HG22 . VAL A 1 110 ? -0.323  -11.651 -2.485  1.00 0.00 ? 110 VAL A HG22 3  
ATOM 5235  H HG23 . VAL A 1 110 ? -1.595  -12.722 -3.074  1.00 0.00 ? 110 VAL A HG23 3  
ATOM 5236  N N    . ILE A 1 111 ? -1.906  -13.736 -5.905  1.00 0.00 ? 111 ILE A N    3  
ATOM 5237  C CA   . ILE A 1 111 ? -2.644  -14.992 -5.941  1.00 0.00 ? 111 ILE A CA   3  
ATOM 5238  C C    . ILE A 1 111 ? -2.791  -15.584 -4.544  1.00 0.00 ? 111 ILE A C    3  
ATOM 5239  O O    . ILE A 1 111 ? -1.842  -15.594 -3.758  1.00 0.00 ? 111 ILE A O    3  
ATOM 5240  C CB   . ILE A 1 111 ? -1.953  -16.024 -6.854  1.00 0.00 ? 111 ILE A CB   3  
ATOM 5241  C CG1  . ILE A 1 111 ? -1.830  -15.476 -8.277  1.00 0.00 ? 111 ILE A CG1  3  
ATOM 5242  C CG2  . ILE A 1 111 ? -2.725  -17.335 -6.850  1.00 0.00 ? 111 ILE A CG2  3  
ATOM 5243  C CD1  . ILE A 1 111 ? -0.448  -15.641 -8.869  1.00 0.00 ? 111 ILE A CD1  3  
ATOM 5244  H H    . ILE A 1 111 ? -0.939  -13.743 -6.071  1.00 0.00 ? 111 ILE A H    3  
ATOM 5245  H HA   . ILE A 1 111 ? -3.626  -14.790 -6.340  1.00 0.00 ? 111 ILE A HA   3  
ATOM 5246  H HB   . ILE A 1 111 ? -0.965  -16.214 -6.462  1.00 0.00 ? 111 ILE A HB   3  
ATOM 5247  H HG12 . ILE A 1 111 ? -2.527  -15.993 -8.916  1.00 0.00 ? 111 ILE A HG12 3  
ATOM 5248  H HG13 . ILE A 1 111 ? -2.065  -14.422 -8.270  1.00 0.00 ? 111 ILE A HG13 3  
ATOM 5249  H HG21 . ILE A 1 111 ? -2.613  -17.821 -7.808  1.00 0.00 ? 111 ILE A HG21 3  
ATOM 5250  H HG22 . ILE A 1 111 ? -2.337  -17.978 -6.073  1.00 0.00 ? 111 ILE A HG22 3  
ATOM 5251  H HG23 . ILE A 1 111 ? -3.770  -17.137 -6.665  1.00 0.00 ? 111 ILE A HG23 3  
ATOM 5252  H HD11 . ILE A 1 111 ? -0.516  -16.198 -9.793  1.00 0.00 ? 111 ILE A HD11 3  
ATOM 5253  H HD12 . ILE A 1 111 ? -0.021  -14.669 -9.066  1.00 0.00 ? 111 ILE A HD12 3  
ATOM 5254  H HD13 . ILE A 1 111 ? 0.181   -16.176 -8.173  1.00 0.00 ? 111 ILE A HD13 3  
ATOM 5255  N N    . THR A 1 112 ? -3.986  -16.080 -4.239  1.00 0.00 ? 112 THR A N    3  
ATOM 5256  C CA   . THR A 1 112 ? -4.258  -16.675 -2.937  1.00 0.00 ? 112 THR A CA   3  
ATOM 5257  C C    . THR A 1 112 ? -3.655  -18.071 -2.834  1.00 0.00 ? 112 THR A C    3  
ATOM 5258  O O    . THR A 1 112 ? -4.291  -19.061 -3.192  1.00 0.00 ? 112 THR A O    3  
ATOM 5259  C CB   . THR A 1 112 ? -5.771  -16.762 -2.665  1.00 0.00 ? 112 THR A CB   3  
ATOM 5260  O OG1  . THR A 1 112 ? -6.468  -17.095 -3.870  1.00 0.00 ? 112 THR A OG1  3  
ATOM 5261  C CG2  . THR A 1 112 ? -6.299  -15.445 -2.115  1.00 0.00 ? 112 THR A CG2  3  
ATOM 5262  H H    . THR A 1 112 ? -4.701  -16.044 -4.909  1.00 0.00 ? 112 THR A H    3  
ATOM 5263  H HA   . THR A 1 112 ? -3.813  -16.044 -2.182  1.00 0.00 ? 112 THR A HA   3  
ATOM 5264  H HB   . THR A 1 112 ? -5.946  -17.537 -1.932  1.00 0.00 ? 112 THR A HB   3  
ATOM 5265  H HG1  . THR A 1 112 ? -7.376  -16.787 -3.810  1.00 0.00 ? 112 THR A HG1  3  
ATOM 5266  H HG21 . THR A 1 112 ? -5.597  -14.656 -2.339  1.00 0.00 ? 112 THR A HG21 3  
ATOM 5267  H HG22 . THR A 1 112 ? -6.421  -15.525 -1.045  1.00 0.00 ? 112 THR A HG22 3  
ATOM 5268  H HG23 . THR A 1 112 ? -7.251  -15.220 -2.571  1.00 0.00 ? 112 THR A HG23 3  
ATOM 5269  N N    . GLN A 1 113 ? -2.422  -18.143 -2.341  1.00 0.00 ? 113 GLN A N    3  
ATOM 5270  C CA   . GLN A 1 113 ? -1.733  -19.419 -2.191  1.00 0.00 ? 113 GLN A CA   3  
ATOM 5271  C C    . GLN A 1 113 ? -0.847  -19.417 -0.948  1.00 0.00 ? 113 GLN A C    3  
ATOM 5272  O O    . GLN A 1 113 ? -0.296  -18.385 -0.566  1.00 0.00 ? 113 GLN A O    3  
ATOM 5273  C CB   . GLN A 1 113 ? -0.889  -19.717 -3.432  1.00 0.00 ? 113 GLN A CB   3  
ATOM 5274  C CG   . GLN A 1 113 ? 0.300   -18.785 -3.597  1.00 0.00 ? 113 GLN A CG   3  
ATOM 5275  C CD   . GLN A 1 113 ? 1.622   -19.526 -3.643  1.00 0.00 ? 113 GLN A CD   3  
ATOM 5276  O OE1  . GLN A 1 113 ? 2.163   -19.921 -2.610  1.00 0.00 ? 113 GLN A OE1  3  
ATOM 5277  N NE2  . GLN A 1 113 ? 2.150   -19.721 -4.846  1.00 0.00 ? 113 GLN A NE2  3  
ATOM 5278  H H    . GLN A 1 113 ? -1.965  -17.319 -2.074  1.00 0.00 ? 113 GLN A H    3  
ATOM 5279  H HA   . GLN A 1 113 ? -2.481  -20.189 -2.084  1.00 0.00 ? 113 GLN A HA   3  
ATOM 5280  H HB2  . GLN A 1 113 ? -0.519  -20.729 -3.367  1.00 0.00 ? 113 GLN A HB2  3  
ATOM 5281  H HB3  . GLN A 1 113 ? -1.513  -19.625 -4.308  1.00 0.00 ? 113 GLN A HB3  3  
ATOM 5282  H HG2  . GLN A 1 113 ? 0.184   -18.230 -4.515  1.00 0.00 ? 113 GLN A HG2  3  
ATOM 5283  H HG3  . GLN A 1 113 ? 0.320   -18.097 -2.763  1.00 0.00 ? 113 GLN A HG3  3  
ATOM 5284  H HE21 . GLN A 1 113 ? 1.664   -19.377 -5.625  1.00 0.00 ? 113 GLN A HE21 3  
ATOM 5285  H HE22 . GLN A 1 113 ? 3.004   -20.197 -4.905  1.00 0.00 ? 113 GLN A HE22 3  
ATOM 5286  N N    . THR A 1 114 ? -0.716  -20.581 -0.320  1.00 0.00 ? 114 THR A N    3  
ATOM 5287  C CA   . THR A 1 114 ? 0.100   -20.713 0.881   1.00 0.00 ? 114 THR A CA   3  
ATOM 5288  C C    . THR A 1 114 ? 1.567   -20.930 0.527   1.00 0.00 ? 114 THR A C    3  
ATOM 5289  O O    . THR A 1 114 ? 2.450   -20.260 1.061   1.00 0.00 ? 114 THR A O    3  
ATOM 5290  C CB   . THR A 1 114 ? -0.382  -21.881 1.762   1.00 0.00 ? 114 THR A CB   3  
ATOM 5291  O OG1  . THR A 1 114 ? -0.364  -23.101 1.011   1.00 0.00 ? 114 THR A OG1  3  
ATOM 5292  C CG2  . THR A 1 114 ? -1.786  -21.621 2.283   1.00 0.00 ? 114 THR A CG2  3  
ATOM 5293  H H    . THR A 1 114 ? -1.181  -21.369 -0.673  1.00 0.00 ? 114 THR A H    3  
ATOM 5294  H HA   . THR A 1 114 ? 0.009   -19.799 1.449   1.00 0.00 ? 114 THR A HA   3  
ATOM 5295  H HB   . THR A 1 114 ? 0.287   -21.975 2.605   1.00 0.00 ? 114 THR A HB   3  
ATOM 5296  H HG1  . THR A 1 114 ? -0.301  -23.846 1.614   1.00 0.00 ? 114 THR A HG1  3  
ATOM 5297  H HG21 . THR A 1 114 ? -1.729  -21.119 3.237   1.00 0.00 ? 114 THR A HG21 3  
ATOM 5298  H HG22 . THR A 1 114 ? -2.306  -22.560 2.402   1.00 0.00 ? 114 THR A HG22 3  
ATOM 5299  H HG23 . THR A 1 114 ? -2.322  -21.000 1.581   1.00 0.00 ? 114 THR A HG23 3  
ATOM 5300  N N    . GLY A 1 115 ? 1.820   -21.871 -0.377  1.00 0.00 ? 115 GLY A N    3  
ATOM 5301  C CA   . GLY A 1 115 ? 3.183   -22.158 -0.787  1.00 0.00 ? 115 GLY A CA   3  
ATOM 5302  C C    . GLY A 1 115 ? 3.488   -23.643 -0.781  1.00 0.00 ? 115 GLY A C    3  
ATOM 5303  O O    . GLY A 1 115 ? 2.585   -24.470 -0.909  1.00 0.00 ? 115 GLY A O    3  
ATOM 5304  H H    . GLY A 1 115 ? 1.076   -22.374 -0.770  1.00 0.00 ? 115 GLY A H    3  
ATOM 5305  H HA2  . GLY A 1 115 ? 3.336   -21.774 -1.784  1.00 0.00 ? 115 GLY A HA2  3  
ATOM 5306  H HA3  . GLY A 1 115 ? 3.862   -21.661 -0.111  1.00 0.00 ? 115 GLY A HA3  3  
ATOM 5307  N N    . SER A 1 116 ? 4.765   -23.982 -0.635  1.00 0.00 ? 116 SER A N    3  
ATOM 5308  C CA   . SER A 1 116 ? 5.188   -25.378 -0.621  1.00 0.00 ? 116 SER A CA   3  
ATOM 5309  C C    . SER A 1 116 ? 5.257   -25.908 0.807   1.00 0.00 ? 116 SER A C    3  
ATOM 5310  O O    . SER A 1 116 ? 5.756   -25.236 1.709   1.00 0.00 ? 116 SER A O    3  
ATOM 5311  C CB   . SER A 1 116 ? 6.553   -25.526 -1.297  1.00 0.00 ? 116 SER A CB   3  
ATOM 5312  O OG   . SER A 1 116 ? 7.582   -24.972 -0.498  1.00 0.00 ? 116 SER A OG   3  
ATOM 5313  H H    . SER A 1 116 ? 5.439   -23.276 -0.540  1.00 0.00 ? 116 SER A H    3  
ATOM 5314  H HA   . SER A 1 116 ? 4.459   -25.953 -1.172  1.00 0.00 ? 116 SER A HA   3  
ATOM 5315  H HB2  . SER A 1 116 ? 6.761   -26.573 -1.455  1.00 0.00 ? 116 SER A HB2  3  
ATOM 5316  H HB3  . SER A 1 116 ? 6.537   -25.015 -2.249  1.00 0.00 ? 116 SER A HB3  3  
ATOM 5317  H HG   . SER A 1 116 ? 8.437   -25.200 -0.870  1.00 0.00 ? 116 SER A HG   3  
ATOM 5318  N N    . GLY A 1 117 ? 4.750   -27.122 1.007   1.00 0.00 ? 117 GLY A N    3  
ATOM 5319  C CA   . GLY A 1 117 ? 4.761   -27.725 2.327   1.00 0.00 ? 117 GLY A CA   3  
ATOM 5320  C C    . GLY A 1 117 ? 3.801   -28.891 2.440   1.00 0.00 ? 117 GLY A C    3  
ATOM 5321  O O    . GLY A 1 117 ? 3.002   -29.155 1.542   1.00 0.00 ? 117 GLY A O    3  
ATOM 5322  H H    . GLY A 1 117 ? 4.365   -27.612 0.249   1.00 0.00 ? 117 GLY A H    3  
ATOM 5323  H HA2  . GLY A 1 117 ? 5.760   -28.072 2.543   1.00 0.00 ? 117 GLY A HA2  3  
ATOM 5324  H HA3  . GLY A 1 117 ? 4.487   -26.975 3.054   1.00 0.00 ? 117 GLY A HA3  3  
ATOM 5325  N N    . PRO A 1 118 ? 3.872   -29.613 3.569   1.00 0.00 ? 118 PRO A N    3  
ATOM 5326  C CA   . PRO A 1 118 ? 3.009   -30.770 3.823   1.00 0.00 ? 118 PRO A CA   3  
ATOM 5327  C C    . PRO A 1 118 ? 1.556   -30.370 4.055   1.00 0.00 ? 118 PRO A C    3  
ATOM 5328  O O    . PRO A 1 118 ? 1.239   -29.678 5.021   1.00 0.00 ? 118 PRO A O    3  
ATOM 5329  C CB   . PRO A 1 118 ? 3.603   -31.384 5.094   1.00 0.00 ? 118 PRO A CB   3  
ATOM 5330  C CG   . PRO A 1 118 ? 4.287   -30.250 5.778   1.00 0.00 ? 118 PRO A CG   3  
ATOM 5331  C CD   . PRO A 1 118 ? 4.800   -29.355 4.682   1.00 0.00 ? 118 PRO A CD   3  
ATOM 5332  H HA   . PRO A 1 118 ? 3.059   -31.488 3.017   1.00 0.00 ? 118 PRO A HA   3  
ATOM 5333  H HB2  . PRO A 1 118 ? 2.811   -31.793 5.703   1.00 0.00 ? 118 PRO A HB2  3  
ATOM 5334  H HB3  . PRO A 1 118 ? 4.301   -32.164 4.828   1.00 0.00 ? 118 PRO A HB3  3  
ATOM 5335  H HG2  . PRO A 1 118 ? 3.584   -29.718 6.399   1.00 0.00 ? 118 PRO A HG2  3  
ATOM 5336  H HG3  . PRO A 1 118 ? 5.109   -30.622 6.372   1.00 0.00 ? 118 PRO A HG3  3  
ATOM 5337  H HD2  . PRO A 1 118 ? 4.755   -28.320 4.991   1.00 0.00 ? 118 PRO A HD2  3  
ATOM 5338  H HD3  . PRO A 1 118 ? 5.810   -29.627 4.414   1.00 0.00 ? 118 PRO A HD3  3  
ATOM 5339  N N    . SER A 1 119 ? 0.675   -30.811 3.162   1.00 0.00 ? 119 SER A N    3  
ATOM 5340  C CA   . SER A 1 119 ? -0.745  -30.497 3.268   1.00 0.00 ? 119 SER A CA   3  
ATOM 5341  C C    . SER A 1 119 ? -1.499  -31.621 3.971   1.00 0.00 ? 119 SER A C    3  
ATOM 5342  O O    . SER A 1 119 ? -1.259  -32.801 3.713   1.00 0.00 ? 119 SER A O    3  
ATOM 5343  C CB   . SER A 1 119 ? -1.340  -30.258 1.879   1.00 0.00 ? 119 SER A CB   3  
ATOM 5344  O OG   . SER A 1 119 ? -1.581  -28.878 1.660   1.00 0.00 ? 119 SER A OG   3  
ATOM 5345  H H    . SER A 1 119 ? 0.990   -31.361 2.414   1.00 0.00 ? 119 SER A H    3  
ATOM 5346  H HA   . SER A 1 119 ? -0.841  -29.594 3.853   1.00 0.00 ? 119 SER A HA   3  
ATOM 5347  H HB2  . SER A 1 119 ? -0.653  -30.615 1.128   1.00 0.00 ? 119 SER A HB2  3  
ATOM 5348  H HB3  . SER A 1 119 ? -2.275  -30.792 1.795   1.00 0.00 ? 119 SER A HB3  3  
ATOM 5349  H HG   . SER A 1 119 ? -2.452  -28.763 1.270   1.00 0.00 ? 119 SER A HG   3  
ATOM 5350  N N    . SER A 1 120 ? -2.414  -31.247 4.860   1.00 0.00 ? 120 SER A N    3  
ATOM 5351  C CA   . SER A 1 120 ? -3.203  -32.222 5.603   1.00 0.00 ? 120 SER A CA   3  
ATOM 5352  C C    . SER A 1 120 ? -2.306  -33.090 6.481   1.00 0.00 ? 120 SER A C    3  
ATOM 5353  O O    . SER A 1 120 ? -1.084  -33.078 6.342   1.00 0.00 ? 120 SER A O    3  
ATOM 5354  C CB   . SER A 1 120 ? -4.000  -33.104 4.641   1.00 0.00 ? 120 SER A CB   3  
ATOM 5355  O OG   . SER A 1 120 ? -5.393  -32.899 4.797   1.00 0.00 ? 120 SER A OG   3  
ATOM 5356  H H    . SER A 1 120 ? -2.560  -30.290 5.021   1.00 0.00 ? 120 SER A H    3  
ATOM 5357  H HA   . SER A 1 120 ? -3.890  -31.680 6.234   1.00 0.00 ? 120 SER A HA   3  
ATOM 5358  H HB2  . SER A 1 120 ? -3.724  -32.866 3.625   1.00 0.00 ? 120 SER A HB2  3  
ATOM 5359  H HB3  . SER A 1 120 ? -3.777  -34.142 4.840   1.00 0.00 ? 120 SER A HB3  3  
ATOM 5360  H HG   . SER A 1 120 ? -5.719  -33.441 5.520   1.00 0.00 ? 120 SER A HG   3  
ATOM 5361  N N    . GLY A 1 121 ? -2.924  -33.841 7.388   1.00 0.00 ? 121 GLY A N    3  
ATOM 5362  C CA   . GLY A 1 121 ? -2.168  -34.705 8.276   1.00 0.00 ? 121 GLY A CA   3  
ATOM 5363  C C    . GLY A 1 121 ? -3.008  -35.831 8.844   1.00 0.00 ? 121 GLY A C    3  
ATOM 5364  O O    . GLY A 1 121 ? -4.164  -36.005 8.460   1.00 0.00 ? 121 GLY A O    3  
ATOM 5365  H H    . GLY A 1 121 ? -3.901  -33.810 7.453   1.00 0.00 ? 121 GLY A H    3  
ATOM 5366  H HA2  . GLY A 1 121 ? -1.338  -35.128 7.729   1.00 0.00 ? 121 GLY A HA2  3  
ATOM 5367  H HA3  . GLY A 1 121 ? -1.782  -34.111 9.092   1.00 0.00 ? 121 GLY A HA3  3  
ATOM 5368  N N    . GLY A 1 1   ? -15.597 52.040  -16.306 1.00 0.00 ? 1   GLY A N    4  
ATOM 5369  C CA   . GLY A 1 1   ? -16.019 51.270  -15.149 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5370  C C    . GLY A 1 1   ? -14.853 50.624  -14.429 1.00 0.00 ? 1   GLY A C    4  
ATOM 5371  O O    . GLY A 1 1   ? -13.811 50.364  -15.028 1.00 0.00 ? 1   GLY A O    4  
ATOM 5372  H H1   . GLY A 1 1   ? -14.643 52.199  -16.465 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5373  H HA2  . GLY A 1 1   ? -16.535 51.925  -14.463 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5374  H HA3  . GLY A 1 1   ? -16.700 50.498  -15.475 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5375  N N    . SER A 1 2   ? -15.030 50.364  -13.137 1.00 0.00 ? 2   SER A N    4  
ATOM 5376  C CA   . SER A 1 2   ? -13.982 49.748  -12.330 1.00 0.00 ? 2   SER A CA   4  
ATOM 5377  C C    . SER A 1 2   ? -14.560 49.152  -11.052 1.00 0.00 ? 2   SER A C    4  
ATOM 5378  O O    . SER A 1 2   ? -14.646 49.825  -10.024 1.00 0.00 ? 2   SER A O    4  
ATOM 5379  C CB   . SER A 1 2   ? -12.904 50.777  -11.986 1.00 0.00 ? 2   SER A CB   4  
ATOM 5380  O OG   . SER A 1 2   ? -11.711 50.529  -12.710 1.00 0.00 ? 2   SER A OG   4  
ATOM 5381  H H    . SER A 1 2   ? -15.884 50.594  -12.716 1.00 0.00 ? 2   SER A H    4  
ATOM 5382  H HA   . SER A 1 2   ? -13.537 48.956  -12.914 1.00 0.00 ? 2   SER A HA   4  
ATOM 5383  H HB2  . SER A 1 2   ? -13.260 51.765  -12.231 1.00 0.00 ? 2   SER A HB2  4  
ATOM 5384  H HB3  . SER A 1 2   ? -12.687 50.727  -10.928 1.00 0.00 ? 2   SER A HB3  4  
ATOM 5385  H HG   . SER A 1 2   ? -11.175 51.325  -12.726 1.00 0.00 ? 2   SER A HG   4  
ATOM 5386  N N    . SER A 1 3   ? -14.956 47.885  -11.122 1.00 0.00 ? 3   SER A N    4  
ATOM 5387  C CA   . SER A 1 3   ? -15.531 47.199  -9.972  1.00 0.00 ? 3   SER A CA   4  
ATOM 5388  C C    . SER A 1 3   ? -14.633 46.050  -9.519  1.00 0.00 ? 3   SER A C    4  
ATOM 5389  O O    . SER A 1 3   ? -13.564 45.824  -10.086 1.00 0.00 ? 3   SER A O    4  
ATOM 5390  C CB   . SER A 1 3   ? -16.925 46.668  -10.311 1.00 0.00 ? 3   SER A CB   4  
ATOM 5391  O OG   . SER A 1 3   ? -17.835 46.914  -9.253  1.00 0.00 ? 3   SER A OG   4  
ATOM 5392  H H    . SER A 1 3   ? -14.862 47.403  -11.970 1.00 0.00 ? 3   SER A H    4  
ATOM 5393  H HA   . SER A 1 3   ? -15.612 47.913  -9.166  1.00 0.00 ? 3   SER A HA   4  
ATOM 5394  H HB2  . SER A 1 3   ? -17.286 47.156  -11.203 1.00 0.00 ? 3   SER A HB2  4  
ATOM 5395  H HB3  . SER A 1 3   ? -16.869 45.602  -10.481 1.00 0.00 ? 3   SER A HB3  4  
ATOM 5396  H HG   . SER A 1 3   ? -18.425 46.164  -9.156  1.00 0.00 ? 3   SER A HG   4  
ATOM 5397  N N    . GLY A 1 4   ? -15.077 45.326  -8.497  1.00 0.00 ? 4   GLY A N    4  
ATOM 5398  C CA   . GLY A 1 4   ? -14.302 44.210  -7.987  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5399  C C    . GLY A 1 4   ? -14.359 44.108  -6.476  1.00 0.00 ? 4   GLY A C    4  
ATOM 5400  O O    . GLY A 1 4   ? -14.361 45.122  -5.778  1.00 0.00 ? 4   GLY A O    4  
ATOM 5401  H H    . GLY A 1 4   ? -15.937 45.552  -8.086  1.00 0.00 ? 4   GLY A H    4  
ATOM 5402  H HA2  . GLY A 1 4   ? -14.686 43.295  -8.413  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5403  H HA3  . GLY A 1 4   ? -13.272 44.333  -8.289  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5404  N N    . SER A 1 5   ? -14.406 42.880  -5.968  1.00 0.00 ? 5   SER A N    4  
ATOM 5405  C CA   . SER A 1 5   ? -14.469 42.650  -4.529  1.00 0.00 ? 5   SER A CA   4  
ATOM 5406  C C    . SER A 1 5   ? -14.189 41.186  -4.201  1.00 0.00 ? 5   SER A C    4  
ATOM 5407  O O    . SER A 1 5   ? -15.106 40.369  -4.130  1.00 0.00 ? 5   SER A O    4  
ATOM 5408  C CB   . SER A 1 5   ? -15.841 43.053  -3.985  1.00 0.00 ? 5   SER A CB   4  
ATOM 5409  O OG   . SER A 1 5   ? -15.900 42.894  -2.579  1.00 0.00 ? 5   SER A OG   4  
ATOM 5410  H H    . SER A 1 5   ? -14.402 42.112  -6.576  1.00 0.00 ? 5   SER A H    4  
ATOM 5411  H HA   . SER A 1 5   ? -13.712 43.262  -4.062  1.00 0.00 ? 5   SER A HA   4  
ATOM 5412  H HB2  . SER A 1 5   ? -16.031 44.089  -4.226  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5413  H HB3  . SER A 1 5   ? -16.601 42.433  -4.439  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5414  H HG   . SER A 1 5   ? -16.621 43.421  -2.227  1.00 0.00 ? 5   SER A HG   4  
ATOM 5415  N N    . SER A 1 6   ? -12.916 40.864  -4.002  1.00 0.00 ? 6   SER A N    4  
ATOM 5416  C CA   . SER A 1 6   ? -12.513 39.499  -3.686  1.00 0.00 ? 6   SER A CA   4  
ATOM 5417  C C    . SER A 1 6   ? -12.336 39.320  -2.181  1.00 0.00 ? 6   SER A C    4  
ATOM 5418  O O    . SER A 1 6   ? -12.096 40.283  -1.455  1.00 0.00 ? 6   SER A O    4  
ATOM 5419  C CB   . SER A 1 6   ? -11.213 39.147  -4.409  1.00 0.00 ? 6   SER A CB   4  
ATOM 5420  O OG   . SER A 1 6   ? -11.425 39.016  -5.804  1.00 0.00 ? 6   SER A OG   4  
ATOM 5421  H H    . SER A 1 6   ? -12.230 41.561  -4.073  1.00 0.00 ? 6   SER A H    4  
ATOM 5422  H HA   . SER A 1 6   ? -13.294 38.835  -4.024  1.00 0.00 ? 6   SER A HA   4  
ATOM 5423  H HB2  . SER A 1 6   ? -10.486 39.926  -4.239  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5424  H HB3  . SER A 1 6   ? -10.832 38.211  -4.026  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5425  H HG   . SER A 1 6   ? -11.151 38.142  -6.089  1.00 0.00 ? 6   SER A HG   4  
ATOM 5426  N N    . GLY A 1 7   ? -12.457 38.078  -1.720  1.00 0.00 ? 7   GLY A N    4  
ATOM 5427  C CA   . GLY A 1 7   ? -12.306 37.795  -0.304  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5428  C C    . GLY A 1 7   ? -10.911 38.101  0.204   1.00 0.00 ? 7   GLY A C    4  
ATOM 5429  O O    . GLY A 1 7   ? -9.987  38.346  -0.570  1.00 0.00 ? 7   GLY A O    4  
ATOM 5430  H H    . GLY A 1 7   ? -12.650 37.349  -2.346  1.00 0.00 ? 7   GLY A H    4  
ATOM 5431  H HA2  . GLY A 1 7   ? -13.020 38.390  0.247   1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5432  H HA3  . GLY A 1 7   ? -12.518 36.750  -0.134  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5433  N N    . PRO A 1 8   ? -10.748 38.092  1.535   1.00 0.00 ? 8   PRO A N    4  
ATOM 5434  C CA   . PRO A 1 8   ? -9.459  38.371  2.176   1.00 0.00 ? 8   PRO A CA   4  
ATOM 5435  C C    . PRO A 1 8   ? -8.445  37.256  1.944   1.00 0.00 ? 8   PRO A C    4  
ATOM 5436  O O    . PRO A 1 8   ? -8.728  36.084  2.188   1.00 0.00 ? 8   PRO A O    4  
ATOM 5437  C CB   . PRO A 1 8   ? -9.815  38.470  3.661   1.00 0.00 ? 8   PRO A CB   4  
ATOM 5438  C CG   . PRO A 1 8   ? -11.053 37.654  3.810   1.00 0.00 ? 8   PRO A CG   4  
ATOM 5439  C CD   . PRO A 1 8   ? -11.807 37.808  2.517   1.00 0.00 ? 8   PRO A CD   4  
ATOM 5440  H HA   . PRO A 1 8   ? -9.044  39.310  1.840   1.00 0.00 ? 8   PRO A HA   4  
ATOM 5441  H HB2  . PRO A 1 8   ? -9.005  38.070  4.255   1.00 0.00 ? 8   PRO A HB2  4  
ATOM 5442  H HB3  . PRO A 1 8   ? -9.989  39.502  3.926   1.00 0.00 ? 8   PRO A HB3  4  
ATOM 5443  H HG2  . PRO A 1 8   ? -10.794 36.619  3.970   1.00 0.00 ? 8   PRO A HG2  4  
ATOM 5444  H HG3  . PRO A 1 8   ? -11.642 38.027  4.633   1.00 0.00 ? 8   PRO A HG3  4  
ATOM 5445  H HD2  . PRO A 1 8   ? -12.327 36.894  2.271   1.00 0.00 ? 8   PRO A HD2  4  
ATOM 5446  H HD3  . PRO A 1 8   ? -12.503 38.633  2.583   1.00 0.00 ? 8   PRO A HD3  4  
ATOM 5447  N N    . VAL A 1 9   ? -7.259  37.630  1.473   1.00 0.00 ? 9   VAL A N    4  
ATOM 5448  C CA   . VAL A 1 9   ? -6.201  36.662  1.209   1.00 0.00 ? 9   VAL A CA   4  
ATOM 5449  C C    . VAL A 1 9   ? -6.634  35.647  0.159   1.00 0.00 ? 9   VAL A C    4  
ATOM 5450  O O    . VAL A 1 9   ? -7.348  34.692  0.458   1.00 0.00 ? 9   VAL A O    4  
ATOM 5451  C CB   . VAL A 1 9   ? -5.794  35.913  2.493   1.00 0.00 ? 9   VAL A CB   4  
ATOM 5452  C CG1  . VAL A 1 9   ? -4.660  34.942  2.206   1.00 0.00 ? 9   VAL A CG1  4  
ATOM 5453  C CG2  . VAL A 1 9   ? -5.399  36.900  3.582   1.00 0.00 ? 9   VAL A CG2  4  
ATOM 5454  H H    . VAL A 1 9   ? -7.092  38.580  1.297   1.00 0.00 ? 9   VAL A H    4  
ATOM 5455  H HA   . VAL A 1 9   ? -5.339  37.201  0.843   1.00 0.00 ? 9   VAL A HA   4  
ATOM 5456  H HB   . VAL A 1 9   ? -6.645  35.347  2.840   1.00 0.00 ? 9   VAL A HB   4  
ATOM 5457  H HG11 . VAL A 1 9   ? -4.292  34.534  3.137   1.00 0.00 ? 9   VAL A HG11 4  
ATOM 5458  H HG12 . VAL A 1 9   ? -5.020  34.141  1.578   1.00 0.00 ? 9   VAL A HG12 4  
ATOM 5459  H HG13 . VAL A 1 9   ? -3.858  35.462  1.702   1.00 0.00 ? 9   VAL A HG13 4  
ATOM 5460  H HG21 . VAL A 1 9   ? -6.261  37.486  3.865   1.00 0.00 ? 9   VAL A HG21 4  
ATOM 5461  H HG22 . VAL A 1 9   ? -5.035  36.358  4.443   1.00 0.00 ? 9   VAL A HG22 4  
ATOM 5462  H HG23 . VAL A 1 9   ? -4.623  37.554  3.213   1.00 0.00 ? 9   VAL A HG23 4  
ATOM 5463  N N    . LEU A 1 10  ? -6.194  35.862  -1.078  1.00 0.00 ? 10  LEU A N    4  
ATOM 5464  C CA   . LEU A 1 10  ? -6.535  34.964  -2.177  1.00 0.00 ? 10  LEU A CA   4  
ATOM 5465  C C    . LEU A 1 10  ? -5.285  34.298  -2.744  1.00 0.00 ? 10  LEU A C    4  
ATOM 5466  O O    . LEU A 1 10  ? -4.164  34.618  -2.348  1.00 0.00 ? 10  LEU A O    4  
ATOM 5467  C CB   . LEU A 1 10  ? -7.264  35.732  -3.281  1.00 0.00 ? 10  LEU A CB   4  
ATOM 5468  C CG   . LEU A 1 10  ? -6.505  36.912  -3.892  1.00 0.00 ? 10  LEU A CG   4  
ATOM 5469  C CD1  . LEU A 1 10  ? -6.700  36.948  -5.399  1.00 0.00 ? 10  LEU A CD1  4  
ATOM 5470  C CD2  . LEU A 1 10  ? -6.956  38.221  -3.260  1.00 0.00 ? 10  LEU A CD2  4  
ATOM 5471  H H    . LEU A 1 10  ? -5.626  36.640  -1.256  1.00 0.00 ? 10  LEU A H    4  
ATOM 5472  H HA   . LEU A 1 10  ? -7.191  34.200  -1.789  1.00 0.00 ? 10  LEU A HA   4  
ATOM 5473  H HB2  . LEU A 1 10  ? -7.488  35.037  -4.075  1.00 0.00 ? 10  LEU A HB2  4  
ATOM 5474  H HB3  . LEU A 1 10  ? -8.186  36.110  -2.865  1.00 0.00 ? 10  LEU A HB3  4  
ATOM 5475  H HG   . LEU A 1 10  ? -5.448  36.791  -3.694  1.00 0.00 ? 10  LEU A HG   4  
ATOM 5476  H HD11 . LEU A 1 10  ? -6.835  35.945  -5.769  1.00 0.00 ? 10  LEU A HD11 4  
ATOM 5477  H HD12 . LEU A 1 10  ? -5.830  37.390  -5.863  1.00 0.00 ? 10  LEU A HD12 4  
ATOM 5478  H HD13 . LEU A 1 10  ? -7.572  37.542  -5.634  1.00 0.00 ? 10  LEU A HD13 4  
ATOM 5479  H HD21 . LEU A 1 10  ? -6.840  39.023  -3.974  1.00 0.00 ? 10  LEU A HD21 4  
ATOM 5480  H HD22 . LEU A 1 10  ? -6.355  38.425  -2.387  1.00 0.00 ? 10  LEU A HD22 4  
ATOM 5481  H HD23 . LEU A 1 10  ? -7.994  38.142  -2.972  1.00 0.00 ? 10  LEU A HD23 4  
ATOM 5482  N N    . THR A 1 11  ? -5.486  33.372  -3.676  1.00 0.00 ? 11  THR A N    4  
ATOM 5483  C CA   . THR A 1 11  ? -4.376  32.662  -4.298  1.00 0.00 ? 11  THR A CA   4  
ATOM 5484  C C    . THR A 1 11  ? -3.460  32.042  -3.249  1.00 0.00 ? 11  THR A C    4  
ATOM 5485  O O    . THR A 1 11  ? -2.239  32.034  -3.405  1.00 0.00 ? 11  THR A O    4  
ATOM 5486  C CB   . THR A 1 11  ? -3.546  33.596  -5.199  1.00 0.00 ? 11  THR A CB   4  
ATOM 5487  O OG1  . THR A 1 11  ? -4.400  34.562  -5.822  1.00 0.00 ? 11  THR A OG1  4  
ATOM 5488  C CG2  . THR A 1 11  ? -2.807  32.803  -6.268  1.00 0.00 ? 11  THR A CG2  4  
ATOM 5489  H H    . THR A 1 11  ? -6.402  33.160  -3.950  1.00 0.00 ? 11  THR A H    4  
ATOM 5490  H HA   . THR A 1 11  ? -4.787  31.874  -4.915  1.00 0.00 ? 11  THR A HA   4  
ATOM 5491  H HB   . THR A 1 11  ? -2.819  34.111  -4.587  1.00 0.00 ? 11  THR A HB   4  
ATOM 5492  H HG1  . THR A 1 11  ? -3.978  34.898  -6.616  1.00 0.00 ? 11  THR A HG1  4  
ATOM 5493  H HG21 . THR A 1 11  ? -1.781  33.138  -6.319  1.00 0.00 ? 11  THR A HG21 4  
ATOM 5494  H HG22 . THR A 1 11  ? -3.285  32.954  -7.224  1.00 0.00 ? 11  THR A HG22 4  
ATOM 5495  H HG23 . THR A 1 11  ? -2.831  31.753  -6.017  1.00 0.00 ? 11  THR A HG23 4  
ATOM 5496  N N    . GLN A 1 12  ? -4.058  31.524  -2.182  1.00 0.00 ? 12  GLN A N    4  
ATOM 5497  C CA   . GLN A 1 12  ? -3.295  30.902  -1.106  1.00 0.00 ? 12  GLN A CA   4  
ATOM 5498  C C    . GLN A 1 12  ? -3.200  29.393  -1.308  1.00 0.00 ? 12  GLN A C    4  
ATOM 5499  O O    . GLN A 1 12  ? -4.199  28.729  -1.590  1.00 0.00 ? 12  GLN A O    4  
ATOM 5500  C CB   . GLN A 1 12  ? -3.939  31.208  0.247   1.00 0.00 ? 12  GLN A CB   4  
ATOM 5501  C CG   . GLN A 1 12  ? -2.974  31.108  1.417   1.00 0.00 ? 12  GLN A CG   4  
ATOM 5502  C CD   . GLN A 1 12  ? -1.984  32.255  1.457   1.00 0.00 ? 12  GLN A CD   4  
ATOM 5503  O OE1  . GLN A 1 12  ? -2.005  33.139  0.600   1.00 0.00 ? 12  GLN A OE1  4  
ATOM 5504  N NE2  . GLN A 1 12  ? -1.109  32.248  2.457   1.00 0.00 ? 12  GLN A NE2  4  
ATOM 5505  H H    . GLN A 1 12  ? -5.035  31.561  -2.115  1.00 0.00 ? 12  GLN A H    4  
ATOM 5506  H HA   . GLN A 1 12  ? -2.300  31.318  -1.123  1.00 0.00 ? 12  GLN A HA   4  
ATOM 5507  H HB2  . GLN A 1 12  ? -4.339  32.210  0.224   1.00 0.00 ? 12  GLN A HB2  4  
ATOM 5508  H HB3  . GLN A 1 12  ? -4.747  30.510  0.415   1.00 0.00 ? 12  GLN A HB3  4  
ATOM 5509  H HG2  . GLN A 1 12  ? -3.540  31.109  2.337   1.00 0.00 ? 12  GLN A HG2  4  
ATOM 5510  H HG3  . GLN A 1 12  ? -2.425  30.181  1.336   1.00 0.00 ? 12  GLN A HG3  4  
ATOM 5511  H HE21 . GLN A 1 12  ? -1.150  31.511  3.102   1.00 0.00 ? 12  GLN A HE21 4  
ATOM 5512  H HE22 . GLN A 1 12  ? -0.457  32.976  2.506   1.00 0.00 ? 12  GLN A HE22 4  
ATOM 5513  N N    . THR A 1 13  ? -1.993  28.856  -1.160  1.00 0.00 ? 13  THR A N    4  
ATOM 5514  C CA   . THR A 1 13  ? -1.767  27.427  -1.328  1.00 0.00 ? 13  THR A CA   4  
ATOM 5515  C C    . THR A 1 13  ? -2.339  26.639  -0.155  1.00 0.00 ? 13  THR A C    4  
ATOM 5516  O O    . THR A 1 13  ? -3.335  25.931  -0.296  1.00 0.00 ? 13  THR A O    4  
ATOM 5517  C CB   . THR A 1 13  ? -0.266  27.106  -1.465  1.00 0.00 ? 13  THR A CB   4  
ATOM 5518  O OG1  . THR A 1 13  ? 0.305   27.882  -2.524  1.00 0.00 ? 13  THR A OG1  4  
ATOM 5519  C CG2  . THR A 1 13  ? -0.051  25.626  -1.739  1.00 0.00 ? 13  THR A CG2  4  
ATOM 5520  H H    . THR A 1 13  ? -1.237  29.437  -0.935  1.00 0.00 ? 13  THR A H    4  
ATOM 5521  H HA   . THR A 1 13  ? -2.264  27.114  -2.235  1.00 0.00 ? 13  THR A HA   4  
ATOM 5522  H HB   . THR A 1 13  ? 0.226   27.361  -0.537  1.00 0.00 ? 13  THR A HB   4  
ATOM 5523  H HG1  . THR A 1 13  ? 0.454   28.780  -2.218  1.00 0.00 ? 13  THR A HG1  4  
ATOM 5524  H HG21 . THR A 1 13  ? 1.007   25.426  -1.824  1.00 0.00 ? 13  THR A HG21 4  
ATOM 5525  H HG22 . THR A 1 13  ? -0.544  25.357  -2.661  1.00 0.00 ? 13  THR A HG22 4  
ATOM 5526  H HG23 . THR A 1 13  ? -0.462  25.046  -0.927  1.00 0.00 ? 13  THR A HG23 4  
ATOM 5527  N N    . SER A 1 14  ? -1.699  26.765  1.005   1.00 0.00 ? 14  SER A N    4  
ATOM 5528  C CA   . SER A 1 14  ? -2.143  26.061  2.201   1.00 0.00 ? 14  SER A CA   4  
ATOM 5529  C C    . SER A 1 14  ? -2.148  24.553  1.975   1.00 0.00 ? 14  SER A C    4  
ATOM 5530  O O    . SER A 1 14  ? -1.843  24.079  0.882   1.00 0.00 ? 14  SER A O    4  
ATOM 5531  C CB   . SER A 1 14  ? -3.540  26.533  2.607   1.00 0.00 ? 14  SER A CB   4  
ATOM 5532  O OG   . SER A 1 14  ? -3.471  27.536  3.605   1.00 0.00 ? 14  SER A OG   4  
ATOM 5533  H H    . SER A 1 14  ? -0.909  27.343  1.053   1.00 0.00 ? 14  SER A H    4  
ATOM 5534  H HA   . SER A 1 14  ? -1.450  26.292  2.998   1.00 0.00 ? 14  SER A HA   4  
ATOM 5535  H HB2  . SER A 1 14  ? -4.046  26.934  1.744   1.00 0.00 ? 14  SER A HB2  4  
ATOM 5536  H HB3  . SER A 1 14  ? -4.101  25.693  2.995   1.00 0.00 ? 14  SER A HB3  4  
ATOM 5537  H HG   . SER A 1 14  ? -4.299  28.022  3.629   1.00 0.00 ? 14  SER A HG   4  
ATOM 5538  N N    . GLU A 1 15  ? -2.495  23.805  3.019   1.00 0.00 ? 15  GLU A N    4  
ATOM 5539  C CA   . GLU A 1 15  ? -2.537  22.349  2.934   1.00 0.00 ? 15  GLU A CA   4  
ATOM 5540  C C    . GLU A 1 15  ? -3.576  21.895  1.913   1.00 0.00 ? 15  GLU A C    4  
ATOM 5541  O O    . GLU A 1 15  ? -4.727  22.330  1.947   1.00 0.00 ? 15  GLU A O    4  
ATOM 5542  C CB   . GLU A 1 15  ? -2.855  21.746  4.304   1.00 0.00 ? 15  GLU A CB   4  
ATOM 5543  C CG   . GLU A 1 15  ? -1.714  21.865  5.300   1.00 0.00 ? 15  GLU A CG   4  
ATOM 5544  C CD   . GLU A 1 15  ? -1.761  23.159  6.090   1.00 0.00 ? 15  GLU A CD   4  
ATOM 5545  O OE1  . GLU A 1 15  ? -2.762  23.384  6.801   1.00 0.00 ? 15  GLU A OE1  4  
ATOM 5546  O OE2  . GLU A 1 15  ? -0.796  23.945  5.997   1.00 0.00 ? 15  GLU A OE2  4  
ATOM 5547  H H    . GLU A 1 15  ? -2.725  24.241  3.865   1.00 0.00 ? 15  GLU A H    4  
ATOM 5548  H HA   . GLU A 1 15  ? -1.564  22.006  2.617   1.00 0.00 ? 15  GLU A HA   4  
ATOM 5549  H HB2  . GLU A 1 15  ? -3.718  22.248  4.714   1.00 0.00 ? 15  GLU A HB2  4  
ATOM 5550  H HB3  . GLU A 1 15  ? -3.087  20.699  4.177   1.00 0.00 ? 15  GLU A HB3  4  
ATOM 5551  H HG2  . GLU A 1 15  ? -1.769  21.037  5.991   1.00 0.00 ? 15  GLU A HG2  4  
ATOM 5552  H HG3  . GLU A 1 15  ? -0.778  21.822  4.763   1.00 0.00 ? 15  GLU A HG3  4  
ATOM 5553  N N    . GLN A 1 16  ? -3.161  21.017  1.005   1.00 0.00 ? 16  GLN A N    4  
ATOM 5554  C CA   . GLN A 1 16  ? -4.055  20.506  -0.027  1.00 0.00 ? 16  GLN A CA   4  
ATOM 5555  C C    . GLN A 1 16  ? -4.097  18.981  -0.002  1.00 0.00 ? 16  GLN A C    4  
ATOM 5556  O O    . GLN A 1 16  ? -3.464  18.346  0.842   1.00 0.00 ? 16  GLN A O    4  
ATOM 5557  C CB   . GLN A 1 16  ? -3.607  20.993  -1.407  1.00 0.00 ? 16  GLN A CB   4  
ATOM 5558  C CG   . GLN A 1 16  ? -4.477  22.104  -1.970  1.00 0.00 ? 16  GLN A CG   4  
ATOM 5559  C CD   . GLN A 1 16  ? -3.982  22.610  -3.310  1.00 0.00 ? 16  GLN A CD   4  
ATOM 5560  O OE1  . GLN A 1 16  ? -4.479  22.207  -4.362  1.00 0.00 ? 16  GLN A OE1  4  
ATOM 5561  N NE2  . GLN A 1 16  ? -2.995  23.498  -3.281  1.00 0.00 ? 16  GLN A NE2  4  
ATOM 5562  H H    . GLN A 1 16  ? -2.232  20.709  1.029   1.00 0.00 ? 16  GLN A H    4  
ATOM 5563  H HA   . GLN A 1 16  ? -5.045  20.885  0.175   1.00 0.00 ? 16  GLN A HA   4  
ATOM 5564  H HB2  . GLN A 1 16  ? -2.594  21.357  -1.335  1.00 0.00 ? 16  GLN A HB2  4  
ATOM 5565  H HB3  . GLN A 1 16  ? -3.635  20.160  -2.095  1.00 0.00 ? 16  GLN A HB3  4  
ATOM 5566  H HG2  . GLN A 1 16  ? -5.482  21.730  -2.094  1.00 0.00 ? 16  GLN A HG2  4  
ATOM 5567  H HG3  . GLN A 1 16  ? -4.483  22.927  -1.271  1.00 0.00 ? 16  GLN A HG3  4  
ATOM 5568  H HE21 . GLN A 1 16  ? -2.646  23.772  -2.406  1.00 0.00 ? 16  GLN A HE21 4  
ATOM 5569  H HE22 . GLN A 1 16  ? -2.654  23.842  -4.133  1.00 0.00 ? 16  GLN A HE22 4  
ATOM 5570  N N    . ALA A 1 17  ? -4.849  18.400  -0.931  1.00 0.00 ? 17  ALA A N    4  
ATOM 5571  C CA   . ALA A 1 17  ? -4.972  16.950  -1.017  1.00 0.00 ? 17  ALA A CA   4  
ATOM 5572  C C    . ALA A 1 17  ? -3.644  16.307  -1.401  1.00 0.00 ? 17  ALA A C    4  
ATOM 5573  O O    . ALA A 1 17  ? -2.751  16.951  -1.952  1.00 0.00 ? 17  ALA A O    4  
ATOM 5574  C CB   . ALA A 1 17  ? -6.053  16.571  -2.018  1.00 0.00 ? 17  ALA A CB   4  
ATOM 5575  H H    . ALA A 1 17  ? -5.329  18.959  -1.576  1.00 0.00 ? 17  ALA A H    4  
ATOM 5576  H HA   . ALA A 1 17  ? -5.272  16.583  -0.046  1.00 0.00 ? 17  ALA A HA   4  
ATOM 5577  H HB1  . ALA A 1 17  ? -5.760  15.671  -2.539  1.00 0.00 ? 17  ALA A HB1  4  
ATOM 5578  H HB2  . ALA A 1 17  ? -6.982  16.399  -1.496  1.00 0.00 ? 17  ALA A HB2  4  
ATOM 5579  H HB3  . ALA A 1 17  ? -6.181  17.373  -2.730  1.00 0.00 ? 17  ALA A HB3  4  
ATOM 5580  N N    . PRO A 1 18  ? -3.507  15.005  -1.102  1.00 0.00 ? 18  PRO A N    4  
ATOM 5581  C CA   . PRO A 1 18  ? -2.290  14.247  -1.408  1.00 0.00 ? 18  PRO A CA   4  
ATOM 5582  C C    . PRO A 1 18  ? -2.105  14.025  -2.904  1.00 0.00 ? 18  PRO A C    4  
ATOM 5583  O O    . PRO A 1 18  ? -2.962  13.436  -3.564  1.00 0.00 ? 18  PRO A O    4  
ATOM 5584  C CB   . PRO A 1 18  ? -2.515  12.914  -0.692  1.00 0.00 ? 18  PRO A CB   4  
ATOM 5585  C CG   . PRO A 1 18  ? -3.996  12.779  -0.600  1.00 0.00 ? 18  PRO A CG   4  
ATOM 5586  C CD   . PRO A 1 18  ? -4.531  14.176  -0.446  1.00 0.00 ? 18  PRO A CD   4  
ATOM 5587  H HA   . PRO A 1 18  ? -1.412  14.730  -1.006  1.00 0.00 ? 18  PRO A HA   4  
ATOM 5588  H HB2  . PRO A 1 18  ? -2.080  12.112  -1.274  1.00 0.00 ? 18  PRO A HB2  4  
ATOM 5589  H HB3  . PRO A 1 18  ? -2.060  12.943  0.286   1.00 0.00 ? 18  PRO A HB3  4  
ATOM 5590  H HG2  . PRO A 1 18  ? -4.381  12.327  -1.501  1.00 0.00 ? 18  PRO A HG2  4  
ATOM 5591  H HG3  . PRO A 1 18  ? -4.256  12.181  0.261   1.00 0.00 ? 18  PRO A HG3  4  
ATOM 5592  H HD2  . PRO A 1 18  ? -5.484  14.272  -0.945  1.00 0.00 ? 18  PRO A HD2  4  
ATOM 5593  H HD3  . PRO A 1 18  ? -4.621  14.432  0.599   1.00 0.00 ? 18  PRO A HD3  4  
ATOM 5594  N N    . SER A 1 19  ? -0.983  14.499  -3.436  1.00 0.00 ? 19  SER A N    4  
ATOM 5595  C CA   . SER A 1 19  ? -0.688  14.355  -4.856  1.00 0.00 ? 19  SER A CA   4  
ATOM 5596  C C    . SER A 1 19  ? 0.448   13.360  -5.076  1.00 0.00 ? 19  SER A C    4  
ATOM 5597  O O    . SER A 1 19  ? 1.232   13.495  -6.015  1.00 0.00 ? 19  SER A O    4  
ATOM 5598  C CB   . SER A 1 19  ? -0.318  15.711  -5.462  1.00 0.00 ? 19  SER A CB   4  
ATOM 5599  O OG   . SER A 1 19  ? -0.307  15.650  -6.877  1.00 0.00 ? 19  SER A OG   4  
ATOM 5600  H H    . SER A 1 19  ? -0.339  14.960  -2.857  1.00 0.00 ? 19  SER A H    4  
ATOM 5601  H HA   . SER A 1 19  ? -1.577  13.983  -5.343  1.00 0.00 ? 19  SER A HA   4  
ATOM 5602  H HB2  . SER A 1 19  ? -1.040  16.449  -5.152  1.00 0.00 ? 19  SER A HB2  4  
ATOM 5603  H HB3  . SER A 1 19  ? 0.664   16.000  -5.117  1.00 0.00 ? 19  SER A HB3  4  
ATOM 5604  H HG   . SER A 1 19  ? 0.570   15.403  -7.180  1.00 0.00 ? 19  SER A HG   4  
ATOM 5605  N N    . SER A 1 20  ? 0.529   12.361  -4.203  1.00 0.00 ? 20  SER A N    4  
ATOM 5606  C CA   . SER A 1 20  ? 1.571   11.345  -4.298  1.00 0.00 ? 20  SER A CA   4  
ATOM 5607  C C    . SER A 1 20  ? 1.035   9.979   -3.880  1.00 0.00 ? 20  SER A C    4  
ATOM 5608  O O    . SER A 1 20  ? 0.394   9.843   -2.839  1.00 0.00 ? 20  SER A O    4  
ATOM 5609  C CB   . SER A 1 20  ? 2.767   11.727  -3.426  1.00 0.00 ? 20  SER A CB   4  
ATOM 5610  O OG   . SER A 1 20  ? 3.923   10.996  -3.797  1.00 0.00 ? 20  SER A OG   4  
ATOM 5611  H H    . SER A 1 20  ? -0.127  12.309  -3.476  1.00 0.00 ? 20  SER A H    4  
ATOM 5612  H HA   . SER A 1 20  ? 1.889   11.293  -5.329  1.00 0.00 ? 20  SER A HA   4  
ATOM 5613  H HB2  . SER A 1 20  ? 2.971   12.780  -3.540  1.00 0.00 ? 20  SER A HB2  4  
ATOM 5614  H HB3  . SER A 1 20  ? 2.537   11.514  -2.391  1.00 0.00 ? 20  SER A HB3  4  
ATOM 5615  H HG   . SER A 1 20  ? 4.014   10.229  -3.226  1.00 0.00 ? 20  SER A HG   4  
ATOM 5616  N N    . ALA A 1 21  ? 1.306   8.968   -4.699  1.00 0.00 ? 21  ALA A N    4  
ATOM 5617  C CA   . ALA A 1 21  ? 0.855   7.611   -4.413  1.00 0.00 ? 21  ALA A CA   4  
ATOM 5618  C C    . ALA A 1 21  ? 1.605   7.024   -3.222  1.00 0.00 ? 21  ALA A C    4  
ATOM 5619  O O    . ALA A 1 21  ? 2.722   7.426   -2.900  1.00 0.00 ? 21  ALA A O    4  
ATOM 5620  C CB   . ALA A 1 21  ? 1.032   6.729   -5.639  1.00 0.00 ? 21  ALA A CB   4  
ATOM 5621  H H    . ALA A 1 21  ? 1.823   9.139   -5.514  1.00 0.00 ? 21  ALA A H    4  
ATOM 5622  H HA   . ALA A 1 21  ? -0.199  7.653   -4.177  1.00 0.00 ? 21  ALA A HA   4  
ATOM 5623  H HB1  . ALA A 1 21  ? 1.965   6.190   -5.563  1.00 0.00 ? 21  ALA A HB1  4  
ATOM 5624  H HB2  . ALA A 1 21  ? 0.214   6.025   -5.696  1.00 0.00 ? 21  ALA A HB2  4  
ATOM 5625  H HB3  . ALA A 1 21  ? 1.041   7.342   -6.527  1.00 0.00 ? 21  ALA A HB3  4  
ATOM 5626  N N    . PRO A 1 22  ? 0.976   6.046   -2.551  1.00 0.00 ? 22  PRO A N    4  
ATOM 5627  C CA   . PRO A 1 22  ? 1.565   5.382   -1.385  1.00 0.00 ? 22  PRO A CA   4  
ATOM 5628  C C    . PRO A 1 22  ? 2.749   4.496   -1.759  1.00 0.00 ? 22  PRO A C    4  
ATOM 5629  O O    . PRO A 1 22  ? 2.855   4.033   -2.895  1.00 0.00 ? 22  PRO A O    4  
ATOM 5630  C CB   . PRO A 1 22  ? 0.413   4.533   -0.841  1.00 0.00 ? 22  PRO A CB   4  
ATOM 5631  C CG   . PRO A 1 22  ? -0.465  4.288   -2.018  1.00 0.00 ? 22  PRO A CG   4  
ATOM 5632  C CD   . PRO A 1 22  ? -0.357  5.517   -2.878  1.00 0.00 ? 22  PRO A CD   4  
ATOM 5633  H HA   . PRO A 1 22  ? 1.874   6.096   -0.635  1.00 0.00 ? 22  PRO A HA   4  
ATOM 5634  H HB2  . PRO A 1 22  ? 0.803   3.609   -0.437  1.00 0.00 ? 22  PRO A HB2  4  
ATOM 5635  H HB3  . PRO A 1 22  ? -0.106  5.078   -0.067  1.00 0.00 ? 22  PRO A HB3  4  
ATOM 5636  H HG2  . PRO A 1 22  ? -0.120  3.420   -2.559  1.00 0.00 ? 22  PRO A HG2  4  
ATOM 5637  H HG3  . PRO A 1 22  ? -1.485  4.147   -1.692  1.00 0.00 ? 22  PRO A HG3  4  
ATOM 5638  H HD2  . PRO A 1 22  ? -0.422  5.252   -3.924  1.00 0.00 ? 22  PRO A HD2  4  
ATOM 5639  H HD3  . PRO A 1 22  ? -1.129  6.227   -2.619  1.00 0.00 ? 22  PRO A HD3  4  
ATOM 5640  N N    . ARG A 1 23  ? 3.637   4.267   -0.797  1.00 0.00 ? 23  ARG A N    4  
ATOM 5641  C CA   . ARG A 1 23  ? 4.814   3.438   -1.027  1.00 0.00 ? 23  ARG A CA   4  
ATOM 5642  C C    . ARG A 1 23  ? 4.780   2.191   -0.147  1.00 0.00 ? 23  ARG A C    4  
ATOM 5643  O O    . ARG A 1 23  ? 3.868   2.013   0.660   1.00 0.00 ? 23  ARG A O    4  
ATOM 5644  C CB   . ARG A 1 23  ? 6.089   4.235   -0.749  1.00 0.00 ? 23  ARG A CB   4  
ATOM 5645  C CG   . ARG A 1 23  ? 6.089   5.619   -1.378  1.00 0.00 ? 23  ARG A CG   4  
ATOM 5646  C CD   . ARG A 1 23  ? 7.491   6.205   -1.437  1.00 0.00 ? 23  ARG A CD   4  
ATOM 5647  N NE   . ARG A 1 23  ? 8.396   5.377   -2.229  1.00 0.00 ? 23  ARG A NE   4  
ATOM 5648  C CZ   . ARG A 1 23  ? 8.376   5.330   -3.557  1.00 0.00 ? 23  ARG A CZ   4  
ATOM 5649  N NH1  . ARG A 1 23  ? 7.502   6.059   -4.236  1.00 0.00 ? 23  ARG A NH1  4  
ATOM 5650  N NH2  . ARG A 1 23  ? 9.232   4.553   -4.207  1.00 0.00 ? 23  ARG A NH2  4  
ATOM 5651  H H    . ARG A 1 23  ? 3.498   4.664   0.088   1.00 0.00 ? 23  ARG A H    4  
ATOM 5652  H HA   . ARG A 1 23  ? 4.809   3.132   -2.062  1.00 0.00 ? 23  ARG A HA   4  
ATOM 5653  H HB2  . ARG A 1 23  ? 6.203   4.349   0.319   1.00 0.00 ? 23  ARG A HB2  4  
ATOM 5654  H HB3  . ARG A 1 23  ? 6.934   3.687   -1.138  1.00 0.00 ? 23  ARG A HB3  4  
ATOM 5655  H HG2  . ARG A 1 23  ? 5.698   5.549   -2.382  1.00 0.00 ? 23  ARG A HG2  4  
ATOM 5656  H HG3  . ARG A 1 23  ? 5.460   6.272   -0.790  1.00 0.00 ? 23  ARG A HG3  4  
ATOM 5657  H HD2  . ARG A 1 23  ? 7.438   7.188   -1.878  1.00 0.00 ? 23  ARG A HD2  4  
ATOM 5658  H HD3  . ARG A 1 23  ? 7.877   6.281   -0.431  1.00 0.00 ? 23  ARG A HD3  4  
ATOM 5659  H HE   . ARG A 1 23  ? 9.051   4.830   -1.748  1.00 0.00 ? 23  ARG A HE   4  
ATOM 5660  H HH11 . ARG A 1 23  ? 6.856   6.646   -3.748  1.00 0.00 ? 23  ARG A HH11 4  
ATOM 5661  H HH12 . ARG A 1 23  ? 7.490   6.023   -5.235  1.00 0.00 ? 23  ARG A HH12 4  
ATOM 5662  H HH21 . ARG A 1 23  ? 9.893   4.002   -3.698  1.00 0.00 ? 23  ARG A HH21 4  
ATOM 5663  H HH22 . ARG A 1 23  ? 9.216   4.518   -5.206  1.00 0.00 ? 23  ARG A HH22 4  
ATOM 5664  N N    . ASP A 1 24  ? 5.779   1.331   -0.309  1.00 0.00 ? 24  ASP A N    4  
ATOM 5665  C CA   . ASP A 1 24  ? 5.866   0.102   0.470   1.00 0.00 ? 24  ASP A CA   4  
ATOM 5666  C C    . ASP A 1 24  ? 4.565   -0.692  0.378   1.00 0.00 ? 24  ASP A C    4  
ATOM 5667  O O    . ASP A 1 24  ? 4.204   -1.418  1.304   1.00 0.00 ? 24  ASP A O    4  
ATOM 5668  C CB   . ASP A 1 24  ? 6.182   0.420   1.933   1.00 0.00 ? 24  ASP A CB   4  
ATOM 5669  C CG   . ASP A 1 24  ? 7.114   -0.599  2.558   1.00 0.00 ? 24  ASP A CG   4  
ATOM 5670  O OD1  . ASP A 1 24  ? 8.332   -0.525  2.299   1.00 0.00 ? 24  ASP A OD1  4  
ATOM 5671  O OD2  . ASP A 1 24  ? 6.624   -1.470  3.307   1.00 0.00 ? 24  ASP A OD2  4  
ATOM 5672  H H    . ASP A 1 24  ? 6.478   1.528   -0.969  1.00 0.00 ? 24  ASP A H    4  
ATOM 5673  H HA   . ASP A 1 24  ? 6.666   -0.496  0.061   1.00 0.00 ? 24  ASP A HA   4  
ATOM 5674  H HB2  . ASP A 1 24  ? 6.651   1.391   1.989   1.00 0.00 ? 24  ASP A HB2  4  
ATOM 5675  H HB3  . ASP A 1 24  ? 5.262   0.435   2.498   1.00 0.00 ? 24  ASP A HB3  4  
ATOM 5676  N N    . VAL A 1 25  ? 3.866   -0.545  -0.742  1.00 0.00 ? 25  VAL A N    4  
ATOM 5677  C CA   . VAL A 1 25  ? 2.606   -1.247  -0.954  1.00 0.00 ? 25  VAL A CA   4  
ATOM 5678  C C    . VAL A 1 25  ? 2.844   -2.652  -1.496  1.00 0.00 ? 25  VAL A C    4  
ATOM 5679  O O    . VAL A 1 25  ? 3.117   -2.831  -2.683  1.00 0.00 ? 25  VAL A O    4  
ATOM 5680  C CB   . VAL A 1 25  ? 1.694   -0.480  -1.930  1.00 0.00 ? 25  VAL A CB   4  
ATOM 5681  C CG1  . VAL A 1 25  ? 0.317   -1.122  -1.989  1.00 0.00 ? 25  VAL A CG1  4  
ATOM 5682  C CG2  . VAL A 1 25  ? 1.593   0.983   -1.525  1.00 0.00 ? 25  VAL A CG2  4  
ATOM 5683  H H    . VAL A 1 25  ? 4.206   0.049   -1.443  1.00 0.00 ? 25  VAL A H    4  
ATOM 5684  H HA   . VAL A 1 25  ? 2.100   -1.319  -0.003  1.00 0.00 ? 25  VAL A HA   4  
ATOM 5685  H HB   . VAL A 1 25  ? 2.133   -0.529  -2.915  1.00 0.00 ? 25  VAL A HB   4  
ATOM 5686  H HG11 . VAL A 1 25  ? -0.354  -0.486  -2.550  1.00 0.00 ? 25  VAL A HG11 4  
ATOM 5687  H HG12 . VAL A 1 25  ? 0.388   -2.085  -2.471  1.00 0.00 ? 25  VAL A HG12 4  
ATOM 5688  H HG13 . VAL A 1 25  ? -0.067  -1.247  -0.987  1.00 0.00 ? 25  VAL A HG13 4  
ATOM 5689  H HG21 . VAL A 1 25  ? 2.340   1.555   -2.056  1.00 0.00 ? 25  VAL A HG21 4  
ATOM 5690  H HG22 . VAL A 1 25  ? 0.611   1.359   -1.774  1.00 0.00 ? 25  VAL A HG22 4  
ATOM 5691  H HG23 . VAL A 1 25  ? 1.755   1.076   -0.462  1.00 0.00 ? 25  VAL A HG23 4  
ATOM 5692  N N    . GLN A 1 26  ? 2.737   -3.644  -0.618  1.00 0.00 ? 26  GLN A N    4  
ATOM 5693  C CA   . GLN A 1 26  ? 2.941   -5.034  -1.008  1.00 0.00 ? 26  GLN A CA   4  
ATOM 5694  C C    . GLN A 1 26  ? 2.014   -5.961  -0.229  1.00 0.00 ? 26  GLN A C    4  
ATOM 5695  O O    . GLN A 1 26  ? 1.722   -5.720  0.942   1.00 0.00 ? 26  GLN A O    4  
ATOM 5696  C CB   . GLN A 1 26  ? 4.398   -5.440  -0.782  1.00 0.00 ? 26  GLN A CB   4  
ATOM 5697  C CG   . GLN A 1 26  ? 4.877   -5.219  0.645   1.00 0.00 ? 26  GLN A CG   4  
ATOM 5698  C CD   . GLN A 1 26  ? 6.386   -5.294  0.772   1.00 0.00 ? 26  GLN A CD   4  
ATOM 5699  O OE1  . GLN A 1 26  ? 6.980   -6.362  0.626   1.00 0.00 ? 26  GLN A OE1  4  
ATOM 5700  N NE2  . GLN A 1 26  ? 7.014   -4.157  1.045   1.00 0.00 ? 26  GLN A NE2  4  
ATOM 5701  H H    . GLN A 1 26  ? 2.517   -3.438  0.314   1.00 0.00 ? 26  GLN A H    4  
ATOM 5702  H HA   . GLN A 1 26  ? 2.714   -5.120  -2.060  1.00 0.00 ? 26  GLN A HA   4  
ATOM 5703  H HB2  . GLN A 1 26  ? 4.508   -6.489  -1.016  1.00 0.00 ? 26  GLN A HB2  4  
ATOM 5704  H HB3  . GLN A 1 26  ? 5.028   -4.864  -1.443  1.00 0.00 ? 26  GLN A HB3  4  
ATOM 5705  H HG2  . GLN A 1 26  ? 4.552   -4.243  0.972   1.00 0.00 ? 26  GLN A HG2  4  
ATOM 5706  H HG3  . GLN A 1 26  ? 4.438   -5.974  1.279   1.00 0.00 ? 26  GLN A HG3  4  
ATOM 5707  H HE21 . GLN A 1 26  ? 6.476   -3.344  1.149   1.00 0.00 ? 26  GLN A HE21 4  
ATOM 5708  H HE22 . GLN A 1 26  ? 7.989   -4.176  1.134   1.00 0.00 ? 26  GLN A HE22 4  
ATOM 5709  N N    . ALA A 1 27  ? 1.556   -7.022  -0.886  1.00 0.00 ? 27  ALA A N    4  
ATOM 5710  C CA   . ALA A 1 27  ? 0.664   -7.985  -0.253  1.00 0.00 ? 27  ALA A CA   4  
ATOM 5711  C C    . ALA A 1 27  ? 1.336   -9.347  -0.114  1.00 0.00 ? 27  ALA A C    4  
ATOM 5712  O O    . ALA A 1 27  ? 1.802   -9.923  -1.099  1.00 0.00 ? 27  ALA A O    4  
ATOM 5713  C CB   . ALA A 1 27  ? -0.627  -8.109  -1.048  1.00 0.00 ? 27  ALA A CB   4  
ATOM 5714  H H    . ALA A 1 27  ? 1.826   -7.159  -1.817  1.00 0.00 ? 27  ALA A H    4  
ATOM 5715  H HA   . ALA A 1 27  ? 0.418   -7.615  0.733   1.00 0.00 ? 27  ALA A HA   4  
ATOM 5716  H HB1  . ALA A 1 27  ? -1.443  -8.335  -0.375  1.00 0.00 ? 27  ALA A HB1  4  
ATOM 5717  H HB2  . ALA A 1 27  ? -0.826  -7.179  -1.558  1.00 0.00 ? 27  ALA A HB2  4  
ATOM 5718  H HB3  . ALA A 1 27  ? -0.529  -8.904  -1.772  1.00 0.00 ? 27  ALA A HB3  4  
ATOM 5719  N N    . ARG A 1 28  ? 1.385   -9.856  1.112   1.00 0.00 ? 28  ARG A N    4  
ATOM 5720  C CA   . ARG A 1 28  ? 2.001   -11.149 1.379   1.00 0.00 ? 28  ARG A CA   4  
ATOM 5721  C C    . ARG A 1 28  ? 0.980   -12.132 1.945   1.00 0.00 ? 28  ARG A C    4  
ATOM 5722  O O    . ARG A 1 28  ? 0.246   -11.810 2.878   1.00 0.00 ? 28  ARG A O    4  
ATOM 5723  C CB   . ARG A 1 28  ? 3.168   -10.990 2.356   1.00 0.00 ? 28  ARG A CB   4  
ATOM 5724  C CG   . ARG A 1 28  ? 2.838   -10.130 3.564   1.00 0.00 ? 28  ARG A CG   4  
ATOM 5725  C CD   . ARG A 1 28  ? 3.953   -10.169 4.597   1.00 0.00 ? 28  ARG A CD   4  
ATOM 5726  N NE   . ARG A 1 28  ? 5.185   -9.562  4.097   1.00 0.00 ? 28  ARG A NE   4  
ATOM 5727  C CZ   . ARG A 1 28  ? 6.377   -9.763  4.644   1.00 0.00 ? 28  ARG A CZ   4  
ATOM 5728  N NH1  . ARG A 1 28  ? 6.501   -10.551 5.703   1.00 0.00 ? 28  ARG A NH1  4  
ATOM 5729  N NH2  . ARG A 1 28  ? 7.451   -9.177  4.130   1.00 0.00 ? 28  ARG A NH2  4  
ATOM 5730  H H    . ARG A 1 28  ? 0.996   -9.350  1.856   1.00 0.00 ? 28  ARG A H    4  
ATOM 5731  H HA   . ARG A 1 28  ? 2.377   -11.537 0.444   1.00 0.00 ? 28  ARG A HA   4  
ATOM 5732  H HB2  . ARG A 1 28  ? 3.464   -11.968 2.707   1.00 0.00 ? 28  ARG A HB2  4  
ATOM 5733  H HB3  . ARG A 1 28  ? 3.998   -10.538 1.834   1.00 0.00 ? 28  ARG A HB3  4  
ATOM 5734  H HG2  . ARG A 1 28  ? 2.698   -9.110  3.241   1.00 0.00 ? 28  ARG A HG2  4  
ATOM 5735  H HG3  . ARG A 1 28  ? 1.928   -10.496 4.015   1.00 0.00 ? 28  ARG A HG3  4  
ATOM 5736  H HD2  . ARG A 1 28  ? 3.631   -9.632  5.476   1.00 0.00 ? 28  ARG A HD2  4  
ATOM 5737  H HD3  . ARG A 1 28  ? 4.150   -11.199 4.856   1.00 0.00 ? 28  ARG A HD3  4  
ATOM 5738  H HE   . ARG A 1 28  ? 5.116   -8.976  3.314   1.00 0.00 ? 28  ARG A HE   4  
ATOM 5739  H HH11 . ARG A 1 28  ? 5.695   -10.996 6.090   1.00 0.00 ? 28  ARG A HH11 4  
ATOM 5740  H HH12 . ARG A 1 28  ? 7.401   -10.701 6.112   1.00 0.00 ? 28  ARG A HH12 4  
ATOM 5741  H HH21 . ARG A 1 28  ? 7.363   -8.582  3.332   1.00 0.00 ? 28  ARG A HH21 4  
ATOM 5742  H HH22 . ARG A 1 28  ? 8.349   -9.327  4.543   1.00 0.00 ? 28  ARG A HH22 4  
ATOM 5743  N N    . MET A 1 29  ? 0.943   -13.331 1.375   1.00 0.00 ? 29  MET A N    4  
ATOM 5744  C CA   . MET A 1 29  ? 0.013   -14.362 1.823   1.00 0.00 ? 29  MET A CA   4  
ATOM 5745  C C    . MET A 1 29  ? 0.533   -15.054 3.078   1.00 0.00 ? 29  MET A C    4  
ATOM 5746  O O    . MET A 1 29  ? 1.710   -15.409 3.161   1.00 0.00 ? 29  MET A O    4  
ATOM 5747  C CB   . MET A 1 29  ? -0.214  -15.392 0.715   1.00 0.00 ? 29  MET A CB   4  
ATOM 5748  C CG   . MET A 1 29  ? -1.553  -15.243 0.012   1.00 0.00 ? 29  MET A CG   4  
ATOM 5749  S SD   . MET A 1 29  ? -2.953  -15.556 1.105   1.00 0.00 ? 29  MET A SD   4  
ATOM 5750  C CE   . MET A 1 29  ? -3.793  -16.862 0.214   1.00 0.00 ? 29  MET A CE   4  
ATOM 5751  H H    . MET A 1 29  ? 1.554   -13.530 0.635   1.00 0.00 ? 29  MET A H    4  
ATOM 5752  H HA   . MET A 1 29  ? -0.926  -13.882 2.054   1.00 0.00 ? 29  MET A HA   4  
ATOM 5753  H HB2  . MET A 1 29  ? 0.568   -15.289 -0.021  1.00 0.00 ? 29  MET A HB2  4  
ATOM 5754  H HB3  . MET A 1 29  ? -0.168  -16.381 1.144   1.00 0.00 ? 29  MET A HB3  4  
ATOM 5755  H HG2  . MET A 1 29  ? -1.634  -14.236 -0.371  1.00 0.00 ? 29  MET A HG2  4  
ATOM 5756  H HG3  . MET A 1 29  ? -1.593  -15.942 -0.811  1.00 0.00 ? 29  MET A HG3  4  
ATOM 5757  H HE1  . MET A 1 29  ? -4.487  -16.427 -0.492  1.00 0.00 ? 29  MET A HE1  4  
ATOM 5758  H HE2  . MET A 1 29  ? -3.068  -17.460 -0.318  1.00 0.00 ? 29  MET A HE2  4  
ATOM 5759  H HE3  . MET A 1 29  ? -4.332  -17.484 0.911   1.00 0.00 ? 29  MET A HE3  4  
ATOM 5760  N N    . LEU A 1 30  ? -0.349  -15.245 4.053   1.00 0.00 ? 30  LEU A N    4  
ATOM 5761  C CA   . LEU A 1 30  ? 0.022   -15.896 5.305   1.00 0.00 ? 30  LEU A CA   4  
ATOM 5762  C C    . LEU A 1 30  ? -0.760  -17.191 5.498   1.00 0.00 ? 30  LEU A C    4  
ATOM 5763  O O    . LEU A 1 30  ? -0.293  -18.117 6.160   1.00 0.00 ? 30  LEU A O    4  
ATOM 5764  C CB   . LEU A 1 30  ? -0.229  -14.955 6.485   1.00 0.00 ? 30  LEU A CB   4  
ATOM 5765  C CG   . LEU A 1 30  ? 0.178   -13.496 6.278   1.00 0.00 ? 30  LEU A CG   4  
ATOM 5766  C CD1  . LEU A 1 30  ? -0.399  -12.619 7.378   1.00 0.00 ? 30  LEU A CD1  4  
ATOM 5767  C CD2  . LEU A 1 30  ? 1.694   -13.366 6.232   1.00 0.00 ? 30  LEU A CD2  4  
ATOM 5768  H H    . LEU A 1 30  ? -1.272  -14.941 3.929   1.00 0.00 ? 30  LEU A H    4  
ATOM 5769  H HA   . LEU A 1 30  ? 1.074   -16.129 5.258   1.00 0.00 ? 30  LEU A HA   4  
ATOM 5770  H HB2  . LEU A 1 30  ? -1.284  -14.975 6.706   1.00 0.00 ? 30  LEU A HB2  4  
ATOM 5771  H HB3  . LEU A 1 30  ? 0.321   -15.336 7.333   1.00 0.00 ? 30  LEU A HB3  4  
ATOM 5772  H HG   . LEU A 1 30  ? -0.217  -13.148 5.334   1.00 0.00 ? 30  LEU A HG   4  
ATOM 5773  H HD11 . LEU A 1 30  ? -0.081  -12.992 8.340   1.00 0.00 ? 30  LEU A HD11 4  
ATOM 5774  H HD12 . LEU A 1 30  ? -1.477  -12.637 7.324   1.00 0.00 ? 30  LEU A HD12 4  
ATOM 5775  H HD13 . LEU A 1 30  ? -0.050  -11.605 7.251   1.00 0.00 ? 30  LEU A HD13 4  
ATOM 5776  H HD21 . LEU A 1 30  ? 2.038   -12.845 7.113   1.00 0.00 ? 30  LEU A HD21 4  
ATOM 5777  H HD22 . LEU A 1 30  ? 1.981   -12.811 5.351   1.00 0.00 ? 30  LEU A HD22 4  
ATOM 5778  H HD23 . LEU A 1 30  ? 2.139   -14.350 6.200   1.00 0.00 ? 30  LEU A HD23 4  
ATOM 5779  N N    . SER A 1 31  ? -1.952  -17.248 4.914   1.00 0.00 ? 31  SER A N    4  
ATOM 5780  C CA   . SER A 1 31  ? -2.800  -18.431 5.022   1.00 0.00 ? 31  SER A CA   4  
ATOM 5781  C C    . SER A 1 31  ? -3.409  -18.789 3.670   1.00 0.00 ? 31  SER A C    4  
ATOM 5782  O O    . SER A 1 31  ? -3.018  -18.245 2.636   1.00 0.00 ? 31  SER A O    4  
ATOM 5783  C CB   . SER A 1 31  ? -3.913  -18.194 6.046   1.00 0.00 ? 31  SER A CB   4  
ATOM 5784  O OG   . SER A 1 31  ? -4.039  -19.299 6.926   1.00 0.00 ? 31  SER A OG   4  
ATOM 5785  H H    . SER A 1 31  ? -2.270  -16.478 4.398   1.00 0.00 ? 31  SER A H    4  
ATOM 5786  H HA   . SER A 1 31  ? -2.184  -19.252 5.355   1.00 0.00 ? 31  SER A HA   4  
ATOM 5787  H HB2  . SER A 1 31  ? -3.681  -17.313 6.626   1.00 0.00 ? 31  SER A HB2  4  
ATOM 5788  H HB3  . SER A 1 31  ? -4.850  -18.050 5.529   1.00 0.00 ? 31  SER A HB3  4  
ATOM 5789  H HG   . SER A 1 31  ? -4.471  -19.016 7.734   1.00 0.00 ? 31  SER A HG   4  
ATOM 5790  N N    . SER A 1 32  ? -4.368  -19.710 3.683   1.00 0.00 ? 32  SER A N    4  
ATOM 5791  C CA   . SER A 1 32  ? -5.029  -20.145 2.458   1.00 0.00 ? 32  SER A CA   4  
ATOM 5792  C C    . SER A 1 32  ? -6.111  -19.154 2.044   1.00 0.00 ? 32  SER A C    4  
ATOM 5793  O O    . SER A 1 32  ? -6.507  -19.097 0.879   1.00 0.00 ? 32  SER A O    4  
ATOM 5794  C CB   . SER A 1 32  ? -5.638  -21.535 2.649   1.00 0.00 ? 32  SER A CB   4  
ATOM 5795  O OG   . SER A 1 32  ? -4.668  -22.457 3.117   1.00 0.00 ? 32  SER A OG   4  
ATOM 5796  H H    . SER A 1 32  ? -4.636  -20.106 4.539   1.00 0.00 ? 32  SER A H    4  
ATOM 5797  H HA   . SER A 1 32  ? -4.283  -20.192 1.679   1.00 0.00 ? 32  SER A HA   4  
ATOM 5798  H HB2  . SER A 1 32  ? -6.439  -21.479 3.370   1.00 0.00 ? 32  SER A HB2  4  
ATOM 5799  H HB3  . SER A 1 32  ? -6.026  -21.888 1.705   1.00 0.00 ? 32  SER A HB3  4  
ATOM 5800  H HG   . SER A 1 32  ? -5.051  -23.001 3.809   1.00 0.00 ? 32  SER A HG   4  
ATOM 5801  N N    . THR A 1 33  ? -6.591  -18.374 3.008   1.00 0.00 ? 33  THR A N    4  
ATOM 5802  C CA   . THR A 1 33  ? -7.630  -17.386 2.745   1.00 0.00 ? 33  THR A CA   4  
ATOM 5803  C C    . THR A 1 33  ? -7.427  -16.136 3.594   1.00 0.00 ? 33  THR A C    4  
ATOM 5804  O O    . THR A 1 33  ? -8.391  -15.514 4.043   1.00 0.00 ? 33  THR A O    4  
ATOM 5805  C CB   . THR A 1 33  ? -9.032  -17.959 3.022   1.00 0.00 ? 33  THR A CB   4  
ATOM 5806  O OG1  . THR A 1 33  ? -9.039  -18.658 4.271   1.00 0.00 ? 33  THR A OG1  4  
ATOM 5807  C CG2  . THR A 1 33  ? -9.464  -18.900 1.907   1.00 0.00 ? 33  THR A CG2  4  
ATOM 5808  H H    . THR A 1 33  ? -6.237  -18.466 3.917   1.00 0.00 ? 33  THR A H    4  
ATOM 5809  H HA   . THR A 1 33  ? -7.575  -17.114 1.701   1.00 0.00 ? 33  THR A HA   4  
ATOM 5810  H HB   . THR A 1 33  ? -9.736  -17.139 3.075   1.00 0.00 ? 33  THR A HB   4  
ATOM 5811  H HG1  . THR A 1 33  ? -9.921  -18.633 4.649   1.00 0.00 ? 33  THR A HG1  4  
ATOM 5812  H HG21 . THR A 1 33  ? -9.060  -19.884 2.091   1.00 0.00 ? 33  THR A HG21 4  
ATOM 5813  H HG22 . THR A 1 33  ? -9.094  -18.530 0.962   1.00 0.00 ? 33  THR A HG22 4  
ATOM 5814  H HG23 . THR A 1 33  ? -10.541 -18.951 1.877   1.00 0.00 ? 33  THR A HG23 4  
ATOM 5815  N N    . THR A 1 34  ? -6.168  -15.770 3.809   1.00 0.00 ? 34  THR A N    4  
ATOM 5816  C CA   . THR A 1 34  ? -5.838  -14.593 4.605   1.00 0.00 ? 34  THR A CA   4  
ATOM 5817  C C    . THR A 1 34  ? -4.638  -13.855 4.022   1.00 0.00 ? 34  THR A C    4  
ATOM 5818  O O    . THR A 1 34  ? -3.544  -14.411 3.924   1.00 0.00 ? 34  THR A O    4  
ATOM 5819  C CB   . THR A 1 34  ? -5.534  -14.971 6.066   1.00 0.00 ? 34  THR A CB   4  
ATOM 5820  O OG1  . THR A 1 34  ? -6.061  -16.272 6.356   1.00 0.00 ? 34  THR A OG1  4  
ATOM 5821  C CG2  . THR A 1 34  ? -6.133  -13.952 7.024   1.00 0.00 ? 34  THR A CG2  4  
ATOM 5822  H H    . THR A 1 34  ? -5.443  -16.306 3.425   1.00 0.00 ? 34  THR A H    4  
ATOM 5823  H HA   . THR A 1 34  ? -6.694  -13.935 4.595   1.00 0.00 ? 34  THR A HA   4  
ATOM 5824  H HB   . THR A 1 34  ? -4.463  -14.986 6.203   1.00 0.00 ? 34  THR A HB   4  
ATOM 5825  H HG1  . THR A 1 34  ? -7.015  -16.258 6.265   1.00 0.00 ? 34  THR A HG1  4  
ATOM 5826  H HG21 . THR A 1 34  ? -7.150  -13.737 6.731   1.00 0.00 ? 34  THR A HG21 4  
ATOM 5827  H HG22 . THR A 1 34  ? -5.549  -13.044 6.993   1.00 0.00 ? 34  THR A HG22 4  
ATOM 5828  H HG23 . THR A 1 34  ? -6.125  -14.352 8.026   1.00 0.00 ? 34  THR A HG23 4  
ATOM 5829  N N    . ILE A 1 35  ? -4.852  -12.601 3.639   1.00 0.00 ? 35  ILE A N    4  
ATOM 5830  C CA   . ILE A 1 35  ? -3.785  -11.786 3.068   1.00 0.00 ? 35  ILE A CA   4  
ATOM 5831  C C    . ILE A 1 35  ? -3.494  -10.573 3.944   1.00 0.00 ? 35  ILE A C    4  
ATOM 5832  O O    . ILE A 1 35  ? -4.345  -10.131 4.718   1.00 0.00 ? 35  ILE A O    4  
ATOM 5833  C CB   . ILE A 1 35  ? -4.142  -11.307 1.649   1.00 0.00 ? 35  ILE A CB   4  
ATOM 5834  C CG1  . ILE A 1 35  ? -5.380  -10.407 1.686   1.00 0.00 ? 35  ILE A CG1  4  
ATOM 5835  C CG2  . ILE A 1 35  ? -4.374  -12.497 0.730   1.00 0.00 ? 35  ILE A CG2  4  
ATOM 5836  C CD1  . ILE A 1 35  ? -5.679  -9.734  0.365   1.00 0.00 ? 35  ILE A CD1  4  
ATOM 5837  H H    . ILE A 1 35  ? -5.746  -12.215 3.743   1.00 0.00 ? 35  ILE A H    4  
ATOM 5838  H HA   . ILE A 1 35  ? -2.896  -12.395 3.008   1.00 0.00 ? 35  ILE A HA   4  
ATOM 5839  H HB   . ILE A 1 35  ? -3.307  -10.742 1.264   1.00 0.00 ? 35  ILE A HB   4  
ATOM 5840  H HG12 . ILE A 1 35  ? -6.239  -10.999 1.958   1.00 0.00 ? 35  ILE A HG12 4  
ATOM 5841  H HG13 . ILE A 1 35  ? -5.231  -9.635  2.428   1.00 0.00 ? 35  ILE A HG13 4  
ATOM 5842  H HG21 . ILE A 1 35  ? -5.155  -12.259 0.023   1.00 0.00 ? 35  ILE A HG21 4  
ATOM 5843  H HG22 . ILE A 1 35  ? -3.463  -12.721 0.197   1.00 0.00 ? 35  ILE A HG22 4  
ATOM 5844  H HG23 . ILE A 1 35  ? -4.668  -13.353 1.319   1.00 0.00 ? 35  ILE A HG23 4  
ATOM 5845  H HD11 . ILE A 1 35  ? -4.861  -9.905  -0.320  1.00 0.00 ? 35  ILE A HD11 4  
ATOM 5846  H HD12 . ILE A 1 35  ? -6.587  -10.141 -0.049  1.00 0.00 ? 35  ILE A HD12 4  
ATOM 5847  H HD13 . ILE A 1 35  ? -5.797  -8.671  0.522   1.00 0.00 ? 35  ILE A HD13 4  
ATOM 5848  N N    . LEU A 1 36  ? -2.283  -10.036 3.818   1.00 0.00 ? 36  LEU A N    4  
ATOM 5849  C CA   . LEU A 1 36  ? -1.879  -8.872  4.596   1.00 0.00 ? 36  LEU A CA   4  
ATOM 5850  C C    . LEU A 1 36  ? -1.392  -7.749  3.685   1.00 0.00 ? 36  LEU A C    4  
ATOM 5851  O O    . LEU A 1 36  ? -0.454  -7.929  2.909   1.00 0.00 ? 36  LEU A O    4  
ATOM 5852  C CB   . LEU A 1 36  ? -0.776  -9.254  5.587   1.00 0.00 ? 36  LEU A CB   4  
ATOM 5853  C CG   . LEU A 1 36  ? -0.531  -8.269  6.730   1.00 0.00 ? 36  LEU A CG   4  
ATOM 5854  C CD1  . LEU A 1 36  ? -0.137  -9.010  7.998   1.00 0.00 ? 36  LEU A CD1  4  
ATOM 5855  C CD2  . LEU A 1 36  ? 0.541   -7.260  6.345   1.00 0.00 ? 36  LEU A CD2  4  
ATOM 5856  H H    . LEU A 1 36  ? -1.649  -10.432 3.186   1.00 0.00 ? 36  LEU A H    4  
ATOM 5857  H HA   . LEU A 1 36  ? -2.741  -8.523  5.146   1.00 0.00 ? 36  LEU A HA   4  
ATOM 5858  H HB2  . LEU A 1 36  ? -1.040  -10.205 6.021   1.00 0.00 ? 36  LEU A HB2  4  
ATOM 5859  H HB3  . LEU A 1 36  ? 0.145   -9.354  5.031   1.00 0.00 ? 36  LEU A HB3  4  
ATOM 5860  H HG   . LEU A 1 36  ? -1.445  -7.726  6.932   1.00 0.00 ? 36  LEU A HG   4  
ATOM 5861  H HD11 . LEU A 1 36  ? -1.012  -9.469  8.433   1.00 0.00 ? 36  LEU A HD11 4  
ATOM 5862  H HD12 . LEU A 1 36  ? 0.293   -8.315  8.702   1.00 0.00 ? 36  LEU A HD12 4  
ATOM 5863  H HD13 . LEU A 1 36  ? 0.589   -9.773  7.757   1.00 0.00 ? 36  LEU A HD13 4  
ATOM 5864  H HD21 . LEU A 1 36  ? 1.228   -7.133  7.168   1.00 0.00 ? 36  LEU A HD21 4  
ATOM 5865  H HD22 . LEU A 1 36  ? 0.078   -6.312  6.113   1.00 0.00 ? 36  LEU A HD22 4  
ATOM 5866  H HD23 . LEU A 1 36  ? 1.079   -7.619  5.479   1.00 0.00 ? 36  LEU A HD23 4  
ATOM 5867  N N    . VAL A 1 37  ? -2.037  -6.590  3.785   1.00 0.00 ? 37  VAL A N    4  
ATOM 5868  C CA   . VAL A 1 37  ? -1.667  -5.438  2.972   1.00 0.00 ? 37  VAL A CA   4  
ATOM 5869  C C    . VAL A 1 37  ? -1.052  -4.337  3.827   1.00 0.00 ? 37  VAL A C    4  
ATOM 5870  O O    . VAL A 1 37  ? -1.699  -3.801  4.726   1.00 0.00 ? 37  VAL A O    4  
ATOM 5871  C CB   . VAL A 1 37  ? -2.885  -4.869  2.220   1.00 0.00 ? 37  VAL A CB   4  
ATOM 5872  C CG1  . VAL A 1 37  ? -2.451  -3.790  1.239   1.00 0.00 ? 37  VAL A CG1  4  
ATOM 5873  C CG2  . VAL A 1 37  ? -3.637  -5.982  1.504   1.00 0.00 ? 37  VAL A CG2  4  
ATOM 5874  H H    . VAL A 1 37  ? -2.777  -6.509  4.421   1.00 0.00 ? 37  VAL A H    4  
ATOM 5875  H HA   . VAL A 1 37  ? -0.940  -5.763  2.242   1.00 0.00 ? 37  VAL A HA   4  
ATOM 5876  H HB   . VAL A 1 37  ? -3.552  -4.420  2.942   1.00 0.00 ? 37  VAL A HB   4  
ATOM 5877  H HG11 . VAL A 1 37  ? -1.776  -3.106  1.733   1.00 0.00 ? 37  VAL A HG11 4  
ATOM 5878  H HG12 . VAL A 1 37  ? -1.950  -4.249  0.398   1.00 0.00 ? 37  VAL A HG12 4  
ATOM 5879  H HG13 . VAL A 1 37  ? -3.319  -3.251  0.890   1.00 0.00 ? 37  VAL A HG13 4  
ATOM 5880  H HG21 . VAL A 1 37  ? -4.586  -6.144  1.992   1.00 0.00 ? 37  VAL A HG21 4  
ATOM 5881  H HG22 . VAL A 1 37  ? -3.805  -5.697  0.475   1.00 0.00 ? 37  VAL A HG22 4  
ATOM 5882  H HG23 . VAL A 1 37  ? -3.053  -6.889  1.536   1.00 0.00 ? 37  VAL A HG23 4  
ATOM 5883  N N    . GLN A 1 38  ? 0.203   -4.004  3.541   1.00 0.00 ? 38  GLN A N    4  
ATOM 5884  C CA   . GLN A 1 38  ? 0.906   -2.965  4.285   1.00 0.00 ? 38  GLN A CA   4  
ATOM 5885  C C    . GLN A 1 38  ? 1.480   -1.913  3.341   1.00 0.00 ? 38  GLN A C    4  
ATOM 5886  O O    . GLN A 1 38  ? 1.920   -2.230  2.236   1.00 0.00 ? 38  GLN A O    4  
ATOM 5887  C CB   . GLN A 1 38  ? 2.028   -3.580  5.122   1.00 0.00 ? 38  GLN A CB   4  
ATOM 5888  C CG   . GLN A 1 38  ? 2.989   -4.438  4.317   1.00 0.00 ? 38  GLN A CG   4  
ATOM 5889  C CD   . GLN A 1 38  ? 3.867   -5.311  5.192   1.00 0.00 ? 38  GLN A CD   4  
ATOM 5890  O OE1  . GLN A 1 38  ? 4.053   -6.498  4.919   1.00 0.00 ? 38  GLN A OE1  4  
ATOM 5891  N NE2  . GLN A 1 38  ? 4.411   -4.728  6.254   1.00 0.00 ? 38  GLN A NE2  4  
ATOM 5892  H H    . GLN A 1 38  ? 0.665   -4.467  2.813   1.00 0.00 ? 38  GLN A H    4  
ATOM 5893  H HA   . GLN A 1 38  ? 0.196   -2.490  4.943   1.00 0.00 ? 38  GLN A HA   4  
ATOM 5894  H HB2  . GLN A 1 38  ? 2.591   -2.785  5.588   1.00 0.00 ? 38  GLN A HB2  4  
ATOM 5895  H HB3  . GLN A 1 38  ? 1.588   -4.198  5.892   1.00 0.00 ? 38  GLN A HB3  4  
ATOM 5896  H HG2  . GLN A 1 38  ? 2.419   -5.075  3.657   1.00 0.00 ? 38  GLN A HG2  4  
ATOM 5897  H HG3  . GLN A 1 38  ? 3.623   -3.790  3.729   1.00 0.00 ? 38  GLN A HG3  4  
ATOM 5898  H HE21 . GLN A 1 38  ? 4.217   -3.779  6.410   1.00 0.00 ? 38  GLN A HE21 4  
ATOM 5899  H HE22 . GLN A 1 38  ? 4.983   -5.269  6.837   1.00 0.00 ? 38  GLN A HE22 4  
ATOM 5900  N N    . TRP A 1 39  ? 1.470   -0.660  3.782   1.00 0.00 ? 39  TRP A N    4  
ATOM 5901  C CA   . TRP A 1 39  ? 1.988   0.438   2.977   1.00 0.00 ? 39  TRP A CA   4  
ATOM 5902  C C    . TRP A 1 39  ? 2.523   1.558   3.863   1.00 0.00 ? 39  TRP A C    4  
ATOM 5903  O O    . TRP A 1 39  ? 2.410   1.502   5.088   1.00 0.00 ? 39  TRP A O    4  
ATOM 5904  C CB   . TRP A 1 39  ? 0.897   0.980   2.052   1.00 0.00 ? 39  TRP A CB   4  
ATOM 5905  C CG   . TRP A 1 39  ? -0.301  1.501   2.788   1.00 0.00 ? 39  TRP A CG   4  
ATOM 5906  C CD1  . TRP A 1 39  ? -0.478  2.766   3.271   1.00 0.00 ? 39  TRP A CD1  4  
ATOM 5907  C CD2  . TRP A 1 39  ? -1.484  0.770   3.127   1.00 0.00 ? 39  TRP A CD2  4  
ATOM 5908  N NE1  . TRP A 1 39  ? -1.702  2.865   3.890   1.00 0.00 ? 39  TRP A NE1  4  
ATOM 5909  C CE2  . TRP A 1 39  ? -2.339  1.655   3.812   1.00 0.00 ? 39  TRP A CE2  4  
ATOM 5910  C CE3  . TRP A 1 39  ? -1.907  -0.545  2.913   1.00 0.00 ? 39  TRP A CE3  4  
ATOM 5911  C CZ2  . TRP A 1 39  ? -3.588  1.265   4.288   1.00 0.00 ? 39  TRP A CZ2  4  
ATOM 5912  C CZ3  . TRP A 1 39  ? -3.147  -0.931  3.385   1.00 0.00 ? 39  TRP A CZ3  4  
ATOM 5913  C CH2  . TRP A 1 39  ? -3.976  -0.028  4.066   1.00 0.00 ? 39  TRP A CH2  4  
ATOM 5914  H H    . TRP A 1 39  ? 1.105   -0.470  4.673   1.00 0.00 ? 39  TRP A H    4  
ATOM 5915  H HA   . TRP A 1 39  ? 2.799   0.053   2.376   1.00 0.00 ? 39  TRP A HA   4  
ATOM 5916  H HB2  . TRP A 1 39  ? 1.302   1.787   1.461   1.00 0.00 ? 39  TRP A HB2  4  
ATOM 5917  H HB3  . TRP A 1 39  ? 0.566   0.188   1.395   1.00 0.00 ? 39  TRP A HB3  4  
ATOM 5918  H HD1  . TRP A 1 39  ? 0.246   3.560   3.177   1.00 0.00 ? 39  TRP A HD1  4  
ATOM 5919  H HE1  . TRP A 1 39  ? -2.061  3.673   4.315   1.00 0.00 ? 39  TRP A HE1  4  
ATOM 5920  H HE3  . TRP A 1 39  ? -1.282  -1.254  2.390   1.00 0.00 ? 39  TRP A HE3  4  
ATOM 5921  H HZ2  . TRP A 1 39  ? -4.239  1.949   4.813   1.00 0.00 ? 39  TRP A HZ2  4  
ATOM 5922  H HZ3  . TRP A 1 39  ? -3.490  -1.943  3.231   1.00 0.00 ? 39  TRP A HZ3  4  
ATOM 5923  H HH2  . TRP A 1 39  ? -4.936  -0.373  4.417   1.00 0.00 ? 39  TRP A HH2  4  
ATOM 5924  N N    . LYS A 1 40  ? 3.104   2.576   3.238   1.00 0.00 ? 40  LYS A N    4  
ATOM 5925  C CA   . LYS A 1 40  ? 3.654   3.710   3.969   1.00 0.00 ? 40  LYS A CA   4  
ATOM 5926  C C    . LYS A 1 40  ? 2.987   5.012   3.538   1.00 0.00 ? 40  LYS A C    4  
ATOM 5927  O O    . LYS A 1 40  ? 2.201   5.032   2.591   1.00 0.00 ? 40  LYS A O    4  
ATOM 5928  C CB   . LYS A 1 40  ? 5.167   3.803   3.745   1.00 0.00 ? 40  LYS A CB   4  
ATOM 5929  C CG   . LYS A 1 40  ? 5.978   2.992   4.741   1.00 0.00 ? 40  LYS A CG   4  
ATOM 5930  C CD   . LYS A 1 40  ? 7.228   3.739   5.179   1.00 0.00 ? 40  LYS A CD   4  
ATOM 5931  C CE   . LYS A 1 40  ? 7.559   3.463   6.638   1.00 0.00 ? 40  LYS A CE   4  
ATOM 5932  N NZ   . LYS A 1 40  ? 8.974   3.031   6.813   1.00 0.00 ? 40  LYS A NZ   4  
ATOM 5933  H H    . LYS A 1 40  ? 3.163   2.564   2.258   1.00 0.00 ? 40  LYS A H    4  
ATOM 5934  H HA   . LYS A 1 40  ? 3.464   3.553   5.020   1.00 0.00 ? 40  LYS A HA   4  
ATOM 5935  H HB2  . LYS A 1 40  ? 5.393   3.446   2.752   1.00 0.00 ? 40  LYS A HB2  4  
ATOM 5936  H HB3  . LYS A 1 40  ? 5.467   4.837   3.824   1.00 0.00 ? 40  LYS A HB3  4  
ATOM 5937  H HG2  . LYS A 1 40  ? 5.369   2.793   5.610   1.00 0.00 ? 40  LYS A HG2  4  
ATOM 5938  H HG3  . LYS A 1 40  ? 6.270   2.059   4.280   1.00 0.00 ? 40  LYS A HG3  4  
ATOM 5939  H HD2  . LYS A 1 40  ? 8.059   3.421   4.567   1.00 0.00 ? 40  LYS A HD2  4  
ATOM 5940  H HD3  . LYS A 1 40  ? 7.068   4.799   5.049   1.00 0.00 ? 40  LYS A HD3  4  
ATOM 5941  H HE2  . LYS A 1 40  ? 7.395   4.366   7.206   1.00 0.00 ? 40  LYS A HE2  4  
ATOM 5942  H HE3  . LYS A 1 40  ? 6.906   2.684   7.000   1.00 0.00 ? 40  LYS A HE3  4  
ATOM 5943  H HZ1  . LYS A 1 40  ? 9.026   1.995   6.874   1.00 0.00 ? 40  LYS A HZ1  4  
ATOM 5944  H HZ2  . LYS A 1 40  ? 9.365   3.437   7.687   1.00 0.00 ? 40  LYS A HZ2  4  
ATOM 5945  H HZ3  . LYS A 1 40  ? 9.548   3.351   6.008   1.00 0.00 ? 40  LYS A HZ3  4  
ATOM 5946  N N    . GLU A 1 41  ? 3.306   6.096   4.238   1.00 0.00 ? 41  GLU A N    4  
ATOM 5947  C CA   . GLU A 1 41  ? 2.735   7.402   3.925   1.00 0.00 ? 41  GLU A CA   4  
ATOM 5948  C C    . GLU A 1 41  ? 3.276   7.928   2.600   1.00 0.00 ? 41  GLU A C    4  
ATOM 5949  O O    . GLU A 1 41  ? 4.338   7.521   2.127   1.00 0.00 ? 41  GLU A O    4  
ATOM 5950  C CB   . GLU A 1 41  ? 3.042   8.397   5.045   1.00 0.00 ? 41  GLU A CB   4  
ATOM 5951  C CG   . GLU A 1 41  ? 1.831   8.755   5.891   1.00 0.00 ? 41  GLU A CG   4  
ATOM 5952  C CD   . GLU A 1 41  ? 1.905   10.161  6.451   1.00 0.00 ? 41  GLU A CD   4  
ATOM 5953  O OE1  . GLU A 1 41  ? 2.979   10.788  6.343   1.00 0.00 ? 41  GLU A OE1  4  
ATOM 5954  O OE2  . GLU A 1 41  ? 0.887   10.637  6.998   1.00 0.00 ? 41  GLU A OE2  4  
ATOM 5955  H H    . GLU A 1 41  ? 3.939   6.017   4.981   1.00 0.00 ? 41  GLU A H    4  
ATOM 5956  H HA   . GLU A 1 41  ? 1.665   7.285   3.843   1.00 0.00 ? 41  GLU A HA   4  
ATOM 5957  H HB2  . GLU A 1 41  ? 3.795   7.974   5.693   1.00 0.00 ? 41  GLU A HB2  4  
ATOM 5958  H HB3  . GLU A 1 41  ? 3.428   9.306   4.606   1.00 0.00 ? 41  GLU A HB3  4  
ATOM 5959  H HG2  . GLU A 1 41  ? 0.945   8.672   5.280   1.00 0.00 ? 41  GLU A HG2  4  
ATOM 5960  H HG3  . GLU A 1 41  ? 1.765   8.059   6.715   1.00 0.00 ? 41  GLU A HG3  4  
ATOM 5961  N N    . PRO A 1 42  ? 2.529   8.856   1.983   1.00 0.00 ? 42  PRO A N    4  
ATOM 5962  C CA   . PRO A 1 42  ? 2.913   9.458   0.702   1.00 0.00 ? 42  PRO A CA   4  
ATOM 5963  C C    . PRO A 1 42  ? 4.122   10.379  0.834   1.00 0.00 ? 42  PRO A C    4  
ATOM 5964  O O    . PRO A 1 42  ? 4.580   10.660  1.940   1.00 0.00 ? 42  PRO A O    4  
ATOM 5965  C CB   . PRO A 1 42  ? 1.671   10.260  0.301   1.00 0.00 ? 42  PRO A CB   4  
ATOM 5966  C CG   . PRO A 1 42  ? 0.984   10.563  1.588   1.00 0.00 ? 42  PRO A CG   4  
ATOM 5967  C CD   . PRO A 1 42  ? 1.252   9.388   2.487   1.00 0.00 ? 42  PRO A CD   4  
ATOM 5968  H HA   . PRO A 1 42  ? 3.114   8.706   -0.046  1.00 0.00 ? 42  PRO A HA   4  
ATOM 5969  H HB2  . PRO A 1 42  ? 1.972   11.165  -0.209  1.00 0.00 ? 42  PRO A HB2  4  
ATOM 5970  H HB3  . PRO A 1 42  ? 1.047   9.664   -0.348  1.00 0.00 ? 42  PRO A HB3  4  
ATOM 5971  H HG2  . PRO A 1 42  ? 1.392   11.465  2.018   1.00 0.00 ? 42  PRO A HG2  4  
ATOM 5972  H HG3  . PRO A 1 42  ? -0.077  10.672  1.420   1.00 0.00 ? 42  PRO A HG3  4  
ATOM 5973  H HD2  . PRO A 1 42  ? 1.349   9.711   3.513   1.00 0.00 ? 42  PRO A HD2  4  
ATOM 5974  H HD3  . PRO A 1 42  ? 0.465   8.653   2.393   1.00 0.00 ? 42  PRO A HD3  4  
ATOM 5975  N N    . GLU A 1 43  ? 4.632   10.844  -0.302  1.00 0.00 ? 43  GLU A N    4  
ATOM 5976  C CA   . GLU A 1 43  ? 5.788   11.732  -0.311  1.00 0.00 ? 43  GLU A CA   4  
ATOM 5977  C C    . GLU A 1 43  ? 5.351   13.194  -0.270  1.00 0.00 ? 43  GLU A C    4  
ATOM 5978  O O    . GLU A 1 43  ? 6.082   14.057  0.216   1.00 0.00 ? 43  GLU A O    4  
ATOM 5979  C CB   . GLU A 1 43  ? 6.643   11.479  -1.556  1.00 0.00 ? 43  GLU A CB   4  
ATOM 5980  C CG   . GLU A 1 43  ? 7.896   10.666  -1.277  1.00 0.00 ? 43  GLU A CG   4  
ATOM 5981  C CD   . GLU A 1 43  ? 7.634   9.485   -0.363  1.00 0.00 ? 43  GLU A CD   4  
ATOM 5982  O OE1  . GLU A 1 43  ? 6.568   8.850   -0.504  1.00 0.00 ? 43  GLU A OE1  4  
ATOM 5983  O OE2  . GLU A 1 43  ? 8.495   9.196   0.496   1.00 0.00 ? 43  GLU A OE2  4  
ATOM 5984  H H    . GLU A 1 43  ? 4.222   10.583  -1.153  1.00 0.00 ? 43  GLU A H    4  
ATOM 5985  H HA   . GLU A 1 43  ? 6.377   11.520  0.568   1.00 0.00 ? 43  GLU A HA   4  
ATOM 5986  H HB2  . GLU A 1 43  ? 6.048   10.949  -2.285  1.00 0.00 ? 43  GLU A HB2  4  
ATOM 5987  H HB3  . GLU A 1 43  ? 6.942   12.431  -1.972  1.00 0.00 ? 43  GLU A HB3  4  
ATOM 5988  H HG2  . GLU A 1 43  ? 8.286   10.297  -2.214  1.00 0.00 ? 43  GLU A HG2  4  
ATOM 5989  H HG3  . GLU A 1 43  ? 8.630   11.307  -0.811  1.00 0.00 ? 43  GLU A HG3  4  
ATOM 5990  N N    . GLU A 1 44  ? 4.155   13.463  -0.785  1.00 0.00 ? 44  GLU A N    4  
ATOM 5991  C CA   . GLU A 1 44  ? 3.622   14.820  -0.808  1.00 0.00 ? 44  GLU A CA   4  
ATOM 5992  C C    . GLU A 1 44  ? 2.242   14.873  -0.160  1.00 0.00 ? 44  GLU A C    4  
ATOM 5993  O O    . GLU A 1 44  ? 1.218   15.009  -0.832  1.00 0.00 ? 44  GLU A O    4  
ATOM 5994  C CB   . GLU A 1 44  ? 3.544   15.336  -2.246  1.00 0.00 ? 44  GLU A CB   4  
ATOM 5995  C CG   . GLU A 1 44  ? 4.806   15.083  -3.053  1.00 0.00 ? 44  GLU A CG   4  
ATOM 5996  C CD   . GLU A 1 44  ? 5.207   16.276  -3.897  1.00 0.00 ? 44  GLU A CD   4  
ATOM 5997  O OE1  . GLU A 1 44  ? 4.417   16.674  -4.779  1.00 0.00 ? 44  GLU A OE1  4  
ATOM 5998  O OE2  . GLU A 1 44  ? 6.314   16.814  -3.677  1.00 0.00 ? 44  GLU A OE2  4  
ATOM 5999  H H    . GLU A 1 44  ? 3.619   12.732  -1.158  1.00 0.00 ? 44  GLU A H    4  
ATOM 6000  H HA   . GLU A 1 44  ? 4.294   15.450  -0.245  1.00 0.00 ? 44  GLU A HA   4  
ATOM 6001  H HB2  . GLU A 1 44  ? 2.717   14.852  -2.745  1.00 0.00 ? 44  GLU A HB2  4  
ATOM 6002  H HB3  . GLU A 1 44  ? 3.365   16.401  -2.223  1.00 0.00 ? 44  GLU A HB3  4  
ATOM 6003  H HG2  . GLU A 1 44  ? 5.613   14.856  -2.373  1.00 0.00 ? 44  GLU A HG2  4  
ATOM 6004  H HG3  . GLU A 1 44  ? 4.637   14.239  -3.705  1.00 0.00 ? 44  GLU A HG3  4  
ATOM 6005  N N    . PRO A 1 45  ? 2.210   14.762  1.176   1.00 0.00 ? 45  PRO A N    4  
ATOM 6006  C CA   . PRO A 1 45  ? 0.961   14.795  1.943   1.00 0.00 ? 45  PRO A CA   4  
ATOM 6007  C C    . PRO A 1 45  ? 0.226   16.123  1.799   1.00 0.00 ? 45  PRO A C    4  
ATOM 6008  O O    . PRO A 1 45  ? -0.956  16.155  1.461   1.00 0.00 ? 45  PRO A O    4  
ATOM 6009  C CB   . PRO A 1 45  ? 1.427   14.596  3.387   1.00 0.00 ? 45  PRO A CB   4  
ATOM 6010  C CG   . PRO A 1 45  ? 2.869   14.975  3.376   1.00 0.00 ? 45  PRO A CG   4  
ATOM 6011  C CD   . PRO A 1 45  ? 3.391   14.598  2.040   1.00 0.00 ? 45  PRO A CD   4  
ATOM 6012  H HA   . PRO A 1 45  ? 0.301   13.988  1.661   1.00 0.00 ? 45  PRO A HA   4  
ATOM 6013  H HB2  . PRO A 1 45  ? 0.856   15.236  4.045   1.00 0.00 ? 45  PRO A HB2  4  
ATOM 6014  H HB3  . PRO A 1 45  ? 1.293   13.564  3.673   1.00 0.00 ? 45  PRO A HB3  4  
ATOM 6015  H HG2  . PRO A 1 45  ? 2.970   16.034  3.557   1.00 0.00 ? 45  PRO A HG2  4  
ATOM 6016  H HG3  . PRO A 1 45  ? 3.402   14.411  4.126   1.00 0.00 ? 45  PRO A HG3  4  
ATOM 6017  H HD2  . PRO A 1 45  ? 4.151   15.325  1.796   1.00 0.00 ? 45  PRO A HD2  4  
ATOM 6018  H HD3  . PRO A 1 45  ? 3.785   13.596  1.966   1.00 0.00 ? 45  PRO A HD3  4  
ATOM 6019  N N    . ASN A 1 46  ? 0.935   17.218  2.057   1.00 0.00 ? 46  ASN A N    4  
ATOM 6020  C CA   . ASN A 1 46  ? 0.349   18.550  1.955   1.00 0.00 ? 46  ASN A CA   4  
ATOM 6021  C C    . ASN A 1 46  ? -0.771  18.729  2.974   1.00 0.00 ? 46  ASN A C    4  
ATOM 6022  O O    . ASN A 1 46  ? -1.677  19.538  2.780   1.00 0.00 ? 46  ASN A O    4  
ATOM 6023  C CB   . ASN A 1 46  ? -0.187  18.787  0.542   1.00 0.00 ? 46  ASN A CB   4  
ATOM 6024  C CG   . ASN A 1 46  ? 0.801   18.371  -0.530  1.00 0.00 ? 46  ASN A CG   4  
ATOM 6025  O OD1  . ASN A 1 46  ? 1.959   18.790  -0.519  1.00 0.00 ? 46  ASN A OD1  4  
ATOM 6026  N ND2  . ASN A 1 46  ? 0.348   17.540  -1.461  1.00 0.00 ? 46  ASN A ND2  4  
ATOM 6027  H H    . ASN A 1 46  ? 1.875   17.127  2.321   1.00 0.00 ? 46  ASN A H    4  
ATOM 6028  H HA   . ASN A 1 46  ? 1.126   19.270  2.160   1.00 0.00 ? 46  ASN A HA   4  
ATOM 6029  H HB2  . ASN A 1 46  ? -1.096  18.216  0.408   1.00 0.00 ? 46  ASN A HB2  4  
ATOM 6030  H HB3  . ASN A 1 46  ? -0.405  19.837  0.417   1.00 0.00 ? 46  ASN A HB3  4  
ATOM 6031  H HD21 . ASN A 1 46  ? -0.586  17.247  -1.407  1.00 0.00 ? 46  ASN A HD21 4  
ATOM 6032  H HD22 . ASN A 1 46  ? 0.965   17.255  -2.166  1.00 0.00 ? 46  ASN A HD22 4  
ATOM 6033  N N    . GLY A 1 47  ? -0.702  17.968  4.063   1.00 0.00 ? 47  GLY A N    4  
ATOM 6034  C CA   . GLY A 1 47  ? -1.716  18.059  5.097   1.00 0.00 ? 47  GLY A CA   4  
ATOM 6035  C C    . GLY A 1 47  ? -1.776  16.817  5.961   1.00 0.00 ? 47  GLY A C    4  
ATOM 6036  O O    . GLY A 1 47  ? -0.935  15.926  5.837   1.00 0.00 ? 47  GLY A O    4  
ATOM 6037  H H    . GLY A 1 47  ? 0.043   17.341  4.164   1.00 0.00 ? 47  GLY A H    4  
ATOM 6038  H HA2  . GLY A 1 47  ? -1.501  18.912  5.724   1.00 0.00 ? 47  GLY A HA2  4  
ATOM 6039  H HA3  . GLY A 1 47  ? -2.679  18.205  4.629   1.00 0.00 ? 47  GLY A HA3  4  
ATOM 6040  N N    . GLN A 1 48  ? -2.770  16.756  6.841   1.00 0.00 ? 48  GLN A N    4  
ATOM 6041  C CA   . GLN A 1 48  ? -2.933  15.612  7.731   1.00 0.00 ? 48  GLN A CA   4  
ATOM 6042  C C    . GLN A 1 48  ? -3.666  14.476  7.028   1.00 0.00 ? 48  GLN A C    4  
ATOM 6043  O O    . GLN A 1 48  ? -4.620  14.704  6.283   1.00 0.00 ? 48  GLN A O    4  
ATOM 6044  C CB   . GLN A 1 48  ? -3.697  16.025  8.990   1.00 0.00 ? 48  GLN A CB   4  
ATOM 6045  C CG   . GLN A 1 48  ? -5.185  16.227  8.760   1.00 0.00 ? 48  GLN A CG   4  
ATOM 6046  C CD   . GLN A 1 48  ? -5.728  17.448  9.479   1.00 0.00 ? 48  GLN A CD   4  
ATOM 6047  O OE1  . GLN A 1 48  ? -6.030  17.397  10.672  1.00 0.00 ? 48  GLN A OE1  4  
ATOM 6048  N NE2  . GLN A 1 48  ? -5.854  18.554  8.755   1.00 0.00 ? 48  GLN A NE2  4  
ATOM 6049  H H    . GLN A 1 48  ? -3.409  17.496  6.893   1.00 0.00 ? 48  GLN A H    4  
ATOM 6050  H HA   . GLN A 1 48  ? -1.950  15.271  8.015   1.00 0.00 ? 48  GLN A HA   4  
ATOM 6051  H HB2  . GLN A 1 48  ? -3.572  15.260  9.741   1.00 0.00 ? 48  GLN A HB2  4  
ATOM 6052  H HB3  . GLN A 1 48  ? -3.284  16.952  9.360   1.00 0.00 ? 48  GLN A HB3  4  
ATOM 6053  H HG2  . GLN A 1 48  ? -5.361  16.346  7.702   1.00 0.00 ? 48  GLN A HG2  4  
ATOM 6054  H HG3  . GLN A 1 48  ? -5.713  15.354  9.116   1.00 0.00 ? 48  GLN A HG3  4  
ATOM 6055  H HE21 . GLN A 1 48  ? -5.595  18.520  7.810   1.00 0.00 ? 48  GLN A HE21 4  
ATOM 6056  H HE22 . GLN A 1 48  ? -6.203  19.356  9.193   1.00 0.00 ? 48  GLN A HE22 4  
ATOM 6057  N N    . ILE A 1 49  ? -3.215  13.249  7.269   1.00 0.00 ? 49  ILE A N    4  
ATOM 6058  C CA   . ILE A 1 49  ? -3.828  12.076  6.660   1.00 0.00 ? 49  ILE A CA   4  
ATOM 6059  C C    . ILE A 1 49  ? -4.919  11.497  7.555   1.00 0.00 ? 49  ILE A C    4  
ATOM 6060  O O    . ILE A 1 49  ? -4.635  10.962  8.627   1.00 0.00 ? 49  ILE A O    4  
ATOM 6061  C CB   . ILE A 1 49  ? -2.785  10.982  6.369   1.00 0.00 ? 49  ILE A CB   4  
ATOM 6062  C CG1  . ILE A 1 49  ? -1.697  11.518  5.435   1.00 0.00 ? 49  ILE A CG1  4  
ATOM 6063  C CG2  . ILE A 1 49  ? -3.454  9.756   5.764   1.00 0.00 ? 49  ILE A CG2  4  
ATOM 6064  C CD1  . ILE A 1 49  ? -2.211  11.886  4.060   1.00 0.00 ? 49  ILE A CD1  4  
ATOM 6065  H H    . ILE A 1 49  ? -2.452  13.131  7.872   1.00 0.00 ? 49  ILE A H    4  
ATOM 6066  H HA   . ILE A 1 49  ? -4.270  12.381  5.721   1.00 0.00 ? 49  ILE A HA   4  
ATOM 6067  H HB   . ILE A 1 49  ? -2.332  10.689  7.305   1.00 0.00 ? 49  ILE A HB   4  
ATOM 6068  H HG12 . ILE A 1 49  ? -1.259  12.400  5.871   1.00 0.00 ? 49  ILE A HG12 4  
ATOM 6069  H HG13 . ILE A 1 49  ? -0.934  10.764  5.312   1.00 0.00 ? 49  ILE A HG13 4  
ATOM 6070  H HG21 . ILE A 1 49  ? -4.400  10.043  5.329   1.00 0.00 ? 49  ILE A HG21 4  
ATOM 6071  H HG22 . ILE A 1 49  ? -2.817  9.341   4.997   1.00 0.00 ? 49  ILE A HG22 4  
ATOM 6072  H HG23 . ILE A 1 49  ? -3.621  9.019   6.535   1.00 0.00 ? 49  ILE A HG23 4  
ATOM 6073  H HD11 . ILE A 1 49  ? -2.015  12.931  3.871   1.00 0.00 ? 49  ILE A HD11 4  
ATOM 6074  H HD12 . ILE A 1 49  ? -1.714  11.283  3.315   1.00 0.00 ? 49  ILE A HD12 4  
ATOM 6075  H HD13 . ILE A 1 49  ? -3.277  11.708  4.013   1.00 0.00 ? 49  ILE A HD13 4  
ATOM 6076  N N    . GLN A 1 50  ? -6.165  11.608  7.106   1.00 0.00 ? 50  GLN A N    4  
ATOM 6077  C CA   . GLN A 1 50  ? -7.297  11.094  7.867   1.00 0.00 ? 50  GLN A CA   4  
ATOM 6078  C C    . GLN A 1 50  ? -7.369  9.573   7.777   1.00 0.00 ? 50  GLN A C    4  
ATOM 6079  O O    . GLN A 1 50  ? -7.916  8.916   8.661   1.00 0.00 ? 50  GLN A O    4  
ATOM 6080  C CB   . GLN A 1 50  ? -8.602  11.708  7.355   1.00 0.00 ? 50  GLN A CB   4  
ATOM 6081  C CG   . GLN A 1 50  ? -8.560  13.224  7.249   1.00 0.00 ? 50  GLN A CG   4  
ATOM 6082  C CD   . GLN A 1 50  ? -8.492  13.903  8.603   1.00 0.00 ? 50  GLN A CD   4  
ATOM 6083  O OE1  . GLN A 1 50  ? -8.700  13.270  9.638   1.00 0.00 ? 50  GLN A OE1  4  
ATOM 6084  N NE2  . GLN A 1 50  ? -8.199  15.198  8.601   1.00 0.00 ? 50  GLN A NE2  4  
ATOM 6085  H H    . GLN A 1 50  ? -6.325  12.045  6.245   1.00 0.00 ? 50  GLN A H    4  
ATOM 6086  H HA   . GLN A 1 50  ? -7.158  11.376  8.900   1.00 0.00 ? 50  GLN A HA   4  
ATOM 6087  H HB2  . GLN A 1 50  ? -8.817  11.305  6.378   1.00 0.00 ? 50  GLN A HB2  4  
ATOM 6088  H HB3  . GLN A 1 50  ? -9.401  11.439  8.031   1.00 0.00 ? 50  GLN A HB3  4  
ATOM 6089  H HG2  . GLN A 1 50  ? -7.689  13.508  6.677   1.00 0.00 ? 50  GLN A HG2  4  
ATOM 6090  H HG3  . GLN A 1 50  ? -9.450  13.560  6.737   1.00 0.00 ? 50  GLN A HG3  4  
ATOM 6091  H HE21 . GLN A 1 50  ? -8.048  15.637  7.737   1.00 0.00 ? 50  GLN A HE21 4  
ATOM 6092  H HE22 . GLN A 1 50  ? -8.149  15.662  9.462   1.00 0.00 ? 50  GLN A HE22 4  
ATOM 6093  N N    . GLY A 1 51  ? -6.811  9.021   6.705   1.00 0.00 ? 51  GLY A N    4  
ATOM 6094  C CA   . GLY A 1 51  ? -6.823  7.582   6.519   1.00 0.00 ? 51  GLY A CA   4  
ATOM 6095  C C    . GLY A 1 51  ? -6.445  7.175   5.109   1.00 0.00 ? 51  GLY A C    4  
ATOM 6096  O O    . GLY A 1 51  ? -5.937  7.987   4.336   1.00 0.00 ? 51  GLY A O    4  
ATOM 6097  H H    . GLY A 1 51  ? -6.390  9.596   6.032   1.00 0.00 ? 51  GLY A H    4  
ATOM 6098  H HA2  . GLY A 1 51  ? -6.126  7.136   7.212   1.00 0.00 ? 51  GLY A HA2  4  
ATOM 6099  H HA3  . GLY A 1 51  ? -7.815  7.211   6.734   1.00 0.00 ? 51  GLY A HA3  4  
ATOM 6100  N N    . TYR A 1 52  ? -6.690  5.914   4.772   1.00 0.00 ? 52  TYR A N    4  
ATOM 6101  C CA   . TYR A 1 52  ? -6.367  5.399   3.447   1.00 0.00 ? 52  TYR A CA   4  
ATOM 6102  C C    . TYR A 1 52  ? -7.469  4.475   2.939   1.00 0.00 ? 52  TYR A C    4  
ATOM 6103  O O    . TYR A 1 52  ? -8.277  3.966   3.717   1.00 0.00 ? 52  TYR A O    4  
ATOM 6104  C CB   . TYR A 1 52  ? -5.033  4.652   3.479   1.00 0.00 ? 52  TYR A CB   4  
ATOM 6105  C CG   . TYR A 1 52  ? -3.944  5.389   4.223   1.00 0.00 ? 52  TYR A CG   4  
ATOM 6106  C CD1  . TYR A 1 52  ? -3.788  5.239   5.595   1.00 0.00 ? 52  TYR A CD1  4  
ATOM 6107  C CD2  . TYR A 1 52  ? -3.069  6.238   3.554   1.00 0.00 ? 52  TYR A CD2  4  
ATOM 6108  C CE1  . TYR A 1 52  ? -2.795  5.910   6.280   1.00 0.00 ? 52  TYR A CE1  4  
ATOM 6109  C CE2  . TYR A 1 52  ? -2.073  6.912   4.230   1.00 0.00 ? 52  TYR A CE2  4  
ATOM 6110  C CZ   . TYR A 1 52  ? -1.938  6.746   5.592   1.00 0.00 ? 52  TYR A CZ   4  
ATOM 6111  O OH   . TYR A 1 52  ? -0.947  7.417   6.270   1.00 0.00 ? 52  TYR A OH   4  
ATOM 6112  H H    . TYR A 1 52  ? -7.098  5.313   5.433   1.00 0.00 ? 52  TYR A H    4  
ATOM 6113  H HA   . TYR A 1 52  ? -6.281  6.242   2.777   1.00 0.00 ? 52  TYR A HA   4  
ATOM 6114  H HB2  . TYR A 1 52  ? -5.175  3.697   3.960   1.00 0.00 ? 52  TYR A HB2  4  
ATOM 6115  H HB3  . TYR A 1 52  ? -4.694  4.492   2.465   1.00 0.00 ? 52  TYR A HB3  4  
ATOM 6116  H HD1  . TYR A 1 52  ? -4.459  4.584   6.131   1.00 0.00 ? 52  TYR A HD1  4  
ATOM 6117  H HD2  . TYR A 1 52  ? -3.178  6.365   2.487   1.00 0.00 ? 52  TYR A HD2  4  
ATOM 6118  H HE1  . TYR A 1 52  ? -2.689  5.780   7.347   1.00 0.00 ? 52  TYR A HE1  4  
ATOM 6119  H HE2  . TYR A 1 52  ? -1.402  7.567   3.693   1.00 0.00 ? 52  TYR A HE2  4  
ATOM 6120  H HH   . TYR A 1 52  ? -0.096  7.016   6.075   1.00 0.00 ? 52  TYR A HH   4  
ATOM 6121  N N    . ARG A 1 53  ? -7.496  4.263   1.627   1.00 0.00 ? 53  ARG A N    4  
ATOM 6122  C CA   . ARG A 1 53  ? -8.498  3.401   1.013   1.00 0.00 ? 53  ARG A CA   4  
ATOM 6123  C C    . ARG A 1 53  ? -7.837  2.272   0.227   1.00 0.00 ? 53  ARG A C    4  
ATOM 6124  O O    . ARG A 1 53  ? -6.914  2.504   -0.554  1.00 0.00 ? 53  ARG A O    4  
ATOM 6125  C CB   . ARG A 1 53  ? -9.406  4.216   0.090   1.00 0.00 ? 53  ARG A CB   4  
ATOM 6126  C CG   . ARG A 1 53  ? -10.621 4.799   0.793   1.00 0.00 ? 53  ARG A CG   4  
ATOM 6127  C CD   . ARG A 1 53  ? -10.914 6.213   0.313   1.00 0.00 ? 53  ARG A CD   4  
ATOM 6128  N NE   . ARG A 1 53  ? -11.882 6.231   -0.780  1.00 0.00 ? 53  ARG A NE   4  
ATOM 6129  C CZ   . ARG A 1 53  ? -12.107 7.294   -1.545  1.00 0.00 ? 53  ARG A CZ   4  
ATOM 6130  N NH1  . ARG A 1 53  ? -11.438 8.419   -1.337  1.00 0.00 ? 53  ARG A NH1  4  
ATOM 6131  N NH2  . ARG A 1 53  ? -13.004 7.232   -2.521  1.00 0.00 ? 53  ARG A NH2  4  
ATOM 6132  H H    . ARG A 1 53  ? -6.827  4.697   1.059   1.00 0.00 ? 53  ARG A H    4  
ATOM 6133  H HA   . ARG A 1 53  ? -9.096  2.971   1.804   1.00 0.00 ? 53  ARG A HA   4  
ATOM 6134  H HB2  . ARG A 1 53  ? -8.835  5.029   -0.331  1.00 0.00 ? 53  ARG A HB2  4  
ATOM 6135  H HB3  . ARG A 1 53  ? -9.752  3.578   -0.709  1.00 0.00 ? 53  ARG A HB3  4  
ATOM 6136  H HG2  . ARG A 1 53  ? -11.479 4.177   0.586   1.00 0.00 ? 53  ARG A HG2  4  
ATOM 6137  H HG3  . ARG A 1 53  ? -10.436 4.820   1.856   1.00 0.00 ? 53  ARG A HG3  4  
ATOM 6138  H HD2  . ARG A 1 53  ? -11.310 6.785   1.140   1.00 0.00 ? 53  ARG A HD2  4  
ATOM 6139  H HD3  . ARG A 1 53  ? -9.994  6.663   -0.026  1.00 0.00 ? 53  ARG A HD3  4  
ATOM 6140  H HE   . ARG A 1 53  ? -12.389 5.409   -0.952  1.00 0.00 ? 53  ARG A HE   4  
ATOM 6141  H HH11 . ARG A 1 53  ? -10.761 8.467   -0.601  1.00 0.00 ? 53  ARG A HH11 4  
ATOM 6142  H HH12 . ARG A 1 53  ? -11.608 9.218   -1.914  1.00 0.00 ? 53  ARG A HH12 4  
ATOM 6143  H HH21 . ARG A 1 53  ? -13.511 6.385   -2.682  1.00 0.00 ? 53  ARG A HH21 4  
ATOM 6144  H HH22 . ARG A 1 53  ? -13.173 8.032   -3.096  1.00 0.00 ? 53  ARG A HH22 4  
ATOM 6145  N N    . VAL A 1 54  ? -8.316  1.051   0.438   1.00 0.00 ? 54  VAL A N    4  
ATOM 6146  C CA   . VAL A 1 54  ? -7.772  -0.113  -0.250  1.00 0.00 ? 54  VAL A CA   4  
ATOM 6147  C C    . VAL A 1 54  ? -8.815  -0.750  -1.163  1.00 0.00 ? 54  VAL A C    4  
ATOM 6148  O O    . VAL A 1 54  ? -9.893  -1.138  -0.713  1.00 0.00 ? 54  VAL A O    4  
ATOM 6149  C CB   . VAL A 1 54  ? -7.266  -1.171  0.748   1.00 0.00 ? 54  VAL A CB   4  
ATOM 6150  C CG1  . VAL A 1 54  ? -6.610  -2.330  0.012   1.00 0.00 ? 54  VAL A CG1  4  
ATOM 6151  C CG2  . VAL A 1 54  ? -6.297  -0.546  1.741   1.00 0.00 ? 54  VAL A CG2  4  
ATOM 6152  H H    . VAL A 1 54  ? -9.053  0.930   1.072   1.00 0.00 ? 54  VAL A H    4  
ATOM 6153  H HA   . VAL A 1 54  ? -6.936  0.215   -0.851  1.00 0.00 ? 54  VAL A HA   4  
ATOM 6154  H HB   . VAL A 1 54  ? -8.114  -1.554  1.296   1.00 0.00 ? 54  VAL A HB   4  
ATOM 6155  H HG11 . VAL A 1 54  ? -6.393  -3.124  0.712   1.00 0.00 ? 54  VAL A HG11 4  
ATOM 6156  H HG12 . VAL A 1 54  ? -7.282  -2.698  -0.751  1.00 0.00 ? 54  VAL A HG12 4  
ATOM 6157  H HG13 . VAL A 1 54  ? -5.694  -1.994  -0.447  1.00 0.00 ? 54  VAL A HG13 4  
ATOM 6158  H HG21 . VAL A 1 54  ? -5.450  -1.200  1.878   1.00 0.00 ? 54  VAL A HG21 4  
ATOM 6159  H HG22 . VAL A 1 54  ? -5.958  0.409   1.362   1.00 0.00 ? 54  VAL A HG22 4  
ATOM 6160  H HG23 . VAL A 1 54  ? -6.796  -0.398  2.687   1.00 0.00 ? 54  VAL A HG23 4  
ATOM 6161  N N    . TYR A 1 55  ? -8.487  -0.853  -2.446  1.00 0.00 ? 55  TYR A N    4  
ATOM 6162  C CA   . TYR A 1 55  ? -9.395  -1.441  -3.422  1.00 0.00 ? 55  TYR A CA   4  
ATOM 6163  C C    . TYR A 1 55  ? -9.000  -2.880  -3.739  1.00 0.00 ? 55  TYR A C    4  
ATOM 6164  O O    . TYR A 1 55  ? -7.922  -3.135  -4.276  1.00 0.00 ? 55  TYR A O    4  
ATOM 6165  C CB   . TYR A 1 55  ? -9.407  -0.609  -4.705  1.00 0.00 ? 55  TYR A CB   4  
ATOM 6166  C CG   . TYR A 1 55  ? -10.002 0.770   -4.528  1.00 0.00 ? 55  TYR A CG   4  
ATOM 6167  C CD1  . TYR A 1 55  ? -9.345  1.741   -3.783  1.00 0.00 ? 55  TYR A CD1  4  
ATOM 6168  C CD2  . TYR A 1 55  ? -11.220 1.103   -5.107  1.00 0.00 ? 55  TYR A CD2  4  
ATOM 6169  C CE1  . TYR A 1 55  ? -9.884  3.002   -3.619  1.00 0.00 ? 55  TYR A CE1  4  
ATOM 6170  C CE2  . TYR A 1 55  ? -11.768 2.361   -4.948  1.00 0.00 ? 55  TYR A CE2  4  
ATOM 6171  C CZ   . TYR A 1 55  ? -11.096 3.307   -4.202  1.00 0.00 ? 55  TYR A CZ   4  
ATOM 6172  O OH   . TYR A 1 55  ? -11.636 4.563   -4.042  1.00 0.00 ? 55  TYR A OH   4  
ATOM 6173  H H    . TYR A 1 55  ? -7.613  -0.525  -2.744  1.00 0.00 ? 55  TYR A H    4  
ATOM 6174  H HA   . TYR A 1 55  ? -10.389 -1.439  -2.995  1.00 0.00 ? 55  TYR A HA   4  
ATOM 6175  H HB2  . TYR A 1 55  ? -8.394  -0.490  -5.058  1.00 0.00 ? 55  TYR A HB2  4  
ATOM 6176  H HB3  . TYR A 1 55  ? -9.986  -1.126  -5.457  1.00 0.00 ? 55  TYR A HB3  4  
ATOM 6177  H HD1  . TYR A 1 55  ? -8.396  1.499   -3.326  1.00 0.00 ? 55  TYR A HD1  4  
ATOM 6178  H HD2  . TYR A 1 55  ? -11.744 0.359   -5.691  1.00 0.00 ? 55  TYR A HD2  4  
ATOM 6179  H HE1  . TYR A 1 55  ? -9.359  3.743   -3.034  1.00 0.00 ? 55  TYR A HE1  4  
ATOM 6180  H HE2  . TYR A 1 55  ? -12.717 2.600   -5.407  1.00 0.00 ? 55  TYR A HE2  4  
ATOM 6181  H HH   . TYR A 1 55  ? -11.065 5.213   -4.456  1.00 0.00 ? 55  TYR A HH   4  
ATOM 6182  N N    . TYR A 1 56  ? -9.880  -3.816  -3.402  1.00 0.00 ? 56  TYR A N    4  
ATOM 6183  C CA   . TYR A 1 56  ? -9.622  -5.231  -3.648  1.00 0.00 ? 56  TYR A CA   4  
ATOM 6184  C C    . TYR A 1 56  ? -10.915 -5.970  -3.976  1.00 0.00 ? 56  TYR A C    4  
ATOM 6185  O O    . TYR A 1 56  ? -11.912 -5.849  -3.262  1.00 0.00 ? 56  TYR A O    4  
ATOM 6186  C CB   . TYR A 1 56  ? -8.952  -5.868  -2.430  1.00 0.00 ? 56  TYR A CB   4  
ATOM 6187  C CG   . TYR A 1 56  ? -9.847  -5.938  -1.213  1.00 0.00 ? 56  TYR A CG   4  
ATOM 6188  C CD1  . TYR A 1 56  ? -9.961  -4.857  -0.348  1.00 0.00 ? 56  TYR A CD1  4  
ATOM 6189  C CD2  . TYR A 1 56  ? -10.577 -7.084  -0.930  1.00 0.00 ? 56  TYR A CD2  4  
ATOM 6190  C CE1  . TYR A 1 56  ? -10.777 -4.917  0.765   1.00 0.00 ? 56  TYR A CE1  4  
ATOM 6191  C CE2  . TYR A 1 56  ? -11.397 -7.153  0.180   1.00 0.00 ? 56  TYR A CE2  4  
ATOM 6192  C CZ   . TYR A 1 56  ? -11.493 -6.066  1.026   1.00 0.00 ? 56  TYR A CZ   4  
ATOM 6193  O OH   . TYR A 1 56  ? -12.307 -6.130  2.133   1.00 0.00 ? 56  TYR A OH   4  
ATOM 6194  H H    . TYR A 1 56  ? -10.721 -3.551  -2.976  1.00 0.00 ? 56  TYR A H    4  
ATOM 6195  H HA   . TYR A 1 56  ? -8.955  -5.304  -4.493  1.00 0.00 ? 56  TYR A HA   4  
ATOM 6196  H HB2  . TYR A 1 56  ? -8.652  -6.873  -2.678  1.00 0.00 ? 56  TYR A HB2  4  
ATOM 6197  H HB3  . TYR A 1 56  ? -8.077  -5.291  -2.166  1.00 0.00 ? 56  TYR A HB3  4  
ATOM 6198  H HD1  . TYR A 1 56  ? -9.399  -3.957  -0.555  1.00 0.00 ? 56  TYR A HD1  4  
ATOM 6199  H HD2  . TYR A 1 56  ? -10.500 -7.934  -1.593  1.00 0.00 ? 56  TYR A HD2  4  
ATOM 6200  H HE1  . TYR A 1 56  ? -10.852 -4.067  1.426   1.00 0.00 ? 56  TYR A HE1  4  
ATOM 6201  H HE2  . TYR A 1 56  ? -11.957 -8.054  0.384   1.00 0.00 ? 56  TYR A HE2  4  
ATOM 6202  H HH   . TYR A 1 56  ? -12.218 -6.992  2.546   1.00 0.00 ? 56  TYR A HH   4  
ATOM 6203  N N    . THR A 1 57  ? -10.891 -6.739  -5.060  1.00 0.00 ? 57  THR A N    4  
ATOM 6204  C CA   . THR A 1 57  ? -12.060 -7.499  -5.484  1.00 0.00 ? 57  THR A CA   4  
ATOM 6205  C C    . THR A 1 57  ? -11.668 -8.632  -6.426  1.00 0.00 ? 57  THR A C    4  
ATOM 6206  O O    . THR A 1 57  ? -10.602 -8.599  -7.040  1.00 0.00 ? 57  THR A O    4  
ATOM 6207  C CB   . THR A 1 57  ? -13.092 -6.596  -6.187  1.00 0.00 ? 57  THR A CB   4  
ATOM 6208  O OG1  . THR A 1 57  ? -14.330 -7.300  -6.344  1.00 0.00 ? 57  THR A OG1  4  
ATOM 6209  C CG2  . THR A 1 57  ? -12.582 -6.147  -7.548  1.00 0.00 ? 57  THR A CG2  4  
ATOM 6210  H H    . THR A 1 57  ? -10.068 -6.794  -5.587  1.00 0.00 ? 57  THR A H    4  
ATOM 6211  H HA   . THR A 1 57  ? -12.521 -7.920  -4.603  1.00 0.00 ? 57  THR A HA   4  
ATOM 6212  H HB   . THR A 1 57  ? -13.259 -5.721  -5.574  1.00 0.00 ? 57  THR A HB   4  
ATOM 6213  H HG1  . THR A 1 57  ? -15.025 -6.833  -5.873  1.00 0.00 ? 57  THR A HG1  4  
ATOM 6214  H HG21 . THR A 1 57  ? -12.459 -7.008  -8.188  1.00 0.00 ? 57  THR A HG21 4  
ATOM 6215  H HG22 . THR A 1 57  ? -11.631 -5.649  -7.428  1.00 0.00 ? 57  THR A HG22 4  
ATOM 6216  H HG23 . THR A 1 57  ? -13.292 -5.467  -7.991  1.00 0.00 ? 57  THR A HG23 4  
ATOM 6217  N N    . MET A 1 58  ? -12.536 -9.632  -6.535  1.00 0.00 ? 58  MET A N    4  
ATOM 6218  C CA   . MET A 1 58  ? -12.279 -10.773 -7.406  1.00 0.00 ? 58  MET A CA   4  
ATOM 6219  C C    . MET A 1 58  ? -12.742 -10.487 -8.830  1.00 0.00 ? 58  MET A C    4  
ATOM 6220  O O    . MET A 1 58  ? -12.339 -11.170 -9.772  1.00 0.00 ? 58  MET A O    4  
ATOM 6221  C CB   . MET A 1 58  ? -12.987 -12.020 -6.869  1.00 0.00 ? 58  MET A CB   4  
ATOM 6222  C CG   . MET A 1 58  ? -14.503 -11.902 -6.863  1.00 0.00 ? 58  MET A CG   4  
ATOM 6223  S SD   . MET A 1 58  ? -15.324 -13.506 -6.795  1.00 0.00 ? 58  MET A SD   4  
ATOM 6224  C CE   . MET A 1 58  ? -14.378 -14.317 -5.508  1.00 0.00 ? 58  MET A CE   4  
ATOM 6225  H H    . MET A 1 58  ? -13.370 -9.601  -6.021  1.00 0.00 ? 58  MET A H    4  
ATOM 6226  H HA   . MET A 1 58  ? -11.214 -10.951 -7.413  1.00 0.00 ? 58  MET A HA   4  
ATOM 6227  H HB2  . MET A 1 58  ? -12.715 -12.866 -7.482  1.00 0.00 ? 58  MET A HB2  4  
ATOM 6228  H HB3  . MET A 1 58  ? -12.658 -12.198 -5.856  1.00 0.00 ? 58  MET A HB3  4  
ATOM 6229  H HG2  . MET A 1 58  ? -14.802 -11.325 -6.000  1.00 0.00 ? 58  MET A HG2  4  
ATOM 6230  H HG3  . MET A 1 58  ? -14.815 -11.390 -7.761  1.00 0.00 ? 58  MET A HG3  4  
ATOM 6231  H HE1  . MET A 1 58  ? -14.833 -15.267 -5.272  1.00 0.00 ? 58  MET A HE1  4  
ATOM 6232  H HE2  . MET A 1 58  ? -13.367 -14.476 -5.852  1.00 0.00 ? 58  MET A HE2  4  
ATOM 6233  H HE3  . MET A 1 58  ? -14.365 -13.694 -4.625  1.00 0.00 ? 58  MET A HE3  4  
ATOM 6234  N N    . ASP A 1 59  ? -13.587 -9.474  -8.980  1.00 0.00 ? 59  ASP A N    4  
ATOM 6235  C CA   . ASP A 1 59  ? -14.102 -9.095  -10.291 1.00 0.00 ? 59  ASP A CA   4  
ATOM 6236  C C    . ASP A 1 59  ? -13.564 -7.732  -10.715 1.00 0.00 ? 59  ASP A C    4  
ATOM 6237  O O    . ASP A 1 59  ? -14.250 -6.714  -10.632 1.00 0.00 ? 59  ASP A O    4  
ATOM 6238  C CB   . ASP A 1 59  ? -15.633 -9.071  -10.273 1.00 0.00 ? 59  ASP A CB   4  
ATOM 6239  C CG   . ASP A 1 59  ? -16.233 -10.461 -10.215 1.00 0.00 ? 59  ASP A CG   4  
ATOM 6240  O OD1  . ASP A 1 59  ? -15.459 -11.440 -10.187 1.00 0.00 ? 59  ASP A OD1  4  
ATOM 6241  O OD2  . ASP A 1 59  ? -17.478 -10.569 -10.201 1.00 0.00 ? 59  ASP A OD2  4  
ATOM 6242  H H    . ASP A 1 59  ? -13.871 -8.966  -8.190  1.00 0.00 ? 59  ASP A H    4  
ATOM 6243  H HA   . ASP A 1 59  ? -13.773 -9.836  -11.003 1.00 0.00 ? 59  ASP A HA   4  
ATOM 6244  H HB2  . ASP A 1 59  ? -15.966 -8.518  -9.407  1.00 0.00 ? 59  ASP A HB2  4  
ATOM 6245  H HB3  . ASP A 1 59  ? -15.988 -8.580  -11.168 1.00 0.00 ? 59  ASP A HB3  4  
ATOM 6246  N N    . PRO A 1 60  ? -12.306 -7.711  -11.179 1.00 0.00 ? 60  PRO A N    4  
ATOM 6247  C CA   . PRO A 1 60  ? -11.647 -6.479  -11.625 1.00 0.00 ? 60  PRO A CA   4  
ATOM 6248  C C    . PRO A 1 60  ? -12.239 -5.942  -12.923 1.00 0.00 ? 60  PRO A C    4  
ATOM 6249  O O    . PRO A 1 60  ? -11.913 -4.836  -13.355 1.00 0.00 ? 60  PRO A O    4  
ATOM 6250  C CB   . PRO A 1 60  ? -10.194 -6.912  -11.839 1.00 0.00 ? 60  PRO A CB   4  
ATOM 6251  C CG   . PRO A 1 60  ? -10.271 -8.374  -12.113 1.00 0.00 ? 60  PRO A CG   4  
ATOM 6252  C CD   . PRO A 1 60  ? -11.430 -8.888  -11.305 1.00 0.00 ? 60  PRO A CD   4  
ATOM 6253  H HA   . PRO A 1 60  ? -11.689 -5.712  -10.866 1.00 0.00 ? 60  PRO A HA   4  
ATOM 6254  H HB2  . PRO A 1 60  ? -9.775  -6.372  -12.675 1.00 0.00 ? 60  PRO A HB2  4  
ATOM 6255  H HB3  . PRO A 1 60  ? -9.619  -6.708  -10.948 1.00 0.00 ? 60  PRO A HB3  4  
ATOM 6256  H HG2  . PRO A 1 60  ? -10.444 -8.541  -13.166 1.00 0.00 ? 60  PRO A HG2  4  
ATOM 6257  H HG3  . PRO A 1 60  ? -9.355  -8.854  -11.802 1.00 0.00 ? 60  PRO A HG3  4  
ATOM 6258  H HD2  . PRO A 1 60  ? -11.932 -9.687  -11.830 1.00 0.00 ? 60  PRO A HD2  4  
ATOM 6259  H HD3  . PRO A 1 60  ? -11.094 -9.224  -10.335 1.00 0.00 ? 60  PRO A HD3  4  
ATOM 6260  N N    . THR A 1 61  ? -13.112 -6.732  -13.542 1.00 0.00 ? 61  THR A N    4  
ATOM 6261  C CA   . THR A 1 61  ? -13.749 -6.336  -14.790 1.00 0.00 ? 61  THR A CA   4  
ATOM 6262  C C    . THR A 1 61  ? -14.709 -5.173  -14.574 1.00 0.00 ? 61  THR A C    4  
ATOM 6263  O O    . THR A 1 61  ? -15.169 -4.549  -15.530 1.00 0.00 ? 61  THR A O    4  
ATOM 6264  C CB   . THR A 1 61  ? -14.518 -7.510  -15.426 1.00 0.00 ? 61  THR A CB   4  
ATOM 6265  O OG1  . THR A 1 61  ? -15.016 -7.129  -16.714 1.00 0.00 ? 61  THR A OG1  4  
ATOM 6266  C CG2  . THR A 1 61  ? -15.676 -7.942  -14.537 1.00 0.00 ? 61  THR A CG2  4  
ATOM 6267  H H    . THR A 1 61  ? -13.331 -7.602  -13.147 1.00 0.00 ? 61  THR A H    4  
ATOM 6268  H HA   . THR A 1 61  ? -12.974 -6.028  -15.477 1.00 0.00 ? 61  THR A HA   4  
ATOM 6269  H HB   . THR A 1 61  ? -13.841 -8.344  -15.542 1.00 0.00 ? 61  THR A HB   4  
ATOM 6270  H HG1  . THR A 1 61  ? -14.364 -7.342  -17.384 1.00 0.00 ? 61  THR A HG1  4  
ATOM 6271  H HG21 . THR A 1 61  ? -16.375 -7.126  -14.433 1.00 0.00 ? 61  THR A HG21 4  
ATOM 6272  H HG22 . THR A 1 61  ? -15.297 -8.220  -13.564 1.00 0.00 ? 61  THR A HG22 4  
ATOM 6273  H HG23 . THR A 1 61  ? -16.174 -8.789  -14.983 1.00 0.00 ? 61  THR A HG23 4  
ATOM 6274  N N    . GLN A 1 62  ? -15.006 -4.884  -13.310 1.00 0.00 ? 62  GLN A N    4  
ATOM 6275  C CA   . GLN A 1 62  ? -15.913 -3.793  -12.969 1.00 0.00 ? 62  GLN A CA   4  
ATOM 6276  C C    . GLN A 1 62  ? -15.135 -2.550  -12.554 1.00 0.00 ? 62  GLN A C    4  
ATOM 6277  O O    . GLN A 1 62  ? -13.939 -2.618  -12.270 1.00 0.00 ? 62  GLN A O    4  
ATOM 6278  C CB   . GLN A 1 62  ? -16.855 -4.220  -11.843 1.00 0.00 ? 62  GLN A CB   4  
ATOM 6279  C CG   . GLN A 1 62  ? -17.384 -5.637  -11.994 1.00 0.00 ? 62  GLN A CG   4  
ATOM 6280  C CD   . GLN A 1 62  ? -18.877 -5.731  -11.754 1.00 0.00 ? 62  GLN A CD   4  
ATOM 6281  O OE1  . GLN A 1 62  ? -19.671 -5.106  -12.458 1.00 0.00 ? 62  GLN A OE1  4  
ATOM 6282  N NE2  . GLN A 1 62  ? -19.269 -6.518  -10.758 1.00 0.00 ? 62  GLN A NE2  4  
ATOM 6283  H H    . GLN A 1 62  ? -14.609 -5.417  -12.593 1.00 0.00 ? 62  GLN A H    4  
ATOM 6284  H HA   . GLN A 1 62  ? -16.497 -3.562  -13.846 1.00 0.00 ? 62  GLN A HA   4  
ATOM 6285  H HB2  . GLN A 1 62  ? -16.327 -4.154  -10.903 1.00 0.00 ? 62  GLN A HB2  4  
ATOM 6286  H HB3  . GLN A 1 62  ? -17.699 -3.546  -11.821 1.00 0.00 ? 62  GLN A HB3  4  
ATOM 6287  H HG2  . GLN A 1 62  ? -17.173 -5.981  -12.996 1.00 0.00 ? 62  GLN A HG2  4  
ATOM 6288  H HG3  . GLN A 1 62  ? -16.878 -6.273  -11.283 1.00 0.00 ? 62  GLN A HG3  4  
ATOM 6289  H HE21 . GLN A 1 62  ? -18.580 -6.984  -10.238 1.00 0.00 ? 62  GLN A HE21 4  
ATOM 6290  H HE22 . GLN A 1 62  ? -20.229 -6.596  -10.580 1.00 0.00 ? 62  GLN A HE22 4  
ATOM 6291  N N    . HIS A 1 63  ? -15.821 -1.412  -12.523 1.00 0.00 ? 63  HIS A N    4  
ATOM 6292  C CA   . HIS A 1 63  ? -15.194 -0.151  -12.142 1.00 0.00 ? 63  HIS A CA   4  
ATOM 6293  C C    . HIS A 1 63  ? -14.612 -0.237  -10.734 1.00 0.00 ? 63  HIS A C    4  
ATOM 6294  O O    . HIS A 1 63  ? -15.224 -0.807  -9.831  1.00 0.00 ? 63  HIS A O    4  
ATOM 6295  C CB   . HIS A 1 63  ? -16.208 0.991   -12.218 1.00 0.00 ? 63  HIS A CB   4  
ATOM 6296  C CG   . HIS A 1 63  ? -15.633 2.267   -12.752 1.00 0.00 ? 63  HIS A CG   4  
ATOM 6297  N ND1  . HIS A 1 63  ? -14.512 2.867   -12.222 1.00 0.00 ? 63  HIS A ND1  4  
ATOM 6298  C CD2  . HIS A 1 63  ? -16.032 3.056   -13.776 1.00 0.00 ? 63  HIS A CD2  4  
ATOM 6299  C CE1  . HIS A 1 63  ? -14.245 3.971   -12.896 1.00 0.00 ? 63  HIS A CE1  4  
ATOM 6300  N NE2  . HIS A 1 63  ? -15.154 4.110   -13.845 1.00 0.00 ? 63  HIS A NE2  4  
ATOM 6301  H H    . HIS A 1 63  ? -16.771 -1.421  -12.760 1.00 0.00 ? 63  HIS A H    4  
ATOM 6302  H HA   . HIS A 1 63  ? -14.393 0.044   -12.837 1.00 0.00 ? 63  HIS A HA   4  
ATOM 6303  H HB2  . HIS A 1 63  ? -17.022 0.697   -12.865 1.00 0.00 ? 63  HIS A HB2  4  
ATOM 6304  H HB3  . HIS A 1 63  ? -16.594 1.188   -11.229 1.00 0.00 ? 63  HIS A HB3  4  
ATOM 6305  H HD2  . HIS A 1 63  ? -16.885 2.891   -14.422 1.00 0.00 ? 63  HIS A HD2  4  
ATOM 6306  H HE1  . HIS A 1 63  ? -13.426 4.648   -12.705 1.00 0.00 ? 63  HIS A HE1  4  
ATOM 6307  H HE2  . HIS A 1 63  ? -15.240 4.888   -14.434 1.00 0.00 ? 63  HIS A HE2  4  
ATOM 6308  N N    . VAL A 1 64  ? -13.424 0.333   -10.554 1.00 0.00 ? 64  VAL A N    4  
ATOM 6309  C CA   . VAL A 1 64  ? -12.760 0.321   -9.257  1.00 0.00 ? 64  VAL A CA   4  
ATOM 6310  C C    . VAL A 1 64  ? -13.671 0.876   -8.167  1.00 0.00 ? 64  VAL A C    4  
ATOM 6311  O O    . VAL A 1 64  ? -13.618 0.441   -7.017  1.00 0.00 ? 64  VAL A O    4  
ATOM 6312  C CB   . VAL A 1 64  ? -11.457 1.142   -9.286  1.00 0.00 ? 64  VAL A CB   4  
ATOM 6313  C CG1  . VAL A 1 64  ? -10.488 0.569   -10.309 1.00 0.00 ? 64  VAL A CG1  4  
ATOM 6314  C CG2  . VAL A 1 64  ? -11.754 2.604   -9.582  1.00 0.00 ? 64  VAL A CG2  4  
ATOM 6315  H H    . VAL A 1 64  ? -12.986 0.773   -11.311 1.00 0.00 ? 64  VAL A H    4  
ATOM 6316  H HA   . VAL A 1 64  ? -12.511 -0.703  -9.018  1.00 0.00 ? 64  VAL A HA   4  
ATOM 6317  H HB   . VAL A 1 64  ? -10.995 1.080   -8.312  1.00 0.00 ? 64  VAL A HB   4  
ATOM 6318  H HG11 . VAL A 1 64  ? -10.895 0.699   -11.302 1.00 0.00 ? 64  VAL A HG11 4  
ATOM 6319  H HG12 . VAL A 1 64  ? -9.541  1.083   -10.238 1.00 0.00 ? 64  VAL A HG12 4  
ATOM 6320  H HG13 . VAL A 1 64  ? -10.342 -0.485  -10.117 1.00 0.00 ? 64  VAL A HG13 4  
ATOM 6321  H HG21 . VAL A 1 64  ? -12.725 2.686   -10.045 1.00 0.00 ? 64  VAL A HG21 4  
ATOM 6322  H HG22 . VAL A 1 64  ? -11.746 3.167   -8.660  1.00 0.00 ? 64  VAL A HG22 4  
ATOM 6323  H HG23 . VAL A 1 64  ? -11.002 2.997   -10.249 1.00 0.00 ? 64  VAL A HG23 4  
ATOM 6324  N N    . ASN A 1 65  ? -14.509 1.839   -8.536  1.00 0.00 ? 65  ASN A N    4  
ATOM 6325  C CA   . ASN A 1 65  ? -15.433 2.454   -7.592  1.00 0.00 ? 65  ASN A CA   4  
ATOM 6326  C C    . ASN A 1 65  ? -16.507 1.460   -7.156  1.00 0.00 ? 65  ASN A C    4  
ATOM 6327  O O    . ASN A 1 65  ? -17.089 1.591   -6.081  1.00 0.00 ? 65  ASN A O    4  
ATOM 6328  C CB   . ASN A 1 65  ? -16.087 3.689   -8.213  1.00 0.00 ? 65  ASN A CB   4  
ATOM 6329  C CG   . ASN A 1 65  ? -17.304 3.339   -9.049  1.00 0.00 ? 65  ASN A CG   4  
ATOM 6330  O OD1  . ASN A 1 65  ? -18.366 3.018   -8.514  1.00 0.00 ? 65  ASN A OD1  4  
ATOM 6331  N ND2  . ASN A 1 65  ? -17.155 3.401   -10.368 1.00 0.00 ? 65  ASN A ND2  4  
ATOM 6332  H H    . ASN A 1 65  ? -14.506 2.144   -9.469  1.00 0.00 ? 65  ASN A H    4  
ATOM 6333  H HA   . ASN A 1 65  ? -14.867 2.756   -6.724  1.00 0.00 ? 65  ASN A HA   4  
ATOM 6334  H HB2  . ASN A 1 65  ? -16.396 4.360   -7.426  1.00 0.00 ? 65  ASN A HB2  4  
ATOM 6335  H HB3  . ASN A 1 65  ? -15.369 4.187   -8.847  1.00 0.00 ? 65  ASN A HB3  4  
ATOM 6336  H HD21 . ASN A 1 65  ? -16.281 3.665   -10.722 1.00 0.00 ? 65  ASN A HD21 4  
ATOM 6337  H HD22 . ASN A 1 65  ? -17.926 3.180   -10.930 1.00 0.00 ? 65  ASN A HD22 4  
ATOM 6338  N N    . ASN A 1 66  ? -16.764 0.467   -8.001  1.00 0.00 ? 66  ASN A N    4  
ATOM 6339  C CA   . ASN A 1 66  ? -17.767 -0.549  -7.705  1.00 0.00 ? 66  ASN A CA   4  
ATOM 6340  C C    . ASN A 1 66  ? -17.168 -1.678  -6.871  1.00 0.00 ? 66  ASN A C    4  
ATOM 6341  O O    . ASN A 1 66  ? -17.893 -2.449  -6.242  1.00 0.00 ? 66  ASN A O    4  
ATOM 6342  C CB   . ASN A 1 66  ? -18.351 -1.113  -9.001  1.00 0.00 ? 66  ASN A CB   4  
ATOM 6343  C CG   . ASN A 1 66  ? -19.773 -1.613  -8.826  1.00 0.00 ? 66  ASN A CG   4  
ATOM 6344  O OD1  . ASN A 1 66  ? -20.541 -1.066  -8.036  1.00 0.00 ? 66  ASN A OD1  4  
ATOM 6345  N ND2  . ASN A 1 66  ? -20.126 -2.659  -9.564  1.00 0.00 ? 66  ASN A ND2  4  
ATOM 6346  H H    . ASN A 1 66  ? -16.266 0.416   -8.845  1.00 0.00 ? 66  ASN A H    4  
ATOM 6347  H HA   . ASN A 1 66  ? -18.558 -0.079  -7.139  1.00 0.00 ? 66  ASN A HA   4  
ATOM 6348  H HB2  . ASN A 1 66  ? -18.354 -0.338  -9.754  1.00 0.00 ? 66  ASN A HB2  4  
ATOM 6349  H HB3  . ASN A 1 66  ? -17.738 -1.935  -9.339  1.00 0.00 ? 66  ASN A HB3  4  
ATOM 6350  H HD21 . ASN A 1 66  ? -19.460 -3.044  -10.172 1.00 0.00 ? 66  ASN A HD21 4  
ATOM 6351  H HD22 . ASN A 1 66  ? -21.039 -3.003  -9.472  1.00 0.00 ? 66  ASN A HD22 4  
ATOM 6352  N N    . TRP A 1 67  ? -15.844 -1.767  -6.870  1.00 0.00 ? 67  TRP A N    4  
ATOM 6353  C CA   . TRP A 1 67  ? -15.148 -2.800  -6.113  1.00 0.00 ? 67  TRP A CA   4  
ATOM 6354  C C    . TRP A 1 67  ? -15.574 -2.784  -4.649  1.00 0.00 ? 67  TRP A C    4  
ATOM 6355  O O    . TRP A 1 67  ? -16.340 -1.919  -4.227  1.00 0.00 ? 67  TRP A O    4  
ATOM 6356  C CB   . TRP A 1 67  ? -13.634 -2.608  -6.219  1.00 0.00 ? 67  TRP A CB   4  
ATOM 6357  C CG   . TRP A 1 67  ? -13.091 -2.901  -7.585  1.00 0.00 ? 67  TRP A CG   4  
ATOM 6358  C CD1  . TRP A 1 67  ? -13.808 -3.033  -8.740  1.00 0.00 ? 67  TRP A CD1  4  
ATOM 6359  C CD2  . TRP A 1 67  ? -11.719 -3.101  -7.937  1.00 0.00 ? 67  TRP A CD2  4  
ATOM 6360  N NE1  . TRP A 1 67  ? -12.963 -3.303  -9.789  1.00 0.00 ? 67  TRP A NE1  4  
ATOM 6361  C CE2  . TRP A 1 67  ? -11.675 -3.349  -9.323  1.00 0.00 ? 67  TRP A CE2  4  
ATOM 6362  C CE3  . TRP A 1 67  ? -10.521 -3.094  -7.217  1.00 0.00 ? 67  TRP A CE3  4  
ATOM 6363  C CZ2  . TRP A 1 67  ? -10.482 -3.588  -9.999  1.00 0.00 ? 67  TRP A CZ2  4  
ATOM 6364  C CZ3  . TRP A 1 67  ? -9.338  -3.332  -7.890  1.00 0.00 ? 67  TRP A CZ3  4  
ATOM 6365  C CH2  . TRP A 1 67  ? -9.325  -3.576  -9.270  1.00 0.00 ? 67  TRP A CH2  4  
ATOM 6366  H H    . TRP A 1 67  ? -15.320 -1.122  -7.392  1.00 0.00 ? 67  TRP A H    4  
ATOM 6367  H HA   . TRP A 1 67  ? -15.410 -3.757  -6.540  1.00 0.00 ? 67  TRP A HA   4  
ATOM 6368  H HB2  . TRP A 1 67  ? -13.390 -1.585  -5.977  1.00 0.00 ? 67  TRP A HB2  4  
ATOM 6369  H HB3  . TRP A 1 67  ? -13.145 -3.266  -5.516  1.00 0.00 ? 67  TRP A HB3  4  
ATOM 6370  H HD1  . TRP A 1 67  ? -14.881 -2.937  -8.804  1.00 0.00 ? 67  TRP A HD1  4  
ATOM 6371  H HE1  . TRP A 1 67  ? -13.238 -3.439  -10.721 1.00 0.00 ? 67  TRP A HE1  4  
ATOM 6372  H HE3  . TRP A 1 67  ? -10.510 -2.908  -6.153  1.00 0.00 ? 67  TRP A HE3  4  
ATOM 6373  H HZ2  . TRP A 1 67  ? -10.457 -3.776  -11.064 1.00 0.00 ? 67  TRP A HZ2  4  
ATOM 6374  H HZ3  . TRP A 1 67  ? -8.402  -3.330  -7.350  1.00 0.00 ? 67  TRP A HZ3  4  
ATOM 6375  H HH2  . TRP A 1 67  ? -8.378  -3.755  -9.754  1.00 0.00 ? 67  TRP A HH2  4  
ATOM 6376  N N    . MET A 1 68  ? -15.071 -3.743  -3.880  1.00 0.00 ? 68  MET A N    4  
ATOM 6377  C CA   . MET A 1 68  ? -15.399 -3.837  -2.461  1.00 0.00 ? 68  MET A CA   4  
ATOM 6378  C C    . MET A 1 68  ? -14.936 -2.591  -1.714  1.00 0.00 ? 68  MET A C    4  
ATOM 6379  O O    . MET A 1 68  ? -15.726 -1.924  -1.045  1.00 0.00 ? 68  MET A O    4  
ATOM 6380  C CB   . MET A 1 68  ? -14.758 -5.083  -1.849  1.00 0.00 ? 68  MET A CB   4  
ATOM 6381  C CG   . MET A 1 68  ? -15.765 -6.148  -1.448  1.00 0.00 ? 68  MET A CG   4  
ATOM 6382  S SD   . MET A 1 68  ? -15.476 -7.724  -2.277  1.00 0.00 ? 68  MET A SD   4  
ATOM 6383  C CE   . MET A 1 68  ? -14.414 -8.542  -1.091  1.00 0.00 ? 68  MET A CE   4  
ATOM 6384  H H    . MET A 1 68  ? -14.465 -4.405  -4.274  1.00 0.00 ? 68  MET A H    4  
ATOM 6385  H HA   . MET A 1 68  ? -16.473 -3.915  -2.375  1.00 0.00 ? 68  MET A HA   4  
ATOM 6386  H HB2  . MET A 1 68  ? -14.078 -5.513  -2.567  1.00 0.00 ? 68  MET A HB2  4  
ATOM 6387  H HB3  . MET A 1 68  ? -14.205 -4.792  -0.968  1.00 0.00 ? 68  MET A HB3  4  
ATOM 6388  H HG2  . MET A 1 68  ? -15.701 -6.303  -0.381  1.00 0.00 ? 68  MET A HG2  4  
ATOM 6389  H HG3  . MET A 1 68  ? -16.756 -5.801  -1.699  1.00 0.00 ? 68  MET A HG3  4  
ATOM 6390  H HE1  . MET A 1 68  ? -13.997 -7.809  -0.415  1.00 0.00 ? 68  MET A HE1  4  
ATOM 6391  H HE2  . MET A 1 68  ? -14.989 -9.262  -0.530  1.00 0.00 ? 68  MET A HE2  4  
ATOM 6392  H HE3  . MET A 1 68  ? -13.613 -9.047  -1.613  1.00 0.00 ? 68  MET A HE3  4  
ATOM 6393  N N    . LYS A 1 69  ? -13.649 -2.283  -1.829  1.00 0.00 ? 69  LYS A N    4  
ATOM 6394  C CA   . LYS A 1 69  ? -13.078 -1.116  -1.164  1.00 0.00 ? 69  LYS A CA   4  
ATOM 6395  C C    . LYS A 1 69  ? -13.103 -1.287  0.350   1.00 0.00 ? 69  LYS A C    4  
ATOM 6396  O O    . LYS A 1 69  ? -14.083 -1.775  0.915   1.00 0.00 ? 69  LYS A O    4  
ATOM 6397  C CB   . LYS A 1 69  ? -13.846 0.147   -1.559  1.00 0.00 ? 69  LYS A CB   4  
ATOM 6398  C CG   . LYS A 1 69  ? -14.133 0.246   -3.048  1.00 0.00 ? 69  LYS A CG   4  
ATOM 6399  C CD   . LYS A 1 69  ? -15.038 1.425   -3.364  1.00 0.00 ? 69  LYS A CD   4  
ATOM 6400  C CE   . LYS A 1 69  ? -14.341 2.749   -3.091  1.00 0.00 ? 69  LYS A CE   4  
ATOM 6401  N NZ   . LYS A 1 69  ? -15.027 3.528   -2.023  1.00 0.00 ? 69  LYS A NZ   4  
ATOM 6402  H H    . LYS A 1 69  ? -13.067 -2.853  -2.376  1.00 0.00 ? 69  LYS A H    4  
ATOM 6403  H HA   . LYS A 1 69  ? -12.053 -1.019  -1.487  1.00 0.00 ? 69  LYS A HA   4  
ATOM 6404  H HB2  . LYS A 1 69  ? -14.788 0.161   -1.030  1.00 0.00 ? 69  LYS A HB2  4  
ATOM 6405  H HB3  . LYS A 1 69  ? -13.267 1.012   -1.267  1.00 0.00 ? 69  LYS A HB3  4  
ATOM 6406  H HG2  . LYS A 1 69  ? -13.200 0.369   -3.577  1.00 0.00 ? 69  LYS A HG2  4  
ATOM 6407  H HG3  . LYS A 1 69  ? -14.618 -0.665  -3.372  1.00 0.00 ? 69  LYS A HG3  4  
ATOM 6408  H HD2  . LYS A 1 69  ? -15.314 1.385   -4.407  1.00 0.00 ? 69  LYS A HD2  4  
ATOM 6409  H HD3  . LYS A 1 69  ? -15.925 1.362   -2.750  1.00 0.00 ? 69  LYS A HD3  4  
ATOM 6410  H HE2  . LYS A 1 69  ? -13.326 2.551   -2.784  1.00 0.00 ? 69  LYS A HE2  4  
ATOM 6411  H HE3  . LYS A 1 69  ? -14.334 3.332   -4.001  1.00 0.00 ? 69  LYS A HE3  4  
ATOM 6412  H HZ1  . LYS A 1 69  ? -15.244 4.486   -2.363  1.00 0.00 ? 69  LYS A HZ1  4  
ATOM 6413  H HZ2  . LYS A 1 69  ? -14.418 3.599   -1.184  1.00 0.00 ? 69  LYS A HZ2  4  
ATOM 6414  H HZ3  . LYS A 1 69  ? -15.915 3.058   -1.754  1.00 0.00 ? 69  LYS A HZ3  4  
ATOM 6415  N N    . HIS A 1 70  ? -12.018 -0.882  1.005   1.00 0.00 ? 70  HIS A N    4  
ATOM 6416  C CA   . HIS A 1 70  ? -11.918 -0.989  2.456   1.00 0.00 ? 70  HIS A CA   4  
ATOM 6417  C C    . HIS A 1 70  ? -11.882 0.392   3.102   1.00 0.00 ? 70  HIS A C    4  
ATOM 6418  O O    . HIS A 1 70  ? -12.034 1.409   2.424   1.00 0.00 ? 70  HIS A O    4  
ATOM 6419  C CB   . HIS A 1 70  ? -10.667 -1.779  2.845   1.00 0.00 ? 70  HIS A CB   4  
ATOM 6420  C CG   . HIS A 1 70  ? -10.937 -2.888  3.815   1.00 0.00 ? 70  HIS A CG   4  
ATOM 6421  N ND1  . HIS A 1 70  ? -12.018 -3.738  3.704   1.00 0.00 ? 70  HIS A ND1  4  
ATOM 6422  C CD2  . HIS A 1 70  ? -10.258 -3.286  4.916   1.00 0.00 ? 70  HIS A CD2  4  
ATOM 6423  C CE1  . HIS A 1 70  ? -11.992 -4.609  4.697   1.00 0.00 ? 70  HIS A CE1  4  
ATOM 6424  N NE2  . HIS A 1 70  ? -10.934 -4.357  5.447   1.00 0.00 ? 70  HIS A NE2  4  
ATOM 6425  H H    . HIS A 1 70  ? -11.270 -0.503  0.500   1.00 0.00 ? 70  HIS A H    4  
ATOM 6426  H HA   . HIS A 1 70  ? -12.791 -1.516  2.811   1.00 0.00 ? 70  HIS A HA   4  
ATOM 6427  H HB2  . HIS A 1 70  ? -10.233 -2.214  1.957   1.00 0.00 ? 70  HIS A HB2  4  
ATOM 6428  H HB3  . HIS A 1 70  ? -9.952  -1.108  3.298   1.00 0.00 ? 70  HIS A HB3  4  
ATOM 6429  H HD1  . HIS A 1 70  ? -12.701 -3.707  3.005   1.00 0.00 ? 70  HIS A HD1  4  
ATOM 6430  H HD2  . HIS A 1 70  ? -9.352  -2.843  5.306   1.00 0.00 ? 70  HIS A HD2  4  
ATOM 6431  H HE1  . HIS A 1 70  ? -12.713 -5.395  4.867   1.00 0.00 ? 70  HIS A HE1  4  
ATOM 6432  N N    . ASN A 1 71  ? -11.682 0.422   4.415   1.00 0.00 ? 71  ASN A N    4  
ATOM 6433  C CA   . ASN A 1 71  ? -11.629 1.680   5.153   1.00 0.00 ? 71  ASN A CA   4  
ATOM 6434  C C    . ASN A 1 71  ? -10.789 1.533   6.418   1.00 0.00 ? 71  ASN A C    4  
ATOM 6435  O O    . ASN A 1 71  ? -11.162 0.815   7.345   1.00 0.00 ? 71  ASN A O    4  
ATOM 6436  C CB   . ASN A 1 71  ? -13.041 2.143   5.516   1.00 0.00 ? 71  ASN A CB   4  
ATOM 6437  C CG   . ASN A 1 71  ? -13.147 3.652   5.614   1.00 0.00 ? 71  ASN A CG   4  
ATOM 6438  O OD1  . ASN A 1 71  ? -12.191 4.329   5.994   1.00 0.00 ? 71  ASN A OD1  4  
ATOM 6439  N ND2  . ASN A 1 71  ? -14.312 4.188   5.271   1.00 0.00 ? 71  ASN A ND2  4  
ATOM 6440  H H    . ASN A 1 71  ? -11.568 -0.421  4.901   1.00 0.00 ? 71  ASN A H    4  
ATOM 6441  H HA   . ASN A 1 71  ? -11.170 2.419   4.513   1.00 0.00 ? 71  ASN A HA   4  
ATOM 6442  H HB2  . ASN A 1 71  ? -13.731 1.802   4.758   1.00 0.00 ? 71  ASN A HB2  4  
ATOM 6443  H HB3  . ASN A 1 71  ? -13.319 1.718   6.468   1.00 0.00 ? 71  ASN A HB3  4  
ATOM 6444  H HD21 . ASN A 1 71  ? -15.028 3.586   4.978   1.00 0.00 ? 71  ASN A HD21 4  
ATOM 6445  H HD22 . ASN A 1 71  ? -14.409 5.162   5.324   1.00 0.00 ? 71  ASN A HD22 4  
ATOM 6446  N N    . VAL A 1 72  ? -9.649  2.220   6.448   1.00 0.00 ? 72  VAL A N    4  
ATOM 6447  C CA   . VAL A 1 72  ? -8.757  2.167   7.599   1.00 0.00 ? 72  VAL A CA   4  
ATOM 6448  C C    . VAL A 1 72  ? -8.748  3.495   8.349   1.00 0.00 ? 72  VAL A C    4  
ATOM 6449  O O    . VAL A 1 72  ? -9.156  4.524   7.812   1.00 0.00 ? 72  VAL A O    4  
ATOM 6450  C CB   . VAL A 1 72  ? -7.316  1.819   7.177   1.00 0.00 ? 72  VAL A CB   4  
ATOM 6451  C CG1  . VAL A 1 72  ? -7.195  0.335   6.867   1.00 0.00 ? 72  VAL A CG1  4  
ATOM 6452  C CG2  . VAL A 1 72  ? -6.895  2.660   5.980   1.00 0.00 ? 72  VAL A CG2  4  
ATOM 6453  H H    . VAL A 1 72  ? -9.405  2.774   5.677   1.00 0.00 ? 72  VAL A H    4  
ATOM 6454  H HA   . VAL A 1 72  ? -9.111  1.392   8.262   1.00 0.00 ? 72  VAL A HA   4  
ATOM 6455  H HB   . VAL A 1 72  ? -6.657  2.048   8.000   1.00 0.00 ? 72  VAL A HB   4  
ATOM 6456  H HG11 . VAL A 1 72  ? -8.169  -0.127  6.930   1.00 0.00 ? 72  VAL A HG11 4  
ATOM 6457  H HG12 . VAL A 1 72  ? -6.798  0.208   5.870   1.00 0.00 ? 72  VAL A HG12 4  
ATOM 6458  H HG13 . VAL A 1 72  ? -6.529  -0.127  7.581   1.00 0.00 ? 72  VAL A HG13 4  
ATOM 6459  H HG21 . VAL A 1 72  ? -7.588  3.477   5.853   1.00 0.00 ? 72  VAL A HG21 4  
ATOM 6460  H HG22 . VAL A 1 72  ? -5.902  3.052   6.147   1.00 0.00 ? 72  VAL A HG22 4  
ATOM 6461  H HG23 . VAL A 1 72  ? -6.894  2.047   5.092   1.00 0.00 ? 72  VAL A HG23 4  
ATOM 6462  N N    . ALA A 1 73  ? -8.280  3.463   9.592   1.00 0.00 ? 73  ALA A N    4  
ATOM 6463  C CA   . ALA A 1 73  ? -8.216  4.665   10.415  1.00 0.00 ? 73  ALA A CA   4  
ATOM 6464  C C    . ALA A 1 73  ? -6.786  4.951   10.857  1.00 0.00 ? 73  ALA A C    4  
ATOM 6465  O O    . ALA A 1 73  ? -6.455  4.834   12.038  1.00 0.00 ? 73  ALA A O    4  
ATOM 6466  C CB   . ALA A 1 73  ? -9.128  4.525   11.625  1.00 0.00 ? 73  ALA A CB   4  
ATOM 6467  H H    . ALA A 1 73  ? -7.969  2.612   9.963   1.00 0.00 ? 73  ALA A H    4  
ATOM 6468  H HA   . ALA A 1 73  ? -8.571  5.495   9.822   1.00 0.00 ? 73  ALA A HA   4  
ATOM 6469  H HB1  . ALA A 1 73  ? -8.704  3.807   12.313  1.00 0.00 ? 73  ALA A HB1  4  
ATOM 6470  H HB2  . ALA A 1 73  ? -9.223  5.482   12.115  1.00 0.00 ? 73  ALA A HB2  4  
ATOM 6471  H HB3  . ALA A 1 73  ? -10.101 4.184   11.305  1.00 0.00 ? 73  ALA A HB3  4  
ATOM 6472  N N    . ASP A 1 74  ? -5.940  5.326   9.905   1.00 0.00 ? 74  ASP A N    4  
ATOM 6473  C CA   . ASP A 1 74  ? -4.543  5.629   10.197  1.00 0.00 ? 74  ASP A CA   4  
ATOM 6474  C C    . ASP A 1 74  ? -3.815  4.391   10.712  1.00 0.00 ? 74  ASP A C    4  
ATOM 6475  O O    . ASP A 1 74  ? -3.118  4.447   11.725  1.00 0.00 ? 74  ASP A O    4  
ATOM 6476  C CB   . ASP A 1 74  ? -4.449  6.757   11.225  1.00 0.00 ? 74  ASP A CB   4  
ATOM 6477  C CG   . ASP A 1 74  ? -3.122  7.489   11.162  1.00 0.00 ? 74  ASP A CG   4  
ATOM 6478  O OD1  . ASP A 1 74  ? -2.879  8.189   10.157  1.00 0.00 ? 74  ASP A OD1  4  
ATOM 6479  O OD2  . ASP A 1 74  ? -2.329  7.362   12.118  1.00 0.00 ? 74  ASP A OD2  4  
ATOM 6480  H H    . ASP A 1 74  ? -6.262  5.400   8.981   1.00 0.00 ? 74  ASP A H    4  
ATOM 6481  H HA   . ASP A 1 74  ? -4.075  5.951   9.280   1.00 0.00 ? 74  ASP A HA   4  
ATOM 6482  H HB2  . ASP A 1 74  ? -5.241  7.469   11.044  1.00 0.00 ? 74  ASP A HB2  4  
ATOM 6483  H HB3  . ASP A 1 74  ? -4.565  6.342   12.217  1.00 0.00 ? 74  ASP A HB3  4  
ATOM 6484  N N    . SER A 1 75  ? -3.983  3.276   10.007  1.00 0.00 ? 75  SER A N    4  
ATOM 6485  C CA   . SER A 1 75  ? -3.344  2.024   10.396  1.00 0.00 ? 75  SER A CA   4  
ATOM 6486  C C    . SER A 1 75  ? -2.180  1.695   9.466   1.00 0.00 ? 75  SER A C    4  
ATOM 6487  O O    . SER A 1 75  ? -1.181  1.115   9.888   1.00 0.00 ? 75  SER A O    4  
ATOM 6488  C CB   . SER A 1 75  ? -4.362  0.883   10.380  1.00 0.00 ? 75  SER A CB   4  
ATOM 6489  O OG   . SER A 1 75  ? -4.748  0.525   11.697  1.00 0.00 ? 75  SER A OG   4  
ATOM 6490  H H    . SER A 1 75  ? -4.550  3.296   9.209   1.00 0.00 ? 75  SER A H    4  
ATOM 6491  H HA   . SER A 1 75  ? -2.965  2.143   11.400  1.00 0.00 ? 75  SER A HA   4  
ATOM 6492  H HB2  . SER A 1 75  ? -5.239  1.193   9.833   1.00 0.00 ? 75  SER A HB2  4  
ATOM 6493  H HB3  . SER A 1 75  ? -3.925  0.020   9.900   1.00 0.00 ? 75  SER A HB3  4  
ATOM 6494  H HG   . SER A 1 75  ? -5.545  1.002   11.937  1.00 0.00 ? 75  SER A HG   4  
ATOM 6495  N N    . GLN A 1 76  ? -2.321  2.071   8.199   1.00 0.00 ? 76  GLN A N    4  
ATOM 6496  C CA   . GLN A 1 76  ? -1.282  1.815   7.208   1.00 0.00 ? 76  GLN A CA   4  
ATOM 6497  C C    . GLN A 1 76  ? -1.074  0.316   7.011   1.00 0.00 ? 76  GLN A C    4  
ATOM 6498  O O    . GLN A 1 76  ? -0.062  -0.110  6.455   1.00 0.00 ? 76  GLN A O    4  
ATOM 6499  C CB   . GLN A 1 76  ? 0.031   2.472   7.634   1.00 0.00 ? 76  GLN A CB   4  
ATOM 6500  C CG   . GLN A 1 76  ? 0.334   3.764   6.891   1.00 0.00 ? 76  GLN A CG   4  
ATOM 6501  C CD   . GLN A 1 76  ? 1.649   4.388   7.316   1.00 0.00 ? 76  GLN A CD   4  
ATOM 6502  O OE1  . GLN A 1 76  ? 1.717   5.581   7.611   1.00 0.00 ? 76  GLN A OE1  4  
ATOM 6503  N NE2  . GLN A 1 76  ? 2.703   3.580   7.350   1.00 0.00 ? 76  GLN A NE2  4  
ATOM 6504  H H    . GLN A 1 76  ? -3.142  2.529   7.924   1.00 0.00 ? 76  GLN A H    4  
ATOM 6505  H HA   . GLN A 1 76  ? -1.603  2.246   6.271   1.00 0.00 ? 76  GLN A HA   4  
ATOM 6506  H HB2  . GLN A 1 76  ? -0.015  2.691   8.689   1.00 0.00 ? 76  GLN A HB2  4  
ATOM 6507  H HB3  . GLN A 1 76  ? 0.841   1.781   7.454   1.00 0.00 ? 76  GLN A HB3  4  
ATOM 6508  H HG2  . GLN A 1 76  ? 0.378   3.555   5.833   1.00 0.00 ? 76  GLN A HG2  4  
ATOM 6509  H HG3  . GLN A 1 76  ? -0.461  4.469   7.084   1.00 0.00 ? 76  GLN A HG3  4  
ATOM 6510  H HE21 . GLN A 1 76  ? 2.575   2.641   7.101   1.00 0.00 ? 76  GLN A HE21 4  
ATOM 6511  H HE22 . GLN A 1 76  ? 3.566   3.956   7.619   1.00 0.00 ? 76  GLN A HE22 4  
ATOM 6512  N N    . ILE A 1 77  ? -2.037  -0.475  7.471   1.00 0.00 ? 77  ILE A N    4  
ATOM 6513  C CA   . ILE A 1 77  ? -1.959  -1.925  7.344   1.00 0.00 ? 77  ILE A CA   4  
ATOM 6514  C C    . ILE A 1 77  ? -3.310  -2.575  7.623   1.00 0.00 ? 77  ILE A C    4  
ATOM 6515  O O    . ILE A 1 77  ? -3.995  -2.223  8.583   1.00 0.00 ? 77  ILE A O    4  
ATOM 6516  C CB   . ILE A 1 77  ? -0.910  -2.518  8.303   1.00 0.00 ? 77  ILE A CB   4  
ATOM 6517  C CG1  . ILE A 1 77  ? -0.685  -3.999  7.995   1.00 0.00 ? 77  ILE A CG1  4  
ATOM 6518  C CG2  . ILE A 1 77  ? -1.348  -2.332  9.748   1.00 0.00 ? 77  ILE A CG2  4  
ATOM 6519  C CD1  . ILE A 1 77  ? 0.532   -4.581  8.679   1.00 0.00 ? 77  ILE A CD1  4  
ATOM 6520  H H    . ILE A 1 77  ? -2.819  -0.074  7.904   1.00 0.00 ? 77  ILE A H    4  
ATOM 6521  H HA   . ILE A 1 77  ? -1.662  -2.155  6.332   1.00 0.00 ? 77  ILE A HA   4  
ATOM 6522  H HB   . ILE A 1 77  ? 0.018   -1.984  8.162   1.00 0.00 ? 77  ILE A HB   4  
ATOM 6523  H HG12 . ILE A 1 77  ? -1.547  -4.562  8.317   1.00 0.00 ? 77  ILE A HG12 4  
ATOM 6524  H HG13 . ILE A 1 77  ? -0.559  -4.122  6.929   1.00 0.00 ? 77  ILE A HG13 4  
ATOM 6525  H HG21 . ILE A 1 77  ? -0.489  -2.411  10.398  1.00 0.00 ? 77  ILE A HG21 4  
ATOM 6526  H HG22 . ILE A 1 77  ? -1.798  -1.358  9.864   1.00 0.00 ? 77  ILE A HG22 4  
ATOM 6527  H HG23 . ILE A 1 77  ? -2.067  -3.094  10.008  1.00 0.00 ? 77  ILE A HG23 4  
ATOM 6528  H HD11 . ILE A 1 77  ? 1.311   -4.744  7.951   1.00 0.00 ? 77  ILE A HD11 4  
ATOM 6529  H HD12 . ILE A 1 77  ? 0.882   -3.896  9.436   1.00 0.00 ? 77  ILE A HD12 4  
ATOM 6530  H HD13 . ILE A 1 77  ? 0.270   -5.522  9.141   1.00 0.00 ? 77  ILE A HD13 4  
ATOM 6531  N N    . THR A 1 78  ? -3.688  -3.527  6.775   1.00 0.00 ? 78  THR A N    4  
ATOM 6532  C CA   . THR A 1 78  ? -4.957  -4.228  6.930   1.00 0.00 ? 78  THR A CA   4  
ATOM 6533  C C    . THR A 1 78  ? -4.854  -5.667  6.441   1.00 0.00 ? 78  THR A C    4  
ATOM 6534  O O    . THR A 1 78  ? -4.106  -5.966  5.509   1.00 0.00 ? 78  THR A O    4  
ATOM 6535  C CB   . THR A 1 78  ? -6.088  -3.516  6.163   1.00 0.00 ? 78  THR A CB   4  
ATOM 6536  O OG1  . THR A 1 78  ? -7.351  -4.098  6.503   1.00 0.00 ? 78  THR A OG1  4  
ATOM 6537  C CG2  . THR A 1 78  ? -5.867  -3.613  4.661   1.00 0.00 ? 78  THR A CG2  4  
ATOM 6538  H H    . THR A 1 78  ? -3.099  -3.763  6.029   1.00 0.00 ? 78  THR A H    4  
ATOM 6539  H HA   . THR A 1 78  ? -5.210  -4.231  7.980   1.00 0.00 ? 78  THR A HA   4  
ATOM 6540  H HB   . THR A 1 78  ? -6.093  -2.473  6.444   1.00 0.00 ? 78  THR A HB   4  
ATOM 6541  H HG1  . THR A 1 78  ? -7.477  -4.057  7.454   1.00 0.00 ? 78  THR A HG1  4  
ATOM 6542  H HG21 . THR A 1 78  ? -4.894  -4.042  4.467   1.00 0.00 ? 78  THR A HG21 4  
ATOM 6543  H HG22 . THR A 1 78  ? -5.920  -2.627  4.225   1.00 0.00 ? 78  THR A HG22 4  
ATOM 6544  H HG23 . THR A 1 78  ? -6.629  -4.241  4.225   1.00 0.00 ? 78  THR A HG23 4  
ATOM 6545  N N    . THR A 1 79  ? -5.609  -6.559  7.074   1.00 0.00 ? 79  THR A N    4  
ATOM 6546  C CA   . THR A 1 79  ? -5.603  -7.967  6.703   1.00 0.00 ? 79  THR A CA   4  
ATOM 6547  C C    . THR A 1 79  ? -6.967  -8.406  6.183   1.00 0.00 ? 79  THR A C    4  
ATOM 6548  O O    . THR A 1 79  ? -7.961  -8.363  6.911   1.00 0.00 ? 79  THR A O    4  
ATOM 6549  C CB   . THR A 1 79  ? -5.208  -8.860  7.894   1.00 0.00 ? 79  THR A CB   4  
ATOM 6550  O OG1  . THR A 1 79  ? -5.950  -8.480  9.058   1.00 0.00 ? 79  THR A OG1  4  
ATOM 6551  C CG2  . THR A 1 79  ? -3.718  -8.754  8.180   1.00 0.00 ? 79  THR A CG2  4  
ATOM 6552  H H    . THR A 1 79  ? -6.185  -6.259  7.808   1.00 0.00 ? 79  THR A H    4  
ATOM 6553  H HA   . THR A 1 79  ? -4.870  -8.104  5.920   1.00 0.00 ? 79  THR A HA   4  
ATOM 6554  H HB   . THR A 1 79  ? -5.440  -9.887  7.648   1.00 0.00 ? 79  THR A HB   4  
ATOM 6555  H HG1  . THR A 1 79  ? -5.859  -9.158  9.732   1.00 0.00 ? 79  THR A HG1  4  
ATOM 6556  H HG21 . THR A 1 79  ? -3.382  -7.749  7.970   1.00 0.00 ? 79  THR A HG21 4  
ATOM 6557  H HG22 . THR A 1 79  ? -3.180  -9.452  7.556   1.00 0.00 ? 79  THR A HG22 4  
ATOM 6558  H HG23 . THR A 1 79  ? -3.533  -8.984  9.220   1.00 0.00 ? 79  THR A HG23 4  
ATOM 6559  N N    . ILE A 1 80  ? -7.008  -8.831  4.926   1.00 0.00 ? 80  ILE A N    4  
ATOM 6560  C CA   . ILE A 1 80  ? -8.251  -9.280  4.311   1.00 0.00 ? 80  ILE A CA   4  
ATOM 6561  C C    . ILE A 1 80  ? -8.329  -10.802 4.277   1.00 0.00 ? 80  ILE A C    4  
ATOM 6562  O O    . ILE A 1 80  ? -7.372  -11.474 3.900   1.00 0.00 ? 80  ILE A O    4  
ATOM 6563  C CB   . ILE A 1 80  ? -8.399  -8.737  2.878   1.00 0.00 ? 80  ILE A CB   4  
ATOM 6564  C CG1  . ILE A 1 80  ? -8.370  -7.207  2.882   1.00 0.00 ? 80  ILE A CG1  4  
ATOM 6565  C CG2  . ILE A 1 80  ? -9.687  -9.246  2.248   1.00 0.00 ? 80  ILE A CG2  4  
ATOM 6566  C CD1  . ILE A 1 80  ? -8.049  -6.604  1.534   1.00 0.00 ? 80  ILE A CD1  4  
ATOM 6567  H H    . ILE A 1 80  ? -6.183  -8.843  4.398   1.00 0.00 ? 80  ILE A H    4  
ATOM 6568  H HA   . ILE A 1 80  ? -9.072  -8.902  4.905   1.00 0.00 ? 80  ILE A HA   4  
ATOM 6569  H HB   . ILE A 1 80  ? -7.571  -9.103  2.290   1.00 0.00 ? 80  ILE A HB   4  
ATOM 6570  H HG12 . ILE A 1 80  ? -9.336  -6.836  3.188   1.00 0.00 ? 80  ILE A HG12 4  
ATOM 6571  H HG13 . ILE A 1 80  ? -7.622  -6.869  3.585   1.00 0.00 ? 80  ILE A HG13 4  
ATOM 6572  H HG21 . ILE A 1 80  ? -9.765  -8.873  1.238   1.00 0.00 ? 80  ILE A HG21 4  
ATOM 6573  H HG22 . ILE A 1 80  ? -9.677  -10.326 2.232   1.00 0.00 ? 80  ILE A HG22 4  
ATOM 6574  H HG23 . ILE A 1 80  ? -10.531 -8.902  2.826   1.00 0.00 ? 80  ILE A HG23 4  
ATOM 6575  H HD11 . ILE A 1 80  ? -8.609  -7.117  0.766   1.00 0.00 ? 80  ILE A HD11 4  
ATOM 6576  H HD12 . ILE A 1 80  ? -8.313  -5.557  1.533   1.00 0.00 ? 80  ILE A HD12 4  
ATOM 6577  H HD13 . ILE A 1 80  ? -6.991  -6.709  1.337   1.00 0.00 ? 80  ILE A HD13 4  
ATOM 6578  N N    . GLY A 1 81  ? -9.480  -11.340 4.672   1.00 0.00 ? 81  GLY A N    4  
ATOM 6579  C CA   . GLY A 1 81  ? -9.662  -12.779 4.677   1.00 0.00 ? 81  GLY A CA   4  
ATOM 6580  C C    . GLY A 1 81  ? -10.992 -13.196 4.081   1.00 0.00 ? 81  GLY A C    4  
ATOM 6581  O O    . GLY A 1 81  ? -11.664 -12.401 3.427   1.00 0.00 ? 81  GLY A O    4  
ATOM 6582  H H    . GLY A 1 81  ? -10.210 -10.753 4.962   1.00 0.00 ? 81  GLY A H    4  
ATOM 6583  H HA2  . GLY A 1 81  ? -8.866  -13.235 4.108   1.00 0.00 ? 81  GLY A HA2  4  
ATOM 6584  H HA3  . GLY A 1 81  ? -9.612  -13.134 5.696   1.00 0.00 ? 81  GLY A HA3  4  
ATOM 6585  N N    . ASN A 1 82  ? -11.371 -14.451 4.304   1.00 0.00 ? 82  ASN A N    4  
ATOM 6586  C CA   . ASN A 1 82  ? -12.629 -14.974 3.781   1.00 0.00 ? 82  ASN A CA   4  
ATOM 6587  C C    . ASN A 1 82  ? -12.626 -14.969 2.255   1.00 0.00 ? 82  ASN A C    4  
ATOM 6588  O O    . ASN A 1 82  ? -13.682 -14.906 1.623   1.00 0.00 ? 82  ASN A O    4  
ATOM 6589  C CB   . ASN A 1 82  ? -13.805 -14.147 4.303   1.00 0.00 ? 82  ASN A CB   4  
ATOM 6590  C CG   . ASN A 1 82  ? -15.121 -14.897 4.218   1.00 0.00 ? 82  ASN A CG   4  
ATOM 6591  O OD1  . ASN A 1 82  ? -15.170 -16.036 3.755   1.00 0.00 ? 82  ASN A OD1  4  
ATOM 6592  N ND2  . ASN A 1 82  ? -16.195 -14.258 4.666   1.00 0.00 ? 82  ASN A ND2  4  
ATOM 6593  H H    . ASN A 1 82  ? -10.793 -15.038 4.832   1.00 0.00 ? 82  ASN A H    4  
ATOM 6594  H HA   . ASN A 1 82  ? -12.732 -15.992 4.127   1.00 0.00 ? 82  ASN A HA   4  
ATOM 6595  H HB2  . ASN A 1 82  ? -13.626 -13.890 5.337   1.00 0.00 ? 82  ASN A HB2  4  
ATOM 6596  H HB3  . ASN A 1 82  ? -13.888 -13.242 3.720   1.00 0.00 ? 82  ASN A HB3  4  
ATOM 6597  H HD21 . ASN A 1 82  ? -16.080 -13.351 5.021   1.00 0.00 ? 82  ASN A HD21 4  
ATOM 6598  H HD22 . ASN A 1 82  ? -17.058 -14.720 4.624   1.00 0.00 ? 82  ASN A HD22 4  
ATOM 6599  N N    . LEU A 1 83  ? -11.435 -15.038 1.671   1.00 0.00 ? 83  LEU A N    4  
ATOM 6600  C CA   . LEU A 1 83  ? -11.295 -15.043 0.218   1.00 0.00 ? 83  LEU A CA   4  
ATOM 6601  C C    . LEU A 1 83  ? -11.256 -16.469 -0.321  1.00 0.00 ? 83  LEU A C    4  
ATOM 6602  O O    . LEU A 1 83  ? -11.471 -17.429 0.419   1.00 0.00 ? 83  LEU A O    4  
ATOM 6603  C CB   . LEU A 1 83  ? -10.026 -14.294 -0.194  1.00 0.00 ? 83  LEU A CB   4  
ATOM 6604  C CG   . LEU A 1 83  ? -9.689  -13.045 0.621   1.00 0.00 ? 83  LEU A CG   4  
ATOM 6605  C CD1  . LEU A 1 83  ? -8.287  -12.558 0.294   1.00 0.00 ? 83  LEU A CD1  4  
ATOM 6606  C CD2  . LEU A 1 83  ? -10.712 -11.948 0.364   1.00 0.00 ? 83  LEU A CD2  4  
ATOM 6607  H H    . LEU A 1 83  ? -10.631 -15.086 2.227   1.00 0.00 ? 83  LEU A H    4  
ATOM 6608  H HA   . LEU A 1 83  ? -12.154 -14.537 -0.200  1.00 0.00 ? 83  LEU A HA   4  
ATOM 6609  H HB2  . LEU A 1 83  ? -9.197  -14.979 -0.108  1.00 0.00 ? 83  LEU A HB2  4  
ATOM 6610  H HB3  . LEU A 1 83  ? -10.140 -13.996 -1.226  1.00 0.00 ? 83  LEU A HB3  4  
ATOM 6611  H HG   . LEU A 1 83  ? -9.719  -13.291 1.673   1.00 0.00 ? 83  LEU A HG   4  
ATOM 6612  H HD11 . LEU A 1 83  ? -8.324  -11.900 -0.562  1.00 0.00 ? 83  LEU A HD11 4  
ATOM 6613  H HD12 . LEU A 1 83  ? -7.654  -13.404 0.071   1.00 0.00 ? 83  LEU A HD12 4  
ATOM 6614  H HD13 . LEU A 1 83  ? -7.885  -12.022 1.142   1.00 0.00 ? 83  LEU A HD13 4  
ATOM 6615  H HD21 . LEU A 1 83  ? -11.465 -11.970 1.137   1.00 0.00 ? 83  LEU A HD21 4  
ATOM 6616  H HD22 . LEU A 1 83  ? -11.178 -12.109 -0.598  1.00 0.00 ? 83  LEU A HD22 4  
ATOM 6617  H HD23 . LEU A 1 83  ? -10.218 -10.988 0.368   1.00 0.00 ? 83  LEU A HD23 4  
ATOM 6618  N N    . VAL A 1 84  ? -10.978 -16.600 -1.614  1.00 0.00 ? 84  VAL A N    4  
ATOM 6619  C CA   . VAL A 1 84  ? -10.907 -17.909 -2.251  1.00 0.00 ? 84  VAL A CA   4  
ATOM 6620  C C    . VAL A 1 84  ? -9.501  -18.193 -2.767  1.00 0.00 ? 84  VAL A C    4  
ATOM 6621  O O    . VAL A 1 84  ? -8.870  -17.358 -3.417  1.00 0.00 ? 84  VAL A O    4  
ATOM 6622  C CB   . VAL A 1 84  ? -11.902 -18.019 -3.421  1.00 0.00 ? 84  VAL A CB   4  
ATOM 6623  C CG1  . VAL A 1 84  ? -11.642 -16.931 -4.449  1.00 0.00 ? 84  VAL A CG1  4  
ATOM 6624  C CG2  . VAL A 1 84  ? -11.824 -19.399 -4.060  1.00 0.00 ? 84  VAL A CG2  4  
ATOM 6625  H H    . VAL A 1 84  ? -10.815 -15.797 -2.152  1.00 0.00 ? 84  VAL A H    4  
ATOM 6626  H HA   . VAL A 1 84  ? -11.166 -18.655 -1.513  1.00 0.00 ? 84  VAL A HA   4  
ATOM 6627  H HB   . VAL A 1 84  ? -12.902 -17.885 -3.030  1.00 0.00 ? 84  VAL A HB   4  
ATOM 6628  H HG11 . VAL A 1 84  ? -12.422 -16.947 -5.196  1.00 0.00 ? 84  VAL A HG11 4  
ATOM 6629  H HG12 . VAL A 1 84  ? -11.632 -15.968 -3.960  1.00 0.00 ? 84  VAL A HG12 4  
ATOM 6630  H HG13 . VAL A 1 84  ? -10.686 -17.104 -4.923  1.00 0.00 ? 84  VAL A HG13 4  
ATOM 6631  H HG21 . VAL A 1 84  ? -12.158 -20.141 -3.351  1.00 0.00 ? 84  VAL A HG21 4  
ATOM 6632  H HG22 . VAL A 1 84  ? -12.456 -19.426 -4.935  1.00 0.00 ? 84  VAL A HG22 4  
ATOM 6633  H HG23 . VAL A 1 84  ? -10.804 -19.604 -4.346  1.00 0.00 ? 84  VAL A HG23 4  
ATOM 6634  N N    . PRO A 1 85  ? -8.996  -19.401 -2.476  1.00 0.00 ? 85  PRO A N    4  
ATOM 6635  C CA   . PRO A 1 85  ? -7.658  -19.824 -2.901  1.00 0.00 ? 85  PRO A CA   4  
ATOM 6636  C C    . PRO A 1 85  ? -7.573  -20.044 -4.409  1.00 0.00 ? 85  PRO A C    4  
ATOM 6637  O O    . PRO A 1 85  ? -8.588  -20.254 -5.072  1.00 0.00 ? 85  PRO A O    4  
ATOM 6638  C CB   . PRO A 1 85  ? -7.450  -21.144 -2.156  1.00 0.00 ? 85  PRO A CB   4  
ATOM 6639  C CG   . PRO A 1 85  ? -8.824  -21.659 -1.904  1.00 0.00 ? 85  PRO A CG   4  
ATOM 6640  C CD   . PRO A 1 85  ? -9.691  -20.447 -1.707  1.00 0.00 ? 85  PRO A CD   4  
ATOM 6641  H HA   . PRO A 1 85  ? -6.903  -19.114 -2.600  1.00 0.00 ? 85  PRO A HA   4  
ATOM 6642  H HB2  . PRO A 1 85  ? -6.878  -21.824 -2.773  1.00 0.00 ? 85  PRO A HB2  4  
ATOM 6643  H HB3  . PRO A 1 85  ? -6.922  -20.960 -1.232  1.00 0.00 ? 85  PRO A HB3  4  
ATOM 6644  H HG2  . PRO A 1 85  ? -9.163  -22.229 -2.757  1.00 0.00 ? 85  PRO A HG2  4  
ATOM 6645  H HG3  . PRO A 1 85  ? -8.829  -22.272 -1.016  1.00 0.00 ? 85  PRO A HG3  4  
ATOM 6646  H HD2  . PRO A 1 85  ? -10.681 -20.622 -2.101  1.00 0.00 ? 85  PRO A HD2  4  
ATOM 6647  H HD3  . PRO A 1 85  ? -9.741  -20.186 -0.659  1.00 0.00 ? 85  PRO A HD3  4  
ATOM 6648  N N    . GLN A 1 86  ? -6.357  -19.995 -4.941  1.00 0.00 ? 86  GLN A N    4  
ATOM 6649  C CA   . GLN A 1 86  ? -6.141  -20.190 -6.371  1.00 0.00 ? 86  GLN A CA   4  
ATOM 6650  C C    . GLN A 1 86  ? -7.000  -19.231 -7.187  1.00 0.00 ? 86  GLN A C    4  
ATOM 6651  O O    . GLN A 1 86  ? -7.729  -19.646 -8.087  1.00 0.00 ? 86  GLN A O    4  
ATOM 6652  C CB   . GLN A 1 86  ? -6.454  -21.635 -6.762  1.00 0.00 ? 86  GLN A CB   4  
ATOM 6653  C CG   . GLN A 1 86  ? -5.574  -22.660 -6.065  1.00 0.00 ? 86  GLN A CG   4  
ATOM 6654  C CD   . GLN A 1 86  ? -6.134  -24.066 -6.155  1.00 0.00 ? 86  GLN A CD   4  
ATOM 6655  O OE1  . GLN A 1 86  ? -7.267  -24.324 -5.746  1.00 0.00 ? 86  GLN A OE1  4  
ATOM 6656  N NE2  . GLN A 1 86  ? -5.340  -24.986 -6.691  1.00 0.00 ? 86  GLN A NE2  4  
ATOM 6657  H H    . GLN A 1 86  ? -5.587  -19.825 -4.360  1.00 0.00 ? 86  GLN A H    4  
ATOM 6658  H HA   . GLN A 1 86  ? -5.100  -19.988 -6.579  1.00 0.00 ? 86  GLN A HA   4  
ATOM 6659  H HB2  . GLN A 1 86  ? -7.483  -21.847 -6.515  1.00 0.00 ? 86  GLN A HB2  4  
ATOM 6660  H HB3  . GLN A 1 86  ? -6.318  -21.744 -7.828  1.00 0.00 ? 86  GLN A HB3  4  
ATOM 6661  H HG2  . GLN A 1 86  ? -4.597  -22.648 -6.523  1.00 0.00 ? 86  GLN A HG2  4  
ATOM 6662  H HG3  . GLN A 1 86  ? -5.486  -22.389 -5.024  1.00 0.00 ? 86  GLN A HG3  4  
ATOM 6663  H HE21 . GLN A 1 86  ? -4.450  -24.709 -6.994  1.00 0.00 ? 86  GLN A HE21 4  
ATOM 6664  H HE22 . GLN A 1 86  ? -5.675  -25.903 -6.762  1.00 0.00 ? 86  GLN A HE22 4  
ATOM 6665  N N    . LYS A 1 87  ? -6.910  -17.945 -6.864  1.00 0.00 ? 87  LYS A N    4  
ATOM 6666  C CA   . LYS A 1 87  ? -7.678  -16.925 -7.568  1.00 0.00 ? 87  LYS A CA   4  
ATOM 6667  C C    . LYS A 1 87  ? -6.968  -15.575 -7.517  1.00 0.00 ? 87  LYS A C    4  
ATOM 6668  O O    . LYS A 1 87  ? -6.637  -15.077 -6.441  1.00 0.00 ? 87  LYS A O    4  
ATOM 6669  C CB   . LYS A 1 87  ? -9.078  -16.799 -6.957  1.00 0.00 ? 87  LYS A CB   4  
ATOM 6670  C CG   . LYS A 1 87  ? -9.985  -17.978 -7.267  1.00 0.00 ? 87  LYS A CG   4  
ATOM 6671  C CD   . LYS A 1 87  ? -10.201 -18.137 -8.763  1.00 0.00 ? 87  LYS A CD   4  
ATOM 6672  C CE   . LYS A 1 87  ? -11.682 -18.155 -9.112  1.00 0.00 ? 87  LYS A CE   4  
ATOM 6673  N NZ   . LYS A 1 87  ? -11.942 -17.579 -10.459 1.00 0.00 ? 87  LYS A NZ   4  
ATOM 6674  H H    . LYS A 1 87  ? -6.312  -17.674 -6.136  1.00 0.00 ? 87  LYS A H    4  
ATOM 6675  H HA   . LYS A 1 87  ? -7.771  -17.231 -8.598  1.00 0.00 ? 87  LYS A HA   4  
ATOM 6676  H HB2  . LYS A 1 87  ? -8.982  -16.715 -5.885  1.00 0.00 ? 87  LYS A HB2  4  
ATOM 6677  H HB3  . LYS A 1 87  ? -9.545  -15.903 -7.341  1.00 0.00 ? 87  LYS A HB3  4  
ATOM 6678  H HG2  . LYS A 1 87  ? -9.531  -18.879 -6.884  1.00 0.00 ? 87  LYS A HG2  4  
ATOM 6679  H HG3  . LYS A 1 87  ? -10.940 -17.820 -6.788  1.00 0.00 ? 87  LYS A HG3  4  
ATOM 6680  H HD2  . LYS A 1 87  ? -9.734  -17.309 -9.276  1.00 0.00 ? 87  LYS A HD2  4  
ATOM 6681  H HD3  . LYS A 1 87  ? -9.752  -19.064 -9.087  1.00 0.00 ? 87  LYS A HD3  4  
ATOM 6682  H HE2  . LYS A 1 87  ? -12.029 -19.177 -9.092  1.00 0.00 ? 87  LYS A HE2  4  
ATOM 6683  H HE3  . LYS A 1 87  ? -12.220 -17.579 -8.373  1.00 0.00 ? 87  LYS A HE3  4  
ATOM 6684  H HZ1  . LYS A 1 87  ? -12.930 -17.259 -10.526 1.00 0.00 ? 87  LYS A HZ1  4  
ATOM 6685  H HZ2  . LYS A 1 87  ? -11.773 -18.297 -11.194 1.00 0.00 ? 87  LYS A HZ2  4  
ATOM 6686  H HZ3  . LYS A 1 87  ? -11.313 -16.769 -10.630 1.00 0.00 ? 87  LYS A HZ3  4  
ATOM 6687  N N    . THR A 1 88  ? -6.737  -14.989 -8.687  1.00 0.00 ? 88  THR A N    4  
ATOM 6688  C CA   . THR A 1 88  ? -6.066  -13.699 -8.776  1.00 0.00 ? 88  THR A CA   4  
ATOM 6689  C C    . THR A 1 88  ? -6.906  -12.597 -8.140  1.00 0.00 ? 88  THR A C    4  
ATOM 6690  O O    . THR A 1 88  ? -8.096  -12.466 -8.426  1.00 0.00 ? 88  THR A O    4  
ATOM 6691  C CB   . THR A 1 88  ? -5.767  -13.320 -10.239 1.00 0.00 ? 88  THR A CB   4  
ATOM 6692  O OG1  . THR A 1 88  ? -5.122  -14.411 -10.905 1.00 0.00 ? 88  THR A OG1  4  
ATOM 6693  C CG2  . THR A 1 88  ? -4.885  -12.084 -10.309 1.00 0.00 ? 88  THR A CG2  4  
ATOM 6694  H H    . THR A 1 88  ? -7.025  -15.437 -9.510  1.00 0.00 ? 88  THR A H    4  
ATOM 6695  H HA   . THR A 1 88  ? -5.127  -13.775 -8.247  1.00 0.00 ? 88  THR A HA   4  
ATOM 6696  H HB   . THR A 1 88  ? -6.702  -13.106 -10.737 1.00 0.00 ? 88  THR A HB   4  
ATOM 6697  H HG1  . THR A 1 88  ? -5.659  -14.694 -11.652 1.00 0.00 ? 88  THR A HG1  4  
ATOM 6698  H HG21 . THR A 1 88  ? -5.496  -11.214 -10.501 1.00 0.00 ? 88  THR A HG21 4  
ATOM 6699  H HG22 . THR A 1 88  ? -4.163  -12.200 -11.105 1.00 0.00 ? 88  THR A HG22 4  
ATOM 6700  H HG23 . THR A 1 88  ? -4.368  -11.957 -9.370  1.00 0.00 ? 88  THR A HG23 4  
ATOM 6701  N N    . TYR A 1 89  ? -6.279  -11.807 -7.275  1.00 0.00 ? 89  TYR A N    4  
ATOM 6702  C CA   . TYR A 1 89  ? -6.970  -10.717 -6.597  1.00 0.00 ? 89  TYR A CA   4  
ATOM 6703  C C    . TYR A 1 89  ? -6.241  -9.393  -6.811  1.00 0.00 ? 89  TYR A C    4  
ATOM 6704  O O    . TYR A 1 89  ? -5.015  -9.325  -6.725  1.00 0.00 ? 89  TYR A O    4  
ATOM 6705  C CB   . TYR A 1 89  ? -7.084  -11.012 -5.100  1.00 0.00 ? 89  TYR A CB   4  
ATOM 6706  C CG   . TYR A 1 89  ? -8.441  -11.540 -4.688  1.00 0.00 ? 89  TYR A CG   4  
ATOM 6707  C CD1  . TYR A 1 89  ? -9.462  -10.671 -4.321  1.00 0.00 ? 89  TYR A CD1  4  
ATOM 6708  C CD2  . TYR A 1 89  ? -8.700  -12.903 -4.668  1.00 0.00 ? 89  TYR A CD2  4  
ATOM 6709  C CE1  . TYR A 1 89  ? -10.703 -11.149 -3.944  1.00 0.00 ? 89  TYR A CE1  4  
ATOM 6710  C CE2  . TYR A 1 89  ? -9.938  -13.389 -4.294  1.00 0.00 ? 89  TYR A CE2  4  
ATOM 6711  C CZ   . TYR A 1 89  ? -10.936 -12.509 -3.933  1.00 0.00 ? 89  TYR A CZ   4  
ATOM 6712  O OH   . TYR A 1 89  ? -12.170 -12.988 -3.559  1.00 0.00 ? 89  TYR A OH   4  
ATOM 6713  H H    . TYR A 1 89  ? -5.329  -11.961 -7.088  1.00 0.00 ? 89  TYR A H    4  
ATOM 6714  H HA   . TYR A 1 89  ? -7.962  -10.641 -7.015  1.00 0.00 ? 89  TYR A HA   4  
ATOM 6715  H HB2  . TYR A 1 89  ? -6.345  -11.751 -4.827  1.00 0.00 ? 89  TYR A HB2  4  
ATOM 6716  H HB3  . TYR A 1 89  ? -6.899  -10.103 -4.546  1.00 0.00 ? 89  TYR A HB3  4  
ATOM 6717  H HD1  . TYR A 1 89  ? -9.275  -9.608  -4.332  1.00 0.00 ? 89  TYR A HD1  4  
ATOM 6718  H HD2  . TYR A 1 89  ? -7.916  -13.590 -4.953  1.00 0.00 ? 89  TYR A HD2  4  
ATOM 6719  H HE1  . TYR A 1 89  ? -11.484 -10.460 -3.661  1.00 0.00 ? 89  TYR A HE1  4  
ATOM 6720  H HE2  . TYR A 1 89  ? -10.122 -14.454 -4.285  1.00 0.00 ? 89  TYR A HE2  4  
ATOM 6721  H HH   . TYR A 1 89  ? -12.072 -13.866 -3.182  1.00 0.00 ? 89  TYR A HH   4  
ATOM 6722  N N    . SER A 1 90  ? -7.006  -8.343  -7.089  1.00 0.00 ? 90  SER A N    4  
ATOM 6723  C CA   . SER A 1 90  ? -6.437  -7.022  -7.319  1.00 0.00 ? 90  SER A CA   4  
ATOM 6724  C C    . SER A 1 90  ? -6.281  -6.261  -6.008  1.00 0.00 ? 90  SER A C    4  
ATOM 6725  O O    . SER A 1 90  ? -7.003  -6.512  -5.041  1.00 0.00 ? 90  SER A O    4  
ATOM 6726  C CB   . SER A 1 90  ? -7.318  -6.224  -8.283  1.00 0.00 ? 90  SER A CB   4  
ATOM 6727  O OG   . SER A 1 90  ? -6.577  -5.788  -9.410  1.00 0.00 ? 90  SER A OG   4  
ATOM 6728  H H    . SER A 1 90  ? -7.980  -8.461  -7.144  1.00 0.00 ? 90  SER A H    4  
ATOM 6729  H HA   . SER A 1 90  ? -5.461  -7.154  -7.763  1.00 0.00 ? 90  SER A HA   4  
ATOM 6730  H HB2  . SER A 1 90  ? -8.131  -6.845  -8.622  1.00 0.00 ? 90  SER A HB2  4  
ATOM 6731  H HB3  . SER A 1 90  ? -7.715  -5.359  -7.771  1.00 0.00 ? 90  SER A HB3  4  
ATOM 6732  H HG   . SER A 1 90  ? -6.033  -5.035  -9.165  1.00 0.00 ? 90  SER A HG   4  
ATOM 6733  N N    . VAL A 1 91  ? -5.334  -5.328  -5.979  1.00 0.00 ? 91  VAL A N    4  
ATOM 6734  C CA   . VAL A 1 91  ? -5.082  -4.530  -4.785  1.00 0.00 ? 91  VAL A CA   4  
ATOM 6735  C C    . VAL A 1 91  ? -4.557  -3.146  -5.152  1.00 0.00 ? 91  VAL A C    4  
ATOM 6736  O O    . VAL A 1 91  ? -3.634  -3.012  -5.956  1.00 0.00 ? 91  VAL A O    4  
ATOM 6737  C CB   . VAL A 1 91  ? -4.072  -5.220  -3.851  1.00 0.00 ? 91  VAL A CB   4  
ATOM 6738  C CG1  . VAL A 1 91  ? -3.798  -4.355  -2.628  1.00 0.00 ? 91  VAL A CG1  4  
ATOM 6739  C CG2  . VAL A 1 91  ? -4.580  -6.594  -3.439  1.00 0.00 ? 91  VAL A CG2  4  
ATOM 6740  H H    . VAL A 1 91  ? -4.791  -5.174  -6.780  1.00 0.00 ? 91  VAL A H    4  
ATOM 6741  H HA   . VAL A 1 91  ? -6.017  -4.420  -4.254  1.00 0.00 ? 91  VAL A HA   4  
ATOM 6742  H HB   . VAL A 1 91  ? -3.144  -5.348  -4.388  1.00 0.00 ? 91  VAL A HB   4  
ATOM 6743  H HG11 . VAL A 1 91  ? -4.722  -4.178  -2.098  1.00 0.00 ? 91  VAL A HG11 4  
ATOM 6744  H HG12 . VAL A 1 91  ? -3.099  -4.861  -1.978  1.00 0.00 ? 91  VAL A HG12 4  
ATOM 6745  H HG13 . VAL A 1 91  ? -3.379  -3.411  -2.942  1.00 0.00 ? 91  VAL A HG13 4  
ATOM 6746  H HG21 . VAL A 1 91  ? -5.630  -6.530  -3.194  1.00 0.00 ? 91  VAL A HG21 4  
ATOM 6747  H HG22 . VAL A 1 91  ? -4.443  -7.288  -4.255  1.00 0.00 ? 91  VAL A HG22 4  
ATOM 6748  H HG23 . VAL A 1 91  ? -4.028  -6.938  -2.577  1.00 0.00 ? 91  VAL A HG23 4  
ATOM 6749  N N    . LYS A 1 92  ? -5.150  -2.118  -4.555  1.00 0.00 ? 92  LYS A N    4  
ATOM 6750  C CA   . LYS A 1 92  ? -4.741  -0.742  -4.815  1.00 0.00 ? 92  LYS A CA   4  
ATOM 6751  C C    . LYS A 1 92  ? -4.895  0.118   -3.564  1.00 0.00 ? 92  LYS A C    4  
ATOM 6752  O O    . LYS A 1 92  ? -5.944  0.112   -2.921  1.00 0.00 ? 92  LYS A O    4  
ATOM 6753  C CB   . LYS A 1 92  ? -5.569  -0.150  -5.959  1.00 0.00 ? 92  LYS A CB   4  
ATOM 6754  C CG   . LYS A 1 92  ? -5.715  -1.082  -7.150  1.00 0.00 ? 92  LYS A CG   4  
ATOM 6755  C CD   . LYS A 1 92  ? -6.657  -0.508  -8.195  1.00 0.00 ? 92  LYS A CD   4  
ATOM 6756  C CE   . LYS A 1 92  ? -5.970  0.551   -9.043  1.00 0.00 ? 92  LYS A CE   4  
ATOM 6757  N NZ   . LYS A 1 92  ? -6.660  0.750   -10.347 1.00 0.00 ? 92  LYS A NZ   4  
ATOM 6758  H H    . LYS A 1 92  ? -5.879  -2.287  -3.923  1.00 0.00 ? 92  LYS A H    4  
ATOM 6759  H HA   . LYS A 1 92  ? -3.701  -0.753  -5.104  1.00 0.00 ? 92  LYS A HA   4  
ATOM 6760  H HB2  . LYS A 1 92  ? -6.556  0.084   -5.589  1.00 0.00 ? 92  LYS A HB2  4  
ATOM 6761  H HB3  . LYS A 1 92  ? -5.095  0.760   -6.296  1.00 0.00 ? 92  LYS A HB3  4  
ATOM 6762  H HG2  . LYS A 1 92  ? -4.745  -1.231  -7.599  1.00 0.00 ? 92  LYS A HG2  4  
ATOM 6763  H HG3  . LYS A 1 92  ? -6.105  -2.030  -6.807  1.00 0.00 ? 92  LYS A HG3  4  
ATOM 6764  H HD2  . LYS A 1 92  ? -6.994  -1.306  -8.839  1.00 0.00 ? 92  LYS A HD2  4  
ATOM 6765  H HD3  . LYS A 1 92  ? -7.506  -0.061  -7.695  1.00 0.00 ? 92  LYS A HD3  4  
ATOM 6766  H HE2  . LYS A 1 92  ? -5.968  1.483   -8.500  1.00 0.00 ? 92  LYS A HE2  4  
ATOM 6767  H HE3  . LYS A 1 92  ? -4.952  0.240   -9.227  1.00 0.00 ? 92  LYS A HE3  4  
ATOM 6768  H HZ1  . LYS A 1 92  ? -6.067  1.324   -10.981 1.00 0.00 ? 92  LYS A HZ1  4  
ATOM 6769  H HZ2  . LYS A 1 92  ? -7.565  1.240   -10.201 1.00 0.00 ? 92  LYS A HZ2  4  
ATOM 6770  H HZ3  . LYS A 1 92  ? -6.844  -0.168  -10.799 1.00 0.00 ? 92  LYS A HZ3  4  
ATOM 6771  N N    . VAL A 1 93  ? -3.843  0.856   -3.226  1.00 0.00 ? 93  VAL A N    4  
ATOM 6772  C CA   . VAL A 1 93  ? -3.862  1.723   -2.054  1.00 0.00 ? 93  VAL A CA   4  
ATOM 6773  C C    . VAL A 1 93  ? -3.664  3.183   -2.447  1.00 0.00 ? 93  VAL A C    4  
ATOM 6774  O O    . VAL A 1 93  ? -2.924  3.490   -3.383  1.00 0.00 ? 93  VAL A O    4  
ATOM 6775  C CB   . VAL A 1 93  ? -2.773  1.322   -1.042  1.00 0.00 ? 93  VAL A CB   4  
ATOM 6776  C CG1  . VAL A 1 93  ? -2.931  2.109   0.250   1.00 0.00 ? 93  VAL A CG1  4  
ATOM 6777  C CG2  . VAL A 1 93  ? -2.819  -0.174  -0.776  1.00 0.00 ? 93  VAL A CG2  4  
ATOM 6778  H H    . VAL A 1 93  ? -3.035  0.819   -3.779  1.00 0.00 ? 93  VAL A H    4  
ATOM 6779  H HA   . VAL A 1 93  ? -4.825  1.617   -1.576  1.00 0.00 ? 93  VAL A HA   4  
ATOM 6780  H HB   . VAL A 1 93  ? -1.809  1.561   -1.468  1.00 0.00 ? 93  VAL A HB   4  
ATOM 6781  H HG11 . VAL A 1 93  ? -2.096  2.786   0.363   1.00 0.00 ? 93  VAL A HG11 4  
ATOM 6782  H HG12 . VAL A 1 93  ? -3.851  2.672   0.220   1.00 0.00 ? 93  VAL A HG12 4  
ATOM 6783  H HG13 . VAL A 1 93  ? -2.953  1.425   1.086   1.00 0.00 ? 93  VAL A HG13 4  
ATOM 6784  H HG21 . VAL A 1 93  ? -2.134  -0.417  0.025   1.00 0.00 ? 93  VAL A HG21 4  
ATOM 6785  H HG22 . VAL A 1 93  ? -3.821  -0.458  -0.490  1.00 0.00 ? 93  VAL A HG22 4  
ATOM 6786  H HG23 . VAL A 1 93  ? -2.533  -0.709  -1.669  1.00 0.00 ? 93  VAL A HG23 4  
ATOM 6787  N N    . LEU A 1 94  ? -4.328  4.079   -1.726  1.00 0.00 ? 94  LEU A N    4  
ATOM 6788  C CA   . LEU A 1 94  ? -4.226  5.509   -1.999  1.00 0.00 ? 94  LEU A CA   4  
ATOM 6789  C C    . LEU A 1 94  ? -4.258  6.313   -0.703  1.00 0.00 ? 94  LEU A C    4  
ATOM 6790  O O    . LEU A 1 94  ? -4.568  5.780   0.363   1.00 0.00 ? 94  LEU A O    4  
ATOM 6791  C CB   . LEU A 1 94  ? -5.363  5.956   -2.919  1.00 0.00 ? 94  LEU A CB   4  
ATOM 6792  C CG   . LEU A 1 94  ? -6.703  6.238   -2.240  1.00 0.00 ? 94  LEU A CG   4  
ATOM 6793  C CD1  . LEU A 1 94  ? -6.800  7.701   -1.838  1.00 0.00 ? 94  LEU A CD1  4  
ATOM 6794  C CD2  . LEU A 1 94  ? -7.857  5.857   -3.158  1.00 0.00 ? 94  LEU A CD2  4  
ATOM 6795  H H    . LEU A 1 94  ? -4.903  3.774   -0.993  1.00 0.00 ? 94  LEU A H    4  
ATOM 6796  H HA   . LEU A 1 94  ? -3.282  5.684   -2.494  1.00 0.00 ? 94  LEU A HA   4  
ATOM 6797  H HB2  . LEU A 1 94  ? -5.048  6.859   -3.418  1.00 0.00 ? 94  LEU A HB2  4  
ATOM 6798  H HB3  . LEU A 1 94  ? -5.518  5.177   -3.652  1.00 0.00 ? 94  LEU A HB3  4  
ATOM 6799  H HG   . LEU A 1 94  ? -6.779  5.640   -1.343  1.00 0.00 ? 94  LEU A HG   4  
ATOM 6800  H HD11 . LEU A 1 94  ? -6.582  7.800   -0.785  1.00 0.00 ? 94  LEU A HD11 4  
ATOM 6801  H HD12 . LEU A 1 94  ? -7.800  8.063   -2.034  1.00 0.00 ? 94  LEU A HD12 4  
ATOM 6802  H HD13 . LEU A 1 94  ? -6.090  8.279   -2.409  1.00 0.00 ? 94  LEU A HD13 4  
ATOM 6803  H HD21 . LEU A 1 94  ? -7.891  6.542   -3.994  1.00 0.00 ? 94  LEU A HD21 4  
ATOM 6804  H HD22 . LEU A 1 94  ? -8.786  5.912   -2.610  1.00 0.00 ? 94  LEU A HD22 4  
ATOM 6805  H HD23 . LEU A 1 94  ? -7.709  4.852   -3.521  1.00 0.00 ? 94  LEU A HD23 4  
ATOM 6806  N N    . ALA A 1 95  ? -3.938  7.599   -0.803  1.00 0.00 ? 95  ALA A N    4  
ATOM 6807  C CA   . ALA A 1 95  ? -3.934  8.479   0.359   1.00 0.00 ? 95  ALA A CA   4  
ATOM 6808  C C    . ALA A 1 95  ? -4.915  9.631   0.179   1.00 0.00 ? 95  ALA A C    4  
ATOM 6809  O O    . ALA A 1 95  ? -5.112  10.125  -0.933  1.00 0.00 ? 95  ALA A O    4  
ATOM 6810  C CB   . ALA A 1 95  ? -2.531  9.011   0.615   1.00 0.00 ? 95  ALA A CB   4  
ATOM 6811  H H    . ALA A 1 95  ? -3.699  7.966   -1.680  1.00 0.00 ? 95  ALA A H    4  
ATOM 6812  H HA   . ALA A 1 95  ? -4.234  7.896   1.219   1.00 0.00 ? 95  ALA A HA   4  
ATOM 6813  H HB1  . ALA A 1 95  ? -2.396  9.174   1.673   1.00 0.00 ? 95  ALA A HB1  4  
ATOM 6814  H HB2  . ALA A 1 95  ? -1.805  8.292   0.265   1.00 0.00 ? 95  ALA A HB2  4  
ATOM 6815  H HB3  . ALA A 1 95  ? -2.399  9.943   0.086   1.00 0.00 ? 95  ALA A HB3  4  
ATOM 6816  N N    . PHE A 1 96  ? -5.528  10.058  1.277   1.00 0.00 ? 96  PHE A N    4  
ATOM 6817  C CA   . PHE A 1 96  ? -6.492  11.152  1.240   1.00 0.00 ? 96  PHE A CA   4  
ATOM 6818  C C    . PHE A 1 96  ? -6.466  11.944  2.544   1.00 0.00 ? 96  PHE A C    4  
ATOM 6819  O O    . PHE A 1 96  ? -6.307  11.377  3.625   1.00 0.00 ? 96  PHE A O    4  
ATOM 6820  C CB   . PHE A 1 96  ? -7.901  10.612  0.984   1.00 0.00 ? 96  PHE A CB   4  
ATOM 6821  C CG   . PHE A 1 96  ? -8.452  9.813   2.128   1.00 0.00 ? 96  PHE A CG   4  
ATOM 6822  C CD1  . PHE A 1 96  ? -9.100  10.439  3.180   1.00 0.00 ? 96  PHE A CD1  4  
ATOM 6823  C CD2  . PHE A 1 96  ? -8.324  8.432   2.151   1.00 0.00 ? 96  PHE A CD2  4  
ATOM 6824  C CE1  . PHE A 1 96  ? -9.609  9.705   4.235   1.00 0.00 ? 96  PHE A CE1  4  
ATOM 6825  C CE2  . PHE A 1 96  ? -8.833  7.694   3.202   1.00 0.00 ? 96  PHE A CE2  4  
ATOM 6826  C CZ   . PHE A 1 96  ? -9.475  8.331   4.247   1.00 0.00 ? 96  PHE A CZ   4  
ATOM 6827  H H    . PHE A 1 96  ? -5.331  9.624   2.135   1.00 0.00 ? 96  PHE A H    4  
ATOM 6828  H HA   . PHE A 1 96  ? -6.214  11.808  0.430   1.00 0.00 ? 96  PHE A HA   4  
ATOM 6829  H HB2  . PHE A 1 96  ? -8.569  11.442  0.805   1.00 0.00 ? 96  PHE A HB2  4  
ATOM 6830  H HB3  . PHE A 1 96  ? -7.881  9.977   0.110   1.00 0.00 ? 96  PHE A HB3  4  
ATOM 6831  H HD1  . PHE A 1 96  ? -9.205  11.515  3.172   1.00 0.00 ? 96  PHE A HD1  4  
ATOM 6832  H HD2  . PHE A 1 96  ? -7.822  7.934   1.337   1.00 0.00 ? 96  PHE A HD2  4  
ATOM 6833  H HE1  . PHE A 1 96  ? -10.112 10.207  5.048   1.00 0.00 ? 96  PHE A HE1  4  
ATOM 6834  H HE2  . PHE A 1 96  ? -8.726  6.619   3.209   1.00 0.00 ? 96  PHE A HE2  4  
ATOM 6835  H HZ   . PHE A 1 96  ? -9.874  7.756   5.070   1.00 0.00 ? 96  PHE A HZ   4  
ATOM 6836  N N    . THR A 1 97  ? -6.627  13.259  2.435   1.00 0.00 ? 97  THR A N    4  
ATOM 6837  C CA   . THR A 1 97  ? -6.621  14.129  3.603   1.00 0.00 ? 97  THR A CA   4  
ATOM 6838  C C    . THR A 1 97  ? -7.949  14.865  3.748   1.00 0.00 ? 97  THR A C    4  
ATOM 6839  O O    . THR A 1 97  ? -8.888  14.627  2.986   1.00 0.00 ? 97  THR A O    4  
ATOM 6840  C CB   . THR A 1 97  ? -5.481  15.161  3.531   1.00 0.00 ? 97  THR A CB   4  
ATOM 6841  O OG1  . THR A 1 97  ? -5.664  16.014  2.395   1.00 0.00 ? 97  THR A OG1  4  
ATOM 6842  C CG2  . THR A 1 97  ? -4.130  14.469  3.439   1.00 0.00 ? 97  THR A CG2  4  
ATOM 6843  H H    . THR A 1 97  ? -6.750  13.651  1.546   1.00 0.00 ? 97  THR A H    4  
ATOM 6844  H HA   . THR A 1 97  ? -6.466  13.513  4.478   1.00 0.00 ? 97  THR A HA   4  
ATOM 6845  H HB   . THR A 1 97  ? -5.501  15.761  4.429   1.00 0.00 ? 97  THR A HB   4  
ATOM 6846  H HG1  . THR A 1 97  ? -4.913  16.607  2.315   1.00 0.00 ? 97  THR A HG1  4  
ATOM 6847  H HG21 . THR A 1 97  ? -3.343  15.193  3.595   1.00 0.00 ? 97  THR A HG21 4  
ATOM 6848  H HG22 . THR A 1 97  ? -4.019  14.022  2.463   1.00 0.00 ? 97  THR A HG22 4  
ATOM 6849  H HG23 . THR A 1 97  ? -4.068  13.701  4.196   1.00 0.00 ? 97  THR A HG23 4  
ATOM 6850  N N    . SER A 1 98  ? -8.021  15.760  4.727   1.00 0.00 ? 98  SER A N    4  
ATOM 6851  C CA   . SER A 1 98  ? -9.236  16.528  4.973   1.00 0.00 ? 98  SER A CA   4  
ATOM 6852  C C    . SER A 1 98  ? -9.595  17.379  3.757   1.00 0.00 ? 98  SER A C    4  
ATOM 6853  O O    . SER A 1 98  ? -10.761 17.710  3.542   1.00 0.00 ? 98  SER A O    4  
ATOM 6854  C CB   . SER A 1 98  ? -9.060  17.422  6.202   1.00 0.00 ? 98  SER A CB   4  
ATOM 6855  O OG   . SER A 1 98  ? -9.964  17.058  7.231   1.00 0.00 ? 98  SER A OG   4  
ATOM 6856  H H    . SER A 1 98  ? -7.240  15.904  5.301   1.00 0.00 ? 98  SER A H    4  
ATOM 6857  H HA   . SER A 1 98  ? -10.039 15.830  5.158   1.00 0.00 ? 98  SER A HA   4  
ATOM 6858  H HB2  . SER A 1 98  ? -8.052  17.324  6.574   1.00 0.00 ? 98  SER A HB2  4  
ATOM 6859  H HB3  . SER A 1 98  ? -9.243  18.451  5.925   1.00 0.00 ? 98  SER A HB3  4  
ATOM 6860  H HG   . SER A 1 98  ? -9.910  17.697  7.945   1.00 0.00 ? 98  SER A HG   4  
ATOM 6861  N N    . ILE A 1 99  ? -8.585  17.731  2.970   1.00 0.00 ? 99  ILE A N    4  
ATOM 6862  C CA   . ILE A 1 99  ? -8.793  18.541  1.777   1.00 0.00 ? 99  ILE A CA   4  
ATOM 6863  C C    . ILE A 1 99  ? -9.472  17.735  0.676   1.00 0.00 ? 99  ILE A C    4  
ATOM 6864  O O    . ILE A 1 99  ? -10.530 18.115  0.177   1.00 0.00 ? 99  ILE A O    4  
ATOM 6865  C CB   . ILE A 1 99  ? -7.463  19.105  1.241   1.00 0.00 ? 99  ILE A CB   4  
ATOM 6866  C CG1  . ILE A 1 99  ? -6.773  19.952  2.313   1.00 0.00 ? 99  ILE A CG1  4  
ATOM 6867  C CG2  . ILE A 1 99  ? -7.705  19.926  -0.017  1.00 0.00 ? 99  ILE A CG2  4  
ATOM 6868  C CD1  . ILE A 1 99  ? -7.585  21.151  2.750   1.00 0.00 ? 99  ILE A CD1  4  
ATOM 6869  H H    . ILE A 1 99  ? -7.677  17.436  3.195   1.00 0.00 ? 99  ILE A H    4  
ATOM 6870  H HA   . ILE A 1 99  ? -9.429  19.372  2.046   1.00 0.00 ? 99  ILE A HA   4  
ATOM 6871  H HB   . ILE A 1 99  ? -6.825  18.275  0.982   1.00 0.00 ? 99  ILE A HB   4  
ATOM 6872  H HG12 . ILE A 1 99  ? -6.589  19.341  3.182   1.00 0.00 ? 99  ILE A HG12 4  
ATOM 6873  H HG13 . ILE A 1 99  ? -5.831  20.311  1.924   1.00 0.00 ? 99  ILE A HG13 4  
ATOM 6874  H HG21 . ILE A 1 99  ? -7.205  19.460  -0.852  1.00 0.00 ? 99  ILE A HG21 4  
ATOM 6875  H HG22 . ILE A 1 99  ? -8.765  19.976  -0.215  1.00 0.00 ? 99  ILE A HG22 4  
ATOM 6876  H HG23 . ILE A 1 99  ? -7.318  20.924  0.124   1.00 0.00 ? 99  ILE A HG23 4  
ATOM 6877  H HD11 . ILE A 1 99  ? -7.787  21.083  3.808   1.00 0.00 ? 99  ILE A HD11 4  
ATOM 6878  H HD12 . ILE A 1 99  ? -7.033  22.055  2.545   1.00 0.00 ? 99  ILE A HD12 4  
ATOM 6879  H HD13 . ILE A 1 99  ? -8.520  21.170  2.208   1.00 0.00 ? 99  ILE A HD13 4  
ATOM 6880  N N    . GLY A 1 100 ? -8.855  16.618  0.302   1.00 0.00 ? 100 GLY A N    4  
ATOM 6881  C CA   . GLY A 1 100 ? -9.415  15.774  -0.738  1.00 0.00 ? 100 GLY A CA   4  
ATOM 6882  C C    . GLY A 1 100 ? -8.766  14.405  -0.787  1.00 0.00 ? 100 GLY A C    4  
ATOM 6883  O O    . GLY A 1 100 ? -8.252  13.919  0.222   1.00 0.00 ? 100 GLY A O    4  
ATOM 6884  H H    . GLY A 1 100 ? -8.013  16.366  0.734   1.00 0.00 ? 100 GLY A H    4  
ATOM 6885  H HA2  . GLY A 1 100 ? -10.474 15.653  -0.557  1.00 0.00 ? 100 GLY A HA2  4  
ATOM 6886  H HA3  . GLY A 1 100 ? -9.278  16.259  -1.693  1.00 0.00 ? 100 GLY A HA3  4  
ATOM 6887  N N    . ASP A 1 101 ? -8.790  13.782  -1.958  1.00 0.00 ? 101 ASP A N    4  
ATOM 6888  C CA   . ASP A 1 101 ? -8.199  12.460  -2.134  1.00 0.00 ? 101 ASP A CA   4  
ATOM 6889  C C    . ASP A 1 101 ? -6.943  12.538  -2.996  1.00 0.00 ? 101 ASP A C    4  
ATOM 6890  O O    . ASP A 1 101 ? -6.632  13.582  -3.567  1.00 0.00 ? 101 ASP A O    4  
ATOM 6891  C CB   . ASP A 1 101 ? -9.211  11.506  -2.771  1.00 0.00 ? 101 ASP A CB   4  
ATOM 6892  C CG   . ASP A 1 101 ? -10.104 12.199  -3.781  1.00 0.00 ? 101 ASP A CG   4  
ATOM 6893  O OD1  . ASP A 1 101 ? -9.565  12.818  -4.721  1.00 0.00 ? 101 ASP A OD1  4  
ATOM 6894  O OD2  . ASP A 1 101 ? -11.341 12.122  -3.631  1.00 0.00 ? 101 ASP A OD2  4  
ATOM 6895  H H    . ASP A 1 101 ? -9.215  14.221  -2.725  1.00 0.00 ? 101 ASP A H    4  
ATOM 6896  H HA   . ASP A 1 101 ? -7.928  12.086  -1.160  1.00 0.00 ? 101 ASP A HA   4  
ATOM 6897  H HB2  . ASP A 1 101 ? -8.679  10.711  -3.273  1.00 0.00 ? 101 ASP A HB2  4  
ATOM 6898  H HB3  . ASP A 1 101 ? -9.834  11.084  -1.996  1.00 0.00 ? 101 ASP A HB3  4  
ATOM 6899  N N    . GLY A 1 102 ? -6.223  11.423  -3.085  1.00 0.00 ? 102 GLY A N    4  
ATOM 6900  C CA   . GLY A 1 102 ? -5.008  11.386  -3.878  1.00 0.00 ? 102 GLY A CA   4  
ATOM 6901  C C    . GLY A 1 102 ? -5.034  10.293  -4.928  1.00 0.00 ? 102 GLY A C    4  
ATOM 6902  O O    . GLY A 1 102 ? -5.941  9.461   -4.967  1.00 0.00 ? 102 GLY A O    4  
ATOM 6903  H H    . GLY A 1 102 ? -6.519  10.619  -2.609  1.00 0.00 ? 102 GLY A H    4  
ATOM 6904  H HA2  . GLY A 1 102 ? -4.882  12.339  -4.369  1.00 0.00 ? 102 GLY A HA2  4  
ATOM 6905  H HA3  . GLY A 1 102 ? -4.167  11.217  -3.220  1.00 0.00 ? 102 GLY A HA3  4  
ATOM 6906  N N    . PRO A 1 103 ? -4.020  10.286  -5.805  1.00 0.00 ? 103 PRO A N    4  
ATOM 6907  C CA   . PRO A 1 103 ? -3.908  9.293   -6.878  1.00 0.00 ? 103 PRO A CA   4  
ATOM 6908  C C    . PRO A 1 103 ? -3.587  7.900   -6.348  1.00 0.00 ? 103 PRO A C    4  
ATOM 6909  O O    . PRO A 1 103 ? -2.811  7.748   -5.403  1.00 0.00 ? 103 PRO A O    4  
ATOM 6910  C CB   . PRO A 1 103 ? -2.751  9.819   -7.731  1.00 0.00 ? 103 PRO A CB   4  
ATOM 6911  C CG   . PRO A 1 103 ? -1.933  10.640  -6.793  1.00 0.00 ? 103 PRO A CG   4  
ATOM 6912  C CD   . PRO A 1 103 ? -2.904  11.247  -5.819  1.00 0.00 ? 103 PRO A CD   4  
ATOM 6913  H HA   . PRO A 1 103 ? -4.807  9.250   -7.475  1.00 0.00 ? 103 PRO A HA   4  
ATOM 6914  H HB2  . PRO A 1 103 ? -2.184  8.989   -8.127  1.00 0.00 ? 103 PRO A HB2  4  
ATOM 6915  H HB3  . PRO A 1 103 ? -3.139  10.417  -8.541  1.00 0.00 ? 103 PRO A HB3  4  
ATOM 6916  H HG2  . PRO A 1 103 ? -1.226  10.010  -6.275  1.00 0.00 ? 103 PRO A HG2  4  
ATOM 6917  H HG3  . PRO A 1 103 ? -1.416  11.415  -7.340  1.00 0.00 ? 103 PRO A HG3  4  
ATOM 6918  H HD2  . PRO A 1 103 ? -2.454  11.329  -4.841  1.00 0.00 ? 103 PRO A HD2  4  
ATOM 6919  H HD3  . PRO A 1 103 ? -3.233  12.215  -6.168  1.00 0.00 ? 103 PRO A HD3  4  
ATOM 6920  N N    . LEU A 1 104 ? -4.187  6.885   -6.960  1.00 0.00 ? 104 LEU A N    4  
ATOM 6921  C CA   . LEU A 1 104 ? -3.963  5.503   -6.549  1.00 0.00 ? 104 LEU A CA   4  
ATOM 6922  C C    . LEU A 1 104 ? -2.526  5.076   -6.830  1.00 0.00 ? 104 LEU A C    4  
ATOM 6923  O O    . LEU A 1 104 ? -1.786  5.774   -7.525  1.00 0.00 ? 104 LEU A O    4  
ATOM 6924  C CB   . LEU A 1 104 ? -4.937  4.571   -7.274  1.00 0.00 ? 104 LEU A CB   4  
ATOM 6925  C CG   . LEU A 1 104 ? -6.423  4.843   -7.044  1.00 0.00 ? 104 LEU A CG   4  
ATOM 6926  C CD1  . LEU A 1 104 ? -7.222  4.547   -8.304  1.00 0.00 ? 104 LEU A CD1  4  
ATOM 6927  C CD2  . LEU A 1 104 ? -6.942  4.016   -5.876  1.00 0.00 ? 104 LEU A CD2  4  
ATOM 6928  H H    . LEU A 1 104 ? -4.794  7.069   -7.706  1.00 0.00 ? 104 LEU A H    4  
ATOM 6929  H HA   . LEU A 1 104 ? -4.143  5.441   -5.486  1.00 0.00 ? 104 LEU A HA   4  
ATOM 6930  H HB2  . LEU A 1 104 ? -4.746  4.655   -8.333  1.00 0.00 ? 104 LEU A HB2  4  
ATOM 6931  H HB3  . LEU A 1 104 ? -4.729  3.562   -6.951  1.00 0.00 ? 104 LEU A HB3  4  
ATOM 6932  H HG   . LEU A 1 104 ? -6.560  5.887   -6.800  1.00 0.00 ? 104 LEU A HG   4  
ATOM 6933  H HD11 . LEU A 1 104 ? -8.238  4.885   -8.173  1.00 0.00 ? 104 LEU A HD11 4  
ATOM 6934  H HD12 . LEU A 1 104 ? -7.217  3.484   -8.492  1.00 0.00 ? 104 LEU A HD12 4  
ATOM 6935  H HD13 . LEU A 1 104 ? -6.775  5.062   -9.142  1.00 0.00 ? 104 LEU A HD13 4  
ATOM 6936  H HD21 . LEU A 1 104 ? -6.187  3.973   -5.103  1.00 0.00 ? 104 LEU A HD21 4  
ATOM 6937  H HD22 . LEU A 1 104 ? -7.166  3.015   -6.216  1.00 0.00 ? 104 LEU A HD22 4  
ATOM 6938  H HD23 . LEU A 1 104 ? -7.837  4.472   -5.481  1.00 0.00 ? 104 LEU A HD23 4  
ATOM 6939  N N    . SER A 1 105 ? -2.140  3.925   -6.290  1.00 0.00 ? 105 SER A N    4  
ATOM 6940  C CA   . SER A 1 105 ? -0.791  3.405   -6.482  1.00 0.00 ? 105 SER A CA   4  
ATOM 6941  C C    . SER A 1 105 ? -0.748  2.426   -7.652  1.00 0.00 ? 105 SER A C    4  
ATOM 6942  O O    . SER A 1 105 ? -1.777  2.105   -8.246  1.00 0.00 ? 105 SER A O    4  
ATOM 6943  C CB   . SER A 1 105 ? -0.302  2.716   -5.207  1.00 0.00 ? 105 SER A CB   4  
ATOM 6944  O OG   . SER A 1 105 ? -0.420  1.309   -5.310  1.00 0.00 ? 105 SER A OG   4  
ATOM 6945  H H    . SER A 1 105 ? -2.777  3.415   -5.747  1.00 0.00 ? 105 SER A H    4  
ATOM 6946  H HA   . SER A 1 105 ? -0.143  4.240   -6.703  1.00 0.00 ? 105 SER A HA   4  
ATOM 6947  H HB2  . SER A 1 105 ? 0.736   2.967   -5.041  1.00 0.00 ? 105 SER A HB2  4  
ATOM 6948  H HB3  . SER A 1 105 ? -0.892  3.056   -4.368  1.00 0.00 ? 105 SER A HB3  4  
ATOM 6949  H HG   . SER A 1 105 ? -1.346  1.069   -5.389  1.00 0.00 ? 105 SER A HG   4  
ATOM 6950  N N    . SER A 1 106 ? 0.452   1.955   -7.976  1.00 0.00 ? 106 SER A N    4  
ATOM 6951  C CA   . SER A 1 106 ? 0.632   1.015   -9.075  1.00 0.00 ? 106 SER A CA   4  
ATOM 6952  C C    . SER A 1 106 ? -0.260  -0.210  -8.896  1.00 0.00 ? 106 SER A C    4  
ATOM 6953  O O    . SER A 1 106 ? -0.267  -0.836  -7.835  1.00 0.00 ? 106 SER A O    4  
ATOM 6954  C CB   . SER A 1 106 ? 2.097   0.585   -9.172  1.00 0.00 ? 106 SER A CB   4  
ATOM 6955  O OG   . SER A 1 106 ? 2.740   1.204   -10.272 1.00 0.00 ? 106 SER A OG   4  
ATOM 6956  H H    . SER A 1 106 ? 1.234   2.248   -7.463  1.00 0.00 ? 106 SER A H    4  
ATOM 6957  H HA   . SER A 1 106 ? 0.352   1.517   -9.990  1.00 0.00 ? 106 SER A HA   4  
ATOM 6958  H HB2  . SER A 1 106 ? 2.611   0.864   -8.266  1.00 0.00 ? 106 SER A HB2  4  
ATOM 6959  H HB3  . SER A 1 106 ? 2.146   -0.487  -9.298  1.00 0.00 ? 106 SER A HB3  4  
ATOM 6960  H HG   . SER A 1 106 ? 2.350   2.067   -10.427 1.00 0.00 ? 106 SER A HG   4  
ATOM 6961  N N    . ASP A 1 107 ? -1.011  -0.547  -9.939  1.00 0.00 ? 107 ASP A N    4  
ATOM 6962  C CA   . ASP A 1 107 ? -1.906  -1.697  -9.899  1.00 0.00 ? 107 ASP A CA   4  
ATOM 6963  C C    . ASP A 1 107 ? -1.129  -2.981  -9.620  1.00 0.00 ? 107 ASP A C    4  
ATOM 6964  O O    . ASP A 1 107 ? -0.315  -3.413  -10.435 1.00 0.00 ? 107 ASP A O    4  
ATOM 6965  C CB   . ASP A 1 107 ? -2.668  -1.824  -11.218 1.00 0.00 ? 107 ASP A CB   4  
ATOM 6966  C CG   . ASP A 1 107 ? -3.154  -0.485  -11.735 1.00 0.00 ? 107 ASP A CG   4  
ATOM 6967  O OD1  . ASP A 1 107 ? -3.394  0.420   -10.910 1.00 0.00 ? 107 ASP A OD1  4  
ATOM 6968  O OD2  . ASP A 1 107 ? -3.296  -0.342  -12.968 1.00 0.00 ? 107 ASP A OD2  4  
ATOM 6969  H H    . ASP A 1 107 ? -0.960  -0.008  -10.757 1.00 0.00 ? 107 ASP A H    4  
ATOM 6970  H HA   . ASP A 1 107 ? -2.612  -1.538  -9.098  1.00 0.00 ? 107 ASP A HA   4  
ATOM 6971  H HB2  . ASP A 1 107 ? -2.019  -2.262  -11.960 1.00 0.00 ? 107 ASP A HB2  4  
ATOM 6972  H HB3  . ASP A 1 107 ? -3.525  -2.466  -11.069 1.00 0.00 ? 107 ASP A HB3  4  
ATOM 6973  N N    . ILE A 1 108 ? -1.385  -3.581  -8.462  1.00 0.00 ? 108 ILE A N    4  
ATOM 6974  C CA   . ILE A 1 108 ? -0.709  -4.815  -8.077  1.00 0.00 ? 108 ILE A CA   4  
ATOM 6975  C C    . ILE A 1 108 ? -1.701  -5.965  -7.944  1.00 0.00 ? 108 ILE A C    4  
ATOM 6976  O O    . ILE A 1 108 ? -2.862  -5.758  -7.595  1.00 0.00 ? 108 ILE A O    4  
ATOM 6977  C CB   . ILE A 1 108 ? 0.049   -4.648  -6.747  1.00 0.00 ? 108 ILE A CB   4  
ATOM 6978  C CG1  . ILE A 1 108 ? -0.900  -4.161  -5.651  1.00 0.00 ? 108 ILE A CG1  4  
ATOM 6979  C CG2  . ILE A 1 108 ? 1.212   -3.682  -6.917  1.00 0.00 ? 108 ILE A CG2  4  
ATOM 6980  C CD1  . ILE A 1 108 ? -0.383  -4.406  -4.251  1.00 0.00 ? 108 ILE A CD1  4  
ATOM 6981  H H    . ILE A 1 108 ? -2.044  -3.187  -7.854  1.00 0.00 ? 108 ILE A H    4  
ATOM 6982  H HA   . ILE A 1 108 ? 0.006   -5.057  -8.849  1.00 0.00 ? 108 ILE A HA   4  
ATOM 6983  H HB   . ILE A 1 108 ? 0.451   -5.611  -6.466  1.00 0.00 ? 108 ILE A HB   4  
ATOM 6984  H HG12 . ILE A 1 108 ? -1.057  -3.100  -5.765  1.00 0.00 ? 108 ILE A HG12 4  
ATOM 6985  H HG13 . ILE A 1 108 ? -1.846  -4.673  -5.750  1.00 0.00 ? 108 ILE A HG13 4  
ATOM 6986  H HG21 . ILE A 1 108 ? 1.712   -3.882  -7.854  1.00 0.00 ? 108 ILE A HG21 4  
ATOM 6987  H HG22 . ILE A 1 108 ? 0.840   -2.669  -6.919  1.00 0.00 ? 108 ILE A HG22 4  
ATOM 6988  H HG23 . ILE A 1 108 ? 1.909   -3.811  -6.103  1.00 0.00 ? 108 ILE A HG23 4  
ATOM 6989  H HD11 . ILE A 1 108 ? -1.204  -4.370  -3.551  1.00 0.00 ? 108 ILE A HD11 4  
ATOM 6990  H HD12 . ILE A 1 108 ? 0.088   -5.377  -4.205  1.00 0.00 ? 108 ILE A HD12 4  
ATOM 6991  H HD13 . ILE A 1 108 ? 0.340   -3.644  -3.996  1.00 0.00 ? 108 ILE A HD13 4  
ATOM 6992  N N    . GLN A 1 109 ? -1.233  -7.178  -8.225  1.00 0.00 ? 109 GLN A N    4  
ATOM 6993  C CA   . GLN A 1 109 ? -2.078  -8.361  -8.136  1.00 0.00 ? 109 GLN A CA   4  
ATOM 6994  C C    . GLN A 1 109 ? -1.360  -9.490  -7.402  1.00 0.00 ? 109 GLN A C    4  
ATOM 6995  O O    . GLN A 1 109 ? -0.199  -9.784  -7.681  1.00 0.00 ? 109 GLN A O    4  
ATOM 6996  C CB   . GLN A 1 109 ? -2.489  -8.828  -9.533  1.00 0.00 ? 109 GLN A CB   4  
ATOM 6997  C CG   . GLN A 1 109 ? -3.696  -8.089  -10.090 1.00 0.00 ? 109 GLN A CG   4  
ATOM 6998  C CD   . GLN A 1 109 ? -3.665  -7.977  -11.601 1.00 0.00 ? 109 GLN A CD   4  
ATOM 6999  O OE1  . GLN A 1 109 ? -4.440  -8.631  -12.300 1.00 0.00 ? 109 GLN A OE1  4  
ATOM 7000  N NE2  . GLN A 1 109 ? -2.767  -7.145  -12.115 1.00 0.00 ? 109 GLN A NE2  4  
ATOM 7001  H H    . GLN A 1 109 ? -0.298  -7.277  -8.498  1.00 0.00 ? 109 GLN A H    4  
ATOM 7002  H HA   . GLN A 1 109 ? -2.965  -8.096  -7.580  1.00 0.00 ? 109 GLN A HA   4  
ATOM 7003  H HB2  . GLN A 1 109 ? -1.659  -8.679  -10.208 1.00 0.00 ? 109 GLN A HB2  4  
ATOM 7004  H HB3  . GLN A 1 109 ? -2.728  -9.881  -9.493  1.00 0.00 ? 109 GLN A HB3  4  
ATOM 7005  H HG2  . GLN A 1 109 ? -4.591  -8.618  -9.801  1.00 0.00 ? 109 GLN A HG2  4  
ATOM 7006  H HG3  . GLN A 1 109 ? -3.718  -7.095  -9.671  1.00 0.00 ? 109 GLN A HG3  4  
ATOM 7007  H HE21 . GLN A 1 109 ? -2.181  -6.658  -11.499 1.00 0.00 ? 109 GLN A HE21 4  
ATOM 7008  H HE22 . GLN A 1 109 ? -2.725  -7.055  -13.090 1.00 0.00 ? 109 GLN A HE22 4  
ATOM 7009  N N    . VAL A 1 110 ? -2.060  -10.117 -6.461  1.00 0.00 ? 110 VAL A N    4  
ATOM 7010  C CA   . VAL A 1 110 ? -1.489  -11.214 -5.688  1.00 0.00 ? 110 VAL A CA   4  
ATOM 7011  C C    . VAL A 1 110 ? -2.399  -12.436 -5.713  1.00 0.00 ? 110 VAL A C    4  
ATOM 7012  O O    . VAL A 1 110 ? -3.605  -12.329 -5.489  1.00 0.00 ? 110 VAL A O    4  
ATOM 7013  C CB   . VAL A 1 110 ? -1.244  -10.799 -4.224  1.00 0.00 ? 110 VAL A CB   4  
ATOM 7014  C CG1  . VAL A 1 110 ? -2.540  -10.341 -3.574  1.00 0.00 ? 110 VAL A CG1  4  
ATOM 7015  C CG2  . VAL A 1 110 ? -0.623  -11.947 -3.443  1.00 0.00 ? 110 VAL A CG2  4  
ATOM 7016  H H    . VAL A 1 110 ? -2.983  -9.837  -6.285  1.00 0.00 ? 110 VAL A H    4  
ATOM 7017  H HA   . VAL A 1 110 ? -0.539  -11.475 -6.129  1.00 0.00 ? 110 VAL A HA   4  
ATOM 7018  H HB   . VAL A 1 110 ? -0.551  -9.971  -4.217  1.00 0.00 ? 110 VAL A HB   4  
ATOM 7019  H HG11 . VAL A 1 110 ? -2.365  -9.427  -3.026  1.00 0.00 ? 110 VAL A HG11 4  
ATOM 7020  H HG12 . VAL A 1 110 ? -3.284  -10.167 -4.338  1.00 0.00 ? 110 VAL A HG12 4  
ATOM 7021  H HG13 . VAL A 1 110 ? -2.893  -11.105 -2.898  1.00 0.00 ? 110 VAL A HG13 4  
ATOM 7022  H HG21 . VAL A 1 110 ? 0.227   -12.332 -3.984  1.00 0.00 ? 110 VAL A HG21 4  
ATOM 7023  H HG22 . VAL A 1 110 ? -0.304  -11.592 -2.474  1.00 0.00 ? 110 VAL A HG22 4  
ATOM 7024  H HG23 . VAL A 1 110 ? -1.354  -12.733 -3.315  1.00 0.00 ? 110 VAL A HG23 4  
ATOM 7025  N N    . ILE A 1 111 ? -1.813  -13.597 -5.986  1.00 0.00 ? 111 ILE A N    4  
ATOM 7026  C CA   . ILE A 1 111 ? -2.571  -14.841 -6.040  1.00 0.00 ? 111 ILE A CA   4  
ATOM 7027  C C    . ILE A 1 111 ? -2.706  -15.462 -4.653  1.00 0.00 ? 111 ILE A C    4  
ATOM 7028  O O    . ILE A 1 111 ? -1.776  -15.418 -3.848  1.00 0.00 ? 111 ILE A O    4  
ATOM 7029  C CB   . ILE A 1 111 ? -1.913  -15.862 -6.986  1.00 0.00 ? 111 ILE A CB   4  
ATOM 7030  C CG1  . ILE A 1 111 ? -1.811  -15.287 -8.400  1.00 0.00 ? 111 ILE A CG1  4  
ATOM 7031  C CG2  . ILE A 1 111 ? -2.700  -17.163 -6.992  1.00 0.00 ? 111 ILE A CG2  4  
ATOM 7032  C CD1  . ILE A 1 111 ? -0.427  -15.397 -8.998  1.00 0.00 ? 111 ILE A CD1  4  
ATOM 7033  H H    . ILE A 1 111 ? -0.849  -13.618 -6.156  1.00 0.00 ? 111 ILE A H    4  
ATOM 7034  H HA   . ILE A 1 111 ? -3.558  -14.613 -6.418  1.00 0.00 ? 111 ILE A HA   4  
ATOM 7035  H HB   . ILE A 1 111 ? -0.920  -16.071 -6.619  1.00 0.00 ? 111 ILE A HB   4  
ATOM 7036  H HG12 . ILE A 1 111 ? -2.494  -15.817 -9.046  1.00 0.00 ? 111 ILE A HG12 4  
ATOM 7037  H HG13 . ILE A 1 111 ? -2.082  -14.243 -8.377  1.00 0.00 ? 111 ILE A HG13 4  
ATOM 7038  H HG21 . ILE A 1 111 ? -2.665  -17.601 -7.978  1.00 0.00 ? 111 ILE A HG21 4  
ATOM 7039  H HG22 . ILE A 1 111 ? -2.267  -17.850 -6.279  1.00 0.00 ? 111 ILE A HG22 4  
ATOM 7040  H HG23 . ILE A 1 111 ? -3.727  -16.964 -6.722  1.00 0.00 ? 111 ILE A HG23 4  
ATOM 7041  H HD11 . ILE A 1 111 ? 0.246   -15.834 -8.275  1.00 0.00 ? 111 ILE A HD11 4  
ATOM 7042  H HD12 . ILE A 1 111 ? -0.462  -16.019 -9.880  1.00 0.00 ? 111 ILE A HD12 4  
ATOM 7043  H HD13 . ILE A 1 111 ? -0.072  -14.412 -9.268  1.00 0.00 ? 111 ILE A HD13 4  
ATOM 7044  N N    . THR A 1 112 ? -3.871  -16.043 -4.383  1.00 0.00 ? 112 THR A N    4  
ATOM 7045  C CA   . THR A 1 112 ? -4.128  -16.674 -3.094  1.00 0.00 ? 112 THR A CA   4  
ATOM 7046  C C    . THR A 1 112 ? -3.538  -18.079 -3.043  1.00 0.00 ? 112 THR A C    4  
ATOM 7047  O O    . THR A 1 112 ? -4.182  -19.046 -3.449  1.00 0.00 ? 112 THR A O    4  
ATOM 7048  C CB   . THR A 1 112 ? -5.637  -16.751 -2.798  1.00 0.00 ? 112 THR A CB   4  
ATOM 7049  O OG1  . THR A 1 112 ? -6.356  -17.072 -3.995  1.00 0.00 ? 112 THR A OG1  4  
ATOM 7050  C CG2  . THR A 1 112 ? -6.147  -15.435 -2.231  1.00 0.00 ? 112 THR A CG2  4  
ATOM 7051  H H    . THR A 1 112 ? -4.573  -16.046 -5.065  1.00 0.00 ? 112 THR A H    4  
ATOM 7052  H HA   . THR A 1 112 ? -3.662  -16.070 -2.328  1.00 0.00 ? 112 THR A HA   4  
ATOM 7053  H HB   . THR A 1 112 ? -5.806  -17.530 -2.066  1.00 0.00 ? 112 THR A HB   4  
ATOM 7054  H HG1  . THR A 1 112 ? -6.505  -16.272 -4.502  1.00 0.00 ? 112 THR A HG1  4  
ATOM 7055  H HG21 . THR A 1 112 ? -6.216  -15.508 -1.156  1.00 0.00 ? 112 THR A HG21 4  
ATOM 7056  H HG22 . THR A 1 112 ? -7.123  -15.221 -2.641  1.00 0.00 ? 112 THR A HG22 4  
ATOM 7057  H HG23 . THR A 1 112 ? -5.463  -14.642 -2.496  1.00 0.00 ? 112 THR A HG23 4  
ATOM 7058  N N    . GLN A 1 113 ? -2.312  -18.182 -2.541  1.00 0.00 ? 113 GLN A N    4  
ATOM 7059  C CA   . GLN A 1 113 ? -1.637  -19.471 -2.437  1.00 0.00 ? 113 GLN A CA   4  
ATOM 7060  C C    . GLN A 1 113 ? -0.791  -19.542 -1.170  1.00 0.00 ? 113 GLN A C    4  
ATOM 7061  O O    . GLN A 1 113 ? -0.115  -18.578 -0.806  1.00 0.00 ? 113 GLN A O    4  
ATOM 7062  C CB   . GLN A 1 113 ? -0.757  -19.710 -3.665  1.00 0.00 ? 113 GLN A CB   4  
ATOM 7063  C CG   . GLN A 1 113 ? 0.516   -18.879 -3.673  1.00 0.00 ? 113 GLN A CG   4  
ATOM 7064  C CD   . GLN A 1 113 ? 1.233   -18.922 -5.008  1.00 0.00 ? 113 GLN A CD   4  
ATOM 7065  O OE1  . GLN A 1 113 ? 0.628   -19.204 -6.042  1.00 0.00 ? 113 GLN A OE1  4  
ATOM 7066  N NE2  . GLN A 1 113 ? 2.531   -18.640 -4.994  1.00 0.00 ? 113 GLN A NE2  4  
ATOM 7067  H H    . GLN A 1 113 ? -1.851  -17.375 -2.234  1.00 0.00 ? 113 GLN A H    4  
ATOM 7068  H HA   . GLN A 1 113 ? -2.394  -20.239 -2.393  1.00 0.00 ? 113 GLN A HA   4  
ATOM 7069  H HB2  . GLN A 1 113 ? -0.481  -20.753 -3.699  1.00 0.00 ? 113 GLN A HB2  4  
ATOM 7070  H HB3  . GLN A 1 113 ? -1.324  -19.468 -4.552  1.00 0.00 ? 113 GLN A HB3  4  
ATOM 7071  H HG2  . GLN A 1 113 ? 0.263   -17.852 -3.451  1.00 0.00 ? 113 GLN A HG2  4  
ATOM 7072  H HG3  . GLN A 1 113 ? 1.182   -19.258 -2.911  1.00 0.00 ? 113 GLN A HG3  4  
ATOM 7073  H HE21 . GLN A 1 113 ? 2.947   -18.424 -4.132  1.00 0.00 ? 113 GLN A HE21 4  
ATOM 7074  H HE22 . GLN A 1 113 ? 3.019   -18.660 -5.841  1.00 0.00 ? 113 GLN A HE22 4  
ATOM 7075  N N    . THR A 1 114 ? -0.833  -20.689 -0.500  1.00 0.00 ? 114 THR A N    4  
ATOM 7076  C CA   . THR A 1 114 ? -0.071  -20.884 0.727   1.00 0.00 ? 114 THR A CA   4  
ATOM 7077  C C    . THR A 1 114 ? 1.366   -21.293 0.425   1.00 0.00 ? 114 THR A C    4  
ATOM 7078  O O    . THR A 1 114 ? 1.647   -22.462 0.162   1.00 0.00 ? 114 THR A O    4  
ATOM 7079  C CB   . THR A 1 114 ? -0.719  -21.956 1.626   1.00 0.00 ? 114 THR A CB   4  
ATOM 7080  O OG1  . THR A 1 114 ? -0.899  -23.170 0.888   1.00 0.00 ? 114 THR A OG1  4  
ATOM 7081  C CG2  . THR A 1 114 ? -2.061  -21.477 2.158   1.00 0.00 ? 114 THR A CG2  4  
ATOM 7082  H H    . THR A 1 114 ? -1.389  -21.421 -0.840  1.00 0.00 ? 114 THR A H    4  
ATOM 7083  H HA   . THR A 1 114 ? -0.063  -19.950 1.269   1.00 0.00 ? 114 THR A HA   4  
ATOM 7084  H HB   . THR A 1 114 ? -0.064  -22.148 2.463   1.00 0.00 ? 114 THR A HB   4  
ATOM 7085  H HG1  . THR A 1 114 ? -0.269  -23.826 1.191   1.00 0.00 ? 114 THR A HG1  4  
ATOM 7086  H HG21 . THR A 1 114 ? -2.269  -21.964 3.100   1.00 0.00 ? 114 THR A HG21 4  
ATOM 7087  H HG22 . THR A 1 114 ? -2.837  -21.718 1.447   1.00 0.00 ? 114 THR A HG22 4  
ATOM 7088  H HG23 . THR A 1 114 ? -2.028  -20.408 2.306   1.00 0.00 ? 114 THR A HG23 4  
ATOM 7089  N N    . GLY A 1 115 ? 2.273   -20.322 0.464   1.00 0.00 ? 115 GLY A N    4  
ATOM 7090  C CA   . GLY A 1 115 ? 3.670   -20.601 0.191   1.00 0.00 ? 115 GLY A CA   4  
ATOM 7091  C C    . GLY A 1 115 ? 4.421   -19.381 -0.303  1.00 0.00 ? 115 GLY A C    4  
ATOM 7092  O O    . GLY A 1 115 ? 3.914   -18.261 -0.230  1.00 0.00 ? 115 GLY A O    4  
ATOM 7093  H H    . GLY A 1 115 ? 1.991   -19.408 0.678   1.00 0.00 ? 115 GLY A H    4  
ATOM 7094  H HA2  . GLY A 1 115 ? 4.139   -20.956 1.096   1.00 0.00 ? 115 GLY A HA2  4  
ATOM 7095  H HA3  . GLY A 1 115 ? 3.731   -21.375 -0.561  1.00 0.00 ? 115 GLY A HA3  4  
ATOM 7096  N N    . SER A 1 116 ? 5.632   -19.595 -0.808  1.00 0.00 ? 116 SER A N    4  
ATOM 7097  C CA   . SER A 1 116 ? 6.455   -18.502 -1.311  1.00 0.00 ? 116 SER A CA   4  
ATOM 7098  C C    . SER A 1 116 ? 6.945   -18.798 -2.725  1.00 0.00 ? 116 SER A C    4  
ATOM 7099  O O    . SER A 1 116 ? 6.980   -19.950 -3.154  1.00 0.00 ? 116 SER A O    4  
ATOM 7100  C CB   . SER A 1 116 ? 7.648   -18.267 -0.385  1.00 0.00 ? 116 SER A CB   4  
ATOM 7101  O OG   . SER A 1 116 ? 7.281   -18.434 0.974   1.00 0.00 ? 116 SER A OG   4  
ATOM 7102  H H    . SER A 1 116 ? 5.980   -20.511 -0.839  1.00 0.00 ? 116 SER A H    4  
ATOM 7103  H HA   . SER A 1 116 ? 5.845   -17.611 -1.333  1.00 0.00 ? 116 SER A HA   4  
ATOM 7104  H HB2  . SER A 1 116 ? 8.431   -18.971 -0.622  1.00 0.00 ? 116 SER A HB2  4  
ATOM 7105  H HB3  . SER A 1 116 ? 8.017   -17.260 -0.524  1.00 0.00 ? 116 SER A HB3  4  
ATOM 7106  H HG   . SER A 1 116 ? 7.714   -19.214 1.329   1.00 0.00 ? 116 SER A HG   4  
ATOM 7107  N N    . GLY A 1 117 ? 7.321   -17.747 -3.447  1.00 0.00 ? 117 GLY A N    4  
ATOM 7108  C CA   . GLY A 1 117 ? 7.803   -17.912 -4.805  1.00 0.00 ? 117 GLY A CA   4  
ATOM 7109  C C    . GLY A 1 117 ? 8.591   -16.712 -5.292  1.00 0.00 ? 117 GLY A C    4  
ATOM 7110  O O    . GLY A 1 117 ? 8.612   -15.657 -4.658  1.00 0.00 ? 117 GLY A O    4  
ATOM 7111  H H    . GLY A 1 117 ? 7.270   -16.851 -3.053  1.00 0.00 ? 117 GLY A H    4  
ATOM 7112  H HA2  . GLY A 1 117 ? 8.436   -18.787 -4.847  1.00 0.00 ? 117 GLY A HA2  4  
ATOM 7113  H HA3  . GLY A 1 117 ? 6.957   -18.063 -5.459  1.00 0.00 ? 117 GLY A HA3  4  
ATOM 7114  N N    . PRO A 1 118 ? 9.261   -16.866 -6.444  1.00 0.00 ? 118 PRO A N    4  
ATOM 7115  C CA   . PRO A 1 118 ? 10.067  -15.797 -7.040  1.00 0.00 ? 118 PRO A CA   4  
ATOM 7116  C C    . PRO A 1 118 ? 9.210   -14.656 -7.577  1.00 0.00 ? 118 PRO A C    4  
ATOM 7117  O O    . PRO A 1 118 ? 9.484   -13.485 -7.315  1.00 0.00 ? 118 PRO A O    4  
ATOM 7118  C CB   . PRO A 1 118 ? 10.798  -16.501 -8.186  1.00 0.00 ? 118 PRO A CB   4  
ATOM 7119  C CG   . PRO A 1 118 ? 9.927   -17.657 -8.538  1.00 0.00 ? 118 PRO A CG   4  
ATOM 7120  C CD   . PRO A 1 118 ? 9.281   -18.097 -7.254  1.00 0.00 ? 118 PRO A CD   4  
ATOM 7121  H HA   . PRO A 1 118 ? 10.788  -15.406 -6.338  1.00 0.00 ? 118 PRO A HA   4  
ATOM 7122  H HB2  . PRO A 1 118 ? 10.910  -15.821 -9.018  1.00 0.00 ? 118 PRO A HB2  4  
ATOM 7123  H HB3  . PRO A 1 118 ? 11.770  -16.830 -7.850  1.00 0.00 ? 118 PRO A HB3  4  
ATOM 7124  H HG2  . PRO A 1 118 ? 9.174   -17.347 -9.248  1.00 0.00 ? 118 PRO A HG2  4  
ATOM 7125  H HG3  . PRO A 1 118 ? 10.525  -18.457 -8.950  1.00 0.00 ? 118 PRO A HG3  4  
ATOM 7126  H HD2  . PRO A 1 118 ? 8.279   -18.454 -7.438  1.00 0.00 ? 118 PRO A HD2  4  
ATOM 7127  H HD3  . PRO A 1 118 ? 9.875   -18.862 -6.776  1.00 0.00 ? 118 PRO A HD3  4  
ATOM 7128  N N    . SER A 1 119 ? 8.172   -15.005 -8.329  1.00 0.00 ? 119 SER A N    4  
ATOM 7129  C CA   . SER A 1 119 ? 7.277   -14.009 -8.907  1.00 0.00 ? 119 SER A CA   4  
ATOM 7130  C C    . SER A 1 119 ? 8.036   -13.072 -9.840  1.00 0.00 ? 119 SER A C    4  
ATOM 7131  O O    . SER A 1 119 ? 8.574   -12.052 -9.410  1.00 0.00 ? 119 SER A O    4  
ATOM 7132  C CB   . SER A 1 119 ? 6.596   -13.203 -7.799  1.00 0.00 ? 119 SER A CB   4  
ATOM 7133  O OG   . SER A 1 119 ? 5.335   -12.714 -8.225  1.00 0.00 ? 119 SER A OG   4  
ATOM 7134  H H    . SER A 1 119 ? 8.005   -15.955 -8.503  1.00 0.00 ? 119 SER A H    4  
ATOM 7135  H HA   . SER A 1 119 ? 6.523   -14.531 -9.475  1.00 0.00 ? 119 SER A HA   4  
ATOM 7136  H HB2  . SER A 1 119 ? 6.451   -13.833 -6.936  1.00 0.00 ? 119 SER A HB2  4  
ATOM 7137  H HB3  . SER A 1 119 ? 7.222   -12.363 -7.531  1.00 0.00 ? 119 SER A HB3  4  
ATOM 7138  H HG   . SER A 1 119 ? 5.456   -11.886 -8.696  1.00 0.00 ? 119 SER A HG   4  
ATOM 7139  N N    . SER A 1 120 ? 8.076   -13.426 -11.121 1.00 0.00 ? 120 SER A N    4  
ATOM 7140  C CA   . SER A 1 120 ? 8.772   -12.619 -12.116 1.00 0.00 ? 120 SER A CA   4  
ATOM 7141  C C    . SER A 1 120 ? 7.779   -11.863 -12.993 1.00 0.00 ? 120 SER A C    4  
ATOM 7142  O O    . SER A 1 120 ? 8.055   -11.580 -14.158 1.00 0.00 ? 120 SER A O    4  
ATOM 7143  C CB   . SER A 1 120 ? 9.667   -13.506 -12.985 1.00 0.00 ? 120 SER A CB   4  
ATOM 7144  O OG   . SER A 1 120 ? 8.893   -14.387 -13.780 1.00 0.00 ? 120 SER A OG   4  
ATOM 7145  H H    . SER A 1 120 ? 7.627   -14.252 -11.402 1.00 0.00 ? 120 SER A H    4  
ATOM 7146  H HA   . SER A 1 120 ? 9.389   -11.905 -11.591 1.00 0.00 ? 120 SER A HA   4  
ATOM 7147  H HB2  . SER A 1 120 ? 10.262  -12.884 -13.635 1.00 0.00 ? 120 SER A HB2  4  
ATOM 7148  H HB3  . SER A 1 120 ? 10.317  -14.089 -12.350 1.00 0.00 ? 120 SER A HB3  4  
ATOM 7149  H HG   . SER A 1 120 ? 8.787   -14.016 -14.660 1.00 0.00 ? 120 SER A HG   4  
ATOM 7150  N N    . GLY A 1 121 ? 6.624   -11.538 -12.423 1.00 0.00 ? 121 GLY A N    4  
ATOM 7151  C CA   . GLY A 1 121 ? 5.607   -10.817 -13.167 1.00 0.00 ? 121 GLY A CA   4  
ATOM 7152  C C    . GLY A 1 121 ? 5.144   -11.572 -14.396 1.00 0.00 ? 121 GLY A C    4  
ATOM 7153  O O    . GLY A 1 121 ? 5.224   -12.799 -14.447 1.00 0.00 ? 121 GLY A O    4  
ATOM 7154  H H    . GLY A 1 121 ? 6.459   -11.789 -11.490 1.00 0.00 ? 121 GLY A H    4  
ATOM 7155  H HA2  . GLY A 1 121 ? 4.758   -10.645 -12.521 1.00 0.00 ? 121 GLY A HA2  4  
ATOM 7156  H HA3  . GLY A 1 121 ? 6.011   -9.864  -13.475 1.00 0.00 ? 121 GLY A HA3  4  
ATOM 7157  N N    . GLY A 1 1   ? 16.629  1.883   2.652   1.00 0.00 ? 1   GLY A N    5  
ATOM 7158  C CA   . GLY A 1 1   ? 16.358  1.769   1.232   1.00 0.00 ? 1   GLY A CA   5  
ATOM 7159  C C    . GLY A 1 1   ? 17.553  1.258   0.452   1.00 0.00 ? 1   GLY A C    5  
ATOM 7160  O O    . GLY A 1 1   ? 18.295  0.401   0.933   1.00 0.00 ? 1   GLY A O    5  
ATOM 7161  H H1   . GLY A 1 1   ? 16.828  2.761   3.043   1.00 0.00 ? 1   GLY A H1   5  
ATOM 7162  H HA2  . GLY A 1 1   ? 15.531  1.091   1.088   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7163  H HA3  . GLY A 1 1   ? 16.085  2.742   0.850   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7164  N N    . SER A 1 2   ? 17.739  1.782   -0.754  1.00 0.00 ? 2   SER A N    5  
ATOM 7165  C CA   . SER A 1 2   ? 18.850  1.369   -1.604  1.00 0.00 ? 2   SER A CA   5  
ATOM 7166  C C    . SER A 1 2   ? 19.277  2.504   -2.530  1.00 0.00 ? 2   SER A C    5  
ATOM 7167  O O    . SER A 1 2   ? 20.458  2.846   -2.608  1.00 0.00 ? 2   SER A O    5  
ATOM 7168  C CB   . SER A 1 2   ? 18.459  0.142   -2.432  1.00 0.00 ? 2   SER A CB   5  
ATOM 7169  O OG   . SER A 1 2   ? 19.550  -0.318  -3.208  1.00 0.00 ? 2   SER A OG   5  
ATOM 7170  H H    . SER A 1 2   ? 17.113  2.461   -1.081  1.00 0.00 ? 2   SER A H    5  
ATOM 7171  H HA   . SER A 1 2   ? 19.680  1.111   -0.964  1.00 0.00 ? 2   SER A HA   5  
ATOM 7172  H HB2  . SER A 1 2   ? 18.144  -0.649  -1.769  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7173  H HB3  . SER A 1 2   ? 17.645  0.403   -3.092  1.00 0.00 ? 2   SER A HB3  5  
ATOM 7174  H HG   . SER A 1 2   ? 19.234  -0.601  -4.069  1.00 0.00 ? 2   SER A HG   5  
ATOM 7175  N N    . SER A 1 3   ? 18.309  3.085   -3.230  1.00 0.00 ? 3   SER A N    5  
ATOM 7176  C CA   . SER A 1 3   ? 18.584  4.180   -4.153  1.00 0.00 ? 3   SER A CA   5  
ATOM 7177  C C    . SER A 1 3   ? 18.110  5.510   -3.575  1.00 0.00 ? 3   SER A C    5  
ATOM 7178  O O    . SER A 1 3   ? 16.912  5.742   -3.422  1.00 0.00 ? 3   SER A O    5  
ATOM 7179  C CB   . SER A 1 3   ? 17.903  3.924   -5.500  1.00 0.00 ? 3   SER A CB   5  
ATOM 7180  O OG   . SER A 1 3   ? 18.830  4.017   -6.566  1.00 0.00 ? 3   SER A OG   5  
ATOM 7181  H H    . SER A 1 3   ? 17.387  2.768   -3.125  1.00 0.00 ? 3   SER A H    5  
ATOM 7182  H HA   . SER A 1 3   ? 19.652  4.227   -4.303  1.00 0.00 ? 3   SER A HA   5  
ATOM 7183  H HB2  . SER A 1 3   ? 17.471  2.936   -5.498  1.00 0.00 ? 3   SER A HB2  5  
ATOM 7184  H HB3  . SER A 1 3   ? 17.123  4.658   -5.649  1.00 0.00 ? 3   SER A HB3  5  
ATOM 7185  H HG   . SER A 1 3   ? 18.864  3.180   -7.035  1.00 0.00 ? 3   SER A HG   5  
ATOM 7186  N N    . GLY A 1 4   ? 19.062  6.382   -3.255  1.00 0.00 ? 4   GLY A N    5  
ATOM 7187  C CA   . GLY A 1 4   ? 18.725  7.679   -2.698  1.00 0.00 ? 4   GLY A CA   5  
ATOM 7188  C C    . GLY A 1 4   ? 18.731  7.677   -1.183  1.00 0.00 ? 4   GLY A C    5  
ATOM 7189  O O    . GLY A 1 4   ? 17.922  6.998   -0.552  1.00 0.00 ? 4   GLY A O    5  
ATOM 7190  H H    . GLY A 1 4   ? 20.002  6.143   -3.400  1.00 0.00 ? 4   GLY A H    5  
ATOM 7191  H HA2  . GLY A 1 4   ? 19.438  8.407   -3.051  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7192  H HA3  . GLY A 1 4   ? 17.739  7.959   -3.042  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7193  N N    . SER A 1 5   ? 19.649  8.440   -0.596  1.00 0.00 ? 5   SER A N    5  
ATOM 7194  C CA   . SER A 1 5   ? 19.763  8.520   0.855   1.00 0.00 ? 5   SER A CA   5  
ATOM 7195  C C    . SER A 1 5   ? 19.420  9.921   1.350   1.00 0.00 ? 5   SER A C    5  
ATOM 7196  O O    . SER A 1 5   ? 18.954  10.097  2.476   1.00 0.00 ? 5   SER A O    5  
ATOM 7197  C CB   . SER A 1 5   ? 21.178  8.141   1.298   1.00 0.00 ? 5   SER A CB   5  
ATOM 7198  O OG   . SER A 1 5   ? 21.146  7.304   2.442   1.00 0.00 ? 5   SER A OG   5  
ATOM 7199  H H    . SER A 1 5   ? 20.268  8.958   -1.154  1.00 0.00 ? 5   SER A H    5  
ATOM 7200  H HA   . SER A 1 5   ? 19.061  7.818   1.282   1.00 0.00 ? 5   SER A HA   5  
ATOM 7201  H HB2  . SER A 1 5   ? 21.676  7.618   0.497   1.00 0.00 ? 5   SER A HB2  5  
ATOM 7202  H HB3  . SER A 1 5   ? 21.728  9.039   1.540   1.00 0.00 ? 5   SER A HB3  5  
ATOM 7203  H HG   . SER A 1 5   ? 20.425  6.676   2.359   1.00 0.00 ? 5   SER A HG   5  
ATOM 7204  N N    . SER A 1 6   ? 19.655  10.916  0.500   1.00 0.00 ? 6   SER A N    5  
ATOM 7205  C CA   . SER A 1 6   ? 19.374  12.303  0.851   1.00 0.00 ? 6   SER A CA   5  
ATOM 7206  C C    . SER A 1 6   ? 18.721  13.039  -0.316  1.00 0.00 ? 6   SER A C    5  
ATOM 7207  O O    . SER A 1 6   ? 18.368  12.431  -1.326  1.00 0.00 ? 6   SER A O    5  
ATOM 7208  C CB   . SER A 1 6   ? 20.664  13.018  1.262   1.00 0.00 ? 6   SER A CB   5  
ATOM 7209  O OG   . SER A 1 6   ? 20.533  13.609  2.542   1.00 0.00 ? 6   SER A OG   5  
ATOM 7210  H H    . SER A 1 6   ? 20.026  10.712  -0.383  1.00 0.00 ? 6   SER A H    5  
ATOM 7211  H HA   . SER A 1 6   ? 18.691  12.303  1.688   1.00 0.00 ? 6   SER A HA   5  
ATOM 7212  H HB2  . SER A 1 6   ? 21.474  12.306  1.289   1.00 0.00 ? 6   SER A HB2  5  
ATOM 7213  H HB3  . SER A 1 6   ? 20.888  13.792  0.541   1.00 0.00 ? 6   SER A HB3  5  
ATOM 7214  H HG   . SER A 1 6   ? 20.809  14.529  2.501   1.00 0.00 ? 6   SER A HG   5  
ATOM 7215  N N    . GLY A 1 7   ? 18.565  14.350  -0.168  1.00 0.00 ? 7   GLY A N    5  
ATOM 7216  C CA   . GLY A 1 7   ? 17.955  15.148  -1.217  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7217  C C    . GLY A 1 7   ? 17.471  16.494  -0.714  1.00 0.00 ? 7   GLY A C    5  
ATOM 7218  O O    . GLY A 1 7   ? 17.590  16.818  0.468   1.00 0.00 ? 7   GLY A O    5  
ATOM 7219  H H    . GLY A 1 7   ? 18.866  14.780  0.659   1.00 0.00 ? 7   GLY A H    5  
ATOM 7220  H HA2  . GLY A 1 7   ? 18.680  15.306  -2.000  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7221  H HA3  . GLY A 1 7   ? 17.115  14.604  -1.622  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7222  N N    . PRO A 1 8   ? 16.911  17.302  -1.625  1.00 0.00 ? 8   PRO A N    5  
ATOM 7223  C CA   . PRO A 1 8   ? 16.397  18.634  -1.292  1.00 0.00 ? 8   PRO A CA   5  
ATOM 7224  C C    . PRO A 1 8   ? 15.139  18.572  -0.430  1.00 0.00 ? 8   PRO A C    5  
ATOM 7225  O O    . PRO A 1 8   ? 14.476  17.537  -0.357  1.00 0.00 ? 8   PRO A O    5  
ATOM 7226  C CB   . PRO A 1 8   ? 16.079  19.244  -2.658  1.00 0.00 ? 8   PRO A CB   5  
ATOM 7227  C CG   . PRO A 1 8   ? 15.833  18.075  -3.547  1.00 0.00 ? 8   PRO A CG   5  
ATOM 7228  C CD   . PRO A 1 8   ? 16.736  16.981  -3.051  1.00 0.00 ? 8   PRO A CD   5  
ATOM 7229  H HA   . PRO A 1 8   ? 17.144  19.234  -0.792  1.00 0.00 ? 8   PRO A HA   5  
ATOM 7230  H HB2  . PRO A 1 8   ? 15.203  19.874  -2.579  1.00 0.00 ? 8   PRO A HB2  5  
ATOM 7231  H HB3  . PRO A 1 8   ? 16.919  19.829  -2.999  1.00 0.00 ? 8   PRO A HB3  5  
ATOM 7232  H HG2  . PRO A 1 8   ? 14.799  17.770  -3.476  1.00 0.00 ? 8   PRO A HG2  5  
ATOM 7233  H HG3  . PRO A 1 8   ? 16.080  18.331  -4.566  1.00 0.00 ? 8   PRO A HG3  5  
ATOM 7234  H HD2  . PRO A 1 8   ? 16.264  16.017  -3.173  1.00 0.00 ? 8   PRO A HD2  5  
ATOM 7235  H HD3  . PRO A 1 8   ? 17.683  17.006  -3.571  1.00 0.00 ? 8   PRO A HD3  5  
ATOM 7236  N N    . VAL A 1 9   ? 14.817  19.684  0.221   1.00 0.00 ? 9   VAL A N    5  
ATOM 7237  C CA   . VAL A 1 9   ? 13.638  19.756  1.074   1.00 0.00 ? 9   VAL A CA   5  
ATOM 7238  C C    . VAL A 1 9   ? 12.826  21.014  0.788   1.00 0.00 ? 9   VAL A C    5  
ATOM 7239  O O    . VAL A 1 9   ? 13.380  22.058  0.441   1.00 0.00 ? 9   VAL A O    5  
ATOM 7240  C CB   . VAL A 1 9   ? 14.023  19.737  2.567   1.00 0.00 ? 9   VAL A CB   5  
ATOM 7241  C CG1  . VAL A 1 9   ? 14.704  18.425  2.926   1.00 0.00 ? 9   VAL A CG1  5  
ATOM 7242  C CG2  . VAL A 1 9   ? 14.919  20.921  2.899   1.00 0.00 ? 9   VAL A CG2  5  
ATOM 7243  H H    . VAL A 1 9   ? 15.385  20.476  0.123   1.00 0.00 ? 9   VAL A H    5  
ATOM 7244  H HA   . VAL A 1 9   ? 13.025  18.890  0.872   1.00 0.00 ? 9   VAL A HA   5  
ATOM 7245  H HB   . VAL A 1 9   ? 13.119  19.820  3.152   1.00 0.00 ? 9   VAL A HB   5  
ATOM 7246  H HG11 . VAL A 1 9   ? 14.235  17.617  2.384   1.00 0.00 ? 9   VAL A HG11 5  
ATOM 7247  H HG12 . VAL A 1 9   ? 15.751  18.478  2.660   1.00 0.00 ? 9   VAL A HG12 5  
ATOM 7248  H HG13 . VAL A 1 9   ? 14.610  18.250  3.987   1.00 0.00 ? 9   VAL A HG13 5  
ATOM 7249  H HG21 . VAL A 1 9   ? 15.702  20.998  2.160   1.00 0.00 ? 9   VAL A HG21 5  
ATOM 7250  H HG22 . VAL A 1 9   ? 14.331  21.828  2.900   1.00 0.00 ? 9   VAL A HG22 5  
ATOM 7251  H HG23 . VAL A 1 9   ? 15.357  20.777  3.876   1.00 0.00 ? 9   VAL A HG23 5  
ATOM 7252  N N    . LEU A 1 10  ? 11.510  20.908  0.932   1.00 0.00 ? 10  LEU A N    5  
ATOM 7253  C CA   . LEU A 1 10  ? 10.620  22.038  0.690   1.00 0.00 ? 10  LEU A CA   5  
ATOM 7254  C C    . LEU A 1 10  ? 9.304   21.867  1.443   1.00 0.00 ? 10  LEU A C    5  
ATOM 7255  O O    . LEU A 1 10  ? 8.840   20.747  1.658   1.00 0.00 ? 10  LEU A O    5  
ATOM 7256  C CB   . LEU A 1 10  ? 10.348  22.184  -0.808  1.00 0.00 ? 10  LEU A CB   5  
ATOM 7257  C CG   . LEU A 1 10  ? 10.613  23.566  -1.407  1.00 0.00 ? 10  LEU A CG   5  
ATOM 7258  C CD1  . LEU A 1 10  ? 11.993  23.616  -2.045  1.00 0.00 ? 10  LEU A CD1  5  
ATOM 7259  C CD2  . LEU A 1 10  ? 9.539   23.921  -2.426  1.00 0.00 ? 10  LEU A CD2  5  
ATOM 7260  H H    . LEU A 1 10  ? 11.127  20.051  1.212   1.00 0.00 ? 10  LEU A H    5  
ATOM 7261  H HA   . LEU A 1 10  ? 11.112  22.931  1.047   1.00 0.00 ? 10  LEU A HA   5  
ATOM 7262  H HB2  . LEU A 1 10  ? 10.970  21.474  -1.329  1.00 0.00 ? 10  LEU A HB2  5  
ATOM 7263  H HB3  . LEU A 1 10  ? 9.308   21.942  -0.980  1.00 0.00 ? 10  LEU A HB3  5  
ATOM 7264  H HG   . LEU A 1 10  ? 10.584  24.305  -0.619  1.00 0.00 ? 10  LEU A HG   5  
ATOM 7265  H HD11 . LEU A 1 10  ? 12.747  23.523  -1.277  1.00 0.00 ? 10  LEU A HD11 5  
ATOM 7266  H HD12 . LEU A 1 10  ? 12.118  24.557  -2.561  1.00 0.00 ? 10  LEU A HD12 5  
ATOM 7267  H HD13 . LEU A 1 10  ? 12.092  22.803  -2.750  1.00 0.00 ? 10  LEU A HD13 5  
ATOM 7268  H HD21 . LEU A 1 10  ? 9.589   23.231  -3.255  1.00 0.00 ? 10  LEU A HD21 5  
ATOM 7269  H HD22 . LEU A 1 10  ? 9.703   24.927  -2.786  1.00 0.00 ? 10  LEU A HD22 5  
ATOM 7270  H HD23 . LEU A 1 10  ? 8.567   23.858  -1.961  1.00 0.00 ? 10  LEU A HD23 5  
ATOM 7271  N N    . THR A 1 11  ? 8.707   22.986  1.840   1.00 0.00 ? 11  THR A N    5  
ATOM 7272  C CA   . THR A 1 11  ? 7.445   22.962  2.569   1.00 0.00 ? 11  THR A CA   5  
ATOM 7273  C C    . THR A 1 11  ? 6.428   23.908  1.941   1.00 0.00 ? 11  THR A C    5  
ATOM 7274  O O    . THR A 1 11  ? 6.781   24.995  1.481   1.00 0.00 ? 11  THR A O    5  
ATOM 7275  C CB   . THR A 1 11  ? 7.642   23.346  4.046   1.00 0.00 ? 11  THR A CB   5  
ATOM 7276  O OG1  . THR A 1 11  ? 6.380   23.350  4.724   1.00 0.00 ? 11  THR A OG1  5  
ATOM 7277  C CG2  . THR A 1 11  ? 8.294   24.714  4.169   1.00 0.00 ? 11  THR A CG2  5  
ATOM 7278  H H    . THR A 1 11  ? 9.126   23.849  1.639   1.00 0.00 ? 11  THR A H    5  
ATOM 7279  H HA   . THR A 1 11  ? 7.056   21.954  2.528   1.00 0.00 ? 11  THR A HA   5  
ATOM 7280  H HB   . THR A 1 11  ? 8.288   22.614  4.510   1.00 0.00 ? 11  THR A HB   5  
ATOM 7281  H HG1  . THR A 1 11  ? 5.833   24.058  4.375   1.00 0.00 ? 11  THR A HG1  5  
ATOM 7282  H HG21 . THR A 1 11  ? 8.325   25.187  3.196   1.00 0.00 ? 11  THR A HG21 5  
ATOM 7283  H HG22 . THR A 1 11  ? 9.297   24.603  4.547   1.00 0.00 ? 11  THR A HG22 5  
ATOM 7284  H HG23 . THR A 1 11  ? 7.719   25.327  4.846   1.00 0.00 ? 11  THR A HG23 5  
ATOM 7285  N N    . GLN A 1 12  ? 5.167   23.489  1.923   1.00 0.00 ? 12  GLN A N    5  
ATOM 7286  C CA   . GLN A 1 12  ? 4.101   24.301  1.350   1.00 0.00 ? 12  GLN A CA   5  
ATOM 7287  C C    . GLN A 1 12  ? 3.418   25.140  2.426   1.00 0.00 ? 12  GLN A C    5  
ATOM 7288  O O    . GLN A 1 12  ? 3.620   24.922  3.620   1.00 0.00 ? 12  GLN A O    5  
ATOM 7289  C CB   . GLN A 1 12  ? 3.072   23.411  0.652   1.00 0.00 ? 12  GLN A CB   5  
ATOM 7290  C CG   . GLN A 1 12  ? 2.998   23.629  -0.851  1.00 0.00 ? 12  GLN A CG   5  
ATOM 7291  C CD   . GLN A 1 12  ? 1.830   22.901  -1.489  1.00 0.00 ? 12  GLN A CD   5  
ATOM 7292  O OE1  . GLN A 1 12  ? 0.903   22.468  -0.803  1.00 0.00 ? 12  GLN A OE1  5  
ATOM 7293  N NE2  . GLN A 1 12  ? 1.868   22.764  -2.809  1.00 0.00 ? 12  GLN A NE2  5  
ATOM 7294  H H    . GLN A 1 12  ? 4.950   22.612  2.304   1.00 0.00 ? 12  GLN A H    5  
ATOM 7295  H HA   . GLN A 1 12  ? 4.543   24.963  0.621   1.00 0.00 ? 12  GLN A HA   5  
ATOM 7296  H HB2  . GLN A 1 12  ? 3.327   22.376  0.832   1.00 0.00 ? 12  GLN A HB2  5  
ATOM 7297  H HB3  . GLN A 1 12  ? 2.096   23.610  1.071   1.00 0.00 ? 12  GLN A HB3  5  
ATOM 7298  H HG2  . GLN A 1 12  ? 2.890   24.686  -1.044  1.00 0.00 ? 12  GLN A HG2  5  
ATOM 7299  H HG3  . GLN A 1 12  ? 3.912   23.273  -1.299  1.00 0.00 ? 12  GLN A HG3  5  
ATOM 7300  H HE21 . GLN A 1 12  ? 2.638   23.135  -3.291  1.00 0.00 ? 12  GLN A HE21 5  
ATOM 7301  H HE22 . GLN A 1 12  ? 1.127   22.298  -3.247  1.00 0.00 ? 12  GLN A HE22 5  
ATOM 7302  N N    . THR A 1 13  ? 2.608   26.102  1.993   1.00 0.00 ? 13  THR A N    5  
ATOM 7303  C CA   . THR A 1 13  ? 1.898   26.975  2.919   1.00 0.00 ? 13  THR A CA   5  
ATOM 7304  C C    . THR A 1 13  ? 0.533   26.398  3.279   1.00 0.00 ? 13  THR A C    5  
ATOM 7305  O O    . THR A 1 13  ? 0.313   25.956  4.406   1.00 0.00 ? 13  THR A O    5  
ATOM 7306  C CB   . THR A 1 13  ? 1.706   28.384  2.326   1.00 0.00 ? 13  THR A CB   5  
ATOM 7307  O OG1  . THR A 1 13  ? 1.574   28.304  0.904   1.00 0.00 ? 13  THR A OG1  5  
ATOM 7308  C CG2  . THR A 1 13  ? 2.881   29.285  2.682   1.00 0.00 ? 13  THR A CG2  5  
ATOM 7309  H H    . THR A 1 13  ? 2.488   26.226  1.030   1.00 0.00 ? 13  THR A H    5  
ATOM 7310  H HA   . THR A 1 13  ? 2.490   27.062  3.818   1.00 0.00 ? 13  THR A HA   5  
ATOM 7311  H HB   . THR A 1 13  ? 0.806   28.813  2.741   1.00 0.00 ? 13  THR A HB   5  
ATOM 7312  H HG1  . THR A 1 13  ? 2.446   28.296  0.500   1.00 0.00 ? 13  THR A HG1  5  
ATOM 7313  H HG21 . THR A 1 13  ? 3.576   29.313  1.856   1.00 0.00 ? 13  THR A HG21 5  
ATOM 7314  H HG22 . THR A 1 13  ? 3.379   28.897  3.559   1.00 0.00 ? 13  THR A HG22 5  
ATOM 7315  H HG23 . THR A 1 13  ? 2.520   30.281  2.884   1.00 0.00 ? 13  THR A HG23 5  
ATOM 7316  N N    . SER A 1 14  ? -0.382  26.407  2.316   1.00 0.00 ? 14  SER A N    5  
ATOM 7317  C CA   . SER A 1 14  ? -1.727  25.888  2.533   1.00 0.00 ? 14  SER A CA   5  
ATOM 7318  C C    . SER A 1 14  ? -1.764  24.376  2.338   1.00 0.00 ? 14  SER A C    5  
ATOM 7319  O O    . SER A 1 14  ? -1.171  23.846  1.399   1.00 0.00 ? 14  SER A O    5  
ATOM 7320  C CB   . SER A 1 14  ? -2.717  26.560  1.580   1.00 0.00 ? 14  SER A CB   5  
ATOM 7321  O OG   . SER A 1 14  ? -2.266  26.482  0.239   1.00 0.00 ? 14  SER A OG   5  
ATOM 7322  H H    . SER A 1 14  ? -0.147  26.774  1.437   1.00 0.00 ? 14  SER A H    5  
ATOM 7323  H HA   . SER A 1 14  ? -2.009  26.114  3.551   1.00 0.00 ? 14  SER A HA   5  
ATOM 7324  H HB2  . SER A 1 14  ? -3.675  26.070  1.654   1.00 0.00 ? 14  SER A HB2  5  
ATOM 7325  H HB3  . SER A 1 14  ? -2.824  27.601  1.852   1.00 0.00 ? 14  SER A HB3  5  
ATOM 7326  H HG   . SER A 1 14  ? -2.675  27.181  -0.277  1.00 0.00 ? 14  SER A HG   5  
ATOM 7327  N N    . GLU A 1 15  ? -2.465  23.686  3.233   1.00 0.00 ? 15  GLU A N    5  
ATOM 7328  C CA   . GLU A 1 15  ? -2.578  22.234  3.159   1.00 0.00 ? 15  GLU A CA   5  
ATOM 7329  C C    . GLU A 1 15  ? -3.637  21.821  2.142   1.00 0.00 ? 15  GLU A C    5  
ATOM 7330  O O    . GLU A 1 15  ? -4.794  22.235  2.233   1.00 0.00 ? 15  GLU A O    5  
ATOM 7331  C CB   . GLU A 1 15  ? -2.923  21.657  4.534   1.00 0.00 ? 15  GLU A CB   5  
ATOM 7332  C CG   . GLU A 1 15  ? -1.827  21.852  5.569   1.00 0.00 ? 15  GLU A CG   5  
ATOM 7333  C CD   . GLU A 1 15  ? -1.981  23.144  6.345   1.00 0.00 ? 15  GLU A CD   5  
ATOM 7334  O OE1  . GLU A 1 15  ? -2.845  23.963  5.969   1.00 0.00 ? 15  GLU A OE1  5  
ATOM 7335  O OE2  . GLU A 1 15  ? -1.238  23.336  7.330   1.00 0.00 ? 15  GLU A OE2  5  
ATOM 7336  H H    . GLU A 1 15  ? -2.916  24.165  3.958   1.00 0.00 ? 15  GLU A H    5  
ATOM 7337  H HA   . GLU A 1 15  ? -1.623  21.843  2.844   1.00 0.00 ? 15  GLU A HA   5  
ATOM 7338  H HB2  . GLU A 1 15  ? -3.821  22.135  4.896   1.00 0.00 ? 15  GLU A HB2  5  
ATOM 7339  H HB3  . GLU A 1 15  ? -3.108  20.598  4.430   1.00 0.00 ? 15  GLU A HB3  5  
ATOM 7340  H HG2  . GLU A 1 15  ? -1.855  21.027  6.264   1.00 0.00 ? 15  GLU A HG2  5  
ATOM 7341  H HG3  . GLU A 1 15  ? -0.872  21.864  5.064   1.00 0.00 ? 15  GLU A HG3  5  
ATOM 7342  N N    . GLN A 1 16  ? -3.235  21.007  1.172   1.00 0.00 ? 16  GLN A N    5  
ATOM 7343  C CA   . GLN A 1 16  ? -4.149  20.540  0.137   1.00 0.00 ? 16  GLN A CA   5  
ATOM 7344  C C    . GLN A 1 16  ? -4.206  19.016  0.109   1.00 0.00 ? 16  GLN A C    5  
ATOM 7345  O O    . GLN A 1 16  ? -3.564  18.347  0.916   1.00 0.00 ? 16  GLN A O    5  
ATOM 7346  C CB   . GLN A 1 16  ? -3.718  21.072  -1.230  1.00 0.00 ? 16  GLN A CB   5  
ATOM 7347  C CG   . GLN A 1 16  ? -4.584  22.211  -1.742  1.00 0.00 ? 16  GLN A CG   5  
ATOM 7348  C CD   . GLN A 1 16  ? -4.115  22.746  -3.080  1.00 0.00 ? 16  GLN A CD   5  
ATOM 7349  O OE1  . GLN A 1 16  ? -3.696  21.986  -3.953  1.00 0.00 ? 16  GLN A OE1  5  
ATOM 7350  N NE2  . GLN A 1 16  ? -4.183  24.061  -3.248  1.00 0.00 ? 16  GLN A NE2  5  
ATOM 7351  H H    . GLN A 1 16  ? -2.301  20.714  1.153   1.00 0.00 ? 16  GLN A H    5  
ATOM 7352  H HA   . GLN A 1 16  ? -5.131  20.921  0.367   1.00 0.00 ? 16  GLN A HA   5  
ATOM 7353  H HB2  . GLN A 1 16  ? -2.700  21.424  -1.162  1.00 0.00 ? 16  GLN A HB2  5  
ATOM 7354  H HB3  . GLN A 1 16  ? -3.763  20.264  -1.948  1.00 0.00 ? 16  GLN A HB3  5  
ATOM 7355  H HG2  . GLN A 1 16  ? -5.597  21.856  -1.849  1.00 0.00 ? 16  GLN A HG2  5  
ATOM 7356  H HG3  . GLN A 1 16  ? -4.559  23.015  -1.021  1.00 0.00 ? 16  GLN A HG3  5  
ATOM 7357  H HE21 . GLN A 1 16  ? -4.527  24.606  -2.508  1.00 0.00 ? 16  GLN A HE21 5  
ATOM 7358  H HE22 . GLN A 1 16  ? -3.885  24.435  -4.104  1.00 0.00 ? 16  GLN A HE22 5  
ATOM 7359  N N    . ALA A 1 17  ? -4.981  18.476  -0.825  1.00 0.00 ? 17  ALA A N    5  
ATOM 7360  C CA   . ALA A 1 17  ? -5.122  17.031  -0.961  1.00 0.00 ? 17  ALA A CA   5  
ATOM 7361  C C    . ALA A 1 17  ? -3.797  16.385  -1.353  1.00 0.00 ? 17  ALA A C    5  
ATOM 7362  O O    . ALA A 1 17  ? -2.891  17.037  -1.872  1.00 0.00 ? 17  ALA A O    5  
ATOM 7363  C CB   . ALA A 1 17  ? -6.197  16.698  -1.985  1.00 0.00 ? 17  ALA A CB   5  
ATOM 7364  H H    . ALA A 1 17  ? -5.468  19.063  -1.441  1.00 0.00 ? 17  ALA A H    5  
ATOM 7365  H HA   . ALA A 1 17  ? -5.435  16.637  -0.004  1.00 0.00 ? 17  ALA A HA   5  
ATOM 7366  H HB1  . ALA A 1 17  ? -7.138  16.536  -1.477  1.00 0.00 ? 17  ALA A HB1  5  
ATOM 7367  H HB2  . ALA A 1 17  ? -6.299  17.519  -2.679  1.00 0.00 ? 17  ALA A HB2  5  
ATOM 7368  H HB3  . ALA A 1 17  ? -5.918  15.805  -2.521  1.00 0.00 ? 17  ALA A HB3  5  
ATOM 7369  N N    . PRO A 1 18  ? -3.679  15.073  -1.100  1.00 0.00 ? 18  PRO A N    5  
ATOM 7370  C CA   . PRO A 1 18  ? -2.470  14.311  -1.419  1.00 0.00 ? 18  PRO A CA   5  
ATOM 7371  C C    . PRO A 1 18  ? -2.272  14.138  -2.921  1.00 0.00 ? 18  PRO A C    5  
ATOM 7372  O O    . PRO A 1 18  ? -3.128  13.582  -3.609  1.00 0.00 ? 18  PRO A O    5  
ATOM 7373  C CB   . PRO A 1 18  ? -2.719  12.955  -0.752  1.00 0.00 ? 18  PRO A CB   5  
ATOM 7374  C CG   . PRO A 1 18  ? -4.202  12.835  -0.680  1.00 0.00 ? 18  PRO A CG   5  
ATOM 7375  C CD   . PRO A 1 18  ? -4.721  14.234  -0.483  1.00 0.00 ? 18  PRO A CD   5  
ATOM 7376  H HA   . PRO A 1 18  ? -1.590  14.766  -0.991  1.00 0.00 ? 18  PRO A HA   5  
ATOM 7377  H HB2  . PRO A 1 18  ? -2.288  12.169  -1.358  1.00 0.00 ? 18  PRO A HB2  5  
ATOM 7378  H HB3  . PRO A 1 18  ? -2.274  12.946  0.230   1.00 0.00 ? 18  PRO A HB3  5  
ATOM 7379  H HG2  . PRO A 1 18  ? -4.584  12.420  -1.600  1.00 0.00 ? 18  PRO A HG2  5  
ATOM 7380  H HG3  . PRO A 1 18  ? -4.479  12.212  0.157   1.00 0.00 ? 18  PRO A HG3  5  
ATOM 7381  H HD2  . PRO A 1 18  ? -5.667  14.360  -0.988  1.00 0.00 ? 18  PRO A HD2  5  
ATOM 7382  H HD3  . PRO A 1 18  ? -4.820  14.454  0.569   1.00 0.00 ? 18  PRO A HD3  5  
ATOM 7383  N N    . SER A 1 19  ? -1.139  14.617  -3.423  1.00 0.00 ? 19  SER A N    5  
ATOM 7384  C CA   . SER A 1 19  ? -0.831  14.520  -4.846  1.00 0.00 ? 19  SER A CA   5  
ATOM 7385  C C    . SER A 1 19  ? 0.325   13.553  -5.085  1.00 0.00 ? 19  SER A C    5  
ATOM 7386  O O    . SER A 1 19  ? 1.188   13.796  -5.929  1.00 0.00 ? 19  SER A O    5  
ATOM 7387  C CB   . SER A 1 19  ? -0.483  15.898  -5.410  1.00 0.00 ? 19  SER A CB   5  
ATOM 7388  O OG   . SER A 1 19  ? -0.440  15.873  -6.827  1.00 0.00 ? 19  SER A OG   5  
ATOM 7389  H H    . SER A 1 19  ? -0.497  15.051  -2.823  1.00 0.00 ? 19  SER A H    5  
ATOM 7390  H HA   . SER A 1 19  ? -1.709  14.145  -5.349  1.00 0.00 ? 19  SER A HA   5  
ATOM 7391  H HB2  . SER A 1 19  ? -1.231  16.612  -5.097  1.00 0.00 ? 19  SER A HB2  5  
ATOM 7392  H HB3  . SER A 1 19  ? 0.484   16.204  -5.037  1.00 0.00 ? 19  SER A HB3  5  
ATOM 7393  H HG   . SER A 1 19  ? -1.159  15.332  -7.159  1.00 0.00 ? 19  SER A HG   5  
ATOM 7394  N N    . SER A 1 20  ? 0.334   12.455  -4.337  1.00 0.00 ? 20  SER A N    5  
ATOM 7395  C CA   . SER A 1 20  ? 1.385   11.452  -4.464  1.00 0.00 ? 20  SER A CA   5  
ATOM 7396  C C    . SER A 1 20  ? 0.886   10.081  -4.019  1.00 0.00 ? 20  SER A C    5  
ATOM 7397  O O    . SER A 1 20  ? 0.282   9.944   -2.955  1.00 0.00 ? 20  SER A O    5  
ATOM 7398  C CB   . SER A 1 20  ? 2.607   11.855  -3.635  1.00 0.00 ? 20  SER A CB   5  
ATOM 7399  O OG   . SER A 1 20  ? 3.524   12.605  -4.412  1.00 0.00 ? 20  SER A OG   5  
ATOM 7400  H H    . SER A 1 20  ? -0.381  12.317  -3.681  1.00 0.00 ? 20  SER A H    5  
ATOM 7401  H HA   . SER A 1 20  ? 1.668   11.399  -5.504  1.00 0.00 ? 20  SER A HA   5  
ATOM 7402  H HB2  . SER A 1 20  ? 2.288   12.456  -2.797  1.00 0.00 ? 20  SER A HB2  5  
ATOM 7403  H HB3  . SER A 1 20  ? 3.102   10.966  -3.274  1.00 0.00 ? 20  SER A HB3  5  
ATOM 7404  H HG   . SER A 1 20  ? 3.068   13.344  -4.822  1.00 0.00 ? 20  SER A HG   5  
ATOM 7405  N N    . ALA A 1 21  ? 1.140   9.070   -4.842  1.00 0.00 ? 21  ALA A N    5  
ATOM 7406  C CA   . ALA A 1 21  ? 0.718   7.709   -4.534  1.00 0.00 ? 21  ALA A CA   5  
ATOM 7407  C C    . ALA A 1 21  ? 1.518   7.137   -3.368  1.00 0.00 ? 21  ALA A C    5  
ATOM 7408  O O    . ALA A 1 21  ? 2.641   7.557   -3.090  1.00 0.00 ? 21  ALA A O    5  
ATOM 7409  C CB   . ALA A 1 21  ? 0.862   6.820   -5.762  1.00 0.00 ? 21  ALA A CB   5  
ATOM 7410  H H    . ALA A 1 21  ? 1.624   9.243   -5.676  1.00 0.00 ? 21  ALA A H    5  
ATOM 7411  H HA   . ALA A 1 21  ? -0.327  7.737   -4.261  1.00 0.00 ? 21  ALA A HA   5  
ATOM 7412  H HB1  . ALA A 1 21  ? 1.820   6.322   -5.733  1.00 0.00 ? 21  ALA A HB1  5  
ATOM 7413  H HB2  . ALA A 1 21  ? 0.073   6.084   -5.768  1.00 0.00 ? 21  ALA A HB2  5  
ATOM 7414  H HB3  . ALA A 1 21  ? 0.797   7.427   -6.653  1.00 0.00 ? 21  ALA A HB3  5  
ATOM 7415  N N    . PRO A 1 22  ? 0.927   6.156   -2.668  1.00 0.00 ? 22  PRO A N    5  
ATOM 7416  C CA   . PRO A 1 22  ? 1.567   5.507   -1.522  1.00 0.00 ? 22  PRO A CA   5  
ATOM 7417  C C    . PRO A 1 22  ? 2.748   4.635   -1.934  1.00 0.00 ? 22  PRO A C    5  
ATOM 7418  O O    . PRO A 1 22  ? 2.855   4.225   -3.090  1.00 0.00 ? 22  PRO A O    5  
ATOM 7419  C CB   . PRO A 1 22  ? 0.446   4.645   -0.932  1.00 0.00 ? 22  PRO A CB   5  
ATOM 7420  C CG   . PRO A 1 22  ? -0.471  4.381   -2.075  1.00 0.00 ? 22  PRO A CG   5  
ATOM 7421  C CD   . PRO A 1 22  ? -0.411  5.607   -2.945  1.00 0.00 ? 22  PRO A CD   5  
ATOM 7422  H HA   . PRO A 1 22  ? 1.893   6.228   -0.787  1.00 0.00 ? 22  PRO A HA   5  
ATOM 7423  H HB2  . PRO A 1 22  ? 0.863   3.729   -0.538  1.00 0.00 ? 22  PRO A HB2  5  
ATOM 7424  H HB3  . PRO A 1 22  ? -0.052  5.188   -0.143  1.00 0.00 ? 22  PRO A HB3  5  
ATOM 7425  H HG2  . PRO A 1 22  ? -0.134  3.514   -2.624  1.00 0.00 ? 22  PRO A HG2  5  
ATOM 7426  H HG3  . PRO A 1 22  ? -1.476  4.230   -1.711  1.00 0.00 ? 22  PRO A HG3  5  
ATOM 7427  H HD2  . PRO A 1 22  ? -0.509  5.336   -3.986  1.00 0.00 ? 22  PRO A HD2  5  
ATOM 7428  H HD3  . PRO A 1 22  ? -1.181  6.308   -2.662  1.00 0.00 ? 22  PRO A HD3  5  
ATOM 7429  N N    . ARG A 1 23  ? 3.632   4.354   -0.982  1.00 0.00 ? 23  ARG A N    5  
ATOM 7430  C CA   . ARG A 1 23  ? 4.806   3.531   -1.246  1.00 0.00 ? 23  ARG A CA   5  
ATOM 7431  C C    . ARG A 1 23  ? 4.845   2.323   -0.314  1.00 0.00 ? 23  ARG A C    5  
ATOM 7432  O O    . ARG A 1 23  ? 4.002   2.183   0.573   1.00 0.00 ? 23  ARG A O    5  
ATOM 7433  C CB   . ARG A 1 23  ? 6.082   4.358   -1.082  1.00 0.00 ? 23  ARG A CB   5  
ATOM 7434  C CG   . ARG A 1 23  ? 6.012   5.725   -1.742  1.00 0.00 ? 23  ARG A CG   5  
ATOM 7435  C CD   . ARG A 1 23  ? 7.274   6.533   -1.485  1.00 0.00 ? 23  ARG A CD   5  
ATOM 7436  N NE   . ARG A 1 23  ? 7.650   6.528   -0.074  1.00 0.00 ? 23  ARG A NE   5  
ATOM 7437  C CZ   . ARG A 1 23  ? 8.873   6.806   0.363   1.00 0.00 ? 23  ARG A CZ   5  
ATOM 7438  N NH1  . ARG A 1 23  ? 9.834   7.109   -0.500  1.00 0.00 ? 23  ARG A NH1  5  
ATOM 7439  N NH2  . ARG A 1 23  ? 9.137   6.782   1.661   1.00 0.00 ? 23  ARG A NH2  5  
ATOM 7440  H H    . ARG A 1 23  ? 3.491   4.710   -0.079  1.00 0.00 ? 23  ARG A H    5  
ATOM 7441  H HA   . ARG A 1 23  ? 4.742   3.181   -2.266  1.00 0.00 ? 23  ARG A HA   5  
ATOM 7442  H HB2  . ARG A 1 23  ? 6.271   4.501   -0.028  1.00 0.00 ? 23  ARG A HB2  5  
ATOM 7443  H HB3  . ARG A 1 23  ? 6.906   3.814   -1.517  1.00 0.00 ? 23  ARG A HB3  5  
ATOM 7444  H HG2  . ARG A 1 23  ? 5.891   5.594   -2.807  1.00 0.00 ? 23  ARG A HG2  5  
ATOM 7445  H HG3  . ARG A 1 23  ? 5.164   6.261   -1.345  1.00 0.00 ? 23  ARG A HG3  5  
ATOM 7446  H HD2  . ARG A 1 23  ? 8.081   6.108   -2.064  1.00 0.00 ? 23  ARG A HD2  5  
ATOM 7447  H HD3  . ARG A 1 23  ? 7.103   7.551   -1.800  1.00 0.00 ? 23  ARG A HD3  5  
ATOM 7448  H HE   . ARG A 1 23  ? 6.954   6.307   0.580   1.00 0.00 ? 23  ARG A HE   5  
ATOM 7449  H HH11 . ARG A 1 23  ? 9.638   7.129   -1.480  1.00 0.00 ? 23  ARG A HH11 5  
ATOM 7450  H HH12 . ARG A 1 23  ? 10.755  7.319   -0.169  1.00 0.00 ? 23  ARG A HH12 5  
ATOM 7451  H HH21 . ARG A 1 23  ? 8.415   6.553   2.314   1.00 0.00 ? 23  ARG A HH21 5  
ATOM 7452  H HH22 . ARG A 1 23  ? 10.059  6.990   1.990   1.00 0.00 ? 23  ARG A HH22 5  
ATOM 7453  N N    . ASP A 1 24  ? 5.827   1.454   -0.522  1.00 0.00 ? 24  ASP A N    5  
ATOM 7454  C CA   . ASP A 1 24  ? 5.976   0.258   0.301   1.00 0.00 ? 24  ASP A CA   5  
ATOM 7455  C C    . ASP A 1 24  ? 4.726   -0.613  0.226   1.00 0.00 ? 24  ASP A C    5  
ATOM 7456  O O    . ASP A 1 24  ? 4.449   -1.398  1.131   1.00 0.00 ? 24  ASP A O    5  
ATOM 7457  C CB   . ASP A 1 24  ? 6.257   0.644   1.753   1.00 0.00 ? 24  ASP A CB   5  
ATOM 7458  C CG   . ASP A 1 24  ? 7.191   -0.332  2.441   1.00 0.00 ? 24  ASP A CG   5  
ATOM 7459  O OD1  . ASP A 1 24  ? 8.108   -0.849  1.771   1.00 0.00 ? 24  ASP A OD1  5  
ATOM 7460  O OD2  . ASP A 1 24  ? 7.003   -0.580  3.651   1.00 0.00 ? 24  ASP A OD2  5  
ATOM 7461  H H    . ASP A 1 24  ? 6.468   1.620   -1.245  1.00 0.00 ? 24  ASP A H    5  
ATOM 7462  H HA   . ASP A 1 24  ? 6.815   -0.304  -0.082  1.00 0.00 ? 24  ASP A HA   5  
ATOM 7463  H HB2  . ASP A 1 24  ? 6.712   1.625   1.777   1.00 0.00 ? 24  ASP A HB2  5  
ATOM 7464  H HB3  . ASP A 1 24  ? 5.326   0.671   2.299   1.00 0.00 ? 24  ASP A HB3  5  
ATOM 7465  N N    . VAL A 1 25  ? 3.973   -0.465  -0.860  1.00 0.00 ? 25  VAL A N    5  
ATOM 7466  C CA   . VAL A 1 25  ? 2.752   -1.238  -1.054  1.00 0.00 ? 25  VAL A CA   5  
ATOM 7467  C C    . VAL A 1 25  ? 3.067   -2.655  -1.524  1.00 0.00 ? 25  VAL A C    5  
ATOM 7468  O O    . VAL A 1 25  ? 3.521   -2.859  -2.648  1.00 0.00 ? 25  VAL A O    5  
ATOM 7469  C CB   . VAL A 1 25  ? 1.817   -0.566  -2.077  1.00 0.00 ? 25  VAL A CB   5  
ATOM 7470  C CG1  . VAL A 1 25  ? 0.471   -1.273  -2.117  1.00 0.00 ? 25  VAL A CG1  5  
ATOM 7471  C CG2  . VAL A 1 25  ? 1.645   0.910   -1.750  1.00 0.00 ? 25  VAL A CG2  5  
ATOM 7472  H H    . VAL A 1 25  ? 4.245   0.177   -1.548  1.00 0.00 ? 25  VAL A H    5  
ATOM 7473  H HA   . VAL A 1 25  ? 2.235   -1.290  -0.107  1.00 0.00 ? 25  VAL A HA   5  
ATOM 7474  H HB   . VAL A 1 25  ? 2.271   -0.646  -3.054  1.00 0.00 ? 25  VAL A HB   5  
ATOM 7475  H HG11 . VAL A 1 25  ? 0.589   -2.243  -2.578  1.00 0.00 ? 25  VAL A HG11 5  
ATOM 7476  H HG12 . VAL A 1 25  ? 0.097   -1.394  -1.111  1.00 0.00 ? 25  VAL A HG12 5  
ATOM 7477  H HG13 . VAL A 1 25  ? -0.227  -0.684  -2.693  1.00 0.00 ? 25  VAL A HG13 5  
ATOM 7478  H HG21 . VAL A 1 25  ? 2.139   1.505   -2.503  1.00 0.00 ? 25  VAL A HG21 5  
ATOM 7479  H HG22 . VAL A 1 25  ? 0.593   1.154   -1.734  1.00 0.00 ? 25  VAL A HG22 5  
ATOM 7480  H HG23 . VAL A 1 25  ? 2.077   1.118   -0.784  1.00 0.00 ? 25  VAL A HG23 5  
ATOM 7481  N N    . GLN A 1 26  ? 2.820   -3.629  -0.652  1.00 0.00 ? 26  GLN A N    5  
ATOM 7482  C CA   . GLN A 1 26  ? 3.078   -5.026  -0.979  1.00 0.00 ? 26  GLN A CA   5  
ATOM 7483  C C    . GLN A 1 26  ? 2.129   -5.947  -0.218  1.00 0.00 ? 26  GLN A C    5  
ATOM 7484  O O    . GLN A 1 26  ? 1.824   -5.711  0.950   1.00 0.00 ? 26  GLN A O    5  
ATOM 7485  C CB   . GLN A 1 26  ? 4.528   -5.389  -0.654  1.00 0.00 ? 26  GLN A CB   5  
ATOM 7486  C CG   . GLN A 1 26  ? 5.549   -4.598  -1.459  1.00 0.00 ? 26  GLN A CG   5  
ATOM 7487  C CD   . GLN A 1 26  ? 6.977   -4.955  -1.099  1.00 0.00 ? 26  GLN A CD   5  
ATOM 7488  O OE1  . GLN A 1 26  ? 7.625   -5.742  -1.791  1.00 0.00 ? 26  GLN A OE1  5  
ATOM 7489  N NE2  . GLN A 1 26  ? 7.477   -4.377  -0.013  1.00 0.00 ? 26  GLN A NE2  5  
ATOM 7490  H H    . GLN A 1 26  ? 2.459   -3.403  0.228   1.00 0.00 ? 26  GLN A H    5  
ATOM 7491  H HA   . GLN A 1 26  ? 2.913   -5.155  -2.039  1.00 0.00 ? 26  GLN A HA   5  
ATOM 7492  H HB2  . GLN A 1 26  ? 4.706   -5.203  0.395   1.00 0.00 ? 26  GLN A HB2  5  
ATOM 7493  H HB3  . GLN A 1 26  ? 4.678   -6.439  -0.857  1.00 0.00 ? 26  GLN A HB3  5  
ATOM 7494  H HG2  . GLN A 1 26  ? 5.396   -4.802  -2.509  1.00 0.00 ? 26  GLN A HG2  5  
ATOM 7495  H HG3  . GLN A 1 26  ? 5.395   -3.546  -1.272  1.00 0.00 ? 26  GLN A HG3  5  
ATOM 7496  H HE21 . GLN A 1 26  ? 6.900   -3.762  0.489   1.00 0.00 ? 26  GLN A HE21 5  
ATOM 7497  H HE22 . GLN A 1 26  ? 8.397   -4.589  0.243   1.00 0.00 ? 26  GLN A HE22 5  
ATOM 7498  N N    . ALA A 1 27  ? 1.663   -6.995  -0.891  1.00 0.00 ? 27  ALA A N    5  
ATOM 7499  C CA   . ALA A 1 27  ? 0.751   -7.951  -0.278  1.00 0.00 ? 27  ALA A CA   5  
ATOM 7500  C C    . ALA A 1 27  ? 1.424   -9.306  -0.083  1.00 0.00 ? 27  ALA A C    5  
ATOM 7501  O O    . ALA A 1 27  ? 1.936   -9.898  -1.034  1.00 0.00 ? 27  ALA A O    5  
ATOM 7502  C CB   . ALA A 1 27  ? -0.504  -8.100  -1.126  1.00 0.00 ? 27  ALA A CB   5  
ATOM 7503  H H    . ALA A 1 27  ? 1.943   -7.129  -1.821  1.00 0.00 ? 27  ALA A H    5  
ATOM 7504  H HA   . ALA A 1 27  ? 0.459   -7.563  0.687   1.00 0.00 ? 27  ALA A HA   5  
ATOM 7505  H HB1  . ALA A 1 27  ? -0.778  -7.138  -1.534  1.00 0.00 ? 27  ALA A HB1  5  
ATOM 7506  H HB2  . ALA A 1 27  ? -0.313  -8.793  -1.932  1.00 0.00 ? 27  ALA A HB2  5  
ATOM 7507  H HB3  . ALA A 1 27  ? -1.310  -8.475  -0.513  1.00 0.00 ? 27  ALA A HB3  5  
ATOM 7508  N N    . ARG A 1 28  ? 1.420   -9.790  1.154   1.00 0.00 ? 28  ARG A N    5  
ATOM 7509  C CA   . ARG A 1 28  ? 2.032   -11.074 1.474   1.00 0.00 ? 28  ARG A CA   5  
ATOM 7510  C C    . ARG A 1 28  ? 0.999   -12.044 2.036   1.00 0.00 ? 28  ARG A C    5  
ATOM 7511  O O    . ARG A 1 28  ? 0.332   -11.751 3.029   1.00 0.00 ? 28  ARG A O    5  
ATOM 7512  C CB   . ARG A 1 28  ? 3.169   -10.885 2.479   1.00 0.00 ? 28  ARG A CB   5  
ATOM 7513  C CG   . ARG A 1 28  ? 2.736   -10.211 3.770   1.00 0.00 ? 28  ARG A CG   5  
ATOM 7514  C CD   . ARG A 1 28  ? 3.929   -9.701  4.561   1.00 0.00 ? 28  ARG A CD   5  
ATOM 7515  N NE   . ARG A 1 28  ? 4.253   -10.572 5.687   1.00 0.00 ? 28  ARG A NE   5  
ATOM 7516  C CZ   . ARG A 1 28  ? 5.432   -10.575 6.299   1.00 0.00 ? 28  ARG A CZ   5  
ATOM 7517  N NH1  . ARG A 1 28  ? 6.394   -9.756  5.896   1.00 0.00 ? 28  ARG A NH1  5  
ATOM 7518  N NH2  . ARG A 1 28  ? 5.650   -11.398 7.317   1.00 0.00 ? 28  ARG A NH2  5  
ATOM 7519  H H    . ARG A 1 28  ? 0.996   -9.271  1.871   1.00 0.00 ? 28  ARG A H    5  
ATOM 7520  H HA   . ARG A 1 28  ? 2.435   -11.485 0.561   1.00 0.00 ? 28  ARG A HA   5  
ATOM 7521  H HB2  . ARG A 1 28  ? 3.581   -11.852 2.726   1.00 0.00 ? 28  ARG A HB2  5  
ATOM 7522  H HB3  . ARG A 1 28  ? 3.940   -10.281 2.024   1.00 0.00 ? 28  ARG A HB3  5  
ATOM 7523  H HG2  . ARG A 1 28  ? 2.093   -9.375  3.531   1.00 0.00 ? 28  ARG A HG2  5  
ATOM 7524  H HG3  . ARG A 1 28  ? 2.193   -10.923 4.373   1.00 0.00 ? 28  ARG A HG3  5  
ATOM 7525  H HD2  . ARG A 1 28  ? 4.784   -9.646  3.902   1.00 0.00 ? 28  ARG A HD2  5  
ATOM 7526  H HD3  . ARG A 1 28  ? 3.701   -8.713  4.936   1.00 0.00 ? 28  ARG A HD3  5  
ATOM 7527  H HE   . ARG A 1 28  ? 3.558   -11.186 6.001   1.00 0.00 ? 28  ARG A HE   5  
ATOM 7528  H HH11 . ARG A 1 28  ? 6.231   -9.134  5.131   1.00 0.00 ? 28  ARG A HH11 5  
ATOM 7529  H HH12 . ARG A 1 28  ? 7.281   -9.759  6.360   1.00 0.00 ? 28  ARG A HH12 5  
ATOM 7530  H HH21 . ARG A 1 28  ? 4.927   -12.016 7.623   1.00 0.00 ? 28  ARG A HH21 5  
ATOM 7531  H HH22 . ARG A 1 28  ? 6.538   -11.400 7.776   1.00 0.00 ? 28  ARG A HH22 5  
ATOM 7532  N N    . MET A 1 29  ? 0.869   -13.200 1.395   1.00 0.00 ? 29  MET A N    5  
ATOM 7533  C CA   . MET A 1 29  ? -0.083  -14.215 1.831   1.00 0.00 ? 29  MET A CA   5  
ATOM 7534  C C    . MET A 1 29  ? 0.469   -15.009 3.011   1.00 0.00 ? 29  MET A C    5  
ATOM 7535  O O    . MET A 1 29  ? 1.660   -15.321 3.059   1.00 0.00 ? 29  MET A O    5  
ATOM 7536  C CB   . MET A 1 29  ? -0.419  -15.161 0.678   1.00 0.00 ? 29  MET A CB   5  
ATOM 7537  C CG   . MET A 1 29  ? -1.838  -15.004 0.154   1.00 0.00 ? 29  MET A CG   5  
ATOM 7538  S SD   . MET A 1 29  ? -3.083  -15.385 1.402   1.00 0.00 ? 29  MET A SD   5  
ATOM 7539  C CE   . MET A 1 29  ? -4.161  -16.482 0.480   1.00 0.00 ? 29  MET A CE   5  
ATOM 7540  H H    . MET A 1 29  ? 1.428   -13.378 0.610   1.00 0.00 ? 29  MET A H    5  
ATOM 7541  H HA   . MET A 1 29  ? -0.985  -13.710 2.143   1.00 0.00 ? 29  MET A HA   5  
ATOM 7542  H HB2  . MET A 1 29  ? 0.264   -14.973 -0.137  1.00 0.00 ? 29  MET A HB2  5  
ATOM 7543  H HB3  . MET A 1 29  ? -0.295  -16.180 1.014   1.00 0.00 ? 29  MET A HB3  5  
ATOM 7544  H HG2  . MET A 1 29  ? -1.976  -13.984 -0.172  1.00 0.00 ? 29  MET A HG2  5  
ATOM 7545  H HG3  . MET A 1 29  ? -1.973  -15.670 -0.685  1.00 0.00 ? 29  MET A HG3  5  
ATOM 7546  H HE1  . MET A 1 29  ? -4.936  -15.903 0.000   1.00 0.00 ? 29  MET A HE1  5  
ATOM 7547  H HE2  . MET A 1 29  ? -3.584  -17.005 -0.267  1.00 0.00 ? 29  MET A HE2  5  
ATOM 7548  H HE3  . MET A 1 29  ? -4.609  -17.195 1.156   1.00 0.00 ? 29  MET A HE3  5  
ATOM 7549  N N    . LEU A 1 30  ? -0.402  -15.332 3.961   1.00 0.00 ? 30  LEU A N    5  
ATOM 7550  C CA   . LEU A 1 30  ? 0.001   -16.090 5.142   1.00 0.00 ? 30  LEU A CA   5  
ATOM 7551  C C    . LEU A 1 30  ? -0.831  -17.360 5.282   1.00 0.00 ? 30  LEU A C    5  
ATOM 7552  O O    . LEU A 1 30  ? -0.334  -18.393 5.731   1.00 0.00 ? 30  LEU A O    5  
ATOM 7553  C CB   . LEU A 1 30  ? -0.145  -15.228 6.398   1.00 0.00 ? 30  LEU A CB   5  
ATOM 7554  C CG   . LEU A 1 30  ? 0.218   -13.751 6.246   1.00 0.00 ? 30  LEU A CG   5  
ATOM 7555  C CD1  . LEU A 1 30  ? -0.227  -12.964 7.468   1.00 0.00 ? 30  LEU A CD1  5  
ATOM 7556  C CD2  . LEU A 1 30  ? 1.714   -13.591 6.020   1.00 0.00 ? 30  LEU A CD2  5  
ATOM 7557  H H    . LEU A 1 30  ? -1.337  -15.055 3.867   1.00 0.00 ? 30  LEU A H    5  
ATOM 7558  H HA   . LEU A 1 30  ? 1.038   -16.364 5.021   1.00 0.00 ? 30  LEU A HA   5  
ATOM 7559  H HB2  . LEU A 1 30  ? -1.174  -15.284 6.719   1.00 0.00 ? 30  LEU A HB2  5  
ATOM 7560  H HB3  . LEU A 1 30  ? 0.492   -15.650 7.162   1.00 0.00 ? 30  LEU A HB3  5  
ATOM 7561  H HG   . LEU A 1 30  ? -0.296  -13.348 5.384   1.00 0.00 ? 30  LEU A HG   5  
ATOM 7562  H HD11 . LEU A 1 30  ? -0.514  -13.648 8.251   1.00 0.00 ? 30  LEU A HD11 5  
ATOM 7563  H HD12 . LEU A 1 30  ? -1.068  -12.339 7.208   1.00 0.00 ? 30  LEU A HD12 5  
ATOM 7564  H HD13 . LEU A 1 30  ? 0.588   -12.343 7.811   1.00 0.00 ? 30  LEU A HD13 5  
ATOM 7565  H HD21 . LEU A 1 30  ? 1.917   -13.563 4.960   1.00 0.00 ? 30  LEU A HD21 5  
ATOM 7566  H HD22 . LEU A 1 30  ? 2.237   -14.426 6.464   1.00 0.00 ? 30  LEU A HD22 5  
ATOM 7567  H HD23 . LEU A 1 30  ? 2.050   -12.672 6.475   1.00 0.00 ? 30  LEU A HD23 5  
ATOM 7568  N N    . SER A 1 31  ? -2.100  -17.277 4.894   1.00 0.00 ? 31  SER A N    5  
ATOM 7569  C CA   . SER A 1 31  ? -3.002  -18.419 4.978   1.00 0.00 ? 31  SER A CA   5  
ATOM 7570  C C    . SER A 1 31  ? -3.606  -18.737 3.614   1.00 0.00 ? 31  SER A C    5  
ATOM 7571  O O    . SER A 1 31  ? -3.153  -18.228 2.588   1.00 0.00 ? 31  SER A O    5  
ATOM 7572  C CB   . SER A 1 31  ? -4.115  -18.144 5.991   1.00 0.00 ? 31  SER A CB   5  
ATOM 7573  O OG   . SER A 1 31  ? -4.374  -19.287 6.788   1.00 0.00 ? 31  SER A OG   5  
ATOM 7574  H H    . SER A 1 31  ? -2.439  -16.426 4.545   1.00 0.00 ? 31  SER A H    5  
ATOM 7575  H HA   . SER A 1 31  ? -2.428  -19.272 5.311   1.00 0.00 ? 31  SER A HA   5  
ATOM 7576  H HB2  . SER A 1 31  ? -3.820  -17.331 6.635   1.00 0.00 ? 31  SER A HB2  5  
ATOM 7577  H HB3  . SER A 1 31  ? -5.019  -17.876 5.462   1.00 0.00 ? 31  SER A HB3  5  
ATOM 7578  H HG   . SER A 1 31  ? -5.315  -19.346 6.967   1.00 0.00 ? 31  SER A HG   5  
ATOM 7579  N N    . SER A 1 32  ? -4.634  -19.580 3.609   1.00 0.00 ? 32  SER A N    5  
ATOM 7580  C CA   . SER A 1 32  ? -5.300  -19.969 2.372   1.00 0.00 ? 32  SER A CA   5  
ATOM 7581  C C    . SER A 1 32  ? -6.517  -19.087 2.110   1.00 0.00 ? 32  SER A C    5  
ATOM 7582  O O    . SER A 1 32  ? -7.169  -19.201 1.071   1.00 0.00 ? 32  SER A O    5  
ATOM 7583  C CB   . SER A 1 32  ? -5.723  -21.437 2.435   1.00 0.00 ? 32  SER A CB   5  
ATOM 7584  O OG   . SER A 1 32  ? -6.204  -21.773 3.725   1.00 0.00 ? 32  SER A OG   5  
ATOM 7585  H H    . SER A 1 32  ? -4.949  -19.952 4.460   1.00 0.00 ? 32  SER A H    5  
ATOM 7586  H HA   . SER A 1 32  ? -4.595  -19.840 1.562   1.00 0.00 ? 32  SER A HA   5  
ATOM 7587  H HB2  . SER A 1 32  ? -6.507  -21.614 1.714   1.00 0.00 ? 32  SER A HB2  5  
ATOM 7588  H HB3  . SER A 1 32  ? -4.874  -22.064 2.205   1.00 0.00 ? 32  SER A HB3  5  
ATOM 7589  H HG   . SER A 1 32  ? -6.789  -21.081 4.040   1.00 0.00 ? 32  SER A HG   5  
ATOM 7590  N N    . THR A 1 33  ? -6.817  -18.207 3.059   1.00 0.00 ? 33  THR A N    5  
ATOM 7591  C CA   . THR A 1 33  ? -7.956  -17.305 2.932   1.00 0.00 ? 33  THR A CA   5  
ATOM 7592  C C    . THR A 1 33  ? -7.760  -16.050 3.775   1.00 0.00 ? 33  THR A C    5  
ATOM 7593  O O    . THR A 1 33  ? -8.725  -15.437 4.232   1.00 0.00 ? 33  THR A O    5  
ATOM 7594  C CB   . THR A 1 33  ? -9.267  -17.993 3.359   1.00 0.00 ? 33  THR A CB   5  
ATOM 7595  O OG1  . THR A 1 33  ? -9.047  -18.783 4.533   1.00 0.00 ? 33  THR A OG1  5  
ATOM 7596  C CG2  . THR A 1 33  ? -9.801  -18.878 2.242   1.00 0.00 ? 33  THR A CG2  5  
ATOM 7597  H H    . THR A 1 33  ? -6.259  -18.163 3.864   1.00 0.00 ? 33  THR A H    5  
ATOM 7598  H HA   . THR A 1 33  ? -8.044  -17.022 1.894   1.00 0.00 ? 33  THR A HA   5  
ATOM 7599  H HB   . THR A 1 33  ? -10.001 -17.232 3.578   1.00 0.00 ? 33  THR A HB   5  
ATOM 7600  H HG1  . THR A 1 33  ? -8.698  -19.640 4.283   1.00 0.00 ? 33  THR A HG1  5  
ATOM 7601  H HG21 . THR A 1 33  ? -9.461  -19.892 2.391   1.00 0.00 ? 33  THR A HG21 5  
ATOM 7602  H HG22 . THR A 1 33  ? -9.442  -18.512 1.291   1.00 0.00 ? 33  THR A HG22 5  
ATOM 7603  H HG23 . THR A 1 33  ? -10.880 -18.855 2.250   1.00 0.00 ? 33  THR A HG23 5  
ATOM 7604  N N    . THR A 1 34  ? -6.502  -15.668 3.976   1.00 0.00 ? 34  THR A N    5  
ATOM 7605  C CA   . THR A 1 34  ? -6.178  -14.485 4.762   1.00 0.00 ? 34  THR A CA   5  
ATOM 7606  C C    . THR A 1 34  ? -4.920  -13.802 4.236   1.00 0.00 ? 34  THR A C    5  
ATOM 7607  O O    . THR A 1 34  ? -3.842  -14.396 4.220   1.00 0.00 ? 34  THR A O    5  
ATOM 7608  C CB   . THR A 1 34  ? -5.974  -14.837 6.248   1.00 0.00 ? 34  THR A CB   5  
ATOM 7609  O OG1  . THR A 1 34  ? -6.520  -16.131 6.524   1.00 0.00 ? 34  THR A OG1  5  
ATOM 7610  C CG2  . THR A 1 34  ? -6.633  -13.800 7.145   1.00 0.00 ? 34  THR A CG2  5  
ATOM 7611  H H    . THR A 1 34  ? -5.775  -16.198 3.586   1.00 0.00 ? 34  THR A H    5  
ATOM 7612  H HA   . THR A 1 34  ? -7.008  -13.797 4.687   1.00 0.00 ? 34  THR A HA   5  
ATOM 7613  H HB   . THR A 1 34  ? -4.913  -14.850 6.457   1.00 0.00 ? 34  THR A HB   5  
ATOM 7614  H HG1  . THR A 1 34  ? -6.659  -16.225 7.470   1.00 0.00 ? 34  THR A HG1  5  
ATOM 7615  H HG21 . THR A 1 34  ? -7.626  -13.585 6.778   1.00 0.00 ? 34  THR A HG21 5  
ATOM 7616  H HG22 . THR A 1 34  ? -6.045  -12.895 7.141   1.00 0.00 ? 34  THR A HG22 5  
ATOM 7617  H HG23 . THR A 1 34  ? -6.697  -14.184 8.152   1.00 0.00 ? 34  THR A HG23 5  
ATOM 7618  N N    . ILE A 1 35  ? -5.067  -12.553 3.809   1.00 0.00 ? 35  ILE A N    5  
ATOM 7619  C CA   . ILE A 1 35  ? -3.941  -11.789 3.282   1.00 0.00 ? 35  ILE A CA   5  
ATOM 7620  C C    . ILE A 1 35  ? -3.581  -10.634 4.210   1.00 0.00 ? 35  ILE A C    5  
ATOM 7621  O O    . ILE A 1 35  ? -4.267  -10.382 5.201   1.00 0.00 ? 35  ILE A O    5  
ATOM 7622  C CB   . ILE A 1 35  ? -4.245  -11.232 1.880   1.00 0.00 ? 35  ILE A CB   5  
ATOM 7623  C CG1  . ILE A 1 35  ? -5.419  -10.250 1.941   1.00 0.00 ? 35  ILE A CG1  5  
ATOM 7624  C CG2  . ILE A 1 35  ? -4.545  -12.366 0.912   1.00 0.00 ? 35  ILE A CG2  5  
ATOM 7625  C CD1  . ILE A 1 35  ? -5.661  -9.517  0.640   1.00 0.00 ? 35  ILE A CD1  5  
ATOM 7626  H H    . ILE A 1 35  ? -5.951  -12.135 3.847   1.00 0.00 ? 35  ILE A H    5  
ATOM 7627  H HA   . ILE A 1 35  ? -3.093  -12.455 3.208   1.00 0.00 ? 35  ILE A HA   5  
ATOM 7628  H HB   . ILE A 1 35  ? -3.368  -10.711 1.527   1.00 0.00 ? 35  ILE A HB   5  
ATOM 7629  H HG12 . ILE A 1 35  ? -6.319  -10.791 2.189   1.00 0.00 ? 35  ILE A HG12 5  
ATOM 7630  H HG13 . ILE A 1 35  ? -5.221  -9.514  2.706   1.00 0.00 ? 35  ILE A HG13 5  
ATOM 7631  H HG21 . ILE A 1 35  ? -4.873  -13.234 1.466   1.00 0.00 ? 35  ILE A HG21 5  
ATOM 7632  H HG22 . ILE A 1 35  ? -5.325  -12.060 0.231   1.00 0.00 ? 35  ILE A HG22 5  
ATOM 7633  H HG23 . ILE A 1 35  ? -3.654  -12.609 0.355   1.00 0.00 ? 35  ILE A HG23 5  
ATOM 7634  H HD11 . ILE A 1 35  ? -4.887  -9.775  -0.069  1.00 0.00 ? 35  ILE A HD11 5  
ATOM 7635  H HD12 . ILE A 1 35  ? -6.624  -9.799  0.242   1.00 0.00 ? 35  ILE A HD12 5  
ATOM 7636  H HD13 . ILE A 1 35  ? -5.642  -8.453  0.818   1.00 0.00 ? 35  ILE A HD13 5  
ATOM 7637  N N    . LEU A 1 36  ? -2.501  -9.933  3.881   1.00 0.00 ? 36  LEU A N    5  
ATOM 7638  C CA   . LEU A 1 36  ? -2.049  -8.802  4.684   1.00 0.00 ? 36  LEU A CA   5  
ATOM 7639  C C    . LEU A 1 36  ? -1.444  -7.715  3.800   1.00 0.00 ? 36  LEU A C    5  
ATOM 7640  O O    . LEU A 1 36  ? -0.488  -7.959  3.065   1.00 0.00 ? 36  LEU A O    5  
ATOM 7641  C CB   . LEU A 1 36  ? -1.022  -9.263  5.719   1.00 0.00 ? 36  LEU A CB   5  
ATOM 7642  C CG   . LEU A 1 36  ? -0.637  -8.237  6.785   1.00 0.00 ? 36  LEU A CG   5  
ATOM 7643  C CD1  . LEU A 1 36  ? -0.135  -8.935  8.040   1.00 0.00 ? 36  LEU A CD1  5  
ATOM 7644  C CD2  . LEU A 1 36  ? 0.415   -7.280  6.247   1.00 0.00 ? 36  LEU A CD2  5  
ATOM 7645  H H    . LEU A 1 36  ? -1.996  -10.181 3.080   1.00 0.00 ? 36  LEU A H    5  
ATOM 7646  H HA   . LEU A 1 36  ? -2.909  -8.395  5.196   1.00 0.00 ? 36  LEU A HA   5  
ATOM 7647  H HB2  . LEU A 1 36  ? -1.427  -10.127 6.224   1.00 0.00 ? 36  LEU A HB2  5  
ATOM 7648  H HB3  . LEU A 1 36  ? -0.124  -9.545  5.190   1.00 0.00 ? 36  LEU A HB3  5  
ATOM 7649  H HG   . LEU A 1 36  ? -1.511  -7.659  7.052   1.00 0.00 ? 36  LEU A HG   5  
ATOM 7650  H HD11 . LEU A 1 36  ? 0.501   -8.262  8.595   1.00 0.00 ? 36  LEU A HD11 5  
ATOM 7651  H HD12 . LEU A 1 36  ? 0.426   -9.814  7.763   1.00 0.00 ? 36  LEU A HD12 5  
ATOM 7652  H HD13 . LEU A 1 36  ? -0.976  -9.223  8.652   1.00 0.00 ? 36  LEU A HD13 5  
ATOM 7653  H HD21 . LEU A 1 36  ? 0.871   -7.704  5.365   1.00 0.00 ? 36  LEU A HD21 5  
ATOM 7654  H HD22 . LEU A 1 36  ? 1.173   -7.118  7.000   1.00 0.00 ? 36  LEU A HD22 5  
ATOM 7655  H HD23 . LEU A 1 36  ? -0.048  -6.338  5.996   1.00 0.00 ? 36  LEU A HD23 5  
ATOM 7656  N N    . VAL A 1 37  ? -2.008  -6.514  3.880   1.00 0.00 ? 37  VAL A N    5  
ATOM 7657  C CA   . VAL A 1 37  ? -1.522  -5.388  3.090   1.00 0.00 ? 37  VAL A CA   5  
ATOM 7658  C C    . VAL A 1 37  ? -0.835  -4.352  3.974   1.00 0.00 ? 37  VAL A C    5  
ATOM 7659  O O    . VAL A 1 37  ? -1.412  -3.878  4.953   1.00 0.00 ? 37  VAL A O    5  
ATOM 7660  C CB   . VAL A 1 37  ? -2.668  -4.707  2.318   1.00 0.00 ? 37  VAL A CB   5  
ATOM 7661  C CG1  . VAL A 1 37  ? -2.120  -3.664  1.357   1.00 0.00 ? 37  VAL A CG1  5  
ATOM 7662  C CG2  . VAL A 1 37  ? -3.498  -5.744  1.574   1.00 0.00 ? 37  VAL A CG2  5  
ATOM 7663  H H    . VAL A 1 37  ? -2.768  -6.382  4.484   1.00 0.00 ? 37  VAL A H    5  
ATOM 7664  H HA   . VAL A 1 37  ? -0.808  -5.767  2.374   1.00 0.00 ? 37  VAL A HA   5  
ATOM 7665  H HB   . VAL A 1 37  ? -3.310  -4.210  3.029   1.00 0.00 ? 37  VAL A HB   5  
ATOM 7666  H HG11 . VAL A 1 37  ? -1.947  -4.118  0.393   1.00 0.00 ? 37  VAL A HG11 5  
ATOM 7667  H HG12 . VAL A 1 37  ? -2.831  -2.859  1.256   1.00 0.00 ? 37  VAL A HG12 5  
ATOM 7668  H HG13 . VAL A 1 37  ? -1.189  -3.276  1.742   1.00 0.00 ? 37  VAL A HG13 5  
ATOM 7669  H HG21 . VAL A 1 37  ? -4.431  -5.899  2.094   1.00 0.00 ? 37  VAL A HG21 5  
ATOM 7670  H HG22 . VAL A 1 37  ? -3.697  -5.395  0.572   1.00 0.00 ? 37  VAL A HG22 5  
ATOM 7671  H HG23 . VAL A 1 37  ? -2.953  -6.676  1.528   1.00 0.00 ? 37  VAL A HG23 5  
ATOM 7672  N N    . GLN A 1 38  ? 0.398   -4.007  3.622   1.00 0.00 ? 38  GLN A N    5  
ATOM 7673  C CA   . GLN A 1 38  ? 1.164   -3.028  4.384   1.00 0.00 ? 38  GLN A CA   5  
ATOM 7674  C C    . GLN A 1 38  ? 1.825   -2.013  3.456   1.00 0.00 ? 38  GLN A C    5  
ATOM 7675  O O    . GLN A 1 38  ? 2.442   -2.381  2.457   1.00 0.00 ? 38  GLN A O    5  
ATOM 7676  C CB   . GLN A 1 38  ? 2.227   -3.727  5.232   1.00 0.00 ? 38  GLN A CB   5  
ATOM 7677  C CG   . GLN A 1 38  ? 3.122   -4.663  4.437   1.00 0.00 ? 38  GLN A CG   5  
ATOM 7678  C CD   . GLN A 1 38  ? 4.368   -5.068  5.200   1.00 0.00 ? 38  GLN A CD   5  
ATOM 7679  O OE1  . GLN A 1 38  ? 5.484   -4.962  4.691   1.00 0.00 ? 38  GLN A OE1  5  
ATOM 7680  N NE2  . GLN A 1 38  ? 4.183   -5.535  6.429   1.00 0.00 ? 38  GLN A NE2  5  
ATOM 7681  H H    . GLN A 1 38  ? 0.804   -4.420  2.832   1.00 0.00 ? 38  GLN A H    5  
ATOM 7682  H HA   . GLN A 1 38  ? 0.479   -2.508  5.036   1.00 0.00 ? 38  GLN A HA   5  
ATOM 7683  H HB2  . GLN A 1 38  ? 2.848   -2.978  5.700   1.00 0.00 ? 38  GLN A HB2  5  
ATOM 7684  H HB3  . GLN A 1 38  ? 1.733   -4.305  6.001   1.00 0.00 ? 38  GLN A HB3  5  
ATOM 7685  H HG2  . GLN A 1 38  ? 2.564   -5.554  4.192   1.00 0.00 ? 38  GLN A HG2  5  
ATOM 7686  H HG3  . GLN A 1 38  ? 3.421   -4.166  3.526   1.00 0.00 ? 38  GLN A HG3  5  
ATOM 7687  H HE21 . GLN A 1 38  ? 3.265   -5.592  6.770   1.00 0.00 ? 38  GLN A HE21 5  
ATOM 7688  H HE22 . GLN A 1 38  ? 4.970   -5.804  6.946   1.00 0.00 ? 38  GLN A HE22 5  
ATOM 7689  N N    . TRP A 1 39  ? 1.690   -0.735  3.794   1.00 0.00 ? 39  TRP A N    5  
ATOM 7690  C CA   . TRP A 1 39  ? 2.275   0.333   2.992   1.00 0.00 ? 39  TRP A CA   5  
ATOM 7691  C C    . TRP A 1 39  ? 2.753   1.479   3.876   1.00 0.00 ? 39  TRP A C    5  
ATOM 7692  O O    . TRP A 1 39  ? 2.558   1.462   5.091   1.00 0.00 ? 39  TRP A O    5  
ATOM 7693  C CB   . TRP A 1 39  ? 1.255   0.849   1.973   1.00 0.00 ? 39  TRP A CB   5  
ATOM 7694  C CG   . TRP A 1 39  ? 0.023   1.423   2.604   1.00 0.00 ? 39  TRP A CG   5  
ATOM 7695  C CD1  . TRP A 1 39  ? -0.165  2.714   3.009   1.00 0.00 ? 39  TRP A CD1  5  
ATOM 7696  C CD2  . TRP A 1 39  ? -1.189  0.725   2.905   1.00 0.00 ? 39  TRP A CD2  5  
ATOM 7697  N NE1  . TRP A 1 39  ? -1.423  2.861   3.542   1.00 0.00 ? 39  TRP A NE1  5  
ATOM 7698  C CE2  . TRP A 1 39  ? -2.071  1.655   3.490   1.00 0.00 ? 39  TRP A CE2  5  
ATOM 7699  C CE3  . TRP A 1 39  ? -1.618  -0.594  2.736   1.00 0.00 ? 39  TRP A CE3  5  
ATOM 7700  C CZ2  . TRP A 1 39  ? -3.353  1.306   3.906   1.00 0.00 ? 39  TRP A CZ2  5  
ATOM 7701  C CZ3  . TRP A 1 39  ? -2.890  -0.940  3.149   1.00 0.00 ? 39  TRP A CZ3  5  
ATOM 7702  C CH2  . TRP A 1 39  ? -3.747  0.007   3.727   1.00 0.00 ? 39  TRP A CH2  5  
ATOM 7703  H H    . TRP A 1 39  ? 1.187   -0.505  4.602   1.00 0.00 ? 39  TRP A H    5  
ATOM 7704  H HA   . TRP A 1 39  ? 3.122   -0.078  2.463   1.00 0.00 ? 39  TRP A HA   5  
ATOM 7705  H HB2  . TRP A 1 39  ? 1.715   1.622   1.374   1.00 0.00 ? 39  TRP A HB2  5  
ATOM 7706  H HB3  . TRP A 1 39  ? 0.955   0.033   1.332   1.00 0.00 ? 39  TRP A HB3  5  
ATOM 7707  H HD1  . TRP A 1 39  ? 0.576   3.493   2.917   1.00 0.00 ? 39  TRP A HD1  5  
ATOM 7708  H HE1  . TRP A 1 39  ? -1.795  3.694   3.900   1.00 0.00 ? 39  TRP A HE1  5  
ATOM 7709  H HE3  . TRP A 1 39  ? -0.972  -1.338  2.291   1.00 0.00 ? 39  TRP A HE3  5  
ATOM 7710  H HZ2  . TRP A 1 39  ? -4.025  2.023   4.352   1.00 0.00 ? 39  TRP A HZ2  5  
ATOM 7711  H HZ3  . TRP A 1 39  ? -3.238  -1.954  3.026   1.00 0.00 ? 39  TRP A HZ3  5  
ATOM 7712  H HH2  . TRP A 1 39  ? -4.732  -0.307  4.035   1.00 0.00 ? 39  TRP A HH2  5  
ATOM 7713  N N    . LYS A 1 40  ? 3.381   2.474   3.259   1.00 0.00 ? 40  LYS A N    5  
ATOM 7714  C CA   . LYS A 1 40  ? 3.887   3.630   3.989   1.00 0.00 ? 40  LYS A CA   5  
ATOM 7715  C C    . LYS A 1 40  ? 3.154   4.901   3.571   1.00 0.00 ? 40  LYS A C    5  
ATOM 7716  O O    . LYS A 1 40  ? 2.374   4.894   2.620   1.00 0.00 ? 40  LYS A O    5  
ATOM 7717  C CB   . LYS A 1 40  ? 5.389   3.793   3.750   1.00 0.00 ? 40  LYS A CB   5  
ATOM 7718  C CG   . LYS A 1 40  ? 6.250   3.075   4.776   1.00 0.00 ? 40  LYS A CG   5  
ATOM 7719  C CD   . LYS A 1 40  ? 7.684   3.574   4.747   1.00 0.00 ? 40  LYS A CD   5  
ATOM 7720  C CE   . LYS A 1 40  ? 8.185   3.912   6.143   1.00 0.00 ? 40  LYS A CE   5  
ATOM 7721  N NZ   . LYS A 1 40  ? 8.800   2.731   6.812   1.00 0.00 ? 40  LYS A NZ   5  
ATOM 7722  H H    . LYS A 1 40  ? 3.507   2.430   2.287   1.00 0.00 ? 40  LYS A H    5  
ATOM 7723  H HA   . LYS A 1 40  ? 3.715   3.460   5.040   1.00 0.00 ? 40  LYS A HA   5  
ATOM 7724  H HB2  . LYS A 1 40  ? 5.631   3.403   2.773   1.00 0.00 ? 40  LYS A HB2  5  
ATOM 7725  H HB3  . LYS A 1 40  ? 5.635   4.845   3.779   1.00 0.00 ? 40  LYS A HB3  5  
ATOM 7726  H HG2  . LYS A 1 40  ? 5.840   3.248   5.760   1.00 0.00 ? 40  LYS A HG2  5  
ATOM 7727  H HG3  . LYS A 1 40  ? 6.241   2.016   4.561   1.00 0.00 ? 40  LYS A HG3  5  
ATOM 7728  H HD2  . LYS A 1 40  ? 8.316   2.804   4.326   1.00 0.00 ? 40  LYS A HD2  5  
ATOM 7729  H HD3  . LYS A 1 40  ? 7.736   4.461   4.131   1.00 0.00 ? 40  LYS A HD3  5  
ATOM 7730  H HE2  . LYS A 1 40  ? 8.923   4.695   6.067   1.00 0.00 ? 40  LYS A HE2  5  
ATOM 7731  H HE3  . LYS A 1 40  ? 7.352   4.258   6.737   1.00 0.00 ? 40  LYS A HE3  5  
ATOM 7732  H HZ1  . LYS A 1 40  ? 9.154   2.061   6.100   1.00 0.00 ? 40  LYS A HZ1  5  
ATOM 7733  H HZ2  . LYS A 1 40  ? 8.095   2.250   7.404   1.00 0.00 ? 40  LYS A HZ2  5  
ATOM 7734  H HZ3  . LYS A 1 40  ? 9.593   3.035   7.412   1.00 0.00 ? 40  LYS A HZ3  5  
ATOM 7735  N N    . GLU A 1 41  ? 3.412   5.990   4.288   1.00 0.00 ? 41  GLU A N    5  
ATOM 7736  C CA   . GLU A 1 41  ? 2.777   7.269   3.989   1.00 0.00 ? 41  GLU A CA   5  
ATOM 7737  C C    . GLU A 1 41  ? 3.279   7.829   2.661   1.00 0.00 ? 41  GLU A C    5  
ATOM 7738  O O    . GLU A 1 41  ? 4.340   7.455   2.162   1.00 0.00 ? 41  GLU A O    5  
ATOM 7739  C CB   . GLU A 1 41  ? 3.047   8.273   5.112   1.00 0.00 ? 41  GLU A CB   5  
ATOM 7740  C CG   . GLU A 1 41  ? 2.045   8.194   6.252   1.00 0.00 ? 41  GLU A CG   5  
ATOM 7741  C CD   . GLU A 1 41  ? 2.677   8.460   7.604   1.00 0.00 ? 41  GLU A CD   5  
ATOM 7742  O OE1  . GLU A 1 41  ? 3.653   9.237   7.661   1.00 0.00 ? 41  GLU A OE1  5  
ATOM 7743  O OE2  . GLU A 1 41  ? 2.195   7.890   8.606   1.00 0.00 ? 41  GLU A OE2  5  
ATOM 7744  H H    . GLU A 1 41  ? 4.044   5.934   5.035   1.00 0.00 ? 41  GLU A H    5  
ATOM 7745  H HA   . GLU A 1 41  ? 1.713   7.102   3.916   1.00 0.00 ? 41  GLU A HA   5  
ATOM 7746  H HB2  . GLU A 1 41  ? 4.033   8.089   5.513   1.00 0.00 ? 41  GLU A HB2  5  
ATOM 7747  H HB3  . GLU A 1 41  ? 3.016   9.271   4.702   1.00 0.00 ? 41  GLU A HB3  5  
ATOM 7748  H HG2  . GLU A 1 41  ? 1.270   8.928   6.085   1.00 0.00 ? 41  GLU A HG2  5  
ATOM 7749  H HG3  . GLU A 1 41  ? 1.607   7.207   6.262   1.00 0.00 ? 41  GLU A HG3  5  
ATOM 7750  N N    . PRO A 1 42  ? 2.497   8.748   2.073   1.00 0.00 ? 42  PRO A N    5  
ATOM 7751  C CA   . PRO A 1 42  ? 2.842   9.380   0.797   1.00 0.00 ? 42  PRO A CA   5  
ATOM 7752  C C    . PRO A 1 42  ? 4.030   10.325  0.919   1.00 0.00 ? 42  PRO A C    5  
ATOM 7753  O O    . PRO A 1 42  ? 4.505   10.602  2.019   1.00 0.00 ? 42  PRO A O    5  
ATOM 7754  C CB   . PRO A 1 42  ? 1.573   10.157  0.433   1.00 0.00 ? 42  PRO A CB   5  
ATOM 7755  C CG   . PRO A 1 42  ? 0.906   10.423  1.739   1.00 0.00 ? 42  PRO A CG   5  
ATOM 7756  C CD   . PRO A 1 42  ? 1.220   9.241   2.614   1.00 0.00 ? 42  PRO A CD   5  
ATOM 7757  H HA   . PRO A 1 42  ? 3.045   8.643   0.032   1.00 0.00 ? 42  PRO A HA   5  
ATOM 7758  H HB2  . PRO A 1 42  ? 1.844   11.075  -0.069  1.00 0.00 ? 42  PRO A HB2  5  
ATOM 7759  H HB3  . PRO A 1 42  ? 0.952   9.557   -0.213  1.00 0.00 ? 42  PRO A HB3  5  
ATOM 7760  H HG2  . PRO A 1 42  ? 1.301   11.328  2.174   1.00 0.00 ? 42  PRO A HG2  5  
ATOM 7761  H HG3  . PRO A 1 42  ? -0.161  10.510  1.593   1.00 0.00 ? 42  PRO A HG3  5  
ATOM 7762  H HD2  . PRO A 1 42  ? 1.329   9.553   3.641   1.00 0.00 ? 42  PRO A HD2  5  
ATOM 7763  H HD3  . PRO A 1 42  ? 0.448   8.491   2.523   1.00 0.00 ? 42  PRO A HD3  5  
ATOM 7764  N N    . GLU A 1 43  ? 4.507   10.819  -0.219  1.00 0.00 ? 43  GLU A N    5  
ATOM 7765  C CA   . GLU A 1 43  ? 5.643   11.734  -0.238  1.00 0.00 ? 43  GLU A CA   5  
ATOM 7766  C C    . GLU A 1 43  ? 5.170   13.185  -0.254  1.00 0.00 ? 43  GLU A C    5  
ATOM 7767  O O    . GLU A 1 43  ? 5.887   14.087  0.182   1.00 0.00 ? 43  GLU A O    5  
ATOM 7768  C CB   . GLU A 1 43  ? 6.527   11.461  -1.456  1.00 0.00 ? 43  GLU A CB   5  
ATOM 7769  C CG   . GLU A 1 43  ? 5.790   11.568  -2.781  1.00 0.00 ? 43  GLU A CG   5  
ATOM 7770  C CD   . GLU A 1 43  ? 6.703   11.957  -3.927  1.00 0.00 ? 43  GLU A CD   5  
ATOM 7771  O OE1  . GLU A 1 43  ? 7.925   11.722  -3.817  1.00 0.00 ? 43  GLU A OE1  5  
ATOM 7772  O OE2  . GLU A 1 43  ? 6.197   12.495  -4.933  1.00 0.00 ? 43  GLU A OE2  5  
ATOM 7773  H H    . GLU A 1 43  ? 4.087   10.561  -1.067  1.00 0.00 ? 43  GLU A H    5  
ATOM 7774  H HA   . GLU A 1 43  ? 6.219   11.566  0.659   1.00 0.00 ? 43  GLU A HA   5  
ATOM 7775  H HB2  . GLU A 1 43  ? 7.342   12.171  -1.462  1.00 0.00 ? 43  GLU A HB2  5  
ATOM 7776  H HB3  . GLU A 1 43  ? 6.933   10.464  -1.374  1.00 0.00 ? 43  GLU A HB3  5  
ATOM 7777  H HG2  . GLU A 1 43  ? 5.340   10.613  -3.006  1.00 0.00 ? 43  GLU A HG2  5  
ATOM 7778  H HG3  . GLU A 1 43  ? 5.016   12.315  -2.687  1.00 0.00 ? 43  GLU A HG3  5  
ATOM 7779  N N    . GLU A 1 44  ? 3.962   13.402  -0.761  1.00 0.00 ? 44  GLU A N    5  
ATOM 7780  C CA   . GLU A 1 44  ? 3.394   14.745  -0.835  1.00 0.00 ? 44  GLU A CA   5  
ATOM 7781  C C    . GLU A 1 44  ? 2.014   14.789  -0.184  1.00 0.00 ? 44  GLU A C    5  
ATOM 7782  O O    . GLU A 1 44  ? 0.992   14.953  -0.849  1.00 0.00 ? 44  GLU A O    5  
ATOM 7783  C CB   . GLU A 1 44  ? 3.298   15.201  -2.293  1.00 0.00 ? 44  GLU A CB   5  
ATOM 7784  C CG   . GLU A 1 44  ? 4.522   15.960  -2.775  1.00 0.00 ? 44  GLU A CG   5  
ATOM 7785  C CD   . GLU A 1 44  ? 4.531   17.406  -2.319  1.00 0.00 ? 44  GLU A CD   5  
ATOM 7786  O OE1  . GLU A 1 44  ? 3.655   18.174  -2.767  1.00 0.00 ? 44  GLU A OE1  5  
ATOM 7787  O OE2  . GLU A 1 44  ? 5.413   17.768  -1.512  1.00 0.00 ? 44  GLU A OE2  5  
ATOM 7788  H H    . GLU A 1 44  ? 3.438   12.643  -1.093  1.00 0.00 ? 44  GLU A H    5  
ATOM 7789  H HA   . GLU A 1 44  ? 4.053   15.412  -0.301  1.00 0.00 ? 44  GLU A HA   5  
ATOM 7790  H HB2  . GLU A 1 44  ? 3.165   14.333  -2.921  1.00 0.00 ? 44  GLU A HB2  5  
ATOM 7791  H HB3  . GLU A 1 44  ? 2.437   15.845  -2.398  1.00 0.00 ? 44  GLU A HB3  5  
ATOM 7792  H HG2  . GLU A 1 44  ? 5.407   15.472  -2.391  1.00 0.00 ? 44  GLU A HG2  5  
ATOM 7793  H HG3  . GLU A 1 44  ? 4.540   15.939  -3.855  1.00 0.00 ? 44  GLU A HG3  5  
ATOM 7794  N N    . PRO A 1 45  ? 1.985   14.639  1.149   1.00 0.00 ? 45  PRO A N    5  
ATOM 7795  C CA   . PRO A 1 45  ? 0.739   14.659  1.919   1.00 0.00 ? 45  PRO A CA   5  
ATOM 7796  C C    . PRO A 1 45  ? 0.016   15.998  1.821   1.00 0.00 ? 45  PRO A C    5  
ATOM 7797  O O    . PRO A 1 45  ? -1.165  16.053  1.478   1.00 0.00 ? 45  PRO A O    5  
ATOM 7798  C CB   . PRO A 1 45  ? 1.205   14.407  3.355   1.00 0.00 ? 45  PRO A CB   5  
ATOM 7799  C CG   . PRO A 1 45  ? 2.650   14.774  3.354   1.00 0.00 ? 45  PRO A CG   5  
ATOM 7800  C CD   . PRO A 1 45  ? 3.166   14.439  2.005   1.00 0.00 ? 45  PRO A CD   5  
ATOM 7801  H HA   . PRO A 1 45  ? 0.070   13.867  1.613   1.00 0.00 ? 45  PRO A HA   5  
ATOM 7802  H HB2  . PRO A 1 45  ? 0.640   15.031  4.035   1.00 0.00 ? 45  PRO A HB2  5  
ATOM 7803  H HB3  . PRO A 1 45  ? 1.062   13.367  3.607   1.00 0.00 ? 45  PRO A HB3  5  
ATOM 7804  H HG2  . PRO A 1 45  ? 2.762   15.824  3.575   1.00 0.00 ? 45  PRO A HG2  5  
ATOM 7805  H HG3  . PRO A 1 45  ? 3.181   14.177  4.081   1.00 0.00 ? 45  PRO A HG3  5  
ATOM 7806  H HD2  . PRO A 1 45  ? 3.931   15.167  1.781   1.00 0.00 ? 45  PRO A HD2  5  
ATOM 7807  H HD3  . PRO A 1 45  ? 3.553   13.436  1.900   1.00 0.00 ? 45  PRO A HD3  5  
ATOM 7808  N N    . ASN A 1 46  ? 0.734   17.076  2.122   1.00 0.00 ? 46  ASN A N    5  
ATOM 7809  C CA   . ASN A 1 46  ? 0.160   18.415  2.067   1.00 0.00 ? 46  ASN A CA   5  
ATOM 7810  C C    . ASN A 1 46  ? -0.965  18.568  3.085   1.00 0.00 ? 46  ASN A C    5  
ATOM 7811  O O    . ASN A 1 46  ? -1.857  19.397  2.918   1.00 0.00 ? 46  ASN A O    5  
ATOM 7812  C CB   . ASN A 1 46  ? -0.365  18.710  0.660   1.00 0.00 ? 46  ASN A CB   5  
ATOM 7813  C CG   . ASN A 1 46  ? 0.595   18.258  -0.423  1.00 0.00 ? 46  ASN A CG   5  
ATOM 7814  O OD1  . ASN A 1 46  ? 1.780   18.592  -0.397  1.00 0.00 ? 46  ASN A OD1  5  
ATOM 7815  N ND2  . ASN A 1 46  ? 0.087   17.494  -1.384  1.00 0.00 ? 46  ASN A ND2  5  
ATOM 7816  H H    . ASN A 1 46  ? 1.671   16.967  2.387   1.00 0.00 ? 46  ASN A H    5  
ATOM 7817  H HA   . ASN A 1 46  ? 0.943   19.120  2.303   1.00 0.00 ? 46  ASN A HA   5  
ATOM 7818  H HB2  . ASN A 1 46  ? -1.305  18.195  0.518   1.00 0.00 ? 46  ASN A HB2  5  
ATOM 7819  H HB3  . ASN A 1 46  ? -0.522  19.773  0.556   1.00 0.00 ? 46  ASN A HB3  5  
ATOM 7820  H HD21 . ASN A 1 46  ? -0.866  17.268  -1.339  1.00 0.00 ? 46  ASN A HD21 5  
ATOM 7821  H HD22 . ASN A 1 46  ? 0.685   17.187  -2.096  1.00 0.00 ? 46  ASN A HD22 5  
ATOM 7822  N N    . GLY A 1 47  ? -0.914  17.761  4.140   1.00 0.00 ? 47  GLY A N    5  
ATOM 7823  C CA   . GLY A 1 47  ? -1.935  17.821  5.171   1.00 0.00 ? 47  GLY A CA   5  
ATOM 7824  C C    . GLY A 1 47  ? -1.943  16.589  6.053   1.00 0.00 ? 47  GLY A C    5  
ATOM 7825  O O    . GLY A 1 47  ? -1.235  15.620  5.780   1.00 0.00 ? 47  GLY A O    5  
ATOM 7826  H H    . GLY A 1 47  ? -0.177  17.119  4.220   1.00 0.00 ? 47  GLY A H    5  
ATOM 7827  H HA2  . GLY A 1 47  ? -1.758  18.691  5.787   1.00 0.00 ? 47  GLY A HA2  5  
ATOM 7828  H HA3  . GLY A 1 47  ? -2.901  17.919  4.699   1.00 0.00 ? 47  GLY A HA3  5  
ATOM 7829  N N    . GLN A 1 48  ? -2.744  16.626  7.112   1.00 0.00 ? 48  GLN A N    5  
ATOM 7830  C CA   . GLN A 1 48  ? -2.838  15.504  8.037   1.00 0.00 ? 48  GLN A CA   5  
ATOM 7831  C C    . GLN A 1 48  ? -3.617  14.350  7.415   1.00 0.00 ? 48  GLN A C    5  
ATOM 7832  O O    . GLN A 1 48  ? -4.805  14.479  7.118   1.00 0.00 ? 48  GLN A O    5  
ATOM 7833  C CB   . GLN A 1 48  ? -3.510  15.944  9.339   1.00 0.00 ? 48  GLN A CB   5  
ATOM 7834  C CG   . GLN A 1 48  ? -2.602  15.848  10.556  1.00 0.00 ? 48  GLN A CG   5  
ATOM 7835  C CD   . GLN A 1 48  ? -2.580  17.125  11.370  1.00 0.00 ? 48  GLN A CD   5  
ATOM 7836  O OE1  . GLN A 1 48  ? -2.527  18.226  10.822  1.00 0.00 ? 48  GLN A OE1  5  
ATOM 7837  N NE2  . GLN A 1 48  ? -2.621  16.985  12.690  1.00 0.00 ? 48  GLN A NE2  5  
ATOM 7838  H H    . GLN A 1 48  ? -3.284  17.428  7.275   1.00 0.00 ? 48  GLN A H    5  
ATOM 7839  H HA   . GLN A 1 48  ? -1.836  15.169  8.256   1.00 0.00 ? 48  GLN A HA   5  
ATOM 7840  H HB2  . GLN A 1 48  ? -3.829  16.972  9.237   1.00 0.00 ? 48  GLN A HB2  5  
ATOM 7841  H HB3  . GLN A 1 48  ? -4.376  15.322  9.513   1.00 0.00 ? 48  GLN A HB3  5  
ATOM 7842  H HG2  . GLN A 1 48  ? -2.951  15.043  11.185  1.00 0.00 ? 48  GLN A HG2  5  
ATOM 7843  H HG3  . GLN A 1 48  ? -1.597  15.633  10.222  1.00 0.00 ? 48  GLN A HG3  5  
ATOM 7844  H HE21 . GLN A 1 48  ? -2.662  16.077  13.059  1.00 0.00 ? 48  GLN A HE21 5  
ATOM 7845  H HE22 . GLN A 1 48  ? -2.608  17.795  13.243  1.00 0.00 ? 48  GLN A HE22 5  
ATOM 7846  N N    . ILE A 1 49  ? -2.941  13.223  7.222   1.00 0.00 ? 49  ILE A N    5  
ATOM 7847  C CA   . ILE A 1 49  ? -3.571  12.046  6.636   1.00 0.00 ? 49  ILE A CA   5  
ATOM 7848  C C    . ILE A 1 49  ? -4.537  11.391  7.619   1.00 0.00 ? 49  ILE A C    5  
ATOM 7849  O O    . ILE A 1 49  ? -4.118  10.805  8.617   1.00 0.00 ? 49  ILE A O    5  
ATOM 7850  C CB   . ILE A 1 49  ? -2.522  11.007  6.196   1.00 0.00 ? 49  ILE A CB   5  
ATOM 7851  C CG1  . ILE A 1 49  ? -1.557  11.624  5.181   1.00 0.00 ? 49  ILE A CG1  5  
ATOM 7852  C CG2  . ILE A 1 49  ? -3.205  9.781   5.609   1.00 0.00 ? 49  ILE A CG2  5  
ATOM 7853  C CD1  . ILE A 1 49  ? -2.222  12.029  3.884   1.00 0.00 ? 49  ILE A CD1  5  
ATOM 7854  H H    . ILE A 1 49  ? -1.996  13.181  7.479   1.00 0.00 ? 49  ILE A H    5  
ATOM 7855  H HA   . ILE A 1 49  ? -4.122  12.364  5.762   1.00 0.00 ? 49  ILE A HA   5  
ATOM 7856  H HB   . ILE A 1 49  ? -1.967  10.697  7.068   1.00 0.00 ? 49  ILE A HB   5  
ATOM 7857  H HG12 . ILE A 1 49  ? -1.105  12.503  5.610   1.00 0.00 ? 49  ILE A HG12 5  
ATOM 7858  H HG13 . ILE A 1 49  ? -0.785  10.904  4.947   1.00 0.00 ? 49  ILE A HG13 5  
ATOM 7859  H HG21 . ILE A 1 49  ? -2.654  9.441   4.745   1.00 0.00 ? 49  ILE A HG21 5  
ATOM 7860  H HG22 . ILE A 1 49  ? -3.232  8.995   6.349   1.00 0.00 ? 49  ILE A HG22 5  
ATOM 7861  H HG23 . ILE A 1 49  ? -4.212  10.036  5.316   1.00 0.00 ? 49  ILE A HG23 5  
ATOM 7862  H HD11 . ILE A 1 49  ? -3.284  11.843  3.950   1.00 0.00 ? 49  ILE A HD11 5  
ATOM 7863  H HD12 . ILE A 1 49  ? -2.051  13.081  3.706   1.00 0.00 ? 49  ILE A HD12 5  
ATOM 7864  H HD13 . ILE A 1 49  ? -1.805  11.454  3.070   1.00 0.00 ? 49  ILE A HD13 5  
ATOM 7865  N N    . GLN A 1 50  ? -5.829  11.495  7.327   1.00 0.00 ? 50  GLN A N    5  
ATOM 7866  C CA   . GLN A 1 50  ? -6.854  10.913  8.185   1.00 0.00 ? 50  GLN A CA   5  
ATOM 7867  C C    . GLN A 1 50  ? -6.899  9.396   8.027   1.00 0.00 ? 50  GLN A C    5  
ATOM 7868  O O    . GLN A 1 50  ? -7.314  8.679   8.935   1.00 0.00 ? 50  GLN A O    5  
ATOM 7869  C CB   . GLN A 1 50  ? -8.222  11.513  7.858   1.00 0.00 ? 50  GLN A CB   5  
ATOM 7870  C CG   . GLN A 1 50  ? -8.262  13.029  7.959   1.00 0.00 ? 50  GLN A CG   5  
ATOM 7871  C CD   . GLN A 1 50  ? -8.206  13.521  9.391   1.00 0.00 ? 50  GLN A CD   5  
ATOM 7872  O OE1  . GLN A 1 50  ? -8.642  12.833  10.314  1.00 0.00 ? 50  GLN A OE1  5  
ATOM 7873  N NE2  . GLN A 1 50  ? -7.668  14.719  9.584   1.00 0.00 ? 50  GLN A NE2  5  
ATOM 7874  H H    . GLN A 1 50  ? -6.099  11.975  6.517   1.00 0.00 ? 50  GLN A H    5  
ATOM 7875  H HA   . GLN A 1 50  ? -6.602  11.148  9.208   1.00 0.00 ? 50  GLN A HA   5  
ATOM 7876  H HB2  . GLN A 1 50  ? -8.495  11.232  6.852   1.00 0.00 ? 50  GLN A HB2  5  
ATOM 7877  H HB3  . GLN A 1 50  ? -8.951  11.109  8.546   1.00 0.00 ? 50  GLN A HB3  5  
ATOM 7878  H HG2  . GLN A 1 50  ? -7.418  13.434  7.421   1.00 0.00 ? 50  GLN A HG2  5  
ATOM 7879  H HG3  . GLN A 1 50  ? -9.177  13.382  7.506   1.00 0.00 ? 50  GLN A HG3  5  
ATOM 7880  H HE21 . GLN A 1 50  ? -7.341  15.212  8.803   1.00 0.00 ? 50  GLN A HE21 5  
ATOM 7881  H HE22 . GLN A 1 50  ? -7.619  15.063  10.500  1.00 0.00 ? 50  GLN A HE22 5  
ATOM 7882  N N    . GLY A 1 51  ? -6.467  8.915   6.864   1.00 0.00 ? 51  GLY A N    5  
ATOM 7883  C CA   . GLY A 1 51  ? -6.467  7.486   6.609   1.00 0.00 ? 51  GLY A CA   5  
ATOM 7884  C C    . GLY A 1 51  ? -6.122  7.156   5.171   1.00 0.00 ? 51  GLY A C    5  
ATOM 7885  O O    . GLY A 1 51  ? -5.481  7.949   4.480   1.00 0.00 ? 51  GLY A O    5  
ATOM 7886  H H    . GLY A 1 51  ? -6.146  9.534   6.176   1.00 0.00 ? 51  GLY A H    5  
ATOM 7887  H HA2  . GLY A 1 51  ? -5.746  7.014   7.259   1.00 0.00 ? 51  GLY A HA2  5  
ATOM 7888  H HA3  . GLY A 1 51  ? -7.448  7.092   6.831   1.00 0.00 ? 51  GLY A HA3  5  
ATOM 7889  N N    . TYR A 1 52  ? -6.547  5.982   4.717   1.00 0.00 ? 52  TYR A N    5  
ATOM 7890  C CA   . TYR A 1 52  ? -6.276  5.545   3.352   1.00 0.00 ? 52  TYR A CA   5  
ATOM 7891  C C    . TYR A 1 52  ? -7.424  4.699   2.812   1.00 0.00 ? 52  TYR A C    5  
ATOM 7892  O O    . TYR A 1 52  ? -8.295  4.261   3.565   1.00 0.00 ? 52  TYR A O    5  
ATOM 7893  C CB   . TYR A 1 52  ? -4.971  4.749   3.299   1.00 0.00 ? 52  TYR A CB   5  
ATOM 7894  C CG   . TYR A 1 52  ? -3.827  5.409   4.035   1.00 0.00 ? 52  TYR A CG   5  
ATOM 7895  C CD1  . TYR A 1 52  ? -3.608  5.161   5.384   1.00 0.00 ? 52  TYR A CD1  5  
ATOM 7896  C CD2  . TYR A 1 52  ? -2.967  6.282   3.381   1.00 0.00 ? 52  TYR A CD2  5  
ATOM 7897  C CE1  . TYR A 1 52  ? -2.564  5.762   6.060   1.00 0.00 ? 52  TYR A CE1  5  
ATOM 7898  C CE2  . TYR A 1 52  ? -1.920  6.888   4.049   1.00 0.00 ? 52  TYR A CE2  5  
ATOM 7899  C CZ   . TYR A 1 52  ? -1.723  6.626   5.389   1.00 0.00 ? 52  TYR A CZ   5  
ATOM 7900  O OH   . TYR A 1 52  ? -0.682  7.227   6.058   1.00 0.00 ? 52  TYR A OH   5  
ATOM 7901  H H    . TYR A 1 52  ? -7.054  5.393   5.315   1.00 0.00 ? 52  TYR A H    5  
ATOM 7902  H HA   . TYR A 1 52  ? -6.172  6.427   2.737   1.00 0.00 ? 52  TYR A HA   5  
ATOM 7903  H HB2  . TYR A 1 52  ? -5.132  3.777   3.741   1.00 0.00 ? 52  TYR A HB2  5  
ATOM 7904  H HB3  . TYR A 1 52  ? -4.676  4.624   2.267   1.00 0.00 ? 52  TYR A HB3  5  
ATOM 7905  H HD1  . TYR A 1 52  ? -4.268  4.485   5.908   1.00 0.00 ? 52  TYR A HD1  5  
ATOM 7906  H HD2  . TYR A 1 52  ? -3.125  6.487   2.331   1.00 0.00 ? 52  TYR A HD2  5  
ATOM 7907  H HE1  . TYR A 1 52  ? -2.410  5.557   7.109   1.00 0.00 ? 52  TYR A HE1  5  
ATOM 7908  H HE2  . TYR A 1 52  ? -1.262  7.562   3.523   1.00 0.00 ? 52  TYR A HE2  5  
ATOM 7909  H HH   . TYR A 1 52  ? -0.763  8.181   5.982   1.00 0.00 ? 52  TYR A HH   5  
ATOM 7910  N N    . ARG A 1 53  ? -7.418  4.472   1.503   1.00 0.00 ? 53  ARG A N    5  
ATOM 7911  C CA   . ARG A 1 53  ? -8.459  3.679   0.860   1.00 0.00 ? 53  ARG A CA   5  
ATOM 7912  C C    . ARG A 1 53  ? -7.852  2.518   0.076   1.00 0.00 ? 53  ARG A C    5  
ATOM 7913  O O    . ARG A 1 53  ? -6.896  2.698   -0.678  1.00 0.00 ? 53  ARG A O    5  
ATOM 7914  C CB   . ARG A 1 53  ? -9.296  4.556   -0.074  1.00 0.00 ? 53  ARG A CB   5  
ATOM 7915  C CG   . ARG A 1 53  ? -10.671 3.983   -0.376  1.00 0.00 ? 53  ARG A CG   5  
ATOM 7916  C CD   . ARG A 1 53  ? -11.584 5.027   -1.002  1.00 0.00 ? 53  ARG A CD   5  
ATOM 7917  N NE   . ARG A 1 53  ? -12.313 5.790   0.007   1.00 0.00 ? 53  ARG A NE   5  
ATOM 7918  C CZ   . ARG A 1 53  ? -13.207 6.730   -0.285  1.00 0.00 ? 53  ARG A CZ   5  
ATOM 7919  N NH1  . ARG A 1 53  ? -13.478 7.019   -1.551  1.00 0.00 ? 53  ARG A NH1  5  
ATOM 7920  N NH2  . ARG A 1 53  ? -13.829 7.380   0.688   1.00 0.00 ? 53  ARG A NH2  5  
ATOM 7921  H H    . ARG A 1 53  ? -6.698  4.848   0.955   1.00 0.00 ? 53  ARG A H    5  
ATOM 7922  H HA   . ARG A 1 53  ? -9.098  3.280   1.634   1.00 0.00 ? 53  ARG A HA   5  
ATOM 7923  H HB2  . ARG A 1 53  ? -9.427  5.525   0.385   1.00 0.00 ? 53  ARG A HB2  5  
ATOM 7924  H HB3  . ARG A 1 53  ? -8.766  4.676   -1.006  1.00 0.00 ? 53  ARG A HB3  5  
ATOM 7925  H HG2  . ARG A 1 53  ? -10.563 3.157   -1.063  1.00 0.00 ? 53  ARG A HG2  5  
ATOM 7926  H HG3  . ARG A 1 53  ? -11.116 3.633   0.543   1.00 0.00 ? 53  ARG A HG3  5  
ATOM 7927  H HD2  . ARG A 1 53  ? -10.983 5.706   -1.587  1.00 0.00 ? 53  ARG A HD2  5  
ATOM 7928  H HD3  . ARG A 1 53  ? -12.293 4.527   -1.644  1.00 0.00 ? 53  ARG A HD3  5  
ATOM 7929  H HE   . ARG A 1 53  ? -12.128 5.593   0.948   1.00 0.00 ? 53  ARG A HE   5  
ATOM 7930  H HH11 . ARG A 1 53  ? -13.011 6.530   -2.287  1.00 0.00 ? 53  ARG A HH11 5  
ATOM 7931  H HH12 . ARG A 1 53  ? -14.153 7.725   -1.768  1.00 0.00 ? 53  ARG A HH12 5  
ATOM 7932  H HH21 . ARG A 1 53  ? -13.628 7.165   1.643   1.00 0.00 ? 53  ARG A HH21 5  
ATOM 7933  H HH22 . ARG A 1 53  ? -14.501 8.087   0.467   1.00 0.00 ? 53  ARG A HH22 5  
ATOM 7934  N N    . VAL A 1 54  ? -8.416  1.328   0.262   1.00 0.00 ? 54  VAL A N    5  
ATOM 7935  C CA   . VAL A 1 54  ? -7.931  0.139   -0.428  1.00 0.00 ? 54  VAL A CA   5  
ATOM 7936  C C    . VAL A 1 54  ? -8.990  -0.419  -1.372  1.00 0.00 ? 54  VAL A C    5  
ATOM 7937  O O    . VAL A 1 54  ? -10.183 -0.392  -1.068  1.00 0.00 ? 54  VAL A O    5  
ATOM 7938  C CB   . VAL A 1 54  ? -7.519  -0.960  0.571   1.00 0.00 ? 54  VAL A CB   5  
ATOM 7939  C CG1  . VAL A 1 54  ? -7.042  -2.202  -0.168  1.00 0.00 ? 54  VAL A CG1  5  
ATOM 7940  C CG2  . VAL A 1 54  ? -6.443  -0.446  1.514   1.00 0.00 ? 54  VAL A CG2  5  
ATOM 7941  H H    . VAL A 1 54  ? -9.175  1.248   0.876   1.00 0.00 ? 54  VAL A H    5  
ATOM 7942  H HA   . VAL A 1 54  ? -7.059  0.417   -1.004  1.00 0.00 ? 54  VAL A HA   5  
ATOM 7943  H HB   . VAL A 1 54  ? -8.386  -1.229  1.157   1.00 0.00 ? 54  VAL A HB   5  
ATOM 7944  H HG11 . VAL A 1 54  ? -6.732  -1.930  -1.167  1.00 0.00 ? 54  VAL A HG11 5  
ATOM 7945  H HG12 . VAL A 1 54  ? -6.208  -2.639  0.361   1.00 0.00 ? 54  VAL A HG12 5  
ATOM 7946  H HG13 . VAL A 1 54  ? -7.848  -2.918  -0.226  1.00 0.00 ? 54  VAL A HG13 5  
ATOM 7947  H HG21 . VAL A 1 54  ? -5.853  0.305   1.011   1.00 0.00 ? 54  VAL A HG21 5  
ATOM 7948  H HG22 . VAL A 1 54  ? -6.908  -0.012  2.388   1.00 0.00 ? 54  VAL A HG22 5  
ATOM 7949  H HG23 . VAL A 1 54  ? -5.806  -1.263  1.817   1.00 0.00 ? 54  VAL A HG23 5  
ATOM 7950  N N    . TYR A 1 55  ? -8.546  -0.927  -2.516  1.00 0.00 ? 55  TYR A N    5  
ATOM 7951  C CA   . TYR A 1 55  ? -9.456  -1.489  -3.507  1.00 0.00 ? 55  TYR A CA   5  
ATOM 7952  C C    . TYR A 1 55  ? -9.052  -2.916  -3.868  1.00 0.00 ? 55  TYR A C    5  
ATOM 7953  O O    . TYR A 1 55  ? -7.975  -3.149  -4.417  1.00 0.00 ? 55  TYR A O    5  
ATOM 7954  C CB   . TYR A 1 55  ? -9.476  -0.619  -4.765  1.00 0.00 ? 55  TYR A CB   5  
ATOM 7955  C CG   . TYR A 1 55  ? -10.039 0.766   -4.534  1.00 0.00 ? 55  TYR A CG   5  
ATOM 7956  C CD1  . TYR A 1 55  ? -9.323  1.715   -3.815  1.00 0.00 ? 55  TYR A CD1  5  
ATOM 7957  C CD2  . TYR A 1 55  ? -11.285 1.122   -5.032  1.00 0.00 ? 55  TYR A CD2  5  
ATOM 7958  C CE1  . TYR A 1 55  ? -9.833  2.981   -3.602  1.00 0.00 ? 55  TYR A CE1  5  
ATOM 7959  C CE2  . TYR A 1 55  ? -11.802 2.386   -4.824  1.00 0.00 ? 55  TYR A CE2  5  
ATOM 7960  C CZ   . TYR A 1 55  ? -11.072 3.312   -4.109  1.00 0.00 ? 55  TYR A CZ   5  
ATOM 7961  O OH   . TYR A 1 55  ? -11.583 4.572   -3.897  1.00 0.00 ? 55  TYR A OH   5  
ATOM 7962  H H    . TYR A 1 55  ? -7.584  -0.921  -2.701  1.00 0.00 ? 55  TYR A H    5  
ATOM 7963  H HA   . TYR A 1 55  ? -10.446 -1.505  -3.076  1.00 0.00 ? 55  TYR A HA   5  
ATOM 7964  H HB2  . TYR A 1 55  ? -8.469  -0.510  -5.135  1.00 0.00 ? 55  TYR A HB2  5  
ATOM 7965  H HB3  . TYR A 1 55  ? -10.081 -1.102  -5.518  1.00 0.00 ? 55  TYR A HB3  5  
ATOM 7966  H HD1  . TYR A 1 55  ? -8.353  1.453   -3.420  1.00 0.00 ? 55  TYR A HD1  5  
ATOM 7967  H HD2  . TYR A 1 55  ? -11.854 0.395   -5.591  1.00 0.00 ? 55  TYR A HD2  5  
ATOM 7968  H HE1  . TYR A 1 55  ? -9.262  3.707   -3.042  1.00 0.00 ? 55  TYR A HE1  5  
ATOM 7969  H HE2  . TYR A 1 55  ? -12.772 2.646   -5.220  1.00 0.00 ? 55  TYR A HE2  5  
ATOM 7970  H HH   . TYR A 1 55  ? -11.983 4.895   -4.709  1.00 0.00 ? 55  TYR A HH   5  
ATOM 7971  N N    . TYR A 1 56  ? -9.926  -3.868  -3.556  1.00 0.00 ? 56  TYR A N    5  
ATOM 7972  C CA   . TYR A 1 56  ? -9.661  -5.271  -3.848  1.00 0.00 ? 56  TYR A CA   5  
ATOM 7973  C C    . TYR A 1 56  ? -10.942 -5.994  -4.255  1.00 0.00 ? 56  TYR A C    5  
ATOM 7974  O O    . TYR A 1 56  ? -11.976 -5.870  -3.599  1.00 0.00 ? 56  TYR A O    5  
ATOM 7975  C CB   . TYR A 1 56  ? -9.043  -5.958  -2.629  1.00 0.00 ? 56  TYR A CB   5  
ATOM 7976  C CG   . TYR A 1 56  ? -10.015 -6.156  -1.486  1.00 0.00 ? 56  TYR A CG   5  
ATOM 7977  C CD1  . TYR A 1 56  ? -10.270 -5.133  -0.579  1.00 0.00 ? 56  TYR A CD1  5  
ATOM 7978  C CD2  . TYR A 1 56  ? -10.679 -7.364  -1.315  1.00 0.00 ? 56  TYR A CD2  5  
ATOM 7979  C CE1  . TYR A 1 56  ? -11.156 -5.310  0.465   1.00 0.00 ? 56  TYR A CE1  5  
ATOM 7980  C CE2  . TYR A 1 56  ? -11.569 -7.549  -0.274  1.00 0.00 ? 56  TYR A CE2  5  
ATOM 7981  C CZ   . TYR A 1 56  ? -11.803 -6.519  0.614   1.00 0.00 ? 56  TYR A CZ   5  
ATOM 7982  O OH   . TYR A 1 56  ? -12.687 -6.699  1.652   1.00 0.00 ? 56  TYR A OH   5  
ATOM 7983  H H    . TYR A 1 56  ? -10.768 -3.620  -3.121  1.00 0.00 ? 56  TYR A H    5  
ATOM 7984  H HA   . TYR A 1 56  ? -8.960  -5.316  -4.668  1.00 0.00 ? 56  TYR A HA   5  
ATOM 7985  H HB2  . TYR A 1 56  ? -8.672  -6.929  -2.919  1.00 0.00 ? 56  TYR A HB2  5  
ATOM 7986  H HB3  . TYR A 1 56  ? -8.222  -5.359  -2.265  1.00 0.00 ? 56  TYR A HB3  5  
ATOM 7987  H HD1  . TYR A 1 56  ? -9.760  -4.188  -0.700  1.00 0.00 ? 56  TYR A HD1  5  
ATOM 7988  H HD2  . TYR A 1 56  ? -10.493 -8.169  -2.012  1.00 0.00 ? 56  TYR A HD2  5  
ATOM 7989  H HE1  . TYR A 1 56  ? -11.339 -4.503  1.160   1.00 0.00 ? 56  TYR A HE1  5  
ATOM 7990  H HE2  . TYR A 1 56  ? -12.074 -8.495  -0.156  1.00 0.00 ? 56  TYR A HE2  5  
ATOM 7991  H HH   . TYR A 1 56  ? -12.709 -7.627  1.898   1.00 0.00 ? 56  TYR A HH   5  
ATOM 7992  N N    . THR A 1 57  ? -10.864 -6.751  -5.346  1.00 0.00 ? 57  THR A N    5  
ATOM 7993  C CA   . THR A 1 57  ? -12.016 -7.493  -5.844  1.00 0.00 ? 57  THR A CA   5  
ATOM 7994  C C    . THR A 1 57  ? -11.582 -8.619  -6.776  1.00 0.00 ? 57  THR A C    5  
ATOM 7995  O O    . THR A 1 57  ? -10.510 -8.562  -7.378  1.00 0.00 ? 57  THR A O    5  
ATOM 7996  C CB   . THR A 1 57  ? -12.996 -6.572  -6.593  1.00 0.00 ? 57  THR A CB   5  
ATOM 7997  O OG1  . THR A 1 57  ? -14.217 -7.270  -6.861  1.00 0.00 ? 57  THR A OG1  5  
ATOM 7998  C CG2  . THR A 1 57  ? -12.390 -6.082  -7.899  1.00 0.00 ? 57  THR A CG2  5  
ATOM 7999  H H    . THR A 1 57  ? -10.012 -6.810  -5.826  1.00 0.00 ? 57  THR A H    5  
ATOM 8000  H HA   . THR A 1 57  ? -12.530 -7.920  -4.996  1.00 0.00 ? 57  THR A HA   5  
ATOM 8001  H HB   . THR A 1 57  ? -13.211 -5.716  -5.970  1.00 0.00 ? 57  THR A HB   5  
ATOM 8002  H HG1  . THR A 1 57  ? -14.916 -6.637  -7.042  1.00 0.00 ? 57  THR A HG1  5  
ATOM 8003  H HG21 . THR A 1 57  ? -11.443 -5.602  -7.698  1.00 0.00 ? 57  THR A HG21 5  
ATOM 8004  H HG22 . THR A 1 57  ? -13.060 -5.375  -8.364  1.00 0.00 ? 57  THR A HG22 5  
ATOM 8005  H HG23 . THR A 1 57  ? -12.234 -6.920  -8.560  1.00 0.00 ? 57  THR A HG23 5  
ATOM 8006  N N    . MET A 1 58  ? -12.421 -9.643  -6.889  1.00 0.00 ? 58  MET A N    5  
ATOM 8007  C CA   . MET A 1 58  ? -12.124 -10.782 -7.752  1.00 0.00 ? 58  MET A CA   5  
ATOM 8008  C C    . MET A 1 58  ? -12.420 -10.452 -9.210  1.00 0.00 ? 58  MET A C    5  
ATOM 8009  O O    . MET A 1 58  ? -11.862 -11.064 -10.120 1.00 0.00 ? 58  MET A O    5  
ATOM 8010  C CB   . MET A 1 58  ? -12.938 -12.002 -7.316  1.00 0.00 ? 58  MET A CB   5  
ATOM 8011  C CG   . MET A 1 58  ? -14.441 -11.770 -7.338  1.00 0.00 ? 58  MET A CG   5  
ATOM 8012  S SD   . MET A 1 58  ? -15.369 -13.267 -7.722  1.00 0.00 ? 58  MET A SD   5  
ATOM 8013  C CE   . MET A 1 58  ? -14.535 -14.459 -6.677  1.00 0.00 ? 58  MET A CE   5  
ATOM 8014  H H    . MET A 1 58  ? -13.262 -9.632  -6.384  1.00 0.00 ? 58  MET A H    5  
ATOM 8015  H HA   . MET A 1 58  ? -11.073 -11.008 -7.651  1.00 0.00 ? 58  MET A HA   5  
ATOM 8016  H HB2  . MET A 1 58  ? -12.713 -12.826 -7.979  1.00 0.00 ? 58  MET A HB2  5  
ATOM 8017  H HB3  . MET A 1 58  ? -12.652 -12.272 -6.311  1.00 0.00 ? 58  MET A HB3  5  
ATOM 8018  H HG2  . MET A 1 58  ? -14.750 -11.411 -6.368  1.00 0.00 ? 58  MET A HG2  5  
ATOM 8019  H HG3  . MET A 1 58  ? -14.664 -11.023 -8.085  1.00 0.00 ? 58  MET A HG3  5  
ATOM 8020  H HE1  . MET A 1 58  ? -13.768 -14.962 -7.247  1.00 0.00 ? 58  MET A HE1  5  
ATOM 8021  H HE2  . MET A 1 58  ? -14.085 -13.949 -5.838  1.00 0.00 ? 58  MET A HE2  5  
ATOM 8022  H HE3  . MET A 1 58  ? -15.251 -15.184 -6.316  1.00 0.00 ? 58  MET A HE3  5  
ATOM 8023  N N    . ASP A 1 59  ? -13.301 -9.482  -9.426  1.00 0.00 ? 59  ASP A N    5  
ATOM 8024  C CA   . ASP A 1 59  ? -13.672 -9.070  -10.776 1.00 0.00 ? 59  ASP A CA   5  
ATOM 8025  C C    . ASP A 1 59  ? -13.178 -7.657  -11.067 1.00 0.00 ? 59  ASP A C    5  
ATOM 8026  O O    . ASP A 1 59  ? -13.941 -6.690  -11.049 1.00 0.00 ? 59  ASP A O    5  
ATOM 8027  C CB   . ASP A 1 59  ? -15.189 -9.142  -10.957 1.00 0.00 ? 59  ASP A CB   5  
ATOM 8028  C CG   . ASP A 1 59  ? -15.680 -10.562 -11.154 1.00 0.00 ? 59  ASP A CG   5  
ATOM 8029  O OD1  . ASP A 1 59  ? -14.855 -11.435 -11.495 1.00 0.00 ? 59  ASP A OD1  5  
ATOM 8030  O OD2  . ASP A 1 59  ? -16.893 -10.802 -10.969 1.00 0.00 ? 59  ASP A OD2  5  
ATOM 8031  H H    . ASP A 1 59  ? -13.713 -9.031  -8.660  1.00 0.00 ? 59  ASP A H    5  
ATOM 8032  H HA   . ASP A 1 59  ? -13.201 -9.751  -11.471 1.00 0.00 ? 59  ASP A HA   5  
ATOM 8033  H HB2  . ASP A 1 59  ? -15.668 -8.733  -10.080 1.00 0.00 ? 59  ASP A HB2  5  
ATOM 8034  H HB3  . ASP A 1 59  ? -15.469 -8.559  -11.822 1.00 0.00 ? 59  ASP A HB3  5  
ATOM 8035  N N    . PRO A 1 60  ? -11.871 -7.529  -11.341 1.00 0.00 ? 60  PRO A N    5  
ATOM 8036  C CA   . PRO A 1 60  ? -11.248 -6.237  -11.640 1.00 0.00 ? 60  PRO A CA   5  
ATOM 8037  C C    . PRO A 1 60  ? -11.685 -5.681  -12.990 1.00 0.00 ? 60  PRO A C    5  
ATOM 8038  O O    . PRO A 1 60  ? -11.380 -4.538  -13.331 1.00 0.00 ? 60  PRO A O    5  
ATOM 8039  C CB   . PRO A 1 60  ? -9.752  -6.560  -11.654 1.00 0.00 ? 60  PRO A CB   5  
ATOM 8040  C CG   . PRO A 1 60  ? -9.681  -8.010  -11.991 1.00 0.00 ? 60  PRO A CG   5  
ATOM 8041  C CD   . PRO A 1 60  ? -10.903 -8.637  -11.380 1.00 0.00 ? 60  PRO A CD   5  
ATOM 8042  H HA   . PRO A 1 60  ? -11.453 -5.509  -10.868 1.00 0.00 ? 60  PRO A HA   5  
ATOM 8043  H HB2  . PRO A 1 60  ? -9.257  -5.955  -12.400 1.00 0.00 ? 60  PRO A HB2  5  
ATOM 8044  H HB3  . PRO A 1 60  ? -9.326  -6.359  -10.681 1.00 0.00 ? 60  PRO A HB3  5  
ATOM 8045  H HG2  . PRO A 1 60  ? -9.689  -8.138  -13.062 1.00 0.00 ? 60  PRO A HG2  5  
ATOM 8046  H HG3  . PRO A 1 60  ? -8.786  -8.441  -11.566 1.00 0.00 ? 60  PRO A HG3  5  
ATOM 8047  H HD2  . PRO A 1 60  ? -11.264 -9.443  -12.002 1.00 0.00 ? 60  PRO A HD2  5  
ATOM 8048  H HD3  . PRO A 1 60  ? -10.686 -8.995  -10.383 1.00 0.00 ? 60  PRO A HD3  5  
ATOM 8049  N N    . THR A 1 61  ? -12.402 -6.496  -13.757 1.00 0.00 ? 61  THR A N    5  
ATOM 8050  C CA   . THR A 1 61  ? -12.881 -6.086  -15.071 1.00 0.00 ? 61  THR A CA   5  
ATOM 8051  C C    . THR A 1 61  ? -13.798 -4.872  -14.967 1.00 0.00 ? 61  THR A C    5  
ATOM 8052  O O    . THR A 1 61  ? -14.022 -4.168  -15.952 1.00 0.00 ? 61  THR A O    5  
ATOM 8053  C CB   . THR A 1 61  ? -13.637 -7.228  -15.775 1.00 0.00 ? 61  THR A CB   5  
ATOM 8054  O OG1  . THR A 1 61  ? -14.009 -6.827  -17.099 1.00 0.00 ? 61  THR A OG1  5  
ATOM 8055  C CG2  . THR A 1 61  ? -14.881 -7.618  -14.990 1.00 0.00 ? 61  THR A CG2  5  
ATOM 8056  H H    . THR A 1 61  ? -12.612 -7.395  -13.429 1.00 0.00 ? 61  THR A H    5  
ATOM 8057  H HA   . THR A 1 61  ? -12.023 -5.827  -15.673 1.00 0.00 ? 61  THR A HA   5  
ATOM 8058  H HB   . THR A 1 61  ? -12.984 -8.087  -15.838 1.00 0.00 ? 61  THR A HB   5  
ATOM 8059  H HG1  . THR A 1 61  ? -14.555 -6.038  -17.052 1.00 0.00 ? 61  THR A HG1  5  
ATOM 8060  H HG21 . THR A 1 61  ? -15.519 -6.755  -14.873 1.00 0.00 ? 61  THR A HG21 5  
ATOM 8061  H HG22 . THR A 1 61  ? -14.591 -7.987  -14.017 1.00 0.00 ? 61  THR A HG22 5  
ATOM 8062  H HG23 . THR A 1 61  ? -15.414 -8.392  -15.522 1.00 0.00 ? 61  THR A HG23 5  
ATOM 8063  N N    . GLN A 1 62  ? -14.324 -4.634  -13.771 1.00 0.00 ? 62  GLN A N    5  
ATOM 8064  C CA   . GLN A 1 62  ? -15.217 -3.505  -13.541 1.00 0.00 ? 62  GLN A CA   5  
ATOM 8065  C C    . GLN A 1 62  ? -14.434 -2.274  -13.094 1.00 0.00 ? 62  GLN A C    5  
ATOM 8066  O O    . GLN A 1 62  ? -13.203 -2.284  -13.070 1.00 0.00 ? 62  GLN A O    5  
ATOM 8067  C CB   . GLN A 1 62  ? -16.267 -3.865  -12.489 1.00 0.00 ? 62  GLN A CB   5  
ATOM 8068  C CG   . GLN A 1 62  ? -16.845 -5.261  -12.658 1.00 0.00 ? 62  GLN A CG   5  
ATOM 8069  C CD   . GLN A 1 62  ? -18.342 -5.305  -12.423 1.00 0.00 ? 62  GLN A CD   5  
ATOM 8070  O OE1  . GLN A 1 62  ? -19.110 -4.630  -13.110 1.00 0.00 ? 62  GLN A OE1  5  
ATOM 8071  N NE2  . GLN A 1 62  ? -18.766 -6.103  -11.451 1.00 0.00 ? 62  GLN A NE2  5  
ATOM 8072  H H    . GLN A 1 62  ? -14.107 -5.232  -13.025 1.00 0.00 ? 62  GLN A H    5  
ATOM 8073  H HA   . GLN A 1 62  ? -15.715 -3.282  -14.472 1.00 0.00 ? 62  GLN A HA   5  
ATOM 8074  H HB2  . GLN A 1 62  ? -15.816 -3.801  -11.509 1.00 0.00 ? 62  GLN A HB2  5  
ATOM 8075  H HB3  . GLN A 1 62  ? -17.078 -3.154  -12.548 1.00 0.00 ? 62  GLN A HB3  5  
ATOM 8076  H HG2  . GLN A 1 62  ? -16.644 -5.600  -13.662 1.00 0.00 ? 62  GLN A HG2  5  
ATOM 8077  H HG3  . GLN A 1 62  ? -16.365 -5.923  -11.953 1.00 0.00 ? 62  GLN A HG3  5  
ATOM 8078  H HE21 . GLN A 1 62  ? -18.097 -6.610  -10.944 1.00 0.00 ? 62  GLN A HE21 5  
ATOM 8079  H HE22 . GLN A 1 62  ? -19.728 -6.150  -11.277 1.00 0.00 ? 62  GLN A HE22 5  
ATOM 8080  N N    . HIS A 1 63  ? -15.156 -1.215  -12.742 1.00 0.00 ? 63  HIS A N    5  
ATOM 8081  C CA   . HIS A 1 63  ? -14.528 0.024   -12.297 1.00 0.00 ? 63  HIS A CA   5  
ATOM 8082  C C    . HIS A 1 63  ? -14.225 -0.028  -10.803 1.00 0.00 ? 63  HIS A C    5  
ATOM 8083  O O    . HIS A 1 63  ? -14.958 -0.647  -10.030 1.00 0.00 ? 63  HIS A O    5  
ATOM 8084  C CB   . HIS A 1 63  ? -15.433 1.218   -12.604 1.00 0.00 ? 63  HIS A CB   5  
ATOM 8085  C CG   . HIS A 1 63  ? -14.681 2.467   -12.945 1.00 0.00 ? 63  HIS A CG   5  
ATOM 8086  N ND1  . HIS A 1 63  ? -14.101 3.279   -11.995 1.00 0.00 ? 63  HIS A ND1  5  
ATOM 8087  C CD2  . HIS A 1 63  ? -14.414 3.041   -14.142 1.00 0.00 ? 63  HIS A CD2  5  
ATOM 8088  C CE1  . HIS A 1 63  ? -13.511 4.300   -12.590 1.00 0.00 ? 63  HIS A CE1  5  
ATOM 8089  N NE2  . HIS A 1 63  ? -13.685 4.178   -13.895 1.00 0.00 ? 63  HIS A NE2  5  
ATOM 8090  H H    . HIS A 1 63  ? -16.134 -1.269  -12.782 1.00 0.00 ? 63  HIS A H    5  
ATOM 8091  H HA   . HIS A 1 63  ? -13.600 0.138   -12.836 1.00 0.00 ? 63  HIS A HA   5  
ATOM 8092  H HB2  . HIS A 1 63  ? -16.068 0.973   -13.444 1.00 0.00 ? 63  HIS A HB2  5  
ATOM 8093  H HB3  . HIS A 1 63  ? -16.050 1.426   -11.742 1.00 0.00 ? 63  HIS A HB3  5  
ATOM 8094  H HD2  . HIS A 1 63  ? -14.717 2.673   -15.112 1.00 0.00 ? 63  HIS A HD2  5  
ATOM 8095  H HE1  . HIS A 1 63  ? -12.977 5.098   -12.098 1.00 0.00 ? 63  HIS A HE1  5  
ATOM 8096  H HE2  . HIS A 1 63  ? -13.424 4.844   -14.563 1.00 0.00 ? 63  HIS A HE2  5  
ATOM 8097  N N    . VAL A 1 64  ? -13.139 0.626   -10.401 1.00 0.00 ? 64  VAL A N    5  
ATOM 8098  C CA   . VAL A 1 64  ? -12.739 0.655   -8.999  1.00 0.00 ? 64  VAL A CA   5  
ATOM 8099  C C    . VAL A 1 64  ? -13.854 1.211   -8.121  1.00 0.00 ? 64  VAL A C    5  
ATOM 8100  O O    . VAL A 1 64  ? -13.910 0.936   -6.923  1.00 0.00 ? 64  VAL A O    5  
ATOM 8101  C CB   . VAL A 1 64  ? -11.469 1.502   -8.796  1.00 0.00 ? 64  VAL A CB   5  
ATOM 8102  C CG1  . VAL A 1 64  ? -10.248 0.770   -9.327  1.00 0.00 ? 64  VAL A CG1  5  
ATOM 8103  C CG2  . VAL A 1 64  ? -11.622 2.860   -9.467  1.00 0.00 ? 64  VAL A CG2  5  
ATOM 8104  H H    . VAL A 1 64  ? -12.595 1.102   -11.064 1.00 0.00 ? 64  VAL A H    5  
ATOM 8105  H HA   . VAL A 1 64  ? -12.524 -0.358  -8.693  1.00 0.00 ? 64  VAL A HA   5  
ATOM 8106  H HB   . VAL A 1 64  ? -11.334 1.663   -7.736  1.00 0.00 ? 64  VAL A HB   5  
ATOM 8107  H HG11 . VAL A 1 64  ? -9.371  1.095   -8.787  1.00 0.00 ? 64  VAL A HG11 5  
ATOM 8108  H HG12 . VAL A 1 64  ? -10.379 -0.294  -9.192  1.00 0.00 ? 64  VAL A HG12 5  
ATOM 8109  H HG13 . VAL A 1 64  ? -10.125 0.987   -10.377 1.00 0.00 ? 64  VAL A HG13 5  
ATOM 8110  H HG21 . VAL A 1 64  ? -11.408 2.764   -10.522 1.00 0.00 ? 64  VAL A HG21 5  
ATOM 8111  H HG22 . VAL A 1 64  ? -12.633 3.216   -9.335  1.00 0.00 ? 64  VAL A HG22 5  
ATOM 8112  H HG23 . VAL A 1 64  ? -10.932 3.561   -9.022  1.00 0.00 ? 64  VAL A HG23 5  
ATOM 8113  N N    . ASN A 1 65  ? -14.742 1.996   -8.725  1.00 0.00 ? 65  ASN A N    5  
ATOM 8114  C CA   . ASN A 1 65  ? -15.855 2.591   -7.998  1.00 0.00 ? 65  ASN A CA   5  
ATOM 8115  C C    . ASN A 1 65  ? -16.912 1.541   -7.666  1.00 0.00 ? 65  ASN A C    5  
ATOM 8116  O O    . ASN A 1 65  ? -17.856 1.809   -6.924  1.00 0.00 ? 65  ASN A O    5  
ATOM 8117  C CB   . ASN A 1 65  ? -16.483 3.720   -8.819  1.00 0.00 ? 65  ASN A CB   5  
ATOM 8118  C CG   . ASN A 1 65  ? -16.455 5.049   -8.088  1.00 0.00 ? 65  ASN A CG   5  
ATOM 8119  O OD1  . ASN A 1 65  ? -17.211 5.264   -7.139  1.00 0.00 ? 65  ASN A OD1  5  
ATOM 8120  N ND2  . ASN A 1 65  ? -15.582 5.948   -8.528  1.00 0.00 ? 65  ASN A ND2  5  
ATOM 8121  H H    . ASN A 1 65  ? -14.644 2.179   -9.683  1.00 0.00 ? 65  ASN A H    5  
ATOM 8122  H HA   . ASN A 1 65  ? -15.470 2.999   -7.075  1.00 0.00 ? 65  ASN A HA   5  
ATOM 8123  H HB2  . ASN A 1 65  ? -15.938 3.828   -9.744  1.00 0.00 ? 65  ASN A HB2  5  
ATOM 8124  H HB3  . ASN A 1 65  ? -17.510 3.471   -9.037  1.00 0.00 ? 65  ASN A HB3  5  
ATOM 8125  H HD21 . ASN A 1 65  ? -15.013 5.707   -9.288  1.00 0.00 ? 65  ASN A HD21 5  
ATOM 8126  H HD22 . ASN A 1 65  ? -15.544 6.815   -8.075  1.00 0.00 ? 65  ASN A HD22 5  
ATOM 8127  N N    . ASN A 1 66  ? -16.744 0.345   -8.221  1.00 0.00 ? 66  ASN A N    5  
ATOM 8128  C CA   . ASN A 1 66  ? -17.682 -0.745  -7.985  1.00 0.00 ? 66  ASN A CA   5  
ATOM 8129  C C    . ASN A 1 66  ? -17.021 -1.871  -7.194  1.00 0.00 ? 66  ASN A C    5  
ATOM 8130  O O    . ASN A 1 66  ? -17.702 -2.707  -6.599  1.00 0.00 ? 66  ASN A O    5  
ATOM 8131  C CB   . ASN A 1 66  ? -18.214 -1.286  -9.314  1.00 0.00 ? 66  ASN A CB   5  
ATOM 8132  C CG   . ASN A 1 66  ? -19.583 -1.925  -9.173  1.00 0.00 ? 66  ASN A CG   5  
ATOM 8133  O OD1  . ASN A 1 66  ? -19.716 -3.015  -8.616  1.00 0.00 ? 66  ASN A OD1  5  
ATOM 8134  N ND2  . ASN A 1 66  ? -20.606 -1.248  -9.677  1.00 0.00 ? 66  ASN A ND2  5  
ATOM 8135  H H    . ASN A 1 66  ? -15.971 0.193   -8.803  1.00 0.00 ? 66  ASN A H    5  
ATOM 8136  H HA   . ASN A 1 66  ? -18.508 -0.354  -7.410  1.00 0.00 ? 66  ASN A HA   5  
ATOM 8137  H HB2  . ASN A 1 66  ? -18.290 -0.473  -10.022 1.00 0.00 ? 66  ASN A HB2  5  
ATOM 8138  H HB3  . ASN A 1 66  ? -17.528 -2.028  -9.694  1.00 0.00 ? 66  ASN A HB3  5  
ATOM 8139  H HD21 . ASN A 1 66  ? -20.425 -0.386  -10.106 1.00 0.00 ? 66  ASN A HD21 5  
ATOM 8140  H HD22 . ASN A 1 66  ? -21.502 -1.637  -9.599  1.00 0.00 ? 66  ASN A HD22 5  
ATOM 8141  N N    . TRP A 1 67  ? -15.694 -1.883  -7.190  1.00 0.00 ? 67  TRP A N    5  
ATOM 8142  C CA   . TRP A 1 67  ? -14.941 -2.904  -6.472  1.00 0.00 ? 67  TRP A CA   5  
ATOM 8143  C C    . TRP A 1 67  ? -15.414 -3.014  -5.027  1.00 0.00 ? 67  TRP A C    5  
ATOM 8144  O O    . TRP A 1 67  ? -16.174 -2.172  -4.547  1.00 0.00 ? 67  TRP A O    5  
ATOM 8145  C CB   . TRP A 1 67  ? -13.445 -2.584  -6.508  1.00 0.00 ? 67  TRP A CB   5  
ATOM 8146  C CG   . TRP A 1 67  ? -12.818 -2.831  -7.846  1.00 0.00 ? 67  TRP A CG   5  
ATOM 8147  C CD1  . TRP A 1 67  ? -13.457 -2.902  -9.051  1.00 0.00 ? 67  TRP A CD1  5  
ATOM 8148  C CD2  . TRP A 1 67  ? -11.427 -3.038  -8.115  1.00 0.00 ? 67  TRP A CD2  5  
ATOM 8149  N NE1  . TRP A 1 67  ? -12.548 -3.142  -10.053 1.00 0.00 ? 67  TRP A NE1  5  
ATOM 8150  C CE2  . TRP A 1 67  ? -11.295 -3.228  -9.505  1.00 0.00 ? 67  TRP A CE2  5  
ATOM 8151  C CE3  . TRP A 1 67  ? -10.280 -3.079  -7.319  1.00 0.00 ? 67  TRP A CE3  5  
ATOM 8152  C CZ2  . TRP A 1 67  ? -10.063 -3.458  -10.111 1.00 0.00 ? 67  TRP A CZ2  5  
ATOM 8153  C CZ3  . TRP A 1 67  ? -9.058  -3.308  -7.922  1.00 0.00 ? 67  TRP A CZ3  5  
ATOM 8154  C CH2  . TRP A 1 67  ? -8.956  -3.494  -9.307  1.00 0.00 ? 67  TRP A CH2  5  
ATOM 8155  H H    . TRP A 1 67  ? -15.207 -1.188  -7.685  1.00 0.00 ? 67  TRP A H    5  
ATOM 8156  H HA   . TRP A 1 67  ? -15.109 -3.849  -6.968  1.00 0.00 ? 67  TRP A HA   5  
ATOM 8157  H HB2  . TRP A 1 67  ? -13.299 -1.544  -6.256  1.00 0.00 ? 67  TRP A HB2  5  
ATOM 8158  H HB3  . TRP A 1 67  ? -12.935 -3.201  -5.781  1.00 0.00 ? 67  TRP A HB3  5  
ATOM 8159  H HD1  . TRP A 1 67  ? -14.522 -2.787  -9.181  1.00 0.00 ? 67  TRP A HD1  5  
ATOM 8160  H HE1  . TRP A 1 67  ? -12.762 -3.233  -11.006 1.00 0.00 ? 67  TRP A HE1  5  
ATOM 8161  H HE3  . TRP A 1 67  ? -10.338 -2.938  -6.249  1.00 0.00 ? 67  TRP A HE3  5  
ATOM 8162  H HZ2  . TRP A 1 67  ? -9.968  -3.603  -11.177 1.00 0.00 ? 67  TRP A HZ2  5  
ATOM 8163  H HZ3  . TRP A 1 67  ? -8.160  -3.343  -7.321  1.00 0.00 ? 67  TRP A HZ3  5  
ATOM 8164  H HH2  . TRP A 1 67  ? -7.981  -3.669  -9.734  1.00 0.00 ? 67  TRP A HH2  5  
ATOM 8165  N N    . MET A 1 68  ? -14.963 -4.058  -4.338  1.00 0.00 ? 68  MET A N    5  
ATOM 8166  C CA   . MET A 1 68  ? -15.342 -4.276  -2.947  1.00 0.00 ? 68  MET A CA   5  
ATOM 8167  C C    . MET A 1 68  ? -14.873 -3.120  -2.069  1.00 0.00 ? 68  MET A C    5  
ATOM 8168  O O    . MET A 1 68  ? -15.611 -2.642  -1.207  1.00 0.00 ? 68  MET A O    5  
ATOM 8169  C CB   . MET A 1 68  ? -14.752 -5.592  -2.436  1.00 0.00 ? 68  MET A CB   5  
ATOM 8170  C CG   . MET A 1 68  ? -15.787 -6.532  -1.840  1.00 0.00 ? 68  MET A CG   5  
ATOM 8171  S SD   . MET A 1 68  ? -15.044 -7.942  -1.000  1.00 0.00 ? 68  MET A SD   5  
ATOM 8172  C CE   . MET A 1 68  ? -14.770 -9.052  -2.380  1.00 0.00 ? 68  MET A CE   5  
ATOM 8173  H H    . MET A 1 68  ? -14.361 -4.695  -4.775  1.00 0.00 ? 68  MET A H    5  
ATOM 8174  H HA   . MET A 1 68  ? -16.419 -4.333  -2.901  1.00 0.00 ? 68  MET A HA   5  
ATOM 8175  H HB2  . MET A 1 68  ? -14.268 -6.099  -3.258  1.00 0.00 ? 68  MET A HB2  5  
ATOM 8176  H HB3  . MET A 1 68  ? -14.017 -5.372  -1.676  1.00 0.00 ? 68  MET A HB3  5  
ATOM 8177  H HG2  . MET A 1 68  ? -16.385 -5.981  -1.129  1.00 0.00 ? 68  MET A HG2  5  
ATOM 8178  H HG3  . MET A 1 68  ? -16.422 -6.895  -2.634  1.00 0.00 ? 68  MET A HG3  5  
ATOM 8179  H HE1  . MET A 1 68  ? -13.710 -9.133  -2.571  1.00 0.00 ? 68  MET A HE1  5  
ATOM 8180  H HE2  . MET A 1 68  ? -15.169 -10.027 -2.142  1.00 0.00 ? 68  MET A HE2  5  
ATOM 8181  H HE3  . MET A 1 68  ? -15.265 -8.663  -3.258  1.00 0.00 ? 68  MET A HE3  5  
ATOM 8182  N N    . LYS A 1 69  ? -13.640 -2.675  -2.292  1.00 0.00 ? 69  LYS A N    5  
ATOM 8183  C CA   . LYS A 1 69  ? -13.073 -1.575  -1.522  1.00 0.00 ? 69  LYS A CA   5  
ATOM 8184  C C    . LYS A 1 69  ? -12.959 -1.945  -0.046  1.00 0.00 ? 69  LYS A C    5  
ATOM 8185  O O    . LYS A 1 69  ? -13.601 -2.887  0.419   1.00 0.00 ? 69  LYS A O    5  
ATOM 8186  C CB   . LYS A 1 69  ? -13.932 -0.318  -1.680  1.00 0.00 ? 69  LYS A CB   5  
ATOM 8187  C CG   . LYS A 1 69  ? -14.224 0.043   -3.126  1.00 0.00 ? 69  LYS A CG   5  
ATOM 8188  C CD   . LYS A 1 69  ? -15.340 1.068   -3.231  1.00 0.00 ? 69  LYS A CD   5  
ATOM 8189  C CE   . LYS A 1 69  ? -14.806 2.438   -3.615  1.00 0.00 ? 69  LYS A CE   5  
ATOM 8190  N NZ   . LYS A 1 69  ? -15.681 3.534   -3.113  1.00 0.00 ? 69  LYS A NZ   5  
ATOM 8191  H H    . LYS A 1 69  ? -13.100 -3.096  -2.993  1.00 0.00 ? 69  LYS A H    5  
ATOM 8192  H HA   . LYS A 1 69  ? -12.085 -1.375  -1.908  1.00 0.00 ? 69  LYS A HA   5  
ATOM 8193  H HB2  . LYS A 1 69  ? -14.873 -0.476  -1.174  1.00 0.00 ? 69  LYS A HB2  5  
ATOM 8194  H HB3  . LYS A 1 69  ? -13.420 0.514   -1.218  1.00 0.00 ? 69  LYS A HB3  5  
ATOM 8195  H HG2  . LYS A 1 69  ? -13.329 0.454   -3.571  1.00 0.00 ? 69  LYS A HG2  5  
ATOM 8196  H HG3  . LYS A 1 69  ? -14.514 -0.851  -3.660  1.00 0.00 ? 69  LYS A HG3  5  
ATOM 8197  H HD2  . LYS A 1 69  ? -16.043 0.744   -3.985  1.00 0.00 ? 69  LYS A HD2  5  
ATOM 8198  H HD3  . LYS A 1 69  ? -15.842 1.139   -2.276  1.00 0.00 ? 69  LYS A HD3  5  
ATOM 8199  H HE2  . LYS A 1 69  ? -13.819 2.556   -3.194  1.00 0.00 ? 69  LYS A HE2  5  
ATOM 8200  H HE3  . LYS A 1 69  ? -14.747 2.499   -4.691  1.00 0.00 ? 69  LYS A HE3  5  
ATOM 8201  H HZ1  . LYS A 1 69  ? -15.424 3.778   -2.136  1.00 0.00 ? 69  LYS A HZ1  5  
ATOM 8202  H HZ2  . LYS A 1 69  ? -16.676 3.236   -3.135  1.00 0.00 ? 69  LYS A HZ2  5  
ATOM 8203  H HZ3  . LYS A 1 69  ? -15.571 4.380   -3.710  1.00 0.00 ? 69  LYS A HZ3  5  
ATOM 8204  N N    . HIS A 1 70  ? -12.141 -1.195  0.686   1.00 0.00 ? 70  HIS A N    5  
ATOM 8205  C CA   . HIS A 1 70  ? -11.946 -1.444  2.109   1.00 0.00 ? 70  HIS A CA   5  
ATOM 8206  C C    . HIS A 1 70  ? -11.876 -0.132  2.885   1.00 0.00 ? 70  HIS A C    5  
ATOM 8207  O O    . HIS A 1 70  ? -12.074 0.943   2.322   1.00 0.00 ? 70  HIS A O    5  
ATOM 8208  C CB   . HIS A 1 70  ? -10.669 -2.253  2.337   1.00 0.00 ? 70  HIS A CB   5  
ATOM 8209  C CG   . HIS A 1 70  ? -10.800 -3.290  3.410   1.00 0.00 ? 70  HIS A CG   5  
ATOM 8210  N ND1  . HIS A 1 70  ? -11.917 -4.086  3.555   1.00 0.00 ? 70  HIS A ND1  5  
ATOM 8211  C CD2  . HIS A 1 70  ? -9.945  -3.662  4.392   1.00 0.00 ? 70  HIS A CD2  5  
ATOM 8212  C CE1  . HIS A 1 70  ? -11.744 -4.900  4.581   1.00 0.00 ? 70  HIS A CE1  5  
ATOM 8213  N NE2  . HIS A 1 70  ? -10.555 -4.662  5.106   1.00 0.00 ? 70  HIS A NE2  5  
ATOM 8214  H H    . HIS A 1 70  ? -11.658 -0.458  0.258   1.00 0.00 ? 70  HIS A H    5  
ATOM 8215  H HA   . HIS A 1 70  ? -12.791 -2.013  2.466   1.00 0.00 ? 70  HIS A HA   5  
ATOM 8216  H HB2  . HIS A 1 70  ? -10.402 -2.758  1.420   1.00 0.00 ? 70  HIS A HB2  5  
ATOM 8217  H HB3  . HIS A 1 70  ? -9.870  -1.583  2.619   1.00 0.00 ? 70  HIS A HB3  5  
ATOM 8218  H HD1  . HIS A 1 70  ? -12.717 -4.057  2.991   1.00 0.00 ? 70  HIS A HD1  5  
ATOM 8219  H HD2  . HIS A 1 70  ? -8.965  -3.247  4.580   1.00 0.00 ? 70  HIS A HD2  5  
ATOM 8220  H HE1  . HIS A 1 70  ? -12.453 -5.635  4.932   1.00 0.00 ? 70  HIS A HE1  5  
ATOM 8221  N N    . ASN A 1 71  ? -11.594 -0.231  4.181   1.00 0.00 ? 71  ASN A N    5  
ATOM 8222  C CA   . ASN A 1 71  ? -11.499 0.948   5.034   1.00 0.00 ? 71  ASN A CA   5  
ATOM 8223  C C    . ASN A 1 71  ? -10.198 0.942   5.829   1.00 0.00 ? 71  ASN A C    5  
ATOM 8224  O O    . ASN A 1 71  ? -9.628  -0.117  6.098   1.00 0.00 ? 71  ASN A O    5  
ATOM 8225  C CB   . ASN A 1 71  ? -12.693 1.009   5.989   1.00 0.00 ? 71  ASN A CB   5  
ATOM 8226  C CG   . ASN A 1 71  ? -13.644 2.141   5.654   1.00 0.00 ? 71  ASN A CG   5  
ATOM 8227  O OD1  . ASN A 1 71  ? -13.994 2.351   4.492   1.00 0.00 ? 71  ASN A OD1  5  
ATOM 8228  N ND2  . ASN A 1 71  ? -14.069 2.880   6.672   1.00 0.00 ? 71  ASN A ND2  5  
ATOM 8229  H H    . ASN A 1 71  ? -11.445 -1.117  4.572   1.00 0.00 ? 71  ASN A H    5  
ATOM 8230  H HA   . ASN A 1 71  ? -11.514 1.820   4.397   1.00 0.00 ? 71  ASN A HA   5  
ATOM 8231  H HB2  . ASN A 1 71  ? -13.239 0.078   5.933   1.00 0.00 ? 71  ASN A HB2  5  
ATOM 8232  H HB3  . ASN A 1 71  ? -12.334 1.152   6.996   1.00 0.00 ? 71  ASN A HB3  5  
ATOM 8233  H HD21 . ASN A 1 71  ? -13.748 2.656   7.572   1.00 0.00 ? 71  ASN A HD21 5  
ATOM 8234  H HD22 . ASN A 1 71  ? -14.685 3.619   6.484   1.00 0.00 ? 71  ASN A HD22 5  
ATOM 8235  N N    . VAL A 1 72  ? -9.733  2.129   6.204   1.00 0.00 ? 72  VAL A N    5  
ATOM 8236  C CA   . VAL A 1 72  ? -8.500  2.260   6.971   1.00 0.00 ? 72  VAL A CA   5  
ATOM 8237  C C    . VAL A 1 72  ? -8.547  3.481   7.883   1.00 0.00 ? 72  VAL A C    5  
ATOM 8238  O O    . VAL A 1 72  ? -9.106  4.516   7.523   1.00 0.00 ? 72  VAL A O    5  
ATOM 8239  C CB   . VAL A 1 72  ? -7.273  2.372   6.046   1.00 0.00 ? 72  VAL A CB   5  
ATOM 8240  C CG1  . VAL A 1 72  ? -6.003  2.547   6.863   1.00 0.00 ? 72  VAL A CG1  5  
ATOM 8241  C CG2  . VAL A 1 72  ? -7.173  1.150   5.144   1.00 0.00 ? 72  VAL A CG2  5  
ATOM 8242  H H    . VAL A 1 72  ? -10.233 2.936   5.960   1.00 0.00 ? 72  VAL A H    5  
ATOM 8243  H HA   . VAL A 1 72  ? -8.388  1.374   7.578   1.00 0.00 ? 72  VAL A HA   5  
ATOM 8244  H HB   . VAL A 1 72  ? -7.397  3.245   5.422   1.00 0.00 ? 72  VAL A HB   5  
ATOM 8245  H HG11 . VAL A 1 72  ? -5.782  3.601   6.962   1.00 0.00 ? 72  VAL A HG11 5  
ATOM 8246  H HG12 . VAL A 1 72  ? -6.141  2.113   7.843   1.00 0.00 ? 72  VAL A HG12 5  
ATOM 8247  H HG13 . VAL A 1 72  ? -5.182  2.054   6.362   1.00 0.00 ? 72  VAL A HG13 5  
ATOM 8248  H HG21 . VAL A 1 72  ? -7.112  0.260   5.752   1.00 0.00 ? 72  VAL A HG21 5  
ATOM 8249  H HG22 . VAL A 1 72  ? -8.048  1.095   4.514   1.00 0.00 ? 72  VAL A HG22 5  
ATOM 8250  H HG23 . VAL A 1 72  ? -6.290  1.228   4.528   1.00 0.00 ? 72  VAL A HG23 5  
ATOM 8251  N N    . ALA A 1 73  ? -7.955  3.350   9.067   1.00 0.00 ? 73  ALA A N    5  
ATOM 8252  C CA   . ALA A 1 73  ? -7.928  4.445   10.030  1.00 0.00 ? 73  ALA A CA   5  
ATOM 8253  C C    . ALA A 1 73  ? -6.498  4.786   10.431  1.00 0.00 ? 73  ALA A C    5  
ATOM 8254  O O    . ALA A 1 73  ? -6.124  4.660   11.598  1.00 0.00 ? 73  ALA A O    5  
ATOM 8255  C CB   . ALA A 1 73  ? -8.752  4.086   11.259  1.00 0.00 ? 73  ALA A CB   5  
ATOM 8256  H H    . ALA A 1 73  ? -7.527  2.501   9.297   1.00 0.00 ? 73  ALA A H    5  
ATOM 8257  H HA   . ALA A 1 73  ? -8.378  5.310   9.567   1.00 0.00 ? 73  ALA A HA   5  
ATOM 8258  H HB1  . ALA A 1 73  ? -8.196  3.392   11.874  1.00 0.00 ? 73  ALA A HB1  5  
ATOM 8259  H HB2  . ALA A 1 73  ? -8.962  4.981   11.824  1.00 0.00 ? 73  ALA A HB2  5  
ATOM 8260  H HB3  . ALA A 1 73  ? -9.679  3.628   10.949  1.00 0.00 ? 73  ALA A HB3  5  
ATOM 8261  N N    . ASP A 1 74  ? -5.702  5.217   9.459   1.00 0.00 ? 74  ASP A N    5  
ATOM 8262  C CA   . ASP A 1 74  ? -4.312  5.577   9.711   1.00 0.00 ? 74  ASP A CA   5  
ATOM 8263  C C    . ASP A 1 74  ? -3.583  4.453   10.440  1.00 0.00 ? 74  ASP A C    5  
ATOM 8264  O O    . ASP A 1 74  ? -3.074  4.643   11.545  1.00 0.00 ? 74  ASP A O    5  
ATOM 8265  C CB   . ASP A 1 74  ? -4.238  6.866   10.532  1.00 0.00 ? 74  ASP A CB   5  
ATOM 8266  C CG   . ASP A 1 74  ? -2.904  7.574   10.380  1.00 0.00 ? 74  ASP A CG   5  
ATOM 8267  O OD1  . ASP A 1 74  ? -2.056  7.079   9.610   1.00 0.00 ? 74  ASP A OD1  5  
ATOM 8268  O OD2  . ASP A 1 74  ? -2.712  8.621   11.031  1.00 0.00 ? 74  ASP A OD2  5  
ATOM 8269  H H    . ASP A 1 74  ? -6.059  5.296   8.549   1.00 0.00 ? 74  ASP A H    5  
ATOM 8270  H HA   . ASP A 1 74  ? -3.834  5.741   8.757   1.00 0.00 ? 74  ASP A HA   5  
ATOM 8271  H HB2  . ASP A 1 74  ? -5.019  7.538   10.207  1.00 0.00 ? 74  ASP A HB2  5  
ATOM 8272  H HB3  . ASP A 1 74  ? -4.382  6.629   11.576  1.00 0.00 ? 74  ASP A HB3  5  
ATOM 8273  N N    . SER A 1 75  ? -3.537  3.281   9.815   1.00 0.00 ? 75  SER A N    5  
ATOM 8274  C CA   . SER A 1 75  ? -2.875  2.125   10.406  1.00 0.00 ? 75  SER A CA   5  
ATOM 8275  C C    . SER A 1 75  ? -1.682  1.689   9.559   1.00 0.00 ? 75  SER A C    5  
ATOM 8276  O O    . SER A 1 75  ? -0.741  1.077   10.062  1.00 0.00 ? 75  SER A O    5  
ATOM 8277  C CB   . SER A 1 75  ? -3.862  0.965   10.552  1.00 0.00 ? 75  SER A CB   5  
ATOM 8278  O OG   . SER A 1 75  ? -4.376  0.896   11.871  1.00 0.00 ? 75  SER A OG   5  
ATOM 8279  H H    . SER A 1 75  ? -3.961  3.193   8.935   1.00 0.00 ? 75  SER A H    5  
ATOM 8280  H HA   . SER A 1 75  ? -2.519  2.411   11.385  1.00 0.00 ? 75  SER A HA   5  
ATOM 8281  H HB2  . SER A 1 75  ? -4.682  1.105   9.865   1.00 0.00 ? 75  SER A HB2  5  
ATOM 8282  H HB3  . SER A 1 75  ? -3.356  0.036   10.326  1.00 0.00 ? 75  SER A HB3  5  
ATOM 8283  H HG   . SER A 1 75  ? -3.649  0.830   12.495  1.00 0.00 ? 75  SER A HG   5  
ATOM 8284  N N    . GLN A 1 76  ? -1.732  2.011   8.270   1.00 0.00 ? 76  GLN A N    5  
ATOM 8285  C CA   . GLN A 1 76  ? -0.657  1.654   7.352   1.00 0.00 ? 76  GLN A CA   5  
ATOM 8286  C C    . GLN A 1 76  ? -0.520  0.139   7.238   1.00 0.00 ? 76  GLN A C    5  
ATOM 8287  O O    . GLN A 1 76  ? 0.497   -0.368  6.765   1.00 0.00 ? 76  GLN A O    5  
ATOM 8288  C CB   . GLN A 1 76  ? 0.666   2.262   7.820   1.00 0.00 ? 76  GLN A CB   5  
ATOM 8289  C CG   . GLN A 1 76  ? 1.071   3.507   7.047   1.00 0.00 ? 76  GLN A CG   5  
ATOM 8290  C CD   . GLN A 1 76  ? 2.159   4.299   7.745   1.00 0.00 ? 76  GLN A CD   5  
ATOM 8291  O OE1  . GLN A 1 76  ? 2.423   4.103   8.932   1.00 0.00 ? 76  GLN A OE1  5  
ATOM 8292  N NE2  . GLN A 1 76  ? 2.800   5.200   7.009   1.00 0.00 ? 76  GLN A NE2  5  
ATOM 8293  H H    . GLN A 1 76  ? -2.509  2.501   7.928   1.00 0.00 ? 76  GLN A H    5  
ATOM 8294  H HA   . GLN A 1 76  ? -0.903  2.054   6.381   1.00 0.00 ? 76  GLN A HA   5  
ATOM 8295  H HB2  . GLN A 1 76  ? 0.580   2.525   8.864   1.00 0.00 ? 76  GLN A HB2  5  
ATOM 8296  H HB3  . GLN A 1 76  ? 1.448   1.526   7.707   1.00 0.00 ? 76  GLN A HB3  5  
ATOM 8297  H HG2  . GLN A 1 76  ? 1.432   3.210   6.074   1.00 0.00 ? 76  GLN A HG2  5  
ATOM 8298  H HG3  . GLN A 1 76  ? 0.203   4.140   6.932   1.00 0.00 ? 76  GLN A HG3  5  
ATOM 8299  H HE21 . GLN A 1 76  ? 2.535   5.303   6.070   1.00 0.00 ? 76  GLN A HE21 5  
ATOM 8300  H HE22 . GLN A 1 76  ? 3.507   5.726   7.434   1.00 0.00 ? 76  GLN A HE22 5  
ATOM 8301  N N    . ILE A 1 77  ? -1.551  -0.577  7.673   1.00 0.00 ? 77  ILE A N    5  
ATOM 8302  C CA   . ILE A 1 77  ? -1.546  -2.034  7.619   1.00 0.00 ? 77  ILE A CA   5  
ATOM 8303  C C    . ILE A 1 77  ? -2.945  -2.597  7.843   1.00 0.00 ? 77  ILE A C    5  
ATOM 8304  O O    . ILE A 1 77  ? -3.668  -2.160  8.739   1.00 0.00 ? 77  ILE A O    5  
ATOM 8305  C CB   . ILE A 1 77  ? -0.590  -2.634  8.666   1.00 0.00 ? 77  ILE A CB   5  
ATOM 8306  C CG1  . ILE A 1 77  ? -0.427  -4.138  8.439   1.00 0.00 ? 77  ILE A CG1  5  
ATOM 8307  C CG2  . ILE A 1 77  ? -1.103  -2.358  10.072  1.00 0.00 ? 77  ILE A CG2  5  
ATOM 8308  C CD1  . ILE A 1 77  ? 0.618   -4.775  9.329   1.00 0.00 ? 77  ILE A CD1  5  
ATOM 8309  H H    . ILE A 1 77  ? -2.333  -0.116  8.040   1.00 0.00 ? 77  ILE A H    5  
ATOM 8310  H HA   . ILE A 1 77  ? -1.204  -2.329  6.637   1.00 0.00 ? 77  ILE A HA   5  
ATOM 8311  H HB   . ILE A 1 77  ? 0.371   -2.154  8.560   1.00 0.00 ? 77  ILE A HB   5  
ATOM 8312  H HG12 . ILE A 1 77  ? -1.368  -4.628  8.630   1.00 0.00 ? 77  ILE A HG12 5  
ATOM 8313  H HG13 . ILE A 1 77  ? -0.138  -4.309  7.412   1.00 0.00 ? 77  ILE A HG13 5  
ATOM 8314  H HG21 . ILE A 1 77  ? -0.285  -2.432  10.775  1.00 0.00 ? 77  ILE A HG21 5  
ATOM 8315  H HG22 . ILE A 1 77  ? -1.522  -1.363  10.112  1.00 0.00 ? 77  ILE A HG22 5  
ATOM 8316  H HG23 . ILE A 1 77  ? -1.863  -3.079  10.326  1.00 0.00 ? 77  ILE A HG23 5  
ATOM 8317  H HD11 . ILE A 1 77  ? 1.531   -4.914  8.769   1.00 0.00 ? 77  ILE A HD11 5  
ATOM 8318  H HD12 . ILE A 1 77  ? 0.807   -4.134  10.178  1.00 0.00 ? 77  ILE A HD12 5  
ATOM 8319  H HD13 . ILE A 1 77  ? 0.259   -5.734  9.676   1.00 0.00 ? 77  ILE A HD13 5  
ATOM 8320  N N    . THR A 1 78  ? -3.324  -3.573  7.023   1.00 0.00 ? 78  THR A N    5  
ATOM 8321  C CA   . THR A 1 78  ? -4.635  -4.198  7.132   1.00 0.00 ? 78  THR A CA   5  
ATOM 8322  C C    . THR A 1 78  ? -4.582  -5.666  6.723   1.00 0.00 ? 78  THR A C    5  
ATOM 8323  O O    . THR A 1 78  ? -3.650  -6.099  6.045   1.00 0.00 ? 78  THR A O    5  
ATOM 8324  C CB   . THR A 1 78  ? -5.676  -3.473  6.260   1.00 0.00 ? 78  THR A CB   5  
ATOM 8325  O OG1  . THR A 1 78  ? -6.989  -3.968  6.550   1.00 0.00 ? 78  THR A OG1  5  
ATOM 8326  C CG2  . THR A 1 78  ? -5.372  -3.663  4.782   1.00 0.00 ? 78  THR A CG2  5  
ATOM 8327  H H    . THR A 1 78  ? -2.703  -3.880  6.329   1.00 0.00 ? 78  THR A H    5  
ATOM 8328  H HA   . THR A 1 78  ? -4.951  -4.132  8.163   1.00 0.00 ? 78  THR A HA   5  
ATOM 8329  H HB   . THR A 1 78  ? -5.641  -2.417  6.486   1.00 0.00 ? 78  THR A HB   5  
ATOM 8330  H HG1  . THR A 1 78  ? -7.104  -4.829  6.142   1.00 0.00 ? 78  THR A HG1  5  
ATOM 8331  H HG21 . THR A 1 78  ? -5.581  -4.686  4.500   1.00 0.00 ? 78  THR A HG21 5  
ATOM 8332  H HG22 . THR A 1 78  ? -4.331  -3.445  4.597   1.00 0.00 ? 78  THR A HG22 5  
ATOM 8333  H HG23 . THR A 1 78  ? -5.990  -2.998  4.198   1.00 0.00 ? 78  THR A HG23 5  
ATOM 8334  N N    . THR A 1 79  ? -5.586  -6.429  7.142   1.00 0.00 ? 79  THR A N    5  
ATOM 8335  C CA   . THR A 1 79  ? -5.653  -7.849  6.821   1.00 0.00 ? 79  THR A CA   5  
ATOM 8336  C C    . THR A 1 79  ? -7.039  -8.234  6.316   1.00 0.00 ? 79  THR A C    5  
ATOM 8337  O O    . THR A 1 79  ? -8.028  -8.116  7.040   1.00 0.00 ? 79  THR A O    5  
ATOM 8338  C CB   . THR A 1 79  ? -5.304  -8.718  8.043   1.00 0.00 ? 79  THR A CB   5  
ATOM 8339  O OG1  . THR A 1 79  ? -5.980  -8.226  9.205   1.00 0.00 ? 79  THR A OG1  5  
ATOM 8340  C CG2  . THR A 1 79  ? -3.803  -8.729  8.289   1.00 0.00 ? 79  THR A CG2  5  
ATOM 8341  H H    . THR A 1 79  ? -6.299  -6.026  7.681   1.00 0.00 ? 79  THR A H    5  
ATOM 8342  H HA   . THR A 1 79  ? -4.929  -8.050  6.045   1.00 0.00 ? 79  THR A HA   5  
ATOM 8343  H HB   . THR A 1 79  ? -5.629  -9.732  7.850   1.00 0.00 ? 79  THR A HB   5  
ATOM 8344  H HG1  . THR A 1 79  ? -5.982  -8.903  9.886   1.00 0.00 ? 79  THR A HG1  5  
ATOM 8345  H HG21 . THR A 1 79  ? -3.352  -7.877  7.802   1.00 0.00 ? 79  THR A HG21 5  
ATOM 8346  H HG22 . THR A 1 79  ? -3.378  -9.638  7.888   1.00 0.00 ? 79  THR A HG22 5  
ATOM 8347  H HG23 . THR A 1 79  ? -3.612  -8.679  9.351   1.00 0.00 ? 79  THR A HG23 5  
ATOM 8348  N N    . ILE A 1 80  ? -7.103  -8.696  5.072   1.00 0.00 ? 80  ILE A N    5  
ATOM 8349  C CA   . ILE A 1 80  ? -8.369  -9.099  4.472   1.00 0.00 ? 80  ILE A CA   5  
ATOM 8350  C C    . ILE A 1 80  ? -8.494  -10.618 4.426   1.00 0.00 ? 80  ILE A C    5  
ATOM 8351  O O    . ILE A 1 80  ? -7.512  -11.328 4.214   1.00 0.00 ? 80  ILE A O    5  
ATOM 8352  C CB   . ILE A 1 80  ? -8.520  -8.539  3.046   1.00 0.00 ? 80  ILE A CB   5  
ATOM 8353  C CG1  . ILE A 1 80  ? -8.433  -7.011  3.062   1.00 0.00 ? 80  ILE A CG1  5  
ATOM 8354  C CG2  . ILE A 1 80  ? -9.838  -8.993  2.435   1.00 0.00 ? 80  ILE A CG2  5  
ATOM 8355  C CD1  . ILE A 1 80  ? -8.340  -6.397  1.683   1.00 0.00 ? 80  ILE A CD1  5  
ATOM 8356  H H    . ILE A 1 80  ? -6.281  -8.766  4.545   1.00 0.00 ? 80  ILE A H    5  
ATOM 8357  H HA   . ILE A 1 80  ? -9.168  -8.702  5.081   1.00 0.00 ? 80  ILE A HA   5  
ATOM 8358  H HB   . ILE A 1 80  ? -7.718  -8.933  2.441   1.00 0.00 ? 80  ILE A HB   5  
ATOM 8359  H HG12 . ILE A 1 80  ? -9.311  -6.612  3.544   1.00 0.00 ? 80  ILE A HG12 5  
ATOM 8360  H HG13 . ILE A 1 80  ? -7.555  -6.715  3.619   1.00 0.00 ? 80  ILE A HG13 5  
ATOM 8361  H HG21 . ILE A 1 80  ? -9.919  -8.610  1.429   1.00 0.00 ? 80  ILE A HG21 5  
ATOM 8362  H HG22 . ILE A 1 80  ? -9.871  -10.073 2.411   1.00 0.00 ? 80  ILE A HG22 5  
ATOM 8363  H HG23 . ILE A 1 80  ? -10.657 -8.621  3.031   1.00 0.00 ? 80  ILE A HG23 5  
ATOM 8364  H HD11 . ILE A 1 80  ? -8.482  -5.328  1.755   1.00 0.00 ? 80  ILE A HD11 5  
ATOM 8365  H HD12 . ILE A 1 80  ? -7.369  -6.605  1.260   1.00 0.00 ? 80  ILE A HD12 5  
ATOM 8366  H HD13 . ILE A 1 80  ? -9.106  -6.818  1.050   1.00 0.00 ? 80  ILE A HD13 5  
ATOM 8367  N N    . GLY A 1 81  ? -9.714  -11.113 4.623   1.00 0.00 ? 81  GLY A N    5  
ATOM 8368  C CA   . GLY A 1 81  ? -9.946  -12.545 4.598   1.00 0.00 ? 81  GLY A CA   5  
ATOM 8369  C C    . GLY A 1 81  ? -11.228 -12.911 3.876   1.00 0.00 ? 81  GLY A C    5  
ATOM 8370  O O    . GLY A 1 81  ? -11.825 -12.078 3.198   1.00 0.00 ? 81  GLY A O    5  
ATOM 8371  H H    . GLY A 1 81  ? -10.460 -10.499 4.787   1.00 0.00 ? 81  GLY A H    5  
ATOM 8372  H HA2  . GLY A 1 81  ? -9.116  -13.025 4.102   1.00 0.00 ? 81  GLY A HA2  5  
ATOM 8373  H HA3  . GLY A 1 81  ? -10.004 -12.907 5.614   1.00 0.00 ? 81  GLY A HA3  5  
ATOM 8374  N N    . ASN A 1 82  ? -11.651 -14.163 4.022   1.00 0.00 ? 82  ASN A N    5  
ATOM 8375  C CA   . ASN A 1 82  ? -12.867 -14.639 3.375   1.00 0.00 ? 82  ASN A CA   5  
ATOM 8376  C C    . ASN A 1 82  ? -12.735 -14.583 1.856   1.00 0.00 ? 82  ASN A C    5  
ATOM 8377  O O    . ASN A 1 82  ? -13.682 -14.228 1.152   1.00 0.00 ? 82  ASN A O    5  
ATOM 8378  C CB   . ASN A 1 82  ? -14.068 -13.804 3.825   1.00 0.00 ? 82  ASN A CB   5  
ATOM 8379  C CG   . ASN A 1 82  ? -15.391 -14.461 3.483   1.00 0.00 ? 82  ASN A CG   5  
ATOM 8380  O OD1  . ASN A 1 82  ? -15.714 -15.534 3.993   1.00 0.00 ? 82  ASN A OD1  5  
ATOM 8381  N ND2  . ASN A 1 82  ? -16.165 -13.818 2.616   1.00 0.00 ? 82  ASN A ND2  5  
ATOM 8382  H H    . ASN A 1 82  ? -11.130 -14.782 4.576   1.00 0.00 ? 82  ASN A H    5  
ATOM 8383  H HA   . ASN A 1 82  ? -13.022 -15.665 3.674   1.00 0.00 ? 82  ASN A HA   5  
ATOM 8384  H HB2  . ASN A 1 82  ? -14.022 -13.666 4.895   1.00 0.00 ? 82  ASN A HB2  5  
ATOM 8385  H HB3  . ASN A 1 82  ? -14.031 -12.839 3.341   1.00 0.00 ? 82  ASN A HB3  5  
ATOM 8386  H HD21 . ASN A 1 82  ? -15.843 -12.967 2.250   1.00 0.00 ? 82  ASN A HD21 5  
ATOM 8387  H HD22 . ASN A 1 82  ? -17.026 -14.220 2.378   1.00 0.00 ? 82  ASN A HD22 5  
ATOM 8388  N N    . LEU A 1 83  ? -11.556 -14.936 1.357   1.00 0.00 ? 83  LEU A N    5  
ATOM 8389  C CA   . LEU A 1 83  ? -11.300 -14.927 -0.079  1.00 0.00 ? 83  LEU A CA   5  
ATOM 8390  C C    . LEU A 1 83  ? -11.204 -16.349 -0.623  1.00 0.00 ? 83  LEU A C    5  
ATOM 8391  O O    . LEU A 1 83  ? -11.183 -17.316 0.137   1.00 0.00 ? 83  LEU A O    5  
ATOM 8392  C CB   . LEU A 1 83  ? -10.009 -14.165 -0.382  1.00 0.00 ? 83  LEU A CB   5  
ATOM 8393  C CG   . LEU A 1 83  ? -9.790  -12.873 0.409   1.00 0.00 ? 83  LEU A CG   5  
ATOM 8394  C CD1  . LEU A 1 83  ? -8.366  -12.371 0.227   1.00 0.00 ? 83  LEU A CD1  5  
ATOM 8395  C CD2  . LEU A 1 83  ? -10.792 -11.811 -0.021  1.00 0.00 ? 83  LEU A CD2  5  
ATOM 8396  H H    . LEU A 1 83  ? -10.841 -15.209 1.968   1.00 0.00 ? 83  LEU A H    5  
ATOM 8397  H HA   . LEU A 1 83  ? -12.126 -14.425 -0.560  1.00 0.00 ? 83  LEU A HA   5  
ATOM 8398  H HB2  . LEU A 1 83  ? -9.179  -14.824 -0.172  1.00 0.00 ? 83  LEU A HB2  5  
ATOM 8399  H HB3  . LEU A 1 83  ? -10.012 -13.915 -1.433  1.00 0.00 ? 83  LEU A HB3  5  
ATOM 8400  H HG   . LEU A 1 83  ? -9.943  -13.072 1.461   1.00 0.00 ? 83  LEU A HG   5  
ATOM 8401  H HD11 . LEU A 1 83  ? -8.123  -11.685 1.025   1.00 0.00 ? 83  LEU A HD11 5  
ATOM 8402  H HD12 . LEU A 1 83  ? -8.283  -11.863 -0.723  1.00 0.00 ? 83  LEU A HD12 5  
ATOM 8403  H HD13 . LEU A 1 83  ? -7.685  -13.208 0.249   1.00 0.00 ? 83  LEU A HD13 5  
ATOM 8404  H HD21 . LEU A 1 83  ? -10.568 -10.882 0.483   1.00 0.00 ? 83  LEU A HD21 5  
ATOM 8405  H HD22 . LEU A 1 83  ? -11.791 -12.131 0.242   1.00 0.00 ? 83  LEU A HD22 5  
ATOM 8406  H HD23 . LEU A 1 83  ? -10.729 -11.667 -1.089  1.00 0.00 ? 83  LEU A HD23 5  
ATOM 8407  N N    . VAL A 1 84  ? -11.144 -16.467 -1.946  1.00 0.00 ? 84  VAL A N    5  
ATOM 8408  C CA   . VAL A 1 84  ? -11.046 -17.769 -2.593  1.00 0.00 ? 84  VAL A CA   5  
ATOM 8409  C C    . VAL A 1 84  ? -9.595  -18.224 -2.700  1.00 0.00 ? 84  VAL A C    5  
ATOM 8410  O O    . VAL A 1 84  ? -8.716  -17.479 -3.133  1.00 0.00 ? 84  VAL A O    5  
ATOM 8411  C CB   . VAL A 1 84  ? -11.670 -17.745 -4.002  1.00 0.00 ? 84  VAL A CB   5  
ATOM 8412  C CG1  . VAL A 1 84  ? -12.069 -19.147 -4.435  1.00 0.00 ? 84  VAL A CG1  5  
ATOM 8413  C CG2  . VAL A 1 84  ? -12.866 -16.806 -4.038  1.00 0.00 ? 84  VAL A CG2  5  
ATOM 8414  H H    . VAL A 1 84  ? -11.165 -15.659 -2.500  1.00 0.00 ? 84  VAL A H    5  
ATOM 8415  H HA   . VAL A 1 84  ? -11.593 -18.483 -1.994  1.00 0.00 ? 84  VAL A HA   5  
ATOM 8416  H HB   . VAL A 1 84  ? -10.927 -17.376 -4.695  1.00 0.00 ? 84  VAL A HB   5  
ATOM 8417  H HG11 . VAL A 1 84  ? -12.471 -19.115 -5.436  1.00 0.00 ? 84  VAL A HG11 5  
ATOM 8418  H HG12 . VAL A 1 84  ? -11.202 -19.791 -4.415  1.00 0.00 ? 84  VAL A HG12 5  
ATOM 8419  H HG13 . VAL A 1 84  ? -12.818 -19.533 -3.758  1.00 0.00 ? 84  VAL A HG13 5  
ATOM 8420  H HG21 . VAL A 1 84  ? -13.595 -17.180 -4.741  1.00 0.00 ? 84  VAL A HG21 5  
ATOM 8421  H HG22 . VAL A 1 84  ? -13.309 -16.749 -3.055  1.00 0.00 ? 84  VAL A HG22 5  
ATOM 8422  H HG23 . VAL A 1 84  ? -12.543 -15.822 -4.344  1.00 0.00 ? 84  VAL A HG23 5  
ATOM 8423  N N    . PRO A 1 85  ? -9.335  -19.475 -2.293  1.00 0.00 ? 85  PRO A N    5  
ATOM 8424  C CA   . PRO A 1 85  ? -7.991  -20.059 -2.335  1.00 0.00 ? 85  PRO A CA   5  
ATOM 8425  C C    . PRO A 1 85  ? -7.514  -20.317 -3.759  1.00 0.00 ? 85  PRO A C    5  
ATOM 8426  O O    . PRO A 1 85  ? -8.228  -20.916 -4.563  1.00 0.00 ? 85  PRO A O    5  
ATOM 8427  C CB   . PRO A 1 85  ? -8.154  -21.380 -1.577  1.00 0.00 ? 85  PRO A CB   5  
ATOM 8428  C CG   . PRO A 1 85  ? -9.594  -21.728 -1.729  1.00 0.00 ? 85  PRO A CG   5  
ATOM 8429  C CD   . PRO A 1 85  ? -10.335 -20.420 -1.766  1.00 0.00 ? 85  PRO A CD   5  
ATOM 8430  H HA   . PRO A 1 85  ? -7.273  -19.435 -1.823  1.00 0.00 ? 85  PRO A HA   5  
ATOM 8431  H HB2  . PRO A 1 85  ? -7.515  -22.132 -2.020  1.00 0.00 ? 85  PRO A HB2  5  
ATOM 8432  H HB3  . PRO A 1 85  ? -7.888  -21.239 -0.540  1.00 0.00 ? 85  PRO A HB3  5  
ATOM 8433  H HG2  . PRO A 1 85  ? -9.747  -22.270 -2.650  1.00 0.00 ? 85  PRO A HG2  5  
ATOM 8434  H HG3  . PRO A 1 85  ? -9.920  -22.318 -0.885  1.00 0.00 ? 85  PRO A HG3  5  
ATOM 8435  H HD2  . PRO A 1 85  ? -11.187 -20.487 -2.424  1.00 0.00 ? 85  PRO A HD2  5  
ATOM 8436  H HD3  . PRO A 1 85  ? -10.645 -20.134 -0.771  1.00 0.00 ? 85  PRO A HD3  5  
ATOM 8437  N N    . GLN A 1 86  ? -6.304  -19.860 -4.066  1.00 0.00 ? 86  GLN A N    5  
ATOM 8438  C CA   . GLN A 1 86  ? -5.732  -20.043 -5.394  1.00 0.00 ? 86  GLN A CA   5  
ATOM 8439  C C    . GLN A 1 86  ? -6.535  -19.279 -6.442  1.00 0.00 ? 86  GLN A C    5  
ATOM 8440  O O    . GLN A 1 86  ? -6.834  -19.803 -7.515  1.00 0.00 ? 86  GLN A O    5  
ATOM 8441  C CB   . GLN A 1 86  ? -5.687  -21.529 -5.754  1.00 0.00 ? 86  GLN A CB   5  
ATOM 8442  C CG   . GLN A 1 86  ? -5.159  -22.410 -4.633  1.00 0.00 ? 86  GLN A CG   5  
ATOM 8443  C CD   . GLN A 1 86  ? -4.760  -23.791 -5.115  1.00 0.00 ? 86  GLN A CD   5  
ATOM 8444  O OE1  . GLN A 1 86  ? -5.349  -24.328 -6.053  1.00 0.00 ? 86  GLN A OE1  5  
ATOM 8445  N NE2  . GLN A 1 86  ? -3.754  -24.375 -4.474  1.00 0.00 ? 86  GLN A NE2  5  
ATOM 8446  H H    . GLN A 1 86  ? -5.783  -19.391 -3.381  1.00 0.00 ? 86  GLN A H    5  
ATOM 8447  H HA   . GLN A 1 86  ? -4.725  -19.655 -5.378  1.00 0.00 ? 86  GLN A HA   5  
ATOM 8448  H HB2  . GLN A 1 86  ? -6.685  -21.857 -6.001  1.00 0.00 ? 86  GLN A HB2  5  
ATOM 8449  H HB3  . GLN A 1 86  ? -5.049  -21.659 -6.616  1.00 0.00 ? 86  GLN A HB3  5  
ATOM 8450  H HG2  . GLN A 1 86  ? -4.293  -21.935 -4.196  1.00 0.00 ? 86  GLN A HG2  5  
ATOM 8451  H HG3  . GLN A 1 86  ? -5.927  -22.515 -3.882  1.00 0.00 ? 86  GLN A HG3  5  
ATOM 8452  H HE21 . GLN A 1 86  ? -3.331  -23.887 -3.735  1.00 0.00 ? 86  GLN A HE21 5  
ATOM 8453  H HE22 . GLN A 1 86  ? -3.475  -25.268 -4.764  1.00 0.00 ? 86  GLN A HE22 5  
ATOM 8454  N N    . LYS A 1 87  ? -6.882  -18.036 -6.122  1.00 0.00 ? 87  LYS A N    5  
ATOM 8455  C CA   . LYS A 1 87  ? -7.651  -17.198 -7.036  1.00 0.00 ? 87  LYS A CA   5  
ATOM 8456  C C    . LYS A 1 87  ? -7.058  -15.795 -7.116  1.00 0.00 ? 87  LYS A C    5  
ATOM 8457  O O    . LYS A 1 87  ? -6.887  -15.123 -6.098  1.00 0.00 ? 87  LYS A O    5  
ATOM 8458  C CB   . LYS A 1 87  ? -9.110  -17.121 -6.583  1.00 0.00 ? 87  LYS A CB   5  
ATOM 8459  C CG   . LYS A 1 87  ? -9.936  -18.332 -6.984  1.00 0.00 ? 87  LYS A CG   5  
ATOM 8460  C CD   . LYS A 1 87  ? -10.027 -18.470 -8.495  1.00 0.00 ? 87  LYS A CD   5  
ATOM 8461  C CE   . LYS A 1 87  ? -11.390 -18.987 -8.926  1.00 0.00 ? 87  LYS A CE   5  
ATOM 8462  N NZ   . LYS A 1 87  ? -11.592 -18.857 -10.397 1.00 0.00 ? 87  LYS A NZ   5  
ATOM 8463  H H    . LYS A 1 87  ? -6.614  -17.674 -5.252  1.00 0.00 ? 87  LYS A H    5  
ATOM 8464  H HA   . LYS A 1 87  ? -7.610  -17.650 -8.015  1.00 0.00 ? 87  LYS A HA   5  
ATOM 8465  H HB2  . LYS A 1 87  ? -9.137  -17.033 -5.507  1.00 0.00 ? 87  LYS A HB2  5  
ATOM 8466  H HB3  . LYS A 1 87  ? -9.564  -16.242 -7.020  1.00 0.00 ? 87  LYS A HB3  5  
ATOM 8467  H HG2  . LYS A 1 87  ? -9.476  -19.220 -6.580  1.00 0.00 ? 87  LYS A HG2  5  
ATOM 8468  H HG3  . LYS A 1 87  ? -10.934 -18.225 -6.582  1.00 0.00 ? 87  LYS A HG3  5  
ATOM 8469  H HD2  . LYS A 1 87  ? -9.862  -17.503 -8.947  1.00 0.00 ? 87  LYS A HD2  5  
ATOM 8470  H HD3  . LYS A 1 87  ? -9.266  -19.160 -8.830  1.00 0.00 ? 87  LYS A HD3  5  
ATOM 8471  H HE2  . LYS A 1 87  ? -11.469 -20.029 -8.652  1.00 0.00 ? 87  LYS A HE2  5  
ATOM 8472  H HE3  . LYS A 1 87  ? -12.155 -18.421 -8.416  1.00 0.00 ? 87  LYS A HE3  5  
ATOM 8473  H HZ1  . LYS A 1 87  ? -12.248 -18.075 -10.599 1.00 0.00 ? 87  LYS A HZ1  5  
ATOM 8474  H HZ2  . LYS A 1 87  ? -11.992 -19.738 -10.782 1.00 0.00 ? 87  LYS A HZ2  5  
ATOM 8475  H HZ3  . LYS A 1 87  ? -10.686 -18.665 -10.866 1.00 0.00 ? 87  LYS A HZ3  5  
ATOM 8476  N N    . THR A 1 88  ? -6.746  -15.357 -8.332  1.00 0.00 ? 88  THR A N    5  
ATOM 8477  C CA   . THR A 1 88  ? -6.172  -14.035 -8.544  1.00 0.00 ? 88  THR A CA   5  
ATOM 8478  C C    . THR A 1 88  ? -7.008  -12.958 -7.865  1.00 0.00 ? 88  THR A C    5  
ATOM 8479  O O    . THR A 1 88  ? -8.236  -13.053 -7.808  1.00 0.00 ? 88  THR A O    5  
ATOM 8480  C CB   . THR A 1 88  ? -6.056  -13.708 -10.045 1.00 0.00 ? 88  THR A CB   5  
ATOM 8481  O OG1  . THR A 1 88  ? -5.493  -14.822 -10.748 1.00 0.00 ? 88  THR A OG1  5  
ATOM 8482  C CG2  . THR A 1 88  ? -5.191  -12.475 -10.265 1.00 0.00 ? 88  THR A CG2  5  
ATOM 8483  H H    . THR A 1 88  ? -6.905  -15.940 -9.104  1.00 0.00 ? 88  THR A H    5  
ATOM 8484  H HA   . THR A 1 88  ? -5.179  -14.029 -8.118  1.00 0.00 ? 88  THR A HA   5  
ATOM 8485  H HB   . THR A 1 88  ? -7.044  -13.509 -10.432 1.00 0.00 ? 88  THR A HB   5  
ATOM 8486  H HG1  . THR A 1 88  ? -4.613  -15.002 -10.409 1.00 0.00 ? 88  THR A HG1  5  
ATOM 8487  H HG21 . THR A 1 88  ? -4.352  -12.732 -10.894 1.00 0.00 ? 88  THR A HG21 5  
ATOM 8488  H HG22 . THR A 1 88  ? -4.832  -12.114 -9.313  1.00 0.00 ? 88  THR A HG22 5  
ATOM 8489  H HG23 . THR A 1 88  ? -5.778  -11.706 -10.744 1.00 0.00 ? 88  THR A HG23 5  
ATOM 8490  N N    . TYR A 1 89  ? -6.339  -11.932 -7.350  1.00 0.00 ? 89  TYR A N    5  
ATOM 8491  C CA   . TYR A 1 89  ? -7.022  -10.836 -6.673  1.00 0.00 ? 89  TYR A CA   5  
ATOM 8492  C C    . TYR A 1 89  ? -6.295  -9.515  -6.904  1.00 0.00 ? 89  TYR A C    5  
ATOM 8493  O O    . TYR A 1 89  ? -5.067  -9.475  -6.984  1.00 0.00 ? 89  TYR A O    5  
ATOM 8494  C CB   . TYR A 1 89  ? -7.123  -11.120 -5.174  1.00 0.00 ? 89  TYR A CB   5  
ATOM 8495  C CG   . TYR A 1 89  ? -8.533  -11.396 -4.702  1.00 0.00 ? 89  TYR A CG   5  
ATOM 8496  C CD1  . TYR A 1 89  ? -9.096  -12.660 -4.835  1.00 0.00 ? 89  TYR A CD1  5  
ATOM 8497  C CD2  . TYR A 1 89  ? -9.302  -10.394 -4.125  1.00 0.00 ? 89  TYR A CD2  5  
ATOM 8498  C CE1  . TYR A 1 89  ? -10.384 -12.916 -4.407  1.00 0.00 ? 89  TYR A CE1  5  
ATOM 8499  C CE2  . TYR A 1 89  ? -10.590 -10.642 -3.692  1.00 0.00 ? 89  TYR A CE2  5  
ATOM 8500  C CZ   . TYR A 1 89  ? -11.127 -11.905 -3.837  1.00 0.00 ? 89  TYR A CZ   5  
ATOM 8501  O OH   . TYR A 1 89  ? -12.410 -12.156 -3.407  1.00 0.00 ? 89  TYR A OH   5  
ATOM 8502  H H    . TYR A 1 89  ? -5.364  -11.911 -7.427  1.00 0.00 ? 89  TYR A H    5  
ATOM 8503  H HA   . TYR A 1 89  ? -8.018  -10.762 -7.083  1.00 0.00 ? 89  TYR A HA   5  
ATOM 8504  H HB2  . TYR A 1 89  ? -6.520  -11.982 -4.936  1.00 0.00 ? 89  TYR A HB2  5  
ATOM 8505  H HB3  . TYR A 1 89  ? -6.752  -10.266 -4.626  1.00 0.00 ? 89  TYR A HB3  5  
ATOM 8506  H HD1  . TYR A 1 89  ? -8.510  -13.451 -5.283  1.00 0.00 ? 89  TYR A HD1  5  
ATOM 8507  H HD2  . TYR A 1 89  ? -8.879  -9.406  -4.013  1.00 0.00 ? 89  TYR A HD2  5  
ATOM 8508  H HE1  . TYR A 1 89  ? -10.804 -13.904 -4.520  1.00 0.00 ? 89  TYR A HE1  5  
ATOM 8509  H HE2  . TYR A 1 89  ? -11.173 -9.850  -3.244  1.00 0.00 ? 89  TYR A HE2  5  
ATOM 8510  H HH   . TYR A 1 89  ? -12.839 -11.329 -3.178  1.00 0.00 ? 89  TYR A HH   5  
ATOM 8511  N N    . SER A 1 90  ? -7.062  -8.435  -7.009  1.00 0.00 ? 90  SER A N    5  
ATOM 8512  C CA   . SER A 1 90  ? -6.493  -7.111  -7.234  1.00 0.00 ? 90  SER A CA   5  
ATOM 8513  C C    . SER A 1 90  ? -6.329  -6.360  -5.916  1.00 0.00 ? 90  SER A C    5  
ATOM 8514  O O    . SER A 1 90  ? -7.070  -6.589  -4.961  1.00 0.00 ? 90  SER A O    5  
ATOM 8515  C CB   . SER A 1 90  ? -7.379  -6.307  -8.187  1.00 0.00 ? 90  SER A CB   5  
ATOM 8516  O OG   . SER A 1 90  ? -7.470  -6.937  -9.453  1.00 0.00 ? 90  SER A OG   5  
ATOM 8517  H H    . SER A 1 90  ? -8.034  -8.531  -6.936  1.00 0.00 ? 90  SER A H    5  
ATOM 8518  H HA   . SER A 1 90  ? -5.521  -7.242  -7.684  1.00 0.00 ? 90  SER A HA   5  
ATOM 8519  H HB2  . SER A 1 90  ? -8.371  -6.223  -7.768  1.00 0.00 ? 90  SER A HB2  5  
ATOM 8520  H HB3  . SER A 1 90  ? -6.959  -5.320  -8.318  1.00 0.00 ? 90  SER A HB3  5  
ATOM 8521  H HG   . SER A 1 90  ? -8.212  -7.546  -9.456  1.00 0.00 ? 90  SER A HG   5  
ATOM 8522  N N    . VAL A 1 91  ? -5.352  -5.460  -5.874  1.00 0.00 ? 91  VAL A N    5  
ATOM 8523  C CA   . VAL A 1 91  ? -5.090  -4.672  -4.675  1.00 0.00 ? 91  VAL A CA   5  
ATOM 8524  C C    . VAL A 1 91  ? -4.567  -3.285  -5.033  1.00 0.00 ? 91  VAL A C    5  
ATOM 8525  O O    . VAL A 1 91  ? -3.719  -3.136  -5.912  1.00 0.00 ? 91  VAL A O    5  
ATOM 8526  C CB   . VAL A 1 91  ? -4.071  -5.371  -3.756  1.00 0.00 ? 91  VAL A CB   5  
ATOM 8527  C CG1  . VAL A 1 91  ? -3.864  -4.568  -2.481  1.00 0.00 ? 91  VAL A CG1  5  
ATOM 8528  C CG2  . VAL A 1 91  ? -4.527  -6.787  -3.437  1.00 0.00 ? 91  VAL A CG2  5  
ATOM 8529  H H    . VAL A 1 91  ? -4.795  -5.320  -6.668  1.00 0.00 ? 91  VAL A H    5  
ATOM 8530  H HA   . VAL A 1 91  ? -6.019  -4.567  -4.134  1.00 0.00 ? 91  VAL A HA   5  
ATOM 8531  H HB   . VAL A 1 91  ? -3.126  -5.427  -4.277  1.00 0.00 ? 91  VAL A HB   5  
ATOM 8532  H HG11 . VAL A 1 91  ? -4.716  -3.924  -2.318  1.00 0.00 ? 91  VAL A HG11 5  
ATOM 8533  H HG12 . VAL A 1 91  ? -3.757  -5.242  -1.644  1.00 0.00 ? 91  VAL A HG12 5  
ATOM 8534  H HG13 . VAL A 1 91  ? -2.971  -3.966  -2.575  1.00 0.00 ? 91  VAL A HG13 5  
ATOM 8535  H HG21 . VAL A 1 91  ? -4.336  -7.426  -4.285  1.00 0.00 ? 91  VAL A HG21 5  
ATOM 8536  H HG22 . VAL A 1 91  ? -3.983  -7.156  -2.579  1.00 0.00 ? 91  VAL A HG22 5  
ATOM 8537  H HG23 . VAL A 1 91  ? -5.584  -6.785  -3.218  1.00 0.00 ? 91  VAL A HG23 5  
ATOM 8538  N N    . LYS A 1 92  ? -5.080  -2.270  -4.344  1.00 0.00 ? 92  LYS A N    5  
ATOM 8539  C CA   . LYS A 1 92  ? -4.664  -0.893  -4.586  1.00 0.00 ? 92  LYS A CA   5  
ATOM 8540  C C    . LYS A 1 92  ? -4.693  -0.082  -3.294  1.00 0.00 ? 92  LYS A C    5  
ATOM 8541  O O    . LYS A 1 92  ? -5.391  -0.434  -2.342  1.00 0.00 ? 92  LYS A O    5  
ATOM 8542  C CB   . LYS A 1 92  ? -5.572  -0.241  -5.631  1.00 0.00 ? 92  LYS A CB   5  
ATOM 8543  C CG   . LYS A 1 92  ? -5.805  -1.106  -6.858  1.00 0.00 ? 92  LYS A CG   5  
ATOM 8544  C CD   . LYS A 1 92  ? -6.639  -0.381  -7.901  1.00 0.00 ? 92  LYS A CD   5  
ATOM 8545  C CE   . LYS A 1 92  ? -5.833  0.701   -8.604  1.00 0.00 ? 92  LYS A CE   5  
ATOM 8546  N NZ   . LYS A 1 92  ? -6.318  0.937   -9.992  1.00 0.00 ? 92  LYS A NZ   5  
ATOM 8547  H H    . LYS A 1 92  ? -5.752  -2.452  -3.653  1.00 0.00 ? 92  LYS A H    5  
ATOM 8548  H HA   . LYS A 1 92  ? -3.652  -0.913  -4.961  1.00 0.00 ? 92  LYS A HA   5  
ATOM 8549  H HB2  . LYS A 1 92  ? -6.529  -0.029  -5.177  1.00 0.00 ? 92  LYS A HB2  5  
ATOM 8550  H HB3  . LYS A 1 92  ? -5.122  0.687   -5.952  1.00 0.00 ? 92  LYS A HB3  5  
ATOM 8551  H HG2  . LYS A 1 92  ? -4.851  -1.365  -7.292  1.00 0.00 ? 92  LYS A HG2  5  
ATOM 8552  H HG3  . LYS A 1 92  ? -6.322  -2.008  -6.559  1.00 0.00 ? 92  LYS A HG3  5  
ATOM 8553  H HD2  . LYS A 1 92  ? -6.981  -1.095  -8.636  1.00 0.00 ? 92  LYS A HD2  5  
ATOM 8554  H HD3  . LYS A 1 92  ? -7.491  0.074   -7.415  1.00 0.00 ? 92  LYS A HD3  5  
ATOM 8555  H HE2  . LYS A 1 92  ? -5.919  1.618   -8.041  1.00 0.00 ? 92  LYS A HE2  5  
ATOM 8556  H HE3  . LYS A 1 92  ? -4.798  0.394   -8.641  1.00 0.00 ? 92  LYS A HE3  5  
ATOM 8557  H HZ1  . LYS A 1 92  ? -6.816  1.849   -10.046 1.00 0.00 ? 92  LYS A HZ1  5  
ATOM 8558  H HZ2  . LYS A 1 92  ? -6.971  0.181   -10.276 1.00 0.00 ? 92  LYS A HZ2  5  
ATOM 8559  H HZ3  . LYS A 1 92  ? -5.515  0.954   -10.653 1.00 0.00 ? 92  LYS A HZ3  5  
ATOM 8560  N N    . VAL A 1 93  ? -3.933  1.008   -3.268  1.00 0.00 ? 93  VAL A N    5  
ATOM 8561  C CA   . VAL A 1 93  ? -3.874  1.872   -2.095  1.00 0.00 ? 93  VAL A CA   5  
ATOM 8562  C C    . VAL A 1 93  ? -3.718  3.334   -2.497  1.00 0.00 ? 93  VAL A C    5  
ATOM 8563  O O    . VAL A 1 93  ? -3.059  3.651   -3.489  1.00 0.00 ? 93  VAL A O    5  
ATOM 8564  C CB   . VAL A 1 93  ? -2.710  1.479   -1.168  1.00 0.00 ? 93  VAL A CB   5  
ATOM 8565  C CG1  . VAL A 1 93  ? -2.781  2.258   0.138   1.00 0.00 ? 93  VAL A CG1  5  
ATOM 8566  C CG2  . VAL A 1 93  ? -2.721  -0.020  -0.904  1.00 0.00 ? 93  VAL A CG2  5  
ATOM 8567  H H    . VAL A 1 93  ? -3.400  1.238   -4.058  1.00 0.00 ? 93  VAL A H    5  
ATOM 8568  H HA   . VAL A 1 93  ? -4.799  1.755   -1.548  1.00 0.00 ? 93  VAL A HA   5  
ATOM 8569  H HB   . VAL A 1 93  ? -1.783  1.729   -1.660  1.00 0.00 ? 93  VAL A HB   5  
ATOM 8570  H HG11 . VAL A 1 93  ? -3.721  2.787   0.190   1.00 0.00 ? 93  VAL A HG11 5  
ATOM 8571  H HG12 . VAL A 1 93  ? -2.703  1.575   0.971   1.00 0.00 ? 93  VAL A HG12 5  
ATOM 8572  H HG13 . VAL A 1 93  ? -1.967  2.968   0.177   1.00 0.00 ? 93  VAL A HG13 5  
ATOM 8573  H HG21 . VAL A 1 93  ? -3.702  -0.316  -0.560  1.00 0.00 ? 93  VAL A HG21 5  
ATOM 8574  H HG22 . VAL A 1 93  ? -2.484  -0.547  -1.815  1.00 0.00 ? 93  VAL A HG22 5  
ATOM 8575  H HG23 . VAL A 1 93  ? -1.987  -0.259  -0.149  1.00 0.00 ? 93  VAL A HG23 5  
ATOM 8576  N N    . LEU A 1 94  ? -4.328  4.224   -1.720  1.00 0.00 ? 94  LEU A N    5  
ATOM 8577  C CA   . LEU A 1 94  ? -4.257  5.654   -1.993  1.00 0.00 ? 94  LEU A CA   5  
ATOM 8578  C C    . LEU A 1 94  ? -4.290  6.459   -0.698  1.00 0.00 ? 94  LEU A C    5  
ATOM 8579  O O    . LEU A 1 94  ? -4.576  5.920   0.372   1.00 0.00 ? 94  LEU A O    5  
ATOM 8580  C CB   . LEU A 1 94  ? -5.412  6.078   -2.901  1.00 0.00 ? 94  LEU A CB   5  
ATOM 8581  C CG   . LEU A 1 94  ? -6.755  6.318   -2.209  1.00 0.00 ? 94  LEU A CG   5  
ATOM 8582  C CD1  . LEU A 1 94  ? -6.884  7.773   -1.786  1.00 0.00 ? 94  LEU A CD1  5  
ATOM 8583  C CD2  . LEU A 1 94  ? -7.904  5.924   -3.126  1.00 0.00 ? 94  LEU A CD2  5  
ATOM 8584  H H    . LEU A 1 94  ? -4.838  3.911   -0.943  1.00 0.00 ? 94  LEU A H    5  
ATOM 8585  H HA   . LEU A 1 94  ? -3.322  5.848   -2.499  1.00 0.00 ? 94  LEU A HA   5  
ATOM 8586  H HB2  . LEU A 1 94  ? -5.127  6.995   -3.394  1.00 0.00 ? 94  LEU A HB2  5  
ATOM 8587  H HB3  . LEU A 1 94  ? -5.554  5.302   -3.640  1.00 0.00 ? 94  LEU A HB3  5  
ATOM 8588  H HG   . LEU A 1 94  ? -6.809  5.707   -1.319  1.00 0.00 ? 94  LEU A HG   5  
ATOM 8589  H HD11 . LEU A 1 94  ? -7.878  8.128   -2.015  1.00 0.00 ? 94  LEU A HD11 5  
ATOM 8590  H HD12 . LEU A 1 94  ? -6.158  8.370   -2.320  1.00 0.00 ? 94  LEU A HD12 5  
ATOM 8591  H HD13 . LEU A 1 94  ? -6.706  7.856   -0.724  1.00 0.00 ? 94  LEU A HD13 5  
ATOM 8592  H HD21 . LEU A 1 94  ? -7.739  4.923   -3.497  1.00 0.00 ? 94  LEU A HD21 5  
ATOM 8593  H HD22 . LEU A 1 94  ? -7.957  6.613   -3.955  1.00 0.00 ? 94  LEU A HD22 5  
ATOM 8594  H HD23 . LEU A 1 94  ? -8.831  5.953   -2.572  1.00 0.00 ? 94  LEU A HD23 5  
ATOM 8595  N N    . ALA A 1 95  ? -3.999  7.752   -0.802  1.00 0.00 ? 95  ALA A N    5  
ATOM 8596  C CA   . ALA A 1 95  ? -4.000  8.631   0.360   1.00 0.00 ? 95  ALA A CA   5  
ATOM 8597  C C    . ALA A 1 95  ? -5.049  9.728   0.217   1.00 0.00 ? 95  ALA A C    5  
ATOM 8598  O O    . ALA A 1 95  ? -5.346  10.179  -0.890  1.00 0.00 ? 95  ALA A O    5  
ATOM 8599  C CB   . ALA A 1 95  ? -2.621  9.241   0.562   1.00 0.00 ? 95  ALA A CB   5  
ATOM 8600  H H    . ALA A 1 95  ? -3.778  8.123   -1.683  1.00 0.00 ? 95  ALA A H    5  
ATOM 8601  H HA   . ALA A 1 95  ? -4.234  8.033   1.230   1.00 0.00 ? 95  ALA A HA   5  
ATOM 8602  H HB1  . ALA A 1 95  ? -2.462  9.430   1.613   1.00 0.00 ? 95  ALA A HB1  5  
ATOM 8603  H HB2  . ALA A 1 95  ? -1.868  8.557   0.200   1.00 0.00 ? 95  ALA A HB2  5  
ATOM 8604  H HB3  . ALA A 1 95  ? -2.556  10.170  0.017   1.00 0.00 ? 95  ALA A HB3  5  
ATOM 8605  N N    . PHE A 1 96  ? -5.613  10.152  1.344   1.00 0.00 ? 96  PHE A N    5  
ATOM 8606  C CA   . PHE A 1 96  ? -6.631  11.195  1.344   1.00 0.00 ? 96  PHE A CA   5  
ATOM 8607  C C    . PHE A 1 96  ? -6.611  11.974  2.656   1.00 0.00 ? 96  PHE A C    5  
ATOM 8608  O O    . PHE A 1 96  ? -6.334  11.419  3.719   1.00 0.00 ? 96  PHE A O    5  
ATOM 8609  C CB   . PHE A 1 96  ? -8.017  10.585  1.122   1.00 0.00 ? 96  PHE A CB   5  
ATOM 8610  C CG   . PHE A 1 96  ? -8.541  9.839   2.315   1.00 0.00 ? 96  PHE A CG   5  
ATOM 8611  C CD1  . PHE A 1 96  ? -9.258  10.499  3.302   1.00 0.00 ? 96  PHE A CD1  5  
ATOM 8612  C CD2  . PHE A 1 96  ? -8.318  8.478   2.453   1.00 0.00 ? 96  PHE A CD2  5  
ATOM 8613  C CE1  . PHE A 1 96  ? -9.744  9.816   4.401   1.00 0.00 ? 96  PHE A CE1  5  
ATOM 8614  C CE2  . PHE A 1 96  ? -8.801  7.790   3.550   1.00 0.00 ? 96  PHE A CE2  5  
ATOM 8615  C CZ   . PHE A 1 96  ? -9.512  8.460   4.525   1.00 0.00 ? 96  PHE A CZ   5  
ATOM 8616  H H    . PHE A 1 96  ? -5.336  9.754   2.196   1.00 0.00 ? 96  PHE A H    5  
ATOM 8617  H HA   . PHE A 1 96  ? -6.412  11.873  0.533   1.00 0.00 ? 96  PHE A HA   5  
ATOM 8618  H HB2  . PHE A 1 96  ? -8.718  11.372  0.889   1.00 0.00 ? 96  PHE A HB2  5  
ATOM 8619  H HB3  . PHE A 1 96  ? -7.970  9.895   0.293   1.00 0.00 ? 96  PHE A HB3  5  
ATOM 8620  H HD1  . PHE A 1 96  ? -9.440  11.560  3.204   1.00 0.00 ? 96  PHE A HD1  5  
ATOM 8621  H HD2  . PHE A 1 96  ? -7.759  7.953   1.692   1.00 0.00 ? 96  PHE A HD2  5  
ATOM 8622  H HE1  . PHE A 1 96  ? -10.301 10.343  5.161   1.00 0.00 ? 96  PHE A HE1  5  
ATOM 8623  H HE2  . PHE A 1 96  ? -8.618  6.731   3.646   1.00 0.00 ? 96  PHE A HE2  5  
ATOM 8624  H HZ   . PHE A 1 96  ? -9.891  7.924   5.384   1.00 0.00 ? 96  PHE A HZ   5  
ATOM 8625  N N    . THR A 1 97  ? -6.908  13.268  2.573   1.00 0.00 ? 97  THR A N    5  
ATOM 8626  C CA   . THR A 1 97  ? -6.922  14.126  3.752   1.00 0.00 ? 97  THR A CA   5  
ATOM 8627  C C    . THR A 1 97  ? -8.217  14.926  3.832   1.00 0.00 ? 97  THR A C    5  
ATOM 8628  O O    . THR A 1 97  ? -9.092  14.799  2.976   1.00 0.00 ? 97  THR A O    5  
ATOM 8629  C CB   . THR A 1 97  ? -5.729  15.100  3.752   1.00 0.00 ? 97  THR A CB   5  
ATOM 8630  O OG1  . THR A 1 97  ? -5.933  16.128  2.776   1.00 0.00 ? 97  THR A OG1  5  
ATOM 8631  C CG2  . THR A 1 97  ? -4.430  14.364  3.456   1.00 0.00 ? 97  THR A CG2  5  
ATOM 8632  H H    . THR A 1 97  ? -7.120  13.653  1.698   1.00 0.00 ? 97  THR A H    5  
ATOM 8633  H HA   . THR A 1 97  ? -6.846  13.495  4.624   1.00 0.00 ? 97  THR A HA   5  
ATOM 8634  H HB   . THR A 1 97  ? -5.654  15.553  4.731   1.00 0.00 ? 97  THR A HB   5  
ATOM 8635  H HG1  . THR A 1 97  ? -6.509  15.798  2.081   1.00 0.00 ? 97  THR A HG1  5  
ATOM 8636  H HG21 . THR A 1 97  ? -3.605  15.059  3.502   1.00 0.00 ? 97  THR A HG21 5  
ATOM 8637  H HG22 . THR A 1 97  ? -4.481  13.929  2.470   1.00 0.00 ? 97  THR A HG22 5  
ATOM 8638  H HG23 . THR A 1 97  ? -4.284  13.584  4.187   1.00 0.00 ? 97  THR A HG23 5  
ATOM 8639  N N    . SER A 1 98  ? -8.331  15.753  4.867   1.00 0.00 ? 98  SER A N    5  
ATOM 8640  C CA   . SER A 1 98  ? -9.523  16.573  5.062   1.00 0.00 ? 98  SER A CA   5  
ATOM 8641  C C    . SER A 1 98  ? -9.813  17.411  3.820   1.00 0.00 ? 98  SER A C    5  
ATOM 8642  O O    . SER A 1 98  ? -10.961 17.768  3.553   1.00 0.00 ? 98  SER A O    5  
ATOM 8643  C CB   . SER A 1 98  ? -9.346  17.485  6.277   1.00 0.00 ? 98  SER A CB   5  
ATOM 8644  O OG   . SER A 1 98  ? -10.512 18.255  6.511   1.00 0.00 ? 98  SER A OG   5  
ATOM 8645  H H    . SER A 1 98  ? -7.601  15.812  5.516   1.00 0.00 ? 98  SER A H    5  
ATOM 8646  H HA   . SER A 1 98  ? -10.357 15.910  5.237   1.00 0.00 ? 98  SER A HA   5  
ATOM 8647  H HB2  . SER A 1 98  ? -9.146  16.883  7.150   1.00 0.00 ? 98  SER A HB2  5  
ATOM 8648  H HB3  . SER A 1 98  ? -8.516  18.155  6.104   1.00 0.00 ? 98  SER A HB3  5  
ATOM 8649  H HG   . SER A 1 98  ? -11.244 17.671  6.726   1.00 0.00 ? 98  SER A HG   5  
ATOM 8650  N N    . ILE A 1 99  ? -8.765  17.725  3.067   1.00 0.00 ? 99  ILE A N    5  
ATOM 8651  C CA   . ILE A 1 99  ? -8.905  18.520  1.854   1.00 0.00 ? 99  ILE A CA   5  
ATOM 8652  C C    . ILE A 1 99  ? -9.565  17.713  0.741   1.00 0.00 ? 99  ILE A C    5  
ATOM 8653  O O    . ILE A 1 99  ? -10.617 18.090  0.224   1.00 0.00 ? 99  ILE A O    5  
ATOM 8654  C CB   . ILE A 1 99  ? -7.544  19.039  1.358   1.00 0.00 ? 99  ILE A CB   5  
ATOM 8655  C CG1  . ILE A 1 99  ? -6.869  19.883  2.442   1.00 0.00 ? 99  ILE A CG1  5  
ATOM 8656  C CG2  . ILE A 1 99  ? -7.716  19.846  0.080   1.00 0.00 ? 99  ILE A CG2  5  
ATOM 8657  C CD1  . ILE A 1 99  ? -7.679  21.090  2.858   1.00 0.00 ? 99  ILE A CD1  5  
ATOM 8658  H H    . ILE A 1 99  ? -7.875  17.412  3.332   1.00 0.00 ? 99  ILE A H    5  
ATOM 8659  H HA   . ILE A 1 99  ? -9.530  19.371  2.084   1.00 0.00 ? 99  ILE A HA   5  
ATOM 8660  H HB   . ILE A 1 99  ? -6.919  18.188  1.135   1.00 0.00 ? 99  ILE A HB   5  
ATOM 8661  H HG12 . ILE A 1 99  ? -6.710  19.273  3.318   1.00 0.00 ? 99  ILE A HG12 5  
ATOM 8662  H HG13 . ILE A 1 99  ? -5.916  20.233  2.073   1.00 0.00 ? 99  ILE A HG13 5  
ATOM 8663  H HG21 . ILE A 1 99  ? -7.327  19.286  -0.756  1.00 0.00 ? 99  ILE A HG21 5  
ATOM 8664  H HG22 . ILE A 1 99  ? -8.766  20.047  -0.078  1.00 0.00 ? 99  ILE A HG22 5  
ATOM 8665  H HG23 . ILE A 1 99  ? -7.181  20.780  0.169   1.00 0.00 ? 99  ILE A HG23 5  
ATOM 8666  H HD11 . ILE A 1 99  ? -7.062  21.974  2.803   1.00 0.00 ? 99  ILE A HD11 5  
ATOM 8667  H HD12 . ILE A 1 99  ? -8.527  21.201  2.199   1.00 0.00 ? 99  ILE A HD12 5  
ATOM 8668  H HD13 . ILE A 1 99  ? -8.027  20.958  3.872   1.00 0.00 ? 99  ILE A HD13 5  
ATOM 8669  N N    . GLY A 1 100 ? -8.941  16.598  0.375   1.00 0.00 ? 100 GLY A N    5  
ATOM 8670  C CA   . GLY A 1 100 ? -9.482  15.753  -0.673  1.00 0.00 ? 100 GLY A CA   5  
ATOM 8671  C C    . GLY A 1 100 ? -8.756  14.425  -0.781  1.00 0.00 ? 100 GLY A C    5  
ATOM 8672  O O    . GLY A 1 100 ? -8.024  14.036  0.128   1.00 0.00 ? 100 GLY A O    5  
ATOM 8673  H H    . GLY A 1 100 ? -8.105  16.346  0.823   1.00 0.00 ? 100 GLY A H    5  
ATOM 8674  H HA2  . GLY A 1 100 ? -10.524 15.565  -0.466  1.00 0.00 ? 100 GLY A HA2  5  
ATOM 8675  H HA3  . GLY A 1 100 ? -9.400  16.272  -1.616  1.00 0.00 ? 100 GLY A HA3  5  
ATOM 8676  N N    . ASP A 1 101 ? -8.962  13.730  -1.894  1.00 0.00 ? 101 ASP A N    5  
ATOM 8677  C CA   . ASP A 1 101 ? -8.322  12.439  -2.117  1.00 0.00 ? 101 ASP A CA   5  
ATOM 8678  C C    . ASP A 1 101 ? -7.089  12.589  -3.002  1.00 0.00 ? 101 ASP A C    5  
ATOM 8679  O O    . ASP A 1 101 ? -6.818  13.668  -3.530  1.00 0.00 ? 101 ASP A O    5  
ATOM 8680  C CB   . ASP A 1 101 ? -9.309  11.462  -2.758  1.00 0.00 ? 101 ASP A CB   5  
ATOM 8681  C CG   . ASP A 1 101 ? -10.100 12.093  -3.886  1.00 0.00 ? 101 ASP A CG   5  
ATOM 8682  O OD1  . ASP A 1 101 ? -9.473  12.583  -4.849  1.00 0.00 ? 101 ASP A OD1  5  
ATOM 8683  O OD2  . ASP A 1 101 ? -11.346 12.097  -3.807  1.00 0.00 ? 101 ASP A OD2  5  
ATOM 8684  H H    . ASP A 1 101 ? -9.558  14.095  -2.581  1.00 0.00 ? 101 ASP A H    5  
ATOM 8685  H HA   . ASP A 1 101 ? -8.016  12.049  -1.157  1.00 0.00 ? 101 ASP A HA   5  
ATOM 8686  H HB2  . ASP A 1 101 ? -8.763  10.618  -3.154  1.00 0.00 ? 101 ASP A HB2  5  
ATOM 8687  H HB3  . ASP A 1 101 ? -10.002 11.114  -2.006  1.00 0.00 ? 101 ASP A HB3  5  
ATOM 8688  N N    . GLY A 1 102 ? -6.343  11.500  -3.159  1.00 0.00 ? 102 GLY A N    5  
ATOM 8689  C CA   . GLY A 1 102 ? -5.145  11.532  -3.979  1.00 0.00 ? 102 GLY A CA   5  
ATOM 8690  C C    . GLY A 1 102 ? -5.140  10.450  -5.040  1.00 0.00 ? 102 GLY A C    5  
ATOM 8691  O O    . GLY A 1 102 ? -6.050  9.623   -5.119  1.00 0.00 ? 102 GLY A O    5  
ATOM 8692  H H    . GLY A 1 102 ? -6.607  10.667  -2.713  1.00 0.00 ? 102 GLY A H    5  
ATOM 8693  H HA2  . GLY A 1 102 ? -5.079  12.495  -4.461  1.00 0.00 ? 102 GLY A HA2  5  
ATOM 8694  H HA3  . GLY A 1 102 ? -4.283  11.398  -3.342  1.00 0.00 ? 102 GLY A HA3  5  
ATOM 8695  N N    . PRO A 1 103 ? -4.098  10.449  -5.885  1.00 0.00 ? 103 PRO A N    5  
ATOM 8696  C CA   . PRO A 1 103 ? -3.955  9.467   -6.964  1.00 0.00 ? 103 PRO A CA   5  
ATOM 8697  C C    . PRO A 1 103 ? -3.657  8.067   -6.438  1.00 0.00 ? 103 PRO A C    5  
ATOM 8698  O O    . PRO A 1 103 ? -2.760  7.880   -5.613  1.00 0.00 ? 103 PRO A O    5  
ATOM 8699  C CB   . PRO A 1 103 ? -2.768  9.998   -7.771  1.00 0.00 ? 103 PRO A CB   5  
ATOM 8700  C CG   . PRO A 1 103 ? -1.978  10.805  -6.799  1.00 0.00 ? 103 PRO A CG   5  
ATOM 8701  C CD   . PRO A 1 103 ? -2.979  11.406  -5.850  1.00 0.00 ? 103 PRO A CD   5  
ATOM 8702  H HA   . PRO A 1 103 ? -4.834  9.435   -7.589  1.00 0.00 ? 103 PRO A HA   5  
ATOM 8703  H HB2  . PRO A 1 103 ? -2.193  9.169   -8.158  1.00 0.00 ? 103 PRO A HB2  5  
ATOM 8704  H HB3  . PRO A 1 103 ? -3.127  10.606  -8.588  1.00 0.00 ? 103 PRO A HB3  5  
ATOM 8705  H HG2  . PRO A 1 103 ? -1.292  10.167  -6.265  1.00 0.00 ? 103 PRO A HG2  5  
ATOM 8706  H HG3  . PRO A 1 103 ? -1.442  11.584  -7.320  1.00 0.00 ? 103 PRO A HG3  5  
ATOM 8707  H HD2  . PRO A 1 103 ? -2.563  11.475  -4.857  1.00 0.00 ? 103 PRO A HD2  5  
ATOM 8708  H HD3  . PRO A 1 103 ? -3.294  12.377  -6.200  1.00 0.00 ? 103 PRO A HD3  5  
ATOM 8709  N N    . LEU A 1 104 ? -4.412  7.086   -6.917  1.00 0.00 ? 104 LEU A N    5  
ATOM 8710  C CA   . LEU A 1 104 ? -4.229  5.702   -6.495  1.00 0.00 ? 104 LEU A CA   5  
ATOM 8711  C C    . LEU A 1 104 ? -2.839  5.198   -6.870  1.00 0.00 ? 104 LEU A C    5  
ATOM 8712  O O    . LEU A 1 104 ? -2.142  5.812   -7.678  1.00 0.00 ? 104 LEU A O    5  
ATOM 8713  C CB   . LEU A 1 104 ? -5.296  4.808   -7.130  1.00 0.00 ? 104 LEU A CB   5  
ATOM 8714  C CG   . LEU A 1 104 ? -6.676  4.841   -6.472  1.00 0.00 ? 104 LEU A CG   5  
ATOM 8715  C CD1  . LEU A 1 104 ? -7.770  4.906   -7.526  1.00 0.00 ? 104 LEU A CD1  5  
ATOM 8716  C CD2  . LEU A 1 104 ? -6.869  3.627   -5.576  1.00 0.00 ? 104 LEU A CD2  5  
ATOM 8717  H H    . LEU A 1 104 ? -5.111  7.296   -7.571  1.00 0.00 ? 104 LEU A H    5  
ATOM 8718  H HA   . LEU A 1 104 ? -4.333  5.667   -5.420  1.00 0.00 ? 104 LEU A HA   5  
ATOM 8719  H HB2  . LEU A 1 104 ? -5.413  5.112   -8.158  1.00 0.00 ? 104 LEU A HB2  5  
ATOM 8720  H HB3  . LEU A 1 104 ? -4.936  3.790   -7.096  1.00 0.00 ? 104 LEU A HB3  5  
ATOM 8721  H HG   . LEU A 1 104 ? -6.754  5.727   -5.857  1.00 0.00 ? 104 LEU A HG   5  
ATOM 8722  H HD11 . LEU A 1 104 ? -7.897  3.932   -7.973  1.00 0.00 ? 104 LEU A HD11 5  
ATOM 8723  H HD12 . LEU A 1 104 ? -7.491  5.619   -8.290  1.00 0.00 ? 104 LEU A HD12 5  
ATOM 8724  H HD13 . LEU A 1 104 ? -8.696  5.216   -7.065  1.00 0.00 ? 104 LEU A HD13 5  
ATOM 8725  H HD21 . LEU A 1 104 ? -7.880  3.613   -5.200  1.00 0.00 ? 104 LEU A HD21 5  
ATOM 8726  H HD22 . LEU A 1 104 ? -6.178  3.677   -4.746  1.00 0.00 ? 104 LEU A HD22 5  
ATOM 8727  H HD23 . LEU A 1 104 ? -6.684  2.727   -6.144  1.00 0.00 ? 104 LEU A HD23 5  
ATOM 8728  N N    . SER A 1 105 ? -2.443  4.074   -6.281  1.00 0.00 ? 105 SER A N    5  
ATOM 8729  C CA   . SER A 1 105 ? -1.135  3.488   -6.552  1.00 0.00 ? 105 SER A CA   5  
ATOM 8730  C C    . SER A 1 105 ? -1.212  2.506   -7.717  1.00 0.00 ? 105 SER A C    5  
ATOM 8731  O O    . SER A 1 105 ? -2.293  2.214   -8.229  1.00 0.00 ? 105 SER A O    5  
ATOM 8732  C CB   . SER A 1 105 ? -0.602  2.779   -5.307  1.00 0.00 ? 105 SER A CB   5  
ATOM 8733  O OG   . SER A 1 105 ? -1.005  1.420   -5.281  1.00 0.00 ? 105 SER A OG   5  
ATOM 8734  H H    . SER A 1 105 ? -3.044  3.631   -5.646  1.00 0.00 ? 105 SER A H    5  
ATOM 8735  H HA   . SER A 1 105 ? -0.462  4.290   -6.816  1.00 0.00 ? 105 SER A HA   5  
ATOM 8736  H HB2  . SER A 1 105 ? 0.476   2.821   -5.305  1.00 0.00 ? 105 SER A HB2  5  
ATOM 8737  H HB3  . SER A 1 105 ? -0.984  3.272   -4.423  1.00 0.00 ? 105 SER A HB3  5  
ATOM 8738  H HG   . SER A 1 105 ? -1.366  1.209   -4.417  1.00 0.00 ? 105 SER A HG   5  
ATOM 8739  N N    . SER A 1 106 ? -0.056  2.000   -8.132  1.00 0.00 ? 106 SER A N    5  
ATOM 8740  C CA   . SER A 1 106 ? 0.011   1.054   -9.240  1.00 0.00 ? 106 SER A CA   5  
ATOM 8741  C C    . SER A 1 106 ? -0.733  -0.235  -8.900  1.00 0.00 ? 106 SER A C    5  
ATOM 8742  O O    . SER A 1 106 ? -0.316  -0.991  -8.021  1.00 0.00 ? 106 SER A O    5  
ATOM 8743  C CB   . SER A 1 106 ? 1.469   0.740   -9.583  1.00 0.00 ? 106 SER A CB   5  
ATOM 8744  O OG   . SER A 1 106 ? 2.355   1.574   -8.860  1.00 0.00 ? 106 SER A OG   5  
ATOM 8745  H H    . SER A 1 106 ? 0.773   2.272   -7.686  1.00 0.00 ? 106 SER A H    5  
ATOM 8746  H HA   . SER A 1 106 ? -0.461  1.512   -10.097 1.00 0.00 ? 106 SER A HA   5  
ATOM 8747  H HB2  . SER A 1 106 ? 1.680   -0.290  -9.337  1.00 0.00 ? 106 SER A HB2  5  
ATOM 8748  H HB3  . SER A 1 106 ? 1.628   0.895   -10.641 1.00 0.00 ? 106 SER A HB3  5  
ATOM 8749  H HG   . SER A 1 106 ? 2.651   1.118   -8.070  1.00 0.00 ? 106 SER A HG   5  
ATOM 8750  N N    . ASP A 1 107 ? -1.835  -0.477  -9.599  1.00 0.00 ? 107 ASP A N    5  
ATOM 8751  C CA   . ASP A 1 107 ? -2.637  -1.673  -9.373  1.00 0.00 ? 107 ASP A CA   5  
ATOM 8752  C C    . ASP A 1 107 ? -1.769  -2.927  -9.426  1.00 0.00 ? 107 ASP A C    5  
ATOM 8753  O O    . ASP A 1 107 ? -1.097  -3.187  -10.425 1.00 0.00 ? 107 ASP A O    5  
ATOM 8754  C CB   . ASP A 1 107 ? -3.756  -1.768  -10.412 1.00 0.00 ? 107 ASP A CB   5  
ATOM 8755  C CG   . ASP A 1 107 ? -3.276  -1.435  -11.810 1.00 0.00 ? 107 ASP A CG   5  
ATOM 8756  O OD1  . ASP A 1 107 ? -2.809  -2.356  -12.513 1.00 0.00 ? 107 ASP A OD1  5  
ATOM 8757  O OD2  . ASP A 1 107 ? -3.367  -0.253  -12.205 1.00 0.00 ? 107 ASP A OD2  5  
ATOM 8758  H H    . ASP A 1 107 ? -2.115  0.164   -10.286 1.00 0.00 ? 107 ASP A H    5  
ATOM 8759  H HA   . ASP A 1 107 ? -3.077  -1.597  -8.390  1.00 0.00 ? 107 ASP A HA   5  
ATOM 8760  H HB2  . ASP A 1 107 ? -4.149  -2.773  -10.416 1.00 0.00 ? 107 ASP A HB2  5  
ATOM 8761  H HB3  . ASP A 1 107 ? -4.543  -1.078  -10.146 1.00 0.00 ? 107 ASP A HB3  5  
ATOM 8762  N N    . ILE A 1 108 ? -1.789  -3.701  -8.344  1.00 0.00 ? 108 ILE A N    5  
ATOM 8763  C CA   . ILE A 1 108 ? -1.003  -4.926  -8.270  1.00 0.00 ? 108 ILE A CA   5  
ATOM 8764  C C    . ILE A 1 108 ? -1.906  -6.152  -8.191  1.00 0.00 ? 108 ILE A C    5  
ATOM 8765  O O    . ILE A 1 108 ? -3.093  -6.043  -7.883  1.00 0.00 ? 108 ILE A O    5  
ATOM 8766  C CB   . ILE A 1 108 ? -0.063  -4.917  -7.051  1.00 0.00 ? 108 ILE A CB   5  
ATOM 8767  C CG1  . ILE A 1 108 ? -0.828  -4.510  -5.791  1.00 0.00 ? 108 ILE A CG1  5  
ATOM 8768  C CG2  . ILE A 1 108 ? 1.109   -3.977  -7.292  1.00 0.00 ? 108 ILE A CG2  5  
ATOM 8769  C CD1  . ILE A 1 108 ? 0.028   -4.491  -4.543  1.00 0.00 ? 108 ILE A CD1  5  
ATOM 8770  H H    . ILE A 1 108 ? -2.343  -3.440  -7.582  1.00 0.00 ? 108 ILE A H    5  
ATOM 8771  H HA   . ILE A 1 108 ? -0.401  -4.991  -9.164  1.00 0.00 ? 108 ILE A HA   5  
ATOM 8772  H HB   . ILE A 1 108 ? 0.329   -5.915  -6.919  1.00 0.00 ? 108 ILE A HB   5  
ATOM 8773  H HG12 . ILE A 1 108 ? -1.234  -3.519  -5.927  1.00 0.00 ? 108 ILE A HG12 5  
ATOM 8774  H HG13 . ILE A 1 108 ? -1.636  -5.208  -5.628  1.00 0.00 ? 108 ILE A HG13 5  
ATOM 8775  H HG21 . ILE A 1 108 ? 0.749   -2.961  -7.348  1.00 0.00 ? 108 ILE A HG21 5  
ATOM 8776  H HG22 . ILE A 1 108 ? 1.815   -4.065  -6.481  1.00 0.00 ? 108 ILE A HG22 5  
ATOM 8777  H HG23 . ILE A 1 108 ? 1.593   -4.237  -8.221  1.00 0.00 ? 108 ILE A HG23 5  
ATOM 8778  H HD11 . ILE A 1 108 ? -0.558  -4.819  -3.698  1.00 0.00 ? 108 ILE A HD11 5  
ATOM 8779  H HD12 . ILE A 1 108 ? 0.872   -5.151  -4.675  1.00 0.00 ? 108 ILE A HD12 5  
ATOM 8780  H HD13 . ILE A 1 108 ? 0.382   -3.486  -4.365  1.00 0.00 ? 108 ILE A HD13 5  
ATOM 8781  N N    . GLN A 1 109 ? -1.336  -7.320  -8.470  1.00 0.00 ? 109 GLN A N    5  
ATOM 8782  C CA   . GLN A 1 109 ? -2.089  -8.567  -8.431  1.00 0.00 ? 109 GLN A CA   5  
ATOM 8783  C C    . GLN A 1 109 ? -1.363  -9.616  -7.593  1.00 0.00 ? 109 GLN A C    5  
ATOM 8784  O O    . GLN A 1 109 ? -0.184  -9.892  -7.813  1.00 0.00 ? 109 GLN A O    5  
ATOM 8785  C CB   . GLN A 1 109 ? -2.316  -9.097  -9.847  1.00 0.00 ? 109 GLN A CB   5  
ATOM 8786  C CG   . GLN A 1 109 ? -3.078  -8.133  -10.742 1.00 0.00 ? 109 GLN A CG   5  
ATOM 8787  C CD   . GLN A 1 109 ? -4.459  -7.808  -10.207 1.00 0.00 ? 109 GLN A CD   5  
ATOM 8788  O OE1  . GLN A 1 109 ? -5.058  -8.600  -9.480  1.00 0.00 ? 109 GLN A OE1  5  
ATOM 8789  N NE2  . GLN A 1 109 ? -4.971  -6.636  -10.563 1.00 0.00 ? 109 GLN A NE2  5  
ATOM 8790  H H    . GLN A 1 109 ? -0.386  -7.342  -8.710  1.00 0.00 ? 109 GLN A H    5  
ATOM 8791  H HA   . GLN A 1 109 ? -3.046  -8.361  -7.976  1.00 0.00 ? 109 GLN A HA   5  
ATOM 8792  H HB2  . GLN A 1 109 ? -1.356  -9.295  -10.303 1.00 0.00 ? 109 GLN A HB2  5  
ATOM 8793  H HB3  . GLN A 1 109 ? -2.875  -10.019 -9.790  1.00 0.00 ? 109 GLN A HB3  5  
ATOM 8794  H HG2  . GLN A 1 109 ? -2.514  -7.215  -10.824 1.00 0.00 ? 109 GLN A HG2  5  
ATOM 8795  H HG3  . GLN A 1 109 ? -3.184  -8.578  -11.721 1.00 0.00 ? 109 GLN A HG3  5  
ATOM 8796  H HE21 . GLN A 1 109 ? -4.436  -6.055  -11.145 1.00 0.00 ? 109 GLN A HE21 5  
ATOM 8797  H HE22 . GLN A 1 109 ? -5.862  -6.400  -10.232 1.00 0.00 ? 109 GLN A HE22 5  
ATOM 8798  N N    . VAL A 1 110 ? -2.076  -10.196 -6.633  1.00 0.00 ? 110 VAL A N    5  
ATOM 8799  C CA   . VAL A 1 110 ? -1.499  -11.214 -5.763  1.00 0.00 ? 110 VAL A CA   5  
ATOM 8800  C C    . VAL A 1 110 ? -2.372  -12.464 -5.726  1.00 0.00 ? 110 VAL A C    5  
ATOM 8801  O O    . VAL A 1 110 ? -3.587  -12.379 -5.546  1.00 0.00 ? 110 VAL A O    5  
ATOM 8802  C CB   . VAL A 1 110 ? -1.316  -10.688 -4.327  1.00 0.00 ? 110 VAL A CB   5  
ATOM 8803  C CG1  . VAL A 1 110 ? -2.649  -10.235 -3.750  1.00 0.00 ? 110 VAL A CG1  5  
ATOM 8804  C CG2  . VAL A 1 110 ? -0.680  -11.753 -3.447  1.00 0.00 ? 110 VAL A CG2  5  
ATOM 8805  H H    . VAL A 1 110 ? -3.012  -9.934  -6.507  1.00 0.00 ? 110 VAL A H    5  
ATOM 8806  H HA   . VAL A 1 110 ? -0.528  -11.477 -6.154  1.00 0.00 ? 110 VAL A HA   5  
ATOM 8807  H HB   . VAL A 1 110 ? -0.654  -9.834  -4.360  1.00 0.00 ? 110 VAL A HB   5  
ATOM 8808  H HG11 . VAL A 1 110 ? -3.311  -11.083 -3.666  1.00 0.00 ? 110 VAL A HG11 5  
ATOM 8809  H HG12 . VAL A 1 110 ? -2.490  -9.802  -2.773  1.00 0.00 ? 110 VAL A HG12 5  
ATOM 8810  H HG13 . VAL A 1 110 ? -3.091  -9.497  -4.403  1.00 0.00 ? 110 VAL A HG13 5  
ATOM 8811  H HG21 . VAL A 1 110 ? -0.058  -11.278 -2.701  1.00 0.00 ? 110 VAL A HG21 5  
ATOM 8812  H HG22 . VAL A 1 110 ? -1.453  -12.327 -2.959  1.00 0.00 ? 110 VAL A HG22 5  
ATOM 8813  H HG23 . VAL A 1 110 ? -0.075  -12.407 -4.055  1.00 0.00 ? 110 VAL A HG23 5  
ATOM 8814  N N    . ILE A 1 111 ? -1.744  -13.622 -5.899  1.00 0.00 ? 111 ILE A N    5  
ATOM 8815  C CA   . ILE A 1 111 ? -2.463  -14.890 -5.885  1.00 0.00 ? 111 ILE A CA   5  
ATOM 8816  C C    . ILE A 1 111 ? -2.563  -15.449 -4.469  1.00 0.00 ? 111 ILE A C    5  
ATOM 8817  O O    . ILE A 1 111 ? -1.579  -15.477 -3.730  1.00 0.00 ? 111 ILE A O    5  
ATOM 8818  C CB   . ILE A 1 111 ? -1.783  -15.933 -6.791  1.00 0.00 ? 111 ILE A CB   5  
ATOM 8819  C CG1  . ILE A 1 111 ? -1.762  -15.445 -8.241  1.00 0.00 ? 111 ILE A CG1  5  
ATOM 8820  C CG2  . ILE A 1 111 ? -2.500  -17.272 -6.687  1.00 0.00 ? 111 ILE A CG2  5  
ATOM 8821  C CD1  . ILE A 1 111 ? -0.401  -15.550 -8.893  1.00 0.00 ? 111 ILE A CD1  5  
ATOM 8822  H H    . ILE A 1 111 ? -0.775  -13.624 -6.039  1.00 0.00 ? 111 ILE A H    5  
ATOM 8823  H HA   . ILE A 1 111 ? -3.461  -14.711 -6.260  1.00 0.00 ? 111 ILE A HA   5  
ATOM 8824  H HB   . ILE A 1 111 ? -0.769  -16.069 -6.448  1.00 0.00 ? 111 ILE A HB   5  
ATOM 8825  H HG12 . ILE A 1 111 ? -2.453  -16.033 -8.822  1.00 0.00 ? 111 ILE A HG12 5  
ATOM 8826  H HG13 . ILE A 1 111 ? -2.065  -14.408 -8.268  1.00 0.00 ? 111 ILE A HG13 5  
ATOM 8827  H HG21 . ILE A 1 111 ? -2.046  -17.976 -7.368  1.00 0.00 ? 111 ILE A HG21 5  
ATOM 8828  H HG22 . ILE A 1 111 ? -2.419  -17.645 -5.677  1.00 0.00 ? 111 ILE A HG22 5  
ATOM 8829  H HG23 . ILE A 1 111 ? -3.541  -17.143 -6.942  1.00 0.00 ? 111 ILE A HG23 5  
ATOM 8830  H HD11 . ILE A 1 111 ? 0.328   -15.866 -8.160  1.00 0.00 ? 111 ILE A HD11 5  
ATOM 8831  H HD12 . ILE A 1 111 ? -0.441  -16.272 -9.695  1.00 0.00 ? 111 ILE A HD12 5  
ATOM 8832  H HD13 . ILE A 1 111 ? -0.115  -14.586 -9.289  1.00 0.00 ? 111 ILE A HD13 5  
ATOM 8833  N N    . THR A 1 112 ? -3.759  -15.896 -4.098  1.00 0.00 ? 112 THR A N    5  
ATOM 8834  C CA   . THR A 1 112 ? -3.988  -16.457 -2.774  1.00 0.00 ? 112 THR A CA   5  
ATOM 8835  C C    . THR A 1 112 ? -3.370  -17.845 -2.648  1.00 0.00 ? 112 THR A C    5  
ATOM 8836  O O    . THR A 1 112 ? -4.021  -18.851 -2.931  1.00 0.00 ? 112 THR A O    5  
ATOM 8837  C CB   . THR A 1 112 ? -5.492  -16.547 -2.453  1.00 0.00 ? 112 THR A CB   5  
ATOM 8838  O OG1  . THR A 1 112 ? -6.187  -17.170 -3.539  1.00 0.00 ? 112 THR A OG1  5  
ATOM 8839  C CG2  . THR A 1 112 ? -6.074  -15.164 -2.198  1.00 0.00 ? 112 THR A CG2  5  
ATOM 8840  H H    . THR A 1 112 ? -4.504  -15.848 -4.734  1.00 0.00 ? 112 THR A H    5  
ATOM 8841  H HA   . THR A 1 112 ? -3.526  -15.801 -2.050  1.00 0.00 ? 112 THR A HA   5  
ATOM 8842  H HB   . THR A 1 112 ? -5.620  -17.143 -1.562  1.00 0.00 ? 112 THR A HB   5  
ATOM 8843  H HG1  . THR A 1 112 ? -7.093  -16.851 -3.564  1.00 0.00 ? 112 THR A HG1  5  
ATOM 8844  H HG21 . THR A 1 112 ? -5.303  -14.418 -2.334  1.00 0.00 ? 112 THR A HG21 5  
ATOM 8845  H HG22 . THR A 1 112 ? -6.452  -15.113 -1.188  1.00 0.00 ? 112 THR A HG22 5  
ATOM 8846  H HG23 . THR A 1 112 ? -6.880  -14.979 -2.895  1.00 0.00 ? 112 THR A HG23 5  
ATOM 8847  N N    . GLN A 1 113 ? -2.112  -17.890 -2.222  1.00 0.00 ? 113 GLN A N    5  
ATOM 8848  C CA   . GLN A 1 113 ? -1.406  -19.157 -2.060  1.00 0.00 ? 113 GLN A CA   5  
ATOM 8849  C C    . GLN A 1 113 ? -0.315  -19.041 -1.000  1.00 0.00 ? 113 GLN A C    5  
ATOM 8850  O O    . GLN A 1 113 ? 0.295   -17.984 -0.835  1.00 0.00 ? 113 GLN A O    5  
ATOM 8851  C CB   . GLN A 1 113 ? -0.796  -19.599 -3.390  1.00 0.00 ? 113 GLN A CB   5  
ATOM 8852  C CG   . GLN A 1 113 ? 0.256   -18.641 -3.926  1.00 0.00 ? 113 GLN A CG   5  
ATOM 8853  C CD   . GLN A 1 113 ? 0.847   -19.102 -5.245  1.00 0.00 ? 113 GLN A CD   5  
ATOM 8854  O OE1  . GLN A 1 113 ? 0.123   -19.499 -6.157  1.00 0.00 ? 113 GLN A OE1  5  
ATOM 8855  N NE2  . GLN A 1 113 ? 2.170   -19.049 -5.351  1.00 0.00 ? 113 GLN A NE2  5  
ATOM 8856  H H    . GLN A 1 113 ? -1.647  -17.055 -2.013  1.00 0.00 ? 113 GLN A H    5  
ATOM 8857  H HA   . GLN A 1 113 ? -2.124  -19.897 -1.739  1.00 0.00 ? 113 GLN A HA   5  
ATOM 8858  H HB2  . GLN A 1 113 ? -0.338  -20.567 -3.259  1.00 0.00 ? 113 GLN A HB2  5  
ATOM 8859  H HB3  . GLN A 1 113 ? -1.584  -19.680 -4.124  1.00 0.00 ? 113 GLN A HB3  5  
ATOM 8860  H HG2  . GLN A 1 113 ? -0.198  -17.673 -4.071  1.00 0.00 ? 113 GLN A HG2  5  
ATOM 8861  H HG3  . GLN A 1 113 ? 1.052   -18.559 -3.200  1.00 0.00 ? 113 GLN A HG3  5  
ATOM 8862  H HE21 . GLN A 1 113 ? 2.682   -18.722 -4.582  1.00 0.00 ? 113 GLN A HE21 5  
ATOM 8863  H HE22 . GLN A 1 113 ? 2.578   -19.341 -6.191  1.00 0.00 ? 113 GLN A HE22 5  
ATOM 8864  N N    . THR A 1 114 ? -0.074  -20.134 -0.283  1.00 0.00 ? 114 THR A N    5  
ATOM 8865  C CA   . THR A 1 114 ? 0.941   -20.155 0.762   1.00 0.00 ? 114 THR A CA   5  
ATOM 8866  C C    . THR A 1 114 ? 2.242   -20.767 0.253   1.00 0.00 ? 114 THR A C    5  
ATOM 8867  O O    . THR A 1 114 ? 3.028   -21.310 1.027   1.00 0.00 ? 114 THR A O    5  
ATOM 8868  C CB   . THR A 1 114 ? 0.463   -20.945 1.995   1.00 0.00 ? 114 THR A CB   5  
ATOM 8869  O OG1  . THR A 1 114 ? 0.342   -22.334 1.669   1.00 0.00 ? 114 THR A OG1  5  
ATOM 8870  C CG2  . THR A 1 114 ? -0.874  -20.417 2.491   1.00 0.00 ? 114 THR A CG2  5  
ATOM 8871  H H    . THR A 1 114 ? -0.594  -20.946 -0.462  1.00 0.00 ? 114 THR A H    5  
ATOM 8872  H HA   . THR A 1 114 ? 1.129   -19.135 1.065   1.00 0.00 ? 114 THR A HA   5  
ATOM 8873  H HB   . THR A 1 114 ? 1.194   -20.830 2.782   1.00 0.00 ? 114 THR A HB   5  
ATOM 8874  H HG1  . THR A 1 114 ? -0.148  -22.784 2.363   1.00 0.00 ? 114 THR A HG1  5  
ATOM 8875  H HG21 . THR A 1 114 ? -1.603  -20.479 1.697   1.00 0.00 ? 114 THR A HG21 5  
ATOM 8876  H HG22 . THR A 1 114 ? -0.763  -19.387 2.798   1.00 0.00 ? 114 THR A HG22 5  
ATOM 8877  H HG23 . THR A 1 114 ? -1.205  -21.009 3.330   1.00 0.00 ? 114 THR A HG23 5  
ATOM 8878  N N    . GLY A 1 115 ? 2.462   -20.674 -1.055  1.00 0.00 ? 115 GLY A N    5  
ATOM 8879  C CA   . GLY A 1 115 ? 3.668   -21.222 -1.646  1.00 0.00 ? 115 GLY A CA   5  
ATOM 8880  C C    . GLY A 1 115 ? 3.418   -22.535 -2.362  1.00 0.00 ? 115 GLY A C    5  
ATOM 8881  O O    . GLY A 1 115 ? 2.270   -22.931 -2.565  1.00 0.00 ? 115 GLY A O    5  
ATOM 8882  H H    . GLY A 1 115 ? 1.798   -20.230 -1.625  1.00 0.00 ? 115 GLY A H    5  
ATOM 8883  H HA2  . GLY A 1 115 ? 4.067   -20.509 -2.352  1.00 0.00 ? 115 GLY A HA2  5  
ATOM 8884  H HA3  . GLY A 1 115 ? 4.395   -21.385 -0.863  1.00 0.00 ? 115 GLY A HA3  5  
ATOM 8885  N N    . SER A 1 116 ? 4.495   -23.211 -2.747  1.00 0.00 ? 116 SER A N    5  
ATOM 8886  C CA   . SER A 1 116 ? 4.388   -24.485 -3.449  1.00 0.00 ? 116 SER A CA   5  
ATOM 8887  C C    . SER A 1 116 ? 5.432   -25.475 -2.942  1.00 0.00 ? 116 SER A C    5  
ATOM 8888  O O    . SER A 1 116 ? 6.358   -25.843 -3.664  1.00 0.00 ? 116 SER A O    5  
ATOM 8889  C CB   . SER A 1 116 ? 4.557   -24.276 -4.956  1.00 0.00 ? 116 SER A CB   5  
ATOM 8890  O OG   . SER A 1 116 ? 3.943   -23.070 -5.376  1.00 0.00 ? 116 SER A OG   5  
ATOM 8891  H H    . SER A 1 116 ? 5.384   -22.843 -2.556  1.00 0.00 ? 116 SER A H    5  
ATOM 8892  H HA   . SER A 1 116 ? 3.405   -24.887 -3.258  1.00 0.00 ? 116 SER A HA   5  
ATOM 8893  H HB2  . SER A 1 116 ? 5.608   -24.233 -5.196  1.00 0.00 ? 116 SER A HB2  5  
ATOM 8894  H HB3  . SER A 1 116 ? 4.100   -25.102 -5.484  1.00 0.00 ? 116 SER A HB3  5  
ATOM 8895  H HG   . SER A 1 116 ? 4.159   -22.369 -4.756  1.00 0.00 ? 116 SER A HG   5  
ATOM 8896  N N    . GLY A 1 117 ? 5.275   -25.903 -1.693  1.00 0.00 ? 117 GLY A N    5  
ATOM 8897  C CA   . GLY A 1 117 ? 6.210   -26.847 -1.109  1.00 0.00 ? 117 GLY A CA   5  
ATOM 8898  C C    . GLY A 1 117 ? 6.566   -26.499 0.323   1.00 0.00 ? 117 GLY A C    5  
ATOM 8899  O O    . GLY A 1 117 ? 6.030   -25.557 0.907   1.00 0.00 ? 117 GLY A O    5  
ATOM 8900  H H    . GLY A 1 117 ? 4.517   -25.577 -1.164  1.00 0.00 ? 117 GLY A H    5  
ATOM 8901  H HA2  . GLY A 1 117 ? 5.770   -27.833 -1.131  1.00 0.00 ? 117 GLY A HA2  5  
ATOM 8902  H HA3  . GLY A 1 117 ? 7.114   -26.854 -1.701  1.00 0.00 ? 117 GLY A HA3  5  
ATOM 8903  N N    . PRO A 1 118 ? 7.490   -27.272 0.911   1.00 0.00 ? 118 PRO A N    5  
ATOM 8904  C CA   . PRO A 1 118 ? 7.937   -27.061 2.291   1.00 0.00 ? 118 PRO A CA   5  
ATOM 8905  C C    . PRO A 1 118 ? 8.762   -25.788 2.445   1.00 0.00 ? 118 PRO A C    5  
ATOM 8906  O O    . PRO A 1 118 ? 9.659   -25.518 1.647   1.00 0.00 ? 118 PRO A O    5  
ATOM 8907  C CB   . PRO A 1 118 ? 8.798   -28.294 2.578   1.00 0.00 ? 118 PRO A CB   5  
ATOM 8908  C CG   . PRO A 1 118 ? 9.276   -28.743 1.240   1.00 0.00 ? 118 PRO A CG   5  
ATOM 8909  C CD   . PRO A 1 118 ? 8.171   -28.412 0.274   1.00 0.00 ? 118 PRO A CD   5  
ATOM 8910  H HA   . PRO A 1 118 ? 7.104   -27.034 2.978   1.00 0.00 ? 118 PRO A HA   5  
ATOM 8911  H HB2  . PRO A 1 118 ? 9.622   -28.020 3.222   1.00 0.00 ? 118 PRO A HB2  5  
ATOM 8912  H HB3  . PRO A 1 118 ? 8.196   -29.054 3.058   1.00 0.00 ? 118 PRO A HB3  5  
ATOM 8913  H HG2  . PRO A 1 118 ? 10.177  -28.212 0.975   1.00 0.00 ? 118 PRO A HG2  5  
ATOM 8914  H HG3  . PRO A 1 118 ? 9.456   -29.808 1.253   1.00 0.00 ? 118 PRO A HG3  5  
ATOM 8915  H HD2  . PRO A 1 118 ? 8.581   -28.131 -0.685  1.00 0.00 ? 118 PRO A HD2  5  
ATOM 8916  H HD3  . PRO A 1 118 ? 7.499   -29.251 0.168   1.00 0.00 ? 118 PRO A HD3  5  
ATOM 8917  N N    . SER A 1 119 ? 8.454   -25.009 3.477   1.00 0.00 ? 119 SER A N    5  
ATOM 8918  C CA   . SER A 1 119 ? 9.165   -23.763 3.733   1.00 0.00 ? 119 SER A CA   5  
ATOM 8919  C C    . SER A 1 119 ? 8.876   -23.252 5.142   1.00 0.00 ? 119 SER A C    5  
ATOM 8920  O O    . SER A 1 119 ? 7.720   -23.068 5.522   1.00 0.00 ? 119 SER A O    5  
ATOM 8921  C CB   . SER A 1 119 ? 8.768   -22.704 2.702   1.00 0.00 ? 119 SER A CB   5  
ATOM 8922  O OG   . SER A 1 119 ? 9.139   -21.406 3.137   1.00 0.00 ? 119 SER A OG   5  
ATOM 8923  H H    . SER A 1 119 ? 7.729   -25.279 4.078   1.00 0.00 ? 119 SER A H    5  
ATOM 8924  H HA   . SER A 1 119 ? 10.224  -23.962 3.645   1.00 0.00 ? 119 SER A HA   5  
ATOM 8925  H HB2  . SER A 1 119 ? 9.264   -22.913 1.767   1.00 0.00 ? 119 SER A HB2  5  
ATOM 8926  H HB3  . SER A 1 119 ? 7.698   -22.730 2.558   1.00 0.00 ? 119 SER A HB3  5  
ATOM 8927  H HG   . SER A 1 119 ? 8.350   -20.897 3.333   1.00 0.00 ? 119 SER A HG   5  
ATOM 8928  N N    . SER A 1 120 ? 9.936   -23.024 5.912   1.00 0.00 ? 120 SER A N    5  
ATOM 8929  C CA   . SER A 1 120 ? 9.797   -22.539 7.279   1.00 0.00 ? 120 SER A CA   5  
ATOM 8930  C C    . SER A 1 120 ? 9.044   -23.549 8.140   1.00 0.00 ? 120 SER A C    5  
ATOM 8931  O O    . SER A 1 120 ? 8.654   -24.615 7.668   1.00 0.00 ? 120 SER A O    5  
ATOM 8932  C CB   . SER A 1 120 ? 9.069   -21.193 7.293   1.00 0.00 ? 120 SER A CB   5  
ATOM 8933  O OG   . SER A 1 120 ? 9.622   -20.325 8.268   1.00 0.00 ? 120 SER A OG   5  
ATOM 8934  H H    . SER A 1 120 ? 10.833  -23.191 5.551   1.00 0.00 ? 120 SER A H    5  
ATOM 8935  H HA   . SER A 1 120 ? 10.789  -22.406 7.685   1.00 0.00 ? 120 SER A HA   5  
ATOM 8936  H HB2  . SER A 1 120 ? 9.156   -20.729 6.323   1.00 0.00 ? 120 SER A HB2  5  
ATOM 8937  H HB3  . SER A 1 120 ? 8.025   -21.355 7.523   1.00 0.00 ? 120 SER A HB3  5  
ATOM 8938  H HG   . SER A 1 120 ? 10.194  -19.685 7.838   1.00 0.00 ? 120 SER A HG   5  
ATOM 8939  N N    . GLY A 1 121 ? 8.842   -23.201 9.408   1.00 0.00 ? 121 GLY A N    5  
ATOM 8940  C CA   . GLY A 1 121 ? 8.136   -24.087 10.316  1.00 0.00 ? 121 GLY A CA   5  
ATOM 8941  C C    . GLY A 1 121 ? 7.738   -23.396 11.605  1.00 0.00 ? 121 GLY A C    5  
ATOM 8942  O O    . GLY A 1 121 ? 6.701   -22.733 11.667  1.00 0.00 ? 121 GLY A O    5  
ATOM 8943  H H    . GLY A 1 121 ? 9.175   -22.337 9.729   1.00 0.00 ? 121 GLY A H    5  
ATOM 8944  H HA2  . GLY A 1 121 ? 7.246   -24.452 9.826   1.00 0.00 ? 121 GLY A HA2  5  
ATOM 8945  H HA3  . GLY A 1 121 ? 8.775   -24.925 10.553  1.00 0.00 ? 121 GLY A HA3  5  
ATOM 8946  N N    . GLY A 1 1   ? -6.217  54.016  3.158   1.00 0.00 ? 1   GLY A N    6  
ATOM 8947  C CA   . GLY A 1 1   ? -7.258  53.100  2.729   1.00 0.00 ? 1   GLY A CA   6  
ATOM 8948  C C    . GLY A 1 1   ? -7.212  51.781  3.475   1.00 0.00 ? 1   GLY A C    6  
ATOM 8949  O O    . GLY A 1 1   ? -7.115  51.757  4.702   1.00 0.00 ? 1   GLY A O    6  
ATOM 8950  H H1   . GLY A 1 1   ? -5.792  53.898  4.034   1.00 0.00 ? 1   GLY A H1   6  
ATOM 8951  H HA2  . GLY A 1 1   ? -8.220  53.562  2.895   1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8952  H HA3  . GLY A 1 1   ? -7.138  52.907  1.673   1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8953  N N    . SER A 1 2   ? -7.282  50.680  2.732   1.00 0.00 ? 2   SER A N    6  
ATOM 8954  C CA   . SER A 1 2   ? -7.254  49.352  3.331   1.00 0.00 ? 2   SER A CA   6  
ATOM 8955  C C    . SER A 1 2   ? -8.447  49.148  4.259   1.00 0.00 ? 2   SER A C    6  
ATOM 8956  O O    . SER A 1 2   ? -9.172  50.092  4.572   1.00 0.00 ? 2   SER A O    6  
ATOM 8957  C CB   . SER A 1 2   ? -5.950  49.145  4.105   1.00 0.00 ? 2   SER A CB   6  
ATOM 8958  O OG   . SER A 1 2   ? -5.817  47.799  4.529   1.00 0.00 ? 2   SER A OG   6  
ATOM 8959  H H    . SER A 1 2   ? -7.358  50.766  1.759   1.00 0.00 ? 2   SER A H    6  
ATOM 8960  H HA   . SER A 1 2   ? -7.307  48.626  2.531   1.00 0.00 ? 2   SER A HA   6  
ATOM 8961  H HB2  . SER A 1 2   ? -5.114  49.393  3.469   1.00 0.00 ? 2   SER A HB2  6  
ATOM 8962  H HB3  . SER A 1 2   ? -5.946  49.786  4.974   1.00 0.00 ? 2   SER A HB3  6  
ATOM 8963  H HG   . SER A 1 2   ? -5.187  47.752  5.252   1.00 0.00 ? 2   SER A HG   6  
ATOM 8964  N N    . SER A 1 3   ? -8.645  47.908  4.696   1.00 0.00 ? 3   SER A N    6  
ATOM 8965  C CA   . SER A 1 3   ? -9.752  47.579  5.585   1.00 0.00 ? 3   SER A CA   6  
ATOM 8966  C C    . SER A 1 3   ? -9.345  46.499  6.584   1.00 0.00 ? 3   SER A C    6  
ATOM 8967  O O    . SER A 1 3   ? -9.560  46.638  7.787   1.00 0.00 ? 3   SER A O    6  
ATOM 8968  C CB   . SER A 1 3   ? -10.963 47.108  4.776   1.00 0.00 ? 3   SER A CB   6  
ATOM 8969  O OG   . SER A 1 3   ? -10.580 46.717  3.468   1.00 0.00 ? 3   SER A OG   6  
ATOM 8970  H H    . SER A 1 3   ? -8.033  47.198  4.411   1.00 0.00 ? 3   SER A H    6  
ATOM 8971  H HA   . SER A 1 3   ? -10.019 48.473  6.128   1.00 0.00 ? 3   SER A HA   6  
ATOM 8972  H HB2  . SER A 1 3   ? -11.420 46.266  5.272   1.00 0.00 ? 3   SER A HB2  6  
ATOM 8973  H HB3  . SER A 1 3   ? -11.678 47.914  4.702   1.00 0.00 ? 3   SER A HB3  6  
ATOM 8974  H HG   . SER A 1 3   ? -10.132 45.869  3.506   1.00 0.00 ? 3   SER A HG   6  
ATOM 8975  N N    . GLY A 1 4   ? -8.753  45.423  6.075   1.00 0.00 ? 4   GLY A N    6  
ATOM 8976  C CA   . GLY A 1 4   ? -8.324  44.336  6.934   1.00 0.00 ? 4   GLY A CA   6  
ATOM 8977  C C    . GLY A 1 4   ? -7.619  43.235  6.168   1.00 0.00 ? 4   GLY A C    6  
ATOM 8978  O O    . GLY A 1 4   ? -7.574  43.255  4.937   1.00 0.00 ? 4   GLY A O    6  
ATOM 8979  H H    . GLY A 1 4   ? -8.607  45.367  5.106   1.00 0.00 ? 4   GLY A H    6  
ATOM 8980  H HA2  . GLY A 1 4   ? -7.652  44.727  7.682   1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8981  H HA3  . GLY A 1 4   ? -9.190  43.917  7.425   1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8982  N N    . SER A 1 5   ? -7.065  42.270  6.896   1.00 0.00 ? 5   SER A N    6  
ATOM 8983  C CA   . SER A 1 5   ? -6.353  41.158  6.276   1.00 0.00 ? 5   SER A CA   6  
ATOM 8984  C C    . SER A 1 5   ? -6.040  40.074  7.302   1.00 0.00 ? 5   SER A C    6  
ATOM 8985  O O    . SER A 1 5   ? -6.034  40.328  8.507   1.00 0.00 ? 5   SER A O    6  
ATOM 8986  C CB   . SER A 1 5   ? -5.058  41.651  5.628   1.00 0.00 ? 5   SER A CB   6  
ATOM 8987  O OG   . SER A 1 5   ? -5.121  41.542  4.217   1.00 0.00 ? 5   SER A OG   6  
ATOM 8988  H H    . SER A 1 5   ? -7.134  42.308  7.873   1.00 0.00 ? 5   SER A H    6  
ATOM 8989  H HA   . SER A 1 5   ? -6.991  40.740  5.512   1.00 0.00 ? 5   SER A HA   6  
ATOM 8990  H HB2  . SER A 1 5   ? -4.899  42.686  5.889   1.00 0.00 ? 5   SER A HB2  6  
ATOM 8991  H HB3  . SER A 1 5   ? -4.230  41.056  5.987   1.00 0.00 ? 5   SER A HB3  6  
ATOM 8992  H HG   . SER A 1 5   ? -5.409  42.377  3.843   1.00 0.00 ? 5   SER A HG   6  
ATOM 8993  N N    . SER A 1 6   ? -5.780  38.864  6.817   1.00 0.00 ? 6   SER A N    6  
ATOM 8994  C CA   . SER A 1 6   ? -5.470  37.740  7.691   1.00 0.00 ? 6   SER A CA   6  
ATOM 8995  C C    . SER A 1 6   ? -4.044  37.842  8.223   1.00 0.00 ? 6   SER A C    6  
ATOM 8996  O O    . SER A 1 6   ? -3.825  38.154  9.392   1.00 0.00 ? 6   SER A O    6  
ATOM 8997  C CB   . SER A 1 6   ? -5.655  36.418  6.943   1.00 0.00 ? 6   SER A CB   6  
ATOM 8998  O OG   . SER A 1 6   ? -7.026  36.157  6.700   1.00 0.00 ? 6   SER A OG   6  
ATOM 8999  H H    . SER A 1 6   ? -5.800  38.725  5.847   1.00 0.00 ? 6   SER A H    6  
ATOM 9000  H HA   . SER A 1 6   ? -6.155  37.770  8.526   1.00 0.00 ? 6   SER A HA   6  
ATOM 9001  H HB2  . SER A 1 6   ? -5.137  36.468  5.997   1.00 0.00 ? 6   SER A HB2  6  
ATOM 9002  H HB3  . SER A 1 6   ? -5.245  35.612  7.536   1.00 0.00 ? 6   SER A HB3  6  
ATOM 9003  H HG   . SER A 1 6   ? -7.399  35.687  7.448   1.00 0.00 ? 6   SER A HG   6  
ATOM 9004  N N    . GLY A 1 7   ? -3.075  37.574  7.352   1.00 0.00 ? 7   GLY A N    6  
ATOM 9005  C CA   . GLY A 1 7   ? -1.681  37.640  7.751   1.00 0.00 ? 7   GLY A CA   6  
ATOM 9006  C C    . GLY A 1 7   ? -1.128  36.289  8.156   1.00 0.00 ? 7   GLY A C    6  
ATOM 9007  O O    . GLY A 1 7   ? -1.863  35.311  8.302   1.00 0.00 ? 7   GLY A O    6  
ATOM 9008  H H    . GLY A 1 7   ? -3.309  37.329  6.432   1.00 0.00 ? 7   GLY A H    6  
ATOM 9009  H HA2  . GLY A 1 7   ? -1.099  38.023  6.926   1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9010  H HA3  . GLY A 1 7   ? -1.589  38.318  8.588   1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9011  N N    . PRO A 1 8   ? 0.199   36.218  8.343   1.00 0.00 ? 8   PRO A N    6  
ATOM 9012  C CA   . PRO A 1 8   ? 0.879   34.980  8.734   1.00 0.00 ? 8   PRO A CA   6  
ATOM 9013  C C    . PRO A 1 8   ? 0.556   34.571  10.167  1.00 0.00 ? 8   PRO A C    6  
ATOM 9014  O O    . PRO A 1 8   ? 0.100   35.384  10.970  1.00 0.00 ? 8   PRO A O    6  
ATOM 9015  C CB   . PRO A 1 8   ? 2.362   35.333  8.600   1.00 0.00 ? 8   PRO A CB   6  
ATOM 9016  C CG   . PRO A 1 8   ? 2.417   36.811  8.768   1.00 0.00 ? 8   PRO A CG   6  
ATOM 9017  C CD   . PRO A 1 8   ? 1.136   37.342  8.187   1.00 0.00 ? 8   PRO A CD   6  
ATOM 9018  H HA   . PRO A 1 8   ? 0.638   34.168  8.066   1.00 0.00 ? 8   PRO A HA   6  
ATOM 9019  H HB2  . PRO A 1 8   ? 2.926   34.824  9.369   1.00 0.00 ? 8   PRO A HB2  6  
ATOM 9020  H HB3  . PRO A 1 8   ? 2.720   35.033  7.627   1.00 0.00 ? 8   PRO A HB3  6  
ATOM 9021  H HG2  . PRO A 1 8   ? 2.483   37.059  9.818   1.00 0.00 ? 8   PRO A HG2  6  
ATOM 9022  H HG3  . PRO A 1 8   ? 3.266   37.211  8.234   1.00 0.00 ? 8   PRO A HG3  6  
ATOM 9023  H HD2  . PRO A 1 8   ? 0.799   38.206  8.741   1.00 0.00 ? 8   PRO A HD2  6  
ATOM 9024  H HD3  . PRO A 1 8   ? 1.270   37.591  7.145   1.00 0.00 ? 8   PRO A HD3  6  
ATOM 9025  N N    . VAL A 1 9   ? 0.797   33.301  10.483  1.00 0.00 ? 9   VAL A N    6  
ATOM 9026  C CA   . VAL A 1 9   ? 0.533   32.783  11.820  1.00 0.00 ? 9   VAL A CA   6  
ATOM 9027  C C    . VAL A 1 9   ? 1.415   31.579  12.127  1.00 0.00 ? 9   VAL A C    6  
ATOM 9028  O O    . VAL A 1 9   ? 1.091   30.760  12.988  1.00 0.00 ? 9   VAL A O    6  
ATOM 9029  C CB   . VAL A 1 9   ? -0.944  32.379  11.985  1.00 0.00 ? 9   VAL A CB   6  
ATOM 9030  C CG1  . VAL A 1 9   ? -1.225  31.073  11.256  1.00 0.00 ? 9   VAL A CG1  6  
ATOM 9031  C CG2  . VAL A 1 9   ? -1.304  32.265  13.459  1.00 0.00 ? 9   VAL A CG2  6  
ATOM 9032  H H    . VAL A 1 9   ? 1.160   32.699  9.801   1.00 0.00 ? 9   VAL A H    6  
ATOM 9033  H HA   . VAL A 1 9   ? 0.751   33.567  12.531  1.00 0.00 ? 9   VAL A HA   6  
ATOM 9034  H HB   . VAL A 1 9   ? -1.559  33.150  11.544  1.00 0.00 ? 9   VAL A HB   6  
ATOM 9035  H HG11 . VAL A 1 9   ? -0.516  30.951  10.450  1.00 0.00 ? 9   VAL A HG11 6  
ATOM 9036  H HG12 . VAL A 1 9   ? -1.131  30.248  11.948  1.00 0.00 ? 9   VAL A HG12 6  
ATOM 9037  H HG13 . VAL A 1 9   ? -2.227  31.094  10.854  1.00 0.00 ? 9   VAL A HG13 6  
ATOM 9038  H HG21 . VAL A 1 9   ? -0.613  32.853  14.043  1.00 0.00 ? 9   VAL A HG21 6  
ATOM 9039  H HG22 . VAL A 1 9   ? -2.308  32.631  13.613  1.00 0.00 ? 9   VAL A HG22 6  
ATOM 9040  H HG23 . VAL A 1 9   ? -1.247  31.231  13.765  1.00 0.00 ? 9   VAL A HG23 6  
ATOM 9041  N N    . LEU A 1 10  ? 2.533   31.476  11.417  1.00 0.00 ? 10  LEU A N    6  
ATOM 9042  C CA   . LEU A 1 10  ? 3.465   30.371  11.613  1.00 0.00 ? 10  LEU A CA   6  
ATOM 9043  C C    . LEU A 1 10  ? 2.779   29.029  11.370  1.00 0.00 ? 10  LEU A C    6  
ATOM 9044  O O    . LEU A 1 10  ? 2.139   28.476  12.264  1.00 0.00 ? 10  LEU A O    6  
ATOM 9045  C CB   . LEU A 1 10  ? 4.045   30.410  13.028  1.00 0.00 ? 10  LEU A CB   6  
ATOM 9046  C CG   . LEU A 1 10  ? 5.324   31.228  13.207  1.00 0.00 ? 10  LEU A CG   6  
ATOM 9047  C CD1  . LEU A 1 10  ? 5.528   31.586  14.671  1.00 0.00 ? 10  LEU A CD1  6  
ATOM 9048  C CD2  . LEU A 1 10  ? 6.526   30.461  12.670  1.00 0.00 ? 10  LEU A CD2  6  
ATOM 9049  H H    . LEU A 1 10  ? 2.738   32.158  10.745  1.00 0.00 ? 10  LEU A H    6  
ATOM 9050  H HA   . LEU A 1 10  ? 4.268   30.484  10.901  1.00 0.00 ? 10  LEU A HA   6  
ATOM 9051  H HB2  . LEU A 1 10  ? 3.293   30.827  13.680  1.00 0.00 ? 10  LEU A HB2  6  
ATOM 9052  H HB3  . LEU A 1 10  ? 4.255   29.393  13.327  1.00 0.00 ? 10  LEU A HB3  6  
ATOM 9053  H HG   . LEU A 1 10  ? 5.237   32.148  12.647  1.00 0.00 ? 10  LEU A HG   6  
ATOM 9054  H HD11 . LEU A 1 10  ? 4.985   32.489  14.899  1.00 0.00 ? 10  LEU A HD11 6  
ATOM 9055  H HD12 . LEU A 1 10  ? 6.581   31.741  14.859  1.00 0.00 ? 10  LEU A HD12 6  
ATOM 9056  H HD13 . LEU A 1 10  ? 5.167   30.780  15.292  1.00 0.00 ? 10  LEU A HD13 6  
ATOM 9057  H HD21 . LEU A 1 10  ? 6.841   30.898  11.735  1.00 0.00 ? 10  LEU A HD21 6  
ATOM 9058  H HD22 . LEU A 1 10  ? 6.251   29.429  12.510  1.00 0.00 ? 10  LEU A HD22 6  
ATOM 9059  H HD23 . LEU A 1 10  ? 7.333   30.513  13.385  1.00 0.00 ? 10  LEU A HD23 6  
ATOM 9060  N N    . THR A 1 11  ? 2.918   28.511  10.153  1.00 0.00 ? 11  THR A N    6  
ATOM 9061  C CA   . THR A 1 11  ? 2.313   27.235  9.792   1.00 0.00 ? 11  THR A CA   6  
ATOM 9062  C C    . THR A 1 11  ? 2.741   26.800  8.395   1.00 0.00 ? 11  THR A C    6  
ATOM 9063  O O    . THR A 1 11  ? 3.471   27.515  7.710   1.00 0.00 ? 11  THR A O    6  
ATOM 9064  C CB   . THR A 1 11  ? 0.775   27.307  9.847   1.00 0.00 ? 11  THR A CB   6  
ATOM 9065  O OG1  . THR A 1 11  ? 0.351   28.674  9.901   1.00 0.00 ? 11  THR A OG1  6  
ATOM 9066  C CG2  . THR A 1 11  ? 0.242   26.557  11.058  1.00 0.00 ? 11  THR A CG2  6  
ATOM 9067  H H    . THR A 1 11  ? 3.441   29.001  9.484   1.00 0.00 ? 11  THR A H    6  
ATOM 9068  H HA   . THR A 1 11  ? 2.645   26.495  10.506  1.00 0.00 ? 11  THR A HA   6  
ATOM 9069  H HB   . THR A 1 11  ? 0.377   26.850  8.953   1.00 0.00 ? 11  THR A HB   6  
ATOM 9070  H HG1  . THR A 1 11  ? 0.966   29.220  9.407   1.00 0.00 ? 11  THR A HG1  6  
ATOM 9071  H HG21 . THR A 1 11  ? -0.169  25.609  10.742  1.00 0.00 ? 11  THR A HG21 6  
ATOM 9072  H HG22 . THR A 1 11  ? -0.530  27.144  11.533  1.00 0.00 ? 11  THR A HG22 6  
ATOM 9073  H HG23 . THR A 1 11  ? 1.046   26.385  11.757  1.00 0.00 ? 11  THR A HG23 6  
ATOM 9074  N N    . GLN A 1 12  ? 2.280   25.625  7.980   1.00 0.00 ? 12  GLN A N    6  
ATOM 9075  C CA   . GLN A 1 12  ? 2.615   25.094  6.664   1.00 0.00 ? 12  GLN A CA   6  
ATOM 9076  C C    . GLN A 1 12  ? 2.195   26.065  5.564   1.00 0.00 ? 12  GLN A C    6  
ATOM 9077  O O    . GLN A 1 12  ? 1.536   27.072  5.826   1.00 0.00 ? 12  GLN A O    6  
ATOM 9078  C CB   . GLN A 1 12  ? 1.942   23.739  6.449   1.00 0.00 ? 12  GLN A CB   6  
ATOM 9079  C CG   . GLN A 1 12  ? 2.208   22.744  7.568   1.00 0.00 ? 12  GLN A CG   6  
ATOM 9080  C CD   . GLN A 1 12  ? 3.684   22.442  7.740   1.00 0.00 ? 12  GLN A CD   6  
ATOM 9081  O OE1  . GLN A 1 12  ? 4.352   23.023  8.598   1.00 0.00 ? 12  GLN A OE1  6  
ATOM 9082  N NE2  . GLN A 1 12  ? 4.202   21.530  6.926   1.00 0.00 ? 12  GLN A NE2  6  
ATOM 9083  H H    . GLN A 1 12  ? 1.701   25.102  8.572   1.00 0.00 ? 12  GLN A H    6  
ATOM 9084  H HA   . GLN A 1 12  ? 3.686   24.966  6.621   1.00 0.00 ? 12  GLN A HA   6  
ATOM 9085  H HB2  . GLN A 1 12  ? 0.876   23.887  6.376   1.00 0.00 ? 12  GLN A HB2  6  
ATOM 9086  H HB3  . GLN A 1 12  ? 2.304   23.312  5.526   1.00 0.00 ? 12  GLN A HB3  6  
ATOM 9087  H HG2  . GLN A 1 12  ? 1.830   23.151  8.494   1.00 0.00 ? 12  GLN A HG2  6  
ATOM 9088  H HG3  . GLN A 1 12  ? 1.692   21.822  7.344   1.00 0.00 ? 12  GLN A HG3  6  
ATOM 9089  H HE21 . GLN A 1 12  ? 3.610   21.109  6.267   1.00 0.00 ? 12  GLN A HE21 6  
ATOM 9090  H HE22 . GLN A 1 12  ? 5.153   21.315  7.016   1.00 0.00 ? 12  GLN A HE22 6  
ATOM 9091  N N    . THR A 1 13  ? 2.578   25.752  4.329   1.00 0.00 ? 13  THR A N    6  
ATOM 9092  C CA   . THR A 1 13  ? 2.242   26.597  3.189   1.00 0.00 ? 13  THR A CA   6  
ATOM 9093  C C    . THR A 1 13  ? 0.976   26.106  2.496   1.00 0.00 ? 13  THR A C    6  
ATOM 9094  O O    . THR A 1 13  ? 1.029   25.581  1.384   1.00 0.00 ? 13  THR A O    6  
ATOM 9095  C CB   . THR A 1 13  ? 3.392   26.639  2.164   1.00 0.00 ? 13  THR A CB   6  
ATOM 9096  O OG1  . THR A 1 13  ? 4.646   26.789  2.840   1.00 0.00 ? 13  THR A OG1  6  
ATOM 9097  C CG2  . THR A 1 13  ? 3.199   27.786  1.182   1.00 0.00 ? 13  THR A CG2  6  
ATOM 9098  H H    . THR A 1 13  ? 3.100   24.937  4.184   1.00 0.00 ? 13  THR A H    6  
ATOM 9099  H HA   . THR A 1 13  ? 2.075   27.600  3.554   1.00 0.00 ? 13  THR A HA   6  
ATOM 9100  H HB   . THR A 1 13  ? 3.397   25.709  1.613   1.00 0.00 ? 13  THR A HB   6  
ATOM 9101  H HG1  . THR A 1 13  ? 4.860   25.973  3.298   1.00 0.00 ? 13  THR A HG1  6  
ATOM 9102  H HG21 . THR A 1 13  ? 3.735   28.655  1.534   1.00 0.00 ? 13  THR A HG21 6  
ATOM 9103  H HG22 . THR A 1 13  ? 2.147   28.019  1.104   1.00 0.00 ? 13  THR A HG22 6  
ATOM 9104  H HG23 . THR A 1 13  ? 3.577   27.496  0.214   1.00 0.00 ? 13  THR A HG23 6  
ATOM 9105  N N    . SER A 1 14  ? -0.162  26.281  3.160   1.00 0.00 ? 14  SER A N    6  
ATOM 9106  C CA   . SER A 1 14  ? -1.442  25.853  2.609   1.00 0.00 ? 14  SER A CA   6  
ATOM 9107  C C    . SER A 1 14  ? -1.490  24.334  2.465   1.00 0.00 ? 14  SER A C    6  
ATOM 9108  O O    . SER A 1 14  ? -0.757  23.752  1.665   1.00 0.00 ? 14  SER A O    6  
ATOM 9109  C CB   . SER A 1 14  ? -1.682  26.513  1.251   1.00 0.00 ? 14  SER A CB   6  
ATOM 9110  O OG   . SER A 1 14  ? -2.644  27.550  1.352   1.00 0.00 ? 14  SER A OG   6  
ATOM 9111  H H    . SER A 1 14  ? -0.139  26.705  4.044   1.00 0.00 ? 14  SER A H    6  
ATOM 9112  H HA   . SER A 1 14  ? -2.218  26.161  3.294   1.00 0.00 ? 14  SER A HA   6  
ATOM 9113  H HB2  . SER A 1 14  ? -0.756  26.932  0.888   1.00 0.00 ? 14  SER A HB2  6  
ATOM 9114  H HB3  . SER A 1 14  ? -2.042  25.772  0.552   1.00 0.00 ? 14  SER A HB3  6  
ATOM 9115  H HG   . SER A 1 14  ? -3.195  27.552  0.566   1.00 0.00 ? 14  SER A HG   6  
ATOM 9116  N N    . GLU A 1 15  ? -2.359  23.699  3.245   1.00 0.00 ? 15  GLU A N    6  
ATOM 9117  C CA   . GLU A 1 15  ? -2.503  22.248  3.204   1.00 0.00 ? 15  GLU A CA   6  
ATOM 9118  C C    . GLU A 1 15  ? -3.551  21.834  2.175   1.00 0.00 ? 15  GLU A C    6  
ATOM 9119  O O    . GLU A 1 15  ? -4.697  22.279  2.229   1.00 0.00 ? 15  GLU A O    6  
ATOM 9120  C CB   . GLU A 1 15  ? -2.888  21.713  4.586   1.00 0.00 ? 15  GLU A CB   6  
ATOM 9121  C CG   . GLU A 1 15  ? -1.800  21.887  5.631   1.00 0.00 ? 15  GLU A CG   6  
ATOM 9122  C CD   . GLU A 1 15  ? -1.941  23.180  6.410   1.00 0.00 ? 15  GLU A CD   6  
ATOM 9123  O OE1  . GLU A 1 15  ? -1.481  24.227  5.911   1.00 0.00 ? 15  GLU A OE1  6  
ATOM 9124  O OE2  . GLU A 1 15  ? -2.513  23.143  7.522   1.00 0.00 ? 15  GLU A OE2  6  
ATOM 9125  H H    . GLU A 1 15  ? -2.916  24.218  3.863   1.00 0.00 ? 15  GLU A H    6  
ATOM 9126  H HA   . GLU A 1 15  ? -1.550  21.828  2.920   1.00 0.00 ? 15  GLU A HA   6  
ATOM 9127  H HB2  . GLU A 1 15  ? -3.773  22.232  4.925   1.00 0.00 ? 15  GLU A HB2  6  
ATOM 9128  H HB3  . GLU A 1 15  ? -3.112  20.659  4.501   1.00 0.00 ? 15  GLU A HB3  6  
ATOM 9129  H HG2  . GLU A 1 15  ? -1.849  21.060  6.324   1.00 0.00 ? 15  GLU A HG2  6  
ATOM 9130  H HG3  . GLU A 1 15  ? -0.840  21.884  5.137   1.00 0.00 ? 15  GLU A HG3  6  
ATOM 9131  N N    . GLN A 1 16  ? -3.147  20.980  1.241   1.00 0.00 ? 16  GLN A N    6  
ATOM 9132  C CA   . GLN A 1 16  ? -4.052  20.506  0.198   1.00 0.00 ? 16  GLN A CA   6  
ATOM 9133  C C    . GLN A 1 16  ? -4.114  18.982  0.184   1.00 0.00 ? 16  GLN A C    6  
ATOM 9134  O O    . GLN A 1 16  ? -3.481  18.318  1.002   1.00 0.00 ? 16  GLN A O    6  
ATOM 9135  C CB   . GLN A 1 16  ? -3.602  21.024  -1.168  1.00 0.00 ? 16  GLN A CB   6  
ATOM 9136  C CG   . GLN A 1 16  ? -4.461  22.160  -1.702  1.00 0.00 ? 16  GLN A CG   6  
ATOM 9137  C CD   . GLN A 1 16  ? -3.988  22.666  -3.050  1.00 0.00 ? 16  GLN A CD   6  
ATOM 9138  O OE1  . GLN A 1 16  ? -3.551  21.888  -3.900  1.00 0.00 ? 16  GLN A OE1  6  
ATOM 9139  N NE2  . GLN A 1 16  ? -4.072  23.975  -3.255  1.00 0.00 ? 16  GLN A NE2  6  
ATOM 9140  H H    . GLN A 1 16  ? -2.222  20.661  1.251   1.00 0.00 ? 16  GLN A H    6  
ATOM 9141  H HA   . GLN A 1 16  ? -5.035  20.892  0.413   1.00 0.00 ? 16  GLN A HA   6  
ATOM 9142  H HB2  . GLN A 1 16  ? -2.584  21.376  -1.091  1.00 0.00 ? 16  GLN A HB2  6  
ATOM 9143  H HB3  . GLN A 1 16  ? -3.639  20.211  -1.879  1.00 0.00 ? 16  GLN A HB3  6  
ATOM 9144  H HG2  . GLN A 1 16  ? -5.476  21.809  -1.803  1.00 0.00 ? 16  GLN A HG2  6  
ATOM 9145  H HG3  . GLN A 1 16  ? -4.431  22.977  -0.996  1.00 0.00 ? 16  GLN A HG3  6  
ATOM 9146  H HE21 . GLN A 1 16  ? -4.429  24.534  -2.532  1.00 0.00 ? 16  GLN A HE21 6  
ATOM 9147  H HE22 . GLN A 1 16  ? -3.772  24.330  -4.117  1.00 0.00 ? 16  GLN A HE22 6  
ATOM 9148  N N    . ALA A 1 17  ? -4.883  18.436  -0.753  1.00 0.00 ? 17  ALA A N    6  
ATOM 9149  C CA   . ALA A 1 17  ? -5.027  16.991  -0.876  1.00 0.00 ? 17  ALA A CA   6  
ATOM 9150  C C    . ALA A 1 17  ? -3.692  16.334  -1.213  1.00 0.00 ? 17  ALA A C    6  
ATOM 9151  O O    . ALA A 1 17  ? -2.764  16.974  -1.707  1.00 0.00 ? 17  ALA A O    6  
ATOM 9152  C CB   . ALA A 1 17  ? -6.066  16.652  -1.934  1.00 0.00 ? 17  ALA A CB   6  
ATOM 9153  H H    . ALA A 1 17  ? -5.362  19.020  -1.377  1.00 0.00 ? 17  ALA A H    6  
ATOM 9154  H HA   . ALA A 1 17  ? -5.376  16.609  0.072   1.00 0.00 ? 17  ALA A HA   6  
ATOM 9155  H HB1  . ALA A 1 17  ? -6.138  17.467  -2.640  1.00 0.00 ? 17  ALA A HB1  6  
ATOM 9156  H HB2  . ALA A 1 17  ? -5.772  15.752  -2.452  1.00 0.00 ? 17  ALA A HB2  6  
ATOM 9157  H HB3  . ALA A 1 17  ? -7.024  16.500  -1.462  1.00 0.00 ? 17  ALA A HB3  6  
ATOM 9158  N N    . PRO A 1 18  ? -3.592  15.024  -0.940  1.00 0.00 ? 18  PRO A N    6  
ATOM 9159  C CA   . PRO A 1 18  ? -2.375  14.251  -1.205  1.00 0.00 ? 18  PRO A CA   6  
ATOM 9160  C C    . PRO A 1 18  ? -2.125  14.059  -2.698  1.00 0.00 ? 18  PRO A C    6  
ATOM 9161  O O    . PRO A 1 18  ? -2.960  13.501  -3.410  1.00 0.00 ? 18  PRO A O    6  
ATOM 9162  C CB   . PRO A 1 18  ? -2.656  12.905  -0.533  1.00 0.00 ? 18  PRO A CB   6  
ATOM 9163  C CG   . PRO A 1 18  ? -4.142  12.795  -0.512  1.00 0.00 ? 18  PRO A CG   6  
ATOM 9164  C CD   . PRO A 1 18  ? -4.659  14.197  -0.350  1.00 0.00 ? 18  PRO A CD   6  
ATOM 9165  H HA   . PRO A 1 18  ? -1.508  14.707  -0.752  1.00 0.00 ? 18  PRO A HA   6  
ATOM 9166  H HB2  . PRO A 1 18  ? -2.208  12.109  -1.112  1.00 0.00 ? 18  PRO A HB2  6  
ATOM 9167  H HB3  . PRO A 1 18  ? -2.247  12.905  0.466   1.00 0.00 ? 18  PRO A HB3  6  
ATOM 9168  H HG2  . PRO A 1 18  ? -4.492  12.370  -1.440  1.00 0.00 ? 18  PRO A HG2  6  
ATOM 9169  H HG3  . PRO A 1 18  ? -4.452  12.183  0.323   1.00 0.00 ? 18  PRO A HG3  6  
ATOM 9170  H HD2  . PRO A 1 18  ? -5.586  14.322  -0.891  1.00 0.00 ? 18  PRO A HD2  6  
ATOM 9171  H HD3  . PRO A 1 18  ? -4.794  14.432  0.695   1.00 0.00 ? 18  PRO A HD3  6  
ATOM 9172  N N    . SER A 1 19  ? -0.970  14.523  -3.163  1.00 0.00 ? 19  SER A N    6  
ATOM 9173  C CA   . SER A 1 19  ? -0.610  14.405  -4.572  1.00 0.00 ? 19  SER A CA   6  
ATOM 9174  C C    . SER A 1 19  ? 0.555   13.439  -4.755  1.00 0.00 ? 19  SER A C    6  
ATOM 9175  O O    . SER A 1 19  ? 1.446   13.672  -5.574  1.00 0.00 ? 19  SER A O    6  
ATOM 9176  C CB   . SER A 1 19  ? -0.247  15.777  -5.143  1.00 0.00 ? 19  SER A CB   6  
ATOM 9177  O OG   . SER A 1 19  ? -0.217  15.747  -6.561  1.00 0.00 ? 19  SER A OG   6  
ATOM 9178  H H    . SER A 1 19  ? -0.346  14.958  -2.545  1.00 0.00 ? 19  SER A H    6  
ATOM 9179  H HA   . SER A 1 19  ? -1.469  14.020  -5.101  1.00 0.00 ? 19  SER A HA   6  
ATOM 9180  H HB2  . SER A 1 19  ? -0.979  16.503  -4.827  1.00 0.00 ? 19  SER A HB2  6  
ATOM 9181  H HB3  . SER A 1 19  ? 0.728   16.067  -4.781  1.00 0.00 ? 19  SER A HB3  6  
ATOM 9182  H HG   . SER A 1 19  ? 0.085   16.595  -6.892  1.00 0.00 ? 19  SER A HG   6  
ATOM 9183  N N    . SER A 1 20  ? 0.542   12.352  -3.991  1.00 0.00 ? 20  SER A N    6  
ATOM 9184  C CA   . SER A 1 20  ? 1.600   11.351  -4.065  1.00 0.00 ? 20  SER A CA   6  
ATOM 9185  C C    . SER A 1 20  ? 1.059   9.965   -3.729  1.00 0.00 ? 20  SER A C    6  
ATOM 9186  O O    . SER A 1 20  ? 0.404   9.772   -2.706  1.00 0.00 ? 20  SER A O    6  
ATOM 9187  C CB   . SER A 1 20  ? 2.740   11.712  -3.111  1.00 0.00 ? 20  SER A CB   6  
ATOM 9188  O OG   . SER A 1 20  ? 3.466   10.556  -2.724  1.00 0.00 ? 20  SER A OG   6  
ATOM 9189  H H    . SER A 1 20  ? -0.196  12.223  -3.357  1.00 0.00 ? 20  SER A H    6  
ATOM 9190  H HA   . SER A 1 20  ? 1.978   11.343  -5.077  1.00 0.00 ? 20  SER A HA   6  
ATOM 9191  H HB2  . SER A 1 20  ? 3.414   12.398  -3.601  1.00 0.00 ? 20  SER A HB2  6  
ATOM 9192  H HB3  . SER A 1 20  ? 2.331   12.178  -2.227  1.00 0.00 ? 20  SER A HB3  6  
ATOM 9193  H HG   . SER A 1 20  ? 2.948   10.049  -2.095  1.00 0.00 ? 20  SER A HG   6  
ATOM 9194  N N    . ALA A 1 21  ? 1.339   9.001   -4.601  1.00 0.00 ? 21  ALA A N    6  
ATOM 9195  C CA   . ALA A 1 21  ? 0.884   7.631   -4.398  1.00 0.00 ? 21  ALA A CA   6  
ATOM 9196  C C    . ALA A 1 21  ? 1.619   6.975   -3.233  1.00 0.00 ? 21  ALA A C    6  
ATOM 9197  O O    . ALA A 1 21  ? 2.733   7.358   -2.878  1.00 0.00 ? 21  ALA A O    6  
ATOM 9198  C CB   . ALA A 1 21  ? 1.073   6.818   -5.670  1.00 0.00 ? 21  ALA A CB   6  
ATOM 9199  H H    . ALA A 1 21  ? 1.866   9.216   -5.400  1.00 0.00 ? 21  ALA A H    6  
ATOM 9200  H HA   . ALA A 1 21  ? -0.173  7.661   -4.172  1.00 0.00 ? 21  ALA A HA   6  
ATOM 9201  H HB1  . ALA A 1 21  ? 2.012   6.284   -5.618  1.00 0.00 ? 21  ALA A HB1  6  
ATOM 9202  H HB2  . ALA A 1 21  ? 0.262   6.112   -5.770  1.00 0.00 ? 21  ALA A HB2  6  
ATOM 9203  H HB3  . ALA A 1 21  ? 1.084   7.480   -6.523  1.00 0.00 ? 21  ALA A HB3  6  
ATOM 9204  N N    . PRO A 1 22  ? 0.982   5.965   -2.626  1.00 0.00 ? 22  PRO A N    6  
ATOM 9205  C CA   . PRO A 1 22  ? 1.557   5.234   -1.491  1.00 0.00 ? 22  PRO A CA   6  
ATOM 9206  C C    . PRO A 1 22  ? 2.744   4.370   -1.902  1.00 0.00 ? 22  PRO A C    6  
ATOM 9207  O O    . PRO A 1 22  ? 2.774   3.822   -3.004  1.00 0.00 ? 22  PRO A O    6  
ATOM 9208  C CB   . PRO A 1 22  ? 0.398   4.359   -1.008  1.00 0.00 ? 22  PRO A CB   6  
ATOM 9209  C CG   . PRO A 1 22  ? -0.468  4.181   -2.208  1.00 0.00 ? 22  PRO A CG   6  
ATOM 9210  C CD   . PRO A 1 22  ? -0.350  5.456   -2.997  1.00 0.00 ? 22  PRO A CD   6  
ATOM 9211  H HA   . PRO A 1 22  ? 1.859   5.905   -0.700  1.00 0.00 ? 22  PRO A HA   6  
ATOM 9212  H HB2  . PRO A 1 22  ? 0.783   3.412   -0.653  1.00 0.00 ? 22  PRO A HB2  6  
ATOM 9213  H HB3  . PRO A 1 22  ? -0.130  4.861   -0.212  1.00 0.00 ? 22  PRO A HB3  6  
ATOM 9214  H HG2  . PRO A 1 22  ? -0.116  3.343   -2.793  1.00 0.00 ? 22  PRO A HG2  6  
ATOM 9215  H HG3  . PRO A 1 22  ? -1.491  4.023   -1.901  1.00 0.00 ? 22  PRO A HG3  6  
ATOM 9216  H HD2  . PRO A 1 22  ? -0.402  5.251   -4.055  1.00 0.00 ? 22  PRO A HD2  6  
ATOM 9217  H HD3  . PRO A 1 22  ? -1.123  6.152   -2.707  1.00 0.00 ? 22  PRO A HD3  6  
ATOM 9218  N N    . ARG A 1 23  ? 3.720   4.250   -1.007  1.00 0.00 ? 23  ARG A N    6  
ATOM 9219  C CA   . ARG A 1 23  ? 4.909   3.451   -1.277  1.00 0.00 ? 23  ARG A CA   6  
ATOM 9220  C C    . ARG A 1 23  ? 4.921   2.188   -0.422  1.00 0.00 ? 23  ARG A C    6  
ATOM 9221  O O    . ARG A 1 23  ? 4.099   2.029   0.481   1.00 0.00 ? 23  ARG A O    6  
ATOM 9222  C CB   . ARG A 1 23  ? 6.172   4.273   -1.008  1.00 0.00 ? 23  ARG A CB   6  
ATOM 9223  C CG   . ARG A 1 23  ? 6.116   5.680   -1.582  1.00 0.00 ? 23  ARG A CG   6  
ATOM 9224  C CD   . ARG A 1 23  ? 7.453   6.392   -1.440  1.00 0.00 ? 23  ARG A CD   6  
ATOM 9225  N NE   . ARG A 1 23  ? 8.001   6.263   -0.093  1.00 0.00 ? 23  ARG A NE   6  
ATOM 9226  C CZ   . ARG A 1 23  ? 9.276   6.486   0.205   1.00 0.00 ? 23  ARG A CZ   6  
ATOM 9227  N NH1  . ARG A 1 23  ? 10.129  6.847   -0.742  1.00 0.00 ? 23  ARG A NH1  6  
ATOM 9228  N NH2  . ARG A 1 23  ? 9.700   6.348   1.455   1.00 0.00 ? 23  ARG A NH2  6  
ATOM 9229  H H    . ARG A 1 23  ? 3.639   4.710   -0.146  1.00 0.00 ? 23  ARG A H    6  
ATOM 9230  H HA   . ARG A 1 23  ? 4.890   3.168   -2.318  1.00 0.00 ? 23  ARG A HA   6  
ATOM 9231  H HB2  . ARG A 1 23  ? 6.319   4.348   0.058   1.00 0.00 ? 23  ARG A HB2  6  
ATOM 9232  H HB3  . ARG A 1 23  ? 7.018   3.763   -1.446  1.00 0.00 ? 23  ARG A HB3  6  
ATOM 9233  H HG2  . ARG A 1 23  ? 5.862   5.622   -2.631  1.00 0.00 ? 23  ARG A HG2  6  
ATOM 9234  H HG3  . ARG A 1 23  ? 5.360   6.242   -1.056  1.00 0.00 ? 23  ARG A HG3  6  
ATOM 9235  H HD2  . ARG A 1 23  ? 8.150   5.964   -2.144  1.00 0.00 ? 23  ARG A HD2  6  
ATOM 9236  H HD3  . ARG A 1 23  ? 7.312   7.439   -1.663  1.00 0.00 ? 23  ARG A HD3  6  
ATOM 9237  H HE   . ARG A 1 23  ? 7.388   5.997   0.623   1.00 0.00 ? 23  ARG A HE   6  
ATOM 9238  H HH11 . ARG A 1 23  ? 9.812   6.952   -1.686  1.00 0.00 ? 23  ARG A HH11 6  
ATOM 9239  H HH12 . ARG A 1 23  ? 11.089  7.015   -0.515  1.00 0.00 ? 23  ARG A HH12 6  
ATOM 9240  H HH21 . ARG A 1 23  ? 9.060   6.076   2.173   1.00 0.00 ? 23  ARG A HH21 6  
ATOM 9241  H HH22 . ARG A 1 23  ? 10.659  6.515   1.680   1.00 0.00 ? 23  ARG A HH22 6  
ATOM 9242  N N    . ASP A 1 24  ? 5.857   1.292   -0.714  1.00 0.00 ? 24  ASP A N    6  
ATOM 9243  C CA   . ASP A 1 24  ? 5.976   0.042   0.027   1.00 0.00 ? 24  ASP A CA   6  
ATOM 9244  C C    . ASP A 1 24  ? 4.669   -0.741  -0.014  1.00 0.00 ? 24  ASP A C    6  
ATOM 9245  O O    . ASP A 1 24  ? 4.389   -1.551  0.871   1.00 0.00 ? 24  ASP A O    6  
ATOM 9246  C CB   . ASP A 1 24  ? 6.373   0.320   1.479   1.00 0.00 ? 24  ASP A CB   6  
ATOM 9247  C CG   . ASP A 1 24  ? 7.629   -0.423  1.888   1.00 0.00 ? 24  ASP A CG   6  
ATOM 9248  O OD1  . ASP A 1 24  ? 8.654   -0.289  1.188   1.00 0.00 ? 24  ASP A OD1  6  
ATOM 9249  O OD2  . ASP A 1 24  ? 7.587   -1.138  2.912   1.00 0.00 ? 24  ASP A OD2  6  
ATOM 9250  H H    . ASP A 1 24  ? 6.484   1.476   -1.445  1.00 0.00 ? 24  ASP A H    6  
ATOM 9251  H HA   . ASP A 1 24  ? 6.750   -0.549  -0.440  1.00 0.00 ? 24  ASP A HA   6  
ATOM 9252  H HB2  . ASP A 1 24  ? 6.548   1.380   1.599   1.00 0.00 ? 24  ASP A HB2  6  
ATOM 9253  H HB3  . ASP A 1 24  ? 5.567   0.015   2.130   1.00 0.00 ? 24  ASP A HB3  6  
ATOM 9254  N N    . VAL A 1 25  ? 3.869   -0.495  -1.047  1.00 0.00 ? 25  VAL A N    6  
ATOM 9255  C CA   . VAL A 1 25  ? 2.590   -1.178  -1.203  1.00 0.00 ? 25  VAL A CA   6  
ATOM 9256  C C    . VAL A 1 25  ? 2.784   -2.595  -1.730  1.00 0.00 ? 25  VAL A C    6  
ATOM 9257  O O    . VAL A 1 25  ? 3.012   -2.797  -2.923  1.00 0.00 ? 25  VAL A O    6  
ATOM 9258  C CB   . VAL A 1 25  ? 1.658   -0.409  -2.159  1.00 0.00 ? 25  VAL A CB   6  
ATOM 9259  C CG1  . VAL A 1 25  ? 0.269   -1.028  -2.161  1.00 0.00 ? 25  VAL A CG1  6  
ATOM 9260  C CG2  . VAL A 1 25  ? 1.595   1.061   -1.773  1.00 0.00 ? 25  VAL A CG2  6  
ATOM 9261  H H    . VAL A 1 25  ? 4.146   0.162   -1.719  1.00 0.00 ? 25  VAL A H    6  
ATOM 9262  H HA   . VAL A 1 25  ? 2.117   -1.226  -0.234  1.00 0.00 ? 25  VAL A HA   6  
ATOM 9263  H HB   . VAL A 1 25  ? 2.062   -0.481  -3.158  1.00 0.00 ? 25  VAL A HB   6  
ATOM 9264  H HG11 . VAL A 1 25  ? 0.312   -2.008  -2.611  1.00 0.00 ? 25  VAL A HG11 6  
ATOM 9265  H HG12 . VAL A 1 25  ? -0.090  -1.112  -1.147  1.00 0.00 ? 25  VAL A HG12 6  
ATOM 9266  H HG13 . VAL A 1 25  ? -0.403  -0.401  -2.730  1.00 0.00 ? 25  VAL A HG13 6  
ATOM 9267  H HG21 . VAL A 1 25  ? 1.186   1.155   -0.779  1.00 0.00 ? 25  VAL A HG21 6  
ATOM 9268  H HG22 . VAL A 1 25  ? 2.591   1.483   -1.795  1.00 0.00 ? 25  VAL A HG22 6  
ATOM 9269  H HG23 . VAL A 1 25  ? 0.967   1.591   -2.474  1.00 0.00 ? 25  VAL A HG23 6  
ATOM 9270  N N    . GLN A 1 26  ? 2.690   -3.571  -0.833  1.00 0.00 ? 26  GLN A N    6  
ATOM 9271  C CA   . GLN A 1 26  ? 2.856   -4.971  -1.209  1.00 0.00 ? 26  GLN A CA   6  
ATOM 9272  C C    . GLN A 1 26  ? 1.949   -5.868  -0.376  1.00 0.00 ? 26  GLN A C    6  
ATOM 9273  O O    . GLN A 1 26  ? 1.706   -5.602  0.801   1.00 0.00 ? 26  GLN A O    6  
ATOM 9274  C CB   . GLN A 1 26  ? 4.314   -5.398  -1.036  1.00 0.00 ? 26  GLN A CB   6  
ATOM 9275  C CG   . GLN A 1 26  ? 4.850   -5.179  0.370   1.00 0.00 ? 26  GLN A CG   6  
ATOM 9276  C CD   . GLN A 1 26  ? 6.363   -5.086  0.410   1.00 0.00 ? 26  GLN A CD   6  
ATOM 9277  O OE1  . GLN A 1 26  ? 7.027   -5.879  1.079   1.00 0.00 ? 26  GLN A OE1  6  
ATOM 9278  N NE2  . GLN A 1 26  ? 6.916   -4.116  -0.306  1.00 0.00 ? 26  GLN A NE2  6  
ATOM 9279  H H    . GLN A 1 26  ? 2.507   -3.346  0.101   1.00 0.00 ? 26  GLN A H    6  
ATOM 9280  H HA   . GLN A 1 26  ? 2.582   -5.069  -2.249  1.00 0.00 ? 26  GLN A HA   6  
ATOM 9281  H HB2  . GLN A 1 26  ? 4.400   -6.448  -1.271  1.00 0.00 ? 26  GLN A HB2  6  
ATOM 9282  H HB3  . GLN A 1 26  ? 4.927   -4.832  -1.723  1.00 0.00 ? 26  GLN A HB3  6  
ATOM 9283  H HG2  . GLN A 1 26  ? 4.438   -4.259  0.758   1.00 0.00 ? 26  GLN A HG2  6  
ATOM 9284  H HG3  . GLN A 1 26  ? 4.537   -6.003  0.993   1.00 0.00 ? 26  GLN A HG3  6  
ATOM 9285  H HE21 . GLN A 1 26  ? 6.325   -3.521  -0.814  1.00 0.00 ? 26  GLN A HE21 6  
ATOM 9286  H HE22 . GLN A 1 26  ? 7.892   -4.034  -0.298  1.00 0.00 ? 26  GLN A HE22 6  
ATOM 9287  N N    . ALA A 1 27  ? 1.448   -6.934  -0.994  1.00 0.00 ? 27  ALA A N    6  
ATOM 9288  C CA   . ALA A 1 27  ? 0.568   -7.873  -0.308  1.00 0.00 ? 27  ALA A CA   6  
ATOM 9289  C C    . ALA A 1 27  ? 1.263   -9.212  -0.085  1.00 0.00 ? 27  ALA A C    6  
ATOM 9290  O O    . ALA A 1 27  ? 1.698   -9.862  -1.036  1.00 0.00 ? 27  ALA A O    6  
ATOM 9291  C CB   . ALA A 1 27  ? -0.716  -8.066  -1.100  1.00 0.00 ? 27  ALA A CB   6  
ATOM 9292  H H    . ALA A 1 27  ? 1.678   -7.093  -1.933  1.00 0.00 ? 27  ALA A H    6  
ATOM 9293  H HA   . ALA A 1 27  ? 0.310   -7.447  0.652   1.00 0.00 ? 27  ALA A HA   6  
ATOM 9294  H HB1  . ALA A 1 27  ? -1.435  -8.599  -0.494  1.00 0.00 ? 27  ALA A HB1  6  
ATOM 9295  H HB2  . ALA A 1 27  ? -1.119  -7.102  -1.374  1.00 0.00 ? 27  ALA A HB2  6  
ATOM 9296  H HB3  . ALA A 1 27  ? -0.506  -8.635  -1.993  1.00 0.00 ? 27  ALA A HB3  6  
ATOM 9297  N N    . ARG A 1 28  ? 1.361   -9.618  1.176   1.00 0.00 ? 28  ARG A N    6  
ATOM 9298  C CA   . ARG A 1 28  ? 2.003   -10.880 1.524   1.00 0.00 ? 28  ARG A CA   6  
ATOM 9299  C C    . ARG A 1 28  ? 0.988   -11.871 2.085   1.00 0.00 ? 28  ARG A C    6  
ATOM 9300  O O    . ARG A 1 28  ? 0.282   -11.573 3.048   1.00 0.00 ? 28  ARG A O    6  
ATOM 9301  C CB   . ARG A 1 28  ? 3.121   -10.646 2.543   1.00 0.00 ? 28  ARG A CB   6  
ATOM 9302  C CG   . ARG A 1 28  ? 2.670   -9.871  3.772   1.00 0.00 ? 28  ARG A CG   6  
ATOM 9303  C CD   . ARG A 1 28  ? 3.843   -9.541  4.683   1.00 0.00 ? 28  ARG A CD   6  
ATOM 9304  N NE   . ARG A 1 28  ? 4.369   -10.729 5.347   1.00 0.00 ? 28  ARG A NE   6  
ATOM 9305  C CZ   . ARG A 1 28  ? 5.226   -10.684 6.362   1.00 0.00 ? 28  ARG A CZ   6  
ATOM 9306  N NH1  . ARG A 1 28  ? 5.647   -9.516  6.827   1.00 0.00 ? 28  ARG A NH1  6  
ATOM 9307  N NH2  . ARG A 1 28  ? 5.662   -11.808 6.916   1.00 0.00 ? 28  ARG A NH2  6  
ATOM 9308  H H    . ARG A 1 28  ? 0.995   -9.057  1.890   1.00 0.00 ? 28  ARG A H    6  
ATOM 9309  H HA   . ARG A 1 28  ? 2.432   -11.294 0.623   1.00 0.00 ? 28  ARG A HA   6  
ATOM 9310  H HB2  . ARG A 1 28  ? 3.503   -11.602 2.868   1.00 0.00 ? 28  ARG A HB2  6  
ATOM 9311  H HB3  . ARG A 1 28  ? 3.915   -10.091 2.067   1.00 0.00 ? 28  ARG A HB3  6  
ATOM 9312  H HG2  . ARG A 1 28  ? 2.205   -8.951  3.455   1.00 0.00 ? 28  ARG A HG2  6  
ATOM 9313  H HG3  . ARG A 1 28  ? 1.956   -10.468 4.320   1.00 0.00 ? 28  ARG A HG3  6  
ATOM 9314  H HD2  . ARG A 1 28  ? 4.626   -9.093  4.090   1.00 0.00 ? 28  ARG A HD2  6  
ATOM 9315  H HD3  . ARG A 1 28  ? 3.511   -8.838  5.431   1.00 0.00 ? 28  ARG A HD3  6  
ATOM 9316  H HE   . ARG A 1 28  ? 4.072   -11.603 5.020   1.00 0.00 ? 28  ARG A HE   6  
ATOM 9317  H HH11 . ARG A 1 28  ? 5.320   -8.667  6.413   1.00 0.00 ? 28  ARG A HH11 6  
ATOM 9318  H HH12 . ARG A 1 28  ? 6.291   -9.484  7.592   1.00 0.00 ? 28  ARG A HH12 6  
ATOM 9319  H HH21 . ARG A 1 28  ? 5.345   -12.691 6.568   1.00 0.00 ? 28  ARG A HH21 6  
ATOM 9320  H HH22 . ARG A 1 28  ? 6.305   -11.773 7.679   1.00 0.00 ? 28  ARG A HH22 6  
ATOM 9321  N N    . MET A 1 29  ? 0.921   -13.051 1.477   1.00 0.00 ? 29  MET A N    6  
ATOM 9322  C CA   . MET A 1 29  ? -0.008  -14.086 1.917   1.00 0.00 ? 29  MET A CA   6  
ATOM 9323  C C    . MET A 1 29  ? 0.563   -14.860 3.100   1.00 0.00 ? 29  MET A C    6  
ATOM 9324  O O    . MET A 1 29  ? 1.755   -15.170 3.136   1.00 0.00 ? 29  MET A O    6  
ATOM 9325  C CB   . MET A 1 29  ? -0.318  -15.045 0.765   1.00 0.00 ? 29  MET A CB   6  
ATOM 9326  C CG   . MET A 1 29  ? -1.736  -14.917 0.234   1.00 0.00 ? 29  MET A CG   6  
ATOM 9327  S SD   . MET A 1 29  ? -2.981  -15.320 1.474   1.00 0.00 ? 29  MET A SD   6  
ATOM 9328  C CE   . MET A 1 29  ? -4.021  -16.452 0.553   1.00 0.00 ? 29  MET A CE   6  
ATOM 9329  H H    . MET A 1 29  ? 1.511   -13.231 0.714   1.00 0.00 ? 29  MET A H    6  
ATOM 9330  H HA   . MET A 1 29  ? -0.922  -13.600 2.224   1.00 0.00 ? 29  MET A HA   6  
ATOM 9331  H HB2  . MET A 1 29  ? 0.367   -14.849 -0.045  1.00 0.00 ? 29  MET A HB2  6  
ATOM 9332  H HB3  . MET A 1 29  ? -0.176  -16.058 1.109   1.00 0.00 ? 29  MET A HB3  6  
ATOM 9333  H HG2  . MET A 1 29  ? -1.893  -13.901 -0.095  1.00 0.00 ? 29  MET A HG2  6  
ATOM 9334  H HG3  . MET A 1 29  ? -1.852  -15.586 -0.606  1.00 0.00 ? 29  MET A HG3  6  
ATOM 9335  H HE1  . MET A 1 29  ? -3.431  -16.950 -0.201  1.00 0.00 ? 29  MET A HE1  6  
ATOM 9336  H HE2  . MET A 1 29  ? -4.437  -17.186 1.227   1.00 0.00 ? 29  MET A HE2  6  
ATOM 9337  H HE3  . MET A 1 29  ? -4.821  -15.903 0.080   1.00 0.00 ? 29  MET A HE3  6  
ATOM 9338  N N    . LEU A 1 30  ? -0.294  -15.171 4.067   1.00 0.00 ? 30  LEU A N    6  
ATOM 9339  C CA   . LEU A 1 30  ? 0.125   -15.908 5.253   1.00 0.00 ? 30  LEU A CA   6  
ATOM 9340  C C    . LEU A 1 30  ? -0.690  -17.189 5.412   1.00 0.00 ? 30  LEU A C    6  
ATOM 9341  O O    . LEU A 1 30  ? -0.179  -18.206 5.882   1.00 0.00 ? 30  LEU A O    6  
ATOM 9342  C CB   . LEU A 1 30  ? -0.025  -15.037 6.501   1.00 0.00 ? 30  LEU A CB   6  
ATOM 9343  C CG   . LEU A 1 30  ? 0.304   -13.554 6.327   1.00 0.00 ? 30  LEU A CG   6  
ATOM 9344  C CD1  . LEU A 1 30  ? -0.139  -12.763 7.547   1.00 0.00 ? 30  LEU A CD1  6  
ATOM 9345  C CD2  . LEU A 1 30  ? 1.793   -13.363 6.076   1.00 0.00 ? 30  LEU A CD2  6  
ATOM 9346  H H    . LEU A 1 30  ? -1.231  -14.896 3.982   1.00 0.00 ? 30  LEU A H    6  
ATOM 9347  H HA   . LEU A 1 30  ? 1.165   -16.171 5.130   1.00 0.00 ? 30  LEU A HA   6  
ATOM 9348  H HB2  . LEU A 1 30  ? -1.049  -15.111 6.834   1.00 0.00 ? 30  LEU A HB2  6  
ATOM 9349  H HB3  . LEU A 1 30  ? 0.631   -15.435 7.263   1.00 0.00 ? 30  LEU A HB3  6  
ATOM 9350  H HG   . LEU A 1 30  ? -0.233  -13.171 5.469   1.00 0.00 ? 30  LEU A HG   6  
ATOM 9351  H HD11 . LEU A 1 30  ? -0.855  -12.011 7.250   1.00 0.00 ? 30  LEU A HD11 6  
ATOM 9352  H HD12 . LEU A 1 30  ? 0.720   -12.283 7.997   1.00 0.00 ? 30  LEU A HD12 6  
ATOM 9353  H HD13 . LEU A 1 30  ? -0.592  -13.431 8.264   1.00 0.00 ? 30  LEU A HD13 6  
ATOM 9354  H HD21 . LEU A 1 30  ? 2.332   -14.227 6.437   1.00 0.00 ? 30  LEU A HD21 6  
ATOM 9355  H HD22 . LEU A 1 30  ? 2.136   -12.482 6.597   1.00 0.00 ? 30  LEU A HD22 6  
ATOM 9356  H HD23 . LEU A 1 30  ? 1.968   -13.248 5.016   1.00 0.00 ? 30  LEU A HD23 6  
ATOM 9357  N N    . SER A 1 31  ? -1.956  -17.132 5.016   1.00 0.00 ? 31  SER A N    6  
ATOM 9358  C CA   . SER A 1 31  ? -2.841  -18.286 5.117   1.00 0.00 ? 31  SER A CA   6  
ATOM 9359  C C    . SER A 1 31  ? -3.440  -18.632 3.756   1.00 0.00 ? 31  SER A C    6  
ATOM 9360  O O    . SER A 1 31  ? -2.991  -18.136 2.724   1.00 0.00 ? 31  SER A O    6  
ATOM 9361  C CB   . SER A 1 31  ? -3.959  -18.013 6.124   1.00 0.00 ? 31  SER A CB   6  
ATOM 9362  O OG   . SER A 1 31  ? -4.219  -19.155 6.921   1.00 0.00 ? 31  SER A OG   6  
ATOM 9363  H H    . SER A 1 31  ? -2.305  -16.292 4.649   1.00 0.00 ? 31  SER A H    6  
ATOM 9364  H HA   . SER A 1 31  ? -2.255  -19.125 5.461   1.00 0.00 ? 31  SER A HA   6  
ATOM 9365  H HB2  . SER A 1 31  ? -3.667  -17.199 6.769   1.00 0.00 ? 31  SER A HB2  6  
ATOM 9366  H HB3  . SER A 1 31  ? -4.861  -17.747 5.592   1.00 0.00 ? 31  SER A HB3  6  
ATOM 9367  H HG   . SER A 1 31  ? -4.793  -18.912 7.651   1.00 0.00 ? 31  SER A HG   6  
ATOM 9368  N N    . SER A 1 32  ? -4.458  -19.487 3.765   1.00 0.00 ? 32  SER A N    6  
ATOM 9369  C CA   . SER A 1 32  ? -5.117  -19.903 2.533   1.00 0.00 ? 32  SER A CA   6  
ATOM 9370  C C    . SER A 1 32  ? -6.351  -19.046 2.260   1.00 0.00 ? 32  SER A C    6  
ATOM 9371  O O    . SER A 1 32  ? -7.007  -19.190 1.228   1.00 0.00 ? 32  SER A O    6  
ATOM 9372  C CB   . SER A 1 32  ? -5.515  -21.378 2.613   1.00 0.00 ? 32  SER A CB   6  
ATOM 9373  O OG   . SER A 1 32  ? -5.984  -21.708 3.910   1.00 0.00 ? 32  SER A OG   6  
ATOM 9374  H H    . SER A 1 32  ? -4.771  -19.848 4.621   1.00 0.00 ? 32  SER A H    6  
ATOM 9375  H HA   . SER A 1 32  ? -4.416  -19.771 1.720   1.00 0.00 ? 32  SER A HA   6  
ATOM 9376  H HB2  . SER A 1 32  ? -6.298  -21.577 1.899   1.00 0.00 ? 32  SER A HB2  6  
ATOM 9377  H HB3  . SER A 1 32  ? -4.656  -21.992 2.387   1.00 0.00 ? 32  SER A HB3  6  
ATOM 9378  H HG   . SER A 1 32  ? -6.090  -22.661 3.978   1.00 0.00 ? 32  SER A HG   6  
ATOM 9379  N N    . THR A 1 33  ? -6.662  -18.154 3.195   1.00 0.00 ? 33  THR A N    6  
ATOM 9380  C CA   . THR A 1 33  ? -7.816  -17.274 3.058   1.00 0.00 ? 33  THR A CA   6  
ATOM 9381  C C    . THR A 1 33  ? -7.635  -16.000 3.874   1.00 0.00 ? 33  THR A C    6  
ATOM 9382  O O    . THR A 1 33  ? -8.608  -15.398 4.331   1.00 0.00 ? 33  THR A O    6  
ATOM 9383  C CB   . THR A 1 33  ? -9.113  -17.976 3.504   1.00 0.00 ? 33  THR A CB   6  
ATOM 9384  O OG1  . THR A 1 33  ? -8.873  -18.736 4.694   1.00 0.00 ? 33  THR A OG1  6  
ATOM 9385  C CG2  . THR A 1 33  ? -9.635  -18.892 2.407   1.00 0.00 ? 33  THR A CG2  6  
ATOM 9386  H H    . THR A 1 33  ? -6.100  -18.087 3.996   1.00 0.00 ? 33  THR A H    6  
ATOM 9387  H HA   . THR A 1 33  ? -7.913  -17.011 2.016   1.00 0.00 ? 33  THR A HA   6  
ATOM 9388  H HB   . THR A 1 33  ? -9.858  -17.223 3.711   1.00 0.00 ? 33  THR A HB   6  
ATOM 9389  H HG1  . THR A 1 33  ? -8.517  -18.162 5.375   1.00 0.00 ? 33  THR A HG1  6  
ATOM 9390  H HG21 . THR A 1 33  ? -10.713 -18.945 2.467   1.00 0.00 ? 33  THR A HG21 6  
ATOM 9391  H HG22 . THR A 1 33  ? -9.219  -19.880 2.534   1.00 0.00 ? 33  THR A HG22 6  
ATOM 9392  H HG23 . THR A 1 33  ? -9.348  -18.500 1.445   1.00 0.00 ? 33  THR A HG23 6  
ATOM 9393  N N    . THR A 1 34  ? -6.383  -15.590 4.058   1.00 0.00 ? 34  THR A N    6  
ATOM 9394  C CA   . THR A 1 34  ? -6.076  -14.387 4.819   1.00 0.00 ? 34  THR A CA   6  
ATOM 9395  C C    . THR A 1 34  ? -4.830  -13.696 4.277   1.00 0.00 ? 34  THR A C    6  
ATOM 9396  O O    . THR A 1 34  ? -3.742  -14.273 4.270   1.00 0.00 ? 34  THR A O    6  
ATOM 9397  C CB   . THR A 1 34  ? -5.862  -14.706 6.312   1.00 0.00 ? 34  THR A CB   6  
ATOM 9398  O OG1  . THR A 1 34  ? -6.356  -16.017 6.607   1.00 0.00 ? 34  THR A OG1  6  
ATOM 9399  C CG2  . THR A 1 34  ? -6.567  -13.682 7.189   1.00 0.00 ? 34  THR A CG2  6  
ATOM 9400  H H    . THR A 1 34  ? -5.650  -16.113 3.669   1.00 0.00 ? 34  THR A H    6  
ATOM 9401  H HA   . THR A 1 34  ? -6.917  -13.713 4.733   1.00 0.00 ? 34  THR A HA   6  
ATOM 9402  H HB   . THR A 1 34  ? -4.804  -14.672 6.524   1.00 0.00 ? 34  THR A HB   6  
ATOM 9403  H HG1  . THR A 1 34  ? -7.313  -16.028 6.516   1.00 0.00 ? 34  THR A HG1  6  
ATOM 9404  H HG21 . THR A 1 34  ? -7.589  -13.568 6.859   1.00 0.00 ? 34  THR A HG21 6  
ATOM 9405  H HG22 . THR A 1 34  ? -6.057  -12.735 7.116   1.00 0.00 ? 34  THR A HG22 6  
ATOM 9406  H HG23 . THR A 1 34  ? -6.556  -14.021 8.214   1.00 0.00 ? 34  THR A HG23 6  
ATOM 9407  N N    . ILE A 1 35  ? -4.997  -12.459 3.821   1.00 0.00 ? 35  ILE A N    6  
ATOM 9408  C CA   . ILE A 1 35  ? -3.884  -11.690 3.278   1.00 0.00 ? 35  ILE A CA   6  
ATOM 9409  C C    . ILE A 1 35  ? -3.542  -10.506 4.178   1.00 0.00 ? 35  ILE A C    6  
ATOM 9410  O O    . ILE A 1 35  ? -4.243  -10.231 5.153   1.00 0.00 ? 35  ILE A O    6  
ATOM 9411  C CB   . ILE A 1 35  ? -4.197  -11.169 1.862   1.00 0.00 ? 35  ILE A CB   6  
ATOM 9412  C CG1  . ILE A 1 35  ? -5.384  -10.206 1.901   1.00 0.00 ? 35  ILE A CG1  6  
ATOM 9413  C CG2  . ILE A 1 35  ? -4.480  -12.332 0.923   1.00 0.00 ? 35  ILE A CG2  6  
ATOM 9414  C CD1  . ILE A 1 35  ? -5.639  -9.507  0.584   1.00 0.00 ? 35  ILE A CD1  6  
ATOM 9415  H H    . ILE A 1 35  ? -5.888  -12.054 3.853   1.00 0.00 ? 35  ILE A H    6  
ATOM 9416  H HA   . ILE A 1 35  ? -3.025  -12.343 3.218   1.00 0.00 ? 35  ILE A HA   6  
ATOM 9417  H HB   . ILE A 1 35  ? -3.328  -10.644 1.496   1.00 0.00 ? 35  ILE A HB   6  
ATOM 9418  H HG12 . ILE A 1 35  ? -6.276  -10.754 2.162   1.00 0.00 ? 35  ILE A HG12 6  
ATOM 9419  H HG13 . ILE A 1 35  ? -5.201  -9.448  2.649   1.00 0.00 ? 35  ILE A HG13 6  
ATOM 9420  H HG21 . ILE A 1 35  ? -5.261  -12.051 0.230   1.00 0.00 ? 35  ILE A HG21 6  
ATOM 9421  H HG22 . ILE A 1 35  ? -3.584  -12.575 0.373   1.00 0.00 ? 35  ILE A HG22 6  
ATOM 9422  H HG23 . ILE A 1 35  ? -4.797  -13.190 1.495   1.00 0.00 ? 35  ILE A HG23 6  
ATOM 9423  H HD11 . ILE A 1 35  ? -5.558  -8.439  0.720   1.00 0.00 ? 35  ILE A HD11 6  
ATOM 9424  H HD12 . ILE A 1 35  ? -4.912  -9.834  -0.145  1.00 0.00 ? 35  ILE A HD12 6  
ATOM 9425  H HD13 . ILE A 1 35  ? -6.633  -9.750  0.234   1.00 0.00 ? 35  ILE A HD13 6  
ATOM 9426  N N    . LEU A 1 36  ? -2.461  -9.810  3.844   1.00 0.00 ? 36  LEU A N    6  
ATOM 9427  C CA   . LEU A 1 36  ? -2.027  -8.653  4.622   1.00 0.00 ? 36  LEU A CA   6  
ATOM 9428  C C    . LEU A 1 36  ? -1.441  -7.577  3.714   1.00 0.00 ? 36  LEU A C    6  
ATOM 9429  O O    . LEU A 1 36  ? -0.483  -7.822  2.979   1.00 0.00 ? 36  LEU A O    6  
ATOM 9430  C CB   . LEU A 1 36  ? -0.992  -9.076  5.665   1.00 0.00 ? 36  LEU A CB   6  
ATOM 9431  C CG   . LEU A 1 36  ? -0.137  -7.953  6.255   1.00 0.00 ? 36  LEU A CG   6  
ATOM 9432  C CD1  . LEU A 1 36  ? -1.018  -6.823  6.764   1.00 0.00 ? 36  LEU A CD1  6  
ATOM 9433  C CD2  . LEU A 1 36  ? 0.746   -8.487  7.373   1.00 0.00 ? 36  LEU A CD2  6  
ATOM 9434  H H    . LEU A 1 36  ? -1.944  -10.077 3.058   1.00 0.00 ? 36  LEU A H    6  
ATOM 9435  H HA   . LEU A 1 36  ? -2.892  -8.250  5.126   1.00 0.00 ? 36  LEU A HA   6  
ATOM 9436  H HB2  . LEU A 1 36  ? -1.518  -9.553  6.477   1.00 0.00 ? 36  LEU A HB2  6  
ATOM 9437  H HB3  . LEU A 1 36  ? -0.327  -9.789  5.200   1.00 0.00 ? 36  LEU A HB3  6  
ATOM 9438  H HG   . LEU A 1 36  ? 0.505   -7.555  5.482   1.00 0.00 ? 36  LEU A HG   6  
ATOM 9439  H HD11 . LEU A 1 36  ? -0.751  -6.588  7.783   1.00 0.00 ? 36  LEU A HD11 6  
ATOM 9440  H HD12 . LEU A 1 36  ? -2.053  -7.127  6.724   1.00 0.00 ? 36  LEU A HD12 6  
ATOM 9441  H HD13 . LEU A 1 36  ? -0.877  -5.949  6.143   1.00 0.00 ? 36  LEU A HD13 6  
ATOM 9442  H HD21 . LEU A 1 36  ? 0.127   -8.833  8.187   1.00 0.00 ? 36  LEU A HD21 6  
ATOM 9443  H HD22 . LEU A 1 36  ? 1.397   -7.699  7.725   1.00 0.00 ? 36  LEU A HD22 6  
ATOM 9444  H HD23 . LEU A 1 36  ? 1.342   -9.308  7.001   1.00 0.00 ? 36  LEU A HD23 6  
ATOM 9445  N N    . VAL A 1 37  ? -2.021  -6.381  3.771   1.00 0.00 ? 37  VAL A N    6  
ATOM 9446  C CA   . VAL A 1 37  ? -1.554  -5.266  2.955   1.00 0.00 ? 37  VAL A CA   6  
ATOM 9447  C C    . VAL A 1 37  ? -0.878  -4.203  3.816   1.00 0.00 ? 37  VAL A C    6  
ATOM 9448  O O    . VAL A 1 37  ? -1.503  -3.616  4.697   1.00 0.00 ? 37  VAL A O    6  
ATOM 9449  C CB   . VAL A 1 37  ? -2.713  -4.618  2.174   1.00 0.00 ? 37  VAL A CB   6  
ATOM 9450  C CG1  . VAL A 1 37  ? -2.182  -3.585  1.191   1.00 0.00 ? 37  VAL A CG1  6  
ATOM 9451  C CG2  . VAL A 1 37  ? -3.530  -5.681  1.456   1.00 0.00 ? 37  VAL A CG2  6  
ATOM 9452  H H    . VAL A 1 37  ? -2.780  -6.248  4.375   1.00 0.00 ? 37  VAL A H    6  
ATOM 9453  H HA   . VAL A 1 37  ? -0.837  -5.650  2.244   1.00 0.00 ? 37  VAL A HA   6  
ATOM 9454  H HB   . VAL A 1 37  ? -3.357  -4.113  2.879   1.00 0.00 ? 37  VAL A HB   6  
ATOM 9455  H HG11 . VAL A 1 37  ? -1.237  -3.202  1.547   1.00 0.00 ? 37  VAL A HG11 6  
ATOM 9456  H HG12 . VAL A 1 37  ? -2.042  -4.048  0.224   1.00 0.00 ? 37  VAL A HG12 6  
ATOM 9457  H HG13 . VAL A 1 37  ? -2.890  -2.774  1.104   1.00 0.00 ? 37  VAL A HG13 6  
ATOM 9458  H HG21 . VAL A 1 37  ? -4.165  -5.209  0.721   1.00 0.00 ? 37  VAL A HG21 6  
ATOM 9459  H HG22 . VAL A 1 37  ? -2.865  -6.376  0.965   1.00 0.00 ? 37  VAL A HG22 6  
ATOM 9460  H HG23 . VAL A 1 37  ? -4.139  -6.212  2.173   1.00 0.00 ? 37  VAL A HG23 6  
ATOM 9461  N N    . GLN A 1 38  ? 0.402   -3.962  3.550   1.00 0.00 ? 38  GLN A N    6  
ATOM 9462  C CA   . GLN A 1 38  ? 1.163   -2.970  4.300   1.00 0.00 ? 38  GLN A CA   6  
ATOM 9463  C C    . GLN A 1 38  ? 1.821   -1.965  3.362   1.00 0.00 ? 38  GLN A C    6  
ATOM 9464  O O    . GLN A 1 38  ? 2.396   -2.340  2.340   1.00 0.00 ? 38  GLN A O    6  
ATOM 9465  C CB   . GLN A 1 38  ? 2.226   -3.655  5.160   1.00 0.00 ? 38  GLN A CB   6  
ATOM 9466  C CG   . GLN A 1 38  ? 3.131   -4.592  4.376   1.00 0.00 ? 38  GLN A CG   6  
ATOM 9467  C CD   . GLN A 1 38  ? 4.480   -4.792  5.040   1.00 0.00 ? 38  GLN A CD   6  
ATOM 9468  O OE1  . GLN A 1 38  ? 5.521   -4.734  4.384   1.00 0.00 ? 38  GLN A OE1  6  
ATOM 9469  N NE2  . GLN A 1 38  ? 4.468   -5.028  6.346   1.00 0.00 ? 38  GLN A NE2  6  
ATOM 9470  H H    . GLN A 1 38  ? 0.845   -4.463  2.834   1.00 0.00 ? 38  GLN A H    6  
ATOM 9471  H HA   . GLN A 1 38  ? 0.475   -2.444  4.945   1.00 0.00 ? 38  GLN A HA   6  
ATOM 9472  H HB2  . GLN A 1 38  ? 2.841   -2.898  5.623   1.00 0.00 ? 38  GLN A HB2  6  
ATOM 9473  H HB3  . GLN A 1 38  ? 1.733   -4.227  5.933   1.00 0.00 ? 38  GLN A HB3  6  
ATOM 9474  H HG2  . GLN A 1 38  ? 2.645   -5.553  4.291   1.00 0.00 ? 38  GLN A HG2  6  
ATOM 9475  H HG3  . GLN A 1 38  ? 3.288   -4.179  3.391   1.00 0.00 ? 38  GLN A HG3  6  
ATOM 9476  H HE21 . GLN A 1 38  ? 3.601   -5.060  6.803   1.00 0.00 ? 38  GLN A HE21 6  
ATOM 9477  H HE22 . GLN A 1 38  ? 5.325   -5.161  6.800   1.00 0.00 ? 38  GLN A HE22 6  
ATOM 9478  N N    . TRP A 1 39  ? 1.733   -0.688  3.714   1.00 0.00 ? 39  TRP A N    6  
ATOM 9479  C CA   . TRP A 1 39  ? 2.320   0.371   2.902   1.00 0.00 ? 39  TRP A CA   6  
ATOM 9480  C C    . TRP A 1 39  ? 2.808   1.520   3.776   1.00 0.00 ? 39  TRP A C    6  
ATOM 9481  O O    . TRP A 1 39  ? 2.618   1.513   4.993   1.00 0.00 ? 39  TRP A O    6  
ATOM 9482  C CB   . TRP A 1 39  ? 1.301   0.887   1.885   1.00 0.00 ? 39  TRP A CB   6  
ATOM 9483  C CG   . TRP A 1 39  ? 0.059   1.442   2.516   1.00 0.00 ? 39  TRP A CG   6  
ATOM 9484  C CD1  . TRP A 1 39  ? -0.158  2.735   2.897   1.00 0.00 ? 39  TRP A CD1  6  
ATOM 9485  C CD2  . TRP A 1 39  ? -1.132  0.719   2.843   1.00 0.00 ? 39  TRP A CD2  6  
ATOM 9486  N NE1  . TRP A 1 39  ? -1.415  2.860   3.440   1.00 0.00 ? 39  TRP A NE1  6  
ATOM 9487  C CE2  . TRP A 1 39  ? -2.032  1.638   3.418   1.00 0.00 ? 39  TRP A CE2  6  
ATOM 9488  C CE3  . TRP A 1 39  ? -1.528  -0.615  2.704   1.00 0.00 ? 39  TRP A CE3  6  
ATOM 9489  C CZ2  . TRP A 1 39  ? -3.301  1.264   3.852   1.00 0.00 ? 39  TRP A CZ2  6  
ATOM 9490  C CZ3  . TRP A 1 39  ? -2.787  -0.984  3.136   1.00 0.00 ? 39  TRP A CZ3  6  
ATOM 9491  C CH2  . TRP A 1 39  ? -3.662  -0.048  3.704   1.00 0.00 ? 39  TRP A CH2  6  
ATOM 9492  H H    . TRP A 1 39  ? 1.261   -0.452  4.541   1.00 0.00 ? 39  TRP A H    6  
ATOM 9493  H HA   . TRP A 1 39  ? 3.163   -0.047  2.372   1.00 0.00 ? 39  TRP A HA   6  
ATOM 9494  H HB2  . TRP A 1 39  ? 1.753   1.670   1.296   1.00 0.00 ? 39  TRP A HB2  6  
ATOM 9495  H HB3  . TRP A 1 39  ? 1.010   0.074   1.234   1.00 0.00 ? 39  TRP A HB3  6  
ATOM 9496  H HD1  . TRP A 1 39  ? 0.561   3.532   2.782   1.00 0.00 ? 39  TRP A HD1  6  
ATOM 9497  H HE1  . TRP A 1 39  ? -1.805  3.692   3.785   1.00 0.00 ? 39  TRP A HE1  6  
ATOM 9498  H HE3  . TRP A 1 39  ? -0.868  -1.350  2.269   1.00 0.00 ? 39  TRP A HE3  6  
ATOM 9499  H HZ2  . TRP A 1 39  ? -3.987  1.973   4.292   1.00 0.00 ? 39  TRP A HZ2  6  
ATOM 9500  H HZ3  . TRP A 1 39  ? -3.110  -2.011  3.038   1.00 0.00 ? 39  TRP A HZ3  6  
ATOM 9501  H HH2  . TRP A 1 39  ? -4.636  -0.381  4.029   1.00 0.00 ? 39  TRP A HH2  6  
ATOM 9502  N N    . LYS A 1 40  ? 3.440   2.508   3.151   1.00 0.00 ? 40  LYS A N    6  
ATOM 9503  C CA   . LYS A 1 40  ? 3.957   3.665   3.871   1.00 0.00 ? 40  LYS A CA   6  
ATOM 9504  C C    . LYS A 1 40  ? 3.262   4.944   3.414   1.00 0.00 ? 40  LYS A C    6  
ATOM 9505  O O    . LYS A 1 40  ? 2.672   4.989   2.335   1.00 0.00 ? 40  LYS A O    6  
ATOM 9506  C CB   . LYS A 1 40  ? 5.467   3.789   3.664   1.00 0.00 ? 40  LYS A CB   6  
ATOM 9507  C CG   . LYS A 1 40  ? 6.283   2.897   4.582   1.00 0.00 ? 40  LYS A CG   6  
ATOM 9508  C CD   . LYS A 1 40  ? 7.772   3.019   4.301   1.00 0.00 ? 40  LYS A CD   6  
ATOM 9509  C CE   . LYS A 1 40  ? 8.586   2.109   5.206   1.00 0.00 ? 40  LYS A CE   6  
ATOM 9510  N NZ   . LYS A 1 40  ? 9.986   2.593   5.364   1.00 0.00 ? 40  LYS A NZ   6  
ATOM 9511  H H    . LYS A 1 40  ? 3.562   2.457   2.178   1.00 0.00 ? 40  LYS A H    6  
ATOM 9512  H HA   . LYS A 1 40  ? 3.757   3.518   4.922   1.00 0.00 ? 40  LYS A HA   6  
ATOM 9513  H HB2  . LYS A 1 40  ? 5.701   3.530   2.642   1.00 0.00 ? 40  LYS A HB2  6  
ATOM 9514  H HB3  . LYS A 1 40  ? 5.760   4.816   3.840   1.00 0.00 ? 40  LYS A HB3  6  
ATOM 9515  H HG2  . LYS A 1 40  ? 6.097   3.185   5.606   1.00 0.00 ? 40  LYS A HG2  6  
ATOM 9516  H HG3  . LYS A 1 40  ? 5.981   1.870   4.433   1.00 0.00 ? 40  LYS A HG3  6  
ATOM 9517  H HD2  . LYS A 1 40  ? 7.958   2.745   3.273   1.00 0.00 ? 40  LYS A HD2  6  
ATOM 9518  H HD3  . LYS A 1 40  ? 8.077   4.043   4.464   1.00 0.00 ? 40  LYS A HD3  6  
ATOM 9519  H HE2  . LYS A 1 40  ? 8.116   2.075   6.178   1.00 0.00 ? 40  LYS A HE2  6  
ATOM 9520  H HE3  . LYS A 1 40  ? 8.603   1.118   4.779   1.00 0.00 ? 40  LYS A HE3  6  
ATOM 9521  H HZ1  . LYS A 1 40  ? 10.289  3.094   4.504   1.00 0.00 ? 40  LYS A HZ1  6  
ATOM 9522  H HZ2  . LYS A 1 40  ? 10.626  1.789   5.525   1.00 0.00 ? 40  LYS A HZ2  6  
ATOM 9523  H HZ3  . LYS A 1 40  ? 10.053  3.242   6.173   1.00 0.00 ? 40  LYS A HZ3  6  
ATOM 9524  N N    . GLU A 1 41  ? 3.339   5.983   4.241   1.00 0.00 ? 41  GLU A N    6  
ATOM 9525  C CA   . GLU A 1 41  ? 2.718   7.262   3.920   1.00 0.00 ? 41  GLU A CA   6  
ATOM 9526  C C    . GLU A 1 41  ? 3.317   7.853   2.646   1.00 0.00 ? 41  GLU A C    6  
ATOM 9527  O O    . GLU A 1 41  ? 4.415   7.493   2.221   1.00 0.00 ? 41  GLU A O    6  
ATOM 9528  C CB   . GLU A 1 41  ? 2.890   8.244   5.080   1.00 0.00 ? 41  GLU A CB   6  
ATOM 9529  C CG   . GLU A 1 41  ? 1.637   8.420   5.920   1.00 0.00 ? 41  GLU A CG   6  
ATOM 9530  C CD   . GLU A 1 41  ? 1.796   9.483   6.989   1.00 0.00 ? 41  GLU A CD   6  
ATOM 9531  O OE1  . GLU A 1 41  ? 2.828   10.186  6.978   1.00 0.00 ? 41  GLU A OE1  6  
ATOM 9532  O OE2  . GLU A 1 41  ? 0.888   9.614   7.836   1.00 0.00 ? 41  GLU A OE2  6  
ATOM 9533  H H    . GLU A 1 41  ? 3.824   5.885   5.087   1.00 0.00 ? 41  GLU A H    6  
ATOM 9534  H HA   . GLU A 1 41  ? 1.664   7.089   3.761   1.00 0.00 ? 41  GLU A HA   6  
ATOM 9535  H HB2  . GLU A 1 41  ? 3.683   7.888   5.722   1.00 0.00 ? 41  GLU A HB2  6  
ATOM 9536  H HB3  . GLU A 1 41  ? 3.169   9.209   4.681   1.00 0.00 ? 41  GLU A HB3  6  
ATOM 9537  H HG2  . GLU A 1 41  ? 0.821   8.701   5.271   1.00 0.00 ? 41  GLU A HG2  6  
ATOM 9538  H HG3  . GLU A 1 41  ? 1.406   7.481   6.400   1.00 0.00 ? 41  GLU A HG3  6  
ATOM 9539  N N    . PRO A 1 42  ? 2.579   8.782   2.021   1.00 0.00 ? 42  PRO A N    6  
ATOM 9540  C CA   . PRO A 1 42  ? 3.017   9.443   0.789   1.00 0.00 ? 42  PRO A CA   6  
ATOM 9541  C C    . PRO A 1 42  ? 4.188   10.389  1.022   1.00 0.00 ? 42  PRO A C    6  
ATOM 9542  O O    . PRO A 1 42  ? 4.575   10.643  2.162   1.00 0.00 ? 42  PRO A O    6  
ATOM 9543  C CB   . PRO A 1 42  ? 1.776   10.226  0.346   1.00 0.00 ? 42  PRO A CB   6  
ATOM 9544  C CG   . PRO A 1 42  ? 1.011   10.462  1.602   1.00 0.00 ? 42  PRO A CG   6  
ATOM 9545  C CD   . PRO A 1 42  ? 1.262   9.260   2.471   1.00 0.00 ? 42  PRO A CD   6  
ATOM 9546  H HA   . PRO A 1 42  ? 3.282   8.724   0.026   1.00 0.00 ? 42  PRO A HA   6  
ATOM 9547  H HB2  . PRO A 1 42  ? 2.080   11.155  -0.113  1.00 0.00 ? 42  PRO A HB2  6  
ATOM 9548  H HB3  . PRO A 1 42  ? 1.209   9.638   -0.359  1.00 0.00 ? 42  PRO A HB3  6  
ATOM 9549  H HG2  . PRO A 1 42  ? 1.366   11.357  2.087   1.00 0.00 ? 42  PRO A HG2  6  
ATOM 9550  H HG3  . PRO A 1 42  ? -0.042  10.548  1.377   1.00 0.00 ? 42  PRO A HG3  6  
ATOM 9551  H HD2  . PRO A 1 42  ? 1.291   9.548   3.512   1.00 0.00 ? 42  PRO A HD2  6  
ATOM 9552  H HD3  . PRO A 1 42  ? 0.502   8.510   2.307   1.00 0.00 ? 42  PRO A HD3  6  
ATOM 9553  N N    . GLU A 1 43  ? 4.749   10.911  -0.065  1.00 0.00 ? 43  GLU A N    6  
ATOM 9554  C CA   . GLU A 1 43  ? 5.878   11.829  0.023   1.00 0.00 ? 43  GLU A CA   6  
ATOM 9555  C C    . GLU A 1 43  ? 5.399   13.277  0.072   1.00 0.00 ? 43  GLU A C    6  
ATOM 9556  O O    . GLU A 1 43  ? 6.083   14.151  0.602   1.00 0.00 ? 43  GLU A O    6  
ATOM 9557  C CB   . GLU A 1 43  ? 6.819   11.632  -1.167  1.00 0.00 ? 43  GLU A CB   6  
ATOM 9558  C CG   . GLU A 1 43  ? 6.121   11.705  -2.515  1.00 0.00 ? 43  GLU A CG   6  
ATOM 9559  C CD   . GLU A 1 43  ? 6.946   12.425  -3.562  1.00 0.00 ? 43  GLU A CD   6  
ATOM 9560  O OE1  . GLU A 1 43  ? 8.064   11.955  -3.864  1.00 0.00 ? 43  GLU A OE1  6  
ATOM 9561  O OE2  . GLU A 1 43  ? 6.475   13.459  -4.080  1.00 0.00 ? 43  GLU A OE2  6  
ATOM 9562  H H    . GLU A 1 43  ? 4.396   10.671  -0.948  1.00 0.00 ? 43  GLU A H    6  
ATOM 9563  H HA   . GLU A 1 43  ? 6.414   11.609  0.934   1.00 0.00 ? 43  GLU A HA   6  
ATOM 9564  H HB2  . GLU A 1 43  ? 7.581   12.396  -1.138  1.00 0.00 ? 43  GLU A HB2  6  
ATOM 9565  H HB3  . GLU A 1 43  ? 7.290   10.664  -1.082  1.00 0.00 ? 43  GLU A HB3  6  
ATOM 9566  H HG2  . GLU A 1 43  ? 5.926   10.700  -2.859  1.00 0.00 ? 43  GLU A HG2  6  
ATOM 9567  H HG3  . GLU A 1 43  ? 5.183   12.229  -2.392  1.00 0.00 ? 43  GLU A HG3  6  
ATOM 9568  N N    . GLU A 1 44  ? 4.216   13.522  -0.485  1.00 0.00 ? 44  GLU A N    6  
ATOM 9569  C CA   . GLU A 1 44  ? 3.646   14.864  -0.507  1.00 0.00 ? 44  GLU A CA   6  
ATOM 9570  C C    . GLU A 1 44  ? 2.258   14.875  0.127   1.00 0.00 ? 44  GLU A C    6  
ATOM 9571  O O    . GLU A 1 44  ? 1.238   14.985  -0.554  1.00 0.00 ? 44  GLU A O    6  
ATOM 9572  C CB   . GLU A 1 44  ? 3.567   15.385  -1.942  1.00 0.00 ? 44  GLU A CB   6  
ATOM 9573  C CG   . GLU A 1 44  ? 4.912   15.807  -2.512  1.00 0.00 ? 44  GLU A CG   6  
ATOM 9574  C CD   . GLU A 1 44  ? 4.918   15.842  -4.027  1.00 0.00 ? 44  GLU A CD   6  
ATOM 9575  O OE1  . GLU A 1 44  ? 4.168   15.057  -4.643  1.00 0.00 ? 44  GLU A OE1  6  
ATOM 9576  O OE2  . GLU A 1 44  ? 5.675   16.656  -4.598  1.00 0.00 ? 44  GLU A OE2  6  
ATOM 9577  H H    . GLU A 1 44  ? 3.717   12.783  -0.892  1.00 0.00 ? 44  GLU A H    6  
ATOM 9578  H HA   . GLU A 1 44  ? 4.295   15.509  0.067   1.00 0.00 ? 44  GLU A HA   6  
ATOM 9579  H HB2  . GLU A 1 44  ? 3.159   14.610  -2.573  1.00 0.00 ? 44  GLU A HB2  6  
ATOM 9580  H HB3  . GLU A 1 44  ? 2.908   16.241  -1.966  1.00 0.00 ? 44  GLU A HB3  6  
ATOM 9581  H HG2  . GLU A 1 44  ? 5.153   16.793  -2.143  1.00 0.00 ? 44  GLU A HG2  6  
ATOM 9582  H HG3  . GLU A 1 44  ? 5.664   15.107  -2.179  1.00 0.00 ? 44  GLU A HG3  6  
ATOM 9583  N N    . PRO A 1 45  ? 2.217   14.756  1.463   1.00 0.00 ? 45  PRO A N    6  
ATOM 9584  C CA   . PRO A 1 45  ? 0.960   14.750  2.218   1.00 0.00 ? 45  PRO A CA   6  
ATOM 9585  C C    . PRO A 1 45  ? 0.192   16.060  2.077   1.00 0.00 ? 45  PRO A C    6  
ATOM 9586  O O    . PRO A 1 45  ? -0.984  16.065  1.716   1.00 0.00 ? 45  PRO A O    6  
ATOM 9587  C CB   . PRO A 1 45  ? 1.417   14.551  3.665   1.00 0.00 ? 45  PRO A CB   6  
ATOM 9588  C CG   . PRO A 1 45  ? 2.849   14.968  3.671   1.00 0.00 ? 45  PRO A CG   6  
ATOM 9589  C CD   . PRO A 1 45  ? 3.393   14.621  2.338   1.00 0.00 ? 45  PRO A CD   6  
ATOM 9590  H HA   . PRO A 1 45  ? 0.325   13.929  1.923   1.00 0.00 ? 45  PRO A HA   6  
ATOM 9591  H HB2  . PRO A 1 45  ? 0.822   15.170  4.322   1.00 0.00 ? 45  PRO A HB2  6  
ATOM 9592  H HB3  . PRO A 1 45  ? 1.307   13.514  3.942   1.00 0.00 ? 45  PRO A HB3  6  
ATOM 9593  H HG2  . PRO A 1 45  ? 2.921   16.027  3.869   1.00 0.00 ? 45  PRO A HG2  6  
ATOM 9594  H HG3  . PRO A 1 45  ? 3.390   14.408  4.418   1.00 0.00 ? 45  PRO A HG3  6  
ATOM 9595  H HD2  . PRO A 1 45  ? 4.135   15.370  2.105   1.00 0.00 ? 45  PRO A HD2  6  
ATOM 9596  H HD3  . PRO A 1 45  ? 3.817   13.630  2.261   1.00 0.00 ? 45  PRO A HD3  6  
ATOM 9597  N N    . ASN A 1 46  ? 0.866   17.169  2.365   1.00 0.00 ? 46  ASN A N    6  
ATOM 9598  C CA   . ASN A 1 46  ? 0.246   18.486  2.269   1.00 0.00 ? 46  ASN A CA   6  
ATOM 9599  C C    . ASN A 1 46  ? -0.903  18.619  3.265   1.00 0.00 ? 46  ASN A C    6  
ATOM 9600  O O    . ASN A 1 46  ? -1.822  19.410  3.064   1.00 0.00 ? 46  ASN A O    6  
ATOM 9601  C CB   . ASN A 1 46  ? -0.264  18.731  0.848   1.00 0.00 ? 46  ASN A CB   6  
ATOM 9602  C CG   . ASN A 1 46  ? 0.708   18.243  -0.207  1.00 0.00 ? 46  ASN A CG   6  
ATOM 9603  O OD1  . ASN A 1 46  ? 1.896   18.565  -0.171  1.00 0.00 ? 46  ASN A OD1  6  
ATOM 9604  N ND2  . ASN A 1 46  ? 0.206   17.462  -1.158  1.00 0.00 ? 46  ASN A ND2  6  
ATOM 9605  H H    . ASN A 1 46  ? 1.802   17.101  2.646   1.00 0.00 ? 46  ASN A H    6  
ATOM 9606  H HA   . ASN A 1 46  ? 0.998   19.224  2.505   1.00 0.00 ? 46  ASN A HA   6  
ATOM 9607  H HB2  . ASN A 1 46  ? -1.202  18.211  0.715   1.00 0.00 ? 46  ASN A HB2  6  
ATOM 9608  H HB3  . ASN A 1 46  ? -0.421  19.790  0.705   1.00 0.00 ? 46  ASN A HB3  6  
ATOM 9609  H HD21 . ASN A 1 46  ? -0.749  17.246  -1.123  1.00 0.00 ? 46  ASN A HD21 6  
ATOM 9610  H HD22 . ASN A 1 46  ? 0.813   17.131  -1.853  1.00 0.00 ? 46  ASN A HD22 6  
ATOM 9611  N N    . GLY A 1 47  ? -0.840  17.839  4.340   1.00 0.00 ? 47  GLY A N    6  
ATOM 9612  C CA   . GLY A 1 47  ? -1.881  17.886  5.351   1.00 0.00 ? 47  GLY A CA   6  
ATOM 9613  C C    . GLY A 1 47  ? -1.951  16.613  6.169   1.00 0.00 ? 47  GLY A C    6  
ATOM 9614  O O    . GLY A 1 47  ? -1.318  15.614  5.829   1.00 0.00 ? 47  GLY A O    6  
ATOM 9615  H H    . GLY A 1 47  ? -0.082  17.228  4.448   1.00 0.00 ? 47  GLY A H    6  
ATOM 9616  H HA2  . GLY A 1 47  ? -1.687  18.717  6.013   1.00 0.00 ? 47  GLY A HA2  6  
ATOM 9617  H HA3  . GLY A 1 47  ? -2.832  18.040  4.864   1.00 0.00 ? 47  GLY A HA3  6  
ATOM 9618  N N    . GLN A 1 48  ? -2.722  16.647  7.251   1.00 0.00 ? 48  GLN A N    6  
ATOM 9619  C CA   . GLN A 1 48  ? -2.869  15.487  8.121   1.00 0.00 ? 48  GLN A CA   6  
ATOM 9620  C C    . GLN A 1 48  ? -3.675  14.390  7.434   1.00 0.00 ? 48  GLN A C    6  
ATOM 9621  O O    . GLN A 1 48  ? -4.771  14.635  6.930   1.00 0.00 ? 48  GLN A O    6  
ATOM 9622  C CB   . GLN A 1 48  ? -3.547  15.889  9.432   1.00 0.00 ? 48  GLN A CB   6  
ATOM 9623  C CG   . GLN A 1 48  ? -2.647  15.757  10.649  1.00 0.00 ? 48  GLN A CG   6  
ATOM 9624  C CD   . GLN A 1 48  ? -3.288  16.299  11.912  1.00 0.00 ? 48  GLN A CD   6  
ATOM 9625  O OE1  . GLN A 1 48  ? -2.831  17.293  12.476  1.00 0.00 ? 48  GLN A OE1  6  
ATOM 9626  N NE2  . GLN A 1 48  ? -4.353  15.646  12.363  1.00 0.00 ? 48  GLN A NE2  6  
ATOM 9627  H H    . GLN A 1 48  ? -3.201  17.473  7.470   1.00 0.00 ? 48  GLN A H    6  
ATOM 9628  H HA   . GLN A 1 48  ? -1.883  15.109  8.340   1.00 0.00 ? 48  GLN A HA   6  
ATOM 9629  H HB2  . GLN A 1 48  ? -3.867  16.918  9.357   1.00 0.00 ? 48  GLN A HB2  6  
ATOM 9630  H HB3  . GLN A 1 48  ? -4.414  15.261  9.582   1.00 0.00 ? 48  GLN A HB3  6  
ATOM 9631  H HG2  . GLN A 1 48  ? -2.419  14.711  10.801  1.00 0.00 ? 48  GLN A HG2  6  
ATOM 9632  H HG3  . GLN A 1 48  ? -1.732  16.300  10.466  1.00 0.00 ? 48  GLN A HG3  6  
ATOM 9633  H HE21 . GLN A 1 48  ? -4.660  14.860  11.864  1.00 0.00 ? 48  GLN A HE21 6  
ATOM 9634  H HE22 . GLN A 1 48  ? -4.786  15.974  13.178  1.00 0.00 ? 48  GLN A HE22 6  
ATOM 9635  N N    . ILE A 1 49  ? -3.124  13.181  7.416   1.00 0.00 ? 49  ILE A N    6  
ATOM 9636  C CA   . ILE A 1 49  ? -3.793  12.047  6.791   1.00 0.00 ? 49  ILE A CA   6  
ATOM 9637  C C    . ILE A 1 49  ? -4.853  11.455  7.715   1.00 0.00 ? 49  ILE A C    6  
ATOM 9638  O O    . ILE A 1 49  ? -4.581  11.165  8.879   1.00 0.00 ? 49  ILE A O    6  
ATOM 9639  C CB   . ILE A 1 49  ? -2.789  10.943  6.407   1.00 0.00 ? 49  ILE A CB   6  
ATOM 9640  C CG1  . ILE A 1 49  ? -1.734  11.495  5.445   1.00 0.00 ? 49  ILE A CG1  6  
ATOM 9641  C CG2  . ILE A 1 49  ? -3.514  9.761   5.783   1.00 0.00 ? 49  ILE A CG2  6  
ATOM 9642  C CD1  . ILE A 1 49  ? -2.302  11.940  4.116   1.00 0.00 ? 49  ILE A CD1  6  
ATOM 9643  H H    . ILE A 1 49  ? -2.249  13.048  7.835   1.00 0.00 ? 49  ILE A H    6  
ATOM 9644  H HA   . ILE A 1 49  ? -4.272  12.398  5.889   1.00 0.00 ? 49  ILE A HA   6  
ATOM 9645  H HB   . ILE A 1 49  ? -2.302  10.601  7.307   1.00 0.00 ? 49  ILE A HB   6  
ATOM 9646  H HG12 . ILE A 1 49  ? -1.252  12.346  5.900   1.00 0.00 ? 49  ILE A HG12 6  
ATOM 9647  H HG13 . ILE A 1 49  ? -0.998  10.728  5.254   1.00 0.00 ? 49  ILE A HG13 6  
ATOM 9648  H HG21 . ILE A 1 49  ? -3.777  9.052   6.555   1.00 0.00 ? 49  ILE A HG21 6  
ATOM 9649  H HG22 . ILE A 1 49  ? -4.413  10.108  5.294   1.00 0.00 ? 49  ILE A HG22 6  
ATOM 9650  H HG23 . ILE A 1 49  ? -2.871  9.283   5.060   1.00 0.00 ? 49  ILE A HG23 6  
ATOM 9651  H HD11 . ILE A 1 49  ? -2.067  12.981  3.953   1.00 0.00 ? 49  ILE A HD11 6  
ATOM 9652  H HD12 . ILE A 1 49  ? -1.874  11.344  3.323   1.00 0.00 ? 49  ILE A HD12 6  
ATOM 9653  H HD13 . ILE A 1 49  ? -3.375  11.811  4.122   1.00 0.00 ? 49  ILE A HD13 6  
ATOM 9654  N N    . GLN A 1 50  ? -6.059  11.279  7.185   1.00 0.00 ? 50  GLN A N    6  
ATOM 9655  C CA   . GLN A 1 50  ? -7.159  10.720  7.963   1.00 0.00 ? 50  GLN A CA   6  
ATOM 9656  C C    . GLN A 1 50  ? -7.229  9.205   7.797   1.00 0.00 ? 50  GLN A C    6  
ATOM 9657  O O    . GLN A 1 50  ? -7.728  8.497   8.670   1.00 0.00 ? 50  GLN A O    6  
ATOM 9658  C CB   . GLN A 1 50  ? -8.485  11.353  7.538   1.00 0.00 ? 50  GLN A CB   6  
ATOM 9659  C CG   . GLN A 1 50  ? -8.627  12.807  7.956   1.00 0.00 ? 50  GLN A CG   6  
ATOM 9660  C CD   . GLN A 1 50  ? -8.932  12.963  9.432   1.00 0.00 ? 50  GLN A CD   6  
ATOM 9661  O OE1  . GLN A 1 50  ? -9.308  12.002  10.105  1.00 0.00 ? 50  GLN A OE1  6  
ATOM 9662  N NE2  . GLN A 1 50  ? -8.772  14.177  9.946   1.00 0.00 ? 50  GLN A NE2  6  
ATOM 9663  H H    . GLN A 1 50  ? -6.212  11.529  6.251   1.00 0.00 ? 50  GLN A H    6  
ATOM 9664  H HA   . GLN A 1 50  ? -6.979  10.948  9.002   1.00 0.00 ? 50  GLN A HA   6  
ATOM 9665  H HB2  . GLN A 1 50  ? -8.567  11.301  6.462   1.00 0.00 ? 50  GLN A HB2  6  
ATOM 9666  H HB3  . GLN A 1 50  ? -9.295  10.794  7.980   1.00 0.00 ? 50  GLN A HB3  6  
ATOM 9667  H HG2  . GLN A 1 50  ? -7.702  13.322  7.740   1.00 0.00 ? 50  GLN A HG2  6  
ATOM 9668  H HG3  . GLN A 1 50  ? -9.428  13.256  7.388   1.00 0.00 ? 50  GLN A HG3  6  
ATOM 9669  H HE21 . GLN A 1 50  ? -8.471  14.895  9.351   1.00 0.00 ? 50  GLN A HE21 6  
ATOM 9670  H HE22 . GLN A 1 50  ? -8.963  14.306  10.898  1.00 0.00 ? 50  GLN A HE22 6  
ATOM 9671  N N    . GLY A 1 51  ? -6.725  8.714   6.669   1.00 0.00 ? 51  GLY A N    6  
ATOM 9672  C CA   . GLY A 1 51  ? -6.741  7.286   6.408   1.00 0.00 ? 51  GLY A CA   6  
ATOM 9673  C C    . GLY A 1 51  ? -6.333  6.951   4.987   1.00 0.00 ? 51  GLY A C    6  
ATOM 9674  O O    . GLY A 1 51  ? -5.707  7.763   4.306   1.00 0.00 ? 51  GLY A O    6  
ATOM 9675  H H    . GLY A 1 51  ? -6.339  9.327   6.007   1.00 0.00 ? 51  GLY A H    6  
ATOM 9676  H HA2  . GLY A 1 51  ? -6.061  6.800   7.091   1.00 0.00 ? 51  GLY A HA2  6  
ATOM 9677  H HA3  . GLY A 1 51  ? -7.739  6.912   6.582   1.00 0.00 ? 51  GLY A HA3  6  
ATOM 9678  N N    . TYR A 1 52  ? -6.687  5.752   4.540   1.00 0.00 ? 52  TYR A N    6  
ATOM 9679  C CA   . TYR A 1 52  ? -6.350  5.310   3.192   1.00 0.00 ? 52  TYR A CA   6  
ATOM 9680  C C    . TYR A 1 52  ? -7.446  4.414   2.622   1.00 0.00 ? 52  TYR A C    6  
ATOM 9681  O O    . TYR A 1 52  ? -8.015  3.583   3.331   1.00 0.00 ? 52  TYR A O    6  
ATOM 9682  C CB   . TYR A 1 52  ? -5.016  4.563   3.196   1.00 0.00 ? 52  TYR A CB   6  
ATOM 9683  C CG   . TYR A 1 52  ? -3.935  5.258   3.993   1.00 0.00 ? 52  TYR A CG   6  
ATOM 9684  C CD1  . TYR A 1 52  ? -3.178  6.279   3.434   1.00 0.00 ? 52  TYR A CD1  6  
ATOM 9685  C CD2  . TYR A 1 52  ? -3.672  4.893   5.308   1.00 0.00 ? 52  TYR A CD2  6  
ATOM 9686  C CE1  . TYR A 1 52  ? -2.190  6.916   4.159   1.00 0.00 ? 52  TYR A CE1  6  
ATOM 9687  C CE2  . TYR A 1 52  ? -2.686  5.525   6.041   1.00 0.00 ? 52  TYR A CE2  6  
ATOM 9688  C CZ   . TYR A 1 52  ? -1.948  6.535   5.462   1.00 0.00 ? 52  TYR A CZ   6  
ATOM 9689  O OH   . TYR A 1 52  ? -0.965  7.169   6.189   1.00 0.00 ? 52  TYR A OH   6  
ATOM 9690  H H    . TYR A 1 52  ? -7.186  5.150   5.129   1.00 0.00 ? 52  TYR A H    6  
ATOM 9691  H HA   . TYR A 1 52  ? -6.258  6.187   2.567   1.00 0.00 ? 52  TYR A HA   6  
ATOM 9692  H HB2  . TYR A 1 52  ? -5.162  3.581   3.620   1.00 0.00 ? 52  TYR A HB2  6  
ATOM 9693  H HB3  . TYR A 1 52  ? -4.664  4.461   2.179   1.00 0.00 ? 52  TYR A HB3  6  
ATOM 9694  H HD1  . TYR A 1 52  ? -3.372  6.576   2.413   1.00 0.00 ? 52  TYR A HD1  6  
ATOM 9695  H HD2  . TYR A 1 52  ? -4.252  4.101   5.760   1.00 0.00 ? 52  TYR A HD2  6  
ATOM 9696  H HE1  . TYR A 1 52  ? -1.612  7.709   3.705   1.00 0.00 ? 52  TYR A HE1  6  
ATOM 9697  H HE2  . TYR A 1 52  ? -2.496  5.227   7.062   1.00 0.00 ? 52  TYR A HE2  6  
ATOM 9698  H HH   . TYR A 1 52  ? -1.093  6.990   7.123   1.00 0.00 ? 52  TYR A HH   6  
ATOM 9699  N N    . ARG A 1 53  ? -7.735  4.589   1.337   1.00 0.00 ? 53  ARG A N    6  
ATOM 9700  C CA   . ARG A 1 53  ? -8.763  3.796   0.672   1.00 0.00 ? 53  ARG A CA   6  
ATOM 9701  C C    . ARG A 1 53  ? -8.148  2.596   -0.042  1.00 0.00 ? 53  ARG A C    6  
ATOM 9702  O O    . ARG A 1 53  ? -7.168  2.731   -0.774  1.00 0.00 ? 53  ARG A O    6  
ATOM 9703  C CB   . ARG A 1 53  ? -9.532  4.659   -0.331  1.00 0.00 ? 53  ARG A CB   6  
ATOM 9704  C CG   . ARG A 1 53  ? -10.591 5.541   0.311   1.00 0.00 ? 53  ARG A CG   6  
ATOM 9705  C CD   . ARG A 1 53  ? -10.643 6.914   -0.341  1.00 0.00 ? 53  ARG A CD   6  
ATOM 9706  N NE   . ARG A 1 53  ? -12.015 7.357   -0.577  1.00 0.00 ? 53  ARG A NE   6  
ATOM 9707  C CZ   . ARG A 1 53  ? -12.333 8.374   -1.368  1.00 0.00 ? 53  ARG A CZ   6  
ATOM 9708  N NH1  . ARG A 1 53  ? -11.383 9.050   -1.998  1.00 0.00 ? 53  ARG A NH1  6  
ATOM 9709  N NH2  . ARG A 1 53  ? -13.604 8.716   -1.531  1.00 0.00 ? 53  ARG A NH2  6  
ATOM 9710  H H    . ARG A 1 53  ? -7.248  5.266   0.824   1.00 0.00 ? 53  ARG A H    6  
ATOM 9711  H HA   . ARG A 1 53  ? -9.448  3.439   1.426   1.00 0.00 ? 53  ARG A HA   6  
ATOM 9712  H HB2  . ARG A 1 53  ? -8.833  5.295   -0.852  1.00 0.00 ? 53  ARG A HB2  6  
ATOM 9713  H HB3  . ARG A 1 53  ? -10.020 4.012   -1.045  1.00 0.00 ? 53  ARG A HB3  6  
ATOM 9714  H HG2  . ARG A 1 53  ? -11.555 5.067   0.204   1.00 0.00 ? 53  ARG A HG2  6  
ATOM 9715  H HG3  . ARG A 1 53  ? -10.361 5.659   1.359   1.00 0.00 ? 53  ARG A HG3  6  
ATOM 9716  H HD2  . ARG A 1 53  ? -10.152 7.623   0.305   1.00 0.00 ? 53  ARG A HD2  6  
ATOM 9717  H HD3  . ARG A 1 53  ? -10.122 6.868   -1.287  1.00 0.00 ? 53  ARG A HD3  6  
ATOM 9718  H HE   . ARG A 1 53  ? -12.733 6.870   -0.121  1.00 0.00 ? 53  ARG A HE   6  
ATOM 9719  H HH11 . ARG A 1 53  ? -10.424 8.793   -1.880  1.00 0.00 ? 53  ARG A HH11 6  
ATOM 9720  H HH12 . ARG A 1 53  ? -11.625 9.815   -2.596  1.00 0.00 ? 53  ARG A HH12 6  
ATOM 9721  H HH21 . ARG A 1 53  ? -14.323 8.209   -1.059  1.00 0.00 ? 53  ARG A HH21 6  
ATOM 9722  H HH22 . ARG A 1 53  ? -13.843 9.482   -2.128  1.00 0.00 ? 53  ARG A HH22 6  
ATOM 9723  N N    . VAL A 1 54  ? -8.729  1.422   0.178   1.00 0.00 ? 54  VAL A N    6  
ATOM 9724  C CA   . VAL A 1 54  ? -8.239  0.197   -0.443  1.00 0.00 ? 54  VAL A CA   6  
ATOM 9725  C C    . VAL A 1 54  ? -9.276  -0.391  -1.393  1.00 0.00 ? 54  VAL A C    6  
ATOM 9726  O O    . VAL A 1 54  ? -10.480 -0.297  -1.150  1.00 0.00 ? 54  VAL A O    6  
ATOM 9727  C CB   . VAL A 1 54  ? -7.871  -0.861  0.614   1.00 0.00 ? 54  VAL A CB   6  
ATOM 9728  C CG1  . VAL A 1 54  ? -7.258  -2.087  -0.047  1.00 0.00 ? 54  VAL A CG1  6  
ATOM 9729  C CG2  . VAL A 1 54  ? -6.921  -0.272  1.647   1.00 0.00 ? 54  VAL A CG2  6  
ATOM 9730  H H    . VAL A 1 54  ? -9.507  1.377   0.771   1.00 0.00 ? 54  VAL A H    6  
ATOM 9731  H HA   . VAL A 1 54  ? -7.349  0.441   -1.004  1.00 0.00 ? 54  VAL A HA   6  
ATOM 9732  H HB   . VAL A 1 54  ? -8.775  -1.166  1.120   1.00 0.00 ? 54  VAL A HB   6  
ATOM 9733  H HG11 . VAL A 1 54  ? -6.450  -1.780  -0.693  1.00 0.00 ? 54  VAL A HG11 6  
ATOM 9734  H HG12 . VAL A 1 54  ? -6.881  -2.754  0.713   1.00 0.00 ? 54  VAL A HG12 6  
ATOM 9735  H HG13 . VAL A 1 54  ? -8.013  -2.594  -0.630  1.00 0.00 ? 54  VAL A HG13 6  
ATOM 9736  H HG21 . VAL A 1 54  ? -6.052  0.130   1.148   1.00 0.00 ? 54  VAL A HG21 6  
ATOM 9737  H HG22 . VAL A 1 54  ? -7.421  0.517   2.189   1.00 0.00 ? 54  VAL A HG22 6  
ATOM 9738  H HG23 . VAL A 1 54  ? -6.617  -1.044  2.338   1.00 0.00 ? 54  VAL A HG23 6  
ATOM 9739  N N    . TYR A 1 55  ? -8.802  -0.997  -2.476  1.00 0.00 ? 55  TYR A N    6  
ATOM 9740  C CA   . TYR A 1 55  ? -9.688  -1.598  -3.465  1.00 0.00 ? 55  TYR A CA   6  
ATOM 9741  C C    . TYR A 1 55  ? -9.226  -3.008  -3.826  1.00 0.00 ? 55  TYR A C    6  
ATOM 9742  O O    . TYR A 1 55  ? -8.103  -3.206  -4.285  1.00 0.00 ? 55  TYR A O    6  
ATOM 9743  C CB   . TYR A 1 55  ? -9.745  -0.733  -4.724  1.00 0.00 ? 55  TYR A CB   6  
ATOM 9744  C CG   . TYR A 1 55  ? -9.980  0.735   -4.440  1.00 0.00 ? 55  TYR A CG   6  
ATOM 9745  C CD1  . TYR A 1 55  ? -8.925  1.574   -4.101  1.00 0.00 ? 55  TYR A CD1  6  
ATOM 9746  C CD2  . TYR A 1 55  ? -11.255 1.281   -4.508  1.00 0.00 ? 55  TYR A CD2  6  
ATOM 9747  C CE1  . TYR A 1 55  ? -9.135  2.914   -3.840  1.00 0.00 ? 55  TYR A CE1  6  
ATOM 9748  C CE2  . TYR A 1 55  ? -11.473 2.620   -4.249  1.00 0.00 ? 55  TYR A CE2  6  
ATOM 9749  C CZ   . TYR A 1 55  ? -10.410 3.433   -3.916  1.00 0.00 ? 55  TYR A CZ   6  
ATOM 9750  O OH   . TYR A 1 55  ? -10.624 4.767   -3.657  1.00 0.00 ? 55  TYR A OH   6  
ATOM 9751  H H    . TYR A 1 55  ? -7.832  -1.039  -2.615  1.00 0.00 ? 55  TYR A H    6  
ATOM 9752  H HA   . TYR A 1 55  ? -10.677 -1.655  -3.034  1.00 0.00 ? 55  TYR A HA   6  
ATOM 9753  H HB2  . TYR A 1 55  ? -8.811  -0.820  -5.256  1.00 0.00 ? 55  TYR A HB2  6  
ATOM 9754  H HB3  . TYR A 1 55  ? -10.550 -1.081  -5.357  1.00 0.00 ? 55  TYR A HB3  6  
ATOM 9755  H HD1  . TYR A 1 55  ? -7.926  1.165   -4.043  1.00 0.00 ? 55  TYR A HD1  6  
ATOM 9756  H HD2  . TYR A 1 55  ? -12.086 0.641   -4.769  1.00 0.00 ? 55  TYR A HD2  6  
ATOM 9757  H HE1  . TYR A 1 55  ? -8.301  3.551   -3.579  1.00 0.00 ? 55  TYR A HE1  6  
ATOM 9758  H HE2  . TYR A 1 55  ? -12.472 3.026   -4.308  1.00 0.00 ? 55  TYR A HE2  6  
ATOM 9759  H HH   . TYR A 1 55  ? -11.190 5.139   -4.336  1.00 0.00 ? 55  TYR A HH   6  
ATOM 9760  N N    . TYR A 1 56  ? -10.103 -3.983  -3.611  1.00 0.00 ? 56  TYR A N    6  
ATOM 9761  C CA   . TYR A 1 56  ? -9.787  -5.373  -3.911  1.00 0.00 ? 56  TYR A CA   6  
ATOM 9762  C C    . TYR A 1 56  ? -11.044 -6.147  -4.298  1.00 0.00 ? 56  TYR A C    6  
ATOM 9763  O O    . TYR A 1 56  ? -12.057 -6.099  -3.599  1.00 0.00 ? 56  TYR A O    6  
ATOM 9764  C CB   . TYR A 1 56  ? -9.117  -6.037  -2.706  1.00 0.00 ? 56  TYR A CB   6  
ATOM 9765  C CG   . TYR A 1 56  ? -10.046 -6.236  -1.530  1.00 0.00 ? 56  TYR A CG   6  
ATOM 9766  C CD1  . TYR A 1 56  ? -10.263 -5.216  -0.610  1.00 0.00 ? 56  TYR A CD1  6  
ATOM 9767  C CD2  . TYR A 1 56  ? -10.707 -7.443  -1.338  1.00 0.00 ? 56  TYR A CD2  6  
ATOM 9768  C CE1  . TYR A 1 56  ? -11.111 -5.394  0.466   1.00 0.00 ? 56  TYR A CE1  6  
ATOM 9769  C CE2  . TYR A 1 56  ? -11.557 -7.628  -0.264  1.00 0.00 ? 56  TYR A CE2  6  
ATOM 9770  C CZ   . TYR A 1 56  ? -11.755 -6.602  0.634   1.00 0.00 ? 56  TYR A CZ   6  
ATOM 9771  O OH   . TYR A 1 56  ? -12.600 -6.784  1.705   1.00 0.00 ? 56  TYR A OH   6  
ATOM 9772  H H    . TYR A 1 56  ? -10.984 -3.761  -3.242  1.00 0.00 ? 56  TYR A H    6  
ATOM 9773  H HA   . TYR A 1 56  ? -9.100  -5.386  -4.744  1.00 0.00 ? 56  TYR A HA   6  
ATOM 9774  H HB2  . TYR A 1 56  ? -8.741  -7.006  -2.999  1.00 0.00 ? 56  TYR A HB2  6  
ATOM 9775  H HB3  . TYR A 1 56  ? -8.292  -5.421  -2.377  1.00 0.00 ? 56  TYR A HB3  6  
ATOM 9776  H HD1  . TYR A 1 56  ? -9.756  -4.272  -0.745  1.00 0.00 ? 56  TYR A HD1  6  
ATOM 9777  H HD2  . TYR A 1 56  ? -10.549 -8.246  -2.043  1.00 0.00 ? 56  TYR A HD2  6  
ATOM 9778  H HE1  . TYR A 1 56  ? -11.266 -4.590  1.171   1.00 0.00 ? 56  TYR A HE1  6  
ATOM 9779  H HE2  . TYR A 1 56  ? -12.062 -8.574  -0.132  1.00 0.00 ? 56  TYR A HE2  6  
ATOM 9780  H HH   . TYR A 1 56  ? -13.171 -7.537  1.537   1.00 0.00 ? 56  TYR A HH   6  
ATOM 9781  N N    . THR A 1 57  ? -10.970 -6.863  -5.415  1.00 0.00 ? 57  THR A N    6  
ATOM 9782  C CA   . THR A 1 57  ? -12.100 -7.647  -5.898  1.00 0.00 ? 57  THR A CA   6  
ATOM 9783  C C    . THR A 1 57  ? -11.646 -8.718  -6.883  1.00 0.00 ? 57  THR A C    6  
ATOM 9784  O O    . THR A 1 57  ? -10.542 -8.651  -7.422  1.00 0.00 ? 57  THR A O    6  
ATOM 9785  C CB   . THR A 1 57  ? -13.154 -6.754  -6.577  1.00 0.00 ? 57  THR A CB   6  
ATOM 9786  O OG1  . THR A 1 57  ? -14.341 -7.512  -6.843  1.00 0.00 ? 57  THR A OG1  6  
ATOM 9787  C CG2  . THR A 1 57  ? -12.616 -6.174  -7.877  1.00 0.00 ? 57  THR A CG2  6  
ATOM 9788  H H    . THR A 1 57  ? -10.135 -6.861  -5.928  1.00 0.00 ? 57  THR A H    6  
ATOM 9789  H HA   . THR A 1 57  ? -12.561 -8.126  -5.046  1.00 0.00 ? 57  THR A HA   6  
ATOM 9790  H HB   . THR A 1 57  ? -13.398 -5.939  -5.911  1.00 0.00 ? 57  THR A HB   6  
ATOM 9791  H HG1  . THR A 1 57  ? -15.021 -7.271  -6.209  1.00 0.00 ? 57  THR A HG1  6  
ATOM 9792  H HG21 . THR A 1 57  ? -11.755 -5.558  -7.666  1.00 0.00 ? 57  THR A HG21 6  
ATOM 9793  H HG22 . THR A 1 57  ? -13.381 -5.577  -8.350  1.00 0.00 ? 57  THR A HG22 6  
ATOM 9794  H HG23 . THR A 1 57  ? -12.329 -6.979  -8.537  1.00 0.00 ? 57  THR A HG23 6  
ATOM 9795  N N    . MET A 1 58  ? -12.505 -9.706  -7.112  1.00 0.00 ? 58  MET A N    6  
ATOM 9796  C CA   . MET A 1 58  ? -12.191 -10.791 -8.035  1.00 0.00 ? 58  MET A CA   6  
ATOM 9797  C C    . MET A 1 58  ? -12.628 -10.441 -9.454  1.00 0.00 ? 58  MET A C    6  
ATOM 9798  O O    . MET A 1 58  ? -12.109 -10.991 -10.426 1.00 0.00 ? 58  MET A O    6  
ATOM 9799  C CB   . MET A 1 58  ? -12.872 -12.085 -7.584  1.00 0.00 ? 58  MET A CB   6  
ATOM 9800  C CG   . MET A 1 58  ? -14.389 -11.990 -7.541  1.00 0.00 ? 58  MET A CG   6  
ATOM 9801  S SD   . MET A 1 58  ? -15.190 -13.598 -7.706  1.00 0.00 ? 58  MET A SD   6  
ATOM 9802  C CE   . MET A 1 58  ? -14.221 -14.576 -6.560  1.00 0.00 ? 58  MET A CE   6  
ATOM 9803  H H    . MET A 1 58  ? -13.370 -9.706  -6.652  1.00 0.00 ? 58  MET A H    6  
ATOM 9804  H HA   . MET A 1 58  ? -11.122 -10.936 -8.025  1.00 0.00 ? 58  MET A HA   6  
ATOM 9805  H HB2  . MET A 1 58  ? -12.601 -12.877 -8.266  1.00 0.00 ? 58  MET A HB2  6  
ATOM 9806  H HB3  . MET A 1 58  ? -12.522 -12.338 -6.595  1.00 0.00 ? 58  MET A HB3  6  
ATOM 9807  H HG2  . MET A 1 58  ? -14.683 -11.552 -6.599  1.00 0.00 ? 58  MET A HG2  6  
ATOM 9808  H HG3  . MET A 1 58  ? -14.719 -11.355 -8.350  1.00 0.00 ? 58  MET A HG3  6  
ATOM 9809  H HE1  . MET A 1 58  ? -13.411 -15.055 -7.091  1.00 0.00 ? 58  MET A HE1  6  
ATOM 9810  H HE2  . MET A 1 58  ? -13.818 -13.936 -5.790  1.00 0.00 ? 58  MET A HE2  6  
ATOM 9811  H HE3  . MET A 1 58  ? -14.851 -15.330 -6.110  1.00 0.00 ? 58  MET A HE3  6  
ATOM 9812  N N    . ASP A 1 59  ? -13.581 -9.524  -9.566  1.00 0.00 ? 59  ASP A N    6  
ATOM 9813  C CA   . ASP A 1 59  ? -14.086 -9.100  -10.867 1.00 0.00 ? 59  ASP A CA   6  
ATOM 9814  C C    . ASP A 1 59  ? -13.709 -7.650  -11.149 1.00 0.00 ? 59  ASP A C    6  
ATOM 9815  O O    . ASP A 1 59  ? -14.528 -6.736  -11.040 1.00 0.00 ? 59  ASP A O    6  
ATOM 9816  C CB   . ASP A 1 59  ? -15.606 -9.266  -10.927 1.00 0.00 ? 59  ASP A CB   6  
ATOM 9817  C CG   . ASP A 1 59  ? -16.021 -10.667 -11.330 1.00 0.00 ? 59  ASP A CG   6  
ATOM 9818  O OD1  . ASP A 1 59  ? -15.227 -11.346 -12.017 1.00 0.00 ? 59  ASP A OD1  6  
ATOM 9819  O OD2  . ASP A 1 59  ? -17.136 -11.085 -10.960 1.00 0.00 ? 59  ASP A OD2  6  
ATOM 9820  H H    . ASP A 1 59  ? -13.956 -9.122  -8.753  1.00 0.00 ? 59  ASP A H    6  
ATOM 9821  H HA   . ASP A 1 59  ? -13.635 -9.729  -11.619 1.00 0.00 ? 59  ASP A HA   6  
ATOM 9822  H HB2  . ASP A 1 59  ? -16.024 -9.054  -9.953  1.00 0.00 ? 59  ASP A HB2  6  
ATOM 9823  H HB3  . ASP A 1 59  ? -16.009 -8.568  -11.646 1.00 0.00 ? 59  ASP A HB3  6  
ATOM 9824  N N    . PRO A 1 60  ? -12.439 -7.431  -11.522 1.00 0.00 ? 60  PRO A N    6  
ATOM 9825  C CA   . PRO A 1 60  ? -11.923 -6.091  -11.827 1.00 0.00 ? 60  PRO A CA   6  
ATOM 9826  C C    . PRO A 1 60  ? -12.502 -5.529  -13.121 1.00 0.00 ? 60  PRO A C    6  
ATOM 9827  O O    . PRO A 1 60  ? -12.299 -4.360  -13.447 1.00 0.00 ? 60  PRO A O    6  
ATOM 9828  C CB   . PRO A 1 60  ? -10.416 -6.317  -11.969 1.00 0.00 ? 60  PRO A CB   6  
ATOM 9829  C CG   . PRO A 1 60  ? -10.282 -7.749  -12.357 1.00 0.00 ? 60  PRO A CG   6  
ATOM 9830  C CD   . PRO A 1 60  ? -11.409 -8.471  -11.673 1.00 0.00 ? 60  PRO A CD   6  
ATOM 9831  H HA   . PRO A 1 60  ? -12.112 -5.400  -11.018 1.00 0.00 ? 60  PRO A HA   6  
ATOM 9832  H HB2  . PRO A 1 60  ? -10.022 -5.661  -12.733 1.00 0.00 ? 60  PRO A HB2  6  
ATOM 9833  H HB3  . PRO A 1 60  ? -9.928  -6.116  -11.027 1.00 0.00 ? 60  PRO A HB3  6  
ATOM 9834  H HG2  . PRO A 1 60  ? -10.368 -7.849  -13.428 1.00 0.00 ? 60  PRO A HG2  6  
ATOM 9835  H HG3  . PRO A 1 60  ? -9.330  -8.132  -12.018 1.00 0.00 ? 60  PRO A HG3  6  
ATOM 9836  H HD2  . PRO A 1 60  ? -11.767 -9.282  -12.289 1.00 0.00 ? 60  PRO A HD2  6  
ATOM 9837  H HD3  . PRO A 1 60  ? -11.091 -8.840  -10.708 1.00 0.00 ? 60  PRO A HD3  6  
ATOM 9838  N N    . THR A 1 61  ? -13.226 -6.370  -13.855 1.00 0.00 ? 61  THR A N    6  
ATOM 9839  C CA   . THR A 1 61  ? -13.833 -5.957  -15.113 1.00 0.00 ? 61  THR A CA   6  
ATOM 9840  C C    . THR A 1 61  ? -14.831 -4.825  -14.896 1.00 0.00 ? 61  THR A C    6  
ATOM 9841  O O    . THR A 1 61  ? -15.200 -4.122  -15.837 1.00 0.00 ? 61  THR A O    6  
ATOM 9842  C CB   . THR A 1 61  ? -14.550 -7.132  -15.804 1.00 0.00 ? 61  THR A CB   6  
ATOM 9843  O OG1  . THR A 1 61  ? -15.035 -6.725  -17.087 1.00 0.00 ? 61  THR A OG1  6  
ATOM 9844  C CG2  . THR A 1 61  ? -15.707 -7.635  -14.954 1.00 0.00 ? 61  THR A CG2  6  
ATOM 9845  H H    . THR A 1 61  ? -13.352 -7.289  -13.541 1.00 0.00 ? 61  THR A H    6  
ATOM 9846  H HA   . THR A 1 61  ? -13.046 -5.608  -15.765 1.00 0.00 ? 61  THR A HA   6  
ATOM 9847  H HB   . THR A 1 61  ? -13.843 -7.938  -15.935 1.00 0.00 ? 61  THR A HB   6  
ATOM 9848  H HG1  . THR A 1 61  ? -14.359 -6.882  -17.751 1.00 0.00 ? 61  THR A HG1  6  
ATOM 9849  H HG21 . THR A 1 61  ? -15.827 -8.698  -15.101 1.00 0.00 ? 61  THR A HG21 6  
ATOM 9850  H HG22 . THR A 1 61  ? -16.615 -7.127  -15.246 1.00 0.00 ? 61  THR A HG22 6  
ATOM 9851  H HG23 . THR A 1 61  ? -15.502 -7.435  -13.914 1.00 0.00 ? 61  THR A HG23 6  
ATOM 9852  N N    . GLN A 1 62  ? -15.265 -4.654  -13.651 1.00 0.00 ? 62  GLN A N    6  
ATOM 9853  C CA   . GLN A 1 62  ? -16.220 -3.607  -13.311 1.00 0.00 ? 62  GLN A CA   6  
ATOM 9854  C C    . GLN A 1 62  ? -15.501 -2.321  -12.917 1.00 0.00 ? 62  GLN A C    6  
ATOM 9855  O O    . GLN A 1 62  ? -14.277 -2.227  -13.012 1.00 0.00 ? 62  GLN A O    6  
ATOM 9856  C CB   . GLN A 1 62  ? -17.130 -4.068  -12.170 1.00 0.00 ? 62  GLN A CB   6  
ATOM 9857  C CG   . GLN A 1 62  ? -17.666 -5.478  -12.353 1.00 0.00 ? 62  GLN A CG   6  
ATOM 9858  C CD   . GLN A 1 62  ? -19.127 -5.600  -11.966 1.00 0.00 ? 62  GLN A CD   6  
ATOM 9859  O OE1  . GLN A 1 62  ? -19.995 -4.960  -12.559 1.00 0.00 ? 62  GLN A OE1  6  
ATOM 9860  N NE2  . GLN A 1 62  ? -19.407 -6.426  -10.963 1.00 0.00 ? 62  GLN A NE2  6  
ATOM 9861  H H    . GLN A 1 62  ? -14.934 -5.247  -12.945 1.00 0.00 ? 62  GLN A H    6  
ATOM 9862  H HA   . GLN A 1 62  ? -16.824 -3.414  -14.185 1.00 0.00 ? 62  GLN A HA   6  
ATOM 9863  H HB2  . GLN A 1 62  ? -16.573 -4.034  -11.246 1.00 0.00 ? 62  GLN A HB2  6  
ATOM 9864  H HB3  . GLN A 1 62  ? -17.970 -3.392  -12.101 1.00 0.00 ? 62  GLN A HB3  6  
ATOM 9865  H HG2  . GLN A 1 62  ? -17.561 -5.759  -13.390 1.00 0.00 ? 62  GLN A HG2  6  
ATOM 9866  H HG3  . GLN A 1 62  ? -17.089 -6.151  -11.737 1.00 0.00 ? 62  GLN A HG3  6  
ATOM 9867  H HE21 . GLN A 1 62  ? -18.664 -6.903  -10.536 1.00 0.00 ? 62  GLN A HE21 6  
ATOM 9868  H HE22 . GLN A 1 62  ? -20.342 -6.525  -10.692 1.00 0.00 ? 62  GLN A HE22 6  
ATOM 9869  N N    . HIS A 1 63  ? -16.271 -1.331  -12.475 1.00 0.00 ? 63  HIS A N    6  
ATOM 9870  C CA   . HIS A 1 63  ? -15.707 -0.050  -12.066 1.00 0.00 ? 63  HIS A CA   6  
ATOM 9871  C C    . HIS A 1 63  ? -15.128 -0.136  -10.656 1.00 0.00 ? 63  HIS A C    6  
ATOM 9872  O O    . HIS A 1 63  ? -15.637 -0.870  -9.809  1.00 0.00 ? 63  HIS A O    6  
ATOM 9873  C CB   . HIS A 1 63  ? -16.774 1.044   -12.125 1.00 0.00 ? 63  HIS A CB   6  
ATOM 9874  C CG   . HIS A 1 63  ? -16.222 2.405   -12.412 1.00 0.00 ? 63  HIS A CG   6  
ATOM 9875  N ND1  . HIS A 1 63  ? -15.277 3.018   -11.616 1.00 0.00 ? 63  HIS A ND1  6  
ATOM 9876  C CD2  . HIS A 1 63  ? -16.484 3.273   -13.417 1.00 0.00 ? 63  HIS A CD2  6  
ATOM 9877  C CE1  . HIS A 1 63  ? -14.984 4.205   -12.118 1.00 0.00 ? 63  HIS A CE1  6  
ATOM 9878  N NE2  . HIS A 1 63  ? -15.704 4.383   -13.212 1.00 0.00 ? 63  HIS A NE2  6  
ATOM 9879  H H    . HIS A 1 63  ? -17.239 -1.466  -12.421 1.00 0.00 ? 63  HIS A H    6  
ATOM 9880  H HA   . HIS A 1 63  ? -14.912 0.198   -12.753 1.00 0.00 ? 63  HIS A HA   6  
ATOM 9881  H HB2  . HIS A 1 63  ? -17.484 0.803   -12.902 1.00 0.00 ? 63  HIS A HB2  6  
ATOM 9882  H HB3  . HIS A 1 63  ? -17.290 1.087   -11.175 1.00 0.00 ? 63  HIS A HB3  6  
ATOM 9883  H HD2  . HIS A 1 63  ? -17.180 3.123   -14.231 1.00 0.00 ? 63  HIS A HD2  6  
ATOM 9884  H HE1  . HIS A 1 63  ? -14.277 4.909   -11.705 1.00 0.00 ? 63  HIS A HE1  6  
ATOM 9885  H HE2  . HIS A 1 63  ? -15.743 5.214   -13.730 1.00 0.00 ? 63  HIS A HE2  6  
ATOM 9886  N N    . VAL A 1 64  ? -14.061 0.617   -10.413 1.00 0.00 ? 64  VAL A N    6  
ATOM 9887  C CA   . VAL A 1 64  ? -13.412 0.626   -9.107  1.00 0.00 ? 64  VAL A CA   6  
ATOM 9888  C C    . VAL A 1 64  ? -14.417 0.910   -7.997  1.00 0.00 ? 64  VAL A C    6  
ATOM 9889  O O    . VAL A 1 64  ? -14.303 0.382   -6.891  1.00 0.00 ? 64  VAL A O    6  
ATOM 9890  C CB   . VAL A 1 64  ? -12.286 1.678   -9.046  1.00 0.00 ? 64  VAL A CB   6  
ATOM 9891  C CG1  . VAL A 1 64  ? -11.645 1.692   -7.667  1.00 0.00 ? 64  VAL A CG1  6  
ATOM 9892  C CG2  . VAL A 1 64  ? -11.248 1.408   -10.125 1.00 0.00 ? 64  VAL A CG2  6  
ATOM 9893  H H    . VAL A 1 64  ? -13.700 1.182   -11.128 1.00 0.00 ? 64  VAL A H    6  
ATOM 9894  H HA   . VAL A 1 64  ? -12.976 -0.348  -8.944  1.00 0.00 ? 64  VAL A HA   6  
ATOM 9895  H HB   . VAL A 1 64  ? -12.719 2.650   -9.227  1.00 0.00 ? 64  VAL A HB   6  
ATOM 9896  H HG11 . VAL A 1 64  ? -10.580 1.539   -7.764  1.00 0.00 ? 64  VAL A HG11 6  
ATOM 9897  H HG12 . VAL A 1 64  ? -11.832 2.644   -7.192  1.00 0.00 ? 64  VAL A HG12 6  
ATOM 9898  H HG13 . VAL A 1 64  ? -12.067 0.900   -7.065  1.00 0.00 ? 64  VAL A HG13 6  
ATOM 9899  H HG21 . VAL A 1 64  ? -10.272 1.688   -9.759  1.00 0.00 ? 64  VAL A HG21 6  
ATOM 9900  H HG22 . VAL A 1 64  ? -11.252 0.357   -10.373 1.00 0.00 ? 64  VAL A HG22 6  
ATOM 9901  H HG23 . VAL A 1 64  ? -11.484 1.986   -11.004 1.00 0.00 ? 64  VAL A HG23 6  
ATOM 9902  N N    . ASN A 1 65  ? -15.405 1.748   -8.299  1.00 0.00 ? 65  ASN A N    6  
ATOM 9903  C CA   . ASN A 1 65  ? -16.432 2.102   -7.326  1.00 0.00 ? 65  ASN A CA   6  
ATOM 9904  C C    . ASN A 1 65  ? -17.331 0.908   -7.025  1.00 0.00 ? 65  ASN A C    6  
ATOM 9905  O O    . ASN A 1 65  ? -17.873 0.786   -5.927  1.00 0.00 ? 65  ASN A O    6  
ATOM 9906  C CB   . ASN A 1 65  ? -17.272 3.272   -7.842  1.00 0.00 ? 65  ASN A CB   6  
ATOM 9907  C CG   . ASN A 1 65  ? -18.318 2.831   -8.848  1.00 0.00 ? 65  ASN A CG   6  
ATOM 9908  O OD1  . ASN A 1 65  ? -19.321 2.214   -8.487  1.00 0.00 ? 65  ASN A OD1  6  
ATOM 9909  N ND2  . ASN A 1 65  ? -18.089 3.145   -10.119 1.00 0.00 ? 65  ASN A ND2  6  
ATOM 9910  H H    . ASN A 1 65  ? -15.443 2.138   -9.196  1.00 0.00 ? 65  ASN A H    6  
ATOM 9911  H HA   . ASN A 1 65  ? -15.935 2.403   -6.414  1.00 0.00 ? 65  ASN A HA   6  
ATOM 9912  H HB2  . ASN A 1 65  ? -17.776 3.740   -7.010  1.00 0.00 ? 65  ASN A HB2  6  
ATOM 9913  H HB3  . ASN A 1 65  ? -16.623 3.992   -8.319  1.00 0.00 ? 65  ASN A HB3  6  
ATOM 9914  H HD21 . ASN A 1 65  ? -17.268 3.637   -10.332 1.00 0.00 ? 65  ASN A HD21 6  
ATOM 9915  H HD22 . ASN A 1 65  ? -18.749 2.873   -10.788 1.00 0.00 ? 65  ASN A HD22 6  
ATOM 9916  N N    . ASN A 1 66  ? -17.485 0.028   -8.009  1.00 0.00 ? 66  ASN A N    6  
ATOM 9917  C CA   . ASN A 1 66  ? -18.319 -1.158  -7.850  1.00 0.00 ? 66  ASN A CA   6  
ATOM 9918  C C    . ASN A 1 66  ? -17.592 -2.231  -7.045  1.00 0.00 ? 66  ASN A C    6  
ATOM 9919  O O    . ASN A 1 66  ? -18.221 -3.077  -6.409  1.00 0.00 ? 66  ASN A O    6  
ATOM 9920  C CB   . ASN A 1 66  ? -18.717 -1.714  -9.219  1.00 0.00 ? 66  ASN A CB   6  
ATOM 9921  C CG   . ASN A 1 66  ? -20.165 -1.421  -9.564  1.00 0.00 ? 66  ASN A CG   6  
ATOM 9922  O OD1  . ASN A 1 66  ? -20.491 -0.339  -10.052 1.00 0.00 ? 66  ASN A OD1  6  
ATOM 9923  N ND2  . ASN A 1 66  ? -21.041 -2.385  -9.308  1.00 0.00 ? 66  ASN A ND2  6  
ATOM 9924  H H    . ASN A 1 66  ? -17.027 0.178   -8.862  1.00 0.00 ? 66  ASN A H    6  
ATOM 9925  H HA   . ASN A 1 66  ? -19.211 -0.866  -7.317  1.00 0.00 ? 66  ASN A HA   6  
ATOM 9926  H HB2  . ASN A 1 66  ? -18.090 -1.269  -9.978  1.00 0.00 ? 66  ASN A HB2  6  
ATOM 9927  H HB3  . ASN A 1 66  ? -18.575 -2.785  -9.223  1.00 0.00 ? 66  ASN A HB3  6  
ATOM 9928  H HD21 . ASN A 1 66  ? -20.709 -3.222  -8.917  1.00 0.00 ? 66  ASN A HD21 6  
ATOM 9929  H HD22 . ASN A 1 66  ? -21.983 -2.223  -9.522  1.00 0.00 ? 66  ASN A HD22 6  
ATOM 9930  N N    . TRP A 1 67  ? -16.265 -2.190  -7.079  1.00 0.00 ? 67  TRP A N    6  
ATOM 9931  C CA   . TRP A 1 67  ? -15.452 -3.158  -6.351  1.00 0.00 ? 67  TRP A CA   6  
ATOM 9932  C C    . TRP A 1 67  ? -15.866 -3.225  -4.886  1.00 0.00 ? 67  TRP A C    6  
ATOM 9933  O O    . TRP A 1 67  ? -16.662 -2.410  -4.418  1.00 0.00 ? 67  TRP A O    6  
ATOM 9934  C CB   . TRP A 1 67  ? -13.971 -2.794  -6.459  1.00 0.00 ? 67  TRP A CB   6  
ATOM 9935  C CG   . TRP A 1 67  ? -13.409 -2.989  -7.835  1.00 0.00 ? 67  TRP A CG   6  
ATOM 9936  C CD1  . TRP A 1 67  ? -14.116 -3.171  -8.990  1.00 0.00 ? 67  TRP A CD1  6  
ATOM 9937  C CD2  . TRP A 1 67  ? -12.024 -3.026  -8.199  1.00 0.00 ? 67  TRP A CD2  6  
ATOM 9938  N NE1  . TRP A 1 67  ? -13.254 -3.318  -10.050 1.00 0.00 ? 67  TRP A NE1  6  
ATOM 9939  C CE2  . TRP A 1 67  ? -11.966 -3.232  -9.592  1.00 0.00 ? 67  TRP A CE2  6  
ATOM 9940  C CE3  . TRP A 1 67  ? -10.831 -2.903  -7.486  1.00 0.00 ? 67  TRP A CE3  6  
ATOM 9941  C CZ2  . TRP A 1 67  ? -10.759 -3.318  -10.280 1.00 0.00 ? 67  TRP A CZ2  6  
ATOM 9942  C CZ3  . TRP A 1 67  ? -9.633  -2.988  -8.170  1.00 0.00 ? 67  TRP A CZ3  6  
ATOM 9943  C CH2  . TRP A 1 67  ? -9.604  -3.193  -9.557  1.00 0.00 ? 67  TRP A CH2  6  
ATOM 9944  H H    . TRP A 1 67  ? -15.820 -1.491  -7.604  1.00 0.00 ? 67  TRP A H    6  
ATOM 9945  H HA   . TRP A 1 67  ? -15.610 -4.127  -6.803  1.00 0.00 ? 67  TRP A HA   6  
ATOM 9946  H HB2  . TRP A 1 67  ? -13.840 -1.757  -6.191  1.00 0.00 ? 67  TRP A HB2  6  
ATOM 9947  H HB3  . TRP A 1 67  ? -13.405 -3.412  -5.777  1.00 0.00 ? 67  TRP A HB3  6  
ATOM 9948  H HD1  . TRP A 1 67  ? -15.193 -3.195  -9.046  1.00 0.00 ? 67  TRP A HD1  6  
ATOM 9949  H HE1  . TRP A 1 67  ? -13.520 -3.460  -10.984 1.00 0.00 ? 67  TRP A HE1  6  
ATOM 9950  H HE3  . TRP A 1 67  ? -10.831 -2.744  -6.417  1.00 0.00 ? 67  TRP A HE3  6  
ATOM 9951  H HZ2  . TRP A 1 67  ? -10.720 -3.475  -11.348 1.00 0.00 ? 67  TRP A HZ2  6  
ATOM 9952  H HZ3  . TRP A 1 67  ? -8.699  -2.896  -7.635  1.00 0.00 ? 67  TRP A HZ3  6  
ATOM 9953  H HH2  . TRP A 1 67  ? -8.648  -3.255  -10.051 1.00 0.00 ? 67  TRP A HH2  6  
ATOM 9954  N N    . MET A 1 68  ? -15.322 -4.200  -4.166  1.00 0.00 ? 68  MET A N    6  
ATOM 9955  C CA   . MET A 1 68  ? -15.635 -4.371  -2.752  1.00 0.00 ? 68  MET A CA   6  
ATOM 9956  C C    . MET A 1 68  ? -15.131 -3.184  -1.936  1.00 0.00 ? 68  MET A C    6  
ATOM 9957  O O    . MET A 1 68  ? -15.854 -2.638  -1.102  1.00 0.00 ? 68  MET A O    6  
ATOM 9958  C CB   . MET A 1 68  ? -15.015 -5.667  -2.223  1.00 0.00 ? 68  MET A CB   6  
ATOM 9959  C CG   . MET A 1 68  ? -16.036 -6.759  -1.948  1.00 0.00 ? 68  MET A CG   6  
ATOM 9960  S SD   . MET A 1 68  ? -15.749 -8.241  -2.934  1.00 0.00 ? 68  MET A SD   6  
ATOM 9961  C CE   . MET A 1 68  ? -14.357 -8.960  -2.066  1.00 0.00 ? 68  MET A CE   6  
ATOM 9962  H H    . MET A 1 68  ? -14.694 -4.818  -4.593  1.00 0.00 ? 68  MET A H    6  
ATOM 9963  H HA   . MET A 1 68  ? -16.709 -4.429  -2.654  1.00 0.00 ? 68  MET A HA   6  
ATOM 9964  H HB2  . MET A 1 68  ? -14.310 -6.038  -2.952  1.00 0.00 ? 68  MET A HB2  6  
ATOM 9965  H HB3  . MET A 1 68  ? -14.493 -5.454  -1.303  1.00 0.00 ? 68  MET A HB3  6  
ATOM 9966  H HG2  . MET A 1 68  ? -15.988 -7.026  -0.903  1.00 0.00 ? 68  MET A HG2  6  
ATOM 9967  H HG3  . MET A 1 68  ? -17.021 -6.379  -2.175  1.00 0.00 ? 68  MET A HG3  6  
ATOM 9968  H HE1  . MET A 1 68  ? -13.552 -8.242  -2.018  1.00 0.00 ? 68  MET A HE1  6  
ATOM 9969  H HE2  . MET A 1 68  ? -14.658 -9.230  -1.064  1.00 0.00 ? 68  MET A HE2  6  
ATOM 9970  H HE3  . MET A 1 68  ? -14.021 -9.843  -2.592  1.00 0.00 ? 68  MET A HE3  6  
ATOM 9971  N N    . LYS A 1 69  ? -13.886 -2.789  -2.180  1.00 0.00 ? 69  LYS A N    6  
ATOM 9972  C CA   . LYS A 1 69  ? -13.285 -1.667  -1.469  1.00 0.00 ? 69  LYS A CA   6  
ATOM 9973  C C    . LYS A 1 69  ? -13.166 -1.967  0.022   1.00 0.00 ? 69  LYS A C    6  
ATOM 9974  O O    . LYS A 1 69  ? -13.857 -2.841  0.545   1.00 0.00 ? 69  LYS A O    6  
ATOM 9975  C CB   . LYS A 1 69  ? -14.117 -0.399  -1.680  1.00 0.00 ? 69  LYS A CB   6  
ATOM 9976  C CG   . LYS A 1 69  ? -14.541 -0.183  -3.123  1.00 0.00 ? 69  LYS A CG   6  
ATOM 9977  C CD   . LYS A 1 69  ? -15.471 1.011   -3.258  1.00 0.00 ? 69  LYS A CD   6  
ATOM 9978  C CE   . LYS A 1 69  ? -14.708 2.324   -3.174  1.00 0.00 ? 69  LYS A CE   6  
ATOM 9979  N NZ   . LYS A 1 69  ? -15.282 3.236   -2.146  1.00 0.00 ? 69  LYS A NZ   6  
ATOM 9980  H H    . LYS A 1 69  ? -13.358 -3.264  -2.856  1.00 0.00 ? 69  LYS A H    6  
ATOM 9981  H HA   . LYS A 1 69  ? -12.296 -1.510  -1.872  1.00 0.00 ? 69  LYS A HA   6  
ATOM 9982  H HB2  . LYS A 1 69  ? -15.007 -0.462  -1.072  1.00 0.00 ? 69  LYS A HB2  6  
ATOM 9983  H HB3  . LYS A 1 69  ? -13.535 0.455   -1.366  1.00 0.00 ? 69  LYS A HB3  6  
ATOM 9984  H HG2  . LYS A 1 69  ? -13.662 -0.009  -3.724  1.00 0.00 ? 69  LYS A HG2  6  
ATOM 9985  H HG3  . LYS A 1 69  ? -15.052 -1.068  -3.474  1.00 0.00 ? 69  LYS A HG3  6  
ATOM 9986  H HD2  . LYS A 1 69  ? -15.972 0.960   -4.212  1.00 0.00 ? 69  LYS A HD2  6  
ATOM 9987  H HD3  . LYS A 1 69  ? -16.202 0.978   -2.462  1.00 0.00 ? 69  LYS A HD3  6  
ATOM 9988  H HE2  . LYS A 1 69  ? -13.680 2.113   -2.921  1.00 0.00 ? 69  LYS A HE2  6  
ATOM 9989  H HE3  . LYS A 1 69  ? -14.749 2.810   -4.138  1.00 0.00 ? 69  LYS A HE3  6  
ATOM 9990  H HZ1  . LYS A 1 69  ? -15.911 2.705   -1.509  1.00 0.00 ? 69  LYS A HZ1  6  
ATOM 9991  H HZ2  . LYS A 1 69  ? -15.831 3.991   -2.605  1.00 0.00 ? 69  LYS A HZ2  6  
ATOM 9992  H HZ3  . LYS A 1 69  ? -14.521 3.667   -1.585  1.00 0.00 ? 69  LYS A HZ3  6  
ATOM 9993  N N    . HIS A 1 70  ? -12.287 -1.237  0.699   1.00 0.00 ? 70  HIS A N    6  
ATOM 9994  C CA   . HIS A 1 70  ? -12.080 -1.424  2.130   1.00 0.00 ? 70  HIS A CA   6  
ATOM 9995  C C    . HIS A 1 70  ? -11.956 -0.080  2.842   1.00 0.00 ? 70  HIS A C    6  
ATOM 9996  O O    . HIS A 1 70  ? -12.129 0.975   2.232   1.00 0.00 ? 70  HIS A O    6  
ATOM 9997  C CB   . HIS A 1 70  ? -10.825 -2.262  2.379   1.00 0.00 ? 70  HIS A CB   6  
ATOM 9998  C CG   . HIS A 1 70  ? -11.010 -3.321  3.424   1.00 0.00 ? 70  HIS A CG   6  
ATOM 9999  N ND1  . HIS A 1 70  ? -12.128 -4.126  3.490   1.00 0.00 ? 70  HIS A ND1  6  
ATOM 10000 C CD2  . HIS A 1 70  ? -10.211 -3.705  4.446   1.00 0.00 ? 70  HIS A CD2  6  
ATOM 10001 C CE1  . HIS A 1 70  ? -12.008 -4.958  4.509   1.00 0.00 ? 70  HIS A CE1  6  
ATOM 10002 N NE2  . HIS A 1 70  ? -10.853 -4.724  5.106   1.00 0.00 ? 70  HIS A NE2  6  
ATOM 10003 H H    . HIS A 1 70  ? -11.766 -0.555  0.226   1.00 0.00 ? 70  HIS A H    6  
ATOM 10004 H HA   . HIS A 1 70  ? -12.936 -1.949  2.525   1.00 0.00 ? 70  HIS A HA   6  
ATOM 10005 H HB2  . HIS A 1 70  ? -10.539 -2.752  1.460   1.00 0.00 ? 70  HIS A HB2  6  
ATOM 10006 H HB3  . HIS A 1 70  ? -10.024 -1.614  2.703   1.00 0.00 ? 70  HIS A HB3  6  
ATOM 10007 H HD1  . HIS A 1 70  ? -12.894 -4.091  2.881   1.00 0.00 ? 70  HIS A HD1  6  
ATOM 10008 H HD2  . HIS A 1 70  ? -9.244  -3.288  4.697   1.00 0.00 ? 70  HIS A HD2  6  
ATOM 10009 H HE1  . HIS A 1 70  ? -12.731 -5.704  4.804   1.00 0.00 ? 70  HIS A HE1  6  
ATOM 10010 N N    . ASN A 1 71  ? -11.658 -0.126  4.136   1.00 0.00 ? 71  ASN A N    6  
ATOM 10011 C CA   . ASN A 1 71  ? -11.514 1.087   4.932   1.00 0.00 ? 71  ASN A CA   6  
ATOM 10012 C C    . ASN A 1 71  ? -10.256 1.027   5.793   1.00 0.00 ? 71  ASN A C    6  
ATOM 10013 O O    . ASN A 1 71  ? -9.762  -0.053  6.117   1.00 0.00 ? 71  ASN A O    6  
ATOM 10014 C CB   . ASN A 1 71  ? -12.743 1.290   5.820   1.00 0.00 ? 71  ASN A CB   6  
ATOM 10015 C CG   . ASN A 1 71  ? -13.355 2.668   5.655   1.00 0.00 ? 71  ASN A CG   6  
ATOM 10016 O OD1  . ASN A 1 71  ? -13.323 3.487   6.575   1.00 0.00 ? 71  ASN A OD1  6  
ATOM 10017 N ND2  . ASN A 1 71  ? -13.914 2.931   4.481   1.00 0.00 ? 71  ASN A ND2  6  
ATOM 10018 H H    . ASN A 1 71  ? -11.532 -0.998  4.567   1.00 0.00 ? 71  ASN A H    6  
ATOM 10019 H HA   . ASN A 1 71  ? -11.431 1.921   4.251   1.00 0.00 ? 71  ASN A HA   6  
ATOM 10020 H HB2  . ASN A 1 71  ? -13.490 0.553   5.562   1.00 0.00 ? 71  ASN A HB2  6  
ATOM 10021 H HB3  . ASN A 1 71  ? -12.459 1.162   6.853   1.00 0.00 ? 71  ASN A HB3  6  
ATOM 10022 H HD21 . ASN A 1 71  ? -13.902 2.231   3.795   1.00 0.00 ? 71  ASN A HD21 6  
ATOM 10023 H HD22 . ASN A 1 71  ? -14.317 3.814   4.347   1.00 0.00 ? 71  ASN A HD22 6  
ATOM 10024 N N    . VAL A 1 72  ? -9.740  2.197   6.160   1.00 0.00 ? 72  VAL A N    6  
ATOM 10025 C CA   . VAL A 1 72  ? -8.541  2.277   6.986   1.00 0.00 ? 72  VAL A CA   6  
ATOM 10026 C C    . VAL A 1 72  ? -8.558  3.528   7.858   1.00 0.00 ? 72  VAL A C    6  
ATOM 10027 O O    . VAL A 1 72  ? -9.041  4.581   7.444   1.00 0.00 ? 72  VAL A O    6  
ATOM 10028 C CB   . VAL A 1 72  ? -7.265  2.285   6.122   1.00 0.00 ? 72  VAL A CB   6  
ATOM 10029 C CG1  . VAL A 1 72  ? -6.027  2.399   6.999   1.00 0.00 ? 72  VAL A CG1  6  
ATOM 10030 C CG2  . VAL A 1 72  ? -7.203  1.036   5.256   1.00 0.00 ? 72  VAL A CG2  6  
ATOM 10031 H H    . VAL A 1 72  ? -10.179 3.024   5.872   1.00 0.00 ? 72  VAL A H    6  
ATOM 10032 H HA   . VAL A 1 72  ? -8.514  1.406   7.623   1.00 0.00 ? 72  VAL A HA   6  
ATOM 10033 H HB   . VAL A 1 72  ? -7.300  3.147   5.472   1.00 0.00 ? 72  VAL A HB   6  
ATOM 10034 H HG11 . VAL A 1 72  ? -6.243  1.999   7.979   1.00 0.00 ? 72  VAL A HG11 6  
ATOM 10035 H HG12 . VAL A 1 72  ? -5.217  1.843   6.552   1.00 0.00 ? 72  VAL A HG12 6  
ATOM 10036 H HG13 . VAL A 1 72  ? -5.746  3.438   7.089   1.00 0.00 ? 72  VAL A HG13 6  
ATOM 10037 H HG21 . VAL A 1 72  ? -7.333  0.162   5.876   1.00 0.00 ? 72  VAL A HG21 6  
ATOM 10038 H HG22 . VAL A 1 72  ? -7.986  1.071   4.513   1.00 0.00 ? 72  VAL A HG22 6  
ATOM 10039 H HG23 . VAL A 1 72  ? -6.243  0.987   4.764   1.00 0.00 ? 72  VAL A HG23 6  
ATOM 10040 N N    . ALA A 1 73  ? -8.027  3.403   9.071   1.00 0.00 ? 73  ALA A N    6  
ATOM 10041 C CA   . ALA A 1 73  ? -7.979  4.523   10.001  1.00 0.00 ? 73  ALA A CA   6  
ATOM 10042 C C    . ALA A 1 73  ? -6.538  4.902   10.332  1.00 0.00 ? 73  ALA A C    6  
ATOM 10043 O O    . ALA A 1 73  ? -6.116  4.831   11.486  1.00 0.00 ? 73  ALA A O    6  
ATOM 10044 C CB   . ALA A 1 73  ? -8.743  4.187   11.273  1.00 0.00 ? 73  ALA A CB   6  
ATOM 10045 H H    . ALA A 1 73  ? -7.657  2.538   9.344   1.00 0.00 ? 73  ALA A H    6  
ATOM 10046 H HA   . ALA A 1 73  ? -8.463  5.368   9.533   1.00 0.00 ? 73  ALA A HA   6  
ATOM 10047 H HB1  . ALA A 1 73  ? -8.376  4.798   12.086  1.00 0.00 ? 73  ALA A HB1  6  
ATOM 10048 H HB2  . ALA A 1 73  ? -9.794  4.380   11.124  1.00 0.00 ? 73  ALA A HB2  6  
ATOM 10049 H HB3  . ALA A 1 73  ? -8.598  3.144   11.514  1.00 0.00 ? 73  ALA A HB3  6  
ATOM 10050 N N    . ASP A 1 74  ? -5.788  5.303   9.311   1.00 0.00 ? 74  ASP A N    6  
ATOM 10051 C CA   . ASP A 1 74  ? -4.394  5.692   9.494   1.00 0.00 ? 74  ASP A CA   6  
ATOM 10052 C C    . ASP A 1 74  ? -3.620  4.608   10.238  1.00 0.00 ? 74  ASP A C    6  
ATOM 10053 O O    . ASP A 1 74  ? -3.076  4.850   11.315  1.00 0.00 ? 74  ASP A O    6  
ATOM 10054 C CB   . ASP A 1 74  ? -4.307  7.014   10.257  1.00 0.00 ? 74  ASP A CB   6  
ATOM 10055 C CG   . ASP A 1 74  ? -3.026  7.767   9.965   1.00 0.00 ? 74  ASP A CG   6  
ATOM 10056 O OD1  . ASP A 1 74  ? -2.805  8.131   8.792   1.00 0.00 ? 74  ASP A OD1  6  
ATOM 10057 O OD2  . ASP A 1 74  ? -2.241  7.992   10.911  1.00 0.00 ? 74  ASP A OD2  6  
ATOM 10058 H H    . ASP A 1 74  ? -6.181  5.337   8.413   1.00 0.00 ? 74  ASP A H    6  
ATOM 10059 H HA   . ASP A 1 74  ? -3.956  5.821   8.515   1.00 0.00 ? 74  ASP A HA   6  
ATOM 10060 H HB2  . ASP A 1 74  ? -5.142  7.639   9.976   1.00 0.00 ? 74  ASP A HB2  6  
ATOM 10061 H HB3  . ASP A 1 74  ? -4.354  6.813   11.317  1.00 0.00 ? 74  ASP A HB3  6  
ATOM 10062 N N    . SER A 1 75  ? -3.579  3.413   9.657   1.00 0.00 ? 75  SER A N    6  
ATOM 10063 C CA   . SER A 1 75  ? -2.875  2.291   10.267  1.00 0.00 ? 75  SER A CA   6  
ATOM 10064 C C    . SER A 1 75  ? -1.707  1.843   9.396   1.00 0.00 ? 75  SER A C    6  
ATOM 10065 O O    . SER A 1 75  ? -0.744  1.252   9.886   1.00 0.00 ? 75  SER A O    6  
ATOM 10066 C CB   . SER A 1 75  ? -3.836  1.123   10.494  1.00 0.00 ? 75  SER A CB   6  
ATOM 10067 O OG   . SER A 1 75  ? -3.667  0.565   11.786  1.00 0.00 ? 75  SER A OG   6  
ATOM 10068 H H    . SER A 1 75  ? -4.033  3.283   8.799   1.00 0.00 ? 75  SER A H    6  
ATOM 10069 H HA   . SER A 1 75  ? -2.491  2.621   11.223  1.00 0.00 ? 75  SER A HA   6  
ATOM 10070 H HB2  . SER A 1 75  ? -4.853  1.471   10.396  1.00 0.00 ? 75  SER A HB2  6  
ATOM 10071 H HB3  . SER A 1 75  ? -3.646  0.355   9.757   1.00 0.00 ? 75  SER A HB3  6  
ATOM 10072 H HG   . SER A 1 75  ? -4.427  0.020   12.002  1.00 0.00 ? 75  SER A HG   6  
ATOM 10073 N N    . GLN A 1 76  ? -1.799  2.127   8.101   1.00 0.00 ? 76  GLN A N    6  
ATOM 10074 C CA   . GLN A 1 76  ? -0.749  1.752   7.161   1.00 0.00 ? 76  GLN A CA   6  
ATOM 10075 C C    . GLN A 1 76  ? -0.607  0.237   7.080   1.00 0.00 ? 76  GLN A C    6  
ATOM 10076 O O    . GLN A 1 76  ? 0.413   -0.277  6.620   1.00 0.00 ? 76  GLN A O    6  
ATOM 10077 C CB   . GLN A 1 76  ? 0.582   2.381   7.572   1.00 0.00 ? 76  GLN A CB   6  
ATOM 10078 C CG   . GLN A 1 76  ? 0.988   3.567   6.712   1.00 0.00 ? 76  GLN A CG   6  
ATOM 10079 C CD   . GLN A 1 76  ? 2.246   4.247   7.212   1.00 0.00 ? 76  GLN A CD   6  
ATOM 10080 O OE1  . GLN A 1 76  ? 2.251   5.448   7.487   1.00 0.00 ? 76  GLN A OE1  6  
ATOM 10081 N NE2  . GLN A 1 76  ? 3.326   3.481   7.334   1.00 0.00 ? 76  GLN A NE2  6  
ATOM 10082 H H    . GLN A 1 76  ? -2.591  2.599   7.772   1.00 0.00 ? 76  GLN A H    6  
ATOM 10083 H HA   . GLN A 1 76  ? -1.028  2.127   6.187   1.00 0.00 ? 76  GLN A HA   6  
ATOM 10084 H HB2  . GLN A 1 76  ? 0.508   2.715   8.597   1.00 0.00 ? 76  GLN A HB2  6  
ATOM 10085 H HB3  . GLN A 1 76  ? 1.356   1.631   7.502   1.00 0.00 ? 76  GLN A HB3  6  
ATOM 10086 H HG2  . GLN A 1 76  ? 1.160   3.221   5.703   1.00 0.00 ? 76  GLN A HG2  6  
ATOM 10087 H HG3  . GLN A 1 76  ? 0.183   4.287   6.712   1.00 0.00 ? 76  GLN A HG3  6  
ATOM 10088 H HE21 . GLN A 1 76  ? 3.248   2.532   7.096   1.00 0.00 ? 76  GLN A HE21 6  
ATOM 10089 H HE22 . GLN A 1 76  ? 4.152   3.895   7.654   1.00 0.00 ? 76  GLN A HE22 6  
ATOM 10090 N N    . ILE A 1 77  ? -1.637  -0.475  7.528   1.00 0.00 ? 77  ILE A N    6  
ATOM 10091 C CA   . ILE A 1 77  ? -1.625  -1.932  7.505   1.00 0.00 ? 77  ILE A CA   6  
ATOM 10092 C C    . ILE A 1 77  ? -3.023  -2.496  7.737   1.00 0.00 ? 77  ILE A C    6  
ATOM 10093 O O    . ILE A 1 77  ? -3.738  -2.062  8.641   1.00 0.00 ? 77  ILE A O    6  
ATOM 10094 C CB   . ILE A 1 77  ? -0.670  -2.504  8.570   1.00 0.00 ? 77  ILE A CB   6  
ATOM 10095 C CG1  . ILE A 1 77  ? -0.534  -4.020  8.404   1.00 0.00 ? 77  ILE A CG1  6  
ATOM 10096 C CG2  . ILE A 1 77  ? -1.166  -2.161  9.968   1.00 0.00 ? 77  ILE A CG2  6  
ATOM 10097 C CD1  . ILE A 1 77  ? 0.493   -4.638  9.325   1.00 0.00 ? 77  ILE A CD1  6  
ATOM 10098 H H    . ILE A 1 77  ? -2.422  -0.008  7.883   1.00 0.00 ? 77  ILE A H    6  
ATOM 10099 H HA   . ILE A 1 77  ? -1.278  -2.248  6.533   1.00 0.00 ? 77  ILE A HA   6  
ATOM 10100 H HB   . ILE A 1 77  ? 0.299   -2.047  8.436   1.00 0.00 ? 77  ILE A HB   6  
ATOM 10101 H HG12 . ILE A 1 77  ? -1.485  -4.484  8.609   1.00 0.00 ? 77  ILE A HG12 6  
ATOM 10102 H HG13 . ILE A 1 77  ? -0.243  -4.237  7.387   1.00 0.00 ? 77  ILE A HG13 6  
ATOM 10103 H HG21 . ILE A 1 77  ? -0.330  -2.139  10.650  1.00 0.00 ? 77  ILE A HG21 6  
ATOM 10104 H HG22 . ILE A 1 77  ? -1.642  -1.192  9.951   1.00 0.00 ? 77  ILE A HG22 6  
ATOM 10105 H HG23 . ILE A 1 77  ? -1.878  -2.907  10.289  1.00 0.00 ? 77  ILE A HG23 6  
ATOM 10106 H HD11 . ILE A 1 77  ? 0.047   -5.465  9.859   1.00 0.00 ? 77  ILE A HD11 6  
ATOM 10107 H HD12 . ILE A 1 77  ? 1.331   -4.992  8.744   1.00 0.00 ? 77  ILE A HD12 6  
ATOM 10108 H HD13 . ILE A 1 77  ? 0.834   -3.898  10.034  1.00 0.00 ? 77  ILE A HD13 6  
ATOM 10109 N N    . THR A 1 78  ? -3.406  -3.469  6.916   1.00 0.00 ? 78  THR A N    6  
ATOM 10110 C CA   . THR A 1 78  ? -4.717  -4.094  7.032   1.00 0.00 ? 78  THR A CA   6  
ATOM 10111 C C    . THR A 1 78  ? -4.667  -5.559  6.617   1.00 0.00 ? 78  THR A C    6  
ATOM 10112 O O    . THR A 1 78  ? -3.824  -5.960  5.813   1.00 0.00 ? 78  THR A O    6  
ATOM 10113 C CB   . THR A 1 78  ? -5.765  -3.364  6.171   1.00 0.00 ? 78  THR A CB   6  
ATOM 10114 O OG1  . THR A 1 78  ? -7.071  -3.885  6.442   1.00 0.00 ? 78  THR A OG1  6  
ATOM 10115 C CG2  . THR A 1 78  ? -5.451  -3.520  4.690   1.00 0.00 ? 78  THR A CG2  6  
ATOM 10116 H H    . THR A 1 78  ? -2.792  -3.772  6.217   1.00 0.00 ? 78  THR A H    6  
ATOM 10117 H HA   . THR A 1 78  ? -5.026  -4.033  8.066   1.00 0.00 ? 78  THR A HA   6  
ATOM 10118 H HB   . THR A 1 78  ? -5.745  -2.314  6.420   1.00 0.00 ? 78  THR A HB   6  
ATOM 10119 H HG1  . THR A 1 78  ? -7.400  -3.511  7.265   1.00 0.00 ? 78  THR A HG1  6  
ATOM 10120 H HG21 . THR A 1 78  ? -5.973  -2.757  4.129   1.00 0.00 ? 78  THR A HG21 6  
ATOM 10121 H HG22 . THR A 1 78  ? -5.769  -4.494  4.355   1.00 0.00 ? 78  THR A HG22 6  
ATOM 10122 H HG23 . THR A 1 78  ? -4.388  -3.414  4.535   1.00 0.00 ? 78  THR A HG23 6  
ATOM 10123 N N    . THR A 1 79  ? -5.575  -6.359  7.169   1.00 0.00 ? 79  THR A N    6  
ATOM 10124 C CA   . THR A 1 79  ? -5.632  -7.781  6.856   1.00 0.00 ? 79  THR A CA   6  
ATOM 10125 C C    . THR A 1 79  ? -7.013  -8.176  6.344   1.00 0.00 ? 79  THR A C    6  
ATOM 10126 O O    . THR A 1 79  ? -8.008  -8.056  7.059   1.00 0.00 ? 79  THR A O    6  
ATOM 10127 C CB   . THR A 1 79  ? -5.290  -8.641  8.087   1.00 0.00 ? 79  THR A CB   6  
ATOM 10128 O OG1  . THR A 1 79  ? -5.995  -8.157  9.236   1.00 0.00 ? 79  THR A OG1  6  
ATOM 10129 C CG2  . THR A 1 79  ? -3.793  -8.622  8.361   1.00 0.00 ? 79  THR A CG2  6  
ATOM 10130 H H    . THR A 1 79  ? -6.219  -5.981  7.804   1.00 0.00 ? 79  THR A H    6  
ATOM 10131 H HA   . THR A 1 79  ? -4.902  -7.984  6.087   1.00 0.00 ? 79  THR A HA   6  
ATOM 10132 H HB   . THR A 1 79  ? -5.592  -9.661  7.891   1.00 0.00 ? 79  THR A HB   6  
ATOM 10133 H HG1  . THR A 1 79  ? -6.020  -8.843  9.909   1.00 0.00 ? 79  THR A HG1  6  
ATOM 10134 H HG21 . THR A 1 79  ? -3.394  -7.650  8.113   1.00 0.00 ? 79  THR A HG21 6  
ATOM 10135 H HG22 . THR A 1 79  ? -3.308  -9.375  7.758   1.00 0.00 ? 79  THR A HG22 6  
ATOM 10136 H HG23 . THR A 1 79  ? -3.616  -8.828  9.405   1.00 0.00 ? 79  THR A HG23 6  
ATOM 10137 N N    . ILE A 1 80  ? -7.066  -8.646  5.102   1.00 0.00 ? 80  ILE A N    6  
ATOM 10138 C CA   . ILE A 1 80  ? -8.325  -9.059  4.496   1.00 0.00 ? 80  ILE A CA   6  
ATOM 10139 C C    . ILE A 1 80  ? -8.445  -10.579 4.461   1.00 0.00 ? 80  ILE A C    6  
ATOM 10140 O O    . ILE A 1 80  ? -7.458  -11.286 4.263   1.00 0.00 ? 80  ILE A O    6  
ATOM 10141 C CB   . ILE A 1 80  ? -8.465  -8.511  3.063   1.00 0.00 ? 80  ILE A CB   6  
ATOM 10142 C CG1  . ILE A 1 80  ? -8.384  -6.984  3.066   1.00 0.00 ? 80  ILE A CG1  6  
ATOM 10143 C CG2  . ILE A 1 80  ? -9.775  -8.976  2.444   1.00 0.00 ? 80  ILE A CG2  6  
ATOM 10144 C CD1  . ILE A 1 80  ? -8.276  -6.380  1.685   1.00 0.00 ? 80  ILE A CD1  6  
ATOM 10145 H H    . ILE A 1 80  ? -6.237  -8.717  4.582   1.00 0.00 ? 80  ILE A H    6  
ATOM 10146 H HA   . ILE A 1 80  ? -9.129  -8.658  5.094   1.00 0.00 ? 80  ILE A HA   6  
ATOM 10147 H HB   . ILE A 1 80  ? -7.655  -8.907  2.470   1.00 0.00 ? 80  ILE A HB   6  
ATOM 10148 H HG12 . ILE A 1 80  ? -9.269  -6.584  3.534   1.00 0.00 ? 80  ILE A HG12 6  
ATOM 10149 H HG13 . ILE A 1 80  ? -7.515  -6.678  3.633   1.00 0.00 ? 80  ILE A HG13 6  
ATOM 10150 H HG21 . ILE A 1 80  ? -9.803  -10.055 2.429   1.00 0.00 ? 80  ILE A HG21 6  
ATOM 10151 H HG22 . ILE A 1 80  ? -10.601 -8.604  3.031   1.00 0.00 ? 80  ILE A HG22 6  
ATOM 10152 H HG23 . ILE A 1 80  ? -9.851  -8.599  1.437   1.00 0.00 ? 80  ILE A HG23 6  
ATOM 10153 H HD11 . ILE A 1 80  ? -9.016  -6.828  1.037   1.00 0.00 ? 80  ILE A HD11 6  
ATOM 10154 H HD12 . ILE A 1 80  ? -8.443  -5.316  1.742   1.00 0.00 ? 80  ILE A HD12 6  
ATOM 10155 H HD13 . ILE A 1 80  ? -7.290  -6.569  1.286   1.00 0.00 ? 80  ILE A HD13 6  
ATOM 10156 N N    . GLY A 1 81  ? -9.664  -11.076 4.652   1.00 0.00 ? 81  GLY A N    6  
ATOM 10157 C CA   . GLY A 1 81  ? -9.892  -12.509 4.638   1.00 0.00 ? 81  GLY A CA   6  
ATOM 10158 C C    . GLY A 1 81  ? -11.164 -12.884 3.905   1.00 0.00 ? 81  GLY A C    6  
ATOM 10159 O O    . GLY A 1 81  ? -11.752 -12.062 3.205   1.00 0.00 ? 81  GLY A O    6  
ATOM 10160 H H    . GLY A 1 81  ? -10.414 -10.463 4.805   1.00 0.00 ? 81  GLY A H    6  
ATOM 10161 H HA2  . GLY A 1 81  ? -9.054  -12.990 4.155   1.00 0.00 ? 81  GLY A HA2  6  
ATOM 10162 H HA3  . GLY A 1 81  ? -9.959  -12.860 5.656   1.00 0.00 ? 81  GLY A HA3  6  
ATOM 10163 N N    . ASN A 1 82  ? -11.589 -14.135 4.064   1.00 0.00 ? 82  ASN A N    6  
ATOM 10164 C CA   . ASN A 1 82  ? -12.799 -14.619 3.411   1.00 0.00 ? 82  ASN A CA   6  
ATOM 10165 C C    . ASN A 1 82  ? -12.646 -14.588 1.893   1.00 0.00 ? 82  ASN A C    6  
ATOM 10166 O O    . ASN A 1 82  ? -13.585 -14.246 1.171   1.00 0.00 ? 82  ASN A O    6  
ATOM 10167 C CB   . ASN A 1 82  ? -14.005 -13.776 3.831   1.00 0.00 ? 82  ASN A CB   6  
ATOM 10168 C CG   . ASN A 1 82  ? -15.310 -14.539 3.720   1.00 0.00 ? 82  ASN A CG   6  
ATOM 10169 O OD1  . ASN A 1 82  ? -15.484 -15.589 4.337   1.00 0.00 ? 82  ASN A OD1  6  
ATOM 10170 N ND2  . ASN A 1 82  ? -16.237 -14.012 2.928   1.00 0.00 ? 82  ASN A ND2  6  
ATOM 10171 H H    . ASN A 1 82  ? -11.076 -14.744 4.636   1.00 0.00 ? 82  ASN A H    6  
ATOM 10172 H HA   . ASN A 1 82  ? -12.958 -15.640 3.723   1.00 0.00 ? 82  ASN A HA   6  
ATOM 10173 H HB2  . ASN A 1 82  ? -13.878 -13.467 4.859   1.00 0.00 ? 82  ASN A HB2  6  
ATOM 10174 H HB3  . ASN A 1 82  ? -14.063 -12.903 3.201   1.00 0.00 ? 82  ASN A HB3  6  
ATOM 10175 H HD21 . ASN A 1 82  ? -16.029 -13.172 2.467   1.00 0.00 ? 82  ASN A HD21 6  
ATOM 10176 H HD22 . ASN A 1 82  ? -17.091 -14.484 2.837   1.00 0.00 ? 82  ASN A HD22 6  
ATOM 10177 N N    . LEU A 1 83  ? -11.460 -14.945 1.415   1.00 0.00 ? 83  LEU A N    6  
ATOM 10178 C CA   . LEU A 1 83  ? -11.184 -14.960 -0.017  1.00 0.00 ? 83  LEU A CA   6  
ATOM 10179 C C    . LEU A 1 83  ? -11.071 -16.389 -0.537  1.00 0.00 ? 83  LEU A C    6  
ATOM 10180 O O    . LEU A 1 83  ? -11.030 -17.342 0.241   1.00 0.00 ? 83  LEU A O    6  
ATOM 10181 C CB   . LEU A 1 83  ? -9.896  -14.191 -0.317  1.00 0.00 ? 83  LEU A CB   6  
ATOM 10182 C CG   . LEU A 1 83  ? -9.697  -12.887 0.458   1.00 0.00 ? 83  LEU A CG   6  
ATOM 10183 C CD1  . LEU A 1 83  ? -8.287  -12.353 0.248   1.00 0.00 ? 83  LEU A CD1  6  
ATOM 10184 C CD2  . LEU A 1 83  ? -10.729 -11.854 0.035   1.00 0.00 ? 83  LEU A CD2  6  
ATOM 10185 H H    . LEU A 1 83  ? -10.752 -15.206 2.039   1.00 0.00 ? 83  LEU A H    6  
ATOM 10186 H HA   . LEU A 1 83  ? -12.008 -14.472 -0.517  1.00 0.00 ? 83  LEU A HA   6  
ATOM 10187 H HB2  . LEU A 1 83  ? -9.064  -14.841 -0.089  1.00 0.00 ? 83  LEU A HB2  6  
ATOM 10188 H HB3  . LEU A 1 83  ? -9.888  -13.956 -1.371  1.00 0.00 ? 83  LEU A HB3  6  
ATOM 10189 H HG   . LEU A 1 83  ? -9.826  -13.080 1.513   1.00 0.00 ? 83  LEU A HG   6  
ATOM 10190 H HD11 . LEU A 1 83  ? -8.153  -12.086 -0.789  1.00 0.00 ? 83  LEU A HD11 6  
ATOM 10191 H HD12 . LEU A 1 83  ? -7.570  -13.112 0.521   1.00 0.00 ? 83  LEU A HD12 6  
ATOM 10192 H HD13 . LEU A 1 83  ? -8.140  -11.480 0.867   1.00 0.00 ? 83  LEU A HD13 6  
ATOM 10193 H HD21 . LEU A 1 83  ? -11.722 -12.257 0.178   1.00 0.00 ? 83  LEU A HD21 6  
ATOM 10194 H HD22 . LEU A 1 83  ? -10.587 -11.608 -1.008  1.00 0.00 ? 83  LEU A HD22 6  
ATOM 10195 H HD23 . LEU A 1 83  ? -10.615 -10.963 0.634   1.00 0.00 ? 83  LEU A HD23 6  
ATOM 10196 N N    . VAL A 1 84  ? -11.016 -16.531 -1.857  1.00 0.00 ? 84  VAL A N    6  
ATOM 10197 C CA   . VAL A 1 84  ? -10.903 -17.844 -2.480  1.00 0.00 ? 84  VAL A CA   6  
ATOM 10198 C C    . VAL A 1 84  ? -9.445  -18.277 -2.589  1.00 0.00 ? 84  VAL A C    6  
ATOM 10199 O O    . VAL A 1 84  ? -8.582  -17.526 -3.045  1.00 0.00 ? 84  VAL A O    6  
ATOM 10200 C CB   . VAL A 1 84  ? -11.536 -17.855 -3.885  1.00 0.00 ? 84  VAL A CB   6  
ATOM 10201 C CG1  . VAL A 1 84  ? -11.906 -19.273 -4.293  1.00 0.00 ? 84  VAL A CG1  6  
ATOM 10202 C CG2  . VAL A 1 84  ? -12.756 -16.946 -3.926  1.00 0.00 ? 84  VAL A CG2  6  
ATOM 10203 H H    . VAL A 1 84  ? -11.053 -15.733 -2.426  1.00 0.00 ? 84  VAL A H    6  
ATOM 10204 H HA   . VAL A 1 84  ? -11.435 -18.554 -1.863  1.00 0.00 ? 84  VAL A HA   6  
ATOM 10205 H HB   . VAL A 1 84  ? -10.810 -17.479 -4.589  1.00 0.00 ? 84  VAL A HB   6  
ATOM 10206 H HG11 . VAL A 1 84  ? -12.340 -19.261 -5.282  1.00 0.00 ? 84  VAL A HG11 6  
ATOM 10207 H HG12 . VAL A 1 84  ? -11.018 -19.889 -4.296  1.00 0.00 ? 84  VAL A HG12 6  
ATOM 10208 H HG13 . VAL A 1 84  ? -12.621 -19.675 -3.591  1.00 0.00 ? 84  VAL A HG13 6  
ATOM 10209 H HG21 . VAL A 1 84  ? -13.186 -16.879 -2.939  1.00 0.00 ? 84  VAL A HG21 6  
ATOM 10210 H HG22 . VAL A 1 84  ? -12.459 -15.961 -4.258  1.00 0.00 ? 84  VAL A HG22 6  
ATOM 10211 H HG23 . VAL A 1 84  ? -13.486 -17.351 -4.610  1.00 0.00 ? 84  VAL A HG23 6  
ATOM 10212 N N    . PRO A 1 85  ? -9.163  -19.516 -2.162  1.00 0.00 ? 85  PRO A N    6  
ATOM 10213 C CA   . PRO A 1 85  ? -7.810  -20.078 -2.202  1.00 0.00 ? 85  PRO A CA   6  
ATOM 10214 C C    . PRO A 1 85  ? -7.339  -20.355 -3.626  1.00 0.00 ? 85  PRO A C    6  
ATOM 10215 O O    . PRO A 1 85  ? -8.053  -20.974 -4.415  1.00 0.00 ? 85  PRO A O    6  
ATOM 10216 C CB   . PRO A 1 85  ? -7.946  -21.385 -1.419  1.00 0.00 ? 85  PRO A CB   6  
ATOM 10217 C CG   . PRO A 1 85  ? -9.381  -21.760 -1.551  1.00 0.00 ? 85  PRO A CG   6  
ATOM 10218 C CD   . PRO A 1 85  ? -10.143 -20.465 -1.607  1.00 0.00 ? 85  PRO A CD   6  
ATOM 10219 H HA   . PRO A 1 85  ? -7.097  -19.433 -1.709  1.00 0.00 ? 85  PRO A HA   6  
ATOM 10220 H HB2  . PRO A 1 85  ? -7.299  -22.136 -1.851  1.00 0.00 ? 85  PRO A HB2  6  
ATOM 10221 H HB3  . PRO A 1 85  ? -7.673  -21.221 -0.387  1.00 0.00 ? 85  PRO A HB3  6  
ATOM 10222 H HG2  . PRO A 1 85  ? -9.531  -22.323 -2.460  1.00 0.00 ? 85  PRO A HG2  6  
ATOM 10223 H HG3  . PRO A 1 85  ? -9.690  -22.340 -0.694  1.00 0.00 ? 85  PRO A HG3  6  
ATOM 10224 H HD2  . PRO A 1 85  ? -10.999 -20.560 -2.258  1.00 0.00 ? 85  PRO A HD2  6  
ATOM 10225 H HD3  . PRO A 1 85  ? -10.451 -20.165 -0.617  1.00 0.00 ? 85  PRO A HD3  6  
ATOM 10226 N N    . GLN A 1 86  ? -6.134  -19.896 -3.946  1.00 0.00 ? 86  GLN A N    6  
ATOM 10227 C CA   . GLN A 1 86  ? -5.569  -20.097 -5.276  1.00 0.00 ? 86  GLN A CA   6  
ATOM 10228 C C    . GLN A 1 86  ? -6.384  -19.353 -6.331  1.00 0.00 ? 86  GLN A C    6  
ATOM 10229 O O    . GLN A 1 86  ? -6.666  -19.888 -7.403  1.00 0.00 ? 86  GLN A O    6  
ATOM 10230 C CB   . GLN A 1 86  ? -5.520  -21.588 -5.613  1.00 0.00 ? 86  GLN A CB   6  
ATOM 10231 C CG   . GLN A 1 86  ? -4.980  -22.448 -4.482  1.00 0.00 ? 86  GLN A CG   6  
ATOM 10232 C CD   . GLN A 1 86  ? -4.592  -23.839 -4.940  1.00 0.00 ? 86  GLN A CD   6  
ATOM 10233 O OE1  . GLN A 1 86  ? -4.011  -24.014 -6.013  1.00 0.00 ? 86  GLN A OE1  6  
ATOM 10234 N NE2  . GLN A 1 86  ? -4.910  -24.842 -4.130  1.00 0.00 ? 86  GLN A NE2  6  
ATOM 10235 H H    . GLN A 1 86  ? -5.612  -19.412 -3.274  1.00 0.00 ? 86  GLN A H    6  
ATOM 10236 H HA   . GLN A 1 86  ? -4.565  -19.703 -5.271  1.00 0.00 ? 86  GLN A HA   6  
ATOM 10237 H HB2  . GLN A 1 86  ? -6.517  -21.926 -5.849  1.00 0.00 ? 86  GLN A HB2  6  
ATOM 10238 H HB3  . GLN A 1 86  ? -4.886  -21.728 -6.475  1.00 0.00 ? 86  GLN A HB3  6  
ATOM 10239 H HG2  . GLN A 1 86  ? -4.107  -21.968 -4.065  1.00 0.00 ? 86  GLN A HG2  6  
ATOM 10240 H HG3  . GLN A 1 86  ? -5.740  -22.535 -3.719  1.00 0.00 ? 86  GLN A HG3  6  
ATOM 10241 H HE21 . GLN A 1 86  ? -5.373  -24.630 -3.291  1.00 0.00 ? 86  GLN A HE21 6  
ATOM 10242 H HE22 . GLN A 1 86  ? -4.672  -25.752 -4.402  1.00 0.00 ? 86  GLN A HE22 6  
ATOM 10243 N N    . LYS A 1 87  ? -6.757  -18.116 -6.018  1.00 0.00 ? 87  LYS A N    6  
ATOM 10244 C CA   . LYS A 1 87  ? -7.538  -17.298 -6.939  1.00 0.00 ? 87  LYS A CA   6  
ATOM 10245 C C    . LYS A 1 87  ? -6.956  -15.892 -7.043  1.00 0.00 ? 87  LYS A C    6  
ATOM 10246 O O    . LYS A 1 87  ? -6.785  -15.203 -6.036  1.00 0.00 ? 87  LYS A O    6  
ATOM 10247 C CB   . LYS A 1 87  ? -8.995  -17.225 -6.479  1.00 0.00 ? 87  LYS A CB   6  
ATOM 10248 C CG   . LYS A 1 87  ? -9.817  -18.441 -6.870  1.00 0.00 ? 87  LYS A CG   6  
ATOM 10249 C CD   . LYS A 1 87  ? -9.920  -18.583 -8.379  1.00 0.00 ? 87  LYS A CD   6  
ATOM 10250 C CE   . LYS A 1 87  ? -11.246 -19.202 -8.791  1.00 0.00 ? 87  LYS A CE   6  
ATOM 10251 N NZ   . LYS A 1 87  ? -11.593 -18.884 -10.205 1.00 0.00 ? 87  LYS A NZ   6  
ATOM 10252 H H    . LYS A 1 87  ? -6.501  -17.745 -5.148  1.00 0.00 ? 87  LYS A H    6  
ATOM 10253 H HA   . LYS A 1 87  ? -7.498  -17.763 -7.912  1.00 0.00 ? 87  LYS A HA   6  
ATOM 10254 H HB2  . LYS A 1 87  ? -9.016  -17.134 -5.402  1.00 0.00 ? 87  LYS A HB2  6  
ATOM 10255 H HB3  . LYS A 1 87  ? -9.455  -16.351 -6.916  1.00 0.00 ? 87  LYS A HB3  6  
ATOM 10256 H HG2  . LYS A 1 87  ? -9.349  -19.327 -6.467  1.00 0.00 ? 87  LYS A HG2  6  
ATOM 10257 H HG3  . LYS A 1 87  ? -10.811 -18.340 -6.458  1.00 0.00 ? 87  LYS A HG3  6  
ATOM 10258 H HD2  . LYS A 1 87  ? -9.836  -17.606 -8.829  1.00 0.00 ? 87  LYS A HD2  6  
ATOM 10259 H HD3  . LYS A 1 87  ? -9.115  -19.214 -8.729  1.00 0.00 ? 87  LYS A HD3  6  
ATOM 10260 H HE2  . LYS A 1 87  ? -11.180 -20.273 -8.679  1.00 0.00 ? 87  LYS A HE2  6  
ATOM 10261 H HE3  . LYS A 1 87  ? -12.023 -18.821 -8.146  1.00 0.00 ? 87  LYS A HE3  6  
ATOM 10262 H HZ1  . LYS A 1 87  ? -12.383 -18.208 -10.235 1.00 0.00 ? 87  LYS A HZ1  6  
ATOM 10263 H HZ2  . LYS A 1 87  ? -11.872 -19.749 -10.707 1.00 0.00 ? 87  LYS A HZ2  6  
ATOM 10264 H HZ3  . LYS A 1 87  ? -10.772 -18.464 -10.687 1.00 0.00 ? 87  LYS A HZ3  6  
ATOM 10265 N N    . THR A 1 88  ? -6.655  -15.469 -8.267  1.00 0.00 ? 88  THR A N    6  
ATOM 10266 C CA   . THR A 1 88  ? -6.093  -14.146 -8.502  1.00 0.00 ? 88  THR A CA   6  
ATOM 10267 C C    . THR A 1 88  ? -6.930  -13.065 -7.826  1.00 0.00 ? 88  THR A C    6  
ATOM 10268 O O    . THR A 1 88  ? -8.155  -13.170 -7.751  1.00 0.00 ? 88  THR A O    6  
ATOM 10269 C CB   . THR A 1 88  ? -5.997  -13.836 -10.008 1.00 0.00 ? 88  THR A CB   6  
ATOM 10270 O OG1  . THR A 1 88  ? -5.366  -14.924 -10.693 1.00 0.00 ? 88  THR A OG1  6  
ATOM 10271 C CG2  . THR A 1 88  ? -5.212  -12.556 -10.248 1.00 0.00 ? 88  THR A CG2  6  
ATOM 10272 H H    . THR A 1 88  ? -6.815  -16.065 -9.029  1.00 0.00 ? 88  THR A H    6  
ATOM 10273 H HA   . THR A 1 88  ? -5.097  -14.127 -8.088  1.00 0.00 ? 88  THR A HA   6  
ATOM 10274 H HB   . THR A 1 88  ? -6.996  -13.706 -10.398 1.00 0.00 ? 88  THR A HB   6  
ATOM 10275 H HG1  . THR A 1 88  ? -4.414  -14.803 -10.676 1.00 0.00 ? 88  THR A HG1  6  
ATOM 10276 H HG21 . THR A 1 88  ? -4.821  -12.190 -9.309  1.00 0.00 ? 88  THR A HG21 6  
ATOM 10277 H HG22 . THR A 1 88  ? -5.861  -11.809 -10.682 1.00 0.00 ? 88  THR A HG22 6  
ATOM 10278 H HG23 . THR A 1 88  ? -4.393  -12.757 -10.923 1.00 0.00 ? 88  THR A HG23 6  
ATOM 10279 N N    . TYR A 1 89  ? -6.261  -12.028 -7.335  1.00 0.00 ? 89  TYR A N    6  
ATOM 10280 C CA   . TYR A 1 89  ? -6.944  -10.928 -6.663  1.00 0.00 ? 89  TYR A CA   6  
ATOM 10281 C C    . TYR A 1 89  ? -6.173  -9.623  -6.834  1.00 0.00 ? 89  TYR A C    6  
ATOM 10282 O O    . TYR A 1 89  ? -4.957  -9.577  -6.645  1.00 0.00 ? 89  TYR A O    6  
ATOM 10283 C CB   . TYR A 1 89  ? -7.117  -11.241 -5.175  1.00 0.00 ? 89  TYR A CB   6  
ATOM 10284 C CG   . TYR A 1 89  ? -8.542  -11.556 -4.786  1.00 0.00 ? 89  TYR A CG   6  
ATOM 10285 C CD1  . TYR A 1 89  ? -9.073  -12.825 -4.985  1.00 0.00 ? 89  TYR A CD1  6  
ATOM 10286 C CD2  . TYR A 1 89  ? -9.359  -10.587 -4.215  1.00 0.00 ? 89  TYR A CD2  6  
ATOM 10287 C CE1  . TYR A 1 89  ? -10.375 -13.118 -4.630  1.00 0.00 ? 89  TYR A CE1  6  
ATOM 10288 C CE2  . TYR A 1 89  ? -10.662 -10.872 -3.856  1.00 0.00 ? 89  TYR A CE2  6  
ATOM 10289 C CZ   . TYR A 1 89  ? -11.166 -12.139 -4.066  1.00 0.00 ? 89  TYR A CZ   6  
ATOM 10290 O OH   . TYR A 1 89  ? -12.464 -12.428 -3.710  1.00 0.00 ? 89  TYR A OH   6  
ATOM 10291 H H    . TYR A 1 89  ? -5.287  -12.000 -7.426  1.00 0.00 ? 89  TYR A H    6  
ATOM 10292 H HA   . TYR A 1 89  ? -7.920  -10.818 -7.113  1.00 0.00 ? 89  TYR A HA   6  
ATOM 10293 H HB2  . TYR A 1 89  ? -6.506  -12.093 -4.921  1.00 0.00 ? 89  TYR A HB2  6  
ATOM 10294 H HB3  . TYR A 1 89  ? -6.795  -10.387 -4.596  1.00 0.00 ? 89  TYR A HB3  6  
ATOM 10295 H HD1  . TYR A 1 89  ? -8.451  -13.591 -5.425  1.00 0.00 ? 89  TYR A HD1  6  
ATOM 10296 H HD2  . TYR A 1 89  ? -8.962  -9.596  -4.052  1.00 0.00 ? 89  TYR A HD2  6  
ATOM 10297 H HE1  . TYR A 1 89  ? -10.770 -14.111 -4.793  1.00 0.00 ? 89  TYR A HE1  6  
ATOM 10298 H HE2  . TYR A 1 89  ? -11.282 -10.106 -3.415  1.00 0.00 ? 89  TYR A HE2  6  
ATOM 10299 H HH   . TYR A 1 89  ? -12.838 -11.682 -3.235  1.00 0.00 ? 89  TYR A HH   6  
ATOM 10300 N N    . SER A 1 90  ? -6.890  -8.561  -7.191  1.00 0.00 ? 90  SER A N    6  
ATOM 10301 C CA   . SER A 1 90  ? -6.275  -7.255  -7.391  1.00 0.00 ? 90  SER A CA   6  
ATOM 10302 C C    . SER A 1 90  ? -6.304  -6.438  -6.104  1.00 0.00 ? 90  SER A C    6  
ATOM 10303 O O    . SER A 1 90  ? -7.156  -6.649  -5.241  1.00 0.00 ? 90  SER A O    6  
ATOM 10304 C CB   . SER A 1 90  ? -6.993  -6.495  -8.507  1.00 0.00 ? 90  SER A CB   6  
ATOM 10305 O OG   . SER A 1 90  ? -6.070  -5.805  -9.331  1.00 0.00 ? 90  SER A OG   6  
ATOM 10306 H H    . SER A 1 90  ? -7.855  -8.662  -7.327  1.00 0.00 ? 90  SER A H    6  
ATOM 10307 H HA   . SER A 1 90  ? -5.246  -7.413  -7.680  1.00 0.00 ? 90  SER A HA   6  
ATOM 10308 H HB2  . SER A 1 90  ? -7.547  -7.193  -9.116  1.00 0.00 ? 90  SER A HB2  6  
ATOM 10309 H HB3  . SER A 1 90  ? -7.673  -5.778  -8.070  1.00 0.00 ? 90  SER A HB3  6  
ATOM 10310 H HG   . SER A 1 90  ? -5.531  -5.221  -8.791  1.00 0.00 ? 90  SER A HG   6  
ATOM 10311 N N    . VAL A 1 91  ? -5.366  -5.504  -5.982  1.00 0.00 ? 91  VAL A N    6  
ATOM 10312 C CA   . VAL A 1 91  ? -5.283  -4.653  -4.799  1.00 0.00 ? 91  VAL A CA   6  
ATOM 10313 C C    . VAL A 1 91  ? -4.818  -3.249  -5.165  1.00 0.00 ? 91  VAL A C    6  
ATOM 10314 O O    . VAL A 1 91  ? -4.050  -3.062  -6.109  1.00 0.00 ? 91  VAL A O    6  
ATOM 10315 C CB   . VAL A 1 91  ? -4.324  -5.243  -3.749  1.00 0.00 ? 91  VAL A CB   6  
ATOM 10316 C CG1  . VAL A 1 91  ? -4.396  -4.448  -2.454  1.00 0.00 ? 91  VAL A CG1  6  
ATOM 10317 C CG2  . VAL A 1 91  ? -4.642  -6.710  -3.502  1.00 0.00 ? 91  VAL A CG2  6  
ATOM 10318 H H    . VAL A 1 91  ? -4.714  -5.384  -6.703  1.00 0.00 ? 91  VAL A H    6  
ATOM 10319 H HA   . VAL A 1 91  ? -6.270  -4.594  -4.362  1.00 0.00 ? 91  VAL A HA   6  
ATOM 10320 H HB   . VAL A 1 91  ? -3.317  -5.175  -4.133  1.00 0.00 ? 91  VAL A HB   6  
ATOM 10321 H HG11 . VAL A 1 91  ? -4.075  -5.071  -1.631  1.00 0.00 ? 91  VAL A HG11 6  
ATOM 10322 H HG12 . VAL A 1 91  ? -3.752  -3.585  -2.526  1.00 0.00 ? 91  VAL A HG12 6  
ATOM 10323 H HG13 . VAL A 1 91  ? -5.413  -4.127  -2.285  1.00 0.00 ? 91  VAL A HG13 6  
ATOM 10324 H HG21 . VAL A 1 91  ? -4.234  -7.307  -4.305  1.00 0.00 ? 91  VAL A HG21 6  
ATOM 10325 H HG22 . VAL A 1 91  ? -4.204  -7.022  -2.565  1.00 0.00 ? 91  VAL A HG22 6  
ATOM 10326 H HG23 . VAL A 1 91  ? -5.713  -6.845  -3.461  1.00 0.00 ? 91  VAL A HG23 6  
ATOM 10327 N N    . LYS A 1 92  ? -5.288  -2.261  -4.411  1.00 0.00 ? 92  LYS A N    6  
ATOM 10328 C CA   . LYS A 1 92  ? -4.919  -0.871  -4.652  1.00 0.00 ? 92  LYS A CA   6  
ATOM 10329 C C    . LYS A 1 92  ? -4.977  -0.060  -3.362  1.00 0.00 ? 92  LYS A C    6  
ATOM 10330 O O    . LYS A 1 92  ? -5.726  -0.391  -2.443  1.00 0.00 ? 92  LYS A O    6  
ATOM 10331 C CB   . LYS A 1 92  ? -5.847  -0.250  -5.699  1.00 0.00 ? 92  LYS A CB   6  
ATOM 10332 C CG   . LYS A 1 92  ? -5.718  -0.880  -7.076  1.00 0.00 ? 92  LYS A CG   6  
ATOM 10333 C CD   . LYS A 1 92  ? -6.644  -0.214  -8.081  1.00 0.00 ? 92  LYS A CD   6  
ATOM 10334 C CE   . LYS A 1 92  ? -5.925  0.873   -8.864  1.00 0.00 ? 92  LYS A CE   6  
ATOM 10335 N NZ   . LYS A 1 92  ? -6.785  1.448   -9.933  1.00 0.00 ? 92  LYS A NZ   6  
ATOM 10336 H H    . LYS A 1 92  ? -5.897  -2.471  -3.672  1.00 0.00 ? 92  LYS A H    6  
ATOM 10337 H HA   . LYS A 1 92  ? -3.907  -0.856  -5.027  1.00 0.00 ? 92  LYS A HA   6  
ATOM 10338 H HB2  . LYS A 1 92  ? -6.869  -0.363  -5.369  1.00 0.00 ? 92  LYS A HB2  6  
ATOM 10339 H HB3  . LYS A 1 92  ? -5.619  0.802   -5.785  1.00 0.00 ? 92  LYS A HB3  6  
ATOM 10340 H HG2  . LYS A 1 92  ? -4.699  -0.775  -7.416  1.00 0.00 ? 92  LYS A HG2  6  
ATOM 10341 H HG3  . LYS A 1 92  ? -5.971  -1.928  -7.007  1.00 0.00 ? 92  LYS A HG3  6  
ATOM 10342 H HD2  . LYS A 1 92  ? -7.004  -0.960  -8.774  1.00 0.00 ? 92  LYS A HD2  6  
ATOM 10343 H HD3  . LYS A 1 92  ? -7.478  0.224   -7.554  1.00 0.00 ? 92  LYS A HD3  6  
ATOM 10344 H HE2  . LYS A 1 92  ? -5.639  1.660   -8.181  1.00 0.00 ? 92  LYS A HE2  6  
ATOM 10345 H HE3  . LYS A 1 92  ? -5.039  0.451   -9.314  1.00 0.00 ? 92  LYS A HE3  6  
ATOM 10346 H HZ1  . LYS A 1 92  ? -7.214  2.339   -9.607  1.00 0.00 ? 92  LYS A HZ1  6  
ATOM 10347 H HZ2  . LYS A 1 92  ? -7.545  0.781   -10.177 1.00 0.00 ? 92  LYS A HZ2  6  
ATOM 10348 H HZ3  . LYS A 1 92  ? -6.220  1.640   -10.784 1.00 0.00 ? 92  LYS A HZ3  6  
ATOM 10349 N N    . VAL A 1 93  ? -4.181  1.003   -3.300  1.00 0.00 ? 93  VAL A N    6  
ATOM 10350 C CA   . VAL A 1 93  ? -4.144  1.863   -2.124  1.00 0.00 ? 93  VAL A CA   6  
ATOM 10351 C C    . VAL A 1 93  ? -3.912  3.319   -2.513  1.00 0.00 ? 93  VAL A C    6  
ATOM 10352 O O    . VAL A 1 93  ? -3.243  3.608   -3.506  1.00 0.00 ? 93  VAL A O    6  
ATOM 10353 C CB   . VAL A 1 93  ? -3.042  1.424   -1.141  1.00 0.00 ? 93  VAL A CB   6  
ATOM 10354 C CG1  . VAL A 1 93  ? -3.130  2.220   0.151   1.00 0.00 ? 93  VAL A CG1  6  
ATOM 10355 C CG2  . VAL A 1 93  ? -3.140  -0.069  -0.866  1.00 0.00 ? 93  VAL A CG2  6  
ATOM 10356 H H    . VAL A 1 93  ? -3.606  1.215   -4.064  1.00 0.00 ? 93  VAL A H    6  
ATOM 10357 H HA   . VAL A 1 93  ? -5.097  1.783   -1.620  1.00 0.00 ? 93  VAL A HA   6  
ATOM 10358 H HB   . VAL A 1 93  ? -2.083  1.623   -1.597  1.00 0.00 ? 93  VAL A HB   6  
ATOM 10359 H HG11 . VAL A 1 93  ? -2.380  2.998   0.145   1.00 0.00 ? 93  VAL A HG11 6  
ATOM 10360 H HG12 . VAL A 1 93  ? -4.110  2.665   0.235   1.00 0.00 ? 93  VAL A HG12 6  
ATOM 10361 H HG13 . VAL A 1 93  ? -2.958  1.562   0.991   1.00 0.00 ? 93  VAL A HG13 6  
ATOM 10362 H HG21 . VAL A 1 93  ? -2.903  -0.617  -1.765  1.00 0.00 ? 93  VAL A HG21 6  
ATOM 10363 H HG22 . VAL A 1 93  ? -2.440  -0.338  -0.087  1.00 0.00 ? 93  VAL A HG22 6  
ATOM 10364 H HG23 . VAL A 1 93  ? -4.142  -0.312  -0.548  1.00 0.00 ? 93  VAL A HG23 6  
ATOM 10365 N N    . LEU A 1 94  ? -4.469  4.231   -1.725  1.00 0.00 ? 94  LEU A N    6  
ATOM 10366 C CA   . LEU A 1 94  ? -4.322  5.659   -1.986  1.00 0.00 ? 94  LEU A CA   6  
ATOM 10367 C C    . LEU A 1 94  ? -4.381  6.460   -0.689  1.00 0.00 ? 94  LEU A C    6  
ATOM 10368 O O    . LEU A 1 94  ? -4.744  5.932   0.361   1.00 0.00 ? 94  LEU A O    6  
ATOM 10369 C CB   . LEU A 1 94  ? -5.416  6.137   -2.944  1.00 0.00 ? 94  LEU A CB   6  
ATOM 10370 C CG   . LEU A 1 94  ? -6.777  6.434   -2.315  1.00 0.00 ? 94  LEU A CG   6  
ATOM 10371 C CD1  . LEU A 1 94  ? -6.858  7.889   -1.882  1.00 0.00 ? 94  LEU A CD1  6  
ATOM 10372 C CD2  . LEU A 1 94  ? -7.899  6.101   -3.288  1.00 0.00 ? 94  LEU A CD2  6  
ATOM 10373 H H    . LEU A 1 94  ? -4.991  3.940   -0.948  1.00 0.00 ? 94  LEU A H    6  
ATOM 10374 H HA   . LEU A 1 94  ? -3.358  5.815   -2.448  1.00 0.00 ? 94  LEU A HA   6  
ATOM 10375 H HB2  . LEU A 1 94  ? -5.066  7.042   -3.419  1.00 0.00 ? 94  LEU A HB2  6  
ATOM 10376 H HB3  . LEU A 1 94  ? -5.556  5.372   -3.693  1.00 0.00 ? 94  LEU A HB3  6  
ATOM 10377 H HG   . LEU A 1 94  ? -6.901  5.818   -1.434  1.00 0.00 ? 94  LEU A HG   6  
ATOM 10378 H HD11 . LEU A 1 94  ? -6.629  7.967   -0.830  1.00 0.00 ? 94  LEU A HD11 6  
ATOM 10379 H HD12 . LEU A 1 94  ? -7.856  8.264   -2.062  1.00 0.00 ? 94  LEU A HD12 6  
ATOM 10380 H HD13 . LEU A 1 94  ? -6.149  8.475   -2.450  1.00 0.00 ? 94  LEU A HD13 6  
ATOM 10381 H HD21 . LEU A 1 94  ? -8.442  7.001   -3.530  1.00 0.00 ? 94  LEU A HD21 6  
ATOM 10382 H HD22 . LEU A 1 94  ? -8.569  5.386   -2.832  1.00 0.00 ? 94  LEU A HD22 6  
ATOM 10383 H HD23 . LEU A 1 94  ? -7.479  5.679   -4.189  1.00 0.00 ? 94  LEU A HD23 6  
ATOM 10384 N N    . ALA A 1 95  ? -4.024  7.737   -0.771  1.00 0.00 ? 95  ALA A N    6  
ATOM 10385 C CA   . ALA A 1 95  ? -4.041  8.612   0.396   1.00 0.00 ? 95  ALA A CA   6  
ATOM 10386 C C    . ALA A 1 95  ? -5.072  9.722   0.233   1.00 0.00 ? 95  ALA A C    6  
ATOM 10387 O O    . ALA A 1 95  ? -5.340  10.179  -0.878  1.00 0.00 ? 95  ALA A O    6  
ATOM 10388 C CB   . ALA A 1 95  ? -2.659  9.203   0.631   1.00 0.00 ? 95  ALA A CB   6  
ATOM 10389 H H    . ALA A 1 95  ? -3.745  8.100   -1.637  1.00 0.00 ? 95  ALA A H    6  
ATOM 10390 H HA   . ALA A 1 95  ? -4.301  8.014   1.256   1.00 0.00 ? 95  ALA A HA   6  
ATOM 10391 H HB1  . ALA A 1 95  ? -2.251  9.549   -0.308  1.00 0.00 ? 95  ALA A HB1  6  
ATOM 10392 H HB2  . ALA A 1 95  ? -2.735  10.032  1.319   1.00 0.00 ? 95  ALA A HB2  6  
ATOM 10393 H HB3  . ALA A 1 95  ? -2.010  8.446   1.048   1.00 0.00 ? 95  ALA A HB3  6  
ATOM 10394 N N    . PHE A 1 96  ? -5.652  10.153  1.350   1.00 0.00 ? 96  PHE A N    6  
ATOM 10395 C CA   . PHE A 1 96  ? -6.657  11.209  1.332   1.00 0.00 ? 96  PHE A CA   6  
ATOM 10396 C C    . PHE A 1 96  ? -6.644  11.994  2.639   1.00 0.00 ? 96  PHE A C    6  
ATOM 10397 O O    . PHE A 1 96  ? -6.464  11.427  3.718   1.00 0.00 ? 96  PHE A O    6  
ATOM 10398 C CB   . PHE A 1 96  ? -8.048  10.616  1.094   1.00 0.00 ? 96  PHE A CB   6  
ATOM 10399 C CG   . PHE A 1 96  ? -8.534  9.755   2.226   1.00 0.00 ? 96  PHE A CG   6  
ATOM 10400 C CD1  . PHE A 1 96  ? -9.162  10.322  3.324   1.00 0.00 ? 96  PHE A CD1  6  
ATOM 10401 C CD2  . PHE A 1 96  ? -8.361  8.382   2.194   1.00 0.00 ? 96  PHE A CD2  6  
ATOM 10402 C CE1  . PHE A 1 96  ? -9.611  9.533   4.366   1.00 0.00 ? 96  PHE A CE1  6  
ATOM 10403 C CE2  . PHE A 1 96  ? -8.808  7.587   3.233   1.00 0.00 ? 96  PHE A CE2  6  
ATOM 10404 C CZ   . PHE A 1 96  ? -9.432  8.165   4.321   1.00 0.00 ? 96  PHE A CZ   6  
ATOM 10405 H H    . PHE A 1 96  ? -5.398  9.748   2.206   1.00 0.00 ? 96  PHE A H    6  
ATOM 10406 H HA   . PHE A 1 96  ? -6.418  11.879  0.521   1.00 0.00 ? 96  PHE A HA   6  
ATOM 10407 H HB2  . PHE A 1 96  ? -8.756  11.420  0.961   1.00 0.00 ? 96  PHE A HB2  6  
ATOM 10408 H HB3  . PHE A 1 96  ? -8.025  10.010  0.201   1.00 0.00 ? 96  PHE A HB3  6  
ATOM 10409 H HD1  . PHE A 1 96  ? -9.302  11.394  3.360   1.00 0.00 ? 96  PHE A HD1  6  
ATOM 10410 H HD2  . PHE A 1 96  ? -7.873  7.929   1.343   1.00 0.00 ? 96  PHE A HD2  6  
ATOM 10411 H HE1  . PHE A 1 96  ? -10.098 9.989   5.216   1.00 0.00 ? 96  PHE A HE1  6  
ATOM 10412 H HE2  . PHE A 1 96  ? -8.667  6.518   3.195   1.00 0.00 ? 96  PHE A HE2  6  
ATOM 10413 H HZ   . PHE A 1 96  ? -9.782  7.547   5.136   1.00 0.00 ? 96  PHE A HZ   6  
ATOM 10414 N N    . THR A 1 97  ? -6.834  13.306  2.537   1.00 0.00 ? 97  THR A N    6  
ATOM 10415 C CA   . THR A 1 97  ? -6.843  14.172  3.711   1.00 0.00 ? 97  THR A CA   6  
ATOM 10416 C C    . THR A 1 97  ? -8.138  14.971  3.794   1.00 0.00 ? 97  THR A C    6  
ATOM 10417 O O    . THR A 1 97  ? -9.006  14.856  2.930   1.00 0.00 ? 97  THR A O    6  
ATOM 10418 C CB   . THR A 1 97  ? -5.650  15.147  3.697   1.00 0.00 ? 97  THR A CB   6  
ATOM 10419 O OG1  . THR A 1 97  ? -5.783  16.068  2.609   1.00 0.00 ? 97  THR A OG1  6  
ATOM 10420 C CG2  . THR A 1 97  ? -4.335  14.393  3.571   1.00 0.00 ? 97  THR A CG2  6  
ATOM 10421 H H    . THR A 1 97  ? -6.972  13.700  1.651   1.00 0.00 ? 97  THR A H    6  
ATOM 10422 H HA   . THR A 1 97  ? -6.760  13.545  4.587   1.00 0.00 ? 97  THR A HA   6  
ATOM 10423 H HB   . THR A 1 97  ? -5.644  15.698  4.626   1.00 0.00 ? 97  THR A HB   6  
ATOM 10424 H HG1  . THR A 1 97  ? -4.938  16.494  2.446   1.00 0.00 ? 97  THR A HG1  6  
ATOM 10425 H HG21 . THR A 1 97  ? -4.324  13.569  4.271   1.00 0.00 ? 97  THR A HG21 6  
ATOM 10426 H HG22 . THR A 1 97  ? -3.515  15.060  3.786   1.00 0.00 ? 97  THR A HG22 6  
ATOM 10427 H HG23 . THR A 1 97  ? -4.234  14.010  2.565   1.00 0.00 ? 97  THR A HG23 6  
ATOM 10428 N N    . SER A 1 98  ? -8.260  15.783  4.840   1.00 0.00 ? 98  SER A N    6  
ATOM 10429 C CA   . SER A 1 98  ? -9.452  16.600  5.038   1.00 0.00 ? 98  SER A CA   6  
ATOM 10430 C C    . SER A 1 98  ? -9.720  17.474  3.818   1.00 0.00 ? 98  SER A C    6  
ATOM 10431 O O    . SER A 1 98  ? -10.860 17.858  3.555   1.00 0.00 ? 98  SER A O    6  
ATOM 10432 C CB   . SER A 1 98  ? -9.292  17.476  6.281   1.00 0.00 ? 98  SER A CB   6  
ATOM 10433 O OG   . SER A 1 98  ? -8.876  18.786  5.933   1.00 0.00 ? 98  SER A OG   6  
ATOM 10434 H H    . SER A 1 98  ? -7.532  15.830  5.495   1.00 0.00 ? 98  SER A H    6  
ATOM 10435 H HA   . SER A 1 98  ? -10.289 15.934  5.182   1.00 0.00 ? 98  SER A HA   6  
ATOM 10436 H HB2  . SER A 1 98  ? -10.238 17.539  6.799   1.00 0.00 ? 98  SER A HB2  6  
ATOM 10437 H HB3  . SER A 1 98  ? -8.552  17.038  6.936   1.00 0.00 ? 98  SER A HB3  6  
ATOM 10438 H HG   . SER A 1 98  ? -8.038  18.979  6.359   1.00 0.00 ? 98  SER A HG   6  
ATOM 10439 N N    . ILE A 1 99  ? -8.662  17.784  3.075   1.00 0.00 ? 99  ILE A N    6  
ATOM 10440 C CA   . ILE A 1 99  ? -8.784  18.610  1.881   1.00 0.00 ? 99  ILE A CA   6  
ATOM 10441 C C    . ILE A 1 99  ? -9.454  17.844  0.746   1.00 0.00 ? 99  ILE A C    6  
ATOM 10442 O O    . ILE A 1 99  ? -10.461 18.285  0.193   1.00 0.00 ? 99  ILE A O    6  
ATOM 10443 C CB   . ILE A 1 99  ? -7.409  19.115  1.402   1.00 0.00 ? 99  ILE A CB   6  
ATOM 10444 C CG1  . ILE A 1 99  ? -6.724  19.921  2.507   1.00 0.00 ? 99  ILE A CG1  6  
ATOM 10445 C CG2  . ILE A 1 99  ? -7.562  19.954  0.143   1.00 0.00 ? 99  ILE A CG2  6  
ATOM 10446 C CD1  . ILE A 1 99  ? -7.494  21.156  2.920   1.00 0.00 ? 99  ILE A CD1  6  
ATOM 10447 H H    . ILE A 1 99  ? -7.779  17.447  3.335   1.00 0.00 ? 99  ILE A H    6  
ATOM 10448 H HA   . ILE A 1 99  ? -9.392  19.468  2.129   1.00 0.00 ? 99  ILE A HA   6  
ATOM 10449 H HB   . ILE A 1 99  ? -6.800  18.255  1.162   1.00 0.00 ? 99  ILE A HB   6  
ATOM 10450 H HG12 . ILE A 1 99  ? -6.608  19.297  3.380   1.00 0.00 ? 99  ILE A HG12 6  
ATOM 10451 H HG13 . ILE A 1 99  ? -5.750  20.236  2.162   1.00 0.00 ? 99  ILE A HG13 6  
ATOM 10452 H HG21 . ILE A 1 99  ? -7.035  20.889  0.267   1.00 0.00 ? 99  ILE A HG21 6  
ATOM 10453 H HG22 . ILE A 1 99  ? -7.147  19.418  -0.698  1.00 0.00 ? 99  ILE A HG22 6  
ATOM 10454 H HG23 . ILE A 1 99  ? -8.608  20.151  -0.034  1.00 0.00 ? 99  ILE A HG23 6  
ATOM 10455 H HD11 . ILE A 1 99  ? -6.965  21.663  3.713   1.00 0.00 ? 99  ILE A HD11 6  
ATOM 10456 H HD12 . ILE A 1 99  ? -7.595  21.817  2.072   1.00 0.00 ? 99  ILE A HD12 6  
ATOM 10457 H HD13 . ILE A 1 99  ? -8.475  20.868  3.270   1.00 0.00 ? 99  ILE A HD13 6  
ATOM 10458 N N    . GLY A 1 100 ? -8.890  16.689  0.405   1.00 0.00 ? 100 GLY A N    6  
ATOM 10459 C CA   . GLY A 1 100 ? -9.447  15.877  -0.661  1.00 0.00 ? 100 GLY A CA   6  
ATOM 10460 C C    . GLY A 1 100 ? -8.820  14.499  -0.728  1.00 0.00 ? 100 GLY A C    6  
ATOM 10461 O O    . GLY A 1 100 ? -8.371  13.964  0.285   1.00 0.00 ? 100 GLY A O    6  
ATOM 10462 H H    . GLY A 1 100 ? -8.087  16.385  0.881   1.00 0.00 ? 100 GLY A H    6  
ATOM 10463 H HA2  . GLY A 1 100 ? -10.509 15.771  -0.501  1.00 0.00 ? 100 GLY A HA2  6  
ATOM 10464 H HA3  . GLY A 1 100 ? -9.285  16.380  -1.603  1.00 0.00 ? 100 GLY A HA3  6  
ATOM 10465 N N    . ASP A 1 101 ? -8.793  13.921  -1.924  1.00 0.00 ? 101 ASP A N    6  
ATOM 10466 C CA   . ASP A 1 101 ? -8.218  12.596  -2.120  1.00 0.00 ? 101 ASP A CA   6  
ATOM 10467 C C    . ASP A 1 101 ? -6.932  12.676  -2.937  1.00 0.00 ? 101 ASP A C    6  
ATOM 10468 O O    . ASP A 1 101 ? -6.558  13.743  -3.421  1.00 0.00 ? 101 ASP A O    6  
ATOM 10469 C CB   . ASP A 1 101 ? -9.223  11.677  -2.816  1.00 0.00 ? 101 ASP A CB   6  
ATOM 10470 C CG   . ASP A 1 101 ? -9.903  12.350  -3.992  1.00 0.00 ? 101 ASP A CG   6  
ATOM 10471 O OD1  . ASP A 1 101 ? -9.259  12.485  -5.053  1.00 0.00 ? 101 ASP A OD1  6  
ATOM 10472 O OD2  . ASP A 1 101 ? -11.081 12.741  -3.852  1.00 0.00 ? 101 ASP A OD2  6  
ATOM 10473 H H    . ASP A 1 101 ? -9.168  14.397  -2.695  1.00 0.00 ? 101 ASP A H    6  
ATOM 10474 H HA   . ASP A 1 101 ? -7.985  12.187  -1.147  1.00 0.00 ? 101 ASP A HA   6  
ATOM 10475 H HB2  . ASP A 1 101 ? -8.709  10.798  -3.176  1.00 0.00 ? 101 ASP A HB2  6  
ATOM 10476 H HB3  . ASP A 1 101 ? -9.982  11.379  -2.106  1.00 0.00 ? 101 ASP A HB3  6  
ATOM 10477 N N    . GLY A 1 102 ? -6.258  11.539  -3.084  1.00 0.00 ? 102 GLY A N    6  
ATOM 10478 C CA   . GLY A 1 102 ? -5.022  11.502  -3.844  1.00 0.00 ? 102 GLY A CA   6  
ATOM 10479 C C    . GLY A 1 102 ? -5.040  10.452  -4.935  1.00 0.00 ? 102 GLY A C    6  
ATOM 10480 O O    . GLY A 1 102 ? -5.976  9.658   -5.046  1.00 0.00 ? 102 GLY A O    6  
ATOM 10481 H H    . GLY A 1 102 ? -6.604  10.718  -2.676  1.00 0.00 ? 102 GLY A H    6  
ATOM 10482 H HA2  . GLY A 1 102 ? -4.859  12.471  -4.292  1.00 0.00 ? 102 GLY A HA2  6  
ATOM 10483 H HA3  . GLY A 1 102 ? -4.205  11.289  -3.168  1.00 0.00 ? 102 GLY A HA3  6  
ATOM 10484 N N    . PRO A 1 103 ? -3.989  10.439  -5.768  1.00 0.00 ? 103 PRO A N    6  
ATOM 10485 C CA   . PRO A 1 103 ? -3.866  9.483   -6.872  1.00 0.00 ? 103 PRO A CA   6  
ATOM 10486 C C    . PRO A 1 103 ? -3.622  8.060   -6.383  1.00 0.00 ? 103 PRO A C    6  
ATOM 10487 O O    . PRO A 1 103 ? -2.988  7.848   -5.348  1.00 0.00 ? 103 PRO A O    6  
ATOM 10488 C CB   . PRO A 1 103 ? -2.653  9.995   -7.652  1.00 0.00 ? 103 PRO A CB   6  
ATOM 10489 C CG   . PRO A 1 103 ? -1.848  10.747  -6.649  1.00 0.00 ? 103 PRO A CG   6  
ATOM 10490 C CD   . PRO A 1 103 ? -2.839  11.355  -5.694  1.00 0.00 ? 103 PRO A CD   6  
ATOM 10491 H HA   . PRO A 1 103 ? -4.738  9.498   -7.509  1.00 0.00 ? 103 PRO A HA   6  
ATOM 10492 H HB2  . PRO A 1 103 ? -2.101  9.159   -8.055  1.00 0.00 ? 103 PRO A HB2  6  
ATOM 10493 H HB3  . PRO A 1 103 ? -2.981  10.638  -8.454  1.00 0.00 ? 103 PRO A HB3  6  
ATOM 10494 H HG2  . PRO A 1 103 ? -1.190  10.072  -6.126  1.00 0.00 ? 103 PRO A HG2  6  
ATOM 10495 H HG3  . PRO A 1 103 ? -1.280  11.523  -7.142  1.00 0.00 ? 103 PRO A HG3  6  
ATOM 10496 H HD2  . PRO A 1 103 ? -2.431  11.383  -4.695  1.00 0.00 ? 103 PRO A HD2  6  
ATOM 10497 H HD3  . PRO A 1 103 ? -3.115  12.347  -6.018  1.00 0.00 ? 103 PRO A HD3  6  
ATOM 10498 N N    . LEU A 1 104 ? -4.127  7.086   -7.132  1.00 0.00 ? 104 LEU A N    6  
ATOM 10499 C CA   . LEU A 1 104 ? -3.963  5.680   -6.774  1.00 0.00 ? 104 LEU A CA   6  
ATOM 10500 C C    . LEU A 1 104 ? -2.583  5.174   -7.181  1.00 0.00 ? 104 LEU A C    6  
ATOM 10501 O O    . LEU A 1 104 ? -1.891  5.801   -7.984  1.00 0.00 ? 104 LEU A O    6  
ATOM 10502 C CB   . LEU A 1 104 ? -5.047  4.835   -7.442  1.00 0.00 ? 104 LEU A CB   6  
ATOM 10503 C CG   . LEU A 1 104 ? -6.471  5.034   -6.920  1.00 0.00 ? 104 LEU A CG   6  
ATOM 10504 C CD1  . LEU A 1 104 ? -7.454  5.130   -8.077  1.00 0.00 ? 104 LEU A CD1  6  
ATOM 10505 C CD2  . LEU A 1 104 ? -6.858  3.901   -5.981  1.00 0.00 ? 104 LEU A CD2  6  
ATOM 10506 H H    . LEU A 1 104 ? -4.622  7.316   -7.946  1.00 0.00 ? 104 LEU A H    6  
ATOM 10507 H HA   . LEU A 1 104 ? -4.062  5.599   -5.703  1.00 0.00 ? 104 LEU A HA   6  
ATOM 10508 H HB2  . LEU A 1 104 ? -5.046  5.067   -8.496  1.00 0.00 ? 104 LEU A HB2  6  
ATOM 10509 H HB3  . LEU A 1 104 ? -4.786  3.795   -7.304  1.00 0.00 ? 104 LEU A HB3  6  
ATOM 10510 H HG   . LEU A 1 104 ? -6.518  5.960   -6.364  1.00 0.00 ? 104 LEU A HG   6  
ATOM 10511 H HD11 . LEU A 1 104 ? -7.628  4.147   -8.485  1.00 0.00 ? 104 LEU A HD11 6  
ATOM 10512 H HD12 . LEU A 1 104 ? -7.046  5.773   -8.843  1.00 0.00 ? 104 LEU A HD12 6  
ATOM 10513 H HD13 . LEU A 1 104 ? -8.388  5.543   -7.721  1.00 0.00 ? 104 LEU A HD13 6  
ATOM 10514 H HD21 . LEU A 1 104 ? -6.506  4.123   -4.985  1.00 0.00 ? 104 LEU A HD21 6  
ATOM 10515 H HD22 . LEU A 1 104 ? -6.409  2.980   -6.324  1.00 0.00 ? 104 LEU A HD22 6  
ATOM 10516 H HD23 . LEU A 1 104 ? -7.932  3.794   -5.971  1.00 0.00 ? 104 LEU A HD23 6  
ATOM 10517 N N    . SER A 1 105 ? -2.191  4.032   -6.624  1.00 0.00 ? 105 SER A N    6  
ATOM 10518 C CA   . SER A 1 105 ? -0.891  3.441   -6.928  1.00 0.00 ? 105 SER A CA   6  
ATOM 10519 C C    . SER A 1 105 ? -0.985  2.522   -8.142  1.00 0.00 ? 105 SER A C    6  
ATOM 10520 O O    . SER A 1 105 ? -2.000  2.495   -8.838  1.00 0.00 ? 105 SER A O    6  
ATOM 10521 C CB   . SER A 1 105 ? -0.370  2.660   -5.722  1.00 0.00 ? 105 SER A CB   6  
ATOM 10522 O OG   . SER A 1 105 ? -0.819  1.315   -5.750  1.00 0.00 ? 105 SER A OG   6  
ATOM 10523 H H    . SER A 1 105 ? -2.786  3.579   -5.992  1.00 0.00 ? 105 SER A H    6  
ATOM 10524 H HA   . SER A 1 105 ? -0.206  4.244   -7.151  1.00 0.00 ? 105 SER A HA   6  
ATOM 10525 H HB2  . SER A 1 105 ? 0.710   2.664   -5.732  1.00 0.00 ? 105 SER A HB2  6  
ATOM 10526 H HB3  . SER A 1 105 ? -0.723  3.125   -4.812  1.00 0.00 ? 105 SER A HB3  6  
ATOM 10527 H HG   . SER A 1 105 ? -1.752  1.295   -5.980  1.00 0.00 ? 105 SER A HG   6  
ATOM 10528 N N    . SER A 1 106 ? 0.083   1.769   -8.390  1.00 0.00 ? 106 SER A N    6  
ATOM 10529 C CA   . SER A 1 106 ? 0.125   0.852   -9.522  1.00 0.00 ? 106 SER A CA   6  
ATOM 10530 C C    . SER A 1 106 ? -0.680  -0.409  -9.228  1.00 0.00 ? 106 SER A C    6  
ATOM 10531 O O    . SER A 1 106 ? -0.414  -1.118  -8.257  1.00 0.00 ? 106 SER A O    6  
ATOM 10532 C CB   . SER A 1 106 ? 1.572   0.481   -9.852  1.00 0.00 ? 106 SER A CB   6  
ATOM 10533 O OG   . SER A 1 106 ? 2.366   0.432   -8.679  1.00 0.00 ? 106 SER A OG   6  
ATOM 10534 H H    . SER A 1 106 ? 0.862   1.836   -7.799  1.00 0.00 ? 106 SER A H    6  
ATOM 10535 H HA   . SER A 1 106 ? -0.311  1.354   -10.372 1.00 0.00 ? 106 SER A HA   6  
ATOM 10536 H HB2  . SER A 1 106 ? 1.594   -0.487  -10.328 1.00 0.00 ? 106 SER A HB2  6  
ATOM 10537 H HB3  . SER A 1 106 ? 1.987   1.220   -10.522 1.00 0.00 ? 106 SER A HB3  6  
ATOM 10538 H HG   . SER A 1 106 ? 3.284   0.593   -8.906  1.00 0.00 ? 106 SER A HG   6  
ATOM 10539 N N    . ASP A 1 107 ? -1.666  -0.685  -10.075 1.00 0.00 ? 107 ASP A N    6  
ATOM 10540 C CA   . ASP A 1 107 ? -2.511  -1.861  -9.909  1.00 0.00 ? 107 ASP A CA   6  
ATOM 10541 C C    . ASP A 1 107 ? -1.666  -3.121  -9.760  1.00 0.00 ? 107 ASP A C    6  
ATOM 10542 O O    . ASP A 1 107 ? -1.014  -3.560  -10.709 1.00 0.00 ? 107 ASP A O    6  
ATOM 10543 C CB   . ASP A 1 107 ? -3.460  -2.007  -11.100 1.00 0.00 ? 107 ASP A CB   6  
ATOM 10544 C CG   . ASP A 1 107 ? -4.255  -0.744  -11.366 1.00 0.00 ? 107 ASP A CG   6  
ATOM 10545 O OD1  . ASP A 1 107 ? -3.638  0.279   -11.731 1.00 0.00 ? 107 ASP A OD1  6  
ATOM 10546 O OD2  . ASP A 1 107 ? -5.494  -0.778  -11.208 1.00 0.00 ? 107 ASP A OD2  6  
ATOM 10547 H H    . ASP A 1 107 ? -1.829  -0.081  -10.831 1.00 0.00 ? 107 ASP A H    6  
ATOM 10548 H HA   . ASP A 1 107 ? -3.095  -1.726  -9.012  1.00 0.00 ? 107 ASP A HA   6  
ATOM 10549 H HB2  . ASP A 1 107 ? -2.884  -2.239  -11.985 1.00 0.00 ? 107 ASP A HB2  6  
ATOM 10550 H HB3  . ASP A 1 107 ? -4.152  -2.813  -10.905 1.00 0.00 ? 107 ASP A HB3  6  
ATOM 10551 N N    . ILE A 1 108 ? -1.680  -3.699  -8.563  1.00 0.00 ? 108 ILE A N    6  
ATOM 10552 C CA   . ILE A 1 108 ? -0.913  -4.908  -8.290  1.00 0.00 ? 108 ILE A CA   6  
ATOM 10553 C C    . ILE A 1 108 ? -1.832  -6.113  -8.114  1.00 0.00 ? 108 ILE A C    6  
ATOM 10554 O O    . ILE A 1 108 ? -2.979  -5.974  -7.690  1.00 0.00 ? 108 ILE A O    6  
ATOM 10555 C CB   . ILE A 1 108 ? -0.044  -4.751  -7.029  1.00 0.00 ? 108 ILE A CB   6  
ATOM 10556 C CG1  . ILE A 1 108 ? -0.888  -4.239  -5.861  1.00 0.00 ? 108 ILE A CG1  6  
ATOM 10557 C CG2  . ILE A 1 108 ? 1.119   -3.809  -7.302  1.00 0.00 ? 108 ILE A CG2  6  
ATOM 10558 C CD1  . ILE A 1 108 ? -0.260  -4.484  -4.507  1.00 0.00 ? 108 ILE A CD1  6  
ATOM 10559 H H    . ILE A 1 108 ? -2.219  -3.303  -7.847  1.00 0.00 ? 108 ILE A H    6  
ATOM 10560 H HA   . ILE A 1 108 ? -0.260  -5.087  -9.133  1.00 0.00 ? 108 ILE A HA   6  
ATOM 10561 H HB   . ILE A 1 108 ? 0.360   -5.718  -6.775  1.00 0.00 ? 108 ILE A HB   6  
ATOM 10562 H HG12 . ILE A 1 108 ? -1.037  -3.177  -5.970  1.00 0.00 ? 108 ILE A HG12 6  
ATOM 10563 H HG13 . ILE A 1 108 ? -1.848  -4.734  -5.876  1.00 0.00 ? 108 ILE A HG13 6  
ATOM 10564 H HG21 . ILE A 1 108 ? 0.788   -2.787  -7.192  1.00 0.00 ? 108 ILE A HG21 6  
ATOM 10565 H HG22 . ILE A 1 108 ? 1.913   -4.006  -6.597  1.00 0.00 ? 108 ILE A HG22 6  
ATOM 10566 H HG23 . ILE A 1 108 ? 1.482   -3.965  -8.306  1.00 0.00 ? 108 ILE A HG23 6  
ATOM 10567 H HD11 . ILE A 1 108 ? 0.415   -3.675  -4.272  1.00 0.00 ? 108 ILE A HD11 6  
ATOM 10568 H HD12 . ILE A 1 108 ? -1.033  -4.540  -3.754  1.00 0.00 ? 108 ILE A HD12 6  
ATOM 10569 H HD13 . ILE A 1 108 ? 0.289   -5.414  -4.528  1.00 0.00 ? 108 ILE A HD13 6  
ATOM 10570 N N    . GLN A 1 109 ? -1.319  -7.294  -8.442  1.00 0.00 ? 109 GLN A N    6  
ATOM 10571 C CA   . GLN A 1 109 ? -2.092  -8.523  -8.319  1.00 0.00 ? 109 GLN A CA   6  
ATOM 10572 C C    . GLN A 1 109 ? -1.335  -9.565  -7.501  1.00 0.00 ? 109 GLN A C    6  
ATOM 10573 O O    . GLN A 1 109 ? -0.135  -9.762  -7.688  1.00 0.00 ? 109 GLN A O    6  
ATOM 10574 C CB   . GLN A 1 109 ? -2.421  -9.085  -9.703  1.00 0.00 ? 109 GLN A CB   6  
ATOM 10575 C CG   . GLN A 1 109 ? -3.329  -8.185  -10.525 1.00 0.00 ? 109 GLN A CG   6  
ATOM 10576 C CD   . GLN A 1 109 ? -3.007  -8.226  -12.006 1.00 0.00 ? 109 GLN A CD   6  
ATOM 10577 O OE1  . GLN A 1 109 ? -2.143  -8.986  -12.443 1.00 0.00 ? 109 GLN A OE1  6  
ATOM 10578 N NE2  . GLN A 1 109 ? -3.702  -7.406  -12.786 1.00 0.00 ? 109 GLN A NE2  6  
ATOM 10579 H H    . GLN A 1 109 ? -0.398  -7.340  -8.775  1.00 0.00 ? 109 GLN A H    6  
ATOM 10580 H HA   . GLN A 1 109 ? -3.014  -8.286  -7.809  1.00 0.00 ? 109 GLN A HA   6  
ATOM 10581 H HB2  . GLN A 1 109 ? -1.501  -9.228  -10.249 1.00 0.00 ? 109 GLN A HB2  6  
ATOM 10582 H HB3  . GLN A 1 109 ? -2.911  -10.040 -9.584  1.00 0.00 ? 109 GLN A HB3  6  
ATOM 10583 H HG2  . GLN A 1 109 ? -4.353  -8.503  -10.386 1.00 0.00 ? 109 GLN A HG2  6  
ATOM 10584 H HG3  . GLN A 1 109 ? -3.220  -7.169  -10.175 1.00 0.00 ? 109 GLN A HG3  6  
ATOM 10585 H HE21 . GLN A 1 109 ? -4.374  -6.827  -12.366 1.00 0.00 ? 109 GLN A HE21 6  
ATOM 10586 H HE22 . GLN A 1 109 ? -3.513  -7.412  -13.747 1.00 0.00 ? 109 GLN A HE22 6  
ATOM 10587 N N    . VAL A 1 110 ? -2.045  -10.229 -6.595  1.00 0.00 ? 110 VAL A N    6  
ATOM 10588 C CA   . VAL A 1 110 ? -1.439  -11.251 -5.749  1.00 0.00 ? 110 VAL A CA   6  
ATOM 10589 C C    . VAL A 1 110 ? -2.303  -12.506 -5.700  1.00 0.00 ? 110 VAL A C    6  
ATOM 10590 O O    . VAL A 1 110 ? -3.514  -12.431 -5.485  1.00 0.00 ? 110 VAL A O    6  
ATOM 10591 C CB   . VAL A 1 110 ? -1.220  -10.735 -4.315  1.00 0.00 ? 110 VAL A CB   6  
ATOM 10592 C CG1  . VAL A 1 110 ? -2.527  -10.230 -3.723  1.00 0.00 ? 110 VAL A CG1  6  
ATOM 10593 C CG2  . VAL A 1 110 ? -0.617  -11.827 -3.443  1.00 0.00 ? 110 VAL A CG2  6  
ATOM 10594 H H    . VAL A 1 110 ? -2.999  -10.028 -6.494  1.00 0.00 ? 110 VAL A H    6  
ATOM 10595 H HA   . VAL A 1 110 ? -0.476  -11.505 -6.168  1.00 0.00 ? 110 VAL A HA   6  
ATOM 10596 H HB   . VAL A 1 110 ? -0.524  -9.909  -4.353  1.00 0.00 ? 110 VAL A HB   6  
ATOM 10597 H HG11 . VAL A 1 110 ? -2.443  -9.173  -3.517  1.00 0.00 ? 110 VAL A HG11 6  
ATOM 10598 H HG12 . VAL A 1 110 ? -3.328  -10.398 -4.427  1.00 0.00 ? 110 VAL A HG12 6  
ATOM 10599 H HG13 . VAL A 1 110 ? -2.734  -10.759 -2.805  1.00 0.00 ? 110 VAL A HG13 6  
ATOM 10600 H HG21 . VAL A 1 110 ? -0.055  -12.511 -4.061  1.00 0.00 ? 110 VAL A HG21 6  
ATOM 10601 H HG22 . VAL A 1 110 ? 0.040   -11.381 -2.711  1.00 0.00 ? 110 VAL A HG22 6  
ATOM 10602 H HG23 . VAL A 1 110 ? -1.408  -12.362 -2.938  1.00 0.00 ? 110 VAL A HG23 6  
ATOM 10603 N N    . ILE A 1 111 ? -1.674  -13.660 -5.898  1.00 0.00 ? 111 ILE A N    6  
ATOM 10604 C CA   . ILE A 1 111 ? -2.385  -14.932 -5.875  1.00 0.00 ? 111 ILE A CA   6  
ATOM 10605 C C    . ILE A 1 111 ? -2.457  -15.495 -4.459  1.00 0.00 ? 111 ILE A C    6  
ATOM 10606 O O    . ILE A 1 111 ? -1.447  -15.579 -3.759  1.00 0.00 ? 111 ILE A O    6  
ATOM 10607 C CB   . ILE A 1 111 ? -1.715  -15.969 -6.794  1.00 0.00 ? 111 ILE A CB   6  
ATOM 10608 C CG1  . ILE A 1 111 ? -1.727  -15.481 -8.244  1.00 0.00 ? 111 ILE A CG1  6  
ATOM 10609 C CG2  . ILE A 1 111 ? -2.416  -17.313 -6.677  1.00 0.00 ? 111 ILE A CG2  6  
ATOM 10610 C CD1  . ILE A 1 111 ? -0.412  -15.692 -8.964  1.00 0.00 ? 111 ILE A CD1  6  
ATOM 10611 H H    . ILE A 1 111 ? -0.708  -13.655 -6.063  1.00 0.00 ? 111 ILE A H    6  
ATOM 10612 H HA   . ILE A 1 111 ? -3.389  -14.758 -6.233  1.00 0.00 ? 111 ILE A HA   6  
ATOM 10613 H HB   . ILE A 1 111 ? -0.692  -16.095 -6.473  1.00 0.00 ? 111 ILE A HB   6  
ATOM 10614 H HG12 . ILE A 1 111 ? -2.492  -16.011 -8.789  1.00 0.00 ? 111 ILE A HG12 6  
ATOM 10615 H HG13 . ILE A 1 111 ? -1.948  -14.423 -8.258  1.00 0.00 ? 111 ILE A HG13 6  
ATOM 10616 H HG21 . ILE A 1 111 ? -3.472  -17.187 -6.868  1.00 0.00 ? 111 ILE A HG21 6  
ATOM 10617 H HG22 . ILE A 1 111 ? -2.000  -18.001 -7.397  1.00 0.00 ? 111 ILE A HG22 6  
ATOM 10618 H HG23 . ILE A 1 111 ? -2.277  -17.707 -5.680  1.00 0.00 ? 111 ILE A HG23 6  
ATOM 10619 H HD11 . ILE A 1 111 ? -0.110  -14.770 -9.438  1.00 0.00 ? 111 ILE A HD11 6  
ATOM 10620 H HD12 . ILE A 1 111 ? 0.341   -15.998 -8.255  1.00 0.00 ? 111 ILE A HD12 6  
ATOM 10621 H HD13 . ILE A 1 111 ? -0.533  -16.459 -9.715  1.00 0.00 ? 111 ILE A HD13 6  
ATOM 10622 N N    . THR A 1 112 ? -3.659  -15.883 -4.043  1.00 0.00 ? 112 THR A N    6  
ATOM 10623 C CA   . THR A 1 112 ? -3.864  -16.439 -2.711  1.00 0.00 ? 112 THR A CA   6  
ATOM 10624 C C    . THR A 1 112 ? -3.218  -17.814 -2.585  1.00 0.00 ? 112 THR A C    6  
ATOM 10625 O O    . THR A 1 112 ? -3.840  -18.832 -2.888  1.00 0.00 ? 112 THR A O    6  
ATOM 10626 C CB   . THR A 1 112 ? -5.362  -16.556 -2.375  1.00 0.00 ? 112 THR A CB   6  
ATOM 10627 O OG1  . THR A 1 112 ? -6.057  -17.197 -3.450  1.00 0.00 ? 112 THR A OG1  6  
ATOM 10628 C CG2  . THR A 1 112 ? -5.967  -15.184 -2.120  1.00 0.00 ? 112 THR A CG2  6  
ATOM 10629 H H    . THR A 1 112 ? -4.425  -15.791 -4.647  1.00 0.00 ? 112 THR A H    6  
ATOM 10630 H HA   . THR A 1 112 ? -3.406  -15.770 -1.996  1.00 0.00 ? 112 THR A HA   6  
ATOM 10631 H HB   . THR A 1 112 ? -5.470  -17.152 -1.481  1.00 0.00 ? 112 THR A HB   6  
ATOM 10632 H HG1  . THR A 1 112 ? -6.965  -16.886 -3.476  1.00 0.00 ? 112 THR A HG1  6  
ATOM 10633 H HG21 . THR A 1 112 ? -5.207  -14.427 -2.237  1.00 0.00 ? 112 THR A HG21 6  
ATOM 10634 H HG22 . THR A 1 112 ? -6.362  -15.146 -1.116  1.00 0.00 ? 112 THR A HG22 6  
ATOM 10635 H HG23 . THR A 1 112 ? -6.764  -15.005 -2.829  1.00 0.00 ? 112 THR A HG23 6  
ATOM 10636 N N    . GLN A 1 113 ? -1.967  -17.836 -2.134  1.00 0.00 ? 113 GLN A N    6  
ATOM 10637 C CA   . GLN A 1 113 ? -1.238  -19.087 -1.967  1.00 0.00 ? 113 GLN A CA   6  
ATOM 10638 C C    . GLN A 1 113 ? -0.191  -18.965 -0.866  1.00 0.00 ? 113 GLN A C    6  
ATOM 10639 O O    . GLN A 1 113 ? 0.421   -17.911 -0.691  1.00 0.00 ? 113 GLN A O    6  
ATOM 10640 C CB   . GLN A 1 113 ? -0.568  -19.490 -3.282  1.00 0.00 ? 113 GLN A CB   6  
ATOM 10641 C CG   . GLN A 1 113 ? 0.521   -18.530 -3.729  1.00 0.00 ? 113 GLN A CG   6  
ATOM 10642 C CD   . GLN A 1 113 ? 1.304   -19.048 -4.920  1.00 0.00 ? 113 GLN A CD   6  
ATOM 10643 O OE1  . GLN A 1 113 ? 2.452   -19.472 -4.787  1.00 0.00 ? 113 GLN A OE1  6  
ATOM 10644 N NE2  . GLN A 1 113 ? 0.685   -19.016 -6.093  1.00 0.00 ? 113 GLN A NE2  6  
ATOM 10645 H H    . GLN A 1 113 ? -1.525  -16.991 -1.909  1.00 0.00 ? 113 GLN A H    6  
ATOM 10646 H HA   . GLN A 1 113 ? -1.949  -19.851 -1.688  1.00 0.00 ? 113 GLN A HA   6  
ATOM 10647 H HB2  . GLN A 1 113 ? -0.129  -20.470 -3.164  1.00 0.00 ? 113 GLN A HB2  6  
ATOM 10648 H HB3  . GLN A 1 113 ? -1.319  -19.534 -4.057  1.00 0.00 ? 113 GLN A HB3  6  
ATOM 10649 H HG2  . GLN A 1 113 ? 0.066   -17.589 -3.999  1.00 0.00 ? 113 GLN A HG2  6  
ATOM 10650 H HG3  . GLN A 1 113 ? 1.207   -18.375 -2.907  1.00 0.00 ? 113 GLN A HG3  6  
ATOM 10651 H HE21 . GLN A 1 113 ? -0.230  -18.664 -6.125  1.00 0.00 ? 113 GLN A HE21 6  
ATOM 10652 H HE22 . GLN A 1 113 ? 1.167   -19.343 -6.880  1.00 0.00 ? 113 GLN A HE22 6  
ATOM 10653 N N    . THR A 1 114 ? 0.012   -20.050 -0.125  1.00 0.00 ? 114 THR A N    6  
ATOM 10654 C CA   . THR A 1 114 ? 0.983   -20.064 0.961   1.00 0.00 ? 114 THR A CA   6  
ATOM 10655 C C    . THR A 1 114 ? 2.278   -20.743 0.532   1.00 0.00 ? 114 THR A C    6  
ATOM 10656 O O    . THR A 1 114 ? 2.851   -21.539 1.274   1.00 0.00 ? 114 THR A O    6  
ATOM 10657 C CB   . THR A 1 114 ? 0.428   -20.786 2.204   1.00 0.00 ? 114 THR A CB   6  
ATOM 10658 O OG1  . THR A 1 114 ? 0.237   -22.176 1.919   1.00 0.00 ? 114 THR A OG1  6  
ATOM 10659 C CG2  . THR A 1 114 ? -0.891  -20.167 2.643   1.00 0.00 ? 114 THR A CG2  6  
ATOM 10660 H H    . THR A 1 114 ? -0.507  -20.860 -0.313  1.00 0.00 ? 114 THR A H    6  
ATOM 10661 H HA   . THR A 1 114 ? 1.197   -19.040 1.231   1.00 0.00 ? 114 THR A HA   6  
ATOM 10662 H HB   . THR A 1 114 ? 1.142   -20.686 3.008   1.00 0.00 ? 114 THR A HB   6  
ATOM 10663 H HG1  . THR A 1 114 ? 0.535   -22.700 2.667   1.00 0.00 ? 114 THR A HG1  6  
ATOM 10664 H HG21 . THR A 1 114 ? -1.710  -20.691 2.171   1.00 0.00 ? 114 THR A HG21 6  
ATOM 10665 H HG22 . THR A 1 114 ? -0.915  -19.127 2.355   1.00 0.00 ? 114 THR A HG22 6  
ATOM 10666 H HG23 . THR A 1 114 ? -0.984  -20.246 3.717   1.00 0.00 ? 114 THR A HG23 6  
ATOM 10667 N N    . GLY A 1 115 ? 2.738   -20.421 -0.676  1.00 0.00 ? 115 GLY A N    6  
ATOM 10668 C CA   . GLY A 1 115 ? 3.964   -21.008 -1.183  1.00 0.00 ? 115 GLY A CA   6  
ATOM 10669 C C    . GLY A 1 115 ? 4.896   -19.977 -1.786  1.00 0.00 ? 115 GLY A C    6  
ATOM 10670 O O    . GLY A 1 115 ? 4.461   -19.093 -2.525  1.00 0.00 ? 115 GLY A O    6  
ATOM 10671 H H    . GLY A 1 115 ? 2.240   -19.780 -1.224  1.00 0.00 ? 115 GLY A H    6  
ATOM 10672 H HA2  . GLY A 1 115 ? 4.473   -21.509 -0.373  1.00 0.00 ? 115 GLY A HA2  6  
ATOM 10673 H HA3  . GLY A 1 115 ? 3.713   -21.736 -1.941  1.00 0.00 ? 115 GLY A HA3  6  
ATOM 10674 N N    . SER A 1 116 ? 6.182   -20.085 -1.467  1.00 0.00 ? 116 SER A N    6  
ATOM 10675 C CA   . SER A 1 116 ? 7.176   -19.148 -1.977  1.00 0.00 ? 116 SER A CA   6  
ATOM 10676 C C    . SER A 1 116 ? 6.856   -17.723 -1.539  1.00 0.00 ? 116 SER A C    6  
ATOM 10677 O O    . SER A 1 116 ? 5.817   -17.466 -0.934  1.00 0.00 ? 116 SER A O    6  
ATOM 10678 C CB   . SER A 1 116 ? 7.242   -19.223 -3.504  1.00 0.00 ? 116 SER A CB   6  
ATOM 10679 O OG   . SER A 1 116 ? 6.848   -20.502 -3.970  1.00 0.00 ? 116 SER A OG   6  
ATOM 10680 H H    . SER A 1 116 ? 6.467   -20.810 -0.872  1.00 0.00 ? 116 SER A H    6  
ATOM 10681 H HA   . SER A 1 116 ? 8.136   -19.431 -1.571  1.00 0.00 ? 116 SER A HA   6  
ATOM 10682 H HB2  . SER A 1 116 ? 6.580   -18.482 -3.926  1.00 0.00 ? 116 SER A HB2  6  
ATOM 10683 H HB3  . SER A 1 116 ? 8.254   -19.029 -3.828  1.00 0.00 ? 116 SER A HB3  6  
ATOM 10684 H HG   . SER A 1 116 ? 7.034   -20.573 -4.909  1.00 0.00 ? 116 SER A HG   6  
ATOM 10685 N N    . GLY A 1 117 ? 7.762   -16.798 -1.850  1.00 0.00 ? 117 GLY A N    6  
ATOM 10686 C CA   . GLY A 1 117 ? 7.559   -15.409 -1.480  1.00 0.00 ? 117 GLY A CA   6  
ATOM 10687 C C    . GLY A 1 117 ? 7.330   -14.517 -2.684  1.00 0.00 ? 117 GLY A C    6  
ATOM 10688 O O    . GLY A 1 117 ? 7.210   -14.985 -3.816  1.00 0.00 ? 117 GLY A O    6  
ATOM 10689 H H    . GLY A 1 117 ? 8.573   -17.062 -2.333  1.00 0.00 ? 117 GLY A H    6  
ATOM 10690 H HA2  . GLY A 1 117 ? 6.700   -15.344 -0.827  1.00 0.00 ? 117 GLY A HA2  6  
ATOM 10691 H HA3  . GLY A 1 117 ? 8.431   -15.060 -0.949  1.00 0.00 ? 117 GLY A HA3  6  
ATOM 10692 N N    . PRO A 1 118 ? 7.262   -13.199 -2.444  1.00 0.00 ? 118 PRO A N    6  
ATOM 10693 C CA   . PRO A 1 118 ? 7.045   -12.212 -3.505  1.00 0.00 ? 118 PRO A CA   6  
ATOM 10694 C C    . PRO A 1 118 ? 8.248   -12.082 -4.432  1.00 0.00 ? 118 PRO A C    6  
ATOM 10695 O O    . PRO A 1 118 ? 9.233   -12.806 -4.291  1.00 0.00 ? 118 PRO A O    6  
ATOM 10696 C CB   . PRO A 1 118 ? 6.820   -10.908 -2.736  1.00 0.00 ? 118 PRO A CB   6  
ATOM 10697 C CG   . PRO A 1 118 ? 7.523   -11.108 -1.438  1.00 0.00 ? 118 PRO A CG   6  
ATOM 10698 C CD   . PRO A 1 118 ? 7.396   -12.572 -1.119  1.00 0.00 ? 118 PRO A CD   6  
ATOM 10699 H HA   . PRO A 1 118 ? 6.165   -12.444 -4.089  1.00 0.00 ? 118 PRO A HA   6  
ATOM 10700 H HB2  . PRO A 1 118 ? 7.240   -10.082 -3.291  1.00 0.00 ? 118 PRO A HB2  6  
ATOM 10701 H HB3  . PRO A 1 118 ? 5.761   -10.749 -2.590  1.00 0.00 ? 118 PRO A HB3  6  
ATOM 10702 H HG2  . PRO A 1 118 ? 8.563   -10.834 -1.538  1.00 0.00 ? 118 PRO A HG2  6  
ATOM 10703 H HG3  . PRO A 1 118 ? 7.050   -10.515 -0.669  1.00 0.00 ? 118 PRO A HG3  6  
ATOM 10704 H HD2  . PRO A 1 118 ? 8.281   -12.925 -0.611  1.00 0.00 ? 118 PRO A HD2  6  
ATOM 10705 H HD3  . PRO A 1 118 ? 6.518   -12.751 -0.517  1.00 0.00 ? 118 PRO A HD3  6  
ATOM 10706 N N    . SER A 1 119 ? 8.161   -11.155 -5.381  1.00 0.00 ? 119 SER A N    6  
ATOM 10707 C CA   . SER A 1 119 ? 9.242   -10.933 -6.334  1.00 0.00 ? 119 SER A CA   6  
ATOM 10708 C C    . SER A 1 119 ? 9.522   -12.196 -7.142  1.00 0.00 ? 119 SER A C    6  
ATOM 10709 O O    . SER A 1 119 ? 8.833   -13.205 -6.995  1.00 0.00 ? 119 SER A O    6  
ATOM 10710 C CB   . SER A 1 119 ? 10.511  -10.489 -5.604  1.00 0.00 ? 119 SER A CB   6  
ATOM 10711 O OG   . SER A 1 119 ? 11.058  -9.323  -6.194  1.00 0.00 ? 119 SER A OG   6  
ATOM 10712 H H    . SER A 1 119 ? 7.349   -10.610 -5.443  1.00 0.00 ? 119 SER A H    6  
ATOM 10713 H HA   . SER A 1 119 ? 8.933   -10.149 -7.010  1.00 0.00 ? 119 SER A HA   6  
ATOM 10714 H HB2  . SER A 1 119 ? 10.274  -10.279 -4.573  1.00 0.00 ? 119 SER A HB2  6  
ATOM 10715 H HB3  . SER A 1 119 ? 11.245  -11.281 -5.651  1.00 0.00 ? 119 SER A HB3  6  
ATOM 10716 H HG   . SER A 1 119 ? 10.822  -9.294  -7.124  1.00 0.00 ? 119 SER A HG   6  
ATOM 10717 N N    . SER A 1 120 ? 10.537  -12.131 -7.997  1.00 0.00 ? 120 SER A N    6  
ATOM 10718 C CA   . SER A 1 120 ? 10.908  -13.268 -8.833  1.00 0.00 ? 120 SER A CA   6  
ATOM 10719 C C    . SER A 1 120 ? 12.423  -13.433 -8.885  1.00 0.00 ? 120 SER A C    6  
ATOM 10720 O O    . SER A 1 120 ? 13.168  -12.606 -8.362  1.00 0.00 ? 120 SER A O    6  
ATOM 10721 C CB   . SER A 1 120 ? 10.354  -13.089 -10.248 1.00 0.00 ? 120 SER A CB   6  
ATOM 10722 O OG   . SER A 1 120 ? 9.015   -12.623 -10.217 1.00 0.00 ? 120 SER A OG   6  
ATOM 10723 H H    . SER A 1 120 ? 11.049  -11.298 -8.070  1.00 0.00 ? 120 SER A H    6  
ATOM 10724 H HA   . SER A 1 120 ? 10.475  -14.154 -8.395  1.00 0.00 ? 120 SER A HA   6  
ATOM 10725 H HB2  . SER A 1 120 ? 10.959  -12.372 -10.781 1.00 0.00 ? 120 SER A HB2  6  
ATOM 10726 H HB3  . SER A 1 120 ? 10.380  -14.038 -10.764 1.00 0.00 ? 120 SER A HB3  6  
ATOM 10727 H HG   . SER A 1 120 ? 8.665   -12.594 -11.111 1.00 0.00 ? 120 SER A HG   6  
ATOM 10728 N N    . GLY A 1 121 ? 12.873  -14.510 -9.522  1.00 0.00 ? 121 GLY A N    6  
ATOM 10729 C CA   . GLY A 1 121 ? 14.297  -14.766 -9.631  1.00 0.00 ? 121 GLY A CA   6  
ATOM 10730 C C    . GLY A 1 121 ? 14.895  -14.191 -10.901 1.00 0.00 ? 121 GLY A C    6  
ATOM 10731 O O    . GLY A 1 121 ? 14.379  -14.418 -11.994 1.00 0.00 ? 121 GLY A O    6  
ATOM 10732 H H    . GLY A 1 121 ? 12.233  -15.136 -9.921  1.00 0.00 ? 121 GLY A H    6  
ATOM 10733 H HA2  . GLY A 1 121 ? 14.797  -14.328 -8.780  1.00 0.00 ? 121 GLY A HA2  6  
ATOM 10734 H HA3  . GLY A 1 121 ? 14.462  -15.834 -9.622  1.00 0.00 ? 121 GLY A HA3  6  
ATOM 10735 N N    . GLY A 1 1   ? 23.721  22.884  4.894   1.00 0.00 ? 1   GLY A N    7  
ATOM 10736 C CA   . GLY A 1 1   ? 24.242  22.519  6.198   1.00 0.00 ? 1   GLY A CA   7  
ATOM 10737 C C    . GLY A 1 1   ? 25.690  22.927  6.381   1.00 0.00 ? 1   GLY A C    7  
ATOM 10738 O O    . GLY A 1 1   ? 26.590  22.091  6.309   1.00 0.00 ? 1   GLY A O    7  
ATOM 10739 H H1   . GLY A 1 1   ? 24.141  22.528  4.084   1.00 0.00 ? 1   GLY A H1   7  
ATOM 10740 H HA2  . GLY A 1 1   ? 23.644  23.000  6.960   1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10741 H HA3  . GLY A 1 1   ? 24.163  21.448  6.318   1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10742 N N    . SER A 1 2   ? 25.914  24.216  6.615   1.00 0.00 ? 2   SER A N    7  
ATOM 10743 C CA   . SER A 1 2   ? 27.264  24.735  6.802   1.00 0.00 ? 2   SER A CA   7  
ATOM 10744 C C    . SER A 1 2   ? 27.251  25.984  7.678   1.00 0.00 ? 2   SER A C    7  
ATOM 10745 O O    . SER A 1 2   ? 27.700  25.956  8.823   1.00 0.00 ? 2   SER A O    7  
ATOM 10746 C CB   . SER A 1 2   ? 27.903  25.056  5.448   1.00 0.00 ? 2   SER A CB   7  
ATOM 10747 O OG   . SER A 1 2   ? 28.855  24.069  5.087   1.00 0.00 ? 2   SER A OG   7  
ATOM 10748 H H    . SER A 1 2   ? 25.155  24.833  6.660   1.00 0.00 ? 2   SER A H    7  
ATOM 10749 H HA   . SER A 1 2   ? 27.848  23.970  7.293   1.00 0.00 ? 2   SER A HA   7  
ATOM 10750 H HB2  . SER A 1 2   ? 27.135  25.092  4.690   1.00 0.00 ? 2   SER A HB2  7  
ATOM 10751 H HB3  . SER A 1 2   ? 28.397  26.013  5.505   1.00 0.00 ? 2   SER A HB3  7  
ATOM 10752 H HG   . SER A 1 2   ? 29.495  24.449  4.481   1.00 0.00 ? 2   SER A HG   7  
ATOM 10753 N N    . SER A 1 3   ? 26.731  27.077  7.131   1.00 0.00 ? 3   SER A N    7  
ATOM 10754 C CA   . SER A 1 3   ? 26.661  28.338  7.860   1.00 0.00 ? 3   SER A CA   7  
ATOM 10755 C C    . SER A 1 3   ? 25.586  28.281  8.941   1.00 0.00 ? 3   SER A C    7  
ATOM 10756 O O    . SER A 1 3   ? 24.926  27.258  9.124   1.00 0.00 ? 3   SER A O    7  
ATOM 10757 C CB   . SER A 1 3   ? 26.373  29.492  6.898   1.00 0.00 ? 3   SER A CB   7  
ATOM 10758 O OG   . SER A 1 3   ? 24.986  29.588  6.618   1.00 0.00 ? 3   SER A OG   7  
ATOM 10759 H H    . SER A 1 3   ? 26.388  27.035  6.213   1.00 0.00 ? 3   SER A H    7  
ATOM 10760 H HA   . SER A 1 3   ? 27.619  28.503  8.330   1.00 0.00 ? 3   SER A HA   7  
ATOM 10761 H HB2  . SER A 1 3   ? 26.703  30.419  7.343   1.00 0.00 ? 3   SER A HB2  7  
ATOM 10762 H HB3  . SER A 1 3   ? 26.904  29.327  5.972   1.00 0.00 ? 3   SER A HB3  7  
ATOM 10763 H HG   . SER A 1 3   ? 24.763  30.499  6.414   1.00 0.00 ? 3   SER A HG   7  
ATOM 10764 N N    . GLY A 1 4   ? 25.415  29.388  9.657   1.00 0.00 ? 4   GLY A N    7  
ATOM 10765 C CA   . GLY A 1 4   ? 24.420  29.444  10.711  1.00 0.00 ? 4   GLY A CA   7  
ATOM 10766 C C    . GLY A 1 4   ? 23.010  29.252  10.189  1.00 0.00 ? 4   GLY A C    7  
ATOM 10767 O O    . GLY A 1 4   ? 22.723  29.553  9.030   1.00 0.00 ? 4   GLY A O    7  
ATOM 10768 H H    . GLY A 1 4   ? 25.969  30.175  9.466   1.00 0.00 ? 4   GLY A H    7  
ATOM 10769 H HA2  . GLY A 1 4   ? 24.634  28.673  11.434  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10770 H HA3  . GLY A 1 4   ? 24.482  30.407  11.197  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10771 N N    . SER A 1 5   ? 22.127  28.744  11.045  1.00 0.00 ? 5   SER A N    7  
ATOM 10772 C CA   . SER A 1 5   ? 20.741  28.506  10.661  1.00 0.00 ? 5   SER A CA   7  
ATOM 10773 C C    . SER A 1 5   ? 19.914  29.781  10.791  1.00 0.00 ? 5   SER A C    7  
ATOM 10774 O O    . SER A 1 5   ? 19.267  30.013  11.813  1.00 0.00 ? 5   SER A O    7  
ATOM 10775 C CB   . SER A 1 5   ? 20.134  27.400  11.526  1.00 0.00 ? 5   SER A CB   7  
ATOM 10776 O OG   . SER A 1 5   ? 18.728  27.338  11.364  1.00 0.00 ? 5   SER A OG   7  
ATOM 10777 H H    . SER A 1 5   ? 22.417  28.525  11.955  1.00 0.00 ? 5   SER A H    7  
ATOM 10778 H HA   . SER A 1 5   ? 20.732  28.190  9.629   1.00 0.00 ? 5   SER A HA   7  
ATOM 10779 H HB2  . SER A 1 5   ? 20.559  26.450  11.242  1.00 0.00 ? 5   SER A HB2  7  
ATOM 10780 H HB3  . SER A 1 5   ? 20.355  27.597  12.565  1.00 0.00 ? 5   SER A HB3  7  
ATOM 10781 H HG   . SER A 1 5   ? 18.398  26.518  11.735  1.00 0.00 ? 5   SER A HG   7  
ATOM 10782 N N    . SER A 1 6   ? 19.940  30.606  9.748   1.00 0.00 ? 6   SER A N    7  
ATOM 10783 C CA   . SER A 1 6   ? 19.196  31.859  9.747   1.00 0.00 ? 6   SER A CA   7  
ATOM 10784 C C    . SER A 1 6   ? 18.869  32.295  8.321   1.00 0.00 ? 6   SER A C    7  
ATOM 10785 O O    . SER A 1 6   ? 19.732  32.793  7.599   1.00 0.00 ? 6   SER A O    7  
ATOM 10786 C CB   . SER A 1 6   ? 19.998  32.954  10.454  1.00 0.00 ? 6   SER A CB   7  
ATOM 10787 O OG   . SER A 1 6   ? 19.305  33.439  11.591  1.00 0.00 ? 6   SER A OG   7  
ATOM 10788 H H    . SER A 1 6   ? 20.475  30.366  8.963   1.00 0.00 ? 6   SER A H    7  
ATOM 10789 H HA   . SER A 1 6   ? 18.273  31.698  10.283  1.00 0.00 ? 6   SER A HA   7  
ATOM 10790 H HB2  . SER A 1 6   ? 20.948  32.552  10.773  1.00 0.00 ? 6   SER A HB2  7  
ATOM 10791 H HB3  . SER A 1 6   ? 20.164  33.774  9.772   1.00 0.00 ? 6   SER A HB3  7  
ATOM 10792 H HG   . SER A 1 6   ? 19.888  33.999  12.107  1.00 0.00 ? 6   SER A HG   7  
ATOM 10793 N N    . GLY A 1 7   ? 17.614  32.104  7.924   1.00 0.00 ? 7   GLY A N    7  
ATOM 10794 C CA   . GLY A 1 7   ? 17.194  32.481  6.588   1.00 0.00 ? 7   GLY A CA   7  
ATOM 10795 C C    . GLY A 1 7   ? 15.695  32.365  6.398   1.00 0.00 ? 7   GLY A C    7  
ATOM 10796 O O    . GLY A 1 7   ? 14.957  32.001  7.313   1.00 0.00 ? 7   GLY A O    7  
ATOM 10797 H H    . GLY A 1 7   ? 16.969  31.703  8.545   1.00 0.00 ? 7   GLY A H    7  
ATOM 10798 H HA2  . GLY A 1 7   ? 17.493  33.503  6.403   1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10799 H HA3  . GLY A 1 7   ? 17.687  31.839  5.874   1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10800 N N    . PRO A 1 8   ? 15.223  32.683  5.183   1.00 0.00 ? 8   PRO A N    7  
ATOM 10801 C CA   . PRO A 1 8   ? 13.797  32.621  4.846   1.00 0.00 ? 8   PRO A CA   7  
ATOM 10802 C C    . PRO A 1 8   ? 13.278  31.188  4.781   1.00 0.00 ? 8   PRO A C    7  
ATOM 10803 O O    . PRO A 1 8   ? 13.662  30.417  3.902   1.00 0.00 ? 8   PRO A O    7  
ATOM 10804 C CB   . PRO A 1 8   ? 13.729  33.277  3.466   1.00 0.00 ? 8   PRO A CB   7  
ATOM 10805 C CG   . PRO A 1 8   ? 15.086  33.078  2.884   1.00 0.00 ? 8   PRO A CG   7  
ATOM 10806 C CD   . PRO A 1 8   ? 16.044  33.125  4.043   1.00 0.00 ? 8   PRO A CD   7  
ATOM 10807 H HA   . PRO A 1 8   ? 13.200  33.188  5.546   1.00 0.00 ? 8   PRO A HA   7  
ATOM 10808 H HB2  . PRO A 1 8   ? 12.969  32.791  2.871   1.00 0.00 ? 8   PRO A HB2  7  
ATOM 10809 H HB3  . PRO A 1 8   ? 13.495  34.325  3.572   1.00 0.00 ? 8   PRO A HB3  7  
ATOM 10810 H HG2  . PRO A 1 8   ? 15.140  32.118  2.394   1.00 0.00 ? 8   PRO A HG2  7  
ATOM 10811 H HG3  . PRO A 1 8   ? 15.306  33.870  2.185   1.00 0.00 ? 8   PRO A HG3  7  
ATOM 10812 H HD2  . PRO A 1 8   ? 16.870  32.450  3.878   1.00 0.00 ? 8   PRO A HD2  7  
ATOM 10813 H HD3  . PRO A 1 8   ? 16.402  34.133  4.196   1.00 0.00 ? 8   PRO A HD3  7  
ATOM 10814 N N    . VAL A 1 9   ? 12.401  30.839  5.719   1.00 0.00 ? 9   VAL A N    7  
ATOM 10815 C CA   . VAL A 1 9   ? 11.829  29.499  5.767   1.00 0.00 ? 9   VAL A CA   7  
ATOM 10816 C C    . VAL A 1 9   ? 10.951  29.232  4.549   1.00 0.00 ? 9   VAL A C    7  
ATOM 10817 O O    . VAL A 1 9   ? 10.144  30.075  4.155   1.00 0.00 ? 9   VAL A O    7  
ATOM 10818 C CB   . VAL A 1 9   ? 10.993  29.292  7.044   1.00 0.00 ? 9   VAL A CB   7  
ATOM 10819 C CG1  . VAL A 1 9   ? 9.769   30.196  7.034   1.00 0.00 ? 9   VAL A CG1  7  
ATOM 10820 C CG2  . VAL A 1 9   ? 10.586  27.833  7.182   1.00 0.00 ? 9   VAL A CG2  7  
ATOM 10821 H H    . VAL A 1 9   ? 12.133  31.498  6.392   1.00 0.00 ? 9   VAL A H    7  
ATOM 10822 H HA   . VAL A 1 9   ? 12.642  28.788  5.774   1.00 0.00 ? 9   VAL A HA   7  
ATOM 10823 H HB   . VAL A 1 9   ? 11.602  29.555  7.896   1.00 0.00 ? 9   VAL A HB   7  
ATOM 10824 H HG11 . VAL A 1 9   ? 9.317   30.198  8.015   1.00 0.00 ? 9   VAL A HG11 7  
ATOM 10825 H HG12 . VAL A 1 9   ? 10.067  31.201  6.773   1.00 0.00 ? 9   VAL A HG12 7  
ATOM 10826 H HG13 . VAL A 1 9   ? 9.058   29.830  6.309   1.00 0.00 ? 9   VAL A HG13 7  
ATOM 10827 H HG21 . VAL A 1 9   ? 9.521   27.739  7.023   1.00 0.00 ? 9   VAL A HG21 7  
ATOM 10828 H HG22 . VAL A 1 9   ? 11.113  27.239  6.449   1.00 0.00 ? 9   VAL A HG22 7  
ATOM 10829 H HG23 . VAL A 1 9   ? 10.834  27.481  8.173   1.00 0.00 ? 9   VAL A HG23 7  
ATOM 10830 N N    . LEU A 1 10  ? 11.113  28.055  3.956   1.00 0.00 ? 10  LEU A N    7  
ATOM 10831 C CA   . LEU A 1 10  ? 10.334  27.676  2.782   1.00 0.00 ? 10  LEU A CA   7  
ATOM 10832 C C    . LEU A 1 10  ? 9.010   27.037  3.189   1.00 0.00 ? 10  LEU A C    7  
ATOM 10833 O O    . LEU A 1 10  ? 8.957   25.854  3.527   1.00 0.00 ? 10  LEU A O    7  
ATOM 10834 C CB   . LEU A 1 10  ? 11.132  26.708  1.906   1.00 0.00 ? 10  LEU A CB   7  
ATOM 10835 C CG   . LEU A 1 10  ? 12.575  27.112  1.603   1.00 0.00 ? 10  LEU A CG   7  
ATOM 10836 C CD1  . LEU A 1 10  ? 13.540  26.027  2.051   1.00 0.00 ? 10  LEU A CD1  7  
ATOM 10837 C CD2  . LEU A 1 10  ? 12.746  27.401  0.118   1.00 0.00 ? 10  LEU A CD2  7  
ATOM 10838 H H    . LEU A 1 10  ? 11.771  27.425  4.315   1.00 0.00 ? 10  LEU A H    7  
ATOM 10839 H HA   . LEU A 1 10  ? 10.127  28.573  2.218   1.00 0.00 ? 10  LEU A HA   7  
ATOM 10840 H HB2  . LEU A 1 10  ? 11.155  25.752  2.407   1.00 0.00 ? 10  LEU A HB2  7  
ATOM 10841 H HB3  . LEU A 1 10  ? 10.610  26.607  0.967   1.00 0.00 ? 10  LEU A HB3  7  
ATOM 10842 H HG   . LEU A 1 10  ? 12.812  28.017  2.148   1.00 0.00 ? 10  LEU A HG   7  
ATOM 10843 H HD11 . LEU A 1 10  ? 13.029  25.077  2.075   1.00 0.00 ? 10  LEU A HD11 7  
ATOM 10844 H HD12 . LEU A 1 10  ? 13.910  26.260  3.039   1.00 0.00 ? 10  LEU A HD12 7  
ATOM 10845 H HD13 . LEU A 1 10  ? 14.369  25.974  1.361   1.00 0.00 ? 10  LEU A HD13 7  
ATOM 10846 H HD21 . LEU A 1 10  ? 11.922  28.006  -0.229  1.00 0.00 ? 10  LEU A HD21 7  
ATOM 10847 H HD22 . LEU A 1 10  ? 12.763  26.468  -0.429  1.00 0.00 ? 10  LEU A HD22 7  
ATOM 10848 H HD23 . LEU A 1 10  ? 13.674  27.928  -0.042  1.00 0.00 ? 10  LEU A HD23 7  
ATOM 10849 N N    . THR A 1 11  ? 7.941   27.827  3.154   1.00 0.00 ? 11  THR A N    7  
ATOM 10850 C CA   . THR A 1 11  ? 6.618   27.339  3.519   1.00 0.00 ? 11  THR A CA   7  
ATOM 10851 C C    . THR A 1 11  ? 5.785   27.031  2.279   1.00 0.00 ? 11  THR A C    7  
ATOM 10852 O O    . THR A 1 11  ? 5.990   27.624  1.220   1.00 0.00 ? 11  THR A O    7  
ATOM 10853 C CB   . THR A 1 11  ? 5.863   28.359  4.391   1.00 0.00 ? 11  THR A CB   7  
ATOM 10854 O OG1  . THR A 1 11  ? 6.796   29.191  5.089   1.00 0.00 ? 11  THR A OG1  7  
ATOM 10855 C CG2  . THR A 1 11  ? 4.958   27.653  5.389   1.00 0.00 ? 11  THR A CG2  7  
ATOM 10856 H H    . THR A 1 11  ? 8.047   28.761  2.877   1.00 0.00 ? 11  THR A H    7  
ATOM 10857 H HA   . THR A 1 11  ? 6.743   26.430  4.091   1.00 0.00 ? 11  THR A HA   7  
ATOM 10858 H HB   . THR A 1 11  ? 5.252   28.978  3.747   1.00 0.00 ? 11  THR A HB   7  
ATOM 10859 H HG1  . THR A 1 11  ? 6.686   30.104  4.806   1.00 0.00 ? 11  THR A HG1  7  
ATOM 10860 H HG21 . THR A 1 11  ? 5.298   26.638  5.529   1.00 0.00 ? 11  THR A HG21 7  
ATOM 10861 H HG22 . THR A 1 11  ? 3.945   27.647  5.015   1.00 0.00 ? 11  THR A HG22 7  
ATOM 10862 H HG23 . THR A 1 11  ? 4.989   28.176  6.334   1.00 0.00 ? 11  THR A HG23 7  
ATOM 10863 N N    . GLN A 1 12  ? 4.845   26.102  2.419   1.00 0.00 ? 12  GLN A N    7  
ATOM 10864 C CA   . GLN A 1 12  ? 3.980   25.717  1.309   1.00 0.00 ? 12  GLN A CA   7  
ATOM 10865 C C    . GLN A 1 12  ? 2.752   26.619  1.238   1.00 0.00 ? 12  GLN A C    7  
ATOM 10866 O O    . GLN A 1 12  ? 2.561   27.495  2.082   1.00 0.00 ? 12  GLN A O    7  
ATOM 10867 C CB   . GLN A 1 12  ? 3.548   24.257  1.455   1.00 0.00 ? 12  GLN A CB   7  
ATOM 10868 C CG   . GLN A 1 12  ? 4.072   23.356  0.348   1.00 0.00 ? 12  GLN A CG   7  
ATOM 10869 C CD   . GLN A 1 12  ? 3.505   23.711  -1.012  1.00 0.00 ? 12  GLN A CD   7  
ATOM 10870 O OE1  . GLN A 1 12  ? 2.288   23.740  -1.202  1.00 0.00 ? 12  GLN A OE1  7  
ATOM 10871 N NE2  . GLN A 1 12  ? 4.387   23.985  -1.966  1.00 0.00 ? 12  GLN A NE2  7  
ATOM 10872 H H    . GLN A 1 12  ? 4.729   25.666  3.287   1.00 0.00 ? 12  GLN A H    7  
ATOM 10873 H HA   . GLN A 1 12  ? 4.546   25.827  0.397   1.00 0.00 ? 12  GLN A HA   7  
ATOM 10874 H HB2  . GLN A 1 12  ? 3.910   23.879  2.399   1.00 0.00 ? 12  GLN A HB2  7  
ATOM 10875 H HB3  . GLN A 1 12  ? 2.469   24.211  1.447   1.00 0.00 ? 12  GLN A HB3  7  
ATOM 10876 H HG2  . GLN A 1 12  ? 5.148   23.443  0.308   1.00 0.00 ? 12  GLN A HG2  7  
ATOM 10877 H HG3  . GLN A 1 12  ? 3.803   22.333  0.578   1.00 0.00 ? 12  GLN A HG3  7  
ATOM 10878 H HE21 . GLN A 1 12  ? 5.340   23.941  -1.742  1.00 0.00 ? 12  GLN A HE21 7  
ATOM 10879 H HE22 . GLN A 1 12  ? 4.047   24.218  -2.856  1.00 0.00 ? 12  GLN A HE22 7  
ATOM 10880 N N    . THR A 1 13  ? 1.922   26.400  0.223   1.00 0.00 ? 13  THR A N    7  
ATOM 10881 C CA   . THR A 1 13  ? 0.713   27.193  0.039   1.00 0.00 ? 13  THR A CA   7  
ATOM 10882 C C    . THR A 1 13  ? -0.491  26.518  0.687   1.00 0.00 ? 13  THR A C    7  
ATOM 10883 O O    . THR A 1 13  ? -1.331  25.934  0.003   1.00 0.00 ? 13  THR A O    7  
ATOM 10884 C CB   . THR A 1 13  ? 0.415   27.425  -1.454  1.00 0.00 ? 13  THR A CB   7  
ATOM 10885 O OG1  . THR A 1 13  ? 0.822   26.285  -2.218  1.00 0.00 ? 13  THR A OG1  7  
ATOM 10886 C CG2  . THR A 1 13  ? 1.134   28.665  -1.962  1.00 0.00 ? 13  THR A CG2  7  
ATOM 10887 H H    . THR A 1 13  ? 2.129   25.687  -0.417  1.00 0.00 ? 13  THR A H    7  
ATOM 10888 H HA   . THR A 1 13  ? 0.871   28.154  0.508   1.00 0.00 ? 13  THR A HA   7  
ATOM 10889 H HB   . THR A 1 13  ? -0.650  27.568  -1.574  1.00 0.00 ? 13  THR A HB   7  
ATOM 10890 H HG1  . THR A 1 13  ? 0.313   26.245  -3.031  1.00 0.00 ? 13  THR A HG1  7  
ATOM 10891 H HG21 . THR A 1 13  ? 0.781   29.532  -1.422  1.00 0.00 ? 13  THR A HG21 7  
ATOM 10892 H HG22 . THR A 1 13  ? 0.931   28.792  -3.016  1.00 0.00 ? 13  THR A HG22 7  
ATOM 10893 H HG23 . THR A 1 13  ? 2.195   28.554  -1.810  1.00 0.00 ? 13  THR A HG23 7  
ATOM 10894 N N    . SER A 1 14  ? -0.569  26.603  2.012   1.00 0.00 ? 14  SER A N    7  
ATOM 10895 C CA   . SER A 1 14  ? -1.670  25.998  2.754   1.00 0.00 ? 14  SER A CA   7  
ATOM 10896 C C    . SER A 1 14  ? -1.676  24.483  2.575   1.00 0.00 ? 14  SER A C    7  
ATOM 10897 O O    . SER A 1 14  ? -0.964  23.945  1.729   1.00 0.00 ? 14  SER A O    7  
ATOM 10898 C CB   . SER A 1 14  ? -3.006  26.584  2.292   1.00 0.00 ? 14  SER A CB   7  
ATOM 10899 O OG   . SER A 1 14  ? -3.960  26.562  3.340   1.00 0.00 ? 14  SER A OG   7  
ATOM 10900 H H    . SER A 1 14  ? 0.132   27.083  2.502   1.00 0.00 ? 14  SER A H    7  
ATOM 10901 H HA   . SER A 1 14  ? -1.529  26.225  3.799   1.00 0.00 ? 14  SER A HA   7  
ATOM 10902 H HB2  . SER A 1 14  ? -2.858  27.605  1.976   1.00 0.00 ? 14  SER A HB2  7  
ATOM 10903 H HB3  . SER A 1 14  ? -3.384  26.002  1.465   1.00 0.00 ? 14  SER A HB3  7  
ATOM 10904 H HG   . SER A 1 14  ? -4.012  27.432  3.743   1.00 0.00 ? 14  SER A HG   7  
ATOM 10905 N N    . GLU A 1 15  ? -2.487  23.802  3.377   1.00 0.00 ? 15  GLU A N    7  
ATOM 10906 C CA   . GLU A 1 15  ? -2.587  22.349  3.309   1.00 0.00 ? 15  GLU A CA   7  
ATOM 10907 C C    . GLU A 1 15  ? -3.622  21.923  2.271   1.00 0.00 ? 15  GLU A C    7  
ATOM 10908 O O    . GLU A 1 15  ? -4.785  22.320  2.341   1.00 0.00 ? 15  GLU A O    7  
ATOM 10909 C CB   . GLU A 1 15  ? -2.957  21.776  4.678   1.00 0.00 ? 15  GLU A CB   7  
ATOM 10910 C CG   . GLU A 1 15  ? -1.931  22.074  5.760   1.00 0.00 ? 15  GLU A CG   7  
ATOM 10911 C CD   . GLU A 1 15  ? -2.250  23.340  6.531   1.00 0.00 ? 15  GLU A CD   7  
ATOM 10912 O OE1  . GLU A 1 15  ? -3.306  23.382  7.195   1.00 0.00 ? 15  GLU A OE1  7  
ATOM 10913 O OE2  . GLU A 1 15  ? -1.440  24.291  6.471   1.00 0.00 ? 15  GLU A OE2  7  
ATOM 10914 H H    . GLU A 1 15  ? -3.032  24.288  4.032   1.00 0.00 ? 15  GLU A H    7  
ATOM 10915 H HA   . GLU A 1 15  ? -1.622  21.965  3.016   1.00 0.00 ? 15  GLU A HA   7  
ATOM 10916 H HB2  . GLU A 1 15  ? -3.905  22.190  4.986   1.00 0.00 ? 15  GLU A HB2  7  
ATOM 10917 H HB3  . GLU A 1 15  ? -3.054  20.703  4.591   1.00 0.00 ? 15  GLU A HB3  7  
ATOM 10918 H HG2  . GLU A 1 15  ? -1.906  21.247  6.452   1.00 0.00 ? 15  GLU A HG2  7  
ATOM 10919 H HG3  . GLU A 1 15  ? -0.962  22.187  5.297   1.00 0.00 ? 15  GLU A HG3  7  
ATOM 10920 N N    . GLN A 1 16  ? -3.190  21.113  1.311   1.00 0.00 ? 16  GLN A N    7  
ATOM 10921 C CA   . GLN A 1 16  ? -4.078  20.634  0.258   1.00 0.00 ? 16  GLN A CA   7  
ATOM 10922 C C    . GLN A 1 16  ? -4.148  19.111  0.258   1.00 0.00 ? 16  GLN A C    7  
ATOM 10923 O O    . GLN A 1 16  ? -3.540  18.451  1.099   1.00 0.00 ? 16  GLN A O    7  
ATOM 10924 C CB   . GLN A 1 16  ? -3.602  21.136  -1.106  1.00 0.00 ? 16  GLN A CB   7  
ATOM 10925 C CG   . GLN A 1 16  ? -4.444  22.272  -1.663  1.00 0.00 ? 16  GLN A CG   7  
ATOM 10926 C CD   . GLN A 1 16  ? -4.198  23.586  -0.945  1.00 0.00 ? 16  GLN A CD   7  
ATOM 10927 O OE1  . GLN A 1 16  ? -4.702  23.807  0.156   1.00 0.00 ? 16  GLN A OE1  7  
ATOM 10928 N NE2  . GLN A 1 16  ? -3.420  24.463  -1.566  1.00 0.00 ? 16  GLN A NE2  7  
ATOM 10929 H H    . GLN A 1 16  ? -2.251  20.830  1.310   1.00 0.00 ? 16  GLN A H    7  
ATOM 10930 H HA   . GLN A 1 16  ? -5.064  21.027  0.453   1.00 0.00 ? 16  GLN A HA   7  
ATOM 10931 H HB2  . GLN A 1 16  ? -2.584  21.480  -1.015  1.00 0.00 ? 16  GLN A HB2  7  
ATOM 10932 H HB3  . GLN A 1 16  ? -3.635  20.315  -1.809  1.00 0.00 ? 16  GLN A HB3  7  
ATOM 10933 H HG2  . GLN A 1 16  ? -4.204  22.403  -2.709  1.00 0.00 ? 16  GLN A HG2  7  
ATOM 10934 H HG3  . GLN A 1 16  ? -5.486  22.013  -1.563  1.00 0.00 ? 16  GLN A HG3  7  
ATOM 10935 H HE21 . GLN A 1 16  ? -3.053  24.218  -2.441  1.00 0.00 ? 16  GLN A HE21 7  
ATOM 10936 H HE22 . GLN A 1 16  ? -3.245  25.319  -1.125  1.00 0.00 ? 16  GLN A HE22 7  
ATOM 10937 N N    . ALA A 1 17  ? -4.896  18.559  -0.693  1.00 0.00 ? 17  ALA A N    7  
ATOM 10938 C CA   . ALA A 1 17  ? -5.044  17.113  -0.805  1.00 0.00 ? 17  ALA A CA   7  
ATOM 10939 C C    . ALA A 1 17  ? -3.721  16.451  -1.174  1.00 0.00 ? 17  ALA A C    7  
ATOM 10940 O O    . ALA A 1 17  ? -2.805  17.089  -1.695  1.00 0.00 ? 17  ALA A O    7  
ATOM 10941 C CB   . ALA A 1 17  ? -6.112  16.770  -1.833  1.00 0.00 ? 17  ALA A CB   7  
ATOM 10942 H H    . ALA A 1 17  ? -5.356  19.137  -1.335  1.00 0.00 ? 17  ALA A H    7  
ATOM 10943 H HA   . ALA A 1 17  ? -5.369  16.736  0.154   1.00 0.00 ? 17  ALA A HA   7  
ATOM 10944 H HB1  . ALA A 1 17  ? -5.830  15.869  -2.358  1.00 0.00 ? 17  ALA A HB1  7  
ATOM 10945 H HB2  . ALA A 1 17  ? -7.056  16.614  -1.333  1.00 0.00 ? 17  ALA A HB2  7  
ATOM 10946 H HB3  . ALA A 1 17  ? -6.208  17.583  -2.537  1.00 0.00 ? 17  ALA A HB3  7  
ATOM 10947 N N    . PRO A 1 18  ? -3.615  15.143  -0.898  1.00 0.00 ? 18  PRO A N    7  
ATOM 10948 C CA   . PRO A 1 18  ? -2.407  14.367  -1.192  1.00 0.00 ? 18  PRO A CA   7  
ATOM 10949 C C    . PRO A 1 18  ? -2.196  14.168  -2.689  1.00 0.00 ? 18  PRO A C    7  
ATOM 10950 O O    . PRO A 1 18  ? -3.053  13.615  -3.378  1.00 0.00 ? 18  PRO A O    7  
ATOM 10951 C CB   . PRO A 1 18  ? -2.671  13.024  -0.506  1.00 0.00 ? 18  PRO A CB   7  
ATOM 10952 C CG   . PRO A 1 18  ? -4.156  12.916  -0.446  1.00 0.00 ? 18  PRO A CG   7  
ATOM 10953 C CD   . PRO A 1 18  ? -4.667  14.321  -0.277  1.00 0.00 ? 18  PRO A CD   7  
ATOM 10954 H HA   . PRO A 1 18  ? -1.527  14.824  -0.765  1.00 0.00 ? 18  PRO A HA   7  
ATOM 10955 H HB2  . PRO A 1 18  ? -2.241  12.226  -1.093  1.00 0.00 ? 18  PRO A HB2  7  
ATOM 10956 H HB3  . PRO A 1 18  ? -2.236  13.028  0.482   1.00 0.00 ? 18  PRO A HB3  7  
ATOM 10957 H HG2  . PRO A 1 18  ? -4.530  12.488  -1.364  1.00 0.00 ? 18  PRO A HG2  7  
ATOM 10958 H HG3  . PRO A 1 18  ? -4.445  12.309  0.398   1.00 0.00 ? 18  PRO A HG3  7  
ATOM 10959 H HD2  . PRO A 1 18  ? -5.607  14.444  -0.792  1.00 0.00 ? 18  PRO A HD2  7  
ATOM 10960 H HD3  . PRO A 1 18  ? -4.774  14.559  0.770   1.00 0.00 ? 18  PRO A HD3  7  
ATOM 10961 N N    . SER A 1 19  ? -1.051  14.623  -3.187  1.00 0.00 ? 19  SER A N    7  
ATOM 10962 C CA   . SER A 1 19  ? -0.730  14.498  -4.604  1.00 0.00 ? 19  SER A CA   7  
ATOM 10963 C C    . SER A 1 19  ? 0.401   13.498  -4.818  1.00 0.00 ? 19  SER A C    7  
ATOM 10964 O O    . SER A 1 19  ? 1.243   13.674  -5.700  1.00 0.00 ? 19  SER A O    7  
ATOM 10965 C CB   . SER A 1 19  ? -0.338  15.859  -5.181  1.00 0.00 ? 19  SER A CB   7  
ATOM 10966 O OG   . SER A 1 19  ? -0.273  15.813  -6.597  1.00 0.00 ? 19  SER A OG   7  
ATOM 10967 H H    . SER A 1 19  ? -0.408  15.056  -2.587  1.00 0.00 ? 19  SER A H    7  
ATOM 10968 H HA   . SER A 1 19  ? -1.612  14.141  -5.113  1.00 0.00 ? 19  SER A HA   7  
ATOM 10969 H HB2  . SER A 1 19  ? -1.071  16.596  -4.891  1.00 0.00 ? 19  SER A HB2  7  
ATOM 10970 H HB3  . SER A 1 19  ? 0.631   16.145  -4.798  1.00 0.00 ? 19  SER A HB3  7  
ATOM 10971 H HG   . SER A 1 19  ? 0.218   16.572  -6.919  1.00 0.00 ? 19  SER A HG   7  
ATOM 10972 N N    . SER A 1 20  ? 0.416   12.446  -4.004  1.00 0.00 ? 20  SER A N    7  
ATOM 10973 C CA   . SER A 1 20  ? 1.446   11.418  -4.100  1.00 0.00 ? 20  SER A CA   7  
ATOM 10974 C C    . SER A 1 20  ? 0.895   10.057  -3.686  1.00 0.00 ? 20  SER A C    7  
ATOM 10975 O O    . SER A 1 20  ? 0.321   9.909   -2.609  1.00 0.00 ? 20  SER A O    7  
ATOM 10976 C CB   . SER A 1 20  ? 2.644   11.784  -3.222  1.00 0.00 ? 20  SER A CB   7  
ATOM 10977 O OG   . SER A 1 20  ? 3.804   11.076  -3.623  1.00 0.00 ? 20  SER A OG   7  
ATOM 10978 H H    . SER A 1 20  ? -0.281  12.363  -3.319  1.00 0.00 ? 20  SER A H    7  
ATOM 10979 H HA   . SER A 1 20  ? 1.767   11.368  -5.130  1.00 0.00 ? 20  SER A HA   7  
ATOM 10980 H HB2  . SER A 1 20  ? 2.838   12.843  -3.305  1.00 0.00 ? 20  SER A HB2  7  
ATOM 10981 H HB3  . SER A 1 20  ? 2.423   11.537  -2.195  1.00 0.00 ? 20  SER A HB3  7  
ATOM 10982 H HG   . SER A 1 20  ? 4.243   11.551  -4.331  1.00 0.00 ? 20  SER A HG   7  
ATOM 10983 N N    . ALA A 1 21  ? 1.073   9.066   -4.554  1.00 0.00 ? 21  ALA A N    7  
ATOM 10984 C CA   . ALA A 1 21  ? 0.597   7.716   -4.280  1.00 0.00 ? 21  ALA A CA   7  
ATOM 10985 C C    . ALA A 1 21  ? 1.405   7.064   -3.164  1.00 0.00 ? 21  ALA A C    7  
ATOM 10986 O O    . ALA A 1 21  ? 2.556   7.420   -2.910  1.00 0.00 ? 21  ALA A O    7  
ATOM 10987 C CB   . ALA A 1 21  ? 0.657   6.868   -5.543  1.00 0.00 ? 21  ALA A CB   7  
ATOM 10988 H H    . ALA A 1 21  ? 1.538   9.247   -5.397  1.00 0.00 ? 21  ALA A H    7  
ATOM 10989 H HA   . ALA A 1 21  ? -0.436  7.784   -3.970  1.00 0.00 ? 21  ALA A HA   7  
ATOM 10990 H HB1  . ALA A 1 21  ? -0.221  6.241   -5.595  1.00 0.00 ? 21  ALA A HB1  7  
ATOM 10991 H HB2  . ALA A 1 21  ? 0.692   7.514   -6.408  1.00 0.00 ? 21  ALA A HB2  7  
ATOM 10992 H HB3  . ALA A 1 21  ? 1.542   6.250   -5.518  1.00 0.00 ? 21  ALA A HB3  7  
ATOM 10993 N N    . PRO A 1 22  ? 0.790   6.088   -2.479  1.00 0.00 ? 22  PRO A N    7  
ATOM 10994 C CA   . PRO A 1 22  ? 1.436   5.367   -1.378  1.00 0.00 ? 22  PRO A CA   7  
ATOM 10995 C C    . PRO A 1 22  ? 2.558   4.455   -1.862  1.00 0.00 ? 22  PRO A C    7  
ATOM 10996 O O    . PRO A 1 22  ? 2.480   3.880   -2.947  1.00 0.00 ? 22  PRO A O    7  
ATOM 10997 C CB   . PRO A 1 22  ? 0.295   4.539   -0.781  1.00 0.00 ? 22  PRO A CB   7  
ATOM 10998 C CG   . PRO A 1 22  ? -0.671  4.361   -1.900  1.00 0.00 ? 22  PRO A CG   7  
ATOM 10999 C CD   . PRO A 1 22  ? -0.581  5.613   -2.728  1.00 0.00 ? 22  PRO A CD   7  
ATOM 11000 H HA   . PRO A 1 22  ? 1.820   6.044   -0.631  1.00 0.00 ? 22  PRO A HA   7  
ATOM 11001 H HB2  . PRO A 1 22  ? 0.679   3.590   -0.435  1.00 0.00 ? 22  PRO A HB2  7  
ATOM 11002 H HB3  . PRO A 1 22  ? -0.150  5.076   0.043   1.00 0.00 ? 22  PRO A HB3  7  
ATOM 11003 H HG2  . PRO A 1 22  ? -0.395  3.501   -2.491  1.00 0.00 ? 22  PRO A HG2  7  
ATOM 11004 H HG3  . PRO A 1 22  ? -1.670  4.243   -1.506  1.00 0.00 ? 22  PRO A HG3  7  
ATOM 11005 H HD2  . PRO A 1 22  ? -0.727  5.386   -3.773  1.00 0.00 ? 22  PRO A HD2  7  
ATOM 11006 H HD3  . PRO A 1 22  ? -1.307  6.340   -2.392  1.00 0.00 ? 22  PRO A HD3  7  
ATOM 11007 N N    . ARG A 1 23  ? 3.602   4.329   -1.050  1.00 0.00 ? 23  ARG A N    7  
ATOM 11008 C CA   . ARG A 1 23  ? 4.743   3.487   -1.395  1.00 0.00 ? 23  ARG A CA   7  
ATOM 11009 C C    . ARG A 1 23  ? 4.829   2.280   -0.466  1.00 0.00 ? 23  ARG A C    7  
ATOM 11010 O O    . ARG A 1 23  ? 4.021   2.131   0.451   1.00 0.00 ? 23  ARG A O    7  
ATOM 11011 C CB   . ARG A 1 23  ? 6.041   4.295   -1.323  1.00 0.00 ? 23  ARG A CB   7  
ATOM 11012 C CG   . ARG A 1 23  ? 5.950   5.654   -1.997  1.00 0.00 ? 23  ARG A CG   7  
ATOM 11013 C CD   . ARG A 1 23  ? 7.279   6.058   -2.616  1.00 0.00 ? 23  ARG A CD   7  
ATOM 11014 N NE   . ARG A 1 23  ? 7.623   5.227   -3.766  1.00 0.00 ? 23  ARG A NE   7  
ATOM 11015 C CZ   . ARG A 1 23  ? 8.789   5.294   -4.399  1.00 0.00 ? 23  ARG A CZ   7  
ATOM 11016 N NH1  . ARG A 1 23  ? 9.719   6.146   -3.994  1.00 0.00 ? 23  ARG A NH1  7  
ATOM 11017 N NH2  . ARG A 1 23  ? 9.026   4.505   -5.440  1.00 0.00 ? 23  ARG A NH2  7  
ATOM 11018 H H    . ARG A 1 23  ? 3.608   4.813   -0.198  1.00 0.00 ? 23  ARG A H    7  
ATOM 11019 H HA   . ARG A 1 23  ? 4.602   3.138   -2.408  1.00 0.00 ? 23  ARG A HA   7  
ATOM 11020 H HB2  . ARG A 1 23  ? 6.296   4.449   -0.285  1.00 0.00 ? 23  ARG A HB2  7  
ATOM 11021 H HB3  . ARG A 1 23  ? 6.827   3.731   -1.800  1.00 0.00 ? 23  ARG A HB3  7  
ATOM 11022 H HG2  . ARG A 1 23  ? 5.202   5.611   -2.775  1.00 0.00 ? 23  ARG A HG2  7  
ATOM 11023 H HG3  . ARG A 1 23  ? 5.666   6.391   -1.261  1.00 0.00 ? 23  ARG A HG3  7  
ATOM 11024 H HD2  . ARG A 1 23  ? 7.215   7.087   -2.933  1.00 0.00 ? 23  ARG A HD2  7  
ATOM 11025 H HD3  . ARG A 1 23  ? 8.053   5.959   -1.868  1.00 0.00 ? 23  ARG A HD3  7  
ATOM 11026 H HE   . ARG A 1 23  ? 6.949   4.589   -4.084  1.00 0.00 ? 23  ARG A HE   7  
ATOM 11027 H HH11 . ARG A 1 23  ? 9.543   6.742   -3.210  1.00 0.00 ? 23  ARG A HH11 7  
ATOM 11028 H HH12 . ARG A 1 23  ? 10.597  6.193   -4.470  1.00 0.00 ? 23  ARG A HH12 7  
ATOM 11029 H HH21 . ARG A 1 23  ? 8.328   3.860   -5.748  1.00 0.00 ? 23  ARG A HH21 7  
ATOM 11030 H HH22 . ARG A 1 23  ? 9.905   4.555   -5.914  1.00 0.00 ? 23  ARG A HH22 7  
ATOM 11031 N N    . ASP A 1 24  ? 5.813   1.420   -0.711  1.00 0.00 ? 24  ASP A N    7  
ATOM 11032 C CA   . ASP A 1 24  ? 6.004   0.227   0.104   1.00 0.00 ? 24  ASP A CA   7  
ATOM 11033 C C    . ASP A 1 24  ? 4.737   -0.622  0.131   1.00 0.00 ? 24  ASP A C    7  
ATOM 11034 O O    . ASP A 1 24  ? 4.508   -1.384  1.071   1.00 0.00 ? 24  ASP A O    7  
ATOM 11035 C CB   . ASP A 1 24  ? 6.405   0.615   1.529   1.00 0.00 ? 24  ASP A CB   7  
ATOM 11036 C CG   . ASP A 1 24  ? 7.308   -0.416  2.178   1.00 0.00 ? 24  ASP A CG   7  
ATOM 11037 O OD1  . ASP A 1 24  ? 7.567   -1.460  1.544   1.00 0.00 ? 24  ASP A OD1  7  
ATOM 11038 O OD2  . ASP A 1 24  ? 7.755   -0.178  3.319   1.00 0.00 ? 24  ASP A OD2  7  
ATOM 11039 H H    . ASP A 1 24  ? 6.424   1.594   -1.457  1.00 0.00 ? 24  ASP A H    7  
ATOM 11040 H HA   . ASP A 1 24  ? 6.801   -0.351  -0.338  1.00 0.00 ? 24  ASP A HA   7  
ATOM 11041 H HB2  . ASP A 1 24  ? 6.927   1.560   1.504   1.00 0.00 ? 24  ASP A HB2  7  
ATOM 11042 H HB3  . ASP A 1 24  ? 5.513   0.716   2.130   1.00 0.00 ? 24  ASP A HB3  7  
ATOM 11043 N N    . VAL A 1 25  ? 3.919   -0.487  -0.907  1.00 0.00 ? 25  VAL A N    7  
ATOM 11044 C CA   . VAL A 1 25  ? 2.674   -1.242  -1.003  1.00 0.00 ? 25  VAL A CA   7  
ATOM 11045 C C    . VAL A 1 25  ? 2.928   -2.656  -1.515  1.00 0.00 ? 25  VAL A C    7  
ATOM 11046 O O    . VAL A 1 25  ? 3.021   -2.882  -2.720  1.00 0.00 ? 25  VAL A O    7  
ATOM 11047 C CB   . VAL A 1 25  ? 1.665   -0.545  -1.933  1.00 0.00 ? 25  VAL A CB   7  
ATOM 11048 C CG1  . VAL A 1 25  ? 0.390   -1.367  -2.049  1.00 0.00 ? 25  VAL A CG1  7  
ATOM 11049 C CG2  . VAL A 1 25  ? 1.360   0.859   -1.430  1.00 0.00 ? 25  VAL A CG2  7  
ATOM 11050 H H    . VAL A 1 25  ? 4.157   0.134   -1.626  1.00 0.00 ? 25  VAL A H    7  
ATOM 11051 H HA   . VAL A 1 25  ? 2.242   -1.300  -0.014  1.00 0.00 ? 25  VAL A HA   7  
ATOM 11052 H HB   . VAL A 1 25  ? 2.107   -0.465  -2.916  1.00 0.00 ? 25  VAL A HB   7  
ATOM 11053 H HG11 . VAL A 1 25  ? 0.591   -2.263  -2.619  1.00 0.00 ? 25  VAL A HG11 7  
ATOM 11054 H HG12 . VAL A 1 25  ? 0.042   -1.635  -1.063  1.00 0.00 ? 25  VAL A HG12 7  
ATOM 11055 H HG13 . VAL A 1 25  ? -0.368  -0.784  -2.552  1.00 0.00 ? 25  VAL A HG13 7  
ATOM 11056 H HG21 . VAL A 1 25  ? 0.977   1.456   -2.245  1.00 0.00 ? 25  VAL A HG21 7  
ATOM 11057 H HG22 . VAL A 1 25  ? 0.621   0.807   -0.644  1.00 0.00 ? 25  VAL A HG22 7  
ATOM 11058 H HG23 . VAL A 1 25  ? 2.264   1.309   -1.049  1.00 0.00 ? 25  VAL A HG23 7  
ATOM 11059 N N    . GLN A 1 26  ? 3.038   -3.604  -0.589  1.00 0.00 ? 26  GLN A N    7  
ATOM 11060 C CA   . GLN A 1 26  ? 3.280   -4.996  -0.947  1.00 0.00 ? 26  GLN A CA   7  
ATOM 11061 C C    . GLN A 1 26  ? 2.283   -5.918  -0.254  1.00 0.00 ? 26  GLN A C    7  
ATOM 11062 O O    . GLN A 1 26  ? 1.908   -5.692  0.896   1.00 0.00 ? 26  GLN A O    7  
ATOM 11063 C CB   . GLN A 1 26  ? 4.708   -5.399  -0.575  1.00 0.00 ? 26  GLN A CB   7  
ATOM 11064 C CG   . GLN A 1 26  ? 5.023   -5.228  0.903   1.00 0.00 ? 26  GLN A CG   7  
ATOM 11065 C CD   . GLN A 1 26  ? 6.417   -5.704  1.261   1.00 0.00 ? 26  GLN A CD   7  
ATOM 11066 O OE1  . GLN A 1 26  ? 6.608   -6.850  1.670   1.00 0.00 ? 26  GLN A OE1  7  
ATOM 11067 N NE2  . GLN A 1 26  ? 7.401   -4.825  1.108   1.00 0.00 ? 26  GLN A NE2  7  
ATOM 11068 H H    . GLN A 1 26  ? 2.954   -3.360  0.357   1.00 0.00 ? 26  GLN A H    7  
ATOM 11069 H HA   . GLN A 1 26  ? 3.157   -5.089  -2.015  1.00 0.00 ? 26  GLN A HA   7  
ATOM 11070 H HB2  . GLN A 1 26  ? 4.856   -6.436  -0.836  1.00 0.00 ? 26  GLN A HB2  7  
ATOM 11071 H HB3  . GLN A 1 26  ? 5.400   -4.792  -1.140  1.00 0.00 ? 26  GLN A HB3  7  
ATOM 11072 H HG2  . GLN A 1 26  ? 4.941   -4.183  1.157   1.00 0.00 ? 26  GLN A HG2  7  
ATOM 11073 H HG3  . GLN A 1 26  ? 4.305   -5.795  1.478   1.00 0.00 ? 26  GLN A HG3  7  
ATOM 11074 H HE21 . GLN A 1 26  ? 7.173   -3.931  0.779   1.00 0.00 ? 26  GLN A HE21 7  
ATOM 11075 H HE22 . GLN A 1 26  ? 8.311   -5.106  1.333   1.00 0.00 ? 26  GLN A HE22 7  
ATOM 11076 N N    . ALA A 1 27  ? 1.855   -6.958  -0.963  1.00 0.00 ? 27  ALA A N    7  
ATOM 11077 C CA   . ALA A 1 27  ? 0.902   -7.915  -0.415  1.00 0.00 ? 27  ALA A CA   7  
ATOM 11078 C C    . ALA A 1 27  ? 1.560   -9.269  -0.176  1.00 0.00 ? 27  ALA A C    7  
ATOM 11079 O O    . ALA A 1 27  ? 2.091   -9.884  -1.101  1.00 0.00 ? 27  ALA A O    7  
ATOM 11080 C CB   . ALA A 1 27  ? -0.291  -8.064  -1.347  1.00 0.00 ? 27  ALA A CB   7  
ATOM 11081 H H    . ALA A 1 27  ? 2.189   -7.086  -1.874  1.00 0.00 ? 27  ALA A H    7  
ATOM 11082 H HA   . ALA A 1 27  ? 0.543   -7.529  0.528   1.00 0.00 ? 27  ALA A HA   7  
ATOM 11083 H HB1  . ALA A 1 27  ? -0.071  -8.809  -2.098  1.00 0.00 ? 27  ALA A HB1  7  
ATOM 11084 H HB2  . ALA A 1 27  ? -1.156  -8.371  -0.779  1.00 0.00 ? 27  ALA A HB2  7  
ATOM 11085 H HB3  . ALA A 1 27  ? -0.493  -7.117  -1.827  1.00 0.00 ? 27  ALA A HB3  7  
ATOM 11086 N N    . ARG A 1 28  ? 1.521   -9.729  1.071   1.00 0.00 ? 28  ARG A N    7  
ATOM 11087 C CA   . ARG A 1 28  ? 2.117   -11.010 1.433   1.00 0.00 ? 28  ARG A CA   7  
ATOM 11088 C C    . ARG A 1 28  ? 1.064   -11.957 2.004   1.00 0.00 ? 28  ARG A C    7  
ATOM 11089 O O    . ARG A 1 28  ? 0.293   -11.582 2.888   1.00 0.00 ? 28  ARG A O    7  
ATOM 11090 C CB   . ARG A 1 28  ? 3.241   -10.806 2.448   1.00 0.00 ? 28  ARG A CB   7  
ATOM 11091 C CG   . ARG A 1 28  ? 2.839   -9.946  3.636   1.00 0.00 ? 28  ARG A CG   7  
ATOM 11092 C CD   . ARG A 1 28  ? 3.763   -10.171 4.823   1.00 0.00 ? 28  ARG A CD   7  
ATOM 11093 N NE   . ARG A 1 28  ? 4.767   -9.118  4.943   1.00 0.00 ? 28  ARG A NE   7  
ATOM 11094 C CZ   . ARG A 1 28  ? 5.469   -8.894  6.048   1.00 0.00 ? 28  ARG A CZ   7  
ATOM 11095 N NH1  . ARG A 1 28  ? 5.278   -9.646  7.124   1.00 0.00 ? 28  ARG A NH1  7  
ATOM 11096 N NH2  . ARG A 1 28  ? 6.365   -7.915  6.079   1.00 0.00 ? 28  ARG A NH2  7  
ATOM 11097 H H    . ARG A 1 28  ? 1.084   -9.193  1.765   1.00 0.00 ? 28  ARG A H    7  
ATOM 11098 H HA   . ARG A 1 28  ? 2.528   -11.449 0.536   1.00 0.00 ? 28  ARG A HA   7  
ATOM 11099 H HB2  . ARG A 1 28  ? 3.554   -11.770 2.820   1.00 0.00 ? 28  ARG A HB2  7  
ATOM 11100 H HB3  . ARG A 1 28  ? 4.075   -10.331 1.954   1.00 0.00 ? 28  ARG A HB3  7  
ATOM 11101 H HG2  . ARG A 1 28  ? 2.887   -8.907  3.349   1.00 0.00 ? 28  ARG A HG2  7  
ATOM 11102 H HG3  . ARG A 1 28  ? 1.829   -10.197 3.924   1.00 0.00 ? 28  ARG A HG3  7  
ATOM 11103 H HD2  . ARG A 1 28  ? 3.169   -10.193 5.726   1.00 0.00 ? 28  ARG A HD2  7  
ATOM 11104 H HD3  . ARG A 1 28  ? 4.263   -11.120 4.700   1.00 0.00 ? 28  ARG A HD3  7  
ATOM 11105 H HE   . ARG A 1 28  ? 4.924   -8.549  4.160   1.00 0.00 ? 28  ARG A HE   7  
ATOM 11106 H HH11 . ARG A 1 28  ? 4.605   -10.384 7.102   1.00 0.00 ? 28  ARG A HH11 7  
ATOM 11107 H HH12 . ARG A 1 28  ? 5.809   -9.476  7.953   1.00 0.00 ? 28  ARG A HH12 7  
ATOM 11108 H HH21 . ARG A 1 28  ? 6.512   -7.346  5.271   1.00 0.00 ? 28  ARG A HH21 7  
ATOM 11109 H HH22 . ARG A 1 28  ? 6.893   -7.747  6.911   1.00 0.00 ? 28  ARG A HH22 7  
ATOM 11110 N N    . MET A 1 29  ? 1.038   -13.183 1.492   1.00 0.00 ? 29  MET A N    7  
ATOM 11111 C CA   . MET A 1 29  ? 0.082   -14.181 1.954   1.00 0.00 ? 29  MET A CA   7  
ATOM 11112 C C    . MET A 1 29  ? 0.557   -14.836 3.247   1.00 0.00 ? 29  MET A C    7  
ATOM 11113 O O    . MET A 1 29  ? 1.754   -15.064 3.436   1.00 0.00 ? 29  MET A O    7  
ATOM 11114 C CB   . MET A 1 29  ? -0.131  -15.250 0.878   1.00 0.00 ? 29  MET A CB   7  
ATOM 11115 C CG   . MET A 1 29  ? -1.472  -15.139 0.171   1.00 0.00 ? 29  MET A CG   7  
ATOM 11116 S SD   . MET A 1 29  ? -2.867  -15.415 1.280   1.00 0.00 ? 29  MET A SD   7  
ATOM 11117 C CE   . MET A 1 29  ? -3.768  -16.676 0.383   1.00 0.00 ? 29  MET A CE   7  
ATOM 11118 H H    . MET A 1 29  ? 1.678   -13.423 0.789   1.00 0.00 ? 29  MET A H    7  
ATOM 11119 H HA   . MET A 1 29  ? -0.856  -13.681 2.141   1.00 0.00 ? 29  MET A HA   7  
ATOM 11120 H HB2  . MET A 1 29  ? 0.650   -15.158 0.138   1.00 0.00 ? 29  MET A HB2  7  
ATOM 11121 H HB3  . MET A 1 29  ? -0.069  -16.224 1.338   1.00 0.00 ? 29  MET A HB3  7  
ATOM 11122 H HG2  . MET A 1 29  ? -1.561  -14.152 -0.256  1.00 0.00 ? 29  MET A HG2  7  
ATOM 11123 H HG3  . MET A 1 29  ? -1.508  -15.875 -0.619  1.00 0.00 ? 29  MET A HG3  7  
ATOM 11124 H HE1  . MET A 1 29  ? -4.423  -16.209 -0.338  1.00 0.00 ? 29  MET A HE1  7  
ATOM 11125 H HE2  . MET A 1 29  ? -3.070  -17.322 -0.130  1.00 0.00 ? 29  MET A HE2  7  
ATOM 11126 H HE3  . MET A 1 29  ? -4.356  -17.260 1.077   1.00 0.00 ? 29  MET A HE3  7  
ATOM 11127 N N    . LEU A 1 30  ? -0.383  -15.133 4.136   1.00 0.00 ? 30  LEU A N    7  
ATOM 11128 C CA   . LEU A 1 30  ? -0.060  -15.760 5.412   1.00 0.00 ? 30  LEU A CA   7  
ATOM 11129 C C    . LEU A 1 30  ? -0.829  -17.066 5.588   1.00 0.00 ? 30  LEU A C    7  
ATOM 11130 O O    . LEU A 1 30  ? -0.316  -18.027 6.163   1.00 0.00 ? 30  LEU A O    7  
ATOM 11131 C CB   . LEU A 1 30  ? -0.381  -14.808 6.566   1.00 0.00 ? 30  LEU A CB   7  
ATOM 11132 C CG   . LEU A 1 30  ? -0.045  -13.334 6.334   1.00 0.00 ? 30  LEU A CG   7  
ATOM 11133 C CD1  . LEU A 1 30  ? -0.633  -12.472 7.440   1.00 0.00 ? 30  LEU A CD1  7  
ATOM 11134 C CD2  . LEU A 1 30  ? 1.463   -13.139 6.246   1.00 0.00 ? 30  LEU A CD2  7  
ATOM 11135 H H    . LEU A 1 30  ? -1.319  -14.927 3.929   1.00 0.00 ? 30  LEU A H    7  
ATOM 11136 H HA   . LEU A 1 30  ? 0.998   -15.974 5.417   1.00 0.00 ? 30  LEU A HA   7  
ATOM 11137 H HB2  . LEU A 1 30  ? -1.438  -14.878 6.769   1.00 0.00 ? 30  LEU A HB2  7  
ATOM 11138 H HB3  . LEU A 1 30  ? 0.172   -15.142 7.433   1.00 0.00 ? 30  LEU A HB3  7  
ATOM 11139 H HG   . LEU A 1 30  ? -0.478  -13.016 5.396   1.00 0.00 ? 30  LEU A HG   7  
ATOM 11140 H HD11 . LEU A 1 30  ? 0.115   -11.776 7.790   1.00 0.00 ? 30  LEU A HD11 7  
ATOM 11141 H HD12 . LEU A 1 30  ? -0.948  -13.103 8.257   1.00 0.00 ? 30  LEU A HD12 7  
ATOM 11142 H HD13 . LEU A 1 30  ? -1.481  -11.926 7.057   1.00 0.00 ? 30  LEU A HD13 7  
ATOM 11143 H HD21 . LEU A 1 30  ? 1.816   -13.499 5.291   1.00 0.00 ? 30  LEU A HD21 7  
ATOM 11144 H HD22 . LEU A 1 30  ? 1.944   -13.691 7.040   1.00 0.00 ? 30  LEU A HD22 7  
ATOM 11145 H HD23 . LEU A 1 30  ? 1.696   -12.090 6.344   1.00 0.00 ? 30  LEU A HD23 7  
ATOM 11146 N N    . SER A 1 31  ? -2.058  -17.096 5.085   1.00 0.00 ? 31  SER A N    7  
ATOM 11147 C CA   . SER A 1 31  ? -2.897  -18.284 5.188   1.00 0.00 ? 31  SER A CA   7  
ATOM 11148 C C    . SER A 1 31  ? -3.489  -18.650 3.829   1.00 0.00 ? 31  SER A C    7  
ATOM 11149 O O    . SER A 1 31  ? -3.092  -18.106 2.801   1.00 0.00 ? 31  SER A O    7  
ATOM 11150 C CB   . SER A 1 31  ? -4.020  -18.055 6.201   1.00 0.00 ? 31  SER A CB   7  
ATOM 11151 O OG   . SER A 1 31  ? -4.150  -19.162 7.077   1.00 0.00 ? 31  SER A OG   7  
ATOM 11152 H H    . SER A 1 31  ? -2.411  -16.298 4.637   1.00 0.00 ? 31  SER A H    7  
ATOM 11153 H HA   . SER A 1 31  ? -2.277  -19.099 5.528   1.00 0.00 ? 31  SER A HA   7  
ATOM 11154 H HB2  . SER A 1 31  ? -3.802  -17.174 6.786   1.00 0.00 ? 31  SER A HB2  7  
ATOM 11155 H HB3  . SER A 1 31  ? -4.953  -17.915 5.675   1.00 0.00 ? 31  SER A HB3  7  
ATOM 11156 H HG   . SER A 1 31  ? -3.600  -19.024 7.852   1.00 0.00 ? 31  SER A HG   7  
ATOM 11157 N N    . SER A 1 32  ? -4.443  -19.575 3.837   1.00 0.00 ? 32  SER A N    7  
ATOM 11158 C CA   . SER A 1 32  ? -5.088  -20.018 2.607   1.00 0.00 ? 32  SER A CA   7  
ATOM 11159 C C    . SER A 1 32  ? -6.144  -19.013 2.156   1.00 0.00 ? 32  SER A C    7  
ATOM 11160 O O    . SER A 1 32  ? -6.505  -18.958 0.980   1.00 0.00 ? 32  SER A O    7  
ATOM 11161 C CB   . SER A 1 32  ? -5.729  -21.393 2.807   1.00 0.00 ? 32  SER A CB   7  
ATOM 11162 O OG   . SER A 1 32  ? -6.361  -21.481 4.073   1.00 0.00 ? 32  SER A OG   7  
ATOM 11163 H H    . SER A 1 32  ? -4.717  -19.972 4.691   1.00 0.00 ? 32  SER A H    7  
ATOM 11164 H HA   . SER A 1 32  ? -4.330  -20.091 1.843   1.00 0.00 ? 32  SER A HA   7  
ATOM 11165 H HB2  . SER A 1 32  ? -6.468  -21.558 2.037   1.00 0.00 ? 32  SER A HB2  7  
ATOM 11166 H HB3  . SER A 1 32  ? -4.966  -22.154 2.744   1.00 0.00 ? 32  SER A HB3  7  
ATOM 11167 H HG   . SER A 1 32  ? -7.309  -21.377 3.965   1.00 0.00 ? 32  SER A HG   7  
ATOM 11168 N N    . THR A 1 33  ? -6.639  -18.219 3.101   1.00 0.00 ? 33  THR A N    7  
ATOM 11169 C CA   . THR A 1 33  ? -7.654  -17.216 2.802   1.00 0.00 ? 33  THR A CA   7  
ATOM 11170 C C    . THR A 1 33  ? -7.451  -15.961 3.644   1.00 0.00 ? 33  THR A C    7  
ATOM 11171 O O    . THR A 1 33  ? -8.416  -15.312 4.051   1.00 0.00 ? 33  THR A O    7  
ATOM 11172 C CB   . THR A 1 33  ? -9.073  -17.764 3.050   1.00 0.00 ? 33  THR A CB   7  
ATOM 11173 O OG1  . THR A 1 33  ? -9.120  -18.456 4.302   1.00 0.00 ? 33  THR A OG1  7  
ATOM 11174 C CG2  . THR A 1 33  ? -9.493  -18.703 1.930   1.00 0.00 ? 33  THR A CG2  7  
ATOM 11175 H H    . THR A 1 33  ? -6.312  -18.311 4.020   1.00 0.00 ? 33  THR A H    7  
ATOM 11176 H HA   . THR A 1 33  ? -7.569  -16.956 1.758   1.00 0.00 ? 33  THR A HA   7  
ATOM 11177 H HB   . THR A 1 33  ? -9.762  -16.933 3.081   1.00 0.00 ? 33  THR A HB   7  
ATOM 11178 H HG1  . THR A 1 33  ? -9.942  -18.947 4.365   1.00 0.00 ? 33  THR A HG1  7  
ATOM 11179 H HG21 . THR A 1 33  ? -9.204  -18.281 0.978   1.00 0.00 ? 33  THR A HG21 7  
ATOM 11180 H HG22 . THR A 1 33  ? -10.565 -18.836 1.955   1.00 0.00 ? 33  THR A HG22 7  
ATOM 11181 H HG23 . THR A 1 33  ? -9.009  -19.658 2.061   1.00 0.00 ? 33  THR A HG23 7  
ATOM 11182 N N    . THR A 1 34  ? -6.192  -15.624 3.901   1.00 0.00 ? 34  THR A N    7  
ATOM 11183 C CA   . THR A 1 34  ? -5.863  -14.447 4.696   1.00 0.00 ? 34  THR A CA   7  
ATOM 11184 C C    . THR A 1 34  ? -4.625  -13.745 4.151   1.00 0.00 ? 34  THR A C    7  
ATOM 11185 O O    . THR A 1 34  ? -3.542  -14.327 4.100   1.00 0.00 ? 34  THR A O    7  
ATOM 11186 C CB   . THR A 1 34  ? -5.622  -14.814 6.172   1.00 0.00 ? 34  THR A CB   7  
ATOM 11187 O OG1  . THR A 1 34  ? -6.158  -16.113 6.448   1.00 0.00 ? 34  THR A OG1  7  
ATOM 11188 C CG2  . THR A 1 34  ? -6.263  -13.789 7.096   1.00 0.00 ? 34  THR A CG2  7  
ATOM 11189 H H    . THR A 1 34  ? -5.467  -16.182 3.549   1.00 0.00 ? 34  THR A H    7  
ATOM 11190 H HA   . THR A 1 34  ? -6.701  -13.767 4.647   1.00 0.00 ? 34  THR A HA   7  
ATOM 11191 H HB   . THR A 1 34  ? -4.558  -14.826 6.356   1.00 0.00 ? 34  THR A HB   7  
ATOM 11192 H HG1  . THR A 1 34  ? -6.058  -16.310 7.381   1.00 0.00 ? 34  THR A HG1  7  
ATOM 11193 H HG21 . THR A 1 34  ? -7.126  -13.356 6.610   1.00 0.00 ? 34  THR A HG21 7  
ATOM 11194 H HG22 . THR A 1 34  ? -5.550  -13.012 7.321   1.00 0.00 ? 34  THR A HG22 7  
ATOM 11195 H HG23 . THR A 1 34  ? -6.570  -14.272 8.010   1.00 0.00 ? 34  THR A HG23 7  
ATOM 11196 N N    . ILE A 1 35  ? -4.793  -12.490 3.744   1.00 0.00 ? 35  ILE A N    7  
ATOM 11197 C CA   . ILE A 1 35  ? -3.687  -11.709 3.205   1.00 0.00 ? 35  ILE A CA   7  
ATOM 11198 C C    . ILE A 1 35  ? -3.357  -10.525 4.109   1.00 0.00 ? 35  ILE A C    7  
ATOM 11199 O O    . ILE A 1 35  ? -4.032  -10.289 5.111   1.00 0.00 ? 35  ILE A O    7  
ATOM 11200 C CB   . ILE A 1 35  ? -4.003  -11.188 1.790   1.00 0.00 ? 35  ILE A CB   7  
ATOM 11201 C CG1  . ILE A 1 35  ? -5.207  -10.244 1.828   1.00 0.00 ? 35  ILE A CG1  7  
ATOM 11202 C CG2  . ILE A 1 35  ? -4.265  -12.351 0.844   1.00 0.00 ? 35  ILE A CG2  7  
ATOM 11203 C CD1  . ILE A 1 35  ? -5.464  -9.539  0.515   1.00 0.00 ? 35  ILE A CD1  7  
ATOM 11204 H H    . ILE A 1 35  ? -5.680  -12.081 3.809   1.00 0.00 ? 35  ILE A H    7  
ATOM 11205 H HA   . ILE A 1 35  ? -2.822  -12.354 3.144   1.00 0.00 ? 35  ILE A HA   7  
ATOM 11206 H HB   . ILE A 1 35  ? -3.142  -10.648 1.430   1.00 0.00 ? 35  ILE A HB   7  
ATOM 11207 H HG12 . ILE A 1 35  ? -6.091  -10.808 2.081   1.00 0.00 ? 35  ILE A HG12 7  
ATOM 11208 H HG13 . ILE A 1 35  ? -5.038  -9.490  2.583   1.00 0.00 ? 35  ILE A HG13 7  
ATOM 11209 H HG21 . ILE A 1 35  ? -3.356  -12.592 0.312   1.00 0.00 ? 35  ILE A HG21 7  
ATOM 11210 H HG22 . ILE A 1 35  ? -4.588  -13.211 1.411   1.00 0.00 ? 35  ILE A HG22 7  
ATOM 11211 H HG23 . ILE A 1 35  ? -5.032  -12.075 0.139   1.00 0.00 ? 35  ILE A HG23 7  
ATOM 11212 H HD11 . ILE A 1 35  ? -5.460  -8.472  0.671   1.00 0.00 ? 35  ILE A HD11 7  
ATOM 11213 H HD12 . ILE A 1 35  ? -4.691  -9.803  -0.193  1.00 0.00 ? 35  ILE A HD12 7  
ATOM 11214 H HD13 . ILE A 1 35  ? -6.426  -9.842  0.126   1.00 0.00 ? 35  ILE A HD13 7  
ATOM 11215 N N    . LEU A 1 36  ? -2.317  -9.783  3.746   1.00 0.00 ? 36  LEU A N    7  
ATOM 11216 C CA   . LEU A 1 36  ? -1.900  -8.622  4.523   1.00 0.00 ? 36  LEU A CA   7  
ATOM 11217 C C    . LEU A 1 36  ? -1.333  -7.534  3.615   1.00 0.00 ? 36  LEU A C    7  
ATOM 11218 O O    . LEU A 1 36  ? -0.373  -7.762  2.879   1.00 0.00 ? 36  LEU A O    7  
ATOM 11219 C CB   . LEU A 1 36  ? -0.854  -9.028  5.563   1.00 0.00 ? 36  LEU A CB   7  
ATOM 11220 C CG   . LEU A 1 36  ? -0.014  -7.894  6.150   1.00 0.00 ? 36  LEU A CG   7  
ATOM 11221 C CD1  . LEU A 1 36  ? -0.910  -6.776  6.662   1.00 0.00 ? 36  LEU A CD1  7  
ATOM 11222 C CD2  . LEU A 1 36  ? 0.882   -8.414  7.264   1.00 0.00 ? 36  LEU A CD2  7  
ATOM 11223 H H    . LEU A 1 36  ? -1.818  -10.021 2.937   1.00 0.00 ? 36  LEU A H    7  
ATOM 11224 H HA   . LEU A 1 36  ? -2.769  -8.232  5.032   1.00 0.00 ? 36  LEU A HA   7  
ATOM 11225 H HB2  . LEU A 1 36  ? -1.369  -9.513  6.377   1.00 0.00 ? 36  LEU A HB2  7  
ATOM 11226 H HB3  . LEU A 1 36  ? -0.179  -9.732  5.094   1.00 0.00 ? 36  LEU A HB3  7  
ATOM 11227 H HG   . LEU A 1 36  ? 0.618   -7.483  5.374   1.00 0.00 ? 36  LEU A HG   7  
ATOM 11228 H HD11 . LEU A 1 36  ? -0.642  -6.538  7.680   1.00 0.00 ? 36  LEU A HD11 7  
ATOM 11229 H HD12 . LEU A 1 36  ? -1.941  -7.096  6.628   1.00 0.00 ? 36  LEU A HD12 7  
ATOM 11230 H HD13 . LEU A 1 36  ? -0.785  -5.901  6.042   1.00 0.00 ? 36  LEU A HD13 7  
ATOM 11231 H HD21 . LEU A 1 36  ? 0.272   -8.750  8.089   1.00 0.00 ? 36  LEU A HD21 7  
ATOM 11232 H HD22 . LEU A 1 36  ? 1.536   -7.622  7.600   1.00 0.00 ? 36  LEU A HD22 7  
ATOM 11233 H HD23 . LEU A 1 36  ? 1.475   -9.238  6.894   1.00 0.00 ? 36  LEU A HD23 7  
ATOM 11234 N N    . VAL A 1 37  ? -1.934  -6.349  3.672   1.00 0.00 ? 37  VAL A N    7  
ATOM 11235 C CA   . VAL A 1 37  ? -1.489  -5.226  2.858   1.00 0.00 ? 37  VAL A CA   7  
ATOM 11236 C C    . VAL A 1 37  ? -0.834  -4.151  3.717   1.00 0.00 ? 37  VAL A C    7  
ATOM 11237 O O    . VAL A 1 37  ? -1.471  -3.573  4.598   1.00 0.00 ? 37  VAL A O    7  
ATOM 11238 C CB   . VAL A 1 37  ? -2.660  -4.599  2.077   1.00 0.00 ? 37  VAL A CB   7  
ATOM 11239 C CG1  . VAL A 1 37  ? -2.149  -3.559  1.092   1.00 0.00 ? 37  VAL A CG1  7  
ATOM 11240 C CG2  . VAL A 1 37  ? -3.458  -5.679  1.359   1.00 0.00 ? 37  VAL A CG2  7  
ATOM 11241 H H    . VAL A 1 37  ? -2.696  -6.229  4.278   1.00 0.00 ? 37  VAL A H    7  
ATOM 11242 H HA   . VAL A 1 37  ? -0.765  -5.594  2.146   1.00 0.00 ? 37  VAL A HA   7  
ATOM 11243 H HB   . VAL A 1 37  ? -3.313  -4.107  2.780   1.00 0.00 ? 37  VAL A HB   7  
ATOM 11244 H HG11 . VAL A 1 37  ? -1.277  -3.072  1.505   1.00 0.00 ? 37  VAL A HG11 7  
ATOM 11245 H HG12 . VAL A 1 37  ? -1.888  -4.041  0.161   1.00 0.00 ? 37  VAL A HG12 7  
ATOM 11246 H HG13 . VAL A 1 37  ? -2.921  -2.825  0.913   1.00 0.00 ? 37  VAL A HG13 7  
ATOM 11247 H HG21 . VAL A 1 37  ? -4.190  -5.215  0.715   1.00 0.00 ? 37  VAL A HG21 7  
ATOM 11248 H HG22 . VAL A 1 37  ? -2.789  -6.286  0.765   1.00 0.00 ? 37  VAL A HG22 7  
ATOM 11249 H HG23 . VAL A 1 37  ? -3.959  -6.300  2.086   1.00 0.00 ? 37  VAL A HG23 7  
ATOM 11250 N N    . GLN A 1 38  ? 0.441   -3.885  3.454   1.00 0.00 ? 38  GLN A N    7  
ATOM 11251 C CA   . GLN A 1 38  ? 1.183   -2.879  4.203   1.00 0.00 ? 38  GLN A CA   7  
ATOM 11252 C C    . GLN A 1 38  ? 1.825   -1.863  3.263   1.00 0.00 ? 38  GLN A C    7  
ATOM 11253 O O    . GLN A 1 38  ? 2.318   -2.218  2.193   1.00 0.00 ? 38  GLN A O    7  
ATOM 11254 C CB   . GLN A 1 38  ? 2.259   -3.545  5.064   1.00 0.00 ? 38  GLN A CB   7  
ATOM 11255 C CG   . GLN A 1 38  ? 3.317   -4.279  4.258   1.00 0.00 ? 38  GLN A CG   7  
ATOM 11256 C CD   . GLN A 1 38  ? 3.474   -5.726  4.682   1.00 0.00 ? 38  GLN A CD   7  
ATOM 11257 O OE1  . GLN A 1 38  ? 3.548   -6.626  3.845   1.00 0.00 ? 38  GLN A OE1  7  
ATOM 11258 N NE2  . GLN A 1 38  ? 3.526   -5.958  5.989   1.00 0.00 ? 38  GLN A NE2  7  
ATOM 11259 H H    . GLN A 1 38  ? 0.895   -4.380  2.739   1.00 0.00 ? 38  GLN A H    7  
ATOM 11260 H HA   . GLN A 1 38  ? 0.487   -2.365  4.848   1.00 0.00 ? 38  GLN A HA   7  
ATOM 11261 H HB2  . GLN A 1 38  ? 2.750   -2.786  5.656   1.00 0.00 ? 38  GLN A HB2  7  
ATOM 11262 H HB3  . GLN A 1 38  ? 1.784   -4.254  5.726   1.00 0.00 ? 38  GLN A HB3  7  
ATOM 11263 H HG2  . GLN A 1 38  ? 3.037   -4.255  3.215   1.00 0.00 ? 38  GLN A HG2  7  
ATOM 11264 H HG3  . GLN A 1 38  ? 4.264   -3.777  4.388   1.00 0.00 ? 38  GLN A HG3  7  
ATOM 11265 H HE21 . GLN A 1 38  ? 3.459   -5.191  6.597   1.00 0.00 ? 38  GLN A HE21 7  
ATOM 11266 H HE22 . GLN A 1 38  ? 3.625   -6.883  6.291   1.00 0.00 ? 38  GLN A HE22 7  
ATOM 11267 N N    . TRP A 1 39  ? 1.814   -0.600  3.672   1.00 0.00 ? 39  TRP A N    7  
ATOM 11268 C CA   . TRP A 1 39  ? 2.395   0.467   2.865   1.00 0.00 ? 39  TRP A CA   7  
ATOM 11269 C C    . TRP A 1 39  ? 2.860   1.624   3.745   1.00 0.00 ? 39  TRP A C    7  
ATOM 11270 O O    . TRP A 1 39  ? 2.639   1.623   4.956   1.00 0.00 ? 39  TRP A O    7  
ATOM 11271 C CB   . TRP A 1 39  ? 1.380   0.969   1.837   1.00 0.00 ? 39  TRP A CB   7  
ATOM 11272 C CG   . TRP A 1 39  ? 0.158   1.579   2.457   1.00 0.00 ? 39  TRP A CG   7  
ATOM 11273 C CD1  . TRP A 1 39  ? -0.010  2.882   2.826   1.00 0.00 ? 39  TRP A CD1  7  
ATOM 11274 C CD2  . TRP A 1 39  ? -1.062  0.906   2.783   1.00 0.00 ? 39  TRP A CD2  7  
ATOM 11275 N NE1  . TRP A 1 39  ? -1.264  3.061   3.362   1.00 0.00 ? 39  TRP A NE1  7  
ATOM 11276 C CE2  . TRP A 1 39  ? -1.928  1.864   3.347   1.00 0.00 ? 39  TRP A CE2  7  
ATOM 11277 C CE3  . TRP A 1 39  ? -1.510  -0.412  2.654   1.00 0.00 ? 39  TRP A CE3  7  
ATOM 11278 C CZ2  . TRP A 1 39  ? -3.214  1.544   3.778   1.00 0.00 ? 39  TRP A CZ2  7  
ATOM 11279 C CZ3  . TRP A 1 39  ? -2.785  -0.728  3.083   1.00 0.00 ? 39  TRP A CZ3  7  
ATOM 11280 C CH2  . TRP A 1 39  ? -3.626  0.246   3.639   1.00 0.00 ? 39  TRP A CH2  7  
ATOM 11281 H H    . TRP A 1 39  ? 1.408   -0.378  4.536   1.00 0.00 ? 39  TRP A H    7  
ATOM 11282 H HA   . TRP A 1 39  ? 3.250   0.062   2.344   1.00 0.00 ? 39  TRP A HA   7  
ATOM 11283 H HB2  . TRP A 1 39  ? 1.845   1.718   1.215   1.00 0.00 ? 39  TRP A HB2  7  
ATOM 11284 H HB3  . TRP A 1 39  ? 1.063   0.141   1.220   1.00 0.00 ? 39  TRP A HB3  7  
ATOM 11285 H HD1  . TRP A 1 39  ? 0.741   3.649   2.710   1.00 0.00 ? 39  TRP A HD1  7  
ATOM 11286 H HE1  . TRP A 1 39  ? -1.622  3.909   3.698   1.00 0.00 ? 39  TRP A HE1  7  
ATOM 11287 H HE3  . TRP A 1 39  ? -0.877  -1.177  2.228   1.00 0.00 ? 39  TRP A HE3  7  
ATOM 11288 H HZ2  . TRP A 1 39  ? -3.873  2.282   4.207   1.00 0.00 ? 39  TRP A HZ2  7  
ATOM 11289 H HZ3  . TRP A 1 39  ? -3.148  -1.741  2.990   1.00 0.00 ? 39  TRP A HZ3  7  
ATOM 11290 H HH2  . TRP A 1 39  ? -4.613  -0.045  3.960   1.00 0.00 ? 39  TRP A HH2  7  
ATOM 11291 N N    . LYS A 1 40  ? 3.506   2.608   3.129   1.00 0.00 ? 40  LYS A N    7  
ATOM 11292 C CA   . LYS A 1 40  ? 4.001   3.771   3.855   1.00 0.00 ? 40  LYS A CA   7  
ATOM 11293 C C    . LYS A 1 40  ? 3.269   5.036   3.420   1.00 0.00 ? 40  LYS A C    7  
ATOM 11294 O O    . LYS A 1 40  ? 2.551   5.036   2.420   1.00 0.00 ? 40  LYS A O    7  
ATOM 11295 C CB   . LYS A 1 40  ? 5.506   3.937   3.630   1.00 0.00 ? 40  LYS A CB   7  
ATOM 11296 C CG   . LYS A 1 40  ? 6.357   3.076   4.548   1.00 0.00 ? 40  LYS A CG   7  
ATOM 11297 C CD   . LYS A 1 40  ? 7.833   3.197   4.215   1.00 0.00 ? 40  LYS A CD   7  
ATOM 11298 C CE   . LYS A 1 40  ? 8.695   3.121   5.466   1.00 0.00 ? 40  LYS A CE   7  
ATOM 11299 N NZ   . LYS A 1 40  ? 9.953   2.358   5.228   1.00 0.00 ? 40  LYS A NZ   7  
ATOM 11300 H H    . LYS A 1 40  ? 3.653   2.551   2.161   1.00 0.00 ? 40  LYS A H    7  
ATOM 11301 H HA   . LYS A 1 40  ? 3.818   3.608   4.907   1.00 0.00 ? 40  LYS A HA   7  
ATOM 11302 H HB2  . LYS A 1 40  ? 5.735   3.672   2.608   1.00 0.00 ? 40  LYS A HB2  7  
ATOM 11303 H HB3  . LYS A 1 40  ? 5.770   4.972   3.794   1.00 0.00 ? 40  LYS A HB3  7  
ATOM 11304 H HG2  . LYS A 1 40  ? 6.202   3.393   5.570   1.00 0.00 ? 40  LYS A HG2  7  
ATOM 11305 H HG3  . LYS A 1 40  ? 6.056   2.044   4.439   1.00 0.00 ? 40  LYS A HG3  7  
ATOM 11306 H HD2  . LYS A 1 40  ? 8.111   2.392   3.550   1.00 0.00 ? 40  LYS A HD2  7  
ATOM 11307 H HD3  . LYS A 1 40  ? 8.008   4.147   3.727   1.00 0.00 ? 40  LYS A HD3  7  
ATOM 11308 H HE2  . LYS A 1 40  ? 8.947   4.122   5.776   1.00 0.00 ? 40  LYS A HE2  7  
ATOM 11309 H HE3  . LYS A 1 40  ? 8.130   2.631   6.247   1.00 0.00 ? 40  LYS A HE3  7  
ATOM 11310 H HZ1  . LYS A 1 40  ? 10.632  2.945   4.704   1.00 0.00 ? 40  LYS A HZ1  7  
ATOM 11311 H HZ2  . LYS A 1 40  ? 9.751   1.502   4.673   1.00 0.00 ? 40  LYS A HZ2  7  
ATOM 11312 H HZ3  . LYS A 1 40  ? 10.378  2.077   6.134   1.00 0.00 ? 40  LYS A HZ3  7  
ATOM 11313 N N    . GLU A 1 41  ? 3.457   6.113   4.176   1.00 0.00 ? 41  GLU A N    7  
ATOM 11314 C CA   . GLU A 1 41  ? 2.814   7.385   3.866   1.00 0.00 ? 41  GLU A CA   7  
ATOM 11315 C C    . GLU A 1 41  ? 3.342   7.955   2.553   1.00 0.00 ? 41  GLU A C    7  
ATOM 11316 O O    . GLU A 1 41  ? 4.419   7.595   2.078   1.00 0.00 ? 41  GLU A O    7  
ATOM 11317 C CB   . GLU A 1 41  ? 3.044   8.387   5.000   1.00 0.00 ? 41  GLU A CB   7  
ATOM 11318 C CG   . GLU A 1 41  ? 1.841   8.561   5.912   1.00 0.00 ? 41  GLU A CG   7  
ATOM 11319 C CD   . GLU A 1 41  ? 2.107   9.525   7.051   1.00 0.00 ? 41  GLU A CD   7  
ATOM 11320 O OE1  . GLU A 1 41  ? 2.785   9.126   8.021   1.00 0.00 ? 41  GLU A OE1  7  
ATOM 11321 O OE2  . GLU A 1 41  ? 1.636   10.679  6.972   1.00 0.00 ? 41  GLU A OE2  7  
ATOM 11322 H H    . GLU A 1 41  ? 4.041   6.052   4.960   1.00 0.00 ? 41  GLU A H    7  
ATOM 11323 H HA   . GLU A 1 41  ? 1.755   7.206   3.766   1.00 0.00 ? 41  GLU A HA   7  
ATOM 11324 H HB2  . GLU A 1 41  ? 3.878   8.052   5.598   1.00 0.00 ? 41  GLU A HB2  7  
ATOM 11325 H HB3  . GLU A 1 41  ? 3.284   9.348   4.570   1.00 0.00 ? 41  GLU A HB3  7  
ATOM 11326 H HG2  . GLU A 1 41  ? 1.014   8.935   5.329   1.00 0.00 ? 41  GLU A HG2  7  
ATOM 11327 H HG3  . GLU A 1 41  ? 1.579   7.599   6.328   1.00 0.00 ? 41  GLU A HG3  7  
ATOM 11328 N N    . PRO A 1 42  ? 2.566   8.869   1.951   1.00 0.00 ? 42  PRO A N    7  
ATOM 11329 C CA   . PRO A 1 42  ? 2.934   9.510   0.685   1.00 0.00 ? 42  PRO A CA   7  
ATOM 11330 C C    . PRO A 1 42  ? 4.109   10.468  0.841   1.00 0.00 ? 42  PRO A C    7  
ATOM 11331 O O    . PRO A 1 42  ? 4.553   10.745  1.954   1.00 0.00 ? 42  PRO A O    7  
ATOM 11332 C CB   . PRO A 1 42  ? 1.667   10.276  0.294   1.00 0.00 ? 42  PRO A CB   7  
ATOM 11333 C CG   . PRO A 1 42  ? 0.965   10.531  1.584   1.00 0.00 ? 42  PRO A CG   7  
ATOM 11334 C CD   . PRO A 1 42  ? 1.269   9.347   2.461   1.00 0.00 ? 42  PRO A CD   7  
ATOM 11335 H HA   . PRO A 1 42  ? 3.164   8.780   -0.077  1.00 0.00 ? 42  PRO A HA   7  
ATOM 11336 H HB2  . PRO A 1 42  ? 1.940   11.199  -0.197  1.00 0.00 ? 42  PRO A HB2  7  
ATOM 11337 H HB3  . PRO A 1 42  ? 1.067   9.672   -0.369  1.00 0.00 ? 42  PRO A HB3  7  
ATOM 11338 H HG2  . PRO A 1 42  ? 1.339   11.437  2.034   1.00 0.00 ? 42  PRO A HG2  7  
ATOM 11339 H HG3  . PRO A 1 42  ? -0.098  10.606  1.411   1.00 0.00 ? 42  PRO A HG3  7  
ATOM 11340 H HD2  . PRO A 1 42  ? 1.350   9.654   3.492   1.00 0.00 ? 42  PRO A HD2  7  
ATOM 11341 H HD3  . PRO A 1 42  ? 0.508   8.589   2.348   1.00 0.00 ? 42  PRO A HD3  7  
ATOM 11342 N N    . GLU A 1 43  ? 4.608   10.973  -0.283  1.00 0.00 ? 43  GLU A N    7  
ATOM 11343 C CA   . GLU A 1 43  ? 5.734   11.901  -0.271  1.00 0.00 ? 43  GLU A CA   7  
ATOM 11344 C C    . GLU A 1 43  ? 5.246   13.345  -0.211  1.00 0.00 ? 43  GLU A C    7  
ATOM 11345 O O    . GLU A 1 43  ? 5.957   14.231  0.265   1.00 0.00 ? 43  GLU A O    7  
ATOM 11346 C CB   . GLU A 1 43  ? 6.606   11.695  -1.510  1.00 0.00 ? 43  GLU A CB   7  
ATOM 11347 C CG   . GLU A 1 43  ? 8.036   11.291  -1.189  1.00 0.00 ? 43  GLU A CG   7  
ATOM 11348 C CD   . GLU A 1 43  ? 9.058   12.085  -1.976  1.00 0.00 ? 43  GLU A CD   7  
ATOM 11349 O OE1  . GLU A 1 43  ? 9.146   11.883  -3.206  1.00 0.00 ? 43  GLU A OE1  7  
ATOM 11350 O OE2  . GLU A 1 43  ? 9.773   12.906  -1.364  1.00 0.00 ? 43  GLU A OE2  7  
ATOM 11351 H H    . GLU A 1 43  ? 4.212   10.713  -1.141  1.00 0.00 ? 43  GLU A H    7  
ATOM 11352 H HA   . GLU A 1 43  ? 6.322   11.695  0.611   1.00 0.00 ? 43  GLU A HA   7  
ATOM 11353 H HB2  . GLU A 1 43  ? 6.165   10.925  -2.123  1.00 0.00 ? 43  GLU A HB2  7  
ATOM 11354 H HB3  . GLU A 1 43  ? 6.635   12.617  -2.071  1.00 0.00 ? 43  GLU A HB3  7  
ATOM 11355 H HG2  . GLU A 1 43  ? 8.212   11.450  -0.135  1.00 0.00 ? 43  GLU A HG2  7  
ATOM 11356 H HG3  . GLU A 1 43  ? 8.160   10.243  -1.419  1.00 0.00 ? 43  GLU A HG3  7  
ATOM 11357 N N    . GLU A 1 44  ? 4.032   13.574  -0.699  1.00 0.00 ? 44  GLU A N    7  
ATOM 11358 C CA   . GLU A 1 44  ? 3.450   14.912  -0.702  1.00 0.00 ? 44  GLU A CA   7  
ATOM 11359 C C    . GLU A 1 44  ? 2.095   14.918  0.000   1.00 0.00 ? 44  GLU A C    7  
ATOM 11360 O O    . GLU A 1 44  ? 1.041   15.011  -0.632  1.00 0.00 ? 44  GLU A O    7  
ATOM 11361 C CB   . GLU A 1 44  ? 3.297   15.422  -2.137  1.00 0.00 ? 44  GLU A CB   7  
ATOM 11362 C CG   . GLU A 1 44  ? 4.574   15.331  -2.955  1.00 0.00 ? 44  GLU A CG   7  
ATOM 11363 C CD   . GLU A 1 44  ? 4.476   16.071  -4.275  1.00 0.00 ? 44  GLU A CD   7  
ATOM 11364 O OE1  . GLU A 1 44  ? 3.971   17.212  -4.278  1.00 0.00 ? 44  GLU A OE1  7  
ATOM 11365 O OE2  . GLU A 1 44  ? 4.902   15.507  -5.304  1.00 0.00 ? 44  GLU A OE2  7  
ATOM 11366 H H    . GLU A 1 44  ? 3.513   12.828  -1.065  1.00 0.00 ? 44  GLU A H    7  
ATOM 11367 H HA   . GLU A 1 44  ? 4.122   15.566  -0.167  1.00 0.00 ? 44  GLU A HA   7  
ATOM 11368 H HB2  . GLU A 1 44  ? 2.533   14.841  -2.632  1.00 0.00 ? 44  GLU A HB2  7  
ATOM 11369 H HB3  . GLU A 1 44  ? 2.987   16.456  -2.107  1.00 0.00 ? 44  GLU A HB3  7  
ATOM 11370 H HG2  . GLU A 1 44  ? 5.385   15.753  -2.382  1.00 0.00 ? 44  GLU A HG2  7  
ATOM 11371 H HG3  . GLU A 1 44  ? 4.783   14.289  -3.157  1.00 0.00 ? 44  GLU A HG3  7  
ATOM 11372 N N    . PRO A 1 45  ? 2.120   14.817  1.336   1.00 0.00 ? 45  PRO A N    7  
ATOM 11373 C CA   . PRO A 1 45  ? 0.903   14.808  2.153   1.00 0.00 ? 45  PRO A CA   7  
ATOM 11374 C C    . PRO A 1 45  ? 0.113   16.106  2.031   1.00 0.00 ? 45  PRO A C    7  
ATOM 11375 O O    . PRO A 1 45  ? -1.080  16.092  1.734   1.00 0.00 ? 45  PRO A O    7  
ATOM 11376 C CB   . PRO A 1 45  ? 1.434   14.636  3.578   1.00 0.00 ? 45  PRO A CB   7  
ATOM 11377 C CG   . PRO A 1 45  ? 2.858   15.067  3.507   1.00 0.00 ? 45  PRO A CG   7  
ATOM 11378 C CD   . PRO A 1 45  ? 3.339   14.702  2.154   1.00 0.00 ? 45  PRO A CD   7  
ATOM 11379 H HA   . PRO A 1 45  ? 0.263   13.973  1.902   1.00 0.00 ? 45  PRO A HA   7  
ATOM 11380 H HB2  . PRO A 1 45  ? 0.865   15.259  4.253   1.00 0.00 ? 45  PRO A HB2  7  
ATOM 11381 H HB3  . PRO A 1 45  ? 1.348   13.602  3.877   1.00 0.00 ? 45  PRO A HB3  7  
ATOM 11382 H HG2  . PRO A 1 45  ? 2.929   16.131  3.680   1.00 0.00 ? 45  PRO A HG2  7  
ATOM 11383 H HG3  . PRO A 1 45  ? 3.442   14.527  4.237   1.00 0.00 ? 45  PRO A HG3  7  
ATOM 11384 H HD2  . PRO A 1 45  ? 4.062   15.455  1.876   1.00 0.00 ? 45  PRO A HD2  7  
ATOM 11385 H HD3  . PRO A 1 45  ? 3.769   13.714  2.069   1.00 0.00 ? 45  PRO A HD3  7  
ATOM 11386 N N    . ASN A 1 46  ? 0.789   17.227  2.261   1.00 0.00 ? 46  ASN A N    7  
ATOM 11387 C CA   . ASN A 1 46  ? 0.149   18.536  2.176   1.00 0.00 ? 46  ASN A CA   7  
ATOM 11388 C C    . ASN A 1 46  ? -0.945  18.676  3.229   1.00 0.00 ? 46  ASN A C    7  
ATOM 11389 O O    . ASN A 1 46  ? -1.890  19.445  3.060   1.00 0.00 ? 46  ASN A O    7  
ATOM 11390 C CB   . ASN A 1 46  ? -0.441  18.749  0.781   1.00 0.00 ? 46  ASN A CB   7  
ATOM 11391 C CG   . ASN A 1 46  ? 0.546   18.415  -0.321  1.00 0.00 ? 46  ASN A CG   7  
ATOM 11392 O OD1  . ASN A 1 46  ? 1.659   18.939  -0.353  1.00 0.00 ? 46  ASN A OD1  7  
ATOM 11393 N ND2  . ASN A 1 46  ? 0.140   17.538  -1.232  1.00 0.00 ? 46  ASN A ND2  7  
ATOM 11394 H H    . ASN A 1 46  ? 1.739   17.175  2.493   1.00 0.00 ? 46  ASN A H    7  
ATOM 11395 H HA   . ASN A 1 46  ? 0.904   19.285  2.357   1.00 0.00 ? 46  ASN A HA   7  
ATOM 11396 H HB2  . ASN A 1 46  ? -1.309  18.117  0.663   1.00 0.00 ? 46  ASN A HB2  7  
ATOM 11397 H HB3  . ASN A 1 46  ? -0.735  19.781  0.675   1.00 0.00 ? 46  ASN A HB3  7  
ATOM 11398 H HD21 . ASN A 1 46  ? -0.759  17.161  -1.144  1.00 0.00 ? 46  ASN A HD21 7  
ATOM 11399 H HD22 . ASN A 1 46  ? 0.759   17.304  -1.956  1.00 0.00 ? 46  ASN A HD22 7  
ATOM 11400 N N    . GLY A 1 47  ? -0.810  17.925  4.320   1.00 0.00 ? 47  GLY A N    7  
ATOM 11401 C CA   . GLY A 1 47  ? -1.793  17.981  5.385   1.00 0.00 ? 47  GLY A CA   7  
ATOM 11402 C C    . GLY A 1 47  ? -1.855  16.694  6.184   1.00 0.00 ? 47  GLY A C    7  
ATOM 11403 O O    . GLY A 1 47  ? -1.276  15.682  5.788   1.00 0.00 ? 47  GLY A O    7  
ATOM 11404 H H    . GLY A 1 47  ? -0.035  17.330  4.401   1.00 0.00 ? 47  GLY A H    7  
ATOM 11405 H HA2  . GLY A 1 47  ? -1.541  18.792  6.050   1.00 0.00 ? 47  GLY A HA2  7  
ATOM 11406 H HA3  . GLY A 1 47  ? -2.765  18.170  4.954   1.00 0.00 ? 47  GLY A HA3  7  
ATOM 11407 N N    . GLN A 1 48  ? -2.559  16.732  7.310   1.00 0.00 ? 48  GLN A N    7  
ATOM 11408 C CA   . GLN A 1 48  ? -2.693  15.559  8.166   1.00 0.00 ? 48  GLN A CA   7  
ATOM 11409 C C    . GLN A 1 48  ? -3.515  14.474  7.480   1.00 0.00 ? 48  GLN A C    7  
ATOM 11410 O O    . GLN A 1 48  ? -4.634  14.722  7.030   1.00 0.00 ? 48  GLN A O    7  
ATOM 11411 C CB   . GLN A 1 48  ? -3.344  15.945  9.496   1.00 0.00 ? 48  GLN A CB   7  
ATOM 11412 C CG   . GLN A 1 48  ? -2.355  16.070  10.644  1.00 0.00 ? 48  GLN A CG   7  
ATOM 11413 C CD   . GLN A 1 48  ? -2.689  17.216  11.579  1.00 0.00 ? 48  GLN A CD   7  
ATOM 11414 O OE1  . GLN A 1 48  ? -3.506  17.072  12.489  1.00 0.00 ? 48  GLN A OE1  7  
ATOM 11415 N NE2  . GLN A 1 48  ? -2.056  18.362  11.359  1.00 0.00 ? 48  GLN A NE2  7  
ATOM 11416 H H    . GLN A 1 48  ? -2.998  17.566  7.572   1.00 0.00 ? 48  GLN A H    7  
ATOM 11417 H HA   . GLN A 1 48  ? -1.702  15.175  8.359   1.00 0.00 ? 48  GLN A HA   7  
ATOM 11418 H HB2  . GLN A 1 48  ? -3.846  16.893  9.377   1.00 0.00 ? 48  GLN A HB2  7  
ATOM 11419 H HB3  . GLN A 1 48  ? -4.073  15.191  9.759   1.00 0.00 ? 48  GLN A HB3  7  
ATOM 11420 H HG2  . GLN A 1 48  ? -2.362  15.151  11.211  1.00 0.00 ? 48  GLN A HG2  7  
ATOM 11421 H HG3  . GLN A 1 48  ? -1.369  16.233  10.236  1.00 0.00 ? 48  GLN A HG3  7  
ATOM 11422 H HE21 . GLN A 1 48  ? -1.419  18.404  10.615  1.00 0.00 ? 48  GLN A HE21 7  
ATOM 11423 H HE22 . GLN A 1 48  ? -2.253  19.120  11.948  1.00 0.00 ? 48  GLN A HE22 7  
ATOM 11424 N N    . ILE A 1 49  ? -2.953  13.273  7.403   1.00 0.00 ? 49  ILE A N    7  
ATOM 11425 C CA   . ILE A 1 49  ? -3.634  12.149  6.771   1.00 0.00 ? 49  ILE A CA   7  
ATOM 11426 C C    . ILE A 1 49  ? -4.700  11.565  7.692   1.00 0.00 ? 49  ILE A C    7  
ATOM 11427 O O    . ILE A 1 49  ? -4.395  11.089  8.785   1.00 0.00 ? 49  ILE A O    7  
ATOM 11428 C CB   . ILE A 1 49  ? -2.644  11.038  6.378   1.00 0.00 ? 49  ILE A CB   7  
ATOM 11429 C CG1  . ILE A 1 49  ? -1.578  11.585  5.427   1.00 0.00 ? 49  ILE A CG1  7  
ATOM 11430 C CG2  . ILE A 1 49  ? -3.383  9.871   5.740   1.00 0.00 ? 49  ILE A CG2  7  
ATOM 11431 C CD1  . ILE A 1 49  ? -2.137  12.061  4.105   1.00 0.00 ? 49  ILE A CD1  7  
ATOM 11432 H H    . ILE A 1 49  ? -2.059  13.137  7.780   1.00 0.00 ? 49  ILE A H    7  
ATOM 11433 H HA   . ILE A 1 49  ? -4.112  12.512  5.871   1.00 0.00 ? 49  ILE A HA   7  
ATOM 11434 H HB   . ILE A 1 49  ? -2.164  10.681  7.277   1.00 0.00 ? 49  ILE A HB   7  
ATOM 11435 H HG12 . ILE A 1 49  ? -1.082  12.421  5.896   1.00 0.00 ? 49  ILE A HG12 7  
ATOM 11436 H HG13 . ILE A 1 49  ? -0.854  10.810  5.224   1.00 0.00 ? 49  ILE A HG13 7  
ATOM 11437 H HG21 . ILE A 1 49  ? -4.202  10.247  5.144   1.00 0.00 ? 49  ILE A HG21 7  
ATOM 11438 H HG22 . ILE A 1 49  ? -2.704  9.318   5.108   1.00 0.00 ? 49  ILE A HG22 7  
ATOM 11439 H HG23 . ILE A 1 49  ? -3.768  9.222   6.512   1.00 0.00 ? 49  ILE A HG23 7  
ATOM 11440 H HD11 . ILE A 1 49  ? -1.685  11.498  3.300   1.00 0.00 ? 49  ILE A HD11 7  
ATOM 11441 H HD12 . ILE A 1 49  ? -3.207  11.914  4.090   1.00 0.00 ? 49  ILE A HD12 7  
ATOM 11442 H HD13 . ILE A 1 49  ? -1.917  13.110  3.976   1.00 0.00 ? 49  ILE A HD13 7  
ATOM 11443 N N    . GLN A 1 50  ? -5.950  11.602  7.242   1.00 0.00 ? 50  GLN A N    7  
ATOM 11444 C CA   . GLN A 1 50  ? -7.060  11.075  8.026   1.00 0.00 ? 50  GLN A CA   7  
ATOM 11445 C C    . GLN A 1 50  ? -7.149  9.557   7.890   1.00 0.00 ? 50  GLN A C    7  
ATOM 11446 O O    . GLN A 1 50  ? -7.660  8.874   8.777   1.00 0.00 ? 50  GLN A O    7  
ATOM 11447 C CB   . GLN A 1 50  ? -8.376  11.716  7.582   1.00 0.00 ? 50  GLN A CB   7  
ATOM 11448 C CG   . GLN A 1 50  ? -8.313  13.233  7.495   1.00 0.00 ? 50  GLN A CG   7  
ATOM 11449 C CD   . GLN A 1 50  ? -8.195  13.890  8.856   1.00 0.00 ? 50  GLN A CD   7  
ATOM 11450 O OE1  . GLN A 1 50  ? -8.916  13.545  9.792   1.00 0.00 ? 50  GLN A OE1  7  
ATOM 11451 N NE2  . GLN A 1 50  ? -7.279  14.846  8.973   1.00 0.00 ? 50  GLN A NE2  7  
ATOM 11452 H H    . GLN A 1 50  ? -6.129  11.994  6.363   1.00 0.00 ? 50  GLN A H    7  
ATOM 11453 H HA   . GLN A 1 50  ? -6.881  11.320  9.061   1.00 0.00 ? 50  GLN A HA   7  
ATOM 11454 H HB2  . GLN A 1 50  ? -8.639  11.331  6.609   1.00 0.00 ? 50  GLN A HB2  7  
ATOM 11455 H HB3  . GLN A 1 50  ? -9.149  11.450  8.287   1.00 0.00 ? 50  GLN A HB3  7  
ATOM 11456 H HG2  . GLN A 1 50  ? -7.457  13.512  6.901   1.00 0.00 ? 50  GLN A HG2  7  
ATOM 11457 H HG3  . GLN A 1 50  ? -9.214  13.590  7.017   1.00 0.00 ? 50  GLN A HG3  7  
ATOM 11458 H HE21 . GLN A 1 50  ? -6.741  15.070  8.184   1.00 0.00 ? 50  GLN A HE21 7  
ATOM 11459 H HE22 . GLN A 1 50  ? -7.180  15.289  9.840   1.00 0.00 ? 50  GLN A HE22 7  
ATOM 11460 N N    . GLY A 1 51  ? -6.651  9.038   6.772   1.00 0.00 ? 51  GLY A N    7  
ATOM 11461 C CA   . GLY A 1 51  ? -6.684  7.605   6.542   1.00 0.00 ? 51  GLY A CA   7  
ATOM 11462 C C    . GLY A 1 51  ? -6.314  7.239   5.118   1.00 0.00 ? 51  GLY A C    7  
ATOM 11463 O O    . GLY A 1 51  ? -5.613  7.988   4.439   1.00 0.00 ? 51  GLY A O    7  
ATOM 11464 H H    . GLY A 1 51  ? -6.256  9.632   6.101   1.00 0.00 ? 51  GLY A H    7  
ATOM 11465 H HA2  . GLY A 1 51  ? -5.992  7.126   7.218   1.00 0.00 ? 51  GLY A HA2  7  
ATOM 11466 H HA3  . GLY A 1 51  ? -7.681  7.243   6.747   1.00 0.00 ? 51  GLY A HA3  7  
ATOM 11467 N N    . TYR A 1 52  ? -6.785  6.082   4.666   1.00 0.00 ? 52  TYR A N    7  
ATOM 11468 C CA   . TYR A 1 52  ? -6.496  5.615   3.315   1.00 0.00 ? 52  TYR A CA   7  
ATOM 11469 C C    . TYR A 1 52  ? -7.651  4.782   2.768   1.00 0.00 ? 52  TYR A C    7  
ATOM 11470 O O    . TYR A 1 52  ? -8.576  4.428   3.498   1.00 0.00 ? 52  TYR A O    7  
ATOM 11471 C CB   . TYR A 1 52  ? -5.208  4.791   3.303   1.00 0.00 ? 52  TYR A CB   7  
ATOM 11472 C CG   . TYR A 1 52  ? -4.036  5.488   3.956   1.00 0.00 ? 52  TYR A CG   7  
ATOM 11473 C CD1  . TYR A 1 52  ? -3.198  6.318   3.222   1.00 0.00 ? 52  TYR A CD1  7  
ATOM 11474 C CD2  . TYR A 1 52  ? -3.768  5.318   5.309   1.00 0.00 ? 52  TYR A CD2  7  
ATOM 11475 C CE1  . TYR A 1 52  ? -2.126  6.956   3.814   1.00 0.00 ? 52  TYR A CE1  7  
ATOM 11476 C CE2  . TYR A 1 52  ? -2.700  5.954   5.910   1.00 0.00 ? 52  TYR A CE2  7  
ATOM 11477 C CZ   . TYR A 1 52  ? -1.881  6.771   5.158   1.00 0.00 ? 52  TYR A CZ   7  
ATOM 11478 O OH   . TYR A 1 52  ? -0.815  7.407   5.753   1.00 0.00 ? 52  TYR A OH   7  
ATOM 11479 H H    . TYR A 1 52  ? -7.339  5.528   5.255   1.00 0.00 ? 52  TYR A H    7  
ATOM 11480 H HA   . TYR A 1 52  ? -6.362  6.483   2.686   1.00 0.00 ? 52  TYR A HA   7  
ATOM 11481 H HB2  . TYR A 1 52  ? -5.376  3.864   3.829   1.00 0.00 ? 52  TYR A HB2  7  
ATOM 11482 H HB3  . TYR A 1 52  ? -4.937  4.574   2.279   1.00 0.00 ? 52  TYR A HB3  7  
ATOM 11483 H HD1  . TYR A 1 52  ? -3.393  6.461   2.168   1.00 0.00 ? 52  TYR A HD1  7  
ATOM 11484 H HD2  . TYR A 1 52  ? -4.411  4.677   5.895   1.00 0.00 ? 52  TYR A HD2  7  
ATOM 11485 H HE1  . TYR A 1 52  ? -1.485  7.596   3.226   1.00 0.00 ? 52  TYR A HE1  7  
ATOM 11486 H HE2  . TYR A 1 52  ? -2.507  5.809   6.964   1.00 0.00 ? 52  TYR A HE2  7  
ATOM 11487 H HH   . TYR A 1 52  ? -1.020  8.338   5.869   1.00 0.00 ? 52  TYR A HH   7  
ATOM 11488 N N    . ARG A 1 53  ? -7.590  4.475   1.476   1.00 0.00 ? 53  ARG A N    7  
ATOM 11489 C CA   . ARG A 1 53  ? -8.631  3.685   0.829   1.00 0.00 ? 53  ARG A CA   7  
ATOM 11490 C C    . ARG A 1 53  ? -8.034  2.466   0.133   1.00 0.00 ? 53  ARG A C    7  
ATOM 11491 O O    . ARG A 1 53  ? -7.008  2.563   -0.544  1.00 0.00 ? 53  ARG A O    7  
ATOM 11492 C CB   . ARG A 1 53  ? -9.394  4.541   -0.183  1.00 0.00 ? 53  ARG A CB   7  
ATOM 11493 C CG   . ARG A 1 53  ? -10.426 5.460   0.450   1.00 0.00 ? 53  ARG A CG   7  
ATOM 11494 C CD   . ARG A 1 53  ? -10.930 6.498   -0.539  1.00 0.00 ? 53  ARG A CD   7  
ATOM 11495 N NE   . ARG A 1 53  ? -11.003 7.830   0.054   1.00 0.00 ? 53  ARG A NE   7  
ATOM 11496 C CZ   . ARG A 1 53  ? -11.911 8.183   0.959   1.00 0.00 ? 53  ARG A CZ   7  
ATOM 11497 N NH1  . ARG A 1 53  ? -12.817 7.308   1.370   1.00 0.00 ? 53  ARG A NH1  7  
ATOM 11498 N NH2  . ARG A 1 53  ? -11.912 9.416   1.452   1.00 0.00 ? 53  ARG A NH2  7  
ATOM 11499 H H    . ARG A 1 53  ? -6.828  4.787   0.946   1.00 0.00 ? 53  ARG A H    7  
ATOM 11500 H HA   . ARG A 1 53  ? -9.316  3.349   1.592   1.00 0.00 ? 53  ARG A HA   7  
ATOM 11501 H HB2  . ARG A 1 53  ? -8.688  5.150   -0.728  1.00 0.00 ? 53  ARG A HB2  7  
ATOM 11502 H HB3  . ARG A 1 53  ? -9.904  3.888   -0.876  1.00 0.00 ? 53  ARG A HB3  7  
ATOM 11503 H HG2  . ARG A 1 53  ? -11.262 4.868   0.792   1.00 0.00 ? 53  ARG A HG2  7  
ATOM 11504 H HG3  . ARG A 1 53  ? -9.973  5.965   1.291   1.00 0.00 ? 53  ARG A HG3  7  
ATOM 11505 H HD2  . ARG A 1 53  ? -10.259 6.527   -1.384  1.00 0.00 ? 53  ARG A HD2  7  
ATOM 11506 H HD3  . ARG A 1 53  ? -11.915 6.208   -0.873  1.00 0.00 ? 53  ARG A HD3  7  
ATOM 11507 H HE   . ARG A 1 53  ? -10.343 8.493   -0.235  1.00 0.00 ? 53  ARG A HE   7  
ATOM 11508 H HH11 . ARG A 1 53  ? -12.817 6.378   1.000   1.00 0.00 ? 53  ARG A HH11 7  
ATOM 11509 H HH12 . ARG A 1 53  ? -13.499 7.575   2.052   1.00 0.00 ? 53  ARG A HH12 7  
ATOM 11510 H HH21 . ARG A 1 53  ? -11.231 10.078  1.144   1.00 0.00 ? 53  ARG A HH21 7  
ATOM 11511 H HH22 . ARG A 1 53  ? -12.596 9.679   2.131   1.00 0.00 ? 53  ARG A HH22 7  
ATOM 11512 N N    . VAL A 1 54  ? -8.681  1.317   0.302   1.00 0.00 ? 54  VAL A N    7  
ATOM 11513 C CA   . VAL A 1 54  ? -8.214  0.080   -0.310  1.00 0.00 ? 54  VAL A CA   7  
ATOM 11514 C C    . VAL A 1 54  ? -9.224  -0.447  -1.325  1.00 0.00 ? 54  VAL A C    7  
ATOM 11515 O O    . VAL A 1 54  ? -10.433 -0.287  -1.154  1.00 0.00 ? 54  VAL A O    7  
ATOM 11516 C CB   . VAL A 1 54  ? -7.955  -1.008  0.750   1.00 0.00 ? 54  VAL A CB   7  
ATOM 11517 C CG1  . VAL A 1 54  ? -7.317  -2.233  0.113   1.00 0.00 ? 54  VAL A CG1  7  
ATOM 11518 C CG2  . VAL A 1 54  ? -7.082  -0.463  1.870   1.00 0.00 ? 54  VAL A CG2  7  
ATOM 11519 H H    . VAL A 1 54  ? -9.491  1.303   0.852   1.00 0.00 ? 54  VAL A H    7  
ATOM 11520 H HA   . VAL A 1 54  ? -7.283  0.287   -0.817  1.00 0.00 ? 54  VAL A HA   7  
ATOM 11521 H HB   . VAL A 1 54  ? -8.904  -1.303  1.174   1.00 0.00 ? 54  VAL A HB   7  
ATOM 11522 H HG11 . VAL A 1 54  ? -7.125  -2.975  0.875   1.00 0.00 ? 54  VAL A HG11 7  
ATOM 11523 H HG12 . VAL A 1 54  ? -7.986  -2.644  -0.630  1.00 0.00 ? 54  VAL A HG12 7  
ATOM 11524 H HG13 . VAL A 1 54  ? -6.386  -1.951  -0.355  1.00 0.00 ? 54  VAL A HG13 7  
ATOM 11525 H HG21 . VAL A 1 54  ? -6.443  -1.249  2.242   1.00 0.00 ? 54  VAL A HG21 7  
ATOM 11526 H HG22 . VAL A 1 54  ? -6.473  0.346   1.491   1.00 0.00 ? 54  VAL A HG22 7  
ATOM 11527 H HG23 . VAL A 1 54  ? -7.707  -0.097  2.670   1.00 0.00 ? 54  VAL A HG23 7  
ATOM 11528 N N    . TYR A 1 55  ? -8.720  -1.074  -2.381  1.00 0.00 ? 55  TYR A N    7  
ATOM 11529 C CA   . TYR A 1 55  ? -9.577  -1.622  -3.426  1.00 0.00 ? 55  TYR A CA   7  
ATOM 11530 C C    . TYR A 1 55  ? -9.130  -3.027  -3.817  1.00 0.00 ? 55  TYR A C    7  
ATOM 11531 O O    . TYR A 1 55  ? -8.007  -3.225  -4.283  1.00 0.00 ? 55  TYR A O    7  
ATOM 11532 C CB   . TYR A 1 55  ? -9.566  -0.710  -4.655  1.00 0.00 ? 55  TYR A CB   7  
ATOM 11533 C CG   . TYR A 1 55  ? -9.954  0.718   -4.352  1.00 0.00 ? 55  TYR A CG   7  
ATOM 11534 C CD1  . TYR A 1 55  ? -9.039  1.606   -3.799  1.00 0.00 ? 55  TYR A CD1  7  
ATOM 11535 C CD2  . TYR A 1 55  ? -11.237 1.183   -4.616  1.00 0.00 ? 55  TYR A CD2  7  
ATOM 11536 C CE1  . TYR A 1 55  ? -9.391  2.913   -3.519  1.00 0.00 ? 55  TYR A CE1  7  
ATOM 11537 C CE2  . TYR A 1 55  ? -11.596 2.487   -4.342  1.00 0.00 ? 55  TYR A CE2  7  
ATOM 11538 C CZ   . TYR A 1 55  ? -10.670 3.349   -3.794  1.00 0.00 ? 55  TYR A CZ   7  
ATOM 11539 O OH   . TYR A 1 55  ? -11.024 4.650   -3.518  1.00 0.00 ? 55  TYR A OH   7  
ATOM 11540 H H    . TYR A 1 55  ? -7.748  -1.170  -2.462  1.00 0.00 ? 55  TYR A H    7  
ATOM 11541 H HA   . TYR A 1 55  ? -10.584 -1.672  -3.037  1.00 0.00 ? 55  TYR A HA   7  
ATOM 11542 H HB2  . TYR A 1 55  ? -8.574  -0.700  -5.078  1.00 0.00 ? 55  TYR A HB2  7  
ATOM 11543 H HB3  . TYR A 1 55  ? -10.260 -1.095  -5.386  1.00 0.00 ? 55  TYR A HB3  7  
ATOM 11544 H HD1  . TYR A 1 55  ? -8.038  1.262   -3.585  1.00 0.00 ? 55  TYR A HD1  7  
ATOM 11545 H HD2  . TYR A 1 55  ? -11.961 0.505   -5.046  1.00 0.00 ? 55  TYR A HD2  7  
ATOM 11546 H HE1  . TYR A 1 55  ? -8.665  3.589   -3.090  1.00 0.00 ? 55  TYR A HE1  7  
ATOM 11547 H HE2  . TYR A 1 55  ? -12.598 2.829   -4.556  1.00 0.00 ? 55  TYR A HE2  7  
ATOM 11548 H HH   . TYR A 1 55  ? -11.975 4.704   -3.402  1.00 0.00 ? 55  TYR A HH   7  
ATOM 11549 N N    . TYR A 1 56  ? -10.015 -3.998  -3.625  1.00 0.00 ? 56  TYR A N    7  
ATOM 11550 C CA   . TYR A 1 56  ? -9.711  -5.385  -3.955  1.00 0.00 ? 56  TYR A CA   7  
ATOM 11551 C C    . TYR A 1 56  ? -10.979 -6.142  -4.340  1.00 0.00 ? 56  TYR A C    7  
ATOM 11552 O O    . TYR A 1 56  ? -11.985 -6.099  -3.630  1.00 0.00 ? 56  TYR A O    7  
ATOM 11553 C CB   . TYR A 1 56  ? -9.031  -6.076  -2.772  1.00 0.00 ? 56  TYR A CB   7  
ATOM 11554 C CG   . TYR A 1 56  ? -9.942  -6.274  -1.581  1.00 0.00 ? 56  TYR A CG   7  
ATOM 11555 C CD1  . TYR A 1 56  ? -10.154 -5.250  -0.666  1.00 0.00 ? 56  TYR A CD1  7  
ATOM 11556 C CD2  . TYR A 1 56  ? -10