data_2DLL
# 
_entry.id   2DLL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DLL         
RCSB  RCSB025557   
WWPDB D_1000025557 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsi002012141.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DLL 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-20 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, H.P.'                                            1 
'Kurosaki, C.'                                           2 
'Yoshida, M.'                                            3 
'Hayashi, F.'                                            4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the IRF domain of human interferon regulator factors 4' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, H.P.'  1 
primary 'Kurosaki, C.' 2 
primary 'Yoshida, M.'  3 
primary 'Hayashi, F.'  4 
primary 'Yokoyama, S.' 5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Interferon regulatory factor 4' 
_entity.formula_weight             13910.570 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'IRF domain, residues 8-115' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IRF-4, Lymphocyte-specific interferon regulatory factor, LSIRF, NF-EM5, Multiple myeloma oncogene 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKT
RLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKT
RLRCALNKSNDFEELVERSQLDISDPYKVYRIVPESGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsi002012141.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   LYS n 
1 9   LEU n 
1 10  ARG n 
1 11  GLN n 
1 12  TRP n 
1 13  LEU n 
1 14  ILE n 
1 15  ASP n 
1 16  GLN n 
1 17  ILE n 
1 18  ASP n 
1 19  SER n 
1 20  GLY n 
1 21  LYS n 
1 22  TYR n 
1 23  PRO n 
1 24  GLY n 
1 25  LEU n 
1 26  VAL n 
1 27  TRP n 
1 28  GLU n 
1 29  ASN n 
1 30  GLU n 
1 31  GLU n 
1 32  LYS n 
1 33  SER n 
1 34  ILE n 
1 35  PHE n 
1 36  ARG n 
1 37  ILE n 
1 38  PRO n 
1 39  TRP n 
1 40  LYS n 
1 41  HIS n 
1 42  ALA n 
1 43  GLY n 
1 44  LYS n 
1 45  GLN n 
1 46  ASP n 
1 47  TYR n 
1 48  ASN n 
1 49  ARG n 
1 50  GLU n 
1 51  GLU n 
1 52  ASP n 
1 53  ALA n 
1 54  ALA n 
1 55  LEU n 
1 56  PHE n 
1 57  LYS n 
1 58  ALA n 
1 59  TRP n 
1 60  ALA n 
1 61  LEU n 
1 62  PHE n 
1 63  LYS n 
1 64  GLY n 
1 65  LYS n 
1 66  PHE n 
1 67  ARG n 
1 68  GLU n 
1 69  GLY n 
1 70  ILE n 
1 71  ASP n 
1 72  LYS n 
1 73  PRO n 
1 74  ASP n 
1 75  PRO n 
1 76  PRO n 
1 77  THR n 
1 78  TRP n 
1 79  LYS n 
1 80  THR n 
1 81  ARG n 
1 82  LEU n 
1 83  ARG n 
1 84  CYS n 
1 85  ALA n 
1 86  LEU n 
1 87  ASN n 
1 88  LYS n 
1 89  SER n 
1 90  ASN n 
1 91  ASP n 
1 92  PHE n 
1 93  GLU n 
1 94  GLU n 
1 95  LEU n 
1 96  VAL n 
1 97  GLU n 
1 98  ARG n 
1 99  SER n 
1 100 GLN n 
1 101 LEU n 
1 102 ASP n 
1 103 ILE n 
1 104 SER n 
1 105 ASP n 
1 106 PRO n 
1 107 TYR n 
1 108 LYS n 
1 109 VAL n 
1 110 TYR n 
1 111 ARG n 
1 112 ILE n 
1 113 VAL n 
1 114 PRO n 
1 115 GLU n 
1 116 SER n 
1 117 GLY n 
1 118 PRO n 
1 119 SER n 
1 120 SER n 
1 121 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'IRF4, MUM1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell free synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050516-06 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IRF4_HUMAN 
_struct_ref.pdbx_db_accession          Q15306 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DLL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 115 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q15306 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  130 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DLL GLY A 1   ? UNP Q15306 ? ? 'CLONING ARTIFACT' 1   1  
1 2DLL SER A 2   ? UNP Q15306 ? ? 'CLONING ARTIFACT' 2   2  
1 2DLL SER A 3   ? UNP Q15306 ? ? 'CLONING ARTIFACT' 3   3  
1 2DLL GLY A 4   ? UNP Q15306 ? ? 'CLONING ARTIFACT' 4   4  
1 2DLL SER A 5   ? UNP Q15306 ? ? 'CLONING ARTIFACT' 5   5  
1 2DLL SER A 6   ? UNP Q15306 ? ? 'CLONING ARTIFACT' 6   6  
1 2DLL GLY A 7   ? UNP Q15306 ? ? 'CLONING ARTIFACT' 7   7  
1 2DLL SER A 116 ? UNP Q15306 ? ? 'CLONING ARTIFACT' 116 8  
1 2DLL GLY A 117 ? UNP Q15306 ? ? 'CLONING ARTIFACT' 117 9  
1 2DLL PRO A 118 ? UNP Q15306 ? ? 'CLONING ARTIFACT' 118 10 
1 2DLL SER A 119 ? UNP Q15306 ? ? 'CLONING ARTIFACT' 119 11 
1 2DLL SER A 120 ? UNP Q15306 ? ? 'CLONING ARTIFACT' 120 12 
1 2DLL GLY A 121 ? UNP Q15306 ? ? 'CLONING ARTIFACT' 121 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1.23mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 
1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DLL 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DLL 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DLL 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRview 5.04     'Johnson, B.A.' 3 
'data analysis'      Kujira  0.93191  'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntent, P.'   5 
refinement           CYANA   2.0.17   'Guntent, P.'   6 
# 
_exptl.entry_id          2DLL 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DLL 
_struct.title                     'Solution structure of the IRF domain of human interferon regulator factors 4' 
_struct.pdbx_descriptor           'Interferon regulatory factor 4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DLL 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            
;IRF domain, Interferon regulatory factor 4, Lymphocyte specific interferon regulatory factor, NF-EM5, Multiple myeloma oncogene 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CYTOKINE
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 9  ? SER A 19 ? LEU A 9  SER A 19 1 ? 11 
HELX_P HELX_P2 2 ARG A 49 ? ASP A 52 ? ARG A 49 ASP A 52 1 ? 4  
HELX_P HELX_P3 3 ALA A 54 ? LYS A 63 ? ALA A 54 LYS A 63 1 ? 10 
HELX_P HELX_P4 4 THR A 77 ? LYS A 88 ? THR A 77 LYS A 88 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 26  ? TRP A 27  ? VAL A 26  TRP A 27  
A 2 ILE A 34  ? PRO A 38  ? ILE A 34  PRO A 38  
A 3 TYR A 107 ? ILE A 112 ? TYR A 107 ILE A 112 
A 4 PHE A 92  ? GLU A 94  ? PHE A 92  GLU A 94  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 26  ? N VAL A 26  O ARG A 36  ? O ARG A 36  
A 2 3 N ILE A 37  ? N ILE A 37  O LYS A 108 ? O LYS A 108 
A 3 4 O ARG A 111 ? O ARG A 111 N GLU A 93  ? N GLU A 93  
# 
_database_PDB_matrix.entry_id          2DLL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DLL 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 2.752   -19.449 6.411   1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 3.453   -19.853 7.615   1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 4.536   -20.877 7.340   1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 5.725   -20.562 7.387   1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 2.210   -18.633 6.412   1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 3.903   -18.981 8.066   1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 2.741   -20.277 8.308   1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 4.125   -22.108 7.053   1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 5.069   -23.184 6.774   1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 5.650   -23.047 5.370   1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 6.866   -23.071 5.184   1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 4.384   -24.544 6.925   1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 5.338   -25.587 7.020   1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 3.163   -22.298 7.030   1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 5.873   -23.114 7.492   1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 3.780   -24.542 7.820   1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 3.755   -24.724 6.066   1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 5.452   -25.834 7.941   1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 4.770   -22.904 4.384   1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 5.193   -22.767 2.996   1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 4.221   -21.887 2.215   1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 3.007   -21.978 2.390   1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 5.297   -24.143 2.334   1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 6.201   -24.117 1.243   1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 3.813   -22.893 4.596   1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 6.167   -22.300 2.990   1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 5.647   -24.862 3.058   1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 4.323   -24.440 1.973   1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 7.049   -23.778 1.537   1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 4.766   -21.035 1.353   1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 3.934   -20.150 0.558   1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 3.255   -20.869 -0.591  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 3.470   -20.534 -1.755  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 5.741   -21.006 1.255   1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 3.178   -19.716 1.195   1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 4.551   -19.358 0.158   1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 2.434   -21.862 -0.263  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 1.726   -22.634 -1.277  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 0.815   -21.734 -2.107  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 0.952   -21.651 -3.327  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 0.903   -23.744 -0.620  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 1.710   -24.544 0.227   1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 2.304   -22.081 0.684   1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 2.462   -23.081 -1.928  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 0.112   -23.303 -0.032  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 0.474   -24.373 -1.387  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 1.670   -25.458 -0.061  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -0.114  -21.062 -1.435  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -1.051  -20.171 -2.110  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -0.749  -18.713 -1.778  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -1.051  -18.239 -0.684  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -2.488  -20.510 -1.711  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -3.399  -19.554 -2.225  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -0.173  -21.171 -0.463  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -0.938  -20.317 -3.174  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -2.748  -21.483 -2.101  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -2.566  -20.522 -0.633  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -3.234  -19.425 -3.161  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -0.150  -18.007 -2.732  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 0.184   -16.610 -2.522  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -1.041  -15.717 -2.515  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -2.026  -15.994 -3.199  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 0.068   -18.438 -3.585  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 0.695   -16.512 -1.576  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 0.845   -16.288 -3.313  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . LYS A 1 8   ? -0.981  -14.641 -1.737  1.00 0.00 ? 8   LYS A N    1  
ATOM 67    C CA   . LYS A 1 8   ? -2.093  -13.703 -1.641  1.00 0.00 ? 8   LYS A CA   1  
ATOM 68    C C    . LYS A 1 8   ? -1.650  -12.398 -0.988  1.00 0.00 ? 8   LYS A C    1  
ATOM 69    O O    . LYS A 1 8   ? -0.656  -12.362 -0.261  1.00 0.00 ? 8   LYS A O    1  
ATOM 70    C CB   . LYS A 1 8   ? -3.242  -14.321 -0.841  1.00 0.00 ? 8   LYS A CB   1  
ATOM 71    C CG   . LYS A 1 8   ? -4.528  -13.516 -0.902  1.00 0.00 ? 8   LYS A CG   1  
ATOM 72    C CD   . LYS A 1 8   ? -5.165  -13.585 -2.280  1.00 0.00 ? 8   LYS A CD   1  
ATOM 73    C CE   . LYS A 1 8   ? -5.821  -14.936 -2.524  1.00 0.00 ? 8   LYS A CE   1  
ATOM 74    N NZ   . LYS A 1 8   ? -6.213  -15.112 -3.950  1.00 0.00 ? 8   LYS A NZ   1  
ATOM 75    H H    . LYS A 1 8   ? -0.169  -14.474 -1.214  1.00 0.00 ? 8   LYS A H    1  
ATOM 76    H HA   . LYS A 1 8   ? -2.436  -13.492 -2.642  1.00 0.00 ? 8   LYS A HA   1  
ATOM 77    H HB2  . LYS A 1 8   ? -3.442  -15.310 -1.227  1.00 0.00 ? 8   LYS A HB2  1  
ATOM 78    H HB3  . LYS A 1 8   ? -2.941  -14.402 0.194   1.00 0.00 ? 8   LYS A HB3  1  
ATOM 79    H HG2  . LYS A 1 8   ? -5.224  -13.910 -0.176  1.00 0.00 ? 8   LYS A HG2  1  
ATOM 80    H HG3  . LYS A 1 8   ? -4.308  -12.484 -0.668  1.00 0.00 ? 8   LYS A HG3  1  
ATOM 81    H HD2  . LYS A 1 8   ? -5.916  -12.813 -2.359  1.00 0.00 ? 8   LYS A HD2  1  
ATOM 82    H HD3  . LYS A 1 8   ? -4.401  -13.425 -3.028  1.00 0.00 ? 8   LYS A HD3  1  
ATOM 83    H HE2  . LYS A 1 8   ? -5.125  -15.714 -2.252  1.00 0.00 ? 8   LYS A HE2  1  
ATOM 84    H HE3  . LYS A 1 8   ? -6.703  -15.009 -1.905  1.00 0.00 ? 8   LYS A HE3  1  
ATOM 85    H HZ1  . LYS A 1 8   ? -6.781  -14.301 -4.267  1.00 0.00 ? 8   LYS A HZ1  1  
ATOM 86    H HZ2  . LYS A 1 8   ? -6.775  -15.980 -4.061  1.00 0.00 ? 8   LYS A HZ2  1  
ATOM 87    H HZ3  . LYS A 1 8   ? -5.365  -15.183 -4.547  1.00 0.00 ? 8   LYS A HZ3  1  
ATOM 88    N N    . LEU A 1 9   ? -2.393  -11.328 -1.250  1.00 0.00 ? 9   LEU A N    1  
ATOM 89    C CA   . LEU A 1 9   ? -2.076  -10.020 -0.686  1.00 0.00 ? 9   LEU A CA   1  
ATOM 90    C C    . LEU A 1 9   ? -2.758  -9.831  0.666   1.00 0.00 ? 9   LEU A C    1  
ATOM 91    O O    . LEU A 1 9   ? -2.134  -9.387  1.630   1.00 0.00 ? 9   LEU A O    1  
ATOM 92    C CB   . LEU A 1 9   ? -2.507  -8.911  -1.647  1.00 0.00 ? 9   LEU A CB   1  
ATOM 93    C CG   . LEU A 1 9   ? -2.304  -7.479  -1.153  1.00 0.00 ? 9   LEU A CG   1  
ATOM 94    C CD1  . LEU A 1 9   ? -0.909  -6.985  -1.506  1.00 0.00 ? 9   LEU A CD1  1  
ATOM 95    C CD2  . LEU A 1 9   ? -3.362  -6.556  -1.740  1.00 0.00 ? 9   LEU A CD2  1  
ATOM 96    H H    . LEU A 1 9   ? -3.172  -11.419 -1.836  1.00 0.00 ? 9   LEU A H    1  
ATOM 97    H HA   . LEU A 1 9   ? -1.007  -9.970  -0.546  1.00 0.00 ? 9   LEU A HA   1  
ATOM 98    H HB2  . LEU A 1 9   ? -1.945  -9.029  -2.561  1.00 0.00 ? 9   LEU A HB2  1  
ATOM 99    H HB3  . LEU A 1 9   ? -3.560  -9.044  -1.854  1.00 0.00 ? 9   LEU A HB3  1  
ATOM 100   H HG   . LEU A 1 9   ? -2.401  -7.459  -0.076  1.00 0.00 ? 9   LEU A HG   1  
ATOM 101   H HD11 . LEU A 1 9   ? -0.317  -7.811  -1.870  1.00 0.00 ? 9   LEU A HD11 1  
ATOM 102   H HD12 . LEU A 1 9   ? -0.442  -6.567  -0.627  1.00 0.00 ? 9   LEU A HD12 1  
ATOM 103   H HD13 . LEU A 1 9   ? -0.979  -6.226  -2.272  1.00 0.00 ? 9   LEU A HD13 1  
ATOM 104   H HD21 . LEU A 1 9   ? -3.991  -6.180  -0.946  1.00 0.00 ? 9   LEU A HD21 1  
ATOM 105   H HD22 . LEU A 1 9   ? -3.966  -7.106  -2.447  1.00 0.00 ? 9   LEU A HD22 1  
ATOM 106   H HD23 . LEU A 1 9   ? -2.882  -5.730  -2.241  1.00 0.00 ? 9   LEU A HD23 1  
ATOM 107   N N    . ARG A 1 10  ? -4.041  -10.174 0.729   1.00 0.00 ? 10  ARG A N    1  
ATOM 108   C CA   . ARG A 1 10  ? -4.806  -10.042 1.962   1.00 0.00 ? 10  ARG A CA   1  
ATOM 109   C C    . ARG A 1 10  ? -3.935  -10.344 3.178   1.00 0.00 ? 10  ARG A C    1  
ATOM 110   O O    . ARG A 1 10  ? -3.726  -9.483  4.032   1.00 0.00 ? 10  ARG A O    1  
ATOM 111   C CB   . ARG A 1 10  ? -6.014  -10.982 1.941   1.00 0.00 ? 10  ARG A CB   1  
ATOM 112   C CG   . ARG A 1 10  ? -7.044  -10.674 3.015   1.00 0.00 ? 10  ARG A CG   1  
ATOM 113   C CD   . ARG A 1 10  ? -6.679  -11.325 4.340   1.00 0.00 ? 10  ARG A CD   1  
ATOM 114   N NE   . ARG A 1 10  ? -7.842  -11.491 5.208   1.00 0.00 ? 10  ARG A NE   1  
ATOM 115   C CZ   . ARG A 1 10  ? -7.917  -12.404 6.169   1.00 0.00 ? 10  ARG A CZ   1  
ATOM 116   N NH1  . ARG A 1 10  ? -6.902  -13.229 6.385   1.00 0.00 ? 10  ARG A NH1  1  
ATOM 117   N NH2  . ARG A 1 10  ? -9.009  -12.493 6.917   1.00 0.00 ? 10  ARG A NH2  1  
ATOM 118   H H    . ARG A 1 10  ? -4.483  -10.522 -0.073  1.00 0.00 ? 10  ARG A H    1  
ATOM 119   H HA   . ARG A 1 10  ? -5.156  -9.023  2.029   1.00 0.00 ? 10  ARG A HA   1  
ATOM 120   H HB2  . ARG A 1 10  ? -6.497  -10.906 0.978   1.00 0.00 ? 10  ARG A HB2  1  
ATOM 121   H HB3  . ARG A 1 10  ? -5.669  -11.995 2.083   1.00 0.00 ? 10  ARG A HB3  1  
ATOM 122   H HG2  . ARG A 1 10  ? -7.097  -9.605  3.155   1.00 0.00 ? 10  ARG A HG2  1  
ATOM 123   H HG3  . ARG A 1 10  ? -8.006  -11.045 2.694   1.00 0.00 ? 10  ARG A HG3  1  
ATOM 124   H HD2  . ARG A 1 10  ? -6.248  -12.295 4.142   1.00 0.00 ? 10  ARG A HD2  1  
ATOM 125   H HD3  . ARG A 1 10  ? -5.952  -10.704 4.842   1.00 0.00 ? 10  ARG A HD3  1  
ATOM 126   H HE   . ARG A 1 10  ? -8.603  -10.891 5.065   1.00 0.00 ? 10  ARG A HE   1  
ATOM 127   H HH11 . ARG A 1 10  ? -6.078  -13.164 5.824   1.00 0.00 ? 10  ARG A HH11 1  
ATOM 128   H HH12 . ARG A 1 10  ? -6.961  -13.916 7.110   1.00 0.00 ? 10  ARG A HH12 1  
ATOM 129   H HH21 . ARG A 1 10  ? -9.777  -11.872 6.757   1.00 0.00 ? 10  ARG A HH21 1  
ATOM 130   H HH22 . ARG A 1 10  ? -9.065  -13.181 7.640   1.00 0.00 ? 10  ARG A HH22 1  
ATOM 131   N N    . GLN A 1 11  ? -3.431  -11.572 3.248   1.00 0.00 ? 11  GLN A N    1  
ATOM 132   C CA   . GLN A 1 11  ? -2.584  -11.987 4.360   1.00 0.00 ? 11  GLN A CA   1  
ATOM 133   C C    . GLN A 1 11  ? -1.182  -11.401 4.225   1.00 0.00 ? 11  GLN A C    1  
ATOM 134   O O    . GLN A 1 11  ? -0.699  -10.711 5.122   1.00 0.00 ? 11  GLN A O    1  
ATOM 135   C CB   . GLN A 1 11  ? -2.507  -13.514 4.427   1.00 0.00 ? 11  GLN A CB   1  
ATOM 136   C CG   . GLN A 1 11  ? -1.543  -14.028 5.484   1.00 0.00 ? 11  GLN A CG   1  
ATOM 137   C CD   . GLN A 1 11  ? -2.048  -13.800 6.895   1.00 0.00 ? 11  GLN A CD   1  
ATOM 138   O OE1  . GLN A 1 11  ? -2.836  -14.588 7.420   1.00 0.00 ? 11  GLN A OE1  1  
ATOM 139   N NE2  . GLN A 1 11  ? -1.597  -12.718 7.519   1.00 0.00 ? 11  GLN A NE2  1  
ATOM 140   H H    . GLN A 1 11  ? -3.634  -12.213 2.536   1.00 0.00 ? 11  GLN A H    1  
ATOM 141   H HA   . GLN A 1 11  ? -3.029  -11.618 5.271   1.00 0.00 ? 11  GLN A HA   1  
ATOM 142   H HB2  . GLN A 1 11  ? -3.490  -13.902 4.648   1.00 0.00 ? 11  GLN A HB2  1  
ATOM 143   H HB3  . GLN A 1 11  ? -2.187  -13.889 3.467   1.00 0.00 ? 11  GLN A HB3  1  
ATOM 144   H HG2  . GLN A 1 11  ? -1.399  -15.088 5.337   1.00 0.00 ? 11  GLN A HG2  1  
ATOM 145   H HG3  . GLN A 1 11  ? -0.598  -13.518 5.369   1.00 0.00 ? 11  GLN A HG3  1  
ATOM 146   H HE21 . GLN A 1 11  ? -0.972  -12.134 7.038   1.00 0.00 ? 11  GLN A HE21 1  
ATOM 147   H HE22 . GLN A 1 11  ? -1.907  -12.546 8.431   1.00 0.00 ? 11  GLN A HE22 1  
ATOM 148   N N    . TRP A 1 12  ? -0.536  -11.681 3.099   1.00 0.00 ? 12  TRP A N    1  
ATOM 149   C CA   . TRP A 1 12  ? 0.811   -11.182 2.847   1.00 0.00 ? 12  TRP A CA   1  
ATOM 150   C C    . TRP A 1 12  ? 0.983   -9.773  3.405   1.00 0.00 ? 12  TRP A C    1  
ATOM 151   O O    . TRP A 1 12  ? 1.819   -9.538  4.278   1.00 0.00 ? 12  TRP A O    1  
ATOM 152   C CB   . TRP A 1 12  ? 1.107   -11.188 1.346   1.00 0.00 ? 12  TRP A CB   1  
ATOM 153   C CG   . TRP A 1 12  ? 2.405   -10.527 0.994   1.00 0.00 ? 12  TRP A CG   1  
ATOM 154   C CD1  . TRP A 1 12  ? 3.629   -11.125 0.894   1.00 0.00 ? 12  TRP A CD1  1  
ATOM 155   C CD2  . TRP A 1 12  ? 2.609   -9.141  0.698   1.00 0.00 ? 12  TRP A CD2  1  
ATOM 156   N NE1  . TRP A 1 12  ? 4.581   -10.194 0.553   1.00 0.00 ? 12  TRP A NE1  1  
ATOM 157   C CE2  . TRP A 1 12  ? 3.980   -8.970  0.426   1.00 0.00 ? 12  TRP A CE2  1  
ATOM 158   C CE3  . TRP A 1 12  ? 1.765   -8.029  0.633   1.00 0.00 ? 12  TRP A CE3  1  
ATOM 159   C CZ2  . TRP A 1 12  ? 4.524   -7.731  0.097   1.00 0.00 ? 12  TRP A CZ2  1  
ATOM 160   C CZ3  . TRP A 1 12  ? 2.307   -6.800  0.306   1.00 0.00 ? 12  TRP A CZ3  1  
ATOM 161   C CH2  . TRP A 1 12  ? 3.676   -6.659  0.041   1.00 0.00 ? 12  TRP A CH2  1  
ATOM 162   H H    . TRP A 1 12  ? -0.974  -12.237 2.421   1.00 0.00 ? 12  TRP A H    1  
ATOM 163   H HA   . TRP A 1 12  ? 1.507   -11.841 3.345   1.00 0.00 ? 12  TRP A HA   1  
ATOM 164   H HB2  . TRP A 1 12  ? 1.148   -12.209 0.998   1.00 0.00 ? 12  TRP A HB2  1  
ATOM 165   H HB3  . TRP A 1 12  ? 0.315   -10.666 0.829   1.00 0.00 ? 12  TRP A HB3  1  
ATOM 166   H HD1  . TRP A 1 12  ? 3.808   -12.176 1.063   1.00 0.00 ? 12  TRP A HD1  1  
ATOM 167   H HE1  . TRP A 1 12  ? 5.535   -10.378 0.421   1.00 0.00 ? 12  TRP A HE1  1  
ATOM 168   H HE3  . TRP A 1 12  ? 0.708   -8.117  0.834   1.00 0.00 ? 12  TRP A HE3  1  
ATOM 169   H HZ2  . TRP A 1 12  ? 5.577   -7.607  -0.111  1.00 0.00 ? 12  TRP A HZ2  1  
ATOM 170   H HZ3  . TRP A 1 12  ? 1.671   -5.929  0.252   1.00 0.00 ? 12  TRP A HZ3  1  
ATOM 171   H HH2  . TRP A 1 12  ? 4.055   -5.681  -0.210  1.00 0.00 ? 12  TRP A HH2  1  
ATOM 172   N N    . LEU A 1 13  ? 0.186   -8.839  2.898   1.00 0.00 ? 13  LEU A N    1  
ATOM 173   C CA   . LEU A 1 13  ? 0.250   -7.453  3.347   1.00 0.00 ? 13  LEU A CA   1  
ATOM 174   C C    . LEU A 1 13  ? 0.125   -7.365  4.864   1.00 0.00 ? 13  LEU A C    1  
ATOM 175   O O    . LEU A 1 13  ? 0.994   -6.812  5.538   1.00 0.00 ? 13  LEU A O    1  
ATOM 176   C CB   . LEU A 1 13  ? -0.856  -6.630  2.684   1.00 0.00 ? 13  LEU A CB   1  
ATOM 177   C CG   . LEU A 1 13  ? -0.787  -5.117  2.898   1.00 0.00 ? 13  LEU A CG   1  
ATOM 178   C CD1  . LEU A 1 13  ? 0.497   -4.553  2.310   1.00 0.00 ? 13  LEU A CD1  1  
ATOM 179   C CD2  . LEU A 1 13  ? -2.001  -4.436  2.283   1.00 0.00 ? 13  LEU A CD2  1  
ATOM 180   H H    . LEU A 1 13  ? -0.460  -9.087  2.205   1.00 0.00 ? 13  LEU A H    1  
ATOM 181   H HA   . LEU A 1 13  ? 1.209   -7.053  3.053   1.00 0.00 ? 13  LEU A HA   1  
ATOM 182   H HB2  . LEU A 1 13  ? -0.815  -6.816  1.622   1.00 0.00 ? 13  LEU A HB2  1  
ATOM 183   H HB3  . LEU A 1 13  ? -1.803  -6.977  3.072   1.00 0.00 ? 13  LEU A HB3  1  
ATOM 184   H HG   . LEU A 1 13  ? -0.787  -4.910  3.959   1.00 0.00 ? 13  LEU A HG   1  
ATOM 185   H HD11 . LEU A 1 13  ? 1.342   -5.094  2.707   1.00 0.00 ? 13  LEU A HD11 1  
ATOM 186   H HD12 . LEU A 1 13  ? 0.583   -3.509  2.570   1.00 0.00 ? 13  LEU A HD12 1  
ATOM 187   H HD13 . LEU A 1 13  ? 0.476   -4.656  1.235   1.00 0.00 ? 13  LEU A HD13 1  
ATOM 188   H HD21 . LEU A 1 13  ? -2.496  -3.837  3.034   1.00 0.00 ? 13  LEU A HD21 1  
ATOM 189   H HD22 . LEU A 1 13  ? -2.686  -5.186  1.913   1.00 0.00 ? 13  LEU A HD22 1  
ATOM 190   H HD23 . LEU A 1 13  ? -1.685  -3.803  1.468   1.00 0.00 ? 13  LEU A HD23 1  
ATOM 191   N N    . ILE A 1 14  ? -0.961  -7.917  5.396   1.00 0.00 ? 14  ILE A N    1  
ATOM 192   C CA   . ILE A 1 14  ? -1.198  -7.904  6.834   1.00 0.00 ? 14  ILE A CA   1  
ATOM 193   C C    . ILE A 1 14  ? 0.052   -8.322  7.601   1.00 0.00 ? 14  ILE A C    1  
ATOM 194   O O    . ILE A 1 14  ? 0.382   -7.740  8.634   1.00 0.00 ? 14  ILE A O    1  
ATOM 195   C CB   . ILE A 1 14  ? -2.360  -8.838  7.222   1.00 0.00 ? 14  ILE A CB   1  
ATOM 196   C CG1  . ILE A 1 14  ? -3.676  -8.317  6.641   1.00 0.00 ? 14  ILE A CG1  1  
ATOM 197   C CG2  . ILE A 1 14  ? -2.455  -8.965  8.735   1.00 0.00 ? 14  ILE A CG2  1  
ATOM 198   C CD1  . ILE A 1 14  ? -4.772  -9.359  6.600   1.00 0.00 ? 14  ILE A CD1  1  
ATOM 199   H H    . ILE A 1 14  ? -1.618  -8.343  4.807   1.00 0.00 ? 14  ILE A H    1  
ATOM 200   H HA   . ILE A 1 14  ? -1.462  -6.896  7.119   1.00 0.00 ? 14  ILE A HA   1  
ATOM 201   H HB   . ILE A 1 14  ? -2.157  -9.817  6.814   1.00 0.00 ? 14  ILE A HB   1  
ATOM 202   H HG12 . ILE A 1 14  ? -4.026  -7.492  7.242   1.00 0.00 ? 14  ILE A HG12 1  
ATOM 203   H HG13 . ILE A 1 14  ? -3.505  -7.975  5.631   1.00 0.00 ? 14  ILE A HG13 1  
ATOM 204   H HG21 . ILE A 1 14  ? -2.367  -10.004 9.015   1.00 0.00 ? 14  ILE A HG21 1  
ATOM 205   H HG22 . ILE A 1 14  ? -1.657  -8.401  9.194   1.00 0.00 ? 14  ILE A HG22 1  
ATOM 206   H HG23 . ILE A 1 14  ? -3.407  -8.581  9.069   1.00 0.00 ? 14  ILE A HG23 1  
ATOM 207   H HD11 . ILE A 1 14  ? -4.372  -10.289 6.223   1.00 0.00 ? 14  ILE A HD11 1  
ATOM 208   H HD12 . ILE A 1 14  ? -5.163  -9.511  7.595   1.00 0.00 ? 14  ILE A HD12 1  
ATOM 209   H HD13 . ILE A 1 14  ? -5.567  -9.020  5.950   1.00 0.00 ? 14  ILE A HD13 1  
ATOM 210   N N    . ASP A 1 15  ? 0.745   -9.332  7.087   1.00 0.00 ? 15  ASP A N    1  
ATOM 211   C CA   . ASP A 1 15  ? 1.962   -9.826  7.721   1.00 0.00 ? 15  ASP A CA   1  
ATOM 212   C C    . ASP A 1 15  ? 3.029   -8.737  7.771   1.00 0.00 ? 15  ASP A C    1  
ATOM 213   O O    . ASP A 1 15  ? 3.778   -8.634  8.742   1.00 0.00 ? 15  ASP A O    1  
ATOM 214   C CB   . ASP A 1 15  ? 2.495   -11.047 6.969   1.00 0.00 ? 15  ASP A CB   1  
ATOM 215   C CG   . ASP A 1 15  ? 3.327   -11.953 7.854   1.00 0.00 ? 15  ASP A CG   1  
ATOM 216   O OD1  . ASP A 1 15  ? 2.742   -12.835 8.517   1.00 0.00 ? 15  ASP A OD1  1  
ATOM 217   O OD2  . ASP A 1 15  ? 4.564   -11.781 7.884   1.00 0.00 ? 15  ASP A OD2  1  
ATOM 218   H H    . ASP A 1 15  ? 0.431   -9.755  6.260   1.00 0.00 ? 15  ASP A H    1  
ATOM 219   H HA   . ASP A 1 15  ? 1.714   -10.117 8.731   1.00 0.00 ? 15  ASP A HA   1  
ATOM 220   H HB2  . ASP A 1 15  ? 1.661   -11.617 6.584   1.00 0.00 ? 15  ASP A HB2  1  
ATOM 221   H HB3  . ASP A 1 15  ? 3.109   -10.714 6.146   1.00 0.00 ? 15  ASP A HB3  1  
ATOM 222   N N    . GLN A 1 16  ? 3.093   -7.930  6.717   1.00 0.00 ? 16  GLN A N    1  
ATOM 223   C CA   . GLN A 1 16  ? 4.071   -6.851  6.641   1.00 0.00 ? 16  GLN A CA   1  
ATOM 224   C C    . GLN A 1 16  ? 3.794   -5.790  7.701   1.00 0.00 ? 16  GLN A C    1  
ATOM 225   O O    . GLN A 1 16  ? 4.718   -5.267  8.325   1.00 0.00 ? 16  GLN A O    1  
ATOM 226   C CB   . GLN A 1 16  ? 4.053   -6.215  5.249   1.00 0.00 ? 16  GLN A CB   1  
ATOM 227   C CG   . GLN A 1 16  ? 4.258   -7.214  4.122   1.00 0.00 ? 16  GLN A CG   1  
ATOM 228   C CD   . GLN A 1 16  ? 5.275   -8.283  4.467   1.00 0.00 ? 16  GLN A CD   1  
ATOM 229   O OE1  . GLN A 1 16  ? 6.451   -7.990  4.685   1.00 0.00 ? 16  GLN A OE1  1  
ATOM 230   N NE2  . GLN A 1 16  ? 4.828   -9.532  4.519   1.00 0.00 ? 16  GLN A NE2  1  
ATOM 231   H H    . GLN A 1 16  ? 2.469   -8.063  5.974   1.00 0.00 ? 16  GLN A H    1  
ATOM 232   H HA   . GLN A 1 16  ? 5.047   -7.275  6.820   1.00 0.00 ? 16  GLN A HA   1  
ATOM 233   H HB2  . GLN A 1 16  ? 3.101   -5.728  5.102   1.00 0.00 ? 16  GLN A HB2  1  
ATOM 234   H HB3  . GLN A 1 16  ? 4.839   -5.477  5.194   1.00 0.00 ? 16  GLN A HB3  1  
ATOM 235   H HG2  . GLN A 1 16  ? 3.314   -7.694  3.907   1.00 0.00 ? 16  GLN A HG2  1  
ATOM 236   H HG3  . GLN A 1 16  ? 4.598   -6.683  3.245   1.00 0.00 ? 16  GLN A HG3  1  
ATOM 237   H HE21 . GLN A 1 16  ? 3.878   -9.691  4.333   1.00 0.00 ? 16  GLN A HE21 1  
ATOM 238   H HE22 . GLN A 1 16  ? 5.464   -10.243 4.739   1.00 0.00 ? 16  GLN A HE22 1  
ATOM 239   N N    . ILE A 1 17  ? 2.518   -5.476  7.898   1.00 0.00 ? 17  ILE A N    1  
ATOM 240   C CA   . ILE A 1 17  ? 2.121   -4.478  8.883   1.00 0.00 ? 17  ILE A CA   1  
ATOM 241   C C    . ILE A 1 17  ? 2.370   -4.977  10.303  1.00 0.00 ? 17  ILE A C    1  
ATOM 242   O O    . ILE A 1 17  ? 2.990   -4.288  11.114  1.00 0.00 ? 17  ILE A O    1  
ATOM 243   C CB   . ILE A 1 17  ? 0.634   -4.104  8.737   1.00 0.00 ? 17  ILE A CB   1  
ATOM 244   C CG1  . ILE A 1 17  ? 0.299   -3.820  7.271   1.00 0.00 ? 17  ILE A CG1  1  
ATOM 245   C CG2  . ILE A 1 17  ? 0.304   -2.898  9.604   1.00 0.00 ? 17  ILE A CG2  1  
ATOM 246   C CD1  . ILE A 1 17  ? -1.129  -4.156  6.902   1.00 0.00 ? 17  ILE A CD1  1  
ATOM 247   H H    . ILE A 1 17  ? 1.827   -5.928  7.370   1.00 0.00 ? 17  ILE A H    1  
ATOM 248   H HA   . ILE A 1 17  ? 2.713   -3.590  8.716   1.00 0.00 ? 17  ILE A HA   1  
ATOM 249   H HB   . ILE A 1 17  ? 0.040   -4.937  9.080   1.00 0.00 ? 17  ILE A HB   1  
ATOM 250   H HG12 . ILE A 1 17  ? 0.456   -2.773  7.069   1.00 0.00 ? 17  ILE A HG12 1  
ATOM 251   H HG13 . ILE A 1 17  ? 0.952   -4.407  6.641   1.00 0.00 ? 17  ILE A HG13 1  
ATOM 252   H HG21 . ILE A 1 17  ? 0.487   -1.992  9.046   1.00 0.00 ? 17  ILE A HG21 1  
ATOM 253   H HG22 . ILE A 1 17  ? -0.736  -2.937  9.893   1.00 0.00 ? 17  ILE A HG22 1  
ATOM 254   H HG23 . ILE A 1 17  ? 0.924   -2.909  10.488  1.00 0.00 ? 17  ILE A HG23 1  
ATOM 255   H HD11 . ILE A 1 17  ? -1.140  -4.730  5.988   1.00 0.00 ? 17  ILE A HD11 1  
ATOM 256   H HD12 . ILE A 1 17  ? -1.581  -4.732  7.696   1.00 0.00 ? 17  ILE A HD12 1  
ATOM 257   H HD13 . ILE A 1 17  ? -1.688  -3.242  6.759   1.00 0.00 ? 17  ILE A HD13 1  
ATOM 258   N N    . ASP A 1 18  ? 1.886   -6.179  10.596  1.00 0.00 ? 18  ASP A N    1  
ATOM 259   C CA   . ASP A 1 18  ? 2.059   -6.772  11.917  1.00 0.00 ? 18  ASP A CA   1  
ATOM 260   C C    . ASP A 1 18  ? 3.536   -6.842  12.292  1.00 0.00 ? 18  ASP A C    1  
ATOM 261   O O    . ASP A 1 18  ? 3.913   -6.543  13.424  1.00 0.00 ? 18  ASP A O    1  
ATOM 262   C CB   . ASP A 1 18  ? 1.443   -8.171  11.955  1.00 0.00 ? 18  ASP A CB   1  
ATOM 263   C CG   . ASP A 1 18  ? 1.046   -8.591  13.357  1.00 0.00 ? 18  ASP A CG   1  
ATOM 264   O OD1  . ASP A 1 18  ? 1.920   -8.584  14.249  1.00 0.00 ? 18  ASP A OD1  1  
ATOM 265   O OD2  . ASP A 1 18  ? -0.140  -8.924  13.562  1.00 0.00 ? 18  ASP A OD2  1  
ATOM 266   H H    . ASP A 1 18  ? 1.401   -6.679  9.906   1.00 0.00 ? 18  ASP A H    1  
ATOM 267   H HA   . ASP A 1 18  ? 1.548   -6.144  12.631  1.00 0.00 ? 18  ASP A HA   1  
ATOM 268   H HB2  . ASP A 1 18  ? 0.561   -8.187  11.331  1.00 0.00 ? 18  ASP A HB2  1  
ATOM 269   H HB3  . ASP A 1 18  ? 2.160   -8.884  11.575  1.00 0.00 ? 18  ASP A HB3  1  
ATOM 270   N N    . SER A 1 19  ? 4.366   -7.239  11.333  1.00 0.00 ? 19  SER A N    1  
ATOM 271   C CA   . SER A 1 19  ? 5.802   -7.354  11.564  1.00 0.00 ? 19  SER A CA   1  
ATOM 272   C C    . SER A 1 19  ? 6.413   -5.989  11.868  1.00 0.00 ? 19  SER A C    1  
ATOM 273   O O    . SER A 1 19  ? 7.370   -5.882  12.634  1.00 0.00 ? 19  SER A O    1  
ATOM 274   C CB   . SER A 1 19  ? 6.488   -7.973  10.345  1.00 0.00 ? 19  SER A CB   1  
ATOM 275   O OG   . SER A 1 19  ? 6.015   -7.390  9.143   1.00 0.00 ? 19  SER A OG   1  
ATOM 276   H H    . SER A 1 19  ? 4.004   -7.464  10.450  1.00 0.00 ? 19  SER A H    1  
ATOM 277   H HA   . SER A 1 19  ? 5.950   -7.999  12.417  1.00 0.00 ? 19  SER A HA   1  
ATOM 278   H HB2  . SER A 1 19  ? 7.553   -7.811  10.414  1.00 0.00 ? 19  SER A HB2  1  
ATOM 279   H HB3  . SER A 1 19  ? 6.285   -9.034  10.321  1.00 0.00 ? 19  SER A HB3  1  
ATOM 280   H HG   . SER A 1 19  ? 5.633   -6.530  9.332   1.00 0.00 ? 19  SER A HG   1  
ATOM 281   N N    . GLY A 1 20  ? 5.852   -4.948  11.261  1.00 0.00 ? 20  GLY A N    1  
ATOM 282   C CA   . GLY A 1 20  ? 6.354   -3.603  11.479  1.00 0.00 ? 20  GLY A CA   1  
ATOM 283   C C    . GLY A 1 20  ? 7.763   -3.419  10.952  1.00 0.00 ? 20  GLY A C    1  
ATOM 284   O O    . GLY A 1 20  ? 8.526   -2.603  11.470  1.00 0.00 ? 20  GLY A O    1  
ATOM 285   H H    . GLY A 1 20  ? 5.091   -5.093  10.661  1.00 0.00 ? 20  GLY A H    1  
ATOM 286   H HA2  . GLY A 1 20  ? 5.700   -2.902  10.982  1.00 0.00 ? 20  GLY A HA2  1  
ATOM 287   H HA3  . GLY A 1 20  ? 6.349   -3.397  12.539  1.00 0.00 ? 20  GLY A HA3  1  
ATOM 288   N N    . LYS A 1 21  ? 8.112   -4.179  9.920   1.00 0.00 ? 21  LYS A N    1  
ATOM 289   C CA   . LYS A 1 21  ? 9.439   -4.097  9.322   1.00 0.00 ? 21  LYS A CA   1  
ATOM 290   C C    . LYS A 1 21  ? 9.606   -2.795  8.545   1.00 0.00 ? 21  LYS A C    1  
ATOM 291   O O    . LYS A 1 21  ? 10.652  -2.149  8.615   1.00 0.00 ? 21  LYS A O    1  
ATOM 292   C CB   . LYS A 1 21  ? 9.678   -5.291  8.394   1.00 0.00 ? 21  LYS A CB   1  
ATOM 293   C CG   . LYS A 1 21  ? 9.271   -6.623  9.001   1.00 0.00 ? 21  LYS A CG   1  
ATOM 294   C CD   . LYS A 1 21  ? 10.124  -7.762  8.466   1.00 0.00 ? 21  LYS A CD   1  
ATOM 295   C CE   . LYS A 1 21  ? 9.653   -8.213  7.092   1.00 0.00 ? 21  LYS A CE   1  
ATOM 296   N NZ   . LYS A 1 21  ? 10.199  -7.351  6.008   1.00 0.00 ? 21  LYS A NZ   1  
ATOM 297   H H    . LYS A 1 21  ? 7.459   -4.811  9.550   1.00 0.00 ? 21  LYS A H    1  
ATOM 298   H HA   . LYS A 1 21  ? 10.165  -4.121  10.120  1.00 0.00 ? 21  LYS A HA   1  
ATOM 299   H HB2  . LYS A 1 21  ? 9.112   -5.145  7.486   1.00 0.00 ? 21  LYS A HB2  1  
ATOM 300   H HB3  . LYS A 1 21  ? 10.729  -5.336  8.150   1.00 0.00 ? 21  LYS A HB3  1  
ATOM 301   H HG2  . LYS A 1 21  ? 9.390   -6.571  10.073  1.00 0.00 ? 21  LYS A HG2  1  
ATOM 302   H HG3  . LYS A 1 21  ? 8.236   -6.816  8.760   1.00 0.00 ? 21  LYS A HG3  1  
ATOM 303   H HD2  . LYS A 1 21  ? 11.148  -7.429  8.392   1.00 0.00 ? 21  LYS A HD2  1  
ATOM 304   H HD3  . LYS A 1 21  ? 10.063  -8.597  9.150   1.00 0.00 ? 21  LYS A HD3  1  
ATOM 305   H HE2  . LYS A 1 21  ? 9.978   -9.229  6.931   1.00 0.00 ? 21  LYS A HE2  1  
ATOM 306   H HE3  . LYS A 1 21  ? 8.574   -8.172  7.065   1.00 0.00 ? 21  LYS A HE3  1  
ATOM 307   H HZ1  . LYS A 1 21  ? 11.040  -7.796  5.588   1.00 0.00 ? 21  LYS A HZ1  1  
ATOM 308   H HZ2  . LYS A 1 21  ? 10.467  -6.422  6.391   1.00 0.00 ? 21  LYS A HZ2  1  
ATOM 309   H HZ3  . LYS A 1 21  ? 9.484   -7.215  5.265   1.00 0.00 ? 21  LYS A HZ3  1  
ATOM 310   N N    . TYR A 1 22  ? 8.569   -2.415  7.807   1.00 0.00 ? 22  TYR A N    1  
ATOM 311   C CA   . TYR A 1 22  ? 8.602   -1.190  7.016   1.00 0.00 ? 22  TYR A CA   1  
ATOM 312   C C    . TYR A 1 22  ? 8.059   -0.010  7.817   1.00 0.00 ? 22  TYR A C    1  
ATOM 313   O O    . TYR A 1 22  ? 7.109   -0.136  8.590   1.00 0.00 ? 22  TYR A O    1  
ATOM 314   C CB   . TYR A 1 22  ? 7.791   -1.365  5.732   1.00 0.00 ? 22  TYR A CB   1  
ATOM 315   C CG   . TYR A 1 22  ? 7.967   -2.721  5.085   1.00 0.00 ? 22  TYR A CG   1  
ATOM 316   C CD1  . TYR A 1 22  ? 7.236   -3.820  5.518   1.00 0.00 ? 22  TYR A CD1  1  
ATOM 317   C CD2  . TYR A 1 22  ? 8.864   -2.902  4.039   1.00 0.00 ? 22  TYR A CD2  1  
ATOM 318   C CE1  . TYR A 1 22  ? 7.394   -5.060  4.931   1.00 0.00 ? 22  TYR A CE1  1  
ATOM 319   C CE2  . TYR A 1 22  ? 9.028   -4.138  3.444   1.00 0.00 ? 22  TYR A CE2  1  
ATOM 320   C CZ   . TYR A 1 22  ? 8.291   -5.214  3.894   1.00 0.00 ? 22  TYR A CZ   1  
ATOM 321   O OH   . TYR A 1 22  ? 8.451   -6.447  3.305   1.00 0.00 ? 22  TYR A OH   1  
ATOM 322   H H    . TYR A 1 22  ? 7.763   -2.971  7.792   1.00 0.00 ? 22  TYR A H    1  
ATOM 323   H HA   . TYR A 1 22  ? 9.631   -0.991  6.756   1.00 0.00 ? 22  TYR A HA   1  
ATOM 324   H HB2  . TYR A 1 22  ? 6.743   -1.239  5.955   1.00 0.00 ? 22  TYR A HB2  1  
ATOM 325   H HB3  . TYR A 1 22  ? 8.094   -0.614  5.017   1.00 0.00 ? 22  TYR A HB3  1  
ATOM 326   H HD1  . TYR A 1 22  ? 6.534   -3.695  6.330   1.00 0.00 ? 22  TYR A HD1  1  
ATOM 327   H HD2  . TYR A 1 22  ? 9.440   -2.057  3.689   1.00 0.00 ? 22  TYR A HD2  1  
ATOM 328   H HE1  . TYR A 1 22  ? 6.817   -5.902  5.282   1.00 0.00 ? 22  TYR A HE1  1  
ATOM 329   H HE2  . TYR A 1 22  ? 9.730   -4.259  2.633   1.00 0.00 ? 22  TYR A HE2  1  
ATOM 330   H HH   . TYR A 1 22  ? 7.642   -6.956  3.403   1.00 0.00 ? 22  TYR A HH   1  
ATOM 331   N N    . PRO A 1 23  ? 8.675   1.166   7.627   1.00 0.00 ? 23  PRO A N    1  
ATOM 332   C CA   . PRO A 1 23  ? 8.271   2.392   8.321   1.00 0.00 ? 23  PRO A CA   1  
ATOM 333   C C    . PRO A 1 23  ? 6.920   2.911   7.841   1.00 0.00 ? 23  PRO A C    1  
ATOM 334   O O    . PRO A 1 23  ? 6.504   2.640   6.715   1.00 0.00 ? 23  PRO A O    1  
ATOM 335   C CB   . PRO A 1 23  ? 9.381   3.384   7.965   1.00 0.00 ? 23  PRO A CB   1  
ATOM 336   C CG   . PRO A 1 23  ? 9.933   2.887   6.673   1.00 0.00 ? 23  PRO A CG   1  
ATOM 337   C CD   . PRO A 1 23  ? 9.814   1.389   6.720   1.00 0.00 ? 23  PRO A CD   1  
ATOM 338   H HA   . PRO A 1 23  ? 8.241   2.251   9.391   1.00 0.00 ? 23  PRO A HA   1  
ATOM 339   H HB2  . PRO A 1 23  ? 8.963   4.375   7.863   1.00 0.00 ? 23  PRO A HB2  1  
ATOM 340   H HB3  . PRO A 1 23  ? 10.132  3.382   8.741   1.00 0.00 ? 23  PRO A HB3  1  
ATOM 341   H HG2  . PRO A 1 23  ? 9.356   3.284   5.851   1.00 0.00 ? 23  PRO A HG2  1  
ATOM 342   H HG3  . PRO A 1 23  ? 10.969  3.178   6.581   1.00 0.00 ? 23  PRO A HG3  1  
ATOM 343   H HD2  . PRO A 1 23  ? 9.606   0.996   5.736   1.00 0.00 ? 23  PRO A HD2  1  
ATOM 344   H HD3  . PRO A 1 23  ? 10.716  0.951   7.121   1.00 0.00 ? 23  PRO A HD3  1  
ATOM 345   N N    . GLY A 1 24  ? 6.238   3.661   8.702   1.00 0.00 ? 24  GLY A N    1  
ATOM 346   C CA   . GLY A 1 24  ? 4.941   4.206   8.347   1.00 0.00 ? 24  GLY A CA   1  
ATOM 347   C C    . GLY A 1 24  ? 3.826   3.190   8.490   1.00 0.00 ? 24  GLY A C    1  
ATOM 348   O O    . GLY A 1 24  ? 2.786   3.478   9.085   1.00 0.00 ? 24  GLY A O    1  
ATOM 349   H H    . GLY A 1 24  ? 6.620   3.845   9.586   1.00 0.00 ? 24  GLY A H    1  
ATOM 350   H HA2  . GLY A 1 24  ? 4.730   5.050   8.987   1.00 0.00 ? 24  GLY A HA2  1  
ATOM 351   H HA3  . GLY A 1 24  ? 4.975   4.545   7.322   1.00 0.00 ? 24  GLY A HA3  1  
ATOM 352   N N    . LEU A 1 25  ? 4.040   1.998   7.944   1.00 0.00 ? 25  LEU A N    1  
ATOM 353   C CA   . LEU A 1 25  ? 3.043   0.935   8.012   1.00 0.00 ? 25  LEU A CA   1  
ATOM 354   C C    . LEU A 1 25  ? 2.792   0.516   9.457   1.00 0.00 ? 25  LEU A C    1  
ATOM 355   O O    . LEU A 1 25  ? 3.583   -0.217  10.048  1.00 0.00 ? 25  LEU A O    1  
ATOM 356   C CB   . LEU A 1 25  ? 3.500   -0.272  7.191   1.00 0.00 ? 25  LEU A CB   1  
ATOM 357   C CG   . LEU A 1 25  ? 2.417   -1.293  6.839   1.00 0.00 ? 25  LEU A CG   1  
ATOM 358   C CD1  . LEU A 1 25  ? 1.331   -0.649  5.992   1.00 0.00 ? 25  LEU A CD1  1  
ATOM 359   C CD2  . LEU A 1 25  ? 3.024   -2.486  6.115   1.00 0.00 ? 25  LEU A CD2  1  
ATOM 360   H H    . LEU A 1 25  ? 4.887   1.828   7.483   1.00 0.00 ? 25  LEU A H    1  
ATOM 361   H HA   . LEU A 1 25  ? 2.123   1.317   7.595   1.00 0.00 ? 25  LEU A HA   1  
ATOM 362   H HB2  . LEU A 1 25  ? 3.919   0.096   6.267   1.00 0.00 ? 25  LEU A HB2  1  
ATOM 363   H HB3  . LEU A 1 25  ? 4.267   -0.783  7.755   1.00 0.00 ? 25  LEU A HB3  1  
ATOM 364   H HG   . LEU A 1 25  ? 1.959   -1.651  7.751   1.00 0.00 ? 25  LEU A HG   1  
ATOM 365   H HD11 . LEU A 1 25  ? 1.347   -1.075  5.001   1.00 0.00 ? 25  LEU A HD11 1  
ATOM 366   H HD12 . LEU A 1 25  ? 1.507   0.415   5.929   1.00 0.00 ? 25  LEU A HD12 1  
ATOM 367   H HD13 . LEU A 1 25  ? 0.367   -0.827  6.446   1.00 0.00 ? 25  LEU A HD13 1  
ATOM 368   H HD21 . LEU A 1 25  ? 3.273   -3.253  6.833   1.00 0.00 ? 25  LEU A HD21 1  
ATOM 369   H HD22 . LEU A 1 25  ? 3.919   -2.174  5.596   1.00 0.00 ? 25  LEU A HD22 1  
ATOM 370   H HD23 . LEU A 1 25  ? 2.311   -2.875  5.403   1.00 0.00 ? 25  LEU A HD23 1  
ATOM 371   N N    . VAL A 1 26  ? 1.683   0.986   10.019  1.00 0.00 ? 26  VAL A N    1  
ATOM 372   C CA   . VAL A 1 26  ? 1.324   0.658   11.394  1.00 0.00 ? 26  VAL A CA   1  
ATOM 373   C C    . VAL A 1 26  ? -0.179  0.450   11.535  1.00 0.00 ? 26  VAL A C    1  
ATOM 374   O O    . VAL A 1 26  ? -0.971  1.071   10.827  1.00 0.00 ? 26  VAL A O    1  
ATOM 375   C CB   . VAL A 1 26  ? 1.772   1.762   12.369  1.00 0.00 ? 26  VAL A CB   1  
ATOM 376   C CG1  . VAL A 1 26  ? 3.274   1.983   12.273  1.00 0.00 ? 26  VAL A CG1  1  
ATOM 377   C CG2  . VAL A 1 26  ? 1.016   3.054   12.095  1.00 0.00 ? 26  VAL A CG2  1  
ATOM 378   H H    . VAL A 1 26  ? 1.091   1.567   9.497   1.00 0.00 ? 26  VAL A H    1  
ATOM 379   H HA   . VAL A 1 26  ? 1.832   -0.257  11.661  1.00 0.00 ? 26  VAL A HA   1  
ATOM 380   H HB   . VAL A 1 26  ? 1.542   1.441   13.375  1.00 0.00 ? 26  VAL A HB   1  
ATOM 381   H HG11 . VAL A 1 26  ? 3.669   1.413   11.444  1.00 0.00 ? 26  VAL A HG11 1  
ATOM 382   H HG12 . VAL A 1 26  ? 3.475   3.033   12.117  1.00 0.00 ? 26  VAL A HG12 1  
ATOM 383   H HG13 . VAL A 1 26  ? 3.745   1.659   13.189  1.00 0.00 ? 26  VAL A HG13 1  
ATOM 384   H HG21 . VAL A 1 26  ? 0.740   3.513   13.032  1.00 0.00 ? 26  VAL A HG21 1  
ATOM 385   H HG22 . VAL A 1 26  ? 1.647   3.729   11.536  1.00 0.00 ? 26  VAL A HG22 1  
ATOM 386   H HG23 . VAL A 1 26  ? 0.127   2.836   11.524  1.00 0.00 ? 26  VAL A HG23 1  
ATOM 387   N N    . TRP A 1 27  ? -0.565  -0.428  12.454  1.00 0.00 ? 27  TRP A N    1  
ATOM 388   C CA   . TRP A 1 27  ? -1.975  -0.718  12.689  1.00 0.00 ? 27  TRP A CA   1  
ATOM 389   C C    . TRP A 1 27  ? -2.619  0.367   13.545  1.00 0.00 ? 27  TRP A C    1  
ATOM 390   O O    . TRP A 1 27  ? -2.313  0.497   14.730  1.00 0.00 ? 27  TRP A O    1  
ATOM 391   C CB   . TRP A 1 27  ? -2.131  -2.080  13.367  1.00 0.00 ? 27  TRP A CB   1  
ATOM 392   C CG   . TRP A 1 27  ? -1.761  -3.231  12.481  1.00 0.00 ? 27  TRP A CG   1  
ATOM 393   C CD1  . TRP A 1 27  ? -0.611  -3.965  12.528  1.00 0.00 ? 27  TRP A CD1  1  
ATOM 394   C CD2  . TRP A 1 27  ? -2.546  -3.778  11.415  1.00 0.00 ? 27  TRP A CD2  1  
ATOM 395   N NE1  . TRP A 1 27  ? -0.632  -4.935  11.555  1.00 0.00 ? 27  TRP A NE1  1  
ATOM 396   C CE2  . TRP A 1 27  ? -1.809  -4.842  10.860  1.00 0.00 ? 27  TRP A CE2  1  
ATOM 397   C CE3  . TRP A 1 27  ? -3.799  -3.474  10.878  1.00 0.00 ? 27  TRP A CE3  1  
ATOM 398   C CZ2  . TRP A 1 27  ? -2.285  -5.600  9.793   1.00 0.00 ? 27  TRP A CZ2  1  
ATOM 399   C CZ3  . TRP A 1 27  ? -4.271  -4.227  9.820   1.00 0.00 ? 27  TRP A CZ3  1  
ATOM 400   C CH2  . TRP A 1 27  ? -3.516  -5.280  9.287   1.00 0.00 ? 27  TRP A CH2  1  
ATOM 401   H H    . TRP A 1 27  ? 0.114   -0.892  12.988  1.00 0.00 ? 27  TRP A H    1  
ATOM 402   H HA   . TRP A 1 27  ? -2.471  -0.745  11.730  1.00 0.00 ? 27  TRP A HA   1  
ATOM 403   H HB2  . TRP A 1 27  ? -1.496  -2.115  14.240  1.00 0.00 ? 27  TRP A HB2  1  
ATOM 404   H HB3  . TRP A 1 27  ? -3.160  -2.208  13.670  1.00 0.00 ? 27  TRP A HB3  1  
ATOM 405   H HD1  . TRP A 1 27  ? 0.191   -3.795  13.230  1.00 0.00 ? 27  TRP A HD1  1  
ATOM 406   H HE1  . TRP A 1 27  ? 0.079   -5.589  11.388  1.00 0.00 ? 27  TRP A HE1  1  
ATOM 407   H HE3  . TRP A 1 27  ? -4.396  -2.666  11.275  1.00 0.00 ? 27  TRP A HE3  1  
ATOM 408   H HZ2  . TRP A 1 27  ? -1.716  -6.415  9.372   1.00 0.00 ? 27  TRP A HZ2  1  
ATOM 409   H HZ3  . TRP A 1 27  ? -5.237  -4.006  9.391   1.00 0.00 ? 27  TRP A HZ3  1  
ATOM 410   H HH2  . TRP A 1 27  ? -3.923  -5.841  8.460   1.00 0.00 ? 27  TRP A HH2  1  
ATOM 411   N N    . GLU A 1 28  ? -3.512  1.142   12.938  1.00 0.00 ? 28  GLU A N    1  
ATOM 412   C CA   . GLU A 1 28  ? -4.197  2.216   13.646  1.00 0.00 ? 28  GLU A CA   1  
ATOM 413   C C    . GLU A 1 28  ? -4.835  1.699   14.932  1.00 0.00 ? 28  GLU A C    1  
ATOM 414   O O    . GLU A 1 28  ? -4.971  2.434   15.909  1.00 0.00 ? 28  GLU A O    1  
ATOM 415   C CB   . GLU A 1 28  ? -5.267  2.847   12.752  1.00 0.00 ? 28  GLU A CB   1  
ATOM 416   C CG   . GLU A 1 28  ? -4.712  3.443   11.469  1.00 0.00 ? 28  GLU A CG   1  
ATOM 417   C CD   . GLU A 1 28  ? -5.540  4.608   10.962  1.00 0.00 ? 28  GLU A CD   1  
ATOM 418   O OE1  . GLU A 1 28  ? -6.746  4.413   10.704  1.00 0.00 ? 28  GLU A OE1  1  
ATOM 419   O OE2  . GLU A 1 28  ? -4.981  5.716   10.823  1.00 0.00 ? 28  GLU A OE2  1  
ATOM 420   H H    . GLU A 1 28  ? -3.713  0.989   11.991  1.00 0.00 ? 28  GLU A H    1  
ATOM 421   H HA   . GLU A 1 28  ? -3.465  2.968   13.899  1.00 0.00 ? 28  GLU A HA   1  
ATOM 422   H HB2  . GLU A 1 28  ? -5.991  2.090   12.489  1.00 0.00 ? 28  GLU A HB2  1  
ATOM 423   H HB3  . GLU A 1 28  ? -5.763  3.631   13.303  1.00 0.00 ? 28  GLU A HB3  1  
ATOM 424   H HG2  . GLU A 1 28  ? -3.706  3.789   11.653  1.00 0.00 ? 28  GLU A HG2  1  
ATOM 425   H HG3  . GLU A 1 28  ? -4.694  2.676   10.709  1.00 0.00 ? 28  GLU A HG3  1  
ATOM 426   N N    . ASN A 1 29  ? -5.225  0.428   14.923  1.00 0.00 ? 29  ASN A N    1  
ATOM 427   C CA   . ASN A 1 29  ? -5.849  -0.188  16.088  1.00 0.00 ? 29  ASN A CA   1  
ATOM 428   C C    . ASN A 1 29  ? -5.073  -1.424  16.531  1.00 0.00 ? 29  ASN A C    1  
ATOM 429   O O    . ASN A 1 29  ? -4.087  -1.807  15.903  1.00 0.00 ? 29  ASN A O    1  
ATOM 430   C CB   . ASN A 1 29  ? -7.298  -0.567  15.775  1.00 0.00 ? 29  ASN A CB   1  
ATOM 431   C CG   . ASN A 1 29  ? -7.407  -1.503  14.587  1.00 0.00 ? 29  ASN A CG   1  
ATOM 432   O OD1  . ASN A 1 29  ? -6.467  -2.229  14.266  1.00 0.00 ? 29  ASN A OD1  1  
ATOM 433   N ND2  . ASN A 1 29  ? -8.560  -1.488  13.926  1.00 0.00 ? 29  ASN A ND2  1  
ATOM 434   H H    . ASN A 1 29  ? -5.089  -0.108  14.114  1.00 0.00 ? 29  ASN A H    1  
ATOM 435   H HA   . ASN A 1 29  ? -5.841  0.535   16.890  1.00 0.00 ? 29  ASN A HA   1  
ATOM 436   H HB2  . ASN A 1 29  ? -7.730  -1.058  16.635  1.00 0.00 ? 29  ASN A HB2  1  
ATOM 437   H HB3  . ASN A 1 29  ? -7.860  0.329   15.557  1.00 0.00 ? 29  ASN A HB3  1  
ATOM 438   H HD21 . ASN A 1 29  ? -9.265  -0.883  14.238  1.00 0.00 ? 29  ASN A HD21 1  
ATOM 439   H HD22 . ASN A 1 29  ? -8.657  -2.084  13.154  1.00 0.00 ? 29  ASN A HD22 1  
ATOM 440   N N    . GLU A 1 30  ? -5.527  -2.044  17.616  1.00 0.00 ? 30  GLU A N    1  
ATOM 441   C CA   . GLU A 1 30  ? -4.875  -3.237  18.143  1.00 0.00 ? 30  GLU A CA   1  
ATOM 442   C C    . GLU A 1 30  ? -5.388  -4.492  17.443  1.00 0.00 ? 30  GLU A C    1  
ATOM 443   O O    . GLU A 1 30  ? -4.662  -5.475  17.298  1.00 0.00 ? 30  GLU A O    1  
ATOM 444   C CB   . GLU A 1 30  ? -5.108  -3.349  19.651  1.00 0.00 ? 30  GLU A CB   1  
ATOM 445   C CG   . GLU A 1 30  ? -4.197  -2.456  20.476  1.00 0.00 ? 30  GLU A CG   1  
ATOM 446   C CD   . GLU A 1 30  ? -4.162  -2.851  21.939  1.00 0.00 ? 30  GLU A CD   1  
ATOM 447   O OE1  . GLU A 1 30  ? -5.185  -3.361  22.442  1.00 0.00 ? 30  GLU A OE1  1  
ATOM 448   O OE2  . GLU A 1 30  ? -3.110  -2.649  22.583  1.00 0.00 ? 30  GLU A OE2  1  
ATOM 449   H H    . GLU A 1 30  ? -6.318  -1.691  18.073  1.00 0.00 ? 30  GLU A H    1  
ATOM 450   H HA   . GLU A 1 30  ? -3.815  -3.145  17.958  1.00 0.00 ? 30  GLU A HA   1  
ATOM 451   H HB2  . GLU A 1 30  ? -6.132  -3.082  19.866  1.00 0.00 ? 30  GLU A HB2  1  
ATOM 452   H HB3  . GLU A 1 30  ? -4.942  -4.373  19.953  1.00 0.00 ? 30  GLU A HB3  1  
ATOM 453   H HG2  . GLU A 1 30  ? -3.195  -2.519  20.078  1.00 0.00 ? 30  GLU A HG2  1  
ATOM 454   H HG3  . GLU A 1 30  ? -4.549  -1.437  20.401  1.00 0.00 ? 30  GLU A HG3  1  
ATOM 455   N N    . GLU A 1 31  ? -6.645  -4.450  17.012  1.00 0.00 ? 31  GLU A N    1  
ATOM 456   C CA   . GLU A 1 31  ? -7.256  -5.584  16.329  1.00 0.00 ? 31  GLU A CA   1  
ATOM 457   C C    . GLU A 1 31  ? -6.502  -5.916  15.045  1.00 0.00 ? 31  GLU A C    1  
ATOM 458   O O    . GLU A 1 31  ? -6.697  -6.978  14.453  1.00 0.00 ? 31  GLU A O    1  
ATOM 459   C CB   . GLU A 1 31  ? -8.723  -5.286  16.010  1.00 0.00 ? 31  GLU A CB   1  
ATOM 460   C CG   . GLU A 1 31  ? -8.930  -3.976  15.269  1.00 0.00 ? 31  GLU A CG   1  
ATOM 461   C CD   . GLU A 1 31  ? -10.396 -3.640  15.078  1.00 0.00 ? 31  GLU A CD   1  
ATOM 462   O OE1  . GLU A 1 31  ? -11.202 -4.576  14.894  1.00 0.00 ? 31  GLU A OE1  1  
ATOM 463   O OE2  . GLU A 1 31  ? -10.738 -2.439  15.113  1.00 0.00 ? 31  GLU A OE2  1  
ATOM 464   H H    . GLU A 1 31  ? -7.174  -3.638  17.158  1.00 0.00 ? 31  GLU A H    1  
ATOM 465   H HA   . GLU A 1 31  ? -7.208  -6.435  16.991  1.00 0.00 ? 31  GLU A HA   1  
ATOM 466   H HB2  . GLU A 1 31  ? -9.117  -6.087  15.402  1.00 0.00 ? 31  GLU A HB2  1  
ATOM 467   H HB3  . GLU A 1 31  ? -9.278  -5.243  16.936  1.00 0.00 ? 31  GLU A HB3  1  
ATOM 468   H HG2  . GLU A 1 31  ? -8.465  -3.181  15.832  1.00 0.00 ? 31  GLU A HG2  1  
ATOM 469   H HG3  . GLU A 1 31  ? -8.463  -4.049  14.298  1.00 0.00 ? 31  GLU A HG3  1  
ATOM 470   N N    . LYS A 1 32  ? -5.641  -4.999  14.618  1.00 0.00 ? 32  LYS A N    1  
ATOM 471   C CA   . LYS A 1 32  ? -4.856  -5.193  13.404  1.00 0.00 ? 32  LYS A CA   1  
ATOM 472   C C    . LYS A 1 32  ? -5.759  -5.254  12.176  1.00 0.00 ? 32  LYS A C    1  
ATOM 473   O O    . LYS A 1 32  ? -5.470  -5.970  11.217  1.00 0.00 ? 32  LYS A O    1  
ATOM 474   C CB   . LYS A 1 32  ? -4.028  -6.476  13.507  1.00 0.00 ? 32  LYS A CB   1  
ATOM 475   C CG   . LYS A 1 32  ? -3.075  -6.492  14.689  1.00 0.00 ? 32  LYS A CG   1  
ATOM 476   C CD   . LYS A 1 32  ? -1.718  -5.916  14.320  1.00 0.00 ? 32  LYS A CD   1  
ATOM 477   C CE   . LYS A 1 32  ? -0.611  -6.500  15.184  1.00 0.00 ? 32  LYS A CE   1  
ATOM 478   N NZ   . LYS A 1 32  ? -0.563  -5.864  16.530  1.00 0.00 ? 32  LYS A NZ   1  
ATOM 479   H H    . LYS A 1 32  ? -5.529  -4.172  15.132  1.00 0.00 ? 32  LYS A H    1  
ATOM 480   H HA   . LYS A 1 32  ? -4.188  -4.350  13.303  1.00 0.00 ? 32  LYS A HA   1  
ATOM 481   H HB2  . LYS A 1 32  ? -4.699  -7.316  13.600  1.00 0.00 ? 32  LYS A HB2  1  
ATOM 482   H HB3  . LYS A 1 32  ? -3.447  -6.588  12.602  1.00 0.00 ? 32  LYS A HB3  1  
ATOM 483   H HG2  . LYS A 1 32  ? -3.498  -5.903  15.489  1.00 0.00 ? 32  LYS A HG2  1  
ATOM 484   H HG3  . LYS A 1 32  ? -2.945  -7.512  15.021  1.00 0.00 ? 32  LYS A HG3  1  
ATOM 485   H HD2  . LYS A 1 32  ? -1.510  -6.143  13.285  1.00 0.00 ? 32  LYS A HD2  1  
ATOM 486   H HD3  . LYS A 1 32  ? -1.743  -4.844  14.458  1.00 0.00 ? 32  LYS A HD3  1  
ATOM 487   H HE2  . LYS A 1 32  ? -0.785  -7.559  15.301  1.00 0.00 ? 32  LYS A HE2  1  
ATOM 488   H HE3  . LYS A 1 32  ? 0.335   -6.343  14.687  1.00 0.00 ? 32  LYS A HE3  1  
ATOM 489   H HZ1  . LYS A 1 32  ? -1.475  -5.988  17.015  1.00 0.00 ? 32  LYS A HZ1  1  
ATOM 490   H HZ2  . LYS A 1 32  ? -0.367  -4.847  16.438  1.00 0.00 ? 32  LYS A HZ2  1  
ATOM 491   H HZ3  . LYS A 1 32  ? 0.185   -6.301  17.105  1.00 0.00 ? 32  LYS A HZ3  1  
ATOM 492   N N    . SER A 1 33  ? -6.852  -4.499  12.213  1.00 0.00 ? 33  SER A N    1  
ATOM 493   C CA   . SER A 1 33  ? -7.798  -4.470  11.104  1.00 0.00 ? 33  SER A CA   1  
ATOM 494   C C    . SER A 1 33  ? -7.554  -3.256  10.213  1.00 0.00 ? 33  SER A C    1  
ATOM 495   O O    . SER A 1 33  ? -7.625  -3.347  8.987   1.00 0.00 ? 33  SER A O    1  
ATOM 496   C CB   . SER A 1 33  ? -9.234  -4.449  11.631  1.00 0.00 ? 33  SER A CB   1  
ATOM 497   O OG   . SER A 1 33  ? -9.482  -5.557  12.479  1.00 0.00 ? 33  SER A OG   1  
ATOM 498   H H    . SER A 1 33  ? -7.027  -3.950  13.006  1.00 0.00 ? 33  SER A H    1  
ATOM 499   H HA   . SER A 1 33  ? -7.651  -5.366  10.519  1.00 0.00 ? 33  SER A HA   1  
ATOM 500   H HB2  . SER A 1 33  ? -9.397  -3.540  12.189  1.00 0.00 ? 33  SER A HB2  1  
ATOM 501   H HB3  . SER A 1 33  ? -9.921  -4.488  10.798  1.00 0.00 ? 33  SER A HB3  1  
ATOM 502   H HG   . SER A 1 33  ? -9.246  -6.369  12.024  1.00 0.00 ? 33  SER A HG   1  
ATOM 503   N N    . ILE A 1 34  ? -7.266  -2.119  10.838  1.00 0.00 ? 34  ILE A N    1  
ATOM 504   C CA   . ILE A 1 34  ? -7.010  -0.887  10.103  1.00 0.00 ? 34  ILE A CA   1  
ATOM 505   C C    . ILE A 1 34  ? -5.555  -0.454  10.246  1.00 0.00 ? 34  ILE A C    1  
ATOM 506   O O    . ILE A 1 34  ? -4.974  -0.540  11.328  1.00 0.00 ? 34  ILE A O    1  
ATOM 507   C CB   . ILE A 1 34  ? -7.924  0.256   10.585  1.00 0.00 ? 34  ILE A CB   1  
ATOM 508   C CG1  . ILE A 1 34  ? -9.380  -0.038  10.219  1.00 0.00 ? 34  ILE A CG1  1  
ATOM 509   C CG2  . ILE A 1 34  ? -7.477  1.580   9.984   1.00 0.00 ? 34  ILE A CG2  1  
ATOM 510   C CD1  . ILE A 1 34  ? -10.142 -0.762  11.307  1.00 0.00 ? 34  ILE A CD1  1  
ATOM 511   H H    . ILE A 1 34  ? -7.224  -2.110  11.817  1.00 0.00 ? 34  ILE A H    1  
ATOM 512   H HA   . ILE A 1 34  ? -7.219  -1.072  9.059   1.00 0.00 ? 34  ILE A HA   1  
ATOM 513   H HB   . ILE A 1 34  ? -7.837  0.328   11.658  1.00 0.00 ? 34  ILE A HB   1  
ATOM 514   H HG12 . ILE A 1 34  ? -9.889  0.892   10.021  1.00 0.00 ? 34  ILE A HG12 1  
ATOM 515   H HG13 . ILE A 1 34  ? -9.403  -0.652  9.331   1.00 0.00 ? 34  ILE A HG13 1  
ATOM 516   H HG21 . ILE A 1 34  ? -8.342  2.199   9.794   1.00 0.00 ? 34  ILE A HG21 1  
ATOM 517   H HG22 . ILE A 1 34  ? -6.819  2.085   10.675  1.00 0.00 ? 34  ILE A HG22 1  
ATOM 518   H HG23 . ILE A 1 34  ? -6.955  1.397   9.057   1.00 0.00 ? 34  ILE A HG23 1  
ATOM 519   H HD11 . ILE A 1 34  ? -11.130 -1.011  10.950  1.00 0.00 ? 34  ILE A HD11 1  
ATOM 520   H HD12 . ILE A 1 34  ? -9.616  -1.666  11.574  1.00 0.00 ? 34  ILE A HD12 1  
ATOM 521   H HD13 . ILE A 1 34  ? -10.225 -0.124  12.175  1.00 0.00 ? 34  ILE A HD13 1  
ATOM 522   N N    . PHE A 1 35  ? -4.972  0.013   9.147   1.00 0.00 ? 35  PHE A N    1  
ATOM 523   C CA   . PHE A 1 35  ? -3.585  0.462   9.149   1.00 0.00 ? 35  PHE A CA   1  
ATOM 524   C C    . PHE A 1 35  ? -3.394  1.647   8.207   1.00 0.00 ? 35  PHE A C    1  
ATOM 525   O O    . PHE A 1 35  ? -4.317  2.040   7.493   1.00 0.00 ? 35  PHE A O    1  
ATOM 526   C CB   . PHE A 1 35  ? -2.656  -0.684  8.739   1.00 0.00 ? 35  PHE A CB   1  
ATOM 527   C CG   . PHE A 1 35  ? -3.018  -1.307  7.421   1.00 0.00 ? 35  PHE A CG   1  
ATOM 528   C CD1  . PHE A 1 35  ? -4.040  -2.238  7.338   1.00 0.00 ? 35  PHE A CD1  1  
ATOM 529   C CD2  . PHE A 1 35  ? -2.335  -0.962  6.266   1.00 0.00 ? 35  PHE A CD2  1  
ATOM 530   C CE1  . PHE A 1 35  ? -4.376  -2.813  6.127   1.00 0.00 ? 35  PHE A CE1  1  
ATOM 531   C CE2  . PHE A 1 35  ? -2.667  -1.533  5.052   1.00 0.00 ? 35  PHE A CE2  1  
ATOM 532   C CZ   . PHE A 1 35  ? -3.688  -2.461  4.982   1.00 0.00 ? 35  PHE A CZ   1  
ATOM 533   H H    . PHE A 1 35  ? -5.488  0.057   8.314   1.00 0.00 ? 35  PHE A H    1  
ATOM 534   H HA   . PHE A 1 35  ? -3.339  0.771   10.152  1.00 0.00 ? 35  PHE A HA   1  
ATOM 535   H HB2  . PHE A 1 35  ? -1.647  -0.309  8.662   1.00 0.00 ? 35  PHE A HB2  1  
ATOM 536   H HB3  . PHE A 1 35  ? -2.693  -1.455  9.494   1.00 0.00 ? 35  PHE A HB3  1  
ATOM 537   H HD1  . PHE A 1 35  ? -4.580  -2.515  8.233   1.00 0.00 ? 35  PHE A HD1  1  
ATOM 538   H HD2  . PHE A 1 35  ? -1.536  -0.237  6.319   1.00 0.00 ? 35  PHE A HD2  1  
ATOM 539   H HE1  . PHE A 1 35  ? -5.175  -3.538  6.076   1.00 0.00 ? 35  PHE A HE1  1  
ATOM 540   H HE2  . PHE A 1 35  ? -2.127  -1.256  4.159   1.00 0.00 ? 35  PHE A HE2  1  
ATOM 541   H HZ   . PHE A 1 35  ? -3.949  -2.908  4.035   1.00 0.00 ? 35  PHE A HZ   1  
ATOM 542   N N    . ARG A 1 36  ? -2.192  2.212   8.212   1.00 0.00 ? 36  ARG A N    1  
ATOM 543   C CA   . ARG A 1 36  ? -1.880  3.353   7.360   1.00 0.00 ? 36  ARG A CA   1  
ATOM 544   C C    . ARG A 1 36  ? -0.628  3.086   6.530   1.00 0.00 ? 36  ARG A C    1  
ATOM 545   O O    . ARG A 1 36  ? 0.362   2.555   7.035   1.00 0.00 ? 36  ARG A O    1  
ATOM 546   C CB   . ARG A 1 36  ? -1.684  4.611   8.208   1.00 0.00 ? 36  ARG A CB   1  
ATOM 547   C CG   . ARG A 1 36  ? -1.200  4.325   9.621   1.00 0.00 ? 36  ARG A CG   1  
ATOM 548   C CD   . ARG A 1 36  ? -0.411  5.494   10.187  1.00 0.00 ? 36  ARG A CD   1  
ATOM 549   N NE   . ARG A 1 36  ? -0.537  5.588   11.639  1.00 0.00 ? 36  ARG A NE   1  
ATOM 550   C CZ   . ARG A 1 36  ? 0.363   6.176   12.419  1.00 0.00 ? 36  ARG A CZ   1  
ATOM 551   N NH1  . ARG A 1 36  ? 1.450   6.720   11.889  1.00 0.00 ? 36  ARG A NH1  1  
ATOM 552   N NH2  . ARG A 1 36  ? 0.177   6.221   13.732  1.00 0.00 ? 36  ARG A NH2  1  
ATOM 553   H H    . ARG A 1 36  ? -1.497  1.853   8.803   1.00 0.00 ? 36  ARG A H    1  
ATOM 554   H HA   . ARG A 1 36  ? -2.714  3.507   6.692   1.00 0.00 ? 36  ARG A HA   1  
ATOM 555   H HB2  . ARG A 1 36  ? -0.957  5.248   7.725   1.00 0.00 ? 36  ARG A HB2  1  
ATOM 556   H HB3  . ARG A 1 36  ? -2.625  5.137   8.273   1.00 0.00 ? 36  ARG A HB3  1  
ATOM 557   H HG2  . ARG A 1 36  ? -2.056  4.142   10.254  1.00 0.00 ? 36  ARG A HG2  1  
ATOM 558   H HG3  . ARG A 1 36  ? -0.569  3.449   9.604   1.00 0.00 ? 36  ARG A HG3  1  
ATOM 559   H HD2  . ARG A 1 36  ? 0.631   5.364   9.934   1.00 0.00 ? 36  ARG A HD2  1  
ATOM 560   H HD3  . ARG A 1 36  ? -0.778  6.407   9.743   1.00 0.00 ? 36  ARG A HD3  1  
ATOM 561   H HE   . ARG A 1 36  ? -1.333  5.193   12.052  1.00 0.00 ? 36  ARG A HE   1  
ATOM 562   H HH11 . ARG A 1 36  ? 1.592   6.688   10.900  1.00 0.00 ? 36  ARG A HH11 1  
ATOM 563   H HH12 . ARG A 1 36  ? 2.126   7.163   12.478  1.00 0.00 ? 36  ARG A HH12 1  
ATOM 564   H HH21 . ARG A 1 36  ? -0.641  5.812   14.135  1.00 0.00 ? 36  ARG A HH21 1  
ATOM 565   H HH22 . ARG A 1 36  ? 0.855   6.664   14.318  1.00 0.00 ? 36  ARG A HH22 1  
ATOM 566   N N    . ILE A 1 37  ? -0.679  3.458   5.255   1.00 0.00 ? 37  ILE A N    1  
ATOM 567   C CA   . ILE A 1 37  ? 0.451   3.259   4.356   1.00 0.00 ? 37  ILE A CA   1  
ATOM 568   C C    . ILE A 1 37  ? 1.032   4.593   3.901   1.00 0.00 ? 37  ILE A C    1  
ATOM 569   O O    . ILE A 1 37  ? 0.317   5.492   3.458   1.00 0.00 ? 37  ILE A O    1  
ATOM 570   C CB   . ILE A 1 37  ? 0.047   2.438   3.118   1.00 0.00 ? 37  ILE A CB   1  
ATOM 571   C CG1  . ILE A 1 37  ? 1.248   2.254   2.187   1.00 0.00 ? 37  ILE A CG1  1  
ATOM 572   C CG2  . ILE A 1 37  ? -1.100  3.117   2.383   1.00 0.00 ? 37  ILE A CG2  1  
ATOM 573   C CD1  . ILE A 1 37  ? 0.935   1.441   0.950   1.00 0.00 ? 37  ILE A CD1  1  
ATOM 574   H H    . ILE A 1 37  ? -1.495  3.877   4.912   1.00 0.00 ? 37  ILE A H    1  
ATOM 575   H HA   . ILE A 1 37  ? 1.212   2.712   4.894   1.00 0.00 ? 37  ILE A HA   1  
ATOM 576   H HB   . ILE A 1 37  ? -0.293  1.470   3.450   1.00 0.00 ? 37  ILE A HB   1  
ATOM 577   H HG12 . ILE A 1 37  ? 1.599   3.222   1.867   1.00 0.00 ? 37  ILE A HG12 1  
ATOM 578   H HG13 . ILE A 1 37  ? 2.037   1.749   2.726   1.00 0.00 ? 37  ILE A HG13 1  
ATOM 579   H HG21 . ILE A 1 37  ? -0.860  3.192   1.333   1.00 0.00 ? 37  ILE A HG21 1  
ATOM 580   H HG22 . ILE A 1 37  ? -2.000  2.534   2.505   1.00 0.00 ? 37  ILE A HG22 1  
ATOM 581   H HG23 . ILE A 1 37  ? -1.253  4.106   2.789   1.00 0.00 ? 37  ILE A HG23 1  
ATOM 582   H HD11 . ILE A 1 37  ? 1.308   0.436   1.076   1.00 0.00 ? 37  ILE A HD11 1  
ATOM 583   H HD12 . ILE A 1 37  ? -0.134  1.413   0.798   1.00 0.00 ? 37  ILE A HD12 1  
ATOM 584   H HD13 . ILE A 1 37  ? 1.408   1.896   0.092   1.00 0.00 ? 37  ILE A HD13 1  
ATOM 585   N N    . PRO A 1 38  ? 2.363   4.727   4.010   1.00 0.00 ? 38  PRO A N    1  
ATOM 586   C CA   . PRO A 1 38  ? 3.071   5.948   3.612   1.00 0.00 ? 38  PRO A CA   1  
ATOM 587   C C    . PRO A 1 38  ? 3.076   6.148   2.100   1.00 0.00 ? 38  PRO A C    1  
ATOM 588   O O    . PRO A 1 38  ? 3.656   5.353   1.361   1.00 0.00 ? 38  PRO A O    1  
ATOM 589   C CB   . PRO A 1 38  ? 4.494   5.715   4.125   1.00 0.00 ? 38  PRO A CB   1  
ATOM 590   C CG   . PRO A 1 38  ? 4.639   4.234   4.182   1.00 0.00 ? 38  PRO A CG   1  
ATOM 591   C CD   . PRO A 1 38  ? 3.278   3.697   4.529   1.00 0.00 ? 38  PRO A CD   1  
ATOM 592   H HA   . PRO A 1 38  ? 2.652   6.822   4.088   1.00 0.00 ? 38  PRO A HA   1  
ATOM 593   H HB2  . PRO A 1 38  ? 5.203   6.157   3.439   1.00 0.00 ? 38  PRO A HB2  1  
ATOM 594   H HB3  . PRO A 1 38  ? 4.605   6.160   5.102   1.00 0.00 ? 38  PRO A HB3  1  
ATOM 595   H HG2  . PRO A 1 38  ? 4.956   3.859   3.221   1.00 0.00 ? 38  PRO A HG2  1  
ATOM 596   H HG3  . PRO A 1 38  ? 5.354   3.964   4.946   1.00 0.00 ? 38  PRO A HG3  1  
ATOM 597   H HD2  . PRO A 1 38  ? 3.110   2.750   4.040   1.00 0.00 ? 38  PRO A HD2  1  
ATOM 598   H HD3  . PRO A 1 38  ? 3.174   3.595   5.599   1.00 0.00 ? 38  PRO A HD3  1  
ATOM 599   N N    . TRP A 1 39  ? 2.427   7.215   1.647   1.00 0.00 ? 39  TRP A N    1  
ATOM 600   C CA   . TRP A 1 39  ? 2.357   7.519   0.223   1.00 0.00 ? 39  TRP A CA   1  
ATOM 601   C C    . TRP A 1 39  ? 3.175   8.763   -0.109  1.00 0.00 ? 39  TRP A C    1  
ATOM 602   O O    . TRP A 1 39  ? 2.738   9.888   0.133   1.00 0.00 ? 39  TRP A O    1  
ATOM 603   C CB   . TRP A 1 39  ? 0.903   7.720   -0.207  1.00 0.00 ? 39  TRP A CB   1  
ATOM 604   C CG   . TRP A 1 39  ? 0.622   7.236   -1.597  1.00 0.00 ? 39  TRP A CG   1  
ATOM 605   C CD1  . TRP A 1 39  ? 0.799   7.932   -2.759  1.00 0.00 ? 39  TRP A CD1  1  
ATOM 606   C CD2  . TRP A 1 39  ? 0.111   5.952   -1.970  1.00 0.00 ? 39  TRP A CD2  1  
ATOM 607   N NE1  . TRP A 1 39  ? 0.430   7.158   -3.832  1.00 0.00 ? 39  TRP A NE1  1  
ATOM 608   C CE2  . TRP A 1 39  ? 0.005   5.938   -3.375  1.00 0.00 ? 39  TRP A CE2  1  
ATOM 609   C CE3  . TRP A 1 39  ? -0.265  4.812   -1.255  1.00 0.00 ? 39  TRP A CE3  1  
ATOM 610   C CZ2  . TRP A 1 39  ? -0.463  4.829   -4.075  1.00 0.00 ? 39  TRP A CZ2  1  
ATOM 611   C CZ3  . TRP A 1 39  ? -0.729  3.712   -1.951  1.00 0.00 ? 39  TRP A CZ3  1  
ATOM 612   C CH2  . TRP A 1 39  ? -0.824  3.726   -3.349  1.00 0.00 ? 39  TRP A CH2  1  
ATOM 613   H H    . TRP A 1 39  ? 1.984   7.812   2.286   1.00 0.00 ? 39  TRP A H    1  
ATOM 614   H HA   . TRP A 1 39  ? 2.769   6.678   -0.315  1.00 0.00 ? 39  TRP A HA   1  
ATOM 615   H HB2  . TRP A 1 39  ? 0.257   7.183   0.471   1.00 0.00 ? 39  TRP A HB2  1  
ATOM 616   H HB3  . TRP A 1 39  ? 0.666   8.774   -0.165  1.00 0.00 ? 39  TRP A HB3  1  
ATOM 617   H HD1  . TRP A 1 39  ? 1.174   8.943   -2.810  1.00 0.00 ? 39  TRP A HD1  1  
ATOM 618   H HE1  . TRP A 1 39  ? 0.466   7.434   -4.772  1.00 0.00 ? 39  TRP A HE1  1  
ATOM 619   H HE3  . TRP A 1 39  ? -0.198  4.781   -0.178  1.00 0.00 ? 39  TRP A HE3  1  
ATOM 620   H HZ2  . TRP A 1 39  ? -0.541  4.824   -5.152  1.00 0.00 ? 39  TRP A HZ2  1  
ATOM 621   H HZ3  . TRP A 1 39  ? -1.024  2.822   -1.416  1.00 0.00 ? 39  TRP A HZ3  1  
ATOM 622   H HH2  . TRP A 1 39  ? -1.192  2.845   -3.851  1.00 0.00 ? 39  TRP A HH2  1  
ATOM 623   N N    . LYS A 1 40  ? 4.364   8.553   -0.663  1.00 0.00 ? 40  LYS A N    1  
ATOM 624   C CA   . LYS A 1 40  ? 5.243   9.657   -1.029  1.00 0.00 ? 40  LYS A CA   1  
ATOM 625   C C    . LYS A 1 40  ? 5.645   9.569   -2.498  1.00 0.00 ? 40  LYS A C    1  
ATOM 626   O O    . LYS A 1 40  ? 5.476   8.529   -3.137  1.00 0.00 ? 40  LYS A O    1  
ATOM 627   C CB   . LYS A 1 40  ? 6.493   9.656   -0.146  1.00 0.00 ? 40  LYS A CB   1  
ATOM 628   C CG   . LYS A 1 40  ? 7.171   11.011  -0.049  1.00 0.00 ? 40  LYS A CG   1  
ATOM 629   C CD   . LYS A 1 40  ? 7.873   11.189  1.287   1.00 0.00 ? 40  LYS A CD   1  
ATOM 630   C CE   . LYS A 1 40  ? 8.154   12.655  1.579   1.00 0.00 ? 40  LYS A CE   1  
ATOM 631   N NZ   . LYS A 1 40  ? 9.390   13.129  0.898   1.00 0.00 ? 40  LYS A NZ   1  
ATOM 632   H H    . LYS A 1 40  ? 4.658   7.633   -0.831  1.00 0.00 ? 40  LYS A H    1  
ATOM 633   H HA   . LYS A 1 40  ? 4.703   10.578  -0.871  1.00 0.00 ? 40  LYS A HA   1  
ATOM 634   H HB2  . LYS A 1 40  ? 6.216   9.342   0.849   1.00 0.00 ? 40  LYS A HB2  1  
ATOM 635   H HB3  . LYS A 1 40  ? 7.204   8.950   -0.551  1.00 0.00 ? 40  LYS A HB3  1  
ATOM 636   H HG2  . LYS A 1 40  ? 7.900   11.097  -0.840  1.00 0.00 ? 40  LYS A HG2  1  
ATOM 637   H HG3  . LYS A 1 40  ? 6.425   11.785  -0.159  1.00 0.00 ? 40  LYS A HG3  1  
ATOM 638   H HD2  . LYS A 1 40  ? 7.244   10.792  2.070   1.00 0.00 ? 40  LYS A HD2  1  
ATOM 639   H HD3  . LYS A 1 40  ? 8.809   10.649  1.266   1.00 0.00 ? 40  LYS A HD3  1  
ATOM 640   H HE2  . LYS A 1 40  ? 7.316   13.244  1.236   1.00 0.00 ? 40  LYS A HE2  1  
ATOM 641   H HE3  . LYS A 1 40  ? 8.269   12.781  2.645   1.00 0.00 ? 40  LYS A HE3  1  
ATOM 642   H HZ1  . LYS A 1 40  ? 9.751   13.985  1.367   1.00 0.00 ? 40  LYS A HZ1  1  
ATOM 643   H HZ2  . LYS A 1 40  ? 9.187   13.354  -0.097  1.00 0.00 ? 40  LYS A HZ2  1  
ATOM 644   H HZ3  . LYS A 1 40  ? 10.123  12.392  0.933   1.00 0.00 ? 40  LYS A HZ3  1  
ATOM 645   N N    . HIS A 1 41  ? 6.179   10.665  -3.028  1.00 0.00 ? 41  HIS A N    1  
ATOM 646   C CA   . HIS A 1 41  ? 6.608   10.709  -4.422  1.00 0.00 ? 41  HIS A CA   1  
ATOM 647   C C    . HIS A 1 41  ? 7.832   11.604  -4.585  1.00 0.00 ? 41  HIS A C    1  
ATOM 648   O O    . HIS A 1 41  ? 7.727   12.830  -4.546  1.00 0.00 ? 41  HIS A O    1  
ATOM 649   C CB   . HIS A 1 41  ? 5.470   11.213  -5.311  1.00 0.00 ? 41  HIS A CB   1  
ATOM 650   C CG   . HIS A 1 41  ? 5.773   11.130  -6.775  1.00 0.00 ? 41  HIS A CG   1  
ATOM 651   N ND1  . HIS A 1 41  ? 6.438   10.066  -7.347  1.00 0.00 ? 41  HIS A ND1  1  
ATOM 652   C CD2  . HIS A 1 41  ? 5.496   11.986  -7.786  1.00 0.00 ? 41  HIS A CD2  1  
ATOM 653   C CE1  . HIS A 1 41  ? 6.558   10.272  -8.646  1.00 0.00 ? 41  HIS A CE1  1  
ATOM 654   N NE2  . HIS A 1 41  ? 5.995   11.430  -8.939  1.00 0.00 ? 41  HIS A NE2  1  
ATOM 655   H H    . HIS A 1 41  ? 6.289   11.461  -2.468  1.00 0.00 ? 41  HIS A H    1  
ATOM 656   H HA   . HIS A 1 41  ? 6.869   9.705   -4.721  1.00 0.00 ? 41  HIS A HA   1  
ATOM 657   H HB2  . HIS A 1 41  ? 4.586   10.623  -5.121  1.00 0.00 ? 41  HIS A HB2  1  
ATOM 658   H HB3  . HIS A 1 41  ? 5.266   12.247  -5.071  1.00 0.00 ? 41  HIS A HB3  1  
ATOM 659   H HD1  . HIS A 1 41  ? 6.773   9.278   -6.871  1.00 0.00 ? 41  HIS A HD1  1  
ATOM 660   H HD2  . HIS A 1 41  ? 4.980   12.932  -7.703  1.00 0.00 ? 41  HIS A HD2  1  
ATOM 661   H HE1  . HIS A 1 41  ? 7.035   9.607   -9.350  1.00 0.00 ? 41  HIS A HE1  1  
ATOM 662   N N    . ALA A 1 42  ? 8.993   10.983  -4.768  1.00 0.00 ? 42  ALA A N    1  
ATOM 663   C CA   . ALA A 1 42  ? 10.237  11.724  -4.939  1.00 0.00 ? 42  ALA A CA   1  
ATOM 664   C C    . ALA A 1 42  ? 10.469  12.077  -6.404  1.00 0.00 ? 42  ALA A C    1  
ATOM 665   O O    . ALA A 1 42  ? 10.506  13.250  -6.771  1.00 0.00 ? 42  ALA A O    1  
ATOM 666   C CB   . ALA A 1 42  ? 11.409  10.919  -4.396  1.00 0.00 ? 42  ALA A CB   1  
ATOM 667   H H    . ALA A 1 42  ? 9.013   10.004  -4.790  1.00 0.00 ? 42  ALA A H    1  
ATOM 668   H HA   . ALA A 1 42  ? 10.163  12.637  -4.366  1.00 0.00 ? 42  ALA A HA   1  
ATOM 669   H HB1  . ALA A 1 42  ? 11.150  10.518  -3.427  1.00 0.00 ? 42  ALA A HB1  1  
ATOM 670   H HB2  . ALA A 1 42  ? 11.633  10.109  -5.073  1.00 0.00 ? 42  ALA A HB2  1  
ATOM 671   H HB3  . ALA A 1 42  ? 12.272  11.560  -4.302  1.00 0.00 ? 42  ALA A HB3  1  
ATOM 672   N N    . GLY A 1 43  ? 10.626  11.053  -7.237  1.00 0.00 ? 43  GLY A N    1  
ATOM 673   C CA   . GLY A 1 43  ? 10.853  11.276  -8.653  1.00 0.00 ? 43  GLY A CA   1  
ATOM 674   C C    . GLY A 1 43  ? 12.326  11.289  -9.009  1.00 0.00 ? 43  GLY A C    1  
ATOM 675   O O    . GLY A 1 43  ? 12.719  10.823  -10.079 1.00 0.00 ? 43  GLY A O    1  
ATOM 676   H H    . GLY A 1 43  ? 10.586  10.138  -6.888  1.00 0.00 ? 43  GLY A H    1  
ATOM 677   H HA2  . GLY A 1 43  ? 10.365  10.493  -9.213  1.00 0.00 ? 43  GLY A HA2  1  
ATOM 678   H HA3  . GLY A 1 43  ? 10.420  12.226  -8.930  1.00 0.00 ? 43  GLY A HA3  1  
ATOM 679   N N    . LYS A 1 44  ? 13.145  11.826  -8.110  1.00 0.00 ? 44  LYS A N    1  
ATOM 680   C CA   . LYS A 1 44  ? 14.585  11.899  -8.334  1.00 0.00 ? 44  LYS A CA   1  
ATOM 681   C C    . LYS A 1 44  ? 15.147  10.531  -8.709  1.00 0.00 ? 44  LYS A C    1  
ATOM 682   O O    . LYS A 1 44  ? 14.452  9.519   -8.619  1.00 0.00 ? 44  LYS A O    1  
ATOM 683   C CB   . LYS A 1 44  ? 15.290  12.425  -7.082  1.00 0.00 ? 44  LYS A CB   1  
ATOM 684   C CG   . LYS A 1 44  ? 16.723  12.861  -7.329  1.00 0.00 ? 44  LYS A CG   1  
ATOM 685   C CD   . LYS A 1 44  ? 17.120  14.015  -6.423  1.00 0.00 ? 44  LYS A CD   1  
ATOM 686   C CE   . LYS A 1 44  ? 17.634  13.517  -5.081  1.00 0.00 ? 44  LYS A CE   1  
ATOM 687   N NZ   . LYS A 1 44  ? 17.947  14.642  -4.155  1.00 0.00 ? 44  LYS A NZ   1  
ATOM 688   H H    . LYS A 1 44  ? 12.773  12.181  -7.276  1.00 0.00 ? 44  LYS A H    1  
ATOM 689   H HA   . LYS A 1 44  ? 14.759  12.583  -9.150  1.00 0.00 ? 44  LYS A HA   1  
ATOM 690   H HB2  . LYS A 1 44  ? 14.738  13.273  -6.702  1.00 0.00 ? 44  LYS A HB2  1  
ATOM 691   H HB3  . LYS A 1 44  ? 15.296  11.647  -6.332  1.00 0.00 ? 44  LYS A HB3  1  
ATOM 692   H HG2  . LYS A 1 44  ? 17.382  12.026  -7.140  1.00 0.00 ? 44  LYS A HG2  1  
ATOM 693   H HG3  . LYS A 1 44  ? 16.822  13.174  -8.359  1.00 0.00 ? 44  LYS A HG3  1  
ATOM 694   H HD2  . LYS A 1 44  ? 17.898  14.588  -6.904  1.00 0.00 ? 44  LYS A HD2  1  
ATOM 695   H HD3  . LYS A 1 44  ? 16.257  14.644  -6.257  1.00 0.00 ? 44  LYS A HD3  1  
ATOM 696   H HE2  . LYS A 1 44  ? 16.880  12.891  -4.630  1.00 0.00 ? 44  LYS A HE2  1  
ATOM 697   H HE3  . LYS A 1 44  ? 18.531  12.938  -5.246  1.00 0.00 ? 44  LYS A HE3  1  
ATOM 698   H HZ1  . LYS A 1 44  ? 17.277  14.645  -3.359  1.00 0.00 ? 44  LYS A HZ1  1  
ATOM 699   H HZ2  . LYS A 1 44  ? 17.874  15.549  -4.658  1.00 0.00 ? 44  LYS A HZ2  1  
ATOM 700   H HZ3  . LYS A 1 44  ? 18.912  14.540  -3.782  1.00 0.00 ? 44  LYS A HZ3  1  
ATOM 701   N N    . GLN A 1 45  ? 16.408  10.510  -9.128  1.00 0.00 ? 45  GLN A N    1  
ATOM 702   C CA   . GLN A 1 45  ? 17.063  9.266   -9.516  1.00 0.00 ? 45  GLN A CA   1  
ATOM 703   C C    . GLN A 1 45  ? 18.158  8.894   -8.522  1.00 0.00 ? 45  GLN A C    1  
ATOM 704   O O    . GLN A 1 45  ? 18.351  7.719   -8.208  1.00 0.00 ? 45  GLN A O    1  
ATOM 705   C CB   . GLN A 1 45  ? 17.654  9.393   -10.921 1.00 0.00 ? 45  GLN A CB   1  
ATOM 706   C CG   . GLN A 1 45  ? 17.694  8.080   -11.686 1.00 0.00 ? 45  GLN A CG   1  
ATOM 707   C CD   . GLN A 1 45  ? 18.608  8.135   -12.893 1.00 0.00 ? 45  GLN A CD   1  
ATOM 708   O OE1  . GLN A 1 45  ? 18.148  8.129   -14.036 1.00 0.00 ? 45  GLN A OE1  1  
ATOM 709   N NE2  . GLN A 1 45  ? 19.912  8.190   -12.647 1.00 0.00 ? 45  GLN A NE2  1  
ATOM 710   H H    . GLN A 1 45  ? 16.909  11.350  -9.178  1.00 0.00 ? 45  GLN A H    1  
ATOM 711   H HA   . GLN A 1 45  ? 16.316  8.486   -9.519  1.00 0.00 ? 45  GLN A HA   1  
ATOM 712   H HB2  . GLN A 1 45  ? 17.062  10.097  -11.486 1.00 0.00 ? 45  GLN A HB2  1  
ATOM 713   H HB3  . GLN A 1 45  ? 18.664  9.768   -10.840 1.00 0.00 ? 45  GLN A HB3  1  
ATOM 714   H HG2  . GLN A 1 45  ? 18.045  7.303   -11.023 1.00 0.00 ? 45  GLN A HG2  1  
ATOM 715   H HG3  . GLN A 1 45  ? 16.695  7.842   -12.019 1.00 0.00 ? 45  GLN A HG3  1  
ATOM 716   H HE21 . GLN A 1 45  ? 20.206  8.190   -11.712 1.00 0.00 ? 45  GLN A HE21 1  
ATOM 717   H HE22 . GLN A 1 45  ? 20.526  8.226   -13.409 1.00 0.00 ? 45  GLN A HE22 1  
ATOM 718   N N    . ASP A 1 46  ? 18.871  9.901   -8.030  1.00 0.00 ? 46  ASP A N    1  
ATOM 719   C CA   . ASP A 1 46  ? 19.946  9.680   -7.071  1.00 0.00 ? 46  ASP A CA   1  
ATOM 720   C C    . ASP A 1 46  ? 19.397  9.143   -5.753  1.00 0.00 ? 46  ASP A C    1  
ATOM 721   O O    . ASP A 1 46  ? 20.089  8.432   -5.024  1.00 0.00 ? 46  ASP A O    1  
ATOM 722   C CB   . ASP A 1 46  ? 20.715  10.980  -6.826  1.00 0.00 ? 46  ASP A CB   1  
ATOM 723   C CG   . ASP A 1 46  ? 21.119  11.665  -8.116  1.00 0.00 ? 46  ASP A CG   1  
ATOM 724   O OD1  . ASP A 1 46  ? 21.813  11.027  -8.934  1.00 0.00 ? 46  ASP A OD1  1  
ATOM 725   O OD2  . ASP A 1 46  ? 20.743  12.841  -8.307  1.00 0.00 ? 46  ASP A OD2  1  
ATOM 726   H H    . ASP A 1 46  ? 18.668  10.816  -8.320  1.00 0.00 ? 46  ASP A H    1  
ATOM 727   H HA   . ASP A 1 46  ? 20.620  8.948   -7.490  1.00 0.00 ? 46  ASP A HA   1  
ATOM 728   H HB2  . ASP A 1 46  ? 20.092  11.657  -6.260  1.00 0.00 ? 46  ASP A HB2  1  
ATOM 729   H HB3  . ASP A 1 46  ? 21.608  10.760  -6.260  1.00 0.00 ? 46  ASP A HB3  1  
ATOM 730   N N    . TYR A 1 47  ? 18.150  9.490   -5.453  1.00 0.00 ? 47  TYR A N    1  
ATOM 731   C CA   . TYR A 1 47  ? 17.509  9.046   -4.221  1.00 0.00 ? 47  TYR A CA   1  
ATOM 732   C C    . TYR A 1 47  ? 17.566  7.526   -4.094  1.00 0.00 ? 47  TYR A C    1  
ATOM 733   O O    . TYR A 1 47  ? 17.726  6.815   -5.085  1.00 0.00 ? 47  TYR A O    1  
ATOM 734   C CB   . TYR A 1 47  ? 16.055  9.518   -4.179  1.00 0.00 ? 47  TYR A CB   1  
ATOM 735   C CG   . TYR A 1 47  ? 15.084  8.547   -4.812  1.00 0.00 ? 47  TYR A CG   1  
ATOM 736   C CD1  . TYR A 1 47  ? 15.049  8.367   -6.189  1.00 0.00 ? 47  TYR A CD1  1  
ATOM 737   C CD2  . TYR A 1 47  ? 14.201  7.809   -4.033  1.00 0.00 ? 47  TYR A CD2  1  
ATOM 738   C CE1  . TYR A 1 47  ? 14.164  7.481   -6.772  1.00 0.00 ? 47  TYR A CE1  1  
ATOM 739   C CE2  . TYR A 1 47  ? 13.313  6.920   -4.607  1.00 0.00 ? 47  TYR A CE2  1  
ATOM 740   C CZ   . TYR A 1 47  ? 13.298  6.760   -5.976  1.00 0.00 ? 47  TYR A CZ   1  
ATOM 741   O OH   . TYR A 1 47  ? 12.414  5.876   -6.552  1.00 0.00 ? 47  TYR A OH   1  
ATOM 742   H H    . TYR A 1 47  ? 17.649  10.059  -6.074  1.00 0.00 ? 47  TYR A H    1  
ATOM 743   H HA   . TYR A 1 47  ? 18.044  9.485   -3.392  1.00 0.00 ? 47  TYR A HA   1  
ATOM 744   H HB2  . TYR A 1 47  ? 15.758  9.660   -3.151  1.00 0.00 ? 47  TYR A HB2  1  
ATOM 745   H HB3  . TYR A 1 47  ? 15.973  10.458  -4.705  1.00 0.00 ? 47  TYR A HB3  1  
ATOM 746   H HD1  . TYR A 1 47  ? 15.728  8.933   -6.810  1.00 0.00 ? 47  TYR A HD1  1  
ATOM 747   H HD2  . TYR A 1 47  ? 14.215  7.938   -2.960  1.00 0.00 ? 47  TYR A HD2  1  
ATOM 748   H HE1  . TYR A 1 47  ? 14.152  7.355   -7.845  1.00 0.00 ? 47  TYR A HE1  1  
ATOM 749   H HE2  . TYR A 1 47  ? 12.635  6.356   -3.984  1.00 0.00 ? 47  TYR A HE2  1  
ATOM 750   H HH   . TYR A 1 47  ? 12.313  5.109   -5.983  1.00 0.00 ? 47  TYR A HH   1  
ATOM 751   N N    . ASN A 1 48  ? 17.432  7.036   -2.866  1.00 0.00 ? 48  ASN A N    1  
ATOM 752   C CA   . ASN A 1 48  ? 17.468  5.601   -2.608  1.00 0.00 ? 48  ASN A CA   1  
ATOM 753   C C    . ASN A 1 48  ? 16.147  4.945   -2.999  1.00 0.00 ? 48  ASN A C    1  
ATOM 754   O O    . ASN A 1 48  ? 15.090  5.293   -2.473  1.00 0.00 ? 48  ASN A O    1  
ATOM 755   C CB   . ASN A 1 48  ? 17.764  5.335   -1.131  1.00 0.00 ? 48  ASN A CB   1  
ATOM 756   C CG   . ASN A 1 48  ? 19.251  5.222   -0.850  1.00 0.00 ? 48  ASN A CG   1  
ATOM 757   O OD1  . ASN A 1 48  ? 20.044  6.044   -1.310  1.00 0.00 ? 48  ASN A OD1  1  
ATOM 758   N ND2  . ASN A 1 48  ? 19.634  4.201   -0.093  1.00 0.00 ? 48  ASN A ND2  1  
ATOM 759   H H    . ASN A 1 48  ? 17.307  7.654   -2.115  1.00 0.00 ? 48  ASN A H    1  
ATOM 760   H HA   . ASN A 1 48  ? 18.259  5.176   -3.207  1.00 0.00 ? 48  ASN A HA   1  
ATOM 761   H HB2  . ASN A 1 48  ? 17.367  6.146   -0.538  1.00 0.00 ? 48  ASN A HB2  1  
ATOM 762   H HB3  . ASN A 1 48  ? 17.290  4.412   -0.834  1.00 0.00 ? 48  ASN A HB3  1  
ATOM 763   H HD21 . ASN A 1 48  ? 18.946  3.586   0.238   1.00 0.00 ? 48  ASN A HD21 1  
ATOM 764   H HD22 . ASN A 1 48  ? 20.589  4.105   0.105   1.00 0.00 ? 48  ASN A HD22 1  
ATOM 765   N N    . ARG A 1 49  ? 16.217  3.994   -3.925  1.00 0.00 ? 49  ARG A N    1  
ATOM 766   C CA   . ARG A 1 49  ? 15.028  3.289   -4.387  1.00 0.00 ? 49  ARG A CA   1  
ATOM 767   C C    . ARG A 1 49  ? 14.723  2.092   -3.492  1.00 0.00 ? 49  ARG A C    1  
ATOM 768   O O    . ARG A 1 49  ? 13.584  1.896   -3.068  1.00 0.00 ? 49  ARG A O    1  
ATOM 769   C CB   . ARG A 1 49  ? 15.213  2.825   -5.833  1.00 0.00 ? 49  ARG A CB   1  
ATOM 770   C CG   . ARG A 1 49  ? 15.670  3.929   -6.773  1.00 0.00 ? 49  ARG A CG   1  
ATOM 771   C CD   . ARG A 1 49  ? 17.186  3.978   -6.881  1.00 0.00 ? 49  ARG A CD   1  
ATOM 772   N NE   . ARG A 1 49  ? 17.627  4.603   -8.124  1.00 0.00 ? 49  ARG A NE   1  
ATOM 773   C CZ   . ARG A 1 49  ? 17.655  3.973   -9.294  1.00 0.00 ? 49  ARG A CZ   1  
ATOM 774   N NH1  . ARG A 1 49  ? 17.270  2.707   -9.378  1.00 0.00 ? 49  ARG A NH1  1  
ATOM 775   N NH2  . ARG A 1 49  ? 18.069  4.610   -10.382 1.00 0.00 ? 49  ARG A NH2  1  
ATOM 776   H H    . ARG A 1 49  ? 17.089  3.761   -4.307  1.00 0.00 ? 49  ARG A H    1  
ATOM 777   H HA   . ARG A 1 49  ? 14.196  3.977   -4.344  1.00 0.00 ? 49  ARG A HA   1  
ATOM 778   H HB2  . ARG A 1 49  ? 15.952  2.037   -5.854  1.00 0.00 ? 49  ARG A HB2  1  
ATOM 779   H HB3  . ARG A 1 49  ? 14.274  2.437   -6.197  1.00 0.00 ? 49  ARG A HB3  1  
ATOM 780   H HG2  . ARG A 1 49  ? 15.256  3.747   -7.754  1.00 0.00 ? 49  ARG A HG2  1  
ATOM 781   H HG3  . ARG A 1 49  ? 15.313  4.877   -6.400  1.00 0.00 ? 49  ARG A HG3  1  
ATOM 782   H HD2  . ARG A 1 49  ? 17.574  4.544   -6.047  1.00 0.00 ? 49  ARG A HD2  1  
ATOM 783   H HD3  . ARG A 1 49  ? 17.569  2.969   -6.840  1.00 0.00 ? 49  ARG A HD3  1  
ATOM 784   H HE   . ARG A 1 49  ? 17.916  5.538   -8.085  1.00 0.00 ? 49  ARG A HE   1  
ATOM 785   H HH11 . ARG A 1 49  ? 16.957  2.225   -8.560  1.00 0.00 ? 49  ARG A HH11 1  
ATOM 786   H HH12 . ARG A 1 49  ? 17.291  2.236   -10.260 1.00 0.00 ? 49  ARG A HH12 1  
ATOM 787   H HH21 . ARG A 1 49  ? 18.360  5.564   -10.322 1.00 0.00 ? 49  ARG A HH21 1  
ATOM 788   H HH22 . ARG A 1 49  ? 18.090  4.135   -11.261 1.00 0.00 ? 49  ARG A HH22 1  
ATOM 789   N N    . GLU A 1 50  ? 15.748  1.294   -3.211  1.00 0.00 ? 50  GLU A N    1  
ATOM 790   C CA   . GLU A 1 50  ? 15.589  0.115   -2.367  1.00 0.00 ? 50  GLU A CA   1  
ATOM 791   C C    . GLU A 1 50  ? 14.546  0.361   -1.280  1.00 0.00 ? 50  GLU A C    1  
ATOM 792   O O    . GLU A 1 50  ? 13.577  -0.386  -1.156  1.00 0.00 ? 50  GLU A O    1  
ATOM 793   C CB   . GLU A 1 50  ? 16.926  -0.268  -1.730  1.00 0.00 ? 50  GLU A CB   1  
ATOM 794   C CG   . GLU A 1 50  ? 17.906  -0.899  -2.705  1.00 0.00 ? 50  GLU A CG   1  
ATOM 795   C CD   . GLU A 1 50  ? 17.497  -2.299  -3.121  1.00 0.00 ? 50  GLU A CD   1  
ATOM 796   O OE1  . GLU A 1 50  ? 16.301  -2.632  -2.983  1.00 0.00 ? 50  GLU A OE1  1  
ATOM 797   O OE2  . GLU A 1 50  ? 18.371  -3.061  -3.583  1.00 0.00 ? 50  GLU A OE2  1  
ATOM 798   H H    . GLU A 1 50  ? 16.632  1.502   -3.579  1.00 0.00 ? 50  GLU A H    1  
ATOM 799   H HA   . GLU A 1 50  ? 15.253  -0.698  -2.994  1.00 0.00 ? 50  GLU A HA   1  
ATOM 800   H HB2  . GLU A 1 50  ? 17.381  0.619   -1.316  1.00 0.00 ? 50  GLU A HB2  1  
ATOM 801   H HB3  . GLU A 1 50  ? 16.741  -0.972  -0.932  1.00 0.00 ? 50  GLU A HB3  1  
ATOM 802   H HG2  . GLU A 1 50  ? 17.964  -0.281  -3.588  1.00 0.00 ? 50  GLU A HG2  1  
ATOM 803   H HG3  . GLU A 1 50  ? 18.878  -0.948  -2.237  1.00 0.00 ? 50  GLU A HG3  1  
ATOM 804   N N    . GLU A 1 51  ? 14.756  1.413   -0.495  1.00 0.00 ? 51  GLU A N    1  
ATOM 805   C CA   . GLU A 1 51  ? 13.835  1.756   0.583   1.00 0.00 ? 51  GLU A CA   1  
ATOM 806   C C    . GLU A 1 51  ? 12.435  2.022   0.038   1.00 0.00 ? 51  GLU A C    1  
ATOM 807   O O    . GLU A 1 51  ? 11.457  1.429   0.493   1.00 0.00 ? 51  GLU A O    1  
ATOM 808   C CB   . GLU A 1 51  ? 14.341  2.984   1.343   1.00 0.00 ? 51  GLU A CB   1  
ATOM 809   C CG   . GLU A 1 51  ? 13.598  3.243   2.643   1.00 0.00 ? 51  GLU A CG   1  
ATOM 810   C CD   . GLU A 1 51  ? 14.083  4.491   3.354   1.00 0.00 ? 51  GLU A CD   1  
ATOM 811   O OE1  . GLU A 1 51  ? 15.111  4.412   4.058   1.00 0.00 ? 51  GLU A OE1  1  
ATOM 812   O OE2  . GLU A 1 51  ? 13.434  5.548   3.205   1.00 0.00 ? 51  GLU A OE2  1  
ATOM 813   H H    . GLU A 1 51  ? 15.548  1.971   -0.643  1.00 0.00 ? 51  GLU A H    1  
ATOM 814   H HA   . GLU A 1 51  ? 13.791  0.917   1.261   1.00 0.00 ? 51  GLU A HA   1  
ATOM 815   H HB2  . GLU A 1 51  ? 15.387  2.845   1.572   1.00 0.00 ? 51  GLU A HB2  1  
ATOM 816   H HB3  . GLU A 1 51  ? 14.231  3.853   0.712   1.00 0.00 ? 51  GLU A HB3  1  
ATOM 817   H HG2  . GLU A 1 51  ? 12.546  3.357   2.426   1.00 0.00 ? 51  GLU A HG2  1  
ATOM 818   H HG3  . GLU A 1 51  ? 13.739  2.395   3.298   1.00 0.00 ? 51  GLU A HG3  1  
ATOM 819   N N    . ASP A 1 52  ? 12.347  2.919   -0.938  1.00 0.00 ? 52  ASP A N    1  
ATOM 820   C CA   . ASP A 1 52  ? 11.067  3.264   -1.546  1.00 0.00 ? 52  ASP A CA   1  
ATOM 821   C C    . ASP A 1 52  ? 10.319  2.010   -1.988  1.00 0.00 ? 52  ASP A C    1  
ATOM 822   O O    . ASP A 1 52  ? 9.097   1.931   -1.868  1.00 0.00 ? 52  ASP A O    1  
ATOM 823   C CB   . ASP A 1 52  ? 11.281  4.193   -2.742  1.00 0.00 ? 52  ASP A CB   1  
ATOM 824   C CG   . ASP A 1 52  ? 9.996   4.472   -3.496  1.00 0.00 ? 52  ASP A CG   1  
ATOM 825   O OD1  . ASP A 1 52  ? 9.232   3.515   -3.741  1.00 0.00 ? 52  ASP A OD1  1  
ATOM 826   O OD2  . ASP A 1 52  ? 9.753   5.648   -3.841  1.00 0.00 ? 52  ASP A OD2  1  
ATOM 827   H H    . ASP A 1 52  ? 13.163  3.358   -1.258  1.00 0.00 ? 52  ASP A H    1  
ATOM 828   H HA   . ASP A 1 52  ? 10.476  3.779   -0.804  1.00 0.00 ? 52  ASP A HA   1  
ATOM 829   H HB2  . ASP A 1 52  ? 11.683  5.133   -2.393  1.00 0.00 ? 52  ASP A HB2  1  
ATOM 830   H HB3  . ASP A 1 52  ? 11.985  3.737   -3.423  1.00 0.00 ? 52  ASP A HB3  1  
ATOM 831   N N    . ALA A 1 53  ? 11.062  1.034   -2.499  1.00 0.00 ? 53  ALA A N    1  
ATOM 832   C CA   . ALA A 1 53  ? 10.469  -0.217  -2.957  1.00 0.00 ? 53  ALA A CA   1  
ATOM 833   C C    . ALA A 1 53  ? 10.747  -1.349  -1.975  1.00 0.00 ? 53  ALA A C    1  
ATOM 834   O O    . ALA A 1 53  ? 10.629  -2.525  -2.318  1.00 0.00 ? 53  ALA A O    1  
ATOM 835   C CB   . ALA A 1 53  ? 10.994  -0.574  -4.340  1.00 0.00 ? 53  ALA A CB   1  
ATOM 836   H H    . ALA A 1 53  ? 12.031  1.157   -2.568  1.00 0.00 ? 53  ALA A H    1  
ATOM 837   H HA   . ALA A 1 53  ? 9.400   -0.072  -3.031  1.00 0.00 ? 53  ALA A HA   1  
ATOM 838   H HB1  . ALA A 1 53  ? 12.041  -0.318  -4.403  1.00 0.00 ? 53  ALA A HB1  1  
ATOM 839   H HB2  . ALA A 1 53  ? 10.871  -1.633  -4.509  1.00 0.00 ? 53  ALA A HB2  1  
ATOM 840   H HB3  . ALA A 1 53  ? 10.442  -0.023  -5.087  1.00 0.00 ? 53  ALA A HB3  1  
ATOM 841   N N    . ALA A 1 54  ? 11.118  -0.986  -0.751  1.00 0.00 ? 54  ALA A N    1  
ATOM 842   C CA   . ALA A 1 54  ? 11.413  -1.972  0.281   1.00 0.00 ? 54  ALA A CA   1  
ATOM 843   C C    . ALA A 1 54  ? 10.256  -2.952  0.450   1.00 0.00 ? 54  ALA A C    1  
ATOM 844   O O    . ALA A 1 54  ? 10.465  -4.162  0.553   1.00 0.00 ? 54  ALA A O    1  
ATOM 845   C CB   . ALA A 1 54  ? 11.716  -1.279  1.602   1.00 0.00 ? 54  ALA A CB   1  
ATOM 846   H H    . ALA A 1 54  ? 11.195  -0.033  -0.538  1.00 0.00 ? 54  ALA A H    1  
ATOM 847   H HA   . ALA A 1 54  ? 12.294  -2.520  -0.021  1.00 0.00 ? 54  ALA A HA   1  
ATOM 848   H HB1  . ALA A 1 54  ? 10.792  -0.956  2.058   1.00 0.00 ? 54  ALA A HB1  1  
ATOM 849   H HB2  . ALA A 1 54  ? 12.223  -1.968  2.261   1.00 0.00 ? 54  ALA A HB2  1  
ATOM 850   H HB3  . ALA A 1 54  ? 12.348  -0.422  1.421   1.00 0.00 ? 54  ALA A HB3  1  
ATOM 851   N N    . LEU A 1 55  ? 9.038   -2.424  0.478   1.00 0.00 ? 55  LEU A N    1  
ATOM 852   C CA   . LEU A 1 55  ? 7.848   -3.252  0.635   1.00 0.00 ? 55  LEU A CA   1  
ATOM 853   C C    . LEU A 1 55  ? 7.350   -3.751  -0.718  1.00 0.00 ? 55  LEU A C    1  
ATOM 854   O O    . LEU A 1 55  ? 7.031   -4.929  -0.877  1.00 0.00 ? 55  LEU A O    1  
ATOM 855   C CB   . LEU A 1 55  ? 6.743   -2.463  1.339   1.00 0.00 ? 55  LEU A CB   1  
ATOM 856   C CG   . LEU A 1 55  ? 5.343   -3.077  1.287   1.00 0.00 ? 55  LEU A CG   1  
ATOM 857   C CD1  . LEU A 1 55  ? 5.280   -4.337  2.137   1.00 0.00 ? 55  LEU A CD1  1  
ATOM 858   C CD2  . LEU A 1 55  ? 4.301   -2.068  1.748   1.00 0.00 ? 55  LEU A CD2  1  
ATOM 859   H H    . LEU A 1 55  ? 8.936   -1.453  0.392   1.00 0.00 ? 55  LEU A H    1  
ATOM 860   H HA   . LEU A 1 55  ? 8.115   -4.104  1.243   1.00 0.00 ? 55  LEU A HA   1  
ATOM 861   H HB2  . LEU A 1 55  ? 7.020   -2.361  2.377   1.00 0.00 ? 55  LEU A HB2  1  
ATOM 862   H HB3  . LEU A 1 55  ? 6.693   -1.485  0.883   1.00 0.00 ? 55  LEU A HB3  1  
ATOM 863   H HG   . LEU A 1 55  ? 5.115   -3.352  0.267   1.00 0.00 ? 55  LEU A HG   1  
ATOM 864   H HD11 . LEU A 1 55  ? 4.834   -4.105  3.092   1.00 0.00 ? 55  LEU A HD11 1  
ATOM 865   H HD12 . LEU A 1 55  ? 6.279   -4.718  2.290   1.00 0.00 ? 55  LEU A HD12 1  
ATOM 866   H HD13 . LEU A 1 55  ? 4.684   -5.082  1.632   1.00 0.00 ? 55  LEU A HD13 1  
ATOM 867   H HD21 . LEU A 1 55  ? 4.387   -1.168  1.158   1.00 0.00 ? 55  LEU A HD21 1  
ATOM 868   H HD22 . LEU A 1 55  ? 4.465   -1.832  2.790   1.00 0.00 ? 55  LEU A HD22 1  
ATOM 869   H HD23 . LEU A 1 55  ? 3.314   -2.488  1.624   1.00 0.00 ? 55  LEU A HD23 1  
ATOM 870   N N    . PHE A 1 56  ? 7.287   -2.847  -1.689  1.00 0.00 ? 56  PHE A N    1  
ATOM 871   C CA   . PHE A 1 56  ? 6.829   -3.195  -3.029  1.00 0.00 ? 56  PHE A CA   1  
ATOM 872   C C    . PHE A 1 56  ? 7.617   -4.379  -3.583  1.00 0.00 ? 56  PHE A C    1  
ATOM 873   O O    . PHE A 1 56  ? 7.039   -5.355  -4.062  1.00 0.00 ? 56  PHE A O    1  
ATOM 874   C CB   . PHE A 1 56  ? 6.966   -1.993  -3.967  1.00 0.00 ? 56  PHE A CB   1  
ATOM 875   C CG   . PHE A 1 56  ? 6.038   -0.861  -3.630  1.00 0.00 ? 56  PHE A CG   1  
ATOM 876   C CD1  . PHE A 1 56  ? 4.761   -0.813  -4.165  1.00 0.00 ? 56  PHE A CD1  1  
ATOM 877   C CD2  . PHE A 1 56  ? 6.443   0.154   -2.778  1.00 0.00 ? 56  PHE A CD2  1  
ATOM 878   C CE1  . PHE A 1 56  ? 3.905   0.228   -3.857  1.00 0.00 ? 56  PHE A CE1  1  
ATOM 879   C CE2  . PHE A 1 56  ? 5.591   1.197   -2.467  1.00 0.00 ? 56  PHE A CE2  1  
ATOM 880   C CZ   . PHE A 1 56  ? 4.321   1.234   -3.006  1.00 0.00 ? 56  PHE A CZ   1  
ATOM 881   H H    . PHE A 1 56  ? 7.555   -1.923  -1.501  1.00 0.00 ? 56  PHE A H    1  
ATOM 882   H HA   . PHE A 1 56  ? 5.788   -3.471  -2.961  1.00 0.00 ? 56  PHE A HA   1  
ATOM 883   H HB2  . PHE A 1 56  ? 7.977   -1.619  -3.915  1.00 0.00 ? 56  PHE A HB2  1  
ATOM 884   H HB3  . PHE A 1 56  ? 6.754   -2.309  -4.977  1.00 0.00 ? 56  PHE A HB3  1  
ATOM 885   H HD1  . PHE A 1 56  ? 4.434   -1.599  -4.830  1.00 0.00 ? 56  PHE A HD1  1  
ATOM 886   H HD2  . PHE A 1 56  ? 7.437   0.126   -2.355  1.00 0.00 ? 56  PHE A HD2  1  
ATOM 887   H HE1  . PHE A 1 56  ? 2.912   0.254   -4.280  1.00 0.00 ? 56  PHE A HE1  1  
ATOM 888   H HE2  . PHE A 1 56  ? 5.919   1.981   -1.801  1.00 0.00 ? 56  PHE A HE2  1  
ATOM 889   H HZ   . PHE A 1 56  ? 3.654   2.048   -2.765  1.00 0.00 ? 56  PHE A HZ   1  
ATOM 890   N N    . LYS A 1 57  ? 8.940   -4.285  -3.515  1.00 0.00 ? 57  LYS A N    1  
ATOM 891   C CA   . LYS A 1 57  ? 9.810   -5.346  -4.007  1.00 0.00 ? 57  LYS A CA   1  
ATOM 892   C C    . LYS A 1 57  ? 9.359   -6.706  -3.484  1.00 0.00 ? 57  LYS A C    1  
ATOM 893   O O    . LYS A 1 57  ? 9.170   -7.647  -4.254  1.00 0.00 ? 57  LYS A O    1  
ATOM 894   C CB   . LYS A 1 57  ? 11.258  -5.082  -3.590  1.00 0.00 ? 57  LYS A CB   1  
ATOM 895   C CG   . LYS A 1 57  ? 12.212  -6.204  -3.962  1.00 0.00 ? 57  LYS A CG   1  
ATOM 896   C CD   . LYS A 1 57  ? 12.825  -5.984  -5.334  1.00 0.00 ? 57  LYS A CD   1  
ATOM 897   C CE   . LYS A 1 57  ? 14.166  -5.272  -5.238  1.00 0.00 ? 57  LYS A CE   1  
ATOM 898   N NZ   . LYS A 1 57  ? 14.008  -3.792  -5.218  1.00 0.00 ? 57  LYS A NZ   1  
ATOM 899   H H    . LYS A 1 57  ? 9.343   -3.481  -3.122  1.00 0.00 ? 57  LYS A H    1  
ATOM 900   H HA   . LYS A 1 57  ? 9.749   -5.351  -5.085  1.00 0.00 ? 57  LYS A HA   1  
ATOM 901   H HB2  . LYS A 1 57  ? 11.598  -4.176  -4.069  1.00 0.00 ? 57  LYS A HB2  1  
ATOM 902   H HB3  . LYS A 1 57  ? 11.293  -4.949  -2.519  1.00 0.00 ? 57  LYS A HB3  1  
ATOM 903   H HG2  . LYS A 1 57  ? 13.004  -6.249  -3.229  1.00 0.00 ? 57  LYS A HG2  1  
ATOM 904   H HG3  . LYS A 1 57  ? 11.670  -7.139  -3.966  1.00 0.00 ? 57  LYS A HG3  1  
ATOM 905   H HD2  . LYS A 1 57  ? 12.972  -6.941  -5.812  1.00 0.00 ? 57  LYS A HD2  1  
ATOM 906   H HD3  . LYS A 1 57  ? 12.151  -5.383  -5.928  1.00 0.00 ? 57  LYS A HD3  1  
ATOM 907   H HE2  . LYS A 1 57  ? 14.661  -5.586  -4.331  1.00 0.00 ? 57  LYS A HE2  1  
ATOM 908   H HE3  . LYS A 1 57  ? 14.768  -5.550  -6.091  1.00 0.00 ? 57  LYS A HE3  1  
ATOM 909   H HZ1  . LYS A 1 57  ? 13.683  -3.455  -6.146  1.00 0.00 ? 57  LYS A HZ1  1  
ATOM 910   H HZ2  . LYS A 1 57  ? 14.918  -3.338  -4.997  1.00 0.00 ? 57  LYS A HZ2  1  
ATOM 911   H HZ3  . LYS A 1 57  ? 13.312  -3.516  -4.496  1.00 0.00 ? 57  LYS A HZ3  1  
ATOM 912   N N    . ALA A 1 58  ? 9.186   -6.801  -2.169  1.00 0.00 ? 58  ALA A N    1  
ATOM 913   C CA   . ALA A 1 58  ? 8.753   -8.045  -1.544  1.00 0.00 ? 58  ALA A CA   1  
ATOM 914   C C    . ALA A 1 58  ? 7.455   -8.549  -2.164  1.00 0.00 ? 58  ALA A C    1  
ATOM 915   O O    . ALA A 1 58  ? 7.348   -9.716  -2.541  1.00 0.00 ? 58  ALA A O    1  
ATOM 916   C CB   . ALA A 1 58  ? 8.583   -7.850  -0.044  1.00 0.00 ? 58  ALA A CB   1  
ATOM 917   H H    . ALA A 1 58  ? 9.352   -6.016  -1.607  1.00 0.00 ? 58  ALA A H    1  
ATOM 918   H HA   . ALA A 1 58  ? 9.526   -8.784  -1.701  1.00 0.00 ? 58  ALA A HA   1  
ATOM 919   H HB1  . ALA A 1 58  ? 8.855   -8.761  0.469   1.00 0.00 ? 58  ALA A HB1  1  
ATOM 920   H HB2  . ALA A 1 58  ? 9.221   -7.045  0.288   1.00 0.00 ? 58  ALA A HB2  1  
ATOM 921   H HB3  . ALA A 1 58  ? 7.554   -7.608  0.172   1.00 0.00 ? 58  ALA A HB3  1  
ATOM 922   N N    . TRP A 1 59  ? 6.471   -7.663  -2.267  1.00 0.00 ? 59  TRP A N    1  
ATOM 923   C CA   . TRP A 1 59  ? 5.179   -8.019  -2.841  1.00 0.00 ? 59  TRP A CA   1  
ATOM 924   C C    . TRP A 1 59  ? 5.356   -8.860  -4.100  1.00 0.00 ? 59  TRP A C    1  
ATOM 925   O O    . TRP A 1 59  ? 4.871   -9.989  -4.178  1.00 0.00 ? 59  TRP A O    1  
ATOM 926   C CB   . TRP A 1 59  ? 4.376   -6.758  -3.164  1.00 0.00 ? 59  TRP A CB   1  
ATOM 927   C CG   . TRP A 1 59  ? 3.146   -7.029  -3.978  1.00 0.00 ? 59  TRP A CG   1  
ATOM 928   C CD1  . TRP A 1 59  ? 2.747   -6.367  -5.104  1.00 0.00 ? 59  TRP A CD1  1  
ATOM 929   C CD2  . TRP A 1 59  ? 2.157   -8.032  -3.727  1.00 0.00 ? 59  TRP A CD2  1  
ATOM 930   N NE1  . TRP A 1 59  ? 1.568   -6.899  -5.568  1.00 0.00 ? 59  TRP A NE1  1  
ATOM 931   C CE2  . TRP A 1 59  ? 1.185   -7.922  -4.742  1.00 0.00 ? 59  TRP A CE2  1  
ATOM 932   C CE3  . TRP A 1 59  ? 1.997   -9.014  -2.746  1.00 0.00 ? 59  TRP A CE3  1  
ATOM 933   C CZ2  . TRP A 1 59  ? 0.072   -8.756  -4.800  1.00 0.00 ? 59  TRP A CZ2  1  
ATOM 934   C CZ3  . TRP A 1 59  ? 0.891   -9.841  -2.805  1.00 0.00 ? 59  TRP A CZ3  1  
ATOM 935   C CH2  . TRP A 1 59  ? -0.059  -9.709  -3.826  1.00 0.00 ? 59  TRP A CH2  1  
ATOM 936   H H    . TRP A 1 59  ? 6.616   -6.747  -1.948  1.00 0.00 ? 59  TRP A H    1  
ATOM 937   H HA   . TRP A 1 59  ? 4.639   -8.600  -2.107  1.00 0.00 ? 59  TRP A HA   1  
ATOM 938   H HB2  . TRP A 1 59  ? 4.068   -6.289  -2.242  1.00 0.00 ? 59  TRP A HB2  1  
ATOM 939   H HB3  . TRP A 1 59  ? 5.001   -6.075  -3.721  1.00 0.00 ? 59  TRP A HB3  1  
ATOM 940   H HD1  . TRP A 1 59  ? 3.287   -5.547  -5.551  1.00 0.00 ? 59  TRP A HD1  1  
ATOM 941   H HE1  . TRP A 1 59  ? 1.081   -6.595  -6.363  1.00 0.00 ? 59  TRP A HE1  1  
ATOM 942   H HE3  . TRP A 1 59  ? 2.719   -9.132  -1.951  1.00 0.00 ? 59  TRP A HE3  1  
ATOM 943   H HZ2  . TRP A 1 59  ? -0.669  -8.667  -5.581  1.00 0.00 ? 59  TRP A HZ2  1  
ATOM 944   H HZ3  . TRP A 1 59  ? 0.751   -10.606 -2.055  1.00 0.00 ? 59  TRP A HZ3  1  
ATOM 945   H HH2  . TRP A 1 59  ? -0.907  -10.376 -3.833  1.00 0.00 ? 59  TRP A HH2  1  
ATOM 946   N N    . ALA A 1 60  ? 6.054   -8.304  -5.085  1.00 0.00 ? 60  ALA A N    1  
ATOM 947   C CA   . ALA A 1 60  ? 6.297   -9.005  -6.340  1.00 0.00 ? 60  ALA A CA   1  
ATOM 948   C C    . ALA A 1 60  ? 7.045   -10.312 -6.103  1.00 0.00 ? 60  ALA A C    1  
ATOM 949   O O    . ALA A 1 60  ? 6.497   -11.397 -6.299  1.00 0.00 ? 60  ALA A O    1  
ATOM 950   C CB   . ALA A 1 60  ? 7.074   -8.115  -7.299  1.00 0.00 ? 60  ALA A CB   1  
ATOM 951   H H    . ALA A 1 60  ? 6.415   -7.401  -4.964  1.00 0.00 ? 60  ALA A H    1  
ATOM 952   H HA   . ALA A 1 60  ? 5.339   -9.226  -6.789  1.00 0.00 ? 60  ALA A HA   1  
ATOM 953   H HB1  . ALA A 1 60  ? 8.028   -8.572  -7.519  1.00 0.00 ? 60  ALA A HB1  1  
ATOM 954   H HB2  . ALA A 1 60  ? 6.513   -7.995  -8.213  1.00 0.00 ? 60  ALA A HB2  1  
ATOM 955   H HB3  . ALA A 1 60  ? 7.234   -7.149  -6.844  1.00 0.00 ? 60  ALA A HB3  1  
ATOM 956   N N    . LEU A 1 61  ? 8.300   -10.201 -5.681  1.00 0.00 ? 61  LEU A N    1  
ATOM 957   C CA   . LEU A 1 61  ? 9.125   -11.376 -5.417  1.00 0.00 ? 61  LEU A CA   1  
ATOM 958   C C    . LEU A 1 61  ? 8.307   -12.476 -4.749  1.00 0.00 ? 61  LEU A C    1  
ATOM 959   O O    . LEU A 1 61  ? 8.485   -13.660 -5.040  1.00 0.00 ? 61  LEU A O    1  
ATOM 960   C CB   . LEU A 1 61  ? 10.314  -10.999 -4.532  1.00 0.00 ? 61  LEU A CB   1  
ATOM 961   C CG   . LEU A 1 61  ? 11.520  -10.392 -5.251  1.00 0.00 ? 61  LEU A CG   1  
ATOM 962   C CD1  . LEU A 1 61  ? 12.312  -9.503  -4.305  1.00 0.00 ? 61  LEU A CD1  1  
ATOM 963   C CD2  . LEU A 1 61  ? 12.407  -11.488 -5.824  1.00 0.00 ? 61  LEU A CD2  1  
ATOM 964   H H    . LEU A 1 61  ? 8.682   -9.310  -5.543  1.00 0.00 ? 61  LEU A H    1  
ATOM 965   H HA   . LEU A 1 61  ? 9.493   -11.741 -6.364  1.00 0.00 ? 61  LEU A HA   1  
ATOM 966   H HB2  . LEU A 1 61  ? 9.970   -10.283 -3.802  1.00 0.00 ? 61  LEU A HB2  1  
ATOM 967   H HB3  . LEU A 1 61  ? 10.646  -11.895 -4.027  1.00 0.00 ? 61  LEU A HB3  1  
ATOM 968   H HG   . LEU A 1 61  ? 11.171  -9.780  -6.071  1.00 0.00 ? 61  LEU A HG   1  
ATOM 969   H HD11 . LEU A 1 61  ? 12.762  -8.696  -4.863  1.00 0.00 ? 61  LEU A HD11 1  
ATOM 970   H HD12 . LEU A 1 61  ? 13.086  -10.085 -3.827  1.00 0.00 ? 61  LEU A HD12 1  
ATOM 971   H HD13 . LEU A 1 61  ? 11.651  -9.097  -3.554  1.00 0.00 ? 61  LEU A HD13 1  
ATOM 972   H HD21 . LEU A 1 61  ? 12.007  -11.814 -6.773  1.00 0.00 ? 61  LEU A HD21 1  
ATOM 973   H HD22 . LEU A 1 61  ? 12.435  -12.323 -5.139  1.00 0.00 ? 61  LEU A HD22 1  
ATOM 974   H HD23 . LEU A 1 61  ? 13.406  -11.104 -5.966  1.00 0.00 ? 61  LEU A HD23 1  
ATOM 975   N N    . PHE A 1 62  ? 7.409   -12.079 -3.854  1.00 0.00 ? 62  PHE A N    1  
ATOM 976   C CA   . PHE A 1 62  ? 6.563   -13.032 -3.145  1.00 0.00 ? 62  PHE A CA   1  
ATOM 977   C C    . PHE A 1 62  ? 5.545   -13.663 -4.091  1.00 0.00 ? 62  PHE A C    1  
ATOM 978   O O    . PHE A 1 62  ? 5.476   -14.886 -4.221  1.00 0.00 ? 62  PHE A O    1  
ATOM 979   C CB   . PHE A 1 62  ? 5.840   -12.341 -1.987  1.00 0.00 ? 62  PHE A CB   1  
ATOM 980   C CG   . PHE A 1 62  ? 4.692   -13.138 -1.436  1.00 0.00 ? 62  PHE A CG   1  
ATOM 981   C CD1  . PHE A 1 62  ? 4.914   -14.160 -0.527  1.00 0.00 ? 62  PHE A CD1  1  
ATOM 982   C CD2  . PHE A 1 62  ? 3.391   -12.865 -1.827  1.00 0.00 ? 62  PHE A CD2  1  
ATOM 983   C CE1  . PHE A 1 62  ? 3.860   -14.895 -0.018  1.00 0.00 ? 62  PHE A CE1  1  
ATOM 984   C CE2  . PHE A 1 62  ? 2.333   -13.596 -1.321  1.00 0.00 ? 62  PHE A CE2  1  
ATOM 985   C CZ   . PHE A 1 62  ? 2.568   -14.613 -0.417  1.00 0.00 ? 62  PHE A CZ   1  
ATOM 986   H H    . PHE A 1 62  ? 7.314   -11.122 -3.665  1.00 0.00 ? 62  PHE A H    1  
ATOM 987   H HA   . PHE A 1 62  ? 7.199   -13.808 -2.749  1.00 0.00 ? 62  PHE A HA   1  
ATOM 988   H HB2  . PHE A 1 62  ? 6.541   -12.172 -1.184  1.00 0.00 ? 62  PHE A HB2  1  
ATOM 989   H HB3  . PHE A 1 62  ? 5.454   -11.392 -2.328  1.00 0.00 ? 62  PHE A HB3  1  
ATOM 990   H HD1  . PHE A 1 62  ? 5.925   -14.381 -0.215  1.00 0.00 ? 62  PHE A HD1  1  
ATOM 991   H HD2  . PHE A 1 62  ? 3.206   -12.071 -2.536  1.00 0.00 ? 62  PHE A HD2  1  
ATOM 992   H HE1  . PHE A 1 62  ? 4.048   -15.689 0.689   1.00 0.00 ? 62  PHE A HE1  1  
ATOM 993   H HE2  . PHE A 1 62  ? 1.324   -13.374 -1.634  1.00 0.00 ? 62  PHE A HE2  1  
ATOM 994   H HZ   . PHE A 1 62  ? 1.743   -15.186 -0.019  1.00 0.00 ? 62  PHE A HZ   1  
ATOM 995   N N    . LYS A 1 63  ? 4.755   -12.821 -4.748  1.00 0.00 ? 63  LYS A N    1  
ATOM 996   C CA   . LYS A 1 63  ? 3.741   -13.294 -5.682  1.00 0.00 ? 63  LYS A CA   1  
ATOM 997   C C    . LYS A 1 63  ? 4.381   -14.033 -6.853  1.00 0.00 ? 63  LYS A C    1  
ATOM 998   O O    . LYS A 1 63  ? 4.153   -15.227 -7.045  1.00 0.00 ? 63  LYS A O    1  
ATOM 999   C CB   . LYS A 1 63  ? 2.908   -12.119 -6.201  1.00 0.00 ? 63  LYS A CB   1  
ATOM 1000  C CG   . LYS A 1 63  ? 2.060   -11.455 -5.131  1.00 0.00 ? 63  LYS A CG   1  
ATOM 1001  C CD   . LYS A 1 63  ? 0.908   -12.347 -4.699  1.00 0.00 ? 63  LYS A CD   1  
ATOM 1002  C CE   . LYS A 1 63  ? -0.249  -12.280 -5.684  1.00 0.00 ? 63  LYS A CE   1  
ATOM 1003  N NZ   . LYS A 1 63  ? -1.456  -12.986 -5.172  1.00 0.00 ? 63  LYS A NZ   1  
ATOM 1004  H H    . LYS A 1 63  ? 4.858   -11.857 -4.602  1.00 0.00 ? 63  LYS A H    1  
ATOM 1005  H HA   . LYS A 1 63  ? 3.094   -13.976 -5.152  1.00 0.00 ? 63  LYS A HA   1  
ATOM 1006  H HB2  . LYS A 1 63  ? 3.575   -11.377 -6.615  1.00 0.00 ? 63  LYS A HB2  1  
ATOM 1007  H HB3  . LYS A 1 63  ? 2.252   -12.476 -6.981  1.00 0.00 ? 63  LYS A HB3  1  
ATOM 1008  H HG2  . LYS A 1 63  ? 2.679   -11.245 -4.272  1.00 0.00 ? 63  LYS A HG2  1  
ATOM 1009  H HG3  . LYS A 1 63  ? 1.660   -10.531 -5.523  1.00 0.00 ? 63  LYS A HG3  1  
ATOM 1010  H HD2  . LYS A 1 63  ? 1.256   -13.368 -4.641  1.00 0.00 ? 63  LYS A HD2  1  
ATOM 1011  H HD3  . LYS A 1 63  ? 0.561   -12.027 -3.727  1.00 0.00 ? 63  LYS A HD3  1  
ATOM 1012  H HE2  . LYS A 1 63  ? -0.496  -11.244 -5.859  1.00 0.00 ? 63  LYS A HE2  1  
ATOM 1013  H HE3  . LYS A 1 63  ? 0.059   -12.738 -6.613  1.00 0.00 ? 63  LYS A HE3  1  
ATOM 1014  H HZ1  . LYS A 1 63  ? -1.694  -12.641 -4.220  1.00 0.00 ? 63  LYS A HZ1  1  
ATOM 1015  H HZ2  . LYS A 1 63  ? -1.277  -14.009 -5.123  1.00 0.00 ? 63  LYS A HZ2  1  
ATOM 1016  H HZ3  . LYS A 1 63  ? -2.265  -12.815 -5.803  1.00 0.00 ? 63  LYS A HZ3  1  
ATOM 1017  N N    . GLY A 1 64  ? 5.185   -13.315 -7.632  1.00 0.00 ? 64  GLY A N    1  
ATOM 1018  C CA   . GLY A 1 64  ? 5.847   -13.921 -8.772  1.00 0.00 ? 64  GLY A CA   1  
ATOM 1019  C C    . GLY A 1 64  ? 7.310   -14.216 -8.505  1.00 0.00 ? 64  GLY A C    1  
ATOM 1020  O O    . GLY A 1 64  ? 7.704   -14.452 -7.363  1.00 0.00 ? 64  GLY A O    1  
ATOM 1021  H H    . GLY A 1 64  ? 5.330   -12.367 -7.430  1.00 0.00 ? 64  GLY A H    1  
ATOM 1022  H HA2  . GLY A 1 64  ? 5.343   -14.843 -9.019  1.00 0.00 ? 64  GLY A HA2  1  
ATOM 1023  H HA3  . GLY A 1 64  ? 5.776   -13.247 -9.614  1.00 0.00 ? 64  GLY A HA3  1  
ATOM 1024  N N    . LYS A 1 65  ? 8.117   -14.205 -9.560  1.00 0.00 ? 65  LYS A N    1  
ATOM 1025  C CA   . LYS A 1 65  ? 9.544   -14.474 -9.435  1.00 0.00 ? 65  LYS A CA   1  
ATOM 1026  C C    . LYS A 1 65  ? 10.362  -13.433 -10.192 1.00 0.00 ? 65  LYS A C    1  
ATOM 1027  O O    . LYS A 1 65  ? 10.433  -13.458 -11.421 1.00 0.00 ? 65  LYS A O    1  
ATOM 1028  C CB   . LYS A 1 65  ? 9.868   -15.874 -9.961  1.00 0.00 ? 65  LYS A CB   1  
ATOM 1029  C CG   . LYS A 1 65  ? 9.219   -16.990 -9.160  1.00 0.00 ? 65  LYS A CG   1  
ATOM 1030  C CD   . LYS A 1 65  ? 10.105  -17.438 -8.010  1.00 0.00 ? 65  LYS A CD   1  
ATOM 1031  C CE   . LYS A 1 65  ? 9.463   -18.569 -7.220  1.00 0.00 ? 65  LYS A CE   1  
ATOM 1032  N NZ   . LYS A 1 65  ? 9.293   -19.796 -8.047  1.00 0.00 ? 65  LYS A NZ   1  
ATOM 1033  H H    . LYS A 1 65  ? 7.743   -14.010 -10.445 1.00 0.00 ? 65  LYS A H    1  
ATOM 1034  H HA   . LYS A 1 65  ? 9.801   -14.424 -8.388  1.00 0.00 ? 65  LYS A HA   1  
ATOM 1035  H HB2  . LYS A 1 65  ? 9.529   -15.949 -10.984 1.00 0.00 ? 65  LYS A HB2  1  
ATOM 1036  H HB3  . LYS A 1 65  ? 10.939  -16.017 -9.935  1.00 0.00 ? 65  LYS A HB3  1  
ATOM 1037  H HG2  . LYS A 1 65  ? 8.281   -16.636 -8.761  1.00 0.00 ? 65  LYS A HG2  1  
ATOM 1038  H HG3  . LYS A 1 65  ? 9.040   -17.832 -9.814  1.00 0.00 ? 65  LYS A HG3  1  
ATOM 1039  H HD2  . LYS A 1 65  ? 11.049  -17.782 -8.405  1.00 0.00 ? 65  LYS A HD2  1  
ATOM 1040  H HD3  . LYS A 1 65  ? 10.273  -16.600 -7.349  1.00 0.00 ? 65  LYS A HD3  1  
ATOM 1041  H HE2  . LYS A 1 65  ? 10.090  -18.800 -6.373  1.00 0.00 ? 65  LYS A HE2  1  
ATOM 1042  H HE3  . LYS A 1 65  ? 8.494   -18.242 -6.872  1.00 0.00 ? 65  LYS A HE3  1  
ATOM 1043  H HZ1  . LYS A 1 65  ? 10.218  -20.234 -8.230  1.00 0.00 ? 65  LYS A HZ1  1  
ATOM 1044  H HZ2  . LYS A 1 65  ? 8.850   -19.555 -8.957  1.00 0.00 ? 65  LYS A HZ2  1  
ATOM 1045  H HZ3  . LYS A 1 65  ? 8.689   -20.481 -7.550  1.00 0.00 ? 65  LYS A HZ3  1  
ATOM 1046  N N    . PHE A 1 66  ? 10.981  -12.520 -9.451  1.00 0.00 ? 66  PHE A N    1  
ATOM 1047  C CA   . PHE A 1 66  ? 11.795  -11.470 -10.053 1.00 0.00 ? 66  PHE A CA   1  
ATOM 1048  C C    . PHE A 1 66  ? 13.281  -11.784 -9.907  1.00 0.00 ? 66  PHE A C    1  
ATOM 1049  O O    . PHE A 1 66  ? 13.772  -12.018 -8.802  1.00 0.00 ? 66  PHE A O    1  
ATOM 1050  C CB   . PHE A 1 66  ? 11.482  -10.119 -9.407  1.00 0.00 ? 66  PHE A CB   1  
ATOM 1051  C CG   . PHE A 1 66  ? 12.594  -9.118  -9.541  1.00 0.00 ? 66  PHE A CG   1  
ATOM 1052  C CD1  . PHE A 1 66  ? 12.851  -8.507  -10.757 1.00 0.00 ? 66  PHE A CD1  1  
ATOM 1053  C CD2  . PHE A 1 66  ? 13.382  -8.789  -8.450  1.00 0.00 ? 66  PHE A CD2  1  
ATOM 1054  C CE1  . PHE A 1 66  ? 13.875  -7.587  -10.883 1.00 0.00 ? 66  PHE A CE1  1  
ATOM 1055  C CE2  . PHE A 1 66  ? 14.407  -7.869  -8.569  1.00 0.00 ? 66  PHE A CE2  1  
ATOM 1056  C CZ   . PHE A 1 66  ? 14.652  -7.266  -9.787  1.00 0.00 ? 66  PHE A CZ   1  
ATOM 1057  H H    . PHE A 1 66  ? 10.887  -12.552 -8.476  1.00 0.00 ? 66  PHE A H    1  
ATOM 1058  H HA   . PHE A 1 66  ? 11.550  -11.423 -11.103 1.00 0.00 ? 66  PHE A HA   1  
ATOM 1059  H HB2  . PHE A 1 66  ? 10.602  -9.700  -9.873  1.00 0.00 ? 66  PHE A HB2  1  
ATOM 1060  H HB3  . PHE A 1 66  ? 11.291  -10.267 -8.355  1.00 0.00 ? 66  PHE A HB3  1  
ATOM 1061  H HD1  . PHE A 1 66  ? 12.243  -8.756  -11.615 1.00 0.00 ? 66  PHE A HD1  1  
ATOM 1062  H HD2  . PHE A 1 66  ? 13.190  -9.260  -7.496  1.00 0.00 ? 66  PHE A HD2  1  
ATOM 1063  H HE1  . PHE A 1 66  ? 14.065  -7.117  -11.836 1.00 0.00 ? 66  PHE A HE1  1  
ATOM 1064  H HE2  . PHE A 1 66  ? 15.013  -7.621  -7.711  1.00 0.00 ? 66  PHE A HE2  1  
ATOM 1065  H HZ   . PHE A 1 66  ? 15.453  -6.548  -9.883  1.00 0.00 ? 66  PHE A HZ   1  
ATOM 1066  N N    . ARG A 1 67  ? 13.992  -11.787 -11.030 1.00 0.00 ? 67  ARG A N    1  
ATOM 1067  C CA   . ARG A 1 67  ? 15.421  -12.073 -11.029 1.00 0.00 ? 67  ARG A CA   1  
ATOM 1068  C C    . ARG A 1 67  ? 16.220  -10.853 -10.581 1.00 0.00 ? 67  ARG A C    1  
ATOM 1069  O O    . ARG A 1 67  ? 16.426  -9.917  -11.353 1.00 0.00 ? 67  ARG A O    1  
ATOM 1070  C CB   . ARG A 1 67  ? 15.877  -12.511 -12.422 1.00 0.00 ? 67  ARG A CB   1  
ATOM 1071  C CG   . ARG A 1 67  ? 16.928  -13.609 -12.402 1.00 0.00 ? 67  ARG A CG   1  
ATOM 1072  C CD   . ARG A 1 67  ? 16.305  -14.971 -12.141 1.00 0.00 ? 67  ARG A CD   1  
ATOM 1073  N NE   . ARG A 1 67  ? 15.934  -15.144 -10.739 1.00 0.00 ? 67  ARG A NE   1  
ATOM 1074  C CZ   . ARG A 1 67  ? 14.993  -15.986 -10.326 1.00 0.00 ? 67  ARG A CZ   1  
ATOM 1075  N NH1  . ARG A 1 67  ? 14.332  -16.729 -11.204 1.00 0.00 ? 67  ARG A NH1  1  
ATOM 1076  N NH2  . ARG A 1 67  ? 14.713  -16.087 -9.033  1.00 0.00 ? 67  ARG A NH2  1  
ATOM 1077  H H    . ARG A 1 67  ? 13.544  -11.593 -11.880 1.00 0.00 ? 67  ARG A H    1  
ATOM 1078  H HA   . ARG A 1 67  ? 15.598  -12.880 -10.332 1.00 0.00 ? 67  ARG A HA   1  
ATOM 1079  H HB2  . ARG A 1 67  ? 15.020  -12.873 -12.971 1.00 0.00 ? 67  ARG A HB2  1  
ATOM 1080  H HB3  . ARG A 1 67  ? 16.290  -11.657 -12.937 1.00 0.00 ? 67  ARG A HB3  1  
ATOM 1081  H HG2  . ARG A 1 67  ? 17.429  -13.632 -13.359 1.00 0.00 ? 67  ARG A HG2  1  
ATOM 1082  H HG3  . ARG A 1 67  ? 17.644  -13.395 -11.623 1.00 0.00 ? 67  ARG A HG3  1  
ATOM 1083  H HD2  . ARG A 1 67  ? 15.420  -15.071 -12.753 1.00 0.00 ? 67  ARG A HD2  1  
ATOM 1084  H HD3  . ARG A 1 67  ? 17.017  -15.736 -12.413 1.00 0.00 ? 67  ARG A HD3  1  
ATOM 1085  H HE   . ARG A 1 67  ? 16.410  -14.605 -10.074 1.00 0.00 ? 67  ARG A HE   1  
ATOM 1086  H HH11 . ARG A 1 67  ? 14.542  -16.656 -12.178 1.00 0.00 ? 67  ARG A HH11 1  
ATOM 1087  H HH12 . ARG A 1 67  ? 13.625  -17.363 -10.890 1.00 0.00 ? 67  ARG A HH12 1  
ATOM 1088  H HH21 . ARG A 1 67  ? 15.209  -15.529 -8.369  1.00 0.00 ? 67  ARG A HH21 1  
ATOM 1089  H HH22 . ARG A 1 67  ? 14.004  -16.721 -8.724  1.00 0.00 ? 67  ARG A HH22 1  
ATOM 1090  N N    . GLU A 1 68  ? 16.666  -10.871 -9.328  1.00 0.00 ? 68  GLU A N    1  
ATOM 1091  C CA   . GLU A 1 68  ? 17.441  -9.765  -8.778  1.00 0.00 ? 68  GLU A CA   1  
ATOM 1092  C C    . GLU A 1 68  ? 18.892  -9.832  -9.244  1.00 0.00 ? 68  GLU A C    1  
ATOM 1093  O O    . GLU A 1 68  ? 19.616  -10.773 -8.922  1.00 0.00 ? 68  GLU A O    1  
ATOM 1094  C CB   . GLU A 1 68  ? 17.383  -9.783  -7.249  1.00 0.00 ? 68  GLU A CB   1  
ATOM 1095  C CG   . GLU A 1 68  ? 17.771  -8.461  -6.609  1.00 0.00 ? 68  GLU A CG   1  
ATOM 1096  C CD   . GLU A 1 68  ? 17.844  -8.544  -5.097  1.00 0.00 ? 68  GLU A CD   1  
ATOM 1097  O OE1  . GLU A 1 68  ? 16.923  -9.128  -4.489  1.00 0.00 ? 68  GLU A OE1  1  
ATOM 1098  O OE2  . GLU A 1 68  ? 18.823  -8.024  -4.521  1.00 0.00 ? 68  GLU A OE2  1  
ATOM 1099  H H    . GLU A 1 68  ? 16.469  -11.645 -8.761  1.00 0.00 ? 68  GLU A H    1  
ATOM 1100  H HA   . GLU A 1 68  ? 17.003  -8.844  -9.134  1.00 0.00 ? 68  GLU A HA   1  
ATOM 1101  H HB2  . GLU A 1 68  ? 16.377  -10.027 -6.942  1.00 0.00 ? 68  GLU A HB2  1  
ATOM 1102  H HB3  . GLU A 1 68  ? 18.056  -10.546 -6.885  1.00 0.00 ? 68  GLU A HB3  1  
ATOM 1103  H HG2  . GLU A 1 68  ? 18.739  -8.164  -6.985  1.00 0.00 ? 68  GLU A HG2  1  
ATOM 1104  H HG3  . GLU A 1 68  ? 17.038  -7.716  -6.880  1.00 0.00 ? 68  GLU A HG3  1  
ATOM 1105  N N    . GLY A 1 69  ? 19.311  -8.826  -10.006 1.00 0.00 ? 69  GLY A N    1  
ATOM 1106  C CA   . GLY A 1 69  ? 20.673  -8.789  -10.505 1.00 0.00 ? 69  GLY A CA   1  
ATOM 1107  C C    . GLY A 1 69  ? 20.754  -9.084  -11.990 1.00 0.00 ? 69  GLY A C    1  
ATOM 1108  O O    . GLY A 1 69  ? 21.480  -8.412  -12.724 1.00 0.00 ? 69  GLY A O    1  
ATOM 1109  H H    . GLY A 1 69  ? 18.689  -8.102  -10.231 1.00 0.00 ? 69  GLY A H    1  
ATOM 1110  H HA2  . GLY A 1 69  ? 21.086  -7.809  -10.320 1.00 0.00 ? 69  GLY A HA2  1  
ATOM 1111  H HA3  . GLY A 1 69  ? 21.259  -9.523  -9.972  1.00 0.00 ? 69  GLY A HA3  1  
ATOM 1112  N N    . ILE A 1 70  ? 20.010  -10.092 -12.433 1.00 0.00 ? 70  ILE A N    1  
ATOM 1113  C CA   . ILE A 1 70  ? 20.002  -10.474 -13.840 1.00 0.00 ? 70  ILE A CA   1  
ATOM 1114  C C    . ILE A 1 70  ? 18.984  -9.655  -14.626 1.00 0.00 ? 70  ILE A C    1  
ATOM 1115  O O    . ILE A 1 70  ? 19.331  -8.974  -15.591 1.00 0.00 ? 70  ILE A O    1  
ATOM 1116  C CB   . ILE A 1 70  ? 19.686  -11.971 -14.015 1.00 0.00 ? 70  ILE A CB   1  
ATOM 1117  C CG1  . ILE A 1 70  ? 20.494  -12.805 -13.019 1.00 0.00 ? 70  ILE A CG1  1  
ATOM 1118  C CG2  . ILE A 1 70  ? 19.977  -12.411 -15.442 1.00 0.00 ? 70  ILE A CG2  1  
ATOM 1119  C CD1  . ILE A 1 70  ? 20.263  -14.294 -13.150 1.00 0.00 ? 70  ILE A CD1  1  
ATOM 1120  H H    . ILE A 1 70  ? 19.452  -10.589 -11.799 1.00 0.00 ? 70  ILE A H    1  
ATOM 1121  H HA   . ILE A 1 70  ? 20.987  -10.285 -14.242 1.00 0.00 ? 70  ILE A HA   1  
ATOM 1122  H HB   . ILE A 1 70  ? 18.633  -12.118 -13.826 1.00 0.00 ? 70  ILE A HB   1  
ATOM 1123  H HG12 . ILE A 1 70  ? 21.545  -12.618 -13.172 1.00 0.00 ? 70  ILE A HG12 1  
ATOM 1124  H HG13 . ILE A 1 70  ? 20.224  -12.514 -12.014 1.00 0.00 ? 70  ILE A HG13 1  
ATOM 1125  H HG21 . ILE A 1 70  ? 19.509  -11.725 -16.132 1.00 0.00 ? 70  ILE A HG21 1  
ATOM 1126  H HG22 . ILE A 1 70  ? 21.044  -12.413 -15.606 1.00 0.00 ? 70  ILE A HG22 1  
ATOM 1127  H HG23 . ILE A 1 70  ? 19.586  -13.404 -15.600 1.00 0.00 ? 70  ILE A HG23 1  
ATOM 1128  H HD11 . ILE A 1 70  ? 19.235  -14.477 -13.426 1.00 0.00 ? 70  ILE A HD11 1  
ATOM 1129  H HD12 . ILE A 1 70  ? 20.917  -14.695 -13.910 1.00 0.00 ? 70  ILE A HD12 1  
ATOM 1130  H HD13 . ILE A 1 70  ? 20.472  -14.775 -12.206 1.00 0.00 ? 70  ILE A HD13 1  
ATOM 1131  N N    . ASP A 1 71  ? 17.725  -9.726  -14.206 1.00 0.00 ? 71  ASP A N    1  
ATOM 1132  C CA   . ASP A 1 71  ? 16.656  -8.989  -14.869 1.00 0.00 ? 71  ASP A CA   1  
ATOM 1133  C C    . ASP A 1 71  ? 16.596  -7.549  -14.367 1.00 0.00 ? 71  ASP A C    1  
ATOM 1134  O O    . ASP A 1 71  ? 16.643  -7.297  -13.163 1.00 0.00 ? 71  ASP A O    1  
ATOM 1135  C CB   . ASP A 1 71  ? 15.311  -9.680  -14.636 1.00 0.00 ? 71  ASP A CB   1  
ATOM 1136  C CG   . ASP A 1 71  ? 15.206  -11.003 -15.367 1.00 0.00 ? 71  ASP A CG   1  
ATOM 1137  O OD1  . ASP A 1 71  ? 16.083  -11.867 -15.159 1.00 0.00 ? 71  ASP A OD1  1  
ATOM 1138  O OD2  . ASP A 1 71  ? 14.246  -11.176 -16.147 1.00 0.00 ? 71  ASP A OD2  1  
ATOM 1139  H H    . ASP A 1 71  ? 17.511  -10.286 -13.431 1.00 0.00 ? 71  ASP A H    1  
ATOM 1140  H HA   . ASP A 1 71  ? 16.866  -8.979  -15.928 1.00 0.00 ? 71  ASP A HA   1  
ATOM 1141  H HB2  . ASP A 1 71  ? 15.186  -9.863  -13.578 1.00 0.00 ? 71  ASP A HB2  1  
ATOM 1142  H HB3  . ASP A 1 71  ? 14.517  -9.034  -14.981 1.00 0.00 ? 71  ASP A HB3  1  
ATOM 1143  N N    . LYS A 1 72  ? 16.492  -6.608  -15.299 1.00 0.00 ? 72  LYS A N    1  
ATOM 1144  C CA   . LYS A 1 72  ? 16.426  -5.193  -14.953 1.00 0.00 ? 72  LYS A CA   1  
ATOM 1145  C C    . LYS A 1 72  ? 15.147  -4.880  -14.184 1.00 0.00 ? 72  LYS A C    1  
ATOM 1146  O O    . LYS A 1 72  ? 14.035  -5.091  -14.668 1.00 0.00 ? 72  LYS A O    1  
ATOM 1147  C CB   . LYS A 1 72  ? 16.495  -4.334  -16.218 1.00 0.00 ? 72  LYS A CB   1  
ATOM 1148  C CG   . LYS A 1 72  ? 17.088  -2.955  -15.985 1.00 0.00 ? 72  LYS A CG   1  
ATOM 1149  C CD   . LYS A 1 72  ? 16.043  -1.978  -15.473 1.00 0.00 ? 72  LYS A CD   1  
ATOM 1150  C CE   . LYS A 1 72  ? 16.505  -0.537  -15.628 1.00 0.00 ? 72  LYS A CE   1  
ATOM 1151  N NZ   . LYS A 1 72  ? 17.572  -0.188  -14.650 1.00 0.00 ? 72  LYS A NZ   1  
ATOM 1152  H H    . LYS A 1 72  ? 16.459  -6.871  -16.243 1.00 0.00 ? 72  LYS A H    1  
ATOM 1153  H HA   . LYS A 1 72  ? 17.274  -4.964  -14.326 1.00 0.00 ? 72  LYS A HA   1  
ATOM 1154  H HB2  . LYS A 1 72  ? 17.101  -4.844  -16.952 1.00 0.00 ? 72  LYS A HB2  1  
ATOM 1155  H HB3  . LYS A 1 72  ? 15.496  -4.211  -16.611 1.00 0.00 ? 72  LYS A HB3  1  
ATOM 1156  H HG2  . LYS A 1 72  ? 17.881  -3.032  -15.256 1.00 0.00 ? 72  LYS A HG2  1  
ATOM 1157  H HG3  . LYS A 1 72  ? 17.490  -2.584  -16.917 1.00 0.00 ? 72  LYS A HG3  1  
ATOM 1158  H HD2  . LYS A 1 72  ? 15.131  -2.113  -16.034 1.00 0.00 ? 72  LYS A HD2  1  
ATOM 1159  H HD3  . LYS A 1 72  ? 15.858  -2.177  -14.427 1.00 0.00 ? 72  LYS A HD3  1  
ATOM 1160  H HE2  . LYS A 1 72  ? 16.887  -0.400  -16.628 1.00 0.00 ? 72  LYS A HE2  1  
ATOM 1161  H HE3  . LYS A 1 72  ? 15.659  0.117   -15.473 1.00 0.00 ? 72  LYS A HE3  1  
ATOM 1162  H HZ1  . LYS A 1 72  ? 17.721  0.841   -14.636 1.00 0.00 ? 72  LYS A HZ1  1  
ATOM 1163  H HZ2  . LYS A 1 72  ? 18.464  -0.652  -14.914 1.00 0.00 ? 72  LYS A HZ2  1  
ATOM 1164  H HZ3  . LYS A 1 72  ? 17.300  -0.501  -13.697 1.00 0.00 ? 72  LYS A HZ3  1  
ATOM 1165  N N    . PRO A 1 73  ? 15.305  -4.364  -12.956 1.00 0.00 ? 73  PRO A N    1  
ATOM 1166  C CA   . PRO A 1 73  ? 14.173  -4.009  -12.094 1.00 0.00 ? 73  PRO A CA   1  
ATOM 1167  C C    . PRO A 1 73  ? 13.408  -2.796  -12.612 1.00 0.00 ? 73  PRO A C    1  
ATOM 1168  O O    . PRO A 1 73  ? 13.956  -1.969  -13.340 1.00 0.00 ? 73  PRO A O    1  
ATOM 1169  C CB   . PRO A 1 73  ? 14.836  -3.690  -10.752 1.00 0.00 ? 73  PRO A CB   1  
ATOM 1170  C CG   . PRO A 1 73  ? 16.224  -3.279  -11.103 1.00 0.00 ? 73  PRO A CG   1  
ATOM 1171  C CD   . PRO A 1 73  ? 16.601  -4.086  -12.315 1.00 0.00 ? 73  PRO A CD   1  
ATOM 1172  H HA   . PRO A 1 73  ? 13.492  -4.839  -11.973 1.00 0.00 ? 73  PRO A HA   1  
ATOM 1173  H HB2  . PRO A 1 73  ? 14.298  -2.890  -10.263 1.00 0.00 ? 73  PRO A HB2  1  
ATOM 1174  H HB3  . PRO A 1 73  ? 14.831  -4.569  -10.126 1.00 0.00 ? 73  PRO A HB3  1  
ATOM 1175  H HG2  . PRO A 1 73  ? 16.248  -2.224  -11.332 1.00 0.00 ? 73  PRO A HG2  1  
ATOM 1176  H HG3  . PRO A 1 73  ? 16.891  -3.501  -10.283 1.00 0.00 ? 73  PRO A HG3  1  
ATOM 1177  H HD2  . PRO A 1 73  ? 17.239  -3.509  -12.968 1.00 0.00 ? 73  PRO A HD2  1  
ATOM 1178  H HD3  . PRO A 1 73  ? 17.089  -5.003  -12.020 1.00 0.00 ? 73  PRO A HD3  1  
ATOM 1179  N N    . ASP A 1 74  ? 12.139  -2.697  -12.232 1.00 0.00 ? 74  ASP A N    1  
ATOM 1180  C CA   . ASP A 1 74  ? 11.298  -1.584  -12.657 1.00 0.00 ? 74  ASP A CA   1  
ATOM 1181  C C    . ASP A 1 74  ? 10.250  -1.258  -11.597 1.00 0.00 ? 74  ASP A C    1  
ATOM 1182  O O    . ASP A 1 74  ? 9.239   -1.946  -11.458 1.00 0.00 ? 74  ASP A O    1  
ATOM 1183  C CB   . ASP A 1 74  ? 10.614  -1.912  -13.985 1.00 0.00 ? 74  ASP A CB   1  
ATOM 1184  C CG   . ASP A 1 74  ? 11.607  -2.139  -15.108 1.00 0.00 ? 74  ASP A CG   1  
ATOM 1185  O OD1  . ASP A 1 74  ? 12.241  -3.215  -15.131 1.00 0.00 ? 74  ASP A OD1  1  
ATOM 1186  O OD2  . ASP A 1 74  ? 11.750  -1.242  -15.964 1.00 0.00 ? 74  ASP A OD2  1  
ATOM 1187  H H    . ASP A 1 74  ? 11.758  -3.389  -11.651 1.00 0.00 ? 74  ASP A H    1  
ATOM 1188  H HA   . ASP A 1 74  ? 11.934  -0.722  -12.794 1.00 0.00 ? 74  ASP A HA   1  
ATOM 1189  H HB2  . ASP A 1 74  ? 10.022  -2.808  -13.866 1.00 0.00 ? 74  ASP A HB2  1  
ATOM 1190  H HB3  . ASP A 1 74  ? 9.967   -1.092  -14.261 1.00 0.00 ? 74  ASP A HB3  1  
ATOM 1191  N N    . PRO A 1 75  ? 10.497  -0.186  -10.831 1.00 0.00 ? 75  PRO A N    1  
ATOM 1192  C CA   . PRO A 1 75  ? 9.586   0.255   -9.770  1.00 0.00 ? 75  PRO A CA   1  
ATOM 1193  C C    . PRO A 1 75  ? 8.137   0.321   -10.240 1.00 0.00 ? 75  PRO A C    1  
ATOM 1194  O O    . PRO A 1 75  ? 7.214   -0.103  -9.544  1.00 0.00 ? 75  PRO A O    1  
ATOM 1195  C CB   . PRO A 1 75  ? 10.100  1.654   -9.420  1.00 0.00 ? 75  PRO A CB   1  
ATOM 1196  C CG   . PRO A 1 75  ? 11.542  1.633   -9.794  1.00 0.00 ? 75  PRO A CG   1  
ATOM 1197  C CD   . PRO A 1 75  ? 11.683  0.680   -10.941 1.00 0.00 ? 75  PRO A CD   1  
ATOM 1198  H HA   . PRO A 1 75  ? 9.653   -0.382  -8.900  1.00 0.00 ? 75  PRO A HA   1  
ATOM 1199  H HB2  . PRO A 1 75  ? 9.554   2.393   -9.989  1.00 0.00 ? 75  PRO A HB2  1  
ATOM 1200  H HB3  . PRO A 1 75  ? 9.969   1.836   -8.364  1.00 0.00 ? 75  PRO A HB3  1  
ATOM 1201  H HG2  . PRO A 1 75  ? 11.857  2.619   -10.097 1.00 0.00 ? 75  PRO A HG2  1  
ATOM 1202  H HG3  . PRO A 1 75  ? 12.133  1.288   -8.958  1.00 0.00 ? 75  PRO A HG3  1  
ATOM 1203  H HD2  . PRO A 1 75  ? 11.680  1.220   -11.877 1.00 0.00 ? 75  PRO A HD2  1  
ATOM 1204  H HD3  . PRO A 1 75  ? 12.591  0.104   -10.839 1.00 0.00 ? 75  PRO A HD3  1  
ATOM 1205  N N    . PRO A 1 76  ? 7.931   0.866   -11.448 1.00 0.00 ? 76  PRO A N    1  
ATOM 1206  C CA   . PRO A 1 76  ? 6.595   1.000   -12.038 1.00 0.00 ? 76  PRO A CA   1  
ATOM 1207  C C    . PRO A 1 76  ? 5.790   -0.292  -11.947 1.00 0.00 ? 76  PRO A C    1  
ATOM 1208  O O    . PRO A 1 76  ? 4.637   -0.288  -11.512 1.00 0.00 ? 76  PRO A O    1  
ATOM 1209  C CB   . PRO A 1 76  ? 6.887   1.346   -13.500 1.00 0.00 ? 76  PRO A CB   1  
ATOM 1210  C CG   . PRO A 1 76  ? 8.228   1.994   -13.476 1.00 0.00 ? 76  PRO A CG   1  
ATOM 1211  C CD   . PRO A 1 76  ? 8.985   1.392   -12.331 1.00 0.00 ? 76  PRO A CD   1  
ATOM 1212  H HA   . PRO A 1 76  ? 6.038   1.804   -11.580 1.00 0.00 ? 76  PRO A HA   1  
ATOM 1213  H HB2  . PRO A 1 76  ? 6.894   0.442   -14.092 1.00 0.00 ? 76  PRO A HB2  1  
ATOM 1214  H HB3  . PRO A 1 76  ? 6.130   2.021   -13.872 1.00 0.00 ? 76  PRO A HB3  1  
ATOM 1215  H HG2  . PRO A 1 76  ? 8.748   1.798   -14.401 1.00 0.00 ? 76  PRO A HG2  1  
ATOM 1216  H HG3  . PRO A 1 76  ? 8.119   3.058   -13.323 1.00 0.00 ? 76  PRO A HG3  1  
ATOM 1217  H HD2  . PRO A 1 76  ? 9.625   0.597   -12.685 1.00 0.00 ? 76  PRO A HD2  1  
ATOM 1218  H HD3  . PRO A 1 76  ? 9.565   2.151   -11.828 1.00 0.00 ? 76  PRO A HD3  1  
ATOM 1219  N N    . THR A 1 77  ? 6.402   -1.397  -12.361 1.00 0.00 ? 77  THR A N    1  
ATOM 1220  C CA   . THR A 1 77  ? 5.742   -2.695  -12.327 1.00 0.00 ? 77  THR A CA   1  
ATOM 1221  C C    . THR A 1 77  ? 5.318   -3.060  -10.909 1.00 0.00 ? 77  THR A C    1  
ATOM 1222  O O    . THR A 1 77  ? 4.189   -3.494  -10.681 1.00 0.00 ? 77  THR A O    1  
ATOM 1223  C CB   . THR A 1 77  ? 6.656   -3.806  -12.878 1.00 0.00 ? 77  THR A CB   1  
ATOM 1224  O OG1  . THR A 1 77  ? 7.006   -3.522  -14.237 1.00 0.00 ? 77  THR A OG1  1  
ATOM 1225  C CG2  . THR A 1 77  ? 5.971   -5.161  -12.797 1.00 0.00 ? 77  THR A CG2  1  
ATOM 1226  H H    . THR A 1 77  ? 7.321   -1.335  -12.697 1.00 0.00 ? 77  THR A H    1  
ATOM 1227  H HA   . THR A 1 77  ? 4.862   -2.639  -12.952 1.00 0.00 ? 77  THR A HA   1  
ATOM 1228  H HB   . THR A 1 77  ? 7.557   -3.838  -12.282 1.00 0.00 ? 77  THR A HB   1  
ATOM 1229  H HG1  . THR A 1 77  ? 6.886   -2.585  -14.410 1.00 0.00 ? 77  THR A HG1  1  
ATOM 1230  H HG21 . THR A 1 77  ? 5.909   -5.593  -13.785 1.00 0.00 ? 77  THR A HG21 1  
ATOM 1231  H HG22 . THR A 1 77  ? 4.976   -5.038  -12.395 1.00 0.00 ? 77  THR A HG22 1  
ATOM 1232  H HG23 . THR A 1 77  ? 6.541   -5.814  -12.154 1.00 0.00 ? 77  THR A HG23 1  
ATOM 1233  N N    . TRP A 1 78  ? 6.229   -2.879  -9.959  1.00 0.00 ? 78  TRP A N    1  
ATOM 1234  C CA   . TRP A 1 78  ? 5.948   -3.189  -8.562  1.00 0.00 ? 78  TRP A CA   1  
ATOM 1235  C C    . TRP A 1 78  ? 4.848   -2.285  -8.015  1.00 0.00 ? 78  TRP A C    1  
ATOM 1236  O O    . TRP A 1 78  ? 3.809   -2.762  -7.557  1.00 0.00 ? 78  TRP A O    1  
ATOM 1237  C CB   . TRP A 1 78  ? 7.215   -3.038  -7.720  1.00 0.00 ? 78  TRP A CB   1  
ATOM 1238  C CG   . TRP A 1 78  ? 8.344   -3.909  -8.183  1.00 0.00 ? 78  TRP A CG   1  
ATOM 1239  C CD1  . TRP A 1 78  ? 8.245   -5.160  -8.722  1.00 0.00 ? 78  TRP A CD1  1  
ATOM 1240  C CD2  . TRP A 1 78  ? 9.740   -3.595  -8.146  1.00 0.00 ? 78  TRP A CD2  1  
ATOM 1241  N NE1  . TRP A 1 78  ? 9.496   -5.642  -9.023  1.00 0.00 ? 78  TRP A NE1  1  
ATOM 1242  C CE2  . TRP A 1 78  ? 10.430  -4.701  -8.680  1.00 0.00 ? 78  TRP A CE2  1  
ATOM 1243  C CE3  . TRP A 1 78  ? 10.474  -2.486  -7.717  1.00 0.00 ? 78  TRP A CE3  1  
ATOM 1244  C CZ2  . TRP A 1 78  ? 11.818  -4.728  -8.793  1.00 0.00 ? 78  TRP A CZ2  1  
ATOM 1245  C CZ3  . TRP A 1 78  ? 11.851  -2.515  -7.829  1.00 0.00 ? 78  TRP A CZ3  1  
ATOM 1246  C CH2  . TRP A 1 78  ? 12.511  -3.629  -8.364  1.00 0.00 ? 78  TRP A CH2  1  
ATOM 1247  H H    . TRP A 1 78  ? 7.111   -2.530  -10.203 1.00 0.00 ? 78  TRP A H    1  
ATOM 1248  H HA   . TRP A 1 78  ? 5.613   -4.214  -8.511  1.00 0.00 ? 78  TRP A HA   1  
ATOM 1249  H HB2  . TRP A 1 78  ? 7.548   -2.011  -7.762  1.00 0.00 ? 78  TRP A HB2  1  
ATOM 1250  H HB3  . TRP A 1 78  ? 6.991   -3.298  -6.695  1.00 0.00 ? 78  TRP A HB3  1  
ATOM 1251  H HD1  . TRP A 1 78  ? 7.314   -5.682  -8.881  1.00 0.00 ? 78  TRP A HD1  1  
ATOM 1252  H HE1  . TRP A 1 78  ? 9.688   -6.518  -9.420  1.00 0.00 ? 78  TRP A HE1  1  
ATOM 1253  H HE3  . TRP A 1 78  ? 9.984   -1.618  -7.301  1.00 0.00 ? 78  TRP A HE3  1  
ATOM 1254  H HZ2  . TRP A 1 78  ? 12.341  -5.579  -9.203  1.00 0.00 ? 78  TRP A HZ2  1  
ATOM 1255  H HZ3  . TRP A 1 78  ? 12.435  -1.667  -7.501  1.00 0.00 ? 78  TRP A HZ3  1  
ATOM 1256  H HH2  . TRP A 1 78  ? 13.588  -3.608  -8.432  1.00 0.00 ? 78  TRP A HH2  1  
ATOM 1257  N N    . LYS A 1 79  ? 5.083   -0.978  -8.064  1.00 0.00 ? 79  LYS A N    1  
ATOM 1258  C CA   . LYS A 1 79  ? 4.112   -0.007  -7.575  1.00 0.00 ? 79  LYS A CA   1  
ATOM 1259  C C    . LYS A 1 79  ? 2.744   -0.238  -8.209  1.00 0.00 ? 79  LYS A C    1  
ATOM 1260  O O    . LYS A 1 79  ? 1.742   -0.392  -7.509  1.00 0.00 ? 79  LYS A O    1  
ATOM 1261  C CB   . LYS A 1 79  ? 4.590   1.416   -7.872  1.00 0.00 ? 79  LYS A CB   1  
ATOM 1262  C CG   . LYS A 1 79  ? 3.975   2.467   -6.963  1.00 0.00 ? 79  LYS A CG   1  
ATOM 1263  C CD   . LYS A 1 79  ? 4.264   3.873   -7.461  1.00 0.00 ? 79  LYS A CD   1  
ATOM 1264  C CE   . LYS A 1 79  ? 3.514   4.917   -6.648  1.00 0.00 ? 79  LYS A CE   1  
ATOM 1265  N NZ   . LYS A 1 79  ? 4.036   6.290   -6.893  1.00 0.00 ? 79  LYS A NZ   1  
ATOM 1266  H H    . LYS A 1 79  ? 5.931   -0.659  -8.441  1.00 0.00 ? 79  LYS A H    1  
ATOM 1267  H HA   . LYS A 1 79  ? 4.027   -0.133  -6.506  1.00 0.00 ? 79  LYS A HA   1  
ATOM 1268  H HB2  . LYS A 1 79  ? 5.663   1.455   -7.757  1.00 0.00 ? 79  LYS A HB2  1  
ATOM 1269  H HB3  . LYS A 1 79  ? 4.337   1.662   -8.894  1.00 0.00 ? 79  LYS A HB3  1  
ATOM 1270  H HG2  . LYS A 1 79  ? 2.905   2.321   -6.931  1.00 0.00 ? 79  LYS A HG2  1  
ATOM 1271  H HG3  . LYS A 1 79  ? 4.385   2.355   -5.970  1.00 0.00 ? 79  LYS A HG3  1  
ATOM 1272  H HD2  . LYS A 1 79  ? 5.324   4.063   -7.380  1.00 0.00 ? 79  LYS A HD2  1  
ATOM 1273  H HD3  . LYS A 1 79  ? 3.960   3.949   -8.496  1.00 0.00 ? 79  LYS A HD3  1  
ATOM 1274  H HE2  . LYS A 1 79  ? 2.470   4.884   -6.919  1.00 0.00 ? 79  LYS A HE2  1  
ATOM 1275  H HE3  . LYS A 1 79  ? 3.621   4.682   -5.599  1.00 0.00 ? 79  LYS A HE3  1  
ATOM 1276  H HZ1  . LYS A 1 79  ? 4.188   6.438   -7.911  1.00 0.00 ? 79  LYS A HZ1  1  
ATOM 1277  H HZ2  . LYS A 1 79  ? 4.939   6.423   -6.396  1.00 0.00 ? 79  LYS A HZ2  1  
ATOM 1278  H HZ3  . LYS A 1 79  ? 3.356   6.998   -6.549  1.00 0.00 ? 79  LYS A HZ3  1  
ATOM 1279  N N    . THR A 1 80  ? 2.709   -0.263  -9.537  1.00 0.00 ? 80  THR A N    1  
ATOM 1280  C CA   . THR A 1 80  ? 1.464   -0.476  -10.265 1.00 0.00 ? 80  THR A CA   1  
ATOM 1281  C C    . THR A 1 80  ? 0.806   -1.788  -9.856  1.00 0.00 ? 80  THR A C    1  
ATOM 1282  O O    . THR A 1 80  ? -0.390  -1.830  -9.567  1.00 0.00 ? 80  THR A O    1  
ATOM 1283  C CB   . THR A 1 80  ? 1.698   -0.484  -11.788 1.00 0.00 ? 80  THR A CB   1  
ATOM 1284  O OG1  . THR A 1 80  ? 2.384   0.709   -12.185 1.00 0.00 ? 80  THR A OG1  1  
ATOM 1285  C CG2  . THR A 1 80  ? 0.379   -0.590  -12.537 1.00 0.00 ? 80  THR A CG2  1  
ATOM 1286  H H    . THR A 1 80  ? 3.541   -0.134  -10.039 1.00 0.00 ? 80  THR A H    1  
ATOM 1287  H HA   . THR A 1 80  ? 0.796   0.340   -10.029 1.00 0.00 ? 80  THR A HA   1  
ATOM 1288  H HB   . THR A 1 80  ? 2.307   -1.341  -12.038 1.00 0.00 ? 80  THR A HB   1  
ATOM 1289  H HG1  . THR A 1 80  ? 2.377   0.778   -13.142 1.00 0.00 ? 80  THR A HG1  1  
ATOM 1290  H HG21 . THR A 1 80  ? -0.433  -0.317  -11.879 1.00 0.00 ? 80  THR A HG21 1  
ATOM 1291  H HG22 . THR A 1 80  ? 0.239   -1.605  -12.878 1.00 0.00 ? 80  THR A HG22 1  
ATOM 1292  H HG23 . THR A 1 80  ? 0.393   0.076   -13.386 1.00 0.00 ? 80  THR A HG23 1  
ATOM 1293  N N    . ARG A 1 81  ? 1.594   -2.858  -9.834  1.00 0.00 ? 81  ARG A N    1  
ATOM 1294  C CA   . ARG A 1 81  ? 1.087   -4.173  -9.460  1.00 0.00 ? 81  ARG A CA   1  
ATOM 1295  C C    . ARG A 1 81  ? 0.359   -4.115  -8.120  1.00 0.00 ? 81  ARG A C    1  
ATOM 1296  O O    . ARG A 1 81  ? -0.809  -4.490  -8.019  1.00 0.00 ? 81  ARG A O    1  
ATOM 1297  C CB   . ARG A 1 81  ? 2.233   -5.184  -9.387  1.00 0.00 ? 81  ARG A CB   1  
ATOM 1298  C CG   . ARG A 1 81  ? 2.573   -5.817  -10.726 1.00 0.00 ? 81  ARG A CG   1  
ATOM 1299  C CD   . ARG A 1 81  ? 1.882   -7.160  -10.899 1.00 0.00 ? 81  ARG A CD   1  
ATOM 1300  N NE   . ARG A 1 81  ? 0.430   -7.048  -10.779 1.00 0.00 ? 81  ARG A NE   1  
ATOM 1301  C CZ   . ARG A 1 81  ? -0.423  -7.851  -11.405 1.00 0.00 ? 81  ARG A CZ   1  
ATOM 1302  N NH1  . ARG A 1 81  ? 0.028   -8.820  -12.190 1.00 0.00 ? 81  ARG A NH1  1  
ATOM 1303  N NH2  . ARG A 1 81  ? -1.730  -7.686  -11.245 1.00 0.00 ? 81  ARG A NH2  1  
ATOM 1304  H H    . ARG A 1 81  ? 2.539   -2.762  -10.075 1.00 0.00 ? 81  ARG A H    1  
ATOM 1305  H HA   . ARG A 1 81  ? 0.389   -4.488  -10.222 1.00 0.00 ? 81  ARG A HA   1  
ATOM 1306  H HB2  . ARG A 1 81  ? 3.115   -4.684  -9.016  1.00 0.00 ? 81  ARG A HB2  1  
ATOM 1307  H HB3  . ARG A 1 81  ? 1.959   -5.971  -8.701  1.00 0.00 ? 81  ARG A HB3  1  
ATOM 1308  H HG2  . ARG A 1 81  ? 2.254   -5.155  -11.518 1.00 0.00 ? 81  ARG A HG2  1  
ATOM 1309  H HG3  . ARG A 1 81  ? 3.642   -5.961  -10.784 1.00 0.00 ? 81  ARG A HG3  1  
ATOM 1310  H HD2  . ARG A 1 81  ? 2.123   -7.551  -11.876 1.00 0.00 ? 81  ARG A HD2  1  
ATOM 1311  H HD3  . ARG A 1 81  ? 2.245   -7.837  -10.141 1.00 0.00 ? 81  ARG A HD3  1  
ATOM 1312  H HE   . ARG A 1 81  ? 0.076   -6.339  -10.204 1.00 0.00 ? 81  ARG A HE   1  
ATOM 1313  H HH11 . ARG A 1 81  ? 1.012   -8.947  -12.311 1.00 0.00 ? 81  ARG A HH11 1  
ATOM 1314  H HH12 . ARG A 1 81  ? -0.617  -9.424  -12.659 1.00 0.00 ? 81  ARG A HH12 1  
ATOM 1315  H HH21 . ARG A 1 81  ? -2.073  -6.957  -10.654 1.00 0.00 ? 81  ARG A HH21 1  
ATOM 1316  H HH22 . ARG A 1 81  ? -2.371  -8.291  -11.716 1.00 0.00 ? 81  ARG A HH22 1  
ATOM 1317  N N    . LEU A 1 82  ? 1.058   -3.642  -7.094  1.00 0.00 ? 82  LEU A N    1  
ATOM 1318  C CA   . LEU A 1 82  ? 0.480   -3.535  -5.759  1.00 0.00 ? 82  LEU A CA   1  
ATOM 1319  C C    . LEU A 1 82  ? -0.637  -2.497  -5.731  1.00 0.00 ? 82  LEU A C    1  
ATOM 1320  O O    . LEU A 1 82  ? -1.793  -2.822  -5.460  1.00 0.00 ? 82  LEU A O    1  
ATOM 1321  C CB   . LEU A 1 82  ? 1.561   -3.165  -4.742  1.00 0.00 ? 82  LEU A CB   1  
ATOM 1322  C CG   . LEU A 1 82  ? 1.164   -3.279  -3.269  1.00 0.00 ? 82  LEU A CG   1  
ATOM 1323  C CD1  . LEU A 1 82  ? 0.777   -4.710  -2.929  1.00 0.00 ? 82  LEU A CD1  1  
ATOM 1324  C CD2  . LEU A 1 82  ? 2.298   -2.803  -2.373  1.00 0.00 ? 82  LEU A CD2  1  
ATOM 1325  H H    . LEU A 1 82  ? 1.985   -3.359  -7.236  1.00 0.00 ? 82  LEU A H    1  
ATOM 1326  H HA   . LEU A 1 82  ? 0.066   -4.498  -5.499  1.00 0.00 ? 82  LEU A HA   1  
ATOM 1327  H HB2  . LEU A 1 82  ? 2.406   -3.815  -4.907  1.00 0.00 ? 82  LEU A HB2  1  
ATOM 1328  H HB3  . LEU A 1 82  ? 1.853   -2.142  -4.929  1.00 0.00 ? 82  LEU A HB3  1  
ATOM 1329  H HG   . LEU A 1 82  ? 0.304   -2.649  -3.085  1.00 0.00 ? 82  LEU A HG   1  
ATOM 1330  H HD11 . LEU A 1 82  ? 1.628   -5.357  -3.079  1.00 0.00 ? 82  LEU A HD11 1  
ATOM 1331  H HD12 . LEU A 1 82  ? -0.033  -5.025  -3.570  1.00 0.00 ? 82  LEU A HD12 1  
ATOM 1332  H HD13 . LEU A 1 82  ? 0.461   -4.762  -1.898  1.00 0.00 ? 82  LEU A HD13 1  
ATOM 1333  H HD21 . LEU A 1 82  ? 2.279   -3.357  -1.446  1.00 0.00 ? 82  LEU A HD21 1  
ATOM 1334  H HD22 . LEU A 1 82  ? 2.175   -1.750  -2.165  1.00 0.00 ? 82  LEU A HD22 1  
ATOM 1335  H HD23 . LEU A 1 82  ? 3.242   -2.965  -2.871  1.00 0.00 ? 82  LEU A HD23 1  
ATOM 1336  N N    . ARG A 1 83  ? -0.284  -1.248  -6.016  1.00 0.00 ? 83  ARG A N    1  
ATOM 1337  C CA   . ARG A 1 83  ? -1.257  -0.162  -6.024  1.00 0.00 ? 83  ARG A CA   1  
ATOM 1338  C C    . ARG A 1 83  ? -2.581  -0.623  -6.625  1.00 0.00 ? 83  ARG A C    1  
ATOM 1339  O O    . ARG A 1 83  ? -3.654  -0.284  -6.124  1.00 0.00 ? 83  ARG A O    1  
ATOM 1340  C CB   . ARG A 1 83  ? -0.714  1.031   -6.814  1.00 0.00 ? 83  ARG A CB   1  
ATOM 1341  C CG   . ARG A 1 83  ? -1.736  2.136   -7.026  1.00 0.00 ? 83  ARG A CG   1  
ATOM 1342  C CD   . ARG A 1 83  ? -1.122  3.334   -7.734  1.00 0.00 ? 83  ARG A CD   1  
ATOM 1343  N NE   . ARG A 1 83  ? -1.781  4.584   -7.366  1.00 0.00 ? 83  ARG A NE   1  
ATOM 1344  C CZ   . ARG A 1 83  ? -1.527  5.749   -7.952  1.00 0.00 ? 83  ARG A CZ   1  
ATOM 1345  N NH1  . ARG A 1 83  ? -0.633  5.822   -8.929  1.00 0.00 ? 83  ARG A NH1  1  
ATOM 1346  N NH2  . ARG A 1 83  ? -2.168  6.843   -7.561  1.00 0.00 ? 83  ARG A NH2  1  
ATOM 1347  H H    . ARG A 1 83  ? 0.653   -1.051  -6.224  1.00 0.00 ? 83  ARG A H    1  
ATOM 1348  H HA   . ARG A 1 83  ? -1.425  0.141   -5.002  1.00 0.00 ? 83  ARG A HA   1  
ATOM 1349  H HB2  . ARG A 1 83  ? 0.128   1.447   -6.282  1.00 0.00 ? 83  ARG A HB2  1  
ATOM 1350  H HB3  . ARG A 1 83  ? -0.384  0.686   -7.782  1.00 0.00 ? 83  ARG A HB3  1  
ATOM 1351  H HG2  . ARG A 1 83  ? -2.547  1.754   -7.627  1.00 0.00 ? 83  ARG A HG2  1  
ATOM 1352  H HG3  . ARG A 1 83  ? -2.115  2.452   -6.065  1.00 0.00 ? 83  ARG A HG3  1  
ATOM 1353  H HD2  . ARG A 1 83  ? -0.078  3.397   -7.467  1.00 0.00 ? 83  ARG A HD2  1  
ATOM 1354  H HD3  . ARG A 1 83  ? -1.213  3.190   -8.800  1.00 0.00 ? 83  ARG A HD3  1  
ATOM 1355  H HE   . ARG A 1 83  ? -2.445  4.553   -6.646  1.00 0.00 ? 83  ARG A HE   1  
ATOM 1356  H HH11 . ARG A 1 83  ? -0.150  4.999   -9.226  1.00 0.00 ? 83  ARG A HH11 1  
ATOM 1357  H HH12 . ARG A 1 83  ? -0.445  6.700   -9.369  1.00 0.00 ? 83  ARG A HH12 1  
ATOM 1358  H HH21 . ARG A 1 83  ? -2.842  6.792   -6.825  1.00 0.00 ? 83  ARG A HH21 1  
ATOM 1359  H HH22 . ARG A 1 83  ? -1.976  7.719   -8.003  1.00 0.00 ? 83  ARG A HH22 1  
ATOM 1360  N N    . CYS A 1 84  ? -2.499  -1.398  -7.702  1.00 0.00 ? 84  CYS A N    1  
ATOM 1361  C CA   . CYS A 1 84  ? -3.691  -1.905  -8.372  1.00 0.00 ? 84  CYS A CA   1  
ATOM 1362  C C    . CYS A 1 84  ? -4.404  -2.938  -7.506  1.00 0.00 ? 84  CYS A C    1  
ATOM 1363  O O    . CYS A 1 84  ? -5.616  -2.866  -7.308  1.00 0.00 ? 84  CYS A O    1  
ATOM 1364  C CB   . CYS A 1 84  ? -3.319  -2.522  -9.721  1.00 0.00 ? 84  CYS A CB   1  
ATOM 1365  S SG   . CYS A 1 84  ? -4.665  -2.526  -10.927 1.00 0.00 ? 84  CYS A SG   1  
ATOM 1366  H H    . CYS A 1 84  ? -1.615  -1.634  -8.055  1.00 0.00 ? 84  CYS A H    1  
ATOM 1367  H HA   . CYS A 1 84  ? -4.356  -1.071  -8.538  1.00 0.00 ? 84  CYS A HA   1  
ATOM 1368  H HB2  . CYS A 1 84  ? -2.497  -1.966  -10.149 1.00 0.00 ? 84  CYS A HB2  1  
ATOM 1369  H HB3  . CYS A 1 84  ? -3.010  -3.545  -9.567  1.00 0.00 ? 84  CYS A HB3  1  
ATOM 1370  H HG   . CYS A 1 84  ? -5.705  -3.135  -10.377 1.00 0.00 ? 84  CYS A HG   1  
ATOM 1371  N N    . ALA A 1 85  ? -3.643  -3.899  -6.993  1.00 0.00 ? 85  ALA A N    1  
ATOM 1372  C CA   . ALA A 1 85  ? -4.202  -4.947  -6.147  1.00 0.00 ? 85  ALA A CA   1  
ATOM 1373  C C    . ALA A 1 85  ? -4.907  -4.354  -4.933  1.00 0.00 ? 85  ALA A C    1  
ATOM 1374  O O    . ALA A 1 85  ? -6.009  -4.773  -4.576  1.00 0.00 ? 85  ALA A O    1  
ATOM 1375  C CB   . ALA A 1 85  ? -3.108  -5.909  -5.708  1.00 0.00 ? 85  ALA A CB   1  
ATOM 1376  H H    . ALA A 1 85  ? -2.682  -3.903  -7.186  1.00 0.00 ? 85  ALA A H    1  
ATOM 1377  H HA   . ALA A 1 85  ? -4.921  -5.501  -6.734  1.00 0.00 ? 85  ALA A HA   1  
ATOM 1378  H HB1  . ALA A 1 85  ? -2.652  -5.543  -4.799  1.00 0.00 ? 85  ALA A HB1  1  
ATOM 1379  H HB2  . ALA A 1 85  ? -3.538  -6.883  -5.528  1.00 0.00 ? 85  ALA A HB2  1  
ATOM 1380  H HB3  . ALA A 1 85  ? -2.360  -5.982  -6.483  1.00 0.00 ? 85  ALA A HB3  1  
ATOM 1381  N N    . LEU A 1 86  ? -4.266  -3.377  -4.300  1.00 0.00 ? 86  LEU A N    1  
ATOM 1382  C CA   . LEU A 1 86  ? -4.833  -2.726  -3.124  1.00 0.00 ? 86  LEU A CA   1  
ATOM 1383  C C    . LEU A 1 86  ? -6.283  -2.322  -3.370  1.00 0.00 ? 86  LEU A C    1  
ATOM 1384  O O    . LEU A 1 86  ? -7.155  -2.566  -2.538  1.00 0.00 ? 86  LEU A O    1  
ATOM 1385  C CB   . LEU A 1 86  ? -4.005  -1.496  -2.749  1.00 0.00 ? 86  LEU A CB   1  
ATOM 1386  C CG   . LEU A 1 86  ? -4.256  -0.916  -1.357  1.00 0.00 ? 86  LEU A CG   1  
ATOM 1387  C CD1  . LEU A 1 86  ? -3.849  -1.913  -0.283  1.00 0.00 ? 86  LEU A CD1  1  
ATOM 1388  C CD2  . LEU A 1 86  ? -3.505  0.396   -1.182  1.00 0.00 ? 86  LEU A CD2  1  
ATOM 1389  H H    . LEU A 1 86  ? -3.392  -3.086  -4.631  1.00 0.00 ? 86  LEU A H    1  
ATOM 1390  H HA   . LEU A 1 86  ? -4.802  -3.433  -2.308  1.00 0.00 ? 86  LEU A HA   1  
ATOM 1391  H HB2  . LEU A 1 86  ? -2.962  -1.767  -2.811  1.00 0.00 ? 86  LEU A HB2  1  
ATOM 1392  H HB3  . LEU A 1 86  ? -4.217  -0.722  -3.474  1.00 0.00 ? 86  LEU A HB3  1  
ATOM 1393  H HG   . LEU A 1 86  ? -5.313  -0.716  -1.242  1.00 0.00 ? 86  LEU A HG   1  
ATOM 1394  H HD11 . LEU A 1 86  ? -4.704  -2.148  0.333   1.00 0.00 ? 86  LEU A HD11 1  
ATOM 1395  H HD12 . LEU A 1 86  ? -3.071  -1.483  0.331   1.00 0.00 ? 86  LEU A HD12 1  
ATOM 1396  H HD13 . LEU A 1 86  ? -3.482  -2.815  -0.749  1.00 0.00 ? 86  LEU A HD13 1  
ATOM 1397  H HD21 . LEU A 1 86  ? -3.983  0.983   -0.411  1.00 0.00 ? 86  LEU A HD21 1  
ATOM 1398  H HD22 . LEU A 1 86  ? -3.518  0.945   -2.112  1.00 0.00 ? 86  LEU A HD22 1  
ATOM 1399  H HD23 . LEU A 1 86  ? -2.484  0.191   -0.897  1.00 0.00 ? 86  LEU A HD23 1  
ATOM 1400  N N    . ASN A 1 87  ? -6.532  -1.705  -4.521  1.00 0.00 ? 87  ASN A N    1  
ATOM 1401  C CA   . ASN A 1 87  ? -7.877  -1.268  -4.878  1.00 0.00 ? 87  ASN A CA   1  
ATOM 1402  C C    . ASN A 1 87  ? -8.717  -2.442  -5.372  1.00 0.00 ? 87  ASN A C    1  
ATOM 1403  O O    . ASN A 1 87  ? -9.874  -2.600  -4.983  1.00 0.00 ? 87  ASN A O    1  
ATOM 1404  C CB   . ASN A 1 87  ? -7.815  -0.183  -5.954  1.00 0.00 ? 87  ASN A CB   1  
ATOM 1405  C CG   . ASN A 1 87  ? -9.014  0.745   -5.910  1.00 0.00 ? 87  ASN A CG   1  
ATOM 1406  O OD1  . ASN A 1 87  ? -8.925  1.868   -5.414  1.00 0.00 ? 87  ASN A OD1  1  
ATOM 1407  N ND2  . ASN A 1 87  ? -10.142 0.277   -6.430  1.00 0.00 ? 87  ASN A ND2  1  
ATOM 1408  H H    . ASN A 1 87  ? -5.795  -1.539  -5.144  1.00 0.00 ? 87  ASN A H    1  
ATOM 1409  H HA   . ASN A 1 87  ? -8.338  -0.858  -3.992  1.00 0.00 ? 87  ASN A HA   1  
ATOM 1410  H HB2  . ASN A 1 87  ? -6.922  0.408   -5.809  1.00 0.00 ? 87  ASN A HB2  1  
ATOM 1411  H HB3  . ASN A 1 87  ? -7.779  -0.650  -6.927  1.00 0.00 ? 87  ASN A HB3  1  
ATOM 1412  H HD21 . ASN A 1 87  ? -10.139 -0.627  -6.808  1.00 0.00 ? 87  ASN A HD21 1  
ATOM 1413  H HD22 . ASN A 1 87  ? -10.933 0.856   -6.416  1.00 0.00 ? 87  ASN A HD22 1  
ATOM 1414  N N    . LYS A 1 88  ? -8.126  -3.265  -6.232  1.00 0.00 ? 88  LYS A N    1  
ATOM 1415  C CA   . LYS A 1 88  ? -8.817  -4.426  -6.779  1.00 0.00 ? 88  LYS A CA   1  
ATOM 1416  C C    . LYS A 1 88  ? -9.444  -5.260  -5.667  1.00 0.00 ? 88  LYS A C    1  
ATOM 1417  O O    . LYS A 1 88  ? -10.586 -5.705  -5.780  1.00 0.00 ? 88  LYS A O    1  
ATOM 1418  C CB   . LYS A 1 88  ? -7.846  -5.287  -7.591  1.00 0.00 ? 88  LYS A CB   1  
ATOM 1419  C CG   . LYS A 1 88  ? -7.692  -4.835  -9.033  1.00 0.00 ? 88  LYS A CG   1  
ATOM 1420  C CD   . LYS A 1 88  ? -8.948  -5.112  -9.842  1.00 0.00 ? 88  LYS A CD   1  
ATOM 1421  C CE   . LYS A 1 88  ? -8.948  -6.526  -10.404 1.00 0.00 ? 88  LYS A CE   1  
ATOM 1422  N NZ   . LYS A 1 88  ? -9.530  -7.504  -9.445  1.00 0.00 ? 88  LYS A NZ   1  
ATOM 1423  H H    . LYS A 1 88  ? -7.201  -3.086  -6.505  1.00 0.00 ? 88  LYS A H    1  
ATOM 1424  H HA   . LYS A 1 88  ? -9.600  -4.070  -7.431  1.00 0.00 ? 88  LYS A HA   1  
ATOM 1425  H HB2  . LYS A 1 88  ? -6.875  -5.256  -7.120  1.00 0.00 ? 88  LYS A HB2  1  
ATOM 1426  H HB3  . LYS A 1 88  ? -8.204  -6.307  -7.592  1.00 0.00 ? 88  LYS A HB3  1  
ATOM 1427  H HG2  . LYS A 1 88  ? -7.494  -3.773  -9.049  1.00 0.00 ? 88  LYS A HG2  1  
ATOM 1428  H HG3  . LYS A 1 88  ? -6.862  -5.364  -9.480  1.00 0.00 ? 88  LYS A HG3  1  
ATOM 1429  H HD2  . LYS A 1 88  ? -9.811  -4.991  -9.204  1.00 0.00 ? 88  LYS A HD2  1  
ATOM 1430  H HD3  . LYS A 1 88  ? -9.001  -4.408  -10.661 1.00 0.00 ? 88  LYS A HD3  1  
ATOM 1431  H HE2  . LYS A 1 88  ? -9.528  -6.537  -11.314 1.00 0.00 ? 88  LYS A HE2  1  
ATOM 1432  H HE3  . LYS A 1 88  ? -7.929  -6.811  -10.624 1.00 0.00 ? 88  LYS A HE3  1  
ATOM 1433  H HZ1  . LYS A 1 88  ? -10.418 -7.890  -9.824  1.00 0.00 ? 88  LYS A HZ1  1  
ATOM 1434  H HZ2  . LYS A 1 88  ? -9.727  -7.040  -8.536  1.00 0.00 ? 88  LYS A HZ2  1  
ATOM 1435  H HZ3  . LYS A 1 88  ? -8.865  -8.287  -9.285  1.00 0.00 ? 88  LYS A HZ3  1  
ATOM 1436  N N    . SER A 1 89  ? -8.690  -5.467  -4.592  1.00 0.00 ? 89  SER A N    1  
ATOM 1437  C CA   . SER A 1 89  ? -9.172  -6.250  -3.459  1.00 0.00 ? 89  SER A CA   1  
ATOM 1438  C C    . SER A 1 89  ? -10.521 -5.728  -2.973  1.00 0.00 ? 89  SER A C    1  
ATOM 1439  O O    . SER A 1 89  ? -10.604 -4.661  -2.368  1.00 0.00 ? 89  SER A O    1  
ATOM 1440  C CB   . SER A 1 89  ? -8.156  -6.211  -2.317  1.00 0.00 ? 89  SER A CB   1  
ATOM 1441  O OG   . SER A 1 89  ? -8.472  -7.169  -1.321  1.00 0.00 ? 89  SER A OG   1  
ATOM 1442  H H    . SER A 1 89  ? -7.788  -5.086  -4.561  1.00 0.00 ? 89  SER A H    1  
ATOM 1443  H HA   . SER A 1 89  ? -9.292  -7.271  -3.789  1.00 0.00 ? 89  SER A HA   1  
ATOM 1444  H HB2  . SER A 1 89  ? -7.172  -6.426  -2.706  1.00 0.00 ? 89  SER A HB2  1  
ATOM 1445  H HB3  . SER A 1 89  ? -8.159  -5.228  -1.868  1.00 0.00 ? 89  SER A HB3  1  
ATOM 1446  H HG   . SER A 1 89  ? -8.124  -6.877  -0.475  1.00 0.00 ? 89  SER A HG   1  
ATOM 1447  N N    . ASN A 1 90  ? -11.576 -6.491  -3.244  1.00 0.00 ? 90  ASN A N    1  
ATOM 1448  C CA   . ASN A 1 90  ? -12.922 -6.106  -2.836  1.00 0.00 ? 90  ASN A CA   1  
ATOM 1449  C C    . ASN A 1 90  ? -13.070 -6.175  -1.319  1.00 0.00 ? 90  ASN A C    1  
ATOM 1450  O O    . ASN A 1 90  ? -13.933 -5.516  -0.739  1.00 0.00 ? 90  ASN A O    1  
ATOM 1451  C CB   . ASN A 1 90  ? -13.958 -7.013  -3.502  1.00 0.00 ? 90  ASN A CB   1  
ATOM 1452  C CG   . ASN A 1 90  ? -14.082 -8.356  -2.808  1.00 0.00 ? 90  ASN A CG   1  
ATOM 1453  O OD1  . ASN A 1 90  ? -14.894 -8.524  -1.898  1.00 0.00 ? 90  ASN A OD1  1  
ATOM 1454  N ND2  . ASN A 1 90  ? -13.275 -9.320  -3.236  1.00 0.00 ? 90  ASN A ND2  1  
ATOM 1455  H H    . ASN A 1 90  ? -11.446 -7.331  -3.731  1.00 0.00 ? 90  ASN A H    1  
ATOM 1456  H HA   . ASN A 1 90  ? -13.088 -5.089  -3.156  1.00 0.00 ? 90  ASN A HA   1  
ATOM 1457  H HB2  . ASN A 1 90  ? -14.922 -6.527  -3.477  1.00 0.00 ? 90  ASN A HB2  1  
ATOM 1458  H HB3  . ASN A 1 90  ? -13.672 -7.184  -4.529  1.00 0.00 ? 90  ASN A HB3  1  
ATOM 1459  H HD21 . ASN A 1 90  ? -12.654 -9.114  -3.966  1.00 0.00 ? 90  ASN A HD21 1  
ATOM 1460  H HD22 . ASN A 1 90  ? -13.335 -10.198 -2.806  1.00 0.00 ? 90  ASN A HD22 1  
ATOM 1461  N N    . ASP A 1 91  ? -12.222 -6.975  -0.683  1.00 0.00 ? 91  ASP A N    1  
ATOM 1462  C CA   . ASP A 1 91  ? -12.257 -7.129  0.767   1.00 0.00 ? 91  ASP A CA   1  
ATOM 1463  C C    . ASP A 1 91  ? -11.552 -5.964  1.454   1.00 0.00 ? 91  ASP A C    1  
ATOM 1464  O O    . ASP A 1 91  ? -11.263 -6.017  2.650   1.00 0.00 ? 91  ASP A O    1  
ATOM 1465  C CB   . ASP A 1 91  ? -11.605 -8.450  1.177   1.00 0.00 ? 91  ASP A CB   1  
ATOM 1466  C CG   . ASP A 1 91  ? -10.343 -8.742  0.390   1.00 0.00 ? 91  ASP A CG   1  
ATOM 1467  O OD1  . ASP A 1 91  ? -10.457 -9.150  -0.785  1.00 0.00 ? 91  ASP A OD1  1  
ATOM 1468  O OD2  . ASP A 1 91  ? -9.241  -8.560  0.948   1.00 0.00 ? 91  ASP A OD2  1  
ATOM 1469  H H    . ASP A 1 91  ? -11.556 -7.475  -1.200  1.00 0.00 ? 91  ASP A H    1  
ATOM 1470  H HA   . ASP A 1 91  ? -13.292 -7.139  1.075   1.00 0.00 ? 91  ASP A HA   1  
ATOM 1471  H HB2  . ASP A 1 91  ? -11.351 -8.408  2.227   1.00 0.00 ? 91  ASP A HB2  1  
ATOM 1472  H HB3  . ASP A 1 91  ? -12.305 -9.256  1.013   1.00 0.00 ? 91  ASP A HB3  1  
ATOM 1473  N N    . PHE A 1 92  ? -11.275 -4.913  0.690   1.00 0.00 ? 92  PHE A N    1  
ATOM 1474  C CA   . PHE A 1 92  ? -10.601 -3.735  1.225   1.00 0.00 ? 92  PHE A CA   1  
ATOM 1475  C C    . PHE A 1 92  ? -11.481 -2.496  1.088   1.00 0.00 ? 92  PHE A C    1  
ATOM 1476  O O    . PHE A 1 92  ? -12.139 -2.299  0.067   1.00 0.00 ? 92  PHE A O    1  
ATOM 1477  C CB   . PHE A 1 92  ? -9.271  -3.511  0.503   1.00 0.00 ? 92  PHE A CB   1  
ATOM 1478  C CG   . PHE A 1 92  ? -8.123  -4.260  1.117   1.00 0.00 ? 92  PHE A CG   1  
ATOM 1479  C CD1  . PHE A 1 92  ? -8.263  -5.589  1.485   1.00 0.00 ? 92  PHE A CD1  1  
ATOM 1480  C CD2  . PHE A 1 92  ? -6.904  -3.636  1.325   1.00 0.00 ? 92  PHE A CD2  1  
ATOM 1481  C CE1  . PHE A 1 92  ? -7.208  -6.281  2.050   1.00 0.00 ? 92  PHE A CE1  1  
ATOM 1482  C CE2  . PHE A 1 92  ? -5.845  -4.324  1.889   1.00 0.00 ? 92  PHE A CE2  1  
ATOM 1483  C CZ   . PHE A 1 92  ? -5.998  -5.647  2.253   1.00 0.00 ? 92  PHE A CZ   1  
ATOM 1484  H H    . PHE A 1 92  ? -11.530 -4.929  -0.256  1.00 0.00 ? 92  PHE A H    1  
ATOM 1485  H HA   . PHE A 1 92  ? -10.408 -3.911  2.271   1.00 0.00 ? 92  PHE A HA   1  
ATOM 1486  H HB2  . PHE A 1 92  ? -9.367  -3.834  -0.523  1.00 0.00 ? 92  PHE A HB2  1  
ATOM 1487  H HB3  . PHE A 1 92  ? -9.031  -2.459  0.524   1.00 0.00 ? 92  PHE A HB3  1  
ATOM 1488  H HD1  . PHE A 1 92  ? -9.210  -6.086  1.327   1.00 0.00 ? 92  PHE A HD1  1  
ATOM 1489  H HD2  . PHE A 1 92  ? -6.783  -2.601  1.042   1.00 0.00 ? 92  PHE A HD2  1  
ATOM 1490  H HE1  . PHE A 1 92  ? -7.331  -7.316  2.333   1.00 0.00 ? 92  PHE A HE1  1  
ATOM 1491  H HE2  . PHE A 1 92  ? -4.900  -3.826  2.047   1.00 0.00 ? 92  PHE A HE2  1  
ATOM 1492  H HZ   . PHE A 1 92  ? -5.173  -6.187  2.693   1.00 0.00 ? 92  PHE A HZ   1  
ATOM 1493  N N    . GLU A 1 93  ? -11.488 -1.665  2.126   1.00 0.00 ? 93  GLU A N    1  
ATOM 1494  C CA   . GLU A 1 93  ? -12.288 -0.446  2.123   1.00 0.00 ? 93  GLU A CA   1  
ATOM 1495  C C    . GLU A 1 93  ? -11.396 0.790   2.042   1.00 0.00 ? 93  GLU A C    1  
ATOM 1496  O O    . GLU A 1 93  ? -10.262 0.781   2.520   1.00 0.00 ? 93  GLU A O    1  
ATOM 1497  C CB   . GLU A 1 93  ? -13.160 -0.378  3.378   1.00 0.00 ? 93  GLU A CB   1  
ATOM 1498  C CG   . GLU A 1 93  ? -14.474 0.356   3.168   1.00 0.00 ? 93  GLU A CG   1  
ATOM 1499  C CD   . GLU A 1 93  ? -15.383 -0.347  2.179   1.00 0.00 ? 93  GLU A CD   1  
ATOM 1500  O OE1  . GLU A 1 93  ? -16.175 -1.210  2.613   1.00 0.00 ? 93  GLU A OE1  1  
ATOM 1501  O OE2  . GLU A 1 93  ? -15.304 -0.034  0.973   1.00 0.00 ? 93  GLU A OE2  1  
ATOM 1502  H H    . GLU A 1 93  ? -10.942 -1.877  2.912   1.00 0.00 ? 93  GLU A H    1  
ATOM 1503  H HA   . GLU A 1 93  ? -12.927 -0.471  1.253   1.00 0.00 ? 93  GLU A HA   1  
ATOM 1504  H HB2  . GLU A 1 93  ? -13.382 -1.384  3.703   1.00 0.00 ? 93  GLU A HB2  1  
ATOM 1505  H HB3  . GLU A 1 93  ? -12.609 0.128   4.157   1.00 0.00 ? 93  GLU A HB3  1  
ATOM 1506  H HG2  . GLU A 1 93  ? -14.986 0.430   4.116   1.00 0.00 ? 93  GLU A HG2  1  
ATOM 1507  H HG3  . GLU A 1 93  ? -14.261 1.348   2.797   1.00 0.00 ? 93  GLU A HG3  1  
ATOM 1508  N N    . GLU A 1 94  ? -11.918 1.851   1.434   1.00 0.00 ? 94  GLU A N    1  
ATOM 1509  C CA   . GLU A 1 94  ? -11.169 3.093   1.290   1.00 0.00 ? 94  GLU A CA   1  
ATOM 1510  C C    . GLU A 1 94  ? -11.447 4.035   2.459   1.00 0.00 ? 94  GLU A C    1  
ATOM 1511  O O    . GLU A 1 94  ? -12.546 4.576   2.587   1.00 0.00 ? 94  GLU A O    1  
ATOM 1512  C CB   . GLU A 1 94  ? -11.528 3.781   -0.029  1.00 0.00 ? 94  GLU A CB   1  
ATOM 1513  C CG   . GLU A 1 94  ? -10.535 4.853   -0.446  1.00 0.00 ? 94  GLU A CG   1  
ATOM 1514  C CD   . GLU A 1 94  ? -11.088 5.777   -1.513  1.00 0.00 ? 94  GLU A CD   1  
ATOM 1515  O OE1  . GLU A 1 94  ? -12.327 5.871   -1.633  1.00 0.00 ? 94  GLU A OE1  1  
ATOM 1516  O OE2  . GLU A 1 94  ? -10.281 6.406   -2.229  1.00 0.00 ? 94  GLU A OE2  1  
ATOM 1517  H H    . GLU A 1 94  ? -12.828 1.796   1.074   1.00 0.00 ? 94  GLU A H    1  
ATOM 1518  H HA   . GLU A 1 94  ? -10.118 2.848   1.283   1.00 0.00 ? 94  GLU A HA   1  
ATOM 1519  H HB2  . GLU A 1 94  ? -11.571 3.035   -0.809  1.00 0.00 ? 94  GLU A HB2  1  
ATOM 1520  H HB3  . GLU A 1 94  ? -12.500 4.240   0.071   1.00 0.00 ? 94  GLU A HB3  1  
ATOM 1521  H HG2  . GLU A 1 94  ? -10.276 5.443   0.420   1.00 0.00 ? 94  GLU A HG2  1  
ATOM 1522  H HG3  . GLU A 1 94  ? -9.647  4.373   -0.831  1.00 0.00 ? 94  GLU A HG3  1  
ATOM 1523  N N    . LEU A 1 95  ? -10.444 4.224   3.309   1.00 0.00 ? 95  LEU A N    1  
ATOM 1524  C CA   . LEU A 1 95  ? -10.579 5.100   4.468   1.00 0.00 ? 95  LEU A CA   1  
ATOM 1525  C C    . LEU A 1 95  ? -10.032 6.491   4.166   1.00 0.00 ? 95  LEU A C    1  
ATOM 1526  O O    . LEU A 1 95  ? -9.749  7.270   5.077   1.00 0.00 ? 95  LEU A O    1  
ATOM 1527  C CB   . LEU A 1 95  ? -9.847  4.502   5.671   1.00 0.00 ? 95  LEU A CB   1  
ATOM 1528  C CG   . LEU A 1 95  ? -10.271 3.091   6.081   1.00 0.00 ? 95  LEU A CG   1  
ATOM 1529  C CD1  . LEU A 1 95  ? -9.636  2.707   7.409   1.00 0.00 ? 95  LEU A CD1  1  
ATOM 1530  C CD2  . LEU A 1 95  ? -11.787 2.992   6.164   1.00 0.00 ? 95  LEU A CD2  1  
ATOM 1531  H H    . LEU A 1 95  ? -9.592  3.766   3.154   1.00 0.00 ? 95  LEU A H    1  
ATOM 1532  H HA   . LEU A 1 95  ? -11.630 5.182   4.701   1.00 0.00 ? 95  LEU A HA   1  
ATOM 1533  H HB2  . LEU A 1 95  ? -8.794  4.476   5.438   1.00 0.00 ? 95  LEU A HB2  1  
ATOM 1534  H HB3  . LEU A 1 95  ? -10.011 5.156   6.516   1.00 0.00 ? 95  LEU A HB3  1  
ATOM 1535  H HG   . LEU A 1 95  ? -9.930  2.388   5.334   1.00 0.00 ? 95  LEU A HG   1  
ATOM 1536  H HD11 . LEU A 1 95  ? -8.805  2.042   7.232   1.00 0.00 ? 95  LEU A HD11 1  
ATOM 1537  H HD12 . LEU A 1 95  ? -10.369 2.212   8.028   1.00 0.00 ? 95  LEU A HD12 1  
ATOM 1538  H HD13 . LEU A 1 95  ? -9.285  3.598   7.910   1.00 0.00 ? 95  LEU A HD13 1  
ATOM 1539  H HD21 . LEU A 1 95  ? -12.061 2.087   6.686   1.00 0.00 ? 95  LEU A HD21 1  
ATOM 1540  H HD22 . LEU A 1 95  ? -12.202 2.972   5.167   1.00 0.00 ? 95  LEU A HD22 1  
ATOM 1541  H HD23 . LEU A 1 95  ? -12.175 3.847   6.698   1.00 0.00 ? 95  LEU A HD23 1  
ATOM 1542  N N    . VAL A 1 96  ? -9.887  6.798   2.881   1.00 0.00 ? 96  VAL A N    1  
ATOM 1543  C CA   . VAL A 1 96  ? -9.377  8.097   2.458   1.00 0.00 ? 96  VAL A CA   1  
ATOM 1544  C C    . VAL A 1 96  ? -9.878  9.209   3.374   1.00 0.00 ? 96  VAL A C    1  
ATOM 1545  O O    . VAL A 1 96  ? -9.212  10.228  3.549   1.00 0.00 ? 96  VAL A O    1  
ATOM 1546  C CB   . VAL A 1 96  ? -9.788  8.417   1.009   1.00 0.00 ? 96  VAL A CB   1  
ATOM 1547  C CG1  . VAL A 1 96  ? -11.303 8.422   0.872   1.00 0.00 ? 96  VAL A CG1  1  
ATOM 1548  C CG2  . VAL A 1 96  ? -9.201  9.750   0.571   1.00 0.00 ? 96  VAL A CG2  1  
ATOM 1549  H H    . VAL A 1 96  ? -10.129 6.136   2.201   1.00 0.00 ? 96  VAL A H    1  
ATOM 1550  H HA   . VAL A 1 96  ? -8.298  8.064   2.505   1.00 0.00 ? 96  VAL A HA   1  
ATOM 1551  H HB   . VAL A 1 96  ? -9.393  7.645   0.365   1.00 0.00 ? 96  VAL A HB   1  
ATOM 1552  H HG11 . VAL A 1 96  ? -11.572 8.251   -0.160  1.00 0.00 ? 96  VAL A HG11 1  
ATOM 1553  H HG12 . VAL A 1 96  ? -11.723 7.641   1.489   1.00 0.00 ? 96  VAL A HG12 1  
ATOM 1554  H HG13 . VAL A 1 96  ? -11.690 9.379   1.190   1.00 0.00 ? 96  VAL A HG13 1  
ATOM 1555  H HG21 . VAL A 1 96  ? -9.327  10.475  1.361   1.00 0.00 ? 96  VAL A HG21 1  
ATOM 1556  H HG22 . VAL A 1 96  ? -8.149  9.628   0.358   1.00 0.00 ? 96  VAL A HG22 1  
ATOM 1557  H HG23 . VAL A 1 96  ? -9.710  10.094  -0.318  1.00 0.00 ? 96  VAL A HG23 1  
ATOM 1558  N N    . GLU A 1 97  ? -11.055 9.003   3.956   1.00 0.00 ? 97  GLU A N    1  
ATOM 1559  C CA   . GLU A 1 97  ? -11.645 9.989   4.854   1.00 0.00 ? 97  GLU A CA   1  
ATOM 1560  C C    . GLU A 1 97  ? -10.653 10.399  5.939   1.00 0.00 ? 97  GLU A C    1  
ATOM 1561  O O    . GLU A 1 97  ? -10.513 11.582  6.252   1.00 0.00 ? 97  GLU A O    1  
ATOM 1562  C CB   . GLU A 1 97  ? -12.916 9.430   5.496   1.00 0.00 ? 97  GLU A CB   1  
ATOM 1563  C CG   . GLU A 1 97  ? -14.007 9.094   4.494   1.00 0.00 ? 97  GLU A CG   1  
ATOM 1564  C CD   . GLU A 1 97  ? -15.152 8.317   5.115   1.00 0.00 ? 97  GLU A CD   1  
ATOM 1565  O OE1  . GLU A 1 97  ? -15.030 7.081   5.244   1.00 0.00 ? 97  GLU A OE1  1  
ATOM 1566  O OE2  . GLU A 1 97  ? -16.169 8.946   5.474   1.00 0.00 ? 97  GLU A OE2  1  
ATOM 1567  H H    . GLU A 1 97  ? -11.538 8.169   3.777   1.00 0.00 ? 97  GLU A H    1  
ATOM 1568  H HA   . GLU A 1 97  ? -11.901 10.859  4.269   1.00 0.00 ? 97  GLU A HA   1  
ATOM 1569  H HB2  . GLU A 1 97  ? -12.666 8.531   6.040   1.00 0.00 ? 97  GLU A HB2  1  
ATOM 1570  H HB3  . GLU A 1 97  ? -13.306 10.161  6.189   1.00 0.00 ? 97  GLU A HB3  1  
ATOM 1571  H HG2  . GLU A 1 97  ? -14.398 10.013  4.084   1.00 0.00 ? 97  GLU A HG2  1  
ATOM 1572  H HG3  . GLU A 1 97  ? -13.578 8.500   3.700   1.00 0.00 ? 97  GLU A HG3  1  
ATOM 1573  N N    . ARG A 1 98  ? -9.966  9.414   6.508   1.00 0.00 ? 98  ARG A N    1  
ATOM 1574  C CA   . ARG A 1 98  ? -8.989  9.672   7.559   1.00 0.00 ? 98  ARG A CA   1  
ATOM 1575  C C    . ARG A 1 98  ? -7.597  9.878   6.967   1.00 0.00 ? 98  ARG A C    1  
ATOM 1576  O O    . ARG A 1 98  ? -6.730  10.487  7.593   1.00 0.00 ? 98  ARG A O    1  
ATOM 1577  C CB   . ARG A 1 98  ? -8.963  8.513   8.557   1.00 0.00 ? 98  ARG A CB   1  
ATOM 1578  C CG   . ARG A 1 98  ? -10.308 7.823   8.724   1.00 0.00 ? 98  ARG A CG   1  
ATOM 1579  C CD   . ARG A 1 98  ? -10.262 6.771   9.821   1.00 0.00 ? 98  ARG A CD   1  
ATOM 1580  N NE   . ARG A 1 98  ? -11.559 6.600   10.470  1.00 0.00 ? 98  ARG A NE   1  
ATOM 1581  C CZ   . ARG A 1 98  ? -11.926 5.488   11.095  1.00 0.00 ? 98  ARG A CZ   1  
ATOM 1582  N NH1  . ARG A 1 98  ? -11.099 4.453   11.157  1.00 0.00 ? 98  ARG A NH1  1  
ATOM 1583  N NH2  . ARG A 1 98  ? -13.124 5.408   11.662  1.00 0.00 ? 98  ARG A NH2  1  
ATOM 1584  H H    . ARG A 1 98  ? -10.122 8.491   6.216   1.00 0.00 ? 98  ARG A H    1  
ATOM 1585  H HA   . ARG A 1 98  ? -9.285  10.573  8.074   1.00 0.00 ? 98  ARG A HA   1  
ATOM 1586  H HB2  . ARG A 1 98  ? -8.247  7.778   8.220   1.00 0.00 ? 98  ARG A HB2  1  
ATOM 1587  H HB3  . ARG A 1 98  ? -8.654  8.890   9.520   1.00 0.00 ? 98  ARG A HB3  1  
ATOM 1588  H HG2  . ARG A 1 98  ? -11.052 8.563   8.981   1.00 0.00 ? 98  ARG A HG2  1  
ATOM 1589  H HG3  . ARG A 1 98  ? -10.576 7.348   7.792   1.00 0.00 ? 98  ARG A HG3  1  
ATOM 1590  H HD2  . ARG A 1 98  ? -9.961  5.830   9.386   1.00 0.00 ? 98  ARG A HD2  1  
ATOM 1591  H HD3  . ARG A 1 98  ? -9.536  7.074   10.561  1.00 0.00 ? 98  ARG A HD3  1  
ATOM 1592  H HE   . ARG A 1 98  ? -12.186 7.352   10.437  1.00 0.00 ? 98  ARG A HE   1  
ATOM 1593  H HH11 . ARG A 1 98  ? -10.196 4.511   10.732  1.00 0.00 ? 98  ARG A HH11 1  
ATOM 1594  H HH12 . ARG A 1 98  ? -11.378 3.617   11.630  1.00 0.00 ? 98  ARG A HH12 1  
ATOM 1595  H HH21 . ARG A 1 98  ? -13.750 6.186   11.618  1.00 0.00 ? 98  ARG A HH21 1  
ATOM 1596  H HH22 . ARG A 1 98  ? -13.400 4.571   12.132  1.00 0.00 ? 98  ARG A HH22 1  
ATOM 1597  N N    . SER A 1 99  ? -7.392  9.366   5.758   1.00 0.00 ? 99  SER A N    1  
ATOM 1598  C CA   . SER A 1 99  ? -6.105  9.491   5.084   1.00 0.00 ? 99  SER A CA   1  
ATOM 1599  C C    . SER A 1 99  ? -5.646  10.945  5.053   1.00 0.00 ? 99  SER A C    1  
ATOM 1600  O O    . SER A 1 99  ? -6.447  11.855  4.843   1.00 0.00 ? 99  SER A O    1  
ATOM 1601  C CB   . SER A 1 99  ? -6.197  8.943   3.658   1.00 0.00 ? 99  SER A CB   1  
ATOM 1602  O OG   . SER A 1 99  ? -6.919  9.827   2.818   1.00 0.00 ? 99  SER A OG   1  
ATOM 1603  H H    . SER A 1 99  ? -8.123  8.891   5.310   1.00 0.00 ? 99  SER A H    1  
ATOM 1604  H HA   . SER A 1 99  ? -5.383  8.909   5.637   1.00 0.00 ? 99  SER A HA   1  
ATOM 1605  H HB2  . SER A 1 99  ? -5.202  8.818   3.258   1.00 0.00 ? 99  SER A HB2  1  
ATOM 1606  H HB3  . SER A 1 99  ? -6.701  7.988   3.674   1.00 0.00 ? 99  SER A HB3  1  
ATOM 1607  H HG   . SER A 1 99  ? -6.967  9.460   1.933   1.00 0.00 ? 99  SER A HG   1  
ATOM 1608  N N    . GLN A 1 100 ? -4.350  11.155  5.265   1.00 0.00 ? 100 GLN A N    1  
ATOM 1609  C CA   . GLN A 1 100 ? -3.784  12.498  5.263   1.00 0.00 ? 100 GLN A CA   1  
ATOM 1610  C C    . GLN A 1 100 ? -2.597  12.587  4.310   1.00 0.00 ? 100 GLN A C    1  
ATOM 1611  O O    . GLN A 1 100 ? -1.503  12.113  4.618   1.00 0.00 ? 100 GLN A O    1  
ATOM 1612  C CB   . GLN A 1 100 ? -3.350  12.894  6.675   1.00 0.00 ? 100 GLN A CB   1  
ATOM 1613  C CG   . GLN A 1 100 ? -4.497  12.951  7.671   1.00 0.00 ? 100 GLN A CG   1  
ATOM 1614  C CD   . GLN A 1 100 ? -5.368  14.178  7.489   1.00 0.00 ? 100 GLN A CD   1  
ATOM 1615  O OE1  . GLN A 1 100 ? -5.246  15.155  8.229   1.00 0.00 ? 100 GLN A OE1  1  
ATOM 1616  N NE2  . GLN A 1 100 ? -6.253  14.136  6.500   1.00 0.00 ? 100 GLN A NE2  1  
ATOM 1617  H H    . GLN A 1 100 ? -3.762  10.388  5.427   1.00 0.00 ? 100 GLN A H    1  
ATOM 1618  H HA   . GLN A 1 100 ? -4.551  13.180  4.927   1.00 0.00 ? 100 GLN A HA   1  
ATOM 1619  H HB2  . GLN A 1 100 ? -2.627  12.175  7.032   1.00 0.00 ? 100 GLN A HB2  1  
ATOM 1620  H HB3  . GLN A 1 100 ? -2.887  13.869  6.637   1.00 0.00 ? 100 GLN A HB3  1  
ATOM 1621  H HG2  . GLN A 1 100 ? -5.111  12.071  7.543   1.00 0.00 ? 100 GLN A HG2  1  
ATOM 1622  H HG3  . GLN A 1 100 ? -4.089  12.961  8.671   1.00 0.00 ? 100 GLN A HG3  1  
ATOM 1623  H HE21 . GLN A 1 100 ? -6.295  13.324  5.952   1.00 0.00 ? 100 GLN A HE21 1  
ATOM 1624  H HE22 . GLN A 1 100 ? -6.829  14.915  6.361   1.00 0.00 ? 100 GLN A HE22 1  
ATOM 1625  N N    . LEU A 1 101 ? -2.820  13.197  3.150   1.00 0.00 ? 101 LEU A N    1  
ATOM 1626  C CA   . LEU A 1 101 ? -1.768  13.348  2.151   1.00 0.00 ? 101 LEU A CA   1  
ATOM 1627  C C    . LEU A 1 101 ? -1.357  14.810  2.009   1.00 0.00 ? 101 LEU A C    1  
ATOM 1628  O O    . LEU A 1 101 ? -0.651  15.178  1.071   1.00 0.00 ? 101 LEU A O    1  
ATOM 1629  C CB   . LEU A 1 101 ? -2.239  12.805  0.800   1.00 0.00 ? 101 LEU A CB   1  
ATOM 1630  C CG   . LEU A 1 101 ? -2.682  11.342  0.782   1.00 0.00 ? 101 LEU A CG   1  
ATOM 1631  C CD1  . LEU A 1 101 ? -3.652  11.092  -0.362  1.00 0.00 ? 101 LEU A CD1  1  
ATOM 1632  C CD2  . LEU A 1 101 ? -1.476  10.421  0.672   1.00 0.00 ? 101 LEU A CD2  1  
ATOM 1633  H H    . LEU A 1 101 ? -3.712  13.554  2.961   1.00 0.00 ? 101 LEU A H    1  
ATOM 1634  H HA   . LEU A 1 101 ? -0.913  12.776  2.481   1.00 0.00 ? 101 LEU A HA   1  
ATOM 1635  H HB2  . LEU A 1 101 ? -3.073  13.407  0.475   1.00 0.00 ? 101 LEU A HB2  1  
ATOM 1636  H HB3  . LEU A 1 101 ? -1.424  12.914  0.099   1.00 0.00 ? 101 LEU A HB3  1  
ATOM 1637  H HG   . LEU A 1 101 ? -3.193  11.116  1.708   1.00 0.00 ? 101 LEU A HG   1  
ATOM 1638  H HD11 . LEU A 1 101 ? -4.199  11.998  -0.574  1.00 0.00 ? 101 LEU A HD11 1  
ATOM 1639  H HD12 . LEU A 1 101 ? -4.344  10.311  -0.083  1.00 0.00 ? 101 LEU A HD12 1  
ATOM 1640  H HD13 . LEU A 1 101 ? -3.102  10.789  -1.240  1.00 0.00 ? 101 LEU A HD13 1  
ATOM 1641  H HD21 . LEU A 1 101 ? -1.392  9.829   1.572   1.00 0.00 ? 101 LEU A HD21 1  
ATOM 1642  H HD22 . LEU A 1 101 ? -0.581  11.013  0.547   1.00 0.00 ? 101 LEU A HD22 1  
ATOM 1643  H HD23 . LEU A 1 101 ? -1.598  9.768   -0.179  1.00 0.00 ? 101 LEU A HD23 1  
ATOM 1644  N N    . ASP A 1 102 ? -1.802  15.637  2.948   1.00 0.00 ? 102 ASP A N    1  
ATOM 1645  C CA   . ASP A 1 102 ? -1.478  17.059  2.930   1.00 0.00 ? 102 ASP A CA   1  
ATOM 1646  C C    . ASP A 1 102 ? -0.675  17.449  4.168   1.00 0.00 ? 102 ASP A C    1  
ATOM 1647  O O    . ASP A 1 102 ? -0.566  18.629  4.502   1.00 0.00 ? 102 ASP A O    1  
ATOM 1648  C CB   . ASP A 1 102 ? -2.757  17.895  2.852   1.00 0.00 ? 102 ASP A CB   1  
ATOM 1649  C CG   . ASP A 1 102 ? -3.203  18.137  1.424   1.00 0.00 ? 102 ASP A CG   1  
ATOM 1650  O OD1  . ASP A 1 102 ? -2.351  18.513  0.592   1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1651  O OD2  . ASP A 1 102 ? -4.405  17.952  1.138   1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1652  H H    . ASP A 1 102 ? -2.361  15.283  3.672   1.00 0.00 ? 102 ASP A H    1  
ATOM 1653  H HA   . ASP A 1 102 ? -0.879  17.252  2.053   1.00 0.00 ? 102 ASP A HA   1  
ATOM 1654  H HB2  . ASP A 1 102 ? -3.549  17.378  3.374   1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1655  H HB3  . ASP A 1 102 ? -2.584  18.851  3.324   1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1656  N N    . ILE A 1 103 ? -0.117  16.451  4.844   1.00 0.00 ? 103 ILE A N    1  
ATOM 1657  C CA   . ILE A 1 103 ? 0.675   16.690  6.044   1.00 0.00 ? 103 ILE A CA   1  
ATOM 1658  C C    . ILE A 1 103 ? 2.134   16.304  5.826   1.00 0.00 ? 103 ILE A C    1  
ATOM 1659  O O    . ILE A 1 103 ? 2.486   15.722  4.799   1.00 0.00 ? 103 ILE A O    1  
ATOM 1660  C CB   . ILE A 1 103 ? 0.122   15.906  7.248   1.00 0.00 ? 103 ILE A CB   1  
ATOM 1661  C CG1  . ILE A 1 103 ? 0.546   14.438  7.167   1.00 0.00 ? 103 ILE A CG1  1  
ATOM 1662  C CG2  . ILE A 1 103 ? -1.393  16.022  7.306   1.00 0.00 ? 103 ILE A CG2  1  
ATOM 1663  C CD1  . ILE A 1 103 ? 0.009   13.720  5.948   1.00 0.00 ? 103 ILE A CD1  1  
ATOM 1664  H H    . ILE A 1 103 ? -0.240  15.532  4.527   1.00 0.00 ? 103 ILE A H    1  
ATOM 1665  H HA   . ILE A 1 103 ? 0.623   17.745  6.272   1.00 0.00 ? 103 ILE A HA   1  
ATOM 1666  H HB   . ILE A 1 103 ? 0.527   16.341  8.149   1.00 0.00 ? 103 ILE A HB   1  
ATOM 1667  H HG12 . ILE A 1 103 ? 1.623   14.382  7.137   1.00 0.00 ? 103 ILE A HG12 1  
ATOM 1668  H HG13 . ILE A 1 103 ? 0.188   13.918  8.044   1.00 0.00 ? 103 ILE A HG13 1  
ATOM 1669  H HG21 . ILE A 1 103 ? -1.779  15.340  8.049   1.00 0.00 ? 103 ILE A HG21 1  
ATOM 1670  H HG22 . ILE A 1 103 ? -1.666  17.033  7.571   1.00 0.00 ? 103 ILE A HG22 1  
ATOM 1671  H HG23 . ILE A 1 103 ? -1.811  15.777  6.341   1.00 0.00 ? 103 ILE A HG23 1  
ATOM 1672  H HD11 . ILE A 1 103 ? 0.630   13.947  5.094   1.00 0.00 ? 103 ILE A HD11 1  
ATOM 1673  H HD12 . ILE A 1 103 ? 0.013   12.656  6.126   1.00 0.00 ? 103 ILE A HD12 1  
ATOM 1674  H HD13 . ILE A 1 103 ? -1.002  14.049  5.754   1.00 0.00 ? 103 ILE A HD13 1  
ATOM 1675  N N    . SER A 1 104 ? 2.978   16.629  6.799   1.00 0.00 ? 104 SER A N    1  
ATOM 1676  C CA   . SER A 1 104 ? 4.400   16.318  6.713   1.00 0.00 ? 104 SER A CA   1  
ATOM 1677  C C    . SER A 1 104 ? 4.619   14.948  6.079   1.00 0.00 ? 104 SER A C    1  
ATOM 1678  O O    . SER A 1 104 ? 5.277   14.828  5.045   1.00 0.00 ? 104 SER A O    1  
ATOM 1679  C CB   . SER A 1 104 ? 5.037   16.356  8.104   1.00 0.00 ? 104 SER A CB   1  
ATOM 1680  O OG   . SER A 1 104 ? 6.404   16.723  8.028   1.00 0.00 ? 104 SER A OG   1  
ATOM 1681  H H    . SER A 1 104 ? 2.637   17.092  7.593   1.00 0.00 ? 104 SER A H    1  
ATOM 1682  H HA   . SER A 1 104 ? 4.867   17.068  6.092   1.00 0.00 ? 104 SER A HA   1  
ATOM 1683  H HB2  . SER A 1 104 ? 4.517   17.077  8.715   1.00 0.00 ? 104 SER A HB2  1  
ATOM 1684  H HB3  . SER A 1 104 ? 4.963   15.379  8.557   1.00 0.00 ? 104 SER A HB3  1  
ATOM 1685  H HG   . SER A 1 104 ? 6.710   16.999  8.895   1.00 0.00 ? 104 SER A HG   1  
ATOM 1686  N N    . ASP A 1 105 ? 4.064   13.917  6.706   1.00 0.00 ? 105 ASP A N    1  
ATOM 1687  C CA   . ASP A 1 105 ? 4.196   12.555  6.203   1.00 0.00 ? 105 ASP A CA   1  
ATOM 1688  C C    . ASP A 1 105 ? 2.861   12.037  5.677   1.00 0.00 ? 105 ASP A C    1  
ATOM 1689  O O    . ASP A 1 105 ? 1.976   11.645  6.438   1.00 0.00 ? 105 ASP A O    1  
ATOM 1690  C CB   . ASP A 1 105 ? 4.717   11.630  7.305   1.00 0.00 ? 105 ASP A CB   1  
ATOM 1691  C CG   . ASP A 1 105 ? 5.326   10.357  6.752   1.00 0.00 ? 105 ASP A CG   1  
ATOM 1692  O OD1  . ASP A 1 105 ? 6.444   10.424  6.200   1.00 0.00 ? 105 ASP A OD1  1  
ATOM 1693  O OD2  . ASP A 1 105 ? 4.684   9.292   6.872   1.00 0.00 ? 105 ASP A OD2  1  
ATOM 1694  H H    . ASP A 1 105 ? 3.551   14.076  7.526   1.00 0.00 ? 105 ASP A H    1  
ATOM 1695  H HA   . ASP A 1 105 ? 4.907   12.568  5.391   1.00 0.00 ? 105 ASP A HA   1  
ATOM 1696  H HB2  . ASP A 1 105 ? 5.474   12.151  7.874   1.00 0.00 ? 105 ASP A HB2  1  
ATOM 1697  H HB3  . ASP A 1 105 ? 3.900   11.364  7.959   1.00 0.00 ? 105 ASP A HB3  1  
ATOM 1698  N N    . PRO A 1 106 ? 2.710   12.036  4.345   1.00 0.00 ? 106 PRO A N    1  
ATOM 1699  C CA   . PRO A 1 106 ? 1.485   11.570  3.687   1.00 0.00 ? 106 PRO A CA   1  
ATOM 1700  C C    . PRO A 1 106 ? 1.301   10.061  3.807   1.00 0.00 ? 106 PRO A C    1  
ATOM 1701  O O    . PRO A 1 106 ? 2.275   9.310   3.874   1.00 0.00 ? 106 PRO A O    1  
ATOM 1702  C CB   . PRO A 1 106 ? 1.694   11.968  2.224   1.00 0.00 ? 106 PRO A CB   1  
ATOM 1703  C CG   . PRO A 1 106 ? 3.173   12.027  2.055   1.00 0.00 ? 106 PRO A CG   1  
ATOM 1704  C CD   . PRO A 1 106 ? 3.723   12.489  3.377   1.00 0.00 ? 106 PRO A CD   1  
ATOM 1705  H HA   . PRO A 1 106 ? 0.611   12.070  4.077   1.00 0.00 ? 106 PRO A HA   1  
ATOM 1706  H HB2  . PRO A 1 106 ? 1.252   11.222  1.579   1.00 0.00 ? 106 PRO A HB2  1  
ATOM 1707  H HB3  . PRO A 1 106 ? 1.238   12.929  2.040   1.00 0.00 ? 106 PRO A HB3  1  
ATOM 1708  H HG2  . PRO A 1 106 ? 3.555   11.047  1.813   1.00 0.00 ? 106 PRO A HG2  1  
ATOM 1709  H HG3  . PRO A 1 106 ? 3.426   12.733  1.278   1.00 0.00 ? 106 PRO A HG3  1  
ATOM 1710  H HD2  . PRO A 1 106 ? 4.678   12.024  3.572   1.00 0.00 ? 106 PRO A HD2  1  
ATOM 1711  H HD3  . PRO A 1 106 ? 3.815   13.565  3.392   1.00 0.00 ? 106 PRO A HD3  1  
ATOM 1712  N N    . TYR A 1 107 ? 0.047   9.623   3.834   1.00 0.00 ? 107 TYR A N    1  
ATOM 1713  C CA   . TYR A 1 107 ? -0.264  8.203   3.949   1.00 0.00 ? 107 TYR A CA   1  
ATOM 1714  C C    . TYR A 1 107 ? -1.738  7.943   3.655   1.00 0.00 ? 107 TYR A C    1  
ATOM 1715  O O    . TYR A 1 107 ? -2.588  8.809   3.868   1.00 0.00 ? 107 TYR A O    1  
ATOM 1716  C CB   . TYR A 1 107 ? 0.087   7.694   5.348   1.00 0.00 ? 107 TYR A CB   1  
ATOM 1717  C CG   . TYR A 1 107 ? -0.735  8.328   6.447   1.00 0.00 ? 107 TYR A CG   1  
ATOM 1718  C CD1  . TYR A 1 107 ? -0.445  9.605   6.909   1.00 0.00 ? 107 TYR A CD1  1  
ATOM 1719  C CD2  . TYR A 1 107 ? -1.803  7.650   7.022   1.00 0.00 ? 107 TYR A CD2  1  
ATOM 1720  C CE1  . TYR A 1 107 ? -1.192  10.188  7.914   1.00 0.00 ? 107 TYR A CE1  1  
ATOM 1721  C CE2  . TYR A 1 107 ? -2.557  8.226   8.026   1.00 0.00 ? 107 TYR A CE2  1  
ATOM 1722  C CZ   . TYR A 1 107 ? -2.248  9.495   8.469   1.00 0.00 ? 107 TYR A CZ   1  
ATOM 1723  O OH   . TYR A 1 107 ? -2.996  10.073  9.469   1.00 0.00 ? 107 TYR A OH   1  
ATOM 1724  H H    . TYR A 1 107 ? -0.687  10.270  3.778   1.00 0.00 ? 107 TYR A H    1  
ATOM 1725  H HA   . TYR A 1 107 ? 0.335   7.673   3.223   1.00 0.00 ? 107 TYR A HA   1  
ATOM 1726  H HB2  . TYR A 1 107 ? -0.076  6.627   5.386   1.00 0.00 ? 107 TYR A HB2  1  
ATOM 1727  H HB3  . TYR A 1 107 ? 1.127   7.902   5.549   1.00 0.00 ? 107 TYR A HB3  1  
ATOM 1728  H HD1  . TYR A 1 107 ? 0.382   10.146  6.472   1.00 0.00 ? 107 TYR A HD1  1  
ATOM 1729  H HD2  . TYR A 1 107 ? -2.043  6.656   6.673   1.00 0.00 ? 107 TYR A HD2  1  
ATOM 1730  H HE1  . TYR A 1 107 ? -0.951  11.182  8.261   1.00 0.00 ? 107 TYR A HE1  1  
ATOM 1731  H HE2  . TYR A 1 107 ? -3.383  7.683   8.461   1.00 0.00 ? 107 TYR A HE2  1  
ATOM 1732  H HH   . TYR A 1 107 ? -3.669  10.636  9.080   1.00 0.00 ? 107 TYR A HH   1  
ATOM 1733  N N    . LYS A 1 108 ? -2.035  6.744   3.166   1.00 0.00 ? 108 LYS A N    1  
ATOM 1734  C CA   . LYS A 1 108 ? -3.406  6.366   2.844   1.00 0.00 ? 108 LYS A CA   1  
ATOM 1735  C C    . LYS A 1 108 ? -3.912  5.290   3.799   1.00 0.00 ? 108 LYS A C    1  
ATOM 1736  O O    . LYS A 1 108 ? -3.316  4.219   3.915   1.00 0.00 ? 108 LYS A O    1  
ATOM 1737  C CB   . LYS A 1 108 ? -3.494  5.865   1.401   1.00 0.00 ? 108 LYS A CB   1  
ATOM 1738  C CG   . LYS A 1 108 ? -3.390  6.972   0.366   1.00 0.00 ? 108 LYS A CG   1  
ATOM 1739  C CD   . LYS A 1 108 ? -3.551  6.432   -1.045  1.00 0.00 ? 108 LYS A CD   1  
ATOM 1740  C CE   . LYS A 1 108 ? -3.475  7.545   -2.080  1.00 0.00 ? 108 LYS A CE   1  
ATOM 1741  N NZ   . LYS A 1 108 ? -4.818  8.117   -2.378  1.00 0.00 ? 108 LYS A NZ   1  
ATOM 1742  H H    . LYS A 1 108 ? -1.314  6.097   3.018   1.00 0.00 ? 108 LYS A H    1  
ATOM 1743  H HA   . LYS A 1 108 ? -4.026  7.244   2.950   1.00 0.00 ? 108 LYS A HA   1  
ATOM 1744  H HB2  . LYS A 1 108 ? -2.692  5.162   1.228   1.00 0.00 ? 108 LYS A HB2  1  
ATOM 1745  H HB3  . LYS A 1 108 ? -4.439  5.361   1.265   1.00 0.00 ? 108 LYS A HB3  1  
ATOM 1746  H HG2  . LYS A 1 108 ? -4.166  7.700   0.551   1.00 0.00 ? 108 LYS A HG2  1  
ATOM 1747  H HG3  . LYS A 1 108 ? -2.422  7.444   0.453   1.00 0.00 ? 108 LYS A HG3  1  
ATOM 1748  H HD2  . LYS A 1 108 ? -2.763  5.720   -1.241  1.00 0.00 ? 108 LYS A HD2  1  
ATOM 1749  H HD3  . LYS A 1 108 ? -4.511  5.941   -1.127  1.00 0.00 ? 108 LYS A HD3  1  
ATOM 1750  H HE2  . LYS A 1 108 ? -2.836  8.327   -1.701  1.00 0.00 ? 108 LYS A HE2  1  
ATOM 1751  H HE3  . LYS A 1 108 ? -3.054  7.144   -2.990  1.00 0.00 ? 108 LYS A HE3  1  
ATOM 1752  H HZ1  . LYS A 1 108 ? -5.188  7.714   -3.263  1.00 0.00 ? 108 LYS A HZ1  1  
ATOM 1753  H HZ2  . LYS A 1 108 ? -4.751  9.149   -2.481  1.00 0.00 ? 108 LYS A HZ2  1  
ATOM 1754  H HZ3  . LYS A 1 108 ? -5.479  7.898   -1.606  1.00 0.00 ? 108 LYS A HZ3  1  
ATOM 1755  N N    . VAL A 1 109 ? -5.016  5.580   4.480   1.00 0.00 ? 109 VAL A N    1  
ATOM 1756  C CA   . VAL A 1 109 ? -5.604  4.635   5.422   1.00 0.00 ? 109 VAL A CA   1  
ATOM 1757  C C    . VAL A 1 109 ? -6.597  3.711   4.727   1.00 0.00 ? 109 VAL A C    1  
ATOM 1758  O O    . VAL A 1 109 ? -7.336  4.134   3.837   1.00 0.00 ? 109 VAL A O    1  
ATOM 1759  C CB   . VAL A 1 109 ? -6.318  5.364   6.576   1.00 0.00 ? 109 VAL A CB   1  
ATOM 1760  C CG1  . VAL A 1 109 ? -6.803  4.368   7.618   1.00 0.00 ? 109 VAL A CG1  1  
ATOM 1761  C CG2  . VAL A 1 109 ? -5.396  6.399   7.203   1.00 0.00 ? 109 VAL A CG2  1  
ATOM 1762  H H    . VAL A 1 109 ? -5.447  6.450   4.344   1.00 0.00 ? 109 VAL A H    1  
ATOM 1763  H HA   . VAL A 1 109 ? -4.805  4.040   5.840   1.00 0.00 ? 109 VAL A HA   1  
ATOM 1764  H HB   . VAL A 1 109 ? -7.179  5.877   6.173   1.00 0.00 ? 109 VAL A HB   1  
ATOM 1765  H HG11 . VAL A 1 109 ? -7.069  3.441   7.133   1.00 0.00 ? 109 VAL A HG11 1  
ATOM 1766  H HG12 . VAL A 1 109 ? -6.018  4.188   8.337   1.00 0.00 ? 109 VAL A HG12 1  
ATOM 1767  H HG13 . VAL A 1 109 ? -7.669  4.770   8.124   1.00 0.00 ? 109 VAL A HG13 1  
ATOM 1768  H HG21 . VAL A 1 109 ? -4.752  5.917   7.923   1.00 0.00 ? 109 VAL A HG21 1  
ATOM 1769  H HG22 . VAL A 1 109 ? -4.795  6.860   6.433   1.00 0.00 ? 109 VAL A HG22 1  
ATOM 1770  H HG23 . VAL A 1 109 ? -5.987  7.155   7.699   1.00 0.00 ? 109 VAL A HG23 1  
ATOM 1771  N N    . TYR A 1 110 ? -6.611  2.449   5.139   1.00 0.00 ? 110 TYR A N    1  
ATOM 1772  C CA   . TYR A 1 110 ? -7.512  1.463   4.555   1.00 0.00 ? 110 TYR A CA   1  
ATOM 1773  C C    . TYR A 1 110 ? -8.043  0.510   5.621   1.00 0.00 ? 110 TYR A C    1  
ATOM 1774  O O    . TYR A 1 110 ? -7.409  0.303   6.655   1.00 0.00 ? 110 TYR A O    1  
ATOM 1775  C CB   . TYR A 1 110 ? -6.796  0.672   3.459   1.00 0.00 ? 110 TYR A CB   1  
ATOM 1776  C CG   . TYR A 1 110 ? -6.889  1.311   2.092   1.00 0.00 ? 110 TYR A CG   1  
ATOM 1777  C CD1  . TYR A 1 110 ? -6.030  2.340   1.724   1.00 0.00 ? 110 TYR A CD1  1  
ATOM 1778  C CD2  . TYR A 1 110 ? -7.836  0.887   1.168   1.00 0.00 ? 110 TYR A CD2  1  
ATOM 1779  C CE1  . TYR A 1 110 ? -6.112  2.927   0.476   1.00 0.00 ? 110 TYR A CE1  1  
ATOM 1780  C CE2  . TYR A 1 110 ? -7.924  1.467   -0.083  1.00 0.00 ? 110 TYR A CE2  1  
ATOM 1781  C CZ   . TYR A 1 110 ? -7.060  2.487   -0.424  1.00 0.00 ? 110 TYR A CZ   1  
ATOM 1782  O OH   . TYR A 1 110 ? -7.145  3.069   -1.668  1.00 0.00 ? 110 TYR A OH   1  
ATOM 1783  H H    . TYR A 1 110 ? -5.998  2.172   5.852   1.00 0.00 ? 110 TYR A H    1  
ATOM 1784  H HA   . TYR A 1 110 ? -8.345  1.994   4.116   1.00 0.00 ? 110 TYR A HA   1  
ATOM 1785  H HB2  . TYR A 1 110 ? -5.751  0.584   3.713   1.00 0.00 ? 110 TYR A HB2  1  
ATOM 1786  H HB3  . TYR A 1 110 ? -7.231  -0.315  3.395   1.00 0.00 ? 110 TYR A HB3  1  
ATOM 1787  H HD1  . TYR A 1 110 ? -5.289  2.682   2.431   1.00 0.00 ? 110 TYR A HD1  1  
ATOM 1788  H HD2  . TYR A 1 110 ? -8.511  0.088   1.438   1.00 0.00 ? 110 TYR A HD2  1  
ATOM 1789  H HE1  . TYR A 1 110 ? -5.436  3.725   0.209   1.00 0.00 ? 110 TYR A HE1  1  
ATOM 1790  H HE2  . TYR A 1 110 ? -8.666  1.123   -0.788  1.00 0.00 ? 110 TYR A HE2  1  
ATOM 1791  H HH   . TYR A 1 110 ? -6.708  2.508   -2.313  1.00 0.00 ? 110 TYR A HH   1  
ATOM 1792  N N    . ARG A 1 111 ? -9.212  -0.067  5.361   1.00 0.00 ? 111 ARG A N    1  
ATOM 1793  C CA   . ARG A 1 111 ? -9.830  -0.998  6.298   1.00 0.00 ? 111 ARG A CA   1  
ATOM 1794  C C    . ARG A 1 111 ? -10.057 -2.357  5.643   1.00 0.00 ? 111 ARG A C    1  
ATOM 1795  O O    . ARG A 1 111 ? -10.704 -2.454  4.600   1.00 0.00 ? 111 ARG A O    1  
ATOM 1796  C CB   . ARG A 1 111 ? -11.158 -0.436  6.806   1.00 0.00 ? 111 ARG A CB   1  
ATOM 1797  C CG   . ARG A 1 111 ? -11.998 -1.451  7.564   1.00 0.00 ? 111 ARG A CG   1  
ATOM 1798  C CD   . ARG A 1 111 ? -13.475 -1.087  7.533   1.00 0.00 ? 111 ARG A CD   1  
ATOM 1799  N NE   . ARG A 1 111 ? -14.290 -2.042  8.278   1.00 0.00 ? 111 ARG A NE   1  
ATOM 1800  C CZ   . ARG A 1 111 ? -15.594 -1.894  8.481   1.00 0.00 ? 111 ARG A CZ   1  
ATOM 1801  N NH1  . ARG A 1 111 ? -16.228 -0.835  7.997   1.00 0.00 ? 111 ARG A NH1  1  
ATOM 1802  N NH2  . ARG A 1 111 ? -16.268 -2.807  9.169   1.00 0.00 ? 111 ARG A NH2  1  
ATOM 1803  H H    . ARG A 1 111 ? -9.670  0.139   4.519   1.00 0.00 ? 111 ARG A H    1  
ATOM 1804  H HA   . ARG A 1 111 ? -9.158  -1.122  7.134   1.00 0.00 ? 111 ARG A HA   1  
ATOM 1805  H HB2  . ARG A 1 111 ? -10.956 0.395   7.466   1.00 0.00 ? 111 ARG A HB2  1  
ATOM 1806  H HB3  . ARG A 1 111 ? -11.733 -0.084  5.963   1.00 0.00 ? 111 ARG A HB3  1  
ATOM 1807  H HG2  . ARG A 1 111 ? -11.869 -2.422  7.111   1.00 0.00 ? 111 ARG A HG2  1  
ATOM 1808  H HG3  . ARG A 1 111 ? -11.666 -1.484  8.591   1.00 0.00 ? 111 ARG A HG3  1  
ATOM 1809  H HD2  . ARG A 1 111 ? -13.599 -0.106  7.968   1.00 0.00 ? 111 ARG A HD2  1  
ATOM 1810  H HD3  . ARG A 1 111 ? -13.805 -1.069  6.505   1.00 0.00 ? 111 ARG A HD3  1  
ATOM 1811  H HE   . ARG A 1 111 ? -13.842 -2.832  8.644   1.00 0.00 ? 111 ARG A HE   1  
ATOM 1812  H HH11 . ARG A 1 111 ? -15.723 -0.146  7.477   1.00 0.00 ? 111 ARG A HH11 1  
ATOM 1813  H HH12 . ARG A 1 111 ? -17.210 -0.726  8.150   1.00 0.00 ? 111 ARG A HH12 1  
ATOM 1814  H HH21 . ARG A 1 111 ? -15.794 -3.607  9.535   1.00 0.00 ? 111 ARG A HH21 1  
ATOM 1815  H HH22 . ARG A 1 111 ? -17.249 -2.695  9.321   1.00 0.00 ? 111 ARG A HH22 1  
ATOM 1816  N N    . ILE A 1 112 ? -9.521  -3.403  6.262   1.00 0.00 ? 112 ILE A N    1  
ATOM 1817  C CA   . ILE A 1 112 ? -9.666  -4.756  5.739   1.00 0.00 ? 112 ILE A CA   1  
ATOM 1818  C C    . ILE A 1 112 ? -11.077 -5.286  5.969   1.00 0.00 ? 112 ILE A C    1  
ATOM 1819  O O    . ILE A 1 112 ? -11.425 -5.698  7.076   1.00 0.00 ? 112 ILE A O    1  
ATOM 1820  C CB   . ILE A 1 112 ? -8.656  -5.721  6.387   1.00 0.00 ? 112 ILE A CB   1  
ATOM 1821  C CG1  . ILE A 1 112 ? -7.226  -5.219  6.171   1.00 0.00 ? 112 ILE A CG1  1  
ATOM 1822  C CG2  . ILE A 1 112 ? -8.822  -7.123  5.819   1.00 0.00 ? 112 ILE A CG2  1  
ATOM 1823  C CD1  . ILE A 1 112 ? -6.199  -5.939  7.017   1.00 0.00 ? 112 ILE A CD1  1  
ATOM 1824  H H    . ILE A 1 112 ? -9.016  -3.262  7.089   1.00 0.00 ? 112 ILE A H    1  
ATOM 1825  H HA   . ILE A 1 112 ? -9.473  -4.725  4.677   1.00 0.00 ? 112 ILE A HA   1  
ATOM 1826  H HB   . ILE A 1 112 ? -8.859  -5.762  7.447   1.00 0.00 ? 112 ILE A HB   1  
ATOM 1827  H HG12 . ILE A 1 112 ? -6.957  -5.355  5.136   1.00 0.00 ? 112 ILE A HG12 1  
ATOM 1828  H HG13 . ILE A 1 112 ? -7.182  -4.168  6.416   1.00 0.00 ? 112 ILE A HG13 1  
ATOM 1829  H HG21 . ILE A 1 112 ? -8.042  -7.763  6.205   1.00 0.00 ? 112 ILE A HG21 1  
ATOM 1830  H HG22 . ILE A 1 112 ? -9.785  -7.516  6.109   1.00 0.00 ? 112 ILE A HG22 1  
ATOM 1831  H HG23 . ILE A 1 112 ? -8.757  -7.085  4.742   1.00 0.00 ? 112 ILE A HG23 1  
ATOM 1832  H HD11 . ILE A 1 112 ? -5.466  -6.405  6.374   1.00 0.00 ? 112 ILE A HD11 1  
ATOM 1833  H HD12 . ILE A 1 112 ? -5.710  -5.232  7.669   1.00 0.00 ? 112 ILE A HD12 1  
ATOM 1834  H HD13 . ILE A 1 112 ? -6.689  -6.697  7.611   1.00 0.00 ? 112 ILE A HD13 1  
ATOM 1835  N N    . VAL A 1 113 ? -11.887 -5.273  4.915   1.00 0.00 ? 113 VAL A N    1  
ATOM 1836  C CA   . VAL A 1 113 ? -13.260 -5.755  5.001   1.00 0.00 ? 113 VAL A CA   1  
ATOM 1837  C C    . VAL A 1 113 ? -13.311 -7.279  4.973   1.00 0.00 ? 113 VAL A C    1  
ATOM 1838  O O    . VAL A 1 113 ? -12.834 -7.923  4.039   1.00 0.00 ? 113 VAL A O    1  
ATOM 1839  C CB   . VAL A 1 113 ? -14.122 -5.202  3.850   1.00 0.00 ? 113 VAL A CB   1  
ATOM 1840  C CG1  . VAL A 1 113 ? -15.601 -5.331  4.180   1.00 0.00 ? 113 VAL A CG1  1  
ATOM 1841  C CG2  . VAL A 1 113 ? -13.756 -3.755  3.559   1.00 0.00 ? 113 VAL A CG2  1  
ATOM 1842  H H    . VAL A 1 113 ? -11.552 -4.933  4.060   1.00 0.00 ? 113 VAL A H    1  
ATOM 1843  H HA   . VAL A 1 113 ? -13.679 -5.408  5.934   1.00 0.00 ? 113 VAL A HA   1  
ATOM 1844  H HB   . VAL A 1 113 ? -13.921 -5.787  2.964   1.00 0.00 ? 113 VAL A HB   1  
ATOM 1845  H HG11 . VAL A 1 113 ? -16.156 -5.529  3.275   1.00 0.00 ? 113 VAL A HG11 1  
ATOM 1846  H HG12 . VAL A 1 113 ? -15.745 -6.144  4.877   1.00 0.00 ? 113 VAL A HG12 1  
ATOM 1847  H HG13 . VAL A 1 113 ? -15.952 -4.410  4.622   1.00 0.00 ? 113 VAL A HG13 1  
ATOM 1848  H HG21 . VAL A 1 113 ? -14.418 -3.362  2.801   1.00 0.00 ? 113 VAL A HG21 1  
ATOM 1849  H HG22 . VAL A 1 113 ? -13.855 -3.169  4.462   1.00 0.00 ? 113 VAL A HG22 1  
ATOM 1850  H HG23 . VAL A 1 113 ? -12.736 -3.704  3.208   1.00 0.00 ? 113 VAL A HG23 1  
ATOM 1851  N N    . PRO A 1 114 ? -13.904 -7.870  6.020   1.00 0.00 ? 114 PRO A N    1  
ATOM 1852  C CA   . PRO A 1 114 ? -14.033 -9.326  6.139   1.00 0.00 ? 114 PRO A CA   1  
ATOM 1853  C C    . PRO A 1 114 ? -15.018 -9.905  5.129   1.00 0.00 ? 114 PRO A C    1  
ATOM 1854  O O    . PRO A 1 114 ? -15.495 -9.200  4.240   1.00 0.00 ? 114 PRO A O    1  
ATOM 1855  C CB   . PRO A 1 114 ? -14.553 -9.520  7.566   1.00 0.00 ? 114 PRO A CB   1  
ATOM 1856  C CG   . PRO A 1 114 ? -15.250 -8.245  7.892   1.00 0.00 ? 114 PRO A CG   1  
ATOM 1857  C CD   . PRO A 1 114 ? -14.495 -7.164  7.169   1.00 0.00 ? 114 PRO A CD   1  
ATOM 1858  H HA   . PRO A 1 114 ? -13.078 -9.818  6.032   1.00 0.00 ? 114 PRO A HA   1  
ATOM 1859  H HB2  . PRO A 1 114 ? -15.232 -10.361 7.592   1.00 0.00 ? 114 PRO A HB2  1  
ATOM 1860  H HB3  . PRO A 1 114 ? -13.724 -9.699  8.234   1.00 0.00 ? 114 PRO A HB3  1  
ATOM 1861  H HG2  . PRO A 1 114 ? -16.271 -8.286  7.546   1.00 0.00 ? 114 PRO A HG2  1  
ATOM 1862  H HG3  . PRO A 1 114 ? -15.220 -8.074  8.958   1.00 0.00 ? 114 PRO A HG3  1  
ATOM 1863  H HD2  . PRO A 1 114 ? -15.171 -6.388  6.839   1.00 0.00 ? 114 PRO A HD2  1  
ATOM 1864  H HD3  . PRO A 1 114 ? -13.726 -6.751  7.805   1.00 0.00 ? 114 PRO A HD3  1  
ATOM 1865  N N    . GLU A 1 115 ? -15.318 -11.192 5.274   1.00 0.00 ? 115 GLU A N    1  
ATOM 1866  C CA   . GLU A 1 115 ? -16.247 -11.864 4.373   1.00 0.00 ? 115 GLU A CA   1  
ATOM 1867  C C    . GLU A 1 115 ? -17.668 -11.825 4.928   1.00 0.00 ? 115 GLU A C    1  
ATOM 1868  O O    . GLU A 1 115 ? -18.612 -11.472 4.221   1.00 0.00 ? 115 GLU A O    1  
ATOM 1869  C CB   . GLU A 1 115 ? -15.815 -13.315 4.150   1.00 0.00 ? 115 GLU A CB   1  
ATOM 1870  C CG   . GLU A 1 115 ? -14.513 -13.451 3.378   1.00 0.00 ? 115 GLU A CG   1  
ATOM 1871  C CD   . GLU A 1 115 ? -13.832 -14.785 3.614   1.00 0.00 ? 115 GLU A CD   1  
ATOM 1872  O OE1  . GLU A 1 115 ? -13.149 -14.928 4.649   1.00 0.00 ? 115 GLU A OE1  1  
ATOM 1873  O OE2  . GLU A 1 115 ? -13.982 -15.686 2.762   1.00 0.00 ? 115 GLU A OE2  1  
ATOM 1874  H H    . GLU A 1 115 ? -14.906 -11.701 6.003   1.00 0.00 ? 115 GLU A H    1  
ATOM 1875  H HA   . GLU A 1 115 ? -16.228 -11.344 3.428   1.00 0.00 ? 115 GLU A HA   1  
ATOM 1876  H HB2  . GLU A 1 115 ? -15.692 -13.794 5.110   1.00 0.00 ? 115 GLU A HB2  1  
ATOM 1877  H HB3  . GLU A 1 115 ? -16.590 -13.828 3.599   1.00 0.00 ? 115 GLU A HB3  1  
ATOM 1878  H HG2  . GLU A 1 115 ? -14.722 -13.352 2.324   1.00 0.00 ? 115 GLU A HG2  1  
ATOM 1879  H HG3  . GLU A 1 115 ? -13.843 -12.662 3.686   1.00 0.00 ? 115 GLU A HG3  1  
ATOM 1880  N N    . SER A 1 116 ? -17.812 -12.191 6.198   1.00 0.00 ? 116 SER A N    1  
ATOM 1881  C CA   . SER A 1 116 ? -19.117 -12.202 6.847   1.00 0.00 ? 116 SER A CA   1  
ATOM 1882  C C    . SER A 1 116 ? -19.493 -10.806 7.336   1.00 0.00 ? 116 SER A C    1  
ATOM 1883  O O    . SER A 1 116 ? -20.373 -10.648 8.181   1.00 0.00 ? 116 SER A O    1  
ATOM 1884  C CB   . SER A 1 116 ? -19.119 -13.183 8.020   1.00 0.00 ? 116 SER A CB   1  
ATOM 1885  O OG   . SER A 1 116 ? -20.431 -13.634 8.307   1.00 0.00 ? 116 SER A OG   1  
ATOM 1886  H H    . SER A 1 116 ? -17.021 -12.462 6.709   1.00 0.00 ? 116 SER A H    1  
ATOM 1887  H HA   . SER A 1 116 ? -19.847 -12.524 6.119   1.00 0.00 ? 116 SER A HA   1  
ATOM 1888  H HB2  . SER A 1 116 ? -18.504 -14.036 7.774   1.00 0.00 ? 116 SER A HB2  1  
ATOM 1889  H HB3  . SER A 1 116 ? -18.720 -12.693 8.896   1.00 0.00 ? 116 SER A HB3  1  
ATOM 1890  H HG   . SER A 1 116 ? -20.494 -14.574 8.124   1.00 0.00 ? 116 SER A HG   1  
ATOM 1891  N N    . GLY A 1 117 ? -18.817 -9.796  6.798   1.00 0.00 ? 117 GLY A N    1  
ATOM 1892  C CA   . GLY A 1 117 ? -19.092 -8.426  7.191   1.00 0.00 ? 117 GLY A CA   1  
ATOM 1893  C C    . GLY A 1 117 ? -20.156 -7.778  6.326   1.00 0.00 ? 117 GLY A C    1  
ATOM 1894  O O    . GLY A 1 117 ? -20.353 -8.144  5.168   1.00 0.00 ? 117 GLY A O    1  
ATOM 1895  H H    . GLY A 1 117 ? -18.125 -9.982  6.128   1.00 0.00 ? 117 GLY A H    1  
ATOM 1896  H HA2  . GLY A 1 117 ? -19.424 -8.418  8.218   1.00 0.00 ? 117 GLY A HA2  1  
ATOM 1897  H HA3  . GLY A 1 117 ? -18.181 -7.851  7.112   1.00 0.00 ? 117 GLY A HA3  1  
ATOM 1898  N N    . PRO A 1 118 ? -20.864 -6.790  6.894   1.00 0.00 ? 118 PRO A N    1  
ATOM 1899  C CA   . PRO A 1 118 ? -21.926 -6.070  6.186   1.00 0.00 ? 118 PRO A CA   1  
ATOM 1900  C C    . PRO A 1 118 ? -21.380 -5.174  5.079   1.00 0.00 ? 118 PRO A C    1  
ATOM 1901  O O    . PRO A 1 118 ? -20.844 -4.098  5.346   1.00 0.00 ? 118 PRO A O    1  
ATOM 1902  C CB   . PRO A 1 118 ? -22.576 -5.226  7.285   1.00 0.00 ? 118 PRO A CB   1  
ATOM 1903  C CG   . PRO A 1 118 ? -21.506 -5.044  8.305   1.00 0.00 ? 118 PRO A CG   1  
ATOM 1904  C CD   . PRO A 1 118 ? -20.683 -6.302  8.271   1.00 0.00 ? 118 PRO A CD   1  
ATOM 1905  H HA   . PRO A 1 118 ? -22.657 -6.748  5.770   1.00 0.00 ? 118 PRO A HA   1  
ATOM 1906  H HB2  . PRO A 1 118 ? -22.896 -4.279  6.873   1.00 0.00 ? 118 PRO A HB2  1  
ATOM 1907  H HB3  . PRO A 1 118 ? -23.425 -5.752  7.693   1.00 0.00 ? 118 PRO A HB3  1  
ATOM 1908  H HG2  . PRO A 1 118 ? -20.897 -4.190  8.051   1.00 0.00 ? 118 PRO A HG2  1  
ATOM 1909  H HG3  . PRO A 1 118 ? -21.949 -4.913  9.281   1.00 0.00 ? 118 PRO A HG3  1  
ATOM 1910  H HD2  . PRO A 1 118 ? -19.645 -6.078  8.468   1.00 0.00 ? 118 PRO A HD2  1  
ATOM 1911  H HD3  . PRO A 1 118 ? -21.059 -7.018  8.986   1.00 0.00 ? 118 PRO A HD3  1  
ATOM 1912  N N    . SER A 1 119 ? -21.519 -5.624  3.836   1.00 0.00 ? 119 SER A N    1  
ATOM 1913  C CA   . SER A 1 119 ? -21.037 -4.864  2.689   1.00 0.00 ? 119 SER A CA   1  
ATOM 1914  C C    . SER A 1 119 ? -21.487 -3.409  2.773   1.00 0.00 ? 119 SER A C    1  
ATOM 1915  O O    . SER A 1 119 ? -20.704 -2.491  2.530   1.00 0.00 ? 119 SER A O    1  
ATOM 1916  C CB   . SER A 1 119 ? -21.540 -5.491  1.387   1.00 0.00 ? 119 SER A CB   1  
ATOM 1917  O OG   . SER A 1 119 ? -20.825 -4.991  0.271   1.00 0.00 ? 119 SER A OG   1  
ATOM 1918  H H    . SER A 1 119 ? -21.955 -6.490  3.688   1.00 0.00 ? 119 SER A H    1  
ATOM 1919  H HA   . SER A 1 119 ? -19.958 -4.896  2.701   1.00 0.00 ? 119 SER A HA   1  
ATOM 1920  H HB2  . SER A 1 119 ? -21.409 -6.562  1.432   1.00 0.00 ? 119 SER A HB2  1  
ATOM 1921  H HB3  . SER A 1 119 ? -22.588 -5.261  1.261   1.00 0.00 ? 119 SER A HB3  1  
ATOM 1922  H HG   . SER A 1 119 ? -20.374 -5.714  -0.172  1.00 0.00 ? 119 SER A HG   1  
ATOM 1923  N N    . SER A 1 120 ? -22.754 -3.207  3.119   1.00 0.00 ? 120 SER A N    1  
ATOM 1924  C CA   . SER A 1 120 ? -23.311 -1.864  3.232   1.00 0.00 ? 120 SER A CA   1  
ATOM 1925  C C    . SER A 1 120 ? -23.370 -1.421  4.690   1.00 0.00 ? 120 SER A C    1  
ATOM 1926  O O    . SER A 1 120 ? -23.280 -2.240  5.604   1.00 0.00 ? 120 SER A O    1  
ATOM 1927  C CB   . SER A 1 120 ? -24.711 -1.817  2.616   1.00 0.00 ? 120 SER A CB   1  
ATOM 1928  O OG   . SER A 1 120 ? -25.539 -2.835  3.151   1.00 0.00 ? 120 SER A OG   1  
ATOM 1929  H H    . SER A 1 120 ? -23.329 -3.981  3.300   1.00 0.00 ? 120 SER A H    1  
ATOM 1930  H HA   . SER A 1 120 ? -22.665 -1.191  2.689   1.00 0.00 ? 120 SER A HA   1  
ATOM 1931  H HB2  . SER A 1 120 ? -25.161 -0.858  2.824   1.00 0.00 ? 120 SER A HB2  1  
ATOM 1932  H HB3  . SER A 1 120 ? -24.636 -1.955  1.547   1.00 0.00 ? 120 SER A HB3  1  
ATOM 1933  H HG   . SER A 1 120 ? -25.585 -2.742  4.106   1.00 0.00 ? 120 SER A HG   1  
ATOM 1934  N N    . GLY A 1 121 ? -23.520 -0.117  4.901   1.00 0.00 ? 121 GLY A N    1  
ATOM 1935  C CA   . GLY A 1 121 ? -23.588 0.414   6.249   1.00 0.00 ? 121 GLY A CA   1  
ATOM 1936  C C    . GLY A 1 121 ? -22.812 1.707   6.403   1.00 0.00 ? 121 GLY A C    1  
ATOM 1937  O O    . GLY A 1 121 ? -22.985 2.640   5.618   1.00 0.00 ? 121 GLY A O    1  
ATOM 1938  H H    . GLY A 1 121 ? -23.586 0.490   4.133   1.00 0.00 ? 121 GLY A H    1  
ATOM 1939  H HA2  . GLY A 1 121 ? -24.622 0.595   6.502   1.00 0.00 ? 121 GLY A HA2  1  
ATOM 1940  H HA3  . GLY A 1 121 ? -23.183 -0.318  6.933   1.00 0.00 ? 121 GLY A HA3  1  
ATOM 1941  N N    . GLY A 1 1   ? 1.316   -31.942 -2.434  1.00 0.00 ? 1   GLY A N    2  
ATOM 1942  C CA   . GLY A 1 1   ? 1.914   -30.795 -1.776  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1943  C C    . GLY A 1 1   ? 2.846   -30.024 -2.690  1.00 0.00 ? 1   GLY A C    2  
ATOM 1944  O O    . GLY A 1 1   ? 3.793   -30.587 -3.240  1.00 0.00 ? 1   GLY A O    2  
ATOM 1945  H H1   . GLY A 1 1   ? 0.732   -32.545 -1.928  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1946  H HA2  . GLY A 1 1   ? 1.128   -30.135 -1.441  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1947  H HA3  . GLY A 1 1   ? 2.473   -31.138 -0.918  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1948  N N    . SER A 1 2   ? 2.578   -28.733 -2.853  1.00 0.00 ? 2   SER A N    2  
ATOM 1949  C CA   . SER A 1 2   ? 3.397   -27.884 -3.710  1.00 0.00 ? 2   SER A CA   2  
ATOM 1950  C C    . SER A 1 2   ? 4.029   -26.750 -2.909  1.00 0.00 ? 2   SER A C    2  
ATOM 1951  O O    . SER A 1 2   ? 3.390   -26.159 -2.039  1.00 0.00 ? 2   SER A O    2  
ATOM 1952  C CB   . SER A 1 2   ? 2.553   -27.309 -4.850  1.00 0.00 ? 2   SER A CB   2  
ATOM 1953  O OG   . SER A 1 2   ? 3.317   -26.429 -5.656  1.00 0.00 ? 2   SER A OG   2  
ATOM 1954  H H    . SER A 1 2   ? 1.809   -28.342 -2.387  1.00 0.00 ? 2   SER A H    2  
ATOM 1955  H HA   . SER A 1 2   ? 4.183   -28.495 -4.129  1.00 0.00 ? 2   SER A HA   2  
ATOM 1956  H HB2  . SER A 1 2   ? 2.188   -28.116 -5.466  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1957  H HB3  . SER A 1 2   ? 1.717   -26.765 -4.436  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1958  H HG   . SER A 1 2   ? 4.251   -26.557 -5.474  1.00 0.00 ? 2   SER A HG   2  
ATOM 1959  N N    . SER A 1 3   ? 5.289   -26.453 -3.209  1.00 0.00 ? 3   SER A N    2  
ATOM 1960  C CA   . SER A 1 3   ? 6.011   -25.393 -2.514  1.00 0.00 ? 3   SER A CA   2  
ATOM 1961  C C    . SER A 1 3   ? 5.632   -24.024 -3.070  1.00 0.00 ? 3   SER A C    2  
ATOM 1962  O O    . SER A 1 3   ? 5.939   -23.700 -4.216  1.00 0.00 ? 3   SER A O    2  
ATOM 1963  C CB   . SER A 1 3   ? 7.520   -25.607 -2.641  1.00 0.00 ? 3   SER A CB   2  
ATOM 1964  O OG   . SER A 1 3   ? 7.914   -25.674 -4.001  1.00 0.00 ? 3   SER A OG   2  
ATOM 1965  H H    . SER A 1 3   ? 5.745   -26.961 -3.913  1.00 0.00 ? 3   SER A H    2  
ATOM 1966  H HA   . SER A 1 3   ? 5.736   -25.434 -1.471  1.00 0.00 ? 3   SER A HA   2  
ATOM 1967  H HB2  . SER A 1 3   ? 8.039   -24.787 -2.169  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1968  H HB3  . SER A 1 3   ? 7.792   -26.533 -2.154  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1969  H HG   . SER A 1 3   ? 7.989   -26.593 -4.268  1.00 0.00 ? 3   SER A HG   2  
ATOM 1970  N N    . GLY A 1 4   ? 4.961   -23.223 -2.247  1.00 0.00 ? 4   GLY A N    2  
ATOM 1971  C CA   . GLY A 1 4   ? 4.550   -21.898 -2.672  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1972  C C    . GLY A 1 4   ? 3.104   -21.602 -2.330  1.00 0.00 ? 4   GLY A C    2  
ATOM 1973  O O    . GLY A 1 4   ? 2.290   -22.516 -2.200  1.00 0.00 ? 4   GLY A O    2  
ATOM 1974  H H    . GLY A 1 4   ? 4.744   -23.535 -1.343  1.00 0.00 ? 4   GLY A H    2  
ATOM 1975  H HA2  . GLY A 1 4   ? 5.181   -21.165 -2.191  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1976  H HA3  . GLY A 1 4   ? 4.678   -21.820 -3.742  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1977  N N    . SER A 1 5   ? 2.783   -20.320 -2.181  1.00 0.00 ? 5   SER A N    2  
ATOM 1978  C CA   . SER A 1 5   ? 1.425   -19.906 -1.846  1.00 0.00 ? 5   SER A CA   2  
ATOM 1979  C C    . SER A 1 5   ? 0.629   -19.582 -3.106  1.00 0.00 ? 5   SER A C    2  
ATOM 1980  O O    . SER A 1 5   ? 1.118   -18.892 -4.002  1.00 0.00 ? 5   SER A O    2  
ATOM 1981  C CB   . SER A 1 5   ? 1.455   -18.689 -0.920  1.00 0.00 ? 5   SER A CB   2  
ATOM 1982  O OG   . SER A 1 5   ? 0.165   -18.409 -0.404  1.00 0.00 ? 5   SER A OG   2  
ATOM 1983  H H    . SER A 1 5   ? 3.476   -19.638 -2.297  1.00 0.00 ? 5   SER A H    2  
ATOM 1984  H HA   . SER A 1 5   ? 0.946   -20.726 -1.333  1.00 0.00 ? 5   SER A HA   2  
ATOM 1985  H HB2  . SER A 1 5   ? 2.125   -18.882 -0.096  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1986  H HB3  . SER A 1 5   ? 1.803   -17.828 -1.473  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1987  H HG   . SER A 1 5   ? 0.150   -17.519 -0.044  1.00 0.00 ? 5   SER A HG   2  
ATOM 1988  N N    . SER A 1 6   ? -0.600  -20.084 -3.168  1.00 0.00 ? 6   SER A N    2  
ATOM 1989  C CA   . SER A 1 6   ? -1.463  -19.852 -4.320  1.00 0.00 ? 6   SER A CA   2  
ATOM 1990  C C    . SER A 1 6   ? -1.585  -18.360 -4.616  1.00 0.00 ? 6   SER A C    2  
ATOM 1991  O O    . SER A 1 6   ? -1.216  -17.897 -5.694  1.00 0.00 ? 6   SER A O    2  
ATOM 1992  C CB   . SER A 1 6   ? -2.850  -20.449 -4.073  1.00 0.00 ? 6   SER A CB   2  
ATOM 1993  O OG   . SER A 1 6   ? -3.786  -19.974 -5.025  1.00 0.00 ? 6   SER A OG   2  
ATOM 1994  H H    . SER A 1 6   ? -0.932  -20.626 -2.422  1.00 0.00 ? 6   SER A H    2  
ATOM 1995  H HA   . SER A 1 6   ? -1.017  -20.340 -5.173  1.00 0.00 ? 6   SER A HA   2  
ATOM 1996  H HB2  . SER A 1 6   ? -2.794  -21.524 -4.147  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1997  H HB3  . SER A 1 6   ? -3.187  -20.173 -3.085  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1998  H HG   . SER A 1 6   ? -4.677  -20.158 -4.717  1.00 0.00 ? 6   SER A HG   2  
ATOM 1999  N N    . GLY A 1 7   ? -2.106  -17.612 -3.648  1.00 0.00 ? 7   GLY A N    2  
ATOM 2000  C CA   . GLY A 1 7   ? -2.268  -16.180 -3.822  1.00 0.00 ? 7   GLY A CA   2  
ATOM 2001  C C    . GLY A 1 7   ? -3.154  -15.563 -2.758  1.00 0.00 ? 7   GLY A C    2  
ATOM 2002  O O    . GLY A 1 7   ? -4.361  -15.804 -2.728  1.00 0.00 ? 7   GLY A O    2  
ATOM 2003  H H    . GLY A 1 7   ? -2.383  -18.035 -2.808  1.00 0.00 ? 7   GLY A H    2  
ATOM 2004  H HA2  . GLY A 1 7   ? -1.296  -15.711 -3.784  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 2005  H HA3  . GLY A 1 7   ? -2.707  -15.995 -4.792  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 2006  N N    . LYS A 1 8   ? -2.554  -14.765 -1.881  1.00 0.00 ? 8   LYS A N    2  
ATOM 2007  C CA   . LYS A 1 8   ? -3.295  -14.111 -0.809  1.00 0.00 ? 8   LYS A CA   2  
ATOM 2008  C C    . LYS A 1 8   ? -2.632  -12.796 -0.414  1.00 0.00 ? 8   LYS A C    2  
ATOM 2009  O O    . LYS A 1 8   ? -1.613  -12.786 0.279   1.00 0.00 ? 8   LYS A O    2  
ATOM 2010  C CB   . LYS A 1 8   ? -3.391  -15.033 0.408   1.00 0.00 ? 8   LYS A CB   2  
ATOM 2011  C CG   . LYS A 1 8   ? -4.380  -16.172 0.232   1.00 0.00 ? 8   LYS A CG   2  
ATOM 2012  C CD   . LYS A 1 8   ? -5.814  -15.668 0.213   1.00 0.00 ? 8   LYS A CD   2  
ATOM 2013  C CE   . LYS A 1 8   ? -6.791  -16.751 0.642   1.00 0.00 ? 8   LYS A CE   2  
ATOM 2014  N NZ   . LYS A 1 8   ? -8.165  -16.494 0.127   1.00 0.00 ? 8   LYS A NZ   2  
ATOM 2015  H H    . LYS A 1 8   ? -1.588  -14.612 -1.957  1.00 0.00 ? 8   LYS A H    2  
ATOM 2016  H HA   . LYS A 1 8   ? -4.290  -13.903 -1.173  1.00 0.00 ? 8   LYS A HA   2  
ATOM 2017  H HB2  . LYS A 1 8   ? -2.417  -15.456 0.602   1.00 0.00 ? 8   LYS A HB2  2  
ATOM 2018  H HB3  . LYS A 1 8   ? -3.697  -14.448 1.264   1.00 0.00 ? 8   LYS A HB3  2  
ATOM 2019  H HG2  . LYS A 1 8   ? -4.174  -16.675 -0.701  1.00 0.00 ? 8   LYS A HG2  2  
ATOM 2020  H HG3  . LYS A 1 8   ? -4.264  -16.867 1.051   1.00 0.00 ? 8   LYS A HG3  2  
ATOM 2021  H HD2  . LYS A 1 8   ? -5.901  -14.831 0.890   1.00 0.00 ? 8   LYS A HD2  2  
ATOM 2022  H HD3  . LYS A 1 8   ? -6.060  -15.349 -0.790  1.00 0.00 ? 8   LYS A HD3  2  
ATOM 2023  H HE2  . LYS A 1 8   ? -6.446  -17.701 0.263   1.00 0.00 ? 8   LYS A HE2  2  
ATOM 2024  H HE3  . LYS A 1 8   ? -6.821  -16.784 1.721   1.00 0.00 ? 8   LYS A HE3  2  
ATOM 2025  H HZ1  . LYS A 1 8   ? -8.184  -15.603 -0.409  1.00 0.00 ? 8   LYS A HZ1  2  
ATOM 2026  H HZ2  . LYS A 1 8   ? -8.836  -16.424 0.919   1.00 0.00 ? 8   LYS A HZ2  2  
ATOM 2027  H HZ3  . LYS A 1 8   ? -8.463  -17.270 -0.498  1.00 0.00 ? 8   LYS A HZ3  2  
ATOM 2028  N N    . LEU A 1 9   ? -3.216  -11.687 -0.855  1.00 0.00 ? 9   LEU A N    2  
ATOM 2029  C CA   . LEU A 1 9   ? -2.682  -10.366 -0.546  1.00 0.00 ? 9   LEU A CA   2  
ATOM 2030  C C    . LEU A 1 9   ? -3.109  -9.919  0.849   1.00 0.00 ? 9   LEU A C    2  
ATOM 2031  O O    . LEU A 1 9   ? -2.303  -9.398  1.619   1.00 0.00 ? 9   LEU A O    2  
ATOM 2032  C CB   . LEU A 1 9   ? -3.152  -9.347  -1.586  1.00 0.00 ? 9   LEU A CB   2  
ATOM 2033  C CG   . LEU A 1 9   ? -3.032  -7.876  -1.187  1.00 0.00 ? 9   LEU A CG   2  
ATOM 2034  C CD1  . LEU A 1 9   ? -1.640  -7.350  -1.498  1.00 0.00 ? 9   LEU A CD1  2  
ATOM 2035  C CD2  . LEU A 1 9   ? -4.090  -7.043  -1.897  1.00 0.00 ? 9   LEU A CD2  2  
ATOM 2036  H H    . LEU A 1 9   ? -4.025  -11.759 -1.403  1.00 0.00 ? 9   LEU A H    2  
ATOM 2037  H HA   . LEU A 1 9   ? -1.605  -10.428 -0.576  1.00 0.00 ? 9   LEU A HA   2  
ATOM 2038  H HB2  . LEU A 1 9   ? -2.568  -9.496  -2.481  1.00 0.00 ? 9   LEU A HB2  2  
ATOM 2039  H HB3  . LEU A 1 9   ? -4.192  -9.550  -1.799  1.00 0.00 ? 9   LEU A HB3  2  
ATOM 2040  H HG   . LEU A 1 9   ? -3.193  -7.784  -0.122  1.00 0.00 ? 9   LEU A HG   2  
ATOM 2041  H HD11 . LEU A 1 9   ? -1.038  -8.147  -1.908  1.00 0.00 ? 9   LEU A HD11 2  
ATOM 2042  H HD12 . LEU A 1 9   ? -1.182  -6.984  -0.591  1.00 0.00 ? 9   LEU A HD12 2  
ATOM 2043  H HD13 . LEU A 1 9   ? -1.711  -6.546  -2.215  1.00 0.00 ? 9   LEU A HD13 2  
ATOM 2044  H HD21 . LEU A 1 9   ? -4.403  -6.235  -1.253  1.00 0.00 ? 9   LEU A HD21 2  
ATOM 2045  H HD22 . LEU A 1 9   ? -4.940  -7.666  -2.133  1.00 0.00 ? 9   LEU A HD22 2  
ATOM 2046  H HD23 . LEU A 1 9   ? -3.676  -6.638  -2.809  1.00 0.00 ? 9   LEU A HD23 2  
ATOM 2047  N N    . ARG A 1 10  ? -4.382  -10.129 1.168   1.00 0.00 ? 10  ARG A N    2  
ATOM 2048  C CA   . ARG A 1 10  ? -4.917  -9.749  2.470   1.00 0.00 ? 10  ARG A CA   2  
ATOM 2049  C C    . ARG A 1 10  ? -3.927  -10.083 3.582   1.00 0.00 ? 10  ARG A C    2  
ATOM 2050  O O    . ARG A 1 10  ? -3.368  -9.189  4.217   1.00 0.00 ? 10  ARG A O    2  
ATOM 2051  C CB   . ARG A 1 10  ? -6.247  -10.459 2.726   1.00 0.00 ? 10  ARG A CB   2  
ATOM 2052  C CG   . ARG A 1 10  ? -6.943  -10.008 4.000   1.00 0.00 ? 10  ARG A CG   2  
ATOM 2053  C CD   . ARG A 1 10  ? -7.771  -11.128 4.609   1.00 0.00 ? 10  ARG A CD   2  
ATOM 2054  N NE   . ARG A 1 10  ? -9.112  -11.193 4.032   1.00 0.00 ? 10  ARG A NE   2  
ATOM 2055  C CZ   . ARG A 1 10  ? -9.420  -11.926 2.968   1.00 0.00 ? 10  ARG A CZ   2  
ATOM 2056  N NH1  . ARG A 1 10  ? -8.489  -12.653 2.368   1.00 0.00 ? 10  ARG A NH1  2  
ATOM 2057  N NH2  . ARG A 1 10  ? -10.663 -11.932 2.503   1.00 0.00 ? 10  ARG A NH2  2  
ATOM 2058  H H    . ARG A 1 10  ? -4.977  -10.548 0.511   1.00 0.00 ? 10  ARG A H    2  
ATOM 2059  H HA   . ARG A 1 10  ? -5.084  -8.682  2.461   1.00 0.00 ? 10  ARG A HA   2  
ATOM 2060  H HB2  . ARG A 1 10  ? -6.910  -10.269 1.894   1.00 0.00 ? 10  ARG A HB2  2  
ATOM 2061  H HB3  . ARG A 1 10  ? -6.067  -11.521 2.796   1.00 0.00 ? 10  ARG A HB3  2  
ATOM 2062  H HG2  . ARG A 1 10  ? -6.196  -9.698  4.716   1.00 0.00 ? 10  ARG A HG2  2  
ATOM 2063  H HG3  . ARG A 1 10  ? -7.592  -9.176  3.770   1.00 0.00 ? 10  ARG A HG3  2  
ATOM 2064  H HD2  . ARG A 1 10  ? -7.269  -12.067 4.431   1.00 0.00 ? 10  ARG A HD2  2  
ATOM 2065  H HD3  . ARG A 1 10  ? -7.854  -10.960 5.672   1.00 0.00 ? 10  ARG A HD3  2  
ATOM 2066  H HE   . ARG A 1 10  ? -9.816  -10.663 4.461   1.00 0.00 ? 10  ARG A HE   2  
ATOM 2067  H HH11 . ARG A 1 10  ? -7.552  -12.651 2.717   1.00 0.00 ? 10  ARG A HH11 2  
ATOM 2068  H HH12 . ARG A 1 10  ? -8.724  -13.205 1.567   1.00 0.00 ? 10  ARG A HH12 2  
ATOM 2069  H HH21 . ARG A 1 10  ? -11.368 -11.385 2.954   1.00 0.00 ? 10  ARG A HH21 2  
ATOM 2070  H HH22 . ARG A 1 10  ? -10.894 -12.484 1.702   1.00 0.00 ? 10  ARG A HH22 2  
ATOM 2071  N N    . GLN A 1 11  ? -3.717  -11.375 3.811   1.00 0.00 ? 11  GLN A N    2  
ATOM 2072  C CA   . GLN A 1 11  ? -2.796  -11.827 4.848   1.00 0.00 ? 11  GLN A CA   2  
ATOM 2073  C C    . GLN A 1 11  ? -1.387  -11.305 4.589   1.00 0.00 ? 11  GLN A C    2  
ATOM 2074  O O    . GLN A 1 11  ? -0.779  -10.675 5.455   1.00 0.00 ? 11  GLN A O    2  
ATOM 2075  C CB   . GLN A 1 11  ? -2.782  -13.355 4.917   1.00 0.00 ? 11  GLN A CB   2  
ATOM 2076  C CG   . GLN A 1 11  ? -2.123  -13.901 6.173   1.00 0.00 ? 11  GLN A CG   2  
ATOM 2077  C CD   . GLN A 1 11  ? -0.926  -13.079 6.608   1.00 0.00 ? 11  GLN A CD   2  
ATOM 2078  O OE1  . GLN A 1 11  ? 0.057   -12.958 5.876   1.00 0.00 ? 11  GLN A OE1  2  
ATOM 2079  N NE2  . GLN A 1 11  ? -1.002  -12.509 7.805   1.00 0.00 ? 11  GLN A NE2  2  
ATOM 2080  H H    . GLN A 1 11  ? -4.193  -12.040 3.272   1.00 0.00 ? 11  GLN A H    2  
ATOM 2081  H HA   . GLN A 1 11  ? -3.143  -11.436 5.792   1.00 0.00 ? 11  GLN A HA   2  
ATOM 2082  H HB2  . GLN A 1 11  ? -3.800  -13.714 4.885   1.00 0.00 ? 11  GLN A HB2  2  
ATOM 2083  H HB3  . GLN A 1 11  ? -2.247  -13.737 4.060   1.00 0.00 ? 11  GLN A HB3  2  
ATOM 2084  H HG2  . GLN A 1 11  ? -2.848  -13.904 6.973   1.00 0.00 ? 11  GLN A HG2  2  
ATOM 2085  H HG3  . GLN A 1 11  ? -1.796  -14.913 5.981   1.00 0.00 ? 11  GLN A HG3  2  
ATOM 2086  H HE21 . GLN A 1 11  ? -1.816  -12.651 8.333   1.00 0.00 ? 11  GLN A HE21 2  
ATOM 2087  H HE22 . GLN A 1 11  ? -0.242  -11.973 8.112   1.00 0.00 ? 11  GLN A HE22 2  
ATOM 2088  N N    . TRP A 1 12  ? -0.874  -11.571 3.393   1.00 0.00 ? 12  TRP A N    2  
ATOM 2089  C CA   . TRP A 1 12  ? 0.465   -11.127 3.021   1.00 0.00 ? 12  TRP A CA   2  
ATOM 2090  C C    . TRP A 1 12  ? 0.745   -9.728  3.559   1.00 0.00 ? 12  TRP A C    2  
ATOM 2091  O O    . TRP A 1 12  ? 1.769   -9.493  4.201   1.00 0.00 ? 12  TRP A O    2  
ATOM 2092  C CB   . TRP A 1 12  ? 0.625   -11.144 1.500   1.00 0.00 ? 12  TRP A CB   2  
ATOM 2093  C CG   . TRP A 1 12  ? 1.898   -10.507 1.029   1.00 0.00 ? 12  TRP A CG   2  
ATOM 2094  C CD1  . TRP A 1 12  ? 3.107   -11.119 0.861   1.00 0.00 ? 12  TRP A CD1  2  
ATOM 2095  C CD2  . TRP A 1 12  ? 2.087   -9.134  0.669   1.00 0.00 ? 12  TRP A CD2  2  
ATOM 2096  N NE1  . TRP A 1 12  ? 4.037   -10.210 0.418   1.00 0.00 ? 12  TRP A NE1  2  
ATOM 2097  C CE2  . TRP A 1 12  ? 3.436   -8.985  0.292   1.00 0.00 ? 12  TRP A CE2  2  
ATOM 2098  C CE3  . TRP A 1 12  ? 1.249   -8.017  0.627   1.00 0.00 ? 12  TRP A CE3  2  
ATOM 2099  C CZ2  . TRP A 1 12  ? 3.963   -7.764  -0.121  1.00 0.00 ? 12  TRP A CZ2  2  
ATOM 2100  C CZ3  . TRP A 1 12  ? 1.773   -6.806  0.217   1.00 0.00 ? 12  TRP A CZ3  2  
ATOM 2101  C CH2  . TRP A 1 12  ? 3.119   -6.687  -0.153  1.00 0.00 ? 12  TRP A CH2  2  
ATOM 2102  H H    . TRP A 1 12  ? -1.407  -12.077 2.745   1.00 0.00 ? 12  TRP A H    2  
ATOM 2103  H HA   . TRP A 1 12  ? 1.174   -11.816 3.456   1.00 0.00 ? 12  TRP A HA   2  
ATOM 2104  H HB2  . TRP A 1 12  ? 0.616   -12.166 1.154   1.00 0.00 ? 12  TRP A HB2  2  
ATOM 2105  H HB3  . TRP A 1 12  ? -0.201  -10.609 1.053   1.00 0.00 ? 12  TRP A HB3  2  
ATOM 2106  H HD1  . TRP A 1 12  ? 3.291   -12.165 1.054   1.00 0.00 ? 12  TRP A HD1  2  
ATOM 2107  H HE1  . TRP A 1 12  ? 4.977   -10.407 0.223   1.00 0.00 ? 12  TRP A HE1  2  
ATOM 2108  H HE3  . TRP A 1 12  ? 0.208   -8.089  0.908   1.00 0.00 ? 12  TRP A HE3  2  
ATOM 2109  H HZ2  . TRP A 1 12  ? 4.998   -7.656  -0.410  1.00 0.00 ? 12  TRP A HZ2  2  
ATOM 2110  H HZ3  . TRP A 1 12  ? 1.140   -5.932  0.179   1.00 0.00 ? 12  TRP A HZ3  2  
ATOM 2111  H HH2  . TRP A 1 12  ? 3.485   -5.722  -0.466  1.00 0.00 ? 12  TRP A HH2  2  
ATOM 2112  N N    . LEU A 1 13  ? -0.171  -8.803  3.294   1.00 0.00 ? 13  LEU A N    2  
ATOM 2113  C CA   . LEU A 1 13  ? -0.022  -7.426  3.752   1.00 0.00 ? 13  LEU A CA   2  
ATOM 2114  C C    . LEU A 1 13  ? -0.077  -7.351  5.275   1.00 0.00 ? 13  LEU A C    2  
ATOM 2115  O O    . LEU A 1 13  ? 0.762   -6.705  5.904   1.00 0.00 ? 13  LEU A O    2  
ATOM 2116  C CB   . LEU A 1 13  ? -1.117  -6.546  3.147   1.00 0.00 ? 13  LEU A CB   2  
ATOM 2117  C CG   . LEU A 1 13  ? -1.017  -5.050  3.447   1.00 0.00 ? 13  LEU A CG   2  
ATOM 2118  C CD1  . LEU A 1 13  ? 0.269   -4.475  2.873   1.00 0.00 ? 13  LEU A CD1  2  
ATOM 2119  C CD2  . LEU A 1 13  ? -2.227  -4.312  2.892   1.00 0.00 ? 13  LEU A CD2  2  
ATOM 2120  H H    . LEU A 1 13  ? -0.966  -9.051  2.778   1.00 0.00 ? 13  LEU A H    2  
ATOM 2121  H HA   . LEU A 1 13  ? 0.941   -7.069  3.420   1.00 0.00 ? 13  LEU A HA   2  
ATOM 2122  H HB2  . LEU A 1 13  ? -1.087  -6.671  2.075   1.00 0.00 ? 13  LEU A HB2  2  
ATOM 2123  H HB3  . LEU A 1 13  ? -2.068  -6.897  3.522   1.00 0.00 ? 13  LEU A HB3  2  
ATOM 2124  H HG   . LEU A 1 13  ? -0.998  -4.904  4.518   1.00 0.00 ? 13  LEU A HG   2  
ATOM 2125  H HD11 . LEU A 1 13  ? 0.252   -4.559  1.797   1.00 0.00 ? 13  LEU A HD11 2  
ATOM 2126  H HD12 . LEU A 1 13  ? 1.114   -5.023  3.264   1.00 0.00 ? 13  LEU A HD12 2  
ATOM 2127  H HD13 . LEU A 1 13  ? 0.355   -3.435  3.153   1.00 0.00 ? 13  LEU A HD13 2  
ATOM 2128  H HD21 . LEU A 1 13  ? -2.127  -4.213  1.821   1.00 0.00 ? 13  LEU A HD21 2  
ATOM 2129  H HD22 . LEU A 1 13  ? -2.287  -3.331  3.340   1.00 0.00 ? 13  LEU A HD22 2  
ATOM 2130  H HD23 . LEU A 1 13  ? -3.123  -4.869  3.120   1.00 0.00 ? 13  LEU A HD23 2  
ATOM 2131  N N    . ILE A 1 14  ? -1.067  -8.016  5.860   1.00 0.00 ? 14  ILE A N    2  
ATOM 2132  C CA   . ILE A 1 14  ? -1.228  -8.026  7.309   1.00 0.00 ? 14  ILE A CA   2  
ATOM 2133  C C    . ILE A 1 14  ? 0.056   -8.468  8.001   1.00 0.00 ? 14  ILE A C    2  
ATOM 2134  O O    . ILE A 1 14  ? 0.434   -7.922  9.038   1.00 0.00 ? 14  ILE A O    2  
ATOM 2135  C CB   . ILE A 1 14  ? -2.378  -8.956  7.740   1.00 0.00 ? 14  ILE A CB   2  
ATOM 2136  C CG1  . ILE A 1 14  ? -3.711  -8.441  7.195   1.00 0.00 ? 14  ILE A CG1  2  
ATOM 2137  C CG2  . ILE A 1 14  ? -2.427  -9.068  9.257   1.00 0.00 ? 14  ILE A CG2  2  
ATOM 2138  C CD1  . ILE A 1 14  ? -4.832  -9.454  7.284   1.00 0.00 ? 14  ILE A CD1  2  
ATOM 2139  H H    . ILE A 1 14  ? -1.704  -8.511  5.304   1.00 0.00 ? 14  ILE A H    2  
ATOM 2140  H HA   . ILE A 1 14  ? -1.468  -7.021  7.624   1.00 0.00 ? 14  ILE A HA   2  
ATOM 2141  H HB   . ILE A 1 14  ? -2.187  -9.938  7.337   1.00 0.00 ? 14  ILE A HB   2  
ATOM 2142  H HG12 . ILE A 1 14  ? -4.009  -7.569  7.755   1.00 0.00 ? 14  ILE A HG12 2  
ATOM 2143  H HG13 . ILE A 1 14  ? -3.587  -8.173  6.156   1.00 0.00 ? 14  ILE A HG13 2  
ATOM 2144  H HG21 . ILE A 1 14  ? -2.968  -9.961  9.534   1.00 0.00 ? 14  ILE A HG21 2  
ATOM 2145  H HG22 . ILE A 1 14  ? -1.421  -9.122  9.646   1.00 0.00 ? 14  ILE A HG22 2  
ATOM 2146  H HG23 . ILE A 1 14  ? -2.926  -8.203  9.666   1.00 0.00 ? 14  ILE A HG23 2  
ATOM 2147  H HD11 . ILE A 1 14  ? -4.439  -10.443 7.098   1.00 0.00 ? 14  ILE A HD11 2  
ATOM 2148  H HD12 . ILE A 1 14  ? -5.272  -9.420  8.269   1.00 0.00 ? 14  ILE A HD12 2  
ATOM 2149  H HD13 . ILE A 1 14  ? -5.585  -9.223  6.544   1.00 0.00 ? 14  ILE A HD13 2  
ATOM 2150  N N    . ASP A 1 15  ? 0.724   -9.459  7.421   1.00 0.00 ? 15  ASP A N    2  
ATOM 2151  C CA   . ASP A 1 15  ? 1.968   -9.973  7.981   1.00 0.00 ? 15  ASP A CA   2  
ATOM 2152  C C    . ASP A 1 15  ? 3.039   -8.888  8.012   1.00 0.00 ? 15  ASP A C    2  
ATOM 2153  O O    . ASP A 1 15  ? 3.787   -8.769  8.982   1.00 0.00 ? 15  ASP A O    2  
ATOM 2154  C CB   . ASP A 1 15  ? 2.462   -11.171 7.168   1.00 0.00 ? 15  ASP A CB   2  
ATOM 2155  C CG   . ASP A 1 15  ? 3.535   -11.960 7.892   1.00 0.00 ? 15  ASP A CG   2  
ATOM 2156  O OD1  . ASP A 1 15  ? 3.244   -12.493 8.983   1.00 0.00 ? 15  ASP A OD1  2  
ATOM 2157  O OD2  . ASP A 1 15  ? 4.666   -12.043 7.368   1.00 0.00 ? 15  ASP A OD2  2  
ATOM 2158  H H    . ASP A 1 15  ? 0.371   -9.854  6.596   1.00 0.00 ? 15  ASP A H    2  
ATOM 2159  H HA   . ASP A 1 15  ? 1.769   -10.294 8.992   1.00 0.00 ? 15  ASP A HA   2  
ATOM 2160  H HB2  . ASP A 1 15  ? 1.629   -11.830 6.969   1.00 0.00 ? 15  ASP A HB2  2  
ATOM 2161  H HB3  . ASP A 1 15  ? 2.869   -10.819 6.231   1.00 0.00 ? 15  ASP A HB3  2  
ATOM 2162  N N    . GLN A 1 16  ? 3.107   -8.099  6.944   1.00 0.00 ? 16  GLN A N    2  
ATOM 2163  C CA   . GLN A 1 16  ? 4.088   -7.025  6.849   1.00 0.00 ? 16  GLN A CA   2  
ATOM 2164  C C    . GLN A 1 16  ? 3.785   -5.920  7.856   1.00 0.00 ? 16  GLN A C    2  
ATOM 2165  O O    . GLN A 1 16  ? 4.693   -5.364  8.474   1.00 0.00 ? 16  GLN A O    2  
ATOM 2166  C CB   . GLN A 1 16  ? 4.109   -6.449  5.433   1.00 0.00 ? 16  GLN A CB   2  
ATOM 2167  C CG   . GLN A 1 16  ? 4.278   -7.502  4.350   1.00 0.00 ? 16  GLN A CG   2  
ATOM 2168  C CD   . GLN A 1 16  ? 5.183   -8.640  4.778   1.00 0.00 ? 16  GLN A CD   2  
ATOM 2169  O OE1  . GLN A 1 16  ? 6.323   -8.421  5.189   1.00 0.00 ? 16  GLN A OE1  2  
ATOM 2170  N NE2  . GLN A 1 16  ? 4.679   -9.865  4.684   1.00 0.00 ? 16  GLN A NE2  2  
ATOM 2171  H H    . GLN A 1 16  ? 2.484   -8.244  6.203   1.00 0.00 ? 16  GLN A H    2  
ATOM 2172  H HA   . GLN A 1 16  ? 5.059   -7.442  7.073   1.00 0.00 ? 16  GLN A HA   2  
ATOM 2173  H HB2  . GLN A 1 16  ? 3.181   -5.926  5.256   1.00 0.00 ? 16  GLN A HB2  2  
ATOM 2174  H HB3  . GLN A 1 16  ? 4.928   -5.749  5.354   1.00 0.00 ? 16  GLN A HB3  2  
ATOM 2175  H HG2  . GLN A 1 16  ? 3.307   -7.907  4.106   1.00 0.00 ? 16  GLN A HG2  2  
ATOM 2176  H HG3  . GLN A 1 16  ? 4.702   -7.034  3.473   1.00 0.00 ? 16  GLN A HG3  2  
ATOM 2177  H HE21 . GLN A 1 16  ? 3.764   -9.964  4.347   1.00 0.00 ? 16  GLN A HE21 2  
ATOM 2178  H HE22 . GLN A 1 16  ? 5.243   -10.619 4.954   1.00 0.00 ? 16  GLN A HE22 2  
ATOM 2179  N N    . ILE A 1 17  ? 2.504   -5.608  8.016   1.00 0.00 ? 17  ILE A N    2  
ATOM 2180  C CA   . ILE A 1 17  ? 2.081   -4.570  8.948   1.00 0.00 ? 17  ILE A CA   2  
ATOM 2181  C C    . ILE A 1 17  ? 2.314   -5.000  10.392  1.00 0.00 ? 17  ILE A C    2  
ATOM 2182  O O    . ILE A 1 17  ? 2.808   -4.224  11.210  1.00 0.00 ? 17  ILE A O    2  
ATOM 2183  C CB   . ILE A 1 17  ? 0.593   -4.218  8.763   1.00 0.00 ? 17  ILE A CB   2  
ATOM 2184  C CG1  . ILE A 1 17  ? 0.295   -3.925  7.291   1.00 0.00 ? 17  ILE A CG1  2  
ATOM 2185  C CG2  . ILE A 1 17  ? 0.218   -3.028  9.632   1.00 0.00 ? 17  ILE A CG2  2  
ATOM 2186  C CD1  . ILE A 1 17  ? -1.131  -4.231  6.891   1.00 0.00 ? 17  ILE A CD1  2  
ATOM 2187  H H    . ILE A 1 17  ? 1.826   -6.087  7.495   1.00 0.00 ? 17  ILE A H    2  
ATOM 2188  H HA   . ILE A 1 17  ? 2.667   -3.684  8.748   1.00 0.00 ? 17  ILE A HA   2  
ATOM 2189  H HB   . ILE A 1 17  ? 0.004   -5.065  9.080   1.00 0.00 ? 17  ILE A HB   2  
ATOM 2190  H HG12 . ILE A 1 17  ? 0.478   -2.881  7.094   1.00 0.00 ? 17  ILE A HG12 2  
ATOM 2191  H HG13 . ILE A 1 17  ? 0.950   -4.523  6.673   1.00 0.00 ? 17  ILE A HG13 2  
ATOM 2192  H HG21 . ILE A 1 17  ? 0.524   -2.114  9.143   1.00 0.00 ? 17  ILE A HG21 2  
ATOM 2193  H HG22 . ILE A 1 17  ? -0.851  -3.014  9.781   1.00 0.00 ? 17  ILE A HG22 2  
ATOM 2194  H HG23 . ILE A 1 17  ? 0.714   -3.108  10.588  1.00 0.00 ? 17  ILE A HG23 2  
ATOM 2195  H HD11 . ILE A 1 17  ? -1.392  -3.652  6.017   1.00 0.00 ? 17  ILE A HD11 2  
ATOM 2196  H HD12 . ILE A 1 17  ? -1.225  -5.283  6.668   1.00 0.00 ? 17  ILE A HD12 2  
ATOM 2197  H HD13 . ILE A 1 17  ? -1.796  -3.975  7.703   1.00 0.00 ? 17  ILE A HD13 2  
ATOM 2198  N N    . ASP A 1 18  ? 1.958   -6.243  10.698  1.00 0.00 ? 18  ASP A N    2  
ATOM 2199  C CA   . ASP A 1 18  ? 2.131   -6.779  12.043  1.00 0.00 ? 18  ASP A CA   2  
ATOM 2200  C C    . ASP A 1 18  ? 3.593   -6.706  12.474  1.00 0.00 ? 18  ASP A C    2  
ATOM 2201  O O    . ASP A 1 18  ? 3.901   -6.293  13.592  1.00 0.00 ? 18  ASP A O    2  
ATOM 2202  C CB   . ASP A 1 18  ? 1.640   -8.226  12.106  1.00 0.00 ? 18  ASP A CB   2  
ATOM 2203  C CG   . ASP A 1 18  ? 1.202   -8.629  13.500  1.00 0.00 ? 18  ASP A CG   2  
ATOM 2204  O OD1  . ASP A 1 18  ? 0.604   -7.786  14.201  1.00 0.00 ? 18  ASP A OD1  2  
ATOM 2205  O OD2  . ASP A 1 18  ? 1.456   -9.788  13.889  1.00 0.00 ? 18  ASP A OD2  2  
ATOM 2206  H H    . ASP A 1 18  ? 1.570   -6.814  10.002  1.00 0.00 ? 18  ASP A H    2  
ATOM 2207  H HA   . ASP A 1 18  ? 1.540   -6.179  12.718  1.00 0.00 ? 18  ASP A HA   2  
ATOM 2208  H HB2  . ASP A 1 18  ? 0.800   -8.344  11.437  1.00 0.00 ? 18  ASP A HB2  2  
ATOM 2209  H HB3  . ASP A 1 18  ? 2.438   -8.884  11.794  1.00 0.00 ? 18  ASP A HB3  2  
ATOM 2210  N N    . SER A 1 19  ? 4.489   -7.110  11.579  1.00 0.00 ? 19  SER A N    2  
ATOM 2211  C CA   . SER A 1 19  ? 5.918   -7.095  11.868  1.00 0.00 ? 19  SER A CA   2  
ATOM 2212  C C    . SER A 1 19  ? 6.404   -5.673  12.133  1.00 0.00 ? 19  SER A C    2  
ATOM 2213  O O    . SER A 1 19  ? 7.289   -5.451  12.958  1.00 0.00 ? 19  SER A O    2  
ATOM 2214  C CB   . SER A 1 19  ? 6.702   -7.705  10.704  1.00 0.00 ? 19  SER A CB   2  
ATOM 2215  O OG   . SER A 1 19  ? 6.346   -7.096  9.475   1.00 0.00 ? 19  SER A OG   2  
ATOM 2216  H H    . SER A 1 19  ? 4.181   -7.429  10.705  1.00 0.00 ? 19  SER A H    2  
ATOM 2217  H HA   . SER A 1 19  ? 6.084   -7.690  12.753  1.00 0.00 ? 19  SER A HA   2  
ATOM 2218  H HB2  . SER A 1 19  ? 7.758   -7.562  10.871  1.00 0.00 ? 19  SER A HB2  2  
ATOM 2219  H HB3  . SER A 1 19  ? 6.487   -8.762  10.644  1.00 0.00 ? 19  SER A HB3  2  
ATOM 2220  H HG   . SER A 1 19  ? 5.491   -6.670  9.564   1.00 0.00 ? 19  SER A HG   2  
ATOM 2221  N N    . GLY A 1 20  ? 5.817   -4.712  11.426  1.00 0.00 ? 20  GLY A N    2  
ATOM 2222  C CA   . GLY A 1 20  ? 6.201   -3.324  11.598  1.00 0.00 ? 20  GLY A CA   2  
ATOM 2223  C C    . GLY A 1 20  ? 7.624   -3.056  11.149  1.00 0.00 ? 20  GLY A C    2  
ATOM 2224  O O    . GLY A 1 20  ? 8.266   -2.116  11.617  1.00 0.00 ? 20  GLY A O    2  
ATOM 2225  H H    . GLY A 1 20  ? 5.116   -4.948  10.782  1.00 0.00 ? 20  GLY A H    2  
ATOM 2226  H HA2  . GLY A 1 20  ? 5.531   -2.702  11.024  1.00 0.00 ? 20  GLY A HA2  2  
ATOM 2227  H HA3  . GLY A 1 20  ? 6.112   -3.064  12.642  1.00 0.00 ? 20  GLY A HA3  2  
ATOM 2228  N N    . LYS A 1 21  ? 8.121   -3.887  10.238  1.00 0.00 ? 21  LYS A N    2  
ATOM 2229  C CA   . LYS A 1 21  ? 9.478   -3.737  9.725   1.00 0.00 ? 21  LYS A CA   2  
ATOM 2230  C C    . LYS A 1 21  ? 9.600   -2.480  8.869   1.00 0.00 ? 21  LYS A C    2  
ATOM 2231  O O    . LYS A 1 21  ? 10.561  -1.721  8.998   1.00 0.00 ? 21  LYS A O    2  
ATOM 2232  C CB   . LYS A 1 21  ? 9.873   -4.966  8.903   1.00 0.00 ? 21  LYS A CB   2  
ATOM 2233  C CG   . LYS A 1 21  ? 9.513   -6.284  9.568   1.00 0.00 ? 21  LYS A CG   2  
ATOM 2234  C CD   . LYS A 1 21  ? 10.488  -7.385  9.188   1.00 0.00 ? 21  LYS A CD   2  
ATOM 2235  C CE   . LYS A 1 21  ? 10.098  -8.048  7.876   1.00 0.00 ? 21  LYS A CE   2  
ATOM 2236  N NZ   . LYS A 1 21  ? 10.695  -7.351  6.703   1.00 0.00 ? 21  LYS A NZ   2  
ATOM 2237  H H    . LYS A 1 21  ? 7.561   -4.618  9.902   1.00 0.00 ? 21  LYS A H    2  
ATOM 2238  H HA   . LYS A 1 21  ? 10.144  -3.650  10.569  1.00 0.00 ? 21  LYS A HA   2  
ATOM 2239  H HB2  . LYS A 1 21  ? 9.373   -4.921  7.947   1.00 0.00 ? 21  LYS A HB2  2  
ATOM 2240  H HB3  . LYS A 1 21  ? 10.941  -4.949  8.742   1.00 0.00 ? 21  LYS A HB3  2  
ATOM 2241  H HG2  . LYS A 1 21  ? 9.533   -6.153  10.640  1.00 0.00 ? 21  LYS A HG2  2  
ATOM 2242  H HG3  . LYS A 1 21  ? 8.519   -6.573  9.258   1.00 0.00 ? 21  LYS A HG3  2  
ATOM 2243  H HD2  . LYS A 1 21  ? 11.475  -6.959  9.083   1.00 0.00 ? 21  LYS A HD2  2  
ATOM 2244  H HD3  . LYS A 1 21  ? 10.498  -8.131  9.970   1.00 0.00 ? 21  LYS A HD3  2  
ATOM 2245  H HE2  . LYS A 1 21  ? 10.440  -9.071  7.889   1.00 0.00 ? 21  LYS A HE2  2  
ATOM 2246  H HE3  . LYS A 1 21  ? 9.022   -8.029  7.785   1.00 0.00 ? 21  LYS A HE3  2  
ATOM 2247  H HZ1  . LYS A 1 21  ? 11.107  -6.443  6.999   1.00 0.00 ? 21  LYS A HZ1  2  
ATOM 2248  H HZ2  . LYS A 1 21  ? 9.965   -7.170  5.985   1.00 0.00 ? 21  LYS A HZ2  2  
ATOM 2249  H HZ3  . LYS A 1 21  ? 11.443  -7.938  6.281   1.00 0.00 ? 21  LYS A HZ3  2  
ATOM 2250  N N    . TYR A 1 22  ? 8.621   -2.265  7.998   1.00 0.00 ? 22  TYR A N    2  
ATOM 2251  C CA   . TYR A 1 22  ? 8.620   -1.101  7.121   1.00 0.00 ? 22  TYR A CA   2  
ATOM 2252  C C    . TYR A 1 22  ? 8.056   0.122   7.839   1.00 0.00 ? 22  TYR A C    2  
ATOM 2253  O O    . TYR A 1 22  ? 7.059   0.047   8.557   1.00 0.00 ? 22  TYR A O    2  
ATOM 2254  C CB   . TYR A 1 22  ? 7.803   -1.386  5.860   1.00 0.00 ? 22  TYR A CB   2  
ATOM 2255  C CG   . TYR A 1 22  ? 7.982   -2.790  5.328   1.00 0.00 ? 22  TYR A CG   2  
ATOM 2256  C CD1  . TYR A 1 22  ? 7.271   -3.855  5.869   1.00 0.00 ? 22  TYR A CD1  2  
ATOM 2257  C CD2  . TYR A 1 22  ? 8.860   -3.052  4.284   1.00 0.00 ? 22  TYR A CD2  2  
ATOM 2258  C CE1  . TYR A 1 22  ? 7.431   -5.139  5.386   1.00 0.00 ? 22  TYR A CE1  2  
ATOM 2259  C CE2  . TYR A 1 22  ? 9.026   -4.334  3.794   1.00 0.00 ? 22  TYR A CE2  2  
ATOM 2260  C CZ   . TYR A 1 22  ? 8.310   -5.374  4.349   1.00 0.00 ? 22  TYR A CZ   2  
ATOM 2261  O OH   . TYR A 1 22  ? 8.471   -6.652  3.865   1.00 0.00 ? 22  TYR A OH   2  
ATOM 2262  H H    . TYR A 1 22  ? 7.882   -2.906  7.941   1.00 0.00 ? 22  TYR A H    2  
ATOM 2263  H HA   . TYR A 1 22  ? 9.643   -0.898  6.838   1.00 0.00 ? 22  TYR A HA   2  
ATOM 2264  H HB2  . TYR A 1 22  ? 6.756   -1.245  6.078   1.00 0.00 ? 22  TYR A HB2  2  
ATOM 2265  H HB3  . TYR A 1 22  ? 8.100   -0.697  5.083   1.00 0.00 ? 22  TYR A HB3  2  
ATOM 2266  H HD1  . TYR A 1 22  ? 6.583   -3.668  6.681   1.00 0.00 ? 22  TYR A HD1  2  
ATOM 2267  H HD2  . TYR A 1 22  ? 9.420   -2.236  3.851   1.00 0.00 ? 22  TYR A HD2  2  
ATOM 2268  H HE1  . TYR A 1 22  ? 6.870   -5.954  5.820   1.00 0.00 ? 22  TYR A HE1  2  
ATOM 2269  H HE2  . TYR A 1 22  ? 9.714   -4.518  2.982   1.00 0.00 ? 22  TYR A HE2  2  
ATOM 2270  H HH   . TYR A 1 22  ? 8.192   -7.284  4.532   1.00 0.00 ? 22  TYR A HH   2  
ATOM 2271  N N    . PRO A 1 23  ? 8.710   1.276   7.642   1.00 0.00 ? 23  PRO A N    2  
ATOM 2272  C CA   . PRO A 1 23  ? 8.292   2.538   8.260   1.00 0.00 ? 23  PRO A CA   2  
ATOM 2273  C C    . PRO A 1 23  ? 6.985   3.064   7.678   1.00 0.00 ? 23  PRO A C    2  
ATOM 2274  O O    . PRO A 1 23  ? 6.705   2.886   6.493   1.00 0.00 ? 23  PRO A O    2  
ATOM 2275  C CB   . PRO A 1 23  ? 9.445   3.491   7.935   1.00 0.00 ? 23  PRO A CB   2  
ATOM 2276  C CG   . PRO A 1 23  ? 10.062  2.932   6.700   1.00 0.00 ? 23  PRO A CG   2  
ATOM 2277  C CD   . PRO A 1 23  ? 9.906   1.439   6.799   1.00 0.00 ? 23  PRO A CD   2  
ATOM 2278  H HA   . PRO A 1 23  ? 8.194   2.441   9.332   1.00 0.00 ? 23  PRO A HA   2  
ATOM 2279  H HB2  . PRO A 1 23  ? 9.056   4.486   7.767   1.00 0.00 ? 23  PRO A HB2  2  
ATOM 2280  H HB3  . PRO A 1 23  ? 10.147  3.506   8.755   1.00 0.00 ? 23  PRO A HB3  2  
ATOM 2281  H HG2  . PRO A 1 23  ? 9.545   3.306   5.829   1.00 0.00 ? 23  PRO A HG2  2  
ATOM 2282  H HG3  . PRO A 1 23  ? 11.108  3.197   6.660   1.00 0.00 ? 23  PRO A HG3  2  
ATOM 2283  H HD2  . PRO A 1 23  ? 9.749   1.011   5.820   1.00 0.00 ? 23  PRO A HD2  2  
ATOM 2284  H HD3  . PRO A 1 23  ? 10.772  1.000   7.271   1.00 0.00 ? 23  PRO A HD3  2  
ATOM 2285  N N    . GLY A 1 24  ? 6.187   3.715   8.519   1.00 0.00 ? 24  GLY A N    2  
ATOM 2286  C CA   . GLY A 1 24  ? 4.918   4.257   8.069   1.00 0.00 ? 24  GLY A CA   2  
ATOM 2287  C C    . GLY A 1 24  ? 3.786   3.255   8.181   1.00 0.00 ? 24  GLY A C    2  
ATOM 2288  O O    . GLY A 1 24  ? 2.663   3.613   8.538   1.00 0.00 ? 24  GLY A O    2  
ATOM 2289  H H    . GLY A 1 24  ? 6.461   3.827   9.454   1.00 0.00 ? 24  GLY A H    2  
ATOM 2290  H HA2  . GLY A 1 24  ? 4.678   5.125   8.666   1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2291  H HA3  . GLY A 1 24  ? 5.015   4.559   7.036   1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2292  N N    . LEU A 1 25  ? 4.080   1.997   7.874   1.00 0.00 ? 25  LEU A N    2  
ATOM 2293  C CA   . LEU A 1 25  ? 3.078   0.939   7.940   1.00 0.00 ? 25  LEU A CA   2  
ATOM 2294  C C    . LEU A 1 25  ? 2.800   0.542   9.386   1.00 0.00 ? 25  LEU A C    2  
ATOM 2295  O O    . LEU A 1 25  ? 3.578   -0.187  10.002  1.00 0.00 ? 25  LEU A O    2  
ATOM 2296  C CB   . LEU A 1 25  ? 3.543   -0.282  7.144   1.00 0.00 ? 25  LEU A CB   2  
ATOM 2297  C CG   . LEU A 1 25  ? 2.455   -1.284  6.755   1.00 0.00 ? 25  LEU A CG   2  
ATOM 2298  C CD1  . LEU A 1 25  ? 1.495   -0.666  5.751   1.00 0.00 ? 25  LEU A CD1  2  
ATOM 2299  C CD2  . LEU A 1 25  ? 3.076   -2.553  6.191   1.00 0.00 ? 25  LEU A CD2  2  
ATOM 2300  H H    . LEU A 1 25  ? 4.992   1.772   7.596   1.00 0.00 ? 25  LEU A H    2  
ATOM 2301  H HA   . LEU A 1 25  ? 2.166   1.318   7.502   1.00 0.00 ? 25  LEU A HA   2  
ATOM 2302  H HB2  . LEU A 1 25  ? 4.006   0.072   6.236   1.00 0.00 ? 25  LEU A HB2  2  
ATOM 2303  H HB3  . LEU A 1 25  ? 4.277   -0.804  7.741   1.00 0.00 ? 25  LEU A HB3  2  
ATOM 2304  H HG   . LEU A 1 25  ? 1.888   -1.550  7.637   1.00 0.00 ? 25  LEU A HG   2  
ATOM 2305  H HD11 . LEU A 1 25  ? 0.499   -1.045  5.924   1.00 0.00 ? 25  LEU A HD11 2  
ATOM 2306  H HD12 . LEU A 1 25  ? 1.808   -0.922  4.749   1.00 0.00 ? 25  LEU A HD12 2  
ATOM 2307  H HD13 . LEU A 1 25  ? 1.497   0.408   5.865   1.00 0.00 ? 25  LEU A HD13 2  
ATOM 2308  H HD21 . LEU A 1 25  ? 4.152   -2.476  6.234   1.00 0.00 ? 25  LEU A HD21 2  
ATOM 2309  H HD22 . LEU A 1 25  ? 2.764   -2.681  5.165   1.00 0.00 ? 25  LEU A HD22 2  
ATOM 2310  H HD23 . LEU A 1 25  ? 2.752   -3.402  6.775   1.00 0.00 ? 25  LEU A HD23 2  
ATOM 2311  N N    . VAL A 1 26  ? 1.684   1.025   9.923   1.00 0.00 ? 26  VAL A N    2  
ATOM 2312  C CA   . VAL A 1 26  ? 1.300   0.718   11.296  1.00 0.00 ? 26  VAL A CA   2  
ATOM 2313  C C    . VAL A 1 26  ? -0.214  0.612   11.433  1.00 0.00 ? 26  VAL A C    2  
ATOM 2314  O O    . VAL A 1 26  ? -0.961  1.242   10.684  1.00 0.00 ? 26  VAL A O    2  
ATOM 2315  C CB   . VAL A 1 26  ? 1.820   1.787   12.276  1.00 0.00 ? 26  VAL A CB   2  
ATOM 2316  C CG1  . VAL A 1 26  ? 3.341   1.820   12.273  1.00 0.00 ? 26  VAL A CG1  2  
ATOM 2317  C CG2  . VAL A 1 26  ? 1.249   3.153   11.927  1.00 0.00 ? 26  VAL A CG2  2  
ATOM 2318  H H    . VAL A 1 26  ? 1.104   1.601   9.382   1.00 0.00 ? 26  VAL A H    2  
ATOM 2319  H HA   . VAL A 1 26  ? 1.744   -0.230  11.562  1.00 0.00 ? 26  VAL A HA   2  
ATOM 2320  H HB   . VAL A 1 26  ? 1.490   1.525   13.270  1.00 0.00 ? 26  VAL A HB   2  
ATOM 2321  H HG11 . VAL A 1 26  ? 3.698   2.016   13.273  1.00 0.00 ? 26  VAL A HG11 2  
ATOM 2322  H HG12 . VAL A 1 26  ? 3.721   0.868   11.933  1.00 0.00 ? 26  VAL A HG12 2  
ATOM 2323  H HG13 . VAL A 1 26  ? 3.683   2.602   11.610  1.00 0.00 ? 26  VAL A HG13 2  
ATOM 2324  H HG21 . VAL A 1 26  ? 0.182   3.149   12.095  1.00 0.00 ? 26  VAL A HG21 2  
ATOM 2325  H HG22 . VAL A 1 26  ? 1.709   3.906   12.550  1.00 0.00 ? 26  VAL A HG22 2  
ATOM 2326  H HG23 . VAL A 1 26  ? 1.449   3.373   10.889  1.00 0.00 ? 26  VAL A HG23 2  
ATOM 2327  N N    . TRP A 1 27  ? -0.661  -0.187  12.395  1.00 0.00 ? 27  TRP A N    2  
ATOM 2328  C CA   . TRP A 1 27  ? -2.088  -0.375  12.631  1.00 0.00 ? 27  TRP A CA   2  
ATOM 2329  C C    . TRP A 1 27  ? -2.674  0.809   13.391  1.00 0.00 ? 27  TRP A C    2  
ATOM 2330  O O    . TRP A 1 27  ? -2.238  1.125   14.497  1.00 0.00 ? 27  TRP A O    2  
ATOM 2331  C CB   . TRP A 1 27  ? -2.330  -1.668  13.411  1.00 0.00 ? 27  TRP A CB   2  
ATOM 2332  C CG   . TRP A 1 27  ? -1.921  -2.900  12.662  1.00 0.00 ? 27  TRP A CG   2  
ATOM 2333  C CD1  . TRP A 1 27  ? -0.786  -3.637  12.853  1.00 0.00 ? 27  TRP A CD1  2  
ATOM 2334  C CD2  . TRP A 1 27  ? -2.641  -3.537  11.601  1.00 0.00 ? 27  TRP A CD2  2  
ATOM 2335  N NE1  . TRP A 1 27  ? -0.758  -4.693  11.975  1.00 0.00 ? 27  TRP A NE1  2  
ATOM 2336  C CE2  . TRP A 1 27  ? -1.885  -4.655  11.197  1.00 0.00 ? 27  TRP A CE2  2  
ATOM 2337  C CE3  . TRP A 1 27  ? -3.852  -3.274  10.955  1.00 0.00 ? 27  TRP A CE3  2  
ATOM 2338  C CZ2  . TRP A 1 27  ? -2.302  -5.505  10.176  1.00 0.00 ? 27  TRP A CZ2  2  
ATOM 2339  C CZ3  . TRP A 1 27  ? -4.264  -4.118  9.942   1.00 0.00 ? 27  TRP A CZ3  2  
ATOM 2340  C CH2  . TRP A 1 27  ? -3.491  -5.223  9.561   1.00 0.00 ? 27  TRP A CH2  2  
ATOM 2341  H H    . TRP A 1 27  ? -0.016  -0.663  12.960  1.00 0.00 ? 27  TRP A H    2  
ATOM 2342  H HA   . TRP A 1 27  ? -2.575  -0.449  11.670  1.00 0.00 ? 27  TRP A HA   2  
ATOM 2343  H HB2  . TRP A 1 27  ? -1.768  -1.637  14.333  1.00 0.00 ? 27  TRP A HB2  2  
ATOM 2344  H HB3  . TRP A 1 27  ? -3.383  -1.750  13.639  1.00 0.00 ? 27  TRP A HB3  2  
ATOM 2345  H HD1  . TRP A 1 27  ? -0.030  -3.409  13.589  1.00 0.00 ? 27  TRP A HD1  2  
ATOM 2346  H HE1  . TRP A 1 27  ? -0.047  -5.366  11.917  1.00 0.00 ? 27  TRP A HE1  2  
ATOM 2347  H HE3  . TRP A 1 27  ? -4.461  -2.427  11.235  1.00 0.00 ? 27  TRP A HE3  2  
ATOM 2348  H HZ2  . TRP A 1 27  ? -1.718  -6.361  9.871   1.00 0.00 ? 27  TRP A HZ2  2  
ATOM 2349  H HZ3  . TRP A 1 27  ? -5.196  -3.930  9.431   1.00 0.00 ? 27  TRP A HZ3  2  
ATOM 2350  H HH2  . TRP A 1 27  ? -3.851  -5.855  8.764   1.00 0.00 ? 27  TRP A HH2  2  
ATOM 2351  N N    . GLU A 1 28  ? -3.666  1.460   12.790  1.00 0.00 ? 28  GLU A N    2  
ATOM 2352  C CA   . GLU A 1 28  ? -4.311  2.610   13.411  1.00 0.00 ? 28  GLU A CA   2  
ATOM 2353  C C    . GLU A 1 28  ? -5.091  2.191   14.654  1.00 0.00 ? 28  GLU A C    2  
ATOM 2354  O O    . GLU A 1 28  ? -5.269  2.978   15.583  1.00 0.00 ? 28  GLU A O    2  
ATOM 2355  C CB   . GLU A 1 28  ? -5.248  3.297   12.416  1.00 0.00 ? 28  GLU A CB   2  
ATOM 2356  C CG   . GLU A 1 28  ? -4.558  3.738   11.135  1.00 0.00 ? 28  GLU A CG   2  
ATOM 2357  C CD   . GLU A 1 28  ? -5.199  4.967   10.521  1.00 0.00 ? 28  GLU A CD   2  
ATOM 2358  O OE1  . GLU A 1 28  ? -6.432  4.960   10.327  1.00 0.00 ? 28  GLU A OE1  2  
ATOM 2359  O OE2  . GLU A 1 28  ? -4.465  5.937   10.234  1.00 0.00 ? 28  GLU A OE2  2  
ATOM 2360  H H    . GLU A 1 28  ? -3.969  1.160   11.908  1.00 0.00 ? 28  GLU A H    2  
ATOM 2361  H HA   . GLU A 1 28  ? -3.539  3.306   13.704  1.00 0.00 ? 28  GLU A HA   2  
ATOM 2362  H HB2  . GLU A 1 28  ? -6.042  2.613   12.156  1.00 0.00 ? 28  GLU A HB2  2  
ATOM 2363  H HB3  . GLU A 1 28  ? -5.676  4.170   12.887  1.00 0.00 ? 28  GLU A HB3  2  
ATOM 2364  H HG2  . GLU A 1 28  ? -3.525  3.962   11.356  1.00 0.00 ? 28  GLU A HG2  2  
ATOM 2365  H HG3  . GLU A 1 28  ? -4.605  2.930   10.420  1.00 0.00 ? 28  GLU A HG3  2  
ATOM 2366  N N    . ASN A 1 29  ? -5.554  0.945   14.662  1.00 0.00 ? 29  ASN A N    2  
ATOM 2367  C CA   . ASN A 1 29  ? -6.316  0.420   15.790  1.00 0.00 ? 29  ASN A CA   2  
ATOM 2368  C C    . ASN A 1 29  ? -5.636  -0.812  16.380  1.00 0.00 ? 29  ASN A C    2  
ATOM 2369  O O    . ASN A 1 29  ? -4.675  -1.332  15.814  1.00 0.00 ? 29  ASN A O    2  
ATOM 2370  C CB   . ASN A 1 29  ? -7.739  0.070   15.351  1.00 0.00 ? 29  ASN A CB   2  
ATOM 2371  C CG   . ASN A 1 29  ? -7.763  -0.879  14.169  1.00 0.00 ? 29  ASN A CG   2  
ATOM 2372  O OD1  . ASN A 1 29  ? -6.806  -1.617  13.931  1.00 0.00 ? 29  ASN A OD1  2  
ATOM 2373  N ND2  . ASN A 1 29  ? -8.859  -0.863  13.420  1.00 0.00 ? 29  ASN A ND2  2  
ATOM 2374  H H    . ASN A 1 29  ? -5.379  0.365   13.892  1.00 0.00 ? 29  ASN A H    2  
ATOM 2375  H HA   . ASN A 1 29  ? -6.360  1.189   16.546  1.00 0.00 ? 29  ASN A HA   2  
ATOM 2376  H HB2  . ASN A 1 29  ? -8.258  -0.399  16.175  1.00 0.00 ? 29  ASN A HB2  2  
ATOM 2377  H HB3  . ASN A 1 29  ? -8.257  0.976   15.074  1.00 0.00 ? 29  ASN A HB3  2  
ATOM 2378  H HD21 . ASN A 1 29  ? -9.582  -0.249  13.668  1.00 0.00 ? 29  ASN A HD21 2  
ATOM 2379  H HD22 . ASN A 1 29  ? -8.901  -1.467  12.649  1.00 0.00 ? 29  ASN A HD22 2  
ATOM 2380  N N    . GLU A 1 30  ? -6.143  -1.272  17.519  1.00 0.00 ? 30  GLU A N    2  
ATOM 2381  C CA   . GLU A 1 30  ? -5.584  -2.442  18.185  1.00 0.00 ? 30  GLU A CA   2  
ATOM 2382  C C    . GLU A 1 30  ? -6.051  -3.728  17.509  1.00 0.00 ? 30  GLU A C    2  
ATOM 2383  O O    . GLU A 1 30  ? -5.319  -4.716  17.458  1.00 0.00 ? 30  GLU A O    2  
ATOM 2384  C CB   . GLU A 1 30  ? -5.983  -2.456  19.662  1.00 0.00 ? 30  GLU A CB   2  
ATOM 2385  C CG   . GLU A 1 30  ? -5.222  -1.449  20.508  1.00 0.00 ? 30  GLU A CG   2  
ATOM 2386  C CD   . GLU A 1 30  ? -3.910  -2.000  21.032  1.00 0.00 ? 30  GLU A CD   2  
ATOM 2387  O OE1  . GLU A 1 30  ? -3.028  -2.316  20.206  1.00 0.00 ? 30  GLU A OE1  2  
ATOM 2388  O OE2  . GLU A 1 30  ? -3.766  -2.116  22.267  1.00 0.00 ? 30  GLU A OE2  2  
ATOM 2389  H H    . GLU A 1 30  ? -6.910  -0.814  17.921  1.00 0.00 ? 30  GLU A H    2  
ATOM 2390  H HA   . GLU A 1 30  ? -4.508  -2.383  18.114  1.00 0.00 ? 30  GLU A HA   2  
ATOM 2391  H HB2  . GLU A 1 30  ? -7.038  -2.236  19.740  1.00 0.00 ? 30  GLU A HB2  2  
ATOM 2392  H HB3  . GLU A 1 30  ? -5.800  -3.442  20.063  1.00 0.00 ? 30  GLU A HB3  2  
ATOM 2393  H HG2  . GLU A 1 30  ? -5.013  -0.577  19.906  1.00 0.00 ? 30  GLU A HG2  2  
ATOM 2394  H HG3  . GLU A 1 30  ? -5.838  -1.165  21.349  1.00 0.00 ? 30  GLU A HG3  2  
ATOM 2395  N N    . GLU A 1 31  ? -7.275  -3.707  16.992  1.00 0.00 ? 31  GLU A N    2  
ATOM 2396  C CA   . GLU A 1 31  ? -7.841  -4.871  16.320  1.00 0.00 ? 31  GLU A CA   2  
ATOM 2397  C C    . GLU A 1 31  ? -6.956  -5.311  15.158  1.00 0.00 ? 31  GLU A C    2  
ATOM 2398  O O    . GLU A 1 31  ? -7.127  -6.401  14.610  1.00 0.00 ? 31  GLU A O    2  
ATOM 2399  C CB   . GLU A 1 31  ? -9.251  -4.560  15.814  1.00 0.00 ? 31  GLU A CB   2  
ATOM 2400  C CG   . GLU A 1 31  ? -9.324  -3.317  14.943  1.00 0.00 ? 31  GLU A CG   2  
ATOM 2401  C CD   . GLU A 1 31  ? -10.749 -2.934  14.593  1.00 0.00 ? 31  GLU A CD   2  
ATOM 2402  O OE1  . GLU A 1 31  ? -11.467 -3.777  14.016  1.00 0.00 ? 31  GLU A OE1  2  
ATOM 2403  O OE2  . GLU A 1 31  ? -11.146 -1.789  14.896  1.00 0.00 ? 31  GLU A OE2  2  
ATOM 2404  H H    . GLU A 1 31  ? -7.811  -2.889  17.064  1.00 0.00 ? 31  GLU A H    2  
ATOM 2405  H HA   . GLU A 1 31  ? -7.896  -5.674  17.039  1.00 0.00 ? 31  GLU A HA   2  
ATOM 2406  H HB2  . GLU A 1 31  ? -9.606  -5.401  15.237  1.00 0.00 ? 31  GLU A HB2  2  
ATOM 2407  H HB3  . GLU A 1 31  ? -9.902  -4.418  16.663  1.00 0.00 ? 31  GLU A HB3  2  
ATOM 2408  H HG2  . GLU A 1 31  ? -8.866  -2.495  15.471  1.00 0.00 ? 31  GLU A HG2  2  
ATOM 2409  H HG3  . GLU A 1 31  ? -8.782  -3.502  14.027  1.00 0.00 ? 31  GLU A HG3  2  
ATOM 2410  N N    . LYS A 1 32  ? -6.010  -4.456  14.785  1.00 0.00 ? 32  LYS A N    2  
ATOM 2411  C CA   . LYS A 1 32  ? -5.097  -4.755  13.688  1.00 0.00 ? 32  LYS A CA   2  
ATOM 2412  C C    . LYS A 1 32  ? -5.857  -4.918  12.376  1.00 0.00 ? 32  LYS A C    2  
ATOM 2413  O O    . LYS A 1 32  ? -5.477  -5.719  11.522  1.00 0.00 ? 32  LYS A O    2  
ATOM 2414  C CB   . LYS A 1 32  ? -4.302  -6.027  13.991  1.00 0.00 ? 32  LYS A CB   2  
ATOM 2415  C CG   . LYS A 1 32  ? -3.400  -5.906  15.206  1.00 0.00 ? 32  LYS A CG   2  
ATOM 2416  C CD   . LYS A 1 32  ? -2.017  -5.403  14.826  1.00 0.00 ? 32  LYS A CD   2  
ATOM 2417  C CE   . LYS A 1 32  ? -0.985  -5.753  15.887  1.00 0.00 ? 32  LYS A CE   2  
ATOM 2418  N NZ   . LYS A 1 32  ? -1.025  -4.803  17.034  1.00 0.00 ? 32  LYS A NZ   2  
ATOM 2419  H H    . LYS A 1 32  ? -5.923  -3.602  15.260  1.00 0.00 ? 32  LYS A H    2  
ATOM 2420  H HA   . LYS A 1 32  ? -4.411  -3.926  13.592  1.00 0.00 ? 32  LYS A HA   2  
ATOM 2421  H HB2  . LYS A 1 32  ? -4.995  -6.837  14.162  1.00 0.00 ? 32  LYS A HB2  2  
ATOM 2422  H HB3  . LYS A 1 32  ? -3.688  -6.265  13.135  1.00 0.00 ? 32  LYS A HB3  2  
ATOM 2423  H HG2  . LYS A 1 32  ? -3.843  -5.212  15.905  1.00 0.00 ? 32  LYS A HG2  2  
ATOM 2424  H HG3  . LYS A 1 32  ? -3.305  -6.877  15.671  1.00 0.00 ? 32  LYS A HG3  2  
ATOM 2425  H HD2  . LYS A 1 32  ? -1.723  -5.857  13.891  1.00 0.00 ? 32  LYS A HD2  2  
ATOM 2426  H HD3  . LYS A 1 32  ? -2.053  -4.329  14.712  1.00 0.00 ? 32  LYS A HD3  2  
ATOM 2427  H HE2  . LYS A 1 32  ? -1.185  -6.749  16.250  1.00 0.00 ? 32  LYS A HE2  2  
ATOM 2428  H HE3  . LYS A 1 32  ? -0.003  -5.723  15.440  1.00 0.00 ? 32  LYS A HE3  2  
ATOM 2429  H HZ1  . LYS A 1 32  ? -1.821  -5.034  17.662  1.00 0.00 ? 32  LYS A HZ1  2  
ATOM 2430  H HZ2  . LYS A 1 32  ? -1.142  -3.830  16.687  1.00 0.00 ? 32  LYS A HZ2  2  
ATOM 2431  H HZ3  . LYS A 1 32  ? -0.140  -4.862  17.577  1.00 0.00 ? 32  LYS A HZ3  2  
ATOM 2432  N N    . SER A 1 33  ? -6.933  -4.152  12.221  1.00 0.00 ? 33  SER A N    2  
ATOM 2433  C CA   . SER A 1 33  ? -7.748  -4.213  11.014  1.00 0.00 ? 33  SER A CA   2  
ATOM 2434  C C    . SER A 1 33  ? -7.483  -3.007  10.117  1.00 0.00 ? 33  SER A C    2  
ATOM 2435  O O    . SER A 1 33  ? -7.454  -3.126  8.892   1.00 0.00 ? 33  SER A O    2  
ATOM 2436  C CB   . SER A 1 33  ? -9.232  -4.276  11.378  1.00 0.00 ? 33  SER A CB   2  
ATOM 2437  O OG   . SER A 1 33  ? -10.046 -4.033  10.243  1.00 0.00 ? 33  SER A OG   2  
ATOM 2438  H H    . SER A 1 33  ? -7.185  -3.532  12.938  1.00 0.00 ? 33  SER A H    2  
ATOM 2439  H HA   . SER A 1 33  ? -7.479  -5.111  10.478  1.00 0.00 ? 33  SER A HA   2  
ATOM 2440  H HB2  . SER A 1 33  ? -9.464  -5.256  11.768  1.00 0.00 ? 33  SER A HB2  2  
ATOM 2441  H HB3  . SER A 1 33  ? -9.448  -3.530  12.128  1.00 0.00 ? 33  SER A HB3  2  
ATOM 2442  H HG   . SER A 1 33  ? -9.500  -4.017  9.454   1.00 0.00 ? 33  SER A HG   2  
ATOM 2443  N N    . ILE A 1 34  ? -7.291  -1.848  10.738  1.00 0.00 ? 34  ILE A N    2  
ATOM 2444  C CA   . ILE A 1 34  ? -7.028  -0.621  9.997   1.00 0.00 ? 34  ILE A CA   2  
ATOM 2445  C C    . ILE A 1 34  ? -5.579  -0.176  10.167  1.00 0.00 ? 34  ILE A C    2  
ATOM 2446  O O    . ILE A 1 34  ? -5.015  -0.265  11.258  1.00 0.00 ? 34  ILE A O    2  
ATOM 2447  C CB   . ILE A 1 34  ? -7.959  0.520   10.448  1.00 0.00 ? 34  ILE A CB   2  
ATOM 2448  C CG1  . ILE A 1 34  ? -9.419  0.157   10.167  1.00 0.00 ? 34  ILE A CG1  2  
ATOM 2449  C CG2  . ILE A 1 34  ? -7.586  1.817   9.747   1.00 0.00 ? 34  ILE A CG2  2  
ATOM 2450  C CD1  . ILE A 1 34  ? -10.403 0.875   11.063  1.00 0.00 ? 34  ILE A CD1  2  
ATOM 2451  H H    . ILE A 1 34  ? -7.326  -1.818  11.716  1.00 0.00 ? 34  ILE A H    2  
ATOM 2452  H HA   . ILE A 1 34  ? -7.212  -0.817  8.951   1.00 0.00 ? 34  ILE A HA   2  
ATOM 2453  H HB   . ILE A 1 34  ? -7.829  0.662   11.510  1.00 0.00 ? 34  ILE A HB   2  
ATOM 2454  H HG12 . ILE A 1 34  ? -9.656  0.410   9.146   1.00 0.00 ? 34  ILE A HG12 2  
ATOM 2455  H HG13 . ILE A 1 34  ? -9.552  -0.906  10.311  1.00 0.00 ? 34  ILE A HG13 2  
ATOM 2456  H HG21 . ILE A 1 34  ? -6.876  2.362   10.353  1.00 0.00 ? 34  ILE A HG21 2  
ATOM 2457  H HG22 . ILE A 1 34  ? -7.142  1.593   8.789   1.00 0.00 ? 34  ILE A HG22 2  
ATOM 2458  H HG23 . ILE A 1 34  ? -8.472  2.417   9.603   1.00 0.00 ? 34  ILE A HG23 2  
ATOM 2459  H HD11 . ILE A 1 34  ? -10.213 1.938   11.029  1.00 0.00 ? 34  ILE A HD11 2  
ATOM 2460  H HD12 . ILE A 1 34  ? -11.409 0.677   10.726  1.00 0.00 ? 34  ILE A HD12 2  
ATOM 2461  H HD13 . ILE A 1 34  ? -10.288 0.523   12.079  1.00 0.00 ? 34  ILE A HD13 2  
ATOM 2462  N N    . PHE A 1 35  ? -4.982  0.304   9.081   1.00 0.00 ? 35  PHE A N    2  
ATOM 2463  C CA   . PHE A 1 35  ? -3.598  0.763   9.110   1.00 0.00 ? 35  PHE A CA   2  
ATOM 2464  C C    . PHE A 1 35  ? -3.373  1.875   8.089   1.00 0.00 ? 35  PHE A C    2  
ATOM 2465  O O    . PHE A 1 35  ? -4.266  2.205   7.308   1.00 0.00 ? 35  PHE A O    2  
ATOM 2466  C CB   . PHE A 1 35  ? -2.646  -0.401  8.831   1.00 0.00 ? 35  PHE A CB   2  
ATOM 2467  C CG   . PHE A 1 35  ? -3.008  -1.192  7.607   1.00 0.00 ? 35  PHE A CG   2  
ATOM 2468  C CD1  . PHE A 1 35  ? -4.066  -2.087  7.632   1.00 0.00 ? 35  PHE A CD1  2  
ATOM 2469  C CD2  . PHE A 1 35  ? -2.290  -1.042  6.431   1.00 0.00 ? 35  PHE A CD2  2  
ATOM 2470  C CE1  . PHE A 1 35  ? -4.402  -2.816  6.507   1.00 0.00 ? 35  PHE A CE1  2  
ATOM 2471  C CE2  . PHE A 1 35  ? -2.622  -1.768  5.303   1.00 0.00 ? 35  PHE A CE2  2  
ATOM 2472  C CZ   . PHE A 1 35  ? -3.679  -2.657  5.342   1.00 0.00 ? 35  PHE A CZ   2  
ATOM 2473  H H    . PHE A 1 35  ? -5.484  0.349   8.240   1.00 0.00 ? 35  PHE A H    2  
ATOM 2474  H HA   . PHE A 1 35  ? -3.399  1.152   10.097  1.00 0.00 ? 35  PHE A HA   2  
ATOM 2475  H HB2  . PHE A 1 35  ? -1.647  -0.015  8.692   1.00 0.00 ? 35  PHE A HB2  2  
ATOM 2476  H HB3  . PHE A 1 35  ? -2.653  -1.073  9.676   1.00 0.00 ? 35  PHE A HB3  2  
ATOM 2477  H HD1  . PHE A 1 35  ? -4.633  -2.212  8.544   1.00 0.00 ? 35  PHE A HD1  2  
ATOM 2478  H HD2  . PHE A 1 35  ? -1.463  -0.348  6.400   1.00 0.00 ? 35  PHE A HD2  2  
ATOM 2479  H HE1  . PHE A 1 35  ? -5.229  -3.510  6.541   1.00 0.00 ? 35  PHE A HE1  2  
ATOM 2480  H HE2  . PHE A 1 35  ? -2.055  -1.642  4.393   1.00 0.00 ? 35  PHE A HE2  2  
ATOM 2481  H HZ   . PHE A 1 35  ? -3.940  -3.225  4.461   1.00 0.00 ? 35  PHE A HZ   2  
ATOM 2482  N N    . ARG A 1 36  ? -2.174  2.449   8.102   1.00 0.00 ? 36  ARG A N    2  
ATOM 2483  C CA   . ARG A 1 36  ? -1.832  3.524   7.179   1.00 0.00 ? 36  ARG A CA   2  
ATOM 2484  C C    . ARG A 1 36  ? -0.540  3.208   6.432   1.00 0.00 ? 36  ARG A C    2  
ATOM 2485  O O    . ARG A 1 36  ? 0.445   2.773   7.031   1.00 0.00 ? 36  ARG A O    2  
ATOM 2486  C CB   . ARG A 1 36  ? -1.686  4.846   7.935   1.00 0.00 ? 36  ARG A CB   2  
ATOM 2487  C CG   . ARG A 1 36  ? -1.113  4.688   9.334   1.00 0.00 ? 36  ARG A CG   2  
ATOM 2488  C CD   . ARG A 1 36  ? -0.422  5.960   9.799   1.00 0.00 ? 36  ARG A CD   2  
ATOM 2489  N NE   . ARG A 1 36  ? -1.377  6.965   10.259  1.00 0.00 ? 36  ARG A NE   2  
ATOM 2490  C CZ   . ARG A 1 36  ? -1.022  8.094   10.863  1.00 0.00 ? 36  ARG A CZ   2  
ATOM 2491  N NH1  . ARG A 1 36  ? 0.259   8.360   11.079  1.00 0.00 ? 36  ARG A NH1  2  
ATOM 2492  N NH2  . ARG A 1 36  ? -1.949  8.959   11.253  1.00 0.00 ? 36  ARG A NH2  2  
ATOM 2493  H H    . ARG A 1 36  ? -1.504  2.142   8.748   1.00 0.00 ? 36  ARG A H    2  
ATOM 2494  H HA   . ARG A 1 36  ? -2.635  3.615   6.463   1.00 0.00 ? 36  ARG A HA   2  
ATOM 2495  H HB2  . ARG A 1 36  ? -1.033  5.498   7.374   1.00 0.00 ? 36  ARG A HB2  2  
ATOM 2496  H HB3  . ARG A 1 36  ? -2.658  5.308   8.017   1.00 0.00 ? 36  ARG A HB3  2  
ATOM 2497  H HG2  . ARG A 1 36  ? -1.917  4.458   10.018  1.00 0.00 ? 36  ARG A HG2  2  
ATOM 2498  H HG3  . ARG A 1 36  ? -0.397  3.880   9.330   1.00 0.00 ? 36  ARG A HG3  2  
ATOM 2499  H HD2  . ARG A 1 36  ? 0.246   5.715   10.611  1.00 0.00 ? 36  ARG A HD2  2  
ATOM 2500  H HD3  . ARG A 1 36  ? 0.146   6.367   8.976   1.00 0.00 ? 36  ARG A HD3  2  
ATOM 2501  H HE   . ARG A 1 36  ? -2.329  6.789   10.110  1.00 0.00 ? 36  ARG A HE   2  
ATOM 2502  H HH11 . ARG A 1 36  ? 0.960   7.710   10.785  1.00 0.00 ? 36  ARG A HH11 2  
ATOM 2503  H HH12 . ARG A 1 36  ? 0.524   9.211   11.533  1.00 0.00 ? 36  ARG A HH12 2  
ATOM 2504  H HH21 . ARG A 1 36  ? -2.916  8.762   11.092  1.00 0.00 ? 36  ARG A HH21 2  
ATOM 2505  H HH22 . ARG A 1 36  ? -1.681  9.808   11.708  1.00 0.00 ? 36  ARG A HH22 2  
ATOM 2506  N N    . ILE A 1 37  ? -0.551  3.429   5.122   1.00 0.00 ? 37  ILE A N    2  
ATOM 2507  C CA   . ILE A 1 37  ? 0.620   3.169   4.294   1.00 0.00 ? 37  ILE A CA   2  
ATOM 2508  C C    . ILE A 1 37  ? 1.183   4.462   3.714   1.00 0.00 ? 37  ILE A C    2  
ATOM 2509  O O    . ILE A 1 37  ? 0.451   5.321   3.221   1.00 0.00 ? 37  ILE A O    2  
ATOM 2510  C CB   . ILE A 1 37  ? 0.290   2.203   3.140   1.00 0.00 ? 37  ILE A CB   2  
ATOM 2511  C CG1  . ILE A 1 37  ? 1.573   1.760   2.434   1.00 0.00 ? 37  ILE A CG1  2  
ATOM 2512  C CG2  . ILE A 1 37  ? -0.663  2.863   2.154   1.00 0.00 ? 37  ILE A CG2  2  
ATOM 2513  C CD1  . ILE A 1 37  ? 1.325   0.906   1.210   1.00 0.00 ? 37  ILE A CD1  2  
ATOM 2514  H H    . ILE A 1 37  ? -1.365  3.777   4.702   1.00 0.00 ? 37  ILE A H    2  
ATOM 2515  H HA   . ILE A 1 37  ? 1.373   2.709   4.917   1.00 0.00 ? 37  ILE A HA   2  
ATOM 2516  H HB   . ILE A 1 37  ? -0.202  1.337   3.555   1.00 0.00 ? 37  ILE A HB   2  
ATOM 2517  H HG12 . ILE A 1 37  ? 2.125   2.633   2.122   1.00 0.00 ? 37  ILE A HG12 2  
ATOM 2518  H HG13 . ILE A 1 37  ? 2.175   1.186   3.124   1.00 0.00 ? 37  ILE A HG13 2  
ATOM 2519  H HG21 . ILE A 1 37  ? -1.361  2.127   1.782   1.00 0.00 ? 37  ILE A HG21 2  
ATOM 2520  H HG22 . ILE A 1 37  ? -1.204  3.653   2.651   1.00 0.00 ? 37  ILE A HG22 2  
ATOM 2521  H HG23 . ILE A 1 37  ? -0.100  3.274   1.329   1.00 0.00 ? 37  ILE A HG23 2  
ATOM 2522  H HD11 . ILE A 1 37  ? 1.883   -0.015  1.294   1.00 0.00 ? 37  ILE A HD11 2  
ATOM 2523  H HD12 . ILE A 1 37  ? 0.272   0.685   1.132   1.00 0.00 ? 37  ILE A HD12 2  
ATOM 2524  H HD13 . ILE A 1 37  ? 1.647   1.441   0.327   1.00 0.00 ? 37  ILE A HD13 2  
ATOM 2525  N N    . PRO A 1 38  ? 2.515   4.607   3.772   1.00 0.00 ? 38  PRO A N    2  
ATOM 2526  C CA   . PRO A 1 38  ? 3.206   5.792   3.255   1.00 0.00 ? 38  PRO A CA   2  
ATOM 2527  C C    . PRO A 1 38  ? 3.166   5.868   1.733   1.00 0.00 ? 38  PRO A C    2  
ATOM 2528  O O    . PRO A 1 38  ? 3.719   5.012   1.044   1.00 0.00 ? 38  PRO A O    2  
ATOM 2529  C CB   . PRO A 1 38  ? 4.645   5.604   3.744   1.00 0.00 ? 38  PRO A CB   2  
ATOM 2530  C CG   . PRO A 1 38  ? 4.797   4.132   3.916   1.00 0.00 ? 38  PRO A CG   2  
ATOM 2531  C CD   . PRO A 1 38  ? 3.449   3.624   4.346   1.00 0.00 ? 38  PRO A CD   2  
ATOM 2532  H HA   . PRO A 1 38  ? 2.799   6.701   3.672   1.00 0.00 ? 38  PRO A HA   2  
ATOM 2533  H HB2  . PRO A 1 38  ? 5.332   5.989   3.003   1.00 0.00 ? 38  PRO A HB2  2  
ATOM 2534  H HB3  . PRO A 1 38  ? 4.783   6.127   4.678   1.00 0.00 ? 38  PRO A HB3  2  
ATOM 2535  H HG2  . PRO A 1 38  ? 5.087   3.681   2.979   1.00 0.00 ? 38  PRO A HG2  2  
ATOM 2536  H HG3  . PRO A 1 38  ? 5.535   3.927   4.677   1.00 0.00 ? 38  PRO A HG3  2  
ATOM 2537  H HD2  . PRO A 1 38  ? 3.270   2.639   3.940   1.00 0.00 ? 38  PRO A HD2  2  
ATOM 2538  H HD3  . PRO A 1 38  ? 3.378   3.608   5.424   1.00 0.00 ? 38  PRO A HD3  2  
ATOM 2539  N N    . TRP A 1 39  ? 2.508   6.899   1.215   1.00 0.00 ? 39  TRP A N    2  
ATOM 2540  C CA   . TRP A 1 39  ? 2.396   7.087   -0.227  1.00 0.00 ? 39  TRP A CA   2  
ATOM 2541  C C    . TRP A 1 39  ? 3.180   8.315   -0.678  1.00 0.00 ? 39  TRP A C    2  
ATOM 2542  O O    . TRP A 1 39  ? 2.726   9.448   -0.515  1.00 0.00 ? 39  TRP A O    2  
ATOM 2543  C CB   . TRP A 1 39  ? 0.928   7.227   -0.632  1.00 0.00 ? 39  TRP A CB   2  
ATOM 2544  C CG   . TRP A 1 39  ? 0.625   6.645   -1.979  1.00 0.00 ? 39  TRP A CG   2  
ATOM 2545  C CD1  . TRP A 1 39  ? 0.807   7.247   -3.192  1.00 0.00 ? 39  TRP A CD1  2  
ATOM 2546  C CD2  . TRP A 1 39  ? 0.085   5.347   -2.250  1.00 0.00 ? 39  TRP A CD2  2  
ATOM 2547  N NE1  . TRP A 1 39  ? 0.413   6.401   -4.200  1.00 0.00 ? 39  TRP A NE1  2  
ATOM 2548  C CE2  . TRP A 1 39  ? -0.033  5.229   -3.649  1.00 0.00 ? 39  TRP A CE2  2  
ATOM 2549  C CE3  . TRP A 1 39  ? -0.308  4.272   -1.448  1.00 0.00 ? 39  TRP A CE3  2  
ATOM 2550  C CZ2  . TRP A 1 39  ? -0.529  4.080   -4.259  1.00 0.00 ? 39  TRP A CZ2  2  
ATOM 2551  C CZ3  . TRP A 1 39  ? -0.800  3.133   -2.055  1.00 0.00 ? 39  TRP A CZ3  2  
ATOM 2552  C CH2  . TRP A 1 39  ? -0.906  3.043   -3.449  1.00 0.00 ? 39  TRP A CH2  2  
ATOM 2553  H H    . TRP A 1 39  ? 2.087   7.549   1.816   1.00 0.00 ? 39  TRP A H    2  
ATOM 2554  H HA   . TRP A 1 39  ? 2.811   6.214   -0.708  1.00 0.00 ? 39  TRP A HA   2  
ATOM 2555  H HB2  . TRP A 1 39  ? 0.311   6.722   0.096   1.00 0.00 ? 39  TRP A HB2  2  
ATOM 2556  H HB3  . TRP A 1 39  ? 0.667   8.275   -0.654  1.00 0.00 ? 39  TRP A HB3  2  
ATOM 2557  H HD1  . TRP A 1 39  ? 1.202   8.242   -3.323  1.00 0.00 ? 39  TRP A HD1  2  
ATOM 2558  H HE1  . TRP A 1 39  ? 0.447   6.604   -5.159  1.00 0.00 ? 39  TRP A HE1  2  
ATOM 2559  H HE3  . TRP A 1 39  ? -0.233  4.323   -0.371  1.00 0.00 ? 39  TRP A HE3  2  
ATOM 2560  H HZ2  . TRP A 1 39  ? -0.617  3.995   -5.332  1.00 0.00 ? 39  TRP A HZ2  2  
ATOM 2561  H HZ3  . TRP A 1 39  ? -1.109  2.292   -1.451  1.00 0.00 ? 39  TRP A HZ3  2  
ATOM 2562  H HH2  . TRP A 1 39  ? -1.296  2.134   -3.880  1.00 0.00 ? 39  TRP A HH2  2  
ATOM 2563  N N    . LYS A 1 40  ? 4.359   8.084   -1.246  1.00 0.00 ? 40  LYS A N    2  
ATOM 2564  C CA   . LYS A 1 40  ? 5.205   9.171   -1.722  1.00 0.00 ? 40  LYS A CA   2  
ATOM 2565  C C    . LYS A 1 40  ? 5.789   8.846   -3.093  1.00 0.00 ? 40  LYS A C    2  
ATOM 2566  O O    . LYS A 1 40  ? 6.143   7.700   -3.372  1.00 0.00 ? 40  LYS A O    2  
ATOM 2567  C CB   . LYS A 1 40  ? 6.336   9.439   -0.726  1.00 0.00 ? 40  LYS A CB   2  
ATOM 2568  C CG   . LYS A 1 40  ? 5.861   9.572   0.711   1.00 0.00 ? 40  LYS A CG   2  
ATOM 2569  C CD   . LYS A 1 40  ? 6.962   9.218   1.697   1.00 0.00 ? 40  LYS A CD   2  
ATOM 2570  C CE   . LYS A 1 40  ? 6.648   9.735   3.092   1.00 0.00 ? 40  LYS A CE   2  
ATOM 2571  N NZ   . LYS A 1 40  ? 5.632   8.891   3.781   1.00 0.00 ? 40  LYS A NZ   2  
ATOM 2572  H H    . LYS A 1 40  ? 4.666   7.159   -1.348  1.00 0.00 ? 40  LYS A H    2  
ATOM 2573  H HA   . LYS A 1 40  ? 4.593   10.057  -1.805  1.00 0.00 ? 40  LYS A HA   2  
ATOM 2574  H HB2  . LYS A 1 40  ? 7.044   8.625   -0.775  1.00 0.00 ? 40  LYS A HB2  2  
ATOM 2575  H HB3  . LYS A 1 40  ? 6.835   10.356  -1.004  1.00 0.00 ? 40  LYS A HB3  2  
ATOM 2576  H HG2  . LYS A 1 40  ? 5.551   10.592  0.886   1.00 0.00 ? 40  LYS A HG2  2  
ATOM 2577  H HG3  . LYS A 1 40  ? 5.023   8.907   0.867   1.00 0.00 ? 40  LYS A HG3  2  
ATOM 2578  H HD2  . LYS A 1 40  ? 7.065   8.143   1.738   1.00 0.00 ? 40  LYS A HD2  2  
ATOM 2579  H HD3  . LYS A 1 40  ? 7.890   9.657   1.360   1.00 0.00 ? 40  LYS A HD3  2  
ATOM 2580  H HE2  . LYS A 1 40  ? 7.556   9.735   3.675   1.00 0.00 ? 40  LYS A HE2  2  
ATOM 2581  H HE3  . LYS A 1 40  ? 6.271   10.744  3.012   1.00 0.00 ? 40  LYS A HE3  2  
ATOM 2582  H HZ1  . LYS A 1 40  ? 5.671   9.051   4.808   1.00 0.00 ? 40  LYS A HZ1  2  
ATOM 2583  H HZ2  . LYS A 1 40  ? 5.814   7.885   3.591   1.00 0.00 ? 40  LYS A HZ2  2  
ATOM 2584  H HZ3  . LYS A 1 40  ? 4.679   9.130   3.440   1.00 0.00 ? 40  LYS A HZ3  2  
ATOM 2585  N N    . HIS A 1 41  ? 5.888   9.861   -3.946  1.00 0.00 ? 41  HIS A N    2  
ATOM 2586  C CA   . HIS A 1 41  ? 6.431   9.683   -5.288  1.00 0.00 ? 41  HIS A CA   2  
ATOM 2587  C C    . HIS A 1 41  ? 7.954   9.765   -5.273  1.00 0.00 ? 41  HIS A C    2  
ATOM 2588  O O    . HIS A 1 41  ? 8.539   10.472  -4.452  1.00 0.00 ? 41  HIS A O    2  
ATOM 2589  C CB   . HIS A 1 41  ? 5.861   10.738  -6.236  1.00 0.00 ? 41  HIS A CB   2  
ATOM 2590  C CG   . HIS A 1 41  ? 6.736   11.016  -7.418  1.00 0.00 ? 41  HIS A CG   2  
ATOM 2591  N ND1  . HIS A 1 41  ? 7.041   10.066  -8.370  1.00 0.00 ? 41  HIS A ND1  2  
ATOM 2592  C CD2  . HIS A 1 41  ? 7.373   12.148  -7.802  1.00 0.00 ? 41  HIS A CD2  2  
ATOM 2593  C CE1  . HIS A 1 41  ? 7.828   10.600  -9.286  1.00 0.00 ? 41  HIS A CE1  2  
ATOM 2594  N NE2  . HIS A 1 41  ? 8.044   11.863  -8.965  1.00 0.00 ? 41  HIS A NE2  2  
ATOM 2595  H H    . HIS A 1 41  ? 5.589   10.751  -3.665  1.00 0.00 ? 41  HIS A H    2  
ATOM 2596  H HA   . HIS A 1 41  ? 6.139   8.703   -5.636  1.00 0.00 ? 41  HIS A HA   2  
ATOM 2597  H HB2  . HIS A 1 41  ? 4.903   10.401  -6.605  1.00 0.00 ? 41  HIS A HB2  2  
ATOM 2598  H HB3  . HIS A 1 41  ? 5.727   11.664  -5.695  1.00 0.00 ? 41  HIS A HB3  2  
ATOM 2599  H HD1  . HIS A 1 41  ? 6.728   9.137   -8.372  1.00 0.00 ? 41  HIS A HD1  2  
ATOM 2600  H HD2  . HIS A 1 41  ? 7.356   13.099  -7.288  1.00 0.00 ? 41  HIS A HD2  2  
ATOM 2601  H HE1  . HIS A 1 41  ? 8.227   10.092  -10.151 1.00 0.00 ? 41  HIS A HE1  2  
ATOM 2602  N N    . ALA A 1 42  ? 8.590   9.038   -6.185  1.00 0.00 ? 42  ALA A N    2  
ATOM 2603  C CA   . ALA A 1 42  ? 10.045  9.030   -6.277  1.00 0.00 ? 42  ALA A CA   2  
ATOM 2604  C C    . ALA A 1 42  ? 10.545  10.166  -7.162  1.00 0.00 ? 42  ALA A C    2  
ATOM 2605  O O    . ALA A 1 42  ? 10.352  10.152  -8.377  1.00 0.00 ? 42  ALA A O    2  
ATOM 2606  C CB   . ALA A 1 42  ? 10.533  7.690   -6.809  1.00 0.00 ? 42  ALA A CB   2  
ATOM 2607  H H    . ALA A 1 42  ? 8.069   8.494   -6.812  1.00 0.00 ? 42  ALA A H    2  
ATOM 2608  H HA   . ALA A 1 42  ? 10.443  9.160   -5.281  1.00 0.00 ? 42  ALA A HA   2  
ATOM 2609  H HB1  . ALA A 1 42  ? 11.602  7.731   -6.957  1.00 0.00 ? 42  ALA A HB1  2  
ATOM 2610  H HB2  . ALA A 1 42  ? 10.296  6.913   -6.098  1.00 0.00 ? 42  ALA A HB2  2  
ATOM 2611  H HB3  . ALA A 1 42  ? 10.047  7.479   -7.750  1.00 0.00 ? 42  ALA A HB3  2  
ATOM 2612  N N    . GLY A 1 43  ? 11.189  11.152  -6.544  1.00 0.00 ? 43  GLY A N    2  
ATOM 2613  C CA   . GLY A 1 43  ? 11.706  12.284  -7.291  1.00 0.00 ? 43  GLY A CA   2  
ATOM 2614  C C    . GLY A 1 43  ? 12.772  13.044  -6.527  1.00 0.00 ? 43  GLY A C    2  
ATOM 2615  O O    . GLY A 1 43  ? 12.835  14.272  -6.590  1.00 0.00 ? 43  GLY A O    2  
ATOM 2616  H H    . GLY A 1 43  ? 11.314  11.110  -5.572  1.00 0.00 ? 43  GLY A H    2  
ATOM 2617  H HA2  . GLY A 1 43  ? 12.128  11.926  -8.218  1.00 0.00 ? 43  GLY A HA2  2  
ATOM 2618  H HA3  . GLY A 1 43  ? 10.891  12.956  -7.513  1.00 0.00 ? 43  GLY A HA3  2  
ATOM 2619  N N    . LYS A 1 44  ? 13.613  12.314  -5.802  1.00 0.00 ? 44  LYS A N    2  
ATOM 2620  C CA   . LYS A 1 44  ? 14.682  12.926  -5.022  1.00 0.00 ? 44  LYS A CA   2  
ATOM 2621  C C    . LYS A 1 44  ? 15.955  12.088  -5.092  1.00 0.00 ? 44  LYS A C    2  
ATOM 2622  O O    . LYS A 1 44  ? 15.916  10.915  -5.461  1.00 0.00 ? 44  LYS A O    2  
ATOM 2623  C CB   . LYS A 1 44  ? 14.247  13.091  -3.564  1.00 0.00 ? 44  LYS A CB   2  
ATOM 2624  C CG   . LYS A 1 44  ? 14.668  14.415  -2.950  1.00 0.00 ? 44  LYS A CG   2  
ATOM 2625  C CD   . LYS A 1 44  ? 15.947  14.273  -2.142  1.00 0.00 ? 44  LYS A CD   2  
ATOM 2626  C CE   . LYS A 1 44  ? 15.988  15.260  -0.986  1.00 0.00 ? 44  LYS A CE   2  
ATOM 2627  N NZ   . LYS A 1 44  ? 16.628  16.547  -1.377  1.00 0.00 ? 44  LYS A NZ   2  
ATOM 2628  H H    . LYS A 1 44  ? 13.512  11.338  -5.792  1.00 0.00 ? 44  LYS A H    2  
ATOM 2629  H HA   . LYS A 1 44  ? 14.883  13.900  -5.442  1.00 0.00 ? 44  LYS A HA   2  
ATOM 2630  H HB2  . LYS A 1 44  ? 13.171  13.020  -3.512  1.00 0.00 ? 44  LYS A HB2  2  
ATOM 2631  H HB3  . LYS A 1 44  ? 14.681  12.293  -2.979  1.00 0.00 ? 44  LYS A HB3  2  
ATOM 2632  H HG2  . LYS A 1 44  ? 14.833  15.132  -3.741  1.00 0.00 ? 44  LYS A HG2  2  
ATOM 2633  H HG3  . LYS A 1 44  ? 13.880  14.767  -2.301  1.00 0.00 ? 44  LYS A HG3  2  
ATOM 2634  H HD2  . LYS A 1 44  ? 16.003  13.270  -1.746  1.00 0.00 ? 44  LYS A HD2  2  
ATOM 2635  H HD3  . LYS A 1 44  ? 16.794  14.454  -2.789  1.00 0.00 ? 44  LYS A HD3  2  
ATOM 2636  H HE2  . LYS A 1 44  ? 14.978  15.456  -0.660  1.00 0.00 ? 44  LYS A HE2  2  
ATOM 2637  H HE3  . LYS A 1 44  ? 16.549  14.821  -0.174  1.00 0.00 ? 44  LYS A HE3  2  
ATOM 2638  H HZ1  . LYS A 1 44  ? 16.859  16.537  -2.391  1.00 0.00 ? 44  LYS A HZ1  2  
ATOM 2639  H HZ2  . LYS A 1 44  ? 17.504  16.689  -0.835  1.00 0.00 ? 44  LYS A HZ2  2  
ATOM 2640  H HZ3  . LYS A 1 44  ? 15.983  17.340  -1.187  1.00 0.00 ? 44  LYS A HZ3  2  
ATOM 2641  N N    . GLN A 1 45  ? 17.080  12.699  -4.735  1.00 0.00 ? 45  GLN A N    2  
ATOM 2642  C CA   . GLN A 1 45  ? 18.364  12.007  -4.757  1.00 0.00 ? 45  GLN A CA   2  
ATOM 2643  C C    . GLN A 1 45  ? 18.664  11.374  -3.402  1.00 0.00 ? 45  GLN A C    2  
ATOM 2644  O O    . GLN A 1 45  ? 19.130  10.237  -3.328  1.00 0.00 ? 45  GLN A O    2  
ATOM 2645  C CB   . GLN A 1 45  ? 19.483  12.978  -5.139  1.00 0.00 ? 45  GLN A CB   2  
ATOM 2646  C CG   . GLN A 1 45  ? 19.744  13.047  -6.635  1.00 0.00 ? 45  GLN A CG   2  
ATOM 2647  C CD   . GLN A 1 45  ? 20.658  11.938  -7.119  1.00 0.00 ? 45  GLN A CD   2  
ATOM 2648  O OE1  . GLN A 1 45  ? 21.360  11.307  -6.329  1.00 0.00 ? 45  GLN A OE1  2  
ATOM 2649  N NE2  . GLN A 1 45  ? 20.653  11.695  -8.424  1.00 0.00 ? 45  GLN A NE2  2  
ATOM 2650  H H    . GLN A 1 45  ? 17.046  13.635  -4.450  1.00 0.00 ? 45  GLN A H    2  
ATOM 2651  H HA   . GLN A 1 45  ? 18.307  11.227  -5.500  1.00 0.00 ? 45  GLN A HA   2  
ATOM 2652  H HB2  . GLN A 1 45  ? 19.219  13.967  -4.795  1.00 0.00 ? 45  GLN A HB2  2  
ATOM 2653  H HB3  . GLN A 1 45  ? 20.395  12.667  -4.650  1.00 0.00 ? 45  GLN A HB3  2  
ATOM 2654  H HG2  . GLN A 1 45  ? 18.802  12.968  -7.156  1.00 0.00 ? 45  GLN A HG2  2  
ATOM 2655  H HG3  . GLN A 1 45  ? 20.203  13.997  -6.863  1.00 0.00 ? 45  GLN A HG3  2  
ATOM 2656  H HE21 . GLN A 1 45  ? 20.069  12.238  -8.994  1.00 0.00 ? 45  GLN A HE21 2  
ATOM 2657  H HE22 . GLN A 1 45  ? 21.235  10.985  -8.765  1.00 0.00 ? 45  GLN A HE22 2  
ATOM 2658  N N    . ASP A 1 46  ? 18.395  12.117  -2.335  1.00 0.00 ? 46  ASP A N    2  
ATOM 2659  C CA   . ASP A 1 46  ? 18.636  11.628  -0.982  1.00 0.00 ? 46  ASP A CA   2  
ATOM 2660  C C    . ASP A 1 46  ? 17.608  10.569  -0.596  1.00 0.00 ? 46  ASP A C    2  
ATOM 2661  O O    . ASP A 1 46  ? 17.629  10.046  0.518   1.00 0.00 ? 46  ASP A O    2  
ATOM 2662  C CB   . ASP A 1 46  ? 18.594  12.785  0.017   1.00 0.00 ? 46  ASP A CB   2  
ATOM 2663  C CG   . ASP A 1 46  ? 19.484  13.940  -0.398  1.00 0.00 ? 46  ASP A CG   2  
ATOM 2664  O OD1  . ASP A 1 46  ? 19.344  14.416  -1.545  1.00 0.00 ? 46  ASP A OD1  2  
ATOM 2665  O OD2  . ASP A 1 46  ? 20.321  14.369  0.424   1.00 0.00 ? 46  ASP A OD2  2  
ATOM 2666  H H    . ASP A 1 46  ? 18.025  13.016  -2.459  1.00 0.00 ? 46  ASP A H    2  
ATOM 2667  H HA   . ASP A 1 46  ? 19.619  11.181  -0.961  1.00 0.00 ? 46  ASP A HA   2  
ATOM 2668  H HB2  . ASP A 1 46  ? 17.580  13.147  0.096   1.00 0.00 ? 46  ASP A HB2  2  
ATOM 2669  H HB3  . ASP A 1 46  ? 18.922  12.430  0.983   1.00 0.00 ? 46  ASP A HB3  2  
ATOM 2670  N N    . TYR A 1 47  ? 16.709  10.259  -1.524  1.00 0.00 ? 47  TYR A N    2  
ATOM 2671  C CA   . TYR A 1 47  ? 15.670  9.265   -1.279  1.00 0.00 ? 47  TYR A CA   2  
ATOM 2672  C C    . TYR A 1 47  ? 16.277  7.879   -1.084  1.00 0.00 ? 47  TYR A C    2  
ATOM 2673  O O    . TYR A 1 47  ? 17.480  7.687   -1.251  1.00 0.00 ? 47  TYR A O    2  
ATOM 2674  C CB   . TYR A 1 47  ? 14.676  9.240   -2.442  1.00 0.00 ? 47  TYR A CB   2  
ATOM 2675  C CG   . TYR A 1 47  ? 15.156  8.438   -3.631  1.00 0.00 ? 47  TYR A CG   2  
ATOM 2676  C CD1  . TYR A 1 47  ? 16.365  8.731   -4.249  1.00 0.00 ? 47  TYR A CD1  2  
ATOM 2677  C CD2  . TYR A 1 47  ? 14.399  7.388   -4.137  1.00 0.00 ? 47  TYR A CD2  2  
ATOM 2678  C CE1  . TYR A 1 47  ? 16.807  8.001   -5.335  1.00 0.00 ? 47  TYR A CE1  2  
ATOM 2679  C CE2  . TYR A 1 47  ? 14.834  6.653   -5.222  1.00 0.00 ? 47  TYR A CE2  2  
ATOM 2680  C CZ   . TYR A 1 47  ? 16.038  6.963   -5.818  1.00 0.00 ? 47  TYR A CZ   2  
ATOM 2681  O OH   . TYR A 1 47  ? 16.474  6.234   -6.901  1.00 0.00 ? 47  TYR A OH   2  
ATOM 2682  H H    . TYR A 1 47  ? 16.743  10.710  -2.393  1.00 0.00 ? 47  TYR A H    2  
ATOM 2683  H HA   . TYR A 1 47  ? 15.147  9.547   -0.377  1.00 0.00 ? 47  TYR A HA   2  
ATOM 2684  H HB2  . TYR A 1 47  ? 13.748  8.806   -2.103  1.00 0.00 ? 47  TYR A HB2  2  
ATOM 2685  H HB3  . TYR A 1 47  ? 14.496  10.251  -2.775  1.00 0.00 ? 47  TYR A HB3  2  
ATOM 2686  H HD1  . TYR A 1 47  ? 16.966  9.544   -3.868  1.00 0.00 ? 47  TYR A HD1  2  
ATOM 2687  H HD2  . TYR A 1 47  ? 13.456  7.148   -3.668  1.00 0.00 ? 47  TYR A HD2  2  
ATOM 2688  H HE1  . TYR A 1 47  ? 17.751  8.244   -5.802  1.00 0.00 ? 47  TYR A HE1  2  
ATOM 2689  H HE2  . TYR A 1 47  ? 14.232  5.840   -5.601  1.00 0.00 ? 47  TYR A HE2  2  
ATOM 2690  H HH   . TYR A 1 47  ? 15.849  6.329   -7.623  1.00 0.00 ? 47  TYR A HH   2  
ATOM 2691  N N    . ASN A 1 48  ? 15.433  6.916   -0.728  1.00 0.00 ? 48  ASN A N    2  
ATOM 2692  C CA   . ASN A 1 48  ? 15.885  5.547   -0.509  1.00 0.00 ? 48  ASN A CA   2  
ATOM 2693  C C    . ASN A 1 48  ? 15.126  4.573   -1.406  1.00 0.00 ? 48  ASN A C    2  
ATOM 2694  O O    . ASN A 1 48  ? 13.918  4.389   -1.257  1.00 0.00 ? 48  ASN A O    2  
ATOM 2695  C CB   . ASN A 1 48  ? 15.700  5.155   0.958   1.00 0.00 ? 48  ASN A CB   2  
ATOM 2696  C CG   . ASN A 1 48  ? 16.578  5.970   1.889   1.00 0.00 ? 48  ASN A CG   2  
ATOM 2697  O OD1  . ASN A 1 48  ? 17.804  5.868   1.851   1.00 0.00 ? 48  ASN A OD1  2  
ATOM 2698  N ND2  . ASN A 1 48  ? 15.952  6.784   2.731   1.00 0.00 ? 48  ASN A ND2  2  
ATOM 2699  H H    . ASN A 1 48  ? 14.484  7.131   -0.610  1.00 0.00 ? 48  ASN A H    2  
ATOM 2700  H HA   . ASN A 1 48  ? 16.935  5.501   -0.755  1.00 0.00 ? 48  ASN A HA   2  
ATOM 2701  H HB2  . ASN A 1 48  ? 14.669  5.312   1.239   1.00 0.00 ? 48  ASN A HB2  2  
ATOM 2702  H HB3  . ASN A 1 48  ? 15.948  4.111   1.081   1.00 0.00 ? 48  ASN A HB3  2  
ATOM 2703  H HD21 . ASN A 1 48  ? 14.973  6.813   2.705   1.00 0.00 ? 48  ASN A HD21 2  
ATOM 2704  H HD22 . ASN A 1 48  ? 16.495  7.322   3.343   1.00 0.00 ? 48  ASN A HD22 2  
ATOM 2705  N N    . ARG A 1 49  ? 15.843  3.953   -2.337  1.00 0.00 ? 49  ARG A N    2  
ATOM 2706  C CA   . ARG A 1 49  ? 15.238  2.999   -3.259  1.00 0.00 ? 49  ARG A CA   2  
ATOM 2707  C C    . ARG A 1 49  ? 14.796  1.738   -2.523  1.00 0.00 ? 49  ARG A C    2  
ATOM 2708  O O    . ARG A 1 49  ? 13.653  1.300   -2.654  1.00 0.00 ? 49  ARG A O    2  
ATOM 2709  C CB   . ARG A 1 49  ? 16.224  2.635   -4.370  1.00 0.00 ? 49  ARG A CB   2  
ATOM 2710  C CG   . ARG A 1 49  ? 16.660  3.823   -5.211  1.00 0.00 ? 49  ARG A CG   2  
ATOM 2711  C CD   . ARG A 1 49  ? 17.365  3.377   -6.483  1.00 0.00 ? 49  ARG A CD   2  
ATOM 2712  N NE   . ARG A 1 49  ? 18.734  2.939   -6.225  1.00 0.00 ? 49  ARG A NE   2  
ATOM 2713  C CZ   . ARG A 1 49  ? 19.762  3.773   -6.109  1.00 0.00 ? 49  ARG A CZ   2  
ATOM 2714  N NH1  . ARG A 1 49  ? 19.577  5.080   -6.227  1.00 0.00 ? 49  ARG A NH1  2  
ATOM 2715  N NH2  . ARG A 1 49  ? 20.979  3.299   -5.874  1.00 0.00 ? 49  ARG A NH2  2  
ATOM 2716  H H    . ARG A 1 49  ? 16.803  4.142   -2.407  1.00 0.00 ? 49  ARG A H    2  
ATOM 2717  H HA   . ARG A 1 49  ? 14.371  3.468   -3.699  1.00 0.00 ? 49  ARG A HA   2  
ATOM 2718  H HB2  . ARG A 1 49  ? 17.104  2.195   -3.924  1.00 0.00 ? 49  ARG A HB2  2  
ATOM 2719  H HB3  . ARG A 1 49  ? 15.761  1.910   -5.022  1.00 0.00 ? 49  ARG A HB3  2  
ATOM 2720  H HG2  . ARG A 1 49  ? 15.789  4.401   -5.480  1.00 0.00 ? 49  ARG A HG2  2  
ATOM 2721  H HG3  . ARG A 1 49  ? 17.335  4.434   -4.631  1.00 0.00 ? 49  ARG A HG3  2  
ATOM 2722  H HD2  . ARG A 1 49  ? 16.812  2.557   -6.917  1.00 0.00 ? 49  ARG A HD2  2  
ATOM 2723  H HD3  . ARG A 1 49  ? 17.386  4.204   -7.176  1.00 0.00 ? 49  ARG A HD3  2  
ATOM 2724  H HE   . ARG A 1 49  ? 18.894  1.977   -6.134  1.00 0.00 ? 49  ARG A HE   2  
ATOM 2725  H HH11 . ARG A 1 49  ? 18.661  5.440   -6.403  1.00 0.00 ? 49  ARG A HH11 2  
ATOM 2726  H HH12 . ARG A 1 49  ? 20.352  5.706   -6.138  1.00 0.00 ? 49  ARG A HH12 2  
ATOM 2727  H HH21 . ARG A 1 49  ? 21.123  2.314   -5.784  1.00 0.00 ? 49  ARG A HH21 2  
ATOM 2728  H HH22 . ARG A 1 49  ? 21.752  3.926   -5.787  1.00 0.00 ? 49  ARG A HH22 2  
ATOM 2729  N N    . GLU A 1 50  ? 15.709  1.160   -1.749  1.00 0.00 ? 50  GLU A N    2  
ATOM 2730  C CA   . GLU A 1 50  ? 15.412  -0.052  -0.993  1.00 0.00 ? 50  GLU A CA   2  
ATOM 2731  C C    . GLU A 1 50  ? 14.222  0.165   -0.063  1.00 0.00 ? 50  GLU A C    2  
ATOM 2732  O O    . GLU A 1 50  ? 13.306  -0.656  -0.010  1.00 0.00 ? 50  GLU A O    2  
ATOM 2733  C CB   . GLU A 1 50  ? 16.635  -0.486  -0.182  1.00 0.00 ? 50  GLU A CB   2  
ATOM 2734  C CG   . GLU A 1 50  ? 17.820  -0.895  -1.040  1.00 0.00 ? 50  GLU A CG   2  
ATOM 2735  C CD   . GLU A 1 50  ? 17.517  -2.091  -1.921  1.00 0.00 ? 50  GLU A CD   2  
ATOM 2736  O OE1  . GLU A 1 50  ? 17.055  -3.121  -1.387  1.00 0.00 ? 50  GLU A OE1  2  
ATOM 2737  O OE2  . GLU A 1 50  ? 17.743  -1.997  -3.146  1.00 0.00 ? 50  GLU A OE2  2  
ATOM 2738  H H    . GLU A 1 50  ? 16.602  1.556   -1.685  1.00 0.00 ? 50  GLU A H    2  
ATOM 2739  H HA   . GLU A 1 50  ? 15.165  -0.831  -1.699  1.00 0.00 ? 50  GLU A HA   2  
ATOM 2740  H HB2  . GLU A 1 50  ? 16.941  0.333   0.452   1.00 0.00 ? 50  GLU A HB2  2  
ATOM 2741  H HB3  . GLU A 1 50  ? 16.360  -1.326  0.439   1.00 0.00 ? 50  GLU A HB3  2  
ATOM 2742  H HG2  . GLU A 1 50  ? 18.096  -0.063  -1.670  1.00 0.00 ? 50  GLU A HG2  2  
ATOM 2743  H HG3  . GLU A 1 50  ? 18.648  -1.144  -0.392  1.00 0.00 ? 50  GLU A HG3  2  
ATOM 2744  N N    . GLU A 1 51  ? 14.243  1.275   0.667   1.00 0.00 ? 51  GLU A N    2  
ATOM 2745  C CA   . GLU A 1 51  ? 13.167  1.598   1.596   1.00 0.00 ? 51  GLU A CA   2  
ATOM 2746  C C    . GLU A 1 51  ? 11.871  1.894   0.846   1.00 0.00 ? 51  GLU A C    2  
ATOM 2747  O O    . GLU A 1 51  ? 10.804  1.398   1.208   1.00 0.00 ? 51  GLU A O    2  
ATOM 2748  C CB   . GLU A 1 51  ? 13.553  2.799   2.462   1.00 0.00 ? 51  GLU A CB   2  
ATOM 2749  C CG   . GLU A 1 51  ? 14.801  2.571   3.298   1.00 0.00 ? 51  GLU A CG   2  
ATOM 2750  C CD   . GLU A 1 51  ? 14.657  1.402   4.254   1.00 0.00 ? 51  GLU A CD   2  
ATOM 2751  O OE1  . GLU A 1 51  ? 13.820  1.490   5.176   1.00 0.00 ? 51  GLU A OE1  2  
ATOM 2752  O OE2  . GLU A 1 51  ? 15.381  0.400   4.079   1.00 0.00 ? 51  GLU A OE2  2  
ATOM 2753  H H    . GLU A 1 51  ? 15.001  1.890   0.580   1.00 0.00 ? 51  GLU A H    2  
ATOM 2754  H HA   . GLU A 1 51  ? 13.011  0.742   2.235   1.00 0.00 ? 51  GLU A HA   2  
ATOM 2755  H HB2  . GLU A 1 51  ? 13.726  3.650   1.819   1.00 0.00 ? 51  GLU A HB2  2  
ATOM 2756  H HB3  . GLU A 1 51  ? 12.735  3.024   3.129   1.00 0.00 ? 51  GLU A HB3  2  
ATOM 2757  H HG2  . GLU A 1 51  ? 15.631  2.373   2.636   1.00 0.00 ? 51  GLU A HG2  2  
ATOM 2758  H HG3  . GLU A 1 51  ? 15.004  3.463   3.871   1.00 0.00 ? 51  GLU A HG3  2  
ATOM 2759  N N    . ASP A 1 52  ? 11.973  2.706   -0.201  1.00 0.00 ? 52  ASP A N    2  
ATOM 2760  C CA   . ASP A 1 52  ? 10.811  3.069   -1.003  1.00 0.00 ? 52  ASP A CA   2  
ATOM 2761  C C    . ASP A 1 52  ? 10.146  1.827   -1.588  1.00 0.00 ? 52  ASP A C    2  
ATOM 2762  O O    . ASP A 1 52  ? 8.938   1.635   -1.451  1.00 0.00 ? 52  ASP A O    2  
ATOM 2763  C CB   . ASP A 1 52  ? 11.218  4.022   -2.128  1.00 0.00 ? 52  ASP A CB   2  
ATOM 2764  C CG   . ASP A 1 52  ? 11.255  5.468   -1.676  1.00 0.00 ? 52  ASP A CG   2  
ATOM 2765  O OD1  . ASP A 1 52  ? 10.308  5.898   -0.985  1.00 0.00 ? 52  ASP A OD1  2  
ATOM 2766  O OD2  . ASP A 1 52  ? 12.231  6.171   -2.013  1.00 0.00 ? 52  ASP A OD2  2  
ATOM 2767  H H    . ASP A 1 52  ? 12.851  3.070   -0.440  1.00 0.00 ? 52  ASP A H    2  
ATOM 2768  H HA   . ASP A 1 52  ? 10.105  3.569   -0.358  1.00 0.00 ? 52  ASP A HA   2  
ATOM 2769  H HB2  . ASP A 1 52  ? 12.201  3.750   -2.483  1.00 0.00 ? 52  ASP A HB2  2  
ATOM 2770  H HB3  . ASP A 1 52  ? 10.510  3.935   -2.939  1.00 0.00 ? 52  ASP A HB3  2  
ATOM 2771  N N    . ALA A 1 53  ? 10.942  0.987   -2.241  1.00 0.00 ? 53  ALA A N    2  
ATOM 2772  C CA   . ALA A 1 53  ? 10.431  -0.237  -2.846  1.00 0.00 ? 53  ALA A CA   2  
ATOM 2773  C C    . ALA A 1 53  ? 10.673  -1.440  -1.940  1.00 0.00 ? 53  ALA A C    2  
ATOM 2774  O O    . ALA A 1 53  ? 10.621  -2.585  -2.387  1.00 0.00 ? 53  ALA A O    2  
ATOM 2775  C CB   . ALA A 1 53  ? 11.073  -0.461  -4.207  1.00 0.00 ? 53  ALA A CB   2  
ATOM 2776  H H    . ALA A 1 53  ? 11.897  1.195   -2.316  1.00 0.00 ? 53  ALA A H    2  
ATOM 2777  H HA   . ALA A 1 53  ? 9.367   -0.117  -2.992  1.00 0.00 ? 53  ALA A HA   2  
ATOM 2778  H HB1  . ALA A 1 53  ? 11.087  0.470   -4.755  1.00 0.00 ? 53  ALA A HB1  2  
ATOM 2779  H HB2  . ALA A 1 53  ? 12.084  -0.816  -4.074  1.00 0.00 ? 53  ALA A HB2  2  
ATOM 2780  H HB3  . ALA A 1 53  ? 10.503  -1.194  -4.757  1.00 0.00 ? 53  ALA A HB3  2  
ATOM 2781  N N    . ALA A 1 54  ? 10.938  -1.171  -0.666  1.00 0.00 ? 54  ALA A N    2  
ATOM 2782  C CA   . ALA A 1 54  ? 11.187  -2.232  0.302   1.00 0.00 ? 54  ALA A CA   2  
ATOM 2783  C C    . ALA A 1 54  ? 10.012  -3.201  0.370   1.00 0.00 ? 54  ALA A C    2  
ATOM 2784  O O    . ALA A 1 54  ? 10.172  -4.403  0.157   1.00 0.00 ? 54  ALA A O    2  
ATOM 2785  C CB   . ALA A 1 54  ? 11.464  -1.638  1.676   1.00 0.00 ? 54  ALA A CB   2  
ATOM 2786  H H    . ALA A 1 54  ? 10.966  -0.238  -0.370  1.00 0.00 ? 54  ALA A H    2  
ATOM 2787  H HA   . ALA A 1 54  ? 12.068  -2.772  -0.013  1.00 0.00 ? 54  ALA A HA   2  
ATOM 2788  H HB1  . ALA A 1 54  ? 10.596  -1.769  2.305   1.00 0.00 ? 54  ALA A HB1  2  
ATOM 2789  H HB2  . ALA A 1 54  ? 12.311  -2.140  2.120   1.00 0.00 ? 54  ALA A HB2  2  
ATOM 2790  H HB3  . ALA A 1 54  ? 11.681  -0.585  1.575   1.00 0.00 ? 54  ALA A HB3  2  
ATOM 2791  N N    . LEU A 1 55  ? 8.831   -2.670  0.668   1.00 0.00 ? 55  LEU A N    2  
ATOM 2792  C CA   . LEU A 1 55  ? 7.627   -3.489  0.764   1.00 0.00 ? 55  LEU A CA   2  
ATOM 2793  C C    . LEU A 1 55  ? 7.136   -3.901  -0.620  1.00 0.00 ? 55  LEU A C    2  
ATOM 2794  O O    . LEU A 1 55  ? 6.940   -5.085  -0.894  1.00 0.00 ? 55  LEU A O    2  
ATOM 2795  C CB   . LEU A 1 55  ? 6.525   -2.726  1.502   1.00 0.00 ? 55  LEU A CB   2  
ATOM 2796  C CG   . LEU A 1 55  ? 5.118   -3.316  1.404   1.00 0.00 ? 55  LEU A CG   2  
ATOM 2797  C CD1  . LEU A 1 55  ? 5.041   -4.638  2.152   1.00 0.00 ? 55  LEU A CD1  2  
ATOM 2798  C CD2  . LEU A 1 55  ? 4.089   -2.335  1.944   1.00 0.00 ? 55  LEU A CD2  2  
ATOM 2799  H H    . LEU A 1 55  ? 8.765   -1.706  0.827   1.00 0.00 ? 55  LEU A H    2  
ATOM 2800  H HA   . LEU A 1 55  ? 7.875   -4.378  1.324   1.00 0.00 ? 55  LEU A HA   2  
ATOM 2801  H HB2  . LEU A 1 55  ? 6.794   -2.684  2.546   1.00 0.00 ? 55  LEU A HB2  2  
ATOM 2802  H HB3  . LEU A 1 55  ? 6.493   -1.723  1.100   1.00 0.00 ? 55  LEU A HB3  2  
ATOM 2803  H HG   . LEU A 1 55  ? 4.887   -3.508  0.365   1.00 0.00 ? 55  LEU A HG   2  
ATOM 2804  H HD11 . LEU A 1 55  ? 5.637   -5.377  1.639   1.00 0.00 ? 55  LEU A HD11 2  
ATOM 2805  H HD12 . LEU A 1 55  ? 4.014   -4.969  2.193   1.00 0.00 ? 55  LEU A HD12 2  
ATOM 2806  H HD13 . LEU A 1 55  ? 5.416   -4.505  3.156   1.00 0.00 ? 55  LEU A HD13 2  
ATOM 2807  H HD21 . LEU A 1 55  ? 3.174   -2.425  1.377   1.00 0.00 ? 55  LEU A HD21 2  
ATOM 2808  H HD22 . LEU A 1 55  ? 4.470   -1.328  1.854   1.00 0.00 ? 55  LEU A HD22 2  
ATOM 2809  H HD23 . LEU A 1 55  ? 3.892   -2.554  2.982   1.00 0.00 ? 55  LEU A HD23 2  
ATOM 2810  N N    . PHE A 1 56  ? 6.942   -2.916  -1.491  1.00 0.00 ? 56  PHE A N    2  
ATOM 2811  C CA   . PHE A 1 56  ? 6.476   -3.176  -2.848  1.00 0.00 ? 56  PHE A CA   2  
ATOM 2812  C C    . PHE A 1 56  ? 7.282   -4.299  -3.494  1.00 0.00 ? 56  PHE A C    2  
ATOM 2813  O O    . PHE A 1 56  ? 6.720   -5.235  -4.063  1.00 0.00 ? 56  PHE A O    2  
ATOM 2814  C CB   . PHE A 1 56  ? 6.577   -1.907  -3.697  1.00 0.00 ? 56  PHE A CB   2  
ATOM 2815  C CG   . PHE A 1 56  ? 5.780   -0.756  -3.152  1.00 0.00 ? 56  PHE A CG   2  
ATOM 2816  C CD1  . PHE A 1 56  ? 4.400   -0.731  -3.278  1.00 0.00 ? 56  PHE A CD1  2  
ATOM 2817  C CD2  . PHE A 1 56  ? 6.410   0.300   -2.514  1.00 0.00 ? 56  PHE A CD2  2  
ATOM 2818  C CE1  . PHE A 1 56  ? 3.664   0.326   -2.779  1.00 0.00 ? 56  PHE A CE1  2  
ATOM 2819  C CE2  . PHE A 1 56  ? 5.679   1.360   -2.012  1.00 0.00 ? 56  PHE A CE2  2  
ATOM 2820  C CZ   . PHE A 1 56  ? 4.304   1.373   -2.144  1.00 0.00 ? 56  PHE A CZ   2  
ATOM 2821  H H    . PHE A 1 56  ? 7.117   -1.992  -1.214  1.00 0.00 ? 56  PHE A H    2  
ATOM 2822  H HA   . PHE A 1 56  ? 5.442   -3.479  -2.790  1.00 0.00 ? 56  PHE A HA   2  
ATOM 2823  H HB2  . PHE A 1 56  ? 7.611   -1.598  -3.749  1.00 0.00 ? 56  PHE A HB2  2  
ATOM 2824  H HB3  . PHE A 1 56  ? 6.219   -2.119  -4.693  1.00 0.00 ? 56  PHE A HB3  2  
ATOM 2825  H HD1  . PHE A 1 56  ? 3.898   -1.550  -3.773  1.00 0.00 ? 56  PHE A HD1  2  
ATOM 2826  H HD2  . PHE A 1 56  ? 7.486   0.291   -2.410  1.00 0.00 ? 56  PHE A HD2  2  
ATOM 2827  H HE1  . PHE A 1 56  ? 2.590   0.334   -2.883  1.00 0.00 ? 56  PHE A HE1  2  
ATOM 2828  H HE2  . PHE A 1 56  ? 6.183   2.177   -1.516  1.00 0.00 ? 56  PHE A HE2  2  
ATOM 2829  H HZ   . PHE A 1 56  ? 3.731   2.200   -1.753  1.00 0.00 ? 56  PHE A HZ   2  
ATOM 2830  N N    . LYS A 1 57  ? 8.604   -4.198  -3.403  1.00 0.00 ? 57  LYS A N    2  
ATOM 2831  C CA   . LYS A 1 57  ? 9.490   -5.204  -3.977  1.00 0.00 ? 57  LYS A CA   2  
ATOM 2832  C C    . LYS A 1 57  ? 9.024   -6.611  -3.613  1.00 0.00 ? 57  LYS A C    2  
ATOM 2833  O O    . LYS A 1 57  ? 8.756   -7.432  -4.489  1.00 0.00 ? 57  LYS A O    2  
ATOM 2834  C CB   . LYS A 1 57  ? 10.924  -4.988  -3.490  1.00 0.00 ? 57  LYS A CB   2  
ATOM 2835  C CG   . LYS A 1 57  ? 11.879  -6.097  -3.898  1.00 0.00 ? 57  LYS A CG   2  
ATOM 2836  C CD   . LYS A 1 57  ? 12.441  -5.865  -5.290  1.00 0.00 ? 57  LYS A CD   2  
ATOM 2837  C CE   . LYS A 1 57  ? 12.874  -7.170  -5.941  1.00 0.00 ? 57  LYS A CE   2  
ATOM 2838  N NZ   . LYS A 1 57  ? 11.722  -7.901  -6.536  1.00 0.00 ? 57  LYS A NZ   2  
ATOM 2839  H H    . LYS A 1 57  ? 8.994   -3.428  -2.937  1.00 0.00 ? 57  LYS A H    2  
ATOM 2840  H HA   . LYS A 1 57  ? 9.463   -5.096  -5.051  1.00 0.00 ? 57  LYS A HA   2  
ATOM 2841  H HB2  . LYS A 1 57  ? 11.293  -4.057  -3.895  1.00 0.00 ? 57  LYS A HB2  2  
ATOM 2842  H HB3  . LYS A 1 57  ? 10.920  -4.925  -2.411  1.00 0.00 ? 57  LYS A HB3  2  
ATOM 2843  H HG2  . LYS A 1 57  ? 12.696  -6.134  -3.192  1.00 0.00 ? 57  LYS A HG2  2  
ATOM 2844  H HG3  . LYS A 1 57  ? 11.348  -7.039  -3.886  1.00 0.00 ? 57  LYS A HG3  2  
ATOM 2845  H HD2  . LYS A 1 57  ? 11.682  -5.404  -5.904  1.00 0.00 ? 57  LYS A HD2  2  
ATOM 2846  H HD3  . LYS A 1 57  ? 13.296  -5.207  -5.218  1.00 0.00 ? 57  LYS A HD3  2  
ATOM 2847  H HE2  . LYS A 1 57  ? 13.589  -6.949  -6.718  1.00 0.00 ? 57  LYS A HE2  2  
ATOM 2848  H HE3  . LYS A 1 57  ? 13.338  -7.794  -5.192  1.00 0.00 ? 57  LYS A HE3  2  
ATOM 2849  H HZ1  . LYS A 1 57  ? 10.858  -7.715  -5.986  1.00 0.00 ? 57  LYS A HZ1  2  
ATOM 2850  H HZ2  . LYS A 1 57  ? 11.907  -8.924  -6.532  1.00 0.00 ? 57  LYS A HZ2  2  
ATOM 2851  H HZ3  . LYS A 1 57  ? 11.569  -7.591  -7.517  1.00 0.00 ? 57  LYS A HZ3  2  
ATOM 2852  N N    . ALA A 1 58  ? 8.930   -6.880  -2.315  1.00 0.00 ? 58  ALA A N    2  
ATOM 2853  C CA   . ALA A 1 58  ? 8.493   -8.185  -1.836  1.00 0.00 ? 58  ALA A CA   2  
ATOM 2854  C C    . ALA A 1 58  ? 7.367   -8.739  -2.701  1.00 0.00 ? 58  ALA A C    2  
ATOM 2855  O O    . ALA A 1 58  ? 7.490   -9.817  -3.282  1.00 0.00 ? 58  ALA A O    2  
ATOM 2856  C CB   . ALA A 1 58  ? 8.050   -8.093  -0.383  1.00 0.00 ? 58  ALA A CB   2  
ATOM 2857  H H    . ALA A 1 58  ? 9.158   -6.184  -1.664  1.00 0.00 ? 58  ALA A H    2  
ATOM 2858  H HA   . ALA A 1 58  ? 9.337   -8.859  -1.886  1.00 0.00 ? 58  ALA A HA   2  
ATOM 2859  H HB1  . ALA A 1 58  ? 8.504   -7.228  0.077   1.00 0.00 ? 58  ALA A HB1  2  
ATOM 2860  H HB2  . ALA A 1 58  ? 6.975   -8.001  -0.341  1.00 0.00 ? 58  ALA A HB2  2  
ATOM 2861  H HB3  . ALA A 1 58  ? 8.357   -8.984  0.144   1.00 0.00 ? 58  ALA A HB3  2  
ATOM 2862  N N    . TRP A 1 59  ? 6.269   -7.996  -2.781  1.00 0.00 ? 59  TRP A N    2  
ATOM 2863  C CA   . TRP A 1 59  ? 5.119   -8.414  -3.575  1.00 0.00 ? 59  TRP A CA   2  
ATOM 2864  C C    . TRP A 1 59  ? 5.541   -8.773  -4.996  1.00 0.00 ? 59  TRP A C    2  
ATOM 2865  O O    . TRP A 1 59  ? 5.215   -9.849  -5.496  1.00 0.00 ? 59  TRP A O    2  
ATOM 2866  C CB   . TRP A 1 59  ? 4.065   -7.306  -3.607  1.00 0.00 ? 59  TRP A CB   2  
ATOM 2867  C CG   . TRP A 1 59  ? 2.776   -7.731  -4.242  1.00 0.00 ? 59  TRP A CG   2  
ATOM 2868  C CD1  . TRP A 1 59  ? 2.237   -7.253  -5.402  1.00 0.00 ? 59  TRP A CD1  2  
ATOM 2869  C CD2  . TRP A 1 59  ? 1.863   -8.719  -3.751  1.00 0.00 ? 59  TRP A CD2  2  
ATOM 2870  N NE1  . TRP A 1 59  ? 1.044   -7.883  -5.661  1.00 0.00 ? 59  TRP A NE1  2  
ATOM 2871  C CE2  . TRP A 1 59  ? 0.793   -8.788  -4.664  1.00 0.00 ? 59  TRP A CE2  2  
ATOM 2872  C CE3  . TRP A 1 59  ? 1.847   -9.553  -2.630  1.00 0.00 ? 59  TRP A CE3  2  
ATOM 2873  C CZ2  . TRP A 1 59  ? -0.280  -9.657  -4.487  1.00 0.00 ? 59  TRP A CZ2  2  
ATOM 2874  C CZ3  . TRP A 1 59  ? 0.781   -10.415 -2.456  1.00 0.00 ? 59  TRP A CZ3  2  
ATOM 2875  C CH2  . TRP A 1 59  ? -0.270  -10.462 -3.381  1.00 0.00 ? 59  TRP A CH2  2  
ATOM 2876  H H    . TRP A 1 59  ? 6.230   -7.146  -2.294  1.00 0.00 ? 59  TRP A H    2  
ATOM 2877  H HA   . TRP A 1 59  ? 4.694   -9.289  -3.106  1.00 0.00 ? 59  TRP A HA   2  
ATOM 2878  H HB2  . TRP A 1 59  ? 3.852   -6.992  -2.597  1.00 0.00 ? 59  TRP A HB2  2  
ATOM 2879  H HB3  . TRP A 1 59  ? 4.453   -6.467  -4.167  1.00 0.00 ? 59  TRP A HB3  2  
ATOM 2880  H HD1  . TRP A 1 59  ? 2.691   -6.489  -6.014  1.00 0.00 ? 59  TRP A HD1  2  
ATOM 2881  H HE1  . TRP A 1 59  ? 0.468   -7.714  -6.436  1.00 0.00 ? 59  TRP A HE1  2  
ATOM 2882  H HE3  . TRP A 1 59  ? 2.648   -9.531  -1.906  1.00 0.00 ? 59  TRP A HE3  2  
ATOM 2883  H HZ2  . TRP A 1 59  ? -1.098  -9.706  -5.192  1.00 0.00 ? 59  TRP A HZ2  2  
ATOM 2884  H HZ3  . TRP A 1 59  ? 0.751   -11.066 -1.595  1.00 0.00 ? 59  TRP A HZ3  2  
ATOM 2885  H HH2  . TRP A 1 59  ? -1.083  -11.150 -3.205  1.00 0.00 ? 59  TRP A HH2  2  
ATOM 2886  N N    . ALA A 1 60  ? 6.267   -7.866  -5.640  1.00 0.00 ? 60  ALA A N    2  
ATOM 2887  C CA   . ALA A 1 60  ? 6.735   -8.089  -7.003  1.00 0.00 ? 60  ALA A CA   2  
ATOM 2888  C C    . ALA A 1 60  ? 7.165   -9.537  -7.205  1.00 0.00 ? 60  ALA A C    2  
ATOM 2889  O O    . ALA A 1 60  ? 7.029   -10.090 -8.298  1.00 0.00 ? 60  ALA A O    2  
ATOM 2890  C CB   . ALA A 1 60  ? 7.883   -7.145  -7.328  1.00 0.00 ? 60  ALA A CB   2  
ATOM 2891  H H    . ALA A 1 60  ? 6.495   -7.027  -5.188  1.00 0.00 ? 60  ALA A H    2  
ATOM 2892  H HA   . ALA A 1 60  ? 5.919   -7.869  -7.676  1.00 0.00 ? 60  ALA A HA   2  
ATOM 2893  H HB1  . ALA A 1 60  ? 8.037   -6.468  -6.499  1.00 0.00 ? 60  ALA A HB1  2  
ATOM 2894  H HB2  . ALA A 1 60  ? 8.782   -7.717  -7.498  1.00 0.00 ? 60  ALA A HB2  2  
ATOM 2895  H HB3  . ALA A 1 60  ? 7.642   -6.578  -8.215  1.00 0.00 ? 60  ALA A HB3  2  
ATOM 2896  N N    . LEU A 1 61  ? 7.686   -10.148 -6.147  1.00 0.00 ? 61  LEU A N    2  
ATOM 2897  C CA   . LEU A 1 61  ? 8.138   -11.534 -6.208  1.00 0.00 ? 61  LEU A CA   2  
ATOM 2898  C C    . LEU A 1 61  ? 7.024   -12.489 -5.792  1.00 0.00 ? 61  LEU A C    2  
ATOM 2899  O O    . LEU A 1 61  ? 6.934   -13.610 -6.292  1.00 0.00 ? 61  LEU A O    2  
ATOM 2900  C CB   . LEU A 1 61  ? 9.359   -11.733 -5.309  1.00 0.00 ? 61  LEU A CB   2  
ATOM 2901  C CG   . LEU A 1 61  ? 10.635  -11.009 -5.739  1.00 0.00 ? 61  LEU A CG   2  
ATOM 2902  C CD1  . LEU A 1 61  ? 11.472  -10.637 -4.525  1.00 0.00 ? 61  LEU A CD1  2  
ATOM 2903  C CD2  . LEU A 1 61  ? 11.440  -11.871 -6.700  1.00 0.00 ? 61  LEU A CD2  2  
ATOM 2904  H H    . LEU A 1 61  ? 7.770   -9.657  -5.303  1.00 0.00 ? 61  LEU A H    2  
ATOM 2905  H HA   . LEU A 1 61  ? 8.415   -11.747 -7.230  1.00 0.00 ? 61  LEU A HA   2  
ATOM 2906  H HB2  . LEU A 1 61  ? 9.101   -11.389 -4.319  1.00 0.00 ? 61  LEU A HB2  2  
ATOM 2907  H HB3  . LEU A 1 61  ? 9.574   -12.792 -5.275  1.00 0.00 ? 61  LEU A HB3  2  
ATOM 2908  H HG   . LEU A 1 61  ? 10.367  -10.095 -6.251  1.00 0.00 ? 61  LEU A HG   2  
ATOM 2909  H HD11 . LEU A 1 61  ? 11.743  -11.532 -3.986  1.00 0.00 ? 61  LEU A HD11 2  
ATOM 2910  H HD12 . LEU A 1 61  ? 10.901  -9.986  -3.879  1.00 0.00 ? 61  LEU A HD12 2  
ATOM 2911  H HD13 . LEU A 1 61  ? 12.368  -10.126 -4.848  1.00 0.00 ? 61  LEU A HD13 2  
ATOM 2912  H HD21 . LEU A 1 61  ? 11.443  -12.892 -6.351  1.00 0.00 ? 61  LEU A HD21 2  
ATOM 2913  H HD22 . LEU A 1 61  ? 12.455  -11.504 -6.749  1.00 0.00 ? 61  LEU A HD22 2  
ATOM 2914  H HD23 . LEU A 1 61  ? 10.993  -11.827 -7.683  1.00 0.00 ? 61  LEU A HD23 2  
ATOM 2915  N N    . PHE A 1 62  ? 6.176   -12.036 -4.875  1.00 0.00 ? 62  PHE A N    2  
ATOM 2916  C CA   . PHE A 1 62  ? 5.066   -12.850 -4.392  1.00 0.00 ? 62  PHE A CA   2  
ATOM 2917  C C    . PHE A 1 62  ? 4.047   -13.094 -5.501  1.00 0.00 ? 62  PHE A C    2  
ATOM 2918  O O    . PHE A 1 62  ? 3.833   -14.230 -5.925  1.00 0.00 ? 62  PHE A O    2  
ATOM 2919  C CB   . PHE A 1 62  ? 4.387   -12.169 -3.201  1.00 0.00 ? 62  PHE A CB   2  
ATOM 2920  C CG   . PHE A 1 62  ? 3.208   -12.931 -2.667  1.00 0.00 ? 62  PHE A CG   2  
ATOM 2921  C CD1  . PHE A 1 62  ? 2.016   -12.972 -3.371  1.00 0.00 ? 62  PHE A CD1  2  
ATOM 2922  C CD2  . PHE A 1 62  ? 3.293   -13.608 -1.461  1.00 0.00 ? 62  PHE A CD2  2  
ATOM 2923  C CE1  . PHE A 1 62  ? 0.930   -13.672 -2.882  1.00 0.00 ? 62  PHE A CE1  2  
ATOM 2924  C CE2  . PHE A 1 62  ? 2.210   -14.310 -0.966  1.00 0.00 ? 62  PHE A CE2  2  
ATOM 2925  C CZ   . PHE A 1 62  ? 1.027   -14.343 -1.678  1.00 0.00 ? 62  PHE A CZ   2  
ATOM 2926  H H    . PHE A 1 62  ? 6.299   -11.133 -4.513  1.00 0.00 ? 62  PHE A H    2  
ATOM 2927  H HA   . PHE A 1 62  ? 5.467   -13.799 -4.072  1.00 0.00 ? 62  PHE A HA   2  
ATOM 2928  H HB2  . PHE A 1 62  ? 5.103   -12.062 -2.400  1.00 0.00 ? 62  PHE A HB2  2  
ATOM 2929  H HB3  . PHE A 1 62  ? 4.043   -11.192 -3.503  1.00 0.00 ? 62  PHE A HB3  2  
ATOM 2930  H HD1  . PHE A 1 62  ? 1.939   -12.449 -4.313  1.00 0.00 ? 62  PHE A HD1  2  
ATOM 2931  H HD2  . PHE A 1 62  ? 4.219   -13.583 -0.903  1.00 0.00 ? 62  PHE A HD2  2  
ATOM 2932  H HE1  . PHE A 1 62  ? 0.006   -13.696 -3.440  1.00 0.00 ? 62  PHE A HE1  2  
ATOM 2933  H HE2  . PHE A 1 62  ? 2.290   -14.833 -0.025  1.00 0.00 ? 62  PHE A HE2  2  
ATOM 2934  H HZ   . PHE A 1 62  ? 0.180   -14.890 -1.293  1.00 0.00 ? 62  PHE A HZ   2  
ATOM 2935  N N    . LYS A 1 63  ? 3.421   -12.019 -5.967  1.00 0.00 ? 63  LYS A N    2  
ATOM 2936  C CA   . LYS A 1 63  ? 2.424   -12.113 -7.028  1.00 0.00 ? 63  LYS A CA   2  
ATOM 2937  C C    . LYS A 1 63  ? 3.082   -12.023 -8.401  1.00 0.00 ? 63  LYS A C    2  
ATOM 2938  O O    . LYS A 1 63  ? 2.745   -12.779 -9.312  1.00 0.00 ? 63  LYS A O    2  
ATOM 2939  C CB   . LYS A 1 63  ? 1.381   -11.004 -6.876  1.00 0.00 ? 63  LYS A CB   2  
ATOM 2940  C CG   . LYS A 1 63  ? 0.046   -11.332 -7.521  1.00 0.00 ? 63  LYS A CG   2  
ATOM 2941  C CD   . LYS A 1 63  ? -0.857  -12.102 -6.573  1.00 0.00 ? 63  LYS A CD   2  
ATOM 2942  C CE   . LYS A 1 63  ? -0.369  -13.529 -6.374  1.00 0.00 ? 63  LYS A CE   2  
ATOM 2943  N NZ   . LYS A 1 63  ? -1.493  -14.467 -6.099  1.00 0.00 ? 63  LYS A NZ   2  
ATOM 2944  H H    . LYS A 1 63  ? 3.634   -11.140 -5.589  1.00 0.00 ? 63  LYS A H    2  
ATOM 2945  H HA   . LYS A 1 63  ? 1.935   -13.071 -6.938  1.00 0.00 ? 63  LYS A HA   2  
ATOM 2946  H HB2  . LYS A 1 63  ? 1.215   -10.824 -5.824  1.00 0.00 ? 63  LYS A HB2  2  
ATOM 2947  H HB3  . LYS A 1 63  ? 1.764   -10.102 -7.331  1.00 0.00 ? 63  LYS A HB3  2  
ATOM 2948  H HG2  . LYS A 1 63  ? -0.445  -10.412 -7.801  1.00 0.00 ? 63  LYS A HG2  2  
ATOM 2949  H HG3  . LYS A 1 63  ? 0.221   -11.931 -8.404  1.00 0.00 ? 63  LYS A HG3  2  
ATOM 2950  H HD2  . LYS A 1 63  ? -0.871  -11.602 -5.616  1.00 0.00 ? 63  LYS A HD2  2  
ATOM 2951  H HD3  . LYS A 1 63  ? -1.857  -12.127 -6.982  1.00 0.00 ? 63  LYS A HD3  2  
ATOM 2952  H HE2  . LYS A 1 63  ? 0.144   -13.848 -7.268  1.00 0.00 ? 63  LYS A HE2  2  
ATOM 2953  H HE3  . LYS A 1 63  ? 0.316   -13.548 -5.539  1.00 0.00 ? 63  LYS A HE3  2  
ATOM 2954  H HZ1  . LYS A 1 63  ? -2.157  -14.040 -5.421  1.00 0.00 ? 63  LYS A HZ1  2  
ATOM 2955  H HZ2  . LYS A 1 63  ? -1.129  -15.354 -5.698  1.00 0.00 ? 63  LYS A HZ2  2  
ATOM 2956  H HZ3  . LYS A 1 63  ? -2.004  -14.681 -6.979  1.00 0.00 ? 63  LYS A HZ3  2  
ATOM 2957  N N    . GLY A 1 64  ? 4.023   -11.095 -8.543  1.00 0.00 ? 64  GLY A N    2  
ATOM 2958  C CA   . GLY A 1 64  ? 4.713   -10.925 -9.808  1.00 0.00 ? 64  GLY A CA   2  
ATOM 2959  C C    . GLY A 1 64  ? 5.528   -12.144 -10.192 1.00 0.00 ? 64  GLY A C    2  
ATOM 2960  O O    . GLY A 1 64  ? 5.682   -12.450 -11.375 1.00 0.00 ? 64  GLY A O    2  
ATOM 2961  H H    . GLY A 1 64  ? 4.251   -10.521 -7.781  1.00 0.00 ? 64  GLY A H    2  
ATOM 2962  H HA2  . GLY A 1 64  ? 3.984   -10.734 -10.581 1.00 0.00 ? 64  GLY A HA2  2  
ATOM 2963  H HA3  . GLY A 1 64  ? 5.374   -10.074 -9.732  1.00 0.00 ? 64  GLY A HA3  2  
ATOM 2964  N N    . LYS A 1 65  ? 6.054   -12.842 -9.191  1.00 0.00 ? 65  LYS A N    2  
ATOM 2965  C CA   . LYS A 1 65  ? 6.859   -14.034 -9.429  1.00 0.00 ? 65  LYS A CA   2  
ATOM 2966  C C    . LYS A 1 65  ? 8.073   -13.708 -10.293 1.00 0.00 ? 65  LYS A C    2  
ATOM 2967  O O    . LYS A 1 65  ? 8.489   -14.514 -11.125 1.00 0.00 ? 65  LYS A O    2  
ATOM 2968  C CB   . LYS A 1 65  ? 6.015   -15.118 -10.104 1.00 0.00 ? 65  LYS A CB   2  
ATOM 2969  C CG   . LYS A 1 65  ? 5.305   -16.036 -9.124  1.00 0.00 ? 65  LYS A CG   2  
ATOM 2970  C CD   . LYS A 1 65  ? 3.953   -15.475 -8.714  1.00 0.00 ? 65  LYS A CD   2  
ATOM 2971  C CE   . LYS A 1 65  ? 2.887   -15.771 -9.758  1.00 0.00 ? 65  LYS A CE   2  
ATOM 2972  N NZ   . LYS A 1 65  ? 1.513   -15.627 -9.203  1.00 0.00 ? 65  LYS A NZ   2  
ATOM 2973  H H    . LYS A 1 65  ? 5.896   -12.548 -8.269  1.00 0.00 ? 65  LYS A H    2  
ATOM 2974  H HA   . LYS A 1 65  ? 7.200   -14.400 -8.472  1.00 0.00 ? 65  LYS A HA   2  
ATOM 2975  H HB2  . LYS A 1 65  ? 5.269   -14.642 -10.724 1.00 0.00 ? 65  LYS A HB2  2  
ATOM 2976  H HB3  . LYS A 1 65  ? 6.658   -15.721 -10.729 1.00 0.00 ? 65  LYS A HB3  2  
ATOM 2977  H HG2  . LYS A 1 65  ? 5.157   -16.999 -9.589  1.00 0.00 ? 65  LYS A HG2  2  
ATOM 2978  H HG3  . LYS A 1 65  ? 5.920   -16.150 -8.243  1.00 0.00 ? 65  LYS A HG3  2  
ATOM 2979  H HD2  . LYS A 1 65  ? 3.657   -15.923 -7.777  1.00 0.00 ? 65  LYS A HD2  2  
ATOM 2980  H HD3  . LYS A 1 65  ? 4.039   -14.405 -8.593  1.00 0.00 ? 65  LYS A HD3  2  
ATOM 2981  H HE2  . LYS A 1 65  ? 3.008   -15.084 -10.581 1.00 0.00 ? 65  LYS A HE2  2  
ATOM 2982  H HE3  . LYS A 1 65  ? 3.019   -16.783 -10.111 1.00 0.00 ? 65  LYS A HE3  2  
ATOM 2983  H HZ1  . LYS A 1 65  ? 1.089   -14.734 -9.528  1.00 0.00 ? 65  LYS A HZ1  2  
ATOM 2984  H HZ2  . LYS A 1 65  ? 1.545   -15.623 -8.164  1.00 0.00 ? 65  LYS A HZ2  2  
ATOM 2985  H HZ3  . LYS A 1 65  ? 0.915   -16.417 -9.519  1.00 0.00 ? 65  LYS A HZ3  2  
ATOM 2986  N N    . PHE A 1 66  ? 8.638   -12.523 -10.088 1.00 0.00 ? 66  PHE A N    2  
ATOM 2987  C CA   . PHE A 1 66  ? 9.805   -12.091 -10.848 1.00 0.00 ? 66  PHE A CA   2  
ATOM 2988  C C    . PHE A 1 66  ? 11.053  -12.849 -10.405 1.00 0.00 ? 66  PHE A C    2  
ATOM 2989  O O    . PHE A 1 66  ? 11.131  -13.331 -9.275  1.00 0.00 ? 66  PHE A O    2  
ATOM 2990  C CB   . PHE A 1 66  ? 10.021  -10.586 -10.679 1.00 0.00 ? 66  PHE A CB   2  
ATOM 2991  C CG   . PHE A 1 66  ? 11.460  -10.170 -10.796 1.00 0.00 ? 66  PHE A CG   2  
ATOM 2992  C CD1  . PHE A 1 66  ? 12.005  -9.852  -12.029 1.00 0.00 ? 66  PHE A CD1  2  
ATOM 2993  C CD2  . PHE A 1 66  ? 12.267  -10.098 -9.672  1.00 0.00 ? 66  PHE A CD2  2  
ATOM 2994  C CE1  . PHE A 1 66  ? 13.329  -9.470  -12.139 1.00 0.00 ? 66  PHE A CE1  2  
ATOM 2995  C CE2  . PHE A 1 66  ? 13.592  -9.717  -9.776  1.00 0.00 ? 66  PHE A CE2  2  
ATOM 2996  C CZ   . PHE A 1 66  ? 14.123  -9.401  -11.011 1.00 0.00 ? 66  PHE A CZ   2  
ATOM 2997  H H    . PHE A 1 66  ? 8.260   -11.924 -9.410  1.00 0.00 ? 66  PHE A H    2  
ATOM 2998  H HA   . PHE A 1 66  ? 9.619   -12.305 -11.889 1.00 0.00 ? 66  PHE A HA   2  
ATOM 2999  H HB2  . PHE A 1 66  ? 9.463   -10.061 -11.440 1.00 0.00 ? 66  PHE A HB2  2  
ATOM 3000  H HB3  . PHE A 1 66  ? 9.666   -10.286 -9.705  1.00 0.00 ? 66  PHE A HB3  2  
ATOM 3001  H HD1  . PHE A 1 66  ? 11.385  -9.904  -12.912 1.00 0.00 ? 66  PHE A HD1  2  
ATOM 3002  H HD2  . PHE A 1 66  ? 11.852  -10.345 -8.704  1.00 0.00 ? 66  PHE A HD2  2  
ATOM 3003  H HE1  . PHE A 1 66  ? 13.742  -9.223  -13.106 1.00 0.00 ? 66  PHE A HE1  2  
ATOM 3004  H HE2  . PHE A 1 66  ? 14.209  -9.664  -8.891  1.00 0.00 ? 66  PHE A HE2  2  
ATOM 3005  H HZ   . PHE A 1 66  ? 15.157  -9.103  -11.094 1.00 0.00 ? 66  PHE A HZ   2  
ATOM 3006  N N    . ARG A 1 67  ? 12.027  -12.950 -11.304 1.00 0.00 ? 67  ARG A N    2  
ATOM 3007  C CA   . ARG A 1 67  ? 13.271  -13.650 -11.008 1.00 0.00 ? 67  ARG A CA   2  
ATOM 3008  C C    . ARG A 1 67  ? 14.455  -12.688 -11.030 1.00 0.00 ? 67  ARG A C    2  
ATOM 3009  O O    . ARG A 1 67  ? 14.771  -12.102 -12.065 1.00 0.00 ? 67  ARG A O    2  
ATOM 3010  C CB   . ARG A 1 67  ? 13.498  -14.779 -12.015 1.00 0.00 ? 67  ARG A CB   2  
ATOM 3011  C CG   . ARG A 1 67  ? 14.252  -15.966 -11.439 1.00 0.00 ? 67  ARG A CG   2  
ATOM 3012  C CD   . ARG A 1 67  ? 13.796  -17.273 -12.067 1.00 0.00 ? 67  ARG A CD   2  
ATOM 3013  N NE   . ARG A 1 67  ? 12.340  -17.370 -12.134 1.00 0.00 ? 67  ARG A NE   2  
ATOM 3014  C CZ   . ARG A 1 67  ? 11.564  -17.520 -11.066 1.00 0.00 ? 67  ARG A CZ   2  
ATOM 3015  N NH1  . ARG A 1 67  ? 12.101  -17.590 -9.856  1.00 0.00 ? 67  ARG A NH1  2  
ATOM 3016  N NH2  . ARG A 1 67  ? 10.247  -17.600 -11.208 1.00 0.00 ? 67  ARG A NH2  2  
ATOM 3017  H H    . ARG A 1 67  ? 11.906  -12.544 -12.188 1.00 0.00 ? 67  ARG A H    2  
ATOM 3018  H HA   . ARG A 1 67  ? 13.185  -14.074 -10.019 1.00 0.00 ? 67  ARG A HA   2  
ATOM 3019  H HB2  . ARG A 1 67  ? 12.539  -15.127 -12.370 1.00 0.00 ? 67  ARG A HB2  2  
ATOM 3020  H HB3  . ARG A 1 67  ? 14.063  -14.391 -12.850 1.00 0.00 ? 67  ARG A HB3  2  
ATOM 3021  H HG2  . ARG A 1 67  ? 15.307  -15.837 -11.630 1.00 0.00 ? 67  ARG A HG2  2  
ATOM 3022  H HG3  . ARG A 1 67  ? 14.079  -16.008 -10.374 1.00 0.00 ? 67  ARG A HG3  2  
ATOM 3023  H HD2  . ARG A 1 67  ? 14.197  -17.336 -13.068 1.00 0.00 ? 67  ARG A HD2  2  
ATOM 3024  H HD3  . ARG A 1 67  ? 14.175  -18.093 -11.475 1.00 0.00 ? 67  ARG A HD3  2  
ATOM 3025  H HE   . ARG A 1 67  ? 11.922  -17.320 -13.018 1.00 0.00 ? 67  ARG A HE   2  
ATOM 3026  H HH11 . ARG A 1 67  ? 13.093  -17.529 -9.747  1.00 0.00 ? 67  ARG A HH11 2  
ATOM 3027  H HH12 . ARG A 1 67  ? 11.514  -17.702 -9.054  1.00 0.00 ? 67  ARG A HH12 2  
ATOM 3028  H HH21 . ARG A 1 67  ? 9.838   -17.547 -12.118 1.00 0.00 ? 67  ARG A HH21 2  
ATOM 3029  H HH22 . ARG A 1 67  ? 9.664   -17.713 -10.404 1.00 0.00 ? 67  ARG A HH22 2  
ATOM 3030  N N    . GLU A 1 68  ? 15.104  -12.529 -9.881  1.00 0.00 ? 68  GLU A N    2  
ATOM 3031  C CA   . GLU A 1 68  ? 16.252  -11.637 -9.769  1.00 0.00 ? 68  GLU A CA   2  
ATOM 3032  C C    . GLU A 1 68  ? 17.450  -12.193 -10.533 1.00 0.00 ? 68  GLU A C    2  
ATOM 3033  O O    . GLU A 1 68  ? 17.628  -13.407 -10.633 1.00 0.00 ? 68  GLU A O    2  
ATOM 3034  C CB   . GLU A 1 68  ? 16.623  -11.428 -8.299  1.00 0.00 ? 68  GLU A CB   2  
ATOM 3035  C CG   . GLU A 1 68  ? 17.302  -10.097 -8.026  1.00 0.00 ? 68  GLU A CG   2  
ATOM 3036  C CD   . GLU A 1 68  ? 16.620  -8.939  -8.729  1.00 0.00 ? 68  GLU A CD   2  
ATOM 3037  O OE1  . GLU A 1 68  ? 16.958  -8.673  -9.901  1.00 0.00 ? 68  GLU A OE1  2  
ATOM 3038  O OE2  . GLU A 1 68  ? 15.747  -8.299  -8.105  1.00 0.00 ? 68  GLU A OE2  2  
ATOM 3039  H H    . GLU A 1 68  ? 14.804  -13.024 -9.090  1.00 0.00 ? 68  GLU A H    2  
ATOM 3040  H HA   . GLU A 1 68  ? 15.976  -10.686 -10.199 1.00 0.00 ? 68  GLU A HA   2  
ATOM 3041  H HB2  . GLU A 1 68  ? 15.724  -11.480 -7.703  1.00 0.00 ? 68  GLU A HB2  2  
ATOM 3042  H HB3  . GLU A 1 68  ? 17.292  -12.219 -7.994  1.00 0.00 ? 68  GLU A HB3  2  
ATOM 3043  H HG2  . GLU A 1 68  ? 17.287  -9.911  -6.963  1.00 0.00 ? 68  GLU A HG2  2  
ATOM 3044  H HG3  . GLU A 1 68  ? 18.325  -10.153 -8.366  1.00 0.00 ? 68  GLU A HG3  2  
ATOM 3045  N N    . GLY A 1 69  ? 18.269  -11.296 -11.073 1.00 0.00 ? 69  GLY A N    2  
ATOM 3046  C CA   . GLY A 1 69  ? 19.439  -11.715 -11.822 1.00 0.00 ? 69  GLY A CA   2  
ATOM 3047  C C    . GLY A 1 69  ? 19.141  -11.926 -13.293 1.00 0.00 ? 69  GLY A C    2  
ATOM 3048  O O    . GLY A 1 69  ? 19.932  -11.541 -14.155 1.00 0.00 ? 69  GLY A O    2  
ATOM 3049  H H    . GLY A 1 69  ? 18.077  -10.341 -10.961 1.00 0.00 ? 69  GLY A H    2  
ATOM 3050  H HA2  . GLY A 1 69  ? 20.205  -10.960 -11.725 1.00 0.00 ? 69  GLY A HA2  2  
ATOM 3051  H HA3  . GLY A 1 69  ? 19.806  -12.641 -11.405 1.00 0.00 ? 69  GLY A HA3  2  
ATOM 3052  N N    . ILE A 1 70  ? 17.998  -12.540 -13.581 1.00 0.00 ? 70  ILE A N    2  
ATOM 3053  C CA   . ILE A 1 70  ? 17.599  -12.801 -14.959 1.00 0.00 ? 70  ILE A CA   2  
ATOM 3054  C C    . ILE A 1 70  ? 16.892  -11.594 -15.565 1.00 0.00 ? 70  ILE A C    2  
ATOM 3055  O O    . ILE A 1 70  ? 17.376  -10.995 -16.525 1.00 0.00 ? 70  ILE A O    2  
ATOM 3056  C CB   . ILE A 1 70  ? 16.670  -14.026 -15.052 1.00 0.00 ? 70  ILE A CB   2  
ATOM 3057  C CG1  . ILE A 1 70  ? 17.375  -15.270 -14.507 1.00 0.00 ? 70  ILE A CG1  2  
ATOM 3058  C CG2  . ILE A 1 70  ? 16.230  -14.248 -16.492 1.00 0.00 ? 70  ILE A CG2  2  
ATOM 3059  C CD1  . ILE A 1 70  ? 16.439  -16.432 -14.254 1.00 0.00 ? 70  ILE A CD1  2  
ATOM 3060  H H    . ILE A 1 70  ? 17.410  -12.822 -12.851 1.00 0.00 ? 70  ILE A H    2  
ATOM 3061  H HA   . ILE A 1 70  ? 18.492  -13.007 -15.531 1.00 0.00 ? 70  ILE A HA   2  
ATOM 3062  H HB   . ILE A 1 70  ? 15.791  -13.830 -14.459 1.00 0.00 ? 70  ILE A HB   2  
ATOM 3063  H HG12 . ILE A 1 70  ? 18.121  -15.594 -15.215 1.00 0.00 ? 70  ILE A HG12 2  
ATOM 3064  H HG13 . ILE A 1 70  ? 17.856  -15.021 -13.572 1.00 0.00 ? 70  ILE A HG13 2  
ATOM 3065  H HG21 . ILE A 1 70  ? 16.456  -15.263 -16.785 1.00 0.00 ? 70  ILE A HG21 2  
ATOM 3066  H HG22 . ILE A 1 70  ? 15.167  -14.080 -16.572 1.00 0.00 ? 70  ILE A HG22 2  
ATOM 3067  H HG23 . ILE A 1 70  ? 16.754  -13.561 -17.139 1.00 0.00 ? 70  ILE A HG23 2  
ATOM 3068  H HD11 . ILE A 1 70  ? 15.510  -16.065 -13.844 1.00 0.00 ? 70  ILE A HD11 2  
ATOM 3069  H HD12 . ILE A 1 70  ? 16.246  -16.947 -15.183 1.00 0.00 ? 70  ILE A HD12 2  
ATOM 3070  H HD13 . ILE A 1 70  ? 16.896  -17.115 -13.552 1.00 0.00 ? 70  ILE A HD13 2  
ATOM 3071  N N    . ASP A 1 71  ? 15.745  -11.240 -14.995 1.00 0.00 ? 71  ASP A N    2  
ATOM 3072  C CA   . ASP A 1 71  ? 14.971  -10.101 -15.477 1.00 0.00 ? 71  ASP A CA   2  
ATOM 3073  C C    . ASP A 1 71  ? 15.430  -8.810  -14.807 1.00 0.00 ? 71  ASP A C    2  
ATOM 3074  O O    . ASP A 1 71  ? 15.850  -8.813  -13.650 1.00 0.00 ? 71  ASP A O    2  
ATOM 3075  C CB   . ASP A 1 71  ? 13.481  -10.323 -15.217 1.00 0.00 ? 71  ASP A CB   2  
ATOM 3076  C CG   . ASP A 1 71  ? 12.811  -11.111 -16.326 1.00 0.00 ? 71  ASP A CG   2  
ATOM 3077  O OD1  . ASP A 1 71  ? 12.439  -10.499 -17.349 1.00 0.00 ? 71  ASP A OD1  2  
ATOM 3078  O OD2  . ASP A 1 71  ? 12.659  -12.341 -16.171 1.00 0.00 ? 71  ASP A OD2  2  
ATOM 3079  H H    . ASP A 1 71  ? 15.410  -11.756 -14.232 1.00 0.00 ? 71  ASP A H    2  
ATOM 3080  H HA   . ASP A 1 71  ? 15.133  -10.017 -16.541 1.00 0.00 ? 71  ASP A HA   2  
ATOM 3081  H HB2  . ASP A 1 71  ? 13.360  -10.867 -14.291 1.00 0.00 ? 71  ASP A HB2  2  
ATOM 3082  H HB3  . ASP A 1 71  ? 12.990  -9.365  -15.134 1.00 0.00 ? 71  ASP A HB3  2  
ATOM 3083  N N    . LYS A 1 72  ? 15.349  -7.706  -15.543 1.00 0.00 ? 72  LYS A N    2  
ATOM 3084  C CA   . LYS A 1 72  ? 15.755  -6.407  -15.022 1.00 0.00 ? 72  LYS A CA   2  
ATOM 3085  C C    . LYS A 1 72  ? 14.705  -5.851  -14.065 1.00 0.00 ? 72  LYS A C    2  
ATOM 3086  O O    . LYS A 1 72  ? 13.537  -5.682  -14.418 1.00 0.00 ? 72  LYS A O    2  
ATOM 3087  C CB   . LYS A 1 72  ? 15.986  -5.423  -16.170 1.00 0.00 ? 72  LYS A CB   2  
ATOM 3088  C CG   . LYS A 1 72  ? 17.005  -4.343  -15.851 1.00 0.00 ? 72  LYS A CG   2  
ATOM 3089  C CD   . LYS A 1 72  ? 18.423  -4.888  -15.884 1.00 0.00 ? 72  LYS A CD   2  
ATOM 3090  C CE   . LYS A 1 72  ? 19.429  -3.803  -16.238 1.00 0.00 ? 72  LYS A CE   2  
ATOM 3091  N NZ   . LYS A 1 72  ? 20.832  -4.259  -16.032 1.00 0.00 ? 72  LYS A NZ   2  
ATOM 3092  H H    . LYS A 1 72  ? 15.006  -7.768  -16.460 1.00 0.00 ? 72  LYS A H    2  
ATOM 3093  H HA   . LYS A 1 72  ? 16.681  -6.541  -14.482 1.00 0.00 ? 72  LYS A HA   2  
ATOM 3094  H HB2  . LYS A 1 72  ? 16.331  -5.971  -17.034 1.00 0.00 ? 72  LYS A HB2  2  
ATOM 3095  H HB3  . LYS A 1 72  ? 15.048  -4.943  -16.411 1.00 0.00 ? 72  LYS A HB3  2  
ATOM 3096  H HG2  . LYS A 1 72  ? 16.919  -3.551  -16.581 1.00 0.00 ? 72  LYS A HG2  2  
ATOM 3097  H HG3  . LYS A 1 72  ? 16.803  -3.950  -14.865 1.00 0.00 ? 72  LYS A HG3  2  
ATOM 3098  H HD2  . LYS A 1 72  ? 18.669  -5.287  -14.911 1.00 0.00 ? 72  LYS A HD2  2  
ATOM 3099  H HD3  . LYS A 1 72  ? 18.480  -5.675  -16.623 1.00 0.00 ? 72  LYS A HD3  2  
ATOM 3100  H HE2  . LYS A 1 72  ? 19.297  -3.532  -17.273 1.00 0.00 ? 72  LYS A HE2  2  
ATOM 3101  H HE3  . LYS A 1 72  ? 19.244  -2.942  -15.613 1.00 0.00 ? 72  LYS A HE3  2  
ATOM 3102  H HZ1  . LYS A 1 72  ? 20.898  -4.832  -15.166 1.00 0.00 ? 72  LYS A HZ1  2  
ATOM 3103  H HZ2  . LYS A 1 72  ? 21.465  -3.439  -15.940 1.00 0.00 ? 72  LYS A HZ2  2  
ATOM 3104  H HZ3  . LYS A 1 72  ? 21.143  -4.835  -16.840 1.00 0.00 ? 72  LYS A HZ3  2  
ATOM 3105  N N    . PRO A 1 73  ? 15.126  -5.560  -12.826 1.00 0.00 ? 73  PRO A N    2  
ATOM 3106  C CA   . PRO A 1 73  ? 14.237  -5.017  -11.795 1.00 0.00 ? 73  PRO A CA   2  
ATOM 3107  C C    . PRO A 1 73  ? 13.811  -3.584  -12.093 1.00 0.00 ? 73  PRO A C    2  
ATOM 3108  O O    . PRO A 1 73  ? 14.560  -2.816  -12.696 1.00 0.00 ? 73  PRO A O    2  
ATOM 3109  C CB   . PRO A 1 73  ? 15.093  -5.067  -10.526 1.00 0.00 ? 73  PRO A CB   2  
ATOM 3110  C CG   . PRO A 1 73  ? 16.499  -5.017  -11.016 1.00 0.00 ? 73  PRO A CG   2  
ATOM 3111  C CD   . PRO A 1 73  ? 16.504  -5.736  -12.336 1.00 0.00 ? 73  PRO A CD   2  
ATOM 3112  H HA   . PRO A 1 73  ? 13.359  -5.633  -11.663 1.00 0.00 ? 73  PRO A HA   2  
ATOM 3113  H HB2  . PRO A 1 73  ? 14.861  -4.218  -9.899  1.00 0.00 ? 73  PRO A HB2  2  
ATOM 3114  H HB3  . PRO A 1 73  ? 14.894  -5.983  -9.990  1.00 0.00 ? 73  PRO A HB3  2  
ATOM 3115  H HG2  . PRO A 1 73  ? 16.806  -3.991  -11.147 1.00 0.00 ? 73  PRO A HG2  2  
ATOM 3116  H HG3  . PRO A 1 73  ? 17.149  -5.518  -10.314 1.00 0.00 ? 73  PRO A HG3  2  
ATOM 3117  H HD2  . PRO A 1 73  ? 17.214  -5.282  -13.011 1.00 0.00 ? 73  PRO A HD2  2  
ATOM 3118  H HD3  . PRO A 1 73  ? 16.731  -6.783  -12.195 1.00 0.00 ? 73  PRO A HD3  2  
ATOM 3119  N N    . ASP A 1 74  ? 12.603  -3.230  -11.666 1.00 0.00 ? 74  ASP A N    2  
ATOM 3120  C CA   . ASP A 1 74  ? 12.078  -1.887  -11.886 1.00 0.00 ? 74  ASP A CA   2  
ATOM 3121  C C    . ASP A 1 74  ? 11.039  -1.530  -10.827 1.00 0.00 ? 74  ASP A C    2  
ATOM 3122  O O    . ASP A 1 74  ? 9.887   -1.963  -10.881 1.00 0.00 ? 74  ASP A O    2  
ATOM 3123  C CB   . ASP A 1 74  ? 11.460  -1.781  -13.281 1.00 0.00 ? 74  ASP A CB   2  
ATOM 3124  C CG   . ASP A 1 74  ? 11.229  -0.343  -13.703 1.00 0.00 ? 74  ASP A CG   2  
ATOM 3125  O OD1  . ASP A 1 74  ? 12.099  0.507   -13.418 1.00 0.00 ? 74  ASP A OD1  2  
ATOM 3126  O OD2  . ASP A 1 74  ? 10.179  -0.068  -14.320 1.00 0.00 ? 74  ASP A OD2  2  
ATOM 3127  H H    . ASP A 1 74  ? 12.053  -3.887  -11.190 1.00 0.00 ? 74  ASP A H    2  
ATOM 3128  H HA   . ASP A 1 74  ? 12.901  -1.193  -11.813 1.00 0.00 ? 74  ASP A HA   2  
ATOM 3129  H HB2  . ASP A 1 74  ? 12.122  -2.245  -13.997 1.00 0.00 ? 74  ASP A HB2  2  
ATOM 3130  H HB3  . ASP A 1 74  ? 10.511  -2.296  -13.287 1.00 0.00 ? 74  ASP A HB3  2  
ATOM 3131  N N    . PRO A 1 75  ? 11.453  -0.723  -9.840  1.00 0.00 ? 75  PRO A N    2  
ATOM 3132  C CA   . PRO A 1 75  ? 10.574  -0.290  -8.749  1.00 0.00 ? 75  PRO A CA   2  
ATOM 3133  C C    . PRO A 1 75  ? 9.229   0.220   -9.256  1.00 0.00 ? 75  PRO A C    2  
ATOM 3134  O O    . PRO A 1 75  ? 8.172   -0.092  -8.707  1.00 0.00 ? 75  PRO A O    2  
ATOM 3135  C CB   . PRO A 1 75  ? 11.361  0.844   -8.088  1.00 0.00 ? 75  PRO A CB   2  
ATOM 3136  C CG   . PRO A 1 75  ? 12.787  0.545   -8.395  1.00 0.00 ? 75  PRO A CG   2  
ATOM 3137  C CD   . PRO A 1 75  ? 12.811  -0.169  -9.712  1.00 0.00 ? 75  PRO A CD   2  
ATOM 3138  H HA   . PRO A 1 75  ? 10.410  -1.083  -8.034  1.00 0.00 ? 75  PRO A HA   2  
ATOM 3139  H HB2  . PRO A 1 75  ? 11.055  1.791   -8.509  1.00 0.00 ? 75  PRO A HB2  2  
ATOM 3140  H HB3  . PRO A 1 75  ? 11.177  0.841   -7.024  1.00 0.00 ? 75  PRO A HB3  2  
ATOM 3141  H HG2  . PRO A 1 75  ? 13.348  1.464   -8.466  1.00 0.00 ? 75  PRO A HG2  2  
ATOM 3142  H HG3  . PRO A 1 75  ? 13.202  -0.091  -7.627  1.00 0.00 ? 75  PRO A HG3  2  
ATOM 3143  H HD2  . PRO A 1 75  ? 13.021  0.528   -10.510 1.00 0.00 ? 75  PRO A HD2  2  
ATOM 3144  H HD3  . PRO A 1 75  ? 13.549  -0.958  -9.695  1.00 0.00 ? 75  PRO A HD3  2  
ATOM 3145  N N    . PRO A 1 76  ? 9.267   1.023   -10.330 1.00 0.00 ? 76  PRO A N    2  
ATOM 3146  C CA   . PRO A 1 76  ? 8.059   1.592   -10.935 1.00 0.00 ? 76  PRO A CA   2  
ATOM 3147  C C    . PRO A 1 76  ? 6.972   0.545   -11.155 1.00 0.00 ? 76  PRO A C    2  
ATOM 3148  O O    . PRO A 1 76  ? 5.796   0.789   -10.882 1.00 0.00 ? 76  PRO A O    2  
ATOM 3149  C CB   . PRO A 1 76  ? 8.557   2.135   -12.277 1.00 0.00 ? 76  PRO A CB   2  
ATOM 3150  C CG   . PRO A 1 76  ? 10.003  2.416   -12.059 1.00 0.00 ? 76  PRO A CG   2  
ATOM 3151  C CD   . PRO A 1 76  ? 10.491  1.436   -11.036 1.00 0.00 ? 76  PRO A CD   2  
ATOM 3152  H HA   . PRO A 1 76  ? 7.662   2.403   -10.342 1.00 0.00 ? 76  PRO A HA   2  
ATOM 3153  H HB2  . PRO A 1 76  ? 8.410   1.390   -13.047 1.00 0.00 ? 76  PRO A HB2  2  
ATOM 3154  H HB3  . PRO A 1 76  ? 8.014   3.033   -12.530 1.00 0.00 ? 76  PRO A HB3  2  
ATOM 3155  H HG2  . PRO A 1 76  ? 10.547  2.283   -12.982 1.00 0.00 ? 76  PRO A HG2  2  
ATOM 3156  H HG3  . PRO A 1 76  ? 10.129  3.423   -11.689 1.00 0.00 ? 76  PRO A HG3  2  
ATOM 3157  H HD2  . PRO A 1 76  ? 10.960  0.593   -11.522 1.00 0.00 ? 76  PRO A HD2  2  
ATOM 3158  H HD3  . PRO A 1 76  ? 11.182  1.917   -10.359 1.00 0.00 ? 76  PRO A HD3  2  
ATOM 3159  N N    . THR A 1 77  ? 7.372   -0.622  -11.649 1.00 0.00 ? 77  THR A N    2  
ATOM 3160  C CA   . THR A 1 77  ? 6.431   -1.706  -11.906 1.00 0.00 ? 77  THR A CA   2  
ATOM 3161  C C    . THR A 1 77  ? 5.877   -2.272  -10.603 1.00 0.00 ? 77  THR A C    2  
ATOM 3162  O O    . THR A 1 77  ? 4.673   -2.497  -10.477 1.00 0.00 ? 77  THR A O    2  
ATOM 3163  C CB   . THR A 1 77  ? 7.091   -2.844  -12.707 1.00 0.00 ? 77  THR A CB   2  
ATOM 3164  O OG1  . THR A 1 77  ? 7.614   -2.336  -13.940 1.00 0.00 ? 77  THR A OG1  2  
ATOM 3165  C CG2  . THR A 1 77  ? 6.091   -3.954  -12.994 1.00 0.00 ? 77  THR A CG2  2  
ATOM 3166  H H    . THR A 1 77  ? 8.322   -0.756  -11.846 1.00 0.00 ? 77  THR A H    2  
ATOM 3167  H HA   . THR A 1 77  ? 5.615   -1.308  -12.491 1.00 0.00 ? 77  THR A HA   2  
ATOM 3168  H HB   . THR A 1 77  ? 7.902   -3.253  -12.122 1.00 0.00 ? 77  THR A HB   2  
ATOM 3169  H HG1  . THR A 1 77  ? 7.549   -3.012  -14.618 1.00 0.00 ? 77  THR A HG1  2  
ATOM 3170  H HG21 . THR A 1 77  ? 6.466   -4.887  -12.600 1.00 0.00 ? 77  THR A HG21 2  
ATOM 3171  H HG22 . THR A 1 77  ? 5.950   -4.044  -14.061 1.00 0.00 ? 77  THR A HG22 2  
ATOM 3172  H HG23 . THR A 1 77  ? 5.148   -3.718  -12.525 1.00 0.00 ? 77  THR A HG23 2  
ATOM 3173  N N    . TRP A 1 78  ? 6.761   -2.500  -9.639  1.00 0.00 ? 78  TRP A N    2  
ATOM 3174  C CA   . TRP A 1 78  ? 6.358   -3.039  -8.345  1.00 0.00 ? 78  TRP A CA   2  
ATOM 3175  C C    . TRP A 1 78  ? 5.430   -2.073  -7.617  1.00 0.00 ? 78  TRP A C    2  
ATOM 3176  O O    . TRP A 1 78  ? 4.298   -2.420  -7.278  1.00 0.00 ? 78  TRP A O    2  
ATOM 3177  C CB   . TRP A 1 78  ? 7.589   -3.329  -7.485  1.00 0.00 ? 78  TRP A CB   2  
ATOM 3178  C CG   . TRP A 1 78  ? 8.716   -3.952  -8.252  1.00 0.00 ? 78  TRP A CG   2  
ATOM 3179  C CD1  . TRP A 1 78  ? 8.614   -4.759  -9.349  1.00 0.00 ? 78  TRP A CD1  2  
ATOM 3180  C CD2  . TRP A 1 78  ? 10.115  -3.821  -7.977  1.00 0.00 ? 78  TRP A CD2  2  
ATOM 3181  N NE1  . TRP A 1 78  ? 9.865   -5.137  -9.773  1.00 0.00 ? 78  TRP A NE1  2  
ATOM 3182  C CE2  . TRP A 1 78  ? 10.803  -4.574  -8.948  1.00 0.00 ? 78  TRP A CE2  2  
ATOM 3183  C CE3  . TRP A 1 78  ? 10.854  -3.140  -7.006  1.00 0.00 ? 78  TRP A CE3  2  
ATOM 3184  C CZ2  . TRP A 1 78  ? 12.192  -4.664  -8.974  1.00 0.00 ? 78  TRP A CZ2  2  
ATOM 3185  C CZ3  . TRP A 1 78  ? 12.232  -3.230  -7.033  1.00 0.00 ? 78  TRP A CZ3  2  
ATOM 3186  C CH2  . TRP A 1 78  ? 12.890  -3.987  -8.012  1.00 0.00 ? 78  TRP A CH2  2  
ATOM 3187  H H    . TRP A 1 78  ? 7.707   -2.300  -9.800  1.00 0.00 ? 78  TRP A H    2  
ATOM 3188  H HA   . TRP A 1 78  ? 5.828   -3.964  -8.523  1.00 0.00 ? 78  TRP A HA   2  
ATOM 3189  H HB2  . TRP A 1 78  ? 7.948   -2.405  -7.057  1.00 0.00 ? 78  TRP A HB2  2  
ATOM 3190  H HB3  . TRP A 1 78  ? 7.312   -4.006  -6.689  1.00 0.00 ? 78  TRP A HB3  2  
ATOM 3191  H HD1  . TRP A 1 78  ? 7.680   -5.050  -9.805  1.00 0.00 ? 78  TRP A HD1  2  
ATOM 3192  H HE1  . TRP A 1 78  ? 10.054  -5.714  -10.542 1.00 0.00 ? 78  TRP A HE1  2  
ATOM 3193  H HE3  . TRP A 1 78  ? 10.365  -2.551  -6.243  1.00 0.00 ? 78  TRP A HE3  2  
ATOM 3194  H HZ2  . TRP A 1 78  ? 12.714  -5.243  -9.723  1.00 0.00 ? 78  TRP A HZ2  2  
ATOM 3195  H HZ3  . TRP A 1 78  ? 12.820  -2.710  -6.290  1.00 0.00 ? 78  TRP A HZ3  2  
ATOM 3196  H HH2  . TRP A 1 78  ? 13.968  -4.029  -7.994  1.00 0.00 ? 78  TRP A HH2  2  
ATOM 3197  N N    . LYS A 1 79  ? 5.915   -0.859  -7.379  1.00 0.00 ? 79  LYS A N    2  
ATOM 3198  C CA   . LYS A 1 79  ? 5.129   0.158   -6.693  1.00 0.00 ? 79  LYS A CA   2  
ATOM 3199  C C    . LYS A 1 79  ? 3.684   0.151   -7.182  1.00 0.00 ? 79  LYS A C    2  
ATOM 3200  O O    . LYS A 1 79  ? 2.748   0.256   -6.388  1.00 0.00 ? 79  LYS A O    2  
ATOM 3201  C CB   . LYS A 1 79  ? 5.745   1.542   -6.911  1.00 0.00 ? 79  LYS A CB   2  
ATOM 3202  C CG   . LYS A 1 79  ? 5.457   2.520   -5.785  1.00 0.00 ? 79  LYS A CG   2  
ATOM 3203  C CD   . LYS A 1 79  ? 6.219   3.822   -5.970  1.00 0.00 ? 79  LYS A CD   2  
ATOM 3204  C CE   . LYS A 1 79  ? 6.488   4.505   -4.638  1.00 0.00 ? 79  LYS A CE   2  
ATOM 3205  N NZ   . LYS A 1 79  ? 7.551   3.807   -3.863  1.00 0.00 ? 79  LYS A NZ   2  
ATOM 3206  H H    . LYS A 1 79  ? 6.825   -0.642  -7.674  1.00 0.00 ? 79  LYS A H    2  
ATOM 3207  H HA   . LYS A 1 79  ? 5.140   -0.069  -5.638  1.00 0.00 ? 79  LYS A HA   2  
ATOM 3208  H HB2  . LYS A 1 79  ? 6.816   1.435   -7.002  1.00 0.00 ? 79  LYS A HB2  2  
ATOM 3209  H HB3  . LYS A 1 79  ? 5.354   1.956   -7.829  1.00 0.00 ? 79  LYS A HB3  2  
ATOM 3210  H HG2  . LYS A 1 79  ? 4.399   2.734   -5.768  1.00 0.00 ? 79  LYS A HG2  2  
ATOM 3211  H HG3  . LYS A 1 79  ? 5.752   2.072   -4.847  1.00 0.00 ? 79  LYS A HG3  2  
ATOM 3212  H HD2  . LYS A 1 79  ? 7.162   3.613   -6.452  1.00 0.00 ? 79  LYS A HD2  2  
ATOM 3213  H HD3  . LYS A 1 79  ? 5.634   4.485   -6.593  1.00 0.00 ? 79  LYS A HD3  2  
ATOM 3214  H HE2  . LYS A 1 79  ? 6.799   5.521   -4.825  1.00 0.00 ? 79  LYS A HE2  2  
ATOM 3215  H HE3  . LYS A 1 79  ? 5.576   4.508   -4.059  1.00 0.00 ? 79  LYS A HE3  2  
ATOM 3216  H HZ1  . LYS A 1 79  ? 8.401   3.688   -4.450  1.00 0.00 ? 79  LYS A HZ1  2  
ATOM 3217  H HZ2  . LYS A 1 79  ? 7.217   2.870   -3.561  1.00 0.00 ? 79  LYS A HZ2  2  
ATOM 3218  H HZ3  . LYS A 1 79  ? 7.801   4.362   -3.019  1.00 0.00 ? 79  LYS A HZ3  2  
ATOM 3219  N N    . THR A 1 80  ? 3.508   0.026   -8.493  1.00 0.00 ? 80  THR A N    2  
ATOM 3220  C CA   . THR A 1 80  ? 2.178   0.005   -9.088  1.00 0.00 ? 80  THR A CA   2  
ATOM 3221  C C    . THR A 1 80  ? 1.500   -1.344  -8.872  1.00 0.00 ? 80  THR A C    2  
ATOM 3222  O O    . THR A 1 80  ? 0.377   -1.412  -8.372  1.00 0.00 ? 80  THR A O    2  
ATOM 3223  C CB   . THR A 1 80  ? 2.232   0.303   -10.598 1.00 0.00 ? 80  THR A CB   2  
ATOM 3224  O OG1  . THR A 1 80  ? 2.816   1.591   -10.823 1.00 0.00 ? 80  THR A OG1  2  
ATOM 3225  C CG2  . THR A 1 80  ? 0.840   0.258   -11.209 1.00 0.00 ? 80  THR A CG2  2  
ATOM 3226  H H    . THR A 1 80  ? 4.293   -0.053  -9.074  1.00 0.00 ? 80  THR A H    2  
ATOM 3227  H HA   . THR A 1 80  ? 1.587   0.774   -8.611  1.00 0.00 ? 80  THR A HA   2  
ATOM 3228  H HB   . THR A 1 80  ? 2.843   -0.450  -11.076 1.00 0.00 ? 80  THR A HB   2  
ATOM 3229  H HG1  . THR A 1 80  ? 2.122   2.251   -10.886 1.00 0.00 ? 80  THR A HG1  2  
ATOM 3230  H HG21 . THR A 1 80  ? 0.818   -0.473  -12.003 1.00 0.00 ? 80  THR A HG21 2  
ATOM 3231  H HG22 . THR A 1 80  ? 0.591   1.230   -11.608 1.00 0.00 ? 80  THR A HG22 2  
ATOM 3232  H HG23 . THR A 1 80  ? 0.122   -0.014  -10.450 1.00 0.00 ? 80  THR A HG23 2  
ATOM 3233  N N    . ARG A 1 81  ? 2.190   -2.415  -9.250  1.00 0.00 ? 81  ARG A N    2  
ATOM 3234  C CA   . ARG A 1 81  ? 1.654   -3.762  -9.097  1.00 0.00 ? 81  ARG A CA   2  
ATOM 3235  C C    . ARG A 1 81  ? 0.793   -3.865  -7.842  1.00 0.00 ? 81  ARG A C    2  
ATOM 3236  O O    . ARG A 1 81  ? -0.237  -4.542  -7.837  1.00 0.00 ? 81  ARG A O    2  
ATOM 3237  C CB   . ARG A 1 81  ? 2.792   -4.782  -9.033  1.00 0.00 ? 81  ARG A CB   2  
ATOM 3238  C CG   . ARG A 1 81  ? 3.328   -5.184  -10.397 1.00 0.00 ? 81  ARG A CG   2  
ATOM 3239  C CD   . ARG A 1 81  ? 2.462   -6.254  -11.043 1.00 0.00 ? 81  ARG A CD   2  
ATOM 3240  N NE   . ARG A 1 81  ? 1.179   -5.721  -11.495 1.00 0.00 ? 81  ARG A NE   2  
ATOM 3241  C CZ   . ARG A 1 81  ? 0.030   -5.937  -10.865 1.00 0.00 ? 81  ARG A CZ   2  
ATOM 3242  N NH1  . ARG A 1 81  ? 0.003   -6.671  -9.762  1.00 0.00 ? 81  ARG A NH1  2  
ATOM 3243  N NH2  . ARG A 1 81  ? -1.095  -5.418  -11.339 1.00 0.00 ? 81  ARG A NH2  2  
ATOM 3244  H H    . ARG A 1 81  ? 3.081   -2.296  -9.642  1.00 0.00 ? 81  ARG A H    2  
ATOM 3245  H HA   . ARG A 1 81  ? 1.041   -3.974  -9.960  1.00 0.00 ? 81  ARG A HA   2  
ATOM 3246  H HB2  . ARG A 1 81  ? 3.606   -4.361  -8.461  1.00 0.00 ? 81  ARG A HB2  2  
ATOM 3247  H HB3  . ARG A 1 81  ? 2.435   -5.671  -8.535  1.00 0.00 ? 81  ARG A HB3  2  
ATOM 3248  H HG2  . ARG A 1 81  ? 3.344   -4.315  -11.038 1.00 0.00 ? 81  ARG A HG2  2  
ATOM 3249  H HG3  . ARG A 1 81  ? 4.331   -5.566  -10.281 1.00 0.00 ? 81  ARG A HG3  2  
ATOM 3250  H HD2  . ARG A 1 81  ? 2.990   -6.663  -11.891 1.00 0.00 ? 81  ARG A HD2  2  
ATOM 3251  H HD3  . ARG A 1 81  ? 2.281   -7.036  -10.320 1.00 0.00 ? 81  ARG A HD3  2  
ATOM 3252  H HE   . ARG A 1 81  ? 1.176   -5.176  -12.309 1.00 0.00 ? 81  ARG A HE   2  
ATOM 3253  H HH11 . ARG A 1 81  ? 0.850   -7.063  -9.402  1.00 0.00 ? 81  ARG A HH11 2  
ATOM 3254  H HH12 . ARG A 1 81  ? -0.863  -6.831  -9.288  1.00 0.00 ? 81  ARG A HH12 2  
ATOM 3255  H HH21 . ARG A 1 81  ? -1.079  -4.864  -12.171 1.00 0.00 ? 81  ARG A HH21 2  
ATOM 3256  H HH22 . ARG A 1 81  ? -1.960  -5.581  -10.864 1.00 0.00 ? 81  ARG A HH22 2  
ATOM 3257  N N    . LEU A 1 82  ? 1.220   -3.191  -6.781  1.00 0.00 ? 82  LEU A N    2  
ATOM 3258  C CA   . LEU A 1 82  ? 0.488   -3.207  -5.519  1.00 0.00 ? 82  LEU A CA   2  
ATOM 3259  C C    . LEU A 1 82  ? -0.697  -2.247  -5.564  1.00 0.00 ? 82  LEU A C    2  
ATOM 3260  O O    . LEU A 1 82  ? -1.852  -2.667  -5.503  1.00 0.00 ? 82  LEU A O    2  
ATOM 3261  C CB   . LEU A 1 82  ? 1.417   -2.834  -4.362  1.00 0.00 ? 82  LEU A CB   2  
ATOM 3262  C CG   . LEU A 1 82  ? 0.941   -3.230  -2.964  1.00 0.00 ? 82  LEU A CG   2  
ATOM 3263  C CD1  . LEU A 1 82  ? 0.673   -4.725  -2.895  1.00 0.00 ? 82  LEU A CD1  2  
ATOM 3264  C CD2  . LEU A 1 82  ? 1.966   -2.821  -1.916  1.00 0.00 ? 82  LEU A CD2  2  
ATOM 3265  H H    . LEU A 1 82  ? 2.047   -2.670  -6.845  1.00 0.00 ? 82  LEU A H    2  
ATOM 3266  H HA   . LEU A 1 82  ? 0.117   -4.209  -5.363  1.00 0.00 ? 82  LEU A HA   2  
ATOM 3267  H HB2  . LEU A 1 82  ? 2.368   -3.314  -4.535  1.00 0.00 ? 82  LEU A HB2  2  
ATOM 3268  H HB3  . LEU A 1 82  ? 1.548   -1.762  -4.377  1.00 0.00 ? 82  LEU A HB3  2  
ATOM 3269  H HG   . LEU A 1 82  ? 0.015   -2.715  -2.747  1.00 0.00 ? 82  LEU A HG   2  
ATOM 3270  H HD11 . LEU A 1 82  ? 0.957   -5.185  -3.829  1.00 0.00 ? 82  LEU A HD11 2  
ATOM 3271  H HD12 . LEU A 1 82  ? -0.379  -4.894  -2.715  1.00 0.00 ? 82  LEU A HD12 2  
ATOM 3272  H HD13 . LEU A 1 82  ? 1.249   -5.157  -2.090  1.00 0.00 ? 82  LEU A HD13 2  
ATOM 3273  H HD21 . LEU A 1 82  ? 2.397   -1.868  -2.188  1.00 0.00 ? 82  LEU A HD21 2  
ATOM 3274  H HD22 . LEU A 1 82  ? 2.746   -3.567  -1.865  1.00 0.00 ? 82  LEU A HD22 2  
ATOM 3275  H HD23 . LEU A 1 82  ? 1.483   -2.737  -0.954  1.00 0.00 ? 82  LEU A HD23 2  
ATOM 3276  N N    . ARG A 1 83  ? -0.401  -0.956  -5.673  1.00 0.00 ? 83  ARG A N    2  
ATOM 3277  C CA   . ARG A 1 83  ? -1.441  0.064   -5.728  1.00 0.00 ? 83  ARG A CA   2  
ATOM 3278  C C    . ARG A 1 83  ? -2.674  -0.456  -6.461  1.00 0.00 ? 83  ARG A C    2  
ATOM 3279  O O    . ARG A 1 83  ? -3.807  -0.153  -6.083  1.00 0.00 ? 83  ARG A O    2  
ATOM 3280  C CB   . ARG A 1 83  ? -0.916  1.323   -6.421  1.00 0.00 ? 83  ARG A CB   2  
ATOM 3281  C CG   . ARG A 1 83  ? -1.133  1.325   -7.926  1.00 0.00 ? 83  ARG A CG   2  
ATOM 3282  C CD   . ARG A 1 83  ? -0.890  2.703   -8.521  1.00 0.00 ? 83  ARG A CD   2  
ATOM 3283  N NE   . ARG A 1 83  ? 0.459   3.190   -8.243  1.00 0.00 ? 83  ARG A NE   2  
ATOM 3284  C CZ   . ARG A 1 83  ? 1.081   4.096   -8.988  1.00 0.00 ? 83  ARG A CZ   2  
ATOM 3285  N NH1  . ARG A 1 83  ? 0.480   4.611   -10.051 1.00 0.00 ? 83  ARG A NH1  2  
ATOM 3286  N NH2  . ARG A 1 83  ? 2.308   4.488   -8.670  1.00 0.00 ? 83  ARG A NH2  2  
ATOM 3287  H H    . ARG A 1 83  ? 0.539   -0.682  -5.717  1.00 0.00 ? 83  ARG A H    2  
ATOM 3288  H HA   . ARG A 1 83  ? -1.717  0.311   -4.714  1.00 0.00 ? 83  ARG A HA   2  
ATOM 3289  H HB2  . ARG A 1 83  ? -1.417  2.185   -6.006  1.00 0.00 ? 83  ARG A HB2  2  
ATOM 3290  H HB3  . ARG A 1 83  ? 0.144   1.407   -6.232  1.00 0.00 ? 83  ARG A HB3  2  
ATOM 3291  H HG2  . ARG A 1 83  ? -0.450  0.623   -8.380  1.00 0.00 ? 83  ARG A HG2  2  
ATOM 3292  H HG3  . ARG A 1 83  ? -2.150  1.027   -8.133  1.00 0.00 ? 83  ARG A HG3  2  
ATOM 3293  H HD2  . ARG A 1 83  ? -1.029  2.648   -9.591  1.00 0.00 ? 83  ARG A HD2  2  
ATOM 3294  H HD3  . ARG A 1 83  ? -1.606  3.393   -8.101  1.00 0.00 ? 83  ARG A HD3  2  
ATOM 3295  H HE   . ARG A 1 83  ? 0.921   2.822   -7.462  1.00 0.00 ? 83  ARG A HE   2  
ATOM 3296  H HH11 . ARG A 1 83  ? -0.445  4.318   -10.293 1.00 0.00 ? 83  ARG A HH11 2  
ATOM 3297  H HH12 . ARG A 1 83  ? 0.951   5.294   -10.610 1.00 0.00 ? 83  ARG A HH12 2  
ATOM 3298  H HH21 . ARG A 1 83  ? 2.765   4.102   -7.870  1.00 0.00 ? 83  ARG A HH21 2  
ATOM 3299  H HH22 . ARG A 1 83  ? 2.776   5.170   -9.232  1.00 0.00 ? 83  ARG A HH22 2  
ATOM 3300  N N    . CYS A 1 84  ? -2.446  -1.238  -7.510  1.00 0.00 ? 84  CYS A N    2  
ATOM 3301  C CA   . CYS A 1 84  ? -3.539  -1.799  -8.297  1.00 0.00 ? 84  CYS A CA   2  
ATOM 3302  C C    . CYS A 1 84  ? -4.262  -2.895  -7.520  1.00 0.00 ? 84  CYS A C    2  
ATOM 3303  O O    . CYS A 1 84  ? -5.488  -2.891  -7.417  1.00 0.00 ? 84  CYS A O    2  
ATOM 3304  C CB   . CYS A 1 84  ? -3.008  -2.359  -9.618  1.00 0.00 ? 84  CYS A CB   2  
ATOM 3305  S SG   . CYS A 1 84  ? -4.222  -2.363  -10.958 1.00 0.00 ? 84  CYS A SG   2  
ATOM 3306  H H    . CYS A 1 84  ? -1.522  -1.444  -7.762  1.00 0.00 ? 84  CYS A H    2  
ATOM 3307  H HA   . CYS A 1 84  ? -4.237  -1.004  -8.507  1.00 0.00 ? 84  CYS A HA   2  
ATOM 3308  H HB2  . CYS A 1 84  ? -2.167  -1.764  -9.940  1.00 0.00 ? 84  CYS A HB2  2  
ATOM 3309  H HB3  . CYS A 1 84  ? -2.683  -3.377  -9.464  1.00 0.00 ? 84  CYS A HB3  2  
ATOM 3310  H HG   . CYS A 1 84  ? -3.903  -1.393  -11.801 1.00 0.00 ? 84  CYS A HG   2  
ATOM 3311  N N    . ALA A 1 85  ? -3.493  -3.833  -6.977  1.00 0.00 ? 85  ALA A N    2  
ATOM 3312  C CA   . ALA A 1 85  ? -4.060  -4.935  -6.210  1.00 0.00 ? 85  ALA A CA   2  
ATOM 3313  C C    . ALA A 1 85  ? -4.900  -4.419  -5.046  1.00 0.00 ? 85  ALA A C    2  
ATOM 3314  O O    . ALA A 1 85  ? -6.049  -4.825  -4.869  1.00 0.00 ? 85  ALA A O    2  
ATOM 3315  C CB   . ALA A 1 85  ? -2.954  -5.848  -5.700  1.00 0.00 ? 85  ALA A CB   2  
ATOM 3316  H H    . ALA A 1 85  ? -2.522  -3.782  -7.094  1.00 0.00 ? 85  ALA A H    2  
ATOM 3317  H HA   . ALA A 1 85  ? -4.692  -5.511  -6.870  1.00 0.00 ? 85  ALA A HA   2  
ATOM 3318  H HB1  . ALA A 1 85  ? -3.182  -6.161  -4.692  1.00 0.00 ? 85  ALA A HB1  2  
ATOM 3319  H HB2  . ALA A 1 85  ? -2.880  -6.715  -6.339  1.00 0.00 ? 85  ALA A HB2  2  
ATOM 3320  H HB3  . ALA A 1 85  ? -2.015  -5.314  -5.708  1.00 0.00 ? 85  ALA A HB3  2  
ATOM 3321  N N    . LEU A 1 86  ? -4.320  -3.523  -4.255  1.00 0.00 ? 86  LEU A N    2  
ATOM 3322  C CA   . LEU A 1 86  ? -5.015  -2.952  -3.107  1.00 0.00 ? 86  LEU A CA   2  
ATOM 3323  C C    . LEU A 1 86  ? -6.465  -2.629  -3.455  1.00 0.00 ? 86  LEU A C    2  
ATOM 3324  O O    . LEU A 1 86  ? -7.392  -3.190  -2.873  1.00 0.00 ? 86  LEU A O    2  
ATOM 3325  C CB   . LEU A 1 86  ? -4.299  -1.687  -2.630  1.00 0.00 ? 86  LEU A CB   2  
ATOM 3326  C CG   . LEU A 1 86  ? -4.483  -1.327  -1.156  1.00 0.00 ? 86  LEU A CG   2  
ATOM 3327  C CD1  . LEU A 1 86  ? -3.847  -2.383  -0.265  1.00 0.00 ? 86  LEU A CD1  2  
ATOM 3328  C CD2  . LEU A 1 86  ? -3.894  0.045   -0.864  1.00 0.00 ? 86  LEU A CD2  2  
ATOM 3329  H H    . LEU A 1 86  ? -3.402  -3.239  -4.447  1.00 0.00 ? 86  LEU A H    2  
ATOM 3330  H HA   . LEU A 1 86  ? -5.002  -3.684  -2.314  1.00 0.00 ? 86  LEU A HA   2  
ATOM 3331  H HB2  . LEU A 1 86  ? -3.243  -1.818  -2.809  1.00 0.00 ? 86  LEU A HB2  2  
ATOM 3332  H HB3  . LEU A 1 86  ? -4.663  -0.859  -3.222  1.00 0.00 ? 86  LEU A HB3  2  
ATOM 3333  H HG   . LEU A 1 86  ? -5.540  -1.293  -0.929  1.00 0.00 ? 86  LEU A HG   2  
ATOM 3334  H HD11 . LEU A 1 86  ? -2.877  -2.041  0.062   1.00 0.00 ? 86  LEU A HD11 2  
ATOM 3335  H HD12 . LEU A 1 86  ? -3.736  -3.303  -0.820  1.00 0.00 ? 86  LEU A HD12 2  
ATOM 3336  H HD13 . LEU A 1 86  ? -4.478  -2.556  0.595   1.00 0.00 ? 86  LEU A HD13 2  
ATOM 3337  H HD21 . LEU A 1 86  ? -4.617  0.639   -0.324  1.00 0.00 ? 86  LEU A HD21 2  
ATOM 3338  H HD22 . LEU A 1 86  ? -3.647  0.536   -1.794  1.00 0.00 ? 86  LEU A HD22 2  
ATOM 3339  H HD23 . LEU A 1 86  ? -3.001  -0.066  -0.267  1.00 0.00 ? 86  LEU A HD23 2  
ATOM 3340  N N    . ASN A 1 87  ? -6.652  -1.722  -4.408  1.00 0.00 ? 87  ASN A N    2  
ATOM 3341  C CA   . ASN A 1 87  ? -7.989  -1.325  -4.835  1.00 0.00 ? 87  ASN A CA   2  
ATOM 3342  C C    . ASN A 1 87  ? -8.781  -2.531  -5.331  1.00 0.00 ? 87  ASN A C    2  
ATOM 3343  O O    . ASN A 1 87  ? -9.964  -2.680  -5.024  1.00 0.00 ? 87  ASN A O    2  
ATOM 3344  C CB   . ASN A 1 87  ? -7.903  -0.268  -5.938  1.00 0.00 ? 87  ASN A CB   2  
ATOM 3345  C CG   . ASN A 1 87  ? -9.152  0.587   -6.017  1.00 0.00 ? 87  ASN A CG   2  
ATOM 3346  O OD1  . ASN A 1 87  ? -9.935  0.476   -6.961  1.00 0.00 ? 87  ASN A OD1  2  
ATOM 3347  N ND2  . ASN A 1 87  ? -9.344  1.447   -5.024  1.00 0.00 ? 87  ASN A ND2  2  
ATOM 3348  H H    . ASN A 1 87  ? -5.872  -1.309  -4.835  1.00 0.00 ? 87  ASN A H    2  
ATOM 3349  H HA   . ASN A 1 87  ? -8.497  -0.902  -3.981  1.00 0.00 ? 87  ASN A HA   2  
ATOM 3350  H HB2  . ASN A 1 87  ? -7.059  0.378   -5.743  1.00 0.00 ? 87  ASN A HB2  2  
ATOM 3351  H HB3  . ASN A 1 87  ? -7.763  -0.759  -6.889  1.00 0.00 ? 87  ASN A HB3  2  
ATOM 3352  H HD21 . ASN A 1 87  ? -8.679  1.481   -4.305  1.00 0.00 ? 87  ASN A HD21 2  
ATOM 3353  H HD22 . ASN A 1 87  ? -10.145 2.012   -5.050  1.00 0.00 ? 87  ASN A HD22 2  
ATOM 3354  N N    . LYS A 1 88  ? -8.121  -3.390  -6.100  1.00 0.00 ? 88  LYS A N    2  
ATOM 3355  C CA   . LYS A 1 88  ? -8.762  -4.584  -6.639  1.00 0.00 ? 88  LYS A CA   2  
ATOM 3356  C C    . LYS A 1 88  ? -9.374  -5.423  -5.522  1.00 0.00 ? 88  LYS A C    2  
ATOM 3357  O O    . LYS A 1 88  ? -10.469 -5.966  -5.669  1.00 0.00 ? 88  LYS A O    2  
ATOM 3358  C CB   . LYS A 1 88  ? -7.749  -5.421  -7.423  1.00 0.00 ? 88  LYS A CB   2  
ATOM 3359  C CG   . LYS A 1 88  ? -7.610  -5.003  -8.877  1.00 0.00 ? 88  LYS A CG   2  
ATOM 3360  C CD   . LYS A 1 88  ? -8.660  -5.668  -9.751  1.00 0.00 ? 88  LYS A CD   2  
ATOM 3361  C CE   . LYS A 1 88  ? -8.234  -5.693  -11.211 1.00 0.00 ? 88  LYS A CE   2  
ATOM 3362  N NZ   . LYS A 1 88  ? -7.232  -6.762  -11.479 1.00 0.00 ? 88  LYS A NZ   2  
ATOM 3363  H H    . LYS A 1 88  ? -7.179  -3.217  -6.310  1.00 0.00 ? 88  LYS A H    2  
ATOM 3364  H HA   . LYS A 1 88  ? -9.548  -4.267  -7.307  1.00 0.00 ? 88  LYS A HA   2  
ATOM 3365  H HB2  . LYS A 1 88  ? -6.782  -5.331  -6.950  1.00 0.00 ? 88  LYS A HB2  2  
ATOM 3366  H HB3  . LYS A 1 88  ? -8.058  -6.456  -7.397  1.00 0.00 ? 88  LYS A HB3  2  
ATOM 3367  H HG2  . LYS A 1 88  ? -7.726  -3.931  -8.946  1.00 0.00 ? 88  LYS A HG2  2  
ATOM 3368  H HG3  . LYS A 1 88  ? -6.628  -5.284  -9.231  1.00 0.00 ? 88  LYS A HG3  2  
ATOM 3369  H HD2  . LYS A 1 88  ? -8.807  -6.683  -9.414  1.00 0.00 ? 88  LYS A HD2  2  
ATOM 3370  H HD3  . LYS A 1 88  ? -9.587  -5.120  -9.665  1.00 0.00 ? 88  LYS A HD3  2  
ATOM 3371  H HE2  . LYS A 1 88  ? -9.105  -5.867  -11.824 1.00 0.00 ? 88  LYS A HE2  2  
ATOM 3372  H HE3  . LYS A 1 88  ? -7.802  -4.736  -11.463 1.00 0.00 ? 88  LYS A HE3  2  
ATOM 3373  H HZ1  . LYS A 1 88  ? -6.509  -6.769  -10.731 1.00 0.00 ? 88  LYS A HZ1  2  
ATOM 3374  H HZ2  . LYS A 1 88  ? -6.767  -6.595  -12.393 1.00 0.00 ? 88  LYS A HZ2  2  
ATOM 3375  H HZ3  . LYS A 1 88  ? -7.699  -7.691  -11.504 1.00 0.00 ? 88  LYS A HZ3  2  
ATOM 3376  N N    . SER A 1 89  ? -8.661  -5.525  -4.405  1.00 0.00 ? 89  SER A N    2  
ATOM 3377  C CA   . SER A 1 89  ? -9.134  -6.300  -3.264  1.00 0.00 ? 89  SER A CA   2  
ATOM 3378  C C    . SER A 1 89  ? -10.548 -5.883  -2.872  1.00 0.00 ? 89  SER A C    2  
ATOM 3379  O O    . SER A 1 89  ? -10.803 -4.716  -2.577  1.00 0.00 ? 89  SER A O    2  
ATOM 3380  C CB   . SER A 1 89  ? -8.189  -6.123  -2.073  1.00 0.00 ? 89  SER A CB   2  
ATOM 3381  O OG   . SER A 1 89  ? -8.537  -6.996  -1.012  1.00 0.00 ? 89  SER A OG   2  
ATOM 3382  H H    . SER A 1 89  ? -7.795  -5.069  -4.348  1.00 0.00 ? 89  SER A H    2  
ATOM 3383  H HA   . SER A 1 89  ? -9.145  -7.341  -3.552  1.00 0.00 ? 89  SER A HA   2  
ATOM 3384  H HB2  . SER A 1 89  ? -7.178  -6.339  -2.384  1.00 0.00 ? 89  SER A HB2  2  
ATOM 3385  H HB3  . SER A 1 89  ? -8.247  -5.104  -1.720  1.00 0.00 ? 89  SER A HB3  2  
ATOM 3386  H HG   . SER A 1 89  ? -9.243  -6.603  -0.493  1.00 0.00 ? 89  SER A HG   2  
ATOM 3387  N N    . ASN A 1 90  ? -11.464 -6.846  -2.872  1.00 0.00 ? 90  ASN A N    2  
ATOM 3388  C CA   . ASN A 1 90  ? -12.853 -6.579  -2.517  1.00 0.00 ? 90  ASN A CA   2  
ATOM 3389  C C    . ASN A 1 90  ? -13.043 -6.607  -1.003  1.00 0.00 ? 90  ASN A C    2  
ATOM 3390  O O    . ASN A 1 90  ? -13.945 -5.962  -0.469  1.00 0.00 ? 90  ASN A O    2  
ATOM 3391  C CB   . ASN A 1 90  ? -13.776 -7.606  -3.176  1.00 0.00 ? 90  ASN A CB   2  
ATOM 3392  C CG   . ASN A 1 90  ? -13.783 -8.933  -2.442  1.00 0.00 ? 90  ASN A CG   2  
ATOM 3393  O OD1  . ASN A 1 90  ? -12.730 -9.506  -2.163  1.00 0.00 ? 90  ASN A OD1  2  
ATOM 3394  N ND2  . ASN A 1 90  ? -14.974 -9.428  -2.126  1.00 0.00 ? 90  ASN A ND2  2  
ATOM 3395  H H    . ASN A 1 90  ? -11.199 -7.757  -3.116  1.00 0.00 ? 90  ASN A H    2  
ATOM 3396  H HA   . ASN A 1 90  ? -13.105 -5.595  -2.882  1.00 0.00 ? 90  ASN A HA   2  
ATOM 3397  H HB2  . ASN A 1 90  ? -14.784 -7.219  -3.190  1.00 0.00 ? 90  ASN A HB2  2  
ATOM 3398  H HB3  . ASN A 1 90  ? -13.447 -7.778  -4.190  1.00 0.00 ? 90  ASN A HB3  2  
ATOM 3399  H HD21 . ASN A 1 90  ? -15.770 -8.916  -2.380  1.00 0.00 ? 90  ASN A HD21 2  
ATOM 3400  H HD22 . ASN A 1 90  ? -15.008 -10.284 -1.650  1.00 0.00 ? 90  ASN A HD22 2  
ATOM 3401  N N    . ASP A 1 91  ? -12.187 -7.357  -0.319  1.00 0.00 ? 91  ASP A N    2  
ATOM 3402  C CA   . ASP A 1 91  ? -12.258 -7.468  1.133   1.00 0.00 ? 91  ASP A CA   2  
ATOM 3403  C C    . ASP A 1 91  ? -11.574 -6.280  1.803   1.00 0.00 ? 91  ASP A C    2  
ATOM 3404  O O    . ASP A 1 91  ? -11.253 -6.325  2.991   1.00 0.00 ? 91  ASP A O    2  
ATOM 3405  C CB   . ASP A 1 91  ? -11.612 -8.774  1.599   1.00 0.00 ? 91  ASP A CB   2  
ATOM 3406  C CG   . ASP A 1 91  ? -12.586 -9.936  1.592   1.00 0.00 ? 91  ASP A CG   2  
ATOM 3407  O OD1  . ASP A 1 91  ? -13.593 -9.872  2.329   1.00 0.00 ? 91  ASP A OD1  2  
ATOM 3408  O OD2  . ASP A 1 91  ? -12.342 -10.910 0.850   1.00 0.00 ? 91  ASP A OD2  2  
ATOM 3409  H H    . ASP A 1 91  ? -11.489 -7.848  -0.802  1.00 0.00 ? 91  ASP A H    2  
ATOM 3410  H HA   . ASP A 1 91  ? -13.300 -7.472  1.415   1.00 0.00 ? 91  ASP A HA   2  
ATOM 3411  H HB2  . ASP A 1 91  ? -10.789 -9.015  0.943   1.00 0.00 ? 91  ASP A HB2  2  
ATOM 3412  H HB3  . ASP A 1 91  ? -11.240 -8.645  2.605   1.00 0.00 ? 91  ASP A HB3  2  
ATOM 3413  N N    . PHE A 1 92  ? -11.353 -5.220  1.033   1.00 0.00 ? 92  PHE A N    2  
ATOM 3414  C CA   . PHE A 1 92  ? -10.704 -4.021  1.552   1.00 0.00 ? 92  PHE A CA   2  
ATOM 3415  C C    . PHE A 1 92  ? -11.606 -2.801  1.386   1.00 0.00 ? 92  PHE A C    2  
ATOM 3416  O O    . PHE A 1 92  ? -12.310 -2.668  0.386   1.00 0.00 ? 92  PHE A O    2  
ATOM 3417  C CB   . PHE A 1 92  ? -9.372  -3.786  0.836   1.00 0.00 ? 92  PHE A CB   2  
ATOM 3418  C CG   . PHE A 1 92  ? -8.204  -4.442  1.514   1.00 0.00 ? 92  PHE A CG   2  
ATOM 3419  C CD1  . PHE A 1 92  ? -8.306  -5.735  2.002   1.00 0.00 ? 92  PHE A CD1  2  
ATOM 3420  C CD2  . PHE A 1 92  ? -7.004  -3.766  1.664   1.00 0.00 ? 92  PHE A CD2  2  
ATOM 3421  C CE1  . PHE A 1 92  ? -7.232  -6.342  2.626   1.00 0.00 ? 92  PHE A CE1  2  
ATOM 3422  C CE2  . PHE A 1 92  ? -5.927  -4.368  2.287   1.00 0.00 ? 92  PHE A CE2  2  
ATOM 3423  C CZ   . PHE A 1 92  ? -6.041  -5.657  2.770   1.00 0.00 ? 92  PHE A CZ   2  
ATOM 3424  H H    . PHE A 1 92  ? -11.631 -5.245  0.094   1.00 0.00 ? 92  PHE A H    2  
ATOM 3425  H HA   . PHE A 1 92  ? -10.516 -4.175  2.603   1.00 0.00 ? 92  PHE A HA   2  
ATOM 3426  H HB2  . PHE A 1 92  ? -9.437  -4.179  -0.167  1.00 0.00 ? 92  PHE A HB2  2  
ATOM 3427  H HB3  . PHE A 1 92  ? -9.179  -2.725  0.791   1.00 0.00 ? 92  PHE A HB3  2  
ATOM 3428  H HD1  . PHE A 1 92  ? -9.237  -6.272  1.891   1.00 0.00 ? 92  PHE A HD1  2  
ATOM 3429  H HD2  . PHE A 1 92  ? -6.913  -2.758  1.288   1.00 0.00 ? 92  PHE A HD2  2  
ATOM 3430  H HE1  . PHE A 1 92  ? -7.325  -7.350  3.003   1.00 0.00 ? 92  PHE A HE1  2  
ATOM 3431  H HE2  . PHE A 1 92  ? -4.997  -3.830  2.398   1.00 0.00 ? 92  PHE A HE2  2  
ATOM 3432  H HZ   . PHE A 1 92  ? -5.201  -6.130  3.256   1.00 0.00 ? 92  PHE A HZ   2  
ATOM 3433  N N    . GLU A 1 93  ? -11.578 -1.914  2.376   1.00 0.00 ? 93  GLU A N    2  
ATOM 3434  C CA   . GLU A 1 93  ? -12.393 -0.705  2.340   1.00 0.00 ? 93  GLU A CA   2  
ATOM 3435  C C    . GLU A 1 93  ? -11.522 0.534   2.152   1.00 0.00 ? 93  GLU A C    2  
ATOM 3436  O O    . GLU A 1 93  ? -10.387 0.583   2.625   1.00 0.00 ? 93  GLU A O    2  
ATOM 3437  C CB   . GLU A 1 93  ? -13.211 -0.577  3.627   1.00 0.00 ? 93  GLU A CB   2  
ATOM 3438  C CG   . GLU A 1 93  ? -14.556 0.100   3.429   1.00 0.00 ? 93  GLU A CG   2  
ATOM 3439  C CD   . GLU A 1 93  ? -15.416 0.068   4.678   1.00 0.00 ? 93  GLU A CD   2  
ATOM 3440  O OE1  . GLU A 1 93  ? -15.629 -1.035  5.223   1.00 0.00 ? 93  GLU A OE1  2  
ATOM 3441  O OE2  . GLU A 1 93  ? -15.874 1.147   5.109   1.00 0.00 ? 93  GLU A OE2  2  
ATOM 3442  H H    . GLU A 1 93  ? -10.996 -2.076  3.147   1.00 0.00 ? 93  GLU A H    2  
ATOM 3443  H HA   . GLU A 1 93  ? -13.069 -0.786  1.502   1.00 0.00 ? 93  GLU A HA   2  
ATOM 3444  H HB2  . GLU A 1 93  ? -13.384 -1.565  4.030   1.00 0.00 ? 93  GLU A HB2  2  
ATOM 3445  H HB3  . GLU A 1 93  ? -12.644 -0.001  4.343   1.00 0.00 ? 93  GLU A HB3  2  
ATOM 3446  H HG2  . GLU A 1 93  ? -14.389 1.131   3.152   1.00 0.00 ? 93  GLU A HG2  2  
ATOM 3447  H HG3  . GLU A 1 93  ? -15.085 -0.403  2.633   1.00 0.00 ? 93  GLU A HG3  2  
ATOM 3448  N N    . GLU A 1 94  ? -12.063 1.531   1.459   1.00 0.00 ? 94  GLU A N    2  
ATOM 3449  C CA   . GLU A 1 94  ? -11.335 2.769   1.208   1.00 0.00 ? 94  GLU A CA   2  
ATOM 3450  C C    . GLU A 1 94  ? -11.545 3.764   2.345   1.00 0.00 ? 94  GLU A C    2  
ATOM 3451  O O    . GLU A 1 94  ? -12.628 4.330   2.499   1.00 0.00 ? 94  GLU A O    2  
ATOM 3452  C CB   . GLU A 1 94  ? -11.783 3.390   -0.117  1.00 0.00 ? 94  GLU A CB   2  
ATOM 3453  C CG   . GLU A 1 94  ? -11.258 4.799   -0.337  1.00 0.00 ? 94  GLU A CG   2  
ATOM 3454  C CD   . GLU A 1 94  ? -11.058 5.125   -1.804  1.00 0.00 ? 94  GLU A CD   2  
ATOM 3455  O OE1  . GLU A 1 94  ? -11.930 4.757   -2.618  1.00 0.00 ? 94  GLU A OE1  2  
ATOM 3456  O OE2  . GLU A 1 94  ? -10.029 5.748   -2.137  1.00 0.00 ? 94  GLU A OE2  2  
ATOM 3457  H H    . GLU A 1 94  ? -12.973 1.431   1.108   1.00 0.00 ? 94  GLU A H    2  
ATOM 3458  H HA   . GLU A 1 94  ? -10.284 2.528   1.145   1.00 0.00 ? 94  GLU A HA   2  
ATOM 3459  H HB2  . GLU A 1 94  ? -11.435 2.767   -0.928  1.00 0.00 ? 94  GLU A HB2  2  
ATOM 3460  H HB3  . GLU A 1 94  ? -12.862 3.423   -0.138  1.00 0.00 ? 94  GLU A HB3  2  
ATOM 3461  H HG2  . GLU A 1 94  ? -11.965 5.501   0.079   1.00 0.00 ? 94  GLU A HG2  2  
ATOM 3462  H HG3  . GLU A 1 94  ? -10.311 4.900   0.172   1.00 0.00 ? 94  GLU A HG3  2  
ATOM 3463  N N    . LEU A 1 95  ? -10.502 3.972   3.141   1.00 0.00 ? 95  LEU A N    2  
ATOM 3464  C CA   . LEU A 1 95  ? -10.570 4.898   4.266   1.00 0.00 ? 95  LEU A CA   2  
ATOM 3465  C C    . LEU A 1 95  ? -10.018 6.266   3.879   1.00 0.00 ? 95  LEU A C    2  
ATOM 3466  O O    . LEU A 1 95  ? -9.683  7.079   4.741   1.00 0.00 ? 95  LEU A O    2  
ATOM 3467  C CB   . LEU A 1 95  ? -9.792  4.341   5.459   1.00 0.00 ? 95  LEU A CB   2  
ATOM 3468  C CG   . LEU A 1 95  ? -10.249 2.978   5.981   1.00 0.00 ? 95  LEU A CG   2  
ATOM 3469  C CD1  . LEU A 1 95  ? -9.612  2.682   7.330   1.00 0.00 ? 95  LEU A CD1  2  
ATOM 3470  C CD2  . LEU A 1 95  ? -11.766 2.928   6.084   1.00 0.00 ? 95  LEU A CD2  2  
ATOM 3471  H H    . LEU A 1 95  ? -9.665  3.492   2.969   1.00 0.00 ? 95  LEU A H    2  
ATOM 3472  H HA   . LEU A 1 95  ? -11.608 5.007   4.543   1.00 0.00 ? 95  LEU A HA   2  
ATOM 3473  H HB2  . LEU A 1 95  ? -8.757  4.252   5.167   1.00 0.00 ? 95  LEU A HB2  2  
ATOM 3474  H HB3  . LEU A 1 95  ? -9.876  5.052   6.269   1.00 0.00 ? 95  LEU A HB3  2  
ATOM 3475  H HG   . LEU A 1 95  ? -9.934  2.210   5.288   1.00 0.00 ? 95  LEU A HG   2  
ATOM 3476  H HD11 . LEU A 1 95  ? -10.327 2.179   7.963   1.00 0.00 ? 95  LEU A HD11 2  
ATOM 3477  H HD12 . LEU A 1 95  ? -9.308  3.608   7.796   1.00 0.00 ? 95  LEU A HD12 2  
ATOM 3478  H HD13 . LEU A 1 95  ? -8.747  2.050   7.189   1.00 0.00 ? 95  LEU A HD13 2  
ATOM 3479  H HD21 . LEU A 1 95  ? -12.124 3.823   6.570   1.00 0.00 ? 95  LEU A HD21 2  
ATOM 3480  H HD22 . LEU A 1 95  ? -12.059 2.063   6.661   1.00 0.00 ? 95  LEU A HD22 2  
ATOM 3481  H HD23 . LEU A 1 95  ? -12.192 2.861   5.093   1.00 0.00 ? 95  LEU A HD23 2  
ATOM 3482  N N    . VAL A 1 96  ? -9.929  6.516   2.576   1.00 0.00 ? 96  VAL A N    2  
ATOM 3483  C CA   . VAL A 1 96  ? -9.421  7.787   2.075   1.00 0.00 ? 96  VAL A CA   2  
ATOM 3484  C C    . VAL A 1 96  ? -9.886  8.948   2.948   1.00 0.00 ? 96  VAL A C    2  
ATOM 3485  O O    . VAL A 1 96  ? -9.235  9.990   3.009   1.00 0.00 ? 96  VAL A O    2  
ATOM 3486  C CB   . VAL A 1 96  ? -9.873  8.038   0.623   1.00 0.00 ? 96  VAL A CB   2  
ATOM 3487  C CG1  . VAL A 1 96  ? -11.381 8.219   0.557   1.00 0.00 ? 96  VAL A CG1  2  
ATOM 3488  C CG2  . VAL A 1 96  ? -9.156  9.249   0.045   1.00 0.00 ? 96  VAL A CG2  2  
ATOM 3489  H H    . VAL A 1 96  ? -10.212 5.829   1.938   1.00 0.00 ? 96  VAL A H    2  
ATOM 3490  H HA   . VAL A 1 96  ? -8.342  7.746   2.092   1.00 0.00 ? 96  VAL A HA   2  
ATOM 3491  H HB   . VAL A 1 96  ? -9.609  7.174   0.031   1.00 0.00 ? 96  VAL A HB   2  
ATOM 3492  H HG11 . VAL A 1 96  ? -11.609 9.212   0.197   1.00 0.00 ? 96  VAL A HG11 2  
ATOM 3493  H HG12 . VAL A 1 96  ? -11.803 7.485   -0.115  1.00 0.00 ? 96  VAL A HG12 2  
ATOM 3494  H HG13 . VAL A 1 96  ? -11.803 8.089   1.543   1.00 0.00 ? 96  VAL A HG13 2  
ATOM 3495  H HG21 . VAL A 1 96  ? -8.456  8.925   -0.710  1.00 0.00 ? 96  VAL A HG21 2  
ATOM 3496  H HG22 . VAL A 1 96  ? -9.880  9.918   -0.398  1.00 0.00 ? 96  VAL A HG22 2  
ATOM 3497  H HG23 . VAL A 1 96  ? -8.626  9.764   0.832   1.00 0.00 ? 96  VAL A HG23 2  
ATOM 3498  N N    . GLU A 1 97  ? -11.016 8.758   3.622   1.00 0.00 ? 97  GLU A N    2  
ATOM 3499  C CA   . GLU A 1 97  ? -11.568 9.790   4.491   1.00 0.00 ? 97  GLU A CA   2  
ATOM 3500  C C    . GLU A 1 97  ? -10.532 10.252  5.513   1.00 0.00 ? 97  GLU A C    2  
ATOM 3501  O O    . GLU A 1 97  ? -10.383 11.448  5.764   1.00 0.00 ? 97  GLU A O    2  
ATOM 3502  C CB   . GLU A 1 97  ? -12.814 9.270   5.211   1.00 0.00 ? 97  GLU A CB   2  
ATOM 3503  C CG   . GLU A 1 97  ? -13.962 8.934   4.275   1.00 0.00 ? 97  GLU A CG   2  
ATOM 3504  C CD   . GLU A 1 97  ? -15.059 8.140   4.957   1.00 0.00 ? 97  GLU A CD   2  
ATOM 3505  O OE1  . GLU A 1 97  ? -14.785 7.002   5.392   1.00 0.00 ? 97  GLU A OE1  2  
ATOM 3506  O OE2  . GLU A 1 97  ? -16.191 8.658   5.056   1.00 0.00 ? 97  GLU A OE2  2  
ATOM 3507  H H    . GLU A 1 97  ? -11.490 7.905   3.531   1.00 0.00 ? 97  GLU A H    2  
ATOM 3508  H HA   . GLU A 1 97  ? -11.846 10.631  3.874   1.00 0.00 ? 97  GLU A HA   2  
ATOM 3509  H HB2  . GLU A 1 97  ? -12.551 8.377   5.760   1.00 0.00 ? 97  GLU A HB2  2  
ATOM 3510  H HB3  . GLU A 1 97  ? -13.153 10.023  5.907   1.00 0.00 ? 97  GLU A HB3  2  
ATOM 3511  H HG2  . GLU A 1 97  ? -14.385 9.854   3.900   1.00 0.00 ? 97  GLU A HG2  2  
ATOM 3512  H HG3  . GLU A 1 97  ? -13.578 8.353   3.449   1.00 0.00 ? 97  GLU A HG3  2  
ATOM 3513  N N    . ARG A 1 98  ? -9.821  9.294   6.099   1.00 0.00 ? 98  ARG A N    2  
ATOM 3514  C CA   . ARG A 1 98  ? -8.801  9.601   7.095   1.00 0.00 ? 98  ARG A CA   2  
ATOM 3515  C C    . ARG A 1 98  ? -7.432  9.758   6.440   1.00 0.00 ? 98  ARG A C    2  
ATOM 3516  O O    . ARG A 1 98  ? -6.535  10.392  6.996   1.00 0.00 ? 98  ARG A O    2  
ATOM 3517  C CB   . ARG A 1 98  ? -8.747  8.501   8.156   1.00 0.00 ? 98  ARG A CB   2  
ATOM 3518  C CG   . ARG A 1 98  ? -10.086 7.823   8.399   1.00 0.00 ? 98  ARG A CG   2  
ATOM 3519  C CD   . ARG A 1 98  ? -10.015 6.856   9.571   1.00 0.00 ? 98  ARG A CD   2  
ATOM 3520  N NE   . ARG A 1 98  ? -11.289 6.759   10.278  1.00 0.00 ? 98  ARG A NE   2  
ATOM 3521  C CZ   . ARG A 1 98  ? -11.398 6.390   11.549  1.00 0.00 ? 98  ARG A CZ   2  
ATOM 3522  N NH1  . ARG A 1 98  ? -10.314 6.084   12.249  1.00 0.00 ? 98  ARG A NH1  2  
ATOM 3523  N NH2  . ARG A 1 98  ? -12.593 6.326   12.123  1.00 0.00 ? 98  ARG A NH2  2  
ATOM 3524  H H    . ARG A 1 98  ? -9.986  8.359   5.857   1.00 0.00 ? 98  ARG A H    2  
ATOM 3525  H HA   . ARG A 1 98  ? -9.069  10.534  7.568   1.00 0.00 ? 98  ARG A HA   2  
ATOM 3526  H HB2  . ARG A 1 98  ? -8.039  7.748   7.843   1.00 0.00 ? 98  ARG A HB2  2  
ATOM 3527  H HB3  . ARG A 1 98  ? -8.412  8.933   9.088   1.00 0.00 ? 98  ARG A HB3  2  
ATOM 3528  H HG2  . ARG A 1 98  ? -10.827 8.578   8.615   1.00 0.00 ? 98  ARG A HG2  2  
ATOM 3529  H HG3  . ARG A 1 98  ? -10.370 7.280   7.511   1.00 0.00 ? 98  ARG A HG3  2  
ATOM 3530  H HD2  . ARG A 1 98  ? -9.747  5.879   9.197   1.00 0.00 ? 98  ARG A HD2  2  
ATOM 3531  H HD3  . ARG A 1 98  ? -9.257  7.199   10.258  1.00 0.00 ? 98  ARG A HD3  2  
ATOM 3532  H HE   . ARG A 1 98  ? -12.103 6.980   9.779   1.00 0.00 ? 98  ARG A HE   2  
ATOM 3533  H HH11 . ARG A 1 98  ? -9.413  6.132   11.820  1.00 0.00 ? 98  ARG A HH11 2  
ATOM 3534  H HH12 . ARG A 1 98  ? -10.399 5.808   13.207  1.00 0.00 ? 98  ARG A HH12 2  
ATOM 3535  H HH21 . ARG A 1 98  ? -13.412 6.555   11.598  1.00 0.00 ? 98  ARG A HH21 2  
ATOM 3536  H HH22 . ARG A 1 98  ? -12.674 6.048   13.079  1.00 0.00 ? 98  ARG A HH22 2  
ATOM 3537  N N    . SER A 1 99  ? -7.278  9.176   5.255   1.00 0.00 ? 99  SER A N    2  
ATOM 3538  C CA   . SER A 1 99  ? -6.017  9.247   4.525   1.00 0.00 ? 99  SER A CA   2  
ATOM 3539  C C    . SER A 1 99  ? -5.546  10.693  4.395   1.00 0.00 ? 99  SER A C    2  
ATOM 3540  O O    . SER A 1 99  ? -6.328  11.584  4.066   1.00 0.00 ? 99  SER A O    2  
ATOM 3541  C CB   . SER A 1 99  ? -6.170  8.622   3.138   1.00 0.00 ? 99  SER A CB   2  
ATOM 3542  O OG   . SER A 1 99  ? -6.839  9.503   2.252   1.00 0.00 ? 99  SER A OG   2  
ATOM 3543  H H    . SER A 1 99  ? -8.030  8.685   4.863   1.00 0.00 ? 99  SER A H    2  
ATOM 3544  H HA   . SER A 1 99  ? -5.280  8.689   5.083   1.00 0.00 ? 99  SER A HA   2  
ATOM 3545  H HB2  . SER A 1 99  ? -5.193  8.400   2.736   1.00 0.00 ? 99  SER A HB2  2  
ATOM 3546  H HB3  . SER A 1 99  ? -6.742  7.709   3.218   1.00 0.00 ? 99  SER A HB3  2  
ATOM 3547  H HG   . SER A 1 99  ? -7.488  10.016  2.739   1.00 0.00 ? 99  SER A HG   2  
ATOM 3548  N N    . GLN A 1 100 ? -4.262  10.915  4.657   1.00 0.00 ? 100 GLN A N    2  
ATOM 3549  C CA   . GLN A 1 100 ? -3.686  12.252  4.570   1.00 0.00 ? 100 GLN A CA   2  
ATOM 3550  C C    . GLN A 1 100 ? -2.492  12.270  3.621   1.00 0.00 ? 100 GLN A C    2  
ATOM 3551  O O    . GLN A 1 100 ? -1.402  11.815  3.970   1.00 0.00 ? 100 GLN A O    2  
ATOM 3552  C CB   . GLN A 1 100 ? -3.258  12.737  5.956   1.00 0.00 ? 100 GLN A CB   2  
ATOM 3553  C CG   . GLN A 1 100 ? -4.411  12.865  6.939   1.00 0.00 ? 100 GLN A CG   2  
ATOM 3554  C CD   . GLN A 1 100 ? -5.327  14.029  6.616   1.00 0.00 ? 100 GLN A CD   2  
ATOM 3555  O OE1  . GLN A 1 100 ? -5.206  15.109  7.195   1.00 0.00 ? 100 GLN A OE1  2  
ATOM 3556  N NE2  . GLN A 1 100 ? -6.251  13.816  5.686   1.00 0.00 ? 100 GLN A NE2  2  
ATOM 3557  H H    . GLN A 1 100 ? -3.689  10.164  4.914   1.00 0.00 ? 100 GLN A H    2  
ATOM 3558  H HA   . GLN A 1 100 ? -4.446  12.916  4.185   1.00 0.00 ? 100 GLN A HA   2  
ATOM 3559  H HB2  . GLN A 1 100 ? -2.542  12.040  6.363   1.00 0.00 ? 100 GLN A HB2  2  
ATOM 3560  H HB3  . GLN A 1 100 ? -2.790  13.705  5.857   1.00 0.00 ? 100 GLN A HB3  2  
ATOM 3561  H HG2  . GLN A 1 100 ? -4.991  11.954  6.914   1.00 0.00 ? 100 GLN A HG2  2  
ATOM 3562  H HG3  . GLN A 1 100 ? -4.008  13.007  7.930   1.00 0.00 ? 100 GLN A HG3  2  
ATOM 3563  H HE21 . GLN A 1 100 ? -6.289  12.930  5.267   1.00 0.00 ? 100 GLN A HE21 2  
ATOM 3564  H HE22 . GLN A 1 100 ? -6.856  14.551  5.458   1.00 0.00 ? 100 GLN A HE22 2  
ATOM 3565  N N    . LEU A 1 101 ? -2.705  12.797  2.420   1.00 0.00 ? 101 LEU A N    2  
ATOM 3566  C CA   . LEU A 1 101 ? -1.646  12.874  1.420   1.00 0.00 ? 101 LEU A CA   2  
ATOM 3567  C C    . LEU A 1 101 ? -1.302  14.326  1.101   1.00 0.00 ? 101 LEU A C    2  
ATOM 3568  O O    . LEU A 1 101 ? -0.616  14.610  0.120   1.00 0.00 ? 101 LEU A O    2  
ATOM 3569  C CB   . LEU A 1 101 ? -2.070  12.146  0.143   1.00 0.00 ? 101 LEU A CB   2  
ATOM 3570  C CG   . LEU A 1 101 ? -2.535  10.700  0.318   1.00 0.00 ? 101 LEU A CG   2  
ATOM 3571  C CD1  . LEU A 1 101 ? -3.563  10.338  -0.743  1.00 0.00 ? 101 LEU A CD1  2  
ATOM 3572  C CD2  . LEU A 1 101 ? -1.349  9.748   0.260   1.00 0.00 ? 101 LEU A CD2  2  
ATOM 3573  H H    . LEU A 1 101 ? -3.595  13.143  2.201   1.00 0.00 ? 101 LEU A H    2  
ATOM 3574  H HA   . LEU A 1 101 ? -0.770  12.390  1.827   1.00 0.00 ? 101 LEU A HA   2  
ATOM 3575  H HB2  . LEU A 1 101 ? -2.881  12.703  -0.301  1.00 0.00 ? 101 LEU A HB2  2  
ATOM 3576  H HB3  . LEU A 1 101 ? -1.225  12.144  -0.531  1.00 0.00 ? 101 LEU A HB3  2  
ATOM 3577  H HG   . LEU A 1 101 ? -3.004  10.594  1.287   1.00 0.00 ? 101 LEU A HG   2  
ATOM 3578  H HD11 . LEU A 1 101 ? -3.057  10.012  -1.638  1.00 0.00 ? 101 LEU A HD11 2  
ATOM 3579  H HD12 . LEU A 1 101 ? -4.169  11.204  -0.967  1.00 0.00 ? 101 LEU A HD12 2  
ATOM 3580  H HD13 . LEU A 1 101 ? -4.195  9.543   -0.375  1.00 0.00 ? 101 LEU A HD13 2  
ATOM 3581  H HD21 . LEU A 1 101 ? -1.187  9.316   1.237   1.00 0.00 ? 101 LEU A HD21 2  
ATOM 3582  H HD22 . LEU A 1 101 ? -0.466  10.291  -0.043  1.00 0.00 ? 101 LEU A HD22 2  
ATOM 3583  H HD23 . LEU A 1 101 ? -1.552  8.962   -0.452  1.00 0.00 ? 101 LEU A HD23 2  
ATOM 3584  N N    . ASP A 1 102 ? -1.782  15.239  1.938   1.00 0.00 ? 102 ASP A N    2  
ATOM 3585  C CA   . ASP A 1 102 ? -1.523  16.661  1.748   1.00 0.00 ? 102 ASP A CA   2  
ATOM 3586  C C    . ASP A 1 102 ? -0.737  17.233  2.923   1.00 0.00 ? 102 ASP A C    2  
ATOM 3587  O O    . ASP A 1 102 ? -0.682  18.448  3.114   1.00 0.00 ? 102 ASP A O    2  
ATOM 3588  C CB   . ASP A 1 102 ? -2.839  17.423  1.579   1.00 0.00 ? 102 ASP A CB   2  
ATOM 3589  C CG   . ASP A 1 102 ? -3.288  17.490  0.133   1.00 0.00 ? 102 ASP A CG   2  
ATOM 3590  O OD1  . ASP A 1 102 ? -2.427  17.703  -0.746  1.00 0.00 ? 102 ASP A OD1  2  
ATOM 3591  O OD2  . ASP A 1 102 ? -4.501  17.331  -0.120  1.00 0.00 ? 102 ASP A OD2  2  
ATOM 3592  H H    . ASP A 1 102 ? -2.323  14.950  2.703   1.00 0.00 ? 102 ASP A H    2  
ATOM 3593  H HA   . ASP A 1 102 ? -0.935  16.774  0.849   1.00 0.00 ? 102 ASP A HA   2  
ATOM 3594  H HB2  . ASP A 1 102 ? -3.609  16.929  2.153   1.00 0.00 ? 102 ASP A HB2  2  
ATOM 3595  H HB3  . ASP A 1 102 ? -2.713  18.431  1.946   1.00 0.00 ? 102 ASP A HB3  2  
ATOM 3596  N N    . ILE A 1 103 ? -0.131  16.349  3.709   1.00 0.00 ? 103 ILE A N    2  
ATOM 3597  C CA   . ILE A 1 103 ? 0.651   16.765  4.866   1.00 0.00 ? 103 ILE A CA   2  
ATOM 3598  C C    . ILE A 1 103 ? 2.121   16.399  4.696   1.00 0.00 ? 103 ILE A C    2  
ATOM 3599  O O    . ILE A 1 103 ? 2.517   15.830  3.678   1.00 0.00 ? 103 ILE A O    2  
ATOM 3600  C CB   . ILE A 1 103 ? 0.121   16.128  6.164   1.00 0.00 ? 103 ILE A CB   2  
ATOM 3601  C CG1  . ILE A 1 103 ? 0.475   14.640  6.208   1.00 0.00 ? 103 ILE A CG1  2  
ATOM 3602  C CG2  . ILE A 1 103 ? -1.384  16.323  6.274   1.00 0.00 ? 103 ILE A CG2  2  
ATOM 3603  C CD1  . ILE A 1 103 ? -0.385  13.787  5.302   1.00 0.00 ? 103 ILE A CD1  2  
ATOM 3604  H H    . ILE A 1 103 ? -0.212  15.394  3.506   1.00 0.00 ? 103 ILE A H    2  
ATOM 3605  H HA   . ILE A 1 103 ? 0.567   17.839  4.956   1.00 0.00 ? 103 ILE A HA   2  
ATOM 3606  H HB   . ILE A 1 103 ? 0.587   16.626  7.000   1.00 0.00 ? 103 ILE A HB   2  
ATOM 3607  H HG12 . ILE A 1 103 ? 1.503   14.511  5.906   1.00 0.00 ? 103 ILE A HG12 2  
ATOM 3608  H HG13 . ILE A 1 103 ? 0.354   14.279  7.219   1.00 0.00 ? 103 ILE A HG13 2  
ATOM 3609  H HG21 . ILE A 1 103 ? -1.751  16.798  5.376   1.00 0.00 ? 103 ILE A HG21 2  
ATOM 3610  H HG22 . ILE A 1 103 ? -1.863  15.363  6.395   1.00 0.00 ? 103 ILE A HG22 2  
ATOM 3611  H HG23 . ILE A 1 103 ? -1.605  16.946  7.127   1.00 0.00 ? 103 ILE A HG23 2  
ATOM 3612  H HD11 . ILE A 1 103 ? -0.885  13.029  5.888   1.00 0.00 ? 103 ILE A HD11 2  
ATOM 3613  H HD12 . ILE A 1 103 ? -1.120  14.408  4.813   1.00 0.00 ? 103 ILE A HD12 2  
ATOM 3614  H HD13 . ILE A 1 103 ? 0.237   13.312  4.558   1.00 0.00 ? 103 ILE A HD13 2  
ATOM 3615  N N    . SER A 1 104 ? 2.927   16.726  5.701   1.00 0.00 ? 104 SER A N    2  
ATOM 3616  C CA   . SER A 1 104 ? 4.355   16.433  5.663   1.00 0.00 ? 104 SER A CA   2  
ATOM 3617  C C    . SER A 1 104 ? 4.610   15.048  5.075   1.00 0.00 ? 104 SER A C    2  
ATOM 3618  O O    . SER A 1 104 ? 5.298   14.908  4.064   1.00 0.00 ? 104 SER A O    2  
ATOM 3619  C CB   . SER A 1 104 ? 4.954   16.520  7.068   1.00 0.00 ? 104 SER A CB   2  
ATOM 3620  O OG   . SER A 1 104 ? 6.360   16.687  7.014   1.00 0.00 ? 104 SER A OG   2  
ATOM 3621  H H    . SER A 1 104 ? 2.553   17.178  6.486   1.00 0.00 ? 104 SER A H    2  
ATOM 3622  H HA   . SER A 1 104 ? 4.828   17.171  5.033   1.00 0.00 ? 104 SER A HA   2  
ATOM 3623  H HB2  . SER A 1 104 ? 4.523   17.363  7.588   1.00 0.00 ? 104 SER A HB2  2  
ATOM 3624  H HB3  . SER A 1 104 ? 4.731   15.612  7.609   1.00 0.00 ? 104 SER A HB3  2  
ATOM 3625  H HG   . SER A 1 104 ? 6.768   15.870  6.717   1.00 0.00 ? 104 SER A HG   2  
ATOM 3626  N N    . ASP A 1 105 ? 4.050   14.028  5.716   1.00 0.00 ? 105 ASP A N    2  
ATOM 3627  C CA   . ASP A 1 105 ? 4.215   12.654  5.258   1.00 0.00 ? 105 ASP A CA   2  
ATOM 3628  C C    . ASP A 1 105 ? 2.883   12.073  4.791   1.00 0.00 ? 105 ASP A C    2  
ATOM 3629  O O    . ASP A 1 105 ? 2.009   11.739  5.591   1.00 0.00 ? 105 ASP A O    2  
ATOM 3630  C CB   . ASP A 1 105 ? 4.799   11.787  6.375   1.00 0.00 ? 105 ASP A CB   2  
ATOM 3631  C CG   . ASP A 1 105 ? 6.204   12.208  6.758   1.00 0.00 ? 105 ASP A CG   2  
ATOM 3632  O OD1  . ASP A 1 105 ? 7.003   12.511  5.847   1.00 0.00 ? 105 ASP A OD1  2  
ATOM 3633  O OD2  . ASP A 1 105 ? 6.506   12.234  7.970   1.00 0.00 ? 105 ASP A OD2  2  
ATOM 3634  H H    . ASP A 1 105 ? 3.513   14.204  6.517   1.00 0.00 ? 105 ASP A H    2  
ATOM 3635  H HA   . ASP A 1 105 ? 4.901   12.662  4.425   1.00 0.00 ? 105 ASP A HA   2  
ATOM 3636  H HB2  . ASP A 1 105 ? 4.169   11.865  7.249   1.00 0.00 ? 105 ASP A HB2  2  
ATOM 3637  H HB3  . ASP A 1 105 ? 4.827   10.759  6.047   1.00 0.00 ? 105 ASP A HB3  2  
ATOM 3638  N N    . PRO A 1 106 ? 2.722   11.952  3.465   1.00 0.00 ? 106 PRO A N    2  
ATOM 3639  C CA   . PRO A 1 106 ? 1.500   11.413  2.862   1.00 0.00 ? 106 PRO A CA   2  
ATOM 3640  C C    . PRO A 1 106 ? 1.338   9.918   3.117   1.00 0.00 ? 106 PRO A C    2  
ATOM 3641  O O    . PRO A 1 106 ? 2.322   9.196   3.278   1.00 0.00 ? 106 PRO A O    2  
ATOM 3642  C CB   . PRO A 1 106 ? 1.693   11.682  1.368   1.00 0.00 ? 106 PRO A CB   2  
ATOM 3643  C CG   . PRO A 1 106 ? 3.170   11.746  1.182   1.00 0.00 ? 106 PRO A CG   2  
ATOM 3644  C CD   . PRO A 1 106 ? 3.722   12.331  2.453   1.00 0.00 ? 106 PRO A CD   2  
ATOM 3645  H HA   . PRO A 1 106 ? 0.621   11.934  3.213   1.00 0.00 ? 106 PRO A HA   2  
ATOM 3646  H HB2  . PRO A 1 106 ? 1.257   10.876  0.795   1.00 0.00 ? 106 PRO A HB2  2  
ATOM 3647  H HB3  . PRO A 1 106 ? 1.222   12.616  1.103   1.00 0.00 ? 106 PRO A HB3  2  
ATOM 3648  H HG2  . PRO A 1 106 ? 3.564   10.753  1.024   1.00 0.00 ? 106 PRO A HG2  2  
ATOM 3649  H HG3  . PRO A 1 106 ? 3.407   12.383  0.343   1.00 0.00 ? 106 PRO A HG3  2  
ATOM 3650  H HD2  . PRO A 1 106 ? 4.685   11.898  2.680   1.00 0.00 ? 106 PRO A HD2  2  
ATOM 3651  H HD3  . PRO A 1 106 ? 3.799   13.405  2.371   1.00 0.00 ? 106 PRO A HD3  2  
ATOM 3652  N N    . TYR A 1 107 ? 0.092   9.461   3.153   1.00 0.00 ? 107 TYR A N    2  
ATOM 3653  C CA   . TYR A 1 107 ? -0.199  8.052   3.391   1.00 0.00 ? 107 TYR A CA   2  
ATOM 3654  C C    . TYR A 1 107 ? -1.662  7.739   3.093   1.00 0.00 ? 107 TYR A C    2  
ATOM 3655  O O    . TYR A 1 107 ? -2.518  8.624   3.123   1.00 0.00 ? 107 TYR A O    2  
ATOM 3656  C CB   . TYR A 1 107 ? 0.129   7.679   4.837   1.00 0.00 ? 107 TYR A CB   2  
ATOM 3657  C CG   . TYR A 1 107 ? -0.714  8.410   5.857   1.00 0.00 ? 107 TYR A CG   2  
ATOM 3658  C CD1  . TYR A 1 107 ? -0.360  9.679   6.300   1.00 0.00 ? 107 TYR A CD1  2  
ATOM 3659  C CD2  . TYR A 1 107 ? -1.866  7.833   6.378   1.00 0.00 ? 107 TYR A CD2  2  
ATOM 3660  C CE1  . TYR A 1 107 ? -1.127  10.350  7.232   1.00 0.00 ? 107 TYR A CE1  2  
ATOM 3661  C CE2  . TYR A 1 107 ? -2.639  8.497   7.310   1.00 0.00 ? 107 TYR A CE2  2  
ATOM 3662  C CZ   . TYR A 1 107 ? -2.266  9.755   7.734   1.00 0.00 ? 107 TYR A CZ   2  
ATOM 3663  O OH   . TYR A 1 107 ? -3.033  10.421  8.662   1.00 0.00 ? 107 TYR A OH   2  
ATOM 3664  H H    . TYR A 1 107 ? -0.651  10.085  3.018   1.00 0.00 ? 107 TYR A H    2  
ATOM 3665  H HA   . TYR A 1 107 ? 0.424   7.468   2.729   1.00 0.00 ? 107 TYR A HA   2  
ATOM 3666  H HB2  . TYR A 1 107 ? -0.030  6.620   4.974   1.00 0.00 ? 107 TYR A HB2  2  
ATOM 3667  H HB3  . TYR A 1 107 ? 1.166   7.911   5.036   1.00 0.00 ? 107 TYR A HB3  2  
ATOM 3668  H HD1  . TYR A 1 107 ? 0.533   10.142  5.904   1.00 0.00 ? 107 TYR A HD1  2  
ATOM 3669  H HD2  . TYR A 1 107 ? -2.156  6.847   6.044   1.00 0.00 ? 107 TYR A HD2  2  
ATOM 3670  H HE1  . TYR A 1 107 ? -0.834  11.335  7.564   1.00 0.00 ? 107 TYR A HE1  2  
ATOM 3671  H HE2  . TYR A 1 107 ? -3.531  8.032   7.703   1.00 0.00 ? 107 TYR A HE2  2  
ATOM 3672  H HH   . TYR A 1 107 ? -3.869  10.674  8.263   1.00 0.00 ? 107 TYR A HH   2  
ATOM 3673  N N    . LYS A 1 108 ? -1.943  6.473   2.805   1.00 0.00 ? 108 LYS A N    2  
ATOM 3674  C CA   . LYS A 1 108 ? -3.302  6.040   2.502   1.00 0.00 ? 108 LYS A CA   2  
ATOM 3675  C C    . LYS A 1 108 ? -3.793  5.028   3.533   1.00 0.00 ? 108 LYS A C    2  
ATOM 3676  O O    . LYS A 1 108 ? -3.150  4.005   3.768   1.00 0.00 ? 108 LYS A O    2  
ATOM 3677  C CB   . LYS A 1 108 ? -3.364  5.427   1.101   1.00 0.00 ? 108 LYS A CB   2  
ATOM 3678  C CG   . LYS A 1 108 ? -3.300  6.455   -0.015  1.00 0.00 ? 108 LYS A CG   2  
ATOM 3679  C CD   . LYS A 1 108 ? -3.353  5.795   -1.383  1.00 0.00 ? 108 LYS A CD   2  
ATOM 3680  C CE   . LYS A 1 108 ? -3.301  6.826   -2.501  1.00 0.00 ? 108 LYS A CE   2  
ATOM 3681  N NZ   . LYS A 1 108 ? -4.662  7.285   -2.895  1.00 0.00 ? 108 LYS A NZ   2  
ATOM 3682  H H    . LYS A 1 108 ? -1.218  5.813   2.796   1.00 0.00 ? 108 LYS A H    2  
ATOM 3683  H HA   . LYS A 1 108 ? -3.942  6.908   2.535   1.00 0.00 ? 108 LYS A HA   2  
ATOM 3684  H HB2  . LYS A 1 108 ? -2.536  4.744   0.983   1.00 0.00 ? 108 LYS A HB2  2  
ATOM 3685  H HB3  . LYS A 1 108 ? -4.289  4.877   1.003   1.00 0.00 ? 108 LYS A HB3  2  
ATOM 3686  H HG2  . LYS A 1 108 ? -4.137  7.129   0.080   1.00 0.00 ? 108 LYS A HG2  2  
ATOM 3687  H HG3  . LYS A 1 108 ? -2.376  7.009   0.071   1.00 0.00 ? 108 LYS A HG3  2  
ATOM 3688  H HD2  . LYS A 1 108 ? -2.509  5.129   -1.485  1.00 0.00 ? 108 LYS A HD2  2  
ATOM 3689  H HD3  . LYS A 1 108 ? -4.271  5.232   -1.467  1.00 0.00 ? 108 LYS A HD3  2  
ATOM 3690  H HE2  . LYS A 1 108 ? -2.728  7.675   -2.164  1.00 0.00 ? 108 LYS A HE2  2  
ATOM 3691  H HE3  . LYS A 1 108 ? -2.818  6.383   -3.359  1.00 0.00 ? 108 LYS A HE3  2  
ATOM 3692  H HZ1  . LYS A 1 108 ? -4.653  8.308   -3.084  1.00 0.00 ? 108 LYS A HZ1  2  
ATOM 3693  H HZ2  . LYS A 1 108 ? -5.340  7.092   -2.130  1.00 0.00 ? 108 LYS A HZ2  2  
ATOM 3694  H HZ3  . LYS A 1 108 ? -4.973  6.787   -3.753  1.00 0.00 ? 108 LYS A HZ3  2  
ATOM 3695  N N    . VAL A 1 109 ? -4.936  5.321   4.145   1.00 0.00 ? 109 VAL A N    2  
ATOM 3696  C CA   . VAL A 1 109 ? -5.514  4.436   5.149   1.00 0.00 ? 109 VAL A CA   2  
ATOM 3697  C C    . VAL A 1 109 ? -6.527  3.484   4.524   1.00 0.00 ? 109 VAL A C    2  
ATOM 3698  O O    . VAL A 1 109 ? -7.261  3.855   3.608   1.00 0.00 ? 109 VAL A O    2  
ATOM 3699  C CB   . VAL A 1 109 ? -6.202  5.235   6.273   1.00 0.00 ? 109 VAL A CB   2  
ATOM 3700  C CG1  . VAL A 1 109 ? -6.657  4.305   7.387   1.00 0.00 ? 109 VAL A CG1  2  
ATOM 3701  C CG2  . VAL A 1 109 ? -5.268  6.308   6.811   1.00 0.00 ? 109 VAL A CG2  2  
ATOM 3702  H H    . VAL A 1 109 ? -5.402  6.152   3.916   1.00 0.00 ? 109 VAL A H    2  
ATOM 3703  H HA   . VAL A 1 109 ? -4.713  3.858   5.586   1.00 0.00 ? 109 VAL A HA   2  
ATOM 3704  H HB   . VAL A 1 109 ? -7.074  5.720   5.860   1.00 0.00 ? 109 VAL A HB   2  
ATOM 3705  H HG11 . VAL A 1 109 ? -6.763  3.303   6.999   1.00 0.00 ? 109 VAL A HG11 2  
ATOM 3706  H HG12 . VAL A 1 109 ? -5.925  4.309   8.181   1.00 0.00 ? 109 VAL A HG12 2  
ATOM 3707  H HG13 . VAL A 1 109 ? -7.608  4.644   7.772   1.00 0.00 ? 109 VAL A HG13 2  
ATOM 3708  H HG21 . VAL A 1 109 ? -4.634  6.666   6.013   1.00 0.00 ? 109 VAL A HG21 2  
ATOM 3709  H HG22 . VAL A 1 109 ? -5.851  7.129   7.203   1.00 0.00 ? 109 VAL A HG22 2  
ATOM 3710  H HG23 . VAL A 1 109 ? -4.657  5.893   7.598   1.00 0.00 ? 109 VAL A HG23 2  
ATOM 3711  N N    . TYR A 1 110 ? -6.562  2.254   5.026   1.00 0.00 ? 110 TYR A N    2  
ATOM 3712  C CA   . TYR A 1 110 ? -7.485  1.247   4.515   1.00 0.00 ? 110 TYR A CA   2  
ATOM 3713  C C    . TYR A 1 110 ? -8.002  0.360   5.644   1.00 0.00 ? 110 TYR A C    2  
ATOM 3714  O O    . TYR A 1 110 ? -7.376  0.251   6.699   1.00 0.00 ? 110 TYR A O    2  
ATOM 3715  C CB   . TYR A 1 110 ? -6.798  0.389   3.451   1.00 0.00 ? 110 TYR A CB   2  
ATOM 3716  C CG   . TYR A 1 110 ? -6.862  0.982   2.062   1.00 0.00 ? 110 TYR A CG   2  
ATOM 3717  C CD1  . TYR A 1 110 ? -5.907  1.895   1.631   1.00 0.00 ? 110 TYR A CD1  2  
ATOM 3718  C CD2  . TYR A 1 110 ? -7.877  0.630   1.180   1.00 0.00 ? 110 TYR A CD2  2  
ATOM 3719  C CE1  . TYR A 1 110 ? -5.962  2.440   0.362   1.00 0.00 ? 110 TYR A CE1  2  
ATOM 3720  C CE2  . TYR A 1 110 ? -7.938  1.169   -0.090  1.00 0.00 ? 110 TYR A CE2  2  
ATOM 3721  C CZ   . TYR A 1 110 ? -6.979  2.073   -0.494  1.00 0.00 ? 110 TYR A CZ   2  
ATOM 3722  O OH   . TYR A 1 110 ? -7.037  2.613   -1.759  1.00 0.00 ? 110 TYR A OH   2  
ATOM 3723  H H    . TYR A 1 110 ? -5.953  2.017   5.755   1.00 0.00 ? 110 TYR A H    2  
ATOM 3724  H HA   . TYR A 1 110 ? -8.321  1.761   4.065   1.00 0.00 ? 110 TYR A HA   2  
ATOM 3725  H HB2  . TYR A 1 110 ? -5.758  0.268   3.712   1.00 0.00 ? 110 TYR A HB2  2  
ATOM 3726  H HB3  . TYR A 1 110 ? -7.272  -0.581  3.420   1.00 0.00 ? 110 TYR A HB3  2  
ATOM 3727  H HD1  . TYR A 1 110 ? -5.112  2.180   2.304   1.00 0.00 ? 110 TYR A HD1  2  
ATOM 3728  H HD2  . TYR A 1 110 ? -8.627  -0.079  1.501   1.00 0.00 ? 110 TYR A HD2  2  
ATOM 3729  H HE1  . TYR A 1 110 ? -5.211  3.148   0.045   1.00 0.00 ? 110 TYR A HE1  2  
ATOM 3730  H HE2  . TYR A 1 110 ? -8.734  0.882   -0.761  1.00 0.00 ? 110 TYR A HE2  2  
ATOM 3731  H HH   . TYR A 1 110 ? -7.636  3.364   -1.758  1.00 0.00 ? 110 TYR A HH   2  
ATOM 3732  N N    . ARG A 1 111 ? -9.148  -0.273  5.413   1.00 0.00 ? 111 ARG A N    2  
ATOM 3733  C CA   . ARG A 1 111 ? -9.750  -1.150  6.409   1.00 0.00 ? 111 ARG A CA   2  
ATOM 3734  C C    . ARG A 1 111 ? -9.987  -2.544  5.834   1.00 0.00 ? 111 ARG A C    2  
ATOM 3735  O O    . ARG A 1 111 ? -10.621 -2.695  4.790   1.00 0.00 ? 111 ARG A O    2  
ATOM 3736  C CB   . ARG A 1 111 ? -11.072 -0.561  6.906   1.00 0.00 ? 111 ARG A CB   2  
ATOM 3737  C CG   . ARG A 1 111 ? -11.903 -1.535  7.725   1.00 0.00 ? 111 ARG A CG   2  
ATOM 3738  C CD   . ARG A 1 111 ? -13.389 -1.233  7.608   1.00 0.00 ? 111 ARG A CD   2  
ATOM 3739  N NE   . ARG A 1 111 ? -14.211 -2.399  7.923   1.00 0.00 ? 111 ARG A NE   2  
ATOM 3740  C CZ   . ARG A 1 111 ? -15.467 -2.320  8.346   1.00 0.00 ? 111 ARG A CZ   2  
ATOM 3741  N NH1  . ARG A 1 111 ? -16.044 -1.136  8.504   1.00 0.00 ? 111 ARG A NH1  2  
ATOM 3742  N NH2  . ARG A 1 111 ? -16.150 -3.426  8.611   1.00 0.00 ? 111 ARG A NH2  2  
ATOM 3743  H H    . ARG A 1 111 ? -9.599  -0.146  4.552   1.00 0.00 ? 111 ARG A H    2  
ATOM 3744  H HA   . ARG A 1 111 ? -9.066  -1.228  7.241   1.00 0.00 ? 111 ARG A HA   2  
ATOM 3745  H HB2  . ARG A 1 111 ? -10.859 0.302   7.521   1.00 0.00 ? 111 ARG A HB2  2  
ATOM 3746  H HB3  . ARG A 1 111 ? -11.656 -0.250  6.054   1.00 0.00 ? 111 ARG A HB3  2  
ATOM 3747  H HG2  . ARG A 1 111 ? -11.722 -2.538  7.367   1.00 0.00 ? 111 ARG A HG2  2  
ATOM 3748  H HG3  . ARG A 1 111 ? -11.610 -1.462  8.761   1.00 0.00 ? 111 ARG A HG3  2  
ATOM 3749  H HD2  . ARG A 1 111 ? -13.636 -0.436  8.293   1.00 0.00 ? 111 ARG A HD2  2  
ATOM 3750  H HD3  . ARG A 1 111 ? -13.600 -0.917  6.598   1.00 0.00 ? 111 ARG A HD3  2  
ATOM 3751  H HE   . ARG A 1 111 ? -13.804 -3.283  7.813   1.00 0.00 ? 111 ARG A HE   2  
ATOM 3752  H HH11 . ARG A 1 111 ? -15.532 -0.301  8.303   1.00 0.00 ? 111 ARG A HH11 2  
ATOM 3753  H HH12 . ARG A 1 111 ? -16.991 -1.080  8.821   1.00 0.00 ? 111 ARG A HH12 2  
ATOM 3754  H HH21 . ARG A 1 111 ? -15.719 -4.320  8.493   1.00 0.00 ? 111 ARG A HH21 2  
ATOM 3755  H HH22 . ARG A 1 111 ? -17.096 -3.366  8.930   1.00 0.00 ? 111 ARG A HH22 2  
ATOM 3756  N N    . ILE A 1 112 ? -9.473  -3.557  6.523   1.00 0.00 ? 112 ILE A N    2  
ATOM 3757  C CA   . ILE A 1 112 ? -9.629  -4.937  6.081   1.00 0.00 ? 112 ILE A CA   2  
ATOM 3758  C C    . ILE A 1 112 ? -11.055 -5.428  6.305   1.00 0.00 ? 112 ILE A C    2  
ATOM 3759  O O    . ILE A 1 112 ? -11.437 -5.769  7.425   1.00 0.00 ? 112 ILE A O    2  
ATOM 3760  C CB   . ILE A 1 112 ? -8.653  -5.877  6.814   1.00 0.00 ? 112 ILE A CB   2  
ATOM 3761  C CG1  . ILE A 1 112 ? -7.210  -5.417  6.600   1.00 0.00 ? 112 ILE A CG1  2  
ATOM 3762  C CG2  . ILE A 1 112 ? -8.835  -7.309  6.335   1.00 0.00 ? 112 ILE A CG2  2  
ATOM 3763  C CD1  . ILE A 1 112 ? -6.201  -6.187  7.423   1.00 0.00 ? 112 ILE A CD1  2  
ATOM 3764  H H    . ILE A 1 112 ? -8.978  -3.372  7.348   1.00 0.00 ? 112 ILE A H    2  
ATOM 3765  H HA   . ILE A 1 112 ? -9.408  -4.975  5.024   1.00 0.00 ? 112 ILE A HA   2  
ATOM 3766  H HB   . ILE A 1 112 ? -8.881  -5.844  7.869   1.00 0.00 ? 112 ILE A HB   2  
ATOM 3767  H HG12 . ILE A 1 112 ? -6.950  -5.539  5.560   1.00 0.00 ? 112 ILE A HG12 2  
ATOM 3768  H HG13 . ILE A 1 112 ? -7.129  -4.373  6.867   1.00 0.00 ? 112 ILE A HG13 2  
ATOM 3769  H HG21 . ILE A 1 112 ? -9.787  -7.686  6.680   1.00 0.00 ? 112 ILE A HG21 2  
ATOM 3770  H HG22 . ILE A 1 112 ? -8.810  -7.332  5.256   1.00 0.00 ? 112 ILE A HG22 2  
ATOM 3771  H HG23 . ILE A 1 112 ? -8.040  -7.924  6.727   1.00 0.00 ? 112 ILE A HG23 2  
ATOM 3772  H HD11 . ILE A 1 112 ? -6.708  -6.959  7.984   1.00 0.00 ? 112 ILE A HD11 2  
ATOM 3773  H HD12 . ILE A 1 112 ? -5.471  -6.638  6.769   1.00 0.00 ? 112 ILE A HD12 2  
ATOM 3774  H HD13 . ILE A 1 112 ? -5.705  -5.514  8.107   1.00 0.00 ? 112 ILE A HD13 2  
ATOM 3775  N N    . VAL A 1 113 ? -11.838 -5.464  5.232   1.00 0.00 ? 113 VAL A N    2  
ATOM 3776  C CA   . VAL A 1 113 ? -13.222 -5.916  5.310   1.00 0.00 ? 113 VAL A CA   2  
ATOM 3777  C C    . VAL A 1 113 ? -13.301 -7.438  5.352   1.00 0.00 ? 113 VAL A C    2  
ATOM 3778  O O    . VAL A 1 113 ? -12.768 -8.136  4.489   1.00 0.00 ? 113 VAL A O    2  
ATOM 3779  C CB   . VAL A 1 113 ? -14.048 -5.403  4.116   1.00 0.00 ? 113 VAL A CB   2  
ATOM 3780  C CG1  . VAL A 1 113 ? -15.536 -5.585  4.378   1.00 0.00 ? 113 VAL A CG1  2  
ATOM 3781  C CG2  . VAL A 1 113 ? -13.724 -3.944  3.831   1.00 0.00 ? 113 VAL A CG2  2  
ATOM 3782  H H    . VAL A 1 113 ? -11.476 -5.180  4.367   1.00 0.00 ? 113 VAL A H    2  
ATOM 3783  H HA   . VAL A 1 113 ? -13.653 -5.518  6.217   1.00 0.00 ? 113 VAL A HA   2  
ATOM 3784  H HB   . VAL A 1 113 ? -13.785 -5.985  3.245   1.00 0.00 ? 113 VAL A HB   2  
ATOM 3785  H HG11 . VAL A 1 113 ? -15.860 -4.873  5.122   1.00 0.00 ? 113 VAL A HG11 2  
ATOM 3786  H HG12 . VAL A 1 113 ? -16.085 -5.426  3.462   1.00 0.00 ? 113 VAL A HG12 2  
ATOM 3787  H HG13 . VAL A 1 113 ? -15.717 -6.588  4.737   1.00 0.00 ? 113 VAL A HG13 2  
ATOM 3788  H HG21 . VAL A 1 113 ? -13.642 -3.796  2.765   1.00 0.00 ? 113 VAL A HG21 2  
ATOM 3789  H HG22 . VAL A 1 113 ? -14.512 -3.317  4.222   1.00 0.00 ? 113 VAL A HG22 2  
ATOM 3790  H HG23 . VAL A 1 113 ? -12.789 -3.684  4.305   1.00 0.00 ? 113 VAL A HG23 2  
ATOM 3791  N N    . PRO A 1 114 ? -13.983 -7.967  6.378   1.00 0.00 ? 114 PRO A N    2  
ATOM 3792  C CA   . PRO A 1 114 ? -14.149 -9.413  6.557   1.00 0.00 ? 114 PRO A CA   2  
ATOM 3793  C C    . PRO A 1 114 ? -15.067 -10.025 5.505   1.00 0.00 ? 114 PRO A C    2  
ATOM 3794  O O    . PRO A 1 114 ? -15.592 -9.323  4.643   1.00 0.00 ? 114 PRO A O    2  
ATOM 3795  C CB   . PRO A 1 114 ? -14.778 -9.528  7.948   1.00 0.00 ? 114 PRO A CB   2  
ATOM 3796  C CG   . PRO A 1 114 ? -15.472 -8.227  8.159   1.00 0.00 ? 114 PRO A CG   2  
ATOM 3797  C CD   . PRO A 1 114 ? -14.644 -7.195  7.444   1.00 0.00 ? 114 PRO A CD   2  
ATOM 3798  H HA   . PRO A 1 114 ? -13.198 -9.926  6.547   1.00 0.00 ? 114 PRO A HA   2  
ATOM 3799  H HB2  . PRO A 1 114 ? -15.474 -10.355 7.964   1.00 0.00 ? 114 PRO A HB2  2  
ATOM 3800  H HB3  . PRO A 1 114 ? -14.005 -9.687  8.685   1.00 0.00 ? 114 PRO A HB3  2  
ATOM 3801  H HG2  . PRO A 1 114 ? -16.465 -8.268  7.738   1.00 0.00 ? 114 PRO A HG2  2  
ATOM 3802  H HG3  . PRO A 1 114 ? -15.519 -8.003  9.214   1.00 0.00 ? 114 PRO A HG3  2  
ATOM 3803  H HD2  . PRO A 1 114 ? -15.277 -6.426  7.026   1.00 0.00 ? 114 PRO A HD2  2  
ATOM 3804  H HD3  . PRO A 1 114 ? -13.916 -6.764  8.115   1.00 0.00 ? 114 PRO A HD3  2  
ATOM 3805  N N    . GLU A 1 115 ? -15.255 -11.339 5.583   1.00 0.00 ? 115 GLU A N    2  
ATOM 3806  C CA   . GLU A 1 115 ? -16.110 -12.045 4.636   1.00 0.00 ? 115 GLU A CA   2  
ATOM 3807  C C    . GLU A 1 115 ? -17.504 -12.262 5.218   1.00 0.00 ? 115 GLU A C    2  
ATOM 3808  O O    . GLU A 1 115 ? -18.509 -11.942 4.583   1.00 0.00 ? 115 GLU A O    2  
ATOM 3809  C CB   . GLU A 1 115 ? -15.488 -13.391 4.259   1.00 0.00 ? 115 GLU A CB   2  
ATOM 3810  C CG   . GLU A 1 115 ? -14.252 -13.267 3.384   1.00 0.00 ? 115 GLU A CG   2  
ATOM 3811  C CD   . GLU A 1 115 ? -13.855 -14.583 2.744   1.00 0.00 ? 115 GLU A CD   2  
ATOM 3812  O OE1  . GLU A 1 115 ? -14.376 -14.891 1.650   1.00 0.00 ? 115 GLU A OE1  2  
ATOM 3813  O OE2  . GLU A 1 115 ? -13.026 -15.306 3.335   1.00 0.00 ? 115 GLU A OE2  2  
ATOM 3814  H H    . GLU A 1 115 ? -14.808 -11.845 6.294   1.00 0.00 ? 115 GLU A H    2  
ATOM 3815  H HA   . GLU A 1 115 ? -16.194 -11.437 3.748   1.00 0.00 ? 115 GLU A HA   2  
ATOM 3816  H HB2  . GLU A 1 115 ? -15.213 -13.913 5.163   1.00 0.00 ? 115 GLU A HB2  2  
ATOM 3817  H HB3  . GLU A 1 115 ? -16.223 -13.977 3.726   1.00 0.00 ? 115 GLU A HB3  2  
ATOM 3818  H HG2  . GLU A 1 115 ? -14.450 -12.549 2.602   1.00 0.00 ? 115 GLU A HG2  2  
ATOM 3819  H HG3  . GLU A 1 115 ? -13.430 -12.917 3.992   1.00 0.00 ? 115 GLU A HG3  2  
ATOM 3820  N N    . SER A 1 116 ? -17.555 -12.807 6.429   1.00 0.00 ? 116 SER A N    2  
ATOM 3821  C CA   . SER A 1 116 ? -18.825 -13.071 7.095   1.00 0.00 ? 116 SER A CA   2  
ATOM 3822  C C    . SER A 1 116 ? -19.591 -11.774 7.338   1.00 0.00 ? 116 SER A C    2  
ATOM 3823  O O    . SER A 1 116 ? -18.998 -10.735 7.626   1.00 0.00 ? 116 SER A O    2  
ATOM 3824  C CB   . SER A 1 116 ? -18.588 -13.793 8.423   1.00 0.00 ? 116 SER A CB   2  
ATOM 3825  O OG   . SER A 1 116 ? -18.150 -12.889 9.424   1.00 0.00 ? 116 SER A OG   2  
ATOM 3826  H H    . SER A 1 116 ? -16.718 -13.040 6.884   1.00 0.00 ? 116 SER A H    2  
ATOM 3827  H HA   . SER A 1 116 ? -19.412 -13.706 6.450   1.00 0.00 ? 116 SER A HA   2  
ATOM 3828  H HB2  . SER A 1 116 ? -19.508 -14.253 8.749   1.00 0.00 ? 116 SER A HB2  2  
ATOM 3829  H HB3  . SER A 1 116 ? -17.833 -14.553 8.286   1.00 0.00 ? 116 SER A HB3  2  
ATOM 3830  H HG   . SER A 1 116 ? -17.229 -12.665 9.272   1.00 0.00 ? 116 SER A HG   2  
ATOM 3831  N N    . GLY A 1 117 ? -20.913 -11.843 7.219   1.00 0.00 ? 117 GLY A N    2  
ATOM 3832  C CA   . GLY A 1 117 ? -21.740 -10.669 7.429   1.00 0.00 ? 117 GLY A CA   2  
ATOM 3833  C C    . GLY A 1 117 ? -21.655 -9.688  6.277   1.00 0.00 ? 117 GLY A C    2  
ATOM 3834  O O    . GLY A 1 117 ? -20.643 -9.599  5.582   1.00 0.00 ? 117 GLY A O    2  
ATOM 3835  H H    . GLY A 1 117 ? -21.331 -12.699 6.988   1.00 0.00 ? 117 GLY A H    2  
ATOM 3836  H HA2  . GLY A 1 117 ? -22.766 -10.981 7.548   1.00 0.00 ? 117 GLY A HA2  2  
ATOM 3837  H HA3  . GLY A 1 117 ? -21.418 -10.173 8.333   1.00 0.00 ? 117 GLY A HA3  2  
ATOM 3838  N N    . PRO A 1 118 ? -22.740 -8.929  6.059   1.00 0.00 ? 118 PRO A N    2  
ATOM 3839  C CA   . PRO A 1 118 ? -22.809 -7.937  4.983   1.00 0.00 ? 118 PRO A CA   2  
ATOM 3840  C C    . PRO A 1 118 ? -21.902 -6.738  5.240   1.00 0.00 ? 118 PRO A C    2  
ATOM 3841  O O    . PRO A 1 118 ? -21.868 -6.200  6.346   1.00 0.00 ? 118 PRO A O    2  
ATOM 3842  C CB   . PRO A 1 118 ? -24.278 -7.507  4.991   1.00 0.00 ? 118 PRO A CB   2  
ATOM 3843  C CG   . PRO A 1 118 ? -24.743 -7.772  6.382   1.00 0.00 ? 118 PRO A CG   2  
ATOM 3844  C CD   . PRO A 1 118 ? -23.982 -8.982  6.849   1.00 0.00 ? 118 PRO A CD   2  
ATOM 3845  H HA   . PRO A 1 118 ? -22.565 -8.373  4.025   1.00 0.00 ? 118 PRO A HA   2  
ATOM 3846  H HB2  . PRO A 1 118 ? -24.350 -6.457  4.743   1.00 0.00 ? 118 PRO A HB2  2  
ATOM 3847  H HB3  . PRO A 1 118 ? -24.832 -8.091  4.272   1.00 0.00 ? 118 PRO A HB3  2  
ATOM 3848  H HG2  . PRO A 1 118 ? -24.521 -6.923  7.011   1.00 0.00 ? 118 PRO A HG2  2  
ATOM 3849  H HG3  . PRO A 1 118 ? -25.804 -7.974  6.381   1.00 0.00 ? 118 PRO A HG3  2  
ATOM 3850  H HD2  . PRO A 1 118 ? -23.771 -8.910  7.905   1.00 0.00 ? 118 PRO A HD2  2  
ATOM 3851  H HD3  . PRO A 1 118 ? -24.537 -9.883  6.633   1.00 0.00 ? 118 PRO A HD3  2  
ATOM 3852  N N    . SER A 1 119 ? -21.169 -6.326  4.211   1.00 0.00 ? 119 SER A N    2  
ATOM 3853  C CA   . SER A 1 119 ? -20.259 -5.192  4.327   1.00 0.00 ? 119 SER A CA   2  
ATOM 3854  C C    . SER A 1 119 ? -21.033 -3.889  4.498   1.00 0.00 ? 119 SER A C    2  
ATOM 3855  O O    . SER A 1 119 ? -22.166 -3.762  4.035   1.00 0.00 ? 119 SER A O    2  
ATOM 3856  C CB   . SER A 1 119 ? -19.359 -5.106  3.092   1.00 0.00 ? 119 SER A CB   2  
ATOM 3857  O OG   . SER A 1 119 ? -18.562 -3.934  3.123   1.00 0.00 ? 119 SER A OG   2  
ATOM 3858  H H    . SER A 1 119 ? -21.240 -6.796  3.354   1.00 0.00 ? 119 SER A H    2  
ATOM 3859  H HA   . SER A 1 119 ? -19.643 -5.349  5.200   1.00 0.00 ? 119 SER A HA   2  
ATOM 3860  H HB2  . SER A 1 119 ? -18.709 -5.967  3.062   1.00 0.00 ? 119 SER A HB2  2  
ATOM 3861  H HB3  . SER A 1 119 ? -19.973 -5.086  2.203   1.00 0.00 ? 119 SER A HB3  2  
ATOM 3862  H HG   . SER A 1 119 ? -18.297 -3.750  4.027   1.00 0.00 ? 119 SER A HG   2  
ATOM 3863  N N    . SER A 1 120 ? -20.412 -2.923  5.167   1.00 0.00 ? 120 SER A N    2  
ATOM 3864  C CA   . SER A 1 120 ? -21.043 -1.630  5.404   1.00 0.00 ? 120 SER A CA   2  
ATOM 3865  C C    . SER A 1 120 ? -20.937 -0.739  4.170   1.00 0.00 ? 120 SER A C    2  
ATOM 3866  O O    . SER A 1 120 ? -19.913 -0.723  3.488   1.00 0.00 ? 120 SER A O    2  
ATOM 3867  C CB   . SER A 1 120 ? -20.396 -0.935  6.605   1.00 0.00 ? 120 SER A CB   2  
ATOM 3868  O OG   . SER A 1 120 ? -20.936 -1.416  7.823   1.00 0.00 ? 120 SER A OG   2  
ATOM 3869  H H    . SER A 1 120 ? -19.508 -3.085  5.512   1.00 0.00 ? 120 SER A H    2  
ATOM 3870  H HA   . SER A 1 120 ? -22.086 -1.805  5.620   1.00 0.00 ? 120 SER A HA   2  
ATOM 3871  H HB2  . SER A 1 120 ? -19.333 -1.123  6.597   1.00 0.00 ? 120 SER A HB2  2  
ATOM 3872  H HB3  . SER A 1 120 ? -20.574 0.128   6.540   1.00 0.00 ? 120 SER A HB3  2  
ATOM 3873  H HG   . SER A 1 120 ? -21.784 -1.834  7.656   1.00 0.00 ? 120 SER A HG   2  
ATOM 3874  N N    . GLY A 1 121 ? -22.005 0.001   3.889   1.00 0.00 ? 121 GLY A N    2  
ATOM 3875  C CA   . GLY A 1 121 ? -22.013 0.884   2.737   1.00 0.00 ? 121 GLY A CA   2  
ATOM 3876  C C    . GLY A 1 121 ? -22.938 0.396   1.639   1.00 0.00 ? 121 GLY A C    2  
ATOM 3877  O O    . GLY A 1 121 ? -22.699 0.650   0.459   1.00 0.00 ? 121 GLY A O    2  
ATOM 3878  H H    . GLY A 1 121 ? -22.794 -0.053  4.468   1.00 0.00 ? 121 GLY A H    2  
ATOM 3879  H HA2  . GLY A 1 121 ? -22.332 1.866   3.052   1.00 0.00 ? 121 GLY A HA2  2  
ATOM 3880  H HA3  . GLY A 1 121 ? -21.010 0.952   2.343   1.00 0.00 ? 121 GLY A HA3  2  
ATOM 3881  N N    . GLY A 1 1   ? -19.811 -24.670 -5.820  1.00 0.00 ? 1   GLY A N    3  
ATOM 3882  C CA   . GLY A 1 1   ? -19.617 -24.946 -4.408  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3883  C C    . GLY A 1 1   ? -19.822 -23.718 -3.543  1.00 0.00 ? 1   GLY A C    3  
ATOM 3884  O O    . GLY A 1 1   ? -20.890 -23.107 -3.564  1.00 0.00 ? 1   GLY A O    3  
ATOM 3885  H H1   . GLY A 1 1   ? -20.449 -23.979 -6.098  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3886  H HA2  . GLY A 1 1   ? -20.317 -25.710 -4.103  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3887  H HA3  . GLY A 1 1   ? -18.612 -25.313 -4.260  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3888  N N    . SER A 1 2   ? -18.796 -23.357 -2.780  1.00 0.00 ? 2   SER A N    3  
ATOM 3889  C CA   . SER A 1 2   ? -18.870 -22.197 -1.899  1.00 0.00 ? 2   SER A CA   3  
ATOM 3890  C C    . SER A 1 2   ? -17.506 -21.526 -1.769  1.00 0.00 ? 2   SER A C    3  
ATOM 3891  O O    . SER A 1 2   ? -16.506 -22.180 -1.471  1.00 0.00 ? 2   SER A O    3  
ATOM 3892  C CB   . SER A 1 2   ? -19.381 -22.611 -0.518  1.00 0.00 ? 2   SER A CB   3  
ATOM 3893  O OG   . SER A 1 2   ? -20.067 -21.543 0.113   1.00 0.00 ? 2   SER A OG   3  
ATOM 3894  H H    . SER A 1 2   ? -17.970 -23.885 -2.808  1.00 0.00 ? 2   SER A H    3  
ATOM 3895  H HA   . SER A 1 2   ? -19.564 -21.494 -2.335  1.00 0.00 ? 2   SER A HA   3  
ATOM 3896  H HB2  . SER A 1 2   ? -20.058 -23.445 -0.622  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3897  H HB3  . SER A 1 2   ? -18.545 -22.901 0.101   1.00 0.00 ? 2   SER A HB3  3  
ATOM 3898  H HG   . SER A 1 2   ? -19.485 -21.118 0.747   1.00 0.00 ? 2   SER A HG   3  
ATOM 3899  N N    . SER A 1 3   ? -17.474 -20.216 -1.993  1.00 0.00 ? 3   SER A N    3  
ATOM 3900  C CA   . SER A 1 3   ? -16.233 -19.456 -1.905  1.00 0.00 ? 3   SER A CA   3  
ATOM 3901  C C    . SER A 1 3   ? -16.400 -18.247 -0.989  1.00 0.00 ? 3   SER A C    3  
ATOM 3902  O O    . SER A 1 3   ? -17.514 -17.781 -0.755  1.00 0.00 ? 3   SER A O    3  
ATOM 3903  C CB   . SER A 1 3   ? -15.790 -18.998 -3.296  1.00 0.00 ? 3   SER A CB   3  
ATOM 3904  O OG   . SER A 1 3   ? -16.789 -18.204 -3.913  1.00 0.00 ? 3   SER A OG   3  
ATOM 3905  H H    . SER A 1 3   ? -18.304 -19.751 -2.226  1.00 0.00 ? 3   SER A H    3  
ATOM 3906  H HA   . SER A 1 3   ? -15.475 -20.104 -1.491  1.00 0.00 ? 3   SER A HA   3  
ATOM 3907  H HB2  . SER A 1 3   ? -14.886 -18.414 -3.210  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3908  H HB3  . SER A 1 3   ? -15.602 -19.864 -3.914  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3909  H HG   . SER A 1 3   ? -16.676 -17.287 -3.652  1.00 0.00 ? 3   SER A HG   3  
ATOM 3910  N N    . GLY A 1 4   ? -15.283 -17.745 -0.472  1.00 0.00 ? 4   GLY A N    3  
ATOM 3911  C CA   . GLY A 1 4   ? -15.326 -16.596 0.413   1.00 0.00 ? 4   GLY A CA   3  
ATOM 3912  C C    . GLY A 1 4   ? -13.956 -16.220 0.944   1.00 0.00 ? 4   GLY A C    3  
ATOM 3913  O O    . GLY A 1 4   ? -13.763 -16.100 2.153   1.00 0.00 ? 4   GLY A O    3  
ATOM 3914  H H    . GLY A 1 4   ? -14.422 -18.158 -0.693  1.00 0.00 ? 4   GLY A H    3  
ATOM 3915  H HA2  . GLY A 1 4   ? -15.735 -15.755 -0.127  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3916  H HA3  . GLY A 1 4   ? -15.972 -16.823 1.248   1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3917  N N    . SER A 1 5   ? -13.002 -16.036 0.037   1.00 0.00 ? 5   SER A N    3  
ATOM 3918  C CA   . SER A 1 5   ? -11.642 -15.678 0.420   1.00 0.00 ? 5   SER A CA   3  
ATOM 3919  C C    . SER A 1 5   ? -11.064 -14.639 -0.536  1.00 0.00 ? 5   SER A C    3  
ATOM 3920  O O    . SER A 1 5   ? -11.481 -14.541 -1.690  1.00 0.00 ? 5   SER A O    3  
ATOM 3921  C CB   . SER A 1 5   ? -10.751 -16.921 0.440   1.00 0.00 ? 5   SER A CB   3  
ATOM 3922  O OG   . SER A 1 5   ? -9.703  -16.782 1.384   1.00 0.00 ? 5   SER A OG   3  
ATOM 3923  H H    . SER A 1 5   ? -13.218 -16.147 -0.913  1.00 0.00 ? 5   SER A H    3  
ATOM 3924  H HA   . SER A 1 5   ? -11.678 -15.255 1.413   1.00 0.00 ? 5   SER A HA   3  
ATOM 3925  H HB2  . SER A 1 5   ? -11.345 -17.783 0.704   1.00 0.00 ? 5   SER A HB2  3  
ATOM 3926  H HB3  . SER A 1 5   ? -10.320 -17.068 -0.540  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3927  H HG   . SER A 1 5   ? -8.910  -17.206 1.047   1.00 0.00 ? 5   SER A HG   3  
ATOM 3928  N N    . SER A 1 6   ? -10.100 -13.865 -0.047  1.00 0.00 ? 6   SER A N    3  
ATOM 3929  C CA   . SER A 1 6   ? -9.466  -12.831 -0.856  1.00 0.00 ? 6   SER A CA   3  
ATOM 3930  C C    . SER A 1 6   ? -8.310  -13.408 -1.668  1.00 0.00 ? 6   SER A C    3  
ATOM 3931  O O    . SER A 1 6   ? -8.300  -13.330 -2.896  1.00 0.00 ? 6   SER A O    3  
ATOM 3932  C CB   . SER A 1 6   ? -8.960  -11.695 0.036   1.00 0.00 ? 6   SER A CB   3  
ATOM 3933  O OG   . SER A 1 6   ? -10.039 -10.966 0.594   1.00 0.00 ? 6   SER A OG   3  
ATOM 3934  H H    . SER A 1 6   ? -9.810  -13.992 0.881   1.00 0.00 ? 6   SER A H    3  
ATOM 3935  H HA   . SER A 1 6   ? -10.208 -12.440 -1.535  1.00 0.00 ? 6   SER A HA   3  
ATOM 3936  H HB2  . SER A 1 6   ? -8.367  -12.108 0.838   1.00 0.00 ? 6   SER A HB2  3  
ATOM 3937  H HB3  . SER A 1 6   ? -8.352  -11.023 -0.552  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3938  H HG   . SER A 1 6   ? -9.697  -10.245 1.128   1.00 0.00 ? 6   SER A HG   3  
ATOM 3939  N N    . GLY A 1 7   ? -7.338  -13.988 -0.972  1.00 0.00 ? 7   GLY A N    3  
ATOM 3940  C CA   . GLY A 1 7   ? -6.190  -14.570 -1.643  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3941  C C    . GLY A 1 7   ? -4.922  -14.467 -0.820  1.00 0.00 ? 7   GLY A C    3  
ATOM 3942  O O    . GLY A 1 7   ? -4.929  -14.739 0.381   1.00 0.00 ? 7   GLY A O    3  
ATOM 3943  H H    . GLY A 1 7   ? -7.399  -14.021 0.006   1.00 0.00 ? 7   GLY A H    3  
ATOM 3944  H HA2  . GLY A 1 7   ? -6.394  -15.612 -1.843  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3945  H HA3  . GLY A 1 7   ? -6.039  -14.057 -2.582  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3946  N N    . LYS A 1 8   ? -3.829  -14.076 -1.466  1.00 0.00 ? 8   LYS A N    3  
ATOM 3947  C CA   . LYS A 1 8   ? -2.546  -13.937 -0.786  1.00 0.00 ? 8   LYS A CA   3  
ATOM 3948  C C    . LYS A 1 8   ? -2.397  -12.544 -0.183  1.00 0.00 ? 8   LYS A C    3  
ATOM 3949  O O    . LYS A 1 8   ? -2.287  -12.392 1.035   1.00 0.00 ? 8   LYS A O    3  
ATOM 3950  C CB   . LYS A 1 8   ? -1.398  -14.208 -1.760  1.00 0.00 ? 8   LYS A CB   3  
ATOM 3951  C CG   . LYS A 1 8   ? -0.975  -15.666 -1.812  1.00 0.00 ? 8   LYS A CG   3  
ATOM 3952  C CD   . LYS A 1 8   ? -1.808  -16.454 -2.809  1.00 0.00 ? 8   LYS A CD   3  
ATOM 3953  C CE   . LYS A 1 8   ? -3.047  -17.046 -2.154  1.00 0.00 ? 8   LYS A CE   3  
ATOM 3954  N NZ   . LYS A 1 8   ? -2.735  -18.292 -1.401  1.00 0.00 ? 8   LYS A NZ   3  
ATOM 3955  H H    . LYS A 1 8   ? -3.887  -13.873 -2.423  1.00 0.00 ? 8   LYS A H    3  
ATOM 3956  H HA   . LYS A 1 8   ? -2.512  -14.667 0.009   1.00 0.00 ? 8   LYS A HA   3  
ATOM 3957  H HB2  . LYS A 1 8   ? -1.705  -13.909 -2.752  1.00 0.00 ? 8   LYS A HB2  3  
ATOM 3958  H HB3  . LYS A 1 8   ? -0.543  -13.618 -1.464  1.00 0.00 ? 8   LYS A HB3  3  
ATOM 3959  H HG2  . LYS A 1 8   ? 0.063   -15.721 -2.105  1.00 0.00 ? 8   LYS A HG2  3  
ATOM 3960  H HG3  . LYS A 1 8   ? -1.097  -16.102 -0.830  1.00 0.00 ? 8   LYS A HG3  3  
ATOM 3961  H HD2  . LYS A 1 8   ? -2.117  -15.796 -3.607  1.00 0.00 ? 8   LYS A HD2  3  
ATOM 3962  H HD3  . LYS A 1 8   ? -1.207  -17.256 -3.213  1.00 0.00 ? 8   LYS A HD3  3  
ATOM 3963  H HE2  . LYS A 1 8   ? -3.462  -16.318 -1.474  1.00 0.00 ? 8   LYS A HE2  3  
ATOM 3964  H HE3  . LYS A 1 8   ? -3.771  -17.272 -2.923  1.00 0.00 ? 8   LYS A HE3  3  
ATOM 3965  H HZ1  . LYS A 1 8   ? -1.933  -18.785 -1.843  1.00 0.00 ? 8   LYS A HZ1  3  
ATOM 3966  H HZ2  . LYS A 1 8   ? -3.560  -18.925 -1.400  1.00 0.00 ? 8   LYS A HZ2  3  
ATOM 3967  H HZ3  . LYS A 1 8   ? -2.487  -18.062 -0.417  1.00 0.00 ? 8   LYS A HZ3  3  
ATOM 3968  N N    . LEU A 1 9   ? -2.397  -11.530 -1.041  1.00 0.00 ? 9   LEU A N    3  
ATOM 3969  C CA   . LEU A 1 9   ? -2.263  -10.149 -0.592  1.00 0.00 ? 9   LEU A CA   3  
ATOM 3970  C C    . LEU A 1 9   ? -2.950  -9.944  0.754   1.00 0.00 ? 9   LEU A C    3  
ATOM 3971  O O    . LEU A 1 9   ? -2.333  -9.479  1.712   1.00 0.00 ? 9   LEU A O    3  
ATOM 3972  C CB   . LEU A 1 9   ? -2.857  -9.195  -1.631  1.00 0.00 ? 9   LEU A CB   3  
ATOM 3973  C CG   . LEU A 1 9   ? -2.907  -7.719  -1.235  1.00 0.00 ? 9   LEU A CG   3  
ATOM 3974  C CD1  . LEU A 1 9   ? -1.623  -7.013  -1.640  1.00 0.00 ? 9   LEU A CD1  3  
ATOM 3975  C CD2  . LEU A 1 9   ? -4.114  -7.039  -1.865  1.00 0.00 ? 9   LEU A CD2  3  
ATOM 3976  H H    . LEU A 1 9   ? -2.488  -11.714 -1.999  1.00 0.00 ? 9   LEU A H    3  
ATOM 3977  H HA   . LEU A 1 9   ? -1.210  -9.937  -0.481  1.00 0.00 ? 9   LEU A HA   3  
ATOM 3978  H HB2  . LEU A 1 9   ? -2.266  -9.276  -2.530  1.00 0.00 ? 9   LEU A HB2  3  
ATOM 3979  H HB3  . LEU A 1 9   ? -3.867  -9.518  -1.836  1.00 0.00 ? 9   LEU A HB3  3  
ATOM 3980  H HG   . LEU A 1 9   ? -3.004  -7.644  -0.160  1.00 0.00 ? 9   LEU A HG   3  
ATOM 3981  H HD11 . LEU A 1 9   ? -1.854  -6.205  -2.317  1.00 0.00 ? 9   LEU A HD11 3  
ATOM 3982  H HD12 . LEU A 1 9   ? -0.965  -7.716  -2.131  1.00 0.00 ? 9   LEU A HD12 3  
ATOM 3983  H HD13 . LEU A 1 9   ? -1.135  -6.619  -0.760  1.00 0.00 ? 9   LEU A HD13 3  
ATOM 3984  H HD21 . LEU A 1 9   ? -5.003  -7.614  -1.653  1.00 0.00 ? 9   LEU A HD21 3  
ATOM 3985  H HD22 . LEU A 1 9   ? -3.973  -6.976  -2.935  1.00 0.00 ? 9   LEU A HD22 3  
ATOM 3986  H HD23 . LEU A 1 9   ? -4.221  -6.045  -1.457  1.00 0.00 ? 9   LEU A HD23 3  
ATOM 3987  N N    . ARG A 1 10  ? -4.230  -10.297 0.819   1.00 0.00 ? 10  ARG A N    3  
ATOM 3988  C CA   . ARG A 1 10  ? -5.000  -10.154 2.049   1.00 0.00 ? 10  ARG A CA   3  
ATOM 3989  C C    . ARG A 1 10  ? -4.128  -10.425 3.271   1.00 0.00 ? 10  ARG A C    3  
ATOM 3990  O O    . ARG A 1 10  ? -3.871  -9.528  4.073   1.00 0.00 ? 10  ARG A O    3  
ATOM 3991  C CB   . ARG A 1 10  ? -6.197  -11.107 2.040   1.00 0.00 ? 10  ARG A CB   3  
ATOM 3992  C CG   . ARG A 1 10  ? -7.209  -10.823 3.137   1.00 0.00 ? 10  ARG A CG   3  
ATOM 3993  C CD   . ARG A 1 10  ? -6.852  -11.546 4.426   1.00 0.00 ? 10  ARG A CD   3  
ATOM 3994  N NE   . ARG A 1 10  ? -7.520  -10.960 5.586   1.00 0.00 ? 10  ARG A NE   3  
ATOM 3995  C CZ   . ARG A 1 10  ? -7.674  -11.594 6.743   1.00 0.00 ? 10  ARG A CZ   3  
ATOM 3996  N NH1  . ARG A 1 10  ? -7.210  -12.827 6.894   1.00 0.00 ? 10  ARG A NH1  3  
ATOM 3997  N NH2  . ARG A 1 10  ? -8.294  -10.995 7.751   1.00 0.00 ? 10  ARG A NH2  3  
ATOM 3998  H H    . ARG A 1 10  ? -4.666  -10.662 0.021   1.00 0.00 ? 10  ARG A H    3  
ATOM 3999  H HA   . ARG A 1 10  ? -5.361  -9.137  2.097   1.00 0.00 ? 10  ARG A HA   3  
ATOM 4000  H HB2  . ARG A 1 10  ? -6.699  -11.027 1.087   1.00 0.00 ? 10  ARG A HB2  3  
ATOM 4001  H HB3  . ARG A 1 10  ? -5.837  -12.117 2.165   1.00 0.00 ? 10  ARG A HB3  3  
ATOM 4002  H HG2  . ARG A 1 10  ? -7.231  -9.760  3.328   1.00 0.00 ? 10  ARG A HG2  3  
ATOM 4003  H HG3  . ARG A 1 10  ? -8.184  -11.152 2.808   1.00 0.00 ? 10  ARG A HG3  3  
ATOM 4004  H HD2  . ARG A 1 10  ? -7.147  -12.580 4.337   1.00 0.00 ? 10  ARG A HD2  3  
ATOM 4005  H HD3  . ARG A 1 10  ? -5.783  -11.488 4.571   1.00 0.00 ? 10  ARG A HD3  3  
ATOM 4006  H HE   . ARG A 1 10  ? -7.871  -10.050 5.496   1.00 0.00 ? 10  ARG A HE   3  
ATOM 4007  H HH11 . ARG A 1 10  ? -6.742  -13.280 6.136   1.00 0.00 ? 10  ARG A HH11 3  
ATOM 4008  H HH12 . ARG A 1 10  ? -7.326  -13.302 7.767   1.00 0.00 ? 10  ARG A HH12 3  
ATOM 4009  H HH21 . ARG A 1 10  ? -8.645  -10.066 7.641   1.00 0.00 ? 10  ARG A HH21 3  
ATOM 4010  H HH22 . ARG A 1 10  ? -8.410  -11.473 8.622   1.00 0.00 ? 10  ARG A HH22 3  
ATOM 4011  N N    . GLN A 1 11  ? -3.679  -11.669 3.407   1.00 0.00 ? 11  GLN A N    3  
ATOM 4012  C CA   . GLN A 1 11  ? -2.838  -12.058 4.532   1.00 0.00 ? 11  GLN A CA   3  
ATOM 4013  C C    . GLN A 1 11  ? -1.432  -11.486 4.384   1.00 0.00 ? 11  GLN A C    3  
ATOM 4014  O O    . GLN A 1 11  ? -0.921  -10.827 5.290   1.00 0.00 ? 11  GLN A O    3  
ATOM 4015  C CB   . GLN A 1 11  ? -2.772  -13.582 4.644   1.00 0.00 ? 11  GLN A CB   3  
ATOM 4016  C CG   . GLN A 1 11  ? -1.771  -14.074 5.677   1.00 0.00 ? 11  GLN A CG   3  
ATOM 4017  C CD   . GLN A 1 11  ? -2.341  -14.086 7.082   1.00 0.00 ? 11  GLN A CD   3  
ATOM 4018  O OE1  . GLN A 1 11  ? -2.718  -15.137 7.602   1.00 0.00 ? 11  GLN A OE1  3  
ATOM 4019  N NE2  . GLN A 1 11  ? -2.407  -12.916 7.705   1.00 0.00 ? 11  GLN A NE2  3  
ATOM 4020  H H    . GLN A 1 11  ? -3.919  -12.340 2.735   1.00 0.00 ? 11  GLN A H    3  
ATOM 4021  H HA   . GLN A 1 11  ? -3.282  -11.659 5.432   1.00 0.00 ? 11  GLN A HA   3  
ATOM 4022  H HB2  . GLN A 1 11  ? -3.749  -13.954 4.915   1.00 0.00 ? 11  GLN A HB2  3  
ATOM 4023  H HB3  . GLN A 1 11  ? -2.494  -13.990 3.683   1.00 0.00 ? 11  GLN A HB3  3  
ATOM 4024  H HG2  . GLN A 1 11  ? -1.471  -15.079 5.419   1.00 0.00 ? 11  GLN A HG2  3  
ATOM 4025  H HG3  . GLN A 1 11  ? -0.908  -13.425 5.660   1.00 0.00 ? 11  GLN A HG3  3  
ATOM 4026  H HE21 . GLN A 1 11  ? -2.090  -12.120 7.228   1.00 0.00 ? 11  GLN A HE21 3  
ATOM 4027  H HE22 . GLN A 1 11  ? -2.772  -12.894 8.613   1.00 0.00 ? 11  GLN A HE22 3  
ATOM 4028  N N    . TRP A 1 12  ? -0.812  -11.743 3.238   1.00 0.00 ? 12  TRP A N    3  
ATOM 4029  C CA   . TRP A 1 12  ? 0.536   -11.254 2.972   1.00 0.00 ? 12  TRP A CA   3  
ATOM 4030  C C    . TRP A 1 12  ? 0.738   -9.865  3.567   1.00 0.00 ? 12  TRP A C    3  
ATOM 4031  O O    . TRP A 1 12  ? 1.594   -9.667  4.431   1.00 0.00 ? 12  TRP A O    3  
ATOM 4032  C CB   . TRP A 1 12  ? 0.801   -11.221 1.466   1.00 0.00 ? 12  TRP A CB   3  
ATOM 4033  C CG   . TRP A 1 12  ? 2.164   -10.706 1.114   1.00 0.00 ? 12  TRP A CG   3  
ATOM 4034  C CD1  . TRP A 1 12  ? 3.319   -11.431 1.036   1.00 0.00 ? 12  TRP A CD1  3  
ATOM 4035  C CD2  . TRP A 1 12  ? 2.513   -9.355  0.794   1.00 0.00 ? 12  TRP A CD2  3  
ATOM 4036  N NE1  . TRP A 1 12  ? 4.365   -10.611 0.687   1.00 0.00 ? 12  TRP A NE1  3  
ATOM 4037  C CE2  . TRP A 1 12  ? 3.897   -9.334  0.532   1.00 0.00 ? 12  TRP A CE2  3  
ATOM 4038  C CE3  . TRP A 1 12  ? 1.792   -8.162  0.701   1.00 0.00 ? 12  TRP A CE3  3  
ATOM 4039  C CZ2  . TRP A 1 12  ? 4.571   -8.165  0.185   1.00 0.00 ? 12  TRP A CZ2  3  
ATOM 4040  C CZ3  . TRP A 1 12  ? 2.462   -7.003  0.357   1.00 0.00 ? 12  TRP A CZ3  3  
ATOM 4041  C CH2  . TRP A 1 12  ? 3.840   -7.012  0.101   1.00 0.00 ? 12  TRP A CH2  3  
ATOM 4042  H H    . TRP A 1 12  ? -1.271  -12.274 2.554   1.00 0.00 ? 12  TRP A H    3  
ATOM 4043  H HA   . TRP A 1 12  ? 1.233   -11.936 3.436   1.00 0.00 ? 12  TRP A HA   3  
ATOM 4044  H HB2  . TRP A 1 12  ? 0.709   -12.220 1.069   1.00 0.00 ? 12  TRP A HB2  3  
ATOM 4045  H HB3  . TRP A 1 12  ? 0.070   -10.580 0.994   1.00 0.00 ? 12  TRP A HB3  3  
ATOM 4046  H HD1  . TRP A 1 12  ? 3.385   -12.491 1.226   1.00 0.00 ? 12  TRP A HD1  3  
ATOM 4047  H HE1  . TRP A 1 12  ? 5.295   -10.897 0.567   1.00 0.00 ? 12  TRP A HE1  3  
ATOM 4048  H HE3  . TRP A 1 12  ? 0.730   -8.135  0.894   1.00 0.00 ? 12  TRP A HE3  3  
ATOM 4049  H HZ2  . TRP A 1 12  ? 5.632   -8.156  -0.016  1.00 0.00 ? 12  TRP A HZ2  3  
ATOM 4050  H HZ3  . TRP A 1 12  ? 1.921   -6.071  0.281   1.00 0.00 ? 12  TRP A HZ3  3  
ATOM 4051  H HH2  . TRP A 1 12  ? 4.322   -6.084  -0.164  1.00 0.00 ? 12  TRP A HH2  3  
ATOM 4052  N N    . LEU A 1 13  ? -0.053  -8.905  3.101   1.00 0.00 ? 13  LEU A N    3  
ATOM 4053  C CA   . LEU A 1 13  ? 0.039   -7.533  3.588   1.00 0.00 ? 13  LEU A CA   3  
ATOM 4054  C C    . LEU A 1 13  ? -0.060  -7.487  5.110   1.00 0.00 ? 13  LEU A C    3  
ATOM 4055  O O    . LEU A 1 13  ? 0.844   -6.996  5.786   1.00 0.00 ? 13  LEU A O    3  
ATOM 4056  C CB   . LEU A 1 13  ? -1.065  -6.675  2.968   1.00 0.00 ? 13  LEU A CB   3  
ATOM 4057  C CG   . LEU A 1 13  ? -0.969  -5.171  3.222   1.00 0.00 ? 13  LEU A CG   3  
ATOM 4058  C CD1  . LEU A 1 13  ? 0.295   -4.603  2.596   1.00 0.00 ? 13  LEU A CD1  3  
ATOM 4059  C CD2  . LEU A 1 13  ? -2.201  -4.459  2.681   1.00 0.00 ? 13  LEU A CD2  3  
ATOM 4060  H H    . LEU A 1 13  ? -0.716  -9.123  2.413   1.00 0.00 ? 13  LEU A H    3  
ATOM 4061  H HA   . LEU A 1 13  ? 1.000   -7.140  3.290   1.00 0.00 ? 13  LEU A HA   3  
ATOM 4062  H HB2  . LEU A 1 13  ? -1.045  -6.832  1.900   1.00 0.00 ? 13  LEU A HB2  3  
ATOM 4063  H HB3  . LEU A 1 13  ? -2.011  -7.019  3.362   1.00 0.00 ? 13  LEU A HB3  3  
ATOM 4064  H HG   . LEU A 1 13  ? -0.921  -4.995  4.288   1.00 0.00 ? 13  LEU A HG   3  
ATOM 4065  H HD11 . LEU A 1 13  ? 0.230   -4.681  1.521   1.00 0.00 ? 13  LEU A HD11 3  
ATOM 4066  H HD12 . LEU A 1 13  ? 1.151   -5.159  2.947   1.00 0.00 ? 13  LEU A HD12 3  
ATOM 4067  H HD13 . LEU A 1 13  ? 0.400   -3.565  2.876   1.00 0.00 ? 13  LEU A HD13 3  
ATOM 4068  H HD21 . LEU A 1 13  ? -2.929  -5.191  2.365   1.00 0.00 ? 13  LEU A HD21 3  
ATOM 4069  H HD22 . LEU A 1 13  ? -1.920  -3.843  1.839   1.00 0.00 ? 13  LEU A HD22 3  
ATOM 4070  H HD23 . LEU A 1 13  ? -2.627  -3.839  3.456   1.00 0.00 ? 13  LEU A HD23 3  
ATOM 4071  N N    . ILE A 1 14  ? -1.163  -8.005  5.641   1.00 0.00 ? 14  ILE A N    3  
ATOM 4072  C CA   . ILE A 1 14  ? -1.378  -8.026  7.083   1.00 0.00 ? 14  ILE A CA   3  
ATOM 4073  C C    . ILE A 1 14  ? -0.126  -8.492  7.819   1.00 0.00 ? 14  ILE A C    3  
ATOM 4074  O O    . ILE A 1 14  ? 0.243   -7.934  8.852   1.00 0.00 ? 14  ILE A O    3  
ATOM 4075  C CB   . ILE A 1 14  ? -2.555  -8.943  7.463   1.00 0.00 ? 14  ILE A CB   3  
ATOM 4076  C CG1  . ILE A 1 14  ? -3.848  -8.445  6.814   1.00 0.00 ? 14  ILE A CG1  3  
ATOM 4077  C CG2  . ILE A 1 14  ? -2.707  -9.011  8.975   1.00 0.00 ? 14  ILE A CG2  3  
ATOM 4078  C CD1  . ILE A 1 14  ? -4.960  -9.472  6.816   1.00 0.00 ? 14  ILE A CD1  3  
ATOM 4079  H H    . ILE A 1 14  ? -1.847  -8.382  5.050   1.00 0.00 ? 14  ILE A H    3  
ATOM 4080  H HA   . ILE A 1 14  ? -1.615  -7.020  7.399   1.00 0.00 ? 14  ILE A HA   3  
ATOM 4081  H HB   . ILE A 1 14  ? -2.339  -9.937  7.102   1.00 0.00 ? 14  ILE A HB   3  
ATOM 4082  H HG12 . ILE A 1 14  ? -4.200  -7.576  7.347   1.00 0.00 ? 14  ILE A HG12 3  
ATOM 4083  H HG13 . ILE A 1 14  ? -3.646  -8.176  5.787   1.00 0.00 ? 14  ILE A HG13 3  
ATOM 4084  H HG21 . ILE A 1 14  ? -3.454  -8.299  9.294   1.00 0.00 ? 14  ILE A HG21 3  
ATOM 4085  H HG22 . ILE A 1 14  ? -3.014  -10.006 9.261   1.00 0.00 ? 14  ILE A HG22 3  
ATOM 4086  H HG23 . ILE A 1 14  ? -1.763  -8.776  9.443   1.00 0.00 ? 14  ILE A HG23 3  
ATOM 4087  H HD11 . ILE A 1 14  ? -4.870  -10.101 5.943   1.00 0.00 ? 14  ILE A HD11 3  
ATOM 4088  H HD12 . ILE A 1 14  ? -4.889  -10.077 7.706   1.00 0.00 ? 14  ILE A HD12 3  
ATOM 4089  H HD13 . ILE A 1 14  ? -5.915  -8.967  6.798   1.00 0.00 ? 14  ILE A HD13 3  
ATOM 4090  N N    . ASP A 1 15  ? 0.523   -9.518  7.278   1.00 0.00 ? 15  ASP A N    3  
ATOM 4091  C CA   . ASP A 1 15  ? 1.736   -10.058 7.882   1.00 0.00 ? 15  ASP A CA   3  
ATOM 4092  C C    . ASP A 1 15  ? 2.843   -9.009  7.909   1.00 0.00 ? 15  ASP A C    3  
ATOM 4093  O O    . ASP A 1 15  ? 3.627   -8.946  8.856   1.00 0.00 ? 15  ASP A O    3  
ATOM 4094  C CB   . ASP A 1 15  ? 2.206   -11.295 7.114   1.00 0.00 ? 15  ASP A CB   3  
ATOM 4095  C CG   . ASP A 1 15  ? 2.935   -12.284 8.001   1.00 0.00 ? 15  ASP A CG   3  
ATOM 4096  O OD1  . ASP A 1 15  ? 2.381   -12.655 9.057   1.00 0.00 ? 15  ASP A OD1  3  
ATOM 4097  O OD2  . ASP A 1 15  ? 4.061   -12.688 7.640   1.00 0.00 ? 15  ASP A OD2  3  
ATOM 4098  H H    . ASP A 1 15  ? 0.179   -9.921  6.454   1.00 0.00 ? 15  ASP A H    3  
ATOM 4099  H HA   . ASP A 1 15  ? 1.502   -10.343 8.897   1.00 0.00 ? 15  ASP A HA   3  
ATOM 4100  H HB2  . ASP A 1 15  ? 1.348   -11.791 6.683   1.00 0.00 ? 15  ASP A HB2  3  
ATOM 4101  H HB3  . ASP A 1 15  ? 2.873   -10.987 6.323   1.00 0.00 ? 15  ASP A HB3  3  
ATOM 4102  N N    . GLN A 1 16  ? 2.901   -8.191  6.864   1.00 0.00 ? 16  GLN A N    3  
ATOM 4103  C CA   . GLN A 1 16  ? 3.914   -7.146  6.767   1.00 0.00 ? 16  GLN A CA   3  
ATOM 4104  C C    . GLN A 1 16  ? 3.678   -6.061  7.813   1.00 0.00 ? 16  GLN A C    3  
ATOM 4105  O O    . GLN A 1 16  ? 4.621   -5.564  8.429   1.00 0.00 ? 16  GLN A O    3  
ATOM 4106  C CB   . GLN A 1 16  ? 3.911   -6.531  5.367   1.00 0.00 ? 16  GLN A CB   3  
ATOM 4107  C CG   . GLN A 1 16  ? 4.041   -7.556  4.252   1.00 0.00 ? 16  GLN A CG   3  
ATOM 4108  C CD   . GLN A 1 16  ? 5.020   -8.664  4.588   1.00 0.00 ? 16  GLN A CD   3  
ATOM 4109  O OE1  . GLN A 1 16  ? 6.206   -8.414  4.808   1.00 0.00 ? 16  GLN A OE1  3  
ATOM 4110  N NE2  . GLN A 1 16  ? 4.529   -9.897  4.631   1.00 0.00 ? 16  GLN A NE2  3  
ATOM 4111  H H    . GLN A 1 16  ? 2.249   -8.292  6.140   1.00 0.00 ? 16  GLN A H    3  
ATOM 4112  H HA   . GLN A 1 16  ? 4.876   -7.600  6.949   1.00 0.00 ? 16  GLN A HA   3  
ATOM 4113  H HB2  . GLN A 1 16  ? 2.987   -5.992  5.225   1.00 0.00 ? 16  GLN A HB2  3  
ATOM 4114  H HB3  . GLN A 1 16  ? 4.738   -5.840  5.288   1.00 0.00 ? 16  GLN A HB3  3  
ATOM 4115  H HG2  . GLN A 1 16  ? 3.072   -7.997  4.071   1.00 0.00 ? 16  GLN A HG2  3  
ATOM 4116  H HG3  . GLN A 1 16  ? 4.380   -7.055  3.357   1.00 0.00 ? 16  GLN A HG3  3  
ATOM 4117  H HE21 . GLN A 1 16  ? 3.574   -10.020 4.444   1.00 0.00 ? 16  GLN A HE21 3  
ATOM 4118  H HE22 . GLN A 1 16  ? 5.139   -10.631 4.845   1.00 0.00 ? 16  GLN A HE22 3  
ATOM 4119  N N    . ILE A 1 17  ? 2.415   -5.698  8.006   1.00 0.00 ? 17  ILE A N    3  
ATOM 4120  C CA   . ILE A 1 17  ? 2.056   -4.672  8.977   1.00 0.00 ? 17  ILE A CA   3  
ATOM 4121  C C    . ILE A 1 17  ? 2.357   -5.131  10.399  1.00 0.00 ? 17  ILE A C    3  
ATOM 4122  O O    . ILE A 1 17  ? 2.912   -4.380  11.201  1.00 0.00 ? 17  ILE A O    3  
ATOM 4123  C CB   . ILE A 1 17  ? 0.565   -4.298  8.876   1.00 0.00 ? 17  ILE A CB   3  
ATOM 4124  C CG1  . ILE A 1 17  ? 0.189   -3.999  7.423   1.00 0.00 ? 17  ILE A CG1  3  
ATOM 4125  C CG2  . ILE A 1 17  ? 0.257   -3.102  9.765   1.00 0.00 ? 17  ILE A CG2  3  
ATOM 4126  C CD1  . ILE A 1 17  ? -1.287  -4.158  7.136   1.00 0.00 ? 17  ILE A CD1  3  
ATOM 4127  H H    . ILE A 1 17  ? 1.708   -6.130  7.484   1.00 0.00 ? 17  ILE A H    3  
ATOM 4128  H HA   . ILE A 1 17  ? 2.643   -3.790  8.763   1.00 0.00 ? 17  ILE A HA   3  
ATOM 4129  H HB   . ILE A 1 17  ? -0.018  -5.136  9.226   1.00 0.00 ? 17  ILE A HB   3  
ATOM 4130  H HG12 . ILE A 1 17  ? 0.465   -2.983  7.188   1.00 0.00 ? 17  ILE A HG12 3  
ATOM 4131  H HG13 . ILE A 1 17  ? 0.729   -4.673  6.774   1.00 0.00 ? 17  ILE A HG13 3  
ATOM 4132  H HG21 . ILE A 1 17  ? 0.879   -2.268  9.475   1.00 0.00 ? 17  ILE A HG21 3  
ATOM 4133  H HG22 . ILE A 1 17  ? -0.782  -2.831  9.655   1.00 0.00 ? 17  ILE A HG22 3  
ATOM 4134  H HG23 . ILE A 1 17  ? 0.456   -3.359  10.795  1.00 0.00 ? 17  ILE A HG23 3  
ATOM 4135  H HD11 . ILE A 1 17  ? -1.439  -4.257  6.071   1.00 0.00 ? 17  ILE A HD11 3  
ATOM 4136  H HD12 . ILE A 1 17  ? -1.659  -5.039  7.637   1.00 0.00 ? 17  ILE A HD12 3  
ATOM 4137  H HD13 . ILE A 1 17  ? -1.819  -3.288  7.494   1.00 0.00 ? 17  ILE A HD13 3  
ATOM 4138  N N    . ASP A 1 18  ? 1.990   -6.371  10.705  1.00 0.00 ? 18  ASP A N    3  
ATOM 4139  C CA   . ASP A 1 18  ? 2.224   -6.933  12.030  1.00 0.00 ? 18  ASP A CA   3  
ATOM 4140  C C    . ASP A 1 18  ? 3.709   -6.910  12.376  1.00 0.00 ? 18  ASP A C    3  
ATOM 4141  O O    . ASP A 1 18  ? 4.094   -6.528  13.481  1.00 0.00 ? 18  ASP A O    3  
ATOM 4142  C CB   . ASP A 1 18  ? 1.693   -8.365  12.101  1.00 0.00 ? 18  ASP A CB   3  
ATOM 4143  C CG   . ASP A 1 18  ? 1.416   -8.810  13.523  1.00 0.00 ? 18  ASP A CG   3  
ATOM 4144  O OD1  . ASP A 1 18  ? 2.173   -8.405  14.430  1.00 0.00 ? 18  ASP A OD1  3  
ATOM 4145  O OD2  . ASP A 1 18  ? 0.441   -9.563  13.730  1.00 0.00 ? 18  ASP A OD2  3  
ATOM 4146  H H    . ASP A 1 18  ? 1.551   -6.921  10.023  1.00 0.00 ? 18  ASP A H    3  
ATOM 4147  H HA   . ASP A 1 18  ? 1.691   -6.326  12.747  1.00 0.00 ? 18  ASP A HA   3  
ATOM 4148  H HB2  . ASP A 1 18  ? 0.773   -8.430  11.538  1.00 0.00 ? 18  ASP A HB2  3  
ATOM 4149  H HB3  . ASP A 1 18  ? 2.422   -9.034  11.669  1.00 0.00 ? 18  ASP A HB3  3  
ATOM 4150  N N    . SER A 1 19  ? 4.540   -7.323  11.423  1.00 0.00 ? 19  SER A N    3  
ATOM 4151  C CA   . SER A 1 19  ? 5.983   -7.355  11.628  1.00 0.00 ? 19  SER A CA   3  
ATOM 4152  C C    . SER A 1 19  ? 6.532   -5.948  11.847  1.00 0.00 ? 19  SER A C    3  
ATOM 4153  O O    . SER A 1 19  ? 7.479   -5.751  12.607  1.00 0.00 ? 19  SER A O    3  
ATOM 4154  C CB   . SER A 1 19  ? 6.676   -8.003  10.428  1.00 0.00 ? 19  SER A CB   3  
ATOM 4155  O OG   . SER A 1 19  ? 6.201   -7.458  9.209   1.00 0.00 ? 19  SER A OG   3  
ATOM 4156  H H    . SER A 1 19  ? 4.172   -7.615  10.563  1.00 0.00 ? 19  SER A H    3  
ATOM 4157  H HA   . SER A 1 19  ? 6.179   -7.946  12.510  1.00 0.00 ? 19  SER A HA   3  
ATOM 4158  H HB2  . SER A 1 19  ? 7.739   -7.832  10.494  1.00 0.00 ? 19  SER A HB2  3  
ATOM 4159  H HB3  . SER A 1 19  ? 6.480   -9.066  10.434  1.00 0.00 ? 19  SER A HB3  3  
ATOM 4160  H HG   . SER A 1 19  ? 6.105   -6.507  9.299   1.00 0.00 ? 19  SER A HG   3  
ATOM 4161  N N    . GLY A 1 20  ? 5.928   -4.972  11.175  1.00 0.00 ? 20  GLY A N    3  
ATOM 4162  C CA   . GLY A 1 20  ? 6.368   -3.596  11.309  1.00 0.00 ? 20  GLY A CA   3  
ATOM 4163  C C    . GLY A 1 20  ? 7.784   -3.390  10.809  1.00 0.00 ? 20  GLY A C    3  
ATOM 4164  O O    . GLY A 1 20  ? 8.499   -2.510  11.290  1.00 0.00 ? 20  GLY A O    3  
ATOM 4165  H H    . GLY A 1 20  ? 5.177   -5.189  10.584  1.00 0.00 ? 20  GLY A H    3  
ATOM 4166  H HA2  . GLY A 1 20  ? 5.702   -2.960  10.746  1.00 0.00 ? 20  GLY A HA2  3  
ATOM 4167  H HA3  . GLY A 1 20  ? 6.323   -3.316  12.351  1.00 0.00 ? 20  GLY A HA3  3  
ATOM 4168  N N    . LYS A 1 21  ? 8.193   -4.203  9.841   1.00 0.00 ? 21  LYS A N    3  
ATOM 4169  C CA   . LYS A 1 21  ? 9.533   -4.107  9.275   1.00 0.00 ? 21  LYS A CA   3  
ATOM 4170  C C    . LYS A 1 21  ? 9.667   -2.861  8.404   1.00 0.00 ? 21  LYS A C    3  
ATOM 4171  O O    . LYS A 1 21  ? 10.695  -2.184  8.429   1.00 0.00 ? 21  LYS A O    3  
ATOM 4172  C CB   . LYS A 1 21  ? 9.851   -5.356  8.449   1.00 0.00 ? 21  LYS A CB   3  
ATOM 4173  C CG   . LYS A 1 21  ? 9.469   -6.654  9.138   1.00 0.00 ? 21  LYS A CG   3  
ATOM 4174  C CD   . LYS A 1 21  ? 10.386  -7.794  8.727   1.00 0.00 ? 21  LYS A CD   3  
ATOM 4175  C CE   . LYS A 1 21  ? 10.114  -8.240  7.298   1.00 0.00 ? 21  LYS A CE   3  
ATOM 4176  N NZ   . LYS A 1 21  ? 10.708  -9.575  7.012   1.00 0.00 ? 21  LYS A NZ   3  
ATOM 4177  H H    . LYS A 1 21  ? 7.577   -4.885  9.498   1.00 0.00 ? 21  LYS A H    3  
ATOM 4178  H HA   . LYS A 1 21  ? 10.234  -4.038  10.092  1.00 0.00 ? 21  LYS A HA   3  
ATOM 4179  H HB2  . LYS A 1 21  ? 9.316   -5.299  7.512   1.00 0.00 ? 21  LYS A HB2  3  
ATOM 4180  H HB3  . LYS A 1 21  ? 10.912  -5.378  8.247   1.00 0.00 ? 21  LYS A HB3  3  
ATOM 4181  H HG2  . LYS A 1 21  ? 9.539   -6.518  10.207  1.00 0.00 ? 21  LYS A HG2  3  
ATOM 4182  H HG3  . LYS A 1 21  ? 8.453   -6.907  8.872   1.00 0.00 ? 21  LYS A HG3  3  
ATOM 4183  H HD2  . LYS A 1 21  ? 11.411  -7.465  8.801   1.00 0.00 ? 21  LYS A HD2  3  
ATOM 4184  H HD3  . LYS A 1 21  ? 10.226  -8.631  9.392   1.00 0.00 ? 21  LYS A HD3  3  
ATOM 4185  H HE2  . LYS A 1 21  ? 9.047   -8.290  7.147   1.00 0.00 ? 21  LYS A HE2  3  
ATOM 4186  H HE3  . LYS A 1 21  ? 10.540  -7.513  6.622   1.00 0.00 ? 21  LYS A HE3  3  
ATOM 4187  H HZ1  . LYS A 1 21  ? 10.171  -10.050 6.258   1.00 0.00 ? 21  LYS A HZ1  3  
ATOM 4188  H HZ2  . LYS A 1 21  ? 10.682  -10.168 7.866   1.00 0.00 ? 21  LYS A HZ2  3  
ATOM 4189  H HZ3  . LYS A 1 21  ? 11.696  -9.469  6.705   1.00 0.00 ? 21  LYS A HZ3  3  
ATOM 4190  N N    . TYR A 1 22  ? 8.624   -2.565  7.638   1.00 0.00 ? 22  TYR A N    3  
ATOM 4191  C CA   . TYR A 1 22  ? 8.626   -1.401  6.760   1.00 0.00 ? 22  TYR A CA   3  
ATOM 4192  C C    . TYR A 1 22  ? 8.078   -0.173  7.481   1.00 0.00 ? 22  TYR A C    3  
ATOM 4193  O O    . TYR A 1 22  ? 7.161   -0.259  8.298   1.00 0.00 ? 22  TYR A O    3  
ATOM 4194  C CB   . TYR A 1 22  ? 7.798   -1.682  5.505   1.00 0.00 ? 22  TYR A CB   3  
ATOM 4195  C CG   . TYR A 1 22  ? 7.972   -3.084  4.966   1.00 0.00 ? 22  TYR A CG   3  
ATOM 4196  C CD1  . TYR A 1 22  ? 7.258   -4.148  5.501   1.00 0.00 ? 22  TYR A CD1  3  
ATOM 4197  C CD2  . TYR A 1 22  ? 8.849   -3.343  3.920   1.00 0.00 ? 22  TYR A CD2  3  
ATOM 4198  C CE1  . TYR A 1 22  ? 7.414   -5.431  5.012   1.00 0.00 ? 22  TYR A CE1  3  
ATOM 4199  C CE2  . TYR A 1 22  ? 9.010   -4.622  3.423   1.00 0.00 ? 22  TYR A CE2  3  
ATOM 4200  C CZ   . TYR A 1 22  ? 8.291   -5.663  3.973   1.00 0.00 ? 22  TYR A CZ   3  
ATOM 4201  O OH   . TYR A 1 22  ? 8.448   -6.939  3.482   1.00 0.00 ? 22  TYR A OH   3  
ATOM 4202  H H    . TYR A 1 22  ? 7.833   -3.143  7.662   1.00 0.00 ? 22  TYR A H    3  
ATOM 4203  H HA   . TYR A 1 22  ? 9.648   -1.207  6.469   1.00 0.00 ? 22  TYR A HA   3  
ATOM 4204  H HB2  . TYR A 1 22  ? 6.753   -1.542  5.732   1.00 0.00 ? 22  TYR A HB2  3  
ATOM 4205  H HB3  . TYR A 1 22  ? 8.089   -0.989  4.728   1.00 0.00 ? 22  TYR A HB3  3  
ATOM 4206  H HD1  . TYR A 1 22  ? 6.571   -3.963  6.315   1.00 0.00 ? 22  TYR A HD1  3  
ATOM 4207  H HD2  . TYR A 1 22  ? 9.411   -2.526  3.491   1.00 0.00 ? 22  TYR A HD2  3  
ATOM 4208  H HE1  . TYR A 1 22  ? 6.850   -6.246  5.442   1.00 0.00 ? 22  TYR A HE1  3  
ATOM 4209  H HE2  . TYR A 1 22  ? 9.697   -4.805  2.610   1.00 0.00 ? 22  TYR A HE2  3  
ATOM 4210  H HH   . TYR A 1 22  ? 8.598   -6.901  2.535   1.00 0.00 ? 22  TYR A HH   3  
ATOM 4211  N N    . PRO A 1 23  ? 8.652   0.999   7.171   1.00 0.00 ? 23  PRO A N    3  
ATOM 4212  C CA   . PRO A 1 23  ? 8.237   2.268   7.776   1.00 0.00 ? 23  PRO A CA   3  
ATOM 4213  C C    . PRO A 1 23  ? 6.855   2.709   7.307   1.00 0.00 ? 23  PRO A C    3  
ATOM 4214  O O    . PRO A 1 23  ? 6.428   2.377   6.202   1.00 0.00 ? 23  PRO A O    3  
ATOM 4215  C CB   . PRO A 1 23  ? 9.305   3.255   7.297   1.00 0.00 ? 23  PRO A CB   3  
ATOM 4216  C CG   . PRO A 1 23  ? 9.823   2.667   6.030   1.00 0.00 ? 23  PRO A CG   3  
ATOM 4217  C CD   . PRO A 1 23  ? 9.750   1.175   6.205   1.00 0.00 ? 23  PRO A CD   3  
ATOM 4218  H HA   . PRO A 1 23  ? 8.251   2.216   8.855   1.00 0.00 ? 23  PRO A HA   3  
ATOM 4219  H HB2  . PRO A 1 23  ? 8.854   4.223   7.129   1.00 0.00 ? 23  PRO A HB2  3  
ATOM 4220  H HB3  . PRO A 1 23  ? 10.083  3.338   8.041   1.00 0.00 ? 23  PRO A HB3  3  
ATOM 4221  H HG2  . PRO A 1 23  ? 9.205   2.978   5.201   1.00 0.00 ? 23  PRO A HG2  3  
ATOM 4222  H HG3  . PRO A 1 23  ? 10.846  2.976   5.874   1.00 0.00 ? 23  PRO A HG3  3  
ATOM 4223  H HD2  . PRO A 1 23  ? 9.518   0.696   5.266   1.00 0.00 ? 23  PRO A HD2  3  
ATOM 4224  H HD3  . PRO A 1 23  ? 10.679  0.796   6.605   1.00 0.00 ? 23  PRO A HD3  3  
ATOM 4225  N N    . GLY A 1 24  ? 6.159   3.460   8.155   1.00 0.00 ? 24  GLY A N    3  
ATOM 4226  C CA   . GLY A 1 24  ? 4.832   3.935   7.809   1.00 0.00 ? 24  GLY A CA   3  
ATOM 4227  C C    . GLY A 1 24  ? 3.765   2.880   8.023   1.00 0.00 ? 24  GLY A C    3  
ATOM 4228  O O    . GLY A 1 24  ? 2.674   3.179   8.512   1.00 0.00 ? 24  GLY A O    3  
ATOM 4229  H H    . GLY A 1 24  ? 6.550   3.693   9.024   1.00 0.00 ? 24  GLY A H    3  
ATOM 4230  H HA2  . GLY A 1 24  ? 4.599   4.796   8.418   1.00 0.00 ? 24  GLY A HA2  3  
ATOM 4231  H HA3  . GLY A 1 24  ? 4.827   4.229   6.770   1.00 0.00 ? 24  GLY A HA3  3  
ATOM 4232  N N    . LEU A 1 25  ? 4.076   1.642   7.655   1.00 0.00 ? 25  LEU A N    3  
ATOM 4233  C CA   . LEU A 1 25  ? 3.135   0.538   7.808   1.00 0.00 ? 25  LEU A CA   3  
ATOM 4234  C C    . LEU A 1 25  ? 2.863   0.255   9.281   1.00 0.00 ? 25  LEU A C    3  
ATOM 4235  O O    . LEU A 1 25  ? 3.703   -0.311  9.981   1.00 0.00 ? 25  LEU A O    3  
ATOM 4236  C CB   . LEU A 1 25  ? 3.678   -0.719  7.126   1.00 0.00 ? 25  LEU A CB   3  
ATOM 4237  C CG   . LEU A 1 25  ? 2.652   -1.810  6.815   1.00 0.00 ? 25  LEU A CG   3  
ATOM 4238  C CD1  . LEU A 1 25  ? 1.567   -1.275  5.894   1.00 0.00 ? 25  LEU A CD1  3  
ATOM 4239  C CD2  . LEU A 1 25  ? 3.333   -3.020  6.193   1.00 0.00 ? 25  LEU A CD2  3  
ATOM 4240  H H    . LEU A 1 25  ? 4.960   1.465   7.271   1.00 0.00 ? 25  LEU A H    3  
ATOM 4241  H HA   . LEU A 1 25  ? 2.209   0.825   7.332   1.00 0.00 ? 25  LEU A HA   3  
ATOM 4242  H HB2  . LEU A 1 25  ? 4.134   -0.419  6.195   1.00 0.00 ? 25  LEU A HB2  3  
ATOM 4243  H HB3  . LEU A 1 25  ? 4.431   -1.146  7.773   1.00 0.00 ? 25  LEU A HB3  3  
ATOM 4244  H HG   . LEU A 1 25  ? 2.182   -2.126  7.736   1.00 0.00 ? 25  LEU A HG   3  
ATOM 4245  H HD11 . LEU A 1 25  ? 1.222   -2.066  5.246   1.00 0.00 ? 25  LEU A HD11 3  
ATOM 4246  H HD12 . LEU A 1 25  ? 1.966   -0.469  5.296   1.00 0.00 ? 25  LEU A HD12 3  
ATOM 4247  H HD13 . LEU A 1 25  ? 0.741   -0.908  6.486   1.00 0.00 ? 25  LEU A HD13 3  
ATOM 4248  H HD21 . LEU A 1 25  ? 4.400   -2.854  6.157   1.00 0.00 ? 25  LEU A HD21 3  
ATOM 4249  H HD22 . LEU A 1 25  ? 2.958   -3.169  5.191   1.00 0.00 ? 25  LEU A HD22 3  
ATOM 4250  H HD23 . LEU A 1 25  ? 3.125   -3.896  6.789   1.00 0.00 ? 25  LEU A HD23 3  
ATOM 4251  N N    . VAL A 1 26  ? 1.682   0.650   9.747   1.00 0.00 ? 26  VAL A N    3  
ATOM 4252  C CA   . VAL A 1 26  ? 1.297   0.435   11.136  1.00 0.00 ? 26  VAL A CA   3  
ATOM 4253  C C    . VAL A 1 26  ? -0.220  0.392   11.286  1.00 0.00 ? 26  VAL A C    3  
ATOM 4254  O O    . VAL A 1 26  ? -0.945  1.071   10.559  1.00 0.00 ? 26  VAL A O    3  
ATOM 4255  C CB   . VAL A 1 26  ? 1.861   1.537   12.052  1.00 0.00 ? 26  VAL A CB   3  
ATOM 4256  C CG1  . VAL A 1 26  ? 3.382   1.517   12.037  1.00 0.00 ? 26  VAL A CG1  3  
ATOM 4257  C CG2  . VAL A 1 26  ? 1.334   2.901   11.631  1.00 0.00 ? 26  VAL A CG2  3  
ATOM 4258  H H    . VAL A 1 26  ? 1.054   1.095   9.140   1.00 0.00 ? 26  VAL A H    3  
ATOM 4259  H HA   . VAL A 1 26  ? 1.707   -0.513  11.454  1.00 0.00 ? 26  VAL A HA   3  
ATOM 4260  H HB   . VAL A 1 26  ? 1.531   1.343   13.062  1.00 0.00 ? 26  VAL A HB   3  
ATOM 4261  H HG11 . VAL A 1 26  ? 3.758   2.176   12.806  1.00 0.00 ? 26  VAL A HG11 3  
ATOM 4262  H HG12 . VAL A 1 26  ? 3.731   0.511   12.221  1.00 0.00 ? 26  VAL A HG12 3  
ATOM 4263  H HG13 . VAL A 1 26  ? 3.737   1.851   11.073  1.00 0.00 ? 26  VAL A HG13 3  
ATOM 4264  H HG21 . VAL A 1 26  ? 0.255   2.893   11.659  1.00 0.00 ? 26  VAL A HG21 3  
ATOM 4265  H HG22 . VAL A 1 26  ? 1.706   3.656   12.308  1.00 0.00 ? 26  VAL A HG22 3  
ATOM 4266  H HG23 . VAL A 1 26  ? 1.667   3.122   10.628  1.00 0.00 ? 26  VAL A HG23 3  
ATOM 4267  N N    . TRP A 1 27  ? -0.692  -0.409  12.234  1.00 0.00 ? 27  TRP A N    3  
ATOM 4268  C CA   . TRP A 1 27  ? -2.124  -0.540  12.480  1.00 0.00 ? 27  TRP A CA   3  
ATOM 4269  C C    . TRP A 1 27  ? -2.652  0.653   13.268  1.00 0.00 ? 27  TRP A C    3  
ATOM 4270  O O    . TRP A 1 27  ? -2.216  0.910   14.389  1.00 0.00 ? 27  TRP A O    3  
ATOM 4271  C CB   . TRP A 1 27  ? -2.415  -1.837  13.238  1.00 0.00 ? 27  TRP A CB   3  
ATOM 4272  C CG   . TRP A 1 27  ? -2.024  -3.069  12.479  1.00 0.00 ? 27  TRP A CG   3  
ATOM 4273  C CD1  . TRP A 1 27  ? -0.901  -3.823  12.665  1.00 0.00 ? 27  TRP A CD1  3  
ATOM 4274  C CD2  . TRP A 1 27  ? -2.754  -3.688  11.414  1.00 0.00 ? 27  TRP A CD2  3  
ATOM 4275  N NE1  . TRP A 1 27  ? -0.889  -4.874  11.779  1.00 0.00 ? 27  TRP A NE1  3  
ATOM 4276  C CE2  . TRP A 1 27  ? -2.015  -4.813  11.002  1.00 0.00 ? 27  TRP A CE2  3  
ATOM 4277  C CE3  . TRP A 1 27  ? -3.961  -3.402  10.770  1.00 0.00 ? 27  TRP A CE3  3  
ATOM 4278  C CZ2  . TRP A 1 27  ? -2.444  -5.650  9.974   1.00 0.00 ? 27  TRP A CZ2  3  
ATOM 4279  C CZ3  . TRP A 1 27  ? -4.385  -4.232  9.751   1.00 0.00 ? 27  TRP A CZ3  3  
ATOM 4280  C CH2  . TRP A 1 27  ? -3.629  -5.346  9.362   1.00 0.00 ? 27  TRP A CH2  3  
ATOM 4281  H H    . TRP A 1 27  ? -0.064  -0.926  12.781  1.00 0.00 ? 27  TRP A H    3  
ATOM 4282  H HA   . TRP A 1 27  ? -2.622  -0.574  11.522  1.00 0.00 ? 27  TRP A HA   3  
ATOM 4283  H HB2  . TRP A 1 27  ? -1.871  -1.832  14.170  1.00 0.00 ? 27  TRP A HB2  3  
ATOM 4284  H HB3  . TRP A 1 27  ? -3.474  -1.894  13.444  1.00 0.00 ? 27  TRP A HB3  3  
ATOM 4285  H HD1  . TRP A 1 27  ? -0.142  -3.612  13.402  1.00 0.00 ? 27  TRP A HD1  3  
ATOM 4286  H HE1  . TRP A 1 27  ? -0.188  -5.556  11.716  1.00 0.00 ? 27  TRP A HE1  3  
ATOM 4287  H HE3  . TRP A 1 27  ? -4.558  -2.548  11.056  1.00 0.00 ? 27  TRP A HE3  3  
ATOM 4288  H HZ2  . TRP A 1 27  ? -1.873  -6.512  9.663   1.00 0.00 ? 27  TRP A HZ2  3  
ATOM 4289  H HZ3  . TRP A 1 27  ? -5.315  -4.027  9.242   1.00 0.00 ? 27  TRP A HZ3  3  
ATOM 4290  H HH2  . TRP A 1 27  ? -3.999  -5.967  8.560   1.00 0.00 ? 27  TRP A HH2  3  
ATOM 4291  N N    . GLU A 1 28  ? -3.594  1.379   12.673  1.00 0.00 ? 28  GLU A N    3  
ATOM 4292  C CA   . GLU A 1 28  ? -4.181  2.546   13.321  1.00 0.00 ? 28  GLU A CA   3  
ATOM 4293  C C    . GLU A 1 28  ? -4.882  2.154   14.618  1.00 0.00 ? 28  GLU A C    3  
ATOM 4294  O O    . GLU A 1 28  ? -4.955  2.941   15.560  1.00 0.00 ? 28  GLU A O    3  
ATOM 4295  C CB   . GLU A 1 28  ? -5.172  3.235   12.381  1.00 0.00 ? 28  GLU A CB   3  
ATOM 4296  C CG   . GLU A 1 28  ? -4.558  3.667   11.060  1.00 0.00 ? 28  GLU A CG   3  
ATOM 4297  C CD   . GLU A 1 28  ? -5.234  4.891   10.474  1.00 0.00 ? 28  GLU A CD   3  
ATOM 4298  O OE1  . GLU A 1 28  ? -6.481  4.954   10.509  1.00 0.00 ? 28  GLU A OE1  3  
ATOM 4299  O OE2  . GLU A 1 28  ? -4.516  5.787   9.981   1.00 0.00 ? 28  GLU A OE2  3  
ATOM 4300  H H    . GLU A 1 28  ? -3.901  1.124   11.778  1.00 0.00 ? 28  GLU A H    3  
ATOM 4301  H HA   . GLU A 1 28  ? -3.381  3.234   13.553  1.00 0.00 ? 28  GLU A HA   3  
ATOM 4302  H HB2  . GLU A 1 28  ? -5.984  2.555   12.172  1.00 0.00 ? 28  GLU A HB2  3  
ATOM 4303  H HB3  . GLU A 1 28  ? -5.567  4.112   12.873  1.00 0.00 ? 28  GLU A HB3  3  
ATOM 4304  H HG2  . GLU A 1 28  ? -3.514  3.893   11.219  1.00 0.00 ? 28  GLU A HG2  3  
ATOM 4305  H HG3  . GLU A 1 28  ? -4.645  2.854   10.354  1.00 0.00 ? 28  GLU A HG3  3  
ATOM 4306  N N    . ASN A 1 29  ? -5.398  0.929   14.657  1.00 0.00 ? 29  ASN A N    3  
ATOM 4307  C CA   . ASN A 1 29  ? -6.095  0.431   15.838  1.00 0.00 ? 29  ASN A CA   3  
ATOM 4308  C C    . ASN A 1 29  ? -5.424  -0.829  16.375  1.00 0.00 ? 29  ASN A C    3  
ATOM 4309  O O    . ASN A 1 29  ? -4.468  -1.333  15.787  1.00 0.00 ? 29  ASN A O    3  
ATOM 4310  C CB   . ASN A 1 29  ? -7.560  0.139   15.505  1.00 0.00 ? 29  ASN A CB   3  
ATOM 4311  C CG   . ASN A 1 29  ? -7.709  -0.785  14.312  1.00 0.00 ? 29  ASN A CG   3  
ATOM 4312  O OD1  . ASN A 1 29  ? -6.805  -1.558  13.995  1.00 0.00 ? 29  ASN A OD1  3  
ATOM 4313  N ND2  . ASN A 1 29  ? -8.854  -0.708  13.644  1.00 0.00 ? 29  ASN A ND2  3  
ATOM 4314  H H    . ASN A 1 29  ? -5.309  0.347   13.874  1.00 0.00 ? 29  ASN A H    3  
ATOM 4315  H HA   . ASN A 1 29  ? -6.054  1.199   16.596  1.00 0.00 ? 29  ASN A HA   3  
ATOM 4316  H HB2  . ASN A 1 29  ? -8.030  -0.328  16.358  1.00 0.00 ? 29  ASN A HB2  3  
ATOM 4317  H HB3  . ASN A 1 29  ? -8.065  1.068   15.284  1.00 0.00 ? 29  ASN A HB3  3  
ATOM 4318  H HD21 . ASN A 1 29  ? -9.529  -0.069  13.953  1.00 0.00 ? 29  ASN A HD21 3  
ATOM 4319  H HD22 . ASN A 1 29  ? -8.977  -1.295  12.868  1.00 0.00 ? 29  ASN A HD22 3  
ATOM 4320  N N    . GLU A 1 30  ? -5.932  -1.331  17.496  1.00 0.00 ? 30  GLU A N    3  
ATOM 4321  C CA   . GLU A 1 30  ? -5.380  -2.532  18.112  1.00 0.00 ? 30  GLU A CA   3  
ATOM 4322  C C    . GLU A 1 30  ? -5.950  -3.789  17.461  1.00 0.00 ? 30  GLU A C    3  
ATOM 4323  O O    . GLU A 1 30  ? -5.275  -4.814  17.371  1.00 0.00 ? 30  GLU A O    3  
ATOM 4324  C CB   . GLU A 1 30  ? -5.676  -2.544  19.614  1.00 0.00 ? 30  GLU A CB   3  
ATOM 4325  C CG   . GLU A 1 30  ? -5.241  -1.276  20.329  1.00 0.00 ? 30  GLU A CG   3  
ATOM 4326  C CD   . GLU A 1 30  ? -6.048  -0.063  19.909  1.00 0.00 ? 30  GLU A CD   3  
ATOM 4327  O OE1  . GLU A 1 30  ? -7.242  -0.230  19.583  1.00 0.00 ? 30  GLU A OE1  3  
ATOM 4328  O OE2  . GLU A 1 30  ? -5.487  1.052   19.906  1.00 0.00 ? 30  GLU A OE2  3  
ATOM 4329  H H    . GLU A 1 30  ? -6.694  -0.884  17.918  1.00 0.00 ? 30  GLU A H    3  
ATOM 4330  H HA   . GLU A 1 30  ? -4.311  -2.519  17.966  1.00 0.00 ? 30  GLU A HA   3  
ATOM 4331  H HB2  . GLU A 1 30  ? -6.739  -2.668  19.758  1.00 0.00 ? 30  GLU A HB2  3  
ATOM 4332  H HB3  . GLU A 1 30  ? -5.160  -3.380  20.063  1.00 0.00 ? 30  GLU A HB3  3  
ATOM 4333  H HG2  . GLU A 1 30  ? -5.362  -1.418  21.393  1.00 0.00 ? 30  GLU A HG2  3  
ATOM 4334  H HG3  . GLU A 1 30  ? -4.200  -1.091  20.108  1.00 0.00 ? 30  GLU A HG3  3  
ATOM 4335  N N    . GLU A 1 31  ? -7.197  -3.701  17.010  1.00 0.00 ? 31  GLU A N    3  
ATOM 4336  C CA   . GLU A 1 31  ? -7.858  -4.831  16.368  1.00 0.00 ? 31  GLU A CA   3  
ATOM 4337  C C    . GLU A 1 31  ? -7.068  -5.305  15.152  1.00 0.00 ? 31  GLU A C    3  
ATOM 4338  O O    . GLU A 1 31  ? -7.334  -6.374  14.602  1.00 0.00 ? 31  GLU A O    3  
ATOM 4339  C CB   . GLU A 1 31  ? -9.280  -4.449  15.950  1.00 0.00 ? 31  GLU A CB   3  
ATOM 4340  C CG   . GLU A 1 31  ? -9.348  -3.181  15.115  1.00 0.00 ? 31  GLU A CG   3  
ATOM 4341  C CD   . GLU A 1 31  ? -10.772 -2.724  14.864  1.00 0.00 ? 31  GLU A CD   3  
ATOM 4342  O OE1  . GLU A 1 31  ? -11.323 -2.003  15.722  1.00 0.00 ? 31  GLU A OE1  3  
ATOM 4343  O OE2  . GLU A 1 31  ? -11.335 -3.088  13.811  1.00 0.00 ? 31  GLU A OE2  3  
ATOM 4344  H H    . GLU A 1 31  ? -7.684  -2.857  17.111  1.00 0.00 ? 31  GLU A H    3  
ATOM 4345  H HA   . GLU A 1 31  ? -7.909  -5.637  17.085  1.00 0.00 ? 31  GLU A HA   3  
ATOM 4346  H HB2  . GLU A 1 31  ? -9.702  -5.259  15.373  1.00 0.00 ? 31  GLU A HB2  3  
ATOM 4347  H HB3  . GLU A 1 31  ? -9.876  -4.303  16.838  1.00 0.00 ? 31  GLU A HB3  3  
ATOM 4348  H HG2  . GLU A 1 31  ? -8.821  -2.395  15.634  1.00 0.00 ? 31  GLU A HG2  3  
ATOM 4349  H HG3  . GLU A 1 31  ? -8.871  -3.365  14.164  1.00 0.00 ? 31  GLU A HG3  3  
ATOM 4350  N N    . LYS A 1 32  ? -6.095  -4.501  14.736  1.00 0.00 ? 32  LYS A N    3  
ATOM 4351  C CA   . LYS A 1 32  ? -5.264  -4.836  13.586  1.00 0.00 ? 32  LYS A CA   3  
ATOM 4352  C C    . LYS A 1 32  ? -6.101  -4.902  12.311  1.00 0.00 ? 32  LYS A C    3  
ATOM 4353  O O    . LYS A 1 32  ? -5.836  -5.714  11.425  1.00 0.00 ? 32  LYS A O    3  
ATOM 4354  C CB   . LYS A 1 32  ? -4.557  -6.174  13.813  1.00 0.00 ? 32  LYS A CB   3  
ATOM 4355  C CG   . LYS A 1 32  ? -3.601  -6.163  14.994  1.00 0.00 ? 32  LYS A CG   3  
ATOM 4356  C CD   . LYS A 1 32  ? -2.201  -5.751  14.574  1.00 0.00 ? 32  LYS A CD   3  
ATOM 4357  C CE   . LYS A 1 32  ? -1.168  -6.135  15.623  1.00 0.00 ? 32  LYS A CE   3  
ATOM 4358  N NZ   . LYS A 1 32  ? -1.065  -5.111  16.700  1.00 0.00 ? 32  LYS A NZ   3  
ATOM 4359  H H    . LYS A 1 32  ? -5.931  -3.662  15.216  1.00 0.00 ? 32  LYS A H    3  
ATOM 4360  H HA   . LYS A 1 32  ? -4.522  -4.060  13.475  1.00 0.00 ? 32  LYS A HA   3  
ATOM 4361  H HB2  . LYS A 1 32  ? -5.302  -6.937  13.987  1.00 0.00 ? 32  LYS A HB2  3  
ATOM 4362  H HB3  . LYS A 1 32  ? -3.996  -6.427  12.925  1.00 0.00 ? 32  LYS A HB3  3  
ATOM 4363  H HG2  . LYS A 1 32  ? -3.964  -5.464  15.733  1.00 0.00 ? 32  LYS A HG2  3  
ATOM 4364  H HG3  . LYS A 1 32  ? -3.562  -7.155  15.422  1.00 0.00 ? 32  LYS A HG3  3  
ATOM 4365  H HD2  . LYS A 1 32  ? -1.953  -6.243  13.645  1.00 0.00 ? 32  LYS A HD2  3  
ATOM 4366  H HD3  . LYS A 1 32  ? -2.177  -4.680  14.433  1.00 0.00 ? 32  LYS A HD3  3  
ATOM 4367  H HE2  . LYS A 1 32  ? -1.454  -7.079  16.061  1.00 0.00 ? 32  LYS A HE2  3  
ATOM 4368  H HE3  . LYS A 1 32  ? -0.207  -6.237  15.142  1.00 0.00 ? 32  LYS A HE3  3  
ATOM 4369  H HZ1  . LYS A 1 32  ? -1.996  -4.681  16.873  1.00 0.00 ? 32  LYS A HZ1  3  
ATOM 4370  H HZ2  . LYS A 1 32  ? -0.397  -4.365  16.420  1.00 0.00 ? 32  LYS A HZ2  3  
ATOM 4371  H HZ3  . LYS A 1 32  ? -0.728  -5.551  17.580  1.00 0.00 ? 32  LYS A HZ3  3  
ATOM 4372  N N    . SER A 1 33  ? -7.110  -4.041  12.226  1.00 0.00 ? 33  SER A N    3  
ATOM 4373  C CA   . SER A 1 33  ? -7.986  -4.003  11.061  1.00 0.00 ? 33  SER A CA   3  
ATOM 4374  C C    . SER A 1 33  ? -7.688  -2.782  10.197  1.00 0.00 ? 33  SER A C    3  
ATOM 4375  O O    . SER A 1 33  ? -7.744  -2.849  8.968   1.00 0.00 ? 33  SER A O    3  
ATOM 4376  C CB   . SER A 1 33  ? -9.452  -3.987  11.499  1.00 0.00 ? 33  SER A CB   3  
ATOM 4377  O OG   . SER A 1 33  ? -10.301 -3.628  10.423  1.00 0.00 ? 33  SER A OG   3  
ATOM 4378  H H    . SER A 1 33  ? -7.270  -3.418  12.966  1.00 0.00 ? 33  SER A H    3  
ATOM 4379  H HA   . SER A 1 33  ? -7.803  -4.895  10.480  1.00 0.00 ? 33  SER A HA   3  
ATOM 4380  H HB2  . SER A 1 33  ? -9.731  -4.968  11.851  1.00 0.00 ? 33  SER A HB2  3  
ATOM 4381  H HB3  . SER A 1 33  ? -9.578  -3.269  12.297  1.00 0.00 ? 33  SER A HB3  3  
ATOM 4382  H HG   . SER A 1 33  ? -11.189 -3.475  10.754  1.00 0.00 ? 33  SER A HG   3  
ATOM 4383  N N    . ILE A 1 34  ? -7.371  -1.668  10.847  1.00 0.00 ? 34  ILE A N    3  
ATOM 4384  C CA   . ILE A 1 34  ? -7.063  -0.431  10.139  1.00 0.00 ? 34  ILE A CA   3  
ATOM 4385  C C    . ILE A 1 34  ? -5.572  -0.116  10.206  1.00 0.00 ? 34  ILE A C    3  
ATOM 4386  O O    . ILE A 1 34  ? -4.943  -0.260  11.254  1.00 0.00 ? 34  ILE A O    3  
ATOM 4387  C CB   . ILE A 1 34  ? -7.854  0.759   10.713  1.00 0.00 ? 34  ILE A CB   3  
ATOM 4388  C CG1  . ILE A 1 34  ? -9.358  0.510   10.582  1.00 0.00 ? 34  ILE A CG1  3  
ATOM 4389  C CG2  . ILE A 1 34  ? -7.461  2.047   10.005  1.00 0.00 ? 34  ILE A CG2  3  
ATOM 4390  C CD1  . ILE A 1 34  ? -10.183 1.239   11.619  1.00 0.00 ? 34  ILE A CD1  3  
ATOM 4391  H H    . ILE A 1 34  ? -7.343  -1.677  11.826  1.00 0.00 ? 34  ILE A H    3  
ATOM 4392  H HA   . ILE A 1 34  ? -7.346  -0.561  9.104   1.00 0.00 ? 34  ILE A HA   3  
ATOM 4393  H HB   . ILE A 1 34  ? -7.602  0.859   11.758  1.00 0.00 ? 34  ILE A HB   3  
ATOM 4394  H HG12 . ILE A 1 34  ? -9.687  0.836   9.608   1.00 0.00 ? 34  ILE A HG12 3  
ATOM 4395  H HG13 . ILE A 1 34  ? -9.551  -0.548  10.688  1.00 0.00 ? 34  ILE A HG13 3  
ATOM 4396  H HG21 . ILE A 1 34  ? -7.555  2.877   10.690  1.00 0.00 ? 34  ILE A HG21 3  
ATOM 4397  H HG22 . ILE A 1 34  ? -6.438  1.974   9.668   1.00 0.00 ? 34  ILE A HG22 3  
ATOM 4398  H HG23 . ILE A 1 34  ? -8.110  2.204   9.157   1.00 0.00 ? 34  ILE A HG23 3  
ATOM 4399  H HD11 . ILE A 1 34  ? -10.481 2.202   11.231  1.00 0.00 ? 34  ILE A HD11 3  
ATOM 4400  H HD12 . ILE A 1 34  ? -11.062 0.658   11.854  1.00 0.00 ? 34  ILE A HD12 3  
ATOM 4401  H HD13 . ILE A 1 34  ? -9.594  1.379   12.514  1.00 0.00 ? 34  ILE A HD13 3  
ATOM 4402  N N    . PHE A 1 35  ? -5.013  0.315   9.080   1.00 0.00 ? 35  PHE A N    3  
ATOM 4403  C CA   . PHE A 1 35  ? -3.596  0.652   9.011   1.00 0.00 ? 35  PHE A CA   3  
ATOM 4404  C C    . PHE A 1 35  ? -3.351  1.765   7.996   1.00 0.00 ? 35  PHE A C    3  
ATOM 4405  O O    . PHE A 1 35  ? -4.266  2.188   7.289   1.00 0.00 ? 35  PHE A O    3  
ATOM 4406  C CB   . PHE A 1 35  ? -2.774  -0.583  8.639   1.00 0.00 ? 35  PHE A CB   3  
ATOM 4407  C CG   . PHE A 1 35  ? -3.272  -1.286  7.408   1.00 0.00 ? 35  PHE A CG   3  
ATOM 4408  C CD1  . PHE A 1 35  ? -4.378  -2.118  7.469   1.00 0.00 ? 35  PHE A CD1  3  
ATOM 4409  C CD2  . PHE A 1 35  ? -2.633  -1.116  6.191   1.00 0.00 ? 35  PHE A CD2  3  
ATOM 4410  C CE1  . PHE A 1 35  ? -4.839  -2.766  6.339   1.00 0.00 ? 35  PHE A CE1  3  
ATOM 4411  C CE2  . PHE A 1 35  ? -3.090  -1.761  5.057   1.00 0.00 ? 35  PHE A CE2  3  
ATOM 4412  C CZ   . PHE A 1 35  ? -4.193  -2.588  5.131   1.00 0.00 ? 35  PHE A CZ   3  
ATOM 4413  H H    . PHE A 1 35  ? -5.567  0.409   8.277   1.00 0.00 ? 35  PHE A H    3  
ATOM 4414  H HA   . PHE A 1 35  ? -3.290  0.997   9.986   1.00 0.00 ? 35  PHE A HA   3  
ATOM 4415  H HB2  . PHE A 1 35  ? -1.752  -0.286  8.460   1.00 0.00 ? 35  PHE A HB2  3  
ATOM 4416  H HB3  . PHE A 1 35  ? -2.802  -1.286  9.458   1.00 0.00 ? 35  PHE A HB3  3  
ATOM 4417  H HD1  . PHE A 1 35  ? -4.884  -2.258  8.414   1.00 0.00 ? 35  PHE A HD1  3  
ATOM 4418  H HD2  . PHE A 1 35  ? -1.769  -0.470  6.131   1.00 0.00 ? 35  PHE A HD2  3  
ATOM 4419  H HE1  . PHE A 1 35  ? -5.702  -3.412  6.401   1.00 0.00 ? 35  PHE A HE1  3  
ATOM 4420  H HE2  . PHE A 1 35  ? -2.583  -1.620  4.114   1.00 0.00 ? 35  PHE A HE2  3  
ATOM 4421  H HZ   . PHE A 1 35  ? -4.552  -3.093  4.247   1.00 0.00 ? 35  PHE A HZ   3  
ATOM 4422  N N    . ARG A 1 36  ? -2.109  2.235   7.931   1.00 0.00 ? 36  ARG A N    3  
ATOM 4423  C CA   . ARG A 1 36  ? -1.743  3.300   7.004   1.00 0.00 ? 36  ARG A CA   3  
ATOM 4424  C C    . ARG A 1 36  ? -0.472  2.942   6.240   1.00 0.00 ? 36  ARG A C    3  
ATOM 4425  O O    . ARG A 1 36  ? 0.509   2.483   6.827   1.00 0.00 ? 36  ARG A O    3  
ATOM 4426  C CB   . ARG A 1 36  ? -1.544  4.615   7.759   1.00 0.00 ? 36  ARG A CB   3  
ATOM 4427  C CG   . ARG A 1 36  ? -0.901  4.443   9.125   1.00 0.00 ? 36  ARG A CG   3  
ATOM 4428  C CD   . ARG A 1 36  ? -0.161  5.700   9.556   1.00 0.00 ? 36  ARG A CD   3  
ATOM 4429  N NE   . ARG A 1 36  ? -1.058  6.684   10.155  1.00 0.00 ? 36  ARG A NE   3  
ATOM 4430  C CZ   . ARG A 1 36  ? -0.638  7.796   10.749  1.00 0.00 ? 36  ARG A CZ   3  
ATOM 4431  N NH1  . ARG A 1 36  ? 0.658   8.063   10.822  1.00 0.00 ? 36  ARG A NH1  3  
ATOM 4432  N NH2  . ARG A 1 36  ? -1.516  8.643   11.270  1.00 0.00 ? 36  ARG A NH2  3  
ATOM 4433  H H    . ARG A 1 36  ? -1.423  1.858   8.520   1.00 0.00 ? 36  ARG A H    3  
ATOM 4434  H HA   . ARG A 1 36  ? -2.552  3.418   6.299   1.00 0.00 ? 36  ARG A HA   3  
ATOM 4435  H HB2  . ARG A 1 36  ? -0.914  5.264   7.168   1.00 0.00 ? 36  ARG A HB2  3  
ATOM 4436  H HB3  . ARG A 1 36  ? -2.505  5.087   7.895   1.00 0.00 ? 36  ARG A HB3  3  
ATOM 4437  H HG2  . ARG A 1 36  ? -1.671  4.225   9.851   1.00 0.00 ? 36  ARG A HG2  3  
ATOM 4438  H HG3  . ARG A 1 36  ? -0.201  3.621   9.082   1.00 0.00 ? 36  ARG A HG3  3  
ATOM 4439  H HD2  . ARG A 1 36  ? 0.593   5.428   10.279  1.00 0.00 ? 36  ARG A HD2  3  
ATOM 4440  H HD3  . ARG A 1 36  ? 0.312   6.137   8.689   1.00 0.00 ? 36  ARG A HD3  3  
ATOM 4441  H HE   . ARG A 1 36  ? -2.021  6.507   10.112  1.00 0.00 ? 36  ARG A HE   3  
ATOM 4442  H HH11 . ARG A 1 36  ? 1.322   7.427   10.429  1.00 0.00 ? 36  ARG A HH11 3  
ATOM 4443  H HH12 . ARG A 1 36  ? 0.972   8.901   11.269  1.00 0.00 ? 36  ARG A HH12 3  
ATOM 4444  H HH21 . ARG A 1 36  ? -2.494  8.445   11.217  1.00 0.00 ? 36  ARG A HH21 3  
ATOM 4445  H HH22 . ARG A 1 36  ? -1.199  9.479   11.717  1.00 0.00 ? 36  ARG A HH22 3  
ATOM 4446  N N    . ILE A 1 37  ? -0.497  3.154   4.929   1.00 0.00 ? 37  ILE A N    3  
ATOM 4447  C CA   . ILE A 1 37  ? 0.653   2.854   4.085   1.00 0.00 ? 37  ILE A CA   3  
ATOM 4448  C C    . ILE A 1 37  ? 1.241   4.127   3.485   1.00 0.00 ? 37  ILE A C    3  
ATOM 4449  O O    . ILE A 1 37  ? 0.526   4.990   2.976   1.00 0.00 ? 37  ILE A O    3  
ATOM 4450  C CB   . ILE A 1 37  ? 0.279   1.887   2.946   1.00 0.00 ? 37  ILE A CB   3  
ATOM 4451  C CG1  . ILE A 1 37  ? 1.535   1.442   2.193   1.00 0.00 ? 37  ILE A CG1  3  
ATOM 4452  C CG2  . ILE A 1 37  ? -0.709  2.546   1.995   1.00 0.00 ? 37  ILE A CG2  3  
ATOM 4453  C CD1  . ILE A 1 37  ? 1.243   0.552   1.005   1.00 0.00 ? 37  ILE A CD1  3  
ATOM 4454  H H    . ILE A 1 37  ? -1.307  3.521   4.519   1.00 0.00 ? 37  ILE A H    3  
ATOM 4455  H HA   . ILE A 1 37  ? 1.404   2.379   4.701   1.00 0.00 ? 37  ILE A HA   3  
ATOM 4456  H HB   . ILE A 1 37  ? -0.198  1.022   3.380   1.00 0.00 ? 37  ILE A HB   3  
ATOM 4457  H HG12 . ILE A 1 37  ? 2.059   2.313   1.833   1.00 0.00 ? 37  ILE A HG12 3  
ATOM 4458  H HG13 . ILE A 1 37  ? 2.175   0.894   2.869   1.00 0.00 ? 37  ILE A HG13 3  
ATOM 4459  H HG21 . ILE A 1 37  ? -1.589  1.927   1.905   1.00 0.00 ? 37  ILE A HG21 3  
ATOM 4460  H HG22 . ILE A 1 37  ? -0.990  3.514   2.383   1.00 0.00 ? 37  ILE A HG22 3  
ATOM 4461  H HG23 . ILE A 1 37  ? -0.251  2.665   1.025   1.00 0.00 ? 37  ILE A HG23 3  
ATOM 4462  H HD11 . ILE A 1 37  ? 0.254   0.767   0.628   1.00 0.00 ? 37  ILE A HD11 3  
ATOM 4463  H HD12 . ILE A 1 37  ? 1.972   0.734   0.230   1.00 0.00 ? 37  ILE A HD12 3  
ATOM 4464  H HD13 . ILE A 1 37  ? 1.294   -0.484  1.310   1.00 0.00 ? 37  ILE A HD13 3  
ATOM 4465  N N    . PRO A 1 38  ? 2.576   4.246   3.542   1.00 0.00 ? 38  PRO A N    3  
ATOM 4466  C CA   . PRO A 1 38  ? 3.290   5.409   3.007   1.00 0.00 ? 38  PRO A CA   3  
ATOM 4467  C C    . PRO A 1 38  ? 3.254   5.461   1.483   1.00 0.00 ? 38  PRO A C    3  
ATOM 4468  O O    . PRO A 1 38  ? 3.934   4.687   0.810   1.00 0.00 ? 38  PRO A O    3  
ATOM 4469  C CB   . PRO A 1 38  ? 4.725   5.202   3.500   1.00 0.00 ? 38  PRO A CB   3  
ATOM 4470  C CG   . PRO A 1 38  ? 4.849   3.731   3.698   1.00 0.00 ? 38  PRO A CG   3  
ATOM 4471  C CD   . PRO A 1 38  ? 3.490   3.256   4.134   1.00 0.00 ? 38  PRO A CD   3  
ATOM 4472  H HA   . PRO A 1 38  ? 2.900   6.333   3.407   1.00 0.00 ? 38  PRO A HA   3  
ATOM 4473  H HB2  . PRO A 1 38  ? 5.420   5.562   2.755   1.00 0.00 ? 38  PRO A HB2  3  
ATOM 4474  H HB3  . PRO A 1 38  ? 4.871   5.738   4.426   1.00 0.00 ? 38  PRO A HB3  3  
ATOM 4475  H HG2  . PRO A 1 38  ? 5.131   3.258   2.770   1.00 0.00 ? 38  PRO A HG2  3  
ATOM 4476  H HG3  . PRO A 1 38  ? 5.582   3.524   4.464   1.00 0.00 ? 38  PRO A HG3  3  
ATOM 4477  H HD2  . PRO A 1 38  ? 3.293   2.268   3.745   1.00 0.00 ? 38  PRO A HD2  3  
ATOM 4478  H HD3  . PRO A 1 38  ? 3.417   3.260   5.212   1.00 0.00 ? 38  PRO A HD3  3  
ATOM 4479  N N    . TRP A 1 39  ? 2.456   6.377   0.946   1.00 0.00 ? 39  TRP A N    3  
ATOM 4480  C CA   . TRP A 1 39  ? 2.332   6.529   -0.499  1.00 0.00 ? 39  TRP A CA   3  
ATOM 4481  C C    . TRP A 1 39  ? 3.404   7.467   -1.042  1.00 0.00 ? 39  TRP A C    3  
ATOM 4482  O O    . TRP A 1 39  ? 3.294   7.972   -2.159  1.00 0.00 ? 39  TRP A O    3  
ATOM 4483  C CB   . TRP A 1 39  ? 0.943   7.060   -0.858  1.00 0.00 ? 39  TRP A CB   3  
ATOM 4484  C CG   . TRP A 1 39  ? 0.437   6.556   -2.176  1.00 0.00 ? 39  TRP A CG   3  
ATOM 4485  C CD1  . TRP A 1 39  ? 0.424   7.233   -3.362  1.00 0.00 ? 39  TRP A CD1  3  
ATOM 4486  C CD2  . TRP A 1 39  ? -0.129  5.268   -2.441  1.00 0.00 ? 39  TRP A CD2  3  
ATOM 4487  N NE1  . TRP A 1 39  ? -0.117  6.444   -4.348  1.00 0.00 ? 39  TRP A NE1  3  
ATOM 4488  C CE2  . TRP A 1 39  ? -0.463  5.233   -3.809  1.00 0.00 ? 39  TRP A CE2  3  
ATOM 4489  C CE3  . TRP A 1 39  ? -0.384  4.140   -1.657  1.00 0.00 ? 39  TRP A CE3  3  
ATOM 4490  C CZ2  . TRP A 1 39  ? -1.040  4.116   -4.406  1.00 0.00 ? 39  TRP A CZ2  3  
ATOM 4491  C CZ3  . TRP A 1 39  ? -0.957  3.032   -2.251  1.00 0.00 ? 39  TRP A CZ3  3  
ATOM 4492  C CH2  . TRP A 1 39  ? -1.279  3.025   -3.615  1.00 0.00 ? 39  TRP A CH2  3  
ATOM 4493  H H    . TRP A 1 39  ? 1.938   6.965   1.536   1.00 0.00 ? 39  TRP A H    3  
ATOM 4494  H HA   . TRP A 1 39  ? 2.462   5.555   -0.946  1.00 0.00 ? 39  TRP A HA   3  
ATOM 4495  H HB2  . TRP A 1 39  ? 0.241   6.759   -0.095  1.00 0.00 ? 39  TRP A HB2  3  
ATOM 4496  H HB3  . TRP A 1 39  ? 0.979   8.139   -0.905  1.00 0.00 ? 39  TRP A HB3  3  
ATOM 4497  H HD1  . TRP A 1 39  ? 0.786   8.242   -3.490  1.00 0.00 ? 39  TRP A HD1  3  
ATOM 4498  H HE1  . TRP A 1 39  ? -0.234  6.706   -5.286  1.00 0.00 ? 39  TRP A HE1  3  
ATOM 4499  H HE3  . TRP A 1 39  ? -0.143  4.126   -0.604  1.00 0.00 ? 39  TRP A HE3  3  
ATOM 4500  H HZ2  . TRP A 1 39  ? -1.294  4.095   -5.456  1.00 0.00 ? 39  TRP A HZ2  3  
ATOM 4501  H HZ3  . TRP A 1 39  ? -1.163  2.151   -1.660  1.00 0.00 ? 39  TRP A HZ3  3  
ATOM 4502  H HH2  . TRP A 1 39  ? -1.726  2.138   -4.036  1.00 0.00 ? 39  TRP A HH2  3  
ATOM 4503  N N    . LYS A 1 40  ? 4.442   7.697   -0.244  1.00 0.00 ? 40  LYS A N    3  
ATOM 4504  C CA   . LYS A 1 40  ? 5.536   8.573   -0.645  1.00 0.00 ? 40  LYS A CA   3  
ATOM 4505  C C    . LYS A 1 40  ? 6.111   8.145   -1.991  1.00 0.00 ? 40  LYS A C    3  
ATOM 4506  O O    . LYS A 1 40  ? 5.924   7.007   -2.424  1.00 0.00 ? 40  LYS A O    3  
ATOM 4507  C CB   . LYS A 1 40  ? 6.638   8.566   0.417   1.00 0.00 ? 40  LYS A CB   3  
ATOM 4508  C CG   . LYS A 1 40  ? 6.143   8.924   1.808   1.00 0.00 ? 40  LYS A CG   3  
ATOM 4509  C CD   . LYS A 1 40  ? 7.291   9.311   2.725   1.00 0.00 ? 40  LYS A CD   3  
ATOM 4510  C CE   . LYS A 1 40  ? 6.921   9.128   4.189   1.00 0.00 ? 40  LYS A CE   3  
ATOM 4511  N NZ   . LYS A 1 40  ? 7.278   7.770   4.686   1.00 0.00 ? 40  LYS A NZ   3  
ATOM 4512  H H    . LYS A 1 40  ? 4.473   7.265   0.635   1.00 0.00 ? 40  LYS A H    3  
ATOM 4513  H HA   . LYS A 1 40  ? 5.143   9.574   -0.737  1.00 0.00 ? 40  LYS A HA   3  
ATOM 4514  H HB2  . LYS A 1 40  ? 7.077   7.580   0.457   1.00 0.00 ? 40  LYS A HB2  3  
ATOM 4515  H HB3  . LYS A 1 40  ? 7.399   9.279   0.134   1.00 0.00 ? 40  LYS A HB3  3  
ATOM 4516  H HG2  . LYS A 1 40  ? 5.460   9.757   1.734   1.00 0.00 ? 40  LYS A HG2  3  
ATOM 4517  H HG3  . LYS A 1 40  ? 5.630   8.071   2.229   1.00 0.00 ? 40  LYS A HG3  3  
ATOM 4518  H HD2  . LYS A 1 40  ? 8.145   8.689   2.502   1.00 0.00 ? 40  LYS A HD2  3  
ATOM 4519  H HD3  . LYS A 1 40  ? 7.544   10.348  2.554   1.00 0.00 ? 40  LYS A HD3  3  
ATOM 4520  H HE2  . LYS A 1 40  ? 7.447   9.866   4.775   1.00 0.00 ? 40  LYS A HE2  3  
ATOM 4521  H HE3  . LYS A 1 40  ? 5.856   9.274   4.298   1.00 0.00 ? 40  LYS A HE3  3  
ATOM 4522  H HZ1  . LYS A 1 40  ? 8.253   7.767   5.048   1.00 0.00 ? 40  LYS A HZ1  3  
ATOM 4523  H HZ2  . LYS A 1 40  ? 7.205   7.077   3.914   1.00 0.00 ? 40  LYS A HZ2  3  
ATOM 4524  H HZ3  . LYS A 1 40  ? 6.634   7.489   5.452   1.00 0.00 ? 40  LYS A HZ3  3  
ATOM 4525  N N    . HIS A 1 41  ? 6.813   9.062   -2.649  1.00 0.00 ? 41  HIS A N    3  
ATOM 4526  C CA   . HIS A 1 41  ? 7.417   8.778   -3.946  1.00 0.00 ? 41  HIS A CA   3  
ATOM 4527  C C    . HIS A 1 41  ? 8.928   8.606   -3.815  1.00 0.00 ? 41  HIS A C    3  
ATOM 4528  O O    . HIS A 1 41  ? 9.486   8.743   -2.727  1.00 0.00 ? 41  HIS A O    3  
ATOM 4529  C CB   . HIS A 1 41  ? 7.104   9.901   -4.935  1.00 0.00 ? 41  HIS A CB   3  
ATOM 4530  C CG   . HIS A 1 41  ? 7.470   11.263  -4.431  1.00 0.00 ? 41  HIS A CG   3  
ATOM 4531  N ND1  . HIS A 1 41  ? 8.772   11.709  -4.345  1.00 0.00 ? 41  HIS A ND1  3  
ATOM 4532  C CD2  . HIS A 1 41  ? 6.695   12.280  -3.987  1.00 0.00 ? 41  HIS A CD2  3  
ATOM 4533  C CE1  . HIS A 1 41  ? 8.782   12.941  -3.868  1.00 0.00 ? 41  HIS A CE1  3  
ATOM 4534  N NE2  . HIS A 1 41  ? 7.534   13.311  -3.642  1.00 0.00 ? 41  HIS A NE2  3  
ATOM 4535  H H    . HIS A 1 41  ? 6.928   9.951   -2.253  1.00 0.00 ? 41  HIS A H    3  
ATOM 4536  H HA   . HIS A 1 41  ? 6.993   7.857   -4.314  1.00 0.00 ? 41  HIS A HA   3  
ATOM 4537  H HB2  . HIS A 1 41  ? 7.651   9.729   -5.850  1.00 0.00 ? 41  HIS A HB2  3  
ATOM 4538  H HB3  . HIS A 1 41  ? 6.045   9.899   -5.149  1.00 0.00 ? 41  HIS A HB3  3  
ATOM 4539  H HD1  . HIS A 1 41  ? 9.569   11.198  -4.595  1.00 0.00 ? 41  HIS A HD1  3  
ATOM 4540  H HD2  . HIS A 1 41  ? 5.616   12.281  -3.915  1.00 0.00 ? 41  HIS A HD2  3  
ATOM 4541  H HE1  . HIS A 1 41  ? 9.660   13.544  -3.692  1.00 0.00 ? 41  HIS A HE1  3  
ATOM 4542  N N    . ALA A 1 42  ? 9.583   8.305   -4.932  1.00 0.00 ? 42  ALA A N    3  
ATOM 4543  C CA   . ALA A 1 42  ? 11.028  8.116   -4.942  1.00 0.00 ? 42  ALA A CA   3  
ATOM 4544  C C    . ALA A 1 42  ? 11.752  9.395   -4.536  1.00 0.00 ? 42  ALA A C    3  
ATOM 4545  O O    . ALA A 1 42  ? 12.638  9.374   -3.682  1.00 0.00 ? 42  ALA A O    3  
ATOM 4546  C CB   . ALA A 1 42  ? 11.491  7.659   -6.317  1.00 0.00 ? 42  ALA A CB   3  
ATOM 4547  H H    . ALA A 1 42  ? 9.082   8.209   -5.768  1.00 0.00 ? 42  ALA A H    3  
ATOM 4548  H HA   . ALA A 1 42  ? 11.268  7.337   -4.232  1.00 0.00 ? 42  ALA A HA   3  
ATOM 4549  H HB1  . ALA A 1 42  ? 11.337  6.594   -6.413  1.00 0.00 ? 42  ALA A HB1  3  
ATOM 4550  H HB2  . ALA A 1 42  ? 10.923  8.175   -7.078  1.00 0.00 ? 42  ALA A HB2  3  
ATOM 4551  H HB3  . ALA A 1 42  ? 12.540  7.883   -6.437  1.00 0.00 ? 42  ALA A HB3  3  
ATOM 4552  N N    . GLY A 1 43  ? 11.370  10.508  -5.154  1.00 0.00 ? 43  GLY A N    3  
ATOM 4553  C CA   . GLY A 1 43  ? 11.994  11.781  -4.844  1.00 0.00 ? 43  GLY A CA   3  
ATOM 4554  C C    . GLY A 1 43  ? 13.482  11.782  -5.131  1.00 0.00 ? 43  GLY A C    3  
ATOM 4555  O O    . GLY A 1 43  ? 13.899  11.743  -6.289  1.00 0.00 ? 43  GLY A O    3  
ATOM 4556  H H    . GLY A 1 43  ? 10.658  10.464  -5.826  1.00 0.00 ? 43  GLY A H    3  
ATOM 4557  H HA2  . GLY A 1 43  ? 11.523  12.553  -5.433  1.00 0.00 ? 43  GLY A HA2  3  
ATOM 4558  H HA3  . GLY A 1 43  ? 11.841  11.998  -3.796  1.00 0.00 ? 43  GLY A HA3  3  
ATOM 4559  N N    . LYS A 1 44  ? 14.287  11.829  -4.075  1.00 0.00 ? 44  LYS A N    3  
ATOM 4560  C CA   . LYS A 1 44  ? 15.738  11.836  -4.219  1.00 0.00 ? 44  LYS A CA   3  
ATOM 4561  C C    . LYS A 1 44  ? 16.277  10.417  -4.368  1.00 0.00 ? 44  LYS A C    3  
ATOM 4562  O O    . LYS A 1 44  ? 16.370  9.673   -3.391  1.00 0.00 ? 44  LYS A O    3  
ATOM 4563  C CB   . LYS A 1 44  ? 16.387  12.515  -3.010  1.00 0.00 ? 44  LYS A CB   3  
ATOM 4564  C CG   . LYS A 1 44  ? 17.588  13.374  -3.368  1.00 0.00 ? 44  LYS A CG   3  
ATOM 4565  C CD   . LYS A 1 44  ? 18.616  12.590  -4.167  1.00 0.00 ? 44  LYS A CD   3  
ATOM 4566  C CE   . LYS A 1 44  ? 18.454  12.822  -5.662  1.00 0.00 ? 44  LYS A CE   3  
ATOM 4567  N NZ   . LYS A 1 44  ? 19.726  12.589  -6.400  1.00 0.00 ? 44  LYS A NZ   3  
ATOM 4568  H H    . LYS A 1 44  ? 13.895  11.859  -3.177  1.00 0.00 ? 44  LYS A H    3  
ATOM 4569  H HA   . LYS A 1 44  ? 15.981  12.396  -5.109  1.00 0.00 ? 44  LYS A HA   3  
ATOM 4570  H HB2  . LYS A 1 44  ? 15.653  13.143  -2.528  1.00 0.00 ? 44  LYS A HB2  3  
ATOM 4571  H HB3  . LYS A 1 44  ? 16.710  11.753  -2.315  1.00 0.00 ? 44  LYS A HB3  3  
ATOM 4572  H HG2  . LYS A 1 44  ? 17.255  14.215  -3.957  1.00 0.00 ? 44  LYS A HG2  3  
ATOM 4573  H HG3  . LYS A 1 44  ? 18.048  13.729  -2.457  1.00 0.00 ? 44  LYS A HG3  3  
ATOM 4574  H HD2  . LYS A 1 44  ? 19.605  12.905  -3.871  1.00 0.00 ? 44  LYS A HD2  3  
ATOM 4575  H HD3  . LYS A 1 44  ? 18.493  11.537  -3.960  1.00 0.00 ? 44  LYS A HD3  3  
ATOM 4576  H HE2  . LYS A 1 44  ? 17.700  12.148  -6.038  1.00 0.00 ? 44  LYS A HE2  3  
ATOM 4577  H HE3  . LYS A 1 44  ? 18.136  13.842  -5.822  1.00 0.00 ? 44  LYS A HE3  3  
ATOM 4578  H HZ1  . LYS A 1 44  ? 20.500  12.411  -5.729  1.00 0.00 ? 44  LYS A HZ1  3  
ATOM 4579  H HZ2  . LYS A 1 44  ? 19.964  13.423  -6.973  1.00 0.00 ? 44  LYS A HZ2  3  
ATOM 4580  H HZ3  . LYS A 1 44  ? 19.629  11.766  -7.028  1.00 0.00 ? 44  LYS A HZ3  3  
ATOM 4581  N N    . GLN A 1 45  ? 16.632  10.049  -5.595  1.00 0.00 ? 45  GLN A N    3  
ATOM 4582  C CA   . GLN A 1 45  ? 17.162  8.719   -5.870  1.00 0.00 ? 45  GLN A CA   3  
ATOM 4583  C C    . GLN A 1 45  ? 18.219  8.331   -4.841  1.00 0.00 ? 45  GLN A C    3  
ATOM 4584  O O    . GLN A 1 45  ? 18.163  7.248   -4.258  1.00 0.00 ? 45  GLN A O    3  
ATOM 4585  C CB   . GLN A 1 45  ? 17.760  8.666   -7.277  1.00 0.00 ? 45  GLN A CB   3  
ATOM 4586  C CG   . GLN A 1 45  ? 18.202  7.274   -7.698  1.00 0.00 ? 45  GLN A CG   3  
ATOM 4587  C CD   . GLN A 1 45  ? 19.167  6.646   -6.712  1.00 0.00 ? 45  GLN A CD   3  
ATOM 4588  O OE1  . GLN A 1 45  ? 20.134  7.276   -6.284  1.00 0.00 ? 45  GLN A OE1  3  
ATOM 4589  N NE2  . GLN A 1 45  ? 18.908  5.396   -6.346  1.00 0.00 ? 45  GLN A NE2  3  
ATOM 4590  H H    . GLN A 1 45  ? 16.534  10.687  -6.332  1.00 0.00 ? 45  GLN A H    3  
ATOM 4591  H HA   . GLN A 1 45  ? 16.344  8.017   -5.810  1.00 0.00 ? 45  GLN A HA   3  
ATOM 4592  H HB2  . GLN A 1 45  ? 17.020  9.015   -7.983  1.00 0.00 ? 45  GLN A HB2  3  
ATOM 4593  H HB3  . GLN A 1 45  ? 18.618  9.320   -7.315  1.00 0.00 ? 45  GLN A HB3  3  
ATOM 4594  H HG2  . GLN A 1 45  ? 17.331  6.642   -7.778  1.00 0.00 ? 45  GLN A HG2  3  
ATOM 4595  H HG3  . GLN A 1 45  ? 18.687  7.341   -8.661  1.00 0.00 ? 45  GLN A HG3  3  
ATOM 4596  H HE21 . GLN A 1 45  ? 18.121  4.955   -6.729  1.00 0.00 ? 45  GLN A HE21 3  
ATOM 4597  H HE22 . GLN A 1 45  ? 19.516  4.964   -5.711  1.00 0.00 ? 45  GLN A HE22 3  
ATOM 4598  N N    . ASP A 1 46  ? 19.180  9.221   -4.624  1.00 0.00 ? 46  ASP A N    3  
ATOM 4599  C CA   . ASP A 1 46  ? 20.250  8.972   -3.664  1.00 0.00 ? 46  ASP A CA   3  
ATOM 4600  C C    . ASP A 1 46  ? 19.691  8.408   -2.362  1.00 0.00 ? 46  ASP A C    3  
ATOM 4601  O O    . ASP A 1 46  ? 20.354  7.630   -1.675  1.00 0.00 ? 46  ASP A O    3  
ATOM 4602  C CB   . ASP A 1 46  ? 21.025  10.261  -3.386  1.00 0.00 ? 46  ASP A CB   3  
ATOM 4603  C CG   . ASP A 1 46  ? 22.204  10.441  -4.321  1.00 0.00 ? 46  ASP A CG   3  
ATOM 4604  O OD1  . ASP A 1 46  ? 22.124  9.969   -5.475  1.00 0.00 ? 46  ASP A OD1  3  
ATOM 4605  O OD2  . ASP A 1 46  ? 23.206  11.056  -3.900  1.00 0.00 ? 46  ASP A OD2  3  
ATOM 4606  H H    . ASP A 1 46  ? 19.170  10.066  -5.120  1.00 0.00 ? 46  ASP A H    3  
ATOM 4607  H HA   . ASP A 1 46  ? 20.921  8.246   -4.097  1.00 0.00 ? 46  ASP A HA   3  
ATOM 4608  H HB2  . ASP A 1 46  ? 20.361  11.105  -3.506  1.00 0.00 ? 46  ASP A HB2  3  
ATOM 4609  H HB3  . ASP A 1 46  ? 21.393  10.239  -2.370  1.00 0.00 ? 46  ASP A HB3  3  
ATOM 4610  N N    . TYR A 1 47  ? 18.469  8.806   -2.027  1.00 0.00 ? 47  TYR A N    3  
ATOM 4611  C CA   . TYR A 1 47  ? 17.822  8.343   -0.805  1.00 0.00 ? 47  TYR A CA   3  
ATOM 4612  C C    . TYR A 1 47  ? 17.702  6.822   -0.795  1.00 0.00 ? 47  TYR A C    3  
ATOM 4613  O O    . TYR A 1 47  ? 18.036  6.155   -1.773  1.00 0.00 ? 47  TYR A O    3  
ATOM 4614  C CB   . TYR A 1 47  ? 16.437  8.977   -0.664  1.00 0.00 ? 47  TYR A CB   3  
ATOM 4615  C CG   . TYR A 1 47  ? 15.326  8.140   -1.257  1.00 0.00 ? 47  TYR A CG   3  
ATOM 4616  C CD1  . TYR A 1 47  ? 15.505  7.463   -2.457  1.00 0.00 ? 47  TYR A CD1  3  
ATOM 4617  C CD2  . TYR A 1 47  ? 14.097  8.029   -0.619  1.00 0.00 ? 47  TYR A CD2  3  
ATOM 4618  C CE1  . TYR A 1 47  ? 14.492  6.698   -3.003  1.00 0.00 ? 47  TYR A CE1  3  
ATOM 4619  C CE2  . TYR A 1 47  ? 13.079  7.265   -1.157  1.00 0.00 ? 47  TYR A CE2  3  
ATOM 4620  C CZ   . TYR A 1 47  ? 13.281  6.602   -2.349  1.00 0.00 ? 47  TYR A CZ   3  
ATOM 4621  O OH   . TYR A 1 47  ? 12.270  5.841   -2.889  1.00 0.00 ? 47  TYR A OH   3  
ATOM 4622  H H    . TYR A 1 47  ? 17.990  9.427   -2.615  1.00 0.00 ? 47  TYR A H    3  
ATOM 4623  H HA   . TYR A 1 47  ? 18.434  8.650   0.031   1.00 0.00 ? 47  TYR A HA   3  
ATOM 4624  H HB2  . TYR A 1 47  ? 16.220  9.122   0.382   1.00 0.00 ? 47  TYR A HB2  3  
ATOM 4625  H HB3  . TYR A 1 47  ? 16.435  9.934   -1.164  1.00 0.00 ? 47  TYR A HB3  3  
ATOM 4626  H HD1  . TYR A 1 47  ? 16.454  7.539   -2.967  1.00 0.00 ? 47  TYR A HD1  3  
ATOM 4627  H HD2  . TYR A 1 47  ? 13.942  8.550   0.315   1.00 0.00 ? 47  TYR A HD2  3  
ATOM 4628  H HE1  . TYR A 1 47  ? 14.650  6.178   -3.937  1.00 0.00 ? 47  TYR A HE1  3  
ATOM 4629  H HE2  . TYR A 1 47  ? 12.131  7.190   -0.645  1.00 0.00 ? 47  TYR A HE2  3  
ATOM 4630  H HH   . TYR A 1 47  ? 12.499  4.911   -2.824  1.00 0.00 ? 47  TYR A HH   3  
ATOM 4631  N N    . ASN A 1 48  ? 17.220  6.281   0.320   1.00 0.00 ? 48  ASN A N    3  
ATOM 4632  C CA   . ASN A 1 48  ? 17.055  4.839   0.459   1.00 0.00 ? 48  ASN A CA   3  
ATOM 4633  C C    . ASN A 1 48  ? 15.791  4.365   -0.253  1.00 0.00 ? 48  ASN A C    3  
ATOM 4634  O O    . ASN A 1 48  ? 14.676  4.639   0.191   1.00 0.00 ? 48  ASN A O    3  
ATOM 4635  C CB   . ASN A 1 48  ? 16.996  4.452   1.938   1.00 0.00 ? 48  ASN A CB   3  
ATOM 4636  C CG   . ASN A 1 48  ? 18.106  5.092   2.748   1.00 0.00 ? 48  ASN A CG   3  
ATOM 4637  O OD1  . ASN A 1 48  ? 17.851  5.886   3.654   1.00 0.00 ? 48  ASN A OD1  3  
ATOM 4638  N ND2  . ASN A 1 48  ? 19.348  4.749   2.425   1.00 0.00 ? 48  ASN A ND2  3  
ATOM 4639  H H    . ASN A 1 48  ? 16.971  6.865   1.066   1.00 0.00 ? 48  ASN A H    3  
ATOM 4640  H HA   . ASN A 1 48  ? 17.910  4.361   0.005   1.00 0.00 ? 48  ASN A HA   3  
ATOM 4641  H HB2  . ASN A 1 48  ? 16.048  4.768   2.349   1.00 0.00 ? 48  ASN A HB2  3  
ATOM 4642  H HB3  . ASN A 1 48  ? 17.082  3.379   2.028   1.00 0.00 ? 48  ASN A HB3  3  
ATOM 4643  H HD21 . ASN A 1 48  ? 19.476  4.110   1.692   1.00 0.00 ? 48  ASN A HD21 3  
ATOM 4644  H HD22 . ASN A 1 48  ? 20.085  5.147   2.933   1.00 0.00 ? 48  ASN A HD22 3  
ATOM 4645  N N    . ARG A 1 49  ? 15.974  3.652   -1.359  1.00 0.00 ? 49  ARG A N    3  
ATOM 4646  C CA   . ARG A 1 49  ? 14.850  3.140   -2.133  1.00 0.00 ? 49  ARG A CA   3  
ATOM 4647  C C    . ARG A 1 49  ? 14.592  1.671   -1.812  1.00 0.00 ? 49  ARG A C    3  
ATOM 4648  O O    . ARG A 1 49  ? 13.471  1.183   -1.952  1.00 0.00 ? 49  ARG A O    3  
ATOM 4649  C CB   . ARG A 1 49  ? 15.116  3.306   -3.631  1.00 0.00 ? 49  ARG A CB   3  
ATOM 4650  C CG   . ARG A 1 49  ? 16.234  2.418   -4.153  1.00 0.00 ? 49  ARG A CG   3  
ATOM 4651  C CD   . ARG A 1 49  ? 17.588  3.100   -4.033  1.00 0.00 ? 49  ARG A CD   3  
ATOM 4652  N NE   . ARG A 1 49  ? 18.260  2.765   -2.780  1.00 0.00 ? 49  ARG A NE   3  
ATOM 4653  C CZ   . ARG A 1 49  ? 19.328  3.410   -2.324  1.00 0.00 ? 49  ARG A CZ   3  
ATOM 4654  N NH1  . ARG A 1 49  ? 19.841  4.420   -3.013  1.00 0.00 ? 49  ARG A NH1  3  
ATOM 4655  N NH2  . ARG A 1 49  ? 19.883  3.046   -1.175  1.00 0.00 ? 49  ARG A NH2  3  
ATOM 4656  H H    . ARG A 1 49  ? 16.887  3.466   -1.663  1.00 0.00 ? 49  ARG A H    3  
ATOM 4657  H HA   . ARG A 1 49  ? 13.975  3.714   -1.866  1.00 0.00 ? 49  ARG A HA   3  
ATOM 4658  H HB2  . ARG A 1 49  ? 14.213  3.068   -4.174  1.00 0.00 ? 49  ARG A HB2  3  
ATOM 4659  H HB3  . ARG A 1 49  ? 15.382  4.334   -3.825  1.00 0.00 ? 49  ARG A HB3  3  
ATOM 4660  H HG2  . ARG A 1 49  ? 16.252  1.503   -3.579  1.00 0.00 ? 49  ARG A HG2  3  
ATOM 4661  H HG3  . ARG A 1 49  ? 16.045  2.192   -5.191  1.00 0.00 ? 49  ARG A HG3  3  
ATOM 4662  H HD2  . ARG A 1 49  ? 18.209  2.785   -4.859  1.00 0.00 ? 49  ARG A HD2  3  
ATOM 4663  H HD3  . ARG A 1 49  ? 17.443  4.169   -4.079  1.00 0.00 ? 49  ARG A HD3  3  
ATOM 4664  H HE   . ARG A 1 49  ? 17.897  2.022   -2.255  1.00 0.00 ? 49  ARG A HE   3  
ATOM 4665  H HH11 . ARG A 1 49  ? 19.424  4.696   -3.878  1.00 0.00 ? 49  ARG A HH11 3  
ATOM 4666  H HH12 . ARG A 1 49  ? 20.644  4.905   -2.666  1.00 0.00 ? 49  ARG A HH12 3  
ATOM 4667  H HH21 . ARG A 1 49  ? 19.499  2.286   -0.653  1.00 0.00 ? 49  ARG A HH21 3  
ATOM 4668  H HH22 . ARG A 1 49  ? 20.687  3.532   -0.832  1.00 0.00 ? 49  ARG A HH22 3  
ATOM 4669  N N    . GLU A 1 50  ? 15.637  0.972   -1.381  1.00 0.00 ? 50  GLU A N    3  
ATOM 4670  C CA   . GLU A 1 50  ? 15.523  -0.441  -1.041  1.00 0.00 ? 50  GLU A CA   3  
ATOM 4671  C C    . GLU A 1 50  ? 14.626  -0.637  0.178   1.00 0.00 ? 50  GLU A C    3  
ATOM 4672  O O    . GLU A 1 50  ? 13.756  -1.507  0.187   1.00 0.00 ? 50  GLU A O    3  
ATOM 4673  C CB   . GLU A 1 50  ? 16.906  -1.037  -0.771  1.00 0.00 ? 50  GLU A CB   3  
ATOM 4674  C CG   . GLU A 1 50  ? 16.977  -2.538  -0.995  1.00 0.00 ? 50  GLU A CG   3  
ATOM 4675  C CD   . GLU A 1 50  ? 18.375  -3.010  -1.345  1.00 0.00 ? 50  GLU A CD   3  
ATOM 4676  O OE1  . GLU A 1 50  ? 19.305  -2.747  -0.554  1.00 0.00 ? 50  GLU A OE1  3  
ATOM 4677  O OE2  . GLU A 1 50  ? 18.539  -3.642  -2.410  1.00 0.00 ? 50  GLU A OE2  3  
ATOM 4678  H H    . GLU A 1 50  ? 16.506  1.418   -1.290  1.00 0.00 ? 50  GLU A H    3  
ATOM 4679  H HA   . GLU A 1 50  ? 15.081  -0.950  -1.884  1.00 0.00 ? 50  GLU A HA   3  
ATOM 4680  H HB2  . GLU A 1 50  ? 17.624  -0.561  -1.424  1.00 0.00 ? 50  GLU A HB2  3  
ATOM 4681  H HB3  . GLU A 1 50  ? 17.178  -0.834  0.255   1.00 0.00 ? 50  GLU A HB3  3  
ATOM 4682  H HG2  . GLU A 1 50  ? 16.660  -3.039  -0.093  1.00 0.00 ? 50  GLU A HG2  3  
ATOM 4683  H HG3  . GLU A 1 50  ? 16.311  -2.800  -1.804  1.00 0.00 ? 50  GLU A HG3  3  
ATOM 4684  N N    . GLU A 1 51  ? 14.846  0.179   1.205   1.00 0.00 ? 51  GLU A N    3  
ATOM 4685  C CA   . GLU A 1 51  ? 14.059  0.094   2.429   1.00 0.00 ? 51  GLU A CA   3  
ATOM 4686  C C    . GLU A 1 51  ? 12.668  0.687   2.223   1.00 0.00 ? 51  GLU A C    3  
ATOM 4687  O O    . GLU A 1 51  ? 11.659  0.046   2.519   1.00 0.00 ? 51  GLU A O    3  
ATOM 4688  C CB   . GLU A 1 51  ? 14.772  0.821   3.571   1.00 0.00 ? 51  GLU A CB   3  
ATOM 4689  C CG   . GLU A 1 51  ? 15.866  -0.002  4.229   1.00 0.00 ? 51  GLU A CG   3  
ATOM 4690  C CD   . GLU A 1 51  ? 17.004  -0.324  3.280   1.00 0.00 ? 51  GLU A CD   3  
ATOM 4691  O OE1  . GLU A 1 51  ? 17.796  0.591   2.973   1.00 0.00 ? 51  GLU A OE1  3  
ATOM 4692  O OE2  . GLU A 1 51  ? 17.102  -1.490  2.844   1.00 0.00 ? 51  GLU A OE2  3  
ATOM 4693  H H    . GLU A 1 51  ? 15.555  0.852   1.137   1.00 0.00 ? 51  GLU A H    3  
ATOM 4694  H HA   . GLU A 1 51  ? 13.958  -0.949  2.687   1.00 0.00 ? 51  GLU A HA   3  
ATOM 4695  H HB2  . GLU A 1 51  ? 15.214  1.728   3.184   1.00 0.00 ? 51  GLU A HB2  3  
ATOM 4696  H HB3  . GLU A 1 51  ? 14.043  1.081   4.325   1.00 0.00 ? 51  GLU A HB3  3  
ATOM 4697  H HG2  . GLU A 1 51  ? 16.262  0.552   5.066   1.00 0.00 ? 51  GLU A HG2  3  
ATOM 4698  H HG3  . GLU A 1 51  ? 15.438  -0.929  4.582   1.00 0.00 ? 51  GLU A HG3  3  
ATOM 4699  N N    . ASP A 1 52  ? 12.623  1.913   1.716   1.00 0.00 ? 52  ASP A N    3  
ATOM 4700  C CA   . ASP A 1 52  ? 11.357  2.593   1.470   1.00 0.00 ? 52  ASP A CA   3  
ATOM 4701  C C    . ASP A 1 52  ? 10.495  1.800   0.493   1.00 0.00 ? 52  ASP A C    3  
ATOM 4702  O O    . ASP A 1 52  ? 9.282   1.689   0.669   1.00 0.00 ? 52  ASP A O    3  
ATOM 4703  C CB   . ASP A 1 52  ? 11.606  4.000   0.923   1.00 0.00 ? 52  ASP A CB   3  
ATOM 4704  C CG   . ASP A 1 52  ? 10.319  4.761   0.674   1.00 0.00 ? 52  ASP A CG   3  
ATOM 4705  O OD1  . ASP A 1 52  ? 9.571   4.375   -0.249  1.00 0.00 ? 52  ASP A OD1  3  
ATOM 4706  O OD2  . ASP A 1 52  ? 10.060  5.743   1.400   1.00 0.00 ? 52  ASP A OD2  3  
ATOM 4707  H H    . ASP A 1 52  ? 13.462  2.372   1.501   1.00 0.00 ? 52  ASP A H    3  
ATOM 4708  H HA   . ASP A 1 52  ? 10.834  2.671   2.411   1.00 0.00 ? 52  ASP A HA   3  
ATOM 4709  H HB2  . ASP A 1 52  ? 12.199  4.556   1.634   1.00 0.00 ? 52  ASP A HB2  3  
ATOM 4710  H HB3  . ASP A 1 52  ? 12.146  3.925   -0.010  1.00 0.00 ? 52  ASP A HB3  3  
ATOM 4711  N N    . ALA A 1 53  ? 11.130  1.250   -0.537  1.00 0.00 ? 53  ALA A N    3  
ATOM 4712  C CA   . ALA A 1 53  ? 10.421  0.466   -1.541  1.00 0.00 ? 53  ALA A CA   3  
ATOM 4713  C C    . ALA A 1 53  ? 10.584  -1.029  -1.285  1.00 0.00 ? 53  ALA A C    3  
ATOM 4714  O O    . ALA A 1 53  ? 10.338  -1.849  -2.169  1.00 0.00 ? 53  ALA A O    3  
ATOM 4715  C CB   . ALA A 1 53  ? 10.916  0.822   -2.934  1.00 0.00 ? 53  ALA A CB   3  
ATOM 4716  H H    . ALA A 1 53  ? 12.098  1.373   -0.622  1.00 0.00 ? 53  ALA A H    3  
ATOM 4717  H HA   . ALA A 1 53  ? 9.372   0.718   -1.482  1.00 0.00 ? 53  ALA A HA   3  
ATOM 4718  H HB1  . ALA A 1 53  ? 11.235  1.854   -2.949  1.00 0.00 ? 53  ALA A HB1  3  
ATOM 4719  H HB2  . ALA A 1 53  ? 11.748  0.184   -3.195  1.00 0.00 ? 53  ALA A HB2  3  
ATOM 4720  H HB3  . ALA A 1 53  ? 10.117  0.681   -3.647  1.00 0.00 ? 53  ALA A HB3  3  
ATOM 4721  N N    . ALA A 1 54  ? 11.000  -1.375  -0.071  1.00 0.00 ? 54  ALA A N    3  
ATOM 4722  C CA   . ALA A 1 54  ? 11.194  -2.772  0.300   1.00 0.00 ? 54  ALA A CA   3  
ATOM 4723  C C    . ALA A 1 54  ? 9.876   -3.539  0.259   1.00 0.00 ? 54  ALA A C    3  
ATOM 4724  O O    . ALA A 1 54  ? 9.777   -4.589  -0.378  1.00 0.00 ? 54  ALA A O    3  
ATOM 4725  C CB   . ALA A 1 54  ? 11.820  -2.867  1.683   1.00 0.00 ? 54  ALA A CB   3  
ATOM 4726  H H    . ALA A 1 54  ? 11.179  -0.676  0.590   1.00 0.00 ? 54  ALA A H    3  
ATOM 4727  H HA   . ALA A 1 54  ? 11.878  -3.214  -0.410  1.00 0.00 ? 54  ALA A HA   3  
ATOM 4728  H HB1  . ALA A 1 54  ? 12.399  -1.976  1.878   1.00 0.00 ? 54  ALA A HB1  3  
ATOM 4729  H HB2  . ALA A 1 54  ? 11.041  -2.960  2.425   1.00 0.00 ? 54  ALA A HB2  3  
ATOM 4730  H HB3  . ALA A 1 54  ? 12.464  -3.733  1.727   1.00 0.00 ? 54  ALA A HB3  3  
ATOM 4731  N N    . LEU A 1 55  ? 8.868   -3.009  0.942   1.00 0.00 ? 55  LEU A N    3  
ATOM 4732  C CA   . LEU A 1 55  ? 7.555   -3.645  0.984   1.00 0.00 ? 55  LEU A CA   3  
ATOM 4733  C C    . LEU A 1 55  ? 7.028   -3.899  -0.424  1.00 0.00 ? 55  LEU A C    3  
ATOM 4734  O O    . LEU A 1 55  ? 6.540   -4.988  -0.729  1.00 0.00 ? 55  LEU A O    3  
ATOM 4735  C CB   . LEU A 1 55  ? 6.568   -2.772  1.761   1.00 0.00 ? 55  LEU A CB   3  
ATOM 4736  C CG   . LEU A 1 55  ? 5.094   -3.159  1.645   1.00 0.00 ? 55  LEU A CG   3  
ATOM 4737  C CD1  . LEU A 1 55  ? 4.745   -4.243  2.652   1.00 0.00 ? 55  LEU A CD1  3  
ATOM 4738  C CD2  . LEU A 1 55  ? 4.205   -1.939  1.842   1.00 0.00 ? 55  LEU A CD2  3  
ATOM 4739  H H    . LEU A 1 55  ? 9.007   -2.171  1.430   1.00 0.00 ? 55  LEU A H    3  
ATOM 4740  H HA   . LEU A 1 55  ? 7.662   -4.592  1.492   1.00 0.00 ? 55  LEU A HA   3  
ATOM 4741  H HB2  . LEU A 1 55  ? 6.840   -2.814  2.805   1.00 0.00 ? 55  LEU A HB2  3  
ATOM 4742  H HB3  . LEU A 1 55  ? 6.674   -1.757  1.404   1.00 0.00 ? 55  LEU A HB3  3  
ATOM 4743  H HG   . LEU A 1 55  ? 4.908   -3.552  0.654   1.00 0.00 ? 55  LEU A HG   3  
ATOM 4744  H HD11 . LEU A 1 55  ? 3.865   -4.773  2.321   1.00 0.00 ? 55  LEU A HD11 3  
ATOM 4745  H HD12 . LEU A 1 55  ? 4.554   -3.793  3.614   1.00 0.00 ? 55  LEU A HD12 3  
ATOM 4746  H HD13 . LEU A 1 55  ? 5.571   -4.935  2.736   1.00 0.00 ? 55  LEU A HD13 3  
ATOM 4747  H HD21 . LEU A 1 55  ? 3.722   -1.999  2.806   1.00 0.00 ? 55  LEU A HD21 3  
ATOM 4748  H HD22 . LEU A 1 55  ? 3.455   -1.911  1.065   1.00 0.00 ? 55  LEU A HD22 3  
ATOM 4749  H HD23 . LEU A 1 55  ? 4.807   -1.044  1.796   1.00 0.00 ? 55  LEU A HD23 3  
ATOM 4750  N N    . PHE A 1 56  ? 7.130   -2.888  -1.280  1.00 0.00 ? 56  PHE A N    3  
ATOM 4751  C CA   . PHE A 1 56  ? 6.665   -3.002  -2.658  1.00 0.00 ? 56  PHE A CA   3  
ATOM 4752  C C    . PHE A 1 56  ? 7.363   -4.154  -3.374  1.00 0.00 ? 56  PHE A C    3  
ATOM 4753  O O    . PHE A 1 56  ? 6.718   -5.100  -3.828  1.00 0.00 ? 56  PHE A O    3  
ATOM 4754  C CB   . PHE A 1 56  ? 6.911   -1.694  -3.412  1.00 0.00 ? 56  PHE A CB   3  
ATOM 4755  C CG   . PHE A 1 56  ? 5.966   -0.592  -3.026  1.00 0.00 ? 56  PHE A CG   3  
ATOM 4756  C CD1  . PHE A 1 56  ? 4.614   -0.688  -3.316  1.00 0.00 ? 56  PHE A CD1  3  
ATOM 4757  C CD2  . PHE A 1 56  ? 6.428   0.539   -2.373  1.00 0.00 ? 56  PHE A CD2  3  
ATOM 4758  C CE1  . PHE A 1 56  ? 3.742   0.324   -2.963  1.00 0.00 ? 56  PHE A CE1  3  
ATOM 4759  C CE2  . PHE A 1 56  ? 5.561   1.555   -2.017  1.00 0.00 ? 56  PHE A CE2  3  
ATOM 4760  C CZ   . PHE A 1 56  ? 4.216   1.447   -2.311  1.00 0.00 ? 56  PHE A CZ   3  
ATOM 4761  H H    . PHE A 1 56  ? 7.529   -2.044  -0.978  1.00 0.00 ? 56  PHE A H    3  
ATOM 4762  H HA   . PHE A 1 56  ? 5.604   -3.199  -2.633  1.00 0.00 ? 56  PHE A HA   3  
ATOM 4763  H HB2  . PHE A 1 56  ? 7.916   -1.354  -3.209  1.00 0.00 ? 56  PHE A HB2  3  
ATOM 4764  H HB3  . PHE A 1 56  ? 6.802   -1.871  -4.471  1.00 0.00 ? 56  PHE A HB3  3  
ATOM 4765  H HD1  . PHE A 1 56  ? 4.242   -1.565  -3.824  1.00 0.00 ? 56  PHE A HD1  3  
ATOM 4766  H HD2  . PHE A 1 56  ? 7.481   0.624   -2.141  1.00 0.00 ? 56  PHE A HD2  3  
ATOM 4767  H HE1  . PHE A 1 56  ? 2.691   0.237   -3.194  1.00 0.00 ? 56  PHE A HE1  3  
ATOM 4768  H HE2  . PHE A 1 56  ? 5.935   2.430   -1.507  1.00 0.00 ? 56  PHE A HE2  3  
ATOM 4769  H HZ   . PHE A 1 56  ? 3.537   2.239   -2.035  1.00 0.00 ? 56  PHE A HZ   3  
ATOM 4770  N N    . LYS A 1 57  ? 8.685   -4.068  -3.472  1.00 0.00 ? 57  LYS A N    3  
ATOM 4771  C CA   . LYS A 1 57  ? 9.473   -5.102  -4.132  1.00 0.00 ? 57  LYS A CA   3  
ATOM 4772  C C    . LYS A 1 57  ? 9.060   -6.490  -3.653  1.00 0.00 ? 57  LYS A C    3  
ATOM 4773  O O    . LYS A 1 57  ? 8.842   -7.395  -4.458  1.00 0.00 ? 57  LYS A O    3  
ATOM 4774  C CB   . LYS A 1 57  ? 10.964  -4.882  -3.868  1.00 0.00 ? 57  LYS A CB   3  
ATOM 4775  C CG   . LYS A 1 57  ? 11.578  -3.786  -4.721  1.00 0.00 ? 57  LYS A CG   3  
ATOM 4776  C CD   . LYS A 1 57  ? 12.999  -3.470  -4.284  1.00 0.00 ? 57  LYS A CD   3  
ATOM 4777  C CE   . LYS A 1 57  ? 13.965  -4.573  -4.689  1.00 0.00 ? 57  LYS A CE   3  
ATOM 4778  N NZ   . LYS A 1 57  ? 14.554  -4.328  -6.035  1.00 0.00 ? 57  LYS A NZ   3  
ATOM 4779  H H    . LYS A 1 57  ? 9.143   -3.289  -3.090  1.00 0.00 ? 57  LYS A H    3  
ATOM 4780  H HA   . LYS A 1 57  ? 9.290   -5.031  -5.194  1.00 0.00 ? 57  LYS A HA   3  
ATOM 4781  H HB2  . LYS A 1 57  ? 11.098  -4.619  -2.829  1.00 0.00 ? 57  LYS A HB2  3  
ATOM 4782  H HB3  . LYS A 1 57  ? 11.492  -5.803  -4.068  1.00 0.00 ? 57  LYS A HB3  3  
ATOM 4783  H HG2  . LYS A 1 57  ? 11.593  -4.109  -5.751  1.00 0.00 ? 57  LYS A HG2  3  
ATOM 4784  H HG3  . LYS A 1 57  ? 10.977  -2.893  -4.630  1.00 0.00 ? 57  LYS A HG3  3  
ATOM 4785  H HD2  . LYS A 1 57  ? 13.312  -2.546  -4.748  1.00 0.00 ? 57  LYS A HD2  3  
ATOM 4786  H HD3  . LYS A 1 57  ? 13.020  -3.361  -3.209  1.00 0.00 ? 57  LYS A HD3  3  
ATOM 4787  H HE2  . LYS A 1 57  ? 14.760  -4.623  -3.961  1.00 0.00 ? 57  LYS A HE2  3  
ATOM 4788  H HE3  . LYS A 1 57  ? 13.432  -5.512  -4.704  1.00 0.00 ? 57  LYS A HE3  3  
ATOM 4789  H HZ1  . LYS A 1 57  ? 13.868  -4.578  -6.775  1.00 0.00 ? 57  LYS A HZ1  3  
ATOM 4790  H HZ2  . LYS A 1 57  ? 15.409  -4.907  -6.161  1.00 0.00 ? 57  LYS A HZ2  3  
ATOM 4791  H HZ3  . LYS A 1 57  ? 14.809  -3.325  -6.136  1.00 0.00 ? 57  LYS A HZ3  3  
ATOM 4792  N N    . ALA A 1 58  ? 8.952   -6.649  -2.338  1.00 0.00 ? 58  ALA A N    3  
ATOM 4793  C CA   . ALA A 1 58  ? 8.561   -7.925  -1.753  1.00 0.00 ? 58  ALA A CA   3  
ATOM 4794  C C    . ALA A 1 58  ? 7.329   -8.494  -2.449  1.00 0.00 ? 58  ALA A C    3  
ATOM 4795  O O    . ALA A 1 58  ? 7.273   -9.685  -2.756  1.00 0.00 ? 58  ALA A O    3  
ATOM 4796  C CB   . ALA A 1 58  ? 8.301   -7.765  -0.262  1.00 0.00 ? 58  ALA A CB   3  
ATOM 4797  H H    . ALA A 1 58  ? 9.138   -5.890  -1.748  1.00 0.00 ? 58  ALA A H    3  
ATOM 4798  H HA   . ALA A 1 58  ? 9.383   -8.615  -1.877  1.00 0.00 ? 58  ALA A HA   3  
ATOM 4799  H HB1  . ALA A 1 58  ? 7.774   -8.634  0.106   1.00 0.00 ? 58  ALA A HB1  3  
ATOM 4800  H HB2  . ALA A 1 58  ? 9.241   -7.666  0.258   1.00 0.00 ? 58  ALA A HB2  3  
ATOM 4801  H HB3  . ALA A 1 58  ? 7.701   -6.883  -0.095  1.00 0.00 ? 58  ALA A HB3  3  
ATOM 4802  N N    . TRP A 1 59  ? 6.345   -7.637  -2.694  1.00 0.00 ? 59  TRP A N    3  
ATOM 4803  C CA   . TRP A 1 59  ? 5.114   -8.055  -3.353  1.00 0.00 ? 59  TRP A CA   3  
ATOM 4804  C C    . TRP A 1 59  ? 5.376   -8.432  -4.807  1.00 0.00 ? 59  TRP A C    3  
ATOM 4805  O O    . TRP A 1 59  ? 5.022   -9.526  -5.248  1.00 0.00 ? 59  TRP A O    3  
ATOM 4806  C CB   . TRP A 1 59  ? 4.069   -6.940  -3.283  1.00 0.00 ? 59  TRP A CB   3  
ATOM 4807  C CG   . TRP A 1 59  ? 2.709   -7.371  -3.742  1.00 0.00 ? 59  TRP A CG   3  
ATOM 4808  C CD1  . TRP A 1 59  ? 1.939   -6.773  -4.699  1.00 0.00 ? 59  TRP A CD1  3  
ATOM 4809  C CD2  . TRP A 1 59  ? 1.957   -8.491  -3.262  1.00 0.00 ? 59  TRP A CD2  3  
ATOM 4810  N NE1  . TRP A 1 59  ? 0.755   -7.454  -4.843  1.00 0.00 ? 59  TRP A NE1  3  
ATOM 4811  C CE2  . TRP A 1 59  ? 0.741   -8.512  -3.973  1.00 0.00 ? 59  TRP A CE2  3  
ATOM 4812  C CE3  . TRP A 1 59  ? 2.193   -9.478  -2.302  1.00 0.00 ? 59  TRP A CE3  3  
ATOM 4813  C CZ2  . TRP A 1 59  ? -0.233  -9.482  -3.752  1.00 0.00 ? 59  TRP A CZ2  3  
ATOM 4814  C CZ3  . TRP A 1 59  ? 1.225   -10.440 -2.083  1.00 0.00 ? 59  TRP A CZ3  3  
ATOM 4815  C CH2  . TRP A 1 59  ? 0.024   -10.437 -2.806  1.00 0.00 ? 59  TRP A CH2  3  
ATOM 4816  H H    . TRP A 1 59  ? 6.449   -6.700  -2.425  1.00 0.00 ? 59  TRP A H    3  
ATOM 4817  H HA   . TRP A 1 59  ? 4.737   -8.922  -2.831  1.00 0.00 ? 59  TRP A HA   3  
ATOM 4818  H HB2  . TRP A 1 59  ? 3.984   -6.599  -2.262  1.00 0.00 ? 59  TRP A HB2  3  
ATOM 4819  H HB3  . TRP A 1 59  ? 4.388   -6.119  -3.908  1.00 0.00 ? 59  TRP A HB3  3  
ATOM 4820  H HD1  . TRP A 1 59  ? 2.232   -5.893  -5.252  1.00 0.00 ? 59  TRP A HD1  3  
ATOM 4821  H HE1  . TRP A 1 59  ? 0.037   -7.220  -5.468  1.00 0.00 ? 59  TRP A HE1  3  
ATOM 4822  H HE3  . TRP A 1 59  ? 3.112   -9.498  -1.735  1.00 0.00 ? 59  TRP A HE3  3  
ATOM 4823  H HZ2  . TRP A 1 59  ? -1.163  -9.493  -4.301  1.00 0.00 ? 59  TRP A HZ2  3  
ATOM 4824  H HZ3  . TRP A 1 59  ? 1.390   -11.211 -1.345  1.00 0.00 ? 59  TRP A HZ3  3  
ATOM 4825  H HH2  . TRP A 1 59  ? -0.703  -11.207 -2.602  1.00 0.00 ? 59  TRP A HH2  3  
ATOM 4826  N N    . ALA A 1 60  ? 5.997   -7.521  -5.548  1.00 0.00 ? 60  ALA A N    3  
ATOM 4827  C CA   . ALA A 1 60  ? 6.308   -7.759  -6.952  1.00 0.00 ? 60  ALA A CA   3  
ATOM 4828  C C    . ALA A 1 60  ? 7.038   -9.086  -7.135  1.00 0.00 ? 60  ALA A C    3  
ATOM 4829  O O    . ALA A 1 60  ? 6.666   -9.899  -7.982  1.00 0.00 ? 60  ALA A O    3  
ATOM 4830  C CB   . ALA A 1 60  ? 7.142   -6.615  -7.510  1.00 0.00 ? 60  ALA A CB   3  
ATOM 4831  H H    . ALA A 1 60  ? 6.254   -6.668  -5.140  1.00 0.00 ? 60  ALA A H    3  
ATOM 4832  H HA   . ALA A 1 60  ? 5.377   -7.794  -7.499  1.00 0.00 ? 60  ALA A HA   3  
ATOM 4833  H HB1  . ALA A 1 60  ? 7.984   -6.433  -6.858  1.00 0.00 ? 60  ALA A HB1  3  
ATOM 4834  H HB2  . ALA A 1 60  ? 7.498   -6.877  -8.495  1.00 0.00 ? 60  ALA A HB2  3  
ATOM 4835  H HB3  . ALA A 1 60  ? 6.534   -5.725  -7.571  1.00 0.00 ? 60  ALA A HB3  3  
ATOM 4836  N N    . LEU A 1 61  ? 8.077   -9.299  -6.335  1.00 0.00 ? 61  LEU A N    3  
ATOM 4837  C CA   . LEU A 1 61  ? 8.860   -10.528 -6.409  1.00 0.00 ? 61  LEU A CA   3  
ATOM 4838  C C    . LEU A 1 61  ? 8.080   -11.706 -5.835  1.00 0.00 ? 61  LEU A C    3  
ATOM 4839  O O    . LEU A 1 61  ? 8.113   -12.810 -6.378  1.00 0.00 ? 61  LEU A O    3  
ATOM 4840  C CB   . LEU A 1 61  ? 10.181  -10.360 -5.657  1.00 0.00 ? 61  LEU A CB   3  
ATOM 4841  C CG   . LEU A 1 61  ? 11.134  -9.297  -6.202  1.00 0.00 ? 61  LEU A CG   3  
ATOM 4842  C CD1  . LEU A 1 61  ? 11.963  -8.696  -5.078  1.00 0.00 ? 61  LEU A CD1  3  
ATOM 4843  C CD2  . LEU A 1 61  ? 12.037  -9.889  -7.275  1.00 0.00 ? 61  LEU A CD2  3  
ATOM 4844  H H    . LEU A 1 61  ? 8.325   -8.615  -5.680  1.00 0.00 ? 61  LEU A H    3  
ATOM 4845  H HA   . LEU A 1 61  ? 9.070   -10.724 -7.450  1.00 0.00 ? 61  LEU A HA   3  
ATOM 4846  H HB2  . LEU A 1 61  ? 9.949   -10.103 -4.635  1.00 0.00 ? 61  LEU A HB2  3  
ATOM 4847  H HB3  . LEU A 1 61  ? 10.696  -11.310 -5.679  1.00 0.00 ? 61  LEU A HB3  3  
ATOM 4848  H HG   . LEU A 1 61  ? 10.557  -8.501  -6.652  1.00 0.00 ? 61  LEU A HG   3  
ATOM 4849  H HD11 . LEU A 1 61  ? 12.701  -9.413  -4.752  1.00 0.00 ? 61  LEU A HD11 3  
ATOM 4850  H HD12 . LEU A 1 61  ? 11.317  -8.441  -4.251  1.00 0.00 ? 61  LEU A HD12 3  
ATOM 4851  H HD13 . LEU A 1 61  ? 12.460  -7.804  -5.434  1.00 0.00 ? 61  LEU A HD13 3  
ATOM 4852  H HD21 . LEU A 1 61  ? 12.356  -10.875 -6.972  1.00 0.00 ? 61  LEU A HD21 3  
ATOM 4853  H HD22 . LEU A 1 61  ? 12.902  -9.256  -7.407  1.00 0.00 ? 61  LEU A HD22 3  
ATOM 4854  H HD23 . LEU A 1 61  ? 11.493  -9.957  -8.205  1.00 0.00 ? 61  LEU A HD23 3  
ATOM 4855  N N    . PHE A 1 62  ? 7.377   -11.463 -4.734  1.00 0.00 ? 62  PHE A N    3  
ATOM 4856  C CA   . PHE A 1 62  ? 6.586   -12.503 -4.086  1.00 0.00 ? 62  PHE A CA   3  
ATOM 4857  C C    . PHE A 1 62  ? 5.573   -13.101 -5.057  1.00 0.00 ? 62  PHE A C    3  
ATOM 4858  O O    . PHE A 1 62  ? 5.571   -14.307 -5.305  1.00 0.00 ? 62  PHE A O    3  
ATOM 4859  C CB   . PHE A 1 62  ? 5.863   -11.936 -2.862  1.00 0.00 ? 62  PHE A CB   3  
ATOM 4860  C CG   . PHE A 1 62  ? 4.699   -12.772 -2.413  1.00 0.00 ? 62  PHE A CG   3  
ATOM 4861  C CD1  . PHE A 1 62  ? 3.452   -12.617 -2.998  1.00 0.00 ? 62  PHE A CD1  3  
ATOM 4862  C CD2  . PHE A 1 62  ? 4.851   -13.713 -1.408  1.00 0.00 ? 62  PHE A CD2  3  
ATOM 4863  C CE1  . PHE A 1 62  ? 2.379   -13.385 -2.586  1.00 0.00 ? 62  PHE A CE1  3  
ATOM 4864  C CE2  . PHE A 1 62  ? 3.782   -14.484 -0.992  1.00 0.00 ? 62  PHE A CE2  3  
ATOM 4865  C CZ   . PHE A 1 62  ? 2.544   -14.320 -1.583  1.00 0.00 ? 62  PHE A CZ   3  
ATOM 4866  H H    . PHE A 1 62  ? 7.390   -10.562 -4.347  1.00 0.00 ? 62  PHE A H    3  
ATOM 4867  H HA   . PHE A 1 62  ? 7.263   -13.280 -3.765  1.00 0.00 ? 62  PHE A HA   3  
ATOM 4868  H HB2  . PHE A 1 62  ? 6.560   -11.870 -2.040  1.00 0.00 ? 62  PHE A HB2  3  
ATOM 4869  H HB3  . PHE A 1 62  ? 5.494   -10.949 -3.097  1.00 0.00 ? 62  PHE A HB3  3  
ATOM 4870  H HD1  . PHE A 1 62  ? 3.321   -11.887 -3.783  1.00 0.00 ? 62  PHE A HD1  3  
ATOM 4871  H HD2  . PHE A 1 62  ? 5.820   -13.842 -0.945  1.00 0.00 ? 62  PHE A HD2  3  
ATOM 4872  H HE1  . PHE A 1 62  ? 1.412   -13.255 -3.049  1.00 0.00 ? 62  PHE A HE1  3  
ATOM 4873  H HE2  . PHE A 1 62  ? 3.915   -15.214 -0.208  1.00 0.00 ? 62  PHE A HE2  3  
ATOM 4874  H HZ   . PHE A 1 62  ? 1.707   -14.920 -1.259  1.00 0.00 ? 62  PHE A HZ   3  
ATOM 4875  N N    . LYS A 1 63  ? 4.713   -12.249 -5.605  1.00 0.00 ? 63  LYS A N    3  
ATOM 4876  C CA   . LYS A 1 63  ? 3.695   -12.691 -6.550  1.00 0.00 ? 63  LYS A CA   3  
ATOM 4877  C C    . LYS A 1 63  ? 4.317   -13.033 -7.900  1.00 0.00 ? 63  LYS A C    3  
ATOM 4878  O O    . LYS A 1 63  ? 4.315   -14.189 -8.320  1.00 0.00 ? 63  LYS A O    3  
ATOM 4879  C CB   . LYS A 1 63  ? 2.630   -11.606 -6.727  1.00 0.00 ? 63  LYS A CB   3  
ATOM 4880  C CG   . LYS A 1 63  ? 1.361   -12.104 -7.398  1.00 0.00 ? 63  LYS A CG   3  
ATOM 4881  C CD   . LYS A 1 63  ? 0.521   -12.942 -6.449  1.00 0.00 ? 63  LYS A CD   3  
ATOM 4882  C CE   . LYS A 1 63  ? -0.482  -12.088 -5.689  1.00 0.00 ? 63  LYS A CE   3  
ATOM 4883  N NZ   . LYS A 1 63  ? -1.630  -11.684 -6.547  1.00 0.00 ? 63  LYS A NZ   3  
ATOM 4884  H H    . LYS A 1 63  ? 4.765   -11.299 -5.368  1.00 0.00 ? 63  LYS A H    3  
ATOM 4885  H HA   . LYS A 1 63  ? 3.230   -13.577 -6.147  1.00 0.00 ? 63  LYS A HA   3  
ATOM 4886  H HB2  . LYS A 1 63  ? 2.369   -11.213 -5.756  1.00 0.00 ? 63  LYS A HB2  3  
ATOM 4887  H HB3  . LYS A 1 63  ? 3.042   -10.809 -7.330  1.00 0.00 ? 63  LYS A HB3  3  
ATOM 4888  H HG2  . LYS A 1 63  ? 0.778   -11.254 -7.721  1.00 0.00 ? 63  LYS A HG2  3  
ATOM 4889  H HG3  . LYS A 1 63  ? 1.629   -12.705 -8.254  1.00 0.00 ? 63  LYS A HG3  3  
ATOM 4890  H HD2  . LYS A 1 63  ? -0.016  -13.686 -7.019  1.00 0.00 ? 63  LYS A HD2  3  
ATOM 4891  H HD3  . LYS A 1 63  ? 1.174   -13.431 -5.740  1.00 0.00 ? 63  LYS A HD3  3  
ATOM 4892  H HE2  . LYS A 1 63  ? -0.854  -12.654 -4.849  1.00 0.00 ? 63  LYS A HE2  3  
ATOM 4893  H HE3  . LYS A 1 63  ? 0.019   -11.200 -5.331  1.00 0.00 ? 63  LYS A HE3  3  
ATOM 4894  H HZ1  . LYS A 1 63  ? -1.328  -10.959 -7.229  1.00 0.00 ? 63  LYS A HZ1  3  
ATOM 4895  H HZ2  . LYS A 1 63  ? -2.395  -11.295 -5.961  1.00 0.00 ? 63  LYS A HZ2  3  
ATOM 4896  H HZ3  . LYS A 1 63  ? -1.992  -12.507 -7.070  1.00 0.00 ? 63  LYS A HZ3  3  
ATOM 4897  N N    . GLY A 1 64  ? 4.850   -12.018 -8.575  1.00 0.00 ? 64  GLY A N    3  
ATOM 4898  C CA   . GLY A 1 64  ? 5.470   -12.233 -9.870  1.00 0.00 ? 64  GLY A CA   3  
ATOM 4899  C C    . GLY A 1 64  ? 6.927   -12.633 -9.756  1.00 0.00 ? 64  GLY A C    3  
ATOM 4900  O O    . GLY A 1 64  ? 7.356   -13.162 -8.730  1.00 0.00 ? 64  GLY A O    3  
ATOM 4901  H H    . GLY A 1 64  ? 4.822   -11.117 -8.190  1.00 0.00 ? 64  GLY A H    3  
ATOM 4902  H HA2  . GLY A 1 64  ? 4.933   -13.013 -10.389 1.00 0.00 ? 64  GLY A HA2  3  
ATOM 4903  H HA3  . GLY A 1 64  ? 5.402   -11.320 -10.444 1.00 0.00 ? 64  GLY A HA3  3  
ATOM 4904  N N    . LYS A 1 65  ? 7.692   -12.381 -10.812 1.00 0.00 ? 65  LYS A N    3  
ATOM 4905  C CA   . LYS A 1 65  ? 9.111   -12.718 -10.828 1.00 0.00 ? 65  LYS A CA   3  
ATOM 4906  C C    . LYS A 1 65  ? 9.925   -11.612 -11.492 1.00 0.00 ? 65  LYS A C    3  
ATOM 4907  O O    . LYS A 1 65  ? 9.871   -11.431 -12.708 1.00 0.00 ? 65  LYS A O    3  
ATOM 4908  C CB   . LYS A 1 65  ? 9.334   -14.041 -11.564 1.00 0.00 ? 65  LYS A CB   3  
ATOM 4909  C CG   . LYS A 1 65  ? 10.608  -14.758 -11.154 1.00 0.00 ? 65  LYS A CG   3  
ATOM 4910  C CD   . LYS A 1 65  ? 10.496  -15.338 -9.754  1.00 0.00 ? 65  LYS A CD   3  
ATOM 4911  C CE   . LYS A 1 65  ? 9.733   -16.654 -9.755  1.00 0.00 ? 65  LYS A CE   3  
ATOM 4912  N NZ   . LYS A 1 65  ? 9.056   -16.904 -8.453  1.00 0.00 ? 65  LYS A NZ   3  
ATOM 4913  H H    . LYS A 1 65  ? 7.293   -11.957 -11.601 1.00 0.00 ? 65  LYS A H    3  
ATOM 4914  H HA   . LYS A 1 65  ? 9.438   -12.825 -9.805  1.00 0.00 ? 65  LYS A HA   3  
ATOM 4915  H HB2  . LYS A 1 65  ? 8.497   -14.695 -11.365 1.00 0.00 ? 65  LYS A HB2  3  
ATOM 4916  H HB3  . LYS A 1 65  ? 9.382   -13.845 -12.626 1.00 0.00 ? 65  LYS A HB3  3  
ATOM 4917  H HG2  . LYS A 1 65  ? 10.799  -15.561 -11.850 1.00 0.00 ? 65  LYS A HG2  3  
ATOM 4918  H HG3  . LYS A 1 65  ? 11.429  -14.056 -11.178 1.00 0.00 ? 65  LYS A HG3  3  
ATOM 4919  H HD2  . LYS A 1 65  ? 11.488  -15.510 -9.364  1.00 0.00 ? 65  LYS A HD2  3  
ATOM 4920  H HD3  . LYS A 1 65  ? 9.976   -14.632 -9.122  1.00 0.00 ? 65  LYS A HD3  3  
ATOM 4921  H HE2  . LYS A 1 65  ? 8.990   -16.624 -10.537 1.00 0.00 ? 65  LYS A HE2  3  
ATOM 4922  H HE3  . LYS A 1 65  ? 10.428  -17.457 -9.950  1.00 0.00 ? 65  LYS A HE3  3  
ATOM 4923  H HZ1  . LYS A 1 65  ? 9.682   -16.634 -7.667  1.00 0.00 ? 65  LYS A HZ1  3  
ATOM 4924  H HZ2  . LYS A 1 65  ? 8.820   -17.913 -8.361  1.00 0.00 ? 65  LYS A HZ2  3  
ATOM 4925  H HZ3  . LYS A 1 65  ? 8.180   -16.347 -8.392  1.00 0.00 ? 65  LYS A HZ3  3  
ATOM 4926  N N    . PHE A 1 66  ? 10.682  -10.875 -10.685 1.00 0.00 ? 66  PHE A N    3  
ATOM 4927  C CA   . PHE A 1 66  ? 11.508  -9.787  -11.194 1.00 0.00 ? 66  PHE A CA   3  
ATOM 4928  C C    . PHE A 1 66  ? 12.983  -10.037 -10.891 1.00 0.00 ? 66  PHE A C    3  
ATOM 4929  O O    . PHE A 1 66  ? 13.335  -10.496 -9.805  1.00 0.00 ? 66  PHE A O    3  
ATOM 4930  C CB   . PHE A 1 66  ? 11.069  -8.455  -10.582 1.00 0.00 ? 66  PHE A CB   3  
ATOM 4931  C CG   . PHE A 1 66  ? 12.182  -7.454  -10.462 1.00 0.00 ? 66  PHE A CG   3  
ATOM 4932  C CD1  . PHE A 1 66  ? 12.708  -6.844  -11.589 1.00 0.00 ? 66  PHE A CD1  3  
ATOM 4933  C CD2  . PHE A 1 66  ? 12.703  -7.123  -9.221  1.00 0.00 ? 66  PHE A CD2  3  
ATOM 4934  C CE1  . PHE A 1 66  ? 13.733  -5.924  -11.482 1.00 0.00 ? 66  PHE A CE1  3  
ATOM 4935  C CE2  . PHE A 1 66  ? 13.728  -6.202  -9.107  1.00 0.00 ? 66  PHE A CE2  3  
ATOM 4936  C CZ   . PHE A 1 66  ? 14.243  -5.601  -10.239 1.00 0.00 ? 66  PHE A CZ   3  
ATOM 4937  H H    . PHE A 1 66  ? 10.683  -11.067 -9.723  1.00 0.00 ? 66  PHE A H    3  
ATOM 4938  H HA   . PHE A 1 66  ? 11.375  -9.743  -12.264 1.00 0.00 ? 66  PHE A HA   3  
ATOM 4939  H HB2  . PHE A 1 66  ? 10.298  -8.020  -11.200 1.00 0.00 ? 66  PHE A HB2  3  
ATOM 4940  H HB3  . PHE A 1 66  ? 10.674  -8.634  -9.593  1.00 0.00 ? 66  PHE A HB3  3  
ATOM 4941  H HD1  . PHE A 1 66  ? 12.310  -7.094  -12.562 1.00 0.00 ? 66  PHE A HD1  3  
ATOM 4942  H HD2  . PHE A 1 66  ? 12.300  -7.592  -8.335  1.00 0.00 ? 66  PHE A HD2  3  
ATOM 4943  H HE1  . PHE A 1 66  ? 14.134  -5.455  -12.368 1.00 0.00 ? 66  PHE A HE1  3  
ATOM 4944  H HE2  . PHE A 1 66  ? 14.124  -5.953  -8.134  1.00 0.00 ? 66  PHE A HE2  3  
ATOM 4945  H HZ   . PHE A 1 66  ? 15.044  -4.883  -10.152 1.00 0.00 ? 66  PHE A HZ   3  
ATOM 4946  N N    . ARG A 1 67  ? 13.839  -9.732  -11.861 1.00 0.00 ? 67  ARG A N    3  
ATOM 4947  C CA   . ARG A 1 67  ? 15.275  -9.924  -11.700 1.00 0.00 ? 67  ARG A CA   3  
ATOM 4948  C C    . ARG A 1 67  ? 15.927  -8.682  -11.101 1.00 0.00 ? 67  ARG A C    3  
ATOM 4949  O O    . ARG A 1 67  ? 15.860  -7.596  -11.676 1.00 0.00 ? 67  ARG A O    3  
ATOM 4950  C CB   . ARG A 1 67  ? 15.921  -10.253 -13.047 1.00 0.00 ? 67  ARG A CB   3  
ATOM 4951  C CG   . ARG A 1 67  ? 15.965  -11.740 -13.355 1.00 0.00 ? 67  ARG A CG   3  
ATOM 4952  C CD   . ARG A 1 67  ? 15.978  -11.999 -14.854 1.00 0.00 ? 67  ARG A CD   3  
ATOM 4953  N NE   . ARG A 1 67  ? 15.742  -13.405 -15.169 1.00 0.00 ? 67  ARG A NE   3  
ATOM 4954  C CZ   . ARG A 1 67  ? 16.165  -13.989 -16.285 1.00 0.00 ? 67  ARG A CZ   3  
ATOM 4955  N NH1  . ARG A 1 67  ? 16.841  -13.291 -17.187 1.00 0.00 ? 67  ARG A NH1  3  
ATOM 4956  N NH2  . ARG A 1 67  ? 15.912  -15.274 -16.500 1.00 0.00 ? 67  ARG A NH2  3  
ATOM 4957  H H    . ARG A 1 67  ? 13.497  -9.369  -12.705 1.00 0.00 ? 67  ARG A H    3  
ATOM 4958  H HA   . ARG A 1 67  ? 15.425  -10.755 -11.027 1.00 0.00 ? 67  ARG A HA   3  
ATOM 4959  H HB2  . ARG A 1 67  ? 15.363  -9.762  -13.831 1.00 0.00 ? 67  ARG A HB2  3  
ATOM 4960  H HB3  . ARG A 1 67  ? 16.934  -9.877  -13.048 1.00 0.00 ? 67  ARG A HB3  3  
ATOM 4961  H HG2  . ARG A 1 67  ? 16.859  -12.163 -12.921 1.00 0.00 ? 67  ARG A HG2  3  
ATOM 4962  H HG3  . ARG A 1 67  ? 15.094  -12.213 -12.925 1.00 0.00 ? 67  ARG A HG3  3  
ATOM 4963  H HD2  . ARG A 1 67  ? 15.205  -11.402 -15.315 1.00 0.00 ? 67  ARG A HD2  3  
ATOM 4964  H HD3  . ARG A 1 67  ? 16.940  -11.707 -15.247 1.00 0.00 ? 67  ARG A HD3  3  
ATOM 4965  H HE   . ARG A 1 67  ? 15.244  -13.939 -14.516 1.00 0.00 ? 67  ARG A HE   3  
ATOM 4966  H HH11 . ARG A 1 67  ? 17.035  -12.324 -17.027 1.00 0.00 ? 67  ARG A HH11 3  
ATOM 4967  H HH12 . ARG A 1 67  ? 17.159  -13.734 -18.026 1.00 0.00 ? 67  ARG A HH12 3  
ATOM 4968  H HH21 . ARG A 1 67  ? 15.402  -15.803 -15.822 1.00 0.00 ? 67  ARG A HH21 3  
ATOM 4969  H HH22 . ARG A 1 67  ? 16.230  -15.712 -17.340 1.00 0.00 ? 67  ARG A HH22 3  
ATOM 4970  N N    . GLU A 1 68  ? 16.557  -8.850  -9.942  1.00 0.00 ? 68  GLU A N    3  
ATOM 4971  C CA   . GLU A 1 68  ? 17.219  -7.741  -9.265  1.00 0.00 ? 68  GLU A CA   3  
ATOM 4972  C C    . GLU A 1 68  ? 18.490  -7.333  -10.004 1.00 0.00 ? 68  GLU A C    3  
ATOM 4973  O O    . GLU A 1 68  ? 18.639  -6.184  -10.418 1.00 0.00 ? 68  GLU A O    3  
ATOM 4974  C CB   . GLU A 1 68  ? 17.555  -8.123  -7.822  1.00 0.00 ? 68  GLU A CB   3  
ATOM 4975  C CG   . GLU A 1 68  ? 17.953  -6.940  -6.956  1.00 0.00 ? 68  GLU A CG   3  
ATOM 4976  C CD   . GLU A 1 68  ? 18.822  -5.941  -7.696  1.00 0.00 ? 68  GLU A CD   3  
ATOM 4977  O OE1  . GLU A 1 68  ? 19.968  -6.294  -8.044  1.00 0.00 ? 68  GLU A OE1  3  
ATOM 4978  O OE2  . GLU A 1 68  ? 18.355  -4.806  -7.927  1.00 0.00 ? 68  GLU A OE2  3  
ATOM 4979  H H    . GLU A 1 68  ? 16.576  -9.740  -9.533  1.00 0.00 ? 68  GLU A H    3  
ATOM 4980  H HA   . GLU A 1 68  ? 16.538  -6.904  -9.256  1.00 0.00 ? 68  GLU A HA   3  
ATOM 4981  H HB2  . GLU A 1 68  ? 16.692  -8.595  -7.377  1.00 0.00 ? 68  GLU A HB2  3  
ATOM 4982  H HB3  . GLU A 1 68  ? 18.374  -8.827  -7.831  1.00 0.00 ? 68  GLU A HB3  3  
ATOM 4983  H HG2  . GLU A 1 68  ? 17.057  -6.437  -6.623  1.00 0.00 ? 68  GLU A HG2  3  
ATOM 4984  H HG3  . GLU A 1 68  ? 18.499  -7.305  -6.099  1.00 0.00 ? 68  GLU A HG3  3  
ATOM 4985  N N    . GLY A 1 69  ? 19.405  -8.284  -10.166 1.00 0.00 ? 69  GLY A N    3  
ATOM 4986  C CA   . GLY A 1 69  ? 20.652  -8.005  -10.854 1.00 0.00 ? 69  GLY A CA   3  
ATOM 4987  C C    . GLY A 1 69  ? 20.499  -8.027  -12.362 1.00 0.00 ? 69  GLY A C    3  
ATOM 4988  O O    . GLY A 1 69  ? 20.643  -6.997  -13.021 1.00 0.00 ? 69  GLY A O    3  
ATOM 4989  H H    . GLY A 1 69  ? 19.232  -9.183  -9.814  1.00 0.00 ? 69  GLY A H    3  
ATOM 4990  H HA2  . GLY A 1 69  ? 21.007  -7.031  -10.552 1.00 0.00 ? 69  GLY A HA2  3  
ATOM 4991  H HA3  . GLY A 1 69  ? 21.382  -8.748  -10.567 1.00 0.00 ? 69  GLY A HA3  3  
ATOM 4992  N N    . ILE A 1 70  ? 20.208  -9.202  -12.909 1.00 0.00 ? 70  ILE A N    3  
ATOM 4993  C CA   . ILE A 1 70  ? 20.037  -9.353  -14.348 1.00 0.00 ? 70  ILE A CA   3  
ATOM 4994  C C    . ILE A 1 70  ? 19.245  -8.188  -14.932 1.00 0.00 ? 70  ILE A C    3  
ATOM 4995  O O    . ILE A 1 70  ? 19.595  -7.652  -15.984 1.00 0.00 ? 70  ILE A O    3  
ATOM 4996  C CB   . ILE A 1 70  ? 19.320  -10.672 -14.695 1.00 0.00 ? 70  ILE A CB   3  
ATOM 4997  C CG1  . ILE A 1 70  ? 20.125  -11.866 -14.178 1.00 0.00 ? 70  ILE A CG1  3  
ATOM 4998  C CG2  . ILE A 1 70  ? 19.108  -10.780 -16.197 1.00 0.00 ? 70  ILE A CG2  3  
ATOM 4999  C CD1  . ILE A 1 70  ? 19.316  -13.140 -14.075 1.00 0.00 ? 70  ILE A CD1  3  
ATOM 5000  H H    . ILE A 1 70  ? 20.106  -9.987  -12.330 1.00 0.00 ? 70  ILE A H    3  
ATOM 5001  H HA   . ILE A 1 70  ? 21.018  -9.370  -14.800 1.00 0.00 ? 70  ILE A HA   3  
ATOM 5002  H HB   . ILE A 1 70  ? 18.352  -10.665 -14.218 1.00 0.00 ? 70  ILE A HB   3  
ATOM 5003  H HG12 . ILE A 1 70  ? 20.952  -12.051 -14.845 1.00 0.00 ? 70  ILE A HG12 3  
ATOM 5004  H HG13 . ILE A 1 70  ? 20.506  -11.634 -13.193 1.00 0.00 ? 70  ILE A HG13 3  
ATOM 5005  H HG21 . ILE A 1 70  ? 18.127  -10.405 -16.450 1.00 0.00 ? 70  ILE A HG21 3  
ATOM 5006  H HG22 . ILE A 1 70  ? 19.858  -10.196 -16.709 1.00 0.00 ? 70  ILE A HG22 3  
ATOM 5007  H HG23 . ILE A 1 70  ? 19.187  -11.813 -16.499 1.00 0.00 ? 70  ILE A HG23 3  
ATOM 5008  H HD11 . ILE A 1 70  ? 18.293  -12.942 -14.359 1.00 0.00 ? 70  ILE A HD11 3  
ATOM 5009  H HD12 . ILE A 1 70  ? 19.735  -13.887 -14.733 1.00 0.00 ? 70  ILE A HD12 3  
ATOM 5010  H HD13 . ILE A 1 70  ? 19.343  -13.503 -13.058 1.00 0.00 ? 70  ILE A HD13 3  
ATOM 5011  N N    . ASP A 1 71  ? 18.177  -7.801  -14.243 1.00 0.00 ? 71  ASP A N    3  
ATOM 5012  C CA   . ASP A 1 71  ? 17.337  -6.697  -14.692 1.00 0.00 ? 71  ASP A CA   3  
ATOM 5013  C C    . ASP A 1 71  ? 17.507  -5.482  -13.786 1.00 0.00 ? 71  ASP A C    3  
ATOM 5014  O O    . ASP A 1 71  ? 17.928  -5.605  -12.636 1.00 0.00 ? 71  ASP A O    3  
ATOM 5015  C CB   . ASP A 1 71  ? 15.869  -7.125  -14.721 1.00 0.00 ? 71  ASP A CB   3  
ATOM 5016  C CG   . ASP A 1 71  ? 15.503  -7.853  -16.000 1.00 0.00 ? 71  ASP A CG   3  
ATOM 5017  O OD1  . ASP A 1 71  ? 16.197  -7.650  -17.018 1.00 0.00 ? 71  ASP A OD1  3  
ATOM 5018  O OD2  . ASP A 1 71  ? 14.522  -8.625  -15.982 1.00 0.00 ? 71  ASP A OD2  3  
ATOM 5019  H H    . ASP A 1 71  ? 17.950  -8.269  -13.412 1.00 0.00 ? 71  ASP A H    3  
ATOM 5020  H HA   . ASP A 1 71  ? 17.644  -6.431  -15.692 1.00 0.00 ? 71  ASP A HA   3  
ATOM 5021  H HB2  . ASP A 1 71  ? 15.676  -7.784  -13.886 1.00 0.00 ? 71  ASP A HB2  3  
ATOM 5022  H HB3  . ASP A 1 71  ? 15.243  -6.249  -14.634 1.00 0.00 ? 71  ASP A HB3  3  
ATOM 5023  N N    . LYS A 1 72  ? 17.179  -4.307  -14.313 1.00 0.00 ? 72  LYS A N    3  
ATOM 5024  C CA   . LYS A 1 72  ? 17.295  -3.068  -13.554 1.00 0.00 ? 72  LYS A CA   3  
ATOM 5025  C C    . LYS A 1 72  ? 16.044  -2.824  -12.715 1.00 0.00 ? 72  LYS A C    3  
ATOM 5026  O O    . LYS A 1 72  ? 14.915  -2.979  -13.182 1.00 0.00 ? 72  LYS A O    3  
ATOM 5027  C CB   . LYS A 1 72  ? 17.527  -1.886  -14.499 1.00 0.00 ? 72  LYS A CB   3  
ATOM 5028  C CG   . LYS A 1 72  ? 18.991  -1.637  -14.813 1.00 0.00 ? 72  LYS A CG   3  
ATOM 5029  C CD   . LYS A 1 72  ? 19.592  -2.779  -15.615 1.00 0.00 ? 72  LYS A CD   3  
ATOM 5030  C CE   . LYS A 1 72  ? 21.049  -2.512  -15.961 1.00 0.00 ? 72  LYS A CE   3  
ATOM 5031  N NZ   . LYS A 1 72  ? 21.183  -1.553  -17.092 1.00 0.00 ? 72  LYS A NZ   3  
ATOM 5032  H H    . LYS A 1 72  ? 16.849  -4.273  -15.236 1.00 0.00 ? 72  LYS A H    3  
ATOM 5033  H HA   . LYS A 1 72  ? 18.144  -3.161  -12.894 1.00 0.00 ? 72  LYS A HA   3  
ATOM 5034  H HB2  . LYS A 1 72  ? 17.008  -2.076  -15.427 1.00 0.00 ? 72  LYS A HB2  3  
ATOM 5035  H HB3  . LYS A 1 72  ? 17.120  -0.993  -14.045 1.00 0.00 ? 72  LYS A HB3  3  
ATOM 5036  H HG2  . LYS A 1 72  ? 19.077  -0.725  -15.386 1.00 0.00 ? 72  LYS A HG2  3  
ATOM 5037  H HG3  . LYS A 1 72  ? 19.537  -1.534  -13.886 1.00 0.00 ? 72  LYS A HG3  3  
ATOM 5038  H HD2  . LYS A 1 72  ? 19.533  -3.687  -15.033 1.00 0.00 ? 72  LYS A HD2  3  
ATOM 5039  H HD3  . LYS A 1 72  ? 19.030  -2.900  -16.530 1.00 0.00 ? 72  LYS A HD3  3  
ATOM 5040  H HE2  . LYS A 1 72  ? 21.542  -2.103  -15.093 1.00 0.00 ? 72  LYS A HE2  3  
ATOM 5041  H HE3  . LYS A 1 72  ? 21.517  -3.446  -16.235 1.00 0.00 ? 72  LYS A HE3  3  
ATOM 5042  H HZ1  . LYS A 1 72  ? 20.282  -1.058  -17.250 1.00 0.00 ? 72  LYS A HZ1  3  
ATOM 5043  H HZ2  . LYS A 1 72  ? 21.443  -2.060  -17.962 1.00 0.00 ? 72  LYS A HZ2  3  
ATOM 5044  H HZ3  . LYS A 1 72  ? 21.919  -0.850  -16.880 1.00 0.00 ? 72  LYS A HZ3  3  
ATOM 5045  N N    . PRO A 1 73  ? 16.247  -2.432  -11.449 1.00 0.00 ? 73  PRO A N    3  
ATOM 5046  C CA   . PRO A 1 73  ? 15.147  -2.157  -10.520 1.00 0.00 ? 73  PRO A CA   3  
ATOM 5047  C C    . PRO A 1 73  ? 14.377  -0.894  -10.890 1.00 0.00 ? 73  PRO A C    3  
ATOM 5048  O O    . PRO A 1 73  ? 14.972  0.135   -11.212 1.00 0.00 ? 73  PRO A O    3  
ATOM 5049  C CB   . PRO A 1 73  ? 15.855  -1.976  -9.175  1.00 0.00 ? 73  PRO A CB   3  
ATOM 5050  C CG   . PRO A 1 73  ? 17.236  -1.542  -9.529  1.00 0.00 ? 73  PRO A CG   3  
ATOM 5051  C CD   . PRO A 1 73  ? 17.566  -2.228  -10.826 1.00 0.00 ? 73  PRO A CD   3  
ATOM 5052  H HA   . PRO A 1 73  ? 14.462  -2.990  -10.458 1.00 0.00 ? 73  PRO A HA   3  
ATOM 5053  H HB2  . PRO A 1 73  ? 15.341  -1.225  -8.592  1.00 0.00 ? 73  PRO A HB2  3  
ATOM 5054  H HB3  . PRO A 1 73  ? 15.862  -2.913  -8.639  1.00 0.00 ? 73  PRO A HB3  3  
ATOM 5055  H HG2  . PRO A 1 73  ? 17.262  -0.470  -9.654  1.00 0.00 ? 73  PRO A HG2  3  
ATOM 5056  H HG3  . PRO A 1 73  ? 17.926  -1.848  -8.757  1.00 0.00 ? 73  PRO A HG3  3  
ATOM 5057  H HD2  . PRO A 1 73  ? 18.188  -1.594  -11.441 1.00 0.00 ? 73  PRO A HD2  3  
ATOM 5058  H HD3  . PRO A 1 73  ? 18.054  -3.173  -10.640 1.00 0.00 ? 73  PRO A HD3  3  
ATOM 5059  N N    . ASP A 1 74  ? 13.053  -0.979  -10.843 1.00 0.00 ? 74  ASP A N    3  
ATOM 5060  C CA   . ASP A 1 74  ? 12.201  0.158   -11.173 1.00 0.00 ? 74  ASP A CA   3  
ATOM 5061  C C    . ASP A 1 74  ? 11.024  0.254   -10.207 1.00 0.00 ? 74  ASP A C    3  
ATOM 5062  O O    . ASP A 1 74  ? 10.042  -0.481  -10.312 1.00 0.00 ? 74  ASP A O    3  
ATOM 5063  C CB   . ASP A 1 74  ? 11.690  0.040   -12.609 1.00 0.00 ? 74  ASP A CB   3  
ATOM 5064  C CG   . ASP A 1 74  ? 12.700  0.534   -13.626 1.00 0.00 ? 74  ASP A CG   3  
ATOM 5065  O OD1  . ASP A 1 74  ? 13.914  0.451   -13.346 1.00 0.00 ? 74  ASP A OD1  3  
ATOM 5066  O OD2  . ASP A 1 74  ? 12.276  1.003   -14.703 1.00 0.00 ? 74  ASP A OD2  3  
ATOM 5067  H H    . ASP A 1 74  ? 12.637  -1.827  -10.580 1.00 0.00 ? 74  ASP A H    3  
ATOM 5068  H HA   . ASP A 1 74  ? 12.796  1.054   -11.085 1.00 0.00 ? 74  ASP A HA   3  
ATOM 5069  H HB2  . ASP A 1 74  ? 11.470  -0.996  -12.823 1.00 0.00 ? 74  ASP A HB2  3  
ATOM 5070  H HB3  . ASP A 1 74  ? 10.787  0.623   -12.712 1.00 0.00 ? 74  ASP A HB3  3  
ATOM 5071  N N    . PRO A 1 75  ? 11.124  1.180   -9.242  1.00 0.00 ? 75  PRO A N    3  
ATOM 5072  C CA   . PRO A 1 75  ? 10.078  1.393   -8.238  1.00 0.00 ? 75  PRO A CA   3  
ATOM 5073  C C    . PRO A 1 75  ? 8.689   1.495   -8.861  1.00 0.00 ? 75  PRO A C    3  
ATOM 5074  O O    . PRO A 1 75  ? 7.717   0.924   -8.365  1.00 0.00 ? 75  PRO A O    3  
ATOM 5075  C CB   . PRO A 1 75  ? 10.472  2.724   -7.592  1.00 0.00 ? 75  PRO A CB   3  
ATOM 5076  C CG   . PRO A 1 75  ? 11.946  2.817   -7.787  1.00 0.00 ? 75  PRO A CG   3  
ATOM 5077  C CD   . PRO A 1 75  ? 12.267  2.090   -9.057  1.00 0.00 ? 75  PRO A CD   3  
ATOM 5078  H HA   . PRO A 1 75  ? 10.080  0.613   -7.491  1.00 0.00 ? 75  PRO A HA   3  
ATOM 5079  H HB2  . PRO A 1 75  ? 9.955   3.534   -8.086  1.00 0.00 ? 75  PRO A HB2  3  
ATOM 5080  H HB3  . PRO A 1 75  ? 10.213  2.710   -6.544  1.00 0.00 ? 75  PRO A HB3  3  
ATOM 5081  H HG2  . PRO A 1 75  ? 12.240  3.852   -7.873  1.00 0.00 ? 75  PRO A HG2  3  
ATOM 5082  H HG3  . PRO A 1 75  ? 12.456  2.349   -6.959  1.00 0.00 ? 75  PRO A HG3  3  
ATOM 5083  H HD2  . PRO A 1 75  ? 12.341  2.788   -9.878  1.00 0.00 ? 75  PRO A HD2  3  
ATOM 5084  H HD3  . PRO A 1 75  ? 13.187  1.536   -8.947  1.00 0.00 ? 75  PRO A HD3  3  
ATOM 5085  N N    . PRO A 1 76  ? 8.591   2.237   -9.973  1.00 0.00 ? 76  PRO A N    3  
ATOM 5086  C CA   . PRO A 1 76  ? 7.326   2.430   -10.688 1.00 0.00 ? 76  PRO A CA   3  
ATOM 5087  C C    . PRO A 1 76  ? 6.585   1.117   -10.919 1.00 0.00 ? 76  PRO A C    3  
ATOM 5088  O O    . PRO A 1 76  ? 5.374   1.031   -10.713 1.00 0.00 ? 76  PRO A O    3  
ATOM 5089  C CB   . PRO A 1 76  ? 7.762   3.040   -12.022 1.00 0.00 ? 76  PRO A CB   3  
ATOM 5090  C CG   . PRO A 1 76  ? 9.055   3.717   -11.725 1.00 0.00 ? 76  PRO A CG   3  
ATOM 5091  C CD   . PRO A 1 76  ? 9.709   2.947   -10.619 1.00 0.00 ? 76  PRO A CD   3  
ATOM 5092  H HA   . PRO A 1 76  ? 6.678   3.121   -10.168 1.00 0.00 ? 76  PRO A HA   3  
ATOM 5093  H HB2  . PRO A 1 76  ? 7.884   2.256   -12.756 1.00 0.00 ? 76  PRO A HB2  3  
ATOM 5094  H HB3  . PRO A 1 76  ? 7.017   3.744   -12.361 1.00 0.00 ? 76  PRO A HB3  3  
ATOM 5095  H HG2  . PRO A 1 76  ? 9.685   3.705   -12.601 1.00 0.00 ? 76  PRO A HG2  3  
ATOM 5096  H HG3  . PRO A 1 76  ? 8.873   4.732   -11.406 1.00 0.00 ? 76  PRO A HG3  3  
ATOM 5097  H HD2  . PRO A 1 76  ? 10.426  2.248   -11.024 1.00 0.00 ? 76  PRO A HD2  3  
ATOM 5098  H HD3  . PRO A 1 76  ? 10.188  3.623   -9.926  1.00 0.00 ? 76  PRO A HD3  3  
ATOM 5099  N N    . THR A 1 77  ? 7.320   0.095   -11.347 1.00 0.00 ? 77  THR A N    3  
ATOM 5100  C CA   . THR A 1 77  ? 6.733   -1.213  -11.606 1.00 0.00 ? 77  THR A CA   3  
ATOM 5101  C C    . THR A 1 77  ? 6.115   -1.799  -10.342 1.00 0.00 ? 77  THR A C    3  
ATOM 5102  O O    . THR A 1 77  ? 4.978   -2.269  -10.356 1.00 0.00 ? 77  THR A O    3  
ATOM 5103  C CB   . THR A 1 77  ? 7.780   -2.199  -12.157 1.00 0.00 ? 77  THR A CB   3  
ATOM 5104  O OG1  . THR A 1 77  ? 8.471   -1.612  -13.265 1.00 0.00 ? 77  THR A OG1  3  
ATOM 5105  C CG2  . THR A 1 77  ? 7.121   -3.499  -12.595 1.00 0.00 ? 77  THR A CG2  3  
ATOM 5106  H H    . THR A 1 77  ? 8.280   0.227   -11.492 1.00 0.00 ? 77  THR A H    3  
ATOM 5107  H HA   . THR A 1 77  ? 5.959   -1.089  -12.350 1.00 0.00 ? 77  THR A HA   3  
ATOM 5108  H HB   . THR A 1 77  ? 8.492   -2.420  -11.374 1.00 0.00 ? 77  THR A HB   3  
ATOM 5109  H HG1  . THR A 1 77  ? 9.089   -0.952  -12.943 1.00 0.00 ? 77  THR A HG1  3  
ATOM 5110  H HG21 . THR A 1 77  ? 6.420   -3.820  -11.838 1.00 0.00 ? 77  THR A HG21 3  
ATOM 5111  H HG22 . THR A 1 77  ? 7.877   -4.258  -12.730 1.00 0.00 ? 77  THR A HG22 3  
ATOM 5112  H HG23 . THR A 1 77  ? 6.598   -3.341  -13.526 1.00 0.00 ? 77  THR A HG23 3  
ATOM 5113  N N    . TRP A 1 78  ? 6.871   -1.766  -9.250  1.00 0.00 ? 78  TRP A N    3  
ATOM 5114  C CA   . TRP A 1 78  ? 6.396   -2.294  -7.976  1.00 0.00 ? 78  TRP A CA   3  
ATOM 5115  C C    . TRP A 1 78  ? 5.233   -1.465  -7.443  1.00 0.00 ? 78  TRP A C    3  
ATOM 5116  O O    . TRP A 1 78  ? 4.140   -1.984  -7.217  1.00 0.00 ? 78  TRP A O    3  
ATOM 5117  C CB   . TRP A 1 78  ? 7.534   -2.316  -6.954  1.00 0.00 ? 78  TRP A CB   3  
ATOM 5118  C CG   . TRP A 1 78  ? 8.814   -2.872  -7.502  1.00 0.00 ? 78  TRP A CG   3  
ATOM 5119  C CD1  . TRP A 1 78  ? 8.948   -3.917  -8.370  1.00 0.00 ? 78  TRP A CD1  3  
ATOM 5120  C CD2  . TRP A 1 78  ? 10.139  -2.412  -7.216  1.00 0.00 ? 78  TRP A CD2  3  
ATOM 5121  N NE1  . TRP A 1 78  ? 10.277  -4.135  -8.641  1.00 0.00 ? 78  TRP A NE1  3  
ATOM 5122  C CE2  . TRP A 1 78  ? 11.028  -3.224  -7.946  1.00 0.00 ? 78  TRP A CE2  3  
ATOM 5123  C CE3  . TRP A 1 78  ? 10.661  -1.392  -6.416  1.00 0.00 ? 78  TRP A CE3  3  
ATOM 5124  C CZ2  . TRP A 1 78  ? 12.408  -3.047  -7.897  1.00 0.00 ? 78  TRP A CZ2  3  
ATOM 5125  C CZ3  . TRP A 1 78  ? 12.031  -1.218  -6.368  1.00 0.00 ? 78  TRP A CZ3  3  
ATOM 5126  C CH2  . TRP A 1 78  ? 12.892  -2.041  -7.106  1.00 0.00 ? 78  TRP A CH2  3  
ATOM 5127  H H    . TRP A 1 78  ? 7.770   -1.378  -9.302  1.00 0.00 ? 78  TRP A H    3  
ATOM 5128  H HA   . TRP A 1 78  ? 6.055   -3.305  -8.144  1.00 0.00 ? 78  TRP A HA   3  
ATOM 5129  H HB2  . TRP A 1 78  ? 7.725   -1.309  -6.616  1.00 0.00 ? 78  TRP A HB2  3  
ATOM 5130  H HB3  . TRP A 1 78  ? 7.239   -2.925  -6.111  1.00 0.00 ? 78  TRP A HB3  3  
ATOM 5131  H HD1  . TRP A 1 78  ? 8.122   -4.482  -8.775  1.00 0.00 ? 78  TRP A HD1  3  
ATOM 5132  H HE1  . TRP A 1 78  ? 10.630  -4.829  -9.237  1.00 0.00 ? 78  TRP A HE1  3  
ATOM 5133  H HE3  . TRP A 1 78  ? 10.014  -0.747  -5.840  1.00 0.00 ? 78  TRP A HE3  3  
ATOM 5134  H HZ2  . TRP A 1 78  ? 13.085  -3.673  -8.461  1.00 0.00 ? 78  TRP A HZ2  3  
ATOM 5135  H HZ3  . TRP A 1 78  ? 12.453  -0.435  -5.755  1.00 0.00 ? 78  TRP A HZ3  3  
ATOM 5136  H HH2  . TRP A 1 78  ? 13.955  -1.869  -7.038  1.00 0.00 ? 78  TRP A HH2  3  
ATOM 5137  N N    . LYS A 1 79  ? 5.475   -0.174  -7.244  1.00 0.00 ? 79  LYS A N    3  
ATOM 5138  C CA   . LYS A 1 79  ? 4.447   0.728   -6.739  1.00 0.00 ? 79  LYS A CA   3  
ATOM 5139  C C    . LYS A 1 79  ? 3.086   0.396   -7.343  1.00 0.00 ? 79  LYS A C    3  
ATOM 5140  O O    . LYS A 1 79  ? 2.096   0.246   -6.626  1.00 0.00 ? 79  LYS A O    3  
ATOM 5141  C CB   . LYS A 1 79  ? 4.815   2.180   -7.051  1.00 0.00 ? 79  LYS A CB   3  
ATOM 5142  C CG   . LYS A 1 79  ? 4.145   3.189   -6.134  1.00 0.00 ? 79  LYS A CG   3  
ATOM 5143  C CD   . LYS A 1 79  ? 2.722   3.486   -6.578  1.00 0.00 ? 79  LYS A CD   3  
ATOM 5144  C CE   . LYS A 1 79  ? 1.866   3.968   -5.417  1.00 0.00 ? 79  LYS A CE   3  
ATOM 5145  N NZ   . LYS A 1 79  ? 1.760   2.943   -4.342  1.00 0.00 ? 79  LYS A NZ   3  
ATOM 5146  H H    . LYS A 1 79  ? 6.367   0.181   -7.443  1.00 0.00 ? 79  LYS A H    3  
ATOM 5147  H HA   . LYS A 1 79  ? 4.392   0.602   -5.668  1.00 0.00 ? 79  LYS A HA   3  
ATOM 5148  H HB2  . LYS A 1 79  ? 5.885   2.296   -6.958  1.00 0.00 ? 79  LYS A HB2  3  
ATOM 5149  H HB3  . LYS A 1 79  ? 4.525   2.402   -8.068  1.00 0.00 ? 79  LYS A HB3  3  
ATOM 5150  H HG2  . LYS A 1 79  ? 4.122   2.790   -5.131  1.00 0.00 ? 79  LYS A HG2  3  
ATOM 5151  H HG3  . LYS A 1 79  ? 4.715   4.107   -6.146  1.00 0.00 ? 79  LYS A HG3  3  
ATOM 5152  H HD2  . LYS A 1 79  ? 2.744   4.254   -7.337  1.00 0.00 ? 79  LYS A HD2  3  
ATOM 5153  H HD3  . LYS A 1 79  ? 2.286   2.585   -6.986  1.00 0.00 ? 79  LYS A HD3  3  
ATOM 5154  H HE2  . LYS A 1 79  ? 2.309   4.863   -5.007  1.00 0.00 ? 79  LYS A HE2  3  
ATOM 5155  H HE3  . LYS A 1 79  ? 0.876   4.193   -5.786  1.00 0.00 ? 79  LYS A HE3  3  
ATOM 5156  H HZ1  . LYS A 1 79  ? 1.575   2.008   -4.758  1.00 0.00 ? 79  LYS A HZ1  3  
ATOM 5157  H HZ2  . LYS A 1 79  ? 0.982   3.182   -3.695  1.00 0.00 ? 79  LYS A HZ2  3  
ATOM 5158  H HZ3  . LYS A 1 79  ? 2.647   2.900   -3.801  1.00 0.00 ? 79  LYS A HZ3  3  
ATOM 5159  N N    . THR A 1 80  ? 3.044   0.282   -8.667  1.00 0.00 ? 80  THR A N    3  
ATOM 5160  C CA   . THR A 1 80  ? 1.806   -0.032  -9.368  1.00 0.00 ? 80  THR A CA   3  
ATOM 5161  C C    . THR A 1 80  ? 1.355   -1.459  -9.074  1.00 0.00 ? 80  THR A C    3  
ATOM 5162  O O    . THR A 1 80  ? 0.230   -1.685  -8.626  1.00 0.00 ? 80  THR A O    3  
ATOM 5163  C CB   . THR A 1 80  ? 1.962   0.142   -10.890 1.00 0.00 ? 80  THR A CB   3  
ATOM 5164  O OG1  . THR A 1 80  ? 2.331   1.491   -11.194 1.00 0.00 ? 80  THR A OG1  3  
ATOM 5165  C CG2  . THR A 1 80  ? 0.669   -0.210  -11.611 1.00 0.00 ? 80  THR A CG2  3  
ATOM 5166  H H    . THR A 1 80  ? 3.866   0.413   -9.183  1.00 0.00 ? 80  THR A H    3  
ATOM 5167  H HA   . THR A 1 80  ? 1.045   0.653   -9.024  1.00 0.00 ? 80  THR A HA   3  
ATOM 5168  H HB   . THR A 1 80  ? 2.741   -0.523  -11.235 1.00 0.00 ? 80  THR A HB   3  
ATOM 5169  H HG1  . THR A 1 80  ? 1.934   1.752   -12.028 1.00 0.00 ? 80  THR A HG1  3  
ATOM 5170  H HG21 . THR A 1 80  ? -0.170  -0.026  -10.955 1.00 0.00 ? 80  THR A HG21 3  
ATOM 5171  H HG22 . THR A 1 80  ? 0.685   -1.252  -11.892 1.00 0.00 ? 80  THR A HG22 3  
ATOM 5172  H HG23 . THR A 1 80  ? 0.573   0.401   -12.496 1.00 0.00 ? 80  THR A HG23 3  
ATOM 5173  N N    . ARG A 1 81  ? 2.239   -2.418  -9.329  1.00 0.00 ? 81  ARG A N    3  
ATOM 5174  C CA   . ARG A 1 81  ? 1.930   -3.823  -9.093  1.00 0.00 ? 81  ARG A CA   3  
ATOM 5175  C C    . ARG A 1 81  ? 1.057   -3.987  -7.852  1.00 0.00 ? 81  ARG A C    3  
ATOM 5176  O O    . ARG A 1 81  ? -0.029  -4.564  -7.916  1.00 0.00 ? 81  ARG A O    3  
ATOM 5177  C CB   . ARG A 1 81  ? 3.220   -4.630  -8.932  1.00 0.00 ? 81  ARG A CB   3  
ATOM 5178  C CG   . ARG A 1 81  ? 3.876   -5.000  -10.252 1.00 0.00 ? 81  ARG A CG   3  
ATOM 5179  C CD   . ARG A 1 81  ? 3.105   -6.098  -10.968 1.00 0.00 ? 81  ARG A CD   3  
ATOM 5180  N NE   . ARG A 1 81  ? 1.916   -5.583  -11.641 1.00 0.00 ? 81  ARG A NE   3  
ATOM 5181  C CZ   . ARG A 1 81  ? 0.783   -6.267  -11.756 1.00 0.00 ? 81  ARG A CZ   3  
ATOM 5182  N NH1  . ARG A 1 81  ? 0.686   -7.487  -11.247 1.00 0.00 ? 81  ARG A NH1  3  
ATOM 5183  N NH2  . ARG A 1 81  ? -0.257  -5.730  -12.382 1.00 0.00 ? 81  ARG A NH2  3  
ATOM 5184  H H    . ARG A 1 81  ? 3.119   -2.175  -9.686  1.00 0.00 ? 81  ARG A H    3  
ATOM 5185  H HA   . ARG A 1 81  ? 1.389   -4.193  -9.951  1.00 0.00 ? 81  ARG A HA   3  
ATOM 5186  H HB2  . ARG A 1 81  ? 3.925   -4.049  -8.356  1.00 0.00 ? 81  ARG A HB2  3  
ATOM 5187  H HB3  . ARG A 1 81  ? 2.996   -5.541  -8.398  1.00 0.00 ? 81  ARG A HB3  3  
ATOM 5188  H HG2  . ARG A 1 81  ? 3.907   -4.126  -10.886 1.00 0.00 ? 81  ARG A HG2  3  
ATOM 5189  H HG3  . ARG A 1 81  ? 4.881   -5.344  -10.060 1.00 0.00 ? 81  ARG A HG3  3  
ATOM 5190  H HD2  . ARG A 1 81  ? 3.753   -6.554  -11.703 1.00 0.00 ? 81  ARG A HD2  3  
ATOM 5191  H HD3  . ARG A 1 81  ? 2.805   -6.840  -10.244 1.00 0.00 ? 81  ARG A HD3  3  
ATOM 5192  H HE   . ARG A 1 81  ? 1.965   -4.683  -12.024 1.00 0.00 ? 81  ARG A HE   3  
ATOM 5193  H HH11 . ARG A 1 81  ? 1.468   -7.894  -10.774 1.00 0.00 ? 81  ARG A HH11 3  
ATOM 5194  H HH12 . ARG A 1 81  ? -0.168  -8.000  -11.334 1.00 0.00 ? 81  ARG A HH12 3  
ATOM 5195  H HH21 . ARG A 1 81  ? -0.188  -4.810  -12.767 1.00 0.00 ? 81  ARG A HH21 3  
ATOM 5196  H HH22 . ARG A 1 81  ? -1.109  -6.246  -12.469 1.00 0.00 ? 81  ARG A HH22 3  
ATOM 5197  N N    . LEU A 1 82  ? 1.539   -3.476  -6.724  1.00 0.00 ? 82  LEU A N    3  
ATOM 5198  C CA   . LEU A 1 82  ? 0.803   -3.566  -5.468  1.00 0.00 ? 82  LEU A CA   3  
ATOM 5199  C C    . LEU A 1 82  ? -0.464  -2.718  -5.517  1.00 0.00 ? 82  LEU A C    3  
ATOM 5200  O O    . LEU A 1 82  ? -1.568  -3.221  -5.312  1.00 0.00 ? 82  LEU A O    3  
ATOM 5201  C CB   . LEU A 1 82  ? 1.687   -3.116  -4.303  1.00 0.00 ? 82  LEU A CB   3  
ATOM 5202  C CG   . LEU A 1 82  ? 1.027   -3.109  -2.924  1.00 0.00 ? 82  LEU A CG   3  
ATOM 5203  C CD1  . LEU A 1 82  ? 0.581   -4.511  -2.538  1.00 0.00 ? 82  LEU A CD1  3  
ATOM 5204  C CD2  . LEU A 1 82  ? 1.980   -2.544  -1.880  1.00 0.00 ? 82  LEU A CD2  3  
ATOM 5205  H H    . LEU A 1 82  ? 2.410   -3.028  -6.736  1.00 0.00 ? 82  LEU A H    3  
ATOM 5206  H HA   . LEU A 1 82  ? 0.525   -4.599  -5.320  1.00 0.00 ? 82  LEU A HA   3  
ATOM 5207  H HB2  . LEU A 1 82  ? 2.538   -3.778  -4.259  1.00 0.00 ? 82  LEU A HB2  3  
ATOM 5208  H HB3  . LEU A 1 82  ? 2.025   -2.111  -4.515  1.00 0.00 ? 82  LEU A HB3  3  
ATOM 5209  H HG   . LEU A 1 82  ? 0.150   -2.477  -2.955  1.00 0.00 ? 82  LEU A HG   3  
ATOM 5210  H HD11 . LEU A 1 82  ? 0.626   -4.620  -1.465  1.00 0.00 ? 82  LEU A HD11 3  
ATOM 5211  H HD12 . LEU A 1 82  ? 1.234   -5.236  -3.001  1.00 0.00 ? 82  LEU A HD12 3  
ATOM 5212  H HD13 . LEU A 1 82  ? -0.432  -4.671  -2.876  1.00 0.00 ? 82  LEU A HD13 3  
ATOM 5213  H HD21 . LEU A 1 82  ? 1.787   -3.013  -0.927  1.00 0.00 ? 82  LEU A HD21 3  
ATOM 5214  H HD22 . LEU A 1 82  ? 1.827   -1.478  -1.793  1.00 0.00 ? 82  LEU A HD22 3  
ATOM 5215  H HD23 . LEU A 1 82  ? 2.998   -2.739  -2.179  1.00 0.00 ? 82  LEU A HD23 3  
ATOM 5216  N N    . ARG A 1 83  ? -0.296  -1.429  -5.793  1.00 0.00 ? 83  ARG A N    3  
ATOM 5217  C CA   . ARG A 1 83  ? -1.426  -0.511  -5.871  1.00 0.00 ? 83  ARG A CA   3  
ATOM 5218  C C    . ARG A 1 83  ? -2.651  -1.205  -6.458  1.00 0.00 ? 83  ARG A C    3  
ATOM 5219  O O    . ARG A 1 83  ? -3.755  -1.098  -5.922  1.00 0.00 ? 83  ARG A O    3  
ATOM 5220  C CB   . ARG A 1 83  ? -1.062  0.709   -6.718  1.00 0.00 ? 83  ARG A CB   3  
ATOM 5221  C CG   . ARG A 1 83  ? -2.235  1.640   -6.981  1.00 0.00 ? 83  ARG A CG   3  
ATOM 5222  C CD   . ARG A 1 83  ? -1.933  2.612   -8.111  1.00 0.00 ? 83  ARG A CD   3  
ATOM 5223  N NE   . ARG A 1 83  ? -3.080  3.459   -8.427  1.00 0.00 ? 83  ARG A NE   3  
ATOM 5224  C CZ   . ARG A 1 83  ? -3.266  4.033   -9.610  1.00 0.00 ? 83  ARG A CZ   3  
ATOM 5225  N NH1  . ARG A 1 83  ? -2.386  3.852   -10.584 1.00 0.00 ? 83  ARG A NH1  3  
ATOM 5226  N NH2  . ARG A 1 83  ? -4.336  4.790   -9.820  1.00 0.00 ? 83  ARG A NH2  3  
ATOM 5227  H H    . ARG A 1 83  ? 0.609   -1.086  -5.947  1.00 0.00 ? 83  ARG A H    3  
ATOM 5228  H HA   . ARG A 1 83  ? -1.658  -0.185  -4.868  1.00 0.00 ? 83  ARG A HA   3  
ATOM 5229  H HB2  . ARG A 1 83  ? -0.293  1.271   -6.209  1.00 0.00 ? 83  ARG A HB2  3  
ATOM 5230  H HB3  . ARG A 1 83  ? -0.680  0.371   -7.669  1.00 0.00 ? 83  ARG A HB3  3  
ATOM 5231  H HG2  . ARG A 1 83  ? -3.098  1.050   -7.251  1.00 0.00 ? 83  ARG A HG2  3  
ATOM 5232  H HG3  . ARG A 1 83  ? -2.446  2.200   -6.083  1.00 0.00 ? 83  ARG A HG3  3  
ATOM 5233  H HD2  . ARG A 1 83  ? -1.105  3.239   -7.817  1.00 0.00 ? 83  ARG A HD2  3  
ATOM 5234  H HD3  . ARG A 1 83  ? -1.661  2.047   -8.990  1.00 0.00 ? 83  ARG A HD3  3  
ATOM 5235  H HE   . ARG A 1 83  ? -3.743  3.606   -7.721  1.00 0.00 ? 83  ARG A HE   3  
ATOM 5236  H HH11 . ARG A 1 83  ? -1.580  3.281   -10.429 1.00 0.00 ? 83  ARG A HH11 3  
ATOM 5237  H HH12 . ARG A 1 83  ? -2.529  4.284   -11.475 1.00 0.00 ? 83  ARG A HH12 3  
ATOM 5238  H HH21 . ARG A 1 83  ? -5.002  4.928   -9.088  1.00 0.00 ? 83  ARG A HH21 3  
ATOM 5239  H HH22 . ARG A 1 83  ? -4.475  5.221   -10.711 1.00 0.00 ? 83  ARG A HH22 3  
ATOM 5240  N N    . CYS A 1 84  ? -2.449  -1.915  -7.563  1.00 0.00 ? 84  CYS A N    3  
ATOM 5241  C CA   . CYS A 1 84  ? -3.537  -2.626  -8.225  1.00 0.00 ? 84  CYS A CA   3  
ATOM 5242  C C    . CYS A 1 84  ? -4.232  -3.578  -7.257  1.00 0.00 ? 84  CYS A C    3  
ATOM 5243  O O    . CYS A 1 84  ? -5.439  -3.483  -7.036  1.00 0.00 ? 84  CYS A O    3  
ATOM 5244  C CB   . CYS A 1 84  ? -3.008  -3.402  -9.431  1.00 0.00 ? 84  CYS A CB   3  
ATOM 5245  S SG   . CYS A 1 84  ? -4.256  -3.745  -10.694 1.00 0.00 ? 84  CYS A SG   3  
ATOM 5246  H H    . CYS A 1 84  ? -1.547  -1.962  -7.943  1.00 0.00 ? 84  CYS A H    3  
ATOM 5247  H HA   . CYS A 1 84  ? -4.253  -1.893  -8.565  1.00 0.00 ? 84  CYS A HA   3  
ATOM 5248  H HB2  . CYS A 1 84  ? -2.218  -2.832  -9.898  1.00 0.00 ? 84  CYS A HB2  3  
ATOM 5249  H HB3  . CYS A 1 84  ? -2.609  -4.348  -9.095  1.00 0.00 ? 84  CYS A HB3  3  
ATOM 5250  H HG   . CYS A 1 84  ? -5.218  -2.843  -10.573 1.00 0.00 ? 84  CYS A HG   3  
ATOM 5251  N N    . ALA A 1 85  ? -3.462  -4.498  -6.685  1.00 0.00 ? 85  ALA A N    3  
ATOM 5252  C CA   . ALA A 1 85  ? -4.004  -5.468  -5.741  1.00 0.00 ? 85  ALA A CA   3  
ATOM 5253  C C    . ALA A 1 85  ? -4.879  -4.787  -4.696  1.00 0.00 ? 85  ALA A C    3  
ATOM 5254  O O    . ALA A 1 85  ? -5.997  -5.227  -4.425  1.00 0.00 ? 85  ALA A O    3  
ATOM 5255  C CB   . ALA A 1 85  ? -2.876  -6.236  -5.069  1.00 0.00 ? 85  ALA A CB   3  
ATOM 5256  H H    . ALA A 1 85  ? -2.507  -4.524  -6.902  1.00 0.00 ? 85  ALA A H    3  
ATOM 5257  H HA   . ALA A 1 85  ? -4.606  -6.174  -6.296  1.00 0.00 ? 85  ALA A HA   3  
ATOM 5258  H HB1  . ALA A 1 85  ? -1.983  -6.167  -5.674  1.00 0.00 ? 85  ALA A HB1  3  
ATOM 5259  H HB2  . ALA A 1 85  ? -2.684  -5.814  -4.094  1.00 0.00 ? 85  ALA A HB2  3  
ATOM 5260  H HB3  . ALA A 1 85  ? -3.159  -7.273  -4.963  1.00 0.00 ? 85  ALA A HB3  3  
ATOM 5261  N N    . LEU A 1 86  ? -4.364  -3.711  -4.110  1.00 0.00 ? 86  LEU A N    3  
ATOM 5262  C CA   . LEU A 1 86  ? -5.100  -2.969  -3.092  1.00 0.00 ? 86  LEU A CA   3  
ATOM 5263  C C    . LEU A 1 86  ? -6.529  -2.692  -3.546  1.00 0.00 ? 86  LEU A C    3  
ATOM 5264  O O    . LEU A 1 86  ? -7.487  -3.175  -2.944  1.00 0.00 ? 86  LEU A O    3  
ATOM 5265  C CB   . LEU A 1 86  ? -4.388  -1.651  -2.780  1.00 0.00 ? 86  LEU A CB   3  
ATOM 5266  C CG   . LEU A 1 86  ? -4.619  -1.079  -1.381  1.00 0.00 ? 86  LEU A CG   3  
ATOM 5267  C CD1  . LEU A 1 86  ? -4.099  -2.036  -0.320  1.00 0.00 ? 86  LEU A CD1  3  
ATOM 5268  C CD2  . LEU A 1 86  ? -3.952  0.283   -1.245  1.00 0.00 ? 86  LEU A CD2  3  
ATOM 5269  H H    . LEU A 1 86  ? -3.469  -3.408  -4.367  1.00 0.00 ? 86  LEU A H    3  
ATOM 5270  H HA   . LEU A 1 86  ? -5.130  -3.573  -2.198  1.00 0.00 ? 86  LEU A HA   3  
ATOM 5271  H HB2  . LEU A 1 86  ? -3.328  -1.812  -2.900  1.00 0.00 ? 86  LEU A HB2  3  
ATOM 5272  H HB3  . LEU A 1 86  ? -4.723  -0.917  -3.498  1.00 0.00 ? 86  LEU A HB3  3  
ATOM 5273  H HG   . LEU A 1 86  ? -5.681  -0.950  -1.222  1.00 0.00 ? 86  LEU A HG   3  
ATOM 5274  H HD11 . LEU A 1 86  ? -4.932  -2.524  0.164   1.00 0.00 ? 86  LEU A HD11 3  
ATOM 5275  H HD12 . LEU A 1 86  ? -3.528  -1.486  0.414   1.00 0.00 ? 86  LEU A HD12 3  
ATOM 5276  H HD13 . LEU A 1 86  ? -3.467  -2.779  -0.784  1.00 0.00 ? 86  LEU A HD13 3  
ATOM 5277  H HD21 . LEU A 1 86  ? -4.183  0.884   -2.112  1.00 0.00 ? 86  LEU A HD21 3  
ATOM 5278  H HD22 . LEU A 1 86  ? -2.882  0.154   -1.171  1.00 0.00 ? 86  LEU A HD22 3  
ATOM 5279  H HD23 . LEU A 1 86  ? -4.319  0.776   -0.357  1.00 0.00 ? 86  LEU A HD23 3  
ATOM 5280  N N    . ASN A 1 87  ? -6.665  -1.913  -4.614  1.00 0.00 ? 87  ASN A N    3  
ATOM 5281  C CA   . ASN A 1 87  ? -7.978  -1.573  -5.151  1.00 0.00 ? 87  ASN A CA   3  
ATOM 5282  C C    . ASN A 1 87  ? -8.751  -2.831  -5.535  1.00 0.00 ? 87  ASN A C    3  
ATOM 5283  O O    . ASN A 1 87  ? -9.943  -2.952  -5.251  1.00 0.00 ? 87  ASN A O    3  
ATOM 5284  C CB   . ASN A 1 87  ? -7.833  -0.658  -6.369  1.00 0.00 ? 87  ASN A CB   3  
ATOM 5285  C CG   . ASN A 1 87  ? -9.091  0.145   -6.641  1.00 0.00 ? 87  ASN A CG   3  
ATOM 5286  O OD1  . ASN A 1 87  ? -9.981  0.230   -5.796  1.00 0.00 ? 87  ASN A OD1  3  
ATOM 5287  N ND2  . ASN A 1 87  ? -9.168  0.738   -7.826  1.00 0.00 ? 87  ASN A ND2  3  
ATOM 5288  H H    . ASN A 1 87  ? -5.864  -1.557  -5.052  1.00 0.00 ? 87  ASN A H    3  
ATOM 5289  H HA   . ASN A 1 87  ? -8.525  -1.049  -4.381  1.00 0.00 ? 87  ASN A HA   3  
ATOM 5290  H HB2  . ASN A 1 87  ? -7.019  0.031   -6.199  1.00 0.00 ? 87  ASN A HB2  3  
ATOM 5291  H HB3  . ASN A 1 87  ? -7.616  -1.258  -7.239  1.00 0.00 ? 87  ASN A HB3  3  
ATOM 5292  H HD21 . ASN A 1 87  ? -8.420  0.627   -8.450  1.00 0.00 ? 87  ASN A HD21 3  
ATOM 5293  H HD22 . ASN A 1 87  ? -9.970  1.264   -8.029  1.00 0.00 ? 87  ASN A HD22 3  
ATOM 5294  N N    . LYS A 1 88  ? -8.064  -3.766  -6.182  1.00 0.00 ? 88  LYS A N    3  
ATOM 5295  C CA   . LYS A 1 88  ? -8.683  -5.017  -6.604  1.00 0.00 ? 88  LYS A CA   3  
ATOM 5296  C C    . LYS A 1 88  ? -9.371  -5.707  -5.431  1.00 0.00 ? 88  LYS A C    3  
ATOM 5297  O O    . LYS A 1 88  ? -10.468 -6.247  -5.572  1.00 0.00 ? 88  LYS A O    3  
ATOM 5298  C CB   . LYS A 1 88  ? -7.634  -5.949  -7.214  1.00 0.00 ? 88  LYS A CB   3  
ATOM 5299  C CG   . LYS A 1 88  ? -7.236  -5.574  -8.631  1.00 0.00 ? 88  LYS A CG   3  
ATOM 5300  C CD   . LYS A 1 88  ? -8.347  -5.878  -9.621  1.00 0.00 ? 88  LYS A CD   3  
ATOM 5301  C CE   . LYS A 1 88  ? -8.410  -7.362  -9.949  1.00 0.00 ? 88  LYS A CE   3  
ATOM 5302  N NZ   . LYS A 1 88  ? -7.195  -7.821  -10.678 1.00 0.00 ? 88  LYS A NZ   3  
ATOM 5303  H H    . LYS A 1 88  ? -7.116  -3.612  -6.380  1.00 0.00 ? 88  LYS A H    3  
ATOM 5304  H HA   . LYS A 1 88  ? -9.424  -4.784  -7.354  1.00 0.00 ? 88  LYS A HA   3  
ATOM 5305  H HB2  . LYS A 1 88  ? -6.748  -5.928  -6.596  1.00 0.00 ? 88  LYS A HB2  3  
ATOM 5306  H HB3  . LYS A 1 88  ? -8.028  -6.955  -7.228  1.00 0.00 ? 88  LYS A HB3  3  
ATOM 5307  H HG2  . LYS A 1 88  ? -7.017  -4.517  -8.666  1.00 0.00 ? 88  LYS A HG2  3  
ATOM 5308  H HG3  . LYS A 1 88  ? -6.355  -6.135  -8.908  1.00 0.00 ? 88  LYS A HG3  3  
ATOM 5309  H HD2  . LYS A 1 88  ? -9.292  -5.575  -9.194  1.00 0.00 ? 88  LYS A HD2  3  
ATOM 5310  H HD3  . LYS A 1 88  ? -8.168  -5.324  -10.532 1.00 0.00 ? 88  LYS A HD3  3  
ATOM 5311  H HE2  . LYS A 1 88  ? -8.499  -7.918  -9.028  1.00 0.00 ? 88  LYS A HE2  3  
ATOM 5312  H HE3  . LYS A 1 88  ? -9.279  -7.545  -10.565 1.00 0.00 ? 88  LYS A HE3  3  
ATOM 5313  H HZ1  . LYS A 1 88  ? -6.649  -7.002  -11.013 1.00 0.00 ? 88  LYS A HZ1  3  
ATOM 5314  H HZ2  . LYS A 1 88  ? -7.468  -8.401  -11.497 1.00 0.00 ? 88  LYS A HZ2  3  
ATOM 5315  H HZ3  . LYS A 1 88  ? -6.595  -8.391  -10.048 1.00 0.00 ? 88  LYS A HZ3  3  
ATOM 5316  N N    . SER A 1 89  ? -8.720  -5.683  -4.272  1.00 0.00 ? 89  SER A N    3  
ATOM 5317  C CA   . SER A 1 89  ? -9.269  -6.309  -3.074  1.00 0.00 ? 89  SER A CA   3  
ATOM 5318  C C    . SER A 1 89  ? -10.691 -5.823  -2.811  1.00 0.00 ? 89  SER A C    3  
ATOM 5319  O O    . SER A 1 89  ? -10.937 -4.624  -2.695  1.00 0.00 ? 89  SER A O    3  
ATOM 5320  C CB   . SER A 1 89  ? -8.382  -6.007  -1.865  1.00 0.00 ? 89  SER A CB   3  
ATOM 5321  O OG   . SER A 1 89  ? -8.495  -7.024  -0.884  1.00 0.00 ? 89  SER A OG   3  
ATOM 5322  H H    . SER A 1 89  ? -7.849  -5.237  -4.223  1.00 0.00 ? 89  SER A H    3  
ATOM 5323  H HA   . SER A 1 89  ? -9.290  -7.376  -3.238  1.00 0.00 ? 89  SER A HA   3  
ATOM 5324  H HB2  . SER A 1 89  ? -7.353  -5.943  -2.183  1.00 0.00 ? 89  SER A HB2  3  
ATOM 5325  H HB3  . SER A 1 89  ? -8.684  -5.066  -1.427  1.00 0.00 ? 89  SER A HB3  3  
ATOM 5326  H HG   . SER A 1 89  ? -7.906  -7.750  -1.106  1.00 0.00 ? 89  SER A HG   3  
ATOM 5327  N N    . ASN A 1 90  ? -11.623 -6.766  -2.717  1.00 0.00 ? 90  ASN A N    3  
ATOM 5328  C CA   . ASN A 1 90  ? -13.022 -6.435  -2.468  1.00 0.00 ? 90  ASN A CA   3  
ATOM 5329  C C    . ASN A 1 90  ? -13.317 -6.413  -0.971  1.00 0.00 ? 90  ASN A C    3  
ATOM 5330  O O    . ASN A 1 90  ? -14.195 -5.682  -0.512  1.00 0.00 ? 90  ASN A O    3  
ATOM 5331  C CB   . ASN A 1 90  ? -13.938 -7.444  -3.165  1.00 0.00 ? 90  ASN A CB   3  
ATOM 5332  C CG   . ASN A 1 90  ? -15.405 -7.186  -2.880  1.00 0.00 ? 90  ASN A CG   3  
ATOM 5333  O OD1  . ASN A 1 90  ? -15.919 -7.562  -1.826  1.00 0.00 ? 90  ASN A OD1  3  
ATOM 5334  N ND2  . ASN A 1 90  ? -16.085 -6.541  -3.820  1.00 0.00 ? 90  ASN A ND2  3  
ATOM 5335  H H    . ASN A 1 90  ? -11.365 -7.706  -2.818  1.00 0.00 ? 90  ASN A H    3  
ATOM 5336  H HA   . ASN A 1 90  ? -13.208 -5.453  -2.875  1.00 0.00 ? 90  ASN A HA   3  
ATOM 5337  H HB2  . ASN A 1 90  ? -13.783 -7.384  -4.232  1.00 0.00 ? 90  ASN A HB2  3  
ATOM 5338  H HB3  . ASN A 1 90  ? -13.693 -8.439  -2.825  1.00 0.00 ? 90  ASN A HB3  3  
ATOM 5339  H HD21 . ASN A 1 90  ? -15.610 -6.271  -4.634  1.00 0.00 ? 90  ASN A HD21 3  
ATOM 5340  H HD22 . ASN A 1 90  ? -17.035 -6.360  -3.661  1.00 0.00 ? 90  ASN A HD22 3  
ATOM 5341  N N    . ASP A 1 91  ? -12.577 -7.217  -0.216  1.00 0.00 ? 91  ASP A N    3  
ATOM 5342  C CA   . ASP A 1 91  ? -12.758 -7.289  1.229   1.00 0.00 ? 91  ASP A CA   3  
ATOM 5343  C C    . ASP A 1 91  ? -12.057 -6.125  1.923   1.00 0.00 ? 91  ASP A C    3  
ATOM 5344  O O    . ASP A 1 91  ? -11.867 -6.137  3.139   1.00 0.00 ? 91  ASP A O    3  
ATOM 5345  C CB   . ASP A 1 91  ? -12.222 -8.617  1.767   1.00 0.00 ? 91  ASP A CB   3  
ATOM 5346  C CG   . ASP A 1 91  ? -13.196 -9.760  1.561   1.00 0.00 ? 91  ASP A CG   3  
ATOM 5347  O OD1  . ASP A 1 91  ? -13.381 -10.179 0.400   1.00 0.00 ? 91  ASP A OD1  3  
ATOM 5348  O OD2  . ASP A 1 91  ? -13.773 -10.236 2.562   1.00 0.00 ? 91  ASP A OD2  3  
ATOM 5349  H H    . ASP A 1 91  ? -11.893 -7.776  -0.641  1.00 0.00 ? 91  ASP A H    3  
ATOM 5350  H HA   . ASP A 1 91  ? -13.816 -7.229  1.435   1.00 0.00 ? 91  ASP A HA   3  
ATOM 5351  H HB2  . ASP A 1 91  ? -11.300 -8.858  1.257   1.00 0.00 ? 91  ASP A HB2  3  
ATOM 5352  H HB3  . ASP A 1 91  ? -12.028 -8.518  2.825   1.00 0.00 ? 91  ASP A HB3  3  
ATOM 5353  N N    . PHE A 1 92  ? -11.674 -5.121  1.141   1.00 0.00 ? 92  PHE A N    3  
ATOM 5354  C CA   . PHE A 1 92  ? -10.992 -3.950  1.680   1.00 0.00 ? 92  PHE A CA   3  
ATOM 5355  C C    . PHE A 1 92  ? -11.849 -2.698  1.515   1.00 0.00 ? 92  PHE A C    3  
ATOM 5356  O O    . PHE A 1 92  ? -12.572 -2.554  0.530   1.00 0.00 ? 92  PHE A O    3  
ATOM 5357  C CB   . PHE A 1 92  ? -9.644  -3.754  0.984   1.00 0.00 ? 92  PHE A CB   3  
ATOM 5358  C CG   . PHE A 1 92  ? -8.532  -4.560  1.592   1.00 0.00 ? 92  PHE A CG   3  
ATOM 5359  C CD1  . PHE A 1 92  ? -8.736  -5.881  1.957   1.00 0.00 ? 92  PHE A CD1  3  
ATOM 5360  C CD2  . PHE A 1 92  ? -7.283  -3.997  1.800   1.00 0.00 ? 92  PHE A CD2  3  
ATOM 5361  C CE1  . PHE A 1 92  ? -7.716  -6.626  2.517   1.00 0.00 ? 92  PHE A CE1  3  
ATOM 5362  C CE2  . PHE A 1 92  ? -6.259  -4.737  2.359   1.00 0.00 ? 92  PHE A CE2  3  
ATOM 5363  C CZ   . PHE A 1 92  ? -6.476  -6.053  2.719   1.00 0.00 ? 92  PHE A CZ   3  
ATOM 5364  H H    . PHE A 1 92  ? -11.854 -5.169  0.179   1.00 0.00 ? 92  PHE A H    3  
ATOM 5365  H HA   . PHE A 1 92  ? -10.824 -4.120  2.732   1.00 0.00 ? 92  PHE A HA   3  
ATOM 5366  H HB2  . PHE A 1 92  ? -9.735  -4.045  -0.052  1.00 0.00 ? 92  PHE A HB2  3  
ATOM 5367  H HB3  . PHE A 1 92  ? -9.367  -2.712  1.038   1.00 0.00 ? 92  PHE A HB3  3  
ATOM 5368  H HD1  . PHE A 1 92  ? -9.707  -6.330  1.800   1.00 0.00 ? 92  PHE A HD1  3  
ATOM 5369  H HD2  . PHE A 1 92  ? -7.113  -2.968  1.520   1.00 0.00 ? 92  PHE A HD2  3  
ATOM 5370  H HE1  . PHE A 1 92  ? -7.889  -7.654  2.798   1.00 0.00 ? 92  PHE A HE1  3  
ATOM 5371  H HE2  . PHE A 1 92  ? -5.290  -4.287  2.516   1.00 0.00 ? 92  PHE A HE2  3  
ATOM 5372  H HZ   . PHE A 1 92  ? -5.677  -6.633  3.156   1.00 0.00 ? 92  PHE A HZ   3  
ATOM 5373  N N    . GLU A 1 93  ? -11.762 -1.796  2.488   1.00 0.00 ? 93  GLU A N    3  
ATOM 5374  C CA   . GLU A 1 93  ? -12.530 -0.557  2.451   1.00 0.00 ? 93  GLU A CA   3  
ATOM 5375  C C    . GLU A 1 93  ? -11.618 0.642   2.210   1.00 0.00 ? 93  GLU A C    3  
ATOM 5376  O O    . GLU A 1 93  ? -10.446 0.628   2.586   1.00 0.00 ? 93  GLU A O    3  
ATOM 5377  C CB   . GLU A 1 93  ? -13.301 -0.371  3.760   1.00 0.00 ? 93  GLU A CB   3  
ATOM 5378  C CG   . GLU A 1 93  ? -14.621 0.363   3.589   1.00 0.00 ? 93  GLU A CG   3  
ATOM 5379  C CD   . GLU A 1 93  ? -15.587 -0.379  2.685   1.00 0.00 ? 93  GLU A CD   3  
ATOM 5380  O OE1  . GLU A 1 93  ? -15.419 -0.307  1.450   1.00 0.00 ? 93  GLU A OE1  3  
ATOM 5381  O OE2  . GLU A 1 93  ? -16.512 -1.031  3.214   1.00 0.00 ? 93  GLU A OE2  3  
ATOM 5382  H H    . GLU A 1 93  ? -11.168 -1.968  3.248   1.00 0.00 ? 93  GLU A H    3  
ATOM 5383  H HA   . GLU A 1 93  ? -13.234 -0.628  1.636   1.00 0.00 ? 93  GLU A HA   3  
ATOM 5384  H HB2  . GLU A 1 93  ? -13.505 -1.342  4.185   1.00 0.00 ? 93  GLU A HB2  3  
ATOM 5385  H HB3  . GLU A 1 93  ? -12.688 0.192   4.447   1.00 0.00 ? 93  GLU A HB3  3  
ATOM 5386  H HG2  . GLU A 1 93  ? -15.080 0.483   4.559   1.00 0.00 ? 93  GLU A HG2  3  
ATOM 5387  H HG3  . GLU A 1 93  ? -14.425 1.335   3.161   1.00 0.00 ? 93  GLU A HG3  3  
ATOM 5388  N N    . GLU A 1 94  ? -12.164 1.677   1.580   1.00 0.00 ? 94  GLU A N    3  
ATOM 5389  C CA   . GLU A 1 94  ? -11.399 2.883   1.288   1.00 0.00 ? 94  GLU A CA   3  
ATOM 5390  C C    . GLU A 1 94  ? -11.558 3.912   2.404   1.00 0.00 ? 94  GLU A C    3  
ATOM 5391  O O    . GLU A 1 94  ? -12.623 4.509   2.566   1.00 0.00 ? 94  GLU A O    3  
ATOM 5392  C CB   . GLU A 1 94  ? -11.846 3.487   -0.045  1.00 0.00 ? 94  GLU A CB   3  
ATOM 5393  C CG   . GLU A 1 94  ? -11.234 4.848   -0.333  1.00 0.00 ? 94  GLU A CG   3  
ATOM 5394  C CD   . GLU A 1 94  ? -11.077 5.115   -1.817  1.00 0.00 ? 94  GLU A CD   3  
ATOM 5395  O OE1  . GLU A 1 94  ? -11.917 4.626   -2.601  1.00 0.00 ? 94  GLU A OE1  3  
ATOM 5396  O OE2  . GLU A 1 94  ? -10.114 5.814   -2.195  1.00 0.00 ? 94  GLU A OE2  3  
ATOM 5397  H H    . GLU A 1 94  ? -13.103 1.628   1.305   1.00 0.00 ? 94  GLU A H    3  
ATOM 5398  H HA   . GLU A 1 94  ? -10.358 2.607   1.216   1.00 0.00 ? 94  GLU A HA   3  
ATOM 5399  H HB2  . GLU A 1 94  ? -11.568 2.814   -0.843  1.00 0.00 ? 94  GLU A HB2  3  
ATOM 5400  H HB3  . GLU A 1 94  ? -12.920 3.594   -0.035  1.00 0.00 ? 94  GLU A HB3  3  
ATOM 5401  H HG2  . GLU A 1 94  ? -11.870 5.611   0.089   1.00 0.00 ? 94  GLU A HG2  3  
ATOM 5402  H HG3  . GLU A 1 94  ? -10.260 4.895   0.131   1.00 0.00 ? 94  GLU A HG3  3  
ATOM 5403  N N    . LEU A 1 95  ? -10.492 4.114   3.170   1.00 0.00 ? 95  LEU A N    3  
ATOM 5404  C CA   . LEU A 1 95  ? -10.513 5.071   4.272   1.00 0.00 ? 95  LEU A CA   3  
ATOM 5405  C C    . LEU A 1 95  ? -9.938  6.415   3.836   1.00 0.00 ? 95  LEU A C    3  
ATOM 5406  O O    . LEU A 1 95  ? -9.564  7.241   4.669   1.00 0.00 ? 95  LEU A O    3  
ATOM 5407  C CB   . LEU A 1 95  ? -9.720  4.526   5.461   1.00 0.00 ? 95  LEU A CB   3  
ATOM 5408  C CG   . LEU A 1 95  ? -10.201 3.192   6.034   1.00 0.00 ? 95  LEU A CG   3  
ATOM 5409  C CD1  . LEU A 1 95  ? -9.553  2.927   7.384   1.00 0.00 ? 95  LEU A CD1  3  
ATOM 5410  C CD2  . LEU A 1 95  ? -11.717 3.180   6.156   1.00 0.00 ? 95  LEU A CD2  3  
ATOM 5411  H H    . LEU A 1 95  ? -9.672  3.609   2.992   1.00 0.00 ? 95  LEU A H    3  
ATOM 5412  H HA   . LEU A 1 95  ? -11.541 5.212   4.569   1.00 0.00 ? 95  LEU A HA   3  
ATOM 5413  H HB2  . LEU A 1 95  ? -8.695  4.400   5.145   1.00 0.00 ? 95  LEU A HB2  3  
ATOM 5414  H HB3  . LEU A 1 95  ? -9.763  5.262   6.251   1.00 0.00 ? 95  LEU A HB3  3  
ATOM 5415  H HG   . LEU A 1 95  ? -9.912  2.394   5.363   1.00 0.00 ? 95  LEU A HG   3  
ATOM 5416  H HD11 . LEU A 1 95  ? -10.161 2.233   7.944   1.00 0.00 ? 95  LEU A HD11 3  
ATOM 5417  H HD12 . LEU A 1 95  ? -9.469  3.854   7.931   1.00 0.00 ? 95  LEU A HD12 3  
ATOM 5418  H HD13 . LEU A 1 95  ? -8.570  2.506   7.235   1.00 0.00 ? 95  LEU A HD13 3  
ATOM 5419  H HD21 . LEU A 1 95  ? -12.022 2.343   6.766   1.00 0.00 ? 95  LEU A HD21 3  
ATOM 5420  H HD22 . LEU A 1 95  ? -12.157 3.088   5.173   1.00 0.00 ? 95  LEU A HD22 3  
ATOM 5421  H HD23 . LEU A 1 95  ? -12.049 4.100   6.614   1.00 0.00 ? 95  LEU A HD23 3  
ATOM 5422  N N    . VAL A 1 96  ? -9.874  6.629   2.526   1.00 0.00 ? 96  VAL A N    3  
ATOM 5423  C CA   . VAL A 1 96  ? -9.349  7.874   1.979   1.00 0.00 ? 96  VAL A CA   3  
ATOM 5424  C C    . VAL A 1 96  ? -9.716  9.061   2.863   1.00 0.00 ? 96  VAL A C    3  
ATOM 5425  O O    . VAL A 1 96  ? -8.977  10.042  2.940   1.00 0.00 ? 96  VAL A O    3  
ATOM 5426  C CB   . VAL A 1 96  ? -9.875  8.128   0.554   1.00 0.00 ? 96  VAL A CB   3  
ATOM 5427  C CG1  . VAL A 1 96  ? -11.375 8.381   0.576   1.00 0.00 ? 96  VAL A CG1  3  
ATOM 5428  C CG2  . VAL A 1 96  ? -9.138  9.295   -0.086  1.00 0.00 ? 96  VAL A CG2  3  
ATOM 5429  H H    . VAL A 1 96  ? -10.188 5.932   1.912   1.00 0.00 ? 96  VAL A H    3  
ATOM 5430  H HA   . VAL A 1 96  ? -8.272  7.791   1.933   1.00 0.00 ? 96  VAL A HA   3  
ATOM 5431  H HB   . VAL A 1 96  ? -9.690  7.244   -0.039  1.00 0.00 ? 96  VAL A HB   3  
ATOM 5432  H HG11 . VAL A 1 96  ? -11.746 8.428   -0.438  1.00 0.00 ? 96  VAL A HG11 3  
ATOM 5433  H HG12 . VAL A 1 96  ? -11.868 7.578   1.104   1.00 0.00 ? 96  VAL A HG12 3  
ATOM 5434  H HG13 . VAL A 1 96  ? -11.574 9.317   1.075   1.00 0.00 ? 96  VAL A HG13 3  
ATOM 5435  H HG21 . VAL A 1 96  ? -8.166  9.399   0.371   1.00 0.00 ? 96  VAL A HG21 3  
ATOM 5436  H HG22 . VAL A 1 96  ? -9.021  9.111   -1.144  1.00 0.00 ? 96  VAL A HG22 3  
ATOM 5437  H HG23 . VAL A 1 96  ? -9.705  10.202  0.060   1.00 0.00 ? 96  VAL A HG23 3  
ATOM 5438  N N    . GLU A 1 97  ? -10.862 8.963   3.530   1.00 0.00 ? 97  GLU A N    3  
ATOM 5439  C CA   . GLU A 1 97  ? -11.327 10.029  4.409   1.00 0.00 ? 97  GLU A CA   3  
ATOM 5440  C C    . GLU A 1 97  ? -10.254 10.402  5.427   1.00 0.00 ? 97  GLU A C    3  
ATOM 5441  O O    . GLU A 1 97  ? -10.008 11.581  5.682   1.00 0.00 ? 97  GLU A O    3  
ATOM 5442  C CB   . GLU A 1 97  ? -12.606 9.602   5.133   1.00 0.00 ? 97  GLU A CB   3  
ATOM 5443  C CG   . GLU A 1 97  ? -13.634 8.954   4.221   1.00 0.00 ? 97  GLU A CG   3  
ATOM 5444  C CD   . GLU A 1 97  ? -13.577 7.439   4.261   1.00 0.00 ? 97  GLU A CD   3  
ATOM 5445  O OE1  . GLU A 1 97  ? -13.817 6.865   5.345   1.00 0.00 ? 97  GLU A OE1  3  
ATOM 5446  O OE2  . GLU A 1 97  ? -13.294 6.827   3.210   1.00 0.00 ? 97  GLU A OE2  3  
ATOM 5447  H H    . GLU A 1 97  ? -11.408 8.155   3.427   1.00 0.00 ? 97  GLU A H    3  
ATOM 5448  H HA   . GLU A 1 97  ? -11.542 10.892  3.798   1.00 0.00 ? 97  GLU A HA   3  
ATOM 5449  H HB2  . GLU A 1 97  ? -12.348 8.896   5.909   1.00 0.00 ? 97  GLU A HB2  3  
ATOM 5450  H HB3  . GLU A 1 97  ? -13.056 10.473  5.586   1.00 0.00 ? 97  GLU A HB3  3  
ATOM 5451  H HG2  . GLU A 1 97  ? -14.620 9.270   4.529   1.00 0.00 ? 97  GLU A HG2  3  
ATOM 5452  H HG3  . GLU A 1 97  ? -13.454 9.279   3.207   1.00 0.00 ? 97  GLU A HG3  3  
ATOM 5453  N N    . ARG A 1 98  ? -9.618  9.388   6.006   1.00 0.00 ? 98  ARG A N    3  
ATOM 5454  C CA   . ARG A 1 98  ? -8.573  9.609   6.998   1.00 0.00 ? 98  ARG A CA   3  
ATOM 5455  C C    . ARG A 1 98  ? -7.215  9.793   6.325   1.00 0.00 ? 98  ARG A C    3  
ATOM 5456  O O    . ARG A 1 98  ? -6.303  10.387  6.899   1.00 0.00 ? 98  ARG A O    3  
ATOM 5457  C CB   . ARG A 1 98  ? -8.513  8.435   7.977   1.00 0.00 ? 98  ARG A CB   3  
ATOM 5458  C CG   . ARG A 1 98  ? -9.881  7.928   8.404   1.00 0.00 ? 98  ARG A CG   3  
ATOM 5459  C CD   . ARG A 1 98  ? -9.778  6.966   9.577   1.00 0.00 ? 98  ARG A CD   3  
ATOM 5460  N NE   . ARG A 1 98  ? -10.968 7.003   10.422  1.00 0.00 ? 98  ARG A NE   3  
ATOM 5461  C CZ   . ARG A 1 98  ? -11.059 6.379   11.591  1.00 0.00 ? 98  ARG A CZ   3  
ATOM 5462  N NH1  . ARG A 1 98  ? -10.036 5.673   12.051  1.00 0.00 ? 98  ARG A NH1  3  
ATOM 5463  N NH2  . ARG A 1 98  ? -12.177 6.460   12.302  1.00 0.00 ? 98  ARG A NH2  3  
ATOM 5464  H H    . ARG A 1 98  ? -9.859  8.470   5.762   1.00 0.00 ? 98  ARG A H    3  
ATOM 5465  H HA   . ARG A 1 98  ? -8.816  10.509  7.542   1.00 0.00 ? 98  ARG A HA   3  
ATOM 5466  H HB2  . ARG A 1 98  ? -7.980  7.619   7.511   1.00 0.00 ? 98  ARG A HB2  3  
ATOM 5467  H HB3  . ARG A 1 98  ? -7.977  8.747   8.861   1.00 0.00 ? 98  ARG A HB3  3  
ATOM 5468  H HG2  . ARG A 1 98  ? -10.492 8.769   8.695   1.00 0.00 ? 98  ARG A HG2  3  
ATOM 5469  H HG3  . ARG A 1 98  ? -10.341 7.418   7.570   1.00 0.00 ? 98  ARG A HG3  3  
ATOM 5470  H HD2  . ARG A 1 98  ? -9.651  5.964   9.194   1.00 0.00 ? 98  ARG A HD2  3  
ATOM 5471  H HD3  . ARG A 1 98  ? -8.917  7.235   10.171  1.00 0.00 ? 98  ARG A HD3  3  
ATOM 5472  H HE   . ARG A 1 98  ? -11.737 7.519   10.101  1.00 0.00 ? 98  ARG A HE   3  
ATOM 5473  H HH11 . ARG A 1 98  ? -9.192  5.611   11.518  1.00 0.00 ? 98  ARG A HH11 3  
ATOM 5474  H HH12 . ARG A 1 98  ? -10.107 5.205   12.932  1.00 0.00 ? 98  ARG A HH12 3  
ATOM 5475  H HH21 . ARG A 1 98  ? -12.950 6.992   11.959  1.00 0.00 ? 98  ARG A HH21 3  
ATOM 5476  H HH22 . ARG A 1 98  ? -12.244 5.990   13.182  1.00 0.00 ? 98  ARG A HH22 3  
ATOM 5477  N N    . SER A 1 99  ? -7.091  9.279   5.105   1.00 0.00 ? 99  SER A N    3  
ATOM 5478  C CA   . SER A 1 99  ? -5.844  9.383   4.356   1.00 0.00 ? 99  SER A CA   3  
ATOM 5479  C C    . SER A 1 99  ? -5.364  10.830  4.298   1.00 0.00 ? 99  SER A C    3  
ATOM 5480  O O    . SER A 1 99  ? -6.142  11.742  4.024   1.00 0.00 ? 99  SER A O    3  
ATOM 5481  C CB   . SER A 1 99  ? -6.030  8.838   2.938   1.00 0.00 ? 99  SER A CB   3  
ATOM 5482  O OG   . SER A 1 99  ? -5.853  7.433   2.905   1.00 0.00 ? 99  SER A OG   3  
ATOM 5483  H H    . SER A 1 99  ? -7.855  8.817   4.701   1.00 0.00 ? 99  SER A H    3  
ATOM 5484  H HA   . SER A 1 99  ? -5.100  8.789   4.866   1.00 0.00 ? 99  SER A HA   3  
ATOM 5485  H HB2  . SER A 1 99  ? -7.026  9.072   2.593   1.00 0.00 ? 99  SER A HB2  3  
ATOM 5486  H HB3  . SER A 1 99  ? -5.304  9.297   2.282   1.00 0.00 ? 99  SER A HB3  3  
ATOM 5487  H HG   . SER A 1 99  ? -6.684  7.011   2.674   1.00 0.00 ? 99  SER A HG   3  
ATOM 5488  N N    . GLN A 1 100 ? -4.076  11.030  4.560   1.00 0.00 ? 100 GLN A N    3  
ATOM 5489  C CA   . GLN A 1 100 ? -3.491  12.366  4.539   1.00 0.00 ? 100 GLN A CA   3  
ATOM 5490  C C    . GLN A 1 100 ? -2.301  12.424  3.587   1.00 0.00 ? 100 GLN A C    3  
ATOM 5491  O O    . GLN A 1 100 ? -1.219  11.924  3.898   1.00 0.00 ? 100 GLN A O    3  
ATOM 5492  C CB   . GLN A 1 100 ? -3.055  12.777  5.946   1.00 0.00 ? 100 GLN A CB   3  
ATOM 5493  C CG   . GLN A 1 100 ? -4.209  12.911  6.926   1.00 0.00 ? 100 GLN A CG   3  
ATOM 5494  C CD   . GLN A 1 100 ? -4.776  14.316  6.972   1.00 0.00 ? 100 GLN A CD   3  
ATOM 5495  O OE1  . GLN A 1 100 ? -4.111  15.252  7.418   1.00 0.00 ? 100 GLN A OE1  3  
ATOM 5496  N NE2  . GLN A 1 100 ? -6.011  14.472  6.508   1.00 0.00 ? 100 GLN A NE2  3  
ATOM 5497  H H    . GLN A 1 100 ? -3.506  10.262  4.772   1.00 0.00 ? 100 GLN A H    3  
ATOM 5498  H HA   . GLN A 1 100 ? -4.248  13.053  4.191   1.00 0.00 ? 100 GLN A HA   3  
ATOM 5499  H HB2  . GLN A 1 100 ? -2.370  12.035  6.328   1.00 0.00 ? 100 GLN A HB2  3  
ATOM 5500  H HB3  . GLN A 1 100 ? -2.548  13.728  5.889   1.00 0.00 ? 100 GLN A HB3  3  
ATOM 5501  H HG2  . GLN A 1 100 ? -4.996  12.232  6.632   1.00 0.00 ? 100 GLN A HG2  3  
ATOM 5502  H HG3  . GLN A 1 100 ? -3.858  12.647  7.913   1.00 0.00 ? 100 GLN A HG3  3  
ATOM 5503  H HE21 . GLN A 1 100 ? -6.480  13.681  6.169   1.00 0.00 ? 100 GLN A HE21 3  
ATOM 5504  H HE22 . GLN A 1 100 ? -6.402  15.369  6.527   1.00 0.00 ? 100 GLN A HE22 3  
ATOM 5505  N N    . LEU A 1 101 ? -2.508  13.036  2.426   1.00 0.00 ? 101 LEU A N    3  
ATOM 5506  C CA   . LEU A 1 101 ? -1.451  13.159  1.427   1.00 0.00 ? 101 LEU A CA   3  
ATOM 5507  C C    . LEU A 1 101 ? -0.922  14.588  1.368   1.00 0.00 ? 101 LEU A C    3  
ATOM 5508  O O    . LEU A 1 101 ? 0.151   14.841  0.821   1.00 0.00 ? 101 LEU A O    3  
ATOM 5509  C CB   . LEU A 1 101 ? -1.971  12.738  0.052   1.00 0.00 ? 101 LEU A CB   3  
ATOM 5510  C CG   . LEU A 1 101 ? -2.522  11.315  -0.051  1.00 0.00 ? 101 LEU A CG   3  
ATOM 5511  C CD1  . LEU A 1 101 ? -3.593  11.234  -1.128  1.00 0.00 ? 101 LEU A CD1  3  
ATOM 5512  C CD2  . LEU A 1 101 ? -1.400  10.328  -0.336  1.00 0.00 ? 101 LEU A CD2  3  
ATOM 5513  H H    . LEU A 1 101 ? -3.391  13.414  2.235   1.00 0.00 ? 101 LEU A H    3  
ATOM 5514  H HA   . LEU A 1 101 ? -0.645  12.501  1.715   1.00 0.00 ? 101 LEU A HA   3  
ATOM 5515  H HB2  . LEU A 1 101 ? -2.761  13.419  -0.226  1.00 0.00 ? 101 LEU A HB2  3  
ATOM 5516  H HB3  . LEU A 1 101 ? -1.155  12.829  -0.651  1.00 0.00 ? 101 LEU A HB3  3  
ATOM 5517  H HG   . LEU A 1 101 ? -2.977  11.043  0.892   1.00 0.00 ? 101 LEU A HG   3  
ATOM 5518  H HD11 . LEU A 1 101 ? -4.497  10.822  -0.707  1.00 0.00 ? 101 LEU A HD11 3  
ATOM 5519  H HD12 . LEU A 1 101 ? -3.248  10.600  -1.931  1.00 0.00 ? 101 LEU A HD12 3  
ATOM 5520  H HD13 . LEU A 1 101 ? -3.793  12.224  -1.512  1.00 0.00 ? 101 LEU A HD13 3  
ATOM 5521  H HD21 . LEU A 1 101 ? -1.187  9.758   0.556   1.00 0.00 ? 101 LEU A HD21 3  
ATOM 5522  H HD22 . LEU A 1 101 ? -0.514  10.868  -0.639  1.00 0.00 ? 101 LEU A HD22 3  
ATOM 5523  H HD23 . LEU A 1 101 ? -1.703  9.658   -1.128  1.00 0.00 ? 101 LEU A HD23 3  
ATOM 5524  N N    . ASP A 1 102 ? -1.682  15.519  1.937   1.00 0.00 ? 102 ASP A N    3  
ATOM 5525  C CA   . ASP A 1 102 ? -1.288  16.923  1.952   1.00 0.00 ? 102 ASP A CA   3  
ATOM 5526  C C    . ASP A 1 102 ? -0.365  17.216  3.130   1.00 0.00 ? 102 ASP A C    3  
ATOM 5527  O O    . ASP A 1 102 ? -0.112  18.375  3.460   1.00 0.00 ? 102 ASP A O    3  
ATOM 5528  C CB   . ASP A 1 102 ? -2.524  17.820  2.020   1.00 0.00 ? 102 ASP A CB   3  
ATOM 5529  C CG   . ASP A 1 102 ? -2.379  19.071  1.176   1.00 0.00 ? 102 ASP A CG   3  
ATOM 5530  O OD1  . ASP A 1 102 ? -1.676  20.005  1.615   1.00 0.00 ? 102 ASP A OD1  3  
ATOM 5531  O OD2  . ASP A 1 102 ? -2.970  19.117  0.076   1.00 0.00 ? 102 ASP A OD2  3  
ATOM 5532  H H    . ASP A 1 102 ? -2.527  15.254  2.357   1.00 0.00 ? 102 ASP A H    3  
ATOM 5533  H HA   . ASP A 1 102 ? -0.756  17.128  1.035   1.00 0.00 ? 102 ASP A HA   3  
ATOM 5534  H HB2  . ASP A 1 102 ? -3.383  17.268  1.667   1.00 0.00 ? 102 ASP A HB2  3  
ATOM 5535  H HB3  . ASP A 1 102 ? -2.689  18.117  3.046   1.00 0.00 ? 102 ASP A HB3  3  
ATOM 5536  N N    . ILE A 1 103 ? 0.134   16.158  3.762   1.00 0.00 ? 103 ILE A N    3  
ATOM 5537  C CA   . ILE A 1 103 ? 1.028   16.303  4.904   1.00 0.00 ? 103 ILE A CA   3  
ATOM 5538  C C    . ILE A 1 103 ? 2.456   15.913  4.536   1.00 0.00 ? 103 ILE A C    3  
ATOM 5539  O O    . ILE A 1 103 ? 2.685   15.213  3.550   1.00 0.00 ? 103 ILE A O    3  
ATOM 5540  C CB   . ILE A 1 103 ? 0.564   15.444  6.095   1.00 0.00 ? 103 ILE A CB   3  
ATOM 5541  C CG1  . ILE A 1 103 ? 0.539   13.964  5.706   1.00 0.00 ? 103 ILE A CG1  3  
ATOM 5542  C CG2  . ILE A 1 103 ? -0.809  15.895  6.570   1.00 0.00 ? 103 ILE A CG2  3  
ATOM 5543  C CD1  . ILE A 1 103 ? 0.133   13.048  6.839   1.00 0.00 ? 103 ILE A CD1  3  
ATOM 5544  H H    . ILE A 1 103 ? -0.105  15.260  3.452   1.00 0.00 ? 103 ILE A H    3  
ATOM 5545  H HA   . ILE A 1 103 ? 1.016   17.340  5.207   1.00 0.00 ? 103 ILE A HA   3  
ATOM 5546  H HB   . ILE A 1 103 ? 1.263   15.584  6.905   1.00 0.00 ? 103 ILE A HB   3  
ATOM 5547  H HG12 . ILE A 1 103 ? -0.162  13.823  4.898   1.00 0.00 ? 103 ILE A HG12 3  
ATOM 5548  H HG13 . ILE A 1 103 ? 1.525   13.670  5.376   1.00 0.00 ? 103 ILE A HG13 3  
ATOM 5549  H HG21 . ILE A 1 103 ? -1.270  15.104  7.142   1.00 0.00 ? 103 ILE A HG21 3  
ATOM 5550  H HG22 . ILE A 1 103 ? -0.704  16.773  7.190   1.00 0.00 ? 103 ILE A HG22 3  
ATOM 5551  H HG23 . ILE A 1 103 ? -1.427  16.129  5.716   1.00 0.00 ? 103 ILE A HG23 3  
ATOM 5552  H HD11 . ILE A 1 103 ? 0.327   12.023  6.560   1.00 0.00 ? 103 ILE A HD11 3  
ATOM 5553  H HD12 . ILE A 1 103 ? 0.701   13.295  7.723   1.00 0.00 ? 103 ILE A HD12 3  
ATOM 5554  H HD13 . ILE A 1 103 ? -0.921  13.172  7.042   1.00 0.00 ? 103 ILE A HD13 3  
ATOM 5555  N N    . SER A 1 104 ? 3.413   16.370  5.338   1.00 0.00 ? 104 SER A N    3  
ATOM 5556  C CA   . SER A 1 104 ? 4.819   16.070  5.096   1.00 0.00 ? 104 SER A CA   3  
ATOM 5557  C C    . SER A 1 104 ? 4.988   14.656  4.550   1.00 0.00 ? 104 SER A C    3  
ATOM 5558  O O    . SER A 1 104 ? 5.582   14.454  3.491   1.00 0.00 ? 104 SER A O    3  
ATOM 5559  C CB   . SER A 1 104 ? 5.626   16.231  6.387   1.00 0.00 ? 104 SER A CB   3  
ATOM 5560  O OG   . SER A 1 104 ? 7.008   16.374  6.110   1.00 0.00 ? 104 SER A OG   3  
ATOM 5561  H H    . SER A 1 104 ? 3.167   16.923  6.109   1.00 0.00 ? 104 SER A H    3  
ATOM 5562  H HA   . SER A 1 104 ? 5.187   16.773  4.363   1.00 0.00 ? 104 SER A HA   3  
ATOM 5563  H HB2  . SER A 1 104 ? 5.284   17.108  6.915   1.00 0.00 ? 104 SER A HB2  3  
ATOM 5564  H HB3  . SER A 1 104 ? 5.483   15.358  7.007   1.00 0.00 ? 104 SER A HB3  3  
ATOM 5565  H HG   . SER A 1 104 ? 7.133   16.525  5.170   1.00 0.00 ? 104 SER A HG   3  
ATOM 5566  N N    . ASP A 1 105 ? 4.462   13.680  5.281   1.00 0.00 ? 105 ASP A N    3  
ATOM 5567  C CA   . ASP A 1 105 ? 4.552   12.283  4.871   1.00 0.00 ? 105 ASP A CA   3  
ATOM 5568  C C    . ASP A 1 105 ? 3.175   11.732  4.514   1.00 0.00 ? 105 ASP A C    3  
ATOM 5569  O O    . ASP A 1 105 ? 2.368   11.398  5.381   1.00 0.00 ? 105 ASP A O    3  
ATOM 5570  C CB   . ASP A 1 105 ? 5.178   11.442  5.985   1.00 0.00 ? 105 ASP A CB   3  
ATOM 5571  C CG   . ASP A 1 105 ? 6.655   11.733  6.169   1.00 0.00 ? 105 ASP A CG   3  
ATOM 5572  O OD1  . ASP A 1 105 ? 7.327   12.053  5.166   1.00 0.00 ? 105 ASP A OD1  3  
ATOM 5573  O OD2  . ASP A 1 105 ? 7.138   11.641  7.316   1.00 0.00 ? 105 ASP A OD2  3  
ATOM 5574  H H    . ASP A 1 105 ? 4.000   13.904  6.117   1.00 0.00 ? 105 ASP A H    3  
ATOM 5575  H HA   . ASP A 1 105 ? 5.184   12.235  3.997   1.00 0.00 ? 105 ASP A HA   3  
ATOM 5576  H HB2  . ASP A 1 105 ? 4.671   11.652  6.915   1.00 0.00 ? 105 ASP A HB2  3  
ATOM 5577  H HB3  . ASP A 1 105 ? 5.063   10.396  5.744   1.00 0.00 ? 105 ASP A HB3  3  
ATOM 5578  N N    . PRO A 1 106 ? 2.899   11.634  3.205   1.00 0.00 ? 106 PRO A N    3  
ATOM 5579  C CA   . PRO A 1 106 ? 1.620   11.124  2.702   1.00 0.00 ? 106 PRO A CA   3  
ATOM 5580  C C    . PRO A 1 106 ? 1.455   9.628   2.949   1.00 0.00 ? 106 PRO A C    3  
ATOM 5581  O O    . PRO A 1 106 ? 2.426   8.872   2.911   1.00 0.00 ? 106 PRO A O    3  
ATOM 5582  C CB   . PRO A 1 106 ? 1.688   11.414  1.201   1.00 0.00 ? 106 PRO A CB   3  
ATOM 5583  C CG   . PRO A 1 106 ? 3.144   11.457  0.889   1.00 0.00 ? 106 PRO A CG   3  
ATOM 5584  C CD   . PRO A 1 106 ? 3.814   12.013  2.115   1.00 0.00 ? 106 PRO A CD   3  
ATOM 5585  H HA   . PRO A 1 106 ? 0.784   11.653  3.135   1.00 0.00 ? 106 PRO A HA   3  
ATOM 5586  H HB2  . PRO A 1 106 ? 1.189   10.624  0.656   1.00 0.00 ? 106 PRO A HB2  3  
ATOM 5587  H HB3  . PRO A 1 106 ? 1.211   12.359  0.991   1.00 0.00 ? 106 PRO A HB3  3  
ATOM 5588  H HG2  . PRO A 1 106 ? 3.505   10.461  0.683   1.00 0.00 ? 106 PRO A HG2  3  
ATOM 5589  H HG3  . PRO A 1 106 ? 3.318   12.103  0.041   1.00 0.00 ? 106 PRO A HG3  3  
ATOM 5590  H HD2  . PRO A 1 106 ? 4.785   11.561  2.252   1.00 0.00 ? 106 PRO A HD2  3  
ATOM 5591  H HD3  . PRO A 1 106 ? 3.902   13.087  2.042   1.00 0.00 ? 106 PRO A HD3  3  
ATOM 5592  N N    . TYR A 1 107 ? 0.220   9.208   3.201   1.00 0.00 ? 107 TYR A N    3  
ATOM 5593  C CA   . TYR A 1 107 ? -0.071  7.802   3.456   1.00 0.00 ? 107 TYR A CA   3  
ATOM 5594  C C    . TYR A 1 107 ? -1.543  7.495   3.197   1.00 0.00 ? 107 TYR A C    3  
ATOM 5595  O O    . TYR A 1 107 ? -2.412  8.346   3.393   1.00 0.00 ? 107 TYR A O    3  
ATOM 5596  C CB   . TYR A 1 107 ? 0.291   7.438   4.897   1.00 0.00 ? 107 TYR A CB   3  
ATOM 5597  C CG   . TYR A 1 107 ? -0.574  8.124   5.931   1.00 0.00 ? 107 TYR A CG   3  
ATOM 5598  C CD1  . TYR A 1 107 ? -1.787  7.574   6.326   1.00 0.00 ? 107 TYR A CD1  3  
ATOM 5599  C CD2  . TYR A 1 107 ? -0.178  9.323   6.511   1.00 0.00 ? 107 TYR A CD2  3  
ATOM 5600  C CE1  . TYR A 1 107 ? -2.580  8.198   7.270   1.00 0.00 ? 107 TYR A CE1  3  
ATOM 5601  C CE2  . TYR A 1 107 ? -0.964  9.953   7.456   1.00 0.00 ? 107 TYR A CE2  3  
ATOM 5602  C CZ   . TYR A 1 107 ? -2.164  9.387   7.832   1.00 0.00 ? 107 TYR A CZ   3  
ATOM 5603  O OH   . TYR A 1 107 ? -2.951  10.013  8.772   1.00 0.00 ? 107 TYR A OH   3  
ATOM 5604  H H    . TYR A 1 107 ? -0.513  9.858   3.218   1.00 0.00 ? 107 TYR A H    3  
ATOM 5605  H HA   . TYR A 1 107 ? 0.532   7.211   2.783   1.00 0.00 ? 107 TYR A HA   3  
ATOM 5606  H HB2  . TYR A 1 107 ? 0.182   6.372   5.030   1.00 0.00 ? 107 TYR A HB2  3  
ATOM 5607  H HB3  . TYR A 1 107 ? 1.317   7.716   5.085   1.00 0.00 ? 107 TYR A HB3  3  
ATOM 5608  H HD1  . TYR A 1 107 ? -2.110  6.643   5.884   1.00 0.00 ? 107 TYR A HD1  3  
ATOM 5609  H HD2  . TYR A 1 107 ? 0.763   9.764   6.213   1.00 0.00 ? 107 TYR A HD2  3  
ATOM 5610  H HE1  . TYR A 1 107 ? -3.520  7.755   7.565   1.00 0.00 ? 107 TYR A HE1  3  
ATOM 5611  H HE2  . TYR A 1 107 ? -0.638  10.884  7.896   1.00 0.00 ? 107 TYR A HE2  3  
ATOM 5612  H HH   . TYR A 1 107 ? -2.801  9.612   9.632   1.00 0.00 ? 107 TYR A HH   3  
ATOM 5613  N N    . LYS A 1 108 ? -1.816  6.272   2.754   1.00 0.00 ? 108 LYS A N    3  
ATOM 5614  C CA   . LYS A 1 108 ? -3.182  5.849   2.468   1.00 0.00 ? 108 LYS A CA   3  
ATOM 5615  C C    . LYS A 1 108 ? -3.682  4.872   3.528   1.00 0.00 ? 108 LYS A C    3  
ATOM 5616  O O    . LYS A 1 108 ? -3.009  3.892   3.849   1.00 0.00 ? 108 LYS A O    3  
ATOM 5617  C CB   . LYS A 1 108 ? -3.258  5.200   1.085   1.00 0.00 ? 108 LYS A CB   3  
ATOM 5618  C CG   . LYS A 1 108 ? -2.837  6.125   -0.045  1.00 0.00 ? 108 LYS A CG   3  
ATOM 5619  C CD   . LYS A 1 108 ? -3.422  5.682   -1.375  1.00 0.00 ? 108 LYS A CD   3  
ATOM 5620  C CE   . LYS A 1 108 ? -3.257  6.755   -2.441  1.00 0.00 ? 108 LYS A CE   3  
ATOM 5621  N NZ   . LYS A 1 108 ? -4.294  6.645   -3.504  1.00 0.00 ? 108 LYS A NZ   3  
ATOM 5622  H H    . LYS A 1 108 ? -1.081  5.638   2.617   1.00 0.00 ? 108 LYS A H    3  
ATOM 5623  H HA   . LYS A 1 108 ? -3.811  6.726   2.480   1.00 0.00 ? 108 LYS A HA   3  
ATOM 5624  H HB2  . LYS A 1 108 ? -2.614  4.333   1.071   1.00 0.00 ? 108 LYS A HB2  3  
ATOM 5625  H HB3  . LYS A 1 108 ? -4.275  4.885   0.903   1.00 0.00 ? 108 LYS A HB3  3  
ATOM 5626  H HG2  . LYS A 1 108 ? -3.181  7.125   0.173   1.00 0.00 ? 108 LYS A HG2  3  
ATOM 5627  H HG3  . LYS A 1 108 ? -1.758  6.121   -0.117  1.00 0.00 ? 108 LYS A HG3  3  
ATOM 5628  H HD2  . LYS A 1 108 ? -2.916  4.786   -1.702  1.00 0.00 ? 108 LYS A HD2  3  
ATOM 5629  H HD3  . LYS A 1 108 ? -4.475  5.476   -1.244  1.00 0.00 ? 108 LYS A HD3  3  
ATOM 5630  H HE2  . LYS A 1 108 ? -3.335  7.724   -1.973  1.00 0.00 ? 108 LYS A HE2  3  
ATOM 5631  H HE3  . LYS A 1 108 ? -2.280  6.650   -2.890  1.00 0.00 ? 108 LYS A HE3  3  
ATOM 5632  H HZ1  . LYS A 1 108 ? -4.005  5.940   -4.212  1.00 0.00 ? 108 LYS A HZ1  3  
ATOM 5633  H HZ2  . LYS A 1 108 ? -4.420  7.563   -3.976  1.00 0.00 ? 108 LYS A HZ2  3  
ATOM 5634  H HZ3  . LYS A 1 108 ? -5.202  6.352   -3.089  1.00 0.00 ? 108 LYS A HZ3  3  
ATOM 5635  N N    . VAL A 1 109 ? -4.866  5.144   4.066   1.00 0.00 ? 109 VAL A N    3  
ATOM 5636  C CA   . VAL A 1 109 ? -5.457  4.288   5.087   1.00 0.00 ? 109 VAL A CA   3  
ATOM 5637  C C    . VAL A 1 109 ? -6.522  3.375   4.490   1.00 0.00 ? 109 VAL A C    3  
ATOM 5638  O O    . VAL A 1 109 ? -7.266  3.774   3.594   1.00 0.00 ? 109 VAL A O    3  
ATOM 5639  C CB   . VAL A 1 109 ? -6.086  5.118   6.221   1.00 0.00 ? 109 VAL A CB   3  
ATOM 5640  C CG1  . VAL A 1 109 ? -6.497  4.219   7.377   1.00 0.00 ? 109 VAL A CG1  3  
ATOM 5641  C CG2  . VAL A 1 109 ? -5.121  6.196   6.691   1.00 0.00 ? 109 VAL A CG2  3  
ATOM 5642  H H    . VAL A 1 109 ? -5.355  5.940   3.769   1.00 0.00 ? 109 VAL A H    3  
ATOM 5643  H HA   . VAL A 1 109 ? -4.670  3.679   5.509   1.00 0.00 ? 109 VAL A HA   3  
ATOM 5644  H HB   . VAL A 1 109 ? -6.973  5.601   5.837   1.00 0.00 ? 109 VAL A HB   3  
ATOM 5645  H HG11 . VAL A 1 109 ? -6.008  4.550   8.282   1.00 0.00 ? 109 VAL A HG11 3  
ATOM 5646  H HG12 . VAL A 1 109 ? -7.568  4.267   7.508   1.00 0.00 ? 109 VAL A HG12 3  
ATOM 5647  H HG13 . VAL A 1 109 ? -6.205  3.201   7.163   1.00 0.00 ? 109 VAL A HG13 3  
ATOM 5648  H HG21 . VAL A 1 109 ? -4.526  6.534   5.855   1.00 0.00 ? 109 VAL A HG21 3  
ATOM 5649  H HG22 . VAL A 1 109 ? -5.678  7.028   7.096   1.00 0.00 ? 109 VAL A HG22 3  
ATOM 5650  H HG23 . VAL A 1 109 ? -4.473  5.792   7.454   1.00 0.00 ? 109 VAL A HG23 3  
ATOM 5651  N N    . TYR A 1 110 ? -6.590  2.147   4.992   1.00 0.00 ? 110 TYR A N    3  
ATOM 5652  C CA   . TYR A 1 110 ? -7.562  1.175   4.506   1.00 0.00 ? 110 TYR A CA   3  
ATOM 5653  C C    . TYR A 1 110 ? -8.076  0.302   5.647   1.00 0.00 ? 110 TYR A C    3  
ATOM 5654  O O    . TYR A 1 110 ? -7.379  0.083   6.638   1.00 0.00 ? 110 TYR A O    3  
ATOM 5655  C CB   . TYR A 1 110 ? -6.940  0.298   3.419   1.00 0.00 ? 110 TYR A CB   3  
ATOM 5656  C CG   . TYR A 1 110 ? -6.993  0.915   2.039   1.00 0.00 ? 110 TYR A CG   3  
ATOM 5657  C CD1  . TYR A 1 110 ? -6.032  1.830   1.629   1.00 0.00 ? 110 TYR A CD1  3  
ATOM 5658  C CD2  . TYR A 1 110 ? -8.005  0.584   1.147   1.00 0.00 ? 110 TYR A CD2  3  
ATOM 5659  C CE1  . TYR A 1 110 ? -6.076  2.397   0.370   1.00 0.00 ? 110 TYR A CE1  3  
ATOM 5660  C CE2  . TYR A 1 110 ? -8.057  1.144   -0.114  1.00 0.00 ? 110 TYR A CE2  3  
ATOM 5661  C CZ   . TYR A 1 110 ? -7.091  2.050   -0.498  1.00 0.00 ? 110 TYR A CZ   3  
ATOM 5662  O OH   . TYR A 1 110 ? -7.140  2.612   -1.754  1.00 0.00 ? 110 TYR A OH   3  
ATOM 5663  H H    . TYR A 1 110 ? -5.969  1.886   5.704   1.00 0.00 ? 110 TYR A H    3  
ATOM 5664  H HA   . TYR A 1 110 ? -8.393  1.721   4.083   1.00 0.00 ? 110 TYR A HA   3  
ATOM 5665  H HB2  . TYR A 1 110 ? -5.904  0.117   3.661   1.00 0.00 ? 110 TYR A HB2  3  
ATOM 5666  H HB3  . TYR A 1 110 ? -7.466  -0.645  3.382   1.00 0.00 ? 110 TYR A HB3  3  
ATOM 5667  H HD1  . TYR A 1 110 ? -5.238  2.099   2.311   1.00 0.00 ? 110 TYR A HD1  3  
ATOM 5668  H HD2  . TYR A 1 110 ? -8.761  -0.126  1.451   1.00 0.00 ? 110 TYR A HD2  3  
ATOM 5669  H HE1  . TYR A 1 110 ? -5.320  3.106   0.068   1.00 0.00 ? 110 TYR A HE1  3  
ATOM 5670  H HE2  . TYR A 1 110 ? -8.852  0.873   -0.794  1.00 0.00 ? 110 TYR A HE2  3  
ATOM 5671  H HH   . TYR A 1 110 ? -8.052  2.654   -2.050  1.00 0.00 ? 110 TYR A HH   3  
ATOM 5672  N N    . ARG A 1 111 ? -9.300  -0.194  5.499   1.00 0.00 ? 111 ARG A N    3  
ATOM 5673  C CA   . ARG A 1 111 ? -9.909  -1.043  6.516   1.00 0.00 ? 111 ARG A CA   3  
ATOM 5674  C C    . ARG A 1 111 ? -10.211 -2.430  5.957   1.00 0.00 ? 111 ARG A C    3  
ATOM 5675  O O    . ARG A 1 111 ? -10.859 -2.563  4.918   1.00 0.00 ? 111 ARG A O    3  
ATOM 5676  C CB   . ARG A 1 111 ? -11.194 -0.402  7.043   1.00 0.00 ? 111 ARG A CB   3  
ATOM 5677  C CG   . ARG A 1 111 ? -12.071 -1.358  7.836   1.00 0.00 ? 111 ARG A CG   3  
ATOM 5678  C CD   . ARG A 1 111 ? -13.535 -0.952  7.775   1.00 0.00 ? 111 ARG A CD   3  
ATOM 5679  N NE   . ARG A 1 111 ? -14.427 -2.081  8.022   1.00 0.00 ? 111 ARG A NE   3  
ATOM 5680  C CZ   . ARG A 1 111 ? -15.668 -1.951  8.479   1.00 0.00 ? 111 ARG A CZ   3  
ATOM 5681  N NH1  . ARG A 1 111 ? -16.161 -0.748  8.736   1.00 0.00 ? 111 ARG A NH1  3  
ATOM 5682  N NH2  . ARG A 1 111 ? -16.419 -3.027  8.678   1.00 0.00 ? 111 ARG A NH2  3  
ATOM 5683  H H    . ARG A 1 111 ? -9.806  0.017   4.687   1.00 0.00 ? 111 ARG A H    3  
ATOM 5684  H HA   . ARG A 1 111 ? -9.206  -1.141  7.330   1.00 0.00 ? 111 ARG A HA   3  
ATOM 5685  H HB2  . ARG A 1 111 ? -10.933 0.427   7.684   1.00 0.00 ? 111 ARG A HB2  3  
ATOM 5686  H HB3  . ARG A 1 111 ? -11.767 -0.033  6.206   1.00 0.00 ? 111 ARG A HB3  3  
ATOM 5687  H HG2  . ARG A 1 111 ? -11.967 -2.351  7.425   1.00 0.00 ? 111 ARG A HG2  3  
ATOM 5688  H HG3  . ARG A 1 111 ? -11.748 -1.357  8.866   1.00 0.00 ? 111 ARG A HG3  3  
ATOM 5689  H HD2  . ARG A 1 111 ? -13.715 -0.193  8.522   1.00 0.00 ? 111 ARG A HD2  3  
ATOM 5690  H HD3  . ARG A 1 111 ? -13.742 -0.548  6.795   1.00 0.00 ? 111 ARG A HD3  3  
ATOM 5691  H HE   . ARG A 1 111 ? -14.083 -2.980  7.838   1.00 0.00 ? 111 ARG A HE   3  
ATOM 5692  H HH11 . ARG A 1 111 ? -15.598 0.065   8.586   1.00 0.00 ? 111 ARG A HH11 3  
ATOM 5693  H HH12 . ARG A 1 111 ? -17.096 -0.653  9.079   1.00 0.00 ? 111 ARG A HH12 3  
ATOM 5694  H HH21 . ARG A 1 111 ? -16.051 -3.936  8.485   1.00 0.00 ? 111 ARG A HH21 3  
ATOM 5695  H HH22 . ARG A 1 111 ? -17.352 -2.929  9.022   1.00 0.00 ? 111 ARG A HH22 3  
ATOM 5696  N N    . ILE A 1 112 ? -9.738  -3.459  6.652   1.00 0.00 ? 112 ILE A N    3  
ATOM 5697  C CA   . ILE A 1 112 ? -9.959  -4.835  6.225   1.00 0.00 ? 112 ILE A CA   3  
ATOM 5698  C C    . ILE A 1 112 ? -11.398 -5.267  6.486   1.00 0.00 ? 112 ILE A C    3  
ATOM 5699  O O    . ILE A 1 112 ? -11.767 -5.584  7.617   1.00 0.00 ? 112 ILE A O    3  
ATOM 5700  C CB   . ILE A 1 112 ? -9.004  -5.807  6.943   1.00 0.00 ? 112 ILE A CB   3  
ATOM 5701  C CG1  . ILE A 1 112 ? -7.549  -5.417  6.677   1.00 0.00 ? 112 ILE A CG1  3  
ATOM 5702  C CG2  . ILE A 1 112 ? -9.266  -7.236  6.492   1.00 0.00 ? 112 ILE A CG2  3  
ATOM 5703  C CD1  . ILE A 1 112 ? -6.550  -6.230  7.470   1.00 0.00 ? 112 ILE A CD1  3  
ATOM 5704  H H    . ILE A 1 112 ? -9.230  -3.288  7.472   1.00 0.00 ? 112 ILE A H    3  
ATOM 5705  H HA   . ILE A 1 112 ? -9.765  -4.889  5.164   1.00 0.00 ? 112 ILE A HA   3  
ATOM 5706  H HB   . ILE A 1 112 ? -9.197  -5.748  8.003   1.00 0.00 ? 112 ILE A HB   3  
ATOM 5707  H HG12 . ILE A 1 112 ? -7.331  -5.556  5.630   1.00 0.00 ? 112 ILE A HG12 3  
ATOM 5708  H HG13 . ILE A 1 112 ? -7.410  -4.377  6.934   1.00 0.00 ? 112 ILE A HG13 3  
ATOM 5709  H HG21 . ILE A 1 112 ? -8.842  -7.387  5.511   1.00 0.00 ? 112 ILE A HG21 3  
ATOM 5710  H HG22 . ILE A 1 112 ? -8.810  -7.922  7.190   1.00 0.00 ? 112 ILE A HG22 3  
ATOM 5711  H HG23 . ILE A 1 112 ? -10.330 -7.413  6.456   1.00 0.00 ? 112 ILE A HG23 3  
ATOM 5712  H HD11 . ILE A 1 112 ? -5.887  -5.565  8.004   1.00 0.00 ? 112 ILE A HD11 3  
ATOM 5713  H HD12 . ILE A 1 112 ? -7.075  -6.858  8.174   1.00 0.00 ? 112 ILE A HD12 3  
ATOM 5714  H HD13 . ILE A 1 112 ? -5.973  -6.848  6.797   1.00 0.00 ? 112 ILE A HD13 3  
ATOM 5715  N N    . VAL A 1 113 ? -12.206 -5.280  5.431   1.00 0.00 ? 113 VAL A N    3  
ATOM 5716  C CA   . VAL A 1 113 ? -13.605 -5.677  5.545   1.00 0.00 ? 113 VAL A CA   3  
ATOM 5717  C C    . VAL A 1 113 ? -13.739 -7.192  5.648   1.00 0.00 ? 113 VAL A C    3  
ATOM 5718  O O    . VAL A 1 113 ? -13.291 -7.941  4.779   1.00 0.00 ? 113 VAL A O    3  
ATOM 5719  C CB   . VAL A 1 113 ? -14.429 -5.180  4.342   1.00 0.00 ? 113 VAL A CB   3  
ATOM 5720  C CG1  . VAL A 1 113 ? -15.917 -5.261  4.644   1.00 0.00 ? 113 VAL A CG1  3  
ATOM 5721  C CG2  . VAL A 1 113 ? -14.028 -3.760  3.972   1.00 0.00 ? 113 VAL A CG2  3  
ATOM 5722  H H    . VAL A 1 113 ? -11.854 -5.017  4.555   1.00 0.00 ? 113 VAL A H    3  
ATOM 5723  H HA   . VAL A 1 113 ? -14.008 -5.228  6.441   1.00 0.00 ? 113 VAL A HA   3  
ATOM 5724  H HB   . VAL A 1 113 ? -14.220 -5.822  3.498   1.00 0.00 ? 113 VAL A HB   3  
ATOM 5725  H HG11 . VAL A 1 113 ? -16.108 -6.108  5.288   1.00 0.00 ? 113 VAL A HG11 3  
ATOM 5726  H HG12 . VAL A 1 113 ? -16.235 -4.354  5.137   1.00 0.00 ? 113 VAL A HG12 3  
ATOM 5727  H HG13 . VAL A 1 113 ? -16.466 -5.382  3.721   1.00 0.00 ? 113 VAL A HG13 3  
ATOM 5728  H HG21 . VAL A 1 113 ? -14.156 -3.116  4.830   1.00 0.00 ? 113 VAL A HG21 3  
ATOM 5729  H HG22 . VAL A 1 113 ? -12.993 -3.746  3.664   1.00 0.00 ? 113 VAL A HG22 3  
ATOM 5730  H HG23 . VAL A 1 113 ? -14.650 -3.409  3.162   1.00 0.00 ? 113 VAL A HG23 3  
ATOM 5731  N N    . PRO A 1 114 ? -14.372 -7.657  6.735   1.00 0.00 ? 114 PRO A N    3  
ATOM 5732  C CA   . PRO A 1 114 ? -14.582 -9.088  6.978   1.00 0.00 ? 114 PRO A CA   3  
ATOM 5733  C C    . PRO A 1 114 ? -15.590 -9.698  6.010   1.00 0.00 ? 114 PRO A C    3  
ATOM 5734  O O    . PRO A 1 114 ? -16.050 -9.036  5.080   1.00 0.00 ? 114 PRO A O    3  
ATOM 5735  C CB   . PRO A 1 114 ? -15.122 -9.129  8.409   1.00 0.00 ? 114 PRO A CB   3  
ATOM 5736  C CG   . PRO A 1 114 ? -15.750 -7.794  8.616   1.00 0.00 ? 114 PRO A CG   3  
ATOM 5737  C CD   . PRO A 1 114 ? -14.932 -6.823  7.811   1.00 0.00 ? 114 PRO A CD   3  
ATOM 5738  H HA   . PRO A 1 114 ? -13.654 -9.639  6.925   1.00 0.00 ? 114 PRO A HA   3  
ATOM 5739  H HB2  . PRO A 1 114 ? -15.847 -9.926  8.500   1.00 0.00 ? 114 PRO A HB2  3  
ATOM 5740  H HB3  . PRO A 1 114 ? -14.309 -9.294  9.100   1.00 0.00 ? 114 PRO A HB3  3  
ATOM 5741  H HG2  . PRO A 1 114 ? -16.770 -7.809  8.262   1.00 0.00 ? 114 PRO A HG2  3  
ATOM 5742  H HG3  . PRO A 1 114 ? -15.719 -7.533  9.663   1.00 0.00 ? 114 PRO A HG3  3  
ATOM 5743  H HD2  . PRO A 1 114 ? -15.561 -6.043  7.407   1.00 0.00 ? 114 PRO A HD2  3  
ATOM 5744  H HD3  . PRO A 1 114 ? -14.145 -6.399  8.418   1.00 0.00 ? 114 PRO A HD3  3  
ATOM 5745  N N    . GLU A 1 115 ? -15.928 -10.964 6.235   1.00 0.00 ? 115 GLU A N    3  
ATOM 5746  C CA   . GLU A 1 115 ? -16.882 -11.662 5.382   1.00 0.00 ? 115 GLU A CA   3  
ATOM 5747  C C    . GLU A 1 115 ? -18.311 -11.225 5.691   1.00 0.00 ? 115 GLU A C    3  
ATOM 5748  O O    . GLU A 1 115 ? -18.544 -10.421 6.594   1.00 0.00 ? 115 GLU A O    3  
ATOM 5749  C CB   . GLU A 1 115 ? -16.749 -13.176 5.564   1.00 0.00 ? 115 GLU A CB   3  
ATOM 5750  C CG   . GLU A 1 115 ? -17.250 -13.673 6.909   1.00 0.00 ? 115 GLU A CG   3  
ATOM 5751  C CD   . GLU A 1 115 ? -17.469 -15.174 6.932   1.00 0.00 ? 115 GLU A CD   3  
ATOM 5752  O OE1  . GLU A 1 115 ? -17.687 -15.758 5.850   1.00 0.00 ? 115 GLU A OE1  3  
ATOM 5753  O OE2  . GLU A 1 115 ? -17.423 -15.763 8.032   1.00 0.00 ? 115 GLU A OE2  3  
ATOM 5754  H H    . GLU A 1 115 ? -15.527 -11.439 6.993   1.00 0.00 ? 115 GLU A H    3  
ATOM 5755  H HA   . GLU A 1 115 ? -16.655 -11.411 4.357   1.00 0.00 ? 115 GLU A HA   3  
ATOM 5756  H HB2  . GLU A 1 115 ? -17.314 -13.670 4.787   1.00 0.00 ? 115 GLU A HB2  3  
ATOM 5757  H HB3  . GLU A 1 115 ? -15.709 -13.448 5.468   1.00 0.00 ? 115 GLU A HB3  3  
ATOM 5758  H HG2  . GLU A 1 115 ? -16.522 -13.420 7.666   1.00 0.00 ? 115 GLU A HG2  3  
ATOM 5759  H HG3  . GLU A 1 115 ? -18.186 -13.184 7.134   1.00 0.00 ? 115 GLU A HG3  3  
ATOM 5760  N N    . SER A 1 116 ? -19.264 -11.760 4.935   1.00 0.00 ? 116 SER A N    3  
ATOM 5761  C CA   . SER A 1 116 ? -20.670 -11.423 5.124   1.00 0.00 ? 116 SER A CA   3  
ATOM 5762  C C    . SER A 1 116 ? -21.505 -12.680 5.346   1.00 0.00 ? 116 SER A C    3  
ATOM 5763  O O    . SER A 1 116 ? -21.224 -13.734 4.778   1.00 0.00 ? 116 SER A O    3  
ATOM 5764  C CB   . SER A 1 116 ? -21.199 -10.652 3.913   1.00 0.00 ? 116 SER A CB   3  
ATOM 5765  O OG   . SER A 1 116 ? -21.397 -11.515 2.807   1.00 0.00 ? 116 SER A OG   3  
ATOM 5766  H H    . SER A 1 116 ? -19.015 -12.396 4.231   1.00 0.00 ? 116 SER A H    3  
ATOM 5767  H HA   . SER A 1 116 ? -20.745 -10.796 6.000   1.00 0.00 ? 116 SER A HA   3  
ATOM 5768  H HB2  . SER A 1 116 ? -22.141 -10.190 4.167   1.00 0.00 ? 116 SER A HB2  3  
ATOM 5769  H HB3  . SER A 1 116 ? -20.486 -9.889  3.637   1.00 0.00 ? 116 SER A HB3  3  
ATOM 5770  H HG   . SER A 1 116 ? -21.659 -10.998 2.041   1.00 0.00 ? 116 SER A HG   3  
ATOM 5771  N N    . GLY A 1 117 ? -22.536 -12.559 6.177   1.00 0.00 ? 117 GLY A N    3  
ATOM 5772  C CA   . GLY A 1 117 ? -23.397 -13.692 6.460   1.00 0.00 ? 117 GLY A CA   3  
ATOM 5773  C C    . GLY A 1 117 ? -24.810 -13.272 6.816   1.00 0.00 ? 117 GLY A C    3  
ATOM 5774  O O    . GLY A 1 117 ? -25.076 -12.110 7.122   1.00 0.00 ? 117 GLY A O    3  
ATOM 5775  H H    . GLY A 1 117 ? -22.713 -11.694 6.602   1.00 0.00 ? 117 GLY A H    3  
ATOM 5776  H HA2  . GLY A 1 117 ? -23.432 -14.331 5.590   1.00 0.00 ? 117 GLY A HA2  3  
ATOM 5777  H HA3  . GLY A 1 117 ? -22.981 -14.249 7.287   1.00 0.00 ? 117 GLY A HA3  3  
ATOM 5778  N N    . PRO A 1 118 ? -25.744 -14.234 6.778   1.00 0.00 ? 118 PRO A N    3  
ATOM 5779  C CA   . PRO A 1 118 ? -27.153 -13.981 7.096   1.00 0.00 ? 118 PRO A CA   3  
ATOM 5780  C C    . PRO A 1 118 ? -27.371 -13.692 8.577   1.00 0.00 ? 118 PRO A C    3  
ATOM 5781  O O    . PRO A 1 118 ? -26.523 -14.009 9.412   1.00 0.00 ? 118 PRO A O    3  
ATOM 5782  C CB   . PRO A 1 118 ? -27.846 -15.287 6.699   1.00 0.00 ? 118 PRO A CB   3  
ATOM 5783  C CG   . PRO A 1 118 ? -26.783 -16.326 6.800   1.00 0.00 ? 118 PRO A CG   3  
ATOM 5784  C CD   . PRO A 1 118 ? -25.498 -15.641 6.423   1.00 0.00 ? 118 PRO A CD   3  
ATOM 5785  H HA   . PRO A 1 118 ? -27.552 -13.167 6.509   1.00 0.00 ? 118 PRO A HA   3  
ATOM 5786  H HB2  . PRO A 1 118 ? -28.661 -15.487 7.380   1.00 0.00 ? 118 PRO A HB2  3  
ATOM 5787  H HB3  . PRO A 1 118 ? -28.224 -15.206 5.691   1.00 0.00 ? 118 PRO A HB3  3  
ATOM 5788  H HG2  . PRO A 1 118 ? -26.728 -16.697 7.811   1.00 0.00 ? 118 PRO A HG2  3  
ATOM 5789  H HG3  . PRO A 1 118 ? -26.993 -17.132 6.113   1.00 0.00 ? 118 PRO A HG3  3  
ATOM 5790  H HD2  . PRO A 1 118 ? -24.675 -16.045 6.993   1.00 0.00 ? 118 PRO A HD2  3  
ATOM 5791  H HD3  . PRO A 1 118 ? -25.312 -15.744 5.364   1.00 0.00 ? 118 PRO A HD3  3  
ATOM 5792  N N    . SER A 1 119 ? -28.511 -13.089 8.897   1.00 0.00 ? 119 SER A N    3  
ATOM 5793  C CA   . SER A 1 119 ? -28.838 -12.754 10.278  1.00 0.00 ? 119 SER A CA   3  
ATOM 5794  C C    . SER A 1 119 ? -30.349 -12.758 10.495  1.00 0.00 ? 119 SER A C    3  
ATOM 5795  O O    . SER A 1 119 ? -31.121 -12.961 9.558   1.00 0.00 ? 119 SER A O    3  
ATOM 5796  C CB   . SER A 1 119 ? -28.262 -11.385 10.643  1.00 0.00 ? 119 SER A CB   3  
ATOM 5797  O OG   . SER A 1 119 ? -29.055 -10.339 10.108  1.00 0.00 ? 119 SER A OG   3  
ATOM 5798  H H    . SER A 1 119 ? -29.147 -12.862 8.186   1.00 0.00 ? 119 SER A H    3  
ATOM 5799  H HA   . SER A 1 119 ? -28.393 -13.504 10.915  1.00 0.00 ? 119 SER A HA   3  
ATOM 5800  H HB2  . SER A 1 119 ? -28.233 -11.284 11.717  1.00 0.00 ? 119 SER A HB2  3  
ATOM 5801  H HB3  . SER A 1 119 ? -27.261 -11.301 10.246  1.00 0.00 ? 119 SER A HB3  3  
ATOM 5802  H HG   . SER A 1 119 ? -28.655 -9.493  10.321  1.00 0.00 ? 119 SER A HG   3  
ATOM 5803  N N    . SER A 1 120 ? -30.762 -12.531 11.737  1.00 0.00 ? 120 SER A N    3  
ATOM 5804  C CA   . SER A 1 120 ? -32.180 -12.512 12.079  1.00 0.00 ? 120 SER A CA   3  
ATOM 5805  C C    . SER A 1 120 ? -32.978 -11.725 11.044  1.00 0.00 ? 120 SER A C    3  
ATOM 5806  O O    . SER A 1 120 ? -34.046 -12.155 10.610  1.00 0.00 ? 120 SER A O    3  
ATOM 5807  C CB   . SER A 1 120 ? -32.382 -11.901 13.468  1.00 0.00 ? 120 SER A CB   3  
ATOM 5808  O OG   . SER A 1 120 ? -32.169 -12.865 14.485  1.00 0.00 ? 120 SER A OG   3  
ATOM 5809  H H    . SER A 1 120 ? -30.098 -12.376 12.441  1.00 0.00 ? 120 SER A H    3  
ATOM 5810  H HA   . SER A 1 120 ? -32.532 -13.532 12.089  1.00 0.00 ? 120 SER A HA   3  
ATOM 5811  H HB2  . SER A 1 120 ? -31.685 -11.089 13.606  1.00 0.00 ? 120 SER A HB2  3  
ATOM 5812  H HB3  . SER A 1 120 ? -33.393 -11.527 13.549  1.00 0.00 ? 120 SER A HB3  3  
ATOM 5813  H HG   . SER A 1 120 ? -31.905 -12.423 15.295  1.00 0.00 ? 120 SER A HG   3  
ATOM 5814  N N    . GLY A 1 121 ? -32.450 -10.569 10.652  1.00 0.00 ? 121 GLY A N    3  
ATOM 5815  C CA   . GLY A 1 121 ? -33.125 -9.740  9.671   1.00 0.00 ? 121 GLY A CA   3  
ATOM 5816  C C    . GLY A 1 121 ? -32.844 -8.264  9.868   1.00 0.00 ? 121 GLY A C    3  
ATOM 5817  O O    . GLY A 1 121 ? -32.375 -7.850  10.929  1.00 0.00 ? 121 GLY A O    3  
ATOM 5818  H H    . GLY A 1 121 ? -31.595 -10.277 11.033  1.00 0.00 ? 121 GLY A H    3  
ATOM 5819  H HA2  . GLY A 1 121 ? -32.798 -10.030 8.684   1.00 0.00 ? 121 GLY A HA2  3  
ATOM 5820  H HA3  . GLY A 1 121 ? -34.190 -9.905  9.750   1.00 0.00 ? 121 GLY A HA3  3  
ATOM 5821  N N    . GLY A 1 1   ? -21.340 -18.766 -12.901 1.00 0.00 ? 1   GLY A N    4  
ATOM 5822  C CA   . GLY A 1 1   ? -20.338 -17.720 -12.813 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5823  C C    . GLY A 1 1   ? -18.974 -18.255 -12.423 1.00 0.00 ? 1   GLY A C    4  
ATOM 5824  O O    . GLY A 1 1   ? -18.718 -18.525 -11.249 1.00 0.00 ? 1   GLY A O    4  
ATOM 5825  H H1   . GLY A 1 1   ? -21.089 -19.656 -13.226 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5826  H HA2  . GLY A 1 1   ? -20.260 -17.229 -13.771 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5827  H HA3  . GLY A 1 1   ? -20.653 -16.998 -12.074 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5828  N N    . SER A 1 2   ? -18.097 -18.411 -13.409 1.00 0.00 ? 2   SER A N    4  
ATOM 5829  C CA   . SER A 1 2   ? -16.754 -18.923 -13.164 1.00 0.00 ? 2   SER A CA   4  
ATOM 5830  C C    . SER A 1 2   ? -15.752 -17.780 -13.035 1.00 0.00 ? 2   SER A C    4  
ATOM 5831  O O    . SER A 1 2   ? -15.735 -16.859 -13.853 1.00 0.00 ? 2   SER A O    4  
ATOM 5832  C CB   . SER A 1 2   ? -16.329 -19.863 -14.294 1.00 0.00 ? 2   SER A CB   4  
ATOM 5833  O OG   . SER A 1 2   ? -16.827 -21.173 -14.081 1.00 0.00 ? 2   SER A OG   4  
ATOM 5834  H H    . SER A 1 2   ? -18.361 -18.179 -14.324 1.00 0.00 ? 2   SER A H    4  
ATOM 5835  H HA   . SER A 1 2   ? -16.774 -19.475 -12.236 1.00 0.00 ? 2   SER A HA   4  
ATOM 5836  H HB2  . SER A 1 2   ? -16.715 -19.493 -15.231 1.00 0.00 ? 2   SER A HB2  4  
ATOM 5837  H HB3  . SER A 1 2   ? -15.251 -19.903 -14.338 1.00 0.00 ? 2   SER A HB3  4  
ATOM 5838  H HG   . SER A 1 2   ? -16.184 -21.682 -13.581 1.00 0.00 ? 2   SER A HG   4  
ATOM 5839  N N    . SER A 1 3   ? -14.919 -17.845 -12.001 1.00 0.00 ? 3   SER A N    4  
ATOM 5840  C CA   . SER A 1 3   ? -13.916 -16.814 -11.762 1.00 0.00 ? 3   SER A CA   4  
ATOM 5841  C C    . SER A 1 3   ? -12.698 -17.396 -11.050 1.00 0.00 ? 3   SER A C    4  
ATOM 5842  O O    . SER A 1 3   ? -12.824 -18.278 -10.202 1.00 0.00 ? 3   SER A O    4  
ATOM 5843  C CB   . SER A 1 3   ? -14.512 -15.676 -10.930 1.00 0.00 ? 3   SER A CB   4  
ATOM 5844  O OG   . SER A 1 3   ? -15.396 -14.886 -11.707 1.00 0.00 ? 3   SER A OG   4  
ATOM 5845  H H    . SER A 1 3   ? -14.982 -18.604 -11.384 1.00 0.00 ? 3   SER A H    4  
ATOM 5846  H HA   . SER A 1 3   ? -13.606 -16.424 -12.720 1.00 0.00 ? 3   SER A HA   4  
ATOM 5847  H HB2  . SER A 1 3   ? -15.057 -16.091 -10.096 1.00 0.00 ? 3   SER A HB2  4  
ATOM 5848  H HB3  . SER A 1 3   ? -13.714 -15.047 -10.562 1.00 0.00 ? 3   SER A HB3  4  
ATOM 5849  H HG   . SER A 1 3   ? -14.922 -14.131 -12.063 1.00 0.00 ? 3   SER A HG   4  
ATOM 5850  N N    . GLY A 1 4   ? -11.518 -16.894 -11.402 1.00 0.00 ? 4   GLY A N    4  
ATOM 5851  C CA   . GLY A 1 4   ? -10.294 -17.375 -10.788 1.00 0.00 ? 4   GLY A CA   4  
ATOM 5852  C C    . GLY A 1 4   ? -9.534  -16.275 -10.074 1.00 0.00 ? 4   GLY A C    4  
ATOM 5853  O O    . GLY A 1 4   ? -8.305  -16.221 -10.134 1.00 0.00 ? 4   GLY A O    4  
ATOM 5854  H H    . GLY A 1 4   ? -11.479 -16.191 -12.085 1.00 0.00 ? 4   GLY A H    4  
ATOM 5855  H HA2  . GLY A 1 4   ? -10.541 -18.149 -10.077 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5856  H HA3  . GLY A 1 4   ? -9.661  -17.794 -11.556 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5857  N N    . SER A 1 5   ? -10.265 -15.396 -9.396  1.00 0.00 ? 5   SER A N    4  
ATOM 5858  C CA   . SER A 1 5   ? -9.651  -14.290 -8.671  1.00 0.00 ? 5   SER A CA   4  
ATOM 5859  C C    . SER A 1 5   ? -8.890  -14.796 -7.449  1.00 0.00 ? 5   SER A C    4  
ATOM 5860  O O    . SER A 1 5   ? -9.319  -15.738 -6.784  1.00 0.00 ? 5   SER A O    4  
ATOM 5861  C CB   . SER A 1 5   ? -10.718 -13.281 -8.239  1.00 0.00 ? 5   SER A CB   4  
ATOM 5862  O OG   . SER A 1 5   ? -11.413 -12.763 -9.360  1.00 0.00 ? 5   SER A OG   4  
ATOM 5863  H H    . SER A 1 5   ? -11.240 -15.493 -9.385  1.00 0.00 ? 5   SER A H    4  
ATOM 5864  H HA   . SER A 1 5   ? -8.956  -13.802 -9.337  1.00 0.00 ? 5   SER A HA   4  
ATOM 5865  H HB2  . SER A 1 5   ? -11.426 -13.768 -7.585  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5866  H HB3  . SER A 1 5   ? -10.245 -12.464 -7.714  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5867  H HG   . SER A 1 5   ? -11.585 -11.828 -9.226  1.00 0.00 ? 5   SER A HG   4  
ATOM 5868  N N    . SER A 1 6   ? -7.757  -14.162 -7.161  1.00 0.00 ? 6   SER A N    4  
ATOM 5869  C CA   . SER A 1 6   ? -6.933  -14.550 -6.023  1.00 0.00 ? 6   SER A CA   4  
ATOM 5870  C C    . SER A 1 6   ? -7.144  -13.597 -4.850  1.00 0.00 ? 6   SER A C    4  
ATOM 5871  O O    . SER A 1 6   ? -7.801  -12.565 -4.984  1.00 0.00 ? 6   SER A O    4  
ATOM 5872  C CB   . SER A 1 6   ? -5.456  -14.569 -6.419  1.00 0.00 ? 6   SER A CB   4  
ATOM 5873  O OG   . SER A 1 6   ? -5.092  -15.823 -6.971  1.00 0.00 ? 6   SER A OG   4  
ATOM 5874  H H    . SER A 1 6   ? -7.469  -13.418 -7.730  1.00 0.00 ? 6   SER A H    4  
ATOM 5875  H HA   . SER A 1 6   ? -7.229  -15.543 -5.722  1.00 0.00 ? 6   SER A HA   4  
ATOM 5876  H HB2  . SER A 1 6   ? -5.272  -13.800 -7.153  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5877  H HB3  . SER A 1 6   ? -4.849  -14.385 -5.545  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5878  H HG   . SER A 1 6   ? -5.006  -15.740 -7.924  1.00 0.00 ? 6   SER A HG   4  
ATOM 5879  N N    . GLY A 1 7   ? -6.581  -13.952 -3.699  1.00 0.00 ? 7   GLY A N    4  
ATOM 5880  C CA   . GLY A 1 7   ? -6.719  -13.119 -2.518  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5881  C C    . GLY A 1 7   ? -5.559  -13.280 -1.556  1.00 0.00 ? 7   GLY A C    4  
ATOM 5882  O O    . GLY A 1 7   ? -5.758  -13.476 -0.357  1.00 0.00 ? 7   GLY A O    4  
ATOM 5883  H H    . GLY A 1 7   ? -6.069  -14.786 -3.651  1.00 0.00 ? 7   GLY A H    4  
ATOM 5884  H HA2  . GLY A 1 7   ? -6.777  -12.085 -2.825  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5885  H HA3  . GLY A 1 7   ? -7.633  -13.385 -2.009  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5886  N N    . LYS A 1 8   ? -4.341  -13.201 -2.082  1.00 0.00 ? 8   LYS A N    4  
ATOM 5887  C CA   . LYS A 1 8   ? -3.143  -13.340 -1.263  1.00 0.00 ? 8   LYS A CA   4  
ATOM 5888  C C    . LYS A 1 8   ? -2.762  -12.008 -0.625  1.00 0.00 ? 8   LYS A C    4  
ATOM 5889  O O    . LYS A 1 8   ? -2.425  -11.948 0.559   1.00 0.00 ? 8   LYS A O    4  
ATOM 5890  C CB   . LYS A 1 8   ? -1.980  -13.863 -2.108  1.00 0.00 ? 8   LYS A CB   4  
ATOM 5891  C CG   . LYS A 1 8   ? -0.958  -14.658 -1.312  1.00 0.00 ? 8   LYS A CG   4  
ATOM 5892  C CD   . LYS A 1 8   ? -1.417  -16.090 -1.089  1.00 0.00 ? 8   LYS A CD   4  
ATOM 5893  C CE   . LYS A 1 8   ? -0.635  -16.757 0.032   1.00 0.00 ? 8   LYS A CE   4  
ATOM 5894  N NZ   . LYS A 1 8   ? -0.581  -18.236 -0.133  1.00 0.00 ? 8   LYS A NZ   4  
ATOM 5895  H H    . LYS A 1 8   ? -4.245  -13.043 -3.045  1.00 0.00 ? 8   LYS A H    4  
ATOM 5896  H HA   . LYS A 1 8   ? -3.357  -14.052 -0.480  1.00 0.00 ? 8   LYS A HA   4  
ATOM 5897  H HB2  . LYS A 1 8   ? -2.374  -14.501 -2.886  1.00 0.00 ? 8   LYS A HB2  4  
ATOM 5898  H HB3  . LYS A 1 8   ? -1.475  -13.024 -2.564  1.00 0.00 ? 8   LYS A HB3  4  
ATOM 5899  H HG2  . LYS A 1 8   ? -0.024  -14.671 -1.854  1.00 0.00 ? 8   LYS A HG2  4  
ATOM 5900  H HG3  . LYS A 1 8   ? -0.814  -14.182 -0.353  1.00 0.00 ? 8   LYS A HG3  4  
ATOM 5901  H HD2  . LYS A 1 8   ? -2.465  -16.087 -0.830  1.00 0.00 ? 8   LYS A HD2  4  
ATOM 5902  H HD3  . LYS A 1 8   ? -1.271  -16.651 -2.002  1.00 0.00 ? 8   LYS A HD3  4  
ATOM 5903  H HE2  . LYS A 1 8   ? 0.371   -16.366 0.033   1.00 0.00 ? 8   LYS A HE2  4  
ATOM 5904  H HE3  . LYS A 1 8   ? -1.112  -16.525 0.973   1.00 0.00 ? 8   LYS A HE3  4  
ATOM 5905  H HZ1  . LYS A 1 8   ? -1.490  -18.659 0.144   1.00 0.00 ? 8   LYS A HZ1  4  
ATOM 5906  H HZ2  . LYS A 1 8   ? 0.171   -18.635 0.464   1.00 0.00 ? 8   LYS A HZ2  4  
ATOM 5907  H HZ3  . LYS A 1 8   ? -0.386  -18.478 -1.125  1.00 0.00 ? 8   LYS A HZ3  4  
ATOM 5908  N N    . LEU A 1 9   ? -2.818  -10.941 -1.415  1.00 0.00 ? 9   LEU A N    4  
ATOM 5909  C CA   . LEU A 1 9   ? -2.481  -9.609  -0.927  1.00 0.00 ? 9   LEU A CA   4  
ATOM 5910  C C    . LEU A 1 9   ? -3.072  -9.370  0.459   1.00 0.00 ? 9   LEU A C    4  
ATOM 5911  O O    . LEU A 1 9   ? -2.398  -8.858  1.353   1.00 0.00 ? 9   LEU A O    4  
ATOM 5912  C CB   . LEU A 1 9   ? -2.988  -8.544  -1.901  1.00 0.00 ? 9   LEU A CB   4  
ATOM 5913  C CG   . LEU A 1 9   ? -2.966  -7.102  -1.390  1.00 0.00 ? 9   LEU A CG   4  
ATOM 5914  C CD1  . LEU A 1 9   ? -1.625  -6.451  -1.691  1.00 0.00 ? 9   LEU A CD1  4  
ATOM 5915  C CD2  . LEU A 1 9   ? -4.101  -6.300  -2.009  1.00 0.00 ? 9   LEU A CD2  4  
ATOM 5916  H H    . LEU A 1 9   ? -3.094  -11.051 -2.349  1.00 0.00 ? 9   LEU A H    4  
ATOM 5917  H HA   . LEU A 1 9   ? -1.405  -9.542  -0.862  1.00 0.00 ? 9   LEU A HA   4  
ATOM 5918  H HB2  . LEU A 1 9   ? -2.377  -8.589  -2.789  1.00 0.00 ? 9   LEU A HB2  4  
ATOM 5919  H HB3  . LEU A 1 9   ? -4.009  -8.789  -2.155  1.00 0.00 ? 9   LEU A HB3  4  
ATOM 5920  H HG   . LEU A 1 9   ? -3.102  -7.105  -0.318  1.00 0.00 ? 9   LEU A HG   4  
ATOM 5921  H HD11 . LEU A 1 9   ? -1.749  -5.714  -2.470  1.00 0.00 ? 9   LEU A HD11 4  
ATOM 5922  H HD12 . LEU A 1 9   ? -0.923  -7.205  -2.016  1.00 0.00 ? 9   LEU A HD12 4  
ATOM 5923  H HD13 . LEU A 1 9   ? -1.249  -5.972  -0.798  1.00 0.00 ? 9   LEU A HD13 4  
ATOM 5924  H HD21 . LEU A 1 9   ? -3.811  -5.262  -2.079  1.00 0.00 ? 9   LEU A HD21 4  
ATOM 5925  H HD22 . LEU A 1 9   ? -4.982  -6.386  -1.389  1.00 0.00 ? 9   LEU A HD22 4  
ATOM 5926  H HD23 . LEU A 1 9   ? -4.316  -6.682  -2.996  1.00 0.00 ? 9   LEU A HD23 4  
ATOM 5927  N N    . ARG A 1 10  ? -4.335  -9.747  0.630   1.00 0.00 ? 10  ARG A N    4  
ATOM 5928  C CA   . ARG A 1 10  ? -5.017  -9.575  1.907   1.00 0.00 ? 10  ARG A CA   4  
ATOM 5929  C C    . ARG A 1 10  ? -4.112  -9.982  3.066   1.00 0.00 ? 10  ARG A C    4  
ATOM 5930  O O    . ARG A 1 10  ? -3.737  -9.152  3.894   1.00 0.00 ? 10  ARG A O    4  
ATOM 5931  C CB   . ARG A 1 10  ? -6.304  -10.401 1.938   1.00 0.00 ? 10  ARG A CB   4  
ATOM 5932  C CG   . ARG A 1 10  ? -7.173  -10.130 3.155   1.00 0.00 ? 10  ARG A CG   4  
ATOM 5933  C CD   . ARG A 1 10  ? -8.037  -11.332 3.501   1.00 0.00 ? 10  ARG A CD   4  
ATOM 5934  N NE   . ARG A 1 10  ? -8.392  -11.362 4.918   1.00 0.00 ? 10  ARG A NE   4  
ATOM 5935  C CZ   . ARG A 1 10  ? -9.469  -11.977 5.393   1.00 0.00 ? 10  ARG A CZ   4  
ATOM 5936  N NH1  . ARG A 1 10  ? -10.291 -12.612 4.569   1.00 0.00 ? 10  ARG A NH1  4  
ATOM 5937  N NH2  . ARG A 1 10  ? -9.724  -11.960 6.695   1.00 0.00 ? 10  ARG A NH2  4  
ATOM 5938  H H    . ARG A 1 10  ? -4.820  -10.149 -0.120  1.00 0.00 ? 10  ARG A H    4  
ATOM 5939  H HA   . ARG A 1 10  ? -5.268  -8.530  2.012   1.00 0.00 ? 10  ARG A HA   4  
ATOM 5940  H HB2  . ARG A 1 10  ? -6.883  -10.177 1.053   1.00 0.00 ? 10  ARG A HB2  4  
ATOM 5941  H HB3  . ARG A 1 10  ? -6.046  -11.449 1.933   1.00 0.00 ? 10  ARG A HB3  4  
ATOM 5942  H HG2  . ARG A 1 10  ? -6.536  -9.904  3.997   1.00 0.00 ? 10  ARG A HG2  4  
ATOM 5943  H HG3  . ARG A 1 10  ? -7.813  -9.285  2.948   1.00 0.00 ? 10  ARG A HG3  4  
ATOM 5944  H HD2  . ARG A 1 10  ? -8.943  -11.289 2.914   1.00 0.00 ? 10  ARG A HD2  4  
ATOM 5945  H HD3  . ARG A 1 10  ? -7.493  -12.232 3.257   1.00 0.00 ? 10  ARG A HD3  4  
ATOM 5946  H HE   . ARG A 1 10  ? -7.798  -10.899 5.544   1.00 0.00 ? 10  ARG A HE   4  
ATOM 5947  H HH11 . ARG A 1 10  ? -10.101 -12.628 3.588   1.00 0.00 ? 10  ARG A HH11 4  
ATOM 5948  H HH12 . ARG A 1 10  ? -11.101 -13.076 4.930   1.00 0.00 ? 10  ARG A HH12 4  
ATOM 5949  H HH21 . ARG A 1 10  ? -9.106  -11.483 7.319   1.00 0.00 ? 10  ARG A HH21 4  
ATOM 5950  H HH22 . ARG A 1 10  ? -10.534 -12.423 7.052   1.00 0.00 ? 10  ARG A HH22 4  
ATOM 5951  N N    . GLN A 1 11  ? -3.766  -11.264 3.118   1.00 0.00 ? 11  GLN A N    4  
ATOM 5952  C CA   . GLN A 1 11  ? -2.905  -11.781 4.176   1.00 0.00 ? 11  GLN A CA   4  
ATOM 5953  C C    . GLN A 1 11  ? -1.491  -11.224 4.048   1.00 0.00 ? 11  GLN A C    4  
ATOM 5954  O O    . GLN A 1 11  ? -0.949  -10.658 4.998   1.00 0.00 ? 11  GLN A O    4  
ATOM 5955  C CB   . GLN A 1 11  ? -2.870  -13.310 4.132   1.00 0.00 ? 11  GLN A CB   4  
ATOM 5956  C CG   . GLN A 1 11  ? -1.851  -13.922 5.080   1.00 0.00 ? 11  GLN A CG   4  
ATOM 5957  C CD   . GLN A 1 11  ? -2.195  -13.686 6.538   1.00 0.00 ? 11  GLN A CD   4  
ATOM 5958  O OE1  . GLN A 1 11  ? -2.888  -14.490 7.161   1.00 0.00 ? 11  GLN A OE1  4  
ATOM 5959  N NE2  . GLN A 1 11  ? -1.709  -12.580 7.089   1.00 0.00 ? 11  GLN A NE2  4  
ATOM 5960  H H    . GLN A 1 11  ? -4.097  -11.877 2.429   1.00 0.00 ? 11  GLN A H    4  
ATOM 5961  H HA   . GLN A 1 11  ? -3.319  -11.466 5.122   1.00 0.00 ? 11  GLN A HA   4  
ATOM 5962  H HB2  . GLN A 1 11  ? -3.847  -13.688 4.394   1.00 0.00 ? 11  GLN A HB2  4  
ATOM 5963  H HB3  . GLN A 1 11  ? -2.629  -13.624 3.127   1.00 0.00 ? 11  GLN A HB3  4  
ATOM 5964  H HG2  . GLN A 1 11  ? -1.809  -14.986 4.904   1.00 0.00 ? 11  GLN A HG2  4  
ATOM 5965  H HG3  . GLN A 1 11  ? -0.884  -13.486 4.878   1.00 0.00 ? 11  GLN A HG3  4  
ATOM 5966  H HE21 . GLN A 1 11  ? -1.165  -11.986 6.531   1.00 0.00 ? 11  GLN A HE21 4  
ATOM 5967  H HE22 . GLN A 1 11  ? -1.916  -12.403 8.030   1.00 0.00 ? 11  GLN A HE22 4  
ATOM 5968  N N    . TRP A 1 12  ? -0.900  -11.389 2.871   1.00 0.00 ? 12  TRP A N    4  
ATOM 5969  C CA   . TRP A 1 12  ? 0.452   -10.903 2.620   1.00 0.00 ? 12  TRP A CA   4  
ATOM 5970  C C    . TRP A 1 12  ? 0.686   -9.564  3.312   1.00 0.00 ? 12  TRP A C    4  
ATOM 5971  O O    . TRP A 1 12  ? 1.559   -9.444  4.173   1.00 0.00 ? 12  TRP A O    4  
ATOM 5972  C CB   . TRP A 1 12  ? 0.695   -10.762 1.116   1.00 0.00 ? 12  TRP A CB   4  
ATOM 5973  C CG   . TRP A 1 12  ? 2.064   -10.255 0.780   1.00 0.00 ? 12  TRP A CG   4  
ATOM 5974  C CD1  . TRP A 1 12  ? 3.199   -10.999 0.625   1.00 0.00 ? 12  TRP A CD1  4  
ATOM 5975  C CD2  . TRP A 1 12  ? 2.443   -8.892  0.561   1.00 0.00 ? 12  TRP A CD2  4  
ATOM 5976  N NE1  . TRP A 1 12  ? 4.260   -10.181 0.322   1.00 0.00 ? 12  TRP A NE1  4  
ATOM 5977  C CE2  . TRP A 1 12  ? 3.823   -8.883  0.276   1.00 0.00 ? 12  TRP A CE2  4  
ATOM 5978  C CE3  . TRP A 1 12  ? 1.751   -7.678  0.576   1.00 0.00 ? 12  TRP A CE3  4  
ATOM 5979  C CZ2  . TRP A 1 12  ? 4.520   -7.708  0.010   1.00 0.00 ? 12  TRP A CZ2  4  
ATOM 5980  C CZ3  . TRP A 1 12  ? 2.445   -6.512  0.312   1.00 0.00 ? 12  TRP A CZ3  4  
ATOM 5981  C CH2  . TRP A 1 12  ? 3.818   -6.534  0.031   1.00 0.00 ? 12  TRP A CH2  4  
ATOM 5982  H H    . TRP A 1 12  ? -1.384  -11.848 2.152   1.00 0.00 ? 12  TRP A H    4  
ATOM 5983  H HA   . TRP A 1 12  ? 1.144   -11.628 3.021   1.00 0.00 ? 12  TRP A HA   4  
ATOM 5984  H HB2  . TRP A 1 12  ? 0.572   -11.727 0.647   1.00 0.00 ? 12  TRP A HB2  4  
ATOM 5985  H HB3  . TRP A 1 12  ? -0.028  -10.072 0.705   1.00 0.00 ? 12  TRP A HB3  4  
ATOM 5986  H HD1  . TRP A 1 12  ? 3.241   -12.072 0.729   1.00 0.00 ? 12  TRP A HD1  4  
ATOM 5987  H HE1  . TRP A 1 12  ? 5.181   -10.478 0.163   1.00 0.00 ? 12  TRP A HE1  4  
ATOM 5988  H HE3  . TRP A 1 12  ? 0.693   -7.641  0.790   1.00 0.00 ? 12  TRP A HE3  4  
ATOM 5989  H HZ2  . TRP A 1 12  ? 5.578   -7.709  -0.209  1.00 0.00 ? 12  TRP A HZ2  4  
ATOM 5990  H HZ3  . TRP A 1 12  ? 1.927   -5.564  0.319   1.00 0.00 ? 12  TRP A HZ3  4  
ATOM 5991  H HH2  . TRP A 1 12  ? 4.319   -5.600  -0.169  1.00 0.00 ? 12  TRP A HH2  4  
ATOM 5992  N N    . LEU A 1 13  ? -0.098  -8.561  2.932   1.00 0.00 ? 13  LEU A N    4  
ATOM 5993  C CA   . LEU A 1 13  ? 0.025   -7.231  3.517   1.00 0.00 ? 13  LEU A CA   4  
ATOM 5994  C C    . LEU A 1 13  ? -0.045  -7.297  5.039   1.00 0.00 ? 13  LEU A C    4  
ATOM 5995  O O    . LEU A 1 13  ? 0.885   -6.881  5.731   1.00 0.00 ? 13  LEU A O    4  
ATOM 5996  C CB   . LEU A 1 13  ? -1.078  -6.314  2.984   1.00 0.00 ? 13  LEU A CB   4  
ATOM 5997  C CG   . LEU A 1 13  ? -0.930  -4.827  3.308   1.00 0.00 ? 13  LEU A CG   4  
ATOM 5998  C CD1  . LEU A 1 13  ? 0.323   -4.262  2.657   1.00 0.00 ? 13  LEU A CD1  4  
ATOM 5999  C CD2  . LEU A 1 13  ? -2.162  -4.058  2.855   1.00 0.00 ? 13  LEU A CD2  4  
ATOM 6000  H H    . LEU A 1 13  ? -0.775  -8.718  2.242   1.00 0.00 ? 13  LEU A H    4  
ATOM 6001  H HA   . LEU A 1 13  ? 0.985   -6.829  3.229   1.00 0.00 ? 13  LEU A HA   4  
ATOM 6002  H HB2  . LEU A 1 13  ? -1.104  -6.418  1.910   1.00 0.00 ? 13  LEU A HB2  4  
ATOM 6003  H HB3  . LEU A 1 13  ? -2.017  -6.652  3.399   1.00 0.00 ? 13  LEU A HB3  4  
ATOM 6004  H HG   . LEU A 1 13  ? -0.833  -4.706  4.378   1.00 0.00 ? 13  LEU A HG   4  
ATOM 6005  H HD11 . LEU A 1 13  ? 0.471   -3.244  2.985   1.00 0.00 ? 13  LEU A HD11 4  
ATOM 6006  H HD12 . LEU A 1 13  ? 0.211   -4.281  1.583   1.00 0.00 ? 13  LEU A HD12 4  
ATOM 6007  H HD13 . LEU A 1 13  ? 1.177   -4.860  2.940   1.00 0.00 ? 13  LEU A HD13 4  
ATOM 6008  H HD21 . LEU A 1 13  ? -2.907  -4.079  3.637   1.00 0.00 ? 13  LEU A HD21 4  
ATOM 6009  H HD22 . LEU A 1 13  ? -2.564  -4.515  1.963   1.00 0.00 ? 13  LEU A HD22 4  
ATOM 6010  H HD23 . LEU A 1 13  ? -1.890  -3.034  2.645   1.00 0.00 ? 13  LEU A HD23 4  
ATOM 6011  N N    . ILE A 1 14  ? -1.151  -7.823  5.554   1.00 0.00 ? 14  ILE A N    4  
ATOM 6012  C CA   . ILE A 1 14  ? -1.339  -7.947  6.994   1.00 0.00 ? 14  ILE A CA   4  
ATOM 6013  C C    . ILE A 1 14  ? -0.066  -8.437  7.675   1.00 0.00 ? 14  ILE A C    4  
ATOM 6014  O O    . ILE A 1 14  ? 0.301   -7.956  8.747   1.00 0.00 ? 14  ILE A O    4  
ATOM 6015  C CB   . ILE A 1 14  ? -2.492  -8.912  7.330   1.00 0.00 ? 14  ILE A CB   4  
ATOM 6016  C CG1  . ILE A 1 14  ? -3.811  -8.382  6.764   1.00 0.00 ? 14  ILE A CG1  4  
ATOM 6017  C CG2  . ILE A 1 14  ? -2.596  -9.108  8.835   1.00 0.00 ? 14  ILE A CG2  4  
ATOM 6018  C CD1  . ILE A 1 14  ? -4.900  -9.429  6.688   1.00 0.00 ? 14  ILE A CD1  4  
ATOM 6019  H H    . ILE A 1 14  ? -1.856  -8.137  4.950   1.00 0.00 ? 14  ILE A H    4  
ATOM 6020  H HA   . ILE A 1 14  ? -1.590  -6.970  7.382   1.00 0.00 ? 14  ILE A HA   4  
ATOM 6021  H HB   . ILE A 1 14  ? -2.274  -9.868  6.880   1.00 0.00 ? 14  ILE A HB   4  
ATOM 6022  H HG12 . ILE A 1 14  ? -4.167  -7.579  7.389   1.00 0.00 ? 14  ILE A HG12 4  
ATOM 6023  H HG13 . ILE A 1 14  ? -3.640  -8.006  5.765   1.00 0.00 ? 14  ILE A HG13 4  
ATOM 6024  H HG21 . ILE A 1 14  ? -3.453  -8.569  9.210   1.00 0.00 ? 14  ILE A HG21 4  
ATOM 6025  H HG22 . ILE A 1 14  ? -2.710  -10.160 9.053   1.00 0.00 ? 14  ILE A HG22 4  
ATOM 6026  H HG23 . ILE A 1 14  ? -1.701  -8.736  9.310   1.00 0.00 ? 14  ILE A HG23 4  
ATOM 6027  H HD11 . ILE A 1 14  ? -5.838  -8.956  6.439   1.00 0.00 ? 14  ILE A HD11 4  
ATOM 6028  H HD12 . ILE A 1 14  ? -4.649  -10.156 5.930   1.00 0.00 ? 14  ILE A HD12 4  
ATOM 6029  H HD13 . ILE A 1 14  ? -4.990  -9.924  7.644   1.00 0.00 ? 14  ILE A HD13 4  
ATOM 6030  N N    . ASP A 1 15  ? 0.605   -9.394  7.044   1.00 0.00 ? 15  ASP A N    4  
ATOM 6031  C CA   . ASP A 1 15  ? 1.840   -9.948  7.587   1.00 0.00 ? 15  ASP A CA   4  
ATOM 6032  C C    . ASP A 1 15  ? 2.940   -8.892  7.620   1.00 0.00 ? 15  ASP A C    4  
ATOM 6033  O O    . ASP A 1 15  ? 3.728   -8.833  8.563   1.00 0.00 ? 15  ASP A O    4  
ATOM 6034  C CB   . ASP A 1 15  ? 2.293   -11.150 6.758   1.00 0.00 ? 15  ASP A CB   4  
ATOM 6035  C CG   . ASP A 1 15  ? 3.221   -12.069 7.529   1.00 0.00 ? 15  ASP A CG   4  
ATOM 6036  O OD1  . ASP A 1 15  ? 4.402   -11.705 7.709   1.00 0.00 ? 15  ASP A OD1  4  
ATOM 6037  O OD2  . ASP A 1 15  ? 2.765   -13.151 7.952   1.00 0.00 ? 15  ASP A OD2  4  
ATOM 6038  H H    . ASP A 1 15  ? 0.262   -9.736  6.192   1.00 0.00 ? 15  ASP A H    4  
ATOM 6039  H HA   . ASP A 1 15  ? 1.641   -10.274 8.597   1.00 0.00 ? 15  ASP A HA   4  
ATOM 6040  H HB2  . ASP A 1 15  ? 1.426   -11.718 6.454   1.00 0.00 ? 15  ASP A HB2  4  
ATOM 6041  H HB3  . ASP A 1 15  ? 2.813   -10.797 5.879   1.00 0.00 ? 15  ASP A HB3  4  
ATOM 6042  N N    . GLN A 1 16  ? 2.988   -8.062  6.583   1.00 0.00 ? 16  GLN A N    4  
ATOM 6043  C CA   . GLN A 1 16  ? 3.994   -7.010  6.493   1.00 0.00 ? 16  GLN A CA   4  
ATOM 6044  C C    . GLN A 1 16  ? 3.753   -5.935  7.547   1.00 0.00 ? 16  GLN A C    4  
ATOM 6045  O O    . GLN A 1 16  ? 4.694   -5.436  8.165   1.00 0.00 ? 16  GLN A O    4  
ATOM 6046  C CB   . GLN A 1 16  ? 3.983   -6.383  5.097   1.00 0.00 ? 16  GLN A CB   4  
ATOM 6047  C CG   . GLN A 1 16  ? 4.121   -7.398  3.974   1.00 0.00 ? 16  GLN A CG   4  
ATOM 6048  C CD   . GLN A 1 16  ? 5.096   -8.510  4.308   1.00 0.00 ? 16  GLN A CD   4  
ATOM 6049  O OE1  . GLN A 1 16  ? 6.277   -8.263  4.553   1.00 0.00 ? 16  GLN A OE1  4  
ATOM 6050  N NE2  . GLN A 1 16  ? 4.605   -9.744  4.321   1.00 0.00 ? 16  GLN A NE2  4  
ATOM 6051  H H    . GLN A 1 16  ? 2.332   -8.160  5.862   1.00 0.00 ? 16  GLN A H    4  
ATOM 6052  H HA   . GLN A 1 16  ? 4.959   -7.459  6.668   1.00 0.00 ? 16  GLN A HA   4  
ATOM 6053  H HB2  . GLN A 1 16  ? 3.053   -5.852  4.961   1.00 0.00 ? 16  GLN A HB2  4  
ATOM 6054  H HB3  . GLN A 1 16  ? 4.802   -5.684  5.024   1.00 0.00 ? 16  GLN A HB3  4  
ATOM 6055  H HG2  . GLN A 1 16  ? 3.153   -7.836  3.780   1.00 0.00 ? 16  GLN A HG2  4  
ATOM 6056  H HG3  . GLN A 1 16  ? 4.468   -6.889  3.087   1.00 0.00 ? 16  GLN A HG3  4  
ATOM 6057  H HE21 . GLN A 1 16  ? 3.654   -9.865  4.115   1.00 0.00 ? 16  GLN A HE21 4  
ATOM 6058  H HE22 . GLN A 1 16  ? 5.213   -10.482 4.533   1.00 0.00 ? 16  GLN A HE22 4  
ATOM 6059  N N    . ILE A 1 17  ? 2.487   -5.583  7.748   1.00 0.00 ? 17  ILE A N    4  
ATOM 6060  C CA   . ILE A 1 17  ? 2.124   -4.568  8.729   1.00 0.00 ? 17  ILE A CA   4  
ATOM 6061  C C    . ILE A 1 17  ? 2.436   -5.036  10.146  1.00 0.00 ? 17  ILE A C    4  
ATOM 6062  O O    . ILE A 1 17  ? 3.080   -4.324  10.918  1.00 0.00 ? 17  ILE A O    4  
ATOM 6063  C CB   . ILE A 1 17  ? 0.630   -4.206  8.637   1.00 0.00 ? 17  ILE A CB   4  
ATOM 6064  C CG1  . ILE A 1 17  ? 0.251   -3.874  7.193   1.00 0.00 ? 17  ILE A CG1  4  
ATOM 6065  C CG2  . ILE A 1 17  ? 0.310   -3.037  9.556   1.00 0.00 ? 17  ILE A CG2  4  
ATOM 6066  C CD1  . ILE A 1 17  ? -1.200  -4.156  6.868   1.00 0.00 ? 17  ILE A CD1  4  
ATOM 6067  H H    . ILE A 1 17  ? 1.782   -6.017  7.225   1.00 0.00 ? 17  ILE A H    4  
ATOM 6068  H HA   . ILE A 1 17  ? 2.702   -3.680  8.519   1.00 0.00 ? 17  ILE A HA   4  
ATOM 6069  H HB   . ILE A 1 17  ? 0.055   -5.058  8.966   1.00 0.00 ? 17  ILE A HB   4  
ATOM 6070  H HG12 . ILE A 1 17  ? 0.433   -2.827  7.010   1.00 0.00 ? 17  ILE A HG12 4  
ATOM 6071  H HG13 . ILE A 1 17  ? 0.861   -4.463  6.524   1.00 0.00 ? 17  ILE A HG13 4  
ATOM 6072  H HG21 . ILE A 1 17  ? 0.833   -2.156  9.213   1.00 0.00 ? 17  ILE A HG21 4  
ATOM 6073  H HG22 . ILE A 1 17  ? -0.753  -2.850  9.545   1.00 0.00 ? 17  ILE A HG22 4  
ATOM 6074  H HG23 . ILE A 1 17  ? 0.624   -3.273  10.562  1.00 0.00 ? 17  ILE A HG23 4  
ATOM 6075  H HD11 . ILE A 1 17  ? -1.301  -5.174  6.523   1.00 0.00 ? 17  ILE A HD11 4  
ATOM 6076  H HD12 . ILE A 1 17  ? -1.801  -4.012  7.753   1.00 0.00 ? 17  ILE A HD12 4  
ATOM 6077  H HD13 . ILE A 1 17  ? -1.533  -3.479  6.094   1.00 0.00 ? 17  ILE A HD13 4  
ATOM 6078  N N    . ASP A 1 18  ? 1.978   -6.237  10.481  1.00 0.00 ? 18  ASP A N    4  
ATOM 6079  C CA   . ASP A 1 18  ? 2.210   -6.802  11.805  1.00 0.00 ? 18  ASP A CA   4  
ATOM 6080  C C    . ASP A 1 18  ? 3.691   -6.746  12.168  1.00 0.00 ? 18  ASP A C    4  
ATOM 6081  O O    . ASP A 1 18  ? 4.054   -6.361  13.279  1.00 0.00 ? 18  ASP A O    4  
ATOM 6082  C CB   . ASP A 1 18  ? 1.714   -8.247  11.860  1.00 0.00 ? 18  ASP A CB   4  
ATOM 6083  C CG   . ASP A 1 18  ? 1.416   -8.704  13.275  1.00 0.00 ? 18  ASP A CG   4  
ATOM 6084  O OD1  . ASP A 1 18  ? 2.074   -8.202  14.211  1.00 0.00 ? 18  ASP A OD1  4  
ATOM 6085  O OD2  . ASP A 1 18  ? 0.526   -9.562  13.447  1.00 0.00 ? 18  ASP A OD2  4  
ATOM 6086  H H    . ASP A 1 18  ? 1.471   -6.756  9.822   1.00 0.00 ? 18  ASP A H    4  
ATOM 6087  H HA   . ASP A 1 18  ? 1.655   -6.213  12.520  1.00 0.00 ? 18  ASP A HA   4  
ATOM 6088  H HB2  . ASP A 1 18  ? 0.808   -8.333  11.277  1.00 0.00 ? 18  ASP A HB2  4  
ATOM 6089  H HB3  . ASP A 1 18  ? 2.469   -8.897  11.443  1.00 0.00 ? 18  ASP A HB3  4  
ATOM 6090  N N    . SER A 1 19  ? 4.542   -7.133  11.222  1.00 0.00 ? 19  SER A N    4  
ATOM 6091  C CA   . SER A 1 19  ? 5.983   -7.131  11.444  1.00 0.00 ? 19  SER A CA   4  
ATOM 6092  C C    . SER A 1 19  ? 6.492   -5.715  11.697  1.00 0.00 ? 19  SER A C    4  
ATOM 6093  O O    . SER A 1 19  ? 7.402   -5.505  12.499  1.00 0.00 ? 19  SER A O    4  
ATOM 6094  C CB   . SER A 1 19  ? 6.706   -7.737  10.239  1.00 0.00 ? 19  SER A CB   4  
ATOM 6095  O OG   . SER A 1 19  ? 6.357   -7.062  9.043   1.00 0.00 ? 19  SER A OG   4  
ATOM 6096  H H    . SER A 1 19  ? 4.191   -7.429  10.356  1.00 0.00 ? 19  SER A H    4  
ATOM 6097  H HA   . SER A 1 19  ? 6.185   -7.735  12.315  1.00 0.00 ? 19  SER A HA   4  
ATOM 6098  H HB2  . SER A 1 19  ? 7.772   -7.658  10.385  1.00 0.00 ? 19  SER A HB2  4  
ATOM 6099  H HB3  . SER A 1 19  ? 6.432   -8.778  10.144  1.00 0.00 ? 19  SER A HB3  4  
ATOM 6100  H HG   . SER A 1 19  ? 5.434   -6.802  9.079   1.00 0.00 ? 19  SER A HG   4  
ATOM 6101  N N    . GLY A 1 20  ? 5.897   -4.747  11.008  1.00 0.00 ? 20  GLY A N    4  
ATOM 6102  C CA   . GLY A 1 20  ? 6.303   -3.363  11.171  1.00 0.00 ? 20  GLY A CA   4  
ATOM 6103  C C    . GLY A 1 20  ? 7.719   -3.113  10.692  1.00 0.00 ? 20  GLY A C    4  
ATOM 6104  O O    . GLY A 1 20  ? 8.381   -2.180  11.147  1.00 0.00 ? 20  GLY A O    4  
ATOM 6105  H H    . GLY A 1 20  ? 5.177   -4.973  10.383  1.00 0.00 ? 20  GLY A H    4  
ATOM 6106  H HA2  . GLY A 1 20  ? 5.628   -2.733  10.612  1.00 0.00 ? 20  GLY A HA2  4  
ATOM 6107  H HA3  . GLY A 1 20  ? 6.238   -3.102  12.218  1.00 0.00 ? 20  GLY A HA3  4  
ATOM 6108  N N    . LYS A 1 21  ? 8.186   -3.950  9.772   1.00 0.00 ? 21  LYS A N    4  
ATOM 6109  C CA   . LYS A 1 21  ? 9.533   -3.817  9.230   1.00 0.00 ? 21  LYS A CA   4  
ATOM 6110  C C    . LYS A 1 21  ? 9.640   -2.587  8.333   1.00 0.00 ? 21  LYS A C    4  
ATOM 6111  O O    . LYS A 1 21  ? 10.647  -1.880  8.351   1.00 0.00 ? 21  LYS A O    4  
ATOM 6112  C CB   . LYS A 1 21  ? 9.914   -5.071  8.441   1.00 0.00 ? 21  LYS A CB   4  
ATOM 6113  C CG   . LYS A 1 21  ? 9.542   -6.367  9.142   1.00 0.00 ? 21  LYS A CG   4  
ATOM 6114  C CD   . LYS A 1 21  ? 10.510  -7.486  8.795   1.00 0.00 ? 21  LYS A CD   4  
ATOM 6115  C CE   . LYS A 1 21  ? 10.059  -8.249  7.559   1.00 0.00 ? 21  LYS A CE   4  
ATOM 6116  N NZ   . LYS A 1 21  ? 9.124   -9.356  7.901   1.00 0.00 ? 21  LYS A NZ   4  
ATOM 6117  H H    . LYS A 1 21  ? 7.610   -4.674  9.448   1.00 0.00 ? 21  LYS A H    4  
ATOM 6118  H HA   . LYS A 1 21  ? 10.215  -3.702  10.059  1.00 0.00 ? 21  LYS A HA   4  
ATOM 6119  H HB2  . LYS A 1 21  ? 9.413   -5.047  7.485   1.00 0.00 ? 21  LYS A HB2  4  
ATOM 6120  H HB3  . LYS A 1 21  ? 10.982  -5.069  8.278   1.00 0.00 ? 21  LYS A HB3  4  
ATOM 6121  H HG2  . LYS A 1 21  ? 9.562   -6.206  10.209  1.00 0.00 ? 21  LYS A HG2  4  
ATOM 6122  H HG3  . LYS A 1 21  ? 8.547   -6.657  8.837   1.00 0.00 ? 21  LYS A HG3  4  
ATOM 6123  H HD2  . LYS A 1 21  ? 11.485  -7.062  8.607   1.00 0.00 ? 21  LYS A HD2  4  
ATOM 6124  H HD3  . LYS A 1 21  ? 10.568  -8.171  9.629   1.00 0.00 ? 21  LYS A HD3  4  
ATOM 6125  H HE2  . LYS A 1 21  ? 9.562   -7.564  6.890   1.00 0.00 ? 21  LYS A HE2  4  
ATOM 6126  H HE3  . LYS A 1 21  ? 10.929  -8.662  7.070   1.00 0.00 ? 21  LYS A HE3  4  
ATOM 6127  H HZ1  . LYS A 1 21  ? 8.253   -8.971  8.321   1.00 0.00 ? 21  LYS A HZ1  4  
ATOM 6128  H HZ2  . LYS A 1 21  ? 9.569   -10.001 8.585   1.00 0.00 ? 21  LYS A HZ2  4  
ATOM 6129  H HZ3  . LYS A 1 21  ? 8.876   -9.893  7.045   1.00 0.00 ? 21  LYS A HZ3  4  
ATOM 6130  N N    . TYR A 1 22  ? 8.595   -2.339  7.551   1.00 0.00 ? 22  TYR A N    4  
ATOM 6131  C CA   . TYR A 1 22  ? 8.572   -1.195  6.646   1.00 0.00 ? 22  TYR A CA   4  
ATOM 6132  C C    . TYR A 1 22  ? 8.068   0.055   7.361   1.00 0.00 ? 22  TYR A C    4  
ATOM 6133  O O    . TYR A 1 22  ? 7.117   0.014   8.142   1.00 0.00 ? 22  TYR A O    4  
ATOM 6134  C CB   . TYR A 1 22  ? 7.688   -1.495  5.434   1.00 0.00 ? 22  TYR A CB   4  
ATOM 6135  C CG   . TYR A 1 22  ? 7.852   -2.899  4.898   1.00 0.00 ? 22  TYR A CG   4  
ATOM 6136  C CD1  . TYR A 1 22  ? 7.142   -3.960  5.444   1.00 0.00 ? 22  TYR A CD1  4  
ATOM 6137  C CD2  . TYR A 1 22  ? 8.717   -3.164  3.843   1.00 0.00 ? 22  TYR A CD2  4  
ATOM 6138  C CE1  . TYR A 1 22  ? 7.289   -5.245  4.958   1.00 0.00 ? 22  TYR A CE1  4  
ATOM 6139  C CE2  . TYR A 1 22  ? 8.870   -4.445  3.349   1.00 0.00 ? 22  TYR A CE2  4  
ATOM 6140  C CZ   . TYR A 1 22  ? 8.154   -5.482  3.909   1.00 0.00 ? 22  TYR A CZ   4  
ATOM 6141  O OH   . TYR A 1 22  ? 8.302   -6.760  3.421   1.00 0.00 ? 22  TYR A OH   4  
ATOM 6142  H H    . TYR A 1 22  ? 7.821   -2.939  7.581   1.00 0.00 ? 22  TYR A H    4  
ATOM 6143  H HA   . TYR A 1 22  ? 9.583   -1.020  6.308   1.00 0.00 ? 22  TYR A HA   4  
ATOM 6144  H HB2  . TYR A 1 22  ? 6.654   -1.365  5.711   1.00 0.00 ? 22  TYR A HB2  4  
ATOM 6145  H HB3  . TYR A 1 22  ? 7.933   -0.805  4.640   1.00 0.00 ? 22  TYR A HB3  4  
ATOM 6146  H HD1  . TYR A 1 22  ? 6.465   -3.771  6.265   1.00 0.00 ? 22  TYR A HD1  4  
ATOM 6147  H HD2  . TYR A 1 22  ? 9.277   -2.349  3.406   1.00 0.00 ? 22  TYR A HD2  4  
ATOM 6148  H HE1  . TYR A 1 22  ? 6.728   -6.057  5.396   1.00 0.00 ? 22  TYR A HE1  4  
ATOM 6149  H HE2  . TYR A 1 22  ? 9.547   -4.631  2.528   1.00 0.00 ? 22  TYR A HE2  4  
ATOM 6150  H HH   . TYR A 1 22  ? 8.301   -6.737  2.461   1.00 0.00 ? 22  TYR A HH   4  
ATOM 6151  N N    . PRO A 1 23  ? 8.720   1.194   7.088   1.00 0.00 ? 23  PRO A N    4  
ATOM 6152  C CA   . PRO A 1 23  ? 8.356   2.479   7.693   1.00 0.00 ? 23  PRO A CA   4  
ATOM 6153  C C    . PRO A 1 23  ? 7.021   3.005   7.178   1.00 0.00 ? 23  PRO A C    4  
ATOM 6154  O O    . PRO A 1 23  ? 6.662   2.789   6.021   1.00 0.00 ? 23  PRO A O    4  
ATOM 6155  C CB   . PRO A 1 23  ? 9.496   3.408   7.267   1.00 0.00 ? 23  PRO A CB   4  
ATOM 6156  C CG   . PRO A 1 23  ? 10.028  2.804   6.013   1.00 0.00 ? 23  PRO A CG   4  
ATOM 6157  C CD   . PRO A 1 23  ? 9.863   1.317   6.167   1.00 0.00 ? 23  PRO A CD   4  
ATOM 6158  H HA   . PRO A 1 23  ? 8.325   2.416   8.771   1.00 0.00 ? 23  PRO A HA   4  
ATOM 6159  H HB2  . PRO A 1 23  ? 9.109   4.402   7.094   1.00 0.00 ? 23  PRO A HB2  4  
ATOM 6160  H HB3  . PRO A 1 23  ? 10.249  3.438   8.041   1.00 0.00 ? 23  PRO A HB3  4  
ATOM 6161  H HG2  . PRO A 1 23  ? 9.462   3.158   5.166   1.00 0.00 ? 23  PRO A HG2  4  
ATOM 6162  H HG3  . PRO A 1 23  ? 11.073  3.054   5.900   1.00 0.00 ? 23  PRO A HG3  4  
ATOM 6163  H HD2  . PRO A 1 23  ? 9.640   0.861   5.214   1.00 0.00 ? 23  PRO A HD2  4  
ATOM 6164  H HD3  . PRO A 1 23  ? 10.752  0.881   6.597   1.00 0.00 ? 23  PRO A HD3  4  
ATOM 6165  N N    . GLY A 1 24  ? 6.288   3.697   8.045   1.00 0.00 ? 24  GLY A N    4  
ATOM 6166  C CA   . GLY A 1 24  ? 5.000   4.243   7.658   1.00 0.00 ? 24  GLY A CA   4  
ATOM 6167  C C    . GLY A 1 24  ? 3.875   3.239   7.812   1.00 0.00 ? 24  GLY A C    4  
ATOM 6168  O O    . GLY A 1 24  ? 2.763   3.596   8.204   1.00 0.00 ? 24  GLY A O    4  
ATOM 6169  H H    . GLY A 1 24  ? 6.624   3.838   8.954   1.00 0.00 ? 24  GLY A H    4  
ATOM 6170  H HA2  . GLY A 1 24  ? 4.787   5.104   8.273   1.00 0.00 ? 24  GLY A HA2  4  
ATOM 6171  H HA3  . GLY A 1 24  ? 5.050   4.555   6.625   1.00 0.00 ? 24  GLY A HA3  4  
ATOM 6172  N N    . LEU A 1 25  ? 4.162   1.979   7.501   1.00 0.00 ? 25  LEU A N    4  
ATOM 6173  C CA   . LEU A 1 25  ? 3.164   0.920   7.606   1.00 0.00 ? 25  LEU A CA   4  
ATOM 6174  C C    . LEU A 1 25  ? 2.949   0.516   9.061   1.00 0.00 ? 25  LEU A C    4  
ATOM 6175  O O    . LEU A 1 25  ? 3.802   -0.132  9.669   1.00 0.00 ? 25  LEU A O    4  
ATOM 6176  C CB   . LEU A 1 25  ? 3.596   -0.297  6.785   1.00 0.00 ? 25  LEU A CB   4  
ATOM 6177  C CG   . LEU A 1 25  ? 2.498   -1.307  6.453   1.00 0.00 ? 25  LEU A CG   4  
ATOM 6178  C CD1  . LEU A 1 25  ? 1.477   -0.694  5.507   1.00 0.00 ? 25  LEU A CD1  4  
ATOM 6179  C CD2  . LEU A 1 25  ? 3.098   -2.568  5.849   1.00 0.00 ? 25  LEU A CD2  4  
ATOM 6180  H H    . LEU A 1 25  ? 5.065   1.756   7.195   1.00 0.00 ? 25  LEU A H    4  
ATOM 6181  H HA   . LEU A 1 25  ? 2.235   1.300   7.209   1.00 0.00 ? 25  LEU A HA   4  
ATOM 6182  H HB2  . LEU A 1 25  ? 4.008   0.062   5.854   1.00 0.00 ? 25  LEU A HB2  4  
ATOM 6183  H HB3  . LEU A 1 25  ? 4.366   -0.814  7.342   1.00 0.00 ? 25  LEU A HB3  4  
ATOM 6184  H HG   . LEU A 1 25  ? 1.984   -1.583  7.364   1.00 0.00 ? 25  LEU A HG   4  
ATOM 6185  H HD11 . LEU A 1 25  ? 1.685   -1.012  4.497   1.00 0.00 ? 25  LEU A HD11 4  
ATOM 6186  H HD12 . LEU A 1 25  ? 1.534   0.383   5.565   1.00 0.00 ? 25  LEU A HD12 4  
ATOM 6187  H HD13 . LEU A 1 25  ? 0.485   -1.017  5.790   1.00 0.00 ? 25  LEU A HD13 4  
ATOM 6188  H HD21 . LEU A 1 25  ? 4.097   -2.358  5.497   1.00 0.00 ? 25  LEU A HD21 4  
ATOM 6189  H HD22 . LEU A 1 25  ? 2.486   -2.896  5.020   1.00 0.00 ? 25  LEU A HD22 4  
ATOM 6190  H HD23 . LEU A 1 25  ? 3.135   -3.344  6.598   1.00 0.00 ? 25  LEU A HD23 4  
ATOM 6191  N N    . VAL A 1 26  ? 1.803   0.901   9.613   1.00 0.00 ? 26  VAL A N    4  
ATOM 6192  C CA   . VAL A 1 26  ? 1.474   0.576   10.996  1.00 0.00 ? 26  VAL A CA   4  
ATOM 6193  C C    . VAL A 1 26  ? -0.035  0.527   11.205  1.00 0.00 ? 26  VAL A C    4  
ATOM 6194  O O    . VAL A 1 26  ? -0.791  1.204   10.506  1.00 0.00 ? 26  VAL A O    4  
ATOM 6195  C CB   . VAL A 1 26  ? 2.084   1.598   11.973  1.00 0.00 ? 26  VAL A CB   4  
ATOM 6196  C CG1  . VAL A 1 26  ? 3.599   1.631   11.836  1.00 0.00 ? 26  VAL A CG1  4  
ATOM 6197  C CG2  . VAL A 1 26  ? 1.489   2.979   11.739  1.00 0.00 ? 26  VAL A CG2  4  
ATOM 6198  H H    . VAL A 1 26  ? 1.163   1.415   9.078   1.00 0.00 ? 26  VAL A H    4  
ATOM 6199  H HA   . VAL A 1 26  ? 1.890   -0.396  11.219  1.00 0.00 ? 26  VAL A HA   4  
ATOM 6200  H HB   . VAL A 1 26  ? 1.843   1.291   12.980  1.00 0.00 ? 26  VAL A HB   4  
ATOM 6201  H HG11 . VAL A 1 26  ? 3.867   2.170   10.939  1.00 0.00 ? 26  VAL A HG11 4  
ATOM 6202  H HG12 . VAL A 1 26  ? 4.028   2.123   12.696  1.00 0.00 ? 26  VAL A HG12 4  
ATOM 6203  H HG13 . VAL A 1 26  ? 3.976   0.620   11.773  1.00 0.00 ? 26  VAL A HG13 4  
ATOM 6204  H HG21 . VAL A 1 26  ? 1.179   3.401   12.683  1.00 0.00 ? 26  VAL A HG21 4  
ATOM 6205  H HG22 . VAL A 1 26  ? 2.232   3.619   11.285  1.00 0.00 ? 26  VAL A HG22 4  
ATOM 6206  H HG23 . VAL A 1 26  ? 0.636   2.897   11.083  1.00 0.00 ? 26  VAL A HG23 4  
ATOM 6207  N N    . TRP A 1 27  ? -0.468  -0.275  12.170  1.00 0.00 ? 27  TRP A N    4  
ATOM 6208  C CA   . TRP A 1 27  ? -1.888  -0.412  12.472  1.00 0.00 ? 27  TRP A CA   4  
ATOM 6209  C C    . TRP A 1 27  ? -2.392  0.785   13.271  1.00 0.00 ? 27  TRP A C    4  
ATOM 6210  O O    . TRP A 1 27  ? -1.846  1.114   14.323  1.00 0.00 ? 27  TRP A O    4  
ATOM 6211  C CB   . TRP A 1 27  ? -2.144  -1.704  13.249  1.00 0.00 ? 27  TRP A CB   4  
ATOM 6212  C CG   . TRP A 1 27  ? -1.741  -2.938  12.500  1.00 0.00 ? 27  TRP A CG   4  
ATOM 6213  C CD1  . TRP A 1 27  ? -0.590  -3.655  12.661  1.00 0.00 ? 27  TRP A CD1  4  
ATOM 6214  C CD2  . TRP A 1 27  ? -2.487  -3.598  11.471  1.00 0.00 ? 27  TRP A CD2  4  
ATOM 6215  N NE1  . TRP A 1 27  ? -0.575  -4.721  11.794  1.00 0.00 ? 27  TRP A NE1  4  
ATOM 6216  C CE2  . TRP A 1 27  ? -1.727  -4.708  11.054  1.00 0.00 ? 27  TRP A CE2  4  
ATOM 6217  C CE3  . TRP A 1 27  ? -3.722  -3.360  10.864  1.00 0.00 ? 27  TRP A CE3  4  
ATOM 6218  C CZ2  . TRP A 1 27  ? -2.165  -5.576  10.057  1.00 0.00 ? 27  TRP A CZ2  4  
ATOM 6219  C CZ3  . TRP A 1 27  ? -4.155  -4.222  9.874   1.00 0.00 ? 27  TRP A CZ3  4  
ATOM 6220  C CH2  . TRP A 1 27  ? -3.378  -5.319  9.479   1.00 0.00 ? 27  TRP A CH2  4  
ATOM 6221  H H    . TRP A 1 27  ? 0.183   -0.789  12.693  1.00 0.00 ? 27  TRP A H    4  
ATOM 6222  H HA   . TRP A 1 27  ? -2.423  -0.455  11.534  1.00 0.00 ? 27  TRP A HA   4  
ATOM 6223  H HB2  . TRP A 1 27  ? -1.586  -1.677  14.173  1.00 0.00 ? 27  TRP A HB2  4  
ATOM 6224  H HB3  . TRP A 1 27  ? -3.199  -1.778  13.472  1.00 0.00 ? 27  TRP A HB3  4  
ATOM 6225  H HD1  . TRP A 1 27  ? 0.187   -3.407  13.368  1.00 0.00 ? 27  TRP A HD1  4  
ATOM 6226  H HE1  . TRP A 1 27  ? 0.144   -5.383  11.719  1.00 0.00 ? 27  TRP A HE1  4  
ATOM 6227  H HE3  . TRP A 1 27  ? -4.335  -2.519  11.155  1.00 0.00 ? 27  TRP A HE3  4  
ATOM 6228  H HZ2  . TRP A 1 27  ? -1.578  -6.427  9.742   1.00 0.00 ? 27  TRP A HZ2  4  
ATOM 6229  H HZ3  . TRP A 1 27  ? -5.107  -4.053  9.393   1.00 0.00 ? 27  TRP A HZ3  4  
ATOM 6230  H HH2  . TRP A 1 27  ? -3.756  -5.966  8.702   1.00 0.00 ? 27  TRP A HH2  4  
ATOM 6231  N N    . GLU A 1 28  ? -3.437  1.432   12.764  1.00 0.00 ? 28  GLU A N    4  
ATOM 6232  C CA   . GLU A 1 28  ? -4.014  2.593   13.432  1.00 0.00 ? 28  GLU A CA   4  
ATOM 6233  C C    . GLU A 1 28  ? -4.636  2.199   14.768  1.00 0.00 ? 28  GLU A C    4  
ATOM 6234  O O    . GLU A 1 28  ? -4.734  3.015   15.683  1.00 0.00 ? 28  GLU A O    4  
ATOM 6235  C CB   . GLU A 1 28  ? -5.069  3.251   12.540  1.00 0.00 ? 28  GLU A CB   4  
ATOM 6236  C CG   . GLU A 1 28  ? -4.509  3.801   11.238  1.00 0.00 ? 28  GLU A CG   4  
ATOM 6237  C CD   . GLU A 1 28  ? -5.329  4.952   10.690  1.00 0.00 ? 28  GLU A CD   4  
ATOM 6238  O OE1  . GLU A 1 28  ? -6.568  4.813   10.612  1.00 0.00 ? 28  GLU A OE1  4  
ATOM 6239  O OE2  . GLU A 1 28  ? -4.732  5.991   10.340  1.00 0.00 ? 28  GLU A OE2  4  
ATOM 6240  H H    . GLU A 1 28  ? -3.829  1.122   11.921  1.00 0.00 ? 28  GLU A H    4  
ATOM 6241  H HA   . GLU A 1 28  ? -3.218  3.300   13.613  1.00 0.00 ? 28  GLU A HA   4  
ATOM 6242  H HB2  . GLU A 1 28  ? -5.827  2.520   12.301  1.00 0.00 ? 28  GLU A HB2  4  
ATOM 6243  H HB3  . GLU A 1 28  ? -5.524  4.065   13.083  1.00 0.00 ? 28  GLU A HB3  4  
ATOM 6244  H HG2  . GLU A 1 28  ? -3.501  4.148   11.413  1.00 0.00 ? 28  GLU A HG2  4  
ATOM 6245  H HG3  . GLU A 1 28  ? -4.492  3.008   10.505  1.00 0.00 ? 28  GLU A HG3  4  
ATOM 6246  N N    . ASN A 1 29  ? -5.054  0.942   14.871  1.00 0.00 ? 29  ASN A N    4  
ATOM 6247  C CA   . ASN A 1 29  ? -5.668  0.438   16.095  1.00 0.00 ? 29  ASN A CA   4  
ATOM 6248  C C    . ASN A 1 29  ? -4.937  -0.801  16.600  1.00 0.00 ? 29  ASN A C    4  
ATOM 6249  O O    . ASN A 1 29  ? -4.030  -1.310  15.942  1.00 0.00 ? 29  ASN A O    4  
ATOM 6250  C CB   . ASN A 1 29  ? -7.143  0.111   15.853  1.00 0.00 ? 29  ASN A CB   4  
ATOM 6251  C CG   . ASN A 1 29  ? -7.344  -0.802  14.658  1.00 0.00 ? 29  ASN A CG   4  
ATOM 6252  O OD1  . ASN A 1 29  ? -6.440  -1.541  14.269  1.00 0.00 ? 29  ASN A OD1  4  
ATOM 6253  N ND2  . ASN A 1 29  ? -8.534  -0.753  14.070  1.00 0.00 ? 29  ASN A ND2  4  
ATOM 6254  H H    . ASN A 1 29  ? -4.948  0.338   14.107  1.00 0.00 ? 29  ASN A H    4  
ATOM 6255  H HA   . ASN A 1 29  ? -5.599  1.213   16.843  1.00 0.00 ? 29  ASN A HA   4  
ATOM 6256  H HB2  . ASN A 1 29  ? -7.545  -0.380  16.727  1.00 0.00 ? 29  ASN A HB2  4  
ATOM 6257  H HB3  . ASN A 1 29  ? -7.686  1.028   15.678  1.00 0.00 ? 29  ASN A HB3  4  
ATOM 6258  H HD21 . ASN A 1 29  ? -9.206  -0.140  14.434  1.00 0.00 ? 29  ASN A HD21 4  
ATOM 6259  H HD22 . ASN A 1 29  ? -8.691  -1.333  13.296  1.00 0.00 ? 29  ASN A HD22 4  
ATOM 6260  N N    . GLU A 1 30  ? -5.339  -1.282  17.773  1.00 0.00 ? 30  GLU A N    4  
ATOM 6261  C CA   . GLU A 1 30  ? -4.721  -2.462  18.366  1.00 0.00 ? 30  GLU A CA   4  
ATOM 6262  C C    . GLU A 1 30  ? -5.332  -3.740  17.799  1.00 0.00 ? 30  GLU A C    4  
ATOM 6263  O O    . GLU A 1 30  ? -4.692  -4.790  17.780  1.00 0.00 ? 30  GLU A O    4  
ATOM 6264  C CB   . GLU A 1 30  ? -4.881  -2.438  19.888  1.00 0.00 ? 30  GLU A CB   4  
ATOM 6265  C CG   . GLU A 1 30  ? -4.018  -1.393  20.575  1.00 0.00 ? 30  GLU A CG   4  
ATOM 6266  C CD   . GLU A 1 30  ? -2.595  -1.867  20.799  1.00 0.00 ? 30  GLU A CD   4  
ATOM 6267  O OE1  . GLU A 1 30  ? -2.132  -2.734  20.029  1.00 0.00 ? 30  GLU A OE1  4  
ATOM 6268  O OE2  . GLU A 1 30  ? -1.946  -1.372  21.743  1.00 0.00 ? 30  GLU A OE2  4  
ATOM 6269  H H    . GLU A 1 30  ? -6.067  -0.832  18.250  1.00 0.00 ? 30  GLU A H    4  
ATOM 6270  H HA   . GLU A 1 30  ? -3.669  -2.442  18.125  1.00 0.00 ? 30  GLU A HA   4  
ATOM 6271  H HB2  . GLU A 1 30  ? -5.915  -2.235  20.126  1.00 0.00 ? 30  GLU A HB2  4  
ATOM 6272  H HB3  . GLU A 1 30  ? -4.615  -3.408  20.280  1.00 0.00 ? 30  GLU A HB3  4  
ATOM 6273  H HG2  . GLU A 1 30  ? -3.993  -0.505  19.961  1.00 0.00 ? 30  GLU A HG2  4  
ATOM 6274  H HG3  . GLU A 1 30  ? -4.458  -1.155  21.532  1.00 0.00 ? 30  GLU A HG3  4  
ATOM 6275  N N    . GLU A 1 31  ? -6.575  -3.640  17.339  1.00 0.00 ? 31  GLU A N    4  
ATOM 6276  C CA   . GLU A 1 31  ? -7.274  -4.788  16.773  1.00 0.00 ? 31  GLU A CA   4  
ATOM 6277  C C    . GLU A 1 31  ? -6.566  -5.291  15.518  1.00 0.00 ? 31  GLU A C    4  
ATOM 6278  O O    . GLU A 1 31  ? -6.869  -6.371  15.010  1.00 0.00 ? 31  GLU A O    4  
ATOM 6279  C CB   . GLU A 1 31  ? -8.722  -4.420  16.442  1.00 0.00 ? 31  GLU A CB   4  
ATOM 6280  C CG   . GLU A 1 31  ? -8.853  -3.168  15.593  1.00 0.00 ? 31  GLU A CG   4  
ATOM 6281  C CD   . GLU A 1 31  ? -10.297 -2.775  15.352  1.00 0.00 ? 31  GLU A CD   4  
ATOM 6282  O OE1  . GLU A 1 31  ? -11.028 -2.567  16.343  1.00 0.00 ? 31  GLU A OE1  4  
ATOM 6283  O OE2  . GLU A 1 31  ? -10.697 -2.675  14.173  1.00 0.00 ? 31  GLU A OE2  4  
ATOM 6284  H H    . GLU A 1 31  ? -7.034  -2.775  17.382  1.00 0.00 ? 31  GLU A H    4  
ATOM 6285  H HA   . GLU A 1 31  ? -7.272  -5.575  17.512  1.00 0.00 ? 31  GLU A HA   4  
ATOM 6286  H HB2  . GLU A 1 31  ? -9.177  -5.242  15.909  1.00 0.00 ? 31  GLU A HB2  4  
ATOM 6287  H HB3  . GLU A 1 31  ? -9.259  -4.261  17.366  1.00 0.00 ? 31  GLU A HB3  4  
ATOM 6288  H HG2  . GLU A 1 31  ? -8.353  -2.353  16.095  1.00 0.00 ? 31  GLU A HG2  4  
ATOM 6289  H HG3  . GLU A 1 31  ? -8.379  -3.344  14.638  1.00 0.00 ? 31  GLU A HG3  4  
ATOM 6290  N N    . LYS A 1 32  ? -5.621  -4.499  15.021  1.00 0.00 ? 32  LYS A N    4  
ATOM 6291  C CA   . LYS A 1 32  ? -4.869  -4.861  13.826  1.00 0.00 ? 32  LYS A CA   4  
ATOM 6292  C C    . LYS A 1 32  ? -5.791  -4.980  12.617  1.00 0.00 ? 32  LYS A C    4  
ATOM 6293  O O    . LYS A 1 32  ? -5.585  -5.827  11.748  1.00 0.00 ? 32  LYS A O    4  
ATOM 6294  C CB   . LYS A 1 32  ? -4.127  -6.182  14.046  1.00 0.00 ? 32  LYS A CB   4  
ATOM 6295  C CG   . LYS A 1 32  ? -3.173  -6.154  15.228  1.00 0.00 ? 32  LYS A CG   4  
ATOM 6296  C CD   . LYS A 1 32  ? -1.760  -5.801  14.795  1.00 0.00 ? 32  LYS A CD   4  
ATOM 6297  C CE   . LYS A 1 32  ? -1.022  -7.017  14.255  1.00 0.00 ? 32  LYS A CE   4  
ATOM 6298  N NZ   . LYS A 1 32  ? -0.659  -7.971  15.339  1.00 0.00 ? 32  LYS A NZ   4  
ATOM 6299  H H    . LYS A 1 32  ? -5.425  -3.650  15.470  1.00 0.00 ? 32  LYS A H    4  
ATOM 6300  H HA   . LYS A 1 32  ? -4.148  -4.080  13.639  1.00 0.00 ? 32  LYS A HA   4  
ATOM 6301  H HB2  . LYS A 1 32  ? -4.853  -6.965  14.214  1.00 0.00 ? 32  LYS A HB2  4  
ATOM 6302  H HB3  . LYS A 1 32  ? -3.559  -6.415  13.157  1.00 0.00 ? 32  LYS A HB3  4  
ATOM 6303  H HG2  . LYS A 1 32  ? -3.515  -5.416  15.938  1.00 0.00 ? 32  LYS A HG2  4  
ATOM 6304  H HG3  . LYS A 1 32  ? -3.164  -7.129  15.695  1.00 0.00 ? 32  LYS A HG3  4  
ATOM 6305  H HD2  . LYS A 1 32  ? -1.807  -5.050  14.021  1.00 0.00 ? 32  LYS A HD2  4  
ATOM 6306  H HD3  . LYS A 1 32  ? -1.219  -5.411  15.646  1.00 0.00 ? 32  LYS A HD3  4  
ATOM 6307  H HE2  . LYS A 1 32  ? -1.658  -7.520  13.543  1.00 0.00 ? 32  LYS A HE2  4  
ATOM 6308  H HE3  . LYS A 1 32  ? -0.121  -6.685  13.762  1.00 0.00 ? 32  LYS A HE3  4  
ATOM 6309  H HZ1  . LYS A 1 32  ? -0.717  -7.500  16.264  1.00 0.00 ? 32  LYS A HZ1  4  
ATOM 6310  H HZ2  . LYS A 1 32  ? 0.312   -8.317  15.200  1.00 0.00 ? 32  LYS A HZ2  4  
ATOM 6311  H HZ3  . LYS A 1 32  ? -1.308  -8.783  15.333  1.00 0.00 ? 32  LYS A HZ3  4  
ATOM 6312  N N    . SER A 1 33  ? -6.807  -4.125  12.568  1.00 0.00 ? 33  SER A N    4  
ATOM 6313  C CA   . SER A 1 33  ? -7.763  -4.135  11.466  1.00 0.00 ? 33  SER A CA   4  
ATOM 6314  C C    . SER A 1 33  ? -7.522  -2.957  10.527  1.00 0.00 ? 33  SER A C    4  
ATOM 6315  O O    . SER A 1 33  ? -7.648  -3.084  9.309   1.00 0.00 ? 33  SER A O    4  
ATOM 6316  C CB   . SER A 1 33  ? -9.194  -4.089  12.004  1.00 0.00 ? 33  SER A CB   4  
ATOM 6317  O OG   . SER A 1 33  ? -9.421  -5.130  12.939  1.00 0.00 ? 33  SER A OG   4  
ATOM 6318  H H    . SER A 1 33  ? -6.919  -3.473  13.291  1.00 0.00 ? 33  SER A H    4  
ATOM 6319  H HA   . SER A 1 33  ? -7.623  -5.053  10.915  1.00 0.00 ? 33  SER A HA   4  
ATOM 6320  H HB2  . SER A 1 33  ? -9.363  -3.141  12.491  1.00 0.00 ? 33  SER A HB2  4  
ATOM 6321  H HB3  . SER A 1 33  ? -9.888  -4.201  11.183  1.00 0.00 ? 33  SER A HB3  4  
ATOM 6322  H HG   . SER A 1 33  ? -8.611  -5.629  13.066  1.00 0.00 ? 33  SER A HG   4  
ATOM 6323  N N    . ILE A 1 34  ? -7.177  -1.810  11.104  1.00 0.00 ? 34  ILE A N    4  
ATOM 6324  C CA   . ILE A 1 34  ? -6.917  -0.609  10.319  1.00 0.00 ? 34  ILE A CA   4  
ATOM 6325  C C    . ILE A 1 34  ? -5.441  -0.230  10.366  1.00 0.00 ? 34  ILE A C    4  
ATOM 6326  O O    . ILE A 1 34  ? -4.781  -0.387  11.393  1.00 0.00 ? 34  ILE A O    4  
ATOM 6327  C CB   . ILE A 1 34  ? -7.758  0.581   10.818  1.00 0.00 ? 34  ILE A CB   4  
ATOM 6328  C CG1  . ILE A 1 34  ? -9.250  0.267   10.695  1.00 0.00 ? 34  ILE A CG1  4  
ATOM 6329  C CG2  . ILE A 1 34  ? -7.409  1.839   10.037  1.00 0.00 ? 34  ILE A CG2  4  
ATOM 6330  C CD1  . ILE A 1 34  ? -10.104 0.978   11.722  1.00 0.00 ? 34  ILE A CD1  4  
ATOM 6331  H H    . ILE A 1 34  ? -7.093  -1.772  12.079  1.00 0.00 ? 34  ILE A H    4  
ATOM 6332  H HA   . ILE A 1 34  ? -7.193  -0.815  9.295   1.00 0.00 ? 34  ILE A HA   4  
ATOM 6333  H HB   . ILE A 1 34  ? -7.517  0.752   11.856  1.00 0.00 ? 34  ILE A HB   4  
ATOM 6334  H HG12 . ILE A 1 34  ? -9.594  0.562   9.717   1.00 0.00 ? 34  ILE A HG12 4  
ATOM 6335  H HG13 . ILE A 1 34  ? -9.398  -0.796  10.819  1.00 0.00 ? 34  ILE A HG13 4  
ATOM 6336  H HG21 . ILE A 1 34  ? -7.250  1.586   9.000   1.00 0.00 ? 34  ILE A HG21 4  
ATOM 6337  H HG22 . ILE A 1 34  ? -8.222  2.546   10.113  1.00 0.00 ? 34  ILE A HG22 4  
ATOM 6338  H HG23 . ILE A 1 34  ? -6.511  2.278   10.444  1.00 0.00 ? 34  ILE A HG23 4  
ATOM 6339  H HD11 . ILE A 1 34  ? -9.797  0.681   12.714  1.00 0.00 ? 34  ILE A HD11 4  
ATOM 6340  H HD12 . ILE A 1 34  ? -9.986  2.045   11.612  1.00 0.00 ? 34  ILE A HD12 4  
ATOM 6341  H HD13 . ILE A 1 34  ? -11.141 0.713   11.573  1.00 0.00 ? 34  ILE A HD13 4  
ATOM 6342  N N    . PHE A 1 35  ? -4.929  0.272   9.247   1.00 0.00 ? 35  PHE A N    4  
ATOM 6343  C CA   . PHE A 1 35  ? -3.530  0.675   9.160   1.00 0.00 ? 35  PHE A CA   4  
ATOM 6344  C C    . PHE A 1 35  ? -3.358  1.831   8.179   1.00 0.00 ? 35  PHE A C    4  
ATOM 6345  O O    . PHE A 1 35  ? -4.282  2.177   7.443   1.00 0.00 ? 35  PHE A O    4  
ATOM 6346  C CB   . PHE A 1 35  ? -2.662  -0.509  8.729   1.00 0.00 ? 35  PHE A CB   4  
ATOM 6347  C CG   . PHE A 1 35  ? -3.154  -1.191  7.484   1.00 0.00 ? 35  PHE A CG   4  
ATOM 6348  C CD1  . PHE A 1 35  ? -4.233  -2.059  7.533   1.00 0.00 ? 35  PHE A CD1  4  
ATOM 6349  C CD2  . PHE A 1 35  ? -2.536  -0.963  6.264   1.00 0.00 ? 35  PHE A CD2  4  
ATOM 6350  C CE1  . PHE A 1 35  ? -4.688  -2.687  6.389   1.00 0.00 ? 35  PHE A CE1  4  
ATOM 6351  C CE2  . PHE A 1 35  ? -2.987  -1.589  5.117   1.00 0.00 ? 35  PHE A CE2  4  
ATOM 6352  C CZ   . PHE A 1 35  ? -4.063  -2.453  5.180   1.00 0.00 ? 35  PHE A CZ   4  
ATOM 6353  H H    . PHE A 1 35  ? -5.506  0.373   8.461   1.00 0.00 ? 35  PHE A H    4  
ATOM 6354  H HA   . PHE A 1 35  ? -3.219  1.001   10.140  1.00 0.00 ? 35  PHE A HA   4  
ATOM 6355  H HB2  . PHE A 1 35  ? -1.658  -0.160  8.541   1.00 0.00 ? 35  PHE A HB2  4  
ATOM 6356  H HB3  . PHE A 1 35  ? -2.643  -1.240  9.523   1.00 0.00 ? 35  PHE A HB3  4  
ATOM 6357  H HD1  . PHE A 1 35  ? -4.722  -2.243  8.479   1.00 0.00 ? 35  PHE A HD1  4  
ATOM 6358  H HD2  . PHE A 1 35  ? -1.694  -0.289  6.214   1.00 0.00 ? 35  PHE A HD2  4  
ATOM 6359  H HE1  . PHE A 1 35  ? -5.529  -3.362  6.442   1.00 0.00 ? 35  PHE A HE1  4  
ATOM 6360  H HE2  . PHE A 1 35  ? -2.497  -1.404  4.173   1.00 0.00 ? 35  PHE A HE2  4  
ATOM 6361  H HZ   . PHE A 1 35  ? -4.417  -2.942  4.285   1.00 0.00 ? 35  PHE A HZ   4  
ATOM 6362  N N    . ARG A 1 36  ? -2.168  2.423   8.176   1.00 0.00 ? 36  ARG A N    4  
ATOM 6363  C CA   . ARG A 1 36  ? -1.874  3.541   7.287   1.00 0.00 ? 36  ARG A CA   4  
ATOM 6364  C C    . ARG A 1 36  ? -0.636  3.253   6.443   1.00 0.00 ? 36  ARG A C    4  
ATOM 6365  O O    . ARG A 1 36  ? 0.390   2.811   6.959   1.00 0.00 ? 36  ARG A O    4  
ATOM 6366  C CB   . ARG A 1 36  ? -1.665  4.822   8.097   1.00 0.00 ? 36  ARG A CB   4  
ATOM 6367  C CG   . ARG A 1 36  ? -0.962  4.596   9.425   1.00 0.00 ? 36  ARG A CG   4  
ATOM 6368  C CD   . ARG A 1 36  ? -0.265  5.857   9.909   1.00 0.00 ? 36  ARG A CD   4  
ATOM 6369  N NE   . ARG A 1 36  ? -1.208  6.828   10.458  1.00 0.00 ? 36  ARG A NE   4  
ATOM 6370  C CZ   . ARG A 1 36  ? -0.868  7.772   11.329  1.00 0.00 ? 36  ARG A CZ   4  
ATOM 6371  N NH1  . ARG A 1 36  ? 0.386   7.872   11.746  1.00 0.00 ? 36  ARG A NH1  4  
ATOM 6372  N NH2  . ARG A 1 36  ? -1.783  8.618   11.783  1.00 0.00 ? 36  ARG A NH2  4  
ATOM 6373  H H    . ARG A 1 36  ? -1.472  2.102   8.786   1.00 0.00 ? 36  ARG A H    4  
ATOM 6374  H HA   . ARG A 1 36  ? -2.720  3.675   6.630   1.00 0.00 ? 36  ARG A HA   4  
ATOM 6375  H HB2  . ARG A 1 36  ? -1.071  5.510   7.513   1.00 0.00 ? 36  ARG A HB2  4  
ATOM 6376  H HB3  . ARG A 1 36  ? -2.628  5.269   8.295   1.00 0.00 ? 36  ARG A HB3  4  
ATOM 6377  H HG2  . ARG A 1 36  ? -1.693  4.297   10.162  1.00 0.00 ? 36  ARG A HG2  4  
ATOM 6378  H HG3  . ARG A 1 36  ? -0.229  3.813   9.305   1.00 0.00 ? 36  ARG A HG3  4  
ATOM 6379  H HD2  . ARG A 1 36  ? 0.447   5.588   10.675  1.00 0.00 ? 36  ARG A HD2  4  
ATOM 6380  H HD3  . ARG A 1 36  ? 0.255   6.306   9.076   1.00 0.00 ? 36  ARG A HD3  4  
ATOM 6381  H HE   . ARG A 1 36  ? -2.141  6.771   10.163  1.00 0.00 ? 36  ARG A HE   4  
ATOM 6382  H HH11 . ARG A 1 36  ? 1.079   7.237   11.405  1.00 0.00 ? 36  ARG A HH11 4  
ATOM 6383  H HH12 . ARG A 1 36  ? 0.640   8.585   12.401  1.00 0.00 ? 36  ARG A HH12 4  
ATOM 6384  H HH21 . ARG A 1 36  ? -2.730  8.546   11.470  1.00 0.00 ? 36  ARG A HH21 4  
ATOM 6385  H HH22 . ARG A 1 36  ? -1.527  9.328   12.438  1.00 0.00 ? 36  ARG A HH22 4  
ATOM 6386  N N    . ILE A 1 37  ? -0.742  3.507   5.142   1.00 0.00 ? 37  ILE A N    4  
ATOM 6387  C CA   . ILE A 1 37  ? 0.369   3.275   4.227   1.00 0.00 ? 37  ILE A CA   4  
ATOM 6388  C C    . ILE A 1 37  ? 0.870   4.585   3.628   1.00 0.00 ? 37  ILE A C    4  
ATOM 6389  O O    . ILE A 1 37  ? 0.092   5.432   3.188   1.00 0.00 ? 37  ILE A O    4  
ATOM 6390  C CB   . ILE A 1 37  ? -0.031  2.321   3.086   1.00 0.00 ? 37  ILE A CB   4  
ATOM 6391  C CG1  . ILE A 1 37  ? 1.176   2.021   2.195   1.00 0.00 ? 37  ILE A CG1  4  
ATOM 6392  C CG2  . ILE A 1 37  ? -1.165  2.921   2.267   1.00 0.00 ? 37  ILE A CG2  4  
ATOM 6393  C CD1  . ILE A 1 37  ? 0.839   1.179   0.985   1.00 0.00 ? 37  ILE A CD1  4  
ATOM 6394  H H    . ILE A 1 37  ? -1.586  3.858   4.791   1.00 0.00 ? 37  ILE A H    4  
ATOM 6395  H HA   . ILE A 1 37  ? 1.172   2.817   4.787   1.00 0.00 ? 37  ILE A HA   4  
ATOM 6396  H HB   . ILE A 1 37  ? -0.385  1.400   3.524   1.00 0.00 ? 37  ILE A HB   4  
ATOM 6397  H HG12 . ILE A 1 37  ? 1.597   2.951   1.845   1.00 0.00 ? 37  ILE A HG12 4  
ATOM 6398  H HG13 . ILE A 1 37  ? 1.918   1.490   2.774   1.00 0.00 ? 37  ILE A HG13 4  
ATOM 6399  H HG21 . ILE A 1 37  ? -0.873  2.967   1.228   1.00 0.00 ? 37  ILE A HG21 4  
ATOM 6400  H HG22 . ILE A 1 37  ? -2.045  2.305   2.366   1.00 0.00 ? 37  ILE A HG22 4  
ATOM 6401  H HG23 . ILE A 1 37  ? -1.380  3.917   2.625   1.00 0.00 ? 37  ILE A HG23 4  
ATOM 6402  H HD11 . ILE A 1 37  ? -0.233  1.133   0.865   1.00 0.00 ? 37  ILE A HD11 4  
ATOM 6403  H HD12 . ILE A 1 37  ? 1.283   1.619   0.105   1.00 0.00 ? 37  ILE A HD12 4  
ATOM 6404  H HD13 . ILE A 1 37  ? 1.228   0.180   1.122   1.00 0.00 ? 37  ILE A HD13 4  
ATOM 6405  N N    . PRO A 1 38  ? 2.200   4.756   3.608   1.00 0.00 ? 38  PRO A N    4  
ATOM 6406  C CA   . PRO A 1 38  ? 2.835   5.959   3.063   1.00 0.00 ? 38  PRO A CA   4  
ATOM 6407  C C    . PRO A 1 38  ? 2.702   6.048   1.546   1.00 0.00 ? 38  PRO A C    4  
ATOM 6408  O O    . PRO A 1 38  ? 3.279   5.243   0.815   1.00 0.00 ? 38  PRO A O    4  
ATOM 6409  C CB   . PRO A 1 38  ? 4.304   5.797   3.462   1.00 0.00 ? 38  PRO A CB   4  
ATOM 6410  C CG   . PRO A 1 38  ? 4.496   4.328   3.611   1.00 0.00 ? 38  PRO A CG   4  
ATOM 6411  C CD   . PRO A 1 38  ? 3.186   3.788   4.116   1.00 0.00 ? 38  PRO A CD   4  
ATOM 6412  H HA   . PRO A 1 38  ? 2.435   6.857   3.511   1.00 0.00 ? 38  PRO A HA   4  
ATOM 6413  H HB2  . PRO A 1 38  ? 4.937   6.203   2.686   1.00 0.00 ? 38  PRO A HB2  4  
ATOM 6414  H HB3  . PRO A 1 38  ? 4.487   6.315   4.392   1.00 0.00 ? 38  PRO A HB3  4  
ATOM 6415  H HG2  . PRO A 1 38  ? 4.738   3.890   2.654   1.00 0.00 ? 38  PRO A HG2  4  
ATOM 6416  H HG3  . PRO A 1 38  ? 5.282   4.131   4.325   1.00 0.00 ? 38  PRO A HG3  4  
ATOM 6417  H HD2  . PRO A 1 38  ? 3.003   2.803   3.711   1.00 0.00 ? 38  PRO A HD2  4  
ATOM 6418  H HD3  . PRO A 1 38  ? 3.180   3.762   5.195   1.00 0.00 ? 38  PRO A HD3  4  
ATOM 6419  N N    . TRP A 1 39  ? 1.940   7.031   1.081   1.00 0.00 ? 39  TRP A N    4  
ATOM 6420  C CA   . TRP A 1 39  ? 1.733   7.225   -0.350  1.00 0.00 ? 39  TRP A CA   4  
ATOM 6421  C C    . TRP A 1 39  ? 2.544   8.410   -0.862  1.00 0.00 ? 39  TRP A C    4  
ATOM 6422  O O    . TRP A 1 39  ? 2.163   9.565   -0.671  1.00 0.00 ? 39  TRP A O    4  
ATOM 6423  C CB   . TRP A 1 39  ? 0.248   7.442   -0.646  1.00 0.00 ? 39  TRP A CB   4  
ATOM 6424  C CG   . TRP A 1 39  ? -0.203  6.800   -1.924  1.00 0.00 ? 39  TRP A CG   4  
ATOM 6425  C CD1  . TRP A 1 39  ? -0.415  7.420   -3.122  1.00 0.00 ? 39  TRP A CD1  4  
ATOM 6426  C CD2  . TRP A 1 39  ? -0.499  5.414   -2.129  1.00 0.00 ? 39  TRP A CD2  4  
ATOM 6427  N NE1  . TRP A 1 39  ? -0.825  6.503   -4.059  1.00 0.00 ? 39  TRP A NE1  4  
ATOM 6428  C CE2  . TRP A 1 39  ? -0.883  5.265   -3.476  1.00 0.00 ? 39  TRP A CE2  4  
ATOM 6429  C CE3  . TRP A 1 39  ? -0.474  4.285   -1.307  1.00 0.00 ? 39  TRP A CE3  4  
ATOM 6430  C CZ2  . TRP A 1 39  ? -1.240  4.033   -4.015  1.00 0.00 ? 39  TRP A CZ2  4  
ATOM 6431  C CZ3  . TRP A 1 39  ? -0.829  3.062   -1.844  1.00 0.00 ? 39  TRP A CZ3  4  
ATOM 6432  C CH2  . TRP A 1 39  ? -1.207  2.944   -3.188  1.00 0.00 ? 39  TRP A CH2  4  
ATOM 6433  H H    . TRP A 1 39  ? 1.506   7.642   1.714   1.00 0.00 ? 39  TRP A H    4  
ATOM 6434  H HA   . TRP A 1 39  ? 2.065   6.331   -0.856  1.00 0.00 ? 39  TRP A HA   4  
ATOM 6435  H HB2  . TRP A 1 39  ? -0.338  7.027   0.160   1.00 0.00 ? 39  TRP A HB2  4  
ATOM 6436  H HB3  . TRP A 1 39  ? 0.054   8.502   -0.718  1.00 0.00 ? 39  TRP A HB3  4  
ATOM 6437  H HD1  . TRP A 1 39  ? -0.279  8.477   -3.292  1.00 0.00 ? 39  TRP A HD1  4  
ATOM 6438  H HE1  . TRP A 1 39  ? -1.039  6.704   -4.995  1.00 0.00 ? 39  TRP A HE1  4  
ATOM 6439  H HE3  . TRP A 1 39  ? -0.185  4.356   -0.268  1.00 0.00 ? 39  TRP A HE3  4  
ATOM 6440  H HZ2  . TRP A 1 39  ? -1.534  3.925   -5.050  1.00 0.00 ? 39  TRP A HZ2  4  
ATOM 6441  H HZ3  . TRP A 1 39  ? -0.816  2.178   -1.224  1.00 0.00 ? 39  TRP A HZ3  4  
ATOM 6442  H HH2  . TRP A 1 39  ? -1.477  1.969   -3.565  1.00 0.00 ? 39  TRP A HH2  4  
ATOM 6443  N N    . LYS A 1 40  ? 3.664   8.118   -1.514  1.00 0.00 ? 40  LYS A N    4  
ATOM 6444  C CA   . LYS A 1 40  ? 4.529   9.159   -2.056  1.00 0.00 ? 40  LYS A CA   4  
ATOM 6445  C C    . LYS A 1 40  ? 5.010   8.793   -3.456  1.00 0.00 ? 40  LYS A C    4  
ATOM 6446  O O    . LYS A 1 40  ? 5.624   7.744   -3.658  1.00 0.00 ? 40  LYS A O    4  
ATOM 6447  C CB   . LYS A 1 40  ? 5.731   9.383   -1.134  1.00 0.00 ? 40  LYS A CB   4  
ATOM 6448  C CG   . LYS A 1 40  ? 5.360   9.482   0.335   1.00 0.00 ? 40  LYS A CG   4  
ATOM 6449  C CD   . LYS A 1 40  ? 6.590   9.659   1.210   1.00 0.00 ? 40  LYS A CD   4  
ATOM 6450  C CE   . LYS A 1 40  ? 6.953   11.128  1.369   1.00 0.00 ? 40  LYS A CE   4  
ATOM 6451  N NZ   . LYS A 1 40  ? 7.842   11.355  2.542   1.00 0.00 ? 40  LYS A NZ   4  
ATOM 6452  H H    . LYS A 1 40  ? 3.915   7.177   -1.635  1.00 0.00 ? 40  LYS A H    4  
ATOM 6453  H HA   . LYS A 1 40  ? 3.955   10.071  -2.112  1.00 0.00 ? 40  LYS A HA   4  
ATOM 6454  H HB2  . LYS A 1 40  ? 6.420   8.560   -1.256  1.00 0.00 ? 40  LYS A HB2  4  
ATOM 6455  H HB3  . LYS A 1 40  ? 6.224   10.300  -1.422  1.00 0.00 ? 40  LYS A HB3  4  
ATOM 6456  H HG2  . LYS A 1 40  ? 4.706   10.330  0.476   1.00 0.00 ? 40  LYS A HG2  4  
ATOM 6457  H HG3  . LYS A 1 40  ? 4.847   8.577   0.630   1.00 0.00 ? 40  LYS A HG3  4  
ATOM 6458  H HD2  . LYS A 1 40  ? 6.391   9.242   2.185   1.00 0.00 ? 40  LYS A HD2  4  
ATOM 6459  H HD3  . LYS A 1 40  ? 7.421   9.139   0.756   1.00 0.00 ? 40  LYS A HD3  4  
ATOM 6460  H HE2  . LYS A 1 40  ? 7.459   11.459  0.475   1.00 0.00 ? 40  LYS A HE2  4  
ATOM 6461  H HE3  . LYS A 1 40  ? 6.045   11.697  1.501   1.00 0.00 ? 40  LYS A HE3  4  
ATOM 6462  H HZ1  . LYS A 1 40  ? 7.476   12.137  3.121   1.00 0.00 ? 40  LYS A HZ1  4  
ATOM 6463  H HZ2  . LYS A 1 40  ? 8.802   11.595  2.222   1.00 0.00 ? 40  LYS A HZ2  4  
ATOM 6464  H HZ3  . LYS A 1 40  ? 7.888   10.496  3.127   1.00 0.00 ? 40  LYS A HZ3  4  
ATOM 6465  N N    . HIS A 1 41  ? 4.729   9.664   -4.420  1.00 0.00 ? 41  HIS A N    4  
ATOM 6466  C CA   . HIS A 1 41  ? 5.136   9.432   -5.802  1.00 0.00 ? 41  HIS A CA   4  
ATOM 6467  C C    . HIS A 1 41  ? 6.582   9.864   -6.022  1.00 0.00 ? 41  HIS A C    4  
ATOM 6468  O O    . HIS A 1 41  ? 7.193   10.488  -5.155  1.00 0.00 ? 41  HIS A O    4  
ATOM 6469  C CB   . HIS A 1 41  ? 4.214   10.188  -6.760  1.00 0.00 ? 41  HIS A CB   4  
ATOM 6470  C CG   . HIS A 1 41  ? 4.487   11.659  -6.818  1.00 0.00 ? 41  HIS A CG   4  
ATOM 6471  N ND1  . HIS A 1 41  ? 4.738   12.423  -5.697  1.00 0.00 ? 41  HIS A ND1  4  
ATOM 6472  C CD2  . HIS A 1 41  ? 4.550   12.507  -7.871  1.00 0.00 ? 41  HIS A CD2  4  
ATOM 6473  C CE1  . HIS A 1 41  ? 4.941   13.678  -6.059  1.00 0.00 ? 41  HIS A CE1  4  
ATOM 6474  N NE2  . HIS A 1 41  ? 4.833   13.755  -7.373  1.00 0.00 ? 41  HIS A NE2  4  
ATOM 6475  H H    . HIS A 1 41  ? 4.238   10.481  -4.197  1.00 0.00 ? 41  HIS A H    4  
ATOM 6476  H HA   . HIS A 1 41  ? 5.055   8.374   -5.998  1.00 0.00 ? 41  HIS A HA   4  
ATOM 6477  H HB2  . HIS A 1 41  ? 4.337   9.789   -7.756  1.00 0.00 ? 41  HIS A HB2  4  
ATOM 6478  H HB3  . HIS A 1 41  ? 3.189   10.052  -6.446  1.00 0.00 ? 41  HIS A HB3  4  
ATOM 6479  H HD1  . HIS A 1 41  ? 4.761   12.095  -4.775  1.00 0.00 ? 41  HIS A HD1  4  
ATOM 6480  H HD2  . HIS A 1 41  ? 4.404   12.251  -8.911  1.00 0.00 ? 41  HIS A HD2  4  
ATOM 6481  H HE1  . HIS A 1 41  ? 5.159   14.500  -5.394  1.00 0.00 ? 41  HIS A HE1  4  
ATOM 6482  N N    . ALA A 1 42  ? 7.125   9.526   -7.187  1.00 0.00 ? 42  ALA A N    4  
ATOM 6483  C CA   . ALA A 1 42  ? 8.499   9.880   -7.522  1.00 0.00 ? 42  ALA A CA   4  
ATOM 6484  C C    . ALA A 1 42  ? 8.797   11.330  -7.156  1.00 0.00 ? 42  ALA A C    4  
ATOM 6485  O O    . ALA A 1 42  ? 9.857   11.638  -6.613  1.00 0.00 ? 42  ALA A O    4  
ATOM 6486  C CB   . ALA A 1 42  ? 8.760   9.642   -9.002  1.00 0.00 ? 42  ALA A CB   4  
ATOM 6487  H H    . ALA A 1 42  ? 6.587   9.029   -7.838  1.00 0.00 ? 42  ALA A H    4  
ATOM 6488  H HA   . ALA A 1 42  ? 9.156   9.234   -6.957  1.00 0.00 ? 42  ALA A HA   4  
ATOM 6489  H HB1  . ALA A 1 42  ? 9.557   8.922   -9.115  1.00 0.00 ? 42  ALA A HB1  4  
ATOM 6490  H HB2  . ALA A 1 42  ? 7.863   9.263   -9.469  1.00 0.00 ? 42  ALA A HB2  4  
ATOM 6491  H HB3  . ALA A 1 42  ? 9.045   10.572  -9.470  1.00 0.00 ? 42  ALA A HB3  4  
ATOM 6492  N N    . GLY A 1 43  ? 7.854   12.218  -7.459  1.00 0.00 ? 43  GLY A N    4  
ATOM 6493  C CA   . GLY A 1 43  ? 8.036   13.625  -7.155  1.00 0.00 ? 43  GLY A CA   4  
ATOM 6494  C C    . GLY A 1 43  ? 8.918   13.848  -5.942  1.00 0.00 ? 43  GLY A C    4  
ATOM 6495  O O    . GLY A 1 43  ? 9.812   14.694  -5.962  1.00 0.00 ? 43  GLY A O    4  
ATOM 6496  H H    . GLY A 1 43  ? 7.029   11.914  -7.892  1.00 0.00 ? 43  GLY A H    4  
ATOM 6497  H HA2  . GLY A 1 43  ? 8.486   14.111  -8.008  1.00 0.00 ? 43  GLY A HA2  4  
ATOM 6498  H HA3  . GLY A 1 43  ? 7.069   14.069  -6.969  1.00 0.00 ? 43  GLY A HA3  4  
ATOM 6499  N N    . LYS A 1 44  ? 8.665   13.088  -4.882  1.00 0.00 ? 44  LYS A N    4  
ATOM 6500  C CA   . LYS A 1 44  ? 9.442   13.205  -3.654  1.00 0.00 ? 44  LYS A CA   4  
ATOM 6501  C C    . LYS A 1 44  ? 10.591  12.202  -3.638  1.00 0.00 ? 44  LYS A C    4  
ATOM 6502  O O    . LYS A 1 44  ? 10.369  10.992  -3.646  1.00 0.00 ? 44  LYS A O    4  
ATOM 6503  C CB   . LYS A 1 44  ? 8.543   12.986  -2.435  1.00 0.00 ? 44  LYS A CB   4  
ATOM 6504  C CG   . LYS A 1 44  ? 7.958   14.270  -1.871  1.00 0.00 ? 44  LYS A CG   4  
ATOM 6505  C CD   . LYS A 1 44  ? 8.850   14.862  -0.793  1.00 0.00 ? 44  LYS A CD   4  
ATOM 6506  C CE   . LYS A 1 44  ? 8.462   14.360  0.589   1.00 0.00 ? 44  LYS A CE   4  
ATOM 6507  N NZ   . LYS A 1 44  ? 7.476   15.259  1.250   1.00 0.00 ? 44  LYS A NZ   4  
ATOM 6508  H H    . LYS A 1 44  ? 7.938   12.431  -4.927  1.00 0.00 ? 44  LYS A H    4  
ATOM 6509  H HA   . LYS A 1 44  ? 9.851   14.203  -3.614  1.00 0.00 ? 44  LYS A HA   4  
ATOM 6510  H HB2  . LYS A 1 44  ? 7.727   12.337  -2.716  1.00 0.00 ? 44  LYS A HB2  4  
ATOM 6511  H HB3  . LYS A 1 44  ? 9.121   12.507  -1.658  1.00 0.00 ? 44  LYS A HB3  4  
ATOM 6512  H HG2  . LYS A 1 44  ? 7.853   14.988  -2.670  1.00 0.00 ? 44  LYS A HG2  4  
ATOM 6513  H HG3  . LYS A 1 44  ? 6.988   14.056  -1.446  1.00 0.00 ? 44  LYS A HG3  4  
ATOM 6514  H HD2  . LYS A 1 44  ? 9.874   14.582  -0.990  1.00 0.00 ? 44  LYS A HD2  4  
ATOM 6515  H HD3  . LYS A 1 44  ? 8.759   15.939  -0.814  1.00 0.00 ? 44  LYS A HD3  4  
ATOM 6516  H HE2  . LYS A 1 44  ? 8.029   13.376  0.492   1.00 0.00 ? 44  LYS A HE2  4  
ATOM 6517  H HE3  . LYS A 1 44  ? 9.351   14.303  1.200   1.00 0.00 ? 44  LYS A HE3  4  
ATOM 6518  H HZ1  . LYS A 1 44  ? 6.509   14.991  0.977   1.00 0.00 ? 44  LYS A HZ1  4  
ATOM 6519  H HZ2  . LYS A 1 44  ? 7.644   16.245  0.964   1.00 0.00 ? 44  LYS A HZ2  4  
ATOM 6520  H HZ3  . LYS A 1 44  ? 7.565   15.190  2.284   1.00 0.00 ? 44  LYS A HZ3  4  
ATOM 6521  N N    . GLN A 1 45  ? 11.817  12.714  -3.614  1.00 0.00 ? 45  GLN A N    4  
ATOM 6522  C CA   . GLN A 1 45  ? 13.000  11.862  -3.597  1.00 0.00 ? 45  GLN A CA   4  
ATOM 6523  C C    . GLN A 1 45  ? 13.532  11.698  -2.177  1.00 0.00 ? 45  GLN A C    4  
ATOM 6524  O O    . GLN A 1 45  ? 13.819  10.586  -1.735  1.00 0.00 ? 45  GLN A O    4  
ATOM 6525  C CB   . GLN A 1 45  ? 14.089  12.446  -4.498  1.00 0.00 ? 45  GLN A CB   4  
ATOM 6526  C CG   . GLN A 1 45  ? 14.994  11.394  -5.119  1.00 0.00 ? 45  GLN A CG   4  
ATOM 6527  C CD   . GLN A 1 45  ? 15.728  11.904  -6.343  1.00 0.00 ? 45  GLN A CD   4  
ATOM 6528  O OE1  . GLN A 1 45  ? 16.048  13.089  -6.440  1.00 0.00 ? 45  GLN A OE1  4  
ATOM 6529  N NE2  . GLN A 1 45  ? 15.999  11.010  -7.286  1.00 0.00 ? 45  GLN A NE2  4  
ATOM 6530  H H    . GLN A 1 45  ? 11.929  13.687  -3.609  1.00 0.00 ? 45  GLN A H    4  
ATOM 6531  H HA   . GLN A 1 45  ? 12.715  10.892  -3.975  1.00 0.00 ? 45  GLN A HA   4  
ATOM 6532  H HB2  . GLN A 1 45  ? 13.619  13.002  -5.296  1.00 0.00 ? 45  GLN A HB2  4  
ATOM 6533  H HB3  . GLN A 1 45  ? 14.701  13.117  -3.914  1.00 0.00 ? 45  GLN A HB3  4  
ATOM 6534  H HG2  . GLN A 1 45  ? 15.723  11.086  -4.384  1.00 0.00 ? 45  GLN A HG2  4  
ATOM 6535  H HG3  . GLN A 1 45  ? 14.393  10.544  -5.405  1.00 0.00 ? 45  GLN A HG3  4  
ATOM 6536  H HE21 . GLN A 1 45  ? 15.713  10.084  -7.141  1.00 0.00 ? 45  GLN A HE21 4  
ATOM 6537  H HE22 . GLN A 1 45  ? 16.472  11.313  -8.089  1.00 0.00 ? 45  GLN A HE22 4  
ATOM 6538  N N    . ASP A 1 46  ? 13.662  12.814  -1.467  1.00 0.00 ? 46  ASP A N    4  
ATOM 6539  C CA   . ASP A 1 46  ? 14.159  12.794  -0.097  1.00 0.00 ? 46  ASP A CA   4  
ATOM 6540  C C    . ASP A 1 46  ? 13.565  11.624  0.681   1.00 0.00 ? 46  ASP A C    4  
ATOM 6541  O O    . ASP A 1 46  ? 14.234  11.017  1.516   1.00 0.00 ? 46  ASP A O    4  
ATOM 6542  C CB   . ASP A 1 46  ? 13.829  14.111  0.607   1.00 0.00 ? 46  ASP A CB   4  
ATOM 6543  C CG   . ASP A 1 46  ? 14.264  15.322  -0.195  1.00 0.00 ? 46  ASP A CG   4  
ATOM 6544  O OD1  . ASP A 1 46  ? 15.463  15.411  -0.530  1.00 0.00 ? 46  ASP A OD1  4  
ATOM 6545  O OD2  . ASP A 1 46  ? 13.405  16.181  -0.486  1.00 0.00 ? 46  ASP A OD2  4  
ATOM 6546  H H    . ASP A 1 46  ? 13.417  13.671  -1.875  1.00 0.00 ? 46  ASP A H    4  
ATOM 6547  H HA   . ASP A 1 46  ? 15.232  12.677  -0.135  1.00 0.00 ? 46  ASP A HA   4  
ATOM 6548  H HB2  . ASP A 1 46  ? 12.761  14.171  0.763   1.00 0.00 ? 46  ASP A HB2  4  
ATOM 6549  H HB3  . ASP A 1 46  ? 14.329  14.136  1.564   1.00 0.00 ? 46  ASP A HB3  4  
ATOM 6550  N N    . TYR A 1 47  ? 12.304  11.315  0.401   1.00 0.00 ? 47  TYR A N    4  
ATOM 6551  C CA   . TYR A 1 47  ? 11.617  10.220  1.076   1.00 0.00 ? 47  TYR A CA   4  
ATOM 6552  C C    . TYR A 1 47  ? 12.432  8.932   0.993   1.00 0.00 ? 47  TYR A C    4  
ATOM 6553  O O    . TYR A 1 47  ? 13.485  8.891   0.357   1.00 0.00 ? 47  TYR A O    4  
ATOM 6554  C CB   . TYR A 1 47  ? 10.234  10.001  0.462   1.00 0.00 ? 47  TYR A CB   4  
ATOM 6555  C CG   . TYR A 1 47  ? 10.224  8.995   -0.667  1.00 0.00 ? 47  TYR A CG   4  
ATOM 6556  C CD1  . TYR A 1 47  ? 11.050  9.155   -1.773  1.00 0.00 ? 47  TYR A CD1  4  
ATOM 6557  C CD2  . TYR A 1 47  ? 9.388   7.886   -0.628  1.00 0.00 ? 47  TYR A CD2  4  
ATOM 6558  C CE1  . TYR A 1 47  ? 11.044  8.238   -2.807  1.00 0.00 ? 47  TYR A CE1  4  
ATOM 6559  C CE2  . TYR A 1 47  ? 9.377   6.964   -1.656  1.00 0.00 ? 47  TYR A CE2  4  
ATOM 6560  C CZ   . TYR A 1 47  ? 10.206  7.144   -2.743  1.00 0.00 ? 47  TYR A CZ   4  
ATOM 6561  O OH   . TYR A 1 47  ? 10.197  6.229   -3.771  1.00 0.00 ? 47  TYR A OH   4  
ATOM 6562  H H    . TYR A 1 47  ? 11.822  11.836  -0.275  1.00 0.00 ? 47  TYR A H    4  
ATOM 6563  H HA   . TYR A 1 47  ? 11.501  10.492  2.115   1.00 0.00 ? 47  TYR A HA   4  
ATOM 6564  H HB2  . TYR A 1 47  ? 9.560   9.647   1.227   1.00 0.00 ? 47  TYR A HB2  4  
ATOM 6565  H HB3  . TYR A 1 47  ? 9.868   10.940  0.073   1.00 0.00 ? 47  TYR A HB3  4  
ATOM 6566  H HD1  . TYR A 1 47  ? 11.705  10.012  -1.819  1.00 0.00 ? 47  TYR A HD1  4  
ATOM 6567  H HD2  . TYR A 1 47  ? 8.740   7.748   0.225   1.00 0.00 ? 47  TYR A HD2  4  
ATOM 6568  H HE1  . TYR A 1 47  ? 11.693  8.379   -3.658  1.00 0.00 ? 47  TYR A HE1  4  
ATOM 6569  H HE2  . TYR A 1 47  ? 8.720   6.107   -1.607  1.00 0.00 ? 47  TYR A HE2  4  
ATOM 6570  H HH   . TYR A 1 47  ? 10.328  5.347   -3.414  1.00 0.00 ? 47  TYR A HH   4  
ATOM 6571  N N    . ASN A 1 48  ? 11.935  7.883   1.640   1.00 0.00 ? 48  ASN A N    4  
ATOM 6572  C CA   . ASN A 1 48  ? 12.616  6.593   1.640   1.00 0.00 ? 48  ASN A CA   4  
ATOM 6573  C C    . ASN A 1 48  ? 12.282  5.802   0.379   1.00 0.00 ? 48  ASN A C    4  
ATOM 6574  O O    . ASN A 1 48  ? 11.116  5.520   0.102   1.00 0.00 ? 48  ASN A O    4  
ATOM 6575  C CB   . ASN A 1 48  ? 12.225  5.787   2.880   1.00 0.00 ? 48  ASN A CB   4  
ATOM 6576  C CG   . ASN A 1 48  ? 12.922  6.280   4.133   1.00 0.00 ? 48  ASN A CG   4  
ATOM 6577  O OD1  . ASN A 1 48  ? 12.764  7.435   4.531   1.00 0.00 ? 48  ASN A OD1  4  
ATOM 6578  N ND2  . ASN A 1 48  ? 13.698  5.405   4.762   1.00 0.00 ? 48  ASN A ND2  4  
ATOM 6579  H H    . ASN A 1 48  ? 11.092  7.978   2.129   1.00 0.00 ? 48  ASN A H    4  
ATOM 6580  H HA   . ASN A 1 48  ? 13.679  6.779   1.663   1.00 0.00 ? 48  ASN A HA   4  
ATOM 6581  H HB2  . ASN A 1 48  ? 11.158  5.864   3.031   1.00 0.00 ? 48  ASN A HB2  4  
ATOM 6582  H HB3  . ASN A 1 48  ? 12.489  4.751   2.727   1.00 0.00 ? 48  ASN A HB3  4  
ATOM 6583  H HD21 . ASN A 1 48  ? 13.777  4.503   4.387   1.00 0.00 ? 48  ASN A HD21 4  
ATOM 6584  H HD22 . ASN A 1 48  ? 14.160  5.697   5.575   1.00 0.00 ? 48  ASN A HD22 4  
ATOM 6585  N N    . ARG A 1 49  ? 13.313  5.446   -0.380  1.00 0.00 ? 49  ARG A N    4  
ATOM 6586  C CA   . ARG A 1 49  ? 13.129  4.687   -1.612  1.00 0.00 ? 49  ARG A CA   4  
ATOM 6587  C C    . ARG A 1 49  ? 13.374  3.200   -1.376  1.00 0.00 ? 49  ARG A C    4  
ATOM 6588  O O    . ARG A 1 49  ? 12.480  2.376   -1.567  1.00 0.00 ? 49  ARG A O    4  
ATOM 6589  C CB   . ARG A 1 49  ? 14.071  5.204   -2.700  1.00 0.00 ? 49  ARG A CB   4  
ATOM 6590  C CG   . ARG A 1 49  ? 13.508  6.375   -3.488  1.00 0.00 ? 49  ARG A CG   4  
ATOM 6591  C CD   . ARG A 1 49  ? 14.072  6.420   -4.900  1.00 0.00 ? 49  ARG A CD   4  
ATOM 6592  N NE   . ARG A 1 49  ? 13.211  7.171   -5.810  1.00 0.00 ? 49  ARG A NE   4  
ATOM 6593  C CZ   . ARG A 1 49  ? 13.643  7.733   -6.933  1.00 0.00 ? 49  ARG A CZ   4  
ATOM 6594  N NH1  . ARG A 1 49  ? 14.918  7.629   -7.283  1.00 0.00 ? 49  ARG A NH1  4  
ATOM 6595  N NH2  . ARG A 1 49  ? 12.799  8.401   -7.709  1.00 0.00 ? 49  ARG A NH2  4  
ATOM 6596  H H    . ARG A 1 49  ? 14.219  5.700   -0.107  1.00 0.00 ? 49  ARG A H    4  
ATOM 6597  H HA   . ARG A 1 49  ? 12.108  4.825   -1.937  1.00 0.00 ? 49  ARG A HA   4  
ATOM 6598  H HB2  . ARG A 1 49  ? 14.995  5.521   -2.239  1.00 0.00 ? 49  ARG A HB2  4  
ATOM 6599  H HB3  . ARG A 1 49  ? 14.280  4.401   -3.390  1.00 0.00 ? 49  ARG A HB3  4  
ATOM 6600  H HG2  . ARG A 1 49  ? 12.434  6.275   -3.545  1.00 0.00 ? 49  ARG A HG2  4  
ATOM 6601  H HG3  . ARG A 1 49  ? 13.759  7.294   -2.980  1.00 0.00 ? 49  ARG A HG3  4  
ATOM 6602  H HD2  . ARG A 1 49  ? 15.044  6.889   -4.870  1.00 0.00 ? 49  ARG A HD2  4  
ATOM 6603  H HD3  . ARG A 1 49  ? 14.171  5.409   -5.265  1.00 0.00 ? 49  ARG A HD3  4  
ATOM 6604  H HE   . ARG A 1 49  ? 12.266  7.260   -5.570  1.00 0.00 ? 49  ARG A HE   4  
ATOM 6605  H HH11 . ARG A 1 49  ? 15.556  7.126   -6.701  1.00 0.00 ? 49  ARG A HH11 4  
ATOM 6606  H HH12 . ARG A 1 49  ? 15.240  8.052   -8.131  1.00 0.00 ? 49  ARG A HH12 4  
ATOM 6607  H HH21 . ARG A 1 49  ? 11.837  8.481   -7.449  1.00 0.00 ? 49  ARG A HH21 4  
ATOM 6608  H HH22 . ARG A 1 49  ? 13.125  8.824   -8.554  1.00 0.00 ? 49  ARG A HH22 4  
ATOM 6609  N N    . GLU A 1 50  ? 14.591  2.865   -0.961  1.00 0.00 ? 50  GLU A N    4  
ATOM 6610  C CA   . GLU A 1 50  ? 14.954  1.476   -0.701  1.00 0.00 ? 50  GLU A CA   4  
ATOM 6611  C C    . GLU A 1 50  ? 14.025  0.857   0.340   1.00 0.00 ? 50  GLU A C    4  
ATOM 6612  O O    . GLU A 1 50  ? 13.455  -0.211  0.121   1.00 0.00 ? 50  GLU A O    4  
ATOM 6613  C CB   . GLU A 1 50  ? 16.405  1.385   -0.224  1.00 0.00 ? 50  GLU A CB   4  
ATOM 6614  C CG   . GLU A 1 50  ? 16.696  2.233   1.003   1.00 0.00 ? 50  GLU A CG   4  
ATOM 6615  C CD   . GLU A 1 50  ? 18.178  2.500   1.189   1.00 0.00 ? 50  GLU A CD   4  
ATOM 6616  O OE1  . GLU A 1 50  ? 18.850  2.830   0.190   1.00 0.00 ? 50  GLU A OE1  4  
ATOM 6617  O OE2  . GLU A 1 50  ? 18.664  2.377   2.332   1.00 0.00 ? 50  GLU A OE2  4  
ATOM 6618  H H    . GLU A 1 50  ? 15.261  3.567   -0.827  1.00 0.00 ? 50  GLU A H    4  
ATOM 6619  H HA   . GLU A 1 50  ? 14.853  0.929   -1.626  1.00 0.00 ? 50  GLU A HA   4  
ATOM 6620  H HB2  . GLU A 1 50  ? 16.629  0.356   0.013   1.00 0.00 ? 50  GLU A HB2  4  
ATOM 6621  H HB3  . GLU A 1 50  ? 17.054  1.711   -1.023  1.00 0.00 ? 50  GLU A HB3  4  
ATOM 6622  H HG2  . GLU A 1 50  ? 16.187  3.179   0.900   1.00 0.00 ? 50  GLU A HG2  4  
ATOM 6623  H HG3  . GLU A 1 50  ? 16.325  1.719   1.877   1.00 0.00 ? 50  GLU A HG3  4  
ATOM 6624  N N    . GLU A 1 51  ? 13.879  1.537   1.473   1.00 0.00 ? 51  GLU A N    4  
ATOM 6625  C CA   . GLU A 1 51  ? 13.021  1.054   2.548   1.00 0.00 ? 51  GLU A CA   4  
ATOM 6626  C C    . GLU A 1 51  ? 11.575  0.931   2.077   1.00 0.00 ? 51  GLU A C    4  
ATOM 6627  O O    . GLU A 1 51  ? 10.949  -0.118  2.226   1.00 0.00 ? 51  GLU A O    4  
ATOM 6628  C CB   . GLU A 1 51  ? 13.098  1.992   3.754   1.00 0.00 ? 51  GLU A CB   4  
ATOM 6629  C CG   . GLU A 1 51  ? 14.312  1.752   4.636   1.00 0.00 ? 51  GLU A CG   4  
ATOM 6630  C CD   . GLU A 1 51  ? 14.512  0.285   4.965   1.00 0.00 ? 51  GLU A CD   4  
ATOM 6631  O OE1  . GLU A 1 51  ? 13.523  -0.382  5.333   1.00 0.00 ? 51  GLU A OE1  4  
ATOM 6632  O OE2  . GLU A 1 51  ? 15.660  -0.196  4.854   1.00 0.00 ? 51  GLU A OE2  4  
ATOM 6633  H H    . GLU A 1 51  ? 14.360  2.383   1.589   1.00 0.00 ? 51  GLU A H    4  
ATOM 6634  H HA   . GLU A 1 51  ? 13.375  0.077   2.841   1.00 0.00 ? 51  GLU A HA   4  
ATOM 6635  H HB2  . GLU A 1 51  ? 13.132  3.012   3.400   1.00 0.00 ? 51  GLU A HB2  4  
ATOM 6636  H HB3  . GLU A 1 51  ? 12.211  1.860   4.355   1.00 0.00 ? 51  GLU A HB3  4  
ATOM 6637  H HG2  . GLU A 1 51  ? 15.191  2.113   4.123   1.00 0.00 ? 51  GLU A HG2  4  
ATOM 6638  H HG3  . GLU A 1 51  ? 14.184  2.299   5.559   1.00 0.00 ? 51  GLU A HG3  4  
ATOM 6639  N N    . ASP A 1 52  ? 11.051  2.011   1.508   1.00 0.00 ? 52  ASP A N    4  
ATOM 6640  C CA   . ASP A 1 52  ? 9.679   2.026   1.014   1.00 0.00 ? 52  ASP A CA   4  
ATOM 6641  C C    . ASP A 1 52  ? 9.471   0.950   -0.047  1.00 0.00 ? 52  ASP A C    4  
ATOM 6642  O O    . ASP A 1 52  ? 8.416   0.320   -0.108  1.00 0.00 ? 52  ASP A O    4  
ATOM 6643  C CB   . ASP A 1 52  ? 9.336   3.401   0.438   1.00 0.00 ? 52  ASP A CB   4  
ATOM 6644  C CG   . ASP A 1 52  ? 7.843   3.607   0.279   1.00 0.00 ? 52  ASP A CG   4  
ATOM 6645  O OD1  . ASP A 1 52  ? 7.073   2.977   1.035   1.00 0.00 ? 52  ASP A OD1  4  
ATOM 6646  O OD2  . ASP A 1 52  ? 7.444   4.398   -0.601  1.00 0.00 ? 52  ASP A OD2  4  
ATOM 6647  H H    . ASP A 1 52  ? 11.600  2.818   1.418   1.00 0.00 ? 52  ASP A H    4  
ATOM 6648  H HA   . ASP A 1 52  ? 9.024   1.823   1.848   1.00 0.00 ? 52  ASP A HA   4  
ATOM 6649  H HB2  . ASP A 1 52  ? 9.717   4.166   1.099   1.00 0.00 ? 52  ASP A HB2  4  
ATOM 6650  H HB3  . ASP A 1 52  ? 9.801   3.504   -0.531  1.00 0.00 ? 52  ASP A HB3  4  
ATOM 6651  N N    . ALA A 1 53  ? 10.485  0.747   -0.882  1.00 0.00 ? 53  ALA A N    4  
ATOM 6652  C CA   . ALA A 1 53  ? 10.415  -0.253  -1.940  1.00 0.00 ? 53  ALA A CA   4  
ATOM 6653  C C    . ALA A 1 53  ? 10.433  -1.665  -1.363  1.00 0.00 ? 53  ALA A C    4  
ATOM 6654  O O    . ALA A 1 53  ? 9.777   -2.566  -1.883  1.00 0.00 ? 53  ALA A O    4  
ATOM 6655  C CB   . ALA A 1 53  ? 11.563  -0.066  -2.920  1.00 0.00 ? 53  ALA A CB   4  
ATOM 6656  H H    . ALA A 1 53  ? 11.301  1.281   -0.783  1.00 0.00 ? 53  ALA A H    4  
ATOM 6657  H HA   . ALA A 1 53  ? 9.488   -0.107  -2.477  1.00 0.00 ? 53  ALA A HA   4  
ATOM 6658  H HB1  . ALA A 1 53  ? 11.320  -0.551  -3.855  1.00 0.00 ? 53  ALA A HB1  4  
ATOM 6659  H HB2  . ALA A 1 53  ? 11.722  0.988   -3.092  1.00 0.00 ? 53  ALA A HB2  4  
ATOM 6660  H HB3  . ALA A 1 53  ? 12.461  -0.504  -2.510  1.00 0.00 ? 53  ALA A HB3  4  
ATOM 6661  N N    . ALA A 1 54  ? 11.190  -1.849  -0.286  1.00 0.00 ? 54  ALA A N    4  
ATOM 6662  C CA   . ALA A 1 54  ? 11.292  -3.151  0.361   1.00 0.00 ? 54  ALA A CA   4  
ATOM 6663  C C    . ALA A 1 54  ? 9.955   -3.883  0.338   1.00 0.00 ? 54  ALA A C    4  
ATOM 6664  O O    . ALA A 1 54  ? 9.889   -5.067  0.005   1.00 0.00 ? 54  ALA A O    4  
ATOM 6665  C CB   . ALA A 1 54  ? 11.784  -2.991  1.792   1.00 0.00 ? 54  ALA A CB   4  
ATOM 6666  H H    . ALA A 1 54  ? 11.690  -1.091  0.082   1.00 0.00 ? 54  ALA A H    4  
ATOM 6667  H HA   . ALA A 1 54  ? 12.021  -3.737  -0.180  1.00 0.00 ? 54  ALA A HA   4  
ATOM 6668  H HB1  . ALA A 1 54  ? 12.091  -1.968  1.954   1.00 0.00 ? 54  ALA A HB1  4  
ATOM 6669  H HB2  . ALA A 1 54  ? 10.987  -3.241  2.476   1.00 0.00 ? 54  ALA A HB2  4  
ATOM 6670  H HB3  . ALA A 1 54  ? 12.623  -3.650  1.960   1.00 0.00 ? 54  ALA A HB3  4  
ATOM 6671  N N    . LEU A 1 55  ? 8.891   -3.172  0.695   1.00 0.00 ? 55  LEU A N    4  
ATOM 6672  C CA   . LEU A 1 55  ? 7.553   -3.754  0.715   1.00 0.00 ? 55  LEU A CA   4  
ATOM 6673  C C    . LEU A 1 55  ? 7.111   -4.152  -0.689  1.00 0.00 ? 55  LEU A C    4  
ATOM 6674  O O    . LEU A 1 55  ? 6.957   -5.335  -0.992  1.00 0.00 ? 55  LEU A O    4  
ATOM 6675  C CB   . LEU A 1 55  ? 6.554   -2.764  1.316   1.00 0.00 ? 55  LEU A CB   4  
ATOM 6676  C CG   . LEU A 1 55  ? 5.077   -3.139  1.185   1.00 0.00 ? 55  LEU A CG   4  
ATOM 6677  C CD1  . LEU A 1 55  ? 4.699   -4.189  2.218   1.00 0.00 ? 55  LEU A CD1  4  
ATOM 6678  C CD2  . LEU A 1 55  ? 4.199   -1.904  1.331   1.00 0.00 ? 55  LEU A CD2  4  
ATOM 6679  H H    . LEU A 1 55  ? 9.006   -2.233  0.950   1.00 0.00 ? 55  LEU A H    4  
ATOM 6680  H HA   . LEU A 1 55  ? 7.587   -4.639  1.333   1.00 0.00 ? 55  LEU A HA   4  
ATOM 6681  H HB2  . LEU A 1 55  ? 6.778   -2.666  2.367   1.00 0.00 ? 55  LEU A HB2  4  
ATOM 6682  H HB3  . LEU A 1 55  ? 6.699   -1.811  0.828   1.00 0.00 ? 55  LEU A HB3  4  
ATOM 6683  H HG   . LEU A 1 55  ? 4.904   -3.559  0.204   1.00 0.00 ? 55  LEU A HG   4  
ATOM 6684  H HD11 . LEU A 1 55  ? 5.595   -4.643  2.614   1.00 0.00 ? 55  LEU A HD11 4  
ATOM 6685  H HD12 . LEU A 1 55  ? 4.087   -4.947  1.752   1.00 0.00 ? 55  LEU A HD12 4  
ATOM 6686  H HD13 . LEU A 1 55  ? 4.146   -3.723  3.020   1.00 0.00 ? 55  LEU A HD13 4  
ATOM 6687  H HD21 . LEU A 1 55  ? 3.278   -2.175  1.826   1.00 0.00 ? 55  LEU A HD21 4  
ATOM 6688  H HD22 . LEU A 1 55  ? 3.978   -1.502  0.353   1.00 0.00 ? 55  LEU A HD22 4  
ATOM 6689  H HD23 . LEU A 1 55  ? 4.718   -1.161  1.918   1.00 0.00 ? 55  LEU A HD23 4  
ATOM 6690  N N    . PHE A 1 56  ? 6.909   -3.155  -1.545  1.00 0.00 ? 56  PHE A N    4  
ATOM 6691  C CA   . PHE A 1 56  ? 6.485   -3.400  -2.918  1.00 0.00 ? 56  PHE A CA   4  
ATOM 6692  C C    . PHE A 1 56  ? 7.334   -4.492  -3.562  1.00 0.00 ? 56  PHE A C    4  
ATOM 6693  O O    . PHE A 1 56  ? 6.817   -5.522  -3.996  1.00 0.00 ? 56  PHE A O    4  
ATOM 6694  C CB   . PHE A 1 56  ? 6.579   -2.113  -3.741  1.00 0.00 ? 56  PHE A CB   4  
ATOM 6695  C CG   . PHE A 1 56  ? 5.837   -0.958  -3.133  1.00 0.00 ? 56  PHE A CG   4  
ATOM 6696  C CD1  . PHE A 1 56  ? 4.496   -0.753  -3.416  1.00 0.00 ? 56  PHE A CD1  4  
ATOM 6697  C CD2  . PHE A 1 56  ? 6.480   -0.076  -2.279  1.00 0.00 ? 56  PHE A CD2  4  
ATOM 6698  C CE1  . PHE A 1 56  ? 3.811   0.310   -2.859  1.00 0.00 ? 56  PHE A CE1  4  
ATOM 6699  C CE2  . PHE A 1 56  ? 5.800   0.988   -1.719  1.00 0.00 ? 56  PHE A CE2  4  
ATOM 6700  C CZ   . PHE A 1 56  ? 4.463   1.181   -2.008  1.00 0.00 ? 56  PHE A CZ   4  
ATOM 6701  H H    . PHE A 1 56  ? 7.048   -2.232  -1.245  1.00 0.00 ? 56  PHE A H    4  
ATOM 6702  H HA   . PHE A 1 56  ? 5.457   -3.727  -2.894  1.00 0.00 ? 56  PHE A HA   4  
ATOM 6703  H HB2  . PHE A 1 56  ? 7.617   -1.829  -3.834  1.00 0.00 ? 56  PHE A HB2  4  
ATOM 6704  H HB3  . PHE A 1 56  ? 6.170   -2.293  -4.724  1.00 0.00 ? 56  PHE A HB3  4  
ATOM 6705  H HD1  . PHE A 1 56  ? 3.984   -1.434  -4.080  1.00 0.00 ? 56  PHE A HD1  4  
ATOM 6706  H HD2  . PHE A 1 56  ? 7.526   -0.227  -2.052  1.00 0.00 ? 56  PHE A HD2  4  
ATOM 6707  H HE1  . PHE A 1 56  ? 2.766   0.459   -3.087  1.00 0.00 ? 56  PHE A HE1  4  
ATOM 6708  H HE2  . PHE A 1 56  ? 6.313   1.667   -1.054  1.00 0.00 ? 56  PHE A HE2  4  
ATOM 6709  H HZ   . PHE A 1 56  ? 3.930   2.013   -1.572  1.00 0.00 ? 56  PHE A HZ   4  
ATOM 6710  N N    . LYS A 1 57  ? 8.641   -4.260  -3.622  1.00 0.00 ? 57  LYS A N    4  
ATOM 6711  C CA   . LYS A 1 57  ? 9.563   -5.222  -4.212  1.00 0.00 ? 57  LYS A CA   4  
ATOM 6712  C C    . LYS A 1 57  ? 9.252   -6.637  -3.735  1.00 0.00 ? 57  LYS A C    4  
ATOM 6713  O O    . LYS A 1 57  ? 9.128   -7.560  -4.540  1.00 0.00 ? 57  LYS A O    4  
ATOM 6714  C CB   . LYS A 1 57  ? 11.007  -4.859  -3.857  1.00 0.00 ? 57  LYS A CB   4  
ATOM 6715  C CG   . LYS A 1 57  ? 12.041  -5.584  -4.701  1.00 0.00 ? 57  LYS A CG   4  
ATOM 6716  C CD   . LYS A 1 57  ? 13.456  -5.194  -4.306  1.00 0.00 ? 57  LYS A CD   4  
ATOM 6717  C CE   . LYS A 1 57  ? 14.484  -5.787  -5.257  1.00 0.00 ? 57  LYS A CE   4  
ATOM 6718  N NZ   . LYS A 1 57  ? 15.839  -5.209  -5.040  1.00 0.00 ? 57  LYS A NZ   4  
ATOM 6719  H H    . LYS A 1 57  ? 8.993   -3.420  -3.259  1.00 0.00 ? 57  LYS A H    4  
ATOM 6720  H HA   . LYS A 1 57  ? 9.444   -5.182  -5.284  1.00 0.00 ? 57  LYS A HA   4  
ATOM 6721  H HB2  . LYS A 1 57  ? 11.142  -3.796  -3.994  1.00 0.00 ? 57  LYS A HB2  4  
ATOM 6722  H HB3  . LYS A 1 57  ? 11.183  -5.105  -2.820  1.00 0.00 ? 57  LYS A HB3  4  
ATOM 6723  H HG2  . LYS A 1 57  ? 11.922  -6.649  -4.564  1.00 0.00 ? 57  LYS A HG2  4  
ATOM 6724  H HG3  . LYS A 1 57  ? 11.885  -5.333  -5.740  1.00 0.00 ? 57  LYS A HG3  4  
ATOM 6725  H HD2  . LYS A 1 57  ? 13.542  -4.117  -4.327  1.00 0.00 ? 57  LYS A HD2  4  
ATOM 6726  H HD3  . LYS A 1 57  ? 13.654  -5.553  -3.306  1.00 0.00 ? 57  LYS A HD3  4  
ATOM 6727  H HE2  . LYS A 1 57  ? 14.527  -6.853  -5.100  1.00 0.00 ? 57  LYS A HE2  4  
ATOM 6728  H HE3  . LYS A 1 57  ? 14.174  -5.585  -6.272  1.00 0.00 ? 57  LYS A HE3  4  
ATOM 6729  H HZ1  . LYS A 1 57  ? 16.066  -4.536  -5.800  1.00 0.00 ? 57  LYS A HZ1  4  
ATOM 6730  H HZ2  . LYS A 1 57  ? 16.553  -5.964  -5.037  1.00 0.00 ? 57  LYS A HZ2  4  
ATOM 6731  H HZ3  . LYS A 1 57  ? 15.873  -4.710  -4.128  1.00 0.00 ? 57  LYS A HZ3  4  
ATOM 6732  N N    . ALA A 1 58  ? 9.126   -6.800  -2.422  1.00 0.00 ? 58  ALA A N    4  
ATOM 6733  C CA   . ALA A 1 58  ? 8.825   -8.102  -1.840  1.00 0.00 ? 58  ALA A CA   4  
ATOM 6734  C C    . ALA A 1 58  ? 7.631   -8.751  -2.531  1.00 0.00 ? 58  ALA A C    4  
ATOM 6735  O O    . ALA A 1 58  ? 7.628   -9.956  -2.783  1.00 0.00 ? 58  ALA A O    4  
ATOM 6736  C CB   . ALA A 1 58  ? 8.562   -7.964  -0.347  1.00 0.00 ? 58  ALA A CB   4  
ATOM 6737  H H    . ALA A 1 58  ? 9.236   -6.026  -1.832  1.00 0.00 ? 58  ALA A H    4  
ATOM 6738  H HA   . ALA A 1 58  ? 9.692   -8.734  -1.970  1.00 0.00 ? 58  ALA A HA   4  
ATOM 6739  H HB1  . ALA A 1 58  ? 9.484   -7.719  0.159   1.00 0.00 ? 58  ALA A HB1  4  
ATOM 6740  H HB2  . ALA A 1 58  ? 7.840   -7.179  -0.181  1.00 0.00 ? 58  ALA A HB2  4  
ATOM 6741  H HB3  . ALA A 1 58  ? 8.176   -8.896  0.038   1.00 0.00 ? 58  ALA A HB3  4  
ATOM 6742  N N    . TRP A 1 59  ? 6.620   -7.945  -2.835  1.00 0.00 ? 59  TRP A N    4  
ATOM 6743  C CA   . TRP A 1 59  ? 5.420   -8.442  -3.498  1.00 0.00 ? 59  TRP A CA   4  
ATOM 6744  C C    . TRP A 1 59  ? 5.762   -9.077  -4.841  1.00 0.00 ? 59  TRP A C    4  
ATOM 6745  O O    . TRP A 1 59  ? 5.218   -10.120 -5.202  1.00 0.00 ? 59  TRP A O    4  
ATOM 6746  C CB   . TRP A 1 59  ? 4.415   -7.306  -3.698  1.00 0.00 ? 59  TRP A CB   4  
ATOM 6747  C CG   . TRP A 1 59  ? 3.167   -7.735  -4.409  1.00 0.00 ? 59  TRP A CG   4  
ATOM 6748  C CD1  . TRP A 1 59  ? 2.813   -7.438  -5.694  1.00 0.00 ? 59  TRP A CD1  4  
ATOM 6749  C CD2  . TRP A 1 59  ? 2.108   -8.536  -3.873  1.00 0.00 ? 59  TRP A CD2  4  
ATOM 6750  N NE1  . TRP A 1 59  ? 1.598   -8.007  -5.990  1.00 0.00 ? 59  TRP A NE1  4  
ATOM 6751  C CE2  . TRP A 1 59  ? 1.145   -8.686  -4.890  1.00 0.00 ? 59  TRP A CE2  4  
ATOM 6752  C CE3  . TRP A 1 59  ? 1.881   -9.143  -2.635  1.00 0.00 ? 59  TRP A CE3  4  
ATOM 6753  C CZ2  . TRP A 1 59  ? -0.026  -9.417  -4.704  1.00 0.00 ? 59  TRP A CZ2  4  
ATOM 6754  C CZ3  . TRP A 1 59  ? 0.718   -9.867  -2.452  1.00 0.00 ? 59  TRP A CZ3  4  
ATOM 6755  C CH2  . TRP A 1 59  ? -0.223  -10.000 -3.482  1.00 0.00 ? 59  TRP A CH2  4  
ATOM 6756  H H    . TRP A 1 59  ? 6.682   -6.993  -2.609  1.00 0.00 ? 59  TRP A H    4  
ATOM 6757  H HA   . TRP A 1 59  ? 4.977   -9.194  -2.860  1.00 0.00 ? 59  TRP A HA   4  
ATOM 6758  H HB2  . TRP A 1 59  ? 4.130   -6.912  -2.734  1.00 0.00 ? 59  TRP A HB2  4  
ATOM 6759  H HB3  . TRP A 1 59  ? 4.879   -6.524  -4.280  1.00 0.00 ? 59  TRP A HB3  4  
ATOM 6760  H HD1  . TRP A 1 59  ? 3.410   -6.842  -6.366  1.00 0.00 ? 59  TRP A HD1  4  
ATOM 6761  H HE1  . TRP A 1 59  ? 1.132   -7.938  -6.850  1.00 0.00 ? 59  TRP A HE1  4  
ATOM 6762  H HE3  . TRP A 1 59  ? 2.594   -9.052  -1.830  1.00 0.00 ? 59  TRP A HE3  4  
ATOM 6763  H HZ2  . TRP A 1 59  ? -0.761  -9.529  -5.488  1.00 0.00 ? 59  TRP A HZ2  4  
ATOM 6764  H HZ3  . TRP A 1 59  ? 0.525   -10.343 -1.502  1.00 0.00 ? 59  TRP A HZ3  4  
ATOM 6765  H HH2  . TRP A 1 59  ? -1.117  -10.575 -3.294  1.00 0.00 ? 59  TRP A HH2  4  
ATOM 6766  N N    . ALA A 1 60  ? 6.668   -8.441  -5.577  1.00 0.00 ? 60  ALA A N    4  
ATOM 6767  C CA   . ALA A 1 60  ? 7.084   -8.945  -6.880  1.00 0.00 ? 60  ALA A CA   4  
ATOM 6768  C C    . ALA A 1 60  ? 7.807   -10.281 -6.746  1.00 0.00 ? 60  ALA A C    4  
ATOM 6769  O O    . ALA A 1 60  ? 7.438   -11.265 -7.387  1.00 0.00 ? 60  ALA A O    4  
ATOM 6770  C CB   . ALA A 1 60  ? 7.974   -7.928  -7.579  1.00 0.00 ? 60  ALA A CB   4  
ATOM 6771  H H    . ALA A 1 60  ? 7.066   -7.613  -5.235  1.00 0.00 ? 60  ALA A H    4  
ATOM 6772  H HA   . ALA A 1 60  ? 6.198   -9.085  -7.482  1.00 0.00 ? 60  ALA A HA   4  
ATOM 6773  H HB1  . ALA A 1 60  ? 8.404   -8.376  -8.464  1.00 0.00 ? 60  ALA A HB1  4  
ATOM 6774  H HB2  . ALA A 1 60  ? 7.386   -7.068  -7.860  1.00 0.00 ? 60  ALA A HB2  4  
ATOM 6775  H HB3  . ALA A 1 60  ? 8.765   -7.622  -6.910  1.00 0.00 ? 60  ALA A HB3  4  
ATOM 6776  N N    . LEU A 1 61  ? 8.840   -10.308 -5.911  1.00 0.00 ? 61  LEU A N    4  
ATOM 6777  C CA   . LEU A 1 61  ? 9.616   -11.523 -5.693  1.00 0.00 ? 61  LEU A CA   4  
ATOM 6778  C C    . LEU A 1 61  ? 8.735   -12.641 -5.145  1.00 0.00 ? 61  LEU A C    4  
ATOM 6779  O O    . LEU A 1 61  ? 8.849   -13.795 -5.559  1.00 0.00 ? 61  LEU A O    4  
ATOM 6780  C CB   . LEU A 1 61  ? 10.771  -11.249 -4.728  1.00 0.00 ? 61  LEU A CB   4  
ATOM 6781  C CG   . LEU A 1 61  ? 11.834  -10.264 -5.216  1.00 0.00 ? 61  LEU A CG   4  
ATOM 6782  C CD1  . LEU A 1 61  ? 12.483  -9.552  -4.039  1.00 0.00 ? 61  LEU A CD1  4  
ATOM 6783  C CD2  . LEU A 1 61  ? 12.883  -10.982 -6.052  1.00 0.00 ? 61  LEU A CD2  4  
ATOM 6784  H H    . LEU A 1 61  ? 9.087   -9.492  -5.428  1.00 0.00 ? 61  LEU A H    4  
ATOM 6785  H HA   . LEU A 1 61  ? 10.020  -11.834 -6.645  1.00 0.00 ? 61  LEU A HA   4  
ATOM 6786  H HB2  . LEU A 1 61  ? 10.352  -10.857 -3.814  1.00 0.00 ? 61  LEU A HB2  4  
ATOM 6787  H HB3  . LEU A 1 61  ? 11.260  -12.190 -4.523  1.00 0.00 ? 61  LEU A HB3  4  
ATOM 6788  H HG   . LEU A 1 61  ? 11.363  -9.516  -5.839  1.00 0.00 ? 61  LEU A HG   4  
ATOM 6789  H HD11 . LEU A 1 61  ? 12.271  -10.094 -3.130  1.00 0.00 ? 61  LEU A HD11 4  
ATOM 6790  H HD12 . LEU A 1 61  ? 12.086  -8.550  -3.961  1.00 0.00 ? 61  LEU A HD12 4  
ATOM 6791  H HD13 . LEU A 1 61  ? 13.551  -9.505  -4.191  1.00 0.00 ? 61  LEU A HD13 4  
ATOM 6792  H HD21 . LEU A 1 61  ? 13.072  -11.958 -5.630  1.00 0.00 ? 61  LEU A HD21 4  
ATOM 6793  H HD22 . LEU A 1 61  ? 13.798  -10.407 -6.052  1.00 0.00 ? 61  LEU A HD22 4  
ATOM 6794  H HD23 . LEU A 1 61  ? 12.524  -11.090 -7.064  1.00 0.00 ? 61  LEU A HD23 4  
ATOM 6795  N N    . PHE A 1 62  ? 7.856   -12.291 -4.212  1.00 0.00 ? 62  PHE A N    4  
ATOM 6796  C CA   . PHE A 1 62  ? 6.954   -13.264 -3.608  1.00 0.00 ? 62  PHE A CA   4  
ATOM 6797  C C    . PHE A 1 62  ? 5.965   -13.803 -4.638  1.00 0.00 ? 62  PHE A C    4  
ATOM 6798  O O    . PHE A 1 62  ? 5.882   -15.010 -4.864  1.00 0.00 ? 62  PHE A O    4  
ATOM 6799  C CB   . PHE A 1 62  ? 6.195   -12.632 -2.439  1.00 0.00 ? 62  PHE A CB   4  
ATOM 6800  C CG   . PHE A 1 62  ? 4.973   -13.403 -2.030  1.00 0.00 ? 62  PHE A CG   4  
ATOM 6801  C CD1  . PHE A 1 62  ? 3.787   -13.270 -2.733  1.00 0.00 ? 62  PHE A CD1  4  
ATOM 6802  C CD2  . PHE A 1 62  ? 5.010   -14.261 -0.943  1.00 0.00 ? 62  PHE A CD2  4  
ATOM 6803  C CE1  . PHE A 1 62  ? 2.660   -13.978 -2.358  1.00 0.00 ? 62  PHE A CE1  4  
ATOM 6804  C CE2  . PHE A 1 62  ? 3.887   -14.971 -0.563  1.00 0.00 ? 62  PHE A CE2  4  
ATOM 6805  C CZ   . PHE A 1 62  ? 2.711   -14.830 -1.273  1.00 0.00 ? 62  PHE A CZ   4  
ATOM 6806  H H    . PHE A 1 62  ? 7.813   -11.355 -3.923  1.00 0.00 ? 62  PHE A H    4  
ATOM 6807  H HA   . PHE A 1 62  ? 7.551   -14.083 -3.237  1.00 0.00 ? 62  PHE A HA   4  
ATOM 6808  H HB2  . PHE A 1 62  ? 6.851   -12.573 -1.584  1.00 0.00 ? 62  PHE A HB2  4  
ATOM 6809  H HB3  . PHE A 1 62  ? 5.884   -11.637 -2.718  1.00 0.00 ? 62  PHE A HB3  4  
ATOM 6810  H HD1  . PHE A 1 62  ? 3.745   -12.605 -3.583  1.00 0.00 ? 62  PHE A HD1  4  
ATOM 6811  H HD2  . PHE A 1 62  ? 5.931   -14.372 -0.387  1.00 0.00 ? 62  PHE A HD2  4  
ATOM 6812  H HE1  . PHE A 1 62  ? 1.742   -13.866 -2.915  1.00 0.00 ? 62  PHE A HE1  4  
ATOM 6813  H HE2  . PHE A 1 62  ? 3.931   -15.637 0.286   1.00 0.00 ? 62  PHE A HE2  4  
ATOM 6814  H HZ   . PHE A 1 62  ? 1.832   -15.384 -0.978  1.00 0.00 ? 62  PHE A HZ   4  
ATOM 6815  N N    . LYS A 1 63  ? 5.217   -12.898 -5.260  1.00 0.00 ? 63  LYS A N    4  
ATOM 6816  C CA   . LYS A 1 63  ? 4.234   -13.280 -6.267  1.00 0.00 ? 63  LYS A CA   4  
ATOM 6817  C C    . LYS A 1 63  ? 4.897   -14.025 -7.421  1.00 0.00 ? 63  LYS A C    4  
ATOM 6818  O O    . LYS A 1 63  ? 4.636   -15.206 -7.641  1.00 0.00 ? 63  LYS A O    4  
ATOM 6819  C CB   . LYS A 1 63  ? 3.508   -12.041 -6.796  1.00 0.00 ? 63  LYS A CB   4  
ATOM 6820  C CG   . LYS A 1 63  ? 2.649   -11.347 -5.754  1.00 0.00 ? 63  LYS A CG   4  
ATOM 6821  C CD   . LYS A 1 63  ? 1.453   -12.198 -5.361  1.00 0.00 ? 63  LYS A CD   4  
ATOM 6822  C CE   . LYS A 1 63  ? 0.450   -12.309 -6.499  1.00 0.00 ? 63  LYS A CE   4  
ATOM 6823  N NZ   . LYS A 1 63  ? -0.862  -12.835 -6.032  1.00 0.00 ? 63  LYS A NZ   4  
ATOM 6824  H H    . LYS A 1 63  ? 5.329   -11.950 -5.037  1.00 0.00 ? 63  LYS A H    4  
ATOM 6825  H HA   . LYS A 1 63  ? 3.515   -13.934 -5.798  1.00 0.00 ? 63  LYS A HA   4  
ATOM 6826  H HB2  . LYS A 1 63  ? 4.242   -11.334 -7.156  1.00 0.00 ? 63  LYS A HB2  4  
ATOM 6827  H HB3  . LYS A 1 63  ? 2.872   -12.335 -7.619  1.00 0.00 ? 63  LYS A HB3  4  
ATOM 6828  H HG2  . LYS A 1 63  ? 3.247   -11.158 -4.875  1.00 0.00 ? 63  LYS A HG2  4  
ATOM 6829  H HG3  . LYS A 1 63  ? 2.295   -10.409 -6.158  1.00 0.00 ? 63  LYS A HG3  4  
ATOM 6830  H HD2  . LYS A 1 63  ? 1.797   -13.188 -5.101  1.00 0.00 ? 63  LYS A HD2  4  
ATOM 6831  H HD3  . LYS A 1 63  ? 0.967   -11.748 -4.507  1.00 0.00 ? 63  LYS A HD3  4  
ATOM 6832  H HE2  . LYS A 1 63  ? 0.304   -11.331 -6.929  1.00 0.00 ? 63  LYS A HE2  4  
ATOM 6833  H HE3  . LYS A 1 63  ? 0.850   -12.976 -7.249  1.00 0.00 ? 63  LYS A HE3  4  
ATOM 6834  H HZ1  . LYS A 1 63  ? -1.445  -13.114 -6.847  1.00 0.00 ? 63  LYS A HZ1  4  
ATOM 6835  H HZ2  . LYS A 1 63  ? -1.368  -12.105 -5.492  1.00 0.00 ? 63  LYS A HZ2  4  
ATOM 6836  H HZ3  . LYS A 1 63  ? -0.718  -13.665 -5.422  1.00 0.00 ? 63  LYS A HZ3  4  
ATOM 6837  N N    . GLY A 1 64  ? 5.759   -13.325 -8.154  1.00 0.00 ? 64  GLY A N    4  
ATOM 6838  C CA   . GLY A 1 64  ? 6.448   -13.938 -9.274  1.00 0.00 ? 64  GLY A CA   4  
ATOM 6839  C C    . GLY A 1 64  ? 7.894   -14.265 -8.958  1.00 0.00 ? 64  GLY A C    4  
ATOM 6840  O O    . GLY A 1 64  ? 8.232   -14.580 -7.817  1.00 0.00 ? 64  GLY A O    4  
ATOM 6841  H H    . GLY A 1 64  ? 5.928   -12.386 -7.931  1.00 0.00 ? 64  GLY A H    4  
ATOM 6842  H HA2  . GLY A 1 64  ? 5.934   -14.848 -9.544  1.00 0.00 ? 64  GLY A HA2  4  
ATOM 6843  H HA3  . GLY A 1 64  ? 6.420   -13.258 -10.114 1.00 0.00 ? 64  GLY A HA3  4  
ATOM 6844  N N    . LYS A 1 65  ? 8.750   -14.192 -9.971  1.00 0.00 ? 65  LYS A N    4  
ATOM 6845  C CA   . LYS A 1 65  ? 10.169  -14.483 -9.797  1.00 0.00 ? 65  LYS A CA   4  
ATOM 6846  C C    . LYS A 1 65  ? 11.029  -13.432 -10.492 1.00 0.00 ? 65  LYS A C    4  
ATOM 6847  O O    . LYS A 1 65  ? 11.071  -13.364 -11.721 1.00 0.00 ? 65  LYS A O    4  
ATOM 6848  C CB   . LYS A 1 65  ? 10.497  -15.872 -10.348 1.00 0.00 ? 65  LYS A CB   4  
ATOM 6849  C CG   . LYS A 1 65  ? 10.316  -16.987 -9.333  1.00 0.00 ? 65  LYS A CG   4  
ATOM 6850  C CD   . LYS A 1 65  ? 11.588  -17.231 -8.539  1.00 0.00 ? 65  LYS A CD   4  
ATOM 6851  C CE   . LYS A 1 65  ? 12.479  -18.261 -9.216  1.00 0.00 ? 65  LYS A CE   4  
ATOM 6852  N NZ   . LYS A 1 65  ? 13.587  -18.707 -8.326  1.00 0.00 ? 65  LYS A NZ   4  
ATOM 6853  H H    . LYS A 1 65  ? 8.421   -13.935 -10.858 1.00 0.00 ? 65  LYS A H    4  
ATOM 6854  H HA   . LYS A 1 65  ? 10.384  -14.464 -8.739  1.00 0.00 ? 65  LYS A HA   4  
ATOM 6855  H HB2  . LYS A 1 65  ? 9.852   -16.073 -11.191 1.00 0.00 ? 65  LYS A HB2  4  
ATOM 6856  H HB3  . LYS A 1 65  ? 11.525  -15.881 -10.681 1.00 0.00 ? 65  LYS A HB3  4  
ATOM 6857  H HG2  . LYS A 1 65  ? 9.525   -16.716 -8.650  1.00 0.00 ? 65  LYS A HG2  4  
ATOM 6858  H HG3  . LYS A 1 65  ? 10.048  -17.896 -9.853  1.00 0.00 ? 65  LYS A HG3  4  
ATOM 6859  H HD2  . LYS A 1 65  ? 12.132  -16.302 -8.454  1.00 0.00 ? 65  LYS A HD2  4  
ATOM 6860  H HD3  . LYS A 1 65  ? 11.325  -17.587 -7.553  1.00 0.00 ? 65  LYS A HD3  4  
ATOM 6861  H HE2  . LYS A 1 65  ? 11.878  -19.116 -9.484  1.00 0.00 ? 65  LYS A HE2  4  
ATOM 6862  H HE3  . LYS A 1 65  ? 12.900  -17.822 -10.108 1.00 0.00 ? 65  LYS A HE3  4  
ATOM 6863  H HZ1  . LYS A 1 65  ? 14.401  -19.014 -8.895  1.00 0.00 ? 65  LYS A HZ1  4  
ATOM 6864  H HZ2  . LYS A 1 65  ? 13.272  -19.503 -7.735  1.00 0.00 ? 65  LYS A HZ2  4  
ATOM 6865  H HZ3  . LYS A 1 65  ? 13.885  -17.926 -7.707  1.00 0.00 ? 65  LYS A HZ3  4  
ATOM 6866  N N    . PHE A 1 66  ? 11.715  -12.617 -9.699  1.00 0.00 ? 66  PHE A N    4  
ATOM 6867  C CA   . PHE A 1 66  ? 12.575  -11.570 -10.238 1.00 0.00 ? 66  PHE A CA   4  
ATOM 6868  C C    . PHE A 1 66  ? 13.941  -11.584 -9.558  1.00 0.00 ? 66  PHE A C    4  
ATOM 6869  O O    . PHE A 1 66  ? 14.085  -12.081 -8.441  1.00 0.00 ? 66  PHE A O    4  
ATOM 6870  C CB   . PHE A 1 66  ? 11.919  -10.199 -10.061 1.00 0.00 ? 66  PHE A CB   4  
ATOM 6871  C CG   . PHE A 1 66  ? 12.903  -9.067  -9.999  1.00 0.00 ? 66  PHE A CG   4  
ATOM 6872  C CD1  . PHE A 1 66  ? 13.639  -8.832  -8.848  1.00 0.00 ? 66  PHE A CD1  4  
ATOM 6873  C CD2  . PHE A 1 66  ? 13.094  -8.236  -11.091 1.00 0.00 ? 66  PHE A CD2  4  
ATOM 6874  C CE1  . PHE A 1 66  ? 14.546  -7.791  -8.788  1.00 0.00 ? 66  PHE A CE1  4  
ATOM 6875  C CE2  . PHE A 1 66  ? 13.999  -7.194  -11.037 1.00 0.00 ? 66  PHE A CE2  4  
ATOM 6876  C CZ   . PHE A 1 66  ? 14.726  -6.970  -9.883  1.00 0.00 ? 66  PHE A CZ   4  
ATOM 6877  H H    . PHE A 1 66  ? 11.641  -12.721 -8.727  1.00 0.00 ? 66  PHE A H    4  
ATOM 6878  H HA   . PHE A 1 66  ? 12.708  -11.762 -11.292 1.00 0.00 ? 66  PHE A HA   4  
ATOM 6879  H HB2  . PHE A 1 66  ? 11.255  -10.016 -10.892 1.00 0.00 ? 66  PHE A HB2  4  
ATOM 6880  H HB3  . PHE A 1 66  ? 11.350  -10.197 -9.143  1.00 0.00 ? 66  PHE A HB3  4  
ATOM 6881  H HD1  . PHE A 1 66  ? 13.498  -9.474  -7.989  1.00 0.00 ? 66  PHE A HD1  4  
ATOM 6882  H HD2  . PHE A 1 66  ? 12.526  -8.408  -11.994 1.00 0.00 ? 66  PHE A HD2  4  
ATOM 6883  H HE1  . PHE A 1 66  ? 15.112  -7.620  -7.884  1.00 0.00 ? 66  PHE A HE1  4  
ATOM 6884  H HE2  . PHE A 1 66  ? 14.138  -6.553  -11.895 1.00 0.00 ? 66  PHE A HE2  4  
ATOM 6885  H HZ   . PHE A 1 66  ? 15.434  -6.157  -9.839  1.00 0.00 ? 66  PHE A HZ   4  
ATOM 6886  N N    . ARG A 1 67  ? 14.941  -11.036 -10.241 1.00 0.00 ? 67  ARG A N    4  
ATOM 6887  C CA   . ARG A 1 67  ? 16.296  -10.986 -9.705  1.00 0.00 ? 67  ARG A CA   4  
ATOM 6888  C C    . ARG A 1 67  ? 16.791  -9.546  -9.610  1.00 0.00 ? 67  ARG A C    4  
ATOM 6889  O O    . ARG A 1 67  ? 16.609  -8.755  -10.535 1.00 0.00 ? 67  ARG A O    4  
ATOM 6890  C CB   . ARG A 1 67  ? 17.244  -11.806 -10.582 1.00 0.00 ? 67  ARG A CB   4  
ATOM 6891  C CG   . ARG A 1 67  ? 16.822  -13.257 -10.744 1.00 0.00 ? 67  ARG A CG   4  
ATOM 6892  C CD   . ARG A 1 67  ? 17.440  -14.140 -9.671  1.00 0.00 ? 67  ARG A CD   4  
ATOM 6893  N NE   . ARG A 1 67  ? 16.861  -15.481 -9.665  1.00 0.00 ? 67  ARG A NE   4  
ATOM 6894  C CZ   . ARG A 1 67  ? 17.518  -16.564 -9.267  1.00 0.00 ? 67  ARG A CZ   4  
ATOM 6895  N NH1  . ARG A 1 67  ? 18.771  -16.465 -8.845  1.00 0.00 ? 67  ARG A NH1  4  
ATOM 6896  N NH2  . ARG A 1 67  ? 16.923  -17.749 -9.290  1.00 0.00 ? 67  ARG A NH2  4  
ATOM 6897  H H    . ARG A 1 67  ? 14.763  -10.656 -11.127 1.00 0.00 ? 67  ARG A H    4  
ATOM 6898  H HA   . ARG A 1 67  ? 16.276  -11.414 -8.714  1.00 0.00 ? 67  ARG A HA   4  
ATOM 6899  H HB2  . ARG A 1 67  ? 17.289  -11.356 -11.562 1.00 0.00 ? 67  ARG A HB2  4  
ATOM 6900  H HB3  . ARG A 1 67  ? 18.229  -11.787 -10.140 1.00 0.00 ? 67  ARG A HB3  4  
ATOM 6901  H HG2  . ARG A 1 67  ? 15.746  -13.320 -10.670 1.00 0.00 ? 67  ARG A HG2  4  
ATOM 6902  H HG3  . ARG A 1 67  ? 17.140  -13.608 -11.714 1.00 0.00 ? 67  ARG A HG3  4  
ATOM 6903  H HD2  . ARG A 1 67  ? 18.501  -14.218 -9.855  1.00 0.00 ? 67  ARG A HD2  4  
ATOM 6904  H HD3  . ARG A 1 67  ? 17.275  -13.682 -8.708  1.00 0.00 ? 67  ARG A HD3  4  
ATOM 6905  H HE   . ARG A 1 67  ? 15.936  -15.577 -9.973  1.00 0.00 ? 67  ARG A HE   4  
ATOM 6906  H HH11 . ARG A 1 67  ? 19.222  -15.573 -8.825  1.00 0.00 ? 67  ARG A HH11 4  
ATOM 6907  H HH12 . ARG A 1 67  ? 19.264  -17.282 -8.544  1.00 0.00 ? 67  ARG A HH12 4  
ATOM 6908  H HH21 . ARG A 1 67  ? 15.978  -17.828 -9.607  1.00 0.00 ? 67  ARG A HH21 4  
ATOM 6909  H HH22 . ARG A 1 67  ? 17.419  -18.564 -8.990  1.00 0.00 ? 67  ARG A HH22 4  
ATOM 6910  N N    . GLU A 1 68  ? 17.416  -9.214  -8.484  1.00 0.00 ? 68  GLU A N    4  
ATOM 6911  C CA   . GLU A 1 68  ? 17.936  -7.869  -8.269  1.00 0.00 ? 68  GLU A CA   4  
ATOM 6912  C C    . GLU A 1 68  ? 19.384  -7.763  -8.737  1.00 0.00 ? 68  GLU A C    4  
ATOM 6913  O O    . GLU A 1 68  ? 19.828  -6.707  -9.186  1.00 0.00 ? 68  GLU A O    4  
ATOM 6914  C CB   . GLU A 1 68  ? 17.838  -7.491  -6.789  1.00 0.00 ? 68  GLU A CB   4  
ATOM 6915  C CG   . GLU A 1 68  ? 18.895  -8.153  -5.921  1.00 0.00 ? 68  GLU A CG   4  
ATOM 6916  C CD   . GLU A 1 68  ? 19.160  -7.388  -4.639  1.00 0.00 ? 68  GLU A CD   4  
ATOM 6917  O OE1  . GLU A 1 68  ? 19.979  -6.446  -4.668  1.00 0.00 ? 68  GLU A OE1  4  
ATOM 6918  O OE2  . GLU A 1 68  ? 18.547  -7.731  -3.607  1.00 0.00 ? 68  GLU A OE2  4  
ATOM 6919  H H    . GLU A 1 68  ? 17.530  -9.889  -7.783  1.00 0.00 ? 68  GLU A H    4  
ATOM 6920  H HA   . GLU A 1 68  ? 17.333  -7.184  -8.846  1.00 0.00 ? 68  GLU A HA   4  
ATOM 6921  H HB2  . GLU A 1 68  ? 17.943  -6.420  -6.695  1.00 0.00 ? 68  GLU A HB2  4  
ATOM 6922  H HB3  . GLU A 1 68  ? 16.866  -7.782  -6.420  1.00 0.00 ? 68  GLU A HB3  4  
ATOM 6923  H HG2  . GLU A 1 68  ? 18.562  -9.148  -5.666  1.00 0.00 ? 68  GLU A HG2  4  
ATOM 6924  H HG3  . GLU A 1 68  ? 19.816  -8.216  -6.482  1.00 0.00 ? 68  GLU A HG3  4  
ATOM 6925  N N    . GLY A 1 69  ? 20.117  -8.867  -8.629  1.00 0.00 ? 69  GLY A N    4  
ATOM 6926  C CA   . GLY A 1 69  ? 21.508  -8.879  -9.044  1.00 0.00 ? 69  GLY A CA   4  
ATOM 6927  C C    . GLY A 1 69  ? 21.666  -9.112  -10.533 1.00 0.00 ? 69  GLY A C    4  
ATOM 6928  O O    . GLY A 1 69  ? 22.536  -8.520  -11.172 1.00 0.00 ? 69  GLY A O    4  
ATOM 6929  H H    . GLY A 1 69  ? 19.710  -9.681  -8.264  1.00 0.00 ? 69  GLY A H    4  
ATOM 6930  H HA2  . GLY A 1 69  ? 21.956  -7.930  -8.789  1.00 0.00 ? 69  GLY A HA2  4  
ATOM 6931  H HA3  . GLY A 1 69  ? 22.024  -9.664  -8.511  1.00 0.00 ? 69  GLY A HA3  4  
ATOM 6932  N N    . ILE A 1 70  ? 20.825  -9.979  -11.087 1.00 0.00 ? 70  ILE A N    4  
ATOM 6933  C CA   . ILE A 1 70  ? 20.877  -10.290 -12.510 1.00 0.00 ? 70  ILE A CA   4  
ATOM 6934  C C    . ILE A 1 70  ? 20.146  -9.232  -13.331 1.00 0.00 ? 70  ILE A C    4  
ATOM 6935  O O    . ILE A 1 70  ? 20.739  -8.578  -14.189 1.00 0.00 ? 70  ILE A O    4  
ATOM 6936  C CB   . ILE A 1 70  ? 20.261  -11.670 -12.808 1.00 0.00 ? 70  ILE A CB   4  
ATOM 6937  C CG1  . ILE A 1 70  ? 21.017  -12.764 -12.051 1.00 0.00 ? 70  ILE A CG1  4  
ATOM 6938  C CG2  . ILE A 1 70  ? 20.277  -11.945 -14.304 1.00 0.00 ? 70  ILE A CG2  4  
ATOM 6939  C CD1  . ILE A 1 70  ? 20.229  -14.045 -11.894 1.00 0.00 ? 70  ILE A CD1  4  
ATOM 6940  H H    . ILE A 1 70  ? 20.153  -10.419 -10.526 1.00 0.00 ? 70  ILE A H    4  
ATOM 6941  H HA   . ILE A 1 70  ? 21.915  -10.309 -12.810 1.00 0.00 ? 70  ILE A HA   4  
ATOM 6942  H HB   . ILE A 1 70  ? 19.233  -11.659 -12.479 1.00 0.00 ? 70  ILE A HB   4  
ATOM 6943  H HG12 . ILE A 1 70  ? 21.926  -12.997 -12.583 1.00 0.00 ? 70  ILE A HG12 4  
ATOM 6944  H HG13 . ILE A 1 70  ? 21.265  -12.402 -11.064 1.00 0.00 ? 70  ILE A HG13 4  
ATOM 6945  H HG21 . ILE A 1 70  ? 21.156  -11.497 -14.743 1.00 0.00 ? 70  ILE A HG21 4  
ATOM 6946  H HG22 . ILE A 1 70  ? 20.295  -13.012 -14.473 1.00 0.00 ? 70  ILE A HG22 4  
ATOM 6947  H HG23 . ILE A 1 70  ? 19.393  -11.523 -14.758 1.00 0.00 ? 70  ILE A HG23 4  
ATOM 6948  H HD11 . ILE A 1 70  ? 19.181  -13.811 -11.774 1.00 0.00 ? 70  ILE A HD11 4  
ATOM 6949  H HD12 . ILE A 1 70  ? 20.364  -14.661 -12.770 1.00 0.00 ? 70  ILE A HD12 4  
ATOM 6950  H HD13 . ILE A 1 70  ? 20.580  -14.578 -11.022 1.00 0.00 ? 70  ILE A HD13 4  
ATOM 6951  N N    . ASP A 1 71  ? 18.856  -9.069  -13.060 1.00 0.00 ? 71  ASP A N    4  
ATOM 6952  C CA   . ASP A 1 71  ? 18.044  -8.088  -13.771 1.00 0.00 ? 71  ASP A CA   4  
ATOM 6953  C C    . ASP A 1 71  ? 18.062  -6.743  -13.052 1.00 0.00 ? 71  ASP A C    4  
ATOM 6954  O O    . ASP A 1 71  ? 18.549  -6.635  -11.926 1.00 0.00 ? 71  ASP A O    4  
ATOM 6955  C CB   . ASP A 1 71  ? 16.604  -8.588  -13.907 1.00 0.00 ? 71  ASP A CB   4  
ATOM 6956  C CG   . ASP A 1 71  ? 16.448  -9.608  -15.018 1.00 0.00 ? 71  ASP A CG   4  
ATOM 6957  O OD1  . ASP A 1 71  ? 16.969  -10.733 -14.867 1.00 0.00 ? 71  ASP A OD1  4  
ATOM 6958  O OD2  . ASP A 1 71  ? 15.805  -9.281  -16.037 1.00 0.00 ? 71  ASP A OD2  4  
ATOM 6959  H H    . ASP A 1 71  ? 18.439  -9.621  -12.365 1.00 0.00 ? 71  ASP A H    4  
ATOM 6960  H HA   . ASP A 1 71  ? 18.465  -7.961  -14.757 1.00 0.00 ? 71  ASP A HA   4  
ATOM 6961  H HB2  . ASP A 1 71  ? 16.300  -9.047  -12.977 1.00 0.00 ? 71  ASP A HB2  4  
ATOM 6962  H HB3  . ASP A 1 71  ? 15.958  -7.749  -14.118 1.00 0.00 ? 71  ASP A HB3  4  
ATOM 6963  N N    . LYS A 1 72  ? 17.531  -5.719  -13.710 1.00 0.00 ? 72  LYS A N    4  
ATOM 6964  C CA   . LYS A 1 72  ? 17.485  -4.379  -13.135 1.00 0.00 ? 72  LYS A CA   4  
ATOM 6965  C C    . LYS A 1 72  ? 16.130  -4.110  -12.489 1.00 0.00 ? 72  LYS A C    4  
ATOM 6966  O O    . LYS A 1 72  ? 15.085  -4.166  -13.137 1.00 0.00 ? 72  LYS A O    4  
ATOM 6967  C CB   . LYS A 1 72  ? 17.767  -3.330  -14.212 1.00 0.00 ? 72  LYS A CB   4  
ATOM 6968  C CG   . LYS A 1 72  ? 18.438  -2.076  -13.679 1.00 0.00 ? 72  LYS A CG   4  
ATOM 6969  C CD   . LYS A 1 72  ? 17.418  -1.053  -13.209 1.00 0.00 ? 72  LYS A CD   4  
ATOM 6970  C CE   . LYS A 1 72  ? 18.065  0.034   -12.366 1.00 0.00 ? 72  LYS A CE   4  
ATOM 6971  N NZ   . LYS A 1 72  ? 18.929  0.930   -13.183 1.00 0.00 ? 72  LYS A NZ   4  
ATOM 6972  H H    . LYS A 1 72  ? 17.158  -5.867  -14.605 1.00 0.00 ? 72  LYS A H    4  
ATOM 6973  H HA   . LYS A 1 72  ? 18.251  -4.318  -12.376 1.00 0.00 ? 72  LYS A HA   4  
ATOM 6974  H HB2  . LYS A 1 72  ? 18.409  -3.765  -14.964 1.00 0.00 ? 72  LYS A HB2  4  
ATOM 6975  H HB3  . LYS A 1 72  ? 16.831  -3.044  -14.672 1.00 0.00 ? 72  LYS A HB3  4  
ATOM 6976  H HG2  . LYS A 1 72  ? 19.072  -2.344  -12.847 1.00 0.00 ? 72  LYS A HG2  4  
ATOM 6977  H HG3  . LYS A 1 72  ? 19.038  -1.638  -14.465 1.00 0.00 ? 72  LYS A HG3  4  
ATOM 6978  H HD2  . LYS A 1 72  ? 16.955  -0.596  -14.072 1.00 0.00 ? 72  LYS A HD2  4  
ATOM 6979  H HD3  . LYS A 1 72  ? 16.664  -1.555  -12.619 1.00 0.00 ? 72  LYS A HD3  4  
ATOM 6980  H HE2  . LYS A 1 72  ? 17.289  0.622   -11.901 1.00 0.00 ? 72  LYS A HE2  4  
ATOM 6981  H HE3  . LYS A 1 72  ? 18.668  -0.434  -11.601 1.00 0.00 ? 72  LYS A HE3  4  
ATOM 6982  H HZ1  . LYS A 1 72  ? 18.346  1.477   -13.849 1.00 0.00 ? 72  LYS A HZ1  4  
ATOM 6983  H HZ2  . LYS A 1 72  ? 19.617  0.368   -13.723 1.00 0.00 ? 72  LYS A HZ2  4  
ATOM 6984  H HZ3  . LYS A 1 72  ? 19.444  1.591   -12.567 1.00 0.00 ? 72  LYS A HZ3  4  
ATOM 6985  N N    . PRO A 1 73  ? 16.146  -3.809  -11.182 1.00 0.00 ? 73  PRO A N    4  
ATOM 6986  C CA   . PRO A 1 73  ? 14.926  -3.523  -10.421 1.00 0.00 ? 73  PRO A CA   4  
ATOM 6987  C C    . PRO A 1 73  ? 14.292  -2.195  -10.820 1.00 0.00 ? 73  PRO A C    4  
ATOM 6988  O O    . PRO A 1 73  ? 14.985  -1.263  -11.229 1.00 0.00 ? 73  PRO A O    4  
ATOM 6989  C CB   . PRO A 1 73  ? 15.417  -3.468  -8.972  1.00 0.00 ? 73  PRO A CB   4  
ATOM 6990  C CG   . PRO A 1 73  ? 16.857  -3.099  -9.074  1.00 0.00 ? 73  PRO A CG   4  
ATOM 6991  C CD   . PRO A 1 73  ? 17.355  -3.724  -10.347 1.00 0.00 ? 73  PRO A CD   4  
ATOM 6992  H HA   . PRO A 1 73  ? 14.198  -4.314  -10.527 1.00 0.00 ? 73  PRO A HA   4  
ATOM 6993  H HB2  . PRO A 1 73  ? 14.854  -2.722  -8.427  1.00 0.00 ? 73  PRO A HB2  4  
ATOM 6994  H HB3  . PRO A 1 73  ? 15.289  -4.434  -8.508  1.00 0.00 ? 73  PRO A HB3  4  
ATOM 6995  H HG2  . PRO A 1 73  ? 16.958  -2.025  -9.118  1.00 0.00 ? 73  PRO A HG2  4  
ATOM 6996  H HG3  . PRO A 1 73  ? 17.397  -3.493  -8.226  1.00 0.00 ? 73  PRO A HG3  4  
ATOM 6997  H HD2  . PRO A 1 73  ? 18.100  -3.094  -10.810 1.00 0.00 ? 73  PRO A HD2  4  
ATOM 6998  H HD3  . PRO A 1 73  ? 17.758  -4.707  -10.152 1.00 0.00 ? 73  PRO A HD3  4  
ATOM 6999  N N    . ASP A 1 74  ? 12.972  -2.114  -10.697 1.00 0.00 ? 74  ASP A N    4  
ATOM 7000  C CA   . ASP A 1 74  ? 12.244  -0.899  -11.044 1.00 0.00 ? 74  ASP A CA   4  
ATOM 7001  C C    . ASP A 1 74  ? 11.004  -0.740  -10.170 1.00 0.00 ? 74  ASP A C    4  
ATOM 7002  O O    . ASP A 1 74  ? 9.977   -1.385  -10.384 1.00 0.00 ? 74  ASP A O    4  
ATOM 7003  C CB   . ASP A 1 74  ? 11.844  -0.921  -12.520 1.00 0.00 ? 74  ASP A CB   4  
ATOM 7004  C CG   . ASP A 1 74  ? 12.977  -1.374  -13.420 1.00 0.00 ? 74  ASP A CG   4  
ATOM 7005  O OD1  . ASP A 1 74  ? 13.940  -0.599  -13.596 1.00 0.00 ? 74  ASP A OD1  4  
ATOM 7006  O OD2  . ASP A 1 74  ? 12.901  -2.503  -13.948 1.00 0.00 ? 74  ASP A OD2  4  
ATOM 7007  H H    . ASP A 1 74  ? 12.474  -2.891  -10.365 1.00 0.00 ? 74  ASP A H    4  
ATOM 7008  H HA   . ASP A 1 74  ? 12.901  -0.059  -10.871 1.00 0.00 ? 74  ASP A HA   4  
ATOM 7009  H HB2  . ASP A 1 74  ? 11.013  -1.599  -12.650 1.00 0.00 ? 74  ASP A HB2  4  
ATOM 7010  H HB3  . ASP A 1 74  ? 11.544  0.072   -12.820 1.00 0.00 ? 74  ASP A HB3  4  
ATOM 7011  N N    . PRO A 1 75  ? 11.099  0.138   -9.160  1.00 0.00 ? 75  PRO A N    4  
ATOM 7012  C CA   . PRO A 1 75  ? 9.995   0.402   -8.234  1.00 0.00 ? 75  PRO A CA   4  
ATOM 7013  C C    . PRO A 1 75  ? 8.675   0.642   -8.958  1.00 0.00 ? 75  PRO A C    4  
ATOM 7014  O O    . PRO A 1 75  ? 7.622   0.138   -8.566  1.00 0.00 ? 75  PRO A O    4  
ATOM 7015  C CB   . PRO A 1 75  ? 10.441  1.669   -7.501  1.00 0.00 ? 75  PRO A CB   4  
ATOM 7016  C CG   . PRO A 1 75  ? 11.929  1.646   -7.575  1.00 0.00 ? 75  PRO A CG   4  
ATOM 7017  C CD   . PRO A 1 75  ? 12.293  0.942   -8.846  1.00 0.00 ? 75  PRO A CD   4  
ATOM 7018  H HA   . PRO A 1 75  ? 9.872   -0.403  -7.523  1.00 0.00 ? 75  PRO A HA   4  
ATOM 7019  H HB2  . PRO A 1 75  ? 10.033  2.538   -7.998  1.00 0.00 ? 75  PRO A HB2  4  
ATOM 7020  H HB3  . PRO A 1 75  ? 10.097  1.638   -6.478  1.00 0.00 ? 75  PRO A HB3  4  
ATOM 7021  H HG2  . PRO A 1 75  ? 12.311  2.655   -7.593  1.00 0.00 ? 75  PRO A HG2  4  
ATOM 7022  H HG3  . PRO A 1 75  ? 12.330  1.106   -6.731  1.00 0.00 ? 75  PRO A HG3  4  
ATOM 7023  H HD2  . PRO A 1 75  ? 12.490  1.661   -9.628  1.00 0.00 ? 75  PRO A HD2  4  
ATOM 7024  H HD3  . PRO A 1 75  ? 13.153  0.308   -8.689  1.00 0.00 ? 75  PRO A HD3  4  
ATOM 7025  N N    . PRO A 1 76  ? 8.729   1.431   -10.042 1.00 0.00 ? 76  PRO A N    4  
ATOM 7026  C CA   . PRO A 1 76  ? 7.546   1.755   -10.845 1.00 0.00 ? 76  PRO A CA   4  
ATOM 7027  C C    . PRO A 1 76  ? 6.722   0.519   -11.189 1.00 0.00 ? 76  PRO A C    4  
ATOM 7028  O O    . PRO A 1 76  ? 5.531   0.616   -11.486 1.00 0.00 ? 76  PRO A O    4  
ATOM 7029  C CB   . PRO A 1 76  ? 8.137   2.374   -12.114 1.00 0.00 ? 76  PRO A CB   4  
ATOM 7030  C CG   . PRO A 1 76  ? 9.453   2.928   -11.687 1.00 0.00 ? 76  PRO A CG   4  
ATOM 7031  C CD   . PRO A 1 76  ? 9.949   2.066   -10.567 1.00 0.00 ? 76  PRO A CD   4  
ATOM 7032  H HA   . PRO A 1 76  ? 6.916   2.479   -10.349 1.00 0.00 ? 76  PRO A HA   4  
ATOM 7033  H HB2  . PRO A 1 76  ? 8.256   1.610   -12.869 1.00 0.00 ? 76  PRO A HB2  4  
ATOM 7034  H HB3  . PRO A 1 76  ? 7.482   3.151   -12.479 1.00 0.00 ? 76  PRO A HB3  4  
ATOM 7035  H HG2  . PRO A 1 76  ? 10.150  2.895   -12.511 1.00 0.00 ? 76  PRO A HG2  4  
ATOM 7036  H HG3  . PRO A 1 76  ? 9.328   3.943   -11.340 1.00 0.00 ? 76  PRO A HG3  4  
ATOM 7037  H HD2  . PRO A 1 76  ? 10.638  1.325   -10.944 1.00 0.00 ? 76  PRO A HD2  4  
ATOM 7038  H HD3  . PRO A 1 76  ? 10.423  2.674   -9.811  1.00 0.00 ? 76  PRO A HD3  4  
ATOM 7039  N N    . THR A 1 77  ? 7.364   -0.645  -11.148 1.00 0.00 ? 77  THR A N    4  
ATOM 7040  C CA   . THR A 1 77  ? 6.691   -1.900  -11.456 1.00 0.00 ? 77  THR A CA   4  
ATOM 7041  C C    . THR A 1 77  ? 6.028   -2.488  -10.216 1.00 0.00 ? 77  THR A C    4  
ATOM 7042  O O    . THR A 1 77  ? 4.868   -2.899  -10.257 1.00 0.00 ? 77  THR A O    4  
ATOM 7043  C CB   . THR A 1 77  ? 7.672   -2.935  -12.039 1.00 0.00 ? 77  THR A CB   4  
ATOM 7044  O OG1  . THR A 1 77  ? 8.364   -2.377  -13.162 1.00 0.00 ? 77  THR A OG1  4  
ATOM 7045  C CG2  . THR A 1 77  ? 6.938   -4.197  -12.465 1.00 0.00 ? 77  THR A CG2  4  
ATOM 7046  H H    . THR A 1 77  ? 8.313   -0.657  -10.905 1.00 0.00 ? 77  THR A H    4  
ATOM 7047  H HA   . THR A 1 77  ? 5.932   -1.698  -12.198 1.00 0.00 ? 77  THR A HA   4  
ATOM 7048  H HB   . THR A 1 77  ? 8.392   -3.196  -11.276 1.00 0.00 ? 77  THR A HB   4  
ATOM 7049  H HG1  . THR A 1 77  ? 8.956   -1.684  -12.861 1.00 0.00 ? 77  THR A HG1  4  
ATOM 7050  H HG21 . THR A 1 77  ? 6.666   -4.121  -13.507 1.00 0.00 ? 77  THR A HG21 4  
ATOM 7051  H HG22 . THR A 1 77  ? 6.046   -4.313  -11.867 1.00 0.00 ? 77  THR A HG22 4  
ATOM 7052  H HG23 . THR A 1 77  ? 7.580   -5.053  -12.322 1.00 0.00 ? 77  THR A HG23 4  
ATOM 7053  N N    . TRP A 1 78  ? 6.769   -2.523  -9.115  1.00 0.00 ? 78  TRP A N    4  
ATOM 7054  C CA   . TRP A 1 78  ? 6.251   -3.060  -7.862  1.00 0.00 ? 78  TRP A CA   4  
ATOM 7055  C C    . TRP A 1 78  ? 5.091   -2.216  -7.346  1.00 0.00 ? 78  TRP A C    4  
ATOM 7056  O O    . TRP A 1 78  ? 4.010   -2.734  -7.065  1.00 0.00 ? 78  TRP A O    4  
ATOM 7057  C CB   . TRP A 1 78  ? 7.361   -3.120  -6.811  1.00 0.00 ? 78  TRP A CB   4  
ATOM 7058  C CG   . TRP A 1 78  ? 8.649   -3.677  -7.339  1.00 0.00 ? 78  TRP A CG   4  
ATOM 7059  C CD1  . TRP A 1 78  ? 8.795   -4.703  -8.229  1.00 0.00 ? 78  TRP A CD1  4  
ATOM 7060  C CD2  . TRP A 1 78  ? 9.971   -3.239  -7.008  1.00 0.00 ? 78  TRP A CD2  4  
ATOM 7061  N NE1  . TRP A 1 78  ? 10.129  -4.929  -8.470  1.00 0.00 ? 78  TRP A NE1  4  
ATOM 7062  C CE2  . TRP A 1 78  ? 10.871  -4.044  -7.735  1.00 0.00 ? 78  TRP A CE2  4  
ATOM 7063  C CE3  . TRP A 1 78  ? 10.483  -2.244  -6.170  1.00 0.00 ? 78  TRP A CE3  4  
ATOM 7064  C CZ2  . TRP A 1 78  ? 12.251  -3.883  -7.646  1.00 0.00 ? 78  TRP A CZ2  4  
ATOM 7065  C CZ3  . TRP A 1 78  ? 11.853  -2.087  -6.084  1.00 0.00 ? 78  TRP A CZ3  4  
ATOM 7066  C CH2  . TRP A 1 78  ? 12.725  -2.902  -6.818  1.00 0.00 ? 78  TRP A CH2  4  
ATOM 7067  H H    . TRP A 1 78  ? 7.687   -2.181  -9.145  1.00 0.00 ? 78  TRP A H    4  
ATOM 7068  H HA   . TRP A 1 78  ? 5.895   -4.062  -8.054  1.00 0.00 ? 78  TRP A HA   4  
ATOM 7069  H HB2  . TRP A 1 78  ? 7.555   -2.124  -6.444  1.00 0.00 ? 78  TRP A HB2  4  
ATOM 7070  H HB3  . TRP A 1 78  ? 7.038   -3.746  -5.992  1.00 0.00 ? 78  TRP A HB3  4  
ATOM 7071  H HD1  . TRP A 1 78  ? 7.974   -5.248  -8.668  1.00 0.00 ? 78  TRP A HD1  4  
ATOM 7072  H HE1  . TRP A 1 78  ? 10.489  -5.612  -9.074  1.00 0.00 ? 78  TRP A HE1  4  
ATOM 7073  H HE3  . TRP A 1 78  ? 9.828   -1.606  -5.596  1.00 0.00 ? 78  TRP A HE3  4  
ATOM 7074  H HZ2  . TRP A 1 78  ? 12.936  -4.503  -8.207  1.00 0.00 ? 78  TRP A HZ2  4  
ATOM 7075  H HZ3  . TRP A 1 78  ? 12.267  -1.323  -5.441  1.00 0.00 ? 78  TRP A HZ3  4  
ATOM 7076  H HH2  . TRP A 1 78  ? 13.787  -2.743  -6.719  1.00 0.00 ? 78  TRP A HH2  4  
ATOM 7077  N N    . LYS A 1 79  ? 5.322   -0.913  -7.223  1.00 0.00 ? 79  LYS A N    4  
ATOM 7078  C CA   . LYS A 1 79  ? 4.296   0.004   -6.743  1.00 0.00 ? 79  LYS A CA   4  
ATOM 7079  C C    . LYS A 1 79  ? 2.981   -0.213  -7.485  1.00 0.00 ? 79  LYS A C    4  
ATOM 7080  O O    . LYS A 1 79  ? 1.915   -0.286  -6.873  1.00 0.00 ? 79  LYS A O    4  
ATOM 7081  C CB   . LYS A 1 79  ? 4.757   1.453   -6.914  1.00 0.00 ? 79  LYS A CB   4  
ATOM 7082  C CG   . LYS A 1 79  ? 5.873   1.852   -5.963  1.00 0.00 ? 79  LYS A CG   4  
ATOM 7083  C CD   . LYS A 1 79  ? 6.500   3.177   -6.365  1.00 0.00 ? 79  LYS A CD   4  
ATOM 7084  C CE   . LYS A 1 79  ? 5.761   4.354   -5.746  1.00 0.00 ? 79  LYS A CE   4  
ATOM 7085  N NZ   . LYS A 1 79  ? 6.106   5.639   -6.416  1.00 0.00 ? 79  LYS A NZ   4  
ATOM 7086  H H    . LYS A 1 79  ? 6.205   -0.560  -7.463  1.00 0.00 ? 79  LYS A H    4  
ATOM 7087  H HA   . LYS A 1 79  ? 4.140   -0.194  -5.693  1.00 0.00 ? 79  LYS A HA   4  
ATOM 7088  H HB2  . LYS A 1 79  ? 5.109   1.589   -7.926  1.00 0.00 ? 79  LYS A HB2  4  
ATOM 7089  H HB3  . LYS A 1 79  ? 3.915   2.109   -6.743  1.00 0.00 ? 79  LYS A HB3  4  
ATOM 7090  H HG2  . LYS A 1 79  ? 5.468   1.946   -4.967  1.00 0.00 ? 79  LYS A HG2  4  
ATOM 7091  H HG3  . LYS A 1 79  ? 6.634   1.086   -5.974  1.00 0.00 ? 79  LYS A HG3  4  
ATOM 7092  H HD2  . LYS A 1 79  ? 7.527   3.195   -6.031  1.00 0.00 ? 79  LYS A HD2  4  
ATOM 7093  H HD3  . LYS A 1 79  ? 6.468   3.269   -7.442  1.00 0.00 ? 79  LYS A HD3  4  
ATOM 7094  H HE2  . LYS A 1 79  ? 4.700   4.184   -5.837  1.00 0.00 ? 79  LYS A HE2  4  
ATOM 7095  H HE3  . LYS A 1 79  ? 6.027   4.419   -4.702  1.00 0.00 ? 79  LYS A HE3  4  
ATOM 7096  H HZ1  . LYS A 1 79  ? 6.712   5.460   -7.242  1.00 0.00 ? 79  LYS A HZ1  4  
ATOM 7097  H HZ2  . LYS A 1 79  ? 6.614   6.261   -5.755  1.00 0.00 ? 79  LYS A HZ2  4  
ATOM 7098  H HZ3  . LYS A 1 79  ? 5.240   6.120   -6.732  1.00 0.00 ? 79  LYS A HZ3  4  
ATOM 7099  N N    . THR A 1 80  ? 3.064   -0.317  -8.808  1.00 0.00 ? 80  THR A N    4  
ATOM 7100  C CA   . THR A 1 80  ? 1.881   -0.526  -9.633  1.00 0.00 ? 80  THR A CA   4  
ATOM 7101  C C    . THR A 1 80  ? 1.276   -1.904  -9.389  1.00 0.00 ? 80  THR A C    4  
ATOM 7102  O O    . THR A 1 80  ? 0.081   -2.029  -9.122  1.00 0.00 ? 80  THR A O    4  
ATOM 7103  C CB   . THR A 1 80  ? 2.208   -0.380  -11.131 1.00 0.00 ? 80  THR A CB   4  
ATOM 7104  O OG1  . THR A 1 80  ? 2.793   0.903   -11.382 1.00 0.00 ? 80  THR A OG1  4  
ATOM 7105  C CG2  . THR A 1 80  ? 0.955   -0.546  -11.978 1.00 0.00 ? 80  THR A CG2  4  
ATOM 7106  H H    . THR A 1 80  ? 3.942   -0.250  -9.238  1.00 0.00 ? 80  THR A H    4  
ATOM 7107  H HA   . THR A 1 80  ? 1.153   0.228   -9.370  1.00 0.00 ? 80  THR A HA   4  
ATOM 7108  H HB   . THR A 1 80  ? 2.915   -1.150  -11.406 1.00 0.00 ? 80  THR A HB   4  
ATOM 7109  H HG1  . THR A 1 80  ? 3.750   0.832   -11.339 1.00 0.00 ? 80  THR A HG1  4  
ATOM 7110  H HG21 . THR A 1 80  ? 1.203   -1.069  -12.890 1.00 0.00 ? 80  THR A HG21 4  
ATOM 7111  H HG22 . THR A 1 80  ? 0.553   0.427   -12.219 1.00 0.00 ? 80  THR A HG22 4  
ATOM 7112  H HG23 . THR A 1 80  ? 0.221   -1.113  -11.426 1.00 0.00 ? 80  THR A HG23 4  
ATOM 7113  N N    . ARG A 1 81  ? 2.110   -2.935  -9.482  1.00 0.00 ? 81  ARG A N    4  
ATOM 7114  C CA   . ARG A 1 81  ? 1.656   -4.305  -9.271  1.00 0.00 ? 81  ARG A CA   4  
ATOM 7115  C C    . ARG A 1 81  ? 1.010   -4.458  -7.898  1.00 0.00 ? 81  ARG A C    4  
ATOM 7116  O O    . ARG A 1 81  ? 0.244   -5.394  -7.661  1.00 0.00 ? 81  ARG A O    4  
ATOM 7117  C CB   . ARG A 1 81  ? 2.828   -5.279  -9.406  1.00 0.00 ? 81  ARG A CB   4  
ATOM 7118  C CG   . ARG A 1 81  ? 3.425   -5.323  -10.804 1.00 0.00 ? 81  ARG A CG   4  
ATOM 7119  C CD   . ARG A 1 81  ? 2.637   -6.249  -11.717 1.00 0.00 ? 81  ARG A CD   4  
ATOM 7120  N NE   . ARG A 1 81  ? 3.472   -6.817  -12.772 1.00 0.00 ? 81  ARG A NE   4  
ATOM 7121  C CZ   . ARG A 1 81  ? 3.094   -7.830  -13.543 1.00 0.00 ? 81  ARG A CZ   4  
ATOM 7122  N NH1  . ARG A 1 81  ? 1.900   -8.384  -13.378 1.00 0.00 ? 81  ARG A NH1  4  
ATOM 7123  N NH2  . ARG A 1 81  ? 3.909   -8.292  -14.482 1.00 0.00 ? 81  ARG A NH2  4  
ATOM 7124  H H    . ARG A 1 81  ? 3.051   -2.772  -9.698  1.00 0.00 ? 81  ARG A H    4  
ATOM 7125  H HA   . ARG A 1 81  ? 0.922   -4.532  -10.029 1.00 0.00 ? 81  ARG A HA   4  
ATOM 7126  H HB2  . ARG A 1 81  ? 3.606   -4.987  -8.716  1.00 0.00 ? 81  ARG A HB2  4  
ATOM 7127  H HB3  . ARG A 1 81  ? 2.486   -6.271  -9.153  1.00 0.00 ? 81  ARG A HB3  4  
ATOM 7128  H HG2  . ARG A 1 81  ? 3.413   -4.327  -11.222 1.00 0.00 ? 81  ARG A HG2  4  
ATOM 7129  H HG3  . ARG A 1 81  ? 4.443   -5.676  -10.738 1.00 0.00 ? 81  ARG A HG3  4  
ATOM 7130  H HD2  . ARG A 1 81  ? 2.226   -7.052  -11.125 1.00 0.00 ? 81  ARG A HD2  4  
ATOM 7131  H HD3  . ARG A 1 81  ? 1.834   -5.687  -12.170 1.00 0.00 ? 81  ARG A HD3  4  
ATOM 7132  H HE   . ARG A 1 81  ? 4.358   -6.423  -12.912 1.00 0.00 ? 81  ARG A HE   4  
ATOM 7133  H HH11 . ARG A 1 81  ? 1.283   -8.037  -12.672 1.00 0.00 ? 81  ARG A HH11 4  
ATOM 7134  H HH12 . ARG A 1 81  ? 1.617   -9.146  -13.960 1.00 0.00 ? 81  ARG A HH12 4  
ATOM 7135  H HH21 . ARG A 1 81  ? 4.810   -7.877  -14.610 1.00 0.00 ? 81  ARG A HH21 4  
ATOM 7136  H HH22 . ARG A 1 81  ? 3.624   -9.055  -15.062 1.00 0.00 ? 81  ARG A HH22 4  
ATOM 7137  N N    . LEU A 1 82  ? 1.322   -3.534  -6.996  1.00 0.00 ? 82  LEU A N    4  
ATOM 7138  C CA   . LEU A 1 82  ? 0.772   -3.567  -5.645  1.00 0.00 ? 82  LEU A CA   4  
ATOM 7139  C C    . LEU A 1 82  ? -0.466  -2.682  -5.540  1.00 0.00 ? 82  LEU A C    4  
ATOM 7140  O O    . LEU A 1 82  ? -1.449  -3.047  -4.894  1.00 0.00 ? 82  LEU A O    4  
ATOM 7141  C CB   . LEU A 1 82  ? 1.825   -3.111  -4.633  1.00 0.00 ? 82  LEU A CB   4  
ATOM 7142  C CG   . LEU A 1 82  ? 1.362   -3.014  -3.179  1.00 0.00 ? 82  LEU A CG   4  
ATOM 7143  C CD1  . LEU A 1 82  ? 0.658   -4.295  -2.757  1.00 0.00 ? 82  LEU A CD1  4  
ATOM 7144  C CD2  . LEU A 1 82  ? 2.540   -2.723  -2.262  1.00 0.00 ? 82  LEU A CD2  4  
ATOM 7145  H H    . LEU A 1 82  ? 1.937   -2.813  -7.243  1.00 0.00 ? 82  LEU A H    4  
ATOM 7146  H HA   . LEU A 1 82  ? 0.491   -4.586  -5.426  1.00 0.00 ? 82  LEU A HA   4  
ATOM 7147  H HB2  . LEU A 1 82  ? 2.646   -3.811  -4.673  1.00 0.00 ? 82  LEU A HB2  4  
ATOM 7148  H HB3  . LEU A 1 82  ? 2.173   -2.134  -4.937  1.00 0.00 ? 82  LEU A HB3  4  
ATOM 7149  H HG   . LEU A 1 82  ? 0.656   -2.200  -3.087  1.00 0.00 ? 82  LEU A HG   4  
ATOM 7150  H HD11 . LEU A 1 82  ? 0.235   -4.165  -1.773  1.00 0.00 ? 82  LEU A HD11 4  
ATOM 7151  H HD12 . LEU A 1 82  ? 1.370   -5.107  -2.739  1.00 0.00 ? 82  LEU A HD12 4  
ATOM 7152  H HD13 . LEU A 1 82  ? -0.129  -4.522  -3.461  1.00 0.00 ? 82  LEU A HD13 4  
ATOM 7153  H HD21 . LEU A 1 82  ? 2.691   -1.656  -2.198  1.00 0.00 ? 82  LEU A HD21 4  
ATOM 7154  H HD22 . LEU A 1 82  ? 3.430   -3.189  -2.660  1.00 0.00 ? 82  LEU A HD22 4  
ATOM 7155  H HD23 . LEU A 1 82  ? 2.336   -3.118  -1.278  1.00 0.00 ? 82  LEU A HD23 4  
ATOM 7156  N N    . ARG A 1 83  ? -0.413  -1.519  -6.181  1.00 0.00 ? 83  ARG A N    4  
ATOM 7157  C CA   . ARG A 1 83  ? -1.530  -0.583  -6.161  1.00 0.00 ? 83  ARG A CA   4  
ATOM 7158  C C    . ARG A 1 83  ? -2.709  -1.127  -6.962  1.00 0.00 ? 83  ARG A C    4  
ATOM 7159  O O    . ARG A 1 83  ? -3.868  -0.888  -6.621  1.00 0.00 ? 83  ARG A O    4  
ATOM 7160  C CB   . ARG A 1 83  ? -1.099  0.772   -6.724  1.00 0.00 ? 83  ARG A CB   4  
ATOM 7161  C CG   . ARG A 1 83  ? -2.263  1.665   -7.120  1.00 0.00 ? 83  ARG A CG   4  
ATOM 7162  C CD   . ARG A 1 83  ? -1.811  2.800   -8.027  1.00 0.00 ? 83  ARG A CD   4  
ATOM 7163  N NE   . ARG A 1 83  ? -0.755  3.602   -7.415  1.00 0.00 ? 83  ARG A NE   4  
ATOM 7164  C CZ   . ARG A 1 83  ? 0.541   3.383   -7.610  1.00 0.00 ? 83  ARG A CZ   4  
ATOM 7165  N NH1  . ARG A 1 83  ? 0.938   2.392   -8.397  1.00 0.00 ? 83  ARG A NH1  4  
ATOM 7166  N NH2  . ARG A 1 83  ? 1.442   4.156   -7.018  1.00 0.00 ? 83  ARG A NH2  4  
ATOM 7167  H H    . ARG A 1 83  ? 0.398   -1.284  -6.679  1.00 0.00 ? 83  ARG A H    4  
ATOM 7168  H HA   . ARG A 1 83  ? -1.837  -0.455  -5.134  1.00 0.00 ? 83  ARG A HA   4  
ATOM 7169  H HB2  . ARG A 1 83  ? -0.514  1.289   -5.978  1.00 0.00 ? 83  ARG A HB2  4  
ATOM 7170  H HB3  . ARG A 1 83  ? -0.487  0.606   -7.598  1.00 0.00 ? 83  ARG A HB3  4  
ATOM 7171  H HG2  . ARG A 1 83  ? -2.998  1.072   -7.644  1.00 0.00 ? 83  ARG A HG2  4  
ATOM 7172  H HG3  . ARG A 1 83  ? -2.703  2.083   -6.227  1.00 0.00 ? 83  ARG A HG3  4  
ATOM 7173  H HD2  . ARG A 1 83  ? -1.441  2.379   -8.950  1.00 0.00 ? 83  ARG A HD2  4  
ATOM 7174  H HD3  . ARG A 1 83  ? -2.658  3.435   -8.235  1.00 0.00 ? 83  ARG A HD3  4  
ATOM 7175  H HE   . ARG A 1 83  ? -1.026  4.339   -6.830  1.00 0.00 ? 83  ARG A HE   4  
ATOM 7176  H HH11 . ARG A 1 83  ? 0.261   1.809   -8.845  1.00 0.00 ? 83  ARG A HH11 4  
ATOM 7177  H HH12 . ARG A 1 83  ? 1.914   2.230   -8.543  1.00 0.00 ? 83  ARG A HH12 4  
ATOM 7178  H HH21 . ARG A 1 83  ? 1.147   4.904   -6.425  1.00 0.00 ? 83  ARG A HH21 4  
ATOM 7179  H HH22 . ARG A 1 83  ? 2.417   3.990   -7.166  1.00 0.00 ? 83  ARG A HH22 4  
ATOM 7180  N N    . CYS A 1 84  ? -2.406  -1.859  -8.029  1.00 0.00 ? 84  CYS A N    4  
ATOM 7181  C CA   . CYS A 1 84  ? -3.440  -2.435  -8.880  1.00 0.00 ? 84  CYS A CA   4  
ATOM 7182  C C    . CYS A 1 84  ? -4.360  -3.348  -8.076  1.00 0.00 ? 84  CYS A C    4  
ATOM 7183  O O    . CYS A 1 84  ? -5.583  -3.230  -8.143  1.00 0.00 ? 84  CYS A O    4  
ATOM 7184  C CB   . CYS A 1 84  ? -2.806  -3.217  -10.031 1.00 0.00 ? 84  CYS A CB   4  
ATOM 7185  S SG   . CYS A 1 84  ? -1.586  -4.445  -9.506  1.00 0.00 ? 84  CYS A SG   4  
ATOM 7186  H H    . CYS A 1 84  ? -1.464  -2.015  -8.250  1.00 0.00 ? 84  CYS A H    4  
ATOM 7187  H HA   . CYS A 1 84  ? -4.025  -1.624  -9.286  1.00 0.00 ? 84  CYS A HA   4  
ATOM 7188  H HB2  . CYS A 1 84  ? -3.581  -3.737  -10.574 1.00 0.00 ? 84  CYS A HB2  4  
ATOM 7189  H HB3  . CYS A 1 84  ? -2.312  -2.525  -10.697 1.00 0.00 ? 84  CYS A HB3  4  
ATOM 7190  H HG   . CYS A 1 84  ? -2.210  -5.351  -8.769  1.00 0.00 ? 84  CYS A HG   4  
ATOM 7191  N N    . ALA A 1 85  ? -3.763  -4.260  -7.316  1.00 0.00 ? 85  ALA A N    4  
ATOM 7192  C CA   . ALA A 1 85  ? -4.528  -5.193  -6.498  1.00 0.00 ? 85  ALA A CA   4  
ATOM 7193  C C    . ALA A 1 85  ? -5.154  -4.488  -5.300  1.00 0.00 ? 85  ALA A C    4  
ATOM 7194  O O    . ALA A 1 85  ? -6.343  -4.647  -5.024  1.00 0.00 ? 85  ALA A O    4  
ATOM 7195  C CB   . ALA A 1 85  ? -3.640  -6.339  -6.034  1.00 0.00 ? 85  ALA A CB   4  
ATOM 7196  H H    . ALA A 1 85  ? -2.784  -4.306  -7.304  1.00 0.00 ? 85  ALA A H    4  
ATOM 7197  H HA   . ALA A 1 85  ? -5.316  -5.606  -7.111  1.00 0.00 ? 85  ALA A HA   4  
ATOM 7198  H HB1  . ALA A 1 85  ? -4.256  -7.130  -5.631  1.00 0.00 ? 85  ALA A HB1  4  
ATOM 7199  H HB2  . ALA A 1 85  ? -3.072  -6.716  -6.871  1.00 0.00 ? 85  ALA A HB2  4  
ATOM 7200  H HB3  . ALA A 1 85  ? -2.965  -5.984  -5.270  1.00 0.00 ? 85  ALA A HB3  4  
ATOM 7201  N N    . LEU A 1 86  ? -4.345  -3.708  -4.590  1.00 0.00 ? 86  LEU A N    4  
ATOM 7202  C CA   . LEU A 1 86  ? -4.820  -2.977  -3.420  1.00 0.00 ? 86  LEU A CA   4  
ATOM 7203  C C    . LEU A 1 86  ? -6.180  -2.342  -3.689  1.00 0.00 ? 86  LEU A C    4  
ATOM 7204  O O    . LEU A 1 86  ? -7.031  -2.275  -2.804  1.00 0.00 ? 86  LEU A O    4  
ATOM 7205  C CB   . LEU A 1 86  ? -3.810  -1.899  -3.023  1.00 0.00 ? 86  LEU A CB   4  
ATOM 7206  C CG   . LEU A 1 86  ? -4.150  -1.090  -1.771  1.00 0.00 ? 86  LEU A CG   4  
ATOM 7207  C CD1  . LEU A 1 86  ? -4.010  -1.950  -0.525  1.00 0.00 ? 86  LEU A CD1  4  
ATOM 7208  C CD2  . LEU A 1 86  ? -3.261  0.141   -1.674  1.00 0.00 ? 86  LEU A CD2  4  
ATOM 7209  H H    . LEU A 1 86  ? -3.407  -3.620  -4.858  1.00 0.00 ? 86  LEU A H    4  
ATOM 7210  H HA   . LEU A 1 86  ? -4.920  -3.682  -2.608  1.00 0.00 ? 86  LEU A HA   4  
ATOM 7211  H HB2  . LEU A 1 86  ? -2.860  -2.382  -2.857  1.00 0.00 ? 86  LEU A HB2  4  
ATOM 7212  H HB3  . LEU A 1 86  ? -3.722  -1.209  -3.850  1.00 0.00 ? 86  LEU A HB3  4  
ATOM 7213  H HG   . LEU A 1 86  ? -5.177  -0.757  -1.832  1.00 0.00 ? 86  LEU A HG   4  
ATOM 7214  H HD11 . LEU A 1 86  ? -4.350  -2.952  -0.739  1.00 0.00 ? 86  LEU A HD11 4  
ATOM 7215  H HD12 . LEU A 1 86  ? -4.606  -1.530  0.272   1.00 0.00 ? 86  LEU A HD12 4  
ATOM 7216  H HD13 . LEU A 1 86  ? -2.974  -1.978  -0.222  1.00 0.00 ? 86  LEU A HD13 4  
ATOM 7217  H HD21 . LEU A 1 86  ? -3.852  0.988   -1.361  1.00 0.00 ? 86  LEU A HD21 4  
ATOM 7218  H HD22 . LEU A 1 86  ? -2.823  0.346   -2.640  1.00 0.00 ? 86  LEU A HD22 4  
ATOM 7219  H HD23 . LEU A 1 86  ? -2.477  -0.037  -0.953  1.00 0.00 ? 86  LEU A HD23 4  
ATOM 7220  N N    . ASN A 1 87  ? -6.378  -1.879  -4.919  1.00 0.00 ? 87  ASN A N    4  
ATOM 7221  C CA   . ASN A 1 87  ? -7.636  -1.250  -5.307  1.00 0.00 ? 87  ASN A CA   4  
ATOM 7222  C C    . ASN A 1 87  ? -8.675  -2.301  -5.687  1.00 0.00 ? 87  ASN A C    4  
ATOM 7223  O O    . ASN A 1 87  ? -9.826  -2.238  -5.254  1.00 0.00 ? 87  ASN A O    4  
ATOM 7224  C CB   . ASN A 1 87  ? -7.412  -0.292  -6.478  1.00 0.00 ? 87  ASN A CB   4  
ATOM 7225  C CG   . ASN A 1 87  ? -8.453  0.810   -6.530  1.00 0.00 ? 87  ASN A CG   4  
ATOM 7226  O OD1  . ASN A 1 87  ? -9.335  0.887   -5.675  1.00 0.00 ? 87  ASN A OD1  4  
ATOM 7227  N ND2  . ASN A 1 87  ? -8.354  1.670   -7.537  1.00 0.00 ? 87  ASN A ND2  4  
ATOM 7228  H H    . ASN A 1 87  ? -5.661  -1.962  -5.583  1.00 0.00 ? 87  ASN A H    4  
ATOM 7229  H HA   . ASN A 1 87  ? -8.001  -0.690  -4.459  1.00 0.00 ? 87  ASN A HA   4  
ATOM 7230  H HB2  . ASN A 1 87  ? -6.437  0.165   -6.380  1.00 0.00 ? 87  ASN A HB2  4  
ATOM 7231  H HB3  . ASN A 1 87  ? -7.454  -0.846  -7.403  1.00 0.00 ? 87  ASN A HB3  4  
ATOM 7232  H HD21 . ASN A 1 87  ? -7.625  1.547   -8.181  1.00 0.00 ? 87  ASN A HD21 4  
ATOM 7233  H HD22 . ASN A 1 87  ? -9.013  2.392   -7.595  1.00 0.00 ? 87  ASN A HD22 4  
ATOM 7234  N N    . LYS A 1 88  ? -8.261  -3.268  -6.498  1.00 0.00 ? 88  LYS A N    4  
ATOM 7235  C CA   . LYS A 1 88  ? -9.153  -4.335  -6.936  1.00 0.00 ? 88  LYS A CA   4  
ATOM 7236  C C    . LYS A 1 88  ? -9.747  -5.073  -5.741  1.00 0.00 ? 88  LYS A C    4  
ATOM 7237  O O    . LYS A 1 88  ? -10.869 -5.575  -5.804  1.00 0.00 ? 88  LYS A O    4  
ATOM 7238  C CB   . LYS A 1 88  ? -8.402  -5.319  -7.835  1.00 0.00 ? 88  LYS A CB   4  
ATOM 7239  C CG   . LYS A 1 88  ? -8.027  -4.743  -9.190  1.00 0.00 ? 88  LYS A CG   4  
ATOM 7240  C CD   . LYS A 1 88  ? -9.219  -4.715  -10.133 1.00 0.00 ? 88  LYS A CD   4  
ATOM 7241  C CE   . LYS A 1 88  ? -8.777  -4.681  -11.588 1.00 0.00 ? 88  LYS A CE   4  
ATOM 7242  N NZ   . LYS A 1 88  ? -8.403  -6.033  -12.086 1.00 0.00 ? 88  LYS A NZ   4  
ATOM 7243  H H    . LYS A 1 88  ? -7.331  -3.265  -6.810  1.00 0.00 ? 88  LYS A H    4  
ATOM 7244  H HA   . LYS A 1 88  ? -9.955  -3.885  -7.501  1.00 0.00 ? 88  LYS A HA   4  
ATOM 7245  H HB2  . LYS A 1 88  ? -7.495  -5.626  -7.335  1.00 0.00 ? 88  LYS A HB2  4  
ATOM 7246  H HB3  . LYS A 1 88  ? -9.024  -6.188  -7.997  1.00 0.00 ? 88  LYS A HB3  4  
ATOM 7247  H HG2  . LYS A 1 88  ? -7.666  -3.734  -9.054  1.00 0.00 ? 88  LYS A HG2  4  
ATOM 7248  H HG3  . LYS A 1 88  ? -7.248  -5.351  -9.627  1.00 0.00 ? 88  LYS A HG3  4  
ATOM 7249  H HD2  . LYS A 1 88  ? -9.816  -5.599  -9.970  1.00 0.00 ? 88  LYS A HD2  4  
ATOM 7250  H HD3  . LYS A 1 88  ? -9.811  -3.835  -9.924  1.00 0.00 ? 88  LYS A HD3  4  
ATOM 7251  H HE2  . LYS A 1 88  ? -9.588  -4.297  -12.187 1.00 0.00 ? 88  LYS A HE2  4  
ATOM 7252  H HE3  . LYS A 1 88  ? -7.923  -4.025  -11.676 1.00 0.00 ? 88  LYS A HE3  4  
ATOM 7253  H HZ1  . LYS A 1 88  ? -8.359  -6.706  -11.293 1.00 0.00 ? 88  LYS A HZ1  4  
ATOM 7254  H HZ2  . LYS A 1 88  ? -7.472  -5.999  -12.548 1.00 0.00 ? 88  LYS A HZ2  4  
ATOM 7255  H HZ3  . LYS A 1 88  ? -9.107  -6.369  -12.773 1.00 0.00 ? 88  LYS A HZ3  4  
ATOM 7256  N N    . SER A 1 89  ? -8.987  -5.133  -4.652  1.00 0.00 ? 89  SER A N    4  
ATOM 7257  C CA   . SER A 1 89  ? -9.438  -5.812  -3.442  1.00 0.00 ? 89  SER A CA   4  
ATOM 7258  C C    . SER A 1 89  ? -10.815 -5.310  -3.018  1.00 0.00 ? 89  SER A C    4  
ATOM 7259  O O    . SER A 1 89  ? -10.986 -4.135  -2.695  1.00 0.00 ? 89  SER A O    4  
ATOM 7260  C CB   . SER A 1 89  ? -8.433  -5.599  -2.308  1.00 0.00 ? 89  SER A CB   4  
ATOM 7261  O OG   . SER A 1 89  ? -8.446  -6.690  -1.404  1.00 0.00 ? 89  SER A OG   4  
ATOM 7262  H H    . SER A 1 89  ? -8.102  -4.713  -4.663  1.00 0.00 ? 89  SER A H    4  
ATOM 7263  H HA   . SER A 1 89  ? -9.504  -6.868  -3.660  1.00 0.00 ? 89  SER A HA   4  
ATOM 7264  H HB2  . SER A 1 89  ? -7.441  -5.502  -2.723  1.00 0.00 ? 89  SER A HB2  4  
ATOM 7265  H HB3  . SER A 1 89  ? -8.688  -4.697  -1.770  1.00 0.00 ? 89  SER A HB3  4  
ATOM 7266  H HG   . SER A 1 89  ? -8.979  -7.401  -1.768  1.00 0.00 ? 89  SER A HG   4  
ATOM 7267  N N    . ASN A 1 90  ? -11.793 -6.209  -3.023  1.00 0.00 ? 90  ASN A N    4  
ATOM 7268  C CA   . ASN A 1 90  ? -13.156 -5.859  -2.640  1.00 0.00 ? 90  ASN A CA   4  
ATOM 7269  C C    . ASN A 1 90  ? -13.348 -5.991  -1.133  1.00 0.00 ? 90  ASN A C    4  
ATOM 7270  O O    . ASN A 1 90  ? -14.224 -5.352  -0.549  1.00 0.00 ? 90  ASN A O    4  
ATOM 7271  C CB   . ASN A 1 90  ? -14.160 -6.750  -3.374  1.00 0.00 ? 90  ASN A CB   4  
ATOM 7272  C CG   . ASN A 1 90  ? -14.016 -6.663  -4.881  1.00 0.00 ? 90  ASN A CG   4  
ATOM 7273  O OD1  . ASN A 1 90  ? -13.236 -7.400  -5.485  1.00 0.00 ? 90  ASN A OD1  4  
ATOM 7274  N ND2  . ASN A 1 90  ? -14.770 -5.759  -5.496  1.00 0.00 ? 90  ASN A ND2  4  
ATOM 7275  H H    . ASN A 1 90  ? -11.594 -7.131  -3.291  1.00 0.00 ? 90  ASN A H    4  
ATOM 7276  H HA   . ASN A 1 90  ? -13.326 -4.831  -2.924  1.00 0.00 ? 90  ASN A HA   4  
ATOM 7277  H HB2  . ASN A 1 90  ? -14.005 -7.777  -3.076  1.00 0.00 ? 90  ASN A HB2  4  
ATOM 7278  H HB3  . ASN A 1 90  ? -15.162 -6.449  -3.108  1.00 0.00 ? 90  ASN A HB3  4  
ATOM 7279  H HD21 . ASN A 1 90  ? -15.368 -5.206  -4.951  1.00 0.00 ? 90  ASN A HD21 4  
ATOM 7280  H HD22 . ASN A 1 90  ? -14.698 -5.682  -6.470  1.00 0.00 ? 90  ASN A HD22 4  
ATOM 7281  N N    . ASP A 1 91  ? -12.524 -6.825  -0.508  1.00 0.00 ? 91  ASP A N    4  
ATOM 7282  C CA   . ASP A 1 91  ? -12.602 -7.041  0.932   1.00 0.00 ? 91  ASP A CA   4  
ATOM 7283  C C    . ASP A 1 91  ? -11.915 -5.909  1.689   1.00 0.00 ? 91  ASP A C    4  
ATOM 7284  O O    . ASP A 1 91  ? -11.672 -6.010  2.892   1.00 0.00 ? 91  ASP A O    4  
ATOM 7285  C CB   . ASP A 1 91  ? -11.963 -8.380  1.304   1.00 0.00 ? 91  ASP A CB   4  
ATOM 7286  C CG   . ASP A 1 91  ? -12.508 -9.530  0.479   1.00 0.00 ? 91  ASP A CG   4  
ATOM 7287  O OD1  . ASP A 1 91  ? -13.719 -9.518  0.171   1.00 0.00 ? 91  ASP A OD1  4  
ATOM 7288  O OD2  . ASP A 1 91  ? -11.724 -10.441 0.141   1.00 0.00 ? 91  ASP A OD2  4  
ATOM 7289  H H    . ASP A 1 91  ? -11.847 -7.307  -1.028  1.00 0.00 ? 91  ASP A H    4  
ATOM 7290  H HA   . ASP A 1 91  ? -13.645 -7.061  1.209   1.00 0.00 ? 91  ASP A HA   4  
ATOM 7291  H HB2  . ASP A 1 91  ? -10.897 -8.320  1.143   1.00 0.00 ? 91  ASP A HB2  4  
ATOM 7292  H HB3  . ASP A 1 91  ? -12.155 -8.586  2.347   1.00 0.00 ? 91  ASP A HB3  4  
ATOM 7293  N N    . PHE A 1 92  ? -11.604 -4.831  0.977   1.00 0.00 ? 92  PHE A N    4  
ATOM 7294  C CA   . PHE A 1 92  ? -10.943 -3.680  1.581   1.00 0.00 ? 92  PHE A CA   4  
ATOM 7295  C C    . PHE A 1 92  ? -11.819 -2.435  1.479   1.00 0.00 ? 92  PHE A C    4  
ATOM 7296  O O    . PHE A 1 92  ? -12.522 -2.238  0.489   1.00 0.00 ? 92  PHE A O    4  
ATOM 7297  C CB   . PHE A 1 92  ? -9.595  -3.426  0.904   1.00 0.00 ? 92  PHE A CB   4  
ATOM 7298  C CG   . PHE A 1 92  ? -8.458  -4.186  1.526   1.00 0.00 ? 92  PHE A CG   4  
ATOM 7299  C CD1  . PHE A 1 92  ? -8.616  -5.510  1.900   1.00 0.00 ? 92  PHE A CD1  4  
ATOM 7300  C CD2  . PHE A 1 92  ? -7.233  -3.575  1.737   1.00 0.00 ? 92  PHE A CD2  4  
ATOM 7301  C CE1  . PHE A 1 92  ? -7.572  -6.213  2.472   1.00 0.00 ? 92  PHE A CE1  4  
ATOM 7302  C CE2  . PHE A 1 92  ? -6.185  -4.272  2.309   1.00 0.00 ? 92  PHE A CE2  4  
ATOM 7303  C CZ   . PHE A 1 92  ? -6.356  -5.593  2.678   1.00 0.00 ? 92  PHE A CZ   4  
ATOM 7304  H H    . PHE A 1 92  ? -11.823 -4.810  0.022   1.00 0.00 ? 92  PHE A H    4  
ATOM 7305  H HA   . PHE A 1 92  ? -10.776 -3.904  2.623   1.00 0.00 ? 92  PHE A HA   4  
ATOM 7306  H HB2  . PHE A 1 92  ? -9.660  -3.718  -0.134  1.00 0.00 ? 92  PHE A HB2  4  
ATOM 7307  H HB3  . PHE A 1 92  ? -9.363  -2.373  0.963   1.00 0.00 ? 92  PHE A HB3  4  
ATOM 7308  H HD1  . PHE A 1 92  ? -9.568  -5.997  1.740   1.00 0.00 ? 92  PHE A HD1  4  
ATOM 7309  H HD2  . PHE A 1 92  ? -7.098  -2.543  1.450   1.00 0.00 ? 92  PHE A HD2  4  
ATOM 7310  H HE1  . PHE A 1 92  ? -7.709  -7.245  2.760   1.00 0.00 ? 92  PHE A HE1  4  
ATOM 7311  H HE2  . PHE A 1 92  ? -5.235  -3.785  2.469   1.00 0.00 ? 92  PHE A HE2  4  
ATOM 7312  H HZ   . PHE A 1 92  ? -5.539  -6.140  3.125   1.00 0.00 ? 92  PHE A HZ   4  
ATOM 7313  N N    . GLU A 1 93  ? -11.769 -1.598  2.511   1.00 0.00 ? 93  GLU A N    4  
ATOM 7314  C CA   . GLU A 1 93  ? -12.559 -0.372  2.538   1.00 0.00 ? 93  GLU A CA   4  
ATOM 7315  C C    . GLU A 1 93  ? -11.663 0.855   2.402   1.00 0.00 ? 93  GLU A C    4  
ATOM 7316  O O    . GLU A 1 93  ? -10.501 0.835   2.804   1.00 0.00 ? 93  GLU A O    4  
ATOM 7317  C CB   . GLU A 1 93  ? -13.366 -0.288  3.836   1.00 0.00 ? 93  GLU A CB   4  
ATOM 7318  C CG   . GLU A 1 93  ? -14.687 0.446   3.684   1.00 0.00 ? 93  GLU A CG   4  
ATOM 7319  C CD   . GLU A 1 93  ? -15.605 -0.207  2.669   1.00 0.00 ? 93  GLU A CD   4  
ATOM 7320  O OE1  . GLU A 1 93  ? -16.322 -1.158  3.045   1.00 0.00 ? 93  GLU A OE1  4  
ATOM 7321  O OE2  . GLU A 1 93  ? -15.606 0.232   1.501   1.00 0.00 ? 93  GLU A OE2  4  
ATOM 7322  H H    . GLU A 1 93  ? -11.189 -1.810  3.272   1.00 0.00 ? 93  GLU A H    4  
ATOM 7323  H HA   . GLU A 1 93  ? -13.242 -0.399  1.702   1.00 0.00 ? 93  GLU A HA   4  
ATOM 7324  H HB2  . GLU A 1 93  ? -13.571 -1.290  4.184   1.00 0.00 ? 93  GLU A HB2  4  
ATOM 7325  H HB3  . GLU A 1 93  ? -12.775 0.227   4.579   1.00 0.00 ? 93  GLU A HB3  4  
ATOM 7326  H HG2  . GLU A 1 93  ? -15.188 0.462   4.641   1.00 0.00 ? 93  GLU A HG2  4  
ATOM 7327  H HG3  . GLU A 1 93  ? -14.487 1.459   3.368   1.00 0.00 ? 93  GLU A HG3  4  
ATOM 7328  N N    . GLU A 1 94  ? -12.215 1.923   1.833   1.00 0.00 ? 94  GLU A N    4  
ATOM 7329  C CA   . GLU A 1 94  ? -11.465 3.159   1.643   1.00 0.00 ? 94  GLU A CA   4  
ATOM 7330  C C    . GLU A 1 94  ? -11.671 4.107   2.821   1.00 0.00 ? 94  GLU A C    4  
ATOM 7331  O O    . GLU A 1 94  ? -12.755 4.660   3.006   1.00 0.00 ? 94  GLU A O    4  
ATOM 7332  C CB   . GLU A 1 94  ? -11.891 3.845   0.343   1.00 0.00 ? 94  GLU A CB   4  
ATOM 7333  C CG   . GLU A 1 94  ? -10.938 4.939   -0.108  1.00 0.00 ? 94  GLU A CG   4  
ATOM 7334  C CD   . GLU A 1 94  ? -11.599 5.943   -1.033  1.00 0.00 ? 94  GLU A CD   4  
ATOM 7335  O OE1  . GLU A 1 94  ? -12.842 6.056   -0.996  1.00 0.00 ? 94  GLU A OE1  4  
ATOM 7336  O OE2  . GLU A 1 94  ? -10.872 6.616   -1.793  1.00 0.00 ? 94  GLU A OE2  4  
ATOM 7337  H H    . GLU A 1 94  ? -13.147 1.878   1.534   1.00 0.00 ? 94  GLU A H    4  
ATOM 7338  H HA   . GLU A 1 94  ? -10.418 2.905   1.579   1.00 0.00 ? 94  GLU A HA   4  
ATOM 7339  H HB2  . GLU A 1 94  ? -11.950 3.102   -0.439  1.00 0.00 ? 94  GLU A HB2  4  
ATOM 7340  H HB3  . GLU A 1 94  ? -12.868 4.283   0.485   1.00 0.00 ? 94  GLU A HB3  4  
ATOM 7341  H HG2  . GLU A 1 94  ? -10.572 5.462   0.763   1.00 0.00 ? 94  GLU A HG2  4  
ATOM 7342  H HG3  . GLU A 1 94  ? -10.108 4.484   -0.629  1.00 0.00 ? 94  GLU A HG3  4  
ATOM 7343  N N    . LEU A 1 95  ? -10.622 4.288   3.617   1.00 0.00 ? 95  LEU A N    4  
ATOM 7344  C CA   . LEU A 1 95  ? -10.686 5.168   4.778   1.00 0.00 ? 95  LEU A CA   4  
ATOM 7345  C C    . LEU A 1 95  ? -10.114 6.544   4.452   1.00 0.00 ? 95  LEU A C    4  
ATOM 7346  O O    . LEU A 1 95  ? -9.774  7.315   5.348   1.00 0.00 ? 95  LEU A O    4  
ATOM 7347  C CB   . LEU A 1 95  ? -9.923  4.551   5.952   1.00 0.00 ? 95  LEU A CB   4  
ATOM 7348  C CG   . LEU A 1 95  ? -10.365 3.151   6.378   1.00 0.00 ? 95  LEU A CG   4  
ATOM 7349  C CD1  . LEU A 1 95  ? -9.657  2.735   7.659   1.00 0.00 ? 95  LEU A CD1  4  
ATOM 7350  C CD2  . LEU A 1 95  ? -11.875 3.100   6.561   1.00 0.00 ? 95  LEU A CD2  4  
ATOM 7351  H H    . LEU A 1 95  ? -9.785  3.820   3.419   1.00 0.00 ? 95  LEU A H    4  
ATOM 7352  H HA   . LEU A 1 95  ? -11.725 5.279   5.053   1.00 0.00 ? 95  LEU A HA   4  
ATOM 7353  H HB2  . LEU A 1 95  ? -8.881  4.500   5.679   1.00 0.00 ? 95  LEU A HB2  4  
ATOM 7354  H HB3  . LEU A 1 95  ? -10.039 5.209   6.802   1.00 0.00 ? 95  LEU A HB3  4  
ATOM 7355  H HG   . LEU A 1 95  ? -10.097 2.445   5.605   1.00 0.00 ? 95  LEU A HG   4  
ATOM 7356  H HD11 . LEU A 1 95  ? -9.273  3.611   8.159   1.00 0.00 ? 95  LEU A HD11 4  
ATOM 7357  H HD12 . LEU A 1 95  ? -8.841  2.070   7.419   1.00 0.00 ? 95  LEU A HD12 4  
ATOM 7358  H HD13 . LEU A 1 95  ? -10.356 2.227   8.307   1.00 0.00 ? 95  LEU A HD13 4  
ATOM 7359  H HD21 . LEU A 1 95  ? -12.206 3.995   7.067   1.00 0.00 ? 95  LEU A HD21 4  
ATOM 7360  H HD22 . LEU A 1 95  ? -12.137 2.235   7.152   1.00 0.00 ? 95  LEU A HD22 4  
ATOM 7361  H HD23 . LEU A 1 95  ? -12.352 3.036   5.594   1.00 0.00 ? 95  LEU A HD23 4  
ATOM 7362  N N    . VAL A 1 96  ? -10.012 6.845   3.161   1.00 0.00 ? 96  VAL A N    4  
ATOM 7363  C CA   . VAL A 1 96  ? -9.485  8.129   2.715   1.00 0.00 ? 96  VAL A CA   4  
ATOM 7364  C C    . VAL A 1 96  ? -9.884  9.249   3.670   1.00 0.00 ? 96  VAL A C    4  
ATOM 7365  O O    . VAL A 1 96  ? -9.158  10.229  3.831   1.00 0.00 ? 96  VAL A O    4  
ATOM 7366  C CB   . VAL A 1 96  ? -9.978  8.477   1.298   1.00 0.00 ? 96  VAL A CB   4  
ATOM 7367  C CG1  . VAL A 1 96  ? -11.498 8.531   1.260   1.00 0.00 ? 96  VAL A CG1  4  
ATOM 7368  C CG2  . VAL A 1 96  ? -9.378  9.796   0.834   1.00 0.00 ? 96  VAL A CG2  4  
ATOM 7369  H H    . VAL A 1 96  ? -10.300 6.189   2.493   1.00 0.00 ? 96  VAL A H    4  
ATOM 7370  H HA   . VAL A 1 96  ? -8.407  8.057   2.691   1.00 0.00 ? 96  VAL A HA   4  
ATOM 7371  H HB   . VAL A 1 96  ? -9.651  7.700   0.624   1.00 0.00 ? 96  VAL A HB   4  
ATOM 7372  H HG11 . VAL A 1 96  ? -11.820 8.902   0.298   1.00 0.00 ? 96  VAL A HG11 4  
ATOM 7373  H HG12 . VAL A 1 96  ? -11.898 7.541   1.418   1.00 0.00 ? 96  VAL A HG12 4  
ATOM 7374  H HG13 . VAL A 1 96  ? -11.854 9.192   2.037   1.00 0.00 ? 96  VAL A HG13 4  
ATOM 7375  H HG21 . VAL A 1 96  ? -8.702  10.168  1.590   1.00 0.00 ? 96  VAL A HG21 4  
ATOM 7376  H HG22 . VAL A 1 96  ? -8.836  9.641   -0.088  1.00 0.00 ? 96  VAL A HG22 4  
ATOM 7377  H HG23 . VAL A 1 96  ? -10.167 10.514  0.671   1.00 0.00 ? 96  VAL A HG23 4  
ATOM 7378  N N    . GLU A 1 97  ? -11.044 9.095   4.301   1.00 0.00 ? 97  GLU A N    4  
ATOM 7379  C CA   . GLU A 1 97  ? -11.540 10.094  5.240   1.00 0.00 ? 97  GLU A CA   4  
ATOM 7380  C C    . GLU A 1 97  ? -10.461 10.475  6.250   1.00 0.00 ? 97  GLU A C    4  
ATOM 7381  O O    . GLU A 1 97  ? -10.267 11.653  6.553   1.00 0.00 ? 97  GLU A O    4  
ATOM 7382  C CB   . GLU A 1 97  ? -12.777 9.569   5.972   1.00 0.00 ? 97  GLU A CB   4  
ATOM 7383  C CG   . GLU A 1 97  ? -13.929 9.218   5.046   1.00 0.00 ? 97  GLU A CG   4  
ATOM 7384  C CD   . GLU A 1 97  ? -15.202 8.883   5.800   1.00 0.00 ? 97  GLU A CD   4  
ATOM 7385  O OE1  . GLU A 1 97  ? -15.344 7.723   6.238   1.00 0.00 ? 97  GLU A OE1  4  
ATOM 7386  O OE2  . GLU A 1 97  ? -16.055 9.783   5.951   1.00 0.00 ? 97  GLU A OE2  4  
ATOM 7387  H H    . GLU A 1 97  ? -11.579 8.292   4.131   1.00 0.00 ? 97  GLU A H    4  
ATOM 7388  H HA   . GLU A 1 97  ? -11.814 10.973  4.676   1.00 0.00 ? 97  GLU A HA   4  
ATOM 7389  H HB2  . GLU A 1 97  ? -12.503 8.683   6.525   1.00 0.00 ? 97  GLU A HB2  4  
ATOM 7390  H HB3  . GLU A 1 97  ? -13.117 10.324  6.666   1.00 0.00 ? 97  GLU A HB3  4  
ATOM 7391  H HG2  . GLU A 1 97  ? -14.124 10.060  4.399   1.00 0.00 ? 97  GLU A HG2  4  
ATOM 7392  H HG3  . GLU A 1 97  ? -13.647 8.364   4.449   1.00 0.00 ? 97  GLU A HG3  4  
ATOM 7393  N N    . ARG A 1 98  ? -9.762  9.470   6.767   1.00 0.00 ? 98  ARG A N    4  
ATOM 7394  C CA   . ARG A 1 98  ? -8.704  9.698   7.744   1.00 0.00 ? 98  ARG A CA   4  
ATOM 7395  C C    . ARG A 1 98  ? -7.365  9.930   7.050   1.00 0.00 ? 98  ARG A C    4  
ATOM 7396  O O    . ARG A 1 98  ? -6.476  10.582  7.598   1.00 0.00 ? 98  ARG A O    4  
ATOM 7397  C CB   . ARG A 1 98  ? -8.597  8.508   8.699   1.00 0.00 ? 98  ARG A CB   4  
ATOM 7398  C CG   . ARG A 1 98  ? -9.938  7.885   9.048   1.00 0.00 ? 98  ARG A CG   4  
ATOM 7399  C CD   . ARG A 1 98  ? -9.804  6.866   10.170  1.00 0.00 ? 98  ARG A CD   4  
ATOM 7400  N NE   . ARG A 1 98  ? -11.011 6.792   10.989  1.00 0.00 ? 98  ARG A NE   4  
ATOM 7401  C CZ   . ARG A 1 98  ? -11.099 6.078   12.106  1.00 0.00 ? 98  ARG A CZ   4  
ATOM 7402  N NH1  . ARG A 1 98  ? -10.055 5.382   12.535  1.00 0.00 ? 98  ARG A NH1  4  
ATOM 7403  N NH2  . ARG A 1 98  ? -12.231 6.061   12.796  1.00 0.00 ? 98  ARG A NH2  4  
ATOM 7404  H H    . ARG A 1 98  ? -9.963  8.553   6.486   1.00 0.00 ? 98  ARG A H    4  
ATOM 7405  H HA   . ARG A 1 98  ? -8.960  10.581  8.310   1.00 0.00 ? 98  ARG A HA   4  
ATOM 7406  H HB2  . ARG A 1 98  ? -7.980  7.749   8.241   1.00 0.00 ? 98  ARG A HB2  4  
ATOM 7407  H HB3  . ARG A 1 98  ? -8.128  8.838   9.614   1.00 0.00 ? 98  ARG A HB3  4  
ATOM 7408  H HG2  . ARG A 1 98  ? -10.616 8.664   9.364   1.00 0.00 ? 98  ARG A HG2  4  
ATOM 7409  H HG3  . ARG A 1 98  ? -10.335 7.393   8.172   1.00 0.00 ? 98  ARG A HG3  4  
ATOM 7410  H HD2  . ARG A 1 98  ? -9.615  5.896   9.736   1.00 0.00 ? 98  ARG A HD2  4  
ATOM 7411  H HD3  . ARG A 1 98  ? -8.972  7.149   10.796  1.00 0.00 ? 98  ARG A HD3  4  
ATOM 7412  H HE   . ARG A 1 98  ? -11.794 7.299   10.690  1.00 0.00 ? 98  ARG A HE   4  
ATOM 7413  H HH11 . ARG A 1 98  ? -9.200  5.394   12.017  1.00 0.00 ? 98  ARG A HH11 4  
ATOM 7414  H HH12 . ARG A 1 98  ? -10.123 4.847   13.377  1.00 0.00 ? 98  ARG A HH12 4  
ATOM 7415  H HH21 . ARG A 1 98  ? -13.020 6.585   12.476  1.00 0.00 ? 98  ARG A HH21 4  
ATOM 7416  H HH22 . ARG A 1 98  ? -12.296 5.523   13.637  1.00 0.00 ? 98  ARG A HH22 4  
ATOM 7417  N N    . SER A 1 99  ? -7.229  9.392   5.843   1.00 0.00 ? 99  SER A N    4  
ATOM 7418  C CA   . SER A 1 99  ? -5.997  9.536   5.076   1.00 0.00 ? 99  SER A CA   4  
ATOM 7419  C C    . SER A 1 99  ? -5.587  11.003  4.978   1.00 0.00 ? 99  SER A C    4  
ATOM 7420  O O    . SER A 1 99  ? -6.397  11.863  4.635   1.00 0.00 ? 99  SER A O    4  
ATOM 7421  C CB   . SER A 1 99  ? -6.172  8.949   3.674   1.00 0.00 ? 99  SER A CB   4  
ATOM 7422  O OG   . SER A 1 99  ? -6.836  9.862   2.818   1.00 0.00 ? 99  SER A OG   4  
ATOM 7423  H H    . SER A 1 99  ? -7.974  8.883   5.460   1.00 0.00 ? 99  SER A H    4  
ATOM 7424  H HA   . SER A 1 99  ? -5.220  8.991   5.591   1.00 0.00 ? 99  SER A HA   4  
ATOM 7425  H HB2  . SER A 1 99  ? -5.202  8.724   3.258   1.00 0.00 ? 99  SER A HB2  4  
ATOM 7426  H HB3  . SER A 1 99  ? -6.756  8.043   3.737   1.00 0.00 ? 99  SER A HB3  4  
ATOM 7427  H HG   . SER A 1 99  ? -7.478  10.366  3.323   1.00 0.00 ? 99  SER A HG   4  
ATOM 7428  N N    . GLN A 1 100 ? -4.323  11.278  5.283   1.00 0.00 ? 100 GLN A N    4  
ATOM 7429  C CA   . GLN A 1 100 ? -3.804  12.640  5.230   1.00 0.00 ? 100 GLN A CA   4  
ATOM 7430  C C    . GLN A 1 100 ? -2.665  12.750  4.222   1.00 0.00 ? 100 GLN A C    4  
ATOM 7431  O O    . GLN A 1 100 ? -1.536  12.343  4.499   1.00 0.00 ? 100 GLN A O    4  
ATOM 7432  C CB   . GLN A 1 100 ? -3.322  13.079  6.614   1.00 0.00 ? 100 GLN A CB   4  
ATOM 7433  C CG   . GLN A 1 100 ? -4.428  13.133  7.655   1.00 0.00 ? 100 GLN A CG   4  
ATOM 7434  C CD   . GLN A 1 100 ? -5.149  14.467  7.672   1.00 0.00 ? 100 GLN A CD   4  
ATOM 7435  O OE1  . GLN A 1 100 ? -4.742  15.396  8.369   1.00 0.00 ? 100 GLN A OE1  4  
ATOM 7436  N NE2  . GLN A 1 100 ? -6.226  14.567  6.901   1.00 0.00 ? 100 GLN A NE2  4  
ATOM 7437  H H    . GLN A 1 100 ? -3.725  10.550  5.549   1.00 0.00 ? 100 GLN A H    4  
ATOM 7438  H HA   . GLN A 1 100 ? -4.608  13.289  4.917   1.00 0.00 ? 100 GLN A HA   4  
ATOM 7439  H HB2  . GLN A 1 100 ? -2.568  12.385  6.955   1.00 0.00 ? 100 GLN A HB2  4  
ATOM 7440  H HB3  . GLN A 1 100 ? -2.884  14.063  6.534   1.00 0.00 ? 100 GLN A HB3  4  
ATOM 7441  H HG2  . GLN A 1 100 ? -5.146  12.356  7.439   1.00 0.00 ? 100 GLN A HG2  4  
ATOM 7442  H HG3  . GLN A 1 100 ? -3.996  12.961  8.629   1.00 0.00 ? 100 GLN A HG3  4  
ATOM 7443  H HE21 . GLN A 1 100 ? -6.492  13.785  6.374   1.00 0.00 ? 100 GLN A HE21 4  
ATOM 7444  H HE22 . GLN A 1 100 ? -6.711  15.417  6.894   1.00 0.00 ? 100 GLN A HE22 4  
ATOM 7445  N N    . LEU A 1 101 ? -2.967  13.303  3.053   1.00 0.00 ? 101 LEU A N    4  
ATOM 7446  C CA   . LEU A 1 101 ? -1.968  13.466  2.002   1.00 0.00 ? 101 LEU A CA   4  
ATOM 7447  C C    . LEU A 1 101 ? -1.487  14.912  1.929   1.00 0.00 ? 101 LEU A C    4  
ATOM 7448  O O    . LEU A 1 101 ? -0.445  15.201  1.341   1.00 0.00 ? 101 LEU A O    4  
ATOM 7449  C CB   . LEU A 1 101 ? -2.545  13.039  0.651   1.00 0.00 ? 101 LEU A CB   4  
ATOM 7450  C CG   . LEU A 1 101 ? -3.161  11.641  0.597   1.00 0.00 ? 101 LEU A CG   4  
ATOM 7451  C CD1  . LEU A 1 101 ? -4.287  11.594  -0.425  1.00 0.00 ? 101 LEU A CD1  4  
ATOM 7452  C CD2  . LEU A 1 101 ? -2.099  10.602  0.271   1.00 0.00 ? 101 LEU A CD2  4  
ATOM 7453  H H    . LEU A 1 101 ? -3.884  13.608  2.890   1.00 0.00 ? 101 LEU A H    4  
ATOM 7454  H HA   . LEU A 1 101 ? -1.128  12.832  2.243   1.00 0.00 ? 101 LEU A HA   4  
ATOM 7455  H HB2  . LEU A 1 101 ? -3.310  13.749  0.380   1.00 0.00 ? 101 LEU A HB2  4  
ATOM 7456  H HB3  . LEU A 1 101 ? -1.746  13.078  -0.075  1.00 0.00 ? 101 LEU A HB3  4  
ATOM 7457  H HG   . LEU A 1 101 ? -3.579  11.401  1.565   1.00 0.00 ? 101 LEU A HG   4  
ATOM 7458  H HD11 . LEU A 1 101 ? -4.477  12.589  -0.798  1.00 0.00 ? 101 LEU A HD11 4  
ATOM 7459  H HD12 . LEU A 1 101 ? -5.181  11.208  0.043   1.00 0.00 ? 101 LEU A HD12 4  
ATOM 7460  H HD13 . LEU A 1 101 ? -4.003  10.949  -1.244  1.00 0.00 ? 101 LEU A HD13 4  
ATOM 7461  H HD21 . LEU A 1 101 ? -2.492  9.900   -0.450  1.00 0.00 ? 101 LEU A HD21 4  
ATOM 7462  H HD22 . LEU A 1 101 ? -1.822  10.075  1.172   1.00 0.00 ? 101 LEU A HD22 4  
ATOM 7463  H HD23 . LEU A 1 101 ? -1.230  11.093  -0.142  1.00 0.00 ? 101 LEU A HD23 4  
ATOM 7464  N N    . ASP A 1 102 ? -2.252  15.816  2.531   1.00 0.00 ? 102 ASP A N    4  
ATOM 7465  C CA   . ASP A 1 102 ? -1.903  17.232  2.536   1.00 0.00 ? 102 ASP A CA   4  
ATOM 7466  C C    . ASP A 1 102 ? -0.918  17.544  3.659   1.00 0.00 ? 102 ASP A C    4  
ATOM 7467  O O    . ASP A 1 102 ? -0.751  18.700  4.047   1.00 0.00 ? 102 ASP A O    4  
ATOM 7468  C CB   . ASP A 1 102 ? -3.160  18.088  2.692   1.00 0.00 ? 102 ASP A CB   4  
ATOM 7469  C CG   . ASP A 1 102 ? -3.973  18.161  1.414   1.00 0.00 ? 102 ASP A CG   4  
ATOM 7470  O OD1  . ASP A 1 102 ? -3.379  18.018  0.325   1.00 0.00 ? 102 ASP A OD1  4  
ATOM 7471  O OD2  . ASP A 1 102 ? -5.202  18.363  1.502   1.00 0.00 ? 102 ASP A OD2  4  
ATOM 7472  H H    . ASP A 1 102 ? -3.072  15.524  2.983   1.00 0.00 ? 102 ASP A H    4  
ATOM 7473  H HA   . ASP A 1 102 ? -1.436  17.462  1.591   1.00 0.00 ? 102 ASP A HA   4  
ATOM 7474  H HB2  . ASP A 1 102 ? -3.782  17.666  3.468   1.00 0.00 ? 102 ASP A HB2  4  
ATOM 7475  H HB3  . ASP A 1 102 ? -2.873  19.091  2.972   1.00 0.00 ? 102 ASP A HB3  4  
ATOM 7476  N N    . ILE A 1 103 ? -0.270  16.505  4.176   1.00 0.00 ? 103 ILE A N    4  
ATOM 7477  C CA   . ILE A 1 103 ? 0.698   16.669  5.253   1.00 0.00 ? 103 ILE A CA   4  
ATOM 7478  C C    . ILE A 1 103 ? 2.106   16.315  4.786   1.00 0.00 ? 103 ILE A C    4  
ATOM 7479  O O    . ILE A 1 103 ? 2.284   15.669  3.754   1.00 0.00 ? 103 ILE A O    4  
ATOM 7480  C CB   . ILE A 1 103 ? 0.338   15.798  6.471   1.00 0.00 ? 103 ILE A CB   4  
ATOM 7481  C CG1  . ILE A 1 103 ? 0.112   14.347  6.038   1.00 0.00 ? 103 ILE A CG1  4  
ATOM 7482  C CG2  . ILE A 1 103 ? -0.897  16.347  7.169   1.00 0.00 ? 103 ILE A CG2  4  
ATOM 7483  C CD1  . ILE A 1 103 ? -0.133  13.403  7.194   1.00 0.00 ? 103 ILE A CD1  4  
ATOM 7484  H H    . ILE A 1 103 ? -0.446  15.608  3.824   1.00 0.00 ? 103 ILE A H    4  
ATOM 7485  H HA   . ILE A 1 103 ? 0.682   17.705  5.560   1.00 0.00 ? 103 ILE A HA   4  
ATOM 7486  H HB   . ILE A 1 103 ? 1.162   15.834  7.167   1.00 0.00 ? 103 ILE A HB   4  
ATOM 7487  H HG12 . ILE A 1 103 ? -0.747  14.303  5.387   1.00 0.00 ? 103 ILE A HG12 4  
ATOM 7488  H HG13 . ILE A 1 103 ? 0.983   13.999  5.503   1.00 0.00 ? 103 ILE A HG13 4  
ATOM 7489  H HG21 . ILE A 1 103 ? -1.102  15.760  8.052   1.00 0.00 ? 103 ILE A HG21 4  
ATOM 7490  H HG22 . ILE A 1 103 ? -0.723  17.374  7.453   1.00 0.00 ? 103 ILE A HG22 4  
ATOM 7491  H HG23 . ILE A 1 103 ? -1.742  16.296  6.499   1.00 0.00 ? 103 ILE A HG23 4  
ATOM 7492  H HD11 . ILE A 1 103 ? -1.118  13.579  7.601   1.00 0.00 ? 103 ILE A HD11 4  
ATOM 7493  H HD12 . ILE A 1 103 ? -0.062  12.383  6.848   1.00 0.00 ? 103 ILE A HD12 4  
ATOM 7494  H HD13 . ILE A 1 103 ? 0.608   13.575  7.962   1.00 0.00 ? 103 ILE A HD13 4  
ATOM 7495  N N    . SER A 1 104 ? 3.103   16.740  5.555   1.00 0.00 ? 104 SER A N    4  
ATOM 7496  C CA   . SER A 1 104 ? 4.496   16.469  5.220   1.00 0.00 ? 104 SER A CA   4  
ATOM 7497  C C    . SER A 1 104 ? 4.653   15.065  4.644   1.00 0.00 ? 104 SER A C    4  
ATOM 7498  O O    . SER A 1 104 ? 5.265   14.878  3.592   1.00 0.00 ? 104 SER A O    4  
ATOM 7499  C CB   . SER A 1 104 ? 5.381   16.626  6.458   1.00 0.00 ? 104 SER A CB   4  
ATOM 7500  O OG   . SER A 1 104 ? 5.327   17.951  6.958   1.00 0.00 ? 104 SER A OG   4  
ATOM 7501  H H    . SER A 1 104 ? 2.897   17.250  6.366   1.00 0.00 ? 104 SER A H    4  
ATOM 7502  H HA   . SER A 1 104 ? 4.803   17.188  4.474   1.00 0.00 ? 104 SER A HA   4  
ATOM 7503  H HB2  . SER A 1 104 ? 5.042   15.950  7.227   1.00 0.00 ? 104 SER A HB2  4  
ATOM 7504  H HB3  . SER A 1 104 ? 6.403   16.393  6.198   1.00 0.00 ? 104 SER A HB3  4  
ATOM 7505  H HG   . SER A 1 104 ? 4.410   18.221  7.052   1.00 0.00 ? 104 SER A HG   4  
ATOM 7506  N N    . ASP A 1 105 ? 4.096   14.081  5.341   1.00 0.00 ? 105 ASP A N    4  
ATOM 7507  C CA   . ASP A 1 105 ? 4.172   12.693  4.900   1.00 0.00 ? 105 ASP A CA   4  
ATOM 7508  C C    . ASP A 1 105 ? 2.780   12.134  4.622   1.00 0.00 ? 105 ASP A C    4  
ATOM 7509  O O    . ASP A 1 105 ? 2.034   11.777  5.534   1.00 0.00 ? 105 ASP A O    4  
ATOM 7510  C CB   . ASP A 1 105 ? 4.877   11.838  5.954   1.00 0.00 ? 105 ASP A CB   4  
ATOM 7511  C CG   . ASP A 1 105 ? 6.388   11.928  5.855   1.00 0.00 ? 105 ASP A CG   4  
ATOM 7512  O OD1  . ASP A 1 105 ? 6.917   13.059  5.860   1.00 0.00 ? 105 ASP A OD1  4  
ATOM 7513  O OD2  . ASP A 1 105 ? 7.040   10.866  5.775   1.00 0.00 ? 105 ASP A OD2  4  
ATOM 7514  H H    . ASP A 1 105 ? 3.621   14.293  6.172   1.00 0.00 ? 105 ASP A H    4  
ATOM 7515  H HA   . ASP A 1 105 ? 4.746   12.667  3.986   1.00 0.00 ? 105 ASP A HA   4  
ATOM 7516  H HB2  . ASP A 1 105 ? 4.579   12.172  6.937   1.00 0.00 ? 105 ASP A HB2  4  
ATOM 7517  H HB3  . ASP A 1 105 ? 4.586   10.806  5.825   1.00 0.00 ? 105 ASP A HB3  4  
ATOM 7518  N N    . PRO A 1 106 ? 2.419   12.057  3.332   1.00 0.00 ? 106 PRO A N    4  
ATOM 7519  C CA   . PRO A 1 106 ? 1.115   11.543  2.905   1.00 0.00 ? 106 PRO A CA   4  
ATOM 7520  C C    . PRO A 1 106 ? 0.980   10.041  3.134   1.00 0.00 ? 106 PRO A C    4  
ATOM 7521  O O    . PRO A 1 106 ? 1.959   9.300   3.046   1.00 0.00 ? 106 PRO A O    4  
ATOM 7522  C CB   . PRO A 1 106 ? 1.082   11.860  1.408   1.00 0.00 ? 106 PRO A CB   4  
ATOM 7523  C CG   . PRO A 1 106 ? 2.514   11.924  1.002   1.00 0.00 ? 106 PRO A CG   4  
ATOM 7524  C CD   . PRO A 1 106 ? 3.258   12.465  2.193   1.00 0.00 ? 106 PRO A CD   4  
ATOM 7525  H HA   . PRO A 1 106 ? 0.304   12.056  3.401   1.00 0.00 ? 106 PRO A HA   4  
ATOM 7526  H HB2  . PRO A 1 106 ? 0.556   11.076  0.882   1.00 0.00 ? 106 PRO A HB2  4  
ATOM 7527  H HB3  . PRO A 1 106 ? 0.584   12.805  1.247   1.00 0.00 ? 106 PRO A HB3  4  
ATOM 7528  H HG2  . PRO A 1 106 ? 2.870   10.936  0.755   1.00 0.00 ? 106 PRO A HG2  4  
ATOM 7529  H HG3  . PRO A 1 106 ? 2.627   12.588  0.158   1.00 0.00 ? 106 PRO A HG3  4  
ATOM 7530  H HD2  . PRO A 1 106 ? 4.240   12.021  2.258   1.00 0.00 ? 106 PRO A HD2  4  
ATOM 7531  H HD3  . PRO A 1 106 ? 3.331   13.541  2.135   1.00 0.00 ? 106 PRO A HD3  4  
ATOM 7532  N N    . TYR A 1 107 ? -0.238  9.599   3.427   1.00 0.00 ? 107 TYR A N    4  
ATOM 7533  C CA   . TYR A 1 107 ? -0.500  8.186   3.671   1.00 0.00 ? 107 TYR A CA   4  
ATOM 7534  C C    . TYR A 1 107 ? -1.974  7.859   3.449   1.00 0.00 ? 107 TYR A C    4  
ATOM 7535  O O    . TYR A 1 107 ? -2.853  8.667   3.749   1.00 0.00 ? 107 TYR A O    4  
ATOM 7536  C CB   . TYR A 1 107 ? -0.091  7.808   5.095   1.00 0.00 ? 107 TYR A CB   4  
ATOM 7537  C CG   . TYR A 1 107 ? -0.959  8.437   6.162   1.00 0.00 ? 107 TYR A CG   4  
ATOM 7538  C CD1  . TYR A 1 107 ? -0.681  9.706   6.652   1.00 0.00 ? 107 TYR A CD1  4  
ATOM 7539  C CD2  . TYR A 1 107 ? -2.058  7.761   6.678   1.00 0.00 ? 107 TYR A CD2  4  
ATOM 7540  C CE1  . TYR A 1 107 ? -1.471  10.284  7.627   1.00 0.00 ? 107 TYR A CE1  4  
ATOM 7541  C CE2  . TYR A 1 107 ? -2.855  8.332   7.652   1.00 0.00 ? 107 TYR A CE2  4  
ATOM 7542  C CZ   . TYR A 1 107 ? -2.557  9.593   8.123   1.00 0.00 ? 107 TYR A CZ   4  
ATOM 7543  O OH   . TYR A 1 107 ? -3.347  10.166  9.093   1.00 0.00 ? 107 TYR A OH   4  
ATOM 7544  H H    . TYR A 1 107 ? -0.978  10.239  3.483   1.00 0.00 ? 107 TYR A H    4  
ATOM 7545  H HA   . TYR A 1 107 ? 0.093   7.613   2.973   1.00 0.00 ? 107 TYR A HA   4  
ATOM 7546  H HB2  . TYR A 1 107 ? -0.152  6.737   5.208   1.00 0.00 ? 107 TYR A HB2  4  
ATOM 7547  H HB3  . TYR A 1 107 ? 0.927   8.125   5.266   1.00 0.00 ? 107 TYR A HB3  4  
ATOM 7548  H HD1  . TYR A 1 107 ? 0.170   10.245  6.261   1.00 0.00 ? 107 TYR A HD1  4  
ATOM 7549  H HD2  . TYR A 1 107 ? -2.289  6.773   6.306   1.00 0.00 ? 107 TYR A HD2  4  
ATOM 7550  H HE1  . TYR A 1 107 ? -1.238  11.272  7.996   1.00 0.00 ? 107 TYR A HE1  4  
ATOM 7551  H HE2  . TYR A 1 107 ? -3.705  7.791   8.041   1.00 0.00 ? 107 TYR A HE2  4  
ATOM 7552  H HH   . TYR A 1 107 ? -3.802  9.477   9.583   1.00 0.00 ? 107 TYR A HH   4  
ATOM 7553  N N    . LYS A 1 108 ? -2.236  6.668   2.922   1.00 0.00 ? 108 LYS A N    4  
ATOM 7554  C CA   . LYS A 1 108 ? -3.602  6.230   2.661   1.00 0.00 ? 108 LYS A CA   4  
ATOM 7555  C C    . LYS A 1 108 ? -4.034  5.167   3.665   1.00 0.00 ? 108 LYS A C    4  
ATOM 7556  O O    . LYS A 1 108 ? -3.385  4.130   3.805   1.00 0.00 ? 108 LYS A O    4  
ATOM 7557  C CB   . LYS A 1 108 ? -3.720  5.681   1.237   1.00 0.00 ? 108 LYS A CB   4  
ATOM 7558  C CG   . LYS A 1 108 ? -4.101  6.731   0.209   1.00 0.00 ? 108 LYS A CG   4  
ATOM 7559  C CD   . LYS A 1 108 ? -3.571  6.379   -1.171  1.00 0.00 ? 108 LYS A CD   4  
ATOM 7560  C CE   . LYS A 1 108 ? -3.665  7.562   -2.123  1.00 0.00 ? 108 LYS A CE   4  
ATOM 7561  N NZ   . LYS A 1 108 ? -4.963  7.585   -2.852  1.00 0.00 ? 108 LYS A NZ   4  
ATOM 7562  H H    . LYS A 1 108 ? -1.492  6.068   2.704   1.00 0.00 ? 108 LYS A H    4  
ATOM 7563  H HA   . LYS A 1 108 ? -4.250  7.088   2.761   1.00 0.00 ? 108 LYS A HA   4  
ATOM 7564  H HB2  . LYS A 1 108 ? -2.771  5.253   0.950   1.00 0.00 ? 108 LYS A HB2  4  
ATOM 7565  H HB3  . LYS A 1 108 ? -4.473  4.906   1.225   1.00 0.00 ? 108 LYS A HB3  4  
ATOM 7566  H HG2  . LYS A 1 108 ? -5.177  6.803   0.162   1.00 0.00 ? 108 LYS A HG2  4  
ATOM 7567  H HG3  . LYS A 1 108 ? -3.688  7.684   0.511   1.00 0.00 ? 108 LYS A HG3  4  
ATOM 7568  H HD2  . LYS A 1 108 ? -2.537  6.082   -1.085  1.00 0.00 ? 108 LYS A HD2  4  
ATOM 7569  H HD3  . LYS A 1 108 ? -4.151  5.559   -1.571  1.00 0.00 ? 108 LYS A HD3  4  
ATOM 7570  H HE2  . LYS A 1 108 ? -3.566  8.474   -1.554  1.00 0.00 ? 108 LYS A HE2  4  
ATOM 7571  H HE3  . LYS A 1 108 ? -2.860  7.495   -2.839  1.00 0.00 ? 108 LYS A HE3  4  
ATOM 7572  H HZ1  . LYS A 1 108 ? -4.900  8.220   -3.674  1.00 0.00 ? 108 LYS A HZ1  4  
ATOM 7573  H HZ2  . LYS A 1 108 ? -5.720  7.924   -2.224  1.00 0.00 ? 108 LYS A HZ2  4  
ATOM 7574  H HZ3  . LYS A 1 108 ? -5.204  6.629   -3.184  1.00 0.00 ? 108 LYS A HZ3  4  
ATOM 7575  N N    . VAL A 1 109 ? -5.135  5.430   4.362   1.00 0.00 ? 109 VAL A N    4  
ATOM 7576  C CA   . VAL A 1 109 ? -5.655  4.494   5.352   1.00 0.00 ? 109 VAL A CA   4  
ATOM 7577  C C    . VAL A 1 109 ? -6.717  3.585   4.743   1.00 0.00 ? 109 VAL A C    4  
ATOM 7578  O O    . VAL A 1 109 ? -7.560  4.032   3.966   1.00 0.00 ? 109 VAL A O    4  
ATOM 7579  C CB   . VAL A 1 109 ? -6.259  5.233   6.560   1.00 0.00 ? 109 VAL A CB   4  
ATOM 7580  C CG1  . VAL A 1 109 ? -6.701  4.242   7.626   1.00 0.00 ? 109 VAL A CG1  4  
ATOM 7581  C CG2  . VAL A 1 109 ? -5.260  6.230   7.128   1.00 0.00 ? 109 VAL A CG2  4  
ATOM 7582  H H    . VAL A 1 109 ? -5.609  6.273   4.206   1.00 0.00 ? 109 VAL A H    4  
ATOM 7583  H HA   . VAL A 1 109 ? -4.833  3.887   5.702   1.00 0.00 ? 109 VAL A HA   4  
ATOM 7584  H HB   . VAL A 1 109 ? -7.129  5.779   6.225   1.00 0.00 ? 109 VAL A HB   4  
ATOM 7585  H HG11 . VAL A 1 109 ? -7.092  4.780   8.478   1.00 0.00 ? 109 VAL A HG11 4  
ATOM 7586  H HG12 . VAL A 1 109 ? -7.468  3.597   7.223   1.00 0.00 ? 109 VAL A HG12 4  
ATOM 7587  H HG13 . VAL A 1 109 ? -5.855  3.646   7.936   1.00 0.00 ? 109 VAL A HG13 4  
ATOM 7588  H HG21 . VAL A 1 109 ? -5.792  7.058   7.572   1.00 0.00 ? 109 VAL A HG21 4  
ATOM 7589  H HG22 . VAL A 1 109 ? -4.656  5.745   7.882   1.00 0.00 ? 109 VAL A HG22 4  
ATOM 7590  H HG23 . VAL A 1 109 ? -4.623  6.594   6.336   1.00 0.00 ? 109 VAL A HG23 4  
ATOM 7591  N N    . TYR A 1 110 ? -6.670  2.307   5.103   1.00 0.00 ? 110 TYR A N    4  
ATOM 7592  C CA   . TYR A 1 110 ? -7.627  1.333   4.591   1.00 0.00 ? 110 TYR A CA   4  
ATOM 7593  C C    . TYR A 1 110 ? -8.092  0.392   5.699   1.00 0.00 ? 110 TYR A C    4  
ATOM 7594  O O    . TYR A 1 110 ? -7.372  0.153   6.668   1.00 0.00 ? 110 TYR A O    4  
ATOM 7595  C CB   . TYR A 1 110 ? -7.005  0.527   3.450   1.00 0.00 ? 110 TYR A CB   4  
ATOM 7596  C CG   . TYR A 1 110 ? -7.089  1.216   2.106   1.00 0.00 ? 110 TYR A CG   4  
ATOM 7597  C CD1  . TYR A 1 110 ? -6.131  2.145   1.720   1.00 0.00 ? 110 TYR A CD1  4  
ATOM 7598  C CD2  . TYR A 1 110 ? -8.126  0.939   1.225   1.00 0.00 ? 110 TYR A CD2  4  
ATOM 7599  C CE1  . TYR A 1 110 ? -6.204  2.778   0.494   1.00 0.00 ? 110 TYR A CE1  4  
ATOM 7600  C CE2  . TYR A 1 110 ? -8.206  1.565   -0.004  1.00 0.00 ? 110 TYR A CE2  4  
ATOM 7601  C CZ   . TYR A 1 110 ? -7.243  2.484   -0.365  1.00 0.00 ? 110 TYR A CZ   4  
ATOM 7602  O OH   . TYR A 1 110 ? -7.319  3.111   -1.587  1.00 0.00 ? 110 TYR A OH   4  
ATOM 7603  H H    . TYR A 1 110 ? -5.975  2.011   5.727   1.00 0.00 ? 110 TYR A H    4  
ATOM 7604  H HA   . TYR A 1 110 ? -8.481  1.875   4.213   1.00 0.00 ? 110 TYR A HA   4  
ATOM 7605  H HB2  . TYR A 1 110 ? -5.963  0.352   3.668   1.00 0.00 ? 110 TYR A HB2  4  
ATOM 7606  H HB3  . TYR A 1 110 ? -7.515  -0.422  3.369   1.00 0.00 ? 110 TYR A HB3  4  
ATOM 7607  H HD1  . TYR A 1 110 ? -5.318  2.373   2.394   1.00 0.00 ? 110 TYR A HD1  4  
ATOM 7608  H HD2  . TYR A 1 110 ? -8.879  0.219   1.511   1.00 0.00 ? 110 TYR A HD2  4  
ATOM 7609  H HE1  . TYR A 1 110 ? -5.449  3.497   0.210   1.00 0.00 ? 110 TYR A HE1  4  
ATOM 7610  H HE2  . TYR A 1 110 ? -9.020  1.336   -0.676  1.00 0.00 ? 110 TYR A HE2  4  
ATOM 7611  H HH   . TYR A 1 110 ? -7.418  2.453   -2.279  1.00 0.00 ? 110 TYR A HH   4  
ATOM 7612  N N    . ARG A 1 111 ? -9.301  -0.138  5.547   1.00 0.00 ? 111 ARG A N    4  
ATOM 7613  C CA   . ARG A 1 111 ? -9.864  -1.052  6.533   1.00 0.00 ? 111 ARG A CA   4  
ATOM 7614  C C    . ARG A 1 111 ? -10.133 -2.421  5.914   1.00 0.00 ? 111 ARG A C    4  
ATOM 7615  O O    . ARG A 1 111 ? -10.796 -2.527  4.882   1.00 0.00 ? 111 ARG A O    4  
ATOM 7616  C CB   . ARG A 1 111 ? -11.160 -0.478  7.110   1.00 0.00 ? 111 ARG A CB   4  
ATOM 7617  C CG   . ARG A 1 111 ? -11.972 -1.488  7.905   1.00 0.00 ? 111 ARG A CG   4  
ATOM 7618  C CD   . ARG A 1 111 ? -13.455 -1.151  7.883   1.00 0.00 ? 111 ARG A CD   4  
ATOM 7619  N NE   . ARG A 1 111 ? -14.289 -2.346  7.969   1.00 0.00 ? 111 ARG A NE   4  
ATOM 7620  C CZ   . ARG A 1 111 ? -15.513 -2.353  8.486   1.00 0.00 ? 111 ARG A CZ   4  
ATOM 7621  N NH1  . ARG A 1 111 ? -16.042 -1.233  8.960   1.00 0.00 ? 111 ARG A NH1  4  
ATOM 7622  N NH2  . ARG A 1 111 ? -16.210 -3.481  8.528   1.00 0.00 ? 111 ARG A NH2  4  
ATOM 7623  H H    . ARG A 1 111 ? -9.828  0.092   4.752   1.00 0.00 ? 111 ARG A H    4  
ATOM 7624  H HA   . ARG A 1 111 ? -9.144  -1.165  7.330   1.00 0.00 ? 111 ARG A HA   4  
ATOM 7625  H HB2  . ARG A 1 111 ? -10.915 0.347   7.763   1.00 0.00 ? 111 ARG A HB2  4  
ATOM 7626  H HB3  . ARG A 1 111 ? -11.772 -0.115  6.299   1.00 0.00 ? 111 ARG A HB3  4  
ATOM 7627  H HG2  . ARG A 1 111 ? -11.831 -2.469  7.474   1.00 0.00 ? 111 ARG A HG2  4  
ATOM 7628  H HG3  . ARG A 1 111 ? -11.627 -1.489  8.928   1.00 0.00 ? 111 ARG A HG3  4  
ATOM 7629  H HD2  . ARG A 1 111 ? -13.676 -0.508  8.721   1.00 0.00 ? 111 ARG A HD2  4  
ATOM 7630  H HD3  . ARG A 1 111 ? -13.678 -0.632  6.963   1.00 0.00 ? 111 ARG A HD3  4  
ATOM 7631  H HE   . ARG A 1 111 ? -13.918 -3.185  7.624   1.00 0.00 ? 111 ARG A HE   4  
ATOM 7632  H HH11 . ARG A 1 111 ? -15.519 -0.382  8.928   1.00 0.00 ? 111 ARG A HH11 4  
ATOM 7633  H HH12 . ARG A 1 111 ? -16.964 -1.241  9.348   1.00 0.00 ? 111 ARG A HH12 4  
ATOM 7634  H HH21 . ARG A 1 111 ? -15.815 -4.327  8.172   1.00 0.00 ? 111 ARG A HH21 4  
ATOM 7635  H HH22 . ARG A 1 111 ? -17.131 -3.485  8.918   1.00 0.00 ? 111 ARG A HH22 4  
ATOM 7636  N N    . ILE A 1 112 ? -9.614  -3.465  6.552   1.00 0.00 ? 112 ILE A N    4  
ATOM 7637  C CA   . ILE A 1 112 ? -9.798  -4.826  6.065   1.00 0.00 ? 112 ILE A CA   4  
ATOM 7638  C C    . ILE A 1 112 ? -11.228 -5.303  6.294   1.00 0.00 ? 112 ILE A C    4  
ATOM 7639  O O    . ILE A 1 112 ? -11.598 -5.677  7.407   1.00 0.00 ? 112 ILE A O    4  
ATOM 7640  C CB   . ILE A 1 112 ? -8.826  -5.805  6.749   1.00 0.00 ? 112 ILE A CB   4  
ATOM 7641  C CG1  . ILE A 1 112 ? -7.378  -5.382  6.493   1.00 0.00 ? 112 ILE A CG1  4  
ATOM 7642  C CG2  . ILE A 1 112 ? -9.065  -7.223  6.251   1.00 0.00 ? 112 ILE A CG2  4  
ATOM 7643  C CD1  . ILE A 1 112 ? -6.371  -6.137  7.333   1.00 0.00 ? 112 ILE A CD1  4  
ATOM 7644  H H    . ILE A 1 112 ? -9.095  -3.316  7.370   1.00 0.00 ? 112 ILE A H    4  
ATOM 7645  H HA   . ILE A 1 112 ? -9.594  -4.830  5.003   1.00 0.00 ? 112 ILE A HA   4  
ATOM 7646  H HB   . ILE A 1 112 ? -9.018  -5.785  7.810   1.00 0.00 ? 112 ILE A HB   4  
ATOM 7647  H HG12 . ILE A 1 112 ? -7.137  -5.552  5.456   1.00 0.00 ? 112 ILE A HG12 4  
ATOM 7648  H HG13 . ILE A 1 112 ? -7.274  -4.330  6.715   1.00 0.00 ? 112 ILE A HG13 4  
ATOM 7649  H HG21 . ILE A 1 112 ? -9.308  -7.862  7.087   1.00 0.00 ? 112 ILE A HG21 4  
ATOM 7650  H HG22 . ILE A 1 112 ? -9.884  -7.224  5.548   1.00 0.00 ? 112 ILE A HG22 4  
ATOM 7651  H HG23 . ILE A 1 112 ? -8.173  -7.590  5.766   1.00 0.00 ? 112 ILE A HG23 4  
ATOM 7652  H HD11 . ILE A 1 112 ? -5.581  -5.466  7.638   1.00 0.00 ? 112 ILE A HD11 4  
ATOM 7653  H HD12 . ILE A 1 112 ? -6.860  -6.540  8.207   1.00 0.00 ? 112 ILE A HD12 4  
ATOM 7654  H HD13 . ILE A 1 112 ? -5.950  -6.945  6.751   1.00 0.00 ? 112 ILE A HD13 4  
ATOM 7655  N N    . VAL A 1 113 ? -12.028 -5.289  5.233   1.00 0.00 ? 113 VAL A N    4  
ATOM 7656  C CA   . VAL A 1 113 ? -13.417 -5.724  5.317   1.00 0.00 ? 113 VAL A CA   4  
ATOM 7657  C C    . VAL A 1 113 ? -13.521 -7.244  5.290   1.00 0.00 ? 113 VAL A C    4  
ATOM 7658  O O    . VAL A 1 113 ? -13.062 -7.906  4.358   1.00 0.00 ? 113 VAL A O    4  
ATOM 7659  C CB   . VAL A 1 113 ? -14.258 -5.142  4.165   1.00 0.00 ? 113 VAL A CB   4  
ATOM 7660  C CG1  . VAL A 1 113 ? -15.743 -5.310  4.450   1.00 0.00 ? 113 VAL A CG1  4  
ATOM 7661  C CG2  . VAL A 1 113 ? -13.912 -3.678  3.940   1.00 0.00 ? 113 VAL A CG2  4  
ATOM 7662  H H    . VAL A 1 113 ? -11.675 -4.981  4.372   1.00 0.00 ? 113 VAL A H    4  
ATOM 7663  H HA   . VAL A 1 113 ? -13.824 -5.361  6.250   1.00 0.00 ? 113 VAL A HA   4  
ATOM 7664  H HB   . VAL A 1 113 ? -14.023 -5.689  3.264   1.00 0.00 ? 113 VAL A HB   4  
ATOM 7665  H HG11 . VAL A 1 113 ? -16.287 -5.334  3.517   1.00 0.00 ? 113 VAL A HG11 4  
ATOM 7666  H HG12 . VAL A 1 113 ? -15.905 -6.233  4.988   1.00 0.00 ? 113 VAL A HG12 4  
ATOM 7667  H HG13 . VAL A 1 113 ? -16.091 -4.479  5.047   1.00 0.00 ? 113 VAL A HG13 4  
ATOM 7668  H HG21 . VAL A 1 113 ? -12.993 -3.443  4.455   1.00 0.00 ? 113 VAL A HG21 4  
ATOM 7669  H HG22 . VAL A 1 113 ? -13.788 -3.495  2.882   1.00 0.00 ? 113 VAL A HG22 4  
ATOM 7670  H HG23 . VAL A 1 113 ? -14.709 -3.057  4.321   1.00 0.00 ? 113 VAL A HG23 4  
ATOM 7671  N N    . PRO A 1 114 ? -14.138 -7.814  6.336   1.00 0.00 ? 114 PRO A N    4  
ATOM 7672  C CA   . PRO A 1 114 ? -14.317 -9.264  6.455   1.00 0.00 ? 114 PRO A CA   4  
ATOM 7673  C C    . PRO A 1 114 ? -15.317 -9.810  5.442   1.00 0.00 ? 114 PRO A C    4  
ATOM 7674  O O    . PRO A 1 114 ? -15.827 -9.071  4.600   1.00 0.00 ? 114 PRO A O    4  
ATOM 7675  C CB   . PRO A 1 114 ? -14.848 -9.440  7.880   1.00 0.00 ? 114 PRO A CB   4  
ATOM 7676  C CG   . PRO A 1 114 ? -15.502 -8.141  8.203   1.00 0.00 ? 114 PRO A CG   4  
ATOM 7677  C CD   . PRO A 1 114 ? -14.708 -7.087  7.482   1.00 0.00 ? 114 PRO A CD   4  
ATOM 7678  H HA   . PRO A 1 114 ? -13.379 -9.790  6.352   1.00 0.00 ? 114 PRO A HA   4  
ATOM 7679  H HB2  . PRO A 1 114 ? -15.556 -10.257 7.904   1.00 0.00 ? 114 PRO A HB2  4  
ATOM 7680  H HB3  . PRO A 1 114 ? -14.028 -9.647  8.551   1.00 0.00 ? 114 PRO A HB3  4  
ATOM 7681  H HG2  . PRO A 1 114 ? -16.523 -8.147  7.853   1.00 0.00 ? 114 PRO A HG2  4  
ATOM 7682  H HG3  . PRO A 1 114 ? -15.471 -7.970  9.269   1.00 0.00 ? 114 PRO A HG3  4  
ATOM 7683  H HD2  . PRO A 1 114 ? -15.355 -6.289  7.149   1.00 0.00 ? 114 PRO A HD2  4  
ATOM 7684  H HD3  . PRO A 1 114 ? -13.927 -6.701  8.120   1.00 0.00 ? 114 PRO A HD3  4  
ATOM 7685  N N    . GLU A 1 115 ? -15.594 -11.107 5.530   1.00 0.00 ? 115 GLU A N    4  
ATOM 7686  C CA   . GLU A 1 115 ? -16.534 -11.751 4.619   1.00 0.00 ? 115 GLU A CA   4  
ATOM 7687  C C    . GLU A 1 115 ? -17.964 -11.627 5.137   1.00 0.00 ? 115 GLU A C    4  
ATOM 7688  O O    . GLU A 1 115 ? -18.201 -11.078 6.213   1.00 0.00 ? 115 GLU A O    4  
ATOM 7689  C CB   . GLU A 1 115 ? -16.172 -13.226 4.436   1.00 0.00 ? 115 GLU A CB   4  
ATOM 7690  C CG   . GLU A 1 115 ? -16.488 -14.085 5.649   1.00 0.00 ? 115 GLU A CG   4  
ATOM 7691  C CD   . GLU A 1 115 ? -16.426 -15.570 5.345   1.00 0.00 ? 115 GLU A CD   4  
ATOM 7692  O OE1  . GLU A 1 115 ? -17.027 -15.994 4.336   1.00 0.00 ? 115 GLU A OE1  4  
ATOM 7693  O OE2  . GLU A 1 115 ? -15.777 -16.306 6.116   1.00 0.00 ? 115 GLU A OE2  4  
ATOM 7694  H H    . GLU A 1 115 ? -15.155 -11.644 6.222   1.00 0.00 ? 115 GLU A H    4  
ATOM 7695  H HA   . GLU A 1 115 ? -16.465 -11.252 3.665   1.00 0.00 ? 115 GLU A HA   4  
ATOM 7696  H HB2  . GLU A 1 115 ? -16.720 -13.617 3.591   1.00 0.00 ? 115 GLU A HB2  4  
ATOM 7697  H HB3  . GLU A 1 115 ? -15.114 -13.302 4.233   1.00 0.00 ? 115 GLU A HB3  4  
ATOM 7698  H HG2  . GLU A 1 115 ? -15.773 -13.863 6.427   1.00 0.00 ? 115 GLU A HG2  4  
ATOM 7699  H HG3  . GLU A 1 115 ? -17.482 -13.845 5.996   1.00 0.00 ? 115 GLU A HG3  4  
ATOM 7700  N N    . SER A 1 116 ? -18.914 -12.141 4.362   1.00 0.00 ? 116 SER A N    4  
ATOM 7701  C CA   . SER A 1 116 ? -20.322 -12.084 4.739   1.00 0.00 ? 116 SER A CA   4  
ATOM 7702  C C    . SER A 1 116 ? -20.954 -13.472 4.689   1.00 0.00 ? 116 SER A C    4  
ATOM 7703  O O    . SER A 1 116 ? -20.670 -14.263 3.791   1.00 0.00 ? 116 SER A O    4  
ATOM 7704  C CB   . SER A 1 116 ? -21.081 -11.132 3.814   1.00 0.00 ? 116 SER A CB   4  
ATOM 7705  O OG   . SER A 1 116 ? -22.391 -10.888 4.298   1.00 0.00 ? 116 SER A OG   4  
ATOM 7706  H H    . SER A 1 116 ? -18.662 -12.566 3.516   1.00 0.00 ? 116 SER A H    4  
ATOM 7707  H HA   . SER A 1 116 ? -20.379 -11.712 5.751   1.00 0.00 ? 116 SER A HA   4  
ATOM 7708  H HB2  . SER A 1 116 ? -20.552 -10.193 3.755   1.00 0.00 ? 116 SER A HB2  4  
ATOM 7709  H HB3  . SER A 1 116 ? -21.150 -11.569 2.829   1.00 0.00 ? 116 SER A HB3  4  
ATOM 7710  H HG   . SER A 1 116 ? -22.962 -11.622 4.061   1.00 0.00 ? 116 SER A HG   4  
ATOM 7711  N N    . GLY A 1 117 ? -21.813 -13.760 5.662   1.00 0.00 ? 117 GLY A N    4  
ATOM 7712  C CA   . GLY A 1 117 ? -22.472 -15.052 5.712   1.00 0.00 ? 117 GLY A CA   4  
ATOM 7713  C C    . GLY A 1 117 ? -23.011 -15.375 7.091   1.00 0.00 ? 117 GLY A C    4  
ATOM 7714  O O    . GLY A 1 117 ? -22.624 -14.769 8.090   1.00 0.00 ? 117 GLY A O    4  
ATOM 7715  H H    . GLY A 1 117 ? -22.000 -13.089 6.353   1.00 0.00 ? 117 GLY A H    4  
ATOM 7716  H HA2  . GLY A 1 117 ? -23.290 -15.053 5.007   1.00 0.00 ? 117 GLY A HA2  4  
ATOM 7717  H HA3  . GLY A 1 117 ? -21.763 -15.816 5.427   1.00 0.00 ? 117 GLY A HA3  4  
ATOM 7718  N N    . PRO A 1 118 ? -23.930 -16.350 7.158   1.00 0.00 ? 118 PRO A N    4  
ATOM 7719  C CA   . PRO A 1 118 ? -24.544 -16.774 8.420   1.00 0.00 ? 118 PRO A CA   4  
ATOM 7720  C C    . PRO A 1 118 ? -23.559 -17.504 9.327   1.00 0.00 ? 118 PRO A C    4  
ATOM 7721  O O    . PRO A 1 118 ? -23.127 -18.616 9.022   1.00 0.00 ? 118 PRO A O    4  
ATOM 7722  C CB   . PRO A 1 118 ? -25.660 -17.721 7.971   1.00 0.00 ? 118 PRO A CB   4  
ATOM 7723  C CG   . PRO A 1 118 ? -25.210 -18.236 6.647   1.00 0.00 ? 118 PRO A CG   4  
ATOM 7724  C CD   . PRO A 1 118 ? -24.438 -17.115 6.007   1.00 0.00 ? 118 PRO A CD   4  
ATOM 7725  H HA   . PRO A 1 118 ? -24.971 -15.938 8.953   1.00 0.00 ? 118 PRO A HA   4  
ATOM 7726  H HB2  . PRO A 1 118 ? -25.769 -18.520 8.690   1.00 0.00 ? 118 PRO A HB2  4  
ATOM 7727  H HB3  . PRO A 1 118 ? -26.588 -17.175 7.887   1.00 0.00 ? 118 PRO A HB3  4  
ATOM 7728  H HG2  . PRO A 1 118 ? -24.575 -19.098 6.785   1.00 0.00 ? 118 PRO A HG2  4  
ATOM 7729  H HG3  . PRO A 1 118 ? -26.068 -18.492 6.043   1.00 0.00 ? 118 PRO A HG3  4  
ATOM 7730  H HD2  . PRO A 1 118 ? -23.625 -17.507 5.414   1.00 0.00 ? 118 PRO A HD2  4  
ATOM 7731  H HD3  . PRO A 1 118 ? -25.091 -16.506 5.399   1.00 0.00 ? 118 PRO A HD3  4  
ATOM 7732  N N    . SER A 1 119 ? -23.210 -16.873 10.443  1.00 0.00 ? 119 SER A N    4  
ATOM 7733  C CA   . SER A 1 119 ? -22.273 -17.461 11.393  1.00 0.00 ? 119 SER A CA   4  
ATOM 7734  C C    . SER A 1 119 ? -23.009 -18.306 12.429  1.00 0.00 ? 119 SER A C    4  
ATOM 7735  O O    . SER A 1 119 ? -24.160 -18.028 12.768  1.00 0.00 ? 119 SER A O    4  
ATOM 7736  C CB   . SER A 1 119 ? -21.466 -16.365 12.092  1.00 0.00 ? 119 SER A CB   4  
ATOM 7737  O OG   . SER A 1 119 ? -22.314 -15.492 12.818  1.00 0.00 ? 119 SER A OG   4  
ATOM 7738  H H    . SER A 1 119 ? -23.589 -15.988 10.630  1.00 0.00 ? 119 SER A H    4  
ATOM 7739  H HA   . SER A 1 119 ? -21.597 -18.098 10.842  1.00 0.00 ? 119 SER A HA   4  
ATOM 7740  H HB2  . SER A 1 119 ? -20.766 -16.819 12.777  1.00 0.00 ? 119 SER A HB2  4  
ATOM 7741  H HB3  . SER A 1 119 ? -20.927 -15.792 11.352  1.00 0.00 ? 119 SER A HB3  4  
ATOM 7742  H HG   . SER A 1 119 ? -23.135 -15.944 13.028  1.00 0.00 ? 119 SER A HG   4  
ATOM 7743  N N    . SER A 1 120 ? -22.337 -19.338 12.928  1.00 0.00 ? 120 SER A N    4  
ATOM 7744  C CA   . SER A 1 120 ? -22.927 -20.226 13.923  1.00 0.00 ? 120 SER A CA   4  
ATOM 7745  C C    . SER A 1 120 ? -22.169 -20.142 15.244  1.00 0.00 ? 120 SER A C    4  
ATOM 7746  O O    . SER A 1 120 ? -21.074 -19.586 15.310  1.00 0.00 ? 120 SER A O    4  
ATOM 7747  C CB   . SER A 1 120 ? -22.928 -21.668 13.413  1.00 0.00 ? 120 SER A CB   4  
ATOM 7748  O OG   . SER A 1 120 ? -23.824 -21.824 12.326  1.00 0.00 ? 120 SER A OG   4  
ATOM 7749  H H    . SER A 1 120 ? -21.422 -19.507 12.618  1.00 0.00 ? 120 SER A H    4  
ATOM 7750  H HA   . SER A 1 120 ? -23.947 -19.910 14.086  1.00 0.00 ? 120 SER A HA   4  
ATOM 7751  H HB2  . SER A 1 120 ? -21.934 -21.932 13.085  1.00 0.00 ? 120 SER A HB2  4  
ATOM 7752  H HB3  . SER A 1 120 ? -23.232 -22.329 14.212  1.00 0.00 ? 120 SER A HB3  4  
ATOM 7753  H HG   . SER A 1 120 ? -24.441 -21.089 12.311  1.00 0.00 ? 120 SER A HG   4  
ATOM 7754  N N    . GLY A 1 121 ? -22.761 -20.700 16.296  1.00 0.00 ? 121 GLY A N    4  
ATOM 7755  C CA   . GLY A 1 121 ? -22.129 -20.678 17.602  1.00 0.00 ? 121 GLY A CA   4  
ATOM 7756  C C    . GLY A 1 121 ? -21.898 -19.269 18.111  1.00 0.00 ? 121 GLY A C    4  
ATOM 7757  O O    . GLY A 1 121 ? -21.262 -19.072 19.146  1.00 0.00 ? 121 GLY A O    4  
ATOM 7758  H H    . GLY A 1 121 ? -23.635 -21.130 16.184  1.00 0.00 ? 121 GLY A H    4  
ATOM 7759  H HA2  . GLY A 1 121 ? -22.758 -21.205 18.303  1.00 0.00 ? 121 GLY A HA2  4  
ATOM 7760  H HA3  . GLY A 1 121 ? -21.177 -21.185 17.536  1.00 0.00 ? 121 GLY A HA3  4  
ATOM 7761  N N    . GLY A 1 1   ? -6.520  -23.064 -0.141  1.00 0.00 ? 1   GLY A N    5  
ATOM 7762  C CA   . GLY A 1 1   ? -5.385  -22.874 0.742   1.00 0.00 ? 1   GLY A CA   5  
ATOM 7763  C C    . GLY A 1 1   ? -5.389  -23.842 1.908   1.00 0.00 ? 1   GLY A C    5  
ATOM 7764  O O    . GLY A 1 1   ? -5.544  -23.435 3.060   1.00 0.00 ? 1   GLY A O    5  
ATOM 7765  H H1   . GLY A 1 1   ? -6.728  -23.959 -0.483  1.00 0.00 ? 1   GLY A H1   5  
ATOM 7766  H HA2  . GLY A 1 1   ? -4.475  -23.012 0.176   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7767  H HA3  . GLY A 1 1   ? -5.408  -21.865 1.126   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7768  N N    . SER A 1 2   ? -5.221  -25.126 1.610   1.00 0.00 ? 2   SER A N    5  
ATOM 7769  C CA   . SER A 1 2   ? -5.212  -26.155 2.643   1.00 0.00 ? 2   SER A CA   5  
ATOM 7770  C C    . SER A 1 2   ? -3.837  -26.256 3.298   1.00 0.00 ? 2   SER A C    5  
ATOM 7771  O O    . SER A 1 2   ? -3.724  -26.332 4.521   1.00 0.00 ? 2   SER A O    5  
ATOM 7772  C CB   . SER A 1 2   ? -5.606  -27.509 2.048   1.00 0.00 ? 2   SER A CB   5  
ATOM 7773  O OG   . SER A 1 2   ? -5.444  -28.549 2.996   1.00 0.00 ? 2   SER A OG   5  
ATOM 7774  H H    . SER A 1 2   ? -5.103  -25.387 0.673   1.00 0.00 ? 2   SER A H    5  
ATOM 7775  H HA   . SER A 1 2   ? -5.936  -25.878 3.395   1.00 0.00 ? 2   SER A HA   5  
ATOM 7776  H HB2  . SER A 1 2   ? -6.640  -27.476 1.740   1.00 0.00 ? 2   SER A HB2  5  
ATOM 7777  H HB3  . SER A 1 2   ? -4.981  -27.717 1.191   1.00 0.00 ? 2   SER A HB3  5  
ATOM 7778  H HG   . SER A 1 2   ? -5.483  -29.398 2.549   1.00 0.00 ? 2   SER A HG   5  
ATOM 7779  N N    . SER A 1 3   ? -2.795  -26.256 2.473   1.00 0.00 ? 3   SER A N    5  
ATOM 7780  C CA   . SER A 1 3   ? -1.427  -26.351 2.970   1.00 0.00 ? 3   SER A CA   5  
ATOM 7781  C C    . SER A 1 3   ? -0.513  -25.376 2.235   1.00 0.00 ? 3   SER A C    5  
ATOM 7782  O O    . SER A 1 3   ? -0.712  -25.090 1.055   1.00 0.00 ? 3   SER A O    5  
ATOM 7783  C CB   . SER A 1 3   ? -0.902  -27.779 2.810   1.00 0.00 ? 3   SER A CB   5  
ATOM 7784  O OG   . SER A 1 3   ? -1.038  -28.226 1.472   1.00 0.00 ? 3   SER A OG   5  
ATOM 7785  H H    . SER A 1 3   ? -2.950  -26.193 1.507   1.00 0.00 ? 3   SER A H    5  
ATOM 7786  H HA   . SER A 1 3   ? -1.437  -26.096 4.019   1.00 0.00 ? 3   SER A HA   5  
ATOM 7787  H HB2  . SER A 1 3   ? 0.142   -27.809 3.082   1.00 0.00 ? 3   SER A HB2  5  
ATOM 7788  H HB3  . SER A 1 3   ? -1.461  -28.440 3.456   1.00 0.00 ? 3   SER A HB3  5  
ATOM 7789  H HG   . SER A 1 3   ? -1.861  -28.712 1.378   1.00 0.00 ? 3   SER A HG   5  
ATOM 7790  N N    . GLY A 1 4   ? 0.491   -24.867 2.943   1.00 0.00 ? 4   GLY A N    5  
ATOM 7791  C CA   . GLY A 1 4   ? 1.422   -23.929 2.343   1.00 0.00 ? 4   GLY A CA   5  
ATOM 7792  C C    . GLY A 1 4   ? 0.844   -22.532 2.228   1.00 0.00 ? 4   GLY A C    5  
ATOM 7793  O O    . GLY A 1 4   ? 0.147   -22.066 3.129   1.00 0.00 ? 4   GLY A O    5  
ATOM 7794  H H    . GLY A 1 4   ? 0.601   -25.131 3.881   1.00 0.00 ? 4   GLY A H    5  
ATOM 7795  H HA2  . GLY A 1 4   ? 2.316   -23.889 2.947   1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7796  H HA3  . GLY A 1 4   ? 1.682   -24.280 1.355   1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7797  N N    . SER A 1 5   ? 1.135   -21.862 1.118   1.00 0.00 ? 5   SER A N    5  
ATOM 7798  C CA   . SER A 1 5   ? 0.643   -20.508 0.891   1.00 0.00 ? 5   SER A CA   5  
ATOM 7799  C C    . SER A 1 5   ? 0.528   -20.215 -0.602  1.00 0.00 ? 5   SER A C    5  
ATOM 7800  O O    . SER A 1 5   ? 1.237   -20.804 -1.418  1.00 0.00 ? 5   SER A O    5  
ATOM 7801  C CB   . SER A 1 5   ? 1.573   -19.489 1.552   1.00 0.00 ? 5   SER A CB   5  
ATOM 7802  O OG   . SER A 1 5   ? 1.533   -19.602 2.964   1.00 0.00 ? 5   SER A OG   5  
ATOM 7803  H H    . SER A 1 5   ? 1.695   -22.288 0.436   1.00 0.00 ? 5   SER A H    5  
ATOM 7804  H HA   . SER A 1 5   ? -0.337  -20.432 1.338   1.00 0.00 ? 5   SER A HA   5  
ATOM 7805  H HB2  . SER A 1 5   ? 2.585   -19.658 1.218   1.00 0.00 ? 5   SER A HB2  5  
ATOM 7806  H HB3  . SER A 1 5   ? 1.264   -18.491 1.274   1.00 0.00 ? 5   SER A HB3  5  
ATOM 7807  H HG   . SER A 1 5   ? 2.196   -20.233 3.254   1.00 0.00 ? 5   SER A HG   5  
ATOM 7808  N N    . SER A 1 6   ? -0.372  -19.301 -0.951  1.00 0.00 ? 6   SER A N    5  
ATOM 7809  C CA   . SER A 1 6   ? -0.584  -18.931 -2.345  1.00 0.00 ? 6   SER A CA   5  
ATOM 7810  C C    . SER A 1 6   ? -0.675  -17.416 -2.498  1.00 0.00 ? 6   SER A C    5  
ATOM 7811  O O    . SER A 1 6   ? -1.179  -16.721 -1.616  1.00 0.00 ? 6   SER A O    5  
ATOM 7812  C CB   . SER A 1 6   ? -1.859  -19.586 -2.880  1.00 0.00 ? 6   SER A CB   5  
ATOM 7813  O OG   . SER A 1 6   ? -1.677  -20.979 -3.066  1.00 0.00 ? 6   SER A OG   5  
ATOM 7814  H H    . SER A 1 6   ? -0.907  -18.867 -0.254  1.00 0.00 ? 6   SER A H    5  
ATOM 7815  H HA   . SER A 1 6   ? 0.261   -19.289 -2.915  1.00 0.00 ? 6   SER A HA   5  
ATOM 7816  H HB2  . SER A 1 6   ? -2.663  -19.432 -2.176  1.00 0.00 ? 6   SER A HB2  5  
ATOM 7817  H HB3  . SER A 1 6   ? -2.119  -19.139 -3.829  1.00 0.00 ? 6   SER A HB3  5  
ATOM 7818  H HG   . SER A 1 6   ? -2.513  -21.382 -3.311  1.00 0.00 ? 6   SER A HG   5  
ATOM 7819  N N    . GLY A 1 7   ? -0.183  -16.910 -3.625  1.00 0.00 ? 7   GLY A N    5  
ATOM 7820  C CA   . GLY A 1 7   ? -0.217  -15.481 -3.874  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7821  C C    . GLY A 1 7   ? -1.460  -14.823 -3.306  1.00 0.00 ? 7   GLY A C    5  
ATOM 7822  O O    . GLY A 1 7   ? -2.552  -14.961 -3.857  1.00 0.00 ? 7   GLY A O    5  
ATOM 7823  H H    . GLY A 1 7   ? 0.207   -17.512 -4.293  1.00 0.00 ? 7   GLY A H    5  
ATOM 7824  H HA2  . GLY A 1 7   ? 0.654   -15.027 -3.426  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7825  H HA3  . GLY A 1 7   ? -0.191  -15.312 -4.940  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7826  N N    . LYS A 1 8   ? -1.295  -14.107 -2.199  1.00 0.00 ? 8   LYS A N    5  
ATOM 7827  C CA   . LYS A 1 8   ? -2.411  -13.426 -1.554  1.00 0.00 ? 8   LYS A CA   5  
ATOM 7828  C C    . LYS A 1 8   ? -1.946  -12.141 -0.877  1.00 0.00 ? 8   LYS A C    5  
ATOM 7829  O O    . LYS A 1 8   ? -1.052  -12.162 -0.030  1.00 0.00 ? 8   LYS A O    5  
ATOM 7830  C CB   . LYS A 1 8   ? -3.072  -14.346 -0.526  1.00 0.00 ? 8   LYS A CB   5  
ATOM 7831  C CG   . LYS A 1 8   ? -3.866  -15.483 -1.148  1.00 0.00 ? 8   LYS A CG   5  
ATOM 7832  C CD   . LYS A 1 8   ? -5.152  -14.982 -1.784  1.00 0.00 ? 8   LYS A CD   5  
ATOM 7833  C CE   . LYS A 1 8   ? -6.196  -14.640 -0.732  1.00 0.00 ? 8   LYS A CE   5  
ATOM 7834  N NZ   . LYS A 1 8   ? -7.348  -13.897 -1.315  1.00 0.00 ? 8   LYS A NZ   5  
ATOM 7835  H H    . LYS A 1 8   ? -0.399  -14.035 -1.806  1.00 0.00 ? 8   LYS A H    5  
ATOM 7836  H HA   . LYS A 1 8   ? -3.132  -13.176 -2.318  1.00 0.00 ? 8   LYS A HA   5  
ATOM 7837  H HB2  . LYS A 1 8   ? -2.305  -14.773 0.103   1.00 0.00 ? 8   LYS A HB2  5  
ATOM 7838  H HB3  . LYS A 1 8   ? -3.743  -13.760 0.085   1.00 0.00 ? 8   LYS A HB3  5  
ATOM 7839  H HG2  . LYS A 1 8   ? -3.262  -15.957 -1.908  1.00 0.00 ? 8   LYS A HG2  5  
ATOM 7840  H HG3  . LYS A 1 8   ? -4.110  -16.202 -0.380  1.00 0.00 ? 8   LYS A HG3  5  
ATOM 7841  H HD2  . LYS A 1 8   ? -4.937  -14.096 -2.362  1.00 0.00 ? 8   LYS A HD2  5  
ATOM 7842  H HD3  . LYS A 1 8   ? -5.546  -15.752 -2.433  1.00 0.00 ? 8   LYS A HD3  5  
ATOM 7843  H HE2  . LYS A 1 8   ? -6.557  -15.556 -0.291  1.00 0.00 ? 8   LYS A HE2  5  
ATOM 7844  H HE3  . LYS A 1 8   ? -5.734  -14.031 0.030   1.00 0.00 ? 8   LYS A HE3  5  
ATOM 7845  H HZ1  . LYS A 1 8   ? -7.124  -13.597 -2.286  1.00 0.00 ? 8   LYS A HZ1  5  
ATOM 7846  H HZ2  . LYS A 1 8   ? -7.555  -13.054 -0.743  1.00 0.00 ? 8   LYS A HZ2  5  
ATOM 7847  H HZ3  . LYS A 1 8   ? -8.191  -14.504 -1.337  1.00 0.00 ? 8   LYS A HZ3  5  
ATOM 7848  N N    . LEU A 1 9   ? -2.559  -11.024 -1.253  1.00 0.00 ? 9   LEU A N    5  
ATOM 7849  C CA   . LEU A 1 9   ? -2.209  -9.729  -0.680  1.00 0.00 ? 9   LEU A CA   5  
ATOM 7850  C C    . LEU A 1 9   ? -2.819  -9.564  0.708   1.00 0.00 ? 9   LEU A C    5  
ATOM 7851  O O    . LEU A 1 9   ? -2.146  -9.137  1.646   1.00 0.00 ? 9   LEU A O    5  
ATOM 7852  C CB   . LEU A 1 9   ? -2.684  -8.599  -1.596  1.00 0.00 ? 9   LEU A CB   5  
ATOM 7853  C CG   . LEU A 1 9   ? -2.654  -7.192  -0.997  1.00 0.00 ? 9   LEU A CG   5  
ATOM 7854  C CD1  . LEU A 1 9   ? -1.302  -6.538  -1.239  1.00 0.00 ? 9   LEU A CD1  5  
ATOM 7855  C CD2  . LEU A 1 9   ? -3.772  -6.341  -1.580  1.00 0.00 ? 9   LEU A CD2  5  
ATOM 7856  H H    . LEU A 1 9   ? -3.264  -11.070 -1.932  1.00 0.00 ? 9   LEU A H    5  
ATOM 7857  H HA   . LEU A 1 9   ? -1.134  -9.684  -0.595  1.00 0.00 ? 9   LEU A HA   5  
ATOM 7858  H HB2  . LEU A 1 9   ? -2.056  -8.598  -2.473  1.00 0.00 ? 9   LEU A HB2  5  
ATOM 7859  H HB3  . LEU A 1 9   ? -3.703  -8.815  -1.885  1.00 0.00 ? 9   LEU A HB3  5  
ATOM 7860  H HG   . LEU A 1 9   ? -2.805  -7.259  0.071   1.00 0.00 ? 9   LEU A HG   5  
ATOM 7861  H HD11 . LEU A 1 9   ? -0.533  -7.108  -0.740  1.00 0.00 ? 9   LEU A HD11 5  
ATOM 7862  H HD12 . LEU A 1 9   ? -1.315  -5.531  -0.849  1.00 0.00 ? 9   LEU A HD12 5  
ATOM 7863  H HD13 . LEU A 1 9   ? -1.101  -6.511  -2.300  1.00 0.00 ? 9   LEU A HD13 5  
ATOM 7864  H HD21 . LEU A 1 9   ? -4.435  -6.026  -0.787  1.00 0.00 ? 9   LEU A HD21 5  
ATOM 7865  H HD22 . LEU A 1 9   ? -4.327  -6.921  -2.303  1.00 0.00 ? 9   LEU A HD22 5  
ATOM 7866  H HD23 . LEU A 1 9   ? -3.349  -5.472  -2.062  1.00 0.00 ? 9   LEU A HD23 5  
ATOM 7867  N N    . ARG A 1 10  ? -4.097  -9.908  0.831   1.00 0.00 ? 10  ARG A N    5  
ATOM 7868  C CA   . ARG A 1 10  ? -4.798  -9.799  2.105   1.00 0.00 ? 10  ARG A CA   5  
ATOM 7869  C C    . ARG A 1 10  ? -3.879  -10.173 3.265   1.00 0.00 ? 10  ARG A C    5  
ATOM 7870  O O    . ARG A 1 10  ? -3.549  -9.335  4.102   1.00 0.00 ? 10  ARG A O    5  
ATOM 7871  C CB   . ARG A 1 10  ? -6.035  -10.699 2.110   1.00 0.00 ? 10  ARG A CB   5  
ATOM 7872  C CG   . ARG A 1 10  ? -6.719  -10.787 3.464   1.00 0.00 ? 10  ARG A CG   5  
ATOM 7873  C CD   . ARG A 1 10  ? -8.219  -10.994 3.318   1.00 0.00 ? 10  ARG A CD   5  
ATOM 7874  N NE   . ARG A 1 10  ? -8.854  -11.310 4.594   1.00 0.00 ? 10  ARG A NE   5  
ATOM 7875  C CZ   . ARG A 1 10  ? -8.971  -12.544 5.071   1.00 0.00 ? 10  ARG A CZ   5  
ATOM 7876  N NH1  . ARG A 1 10  ? -8.498  -13.573 4.381   1.00 0.00 ? 10  ARG A NH1  5  
ATOM 7877  N NH2  . ARG A 1 10  ? -9.563  -12.752 6.240   1.00 0.00 ? 10  ARG A NH2  5  
ATOM 7878  H H    . ARG A 1 10  ? -4.581  -10.242 0.047   1.00 0.00 ? 10  ARG A H    5  
ATOM 7879  H HA   . ARG A 1 10  ? -5.110  -8.773  2.226   1.00 0.00 ? 10  ARG A HA   5  
ATOM 7880  H HB2  . ARG A 1 10  ? -6.748  -10.316 1.395   1.00 0.00 ? 10  ARG A HB2  5  
ATOM 7881  H HB3  . ARG A 1 10  ? -5.741  -11.695 1.814   1.00 0.00 ? 10  ARG A HB3  5  
ATOM 7882  H HG2  . ARG A 1 10  ? -6.304  -11.620 4.013   1.00 0.00 ? 10  ARG A HG2  5  
ATOM 7883  H HG3  . ARG A 1 10  ? -6.542  -9.871  4.006   1.00 0.00 ? 10  ARG A HG3  5  
ATOM 7884  H HD2  . ARG A 1 10  ? -8.656  -10.089 2.923   1.00 0.00 ? 10  ARG A HD2  5  
ATOM 7885  H HD3  . ARG A 1 10  ? -8.391  -11.807 2.629   1.00 0.00 ? 10  ARG A HD3  5  
ATOM 7886  H HE   . ARG A 1 10  ? -9.212  -10.565 5.120   1.00 0.00 ? 10  ARG A HE   5  
ATOM 7887  H HH11 . ARG A 1 10  ? -8.051  -13.419 3.500   1.00 0.00 ? 10  ARG A HH11 5  
ATOM 7888  H HH12 . ARG A 1 10  ? -8.586  -14.501 4.742   1.00 0.00 ? 10  ARG A HH12 5  
ATOM 7889  H HH21 . ARG A 1 10  ? -9.921  -11.979 6.763   1.00 0.00 ? 10  ARG A HH21 5  
ATOM 7890  H HH22 . ARG A 1 10  ? -9.651  -13.681 6.598   1.00 0.00 ? 10  ARG A HH22 5  
ATOM 7891  N N    . GLN A 1 11  ? -3.471  -11.438 3.305   1.00 0.00 ? 11  GLN A N    5  
ATOM 7892  C CA   . GLN A 1 11  ? -2.592  -11.922 4.363   1.00 0.00 ? 11  GLN A CA   5  
ATOM 7893  C C    . GLN A 1 11  ? -1.198  -11.318 4.231   1.00 0.00 ? 11  GLN A C    5  
ATOM 7894  O O    . GLN A 1 11  ? -0.690  -10.695 5.164   1.00 0.00 ? 11  GLN A O    5  
ATOM 7895  C CB   . GLN A 1 11  ? -2.504  -13.449 4.322   1.00 0.00 ? 11  GLN A CB   5  
ATOM 7896  C CG   . GLN A 1 11  ? -1.475  -14.025 5.282   1.00 0.00 ? 11  GLN A CG   5  
ATOM 7897  C CD   . GLN A 1 11  ? -1.830  -13.779 6.735   1.00 0.00 ? 11  GLN A CD   5  
ATOM 7898  O OE1  . GLN A 1 11  ? -2.525  -14.580 7.361   1.00 0.00 ? 11  GLN A OE1  5  
ATOM 7899  N NE2  . GLN A 1 11  ? -1.353  -12.666 7.281   1.00 0.00 ? 11  GLN A NE2  5  
ATOM 7900  H H    . GLN A 1 11  ? -3.768  -12.059 2.609   1.00 0.00 ? 11  GLN A H    5  
ATOM 7901  H HA   . GLN A 1 11  ? -3.013  -11.620 5.309   1.00 0.00 ? 11  GLN A HA   5  
ATOM 7902  H HB2  . GLN A 1 11  ? -3.470  -13.860 4.575   1.00 0.00 ? 11  GLN A HB2  5  
ATOM 7903  H HB3  . GLN A 1 11  ? -2.242  -13.756 3.321   1.00 0.00 ? 11  GLN A HB3  5  
ATOM 7904  H HG2  . GLN A 1 11  ? -1.407  -15.091 5.120   1.00 0.00 ? 11  GLN A HG2  5  
ATOM 7905  H HG3  . GLN A 1 11  ? -0.518  -13.569 5.078   1.00 0.00 ? 11  GLN A HG3  5  
ATOM 7906  H HE21 . GLN A 1 11  ? -0.808  -12.074 6.721   1.00 0.00 ? 11  GLN A HE21 5  
ATOM 7907  H HE22 . GLN A 1 11  ? -1.568  -12.482 8.218   1.00 0.00 ? 11  GLN A HE22 5  
ATOM 7908  N N    . TRP A 1 12  ? -0.584  -11.507 3.068   1.00 0.00 ? 12  TRP A N    5  
ATOM 7909  C CA   . TRP A 1 12  ? 0.752   -10.980 2.815   1.00 0.00 ? 12  TRP A CA   5  
ATOM 7910  C C    . TRP A 1 12  ? 0.935   -9.618  3.477   1.00 0.00 ? 12  TRP A C    5  
ATOM 7911  O O    . TRP A 1 12  ? 1.789   -9.450  4.349   1.00 0.00 ? 12  TRP A O    5  
ATOM 7912  C CB   . TRP A 1 12  ? 1.002   -10.867 1.311   1.00 0.00 ? 12  TRP A CB   5  
ATOM 7913  C CG   . TRP A 1 12  ? 2.345   -10.294 0.973   1.00 0.00 ? 12  TRP A CG   5  
ATOM 7914  C CD1  . TRP A 1 12  ? 3.522   -10.977 0.859   1.00 0.00 ? 12  TRP A CD1  5  
ATOM 7915  C CD2  . TRP A 1 12  ? 2.649   -8.921  0.707   1.00 0.00 ? 12  TRP A CD2  5  
ATOM 7916  N NE1  . TRP A 1 12  ? 4.539   -10.111 0.538   1.00 0.00 ? 12  TRP A NE1  5  
ATOM 7917  C CE2  . TRP A 1 12  ? 4.030   -8.844  0.438   1.00 0.00 ? 12  TRP A CE2  5  
ATOM 7918  C CE3  . TRP A 1 12  ? 1.889   -7.749  0.667   1.00 0.00 ? 12  TRP A CE3  5  
ATOM 7919  C CZ2  . TRP A 1 12  ? 4.663   -7.641  0.136   1.00 0.00 ? 12  TRP A CZ2  5  
ATOM 7920  C CZ3  . TRP A 1 12  ? 2.519   -6.556  0.368   1.00 0.00 ? 12  TRP A CZ3  5  
ATOM 7921  C CH2  . TRP A 1 12  ? 3.894   -6.509  0.105   1.00 0.00 ? 12  TRP A CH2  5  
ATOM 7922  H H    . TRP A 1 12  ? -1.040  -12.012 2.363   1.00 0.00 ? 12  TRP A H    5  
ATOM 7923  H HA   . TRP A 1 12  ? 1.466   -11.671 3.239   1.00 0.00 ? 12  TRP A HA   5  
ATOM 7924  H HB2  . TRP A 1 12  ? 0.937   -11.849 0.867   1.00 0.00 ? 12  TRP A HB2  5  
ATOM 7925  H HB3  . TRP A 1 12  ? 0.247   -10.228 0.875   1.00 0.00 ? 12  TRP A HB3  5  
ATOM 7926  H HD1  . TRP A 1 12  ? 3.624   -12.042 1.004   1.00 0.00 ? 12  TRP A HD1  5  
ATOM 7927  H HE1  . TRP A 1 12  ? 5.478   -10.361 0.401   1.00 0.00 ? 12  TRP A HE1  5  
ATOM 7928  H HE3  . TRP A 1 12  ? 0.827   -7.764  0.867   1.00 0.00 ? 12  TRP A HE3  5  
ATOM 7929  H HZ2  . TRP A 1 12  ? 5.722   -7.589  -0.069  1.00 0.00 ? 12  TRP A HZ2  5  
ATOM 7930  H HZ3  . TRP A 1 12  ? 1.948   -5.640  0.333   1.00 0.00 ? 12  TRP A HZ3  5  
ATOM 7931  H HH2  . TRP A 1 12  ? 4.345   -5.556  -0.124  1.00 0.00 ? 12  TRP A HH2  5  
ATOM 7932  N N    . LEU A 1 13  ? 0.129   -8.649  3.058   1.00 0.00 ? 13  LEU A N    5  
ATOM 7933  C CA   . LEU A 1 13  ? 0.202   -7.301  3.611   1.00 0.00 ? 13  LEU A CA   5  
ATOM 7934  C C    . LEU A 1 13  ? 0.093   -7.330  5.132   1.00 0.00 ? 13  LEU A C    5  
ATOM 7935  O O    . LEU A 1 13  ? 1.011   -6.911  5.838   1.00 0.00 ? 13  LEU A O    5  
ATOM 7936  C CB   . LEU A 1 13  ? -0.908  -6.427  3.025   1.00 0.00 ? 13  LEU A CB   5  
ATOM 7937  C CG   . LEU A 1 13  ? -0.792  -4.926  3.290   1.00 0.00 ? 13  LEU A CG   5  
ATOM 7938  C CD1  . LEU A 1 13  ? 0.483   -4.372  2.672   1.00 0.00 ? 13  LEU A CD1  5  
ATOM 7939  C CD2  . LEU A 1 13  ? -2.011  -4.193  2.750   1.00 0.00 ? 13  LEU A CD2  5  
ATOM 7940  H H    . LEU A 1 13  ? -0.531  -8.843  2.361   1.00 0.00 ? 13  LEU A H    5  
ATOM 7941  H HA   . LEU A 1 13  ? 1.160   -6.883  3.339   1.00 0.00 ? 13  LEU A HA   5  
ATOM 7942  H HB2  . LEU A 1 13  ? -0.915  -6.574  1.956   1.00 0.00 ? 13  LEU A HB2  5  
ATOM 7943  H HB3  . LEU A 1 13  ? -1.848  -6.766  3.439   1.00 0.00 ? 13  LEU A HB3  5  
ATOM 7944  H HG   . LEU A 1 13  ? -0.745  -4.758  4.358   1.00 0.00 ? 13  LEU A HG   5  
ATOM 7945  H HD11 . LEU A 1 13  ? 1.339   -4.824  3.148   1.00 0.00 ? 13  LEU A HD11 5  
ATOM 7946  H HD12 . LEU A 1 13  ? 0.515   -3.302  2.814   1.00 0.00 ? 13  LEU A HD12 5  
ATOM 7947  H HD13 . LEU A 1 13  ? 0.497   -4.596  1.616   1.00 0.00 ? 13  LEU A HD13 5  
ATOM 7948  H HD21 . LEU A 1 13  ? -1.707  -3.525  1.958   1.00 0.00 ? 13  LEU A HD21 5  
ATOM 7949  H HD22 . LEU A 1 13  ? -2.469  -3.622  3.545   1.00 0.00 ? 13  LEU A HD22 5  
ATOM 7950  H HD23 . LEU A 1 13  ? -2.721  -4.909  2.365   1.00 0.00 ? 13  LEU A HD23 5  
ATOM 7951  N N    . ILE A 1 14  ? -1.034  -7.828  5.630   1.00 0.00 ? 14  ILE A N    5  
ATOM 7952  C CA   . ILE A 1 14  ? -1.261  -7.914  7.067   1.00 0.00 ? 14  ILE A CA   5  
ATOM 7953  C C    . ILE A 1 14  ? -0.013  -8.407  7.792   1.00 0.00 ? 14  ILE A C    5  
ATOM 7954  O O    . ILE A 1 14  ? 0.338   -7.901  8.858   1.00 0.00 ? 14  ILE A O    5  
ATOM 7955  C CB   . ILE A 1 14  ? -2.436  -8.854  7.396   1.00 0.00 ? 14  ILE A CB   5  
ATOM 7956  C CG1  . ILE A 1 14  ? -3.729  -8.327  6.770   1.00 0.00 ? 14  ILE A CG1  5  
ATOM 7957  C CG2  . ILE A 1 14  ? -2.592  -9.000  8.902   1.00 0.00 ? 14  ILE A CG2  5  
ATOM 7958  C CD1  . ILE A 1 14  ? -4.803  -9.381  6.624   1.00 0.00 ? 14  ILE A CD1  5  
ATOM 7959  H H    . ILE A 1 14  ? -1.728  -8.146  5.016   1.00 0.00 ? 14  ILE A H    5  
ATOM 7960  H HA   . ILE A 1 14  ? -1.505  -6.925  7.426   1.00 0.00 ? 14  ILE A HA   5  
ATOM 7961  H HB   . ILE A 1 14  ? -2.216  -9.827  6.985   1.00 0.00 ? 14  ILE A HB   5  
ATOM 7962  H HG12 . ILE A 1 14  ? -4.124  -7.535  7.388   1.00 0.00 ? 14  ILE A HG12 5  
ATOM 7963  H HG13 . ILE A 1 14  ? -3.511  -7.935  5.787   1.00 0.00 ? 14  ILE A HG13 5  
ATOM 7964  H HG21 . ILE A 1 14  ? -3.325  -8.292  9.259   1.00 0.00 ? 14  ILE A HG21 5  
ATOM 7965  H HG22 . ILE A 1 14  ? -2.918  -10.003 9.134   1.00 0.00 ? 14  ILE A HG22 5  
ATOM 7966  H HG23 . ILE A 1 14  ? -1.644  -8.810  9.383   1.00 0.00 ? 14  ILE A HG23 5  
ATOM 7967  H HD11 . ILE A 1 14  ? -5.426  -9.387  7.506   1.00 0.00 ? 14  ILE A HD11 5  
ATOM 7968  H HD12 . ILE A 1 14  ? -5.408  -9.162  5.756   1.00 0.00 ? 14  ILE A HD12 5  
ATOM 7969  H HD13 . ILE A 1 14  ? -4.341  -10.351 6.504   1.00 0.00 ? 14  ILE A HD13 5  
ATOM 7970  N N    . ASP A 1 15  ? 0.654   -9.395  7.206   1.00 0.00 ? 15  ASP A N    5  
ATOM 7971  C CA   . ASP A 1 15  ? 1.865   -9.955  7.795   1.00 0.00 ? 15  ASP A CA   5  
ATOM 7972  C C    . ASP A 1 15  ? 2.967   -8.903  7.873   1.00 0.00 ? 15  ASP A C    5  
ATOM 7973  O O    . ASP A 1 15  ? 3.699   -8.830  8.860   1.00 0.00 ? 15  ASP A O    5  
ATOM 7974  C CB   . ASP A 1 15  ? 2.346   -11.156 6.979   1.00 0.00 ? 15  ASP A CB   5  
ATOM 7975  C CG   . ASP A 1 15  ? 3.160   -12.130 7.807   1.00 0.00 ? 15  ASP A CG   5  
ATOM 7976  O OD1  . ASP A 1 15  ? 4.298   -11.781 8.185   1.00 0.00 ? 15  ASP A OD1  5  
ATOM 7977  O OD2  . ASP A 1 15  ? 2.659   -13.241 8.078   1.00 0.00 ? 15  ASP A OD2  5  
ATOM 7978  H H    . ASP A 1 15  ? 0.323   -9.757  6.357   1.00 0.00 ? 15  ASP A H    5  
ATOM 7979  H HA   . ASP A 1 15  ? 1.627   -10.283 8.795   1.00 0.00 ? 15  ASP A HA   5  
ATOM 7980  H HB2  . ASP A 1 15  ? 1.489   -11.679 6.581   1.00 0.00 ? 15  ASP A HB2  5  
ATOM 7981  H HB3  . ASP A 1 15  ? 2.960   -10.805 6.162   1.00 0.00 ? 15  ASP A HB3  5  
ATOM 7982  N N    . GLN A 1 16  ? 3.079   -8.092  6.826   1.00 0.00 ? 16  GLN A N    5  
ATOM 7983  C CA   . GLN A 1 16  ? 4.094   -7.045  6.777   1.00 0.00 ? 16  GLN A CA   5  
ATOM 7984  C C    . GLN A 1 16  ? 3.804   -5.958  7.806   1.00 0.00 ? 16  GLN A C    5  
ATOM 7985  O O    . GLN A 1 16  ? 4.716   -5.448  8.458   1.00 0.00 ? 16  GLN A O    5  
ATOM 7986  C CB   . GLN A 1 16  ? 4.158   -6.434  5.376   1.00 0.00 ? 16  GLN A CB   5  
ATOM 7987  C CG   . GLN A 1 16  ? 4.355   -7.461  4.273   1.00 0.00 ? 16  GLN A CG   5  
ATOM 7988  C CD   . GLN A 1 16  ? 5.311   -8.569  4.670   1.00 0.00 ? 16  GLN A CD   5  
ATOM 7989  O OE1  . GLN A 1 16  ? 6.474   -8.317  4.984   1.00 0.00 ? 16  GLN A OE1  5  
ATOM 7990  N NE2  . GLN A 1 16  ? 4.823   -9.804  4.658   1.00 0.00 ? 16  GLN A NE2  5  
ATOM 7991  H H    . GLN A 1 16  ? 2.467   -8.199  6.070   1.00 0.00 ? 16  GLN A H    5  
ATOM 7992  H HA   . GLN A 1 16  ? 5.047   -7.496  7.007   1.00 0.00 ? 16  GLN A HA   5  
ATOM 7993  H HB2  . GLN A 1 16  ? 3.238   -5.903  5.185   1.00 0.00 ? 16  GLN A HB2  5  
ATOM 7994  H HB3  . GLN A 1 16  ? 4.981   -5.736  5.339   1.00 0.00 ? 16  GLN A HB3  5  
ATOM 7995  H HG2  . GLN A 1 16  ? 3.398   -7.901  4.033   1.00 0.00 ? 16  GLN A HG2  5  
ATOM 7996  H HG3  . GLN A 1 16  ? 4.748   -6.961  3.400   1.00 0.00 ? 16  GLN A HG3  5  
ATOM 7997  H HE21 . GLN A 1 16  ? 3.887   -9.929  4.396   1.00 0.00 ? 16  GLN A HE21 5  
ATOM 7998  H HE22 . GLN A 1 16  ? 5.419   -10.539 4.910   1.00 0.00 ? 16  GLN A HE22 5  
ATOM 7999  N N    . ILE A 1 17  ? 2.530   -5.606  7.946   1.00 0.00 ? 17  ILE A N    5  
ATOM 8000  C CA   . ILE A 1 17  ? 2.122   -4.580  8.897   1.00 0.00 ? 17  ILE A CA   5  
ATOM 8001  C C    . ILE A 1 17  ? 2.394   -5.019  10.331  1.00 0.00 ? 17  ILE A C    5  
ATOM 8002  O O    . ILE A 1 17  ? 3.002   -4.286  11.111  1.00 0.00 ? 17  ILE A O    5  
ATOM 8003  C CB   . ILE A 1 17  ? 0.627   -4.240  8.751   1.00 0.00 ? 17  ILE A CB   5  
ATOM 8004  C CG1  . ILE A 1 17  ? 0.286   -3.958  7.286   1.00 0.00 ? 17  ILE A CG1  5  
ATOM 8005  C CG2  . ILE A 1 17  ? 0.267   -3.047  9.623   1.00 0.00 ? 17  ILE A CG2  5  
ATOM 8006  C CD1  . ILE A 1 17  ? -1.134  -4.323  6.915   1.00 0.00 ? 17  ILE A CD1  5  
ATOM 8007  H H    . ILE A 1 17  ? 1.850   -6.049  7.398   1.00 0.00 ? 17  ILE A H    5  
ATOM 8008  H HA   . ILE A 1 17  ? 2.695   -3.687  8.690   1.00 0.00 ? 17  ILE A HA   5  
ATOM 8009  H HB   . ILE A 1 17  ? 0.053   -5.090  9.089   1.00 0.00 ? 17  ILE A HB   5  
ATOM 8010  H HG12 . ILE A 1 17  ? 0.420   -2.907  7.088   1.00 0.00 ? 17  ILE A HG12 5  
ATOM 8011  H HG13 . ILE A 1 17  ? 0.952   -4.528  6.654   1.00 0.00 ? 17  ILE A HG13 5  
ATOM 8012  H HG21 . ILE A 1 17  ? 0.880   -3.054  10.513  1.00 0.00 ? 17  ILE A HG21 5  
ATOM 8013  H HG22 . ILE A 1 17  ? 0.441   -2.134  9.074   1.00 0.00 ? 17  ILE A HG22 5  
ATOM 8014  H HG23 . ILE A 1 17  ? -0.774  -3.106  9.903   1.00 0.00 ? 17  ILE A HG23 5  
ATOM 8015  H HD11 . ILE A 1 17  ? -1.127  -5.191  6.273   1.00 0.00 ? 17  ILE A HD11 5  
ATOM 8016  H HD12 . ILE A 1 17  ? -1.697  -4.541  7.810   1.00 0.00 ? 17  ILE A HD12 5  
ATOM 8017  H HD13 . ILE A 1 17  ? -1.594  -3.495  6.394   1.00 0.00 ? 17  ILE A HD13 5  
ATOM 8018  N N    . ASP A 1 18  ? 1.942   -6.221  10.672  1.00 0.00 ? 18  ASP A N    5  
ATOM 8019  C CA   . ASP A 1 18  ? 2.139   -6.760  12.013  1.00 0.00 ? 18  ASP A CA   5  
ATOM 8020  C C    . ASP A 1 18  ? 3.609   -6.694  12.414  1.00 0.00 ? 18  ASP A C    5  
ATOM 8021  O O    . ASP A 1 18  ? 3.948   -6.194  13.486  1.00 0.00 ? 18  ASP A O    5  
ATOM 8022  C CB   . ASP A 1 18  ? 1.643   -8.205  12.082  1.00 0.00 ? 18  ASP A CB   5  
ATOM 8023  C CG   . ASP A 1 18  ? 1.318   -8.638  13.498  1.00 0.00 ? 18  ASP A CG   5  
ATOM 8024  O OD1  . ASP A 1 18  ? 0.199   -8.343  13.967  1.00 0.00 ? 18  ASP A OD1  5  
ATOM 8025  O OD2  . ASP A 1 18  ? 2.184   -9.272  14.138  1.00 0.00 ? 18  ASP A OD2  5  
ATOM 8026  H H    . ASP A 1 18  ? 1.464   -6.758  10.006  1.00 0.00 ? 18  ASP A H    5  
ATOM 8027  H HA   . ASP A 1 18  ? 1.564   -6.158  12.700  1.00 0.00 ? 18  ASP A HA   5  
ATOM 8028  H HB2  . ASP A 1 18  ? 0.749   -8.301  11.483  1.00 0.00 ? 18  ASP A HB2  5  
ATOM 8029  H HB3  . ASP A 1 18  ? 2.406   -8.860  11.690  1.00 0.00 ? 18  ASP A HB3  5  
ATOM 8030  N N    . SER A 1 19  ? 4.478   -7.204  11.546  1.00 0.00 ? 19  SER A N    5  
ATOM 8031  C CA   . SER A 1 19  ? 5.911   -7.207  11.812  1.00 0.00 ? 19  SER A CA   5  
ATOM 8032  C C    . SER A 1 19  ? 6.418   -5.793  12.079  1.00 0.00 ? 19  SER A C    5  
ATOM 8033  O O    . SER A 1 19  ? 7.199   -5.565  13.001  1.00 0.00 ? 19  SER A O    5  
ATOM 8034  C CB   . SER A 1 19  ? 6.669   -7.819  10.632  1.00 0.00 ? 19  SER A CB   5  
ATOM 8035  O OG   . SER A 1 19  ? 6.209   -7.289  9.401   1.00 0.00 ? 19  SER A OG   5  
ATOM 8036  H H    . SER A 1 19  ? 4.145   -7.588  10.708  1.00 0.00 ? 19  SER A H    5  
ATOM 8037  H HA   . SER A 1 19  ? 6.084   -7.810  12.691  1.00 0.00 ? 19  SER A HA   5  
ATOM 8038  H HB2  . SER A 1 19  ? 7.722   -7.602  10.732  1.00 0.00 ? 19  SER A HB2  5  
ATOM 8039  H HB3  . SER A 1 19  ? 6.520   -8.889  10.628  1.00 0.00 ? 19  SER A HB3  5  
ATOM 8040  H HG   . SER A 1 19  ? 6.661   -7.725  8.675   1.00 0.00 ? 19  SER A HG   5  
ATOM 8041  N N    . GLY A 1 20  ? 5.966   -4.845  11.263  1.00 0.00 ? 20  GLY A N    5  
ATOM 8042  C CA   . GLY A 1 20  ? 6.383   -3.465  11.425  1.00 0.00 ? 20  GLY A CA   5  
ATOM 8043  C C    . GLY A 1 20  ? 7.803   -3.229  10.951  1.00 0.00 ? 20  GLY A C    5  
ATOM 8044  O O    . GLY A 1 20  ? 8.490   -2.334  11.443  1.00 0.00 ? 20  GLY A O    5  
ATOM 8045  H H    . GLY A 1 20  ? 5.344   -5.086  10.544  1.00 0.00 ? 20  GLY A H    5  
ATOM 8046  H HA2  . GLY A 1 20  ? 5.716   -2.830  10.862  1.00 0.00 ? 20  GLY A HA2  5  
ATOM 8047  H HA3  . GLY A 1 20  ? 6.317   -3.202  12.471  1.00 0.00 ? 20  GLY A HA3  5  
ATOM 8048  N N    . LYS A 1 21  ? 8.247   -4.035  9.992   1.00 0.00 ? 21  LYS A N    5  
ATOM 8049  C CA   . LYS A 1 21  ? 9.595   -3.911  9.450   1.00 0.00 ? 21  LYS A CA   5  
ATOM 8050  C C    . LYS A 1 21  ? 9.724   -2.654  8.595   1.00 0.00 ? 21  LYS A C    5  
ATOM 8051  O O    . LYS A 1 21  ? 10.737  -1.956  8.649   1.00 0.00 ? 21  LYS A O    5  
ATOM 8052  C CB   . LYS A 1 21  ? 9.947   -5.145  8.617   1.00 0.00 ? 21  LYS A CB   5  
ATOM 8053  C CG   . LYS A 1 21  ? 9.459   -6.449  9.225   1.00 0.00 ? 21  LYS A CG   5  
ATOM 8054  C CD   . LYS A 1 21  ? 10.329  -7.621  8.803   1.00 0.00 ? 21  LYS A CD   5  
ATOM 8055  C CE   . LYS A 1 21  ? 9.531   -8.915  8.747   1.00 0.00 ? 21  LYS A CE   5  
ATOM 8056  N NZ   . LYS A 1 21  ? 10.148  -9.906  7.822   1.00 0.00 ? 21  LYS A NZ   5  
ATOM 8057  H H    . LYS A 1 21  ? 7.652   -4.730  9.639   1.00 0.00 ? 21  LYS A H    5  
ATOM 8058  H HA   . LYS A 1 21  ? 10.281  -3.839  10.280  1.00 0.00 ? 21  LYS A HA   5  
ATOM 8059  H HB2  . LYS A 1 21  ? 9.506   -5.042  7.637   1.00 0.00 ? 21  LYS A HB2  5  
ATOM 8060  H HB3  . LYS A 1 21  ? 11.022  -5.200  8.515   1.00 0.00 ? 21  LYS A HB3  5  
ATOM 8061  H HG2  . LYS A 1 21  ? 9.484   -6.365  10.301  1.00 0.00 ? 21  LYS A HG2  5  
ATOM 8062  H HG3  . LYS A 1 21  ? 8.444   -6.629  8.899   1.00 0.00 ? 21  LYS A HG3  5  
ATOM 8063  H HD2  . LYS A 1 21  ? 10.738  -7.421  7.824   1.00 0.00 ? 21  LYS A HD2  5  
ATOM 8064  H HD3  . LYS A 1 21  ? 11.134  -7.735  9.516   1.00 0.00 ? 21  LYS A HD3  5  
ATOM 8065  H HE2  . LYS A 1 21  ? 9.487   -9.339  9.738   1.00 0.00 ? 21  LYS A HE2  5  
ATOM 8066  H HE3  . LYS A 1 21  ? 8.531   -8.691  8.406   1.00 0.00 ? 21  LYS A HE3  5  
ATOM 8067  H HZ1  . LYS A 1 21  ? 9.468   -10.664 7.606   1.00 0.00 ? 21  LYS A HZ1  5  
ATOM 8068  H HZ2  . LYS A 1 21  ? 10.991  -10.328 8.261   1.00 0.00 ? 21  LYS A HZ2  5  
ATOM 8069  H HZ3  . LYS A 1 21  ? 10.427  -9.442  6.935   1.00 0.00 ? 21  LYS A HZ3  5  
ATOM 8070  N N    . TYR A 1 22  ? 8.692   -2.371  7.808   1.00 0.00 ? 22  TYR A N    5  
ATOM 8071  C CA   . TYR A 1 22  ? 8.690   -1.199  6.941   1.00 0.00 ? 22  TYR A CA   5  
ATOM 8072  C C    . TYR A 1 22  ? 8.091   0.008   7.657   1.00 0.00 ? 22  TYR A C    5  
ATOM 8073  O O    . TYR A 1 22  ? 7.142   -0.106  8.433   1.00 0.00 ? 22  TYR A O    5  
ATOM 8074  C CB   . TYR A 1 22  ? 7.906   -1.487  5.660   1.00 0.00 ? 22  TYR A CB   5  
ATOM 8075  C CG   . TYR A 1 22  ? 8.108   -2.888  5.128   1.00 0.00 ? 22  TYR A CG   5  
ATOM 8076  C CD1  . TYR A 1 22  ? 7.357   -3.951  5.614   1.00 0.00 ? 22  TYR A CD1  5  
ATOM 8077  C CD2  . TYR A 1 22  ? 9.049   -3.148  4.140   1.00 0.00 ? 22  TYR A CD2  5  
ATOM 8078  C CE1  . TYR A 1 22  ? 7.538   -5.233  5.132   1.00 0.00 ? 22  TYR A CE1  5  
ATOM 8079  C CE2  . TYR A 1 22  ? 9.236   -4.426  3.651   1.00 0.00 ? 22  TYR A CE2  5  
ATOM 8080  C CZ   . TYR A 1 22  ? 8.479   -5.465  4.150   1.00 0.00 ? 22  TYR A CZ   5  
ATOM 8081  O OH   . TYR A 1 22  ? 8.661   -6.740  3.666   1.00 0.00 ? 22  TYR A OH   5  
ATOM 8082  H H    . TYR A 1 22  ? 7.912   -2.965  7.809   1.00 0.00 ? 22  TYR A H    5  
ATOM 8083  H HA   . TYR A 1 22  ? 9.715   -0.977  6.682   1.00 0.00 ? 22  TYR A HA   5  
ATOM 8084  H HB2  . TYR A 1 22  ? 6.853   -1.354  5.853   1.00 0.00 ? 22  TYR A HB2  5  
ATOM 8085  H HB3  . TYR A 1 22  ? 8.216   -0.793  4.892   1.00 0.00 ? 22  TYR A HB3  5  
ATOM 8086  H HD1  . TYR A 1 22  ? 6.621   -3.765  6.383   1.00 0.00 ? 22  TYR A HD1  5  
ATOM 8087  H HD2  . TYR A 1 22  ? 9.640   -2.332  3.750   1.00 0.00 ? 22  TYR A HD2  5  
ATOM 8088  H HE1  . TYR A 1 22  ? 6.945   -6.046  5.523   1.00 0.00 ? 22  TYR A HE1  5  
ATOM 8089  H HE2  . TYR A 1 22  ? 9.972   -4.609  2.882   1.00 0.00 ? 22  TYR A HE2  5  
ATOM 8090  H HH   . TYR A 1 22  ? 8.208   -7.367  4.236   1.00 0.00 ? 22  TYR A HH   5  
ATOM 8091  N N    . PRO A 1 23  ? 8.658   1.194   7.391   1.00 0.00 ? 23  PRO A N    5  
ATOM 8092  C CA   . PRO A 1 23  ? 8.196   2.446   7.998   1.00 0.00 ? 23  PRO A CA   5  
ATOM 8093  C C    . PRO A 1 23  ? 6.827   2.872   7.478   1.00 0.00 ? 23  PRO A C    5  
ATOM 8094  O O    . PRO A 1 23  ? 6.450   2.546   6.353   1.00 0.00 ? 23  PRO A O    5  
ATOM 8095  C CB   . PRO A 1 23  ? 9.266   3.458   7.580   1.00 0.00 ? 23  PRO A CB   5  
ATOM 8096  C CG   . PRO A 1 23  ? 9.847   2.900   6.327   1.00 0.00 ? 23  PRO A CG   5  
ATOM 8097  C CD   . PRO A 1 23  ? 9.792   1.405   6.476   1.00 0.00 ? 23  PRO A CD   5  
ATOM 8098  H HA   . PRO A 1 23  ? 8.165   2.377   9.075   1.00 0.00 ? 23  PRO A HA   5  
ATOM 8099  H HB2  . PRO A 1 23  ? 8.806   4.422   7.408   1.00 0.00 ? 23  PRO A HB2  5  
ATOM 8100  H HB3  . PRO A 1 23  ? 10.010  3.542   8.357   1.00 0.00 ? 23  PRO A HB3  5  
ATOM 8101  H HG2  . PRO A 1 23  ? 9.260   3.215   5.478   1.00 0.00 ? 23  PRO A HG2  5  
ATOM 8102  H HG3  . PRO A 1 23  ? 10.870  3.228   6.220   1.00 0.00 ? 23  PRO A HG3  5  
ATOM 8103  H HD2  . PRO A 1 23  ? 9.608   0.937   5.520   1.00 0.00 ? 23  PRO A HD2  5  
ATOM 8104  H HD3  . PRO A 1 23  ? 10.710  1.035   6.909   1.00 0.00 ? 23  PRO A HD3  5  
ATOM 8105  N N    . GLY A 1 24  ? 6.087   3.605   8.304   1.00 0.00 ? 24  GLY A N    5  
ATOM 8106  C CA   . GLY A 1 24  ? 4.768   4.064   7.909   1.00 0.00 ? 24  GLY A CA   5  
ATOM 8107  C C    . GLY A 1 24  ? 3.707   2.996   8.080   1.00 0.00 ? 24  GLY A C    5  
ATOM 8108  O O    . GLY A 1 24  ? 2.591   3.282   8.518   1.00 0.00 ? 24  GLY A O    5  
ATOM 8109  H H    . GLY A 1 24  ? 6.439   3.835   9.189   1.00 0.00 ? 24  GLY A H    5  
ATOM 8110  H HA2  . GLY A 1 24  ? 4.502   4.921   8.510   1.00 0.00 ? 24  GLY A HA2  5  
ATOM 8111  H HA3  . GLY A 1 24  ? 4.799   4.361   6.871   1.00 0.00 ? 24  GLY A HA3  5  
ATOM 8112  N N    . LEU A 1 25  ? 4.052   1.761   7.733   1.00 0.00 ? 25  LEU A N    5  
ATOM 8113  C CA   . LEU A 1 25  ? 3.120   0.645   7.849   1.00 0.00 ? 25  LEU A CA   5  
ATOM 8114  C C    . LEU A 1 25  ? 2.861   0.301   9.312   1.00 0.00 ? 25  LEU A C    5  
ATOM 8115  O O    . LEU A 1 25  ? 3.682   -0.345  9.964   1.00 0.00 ? 25  LEU A O    5  
ATOM 8116  C CB   . LEU A 1 25  ? 3.666   -0.581  7.114   1.00 0.00 ? 25  LEU A CB   5  
ATOM 8117  C CG   . LEU A 1 25  ? 2.636   -1.636  6.710   1.00 0.00 ? 25  LEU A CG   5  
ATOM 8118  C CD1  . LEU A 1 25  ? 1.615   -1.046  5.750   1.00 0.00 ? 25  LEU A CD1  5  
ATOM 8119  C CD2  . LEU A 1 25  ? 3.324   -2.841  6.085   1.00 0.00 ? 25  LEU A CD2  5  
ATOM 8120  H H    . LEU A 1 25  ? 4.955   1.594   7.391   1.00 0.00 ? 25  LEU A H    5  
ATOM 8121  H HA   . LEU A 1 25  ? 2.188   0.942   7.391   1.00 0.00 ? 25  LEU A HA   5  
ATOM 8122  H HB2  . LEU A 1 25  ? 4.156   -0.237  6.216   1.00 0.00 ? 25  LEU A HB2  5  
ATOM 8123  H HB3  . LEU A 1 25  ? 4.392   -1.055  7.759   1.00 0.00 ? 25  LEU A HB3  5  
ATOM 8124  H HG   . LEU A 1 25  ? 2.109   -1.971  7.593   1.00 0.00 ? 25  LEU A HG   5  
ATOM 8125  H HD11 . LEU A 1 25  ? 1.087   -1.844  5.251   1.00 0.00 ? 25  LEU A HD11 5  
ATOM 8126  H HD12 . LEU A 1 25  ? 2.122   -0.435  5.017   1.00 0.00 ? 25  LEU A HD12 5  
ATOM 8127  H HD13 . LEU A 1 25  ? 0.913   -0.438  6.301   1.00 0.00 ? 25  LEU A HD13 5  
ATOM 8128  H HD21 . LEU A 1 25  ? 3.332   -3.657  6.793   1.00 0.00 ? 25  LEU A HD21 5  
ATOM 8129  H HD22 . LEU A 1 25  ? 4.340   -2.581  5.825   1.00 0.00 ? 25  LEU A HD22 5  
ATOM 8130  H HD23 . LEU A 1 25  ? 2.789   -3.140  5.196   1.00 0.00 ? 25  LEU A HD23 5  
ATOM 8131  N N    . VAL A 1 26  ? 1.713   0.735   9.823   1.00 0.00 ? 26  VAL A N    5  
ATOM 8132  C CA   . VAL A 1 26  ? 1.344   0.471   11.208  1.00 0.00 ? 26  VAL A CA   5  
ATOM 8133  C C    . VAL A 1 26  ? -0.169  0.369   11.364  1.00 0.00 ? 26  VAL A C    5  
ATOM 8134  O O    . VAL A 1 26  ? -0.923  1.026   10.646  1.00 0.00 ? 26  VAL A O    5  
ATOM 8135  C CB   . VAL A 1 26  ? 1.873   1.569   12.150  1.00 0.00 ? 26  VAL A CB   5  
ATOM 8136  C CG1  . VAL A 1 26  ? 3.394   1.602   12.129  1.00 0.00 ? 26  VAL A CG1  5  
ATOM 8137  C CG2  . VAL A 1 26  ? 1.297   2.923   11.765  1.00 0.00 ? 26  VAL A CG2  5  
ATOM 8138  H H    . VAL A 1 26  ? 1.099   1.245   9.254   1.00 0.00 ? 26  VAL A H    5  
ATOM 8139  H HA   . VAL A 1 26  ? 1.790   -0.469  11.499  1.00 0.00 ? 26  VAL A HA   5  
ATOM 8140  H HB   . VAL A 1 26  ? 1.554   1.337   13.155  1.00 0.00 ? 26  VAL A HB   5  
ATOM 8141  H HG11 . VAL A 1 26  ? 3.728   2.267   11.346  1.00 0.00 ? 26  VAL A HG11 5  
ATOM 8142  H HG12 . VAL A 1 26  ? 3.759   1.954   13.083  1.00 0.00 ? 26  VAL A HG12 5  
ATOM 8143  H HG13 . VAL A 1 26  ? 3.773   0.608   11.943  1.00 0.00 ? 26  VAL A HG13 5  
ATOM 8144  H HG21 . VAL A 1 26  ? 1.546   3.141   10.737  1.00 0.00 ? 26  VAL A HG21 5  
ATOM 8145  H HG22 . VAL A 1 26  ? 0.222   2.903   11.878  1.00 0.00 ? 26  VAL A HG22 5  
ATOM 8146  H HG23 . VAL A 1 26  ? 1.711   3.686   12.407  1.00 0.00 ? 26  VAL A HG23 5  
ATOM 8147  N N    . TRP A 1 27  ? -0.607  -0.457  12.307  1.00 0.00 ? 27  TRP A N    5  
ATOM 8148  C CA   . TRP A 1 27  ? -2.031  -0.645  12.558  1.00 0.00 ? 27  TRP A CA   5  
ATOM 8149  C C    . TRP A 1 27  ? -2.604  0.528   13.347  1.00 0.00 ? 27  TRP A C    5  
ATOM 8150  O O    . TRP A 1 27  ? -2.149  0.826   14.451  1.00 0.00 ? 27  TRP A O    5  
ATOM 8151  C CB   . TRP A 1 27  ? -2.269  -1.951  13.318  1.00 0.00 ? 27  TRP A CB   5  
ATOM 8152  C CG   . TRP A 1 27  ? -1.927  -3.172  12.520  1.00 0.00 ? 27  TRP A CG   5  
ATOM 8153  C CD1  . TRP A 1 27  ? -0.835  -3.977  12.680  1.00 0.00 ? 27  TRP A CD1  5  
ATOM 8154  C CD2  . TRP A 1 27  ? -2.680  -3.727  11.436  1.00 0.00 ? 27  TRP A CD2  5  
ATOM 8155  N NE1  . TRP A 1 27  ? -0.864  -4.998  11.761  1.00 0.00 ? 27  TRP A NE1  5  
ATOM 8156  C CE2  . TRP A 1 27  ? -1.986  -4.868  10.987  1.00 0.00 ? 27  TRP A CE2  5  
ATOM 8157  C CE3  . TRP A 1 27  ? -3.875  -3.373  10.803  1.00 0.00 ? 27  TRP A CE3  5  
ATOM 8158  C CZ2  . TRP A 1 27  ? -2.448  -5.653  9.934   1.00 0.00 ? 27  TRP A CZ2  5  
ATOM 8159  C CZ3  . TRP A 1 27  ? -4.331  -4.153  9.758   1.00 0.00 ? 27  TRP A CZ3  5  
ATOM 8160  C CH2  . TRP A 1 27  ? -3.620  -5.283  9.332   1.00 0.00 ? 27  TRP A CH2  5  
ATOM 8161  H H    . TRP A 1 27  ? 0.043   -0.953  12.848  1.00 0.00 ? 27  TRP A H    5  
ATOM 8162  H HA   . TRP A 1 27  ? -2.531  -0.699  11.602  1.00 0.00 ? 27  TRP A HA   5  
ATOM 8163  H HB2  . TRP A 1 27  ? -1.663  -1.956  14.211  1.00 0.00 ? 27  TRP A HB2  5  
ATOM 8164  H HB3  . TRP A 1 27  ? -3.312  -2.013  13.594  1.00 0.00 ? 27  TRP A HB3  5  
ATOM 8165  H HD1  . TRP A 1 27  ? -0.068  -3.819  13.423  1.00 0.00 ? 27  TRP A HD1  5  
ATOM 8166  H HE1  . TRP A 1 27  ? -0.190  -5.705  11.676  1.00 0.00 ? 27  TRP A HE1  5  
ATOM 8167  H HE3  . TRP A 1 27  ? -4.437  -2.506  11.117  1.00 0.00 ? 27  TRP A HE3  5  
ATOM 8168  H HZ2  . TRP A 1 27  ? -1.911  -6.527  9.595   1.00 0.00 ? 27  TRP A HZ2  5  
ATOM 8169  H HZ3  . TRP A 1 27  ? -5.252  -3.894  9.256   1.00 0.00 ? 27  TRP A HZ3  5  
ATOM 8170  H HH2  . TRP A 1 27  ? -4.014  -5.862  8.512   1.00 0.00 ? 27  TRP A HH2  5  
ATOM 8171  N N    . GLU A 1 28  ? -3.604  1.190   12.773  1.00 0.00 ? 28  GLU A N    5  
ATOM 8172  C CA   . GLU A 1 28  ? -4.238  2.330   13.424  1.00 0.00 ? 28  GLU A CA   5  
ATOM 8173  C C    . GLU A 1 28  ? -4.947  1.901   14.705  1.00 0.00 ? 28  GLU A C    5  
ATOM 8174  O O    . GLU A 1 28  ? -5.179  2.712   15.600  1.00 0.00 ? 28  GLU A O    5  
ATOM 8175  C CB   . GLU A 1 28  ? -5.235  2.998   12.475  1.00 0.00 ? 28  GLU A CB   5  
ATOM 8176  C CG   . GLU A 1 28  ? -4.604  3.515   11.194  1.00 0.00 ? 28  GLU A CG   5  
ATOM 8177  C CD   . GLU A 1 28  ? -5.327  4.725   10.634  1.00 0.00 ? 28  GLU A CD   5  
ATOM 8178  O OE1  . GLU A 1 28  ? -6.572  4.682   10.541  1.00 0.00 ? 28  GLU A OE1  5  
ATOM 8179  O OE2  . GLU A 1 28  ? -4.648  5.714   10.288  1.00 0.00 ? 28  GLU A OE2  5  
ATOM 8180  H H    . GLU A 1 28  ? -3.923  0.904   11.891  1.00 0.00 ? 28  GLU A H    5  
ATOM 8181  H HA   . GLU A 1 28  ? -3.464  3.040   13.676  1.00 0.00 ? 28  GLU A HA   5  
ATOM 8182  H HB2  . GLU A 1 28  ? -5.999  2.281   12.213  1.00 0.00 ? 28  GLU A HB2  5  
ATOM 8183  H HB3  . GLU A 1 28  ? -5.696  3.831   12.986  1.00 0.00 ? 28  GLU A HB3  5  
ATOM 8184  H HG2  . GLU A 1 28  ? -3.580  3.790   11.397  1.00 0.00 ? 28  GLU A HG2  5  
ATOM 8185  H HG3  . GLU A 1 28  ? -4.624  2.728   10.455  1.00 0.00 ? 28  GLU A HG3  5  
ATOM 8186  N N    . ASN A 1 29  ? -5.289  0.619   14.784  1.00 0.00 ? 29  ASN A N    5  
ATOM 8187  C CA   . ASN A 1 29  ? -5.972  0.081   15.955  1.00 0.00 ? 29  ASN A CA   5  
ATOM 8188  C C    . ASN A 1 29  ? -5.281  -1.184  16.455  1.00 0.00 ? 29  ASN A C    5  
ATOM 8189  O O    . ASN A 1 29  ? -4.312  -1.651  15.857  1.00 0.00 ? 29  ASN A O    5  
ATOM 8190  C CB   . ASN A 1 29  ? -7.435  -0.221  15.623  1.00 0.00 ? 29  ASN A CB   5  
ATOM 8191  C CG   . ASN A 1 29  ? -7.580  -1.106  14.400  1.00 0.00 ? 29  ASN A CG   5  
ATOM 8192  O OD1  . ASN A 1 29  ? -6.657  -1.834  14.034  1.00 0.00 ? 29  ASN A OD1  5  
ATOM 8193  N ND2  . ASN A 1 29  ? -8.743  -1.047  13.762  1.00 0.00 ? 29  ASN A ND2  5  
ATOM 8194  H H    . ASN A 1 29  ? -5.077  0.020   14.038  1.00 0.00 ? 29  ASN A H    5  
ATOM 8195  H HA   . ASN A 1 29  ? -5.936  0.828   16.733  1.00 0.00 ? 29  ASN A HA   5  
ATOM 8196  H HB2  . ASN A 1 29  ? -7.892  -0.723  16.463  1.00 0.00 ? 29  ASN A HB2  5  
ATOM 8197  H HB3  . ASN A 1 29  ? -7.955  0.707   15.437  1.00 0.00 ? 29  ASN A HB3  5  
ATOM 8198  H HD21 . ASN A 1 29  ? -9.433  -0.444  14.110  1.00 0.00 ? 29  ASN A HD21 5  
ATOM 8199  H HD22 . ASN A 1 29  ? -8.864  -1.609  12.968  1.00 0.00 ? 29  ASN A HD22 5  
ATOM 8200  N N    . GLU A 1 30  ? -5.788  -1.734  17.554  1.00 0.00 ? 30  GLU A N    5  
ATOM 8201  C CA   . GLU A 1 30  ? -5.219  -2.945  18.134  1.00 0.00 ? 30  GLU A CA   5  
ATOM 8202  C C    . GLU A 1 30  ? -5.801  -4.191  17.471  1.00 0.00 ? 30  GLU A C    5  
ATOM 8203  O O    . GLU A 1 30  ? -5.187  -5.257  17.484  1.00 0.00 ? 30  GLU A O    5  
ATOM 8204  C CB   . GLU A 1 30  ? -5.479  -2.986  19.641  1.00 0.00 ? 30  GLU A CB   5  
ATOM 8205  C CG   . GLU A 1 30  ? -4.702  -1.940  20.422  1.00 0.00 ? 30  GLU A CG   5  
ATOM 8206  C CD   . GLU A 1 30  ? -3.315  -2.413  20.809  1.00 0.00 ? 30  GLU A CD   5  
ATOM 8207  O OE1  . GLU A 1 30  ? -3.210  -3.460  21.482  1.00 0.00 ? 30  GLU A OE1  5  
ATOM 8208  O OE2  . GLU A 1 30  ? -2.333  -1.735  20.439  1.00 0.00 ? 30  GLU A OE2  5  
ATOM 8209  H H    . GLU A 1 30  ? -6.562  -1.315  17.985  1.00 0.00 ? 30  GLU A H    5  
ATOM 8210  H HA   . GLU A 1 30  ? -4.154  -2.926  17.962  1.00 0.00 ? 30  GLU A HA   5  
ATOM 8211  H HB2  . GLU A 1 30  ? -6.533  -2.828  19.816  1.00 0.00 ? 30  GLU A HB2  5  
ATOM 8212  H HB3  . GLU A 1 30  ? -5.204  -3.962  20.014  1.00 0.00 ? 30  GLU A HB3  5  
ATOM 8213  H HG2  . GLU A 1 30  ? -4.607  -1.053  19.814  1.00 0.00 ? 30  GLU A HG2  5  
ATOM 8214  H HG3  . GLU A 1 30  ? -5.250  -1.701  21.322  1.00 0.00 ? 30  GLU A HG3  5  
ATOM 8215  N N    . GLU A 1 31  ? -6.990  -4.046  16.894  1.00 0.00 ? 31  GLU A N    5  
ATOM 8216  C CA   . GLU A 1 31  ? -7.655  -5.160  16.228  1.00 0.00 ? 31  GLU A CA   5  
ATOM 8217  C C    . GLU A 1 31  ? -6.901  -5.568  14.965  1.00 0.00 ? 31  GLU A C    5  
ATOM 8218  O O    . GLU A 1 31  ? -7.213  -6.583  14.342  1.00 0.00 ? 31  GLU A O    5  
ATOM 8219  C CB   . GLU A 1 31  ? -9.096  -4.785  15.876  1.00 0.00 ? 31  GLU A CB   5  
ATOM 8220  C CG   . GLU A 1 31  ? -9.214  -3.489  15.091  1.00 0.00 ? 31  GLU A CG   5  
ATOM 8221  C CD   . GLU A 1 31  ? -10.654 -3.106  14.810  1.00 0.00 ? 31  GLU A CD   5  
ATOM 8222  O OE1  . GLU A 1 31  ? -11.457 -4.008  14.492  1.00 0.00 ? 31  GLU A OE1  5  
ATOM 8223  O OE2  . GLU A 1 31  ? -10.977 -1.904  14.909  1.00 0.00 ? 31  GLU A OE2  5  
ATOM 8224  H H    . GLU A 1 31  ? -7.430  -3.171  16.917  1.00 0.00 ? 31  GLU A H    5  
ATOM 8225  H HA   . GLU A 1 31  ? -7.667  -5.996  16.911  1.00 0.00 ? 31  GLU A HA   5  
ATOM 8226  H HB2  . GLU A 1 31  ? -9.528  -5.580  15.286  1.00 0.00 ? 31  GLU A HB2  5  
ATOM 8227  H HB3  . GLU A 1 31  ? -9.661  -4.680  16.790  1.00 0.00 ? 31  GLU A HB3  5  
ATOM 8228  H HG2  . GLU A 1 31  ? -8.751  -2.696  15.659  1.00 0.00 ? 31  GLU A HG2  5  
ATOM 8229  H HG3  . GLU A 1 31  ? -8.697  -3.606  14.150  1.00 0.00 ? 31  GLU A HG3  5  
ATOM 8230  N N    . LYS A 1 32  ? -5.907  -4.769  14.593  1.00 0.00 ? 32  LYS A N    5  
ATOM 8231  C CA   . LYS A 1 32  ? -5.106  -5.045  13.406  1.00 0.00 ? 32  LYS A CA   5  
ATOM 8232  C C    . LYS A 1 32  ? -5.981  -5.079  12.157  1.00 0.00 ? 32  LYS A C    5  
ATOM 8233  O O    . LYS A 1 32  ? -5.701  -5.817  11.212  1.00 0.00 ? 32  LYS A O    5  
ATOM 8234  C CB   . LYS A 1 32  ? -4.369  -6.377  13.562  1.00 0.00 ? 32  LYS A CB   5  
ATOM 8235  C CG   . LYS A 1 32  ? -3.560  -6.478  14.843  1.00 0.00 ? 32  LYS A CG   5  
ATOM 8236  C CD   . LYS A 1 32  ? -2.239  -5.736  14.729  1.00 0.00 ? 32  LYS A CD   5  
ATOM 8237  C CE   . LYS A 1 32  ? -1.161  -6.381  15.587  1.00 0.00 ? 32  LYS A CE   5  
ATOM 8238  N NZ   . LYS A 1 32  ? -1.229  -5.922  17.002  1.00 0.00 ? 32  LYS A NZ   5  
ATOM 8239  H H    . LYS A 1 32  ? -5.706  -3.974  15.131  1.00 0.00 ? 32  LYS A H    5  
ATOM 8240  H HA   . LYS A 1 32  ? -4.382  -4.252  13.303  1.00 0.00 ? 32  LYS A HA   5  
ATOM 8241  H HB2  . LYS A 1 32  ? -5.092  -7.178  13.553  1.00 0.00 ? 32  LYS A HB2  5  
ATOM 8242  H HB3  . LYS A 1 32  ? -3.696  -6.501  12.725  1.00 0.00 ? 32  LYS A HB3  5  
ATOM 8243  H HG2  . LYS A 1 32  ? -4.131  -6.050  15.654  1.00 0.00 ? 32  LYS A HG2  5  
ATOM 8244  H HG3  . LYS A 1 32  ? -3.361  -7.520  15.051  1.00 0.00 ? 32  LYS A HG3  5  
ATOM 8245  H HD2  . LYS A 1 32  ? -1.917  -5.747  13.698  1.00 0.00 ? 32  LYS A HD2  5  
ATOM 8246  H HD3  . LYS A 1 32  ? -2.380  -4.714  15.053  1.00 0.00 ? 32  LYS A HD3  5  
ATOM 8247  H HE2  . LYS A 1 32  ? -1.290  -7.452  15.559  1.00 0.00 ? 32  LYS A HE2  5  
ATOM 8248  H HE3  . LYS A 1 32  ? -0.194  -6.125  15.180  1.00 0.00 ? 32  LYS A HE3  5  
ATOM 8249  H HZ1  . LYS A 1 32  ? -0.642  -6.534  17.604  1.00 0.00 ? 32  LYS A HZ1  5  
ATOM 8250  H HZ2  . LYS A 1 32  ? -2.211  -5.959  17.342  1.00 0.00 ? 32  LYS A HZ2  5  
ATOM 8251  H HZ3  . LYS A 1 32  ? -0.884  -4.944  17.077  1.00 0.00 ? 32  LYS A HZ3  5  
ATOM 8252  N N    . SER A 1 33  ? -7.039  -4.275  12.158  1.00 0.00 ? 33  SER A N    5  
ATOM 8253  C CA   . SER A 1 33  ? -7.955  -4.215  11.025  1.00 0.00 ? 33  SER A CA   5  
ATOM 8254  C C    . SER A 1 33  ? -7.675  -2.987  10.165  1.00 0.00 ? 33  SER A C    5  
ATOM 8255  O O    . SER A 1 33  ? -7.736  -3.049  8.936   1.00 0.00 ? 33  SER A O    5  
ATOM 8256  C CB   . SER A 1 33  ? -9.404  -4.189  11.515  1.00 0.00 ? 33  SER A CB   5  
ATOM 8257  O OG   . SER A 1 33  ? -10.288 -3.815  10.472  1.00 0.00 ? 33  SER A OG   5  
ATOM 8258  H H    . SER A 1 33  ? -7.209  -3.710  12.941  1.00 0.00 ? 33  SER A H    5  
ATOM 8259  H HA   . SER A 1 33  ? -7.802  -5.101  10.428  1.00 0.00 ? 33  SER A HA   5  
ATOM 8260  H HB2  . SER A 1 33  ? -9.679  -5.171  11.868  1.00 0.00 ? 33  SER A HB2  5  
ATOM 8261  H HB3  . SER A 1 33  ? -9.496  -3.477  12.322  1.00 0.00 ? 33  SER A HB3  5  
ATOM 8262  H HG   . SER A 1 33  ? -11.044 -3.355  10.844  1.00 0.00 ? 33  SER A HG   5  
ATOM 8263  N N    . ILE A 1 34  ? -7.368  -1.871  10.819  1.00 0.00 ? 34  ILE A N    5  
ATOM 8264  C CA   . ILE A 1 34  ? -7.078  -0.629  10.114  1.00 0.00 ? 34  ILE A CA   5  
ATOM 8265  C C    . ILE A 1 34  ? -5.599  -0.270  10.218  1.00 0.00 ? 34  ILE A C    5  
ATOM 8266  O O    . ILE A 1 34  ? -4.994  -0.388  11.284  1.00 0.00 ? 34  ILE A O    5  
ATOM 8267  C CB   . ILE A 1 34  ? -7.918  0.539   10.664  1.00 0.00 ? 34  ILE A CB   5  
ATOM 8268  C CG1  . ILE A 1 34  ? -9.409  0.257   10.475  1.00 0.00 ? 34  ILE A CG1  5  
ATOM 8269  C CG2  . ILE A 1 34  ? -7.528  1.840   9.978   1.00 0.00 ? 34  ILE A CG2  5  
ATOM 8270  C CD1  . ILE A 1 34  ? -10.286 0.913   11.518  1.00 0.00 ? 34  ILE A CD1  5  
ATOM 8271  H H    . ILE A 1 34  ? -7.335  -1.885  11.798  1.00 0.00 ? 34  ILE A H    5  
ATOM 8272  H HA   . ILE A 1 34  ? -7.331  -0.769  9.073   1.00 0.00 ? 34  ILE A HA   5  
ATOM 8273  H HB   . ILE A 1 34  ? -7.708  0.639   11.718  1.00 0.00 ? 34  ILE A HB   5  
ATOM 8274  H HG12 . ILE A 1 34  ? -9.719  0.619   9.507   1.00 0.00 ? 34  ILE A HG12 5  
ATOM 8275  H HG13 . ILE A 1 34  ? -9.575  -0.810  10.525  1.00 0.00 ? 34  ILE A HG13 5  
ATOM 8276  H HG21 . ILE A 1 34  ? -7.594  2.654   10.685  1.00 0.00 ? 34  ILE A HG21 5  
ATOM 8277  H HG22 . ILE A 1 34  ? -6.516  1.765   9.612   1.00 0.00 ? 34  ILE A HG22 5  
ATOM 8278  H HG23 . ILE A 1 34  ? -8.198  2.027   9.152   1.00 0.00 ? 34  ILE A HG23 5  
ATOM 8279  H HD11 . ILE A 1 34  ? -9.673  1.257   12.339  1.00 0.00 ? 34  ILE A HD11 5  
ATOM 8280  H HD12 . ILE A 1 34  ? -10.804 1.752   11.078  1.00 0.00 ? 34  ILE A HD12 5  
ATOM 8281  H HD13 . ILE A 1 34  ? -11.007 0.197   11.885  1.00 0.00 ? 34  ILE A HD13 5  
ATOM 8282  N N    . PHE A 1 35  ? -5.023  0.170   9.105   1.00 0.00 ? 35  PHE A N    5  
ATOM 8283  C CA   . PHE A 1 35  ? -3.615  0.547   9.071   1.00 0.00 ? 35  PHE A CA   5  
ATOM 8284  C C    . PHE A 1 35  ? -3.382  1.691   8.087   1.00 0.00 ? 35  PHE A C    5  
ATOM 8285  O O    . PHE A 1 35  ? -4.292  2.097   7.365   1.00 0.00 ? 35  PHE A O    5  
ATOM 8286  C CB   . PHE A 1 35  ? -2.752  -0.656  8.685   1.00 0.00 ? 35  PHE A CB   5  
ATOM 8287  C CG   . PHE A 1 35  ? -3.195  -1.330  7.417   1.00 0.00 ? 35  PHE A CG   5  
ATOM 8288  C CD1  . PHE A 1 35  ? -4.363  -2.074  7.384   1.00 0.00 ? 35  PHE A CD1  5  
ATOM 8289  C CD2  . PHE A 1 35  ? -2.443  -1.219  6.259   1.00 0.00 ? 35  PHE A CD2  5  
ATOM 8290  C CE1  . PHE A 1 35  ? -4.774  -2.694  6.220   1.00 0.00 ? 35  PHE A CE1  5  
ATOM 8291  C CE2  . PHE A 1 35  ? -2.848  -1.837  5.091   1.00 0.00 ? 35  PHE A CE2  5  
ATOM 8292  C CZ   . PHE A 1 35  ? -4.015  -2.577  5.072   1.00 0.00 ? 35  PHE A CZ   5  
ATOM 8293  H H    . PHE A 1 35  ? -5.558  0.242   8.286   1.00 0.00 ? 35  PHE A H    5  
ATOM 8294  H HA   . PHE A 1 35  ? -3.336  0.876   10.060  1.00 0.00 ? 35  PHE A HA   5  
ATOM 8295  H HB2  . PHE A 1 35  ? -1.732  -0.329  8.547   1.00 0.00 ? 35  PHE A HB2  5  
ATOM 8296  H HB3  . PHE A 1 35  ? -2.788  -1.385  9.480   1.00 0.00 ? 35  PHE A HB3  5  
ATOM 8297  H HD1  . PHE A 1 35  ? -4.958  -2.166  8.282   1.00 0.00 ? 35  PHE A HD1  5  
ATOM 8298  H HD2  . PHE A 1 35  ? -1.530  -0.642  6.273   1.00 0.00 ? 35  PHE A HD2  5  
ATOM 8299  H HE1  . PHE A 1 35  ? -5.687  -3.272  6.208   1.00 0.00 ? 35  PHE A HE1  5  
ATOM 8300  H HE2  . PHE A 1 35  ? -2.253  -1.744  4.195   1.00 0.00 ? 35  PHE A HE2  5  
ATOM 8301  H HZ   . PHE A 1 35  ? -4.334  -3.060  4.161   1.00 0.00 ? 35  PHE A HZ   5  
ATOM 8302  N N    . ARG A 1 36  ? -2.157  2.205   8.067   1.00 0.00 ? 36  ARG A N    5  
ATOM 8303  C CA   . ARG A 1 36  ? -1.804  3.303   7.175   1.00 0.00 ? 36  ARG A CA   5  
ATOM 8304  C C    . ARG A 1 36  ? -0.515  2.995   6.418   1.00 0.00 ? 36  ARG A C    5  
ATOM 8305  O O    . ARG A 1 36  ? 0.475   2.560   7.008   1.00 0.00 ? 36  ARG A O    5  
ATOM 8306  C CB   . ARG A 1 36  ? -1.645  4.601   7.967   1.00 0.00 ? 36  ARG A CB   5  
ATOM 8307  C CG   . ARG A 1 36  ? -1.039  4.403   9.347   1.00 0.00 ? 36  ARG A CG   5  
ATOM 8308  C CD   . ARG A 1 36  ? -0.365  5.670   9.848   1.00 0.00 ? 36  ARG A CD   5  
ATOM 8309  N NE   . ARG A 1 36  ? -1.296  6.541   10.561  1.00 0.00 ? 36  ARG A NE   5  
ATOM 8310  C CZ   . ARG A 1 36  ? -1.000  7.778   10.942  1.00 0.00 ? 36  ARG A CZ   5  
ATOM 8311  N NH1  . ARG A 1 36  ? 0.195   8.289   10.678  1.00 0.00 ? 36  ARG A NH1  5  
ATOM 8312  N NH2  . ARG A 1 36  ? -1.900  8.509   11.587  1.00 0.00 ? 36  ARG A NH2  5  
ATOM 8313  H H    . ARG A 1 36  ? -1.474  1.839   8.667   1.00 0.00 ? 36  ARG A H    5  
ATOM 8314  H HA   . ARG A 1 36  ? -2.606  3.422   6.462   1.00 0.00 ? 36  ARG A HA   5  
ATOM 8315  H HB2  . ARG A 1 36  ? -1.006  5.273   7.412   1.00 0.00 ? 36  ARG A HB2  5  
ATOM 8316  H HB3  . ARG A 1 36  ? -2.616  5.057   8.086   1.00 0.00 ? 36  ARG A HB3  5  
ATOM 8317  H HG2  . ARG A 1 36  ? -1.823  4.129   10.038  1.00 0.00 ? 36  ARG A HG2  5  
ATOM 8318  H HG3  . ARG A 1 36  ? -0.307  3.611   9.298   1.00 0.00 ? 36  ARG A HG3  5  
ATOM 8319  H HD2  . ARG A 1 36  ? 0.439   5.396   10.515  1.00 0.00 ? 36  ARG A HD2  5  
ATOM 8320  H HD3  . ARG A 1 36  ? 0.038   6.206   9.001   1.00 0.00 ? 36  ARG A HD3  5  
ATOM 8321  H HE   . ARG A 1 36  ? -2.184  6.184   10.766  1.00 0.00 ? 36  ARG A HE   5  
ATOM 8322  H HH11 . ARG A 1 36  ? 0.876   7.741   10.191  1.00 0.00 ? 36  ARG A HH11 5  
ATOM 8323  H HH12 . ARG A 1 36  ? 0.415   9.222   10.965  1.00 0.00 ? 36  ARG A HH12 5  
ATOM 8324  H HH21 . ARG A 1 36  ? -2.802  8.127   11.787  1.00 0.00 ? 36  ARG A HH21 5  
ATOM 8325  H HH22 . ARG A 1 36  ? -1.677  9.440   11.873  1.00 0.00 ? 36  ARG A HH22 5  
ATOM 8326  N N    . ILE A 1 37  ? -0.535  3.223   5.109   1.00 0.00 ? 37  ILE A N    5  
ATOM 8327  C CA   . ILE A 1 37  ? 0.632   2.970   4.272   1.00 0.00 ? 37  ILE A CA   5  
ATOM 8328  C C    . ILE A 1 37  ? 1.179   4.268   3.687   1.00 0.00 ? 37  ILE A C    5  
ATOM 8329  O O    . ILE A 1 37  ? 0.436   5.122   3.204   1.00 0.00 ? 37  ILE A O    5  
ATOM 8330  C CB   . ILE A 1 37  ? 0.301   2.001   3.123   1.00 0.00 ? 37  ILE A CB   5  
ATOM 8331  C CG1  . ILE A 1 37  ? 1.586   1.524   2.443   1.00 0.00 ? 37  ILE A CG1  5  
ATOM 8332  C CG2  . ILE A 1 37  ? -0.621  2.670   2.115   1.00 0.00 ? 37  ILE A CG2  5  
ATOM 8333  C CD1  . ILE A 1 37  ? 1.342   0.598   1.271   1.00 0.00 ? 37  ILE A CD1  5  
ATOM 8334  H H    . ILE A 1 37  ? -1.353  3.569   4.697   1.00 0.00 ? 37  ILE A H    5  
ATOM 8335  H HA   . ILE A 1 37  ? 1.393   2.518   4.891   1.00 0.00 ? 37  ILE A HA   5  
ATOM 8336  H HB   . ILE A 1 37  ? -0.216  1.149   3.537   1.00 0.00 ? 37  ILE A HB   5  
ATOM 8337  H HG12 . ILE A 1 37  ? 2.133   2.380   2.080   1.00 0.00 ? 37  ILE A HG12 5  
ATOM 8338  H HG13 . ILE A 1 37  ? 2.191   0.994   3.165   1.00 0.00 ? 37  ILE A HG13 5  
ATOM 8339  H HG21 . ILE A 1 37  ? -0.978  1.933   1.409   1.00 0.00 ? 37  ILE A HG21 5  
ATOM 8340  H HG22 . ILE A 1 37  ? -1.462  3.108   2.632   1.00 0.00 ? 37  ILE A HG22 5  
ATOM 8341  H HG23 . ILE A 1 37  ? -0.080  3.441   1.587   1.00 0.00 ? 37  ILE A HG23 5  
ATOM 8342  H HD11 . ILE A 1 37  ? 1.835   -0.346  1.450   1.00 0.00 ? 37  ILE A HD11 5  
ATOM 8343  H HD12 . ILE A 1 37  ? 0.281   0.436   1.155   1.00 0.00 ? 37  ILE A HD12 5  
ATOM 8344  H HD13 . ILE A 1 37  ? 1.739   1.046   0.371   1.00 0.00 ? 37  ILE A HD13 5  
ATOM 8345  N N    . PRO A 1 38  ? 2.511   4.419   3.727   1.00 0.00 ? 38  PRO A N    5  
ATOM 8346  C CA   . PRO A 1 38  ? 3.189   5.609   3.203   1.00 0.00 ? 38  PRO A CA   5  
ATOM 8347  C C    . PRO A 1 38  ? 3.128   5.687   1.681   1.00 0.00 ? 38  PRO A C    5  
ATOM 8348  O O    . PRO A 1 38  ? 3.752   4.887   0.984   1.00 0.00 ? 38  PRO A O    5  
ATOM 8349  C CB   . PRO A 1 38  ? 4.635   5.429   3.672   1.00 0.00 ? 38  PRO A CB   5  
ATOM 8350  C CG   . PRO A 1 38  ? 4.798   3.958   3.841   1.00 0.00 ? 38  PRO A CG   5  
ATOM 8351  C CD   . PRO A 1 38  ? 3.459   3.441   4.288   1.00 0.00 ? 38  PRO A CD   5  
ATOM 8352  H HA   . PRO A 1 38  ? 2.782   6.516   3.625   1.00 0.00 ? 38  PRO A HA   5  
ATOM 8353  H HB2  . PRO A 1 38  ? 5.310   5.819   2.922   1.00 0.00 ? 38  PRO A HB2  5  
ATOM 8354  H HB3  . PRO A 1 38  ? 4.782   5.952   4.604   1.00 0.00 ? 38  PRO A HB3  5  
ATOM 8355  H HG2  . PRO A 1 38  ? 5.078   3.509   2.900   1.00 0.00 ? 38  PRO A HG2  5  
ATOM 8356  H HG3  . PRO A 1 38  ? 5.547   3.756   4.592   1.00 0.00 ? 38  PRO A HG3  5  
ATOM 8357  H HD2  . PRO A 1 38  ? 3.280   2.456   3.884   1.00 0.00 ? 38  PRO A HD2  5  
ATOM 8358  H HD3  . PRO A 1 38  ? 3.402   3.425   5.366   1.00 0.00 ? 38  PRO A HD3  5  
ATOM 8359  N N    . TRP A 1 39  ? 2.373   6.654   1.173   1.00 0.00 ? 39  TRP A N    5  
ATOM 8360  C CA   . TRP A 1 39  ? 2.232   6.836   -0.267  1.00 0.00 ? 39  TRP A CA   5  
ATOM 8361  C C    . TRP A 1 39  ? 3.195   7.902   -0.779  1.00 0.00 ? 39  TRP A C    5  
ATOM 8362  O O    . TRP A 1 39  ? 3.046   8.404   -1.893  1.00 0.00 ? 39  TRP A O    5  
ATOM 8363  C CB   . TRP A 1 39  ? 0.793   7.222   -0.615  1.00 0.00 ? 39  TRP A CB   5  
ATOM 8364  C CG   . TRP A 1 39  ? 0.340   6.691   -1.941  1.00 0.00 ? 39  TRP A CG   5  
ATOM 8365  C CD1  . TRP A 1 39  ? 0.276   7.378   -3.120  1.00 0.00 ? 39  TRP A CD1  5  
ATOM 8366  C CD2  . TRP A 1 39  ? -0.115  5.363   -2.223  1.00 0.00 ? 39  TRP A CD2  5  
ATOM 8367  N NE1  . TRP A 1 39  ? -0.191  6.557   -4.118  1.00 0.00 ? 39  TRP A NE1  5  
ATOM 8368  C CE2  . TRP A 1 39  ? -0.438  5.315   -3.593  1.00 0.00 ? 39  TRP A CE2  5  
ATOM 8369  C CE3  . TRP A 1 39  ? -0.280  4.210   -1.451  1.00 0.00 ? 39  TRP A CE3  5  
ATOM 8370  C CZ2  . TRP A 1 39  ? -0.915  4.160   -4.205  1.00 0.00 ? 39  TRP A CZ2  5  
ATOM 8371  C CZ3  . TRP A 1 39  ? -0.755  3.064   -2.060  1.00 0.00 ? 39  TRP A CZ3  5  
ATOM 8372  C CH2  . TRP A 1 39  ? -1.067  3.045   -3.426  1.00 0.00 ? 39  TRP A CH2  5  
ATOM 8373  H H    . TRP A 1 39  ? 1.900   7.261   1.780   1.00 0.00 ? 39  TRP A H    5  
ATOM 8374  H HA   . TRP A 1 39  ? 2.468   5.896   -0.744  1.00 0.00 ? 39  TRP A HA   5  
ATOM 8375  H HB2  . TRP A 1 39  ? 0.130   6.834   0.144   1.00 0.00 ? 39  TRP A HB2  5  
ATOM 8376  H HB3  . TRP A 1 39  ? 0.713   8.299   -0.641  1.00 0.00 ? 39  TRP A HB3  5  
ATOM 8377  H HD1  . TRP A 1 39  ? 0.554   8.414   -3.236  1.00 0.00 ? 39  TRP A HD1  5  
ATOM 8378  H HE1  . TRP A 1 39  ? -0.324  6.817   -5.053  1.00 0.00 ? 39  TRP A HE1  5  
ATOM 8379  H HE3  . TRP A 1 39  ? -0.045  4.205   -0.397  1.00 0.00 ? 39  TRP A HE3  5  
ATOM 8380  H HZ2  . TRP A 1 39  ? -1.160  4.129   -5.257  1.00 0.00 ? 39  TRP A HZ2  5  
ATOM 8381  H HZ3  . TRP A 1 39  ? -0.889  2.163   -1.480  1.00 0.00 ? 39  TRP A HZ3  5  
ATOM 8382  H HH2  . TRP A 1 39  ? -1.435  2.128   -3.859  1.00 0.00 ? 39  TRP A HH2  5  
ATOM 8383  N N    . LYS A 1 40  ? 4.182   8.245   0.042   1.00 0.00 ? 40  LYS A N    5  
ATOM 8384  C CA   . LYS A 1 40  ? 5.170   9.251   -0.327  1.00 0.00 ? 40  LYS A CA   5  
ATOM 8385  C C    . LYS A 1 40  ? 6.128   8.710   -1.384  1.00 0.00 ? 40  LYS A C    5  
ATOM 8386  O O    . LYS A 1 40  ? 6.425   7.515   -1.414  1.00 0.00 ? 40  LYS A O    5  
ATOM 8387  C CB   . LYS A 1 40  ? 5.956   9.700   0.907   1.00 0.00 ? 40  LYS A CB   5  
ATOM 8388  C CG   . LYS A 1 40  ? 6.823   10.924  0.664   1.00 0.00 ? 40  LYS A CG   5  
ATOM 8389  C CD   . LYS A 1 40  ? 7.934   11.034  1.695   1.00 0.00 ? 40  LYS A CD   5  
ATOM 8390  C CE   . LYS A 1 40  ? 7.500   11.862  2.895   1.00 0.00 ? 40  LYS A CE   5  
ATOM 8391  N NZ   . LYS A 1 40  ? 8.545   11.890  3.956   1.00 0.00 ? 40  LYS A NZ   5  
ATOM 8392  H H    . LYS A 1 40  ? 4.247   7.809   0.919   1.00 0.00 ? 40  LYS A H    5  
ATOM 8393  H HA   . LYS A 1 40  ? 4.644   10.099  -0.736  1.00 0.00 ? 40  LYS A HA   5  
ATOM 8394  H HB2  . LYS A 1 40  ? 5.259   9.929   1.699   1.00 0.00 ? 40  LYS A HB2  5  
ATOM 8395  H HB3  . LYS A 1 40  ? 6.596   8.889   1.226   1.00 0.00 ? 40  LYS A HB3  5  
ATOM 8396  H HG2  . LYS A 1 40  ? 7.264   10.852  -0.319  1.00 0.00 ? 40  LYS A HG2  5  
ATOM 8397  H HG3  . LYS A 1 40  ? 6.204   11.808  0.719   1.00 0.00 ? 40  LYS A HG3  5  
ATOM 8398  H HD2  . LYS A 1 40  ? 8.200   10.043  2.033   1.00 0.00 ? 40  LYS A HD2  5  
ATOM 8399  H HD3  . LYS A 1 40  ? 8.793   11.503  1.237   1.00 0.00 ? 40  LYS A HD3  5  
ATOM 8400  H HE2  . LYS A 1 40  ? 7.304   12.871  2.568   1.00 0.00 ? 40  LYS A HE2  5  
ATOM 8401  H HE3  . LYS A 1 40  ? 6.596   11.434  3.303   1.00 0.00 ? 40  LYS A HE3  5  
ATOM 8402  H HZ1  . LYS A 1 40  ? 8.836   12.871  4.144   1.00 0.00 ? 40  LYS A HZ1  5  
ATOM 8403  H HZ2  . LYS A 1 40  ? 9.377   11.346  3.652   1.00 0.00 ? 40  LYS A HZ2  5  
ATOM 8404  H HZ3  . LYS A 1 40  ? 8.174   11.475  4.834   1.00 0.00 ? 40  LYS A HZ3  5  
ATOM 8405  N N    . HIS A 1 41  ? 6.610   9.597   -2.249  1.00 0.00 ? 41  HIS A N    5  
ATOM 8406  C CA   . HIS A 1 41  ? 7.536   9.209   -3.306  1.00 0.00 ? 41  HIS A CA   5  
ATOM 8407  C C    . HIS A 1 41  ? 8.501   10.346  -3.628  1.00 0.00 ? 41  HIS A C    5  
ATOM 8408  O O    . HIS A 1 41  ? 8.083   11.435  -4.018  1.00 0.00 ? 41  HIS A O    5  
ATOM 8409  C CB   . HIS A 1 41  ? 6.767   8.805   -4.564  1.00 0.00 ? 41  HIS A CB   5  
ATOM 8410  C CG   . HIS A 1 41  ? 7.548   8.991   -5.829  1.00 0.00 ? 41  HIS A CG   5  
ATOM 8411  N ND1  . HIS A 1 41  ? 8.851   8.565   -5.978  1.00 0.00 ? 41  HIS A ND1  5  
ATOM 8412  C CD2  . HIS A 1 41  ? 7.202   9.559   -7.008  1.00 0.00 ? 41  HIS A CD2  5  
ATOM 8413  C CE1  . HIS A 1 41  ? 9.273   8.865   -7.194  1.00 0.00 ? 41  HIS A CE1  5  
ATOM 8414  N NE2  . HIS A 1 41  ? 8.291   9.468   -7.839  1.00 0.00 ? 41  HIS A NE2  5  
ATOM 8415  H H    . HIS A 1 41  ? 6.336   10.535  -2.174  1.00 0.00 ? 41  HIS A H    5  
ATOM 8416  H HA   . HIS A 1 41  ? 8.104   8.361   -2.954  1.00 0.00 ? 41  HIS A HA   5  
ATOM 8417  H HB2  . HIS A 1 41  ? 6.495   7.762   -4.493  1.00 0.00 ? 41  HIS A HB2  5  
ATOM 8418  H HB3  . HIS A 1 41  ? 5.869   9.402   -4.637  1.00 0.00 ? 41  HIS A HB3  5  
ATOM 8419  H HD1  . HIS A 1 41  ? 9.387   8.112   -5.295  1.00 0.00 ? 41  HIS A HD1  5  
ATOM 8420  H HD2  . HIS A 1 41  ? 6.246   10.002  -7.250  1.00 0.00 ? 41  HIS A HD2  5  
ATOM 8421  H HE1  . HIS A 1 41  ? 10.253  8.653   -7.593  1.00 0.00 ? 41  HIS A HE1  5  
ATOM 8422  N N    . ALA A 1 42  ? 9.793   10.084  -3.461  1.00 0.00 ? 42  ALA A N    5  
ATOM 8423  C CA   . ALA A 1 42  ? 10.817  11.085  -3.734  1.00 0.00 ? 42  ALA A CA   5  
ATOM 8424  C C    . ALA A 1 42  ? 11.513  10.809  -5.063  1.00 0.00 ? 42  ALA A C    5  
ATOM 8425  O O    . ALA A 1 42  ? 11.390  9.722   -5.625  1.00 0.00 ? 42  ALA A O    5  
ATOM 8426  C CB   . ALA A 1 42  ? 11.832  11.125  -2.602  1.00 0.00 ? 42  ALA A CB   5  
ATOM 8427  H H    . ALA A 1 42  ? 10.065  9.197   -3.147  1.00 0.00 ? 42  ALA A H    5  
ATOM 8428  H HA   . ALA A 1 42  ? 10.334  12.051  -3.786  1.00 0.00 ? 42  ALA A HA   5  
ATOM 8429  H HB1  . ALA A 1 42  ? 11.341  10.886  -1.670  1.00 0.00 ? 42  ALA A HB1  5  
ATOM 8430  H HB2  . ALA A 1 42  ? 12.613  10.404  -2.793  1.00 0.00 ? 42  ALA A HB2  5  
ATOM 8431  H HB3  . ALA A 1 42  ? 12.262  12.114  -2.539  1.00 0.00 ? 42  ALA A HB3  5  
ATOM 8432  N N    . GLY A 1 43  ? 12.246  11.802  -5.559  1.00 0.00 ? 43  GLY A N    5  
ATOM 8433  C CA   . GLY A 1 43  ? 12.950  11.645  -6.819  1.00 0.00 ? 43  GLY A CA   5  
ATOM 8434  C C    . GLY A 1 43  ? 14.447  11.837  -6.673  1.00 0.00 ? 43  GLY A C    5  
ATOM 8435  O O    . GLY A 1 43  ? 15.014  12.789  -7.211  1.00 0.00 ? 43  GLY A O    5  
ATOM 8436  H H    . GLY A 1 43  ? 12.308  12.647  -5.067  1.00 0.00 ? 43  GLY A H    5  
ATOM 8437  H HA2  . GLY A 1 43  ? 12.760  10.655  -7.204  1.00 0.00 ? 43  GLY A HA2  5  
ATOM 8438  H HA3  . GLY A 1 43  ? 12.572  12.373  -7.522  1.00 0.00 ? 43  GLY A HA3  5  
ATOM 8439  N N    . LYS A 1 44  ? 15.090  10.933  -5.943  1.00 0.00 ? 44  LYS A N    5  
ATOM 8440  C CA   . LYS A 1 44  ? 16.530  11.006  -5.727  1.00 0.00 ? 44  LYS A CA   5  
ATOM 8441  C C    . LYS A 1 44  ? 17.137  9.610   -5.632  1.00 0.00 ? 44  LYS A C    5  
ATOM 8442  O O    . LYS A 1 44  ? 16.438  8.638   -5.346  1.00 0.00 ? 44  LYS A O    5  
ATOM 8443  C CB   . LYS A 1 44  ? 16.836  11.795  -4.452  1.00 0.00 ? 44  LYS A CB   5  
ATOM 8444  C CG   . LYS A 1 44  ? 16.483  13.269  -4.550  1.00 0.00 ? 44  LYS A CG   5  
ATOM 8445  C CD   . LYS A 1 44  ? 17.425  14.124  -3.718  1.00 0.00 ? 44  LYS A CD   5  
ATOM 8446  C CE   . LYS A 1 44  ? 16.879  15.531  -3.528  1.00 0.00 ? 44  LYS A CE   5  
ATOM 8447  N NZ   . LYS A 1 44  ? 17.197  16.411  -4.687  1.00 0.00 ? 44  LYS A NZ   5  
ATOM 8448  H H    . LYS A 1 44  ? 14.583  10.196  -5.539  1.00 0.00 ? 44  LYS A H    5  
ATOM 8449  H HA   . LYS A 1 44  ? 16.966  11.518  -6.571  1.00 0.00 ? 44  LYS A HA   5  
ATOM 8450  H HB2  . LYS A 1 44  ? 16.276  11.366  -3.634  1.00 0.00 ? 44  LYS A HB2  5  
ATOM 8451  H HB3  . LYS A 1 44  ? 17.891  11.712  -4.236  1.00 0.00 ? 44  LYS A HB3  5  
ATOM 8452  H HG2  . LYS A 1 44  ? 16.550  13.579  -5.582  1.00 0.00 ? 44  LYS A HG2  5  
ATOM 8453  H HG3  . LYS A 1 44  ? 15.472  13.413  -4.194  1.00 0.00 ? 44  LYS A HG3  5  
ATOM 8454  H HD2  . LYS A 1 44  ? 17.552  13.666  -2.749  1.00 0.00 ? 44  LYS A HD2  5  
ATOM 8455  H HD3  . LYS A 1 44  ? 18.381  14.183  -4.219  1.00 0.00 ? 44  LYS A HD3  5  
ATOM 8456  H HE2  . LYS A 1 44  ? 15.807  15.475  -3.413  1.00 0.00 ? 44  LYS A HE2  5  
ATOM 8457  H HE3  . LYS A 1 44  ? 17.315  15.954  -2.635  1.00 0.00 ? 44  LYS A HE3  5  
ATOM 8458  H HZ1  . LYS A 1 44  ? 17.625  15.852  -5.452  1.00 0.00 ? 44  LYS A HZ1  5  
ATOM 8459  H HZ2  . LYS A 1 44  ? 17.867  17.152  -4.399  1.00 0.00 ? 44  LYS A HZ2  5  
ATOM 8460  H HZ3  . LYS A 1 44  ? 16.330  16.861  -5.043  1.00 0.00 ? 44  LYS A HZ3  5  
ATOM 8461  N N    . GLN A 1 45  ? 18.441  9.519   -5.871  1.00 0.00 ? 45  GLN A N    5  
ATOM 8462  C CA   . GLN A 1 45  ? 19.142  8.242   -5.811  1.00 0.00 ? 45  GLN A CA   5  
ATOM 8463  C C    . GLN A 1 45  ? 19.829  8.061   -4.461  1.00 0.00 ? 45  GLN A C    5  
ATOM 8464  O O    . GLN A 1 45  ? 19.629  7.055   -3.782  1.00 0.00 ? 45  GLN A O    5  
ATOM 8465  C CB   . GLN A 1 45  ? 20.172  8.147   -6.938  1.00 0.00 ? 45  GLN A CB   5  
ATOM 8466  C CG   . GLN A 1 45  ? 20.611  6.724   -7.243  1.00 0.00 ? 45  GLN A CG   5  
ATOM 8467  C CD   . GLN A 1 45  ? 19.662  6.010   -8.185  1.00 0.00 ? 45  GLN A CD   5  
ATOM 8468  O OE1  . GLN A 1 45  ? 18.964  5.075   -7.790  1.00 0.00 ? 45  GLN A OE1  5  
ATOM 8469  N NE2  . GLN A 1 45  ? 19.631  6.446   -9.438  1.00 0.00 ? 45  GLN A NE2  5  
ATOM 8470  H H    . GLN A 1 45  ? 18.944  10.330  -6.093  1.00 0.00 ? 45  GLN A H    5  
ATOM 8471  H HA   . GLN A 1 45  ? 18.411  7.457   -5.936  1.00 0.00 ? 45  GLN A HA   5  
ATOM 8472  H HB2  . GLN A 1 45  ? 19.745  8.570   -7.835  1.00 0.00 ? 45  GLN A HB2  5  
ATOM 8473  H HB3  . GLN A 1 45  ? 21.045  8.719   -6.660  1.00 0.00 ? 45  GLN A HB3  5  
ATOM 8474  H HG2  . GLN A 1 45  ? 21.590  6.753   -7.697  1.00 0.00 ? 45  GLN A HG2  5  
ATOM 8475  H HG3  . GLN A 1 45  ? 20.661  6.171   -6.317  1.00 0.00 ? 45  GLN A HG3  5  
ATOM 8476  H HE21 . GLN A 1 45  ? 20.216  7.194   -9.682  1.00 0.00 ? 45  GLN A HE21 5  
ATOM 8477  H HE22 . GLN A 1 45  ? 19.028  6.002   -10.068 1.00 0.00 ? 45  GLN A HE22 5  
ATOM 8478  N N    . ASP A 1 46  ? 20.641  9.041   -4.081  1.00 0.00 ? 46  ASP A N    5  
ATOM 8479  C CA   . ASP A 1 46  ? 21.358  8.991   -2.812  1.00 0.00 ? 46  ASP A CA   5  
ATOM 8480  C C    . ASP A 1 46  ? 20.463  8.447   -1.703  1.00 0.00 ? 46  ASP A C    5  
ATOM 8481  O O    . ASP A 1 46  ? 20.918  7.707   -0.831  1.00 0.00 ? 46  ASP A O    5  
ATOM 8482  C CB   . ASP A 1 46  ? 21.870  10.382  -2.435  1.00 0.00 ? 46  ASP A CB   5  
ATOM 8483  C CG   . ASP A 1 46  ? 23.208  10.699  -3.073  1.00 0.00 ? 46  ASP A CG   5  
ATOM 8484  O OD1  . ASP A 1 46  ? 24.207  10.044  -2.711  1.00 0.00 ? 46  ASP A OD1  5  
ATOM 8485  O OD2  . ASP A 1 46  ? 23.256  11.603  -3.934  1.00 0.00 ? 46  ASP A OD2  5  
ATOM 8486  H H    . ASP A 1 46  ? 20.760  9.818   -4.666  1.00 0.00 ? 46  ASP A H    5  
ATOM 8487  H HA   . ASP A 1 46  ? 22.201  8.328   -2.934  1.00 0.00 ? 46  ASP A HA   5  
ATOM 8488  H HB2  . ASP A 1 46  ? 21.153  11.123  -2.760  1.00 0.00 ? 46  ASP A HB2  5  
ATOM 8489  H HB3  . ASP A 1 46  ? 21.980  10.440  -1.362  1.00 0.00 ? 46  ASP A HB3  5  
ATOM 8490  N N    . TYR A 1 47  ? 19.188  8.820   -1.742  1.00 0.00 ? 47  TYR A N    5  
ATOM 8491  C CA   . TYR A 1 47  ? 18.230  8.373   -0.738  1.00 0.00 ? 47  TYR A CA   5  
ATOM 8492  C C    . TYR A 1 47  ? 18.171  6.850   -0.682  1.00 0.00 ? 47  TYR A C    5  
ATOM 8493  O O    . TYR A 1 47  ? 18.840  6.163   -1.453  1.00 0.00 ? 47  TYR A O    5  
ATOM 8494  C CB   . TYR A 1 47  ? 16.841  8.938   -1.042  1.00 0.00 ? 47  TYR A CB   5  
ATOM 8495  C CG   . TYR A 1 47  ? 15.997  8.034   -1.912  1.00 0.00 ? 47  TYR A CG   5  
ATOM 8496  C CD1  . TYR A 1 47  ? 16.507  7.491   -3.085  1.00 0.00 ? 47  TYR A CD1  5  
ATOM 8497  C CD2  . TYR A 1 47  ? 14.689  7.723   -1.561  1.00 0.00 ? 47  TYR A CD2  5  
ATOM 8498  C CE1  . TYR A 1 47  ? 15.739  6.665   -3.883  1.00 0.00 ? 47  TYR A CE1  5  
ATOM 8499  C CE2  . TYR A 1 47  ? 13.914  6.897   -2.353  1.00 0.00 ? 47  TYR A CE2  5  
ATOM 8500  C CZ   . TYR A 1 47  ? 14.444  6.371   -3.512  1.00 0.00 ? 47  TYR A CZ   5  
ATOM 8501  O OH   . TYR A 1 47  ? 13.675  5.549   -4.304  1.00 0.00 ? 47  TYR A OH   5  
ATOM 8502  H H    . TYR A 1 47  ? 18.885  9.412   -2.462  1.00 0.00 ? 47  TYR A H    5  
ATOM 8503  H HA   . TYR A 1 47  ? 18.557  8.745   0.222   1.00 0.00 ? 47  TYR A HA   5  
ATOM 8504  H HB2  . TYR A 1 47  ? 16.312  9.093   -0.114  1.00 0.00 ? 47  TYR A HB2  5  
ATOM 8505  H HB3  . TYR A 1 47  ? 16.948  9.884   -1.552  1.00 0.00 ? 47  TYR A HB3  5  
ATOM 8506  H HD1  . TYR A 1 47  ? 17.522  7.724   -3.372  1.00 0.00 ? 47  TYR A HD1  5  
ATOM 8507  H HD2  . TYR A 1 47  ? 14.277  8.138   -0.652  1.00 0.00 ? 47  TYR A HD2  5  
ATOM 8508  H HE1  . TYR A 1 47  ? 16.154  6.253   -4.791  1.00 0.00 ? 47  TYR A HE1  5  
ATOM 8509  H HE2  . TYR A 1 47  ? 12.899  6.667   -2.063  1.00 0.00 ? 47  TYR A HE2  5  
ATOM 8510  H HH   . TYR A 1 47  ? 12.746  5.742   -4.158  1.00 0.00 ? 47  TYR A HH   5  
ATOM 8511  N N    . ASN A 1 48  ? 17.363  6.329   0.236   1.00 0.00 ? 48  ASN A N    5  
ATOM 8512  C CA   . ASN A 1 48  ? 17.215  4.887   0.394   1.00 0.00 ? 48  ASN A CA   5  
ATOM 8513  C C    . ASN A 1 48  ? 16.043  4.366   -0.432  1.00 0.00 ? 48  ASN A C    5  
ATOM 8514  O O    . ASN A 1 48  ? 14.882  4.594   -0.093  1.00 0.00 ? 48  ASN A O    5  
ATOM 8515  C CB   . ASN A 1 48  ? 17.011  4.532   1.869   1.00 0.00 ? 48  ASN A CB   5  
ATOM 8516  C CG   . ASN A 1 48  ? 17.995  5.245   2.776   1.00 0.00 ? 48  ASN A CG   5  
ATOM 8517  O OD1  . ASN A 1 48  ? 17.856  6.438   3.046   1.00 0.00 ? 48  ASN A OD1  5  
ATOM 8518  N ND2  . ASN A 1 48  ? 18.998  4.515   3.251   1.00 0.00 ? 48  ASN A ND2  5  
ATOM 8519  H H    . ASN A 1 48  ? 16.855  6.928   0.822   1.00 0.00 ? 48  ASN A H    5  
ATOM 8520  H HA   . ASN A 1 48  ? 18.123  4.420   0.043   1.00 0.00 ? 48  ASN A HA   5  
ATOM 8521  H HB2  . ASN A 1 48  ? 16.011  4.812   2.165   1.00 0.00 ? 48  ASN A HB2  5  
ATOM 8522  H HB3  . ASN A 1 48  ? 17.136  3.468   1.998   1.00 0.00 ? 48  ASN A HB3  5  
ATOM 8523  H HD21 . ASN A 1 48  ? 19.046  3.571   2.993   1.00 0.00 ? 48  ASN A HD21 5  
ATOM 8524  H HD22 . ASN A 1 48  ? 19.648  4.951   3.840   1.00 0.00 ? 48  ASN A HD22 5  
ATOM 8525  N N    . ARG A 1 49  ? 16.356  3.666   -1.518  1.00 0.00 ? 49  ARG A N    5  
ATOM 8526  C CA   . ARG A 1 49  ? 15.329  3.114   -2.393  1.00 0.00 ? 49  ARG A CA   5  
ATOM 8527  C C    . ARG A 1 49  ? 15.023  1.665   -2.026  1.00 0.00 ? 49  ARG A C    5  
ATOM 8528  O O    . ARG A 1 49  ? 13.896  1.199   -2.185  1.00 0.00 ? 49  ARG A O    5  
ATOM 8529  C CB   . ARG A 1 49  ? 15.775  3.198   -3.854  1.00 0.00 ? 49  ARG A CB   5  
ATOM 8530  C CG   . ARG A 1 49  ? 17.002  2.357   -4.165  1.00 0.00 ? 49  ARG A CG   5  
ATOM 8531  C CD   . ARG A 1 49  ? 18.265  3.203   -4.195  1.00 0.00 ? 49  ARG A CD   5  
ATOM 8532  N NE   . ARG A 1 49  ? 19.451  2.407   -4.501  1.00 0.00 ? 49  ARG A NE   5  
ATOM 8533  C CZ   . ARG A 1 49  ? 20.166  1.770   -3.580  1.00 0.00 ? 49  ARG A CZ   5  
ATOM 8534  N NH1  . ARG A 1 49  ? 19.817  1.836   -2.302  1.00 0.00 ? 49  ARG A NH1  5  
ATOM 8535  N NH2  . ARG A 1 49  ? 21.232  1.066   -3.936  1.00 0.00 ? 49  ARG A NH2  5  
ATOM 8536  H H    . ARG A 1 49  ? 17.300  3.518   -1.736  1.00 0.00 ? 49  ARG A H    5  
ATOM 8537  H HA   . ARG A 1 49  ? 14.433  3.702   -2.265  1.00 0.00 ? 49  ARG A HA   5  
ATOM 8538  H HB2  . ARG A 1 49  ? 14.966  2.861   -4.485  1.00 0.00 ? 49  ARG A HB2  5  
ATOM 8539  H HB3  . ARG A 1 49  ? 16.001  4.227   -4.090  1.00 0.00 ? 49  ARG A HB3  5  
ATOM 8540  H HG2  . ARG A 1 49  ? 17.109  1.597   -3.405  1.00 0.00 ? 49  ARG A HG2  5  
ATOM 8541  H HG3  . ARG A 1 49  ? 16.870  1.888   -5.129  1.00 0.00 ? 49  ARG A HG3  5  
ATOM 8542  H HD2  . ARG A 1 49  ? 18.153  3.967   -4.950  1.00 0.00 ? 49  ARG A HD2  5  
ATOM 8543  H HD3  . ARG A 1 49  ? 18.394  3.668   -3.229  1.00 0.00 ? 49  ARG A HD3  5  
ATOM 8544  H HE   . ARG A 1 49  ? 19.727  2.345   -5.438  1.00 0.00 ? 49  ARG A HE   5  
ATOM 8545  H HH11 . ARG A 1 49  ? 19.013  2.365   -2.031  1.00 0.00 ? 49  ARG A HH11 5  
ATOM 8546  H HH12 . ARG A 1 49  ? 20.356  1.354   -1.611  1.00 0.00 ? 49  ARG A HH12 5  
ATOM 8547  H HH21 . ARG A 1 49  ? 21.498  1.014   -4.898  1.00 0.00 ? 49  ARG A HH21 5  
ATOM 8548  H HH22 . ARG A 1 49  ? 21.769  0.587   -3.242  1.00 0.00 ? 49  ARG A HH22 5  
ATOM 8549  N N    . GLU A 1 50  ? 16.036  0.958   -1.533  1.00 0.00 ? 50  GLU A N    5  
ATOM 8550  C CA   . GLU A 1 50  ? 15.875  -0.438  -1.145  1.00 0.00 ? 50  GLU A CA   5  
ATOM 8551  C C    . GLU A 1 50  ? 14.927  -0.566  0.044   1.00 0.00 ? 50  GLU A C    5  
ATOM 8552  O O    . GLU A 1 50  ? 14.100  -1.475  0.096   1.00 0.00 ? 50  GLU A O    5  
ATOM 8553  C CB   . GLU A 1 50  ? 17.232  -1.054  -0.798  1.00 0.00 ? 50  GLU A CB   5  
ATOM 8554  C CG   . GLU A 1 50  ? 18.117  -1.297  -2.009  1.00 0.00 ? 50  GLU A CG   5  
ATOM 8555  C CD   . GLU A 1 50  ? 17.618  -2.436  -2.877  1.00 0.00 ? 50  GLU A CD   5  
ATOM 8556  O OE1  . GLU A 1 50  ? 17.840  -3.607  -2.506  1.00 0.00 ? 50  GLU A OE1  5  
ATOM 8557  O OE2  . GLU A 1 50  ? 17.005  -2.155  -3.928  1.00 0.00 ? 50  GLU A OE2  5  
ATOM 8558  H H    . GLU A 1 50  ? 16.912  1.386   -1.430  1.00 0.00 ? 50  GLU A H    5  
ATOM 8559  H HA   . GLU A 1 50  ? 15.453  -0.969  -1.985  1.00 0.00 ? 50  GLU A HA   5  
ATOM 8560  H HB2  . GLU A 1 50  ? 17.753  -0.391  -0.124  1.00 0.00 ? 50  GLU A HB2  5  
ATOM 8561  H HB3  . GLU A 1 50  ? 17.068  -2.000  -0.303  1.00 0.00 ? 50  GLU A HB3  5  
ATOM 8562  H HG2  . GLU A 1 50  ? 18.146  -0.397  -2.605  1.00 0.00 ? 50  GLU A HG2  5  
ATOM 8563  H HG3  . GLU A 1 50  ? 19.114  -1.534  -1.668  1.00 0.00 ? 50  GLU A HG3  5  
ATOM 8564  N N    . GLU A 1 51  ? 15.056  0.352   0.997   1.00 0.00 ? 51  GLU A N    5  
ATOM 8565  C CA   . GLU A 1 51  ? 14.212  0.341   2.186   1.00 0.00 ? 51  GLU A CA   5  
ATOM 8566  C C    . GLU A 1 51  ? 12.808  0.845   1.862   1.00 0.00 ? 51  GLU A C    5  
ATOM 8567  O O    . GLU A 1 51  ? 11.821  0.137   2.063   1.00 0.00 ? 51  GLU A O    5  
ATOM 8568  C CB   . GLU A 1 51  ? 14.833  1.201   3.288   1.00 0.00 ? 51  GLU A CB   5  
ATOM 8569  C CG   . GLU A 1 51  ? 15.975  0.519   4.023   1.00 0.00 ? 51  GLU A CG   5  
ATOM 8570  C CD   . GLU A 1 51  ? 16.693  1.451   4.979   1.00 0.00 ? 51  GLU A CD   5  
ATOM 8571  O OE1  . GLU A 1 51  ? 16.061  2.421   5.448   1.00 0.00 ? 51  GLU A OE1  5  
ATOM 8572  O OE2  . GLU A 1 51  ? 17.886  1.211   5.259   1.00 0.00 ? 51  GLU A OE2  5  
ATOM 8573  H H    . GLU A 1 51  ? 15.734  1.052   0.899   1.00 0.00 ? 51  GLU A H    5  
ATOM 8574  H HA   . GLU A 1 51  ? 14.143  -0.679  2.535   1.00 0.00 ? 51  GLU A HA   5  
ATOM 8575  H HB2  . GLU A 1 51  ? 15.210  2.113   2.847   1.00 0.00 ? 51  GLU A HB2  5  
ATOM 8576  H HB3  . GLU A 1 51  ? 14.068  1.450   4.008   1.00 0.00 ? 51  GLU A HB3  5  
ATOM 8577  H HG2  . GLU A 1 51  ? 15.578  -0.313  4.585   1.00 0.00 ? 51  GLU A HG2  5  
ATOM 8578  H HG3  . GLU A 1 51  ? 16.686  0.154   3.297   1.00 0.00 ? 51  GLU A HG3  5  
ATOM 8579  N N    . ASP A 1 52  ? 12.729  2.073   1.362   1.00 0.00 ? 52  ASP A N    5  
ATOM 8580  C CA   . ASP A 1 52  ? 11.447  2.673   1.009   1.00 0.00 ? 52  ASP A CA   5  
ATOM 8581  C C    . ASP A 1 52  ? 10.635  1.737   0.120   1.00 0.00 ? 52  ASP A C    5  
ATOM 8582  O O    . ASP A 1 52  ? 9.443   1.527   0.348   1.00 0.00 ? 52  ASP A O    5  
ATOM 8583  C CB   . ASP A 1 52  ? 11.664  4.010   0.299   1.00 0.00 ? 52  ASP A CB   5  
ATOM 8584  C CG   . ASP A 1 52  ? 10.398  4.840   0.228   1.00 0.00 ? 52  ASP A CG   5  
ATOM 8585  O OD1  . ASP A 1 52  ? 10.014  5.427   1.262   1.00 0.00 ? 52  ASP A OD1  5  
ATOM 8586  O OD2  . ASP A 1 52  ? 9.791   4.905   -0.861  1.00 0.00 ? 52  ASP A OD2  5  
ATOM 8587  H H    . ASP A 1 52  ? 13.552  2.588   1.225   1.00 0.00 ? 52  ASP A H    5  
ATOM 8588  H HA   . ASP A 1 52  ? 10.900  2.847   1.923   1.00 0.00 ? 52  ASP A HA   5  
ATOM 8589  H HB2  . ASP A 1 52  ? 12.414  4.576   0.831   1.00 0.00 ? 52  ASP A HB2  5  
ATOM 8590  H HB3  . ASP A 1 52  ? 12.008  3.823   -0.708  1.00 0.00 ? 52  ASP A HB3  5  
ATOM 8591  N N    . ALA A 1 53  ? 11.287  1.177   -0.893  1.00 0.00 ? 53  ALA A N    5  
ATOM 8592  C CA   . ALA A 1 53  ? 10.625  0.262   -1.815  1.00 0.00 ? 53  ALA A CA   5  
ATOM 8593  C C    . ALA A 1 53  ? 10.798  -1.186  -1.370  1.00 0.00 ? 53  ALA A C    5  
ATOM 8594  O O    . ALA A 1 53  ? 10.602  -2.114  -2.155  1.00 0.00 ? 53  ALA A O    5  
ATOM 8595  C CB   . ALA A 1 53  ? 11.166  0.451   -3.225  1.00 0.00 ? 53  ALA A CB   5  
ATOM 8596  H H    . ALA A 1 53  ? 12.236  1.383   -1.023  1.00 0.00 ? 53  ALA A H    5  
ATOM 8597  H HA   . ALA A 1 53  ? 9.572   0.502   -1.825  1.00 0.00 ? 53  ALA A HA   5  
ATOM 8598  H HB1  . ALA A 1 53  ? 10.642  -0.208  -3.902  1.00 0.00 ? 53  ALA A HB1  5  
ATOM 8599  H HB2  . ALA A 1 53  ? 11.019  1.475   -3.533  1.00 0.00 ? 53  ALA A HB2  5  
ATOM 8600  H HB3  . ALA A 1 53  ? 12.221  0.218   -3.240  1.00 0.00 ? 53  ALA A HB3  5  
ATOM 8601  N N    . ALA A 1 54  ? 11.166  -1.372  -0.107  1.00 0.00 ? 54  ALA A N    5  
ATOM 8602  C CA   . ALA A 1 54  ? 11.363  -2.708  0.443   1.00 0.00 ? 54  ALA A CA   5  
ATOM 8603  C C    . ALA A 1 54  ? 10.057  -3.496  0.452   1.00 0.00 ? 54  ALA A C    5  
ATOM 8604  O O    . ALA A 1 54  ? 10.029  -4.674  0.093   1.00 0.00 ? 54  ALA A O    5  
ATOM 8605  C CB   . ALA A 1 54  ? 11.939  -2.621  1.848   1.00 0.00 ? 54  ALA A CB   5  
ATOM 8606  H H    . ALA A 1 54  ? 11.306  -0.593  0.470   1.00 0.00 ? 54  ALA A H    5  
ATOM 8607  H HA   . ALA A 1 54  ? 12.078  -3.223  -0.182  1.00 0.00 ? 54  ALA A HA   5  
ATOM 8608  H HB1  . ALA A 1 54  ? 12.836  -2.018  1.832   1.00 0.00 ? 54  ALA A HB1  5  
ATOM 8609  H HB2  . ALA A 1 54  ? 11.213  -2.168  2.507   1.00 0.00 ? 54  ALA A HB2  5  
ATOM 8610  H HB3  . ALA A 1 54  ? 12.178  -3.613  2.201   1.00 0.00 ? 54  ALA A HB3  5  
ATOM 8611  N N    . LEU A 1 55  ? 8.979   -2.840  0.865   1.00 0.00 ? 55  LEU A N    5  
ATOM 8612  C CA   . LEU A 1 55  ? 7.669   -3.479  0.921   1.00 0.00 ? 55  LEU A CA   5  
ATOM 8613  C C    . LEU A 1 55  ? 7.219   -3.923  -0.467  1.00 0.00 ? 55  LEU A C    5  
ATOM 8614  O O    . LEU A 1 55  ? 6.857   -5.082  -0.673  1.00 0.00 ? 55  LEU A O    5  
ATOM 8615  C CB   . LEU A 1 55  ? 6.638   -2.523  1.523   1.00 0.00 ? 55  LEU A CB   5  
ATOM 8616  C CG   . LEU A 1 55  ? 5.186   -3.002  1.503   1.00 0.00 ? 55  LEU A CG   5  
ATOM 8617  C CD1  . LEU A 1 55  ? 5.014   -4.221  2.397   1.00 0.00 ? 55  LEU A CD1  5  
ATOM 8618  C CD2  . LEU A 1 55  ? 4.249   -1.884  1.937   1.00 0.00 ? 55  LEU A CD2  5  
ATOM 8619  H H    . LEU A 1 55  ? 9.064   -1.903  1.138   1.00 0.00 ? 55  LEU A H    5  
ATOM 8620  H HA   . LEU A 1 55  ? 7.753   -4.350  1.555   1.00 0.00 ? 55  LEU A HA   5  
ATOM 8621  H HB2  . LEU A 1 55  ? 6.913   -2.344  2.550   1.00 0.00 ? 55  LEU A HB2  5  
ATOM 8622  H HB3  . LEU A 1 55  ? 6.688   -1.595  0.971   1.00 0.00 ? 55  LEU A HB3  5  
ATOM 8623  H HG   . LEU A 1 55  ? 4.921   -3.289  0.495   1.00 0.00 ? 55  LEU A HG   5  
ATOM 8624  H HD11 . LEU A 1 55  ? 4.629   -5.043  1.814   1.00 0.00 ? 55  LEU A HD11 5  
ATOM 8625  H HD12 . LEU A 1 55  ? 4.322   -3.988  3.193   1.00 0.00 ? 55  LEU A HD12 5  
ATOM 8626  H HD13 . LEU A 1 55  ? 5.970   -4.494  2.820   1.00 0.00 ? 55  LEU A HD13 5  
ATOM 8627  H HD21 . LEU A 1 55  ? 4.667   -0.932  1.646   1.00 0.00 ? 55  LEU A HD21 5  
ATOM 8628  H HD22 . LEU A 1 55  ? 4.128   -1.911  3.010   1.00 0.00 ? 55  LEU A HD22 5  
ATOM 8629  H HD23 . LEU A 1 55  ? 3.288   -2.016  1.462   1.00 0.00 ? 55  LEU A HD23 5  
ATOM 8630  N N    . PHE A 1 56  ? 7.247   -2.995  -1.417  1.00 0.00 ? 56  PHE A N    5  
ATOM 8631  C CA   . PHE A 1 56  ? 6.843   -3.290  -2.787  1.00 0.00 ? 56  PHE A CA   5  
ATOM 8632  C C    . PHE A 1 56  ? 7.767   -4.330  -3.414  1.00 0.00 ? 56  PHE A C    5  
ATOM 8633  O O    . PHE A 1 56  ? 7.313   -5.261  -4.079  1.00 0.00 ? 56  PHE A O    5  
ATOM 8634  C CB   . PHE A 1 56  ? 6.848   -2.013  -3.629  1.00 0.00 ? 56  PHE A CB   5  
ATOM 8635  C CG   . PHE A 1 56  ? 6.061   -0.889  -3.018  1.00 0.00 ? 56  PHE A CG   5  
ATOM 8636  C CD1  . PHE A 1 56  ? 6.627   -0.077  -2.049  1.00 0.00 ? 56  PHE A CD1  5  
ATOM 8637  C CD2  . PHE A 1 56  ? 4.755   -0.645  -3.413  1.00 0.00 ? 56  PHE A CD2  5  
ATOM 8638  C CE1  . PHE A 1 56  ? 5.906   0.959   -1.485  1.00 0.00 ? 56  PHE A CE1  5  
ATOM 8639  C CE2  . PHE A 1 56  ? 4.030   0.389   -2.852  1.00 0.00 ? 56  PHE A CE2  5  
ATOM 8640  C CZ   . PHE A 1 56  ? 4.605   1.191   -1.886  1.00 0.00 ? 56  PHE A CZ   5  
ATOM 8641  H H    . PHE A 1 56  ? 7.545   -2.089  -1.191  1.00 0.00 ? 56  PHE A H    5  
ATOM 8642  H HA   . PHE A 1 56  ? 5.840   -3.688  -2.757  1.00 0.00 ? 56  PHE A HA   5  
ATOM 8643  H HB2  . PHE A 1 56  ? 7.866   -1.676  -3.753  1.00 0.00 ? 56  PHE A HB2  5  
ATOM 8644  H HB3  . PHE A 1 56  ? 6.423   -2.228  -4.598  1.00 0.00 ? 56  PHE A HB3  5  
ATOM 8645  H HD1  . PHE A 1 56  ? 7.645   -0.258  -1.733  1.00 0.00 ? 56  PHE A HD1  5  
ATOM 8646  H HD2  . PHE A 1 56  ? 4.303   -1.272  -4.167  1.00 0.00 ? 56  PHE A HD2  5  
ATOM 8647  H HE1  . PHE A 1 56  ? 6.359   1.584   -0.729  1.00 0.00 ? 56  PHE A HE1  5  
ATOM 8648  H HE2  . PHE A 1 56  ? 3.013   0.569   -3.168  1.00 0.00 ? 56  PHE A HE2  5  
ATOM 8649  H HZ   . PHE A 1 56  ? 4.040   2.000   -1.447  1.00 0.00 ? 56  PHE A HZ   5  
ATOM 8650  N N    . LYS A 1 57  ? 9.068   -4.164  -3.198  1.00 0.00 ? 57  LYS A N    5  
ATOM 8651  C CA   . LYS A 1 57  ? 10.058  -5.087  -3.740  1.00 0.00 ? 57  LYS A CA   5  
ATOM 8652  C C    . LYS A 1 57  ? 9.691   -6.531  -3.414  1.00 0.00 ? 57  LYS A C    5  
ATOM 8653  O O    . LYS A 1 57  ? 9.703   -7.397  -4.288  1.00 0.00 ? 57  LYS A O    5  
ATOM 8654  C CB   . LYS A 1 57  ? 11.446  -4.763  -3.182  1.00 0.00 ? 57  LYS A CB   5  
ATOM 8655  C CG   . LYS A 1 57  ? 12.568  -5.525  -3.864  1.00 0.00 ? 57  LYS A CG   5  
ATOM 8656  C CD   . LYS A 1 57  ? 13.129  -4.752  -5.046  1.00 0.00 ? 57  LYS A CD   5  
ATOM 8657  C CE   . LYS A 1 57  ? 14.456  -5.332  -5.512  1.00 0.00 ? 57  LYS A CE   5  
ATOM 8658  N NZ   . LYS A 1 57  ? 15.339  -4.289  -6.105  1.00 0.00 ? 57  LYS A NZ   5  
ATOM 8659  H H    . LYS A 1 57  ? 9.369   -3.402  -2.659  1.00 0.00 ? 57  LYS A H    5  
ATOM 8660  H HA   . LYS A 1 57  ? 10.073  -4.965  -4.812  1.00 0.00 ? 57  LYS A HA   5  
ATOM 8661  H HB2  . LYS A 1 57  ? 11.631  -3.706  -3.302  1.00 0.00 ? 57  LYS A HB2  5  
ATOM 8662  H HB3  . LYS A 1 57  ? 11.463  -5.006  -2.129  1.00 0.00 ? 57  LYS A HB3  5  
ATOM 8663  H HG2  . LYS A 1 57  ? 13.361  -5.696  -3.151  1.00 0.00 ? 57  LYS A HG2  5  
ATOM 8664  H HG3  . LYS A 1 57  ? 12.186  -6.473  -4.215  1.00 0.00 ? 57  LYS A HG3  5  
ATOM 8665  H HD2  . LYS A 1 57  ? 12.424  -4.796  -5.862  1.00 0.00 ? 57  LYS A HD2  5  
ATOM 8666  H HD3  . LYS A 1 57  ? 13.279  -3.722  -4.753  1.00 0.00 ? 57  LYS A HD3  5  
ATOM 8667  H HE2  . LYS A 1 57  ? 14.957  -5.777  -4.666  1.00 0.00 ? 57  LYS A HE2  5  
ATOM 8668  H HE3  . LYS A 1 57  ? 14.261  -6.091  -6.255  1.00 0.00 ? 57  LYS A HE3  5  
ATOM 8669  H HZ1  . LYS A 1 57  ? 14.851  -3.371  -6.114  1.00 0.00 ? 57  LYS A HZ1  5  
ATOM 8670  H HZ2  . LYS A 1 57  ? 15.589  -4.545  -7.081  1.00 0.00 ? 57  LYS A HZ2  5  
ATOM 8671  H HZ3  . LYS A 1 57  ? 16.212  -4.200  -5.546  1.00 0.00 ? 57  LYS A HZ3  5  
ATOM 8672  N N    . ALA A 1 58  ? 9.365   -6.783  -2.150  1.00 0.00 ? 58  ALA A N    5  
ATOM 8673  C CA   . ALA A 1 58  ? 8.992   -8.122  -1.710  1.00 0.00 ? 58  ALA A CA   5  
ATOM 8674  C C    . ALA A 1 58  ? 7.676   -8.561  -2.344  1.00 0.00 ? 58  ALA A C    5  
ATOM 8675  O O    . ALA A 1 58  ? 7.523   -9.715  -2.743  1.00 0.00 ? 58  ALA A O    5  
ATOM 8676  C CB   . ALA A 1 58  ? 8.891   -8.170  -0.193  1.00 0.00 ? 58  ALA A CB   5  
ATOM 8677  H H    . ALA A 1 58  ? 9.374   -6.052  -1.499  1.00 0.00 ? 58  ALA A H    5  
ATOM 8678  H HA   . ALA A 1 58  ? 9.772   -8.804  -2.017  1.00 0.00 ? 58  ALA A HA   5  
ATOM 8679  H HB1  . ALA A 1 58  ? 9.874   -8.035  0.236   1.00 0.00 ? 58  ALA A HB1  5  
ATOM 8680  H HB2  . ALA A 1 58  ? 8.237   -7.382  0.150   1.00 0.00 ? 58  ALA A HB2  5  
ATOM 8681  H HB3  . ALA A 1 58  ? 8.494   -9.127  0.111   1.00 0.00 ? 58  ALA A HB3  5  
ATOM 8682  N N    . TRP A 1 59  ? 6.729   -7.634  -2.432  1.00 0.00 ? 59  TRP A N    5  
ATOM 8683  C CA   . TRP A 1 59  ? 5.425   -7.926  -3.016  1.00 0.00 ? 59  TRP A CA   5  
ATOM 8684  C C    . TRP A 1 59  ? 5.576   -8.619  -4.366  1.00 0.00 ? 59  TRP A C    5  
ATOM 8685  O O    . TRP A 1 59  ? 5.099   -9.737  -4.556  1.00 0.00 ? 59  TRP A O    5  
ATOM 8686  C CB   . TRP A 1 59  ? 4.616   -6.638  -3.178  1.00 0.00 ? 59  TRP A CB   5  
ATOM 8687  C CG   . TRP A 1 59  ? 3.488   -6.765  -4.157  1.00 0.00 ? 59  TRP A CG   5  
ATOM 8688  C CD1  . TRP A 1 59  ? 3.440   -6.255  -5.423  1.00 0.00 ? 59  TRP A CD1  5  
ATOM 8689  C CD2  . TRP A 1 59  ? 2.245   -7.444  -3.949  1.00 0.00 ? 59  TRP A CD2  5  
ATOM 8690  N NE1  . TRP A 1 59  ? 2.242   -6.576  -6.014  1.00 0.00 ? 59  TRP A NE1  5  
ATOM 8691  C CE2  . TRP A 1 59  ? 1.491   -7.306  -5.131  1.00 0.00 ? 59  TRP A CE2  5  
ATOM 8692  C CE3  . TRP A 1 59  ? 1.696   -8.157  -2.880  1.00 0.00 ? 59  TRP A CE3  5  
ATOM 8693  C CZ2  . TRP A 1 59  ? 0.219   -7.854  -5.271  1.00 0.00 ? 59  TRP A CZ2  5  
ATOM 8694  C CZ3  . TRP A 1 59  ? 0.432   -8.700  -3.020  1.00 0.00 ? 59  TRP A CZ3  5  
ATOM 8695  C CH2  . TRP A 1 59  ? -0.294  -8.547  -4.208  1.00 0.00 ? 59  TRP A CH2  5  
ATOM 8696  H H    . TRP A 1 59  ? 6.911   -6.731  -2.096  1.00 0.00 ? 59  TRP A H    5  
ATOM 8697  H HA   . TRP A 1 59  ? 4.901   -8.587  -2.341  1.00 0.00 ? 59  TRP A HA   5  
ATOM 8698  H HB2  . TRP A 1 59  ? 4.198   -6.360  -2.222  1.00 0.00 ? 59  TRP A HB2  5  
ATOM 8699  H HB3  . TRP A 1 59  ? 5.271   -5.851  -3.523  1.00 0.00 ? 59  TRP A HB3  5  
ATOM 8700  H HD1  . TRP A 1 59  ? 4.234   -5.683  -5.878  1.00 0.00 ? 59  TRP A HD1  5  
ATOM 8701  H HE1  . TRP A 1 59  ? 1.970   -6.324  -6.922  1.00 0.00 ? 59  TRP A HE1  5  
ATOM 8702  H HE3  . TRP A 1 59  ? 2.240   -8.286  -1.956  1.00 0.00 ? 59  TRP A HE3  5  
ATOM 8703  H HZ2  . TRP A 1 59  ? -0.354  -7.745  -6.180  1.00 0.00 ? 59  TRP A HZ2  5  
ATOM 8704  H HZ3  . TRP A 1 59  ? -0.008  -9.254  -2.204  1.00 0.00 ? 59  TRP A HZ3  5  
ATOM 8705  H HH2  . TRP A 1 59  ? -1.277  -8.987  -4.273  1.00 0.00 ? 59  TRP A HH2  5  
ATOM 8706  N N    . ALA A 1 60  ? 6.244   -7.949  -5.299  1.00 0.00 ? 60  ALA A N    5  
ATOM 8707  C CA   . ALA A 1 60  ? 6.460   -8.502  -6.630  1.00 0.00 ? 60  ALA A CA   5  
ATOM 8708  C C    . ALA A 1 60  ? 7.080   -9.893  -6.552  1.00 0.00 ? 60  ALA A C    5  
ATOM 8709  O O    . ALA A 1 60  ? 6.451   -10.886 -6.919  1.00 0.00 ? 60  ALA A O    5  
ATOM 8710  C CB   . ALA A 1 60  ? 7.342   -7.573  -7.451  1.00 0.00 ? 60  ALA A CB   5  
ATOM 8711  H H    . ALA A 1 60  ? 6.601   -7.061  -5.087  1.00 0.00 ? 60  ALA A H    5  
ATOM 8712  H HA   . ALA A 1 60  ? 5.500   -8.574  -7.121  1.00 0.00 ? 60  ALA A HA   5  
ATOM 8713  H HB1  . ALA A 1 60  ? 8.186   -7.260  -6.855  1.00 0.00 ? 60  ALA A HB1  5  
ATOM 8714  H HB2  . ALA A 1 60  ? 7.694   -8.095  -8.329  1.00 0.00 ? 60  ALA A HB2  5  
ATOM 8715  H HB3  . ALA A 1 60  ? 6.771   -6.707  -7.751  1.00 0.00 ? 60  ALA A HB3  5  
ATOM 8716  N N    . LEU A 1 61  ? 8.318   -9.957  -6.073  1.00 0.00 ? 61  LEU A N    5  
ATOM 8717  C CA   . LEU A 1 61  ? 9.025   -11.227 -5.948  1.00 0.00 ? 61  LEU A CA   5  
ATOM 8718  C C    . LEU A 1 61  ? 8.125   -12.292 -5.330  1.00 0.00 ? 61  LEU A C    5  
ATOM 8719  O O    . LEU A 1 61  ? 8.130   -13.448 -5.756  1.00 0.00 ? 61  LEU A O    5  
ATOM 8720  C CB   . LEU A 1 61  ? 10.284  -11.051 -5.097  1.00 0.00 ? 61  LEU A CB   5  
ATOM 8721  C CG   . LEU A 1 61  ? 11.368  -10.145 -5.682  1.00 0.00 ? 61  LEU A CG   5  
ATOM 8722  C CD1  . LEU A 1 61  ? 12.186  -9.505  -4.572  1.00 0.00 ? 61  LEU A CD1  5  
ATOM 8723  C CD2  . LEU A 1 61  ? 12.268  -10.932 -6.624  1.00 0.00 ? 61  LEU A CD2  5  
ATOM 8724  H H    . LEU A 1 61  ? 8.768   -9.132  -5.797  1.00 0.00 ? 61  LEU A H    5  
ATOM 8725  H HA   . LEU A 1 61  ? 9.312   -11.546 -6.939  1.00 0.00 ? 61  LEU A HA   5  
ATOM 8726  H HB2  . LEU A 1 61  ? 9.985   -10.636 -4.146  1.00 0.00 ? 61  LEU A HB2  5  
ATOM 8727  H HB3  . LEU A 1 61  ? 10.716  -12.029 -4.941  1.00 0.00 ? 61  LEU A HB3  5  
ATOM 8728  H HG   . LEU A 1 61  ? 10.899  -9.353  -6.250  1.00 0.00 ? 61  LEU A HG   5  
ATOM 8729  H HD11 . LEU A 1 61  ? 11.930  -8.459  -4.494  1.00 0.00 ? 61  LEU A HD11 5  
ATOM 8730  H HD12 . LEU A 1 61  ? 13.237  -9.603  -4.796  1.00 0.00 ? 61  LEU A HD12 5  
ATOM 8731  H HD13 . LEU A 1 61  ? 11.970  -9.999  -3.635  1.00 0.00 ? 61  LEU A HD13 5  
ATOM 8732  H HD21 . LEU A 1 61  ? 13.077  -10.299 -6.960  1.00 0.00 ? 61  LEU A HD21 5  
ATOM 8733  H HD22 . LEU A 1 61  ? 11.694  -11.265 -7.477  1.00 0.00 ? 61  LEU A HD22 5  
ATOM 8734  H HD23 . LEU A 1 61  ? 12.672  -11.788 -6.105  1.00 0.00 ? 61  LEU A HD23 5  
ATOM 8735  N N    . PHE A 1 62  ? 7.351   -11.896 -4.325  1.00 0.00 ? 62  PHE A N    5  
ATOM 8736  C CA   . PHE A 1 62  ? 6.444   -12.816 -3.649  1.00 0.00 ? 62  PHE A CA   5  
ATOM 8737  C C    . PHE A 1 62  ? 5.363   -13.314 -4.604  1.00 0.00 ? 62  PHE A C    5  
ATOM 8738  O O    . PHE A 1 62  ? 5.300   -14.500 -4.926  1.00 0.00 ? 62  PHE A O    5  
ATOM 8739  C CB   . PHE A 1 62  ? 5.799   -12.135 -2.440  1.00 0.00 ? 62  PHE A CB   5  
ATOM 8740  C CG   . PHE A 1 62  ? 4.518   -12.783 -2.000  1.00 0.00 ? 62  PHE A CG   5  
ATOM 8741  C CD1  . PHE A 1 62  ? 4.533   -14.008 -1.351  1.00 0.00 ? 62  PHE A CD1  5  
ATOM 8742  C CD2  . PHE A 1 62  ? 3.299   -12.168 -2.235  1.00 0.00 ? 62  PHE A CD2  5  
ATOM 8743  C CE1  . PHE A 1 62  ? 3.355   -14.607 -0.944  1.00 0.00 ? 62  PHE A CE1  5  
ATOM 8744  C CE2  . PHE A 1 62  ? 2.118   -12.762 -1.829  1.00 0.00 ? 62  PHE A CE2  5  
ATOM 8745  C CZ   . PHE A 1 62  ? 2.147   -13.983 -1.185  1.00 0.00 ? 62  PHE A CZ   5  
ATOM 8746  H H    . PHE A 1 62  ? 7.392   -10.962 -4.030  1.00 0.00 ? 62  PHE A H    5  
ATOM 8747  H HA   . PHE A 1 62  ? 7.023   -13.661 -3.309  1.00 0.00 ? 62  PHE A HA   5  
ATOM 8748  H HB2  . PHE A 1 62  ? 6.488   -12.164 -1.610  1.00 0.00 ? 62  PHE A HB2  5  
ATOM 8749  H HB3  . PHE A 1 62  ? 5.584   -11.107 -2.689  1.00 0.00 ? 62  PHE A HB3  5  
ATOM 8750  H HD1  . PHE A 1 62  ? 5.479   -14.496 -1.163  1.00 0.00 ? 62  PHE A HD1  5  
ATOM 8751  H HD2  . PHE A 1 62  ? 3.275   -11.214 -2.740  1.00 0.00 ? 62  PHE A HD2  5  
ATOM 8752  H HE1  . PHE A 1 62  ? 3.382   -15.561 -0.440  1.00 0.00 ? 62  PHE A HE1  5  
ATOM 8753  H HE2  . PHE A 1 62  ? 1.175   -12.273 -2.019  1.00 0.00 ? 62  PHE A HE2  5  
ATOM 8754  H HZ   . PHE A 1 62  ? 1.226   -14.449 -0.867  1.00 0.00 ? 62  PHE A HZ   5  
ATOM 8755  N N    . LYS A 1 63  ? 4.512   -12.397 -5.053  1.00 0.00 ? 63  LYS A N    5  
ATOM 8756  C CA   . LYS A 1 63  ? 3.433   -12.740 -5.972  1.00 0.00 ? 63  LYS A CA   5  
ATOM 8757  C C    . LYS A 1 63  ? 3.960   -13.548 -7.153  1.00 0.00 ? 63  LYS A C    5  
ATOM 8758  O O    . LYS A 1 63  ? 3.591   -14.707 -7.338  1.00 0.00 ? 63  LYS A O    5  
ATOM 8759  C CB   . LYS A 1 63  ? 2.742   -11.471 -6.476  1.00 0.00 ? 63  LYS A CB   5  
ATOM 8760  C CG   . LYS A 1 63  ? 2.095   -10.651 -5.373  1.00 0.00 ? 63  LYS A CG   5  
ATOM 8761  C CD   . LYS A 1 63  ? 0.904   -11.374 -4.767  1.00 0.00 ? 63  LYS A CD   5  
ATOM 8762  C CE   . LYS A 1 63  ? -0.297  -11.351 -5.701  1.00 0.00 ? 63  LYS A CE   5  
ATOM 8763  N NZ   . LYS A 1 63  ? -1.501  -11.961 -5.073  1.00 0.00 ? 63  LYS A NZ   5  
ATOM 8764  H H    . LYS A 1 63  ? 4.614   -11.467 -4.761  1.00 0.00 ? 63  LYS A H    5  
ATOM 8765  H HA   . LYS A 1 63  ? 2.716   -13.340 -5.432  1.00 0.00 ? 63  LYS A HA   5  
ATOM 8766  H HB2  . LYS A 1 63  ? 3.473   -10.851 -6.974  1.00 0.00 ? 63  LYS A HB2  5  
ATOM 8767  H HB3  . LYS A 1 63  ? 1.976   -11.749 -7.185  1.00 0.00 ? 63  LYS A HB3  5  
ATOM 8768  H HG2  . LYS A 1 63  ? 2.824   -10.469 -4.597  1.00 0.00 ? 63  LYS A HG2  5  
ATOM 8769  H HG3  . LYS A 1 63  ? 1.761   -9.709  -5.785  1.00 0.00 ? 63  LYS A HG3  5  
ATOM 8770  H HD2  . LYS A 1 63  ? 1.176   -12.402 -4.576  1.00 0.00 ? 63  LYS A HD2  5  
ATOM 8771  H HD3  . LYS A 1 63  ? 0.635   -10.892 -3.838  1.00 0.00 ? 63  LYS A HD3  5  
ATOM 8772  H HE2  . LYS A 1 63  ? -0.516  -10.326 -5.958  1.00 0.00 ? 63  LYS A HE2  5  
ATOM 8773  H HE3  . LYS A 1 63  ? -0.050  -11.901 -6.597  1.00 0.00 ? 63  LYS A HE3  5  
ATOM 8774  H HZ1  . LYS A 1 63  ? -1.248  -12.862 -4.618  1.00 0.00 ? 63  LYS A HZ1  5  
ATOM 8775  H HZ2  . LYS A 1 63  ? -2.227  -12.142 -5.794  1.00 0.00 ? 63  LYS A HZ2  5  
ATOM 8776  H HZ3  . LYS A 1 63  ? -1.893  -11.320 -4.354  1.00 0.00 ? 63  LYS A HZ3  5  
ATOM 8777  N N    . GLY A 1 64  ? 4.825   -12.928 -7.950  1.00 0.00 ? 64  GLY A N    5  
ATOM 8778  C CA   . GLY A 1 64  ? 5.389   -13.606 -9.103  1.00 0.00 ? 64  GLY A CA   5  
ATOM 8779  C C    . GLY A 1 64  ? 6.827   -14.030 -8.879  1.00 0.00 ? 64  GLY A C    5  
ATOM 8780  O O    . GLY A 1 64  ? 7.213   -14.381 -7.764  1.00 0.00 ? 64  GLY A O    5  
ATOM 8781  H H    . GLY A 1 64  ? 5.082   -12.003 -7.753  1.00 0.00 ? 64  GLY A H    5  
ATOM 8782  H HA2  . GLY A 1 64  ? 4.795   -14.481 -9.318  1.00 0.00 ? 64  GLY A HA2  5  
ATOM 8783  H HA3  . GLY A 1 64  ? 5.351   -12.939 -9.952  1.00 0.00 ? 64  GLY A HA3  5  
ATOM 8784  N N    . LYS A 1 65  ? 7.623   -14.001 -9.943  1.00 0.00 ? 65  LYS A N    5  
ATOM 8785  C CA   . LYS A 1 65  ? 9.027   -14.386 -9.859  1.00 0.00 ? 65  LYS A CA   5  
ATOM 8786  C C    . LYS A 1 65  ? 9.900   -13.443 -10.681 1.00 0.00 ? 65  LYS A C    5  
ATOM 8787  O O    . LYS A 1 65  ? 9.859   -13.458 -11.912 1.00 0.00 ? 65  LYS A O    5  
ATOM 8788  C CB   . LYS A 1 65  ? 9.212   -15.825 -10.347 1.00 0.00 ? 65  LYS A CB   5  
ATOM 8789  C CG   . LYS A 1 65  ? 8.950   -16.869 -9.275  1.00 0.00 ? 65  LYS A CG   5  
ATOM 8790  C CD   . LYS A 1 65  ? 7.472   -17.208 -9.177  1.00 0.00 ? 65  LYS A CD   5  
ATOM 8791  C CE   . LYS A 1 65  ? 7.104   -17.697 -7.784  1.00 0.00 ? 65  LYS A CE   5  
ATOM 8792  N NZ   . LYS A 1 65  ? 5.672   -18.097 -7.697  1.00 0.00 ? 65  LYS A NZ   5  
ATOM 8793  H H    . LYS A 1 65  ? 7.257   -13.713 -10.806 1.00 0.00 ? 65  LYS A H    5  
ATOM 8794  H HA   . LYS A 1 65  ? 9.327   -14.325 -8.824  1.00 0.00 ? 65  LYS A HA   5  
ATOM 8795  H HB2  . LYS A 1 65  ? 8.534   -16.004 -11.168 1.00 0.00 ? 65  LYS A HB2  5  
ATOM 8796  H HB3  . LYS A 1 65  ? 10.228  -15.946 -10.696 1.00 0.00 ? 65  LYS A HB3  5  
ATOM 8797  H HG2  . LYS A 1 65  ? 9.499   -17.767 -9.518  1.00 0.00 ? 65  LYS A HG2  5  
ATOM 8798  H HG3  . LYS A 1 65  ? 9.287   -16.486 -8.322  1.00 0.00 ? 65  LYS A HG3  5  
ATOM 8799  H HD2  . LYS A 1 65  ? 6.893   -16.325 -9.400  1.00 0.00 ? 65  LYS A HD2  5  
ATOM 8800  H HD3  . LYS A 1 65  ? 7.241   -17.983 -9.894  1.00 0.00 ? 65  LYS A HD3  5  
ATOM 8801  H HE2  . LYS A 1 65  ? 7.722   -18.548 -7.541  1.00 0.00 ? 65  LYS A HE2  5  
ATOM 8802  H HE3  . LYS A 1 65  ? 7.291   -16.903 -7.077  1.00 0.00 ? 65  LYS A HE3  5  
ATOM 8803  H HZ1  . LYS A 1 65  ? 5.080   -17.415 -8.213  1.00 0.00 ? 65  LYS A HZ1  5  
ATOM 8804  H HZ2  . LYS A 1 65  ? 5.368   -18.120 -6.703  1.00 0.00 ? 65  LYS A HZ2  5  
ATOM 8805  H HZ3  . LYS A 1 65  ? 5.538   -19.041 -8.112  1.00 0.00 ? 65  LYS A HZ3  5  
ATOM 8806  N N    . PHE A 1 66  ? 10.689  -12.625 -9.994  1.00 0.00 ? 66  PHE A N    5  
ATOM 8807  C CA   . PHE A 1 66  ? 11.573  -11.676 -10.660 1.00 0.00 ? 66  PHE A CA   5  
ATOM 8808  C C    . PHE A 1 66  ? 12.962  -11.691 -10.031 1.00 0.00 ? 66  PHE A C    5  
ATOM 8809  O O    . PHE A 1 66  ? 13.138  -12.145 -8.900  1.00 0.00 ? 66  PHE A O    5  
ATOM 8810  C CB   . PHE A 1 66  ? 10.985  -10.265 -10.591 1.00 0.00 ? 66  PHE A CB   5  
ATOM 8811  C CG   . PHE A 1 66  ? 12.018  -9.179  -10.686 1.00 0.00 ? 66  PHE A CG   5  
ATOM 8812  C CD1  . PHE A 1 66  ? 12.773  -8.824  -9.579  1.00 0.00 ? 66  PHE A CD1  5  
ATOM 8813  C CD2  . PHE A 1 66  ? 12.236  -8.513  -11.881 1.00 0.00 ? 66  PHE A CD2  5  
ATOM 8814  C CE1  . PHE A 1 66  ? 13.725  -7.826  -9.662  1.00 0.00 ? 66  PHE A CE1  5  
ATOM 8815  C CE2  . PHE A 1 66  ? 13.187  -7.515  -11.971 1.00 0.00 ? 66  PHE A CE2  5  
ATOM 8816  C CZ   . PHE A 1 66  ? 13.932  -7.170  -10.860 1.00 0.00 ? 66  PHE A CZ   5  
ATOM 8817  H H    . PHE A 1 66  ? 10.677  -12.661 -9.014  1.00 0.00 ? 66  PHE A H    5  
ATOM 8818  H HA   . PHE A 1 66  ? 11.656  -11.972 -11.695 1.00 0.00 ? 66  PHE A HA   5  
ATOM 8819  H HB2  . PHE A 1 66  ? 10.290  -10.132 -11.407 1.00 0.00 ? 66  PHE A HB2  5  
ATOM 8820  H HB3  . PHE A 1 66  ? 10.461  -10.146 -9.655  1.00 0.00 ? 66  PHE A HB3  5  
ATOM 8821  H HD1  . PHE A 1 66  ? 12.611  -9.337  -8.641  1.00 0.00 ? 66  PHE A HD1  5  
ATOM 8822  H HD2  . PHE A 1 66  ? 11.654  -8.781  -12.751 1.00 0.00 ? 66  PHE A HD2  5  
ATOM 8823  H HE1  . PHE A 1 66  ? 14.305  -7.559  -8.792  1.00 0.00 ? 66  PHE A HE1  5  
ATOM 8824  H HE2  . PHE A 1 66  ? 13.347  -7.003  -12.908 1.00 0.00 ? 66  PHE A HE2  5  
ATOM 8825  H HZ   . PHE A 1 66  ? 14.676  -6.390  -10.927 1.00 0.00 ? 66  PHE A HZ   5  
ATOM 8826  N N    . ARG A 1 67  ? 13.947  -11.192 -10.772 1.00 0.00 ? 67  ARG A N    5  
ATOM 8827  C CA   . ARG A 1 67  ? 15.321  -11.150 -10.288 1.00 0.00 ? 67  ARG A CA   5  
ATOM 8828  C C    . ARG A 1 67  ? 15.894  -9.740  -10.399 1.00 0.00 ? 67  ARG A C    5  
ATOM 8829  O O    . ARG A 1 67  ? 15.861  -9.129  -11.467 1.00 0.00 ? 67  ARG A O    5  
ATOM 8830  C CB   . ARG A 1 67  ? 16.192  -12.129 -11.076 1.00 0.00 ? 67  ARG A CB   5  
ATOM 8831  C CG   . ARG A 1 67  ? 16.111  -13.560 -10.571 1.00 0.00 ? 67  ARG A CG   5  
ATOM 8832  C CD   . ARG A 1 67  ? 17.183  -13.846 -9.531  1.00 0.00 ? 67  ARG A CD   5  
ATOM 8833  N NE   . ARG A 1 67  ? 16.851  -13.268 -8.231  1.00 0.00 ? 67  ARG A NE   5  
ATOM 8834  C CZ   . ARG A 1 67  ? 16.003  -13.825 -7.374  1.00 0.00 ? 67  ARG A CZ   5  
ATOM 8835  N NH1  . ARG A 1 67  ? 15.404  -14.968 -7.678  1.00 0.00 ? 67  ARG A NH1  5  
ATOM 8836  N NH2  . ARG A 1 67  ? 15.753  -13.239 -6.210  1.00 0.00 ? 67  ARG A NH2  5  
ATOM 8837  H H    . ARG A 1 67  ? 13.744  -10.845 -11.665 1.00 0.00 ? 67  ARG A H    5  
ATOM 8838  H HA   . ARG A 1 67  ? 15.316  -11.443 -9.248  1.00 0.00 ? 67  ARG A HA   5  
ATOM 8839  H HB2  . ARG A 1 67  ? 15.881  -12.118 -12.111 1.00 0.00 ? 67  ARG A HB2  5  
ATOM 8840  H HB3  . ARG A 1 67  ? 17.221  -11.807 -11.015 1.00 0.00 ? 67  ARG A HB3  5  
ATOM 8841  H HG2  . ARG A 1 67  ? 15.140  -13.720 -10.125 1.00 0.00 ? 67  ARG A HG2  5  
ATOM 8842  H HG3  . ARG A 1 67  ? 16.241  -14.234 -11.404 1.00 0.00 ? 67  ARG A HG3  5  
ATOM 8843  H HD2  . ARG A 1 67  ? 17.285  -14.915 -9.423  1.00 0.00 ? 67  ARG A HD2  5  
ATOM 8844  H HD3  . ARG A 1 67  ? 18.117  -13.427 -9.873  1.00 0.00 ? 67  ARG A HD3  5  
ATOM 8845  H HE   . ARG A 1 67  ? 17.283  -12.424 -7.986  1.00 0.00 ? 67  ARG A HE   5  
ATOM 8846  H HH11 . ARG A 1 67  ? 15.591  -15.413 -8.553  1.00 0.00 ? 67  ARG A HH11 5  
ATOM 8847  H HH12 . ARG A 1 67  ? 14.766  -15.386 -7.030  1.00 0.00 ? 67  ARG A HH12 5  
ATOM 8848  H HH21 . ARG A 1 67  ? 16.203  -12.378 -5.977  1.00 0.00 ? 67  ARG A HH21 5  
ATOM 8849  H HH22 . ARG A 1 67  ? 15.114  -13.659 -5.566  1.00 0.00 ? 67  ARG A HH22 5  
ATOM 8850  N N    . GLU A 1 68  ? 16.417  -9.230  -9.288  1.00 0.00 ? 68  GLU A N    5  
ATOM 8851  C CA   . GLU A 1 68  ? 16.995  -7.891  -9.262  1.00 0.00 ? 68  GLU A CA   5  
ATOM 8852  C C    . GLU A 1 68  ? 18.412  -7.900  -9.827  1.00 0.00 ? 68  GLU A C    5  
ATOM 8853  O O    . GLU A 1 68  ? 18.820  -6.971  -10.524 1.00 0.00 ? 68  GLU A O    5  
ATOM 8854  C CB   . GLU A 1 68  ? 17.007  -7.345  -7.833  1.00 0.00 ? 68  GLU A CB   5  
ATOM 8855  C CG   . GLU A 1 68  ? 18.139  -7.893  -6.981  1.00 0.00 ? 68  GLU A CG   5  
ATOM 8856  C CD   . GLU A 1 68  ? 18.251  -7.194  -5.640  1.00 0.00 ? 68  GLU A CD   5  
ATOM 8857  O OE1  . GLU A 1 68  ? 18.219  -5.946  -5.616  1.00 0.00 ? 68  GLU A OE1  5  
ATOM 8858  O OE2  . GLU A 1 68  ? 18.371  -7.897  -4.614  1.00 0.00 ? 68  GLU A OE2  5  
ATOM 8859  H H    . GLU A 1 68  ? 16.413  -9.766  -8.468  1.00 0.00 ? 68  GLU A H    5  
ATOM 8860  H HA   . GLU A 1 68  ? 16.379  -7.252  -9.876  1.00 0.00 ? 68  GLU A HA   5  
ATOM 8861  H HB2  . GLU A 1 68  ? 17.101  -6.270  -7.872  1.00 0.00 ? 68  GLU A HB2  5  
ATOM 8862  H HB3  . GLU A 1 68  ? 16.071  -7.598  -7.356  1.00 0.00 ? 68  GLU A HB3  5  
ATOM 8863  H HG2  . GLU A 1 68  ? 17.965  -8.945  -6.808  1.00 0.00 ? 68  GLU A HG2  5  
ATOM 8864  H HG3  . GLU A 1 68  ? 19.069  -7.766  -7.515  1.00 0.00 ? 68  GLU A HG3  5  
ATOM 8865  N N    . GLY A 1 69  ? 19.159  -8.956  -9.519  1.00 0.00 ? 69  GLY A N    5  
ATOM 8866  C CA   . GLY A 1 69  ? 20.523  -9.065  -10.003 1.00 0.00 ? 69  GLY A CA   5  
ATOM 8867  C C    . GLY A 1 69  ? 20.589  -9.387  -11.483 1.00 0.00 ? 69  GLY A C    5  
ATOM 8868  O O    . GLY A 1 69  ? 21.464  -8.891  -12.194 1.00 0.00 ? 69  GLY A O    5  
ATOM 8869  H H    . GLY A 1 69  ? 18.782  -9.666  -8.959  1.00 0.00 ? 69  GLY A H    5  
ATOM 8870  H HA2  . GLY A 1 69  ? 21.033  -8.131  -9.825  1.00 0.00 ? 69  GLY A HA2  5  
ATOM 8871  H HA3  . GLY A 1 69  ? 21.026  -9.848  -9.454  1.00 0.00 ? 69  GLY A HA3  5  
ATOM 8872  N N    . ILE A 1 70  ? 19.664  -10.219 -11.948 1.00 0.00 ? 70  ILE A N    5  
ATOM 8873  C CA   . ILE A 1 70  ? 19.622  -10.605 -13.353 1.00 0.00 ? 70  ILE A CA   5  
ATOM 8874  C C    . ILE A 1 70  ? 18.825  -9.599  -14.176 1.00 0.00 ? 70  ILE A C    5  
ATOM 8875  O O    . ILE A 1 70  ? 19.307  -9.089  -15.188 1.00 0.00 ? 70  ILE A O    5  
ATOM 8876  C CB   . ILE A 1 70  ? 19.003  -12.004 -13.533 1.00 0.00 ? 70  ILE A CB   5  
ATOM 8877  C CG1  . ILE A 1 70  ? 19.791  -13.042 -12.731 1.00 0.00 ? 70  ILE A CG1  5  
ATOM 8878  C CG2  . ILE A 1 70  ? 18.967  -12.381 -15.007 1.00 0.00 ? 70  ILE A CG2  5  
ATOM 8879  C CD1  . ILE A 1 70  ? 19.058  -14.354 -12.556 1.00 0.00 ? 70  ILE A CD1  5  
ATOM 8880  H H    . ILE A 1 70  ? 18.993  -10.580 -11.332 1.00 0.00 ? 70  ILE A H    5  
ATOM 8881  H HA   . ILE A 1 70  ? 20.637  -10.633 -13.721 1.00 0.00 ? 70  ILE A HA   5  
ATOM 8882  H HB   . ILE A 1 70  ? 17.987  -11.974 -13.169 1.00 0.00 ? 70  ILE A HB   5  
ATOM 8883  H HG12 . ILE A 1 70  ? 20.721  -13.247 -13.236 1.00 0.00 ? 70  ILE A HG12 5  
ATOM 8884  H HG13 . ILE A 1 70  ? 19.999  -12.644 -11.749 1.00 0.00 ? 70  ILE A HG13 5  
ATOM 8885  H HG21 . ILE A 1 70  ? 19.865  -12.028 -15.491 1.00 0.00 ? 70  ILE A HG21 5  
ATOM 8886  H HG22 . ILE A 1 70  ? 18.907  -13.455 -15.102 1.00 0.00 ? 70  ILE A HG22 5  
ATOM 8887  H HG23 . ILE A 1 70  ? 18.104  -11.929 -15.473 1.00 0.00 ? 70  ILE A HG23 5  
ATOM 8888  H HD11 . ILE A 1 70  ? 18.041  -14.160 -12.250 1.00 0.00 ? 70  ILE A HD11 5  
ATOM 8889  H HD12 . ILE A 1 70  ? 19.057  -14.894 -13.491 1.00 0.00 ? 70  ILE A HD12 5  
ATOM 8890  H HD13 . ILE A 1 70  ? 19.555  -14.945 -11.800 1.00 0.00 ? 70  ILE A HD13 5  
ATOM 8891  N N    . ASP A 1 71  ? 17.604  -9.317  -13.736 1.00 0.00 ? 71  ASP A N    5  
ATOM 8892  C CA   . ASP A 1 71  ? 16.740  -8.369  -14.430 1.00 0.00 ? 71  ASP A CA   5  
ATOM 8893  C C    . ASP A 1 71  ? 16.934  -6.957  -13.885 1.00 0.00 ? 71  ASP A C    5  
ATOM 8894  O O    . ASP A 1 71  ? 17.676  -6.747  -12.925 1.00 0.00 ? 71  ASP A O    5  
ATOM 8895  C CB   . ASP A 1 71  ? 15.275  -8.786  -14.293 1.00 0.00 ? 71  ASP A CB   5  
ATOM 8896  C CG   . ASP A 1 71  ? 14.448  -8.402  -15.504 1.00 0.00 ? 71  ASP A CG   5  
ATOM 8897  O OD1  . ASP A 1 71  ? 14.864  -7.482  -16.239 1.00 0.00 ? 71  ASP A OD1  5  
ATOM 8898  O OD2  . ASP A 1 71  ? 13.386  -9.023  -15.717 1.00 0.00 ? 71  ASP A OD2  5  
ATOM 8899  H H    . ASP A 1 71  ? 17.276  -9.756  -12.923 1.00 0.00 ? 71  ASP A H    5  
ATOM 8900  H HA   . ASP A 1 71  ? 17.011  -8.378  -15.475 1.00 0.00 ? 71  ASP A HA   5  
ATOM 8901  H HB2  . ASP A 1 71  ? 15.223  -9.858  -14.169 1.00 0.00 ? 71  ASP A HB2  5  
ATOM 8902  H HB3  . ASP A 1 71  ? 14.851  -8.306  -13.423 1.00 0.00 ? 71  ASP A HB3  5  
ATOM 8903  N N    . LYS A 1 72  ? 16.262  -5.992  -14.503 1.00 0.00 ? 72  LYS A N    5  
ATOM 8904  C CA   . LYS A 1 72  ? 16.359  -4.600  -14.081 1.00 0.00 ? 72  LYS A CA   5  
ATOM 8905  C C    . LYS A 1 72  ? 15.200  -4.229  -13.161 1.00 0.00 ? 72  LYS A C    5  
ATOM 8906  O O    . LYS A 1 72  ? 14.029  -4.309  -13.535 1.00 0.00 ? 72  LYS A O    5  
ATOM 8907  C CB   . LYS A 1 72  ? 16.373  -3.676  -15.301 1.00 0.00 ? 72  LYS A CB   5  
ATOM 8908  C CG   . LYS A 1 72  ? 17.160  -2.395  -15.084 1.00 0.00 ? 72  LYS A CG   5  
ATOM 8909  C CD   . LYS A 1 72  ? 16.296  -1.307  -14.468 1.00 0.00 ? 72  LYS A CD   5  
ATOM 8910  C CE   . LYS A 1 72  ? 16.826  0.080   -14.799 1.00 0.00 ? 72  LYS A CE   5  
ATOM 8911  N NZ   . LYS A 1 72  ? 16.015  1.151   -14.158 1.00 0.00 ? 72  LYS A NZ   5  
ATOM 8912  H H    . LYS A 1 72  ? 15.686  -6.223  -15.263 1.00 0.00 ? 72  LYS A H    5  
ATOM 8913  H HA   . LYS A 1 72  ? 17.285  -4.481  -13.539 1.00 0.00 ? 72  LYS A HA   5  
ATOM 8914  H HB2  . LYS A 1 72  ? 16.810  -4.206  -16.134 1.00 0.00 ? 72  LYS A HB2  5  
ATOM 8915  H HB3  . LYS A 1 72  ? 15.355  -3.410  -15.548 1.00 0.00 ? 72  LYS A HB3  5  
ATOM 8916  H HG2  . LYS A 1 72  ? 17.988  -2.599  -14.422 1.00 0.00 ? 72  LYS A HG2  5  
ATOM 8917  H HG3  . LYS A 1 72  ? 17.535  -2.048  -16.037 1.00 0.00 ? 72  LYS A HG3  5  
ATOM 8918  H HD2  . LYS A 1 72  ? 15.291  -1.396  -14.853 1.00 0.00 ? 72  LYS A HD2  5  
ATOM 8919  H HD3  . LYS A 1 72  ? 16.285  -1.433  -13.395 1.00 0.00 ? 72  LYS A HD3  5  
ATOM 8920  H HE2  . LYS A 1 72  ? 17.845  0.154   -14.449 1.00 0.00 ? 72  LYS A HE2  5  
ATOM 8921  H HE3  . LYS A 1 72  ? 16.803  0.214   -15.870 1.00 0.00 ? 72  LYS A HE3  5  
ATOM 8922  H HZ1  . LYS A 1 72  ? 15.504  1.695   -14.883 1.00 0.00 ? 72  LYS A HZ1  5  
ATOM 8923  H HZ2  . LYS A 1 72  ? 16.633  1.798   -13.627 1.00 0.00 ? 72  LYS A HZ2  5  
ATOM 8924  H HZ3  . LYS A 1 72  ? 15.324  0.733   -13.502 1.00 0.00 ? 72  LYS A HZ3  5  
ATOM 8925  N N    . PRO A 1 73  ? 15.531  -3.810  -11.931 1.00 0.00 ? 73  PRO A N    5  
ATOM 8926  C CA   . PRO A 1 73  ? 14.531  -3.416  -10.933 1.00 0.00 ? 73  PRO A CA   5  
ATOM 8927  C C    . PRO A 1 73  ? 13.834  -2.109  -11.297 1.00 0.00 ? 73  PRO A C    5  
ATOM 8928  O O    . PRO A 1 73  ? 14.485  -1.090  -11.523 1.00 0.00 ? 73  PRO A O    5  
ATOM 8929  C CB   . PRO A 1 73  ? 15.355  -3.245  -9.654  1.00 0.00 ? 73  PRO A CB   5  
ATOM 8930  C CG   . PRO A 1 73  ? 16.732  -2.935  -10.129 1.00 0.00 ? 73  PRO A CG   5  
ATOM 8931  C CD   . PRO A 1 73  ? 16.906  -3.690  -11.418 1.00 0.00 ? 73  PRO A CD   5  
ATOM 8932  H HA   . PRO A 1 73  ? 13.791  -4.189  -10.787 1.00 0.00 ? 73  PRO A HA   5  
ATOM 8933  H HB2  . PRO A 1 73  ? 14.947  -2.435  -9.066  1.00 0.00 ? 73  PRO A HB2  5  
ATOM 8934  H HB3  . PRO A 1 73  ? 15.332  -4.160  -9.082  1.00 0.00 ? 73  PRO A HB3  5  
ATOM 8935  H HG2  . PRO A 1 73  ? 16.831  -1.873  -10.300 1.00 0.00 ? 73  PRO A HG2  5  
ATOM 8936  H HG3  . PRO A 1 73  ? 17.455  -3.268  -9.400  1.00 0.00 ? 73  PRO A HG3  5  
ATOM 8937  H HD2  . PRO A 1 73  ? 17.525  -3.129  -12.103 1.00 0.00 ? 73  PRO A HD2  5  
ATOM 8938  H HD3  . PRO A 1 73  ? 17.333  -4.663  -11.230 1.00 0.00 ? 73  PRO A HD3  5  
ATOM 8939  N N    . ASP A 1 74  ? 12.507  -2.147  -11.349 1.00 0.00 ? 74  ASP A N    5  
ATOM 8940  C CA   . ASP A 1 74  ? 11.721  -0.965  -11.684 1.00 0.00 ? 74  ASP A CA   5  
ATOM 8941  C C    . ASP A 1 74  ? 10.626  -0.730  -10.648 1.00 0.00 ? 74  ASP A C    5  
ATOM 8942  O O    . ASP A 1 74  ? 9.590   -1.395  -10.643 1.00 0.00 ? 74  ASP A O    5  
ATOM 8943  C CB   . ASP A 1 74  ? 11.102  -1.114  -13.074 1.00 0.00 ? 74  ASP A CB   5  
ATOM 8944  C CG   . ASP A 1 74  ? 12.096  -1.627  -14.098 1.00 0.00 ? 74  ASP A CG   5  
ATOM 8945  O OD1  . ASP A 1 74  ? 13.312  -1.437  -13.891 1.00 0.00 ? 74  ASP A OD1  5  
ATOM 8946  O OD2  . ASP A 1 74  ? 11.657  -2.219  -15.107 1.00 0.00 ? 74  ASP A OD2  5  
ATOM 8947  H H    . ASP A 1 74  ? 12.045  -2.990  -11.158 1.00 0.00 ? 74  ASP A H    5  
ATOM 8948  H HA   . ASP A 1 74  ? 12.386  -0.115  -11.685 1.00 0.00 ? 74  ASP A HA   5  
ATOM 8949  H HB2  . ASP A 1 74  ? 10.277  -1.810  -13.021 1.00 0.00 ? 74  ASP A HB2  5  
ATOM 8950  H HB3  . ASP A 1 74  ? 10.737  -0.153  -13.404 1.00 0.00 ? 74  ASP A HB3  5  
ATOM 8951  N N    . PRO A 1 75  ? 10.859  0.237   -9.749  1.00 0.00 ? 75  PRO A N    5  
ATOM 8952  C CA   . PRO A 1 75  ? 9.904   0.581   -8.691  1.00 0.00 ? 75  PRO A CA   5  
ATOM 8953  C C    . PRO A 1 75  ? 8.486   0.751   -9.224  1.00 0.00 ? 75  PRO A C    5  
ATOM 8954  O O    . PRO A 1 75  ? 7.514   0.280   -8.633  1.00 0.00 ? 75  PRO A O    5  
ATOM 8955  C CB   . PRO A 1 75  ? 10.436  1.912   -8.153  1.00 0.00 ? 75  PRO A CB   5  
ATOM 8956  C CG   . PRO A 1 75  ? 11.895  1.886   -8.452  1.00 0.00 ? 75  PRO A CG   5  
ATOM 8957  C CD   . PRO A 1 75  ? 12.073  1.069   -9.695  1.00 0.00 ? 75  PRO A CD   5  
ATOM 8958  H HA   . PRO A 1 75  ? 9.905   -0.155  -7.901  1.00 0.00 ? 75  PRO A HA   5  
ATOM 8959  H HB2  . PRO A 1 75  ? 9.943   2.731   -8.658  1.00 0.00 ? 75  PRO A HB2  5  
ATOM 8960  H HB3  . PRO A 1 75  ? 10.252  1.974   -7.091  1.00 0.00 ? 75  PRO A HB3  5  
ATOM 8961  H HG2  . PRO A 1 75  ? 12.254  2.890   -8.619  1.00 0.00 ? 75  PRO A HG2  5  
ATOM 8962  H HG3  . PRO A 1 75  ? 12.429  1.426   -7.633  1.00 0.00 ? 75  PRO A HG3  5  
ATOM 8963  H HD2  . PRO A 1 75  ? 12.137  1.714   -10.559 1.00 0.00 ? 75  PRO A HD2  5  
ATOM 8964  H HD3  . PRO A 1 75  ? 12.957  0.455   -9.614  1.00 0.00 ? 75  PRO A HD3  5  
ATOM 8965  N N    . PRO A 1 76  ? 8.361   1.440   -10.368 1.00 0.00 ? 76  PRO A N    5  
ATOM 8966  C CA   . PRO A 1 76  ? 7.064   1.686   -11.006 1.00 0.00 ? 76  PRO A CA   5  
ATOM 8967  C C    . PRO A 1 76  ? 6.220   0.421   -11.111 1.00 0.00 ? 76  PRO A C    5  
ATOM 8968  O O    . PRO A 1 76  ? 5.058   0.402   -10.704 1.00 0.00 ? 76  PRO A O    5  
ATOM 8969  C CB   . PRO A 1 76  ? 7.445   2.192   -12.400 1.00 0.00 ? 76  PRO A CB   5  
ATOM 8970  C CG   . PRO A 1 76  ? 8.801   2.786   -12.230 1.00 0.00 ? 76  PRO A CG   5  
ATOM 8971  C CD   . PRO A 1 76  ? 9.476   2.030   -11.128 1.00 0.00 ? 76  PRO A CD   5  
ATOM 8972  H HA   . PRO A 1 76  ? 6.505   2.449   -10.486 1.00 0.00 ? 76  PRO A HA   5  
ATOM 8973  H HB2  . PRO A 1 76  ? 7.461   1.363   -13.094 1.00 0.00 ? 76  PRO A HB2  5  
ATOM 8974  H HB3  . PRO A 1 76  ? 6.729   2.930   -12.728 1.00 0.00 ? 76  PRO A HB3  5  
ATOM 8975  H HG2  . PRO A 1 76  ? 9.365   2.683   -13.144 1.00 0.00 ? 76  PRO A HG2  5  
ATOM 8976  H HG3  . PRO A 1 76  ? 8.712   3.828   -11.958 1.00 0.00 ? 76  PRO A HG3  5  
ATOM 8977  H HD2  . PRO A 1 76  ? 10.112  1.260   -11.539 1.00 0.00 ? 76  PRO A HD2  5  
ATOM 8978  H HD3  . PRO A 1 76  ? 10.049  2.705   -10.509 1.00 0.00 ? 76  PRO A HD3  5  
ATOM 8979  N N    . THR A 1 77  ? 6.811   -0.636  -11.659 1.00 0.00 ? 77  THR A N    5  
ATOM 8980  C CA   . THR A 1 77  ? 6.112   -1.905  -11.818 1.00 0.00 ? 77  THR A CA   5  
ATOM 8981  C C    . THR A 1 77  ? 5.534   -2.384  -10.492 1.00 0.00 ? 77  THR A C    5  
ATOM 8982  O O    . THR A 1 77  ? 4.372   -2.784  -10.419 1.00 0.00 ? 77  THR A O    5  
ATOM 8983  C CB   . THR A 1 77  ? 7.046   -2.994  -12.381 1.00 0.00 ? 77  THR A CB   5  
ATOM 8984  O OG1  . THR A 1 77  ? 7.572   -2.581  -13.647 1.00 0.00 ? 77  THR A OG1  5  
ATOM 8985  C CG2  . THR A 1 77  ? 6.305   -4.313  -12.539 1.00 0.00 ? 77  THR A CG2  5  
ATOM 8986  H H    . THR A 1 77  ? 7.738   -0.558  -11.965 1.00 0.00 ? 77  THR A H    5  
ATOM 8987  H HA   . THR A 1 77  ? 5.304   -1.756  -12.520 1.00 0.00 ? 77  THR A HA   5  
ATOM 8988  H HB   . THR A 1 77  ? 7.864   -3.138  -11.689 1.00 0.00 ? 77  THR A HB   5  
ATOM 8989  H HG1  . THR A 1 77  ? 8.529   -2.660  -13.637 1.00 0.00 ? 77  THR A HG1  5  
ATOM 8990  H HG21 . THR A 1 77  ? 6.995   -5.075  -12.871 1.00 0.00 ? 77  THR A HG21 5  
ATOM 8991  H HG22 . THR A 1 77  ? 5.517   -4.198  -13.268 1.00 0.00 ? 77  THR A HG22 5  
ATOM 8992  H HG23 . THR A 1 77  ? 5.879   -4.602  -11.590 1.00 0.00 ? 77  THR A HG23 5  
ATOM 8993  N N    . TRP A 1 78  ? 6.350   -2.340  -9.445  1.00 0.00 ? 78  TRP A N    5  
ATOM 8994  C CA   . TRP A 1 78  ? 5.918   -2.769  -8.120  1.00 0.00 ? 78  TRP A CA   5  
ATOM 8995  C C    . TRP A 1 78  ? 4.826   -1.852  -7.580  1.00 0.00 ? 78  TRP A C    5  
ATOM 8996  O O    . TRP A 1 78  ? 3.793   -2.317  -7.098  1.00 0.00 ? 78  TRP A O    5  
ATOM 8997  C CB   . TRP A 1 78  ? 7.105   -2.791  -7.156  1.00 0.00 ? 78  TRP A CB   5  
ATOM 8998  C CG   . TRP A 1 78  ? 8.304   -3.502  -7.707  1.00 0.00 ? 78  TRP A CG   5  
ATOM 8999  C CD1  . TRP A 1 78  ? 8.304   -4.603  -8.515  1.00 0.00 ? 78  TRP A CD1  5  
ATOM 9000  C CD2  . TRP A 1 78  ? 9.678   -3.163  -7.488  1.00 0.00 ? 78  TRP A CD2  5  
ATOM 9001  N NE1  . TRP A 1 78  ? 9.596   -4.968  -8.812  1.00 0.00 ? 78  TRP A NE1  5  
ATOM 9002  C CE2  . TRP A 1 78  ? 10.456  -4.100  -8.195  1.00 0.00 ? 78  TRP A CE2  5  
ATOM 9003  C CE3  . TRP A 1 78  ? 10.325  -2.157  -6.766  1.00 0.00 ? 78  TRP A CE3  5  
ATOM 9004  C CZ2  . TRP A 1 78  ? 11.848  -4.060  -8.197  1.00 0.00 ? 78  TRP A CZ2  5  
ATOM 9005  C CZ3  . TRP A 1 78  ? 11.707  -2.118  -6.769  1.00 0.00 ? 78  TRP A CZ3  5  
ATOM 9006  C CH2  . TRP A 1 78  ? 12.456  -3.064  -7.482  1.00 0.00 ? 78  TRP A CH2  5  
ATOM 9007  H H    . TRP A 1 78  ? 7.266   -2.011  -9.566  1.00 0.00 ? 78  TRP A H    5  
ATOM 9008  H HA   . TRP A 1 78  ? 5.520   -3.769  -8.210  1.00 0.00 ? 78  TRP A HA   5  
ATOM 9009  H HB2  . TRP A 1 78  ? 7.395   -1.777  -6.928  1.00 0.00 ? 78  TRP A HB2  5  
ATOM 9010  H HB3  . TRP A 1 78  ? 6.810   -3.291  -6.245  1.00 0.00 ? 78  TRP A HB3  5  
ATOM 9011  H HD1  . TRP A 1 78  ? 7.413   -5.104  -8.861  1.00 0.00 ? 78  TRP A HD1  5  
ATOM 9012  H HE1  . TRP A 1 78  ? 9.857   -5.727  -9.376  1.00 0.00 ? 78  TRP A HE1  5  
ATOM 9013  H HE3  . TRP A 1 78  ? 9.765   -1.419  -6.211  1.00 0.00 ? 78  TRP A HE3  5  
ATOM 9014  H HZ2  . TRP A 1 78  ? 12.440  -4.781  -8.742  1.00 0.00 ? 78  TRP A HZ2  5  
ATOM 9015  H HZ3  . TRP A 1 78  ? 12.225  -1.348  -6.216  1.00 0.00 ? 78  TRP A HZ3  5  
ATOM 9016  H HH2  . TRP A 1 78  ? 13.532  -2.996  -7.456  1.00 0.00 ? 78  TRP A HH2  5  
ATOM 9017  N N    . LYS A 1 79  ? 5.060   -0.547  -7.664  1.00 0.00 ? 79  LYS A N    5  
ATOM 9018  C CA   . LYS A 1 79  ? 4.096   0.437   -7.185  1.00 0.00 ? 79  LYS A CA   5  
ATOM 9019  C C    . LYS A 1 79  ? 2.739   0.238   -7.852  1.00 0.00 ? 79  LYS A C    5  
ATOM 9020  O O    . LYS A 1 79  ? 1.720   0.086   -7.178  1.00 0.00 ? 79  LYS A O    5  
ATOM 9021  C CB   . LYS A 1 79  ? 4.606   1.854   -7.455  1.00 0.00 ? 79  LYS A CB   5  
ATOM 9022  C CG   . LYS A 1 79  ? 4.092   2.884   -6.464  1.00 0.00 ? 79  LYS A CG   5  
ATOM 9023  C CD   . LYS A 1 79  ? 2.767   3.476   -6.912  1.00 0.00 ? 79  LYS A CD   5  
ATOM 9024  C CE   . LYS A 1 79  ? 2.461   4.774   -6.181  1.00 0.00 ? 79  LYS A CE   5  
ATOM 9025  N NZ   . LYS A 1 79  ? 3.095   5.947   -6.844  1.00 0.00 ? 79  LYS A NZ   5  
ATOM 9026  H H    . LYS A 1 79  ? 5.903   -0.237  -8.059  1.00 0.00 ? 79  LYS A H    5  
ATOM 9027  H HA   . LYS A 1 79  ? 3.984   0.300   -6.120  1.00 0.00 ? 79  LYS A HA   5  
ATOM 9028  H HB2  . LYS A 1 79  ? 5.685   1.850   -7.411  1.00 0.00 ? 79  LYS A HB2  5  
ATOM 9029  H HB3  . LYS A 1 79  ? 4.296   2.153   -8.446  1.00 0.00 ? 79  LYS A HB3  5  
ATOM 9030  H HG2  . LYS A 1 79  ? 3.956   2.409   -5.503  1.00 0.00 ? 79  LYS A HG2  5  
ATOM 9031  H HG3  . LYS A 1 79  ? 4.819   3.679   -6.375  1.00 0.00 ? 79  LYS A HG3  5  
ATOM 9032  H HD2  . LYS A 1 79  ? 2.811   3.675   -7.972  1.00 0.00 ? 79  LYS A HD2  5  
ATOM 9033  H HD3  . LYS A 1 79  ? 1.978   2.765   -6.710  1.00 0.00 ? 79  LYS A HD3  5  
ATOM 9034  H HE2  . LYS A 1 79  ? 1.391   4.918   -6.161  1.00 0.00 ? 79  LYS A HE2  5  
ATOM 9035  H HE3  . LYS A 1 79  ? 2.832   4.699   -5.169  1.00 0.00 ? 79  LYS A HE3  5  
ATOM 9036  H HZ1  . LYS A 1 79  ? 4.039   5.690   -7.197  1.00 0.00 ? 79  LYS A HZ1  5  
ATOM 9037  H HZ2  . LYS A 1 79  ? 3.193   6.731   -6.167  1.00 0.00 ? 79  LYS A HZ2  5  
ATOM 9038  H HZ3  . LYS A 1 79  ? 2.512   6.264   -7.644  1.00 0.00 ? 79  LYS A HZ3  5  
ATOM 9039  N N    . THR A 1 80  ? 2.732   0.238   -9.182  1.00 0.00 ? 80  THR A N    5  
ATOM 9040  C CA   . THR A 1 80  ? 1.501   0.057   -9.940  1.00 0.00 ? 80  THR A CA   5  
ATOM 9041  C C    . THR A 1 80  ? 0.884   -1.310  -9.669  1.00 0.00 ? 80  THR A C    5  
ATOM 9042  O O    . THR A 1 80  ? -0.329  -1.432  -9.500  1.00 0.00 ? 80  THR A O    5  
ATOM 9043  C CB   . THR A 1 80  ? 1.746   0.207   -11.454 1.00 0.00 ? 80  THR A CB   5  
ATOM 9044  O OG1  . THR A 1 80  ? 2.354   1.474   -11.729 1.00 0.00 ? 80  THR A OG1  5  
ATOM 9045  C CG2  . THR A 1 80  ? 0.442   0.085   -12.228 1.00 0.00 ? 80  THR A CG2  5  
ATOM 9046  H H    . THR A 1 80  ? 3.577   0.364   -9.663  1.00 0.00 ? 80  THR A H    5  
ATOM 9047  H HA   . THR A 1 80  ? 0.804   0.823   -9.632  1.00 0.00 ? 80  THR A HA   5  
ATOM 9048  H HB   . THR A 1 80  ? 2.413   -0.581  -11.774 1.00 0.00 ? 80  THR A HB   5  
ATOM 9049  H HG1  . THR A 1 80  ? 1.699   2.170   -11.634 1.00 0.00 ? 80  THR A HG1  5  
ATOM 9050  H HG21 . THR A 1 80  ? 0.475   -0.795  -12.852 1.00 0.00 ? 80  THR A HG21 5  
ATOM 9051  H HG22 . THR A 1 80  ? 0.308   0.960   -12.846 1.00 0.00 ? 80  THR A HG22 5  
ATOM 9052  H HG23 . THR A 1 80  ? -0.381  0.004   -11.534 1.00 0.00 ? 80  THR A HG23 5  
ATOM 9053  N N    . ARG A 1 81  ? 1.728   -2.337  -9.629  1.00 0.00 ? 81  ARG A N    5  
ATOM 9054  C CA   . ARG A 1 81  ? 1.264   -3.697  -9.379  1.00 0.00 ? 81  ARG A CA   5  
ATOM 9055  C C    . ARG A 1 81  ? 0.532   -3.784  -8.043  1.00 0.00 ? 81  ARG A C    5  
ATOM 9056  O O    . ARG A 1 81  ? -0.592  -4.283  -7.970  1.00 0.00 ? 81  ARG A O    5  
ATOM 9057  C CB   . ARG A 1 81  ? 2.444   -4.670  -9.391  1.00 0.00 ? 81  ARG A CB   5  
ATOM 9058  C CG   . ARG A 1 81  ? 2.753   -5.235  -10.768 1.00 0.00 ? 81  ARG A CG   5  
ATOM 9059  C CD   . ARG A 1 81  ? 3.601   -6.494  -10.676 1.00 0.00 ? 81  ARG A CD   5  
ATOM 9060  N NE   . ARG A 1 81  ? 4.095   -6.918  -11.984 1.00 0.00 ? 81  ARG A NE   5  
ATOM 9061  C CZ   . ARG A 1 81  ? 5.072   -7.803  -12.149 1.00 0.00 ? 81  ARG A CZ   5  
ATOM 9062  N NH1  . ARG A 1 81  ? 5.656   -8.355  -11.094 1.00 0.00 ? 81  ARG A NH1  5  
ATOM 9063  N NH2  . ARG A 1 81  ? 5.466   -8.137  -13.371 1.00 0.00 ? 81  ARG A NH2  5  
ATOM 9064  H H    . ARG A 1 81  ? 2.684   -2.177  -9.771  1.00 0.00 ? 81  ARG A H    5  
ATOM 9065  H HA   . ARG A 1 81  ? 0.579   -3.965  -10.169 1.00 0.00 ? 81  ARG A HA   5  
ATOM 9066  H HB2  . ARG A 1 81  ? 3.324   -4.157  -9.031  1.00 0.00 ? 81  ARG A HB2  5  
ATOM 9067  H HB3  . ARG A 1 81  ? 2.222   -5.494  -8.730  1.00 0.00 ? 81  ARG A HB3  5  
ATOM 9068  H HG2  . ARG A 1 81  ? 1.825   -5.475  -11.265 1.00 0.00 ? 81  ARG A HG2  5  
ATOM 9069  H HG3  . ARG A 1 81  ? 3.289   -4.491  -11.339 1.00 0.00 ? 81  ARG A HG3  5  
ATOM 9070  H HD2  . ARG A 1 81  ? 4.444   -6.298  -10.030 1.00 0.00 ? 81  ARG A HD2  5  
ATOM 9071  H HD3  . ARG A 1 81  ? 3.001   -7.286  -10.254 1.00 0.00 ? 81  ARG A HD3  5  
ATOM 9072  H HE   . ARG A 1 81  ? 3.677   -6.522  -12.777 1.00 0.00 ? 81  ARG A HE   5  
ATOM 9073  H HH11 . ARG A 1 81  ? 5.361   -8.105  -10.172 1.00 0.00 ? 81  ARG A HH11 5  
ATOM 9074  H HH12 . ARG A 1 81  ? 6.391   -9.022  -11.222 1.00 0.00 ? 81  ARG A HH12 5  
ATOM 9075  H HH21 . ARG A 1 81  ? 5.028   -7.724  -14.168 1.00 0.00 ? 81  ARG A HH21 5  
ATOM 9076  H HH22 . ARG A 1 81  ? 6.201   -8.803  -13.494 1.00 0.00 ? 81  ARG A HH22 5  
ATOM 9077  N N    . LEU A 1 82  ? 1.176   -3.297  -6.988  1.00 0.00 ? 82  LEU A N    5  
ATOM 9078  C CA   . LEU A 1 82  ? 0.587   -3.321  -5.654  1.00 0.00 ? 82  LEU A CA   5  
ATOM 9079  C C    . LEU A 1 82  ? -0.624  -2.397  -5.577  1.00 0.00 ? 82  LEU A C    5  
ATOM 9080  O O    . LEU A 1 82  ? -1.757  -2.854  -5.423  1.00 0.00 ? 82  LEU A O    5  
ATOM 9081  C CB   . LEU A 1 82  ? 1.625   -2.908  -4.609  1.00 0.00 ? 82  LEU A CB   5  
ATOM 9082  C CG   . LEU A 1 82  ? 1.241   -3.149  -3.149  1.00 0.00 ? 82  LEU A CG   5  
ATOM 9083  C CD1  . LEU A 1 82  ? 1.058   -4.635  -2.884  1.00 0.00 ? 82  LEU A CD1  5  
ATOM 9084  C CD2  . LEU A 1 82  ? 2.293   -2.564  -2.217  1.00 0.00 ? 82  LEU A CD2  5  
ATOM 9085  H H    . LEU A 1 82  ? 2.069   -2.912  -7.108  1.00 0.00 ? 82  LEU A H    5  
ATOM 9086  H HA   . LEU A 1 82  ? 0.267   -4.332  -5.451  1.00 0.00 ? 82  LEU A HA   5  
ATOM 9087  H HB2  . LEU A 1 82  ? 2.532   -3.459  -4.808  1.00 0.00 ? 82  LEU A HB2  5  
ATOM 9088  H HB3  . LEU A 1 82  ? 1.815   -1.851  -4.732  1.00 0.00 ? 82  LEU A HB3  5  
ATOM 9089  H HG   . LEU A 1 82  ? 0.301   -2.656  -2.945  1.00 0.00 ? 82  LEU A HG   5  
ATOM 9090  H HD11 . LEU A 1 82  ? 0.703   -4.780  -1.874  1.00 0.00 ? 82  LEU A HD11 5  
ATOM 9091  H HD12 . LEU A 1 82  ? 2.003   -5.142  -3.009  1.00 0.00 ? 82  LEU A HD12 5  
ATOM 9092  H HD13 . LEU A 1 82  ? 0.338   -5.039  -3.581  1.00 0.00 ? 82  LEU A HD13 5  
ATOM 9093  H HD21 . LEU A 1 82  ? 2.455   -3.240  -1.390  1.00 0.00 ? 82  LEU A HD21 5  
ATOM 9094  H HD22 . LEU A 1 82  ? 1.950   -1.611  -1.841  1.00 0.00 ? 82  LEU A HD22 5  
ATOM 9095  H HD23 . LEU A 1 82  ? 3.217   -2.428  -2.758  1.00 0.00 ? 82  LEU A HD23 5  
ATOM 9096  N N    . ARG A 1 83  ? -0.377  -1.096  -5.687  1.00 0.00 ? 83  ARG A N    5  
ATOM 9097  C CA   . ARG A 1 83  ? -1.448  -0.108  -5.631  1.00 0.00 ? 83  ARG A CA   5  
ATOM 9098  C C    . ARG A 1 83  ? -2.735  -0.666  -6.231  1.00 0.00 ? 83  ARG A C    5  
ATOM 9099  O O    . ARG A 1 83  ? -3.813  -0.524  -5.653  1.00 0.00 ? 83  ARG A O    5  
ATOM 9100  C CB   . ARG A 1 83  ? -1.036  1.164   -6.374  1.00 0.00 ? 83  ARG A CB   5  
ATOM 9101  C CG   . ARG A 1 83  ? -1.018  1.008   -7.886  1.00 0.00 ? 83  ARG A CG   5  
ATOM 9102  C CD   . ARG A 1 83  ? -0.670  2.317   -8.578  1.00 0.00 ? 83  ARG A CD   5  
ATOM 9103  N NE   . ARG A 1 83  ? -1.080  2.321   -9.980  1.00 0.00 ? 83  ARG A NE   5  
ATOM 9104  C CZ   . ARG A 1 83  ? -1.351  3.427   -10.663 1.00 0.00 ? 83  ARG A CZ   5  
ATOM 9105  N NH1  . ARG A 1 83  ? -1.255  4.613   -10.076 1.00 0.00 ? 83  ARG A NH1  5  
ATOM 9106  N NH2  . ARG A 1 83  ? -1.717  3.350   -11.936 1.00 0.00 ? 83  ARG A NH2  5  
ATOM 9107  H H    . ARG A 1 83  ? 0.547   -0.793  -5.808  1.00 0.00 ? 83  ARG A H    5  
ATOM 9108  H HA   . ARG A 1 83  ? -1.623  0.133   -4.593  1.00 0.00 ? 83  ARG A HA   5  
ATOM 9109  H HB2  . ARG A 1 83  ? -1.729  1.954   -6.124  1.00 0.00 ? 83  ARG A HB2  5  
ATOM 9110  H HB3  . ARG A 1 83  ? -0.046  1.450   -6.052  1.00 0.00 ? 83  ARG A HB3  5  
ATOM 9111  H HG2  . ARG A 1 83  ? -0.281  0.265   -8.154  1.00 0.00 ? 83  ARG A HG2  5  
ATOM 9112  H HG3  . ARG A 1 83  ? -1.994  0.684   -8.216  1.00 0.00 ? 83  ARG A HG3  5  
ATOM 9113  H HD2  . ARG A 1 83  ? -1.171  3.124   -8.064  1.00 0.00 ? 83  ARG A HD2  5  
ATOM 9114  H HD3  . ARG A 1 83  ? 0.398   2.464   -8.524  1.00 0.00 ? 83  ARG A HD3  5  
ATOM 9115  H HE   . ARG A 1 83  ? -1.156  1.456   -10.432 1.00 0.00 ? 83  ARG A HE   5  
ATOM 9116  H HH11 . ARG A 1 83  ? -0.979  4.674   -9.118  1.00 0.00 ? 83  ARG A HH11 5  
ATOM 9117  H HH12 . ARG A 1 83  ? -1.459  5.444   -10.593 1.00 0.00 ? 83  ARG A HH12 5  
ATOM 9118  H HH21 . ARG A 1 83  ? -1.789  2.458   -12.381 1.00 0.00 ? 83  ARG A HH21 5  
ATOM 9119  H HH22 . ARG A 1 83  ? -1.921  4.183   -12.449 1.00 0.00 ? 83  ARG A HH22 5  
ATOM 9120  N N    . CYS A 1 84  ? -2.614  -1.300  -7.392  1.00 0.00 ? 84  CYS A N    5  
ATOM 9121  C CA   . CYS A 1 84  ? -3.768  -1.878  -8.071  1.00 0.00 ? 84  CYS A CA   5  
ATOM 9122  C C    . CYS A 1 84  ? -4.428  -2.948  -7.207  1.00 0.00 ? 84  CYS A C    5  
ATOM 9123  O O    . CYS A 1 84  ? -5.595  -2.827  -6.836  1.00 0.00 ? 84  CYS A O    5  
ATOM 9124  C CB   . CYS A 1 84  ? -3.347  -2.479  -9.414  1.00 0.00 ? 84  CYS A CB   5  
ATOM 9125  S SG   . CYS A 1 84  ? -4.672  -2.537  -10.643 1.00 0.00 ? 84  CYS A SG   5  
ATOM 9126  H H    . CYS A 1 84  ? -1.728  -1.380  -7.803  1.00 0.00 ? 84  CYS A H    5  
ATOM 9127  H HA   . CYS A 1 84  ? -4.479  -1.086  -8.248  1.00 0.00 ? 84  CYS A HA   5  
ATOM 9128  H HB2  . CYS A 1 84  ? -2.543  -1.889  -9.827  1.00 0.00 ? 84  CYS A HB2  5  
ATOM 9129  H HB3  . CYS A 1 84  ? -2.999  -3.488  -9.255  1.00 0.00 ? 84  CYS A HB3  5  
ATOM 9130  H HG   . CYS A 1 84  ? -4.541  -3.662  -11.331 1.00 0.00 ? 84  CYS A HG   5  
ATOM 9131  N N    . ALA A 1 85  ? -3.673  -3.995  -6.891  1.00 0.00 ? 85  ALA A N    5  
ATOM 9132  C CA   . ALA A 1 85  ? -4.184  -5.085  -6.070  1.00 0.00 ? 85  ALA A CA   5  
ATOM 9133  C C    . ALA A 1 85  ? -5.008  -4.554  -4.902  1.00 0.00 ? 85  ALA A C    5  
ATOM 9134  O O    . ALA A 1 85  ? -6.168  -4.928  -4.726  1.00 0.00 ? 85  ALA A O    5  
ATOM 9135  C CB   . ALA A 1 85  ? -3.037  -5.946  -5.562  1.00 0.00 ? 85  ALA A CB   5  
ATOM 9136  H H    . ALA A 1 85  ? -2.750  -4.034  -7.217  1.00 0.00 ? 85  ALA A H    5  
ATOM 9137  H HA   . ALA A 1 85  ? -4.817  -5.703  -6.692  1.00 0.00 ? 85  ALA A HA   5  
ATOM 9138  H HB1  . ALA A 1 85  ? -2.257  -5.982  -6.308  1.00 0.00 ? 85  ALA A HB1  5  
ATOM 9139  H HB2  . ALA A 1 85  ? -2.645  -5.520  -4.650  1.00 0.00 ? 85  ALA A HB2  5  
ATOM 9140  H HB3  . ALA A 1 85  ? -3.396  -6.945  -5.367  1.00 0.00 ? 85  ALA A HB3  5  
ATOM 9141  N N    . LEU A 1 86  ? -4.401  -3.680  -4.106  1.00 0.00 ? 86  LEU A N    5  
ATOM 9142  C CA   . LEU A 1 86  ? -5.078  -3.097  -2.953  1.00 0.00 ? 86  LEU A CA   5  
ATOM 9143  C C    . LEU A 1 86  ? -6.510  -2.705  -3.303  1.00 0.00 ? 86  LEU A C    5  
ATOM 9144  O O    . LEU A 1 86  ? -7.461  -3.154  -2.665  1.00 0.00 ? 86  LEU A O    5  
ATOM 9145  C CB   . LEU A 1 86  ? -4.310  -1.873  -2.451  1.00 0.00 ? 86  LEU A CB   5  
ATOM 9146  C CG   . LEU A 1 86  ? -4.542  -1.488  -0.989  1.00 0.00 ? 86  LEU A CG   5  
ATOM 9147  C CD1  . LEU A 1 86  ? -3.952  -2.539  -0.061  1.00 0.00 ? 86  LEU A CD1  5  
ATOM 9148  C CD2  . LEU A 1 86  ? -3.944  -0.120  -0.697  1.00 0.00 ? 86  LEU A CD2  5  
ATOM 9149  H H    . LEU A 1 86  ? -3.476  -3.421  -4.297  1.00 0.00 ? 86  LEU A H    5  
ATOM 9150  H HA   . LEU A 1 86  ? -5.102  -3.842  -2.171  1.00 0.00 ? 86  LEU A HA   5  
ATOM 9151  H HB2  . LEU A 1 86  ? -3.257  -2.069  -2.578  1.00 0.00 ? 86  LEU A HB2  5  
ATOM 9152  H HB3  . LEU A 1 86  ? -4.595  -1.031  -3.065  1.00 0.00 ? 86  LEU A HB3  5  
ATOM 9153  H HG   . LEU A 1 86  ? -5.606  -1.437  -0.801  1.00 0.00 ? 86  LEU A HG   5  
ATOM 9154  H HD11 . LEU A 1 86  ? -4.737  -2.964  0.546   1.00 0.00 ? 86  LEU A HD11 5  
ATOM 9155  H HD12 . LEU A 1 86  ? -3.211  -2.080  0.577   1.00 0.00 ? 86  LEU A HD12 5  
ATOM 9156  H HD13 . LEU A 1 86  ? -3.489  -3.318  -0.648  1.00 0.00 ? 86  LEU A HD13 5  
ATOM 9157  H HD21 . LEU A 1 86  ? -2.875  -0.212  -0.578  1.00 0.00 ? 86  LEU A HD21 5  
ATOM 9158  H HD22 . LEU A 1 86  ? -4.375  0.274   0.212   1.00 0.00 ? 86  LEU A HD22 5  
ATOM 9159  H HD23 . LEU A 1 86  ? -4.159  0.549   -1.517  1.00 0.00 ? 86  LEU A HD23 5  
ATOM 9160  N N    . ASN A 1 87  ? -6.656  -1.866  -4.324  1.00 0.00 ? 87  ASN A N    5  
ATOM 9161  C CA   . ASN A 1 87  ? -7.972  -1.415  -4.760  1.00 0.00 ? 87  ASN A CA   5  
ATOM 9162  C C    . ASN A 1 87  ? -8.813  -2.588  -5.254  1.00 0.00 ? 87  ASN A C    5  
ATOM 9163  O O    . ASN A 1 87  ? -10.005 -2.680  -4.958  1.00 0.00 ? 87  ASN A O    5  
ATOM 9164  C CB   . ASN A 1 87  ? -7.834  -0.370  -5.869  1.00 0.00 ? 87  ASN A CB   5  
ATOM 9165  C CG   . ASN A 1 87  ? -9.140  0.347   -6.154  1.00 0.00 ? 87  ASN A CG   5  
ATOM 9166  O OD1  . ASN A 1 87  ? -9.802  0.839   -5.241  1.00 0.00 ? 87  ASN A OD1  5  
ATOM 9167  N ND2  . ASN A 1 87  ? -9.516  0.407   -7.426  1.00 0.00 ? 87  ASN A ND2  5  
ATOM 9168  H H    . ASN A 1 87  ? -5.859  -1.542  -4.794  1.00 0.00 ? 87  ASN A H    5  
ATOM 9169  H HA   . ASN A 1 87  ? -8.466  -0.964  -3.913  1.00 0.00 ? 87  ASN A HA   5  
ATOM 9170  H HB2  . ASN A 1 87  ? -7.099  0.365   -5.573  1.00 0.00 ? 87  ASN A HB2  5  
ATOM 9171  H HB3  . ASN A 1 87  ? -7.505  -0.856  -6.776  1.00 0.00 ? 87  ASN A HB3  5  
ATOM 9172  H HD21 . ASN A 1 87  ? -8.938  -0.008  -8.101  1.00 0.00 ? 87  ASN A HD21 5  
ATOM 9173  H HD22 . ASN A 1 87  ? -10.355 0.865   -7.639  1.00 0.00 ? 87  ASN A HD22 5  
ATOM 9174  N N    . LYS A 1 88  ? -8.185  -3.484  -6.007  1.00 0.00 ? 88  LYS A N    5  
ATOM 9175  C CA   . LYS A 1 88  ? -8.873  -4.654  -6.541  1.00 0.00 ? 88  LYS A CA   5  
ATOM 9176  C C    . LYS A 1 88  ? -9.548  -5.444  -5.425  1.00 0.00 ? 88  LYS A C    5  
ATOM 9177  O O    . LYS A 1 88  ? -10.665 -5.936  -5.587  1.00 0.00 ? 88  LYS A O    5  
ATOM 9178  C CB   . LYS A 1 88  ? -7.888  -5.552  -7.293  1.00 0.00 ? 88  LYS A CB   5  
ATOM 9179  C CG   . LYS A 1 88  ? -7.514  -5.027  -8.668  1.00 0.00 ? 88  LYS A CG   5  
ATOM 9180  C CD   . LYS A 1 88  ? -8.377  -5.647  -9.755  1.00 0.00 ? 88  LYS A CD   5  
ATOM 9181  C CE   . LYS A 1 88  ? -9.579  -4.773  -10.078 1.00 0.00 ? 88  LYS A CE   5  
ATOM 9182  N NZ   . LYS A 1 88  ? -9.264  -3.764  -11.128 1.00 0.00 ? 88  LYS A NZ   5  
ATOM 9183  H H    . LYS A 1 88  ? -7.233  -3.356  -6.208  1.00 0.00 ? 88  LYS A H    5  
ATOM 9184  H HA   . LYS A 1 88  ? -9.629  -4.308  -7.229  1.00 0.00 ? 88  LYS A HA   5  
ATOM 9185  H HB2  . LYS A 1 88  ? -6.985  -5.644  -6.708  1.00 0.00 ? 88  LYS A HB2  5  
ATOM 9186  H HB3  . LYS A 1 88  ? -8.330  -6.530  -7.412  1.00 0.00 ? 88  LYS A HB3  5  
ATOM 9187  H HG2  . LYS A 1 88  ? -7.649  -3.956  -8.684  1.00 0.00 ? 88  LYS A HG2  5  
ATOM 9188  H HG3  . LYS A 1 88  ? -6.478  -5.264  -8.864  1.00 0.00 ? 88  LYS A HG3  5  
ATOM 9189  H HD2  . LYS A 1 88  ? -7.783  -5.768  -10.648 1.00 0.00 ? 88  LYS A HD2  5  
ATOM 9190  H HD3  . LYS A 1 88  ? -8.725  -6.613  -9.418  1.00 0.00 ? 88  LYS A HD3  5  
ATOM 9191  H HE2  . LYS A 1 88  ? -10.382 -5.403  -10.426 1.00 0.00 ? 88  LYS A HE2  5  
ATOM 9192  H HE3  . LYS A 1 88  ? -9.887  -4.260  -9.179  1.00 0.00 ? 88  LYS A HE3  5  
ATOM 9193  H HZ1  . LYS A 1 88  ? -8.264  -3.835  -11.403 1.00 0.00 ? 88  LYS A HZ1  5  
ATOM 9194  H HZ2  . LYS A 1 88  ? -9.446  -2.806  -10.768 1.00 0.00 ? 88  LYS A HZ2  5  
ATOM 9195  H HZ3  . LYS A 1 88  ? -9.856  -3.926  -11.968 1.00 0.00 ? 88  LYS A HZ3  5  
ATOM 9196  N N    . SER A 1 89  ? -8.864  -5.561  -4.291  1.00 0.00 ? 89  SER A N    5  
ATOM 9197  C CA   . SER A 1 89  ? -9.397  -6.294  -3.149  1.00 0.00 ? 89  SER A CA   5  
ATOM 9198  C C    . SER A 1 89  ? -10.796 -5.801  -2.792  1.00 0.00 ? 89  SER A C    5  
ATOM 9199  O O    . SER A 1 89  ? -10.978 -4.651  -2.395  1.00 0.00 ? 89  SER A O    5  
ATOM 9200  C CB   . SER A 1 89  ? -8.468  -6.145  -1.942  1.00 0.00 ? 89  SER A CB   5  
ATOM 9201  O OG   . SER A 1 89  ? -7.411  -7.087  -1.993  1.00 0.00 ? 89  SER A OG   5  
ATOM 9202  H H    . SER A 1 89  ? -7.978  -5.146  -4.223  1.00 0.00 ? 89  SER A H    5  
ATOM 9203  H HA   . SER A 1 89  ? -9.454  -7.337  -3.421  1.00 0.00 ? 89  SER A HA   5  
ATOM 9204  H HB2  . SER A 1 89  ? -8.048  -5.151  -1.935  1.00 0.00 ? 89  SER A HB2  5  
ATOM 9205  H HB3  . SER A 1 89  ? -9.033  -6.304  -1.035  1.00 0.00 ? 89  SER A HB3  5  
ATOM 9206  H HG   . SER A 1 89  ? -6.934  -6.989  -2.820  1.00 0.00 ? 89  SER A HG   5  
ATOM 9207  N N    . ASN A 1 90  ? -11.782 -6.681  -2.937  1.00 0.00 ? 90  ASN A N    5  
ATOM 9208  C CA   . ASN A 1 90  ? -13.165 -6.336  -2.631  1.00 0.00 ? 90  ASN A CA   5  
ATOM 9209  C C    . ASN A 1 90  ? -13.407 -6.341  -1.125  1.00 0.00 ? 90  ASN A C    5  
ATOM 9210  O O    . ASN A 1 90  ? -14.249 -5.600  -0.618  1.00 0.00 ? 90  ASN A O    5  
ATOM 9211  C CB   . ASN A 1 90  ? -14.120 -7.316  -3.316  1.00 0.00 ? 90  ASN A CB   5  
ATOM 9212  C CG   . ASN A 1 90  ? -13.963 -7.318  -4.824  1.00 0.00 ? 90  ASN A CG   5  
ATOM 9213  O OD1  . ASN A 1 90  ? -13.395 -6.391  -5.401  1.00 0.00 ? 90  ASN A OD1  5  
ATOM 9214  N ND2  . ASN A 1 90  ? -14.469 -8.362  -5.470  1.00 0.00 ? 90  ASN A ND2  5  
ATOM 9215  H H    . ASN A 1 90  ? -11.574 -7.583  -3.258  1.00 0.00 ? 90  ASN A H    5  
ATOM 9216  H HA   . ASN A 1 90  ? -13.351 -5.342  -3.010  1.00 0.00 ? 90  ASN A HA   5  
ATOM 9217  H HB2  . ASN A 1 90  ? -13.924 -8.314  -2.952  1.00 0.00 ? 90  ASN A HB2  5  
ATOM 9218  H HB3  . ASN A 1 90  ? -15.138 -7.044  -3.078  1.00 0.00 ? 90  ASN A HB3  5  
ATOM 9219  H HD21 . ASN A 1 90  ? -14.908 -9.063  -4.945  1.00 0.00 ? 90  ASN A HD21 5  
ATOM 9220  H HD22 . ASN A 1 90  ? -14.381 -8.389  -6.446  1.00 0.00 ? 90  ASN A HD22 5  
ATOM 9221  N N    . ASP A 1 91  ? -12.663 -7.182  -0.415  1.00 0.00 ? 91  ASP A N    5  
ATOM 9222  C CA   . ASP A 1 91  ? -12.794 -7.284  1.034   1.00 0.00 ? 91  ASP A CA   5  
ATOM 9223  C C    . ASP A 1 91  ? -12.071 -6.133  1.727   1.00 0.00 ? 91  ASP A C    5  
ATOM 9224  O O    . ASP A 1 91  ? -11.889 -6.144  2.945   1.00 0.00 ? 91  ASP A O    5  
ATOM 9225  C CB   . ASP A 1 91  ? -12.239 -8.621  1.525   1.00 0.00 ? 91  ASP A CB   5  
ATOM 9226  C CG   . ASP A 1 91  ? -13.216 -9.763  1.325   1.00 0.00 ? 91  ASP A CG   5  
ATOM 9227  O OD1  . ASP A 1 91  ? -14.063 -9.665  0.412   1.00 0.00 ? 91  ASP A OD1  5  
ATOM 9228  O OD2  . ASP A 1 91  ? -13.134 -10.754 2.080   1.00 0.00 ? 91  ASP A OD2  5  
ATOM 9229  H H    . ASP A 1 91  ? -12.008 -7.748  -0.876  1.00 0.00 ? 91  ASP A H    5  
ATOM 9230  H HA   . ASP A 1 91  ? -13.845 -7.230  1.276   1.00 0.00 ? 91  ASP A HA   5  
ATOM 9231  H HB2  . ASP A 1 91  ? -11.332 -8.849  0.983   1.00 0.00 ? 91  ASP A HB2  5  
ATOM 9232  H HB3  . ASP A 1 91  ? -12.013 -8.545  2.579   1.00 0.00 ? 91  ASP A HB3  5  
ATOM 9233  N N    . PHE A 1 92  ? -11.660 -5.142  0.943   1.00 0.00 ? 92  PHE A N    5  
ATOM 9234  C CA   . PHE A 1 92  ? -10.955 -3.984  1.481   1.00 0.00 ? 92  PHE A CA   5  
ATOM 9235  C C    . PHE A 1 92  ? -11.775 -2.711  1.291   1.00 0.00 ? 92  PHE A C    5  
ATOM 9236  O O    . PHE A 1 92  ? -12.433 -2.532  0.267   1.00 0.00 ? 92  PHE A O    5  
ATOM 9237  C CB   . PHE A 1 92  ? -9.591  -3.832  0.805   1.00 0.00 ? 92  PHE A CB   5  
ATOM 9238  C CG   . PHE A 1 92  ? -8.502  -4.629  1.465   1.00 0.00 ? 92  PHE A CG   5  
ATOM 9239  C CD1  . PHE A 1 92  ? -8.744  -5.917  1.915   1.00 0.00 ? 92  PHE A CD1  5  
ATOM 9240  C CD2  . PHE A 1 92  ? -7.237  -4.090  1.636   1.00 0.00 ? 92  PHE A CD2  5  
ATOM 9241  C CE1  . PHE A 1 92  ? -7.744  -6.653  2.523   1.00 0.00 ? 92  PHE A CE1  5  
ATOM 9242  C CE2  . PHE A 1 92  ? -6.234  -4.821  2.242   1.00 0.00 ? 92  PHE A CE2  5  
ATOM 9243  C CZ   . PHE A 1 92  ? -6.488  -6.104  2.687   1.00 0.00 ? 92  PHE A CZ   5  
ATOM 9244  H H    . PHE A 1 92  ? -11.835 -5.190  -0.020  1.00 0.00 ? 92  PHE A H    5  
ATOM 9245  H HA   . PHE A 1 92  ? -10.807 -4.148  2.538   1.00 0.00 ? 92  PHE A HA   5  
ATOM 9246  H HB2  . PHE A 1 92  ? -9.667  -4.160  -0.220  1.00 0.00 ? 92  PHE A HB2  5  
ATOM 9247  H HB3  . PHE A 1 92  ? -9.302  -2.792  0.825   1.00 0.00 ? 92  PHE A HB3  5  
ATOM 9248  H HD1  . PHE A 1 92  ? -9.727  -6.347  1.787   1.00 0.00 ? 92  PHE A HD1  5  
ATOM 9249  H HD2  . PHE A 1 92  ? -7.037  -3.086  1.290   1.00 0.00 ? 92  PHE A HD2  5  
ATOM 9250  H HE1  . PHE A 1 92  ? -7.947  -7.655  2.869   1.00 0.00 ? 92  PHE A HE1  5  
ATOM 9251  H HE2  . PHE A 1 92  ? -5.252  -4.390  2.370   1.00 0.00 ? 92  PHE A HE2  5  
ATOM 9252  H HZ   . PHE A 1 92  ? -5.705  -6.678  3.161   1.00 0.00 ? 92  PHE A HZ   5  
ATOM 9253  N N    . GLU A 1 93  ? -11.729 -1.831  2.286   1.00 0.00 ? 93  GLU A N    5  
ATOM 9254  C CA   . GLU A 1 93  ? -12.468 -0.575  2.229   1.00 0.00 ? 93  GLU A CA   5  
ATOM 9255  C C    . GLU A 1 93  ? -11.519 0.609   2.075   1.00 0.00 ? 93  GLU A C    5  
ATOM 9256  O O    . GLU A 1 93  ? -10.379 0.567   2.537   1.00 0.00 ? 93  GLU A O    5  
ATOM 9257  C CB   . GLU A 1 93  ? -13.319 -0.401  3.489   1.00 0.00 ? 93  GLU A CB   5  
ATOM 9258  C CG   . GLU A 1 93  ? -14.603 0.377   3.254   1.00 0.00 ? 93  GLU A CG   5  
ATOM 9259  C CD   . GLU A 1 93  ? -15.520 -0.301  2.254   1.00 0.00 ? 93  GLU A CD   5  
ATOM 9260  O OE1  . GLU A 1 93  ? -15.278 -0.164  1.037   1.00 0.00 ? 93  GLU A OE1  5  
ATOM 9261  O OE2  . GLU A 1 93  ? -16.481 -0.970  2.690   1.00 0.00 ? 93  GLU A OE2  5  
ATOM 9262  H H    . GLU A 1 93  ? -11.186 -2.030  3.077   1.00 0.00 ? 93  GLU A H    5  
ATOM 9263  H HA   . GLU A 1 93  ? -13.120 -0.613  1.369   1.00 0.00 ? 93  GLU A HA   5  
ATOM 9264  H HB2  . GLU A 1 93  ? -13.577 -1.377  3.873   1.00 0.00 ? 93  GLU A HB2  5  
ATOM 9265  H HB3  . GLU A 1 93  ? -12.736 0.125   4.231   1.00 0.00 ? 93  GLU A HB3  5  
ATOM 9266  H HG2  . GLU A 1 93  ? -15.128 0.473   4.192   1.00 0.00 ? 93  GLU A HG2  5  
ATOM 9267  H HG3  . GLU A 1 93  ? -14.352 1.359   2.881   1.00 0.00 ? 93  GLU A HG3  5  
ATOM 9268  N N    . GLU A 1 94  ? -11.997 1.663   1.421   1.00 0.00 ? 94  GLU A N    5  
ATOM 9269  C CA   . GLU A 1 94  ? -11.190 2.858   1.205   1.00 0.00 ? 94  GLU A CA   5  
ATOM 9270  C C    . GLU A 1 94  ? -11.412 3.874   2.323   1.00 0.00 ? 94  GLU A C    5  
ATOM 9271  O O    . GLU A 1 94  ? -12.483 4.471   2.431   1.00 0.00 ? 94  GLU A O    5  
ATOM 9272  C CB   . GLU A 1 94  ? -11.527 3.490   -0.147  1.00 0.00 ? 94  GLU A CB   5  
ATOM 9273  C CG   . GLU A 1 94  ? -10.486 4.487   -0.629  1.00 0.00 ? 94  GLU A CG   5  
ATOM 9274  C CD   . GLU A 1 94  ? -10.955 5.284   -1.831  1.00 0.00 ? 94  GLU A CD   5  
ATOM 9275  O OE1  . GLU A 1 94  ? -11.758 4.746   -2.622  1.00 0.00 ? 94  GLU A OE1  5  
ATOM 9276  O OE2  . GLU A 1 94  ? -10.519 6.444   -1.981  1.00 0.00 ? 94  GLU A OE2  5  
ATOM 9277  H H    . GLU A 1 94  ? -12.914 1.636   1.076   1.00 0.00 ? 94  GLU A H    5  
ATOM 9278  H HA   . GLU A 1 94  ? -10.152 2.562   1.205   1.00 0.00 ? 94  GLU A HA   5  
ATOM 9279  H HB2  . GLU A 1 94  ? -11.614 2.706   -0.885  1.00 0.00 ? 94  GLU A HB2  5  
ATOM 9280  H HB3  . GLU A 1 94  ? -12.474 4.002   -0.065  1.00 0.00 ? 94  GLU A HB3  5  
ATOM 9281  H HG2  . GLU A 1 94  ? -10.265 5.173   0.174   1.00 0.00 ? 94  GLU A HG2  5  
ATOM 9282  H HG3  . GLU A 1 94  ? -9.589  3.949   -0.899  1.00 0.00 ? 94  GLU A HG3  5  
ATOM 9283  N N    . LEU A 1 95  ? -10.391 4.063   3.152   1.00 0.00 ? 95  LEU A N    5  
ATOM 9284  C CA   . LEU A 1 95  ? -10.473 5.006   4.262   1.00 0.00 ? 95  LEU A CA   5  
ATOM 9285  C C    . LEU A 1 95  ? -9.871  6.354   3.878   1.00 0.00 ? 95  LEU A C    5  
ATOM 9286  O O    . LEU A 1 95  ? -9.543  7.168   4.741   1.00 0.00 ? 95  LEU A O    5  
ATOM 9287  C CB   . LEU A 1 95  ? -9.752  4.444   5.488   1.00 0.00 ? 95  LEU A CB   5  
ATOM 9288  C CG   . LEU A 1 95  ? -10.240 3.084   5.990   1.00 0.00 ? 95  LEU A CG   5  
ATOM 9289  C CD1  . LEU A 1 95  ? -9.527  2.702   7.277   1.00 0.00 ? 95  LEU A CD1  5  
ATOM 9290  C CD2  . LEU A 1 95  ? -11.748 3.103   6.199   1.00 0.00 ? 95  LEU A CD2  5  
ATOM 9291  H H    . LEU A 1 95  ? -9.563  3.558   3.015   1.00 0.00 ? 95  LEU A H    5  
ATOM 9292  H HA   . LEU A 1 95  ? -11.517 5.147   4.501   1.00 0.00 ? 95  LEU A HA   5  
ATOM 9293  H HB2  . LEU A 1 95  ? -8.706  4.348   5.242   1.00 0.00 ? 95  LEU A HB2  5  
ATOM 9294  H HB3  . LEU A 1 95  ? -9.867  5.155   6.294   1.00 0.00 ? 95  LEU A HB3  5  
ATOM 9295  H HG   . LEU A 1 95  ? -10.015 2.331   5.247   1.00 0.00 ? 95  LEU A HG   5  
ATOM 9296  H HD11 . LEU A 1 95  ? -10.220 2.205   7.939   1.00 0.00 ? 95  LEU A HD11 5  
ATOM 9297  H HD12 . LEU A 1 95  ? -9.146  3.592   7.756   1.00 0.00 ? 95  LEU A HD12 5  
ATOM 9298  H HD13 . LEU A 1 95  ? -8.706  2.037   7.049   1.00 0.00 ? 95  LEU A HD13 5  
ATOM 9299  H HD21 . LEU A 1 95  ? -12.244 3.009   5.245   1.00 0.00 ? 95  LEU A HD21 5  
ATOM 9300  H HD22 . LEU A 1 95  ? -12.035 4.035   6.664   1.00 0.00 ? 95  LEU A HD22 5  
ATOM 9301  H HD23 . LEU A 1 95  ? -12.033 2.280   6.836   1.00 0.00 ? 95  LEU A HD23 5  
ATOM 9302  N N    . VAL A 1 96  ? -9.730  6.584   2.576   1.00 0.00 ? 96  VAL A N    5  
ATOM 9303  C CA   . VAL A 1 96  ? -9.171  7.834   2.077   1.00 0.00 ? 96  VAL A CA   5  
ATOM 9304  C C    . VAL A 1 96  ? -9.585  9.010   2.954   1.00 0.00 ? 96  VAL A C    5  
ATOM 9305  O O    . VAL A 1 96  ? -8.839  9.977   3.104   1.00 0.00 ? 96  VAL A O    5  
ATOM 9306  C CB   . VAL A 1 96  ? -9.614  8.108   0.627   1.00 0.00 ? 96  VAL A CB   5  
ATOM 9307  C CG1  . VAL A 1 96  ? -11.132 8.092   0.521   1.00 0.00 ? 96  VAL A CG1  5  
ATOM 9308  C CG2  . VAL A 1 96  ? -9.051  9.434   0.140   1.00 0.00 ? 96  VAL A CG2  5  
ATOM 9309  H H    . VAL A 1 96  ? -10.010 5.896   1.936   1.00 0.00 ? 96  VAL A H    5  
ATOM 9310  H HA   . VAL A 1 96  ? -8.094  7.748   2.091   1.00 0.00 ? 96  VAL A HA   5  
ATOM 9311  H HB   . VAL A 1 96  ? -9.223  7.322   -0.002  1.00 0.00 ? 96  VAL A HB   5  
ATOM 9312  H HG11 . VAL A 1 96  ? -11.434 7.343   -0.197  1.00 0.00 ? 96  VAL A HG11 5  
ATOM 9313  H HG12 . VAL A 1 96  ? -11.558 7.861   1.486   1.00 0.00 ? 96  VAL A HG12 5  
ATOM 9314  H HG13 . VAL A 1 96  ? -11.480 9.061   0.196   1.00 0.00 ? 96  VAL A HG13 5  
ATOM 9315  H HG21 . VAL A 1 96  ? -8.223  9.249   -0.528  1.00 0.00 ? 96  VAL A HG21 5  
ATOM 9316  H HG22 . VAL A 1 96  ? -9.821  9.981   -0.385  1.00 0.00 ? 96  VAL A HG22 5  
ATOM 9317  H HG23 . VAL A 1 96  ? -8.711  10.014  0.985   1.00 0.00 ? 96  VAL A HG23 5  
ATOM 9318  N N    . GLU A 1 97  ? -10.779 8.919   3.531   1.00 0.00 ? 97  GLU A N    5  
ATOM 9319  C CA   . GLU A 1 97  ? -11.292 9.977   4.394   1.00 0.00 ? 97  GLU A CA   5  
ATOM 9320  C C    . GLU A 1 97  ? -10.282 10.329  5.482   1.00 0.00 ? 97  GLU A C    5  
ATOM 9321  O O    . GLU A 1 97  ? -10.053 11.503  5.775   1.00 0.00 ? 97  GLU A O    5  
ATOM 9322  C CB   . GLU A 1 97  ? -12.616 9.550   5.030   1.00 0.00 ? 97  GLU A CB   5  
ATOM 9323  C CG   . GLU A 1 97  ? -13.729 9.317   4.021   1.00 0.00 ? 97  GLU A CG   5  
ATOM 9324  C CD   . GLU A 1 97  ? -14.921 8.600   4.623   1.00 0.00 ? 97  GLU A CD   5  
ATOM 9325  O OE1  . GLU A 1 97  ? -14.715 7.748   5.513   1.00 0.00 ? 97  GLU A OE1  5  
ATOM 9326  O OE2  . GLU A 1 97  ? -16.061 8.891   4.204   1.00 0.00 ? 97  GLU A OE2  5  
ATOM 9327  H H    . GLU A 1 97  ? -11.328 8.123   3.373   1.00 0.00 ? 97  GLU A H    5  
ATOM 9328  H HA   . GLU A 1 97  ? -11.462 10.850  3.782   1.00 0.00 ? 97  GLU A HA   5  
ATOM 9329  H HB2  . GLU A 1 97  ? -12.459 8.634   5.580   1.00 0.00 ? 97  GLU A HB2  5  
ATOM 9330  H HB3  . GLU A 1 97  ? -12.937 10.320  5.716   1.00 0.00 ? 97  GLU A HB3  5  
ATOM 9331  H HG2  . GLU A 1 97  ? -14.058 10.272  3.640   1.00 0.00 ? 97  GLU A HG2  5  
ATOM 9332  H HG3  . GLU A 1 97  ? -13.341 8.720   3.209   1.00 0.00 ? 97  GLU A HG3  5  
ATOM 9333  N N    . ARG A 1 98  ? -9.683  9.304   6.079   1.00 0.00 ? 98  ARG A N    5  
ATOM 9334  C CA   . ARG A 1 98  ? -8.699  9.504   7.136   1.00 0.00 ? 98  ARG A CA   5  
ATOM 9335  C C    . ARG A 1 98  ? -7.308  9.721   6.550   1.00 0.00 ? 98  ARG A C    5  
ATOM 9336  O O    . ARG A 1 98  ? -6.455  10.359  7.169   1.00 0.00 ? 98  ARG A O    5  
ATOM 9337  C CB   . ARG A 1 98  ? -8.684  8.301   8.082   1.00 0.00 ? 98  ARG A CB   5  
ATOM 9338  C CG   . ARG A 1 98  ? -10.070 7.784   8.432   1.00 0.00 ? 98  ARG A CG   5  
ATOM 9339  C CD   . ARG A 1 98  ? -10.012 6.738   9.534   1.00 0.00 ? 98  ARG A CD   5  
ATOM 9340  N NE   . ARG A 1 98  ? -11.236 6.714   10.331  1.00 0.00 ? 98  ARG A NE   5  
ATOM 9341  C CZ   . ARG A 1 98  ? -11.688 5.630   10.951  1.00 0.00 ? 98  ARG A CZ   5  
ATOM 9342  N NH1  . ARG A 1 98  ? -11.020 4.488   10.868  1.00 0.00 ? 98  ARG A NH1  5  
ATOM 9343  N NH2  . ARG A 1 98  ? -12.810 5.688   11.658  1.00 0.00 ? 98  ARG A NH2  5  
ATOM 9344  H H    . ARG A 1 98  ? -9.908  8.391   5.802   1.00 0.00 ? 98  ARG A H    5  
ATOM 9345  H HA   . ARG A 1 98  ? -8.985  10.384  7.693   1.00 0.00 ? 98  ARG A HA   5  
ATOM 9346  H HB2  . ARG A 1 98  ? -8.132  7.498   7.616   1.00 0.00 ? 98  ARG A HB2  5  
ATOM 9347  H HB3  . ARG A 1 98  ? -8.187  8.585   8.997   1.00 0.00 ? 98  ARG A HB3  5  
ATOM 9348  H HG2  . ARG A 1 98  ? -10.679 8.611   8.767   1.00 0.00 ? 98  ARG A HG2  5  
ATOM 9349  H HG3  . ARG A 1 98  ? -10.512 7.342   7.551   1.00 0.00 ? 98  ARG A HG3  5  
ATOM 9350  H HD2  . ARG A 1 98  ? -9.868  5.767   9.084   1.00 0.00 ? 98  ARG A HD2  5  
ATOM 9351  H HD3  . ARG A 1 98  ? -9.177  6.962   10.181  1.00 0.00 ? 98  ARG A HD3  5  
ATOM 9352  H HE   . ARG A 1 98  ? -11.745 7.548   10.406  1.00 0.00 ? 98  ARG A HE   5  
ATOM 9353  H HH11 . ARG A 1 98  ? -10.174 4.442   10.337  1.00 0.00 ? 98  ARG A HH11 5  
ATOM 9354  H HH12 . ARG A 1 98  ? -11.362 3.673   11.337  1.00 0.00 ? 98  ARG A HH12 5  
ATOM 9355  H HH21 . ARG A 1 98  ? -13.316 6.547   11.723  1.00 0.00 ? 98  ARG A HH21 5  
ATOM 9356  H HH22 . ARG A 1 98  ? -13.149 4.871   12.124  1.00 0.00 ? 98  ARG A HH22 5  
ATOM 9357  N N    . SER A 1 99  ? -7.085  9.187   5.354   1.00 0.00 ? 99  SER A N    5  
ATOM 9358  C CA   . SER A 1 99  ? -5.795  9.319   4.686   1.00 0.00 ? 99  SER A CA   5  
ATOM 9359  C C    . SER A 1 99  ? -5.360  10.780  4.629   1.00 0.00 ? 99  SER A C    5  
ATOM 9360  O O    . SER A 1 99  ? -6.138  11.655  4.250   1.00 0.00 ? 99  SER A O    5  
ATOM 9361  C CB   . SER A 1 99  ? -5.868  8.741   3.271   1.00 0.00 ? 99  SER A CB   5  
ATOM 9362  O OG   . SER A 1 99  ? -6.293  9.722   2.341   1.00 0.00 ? 99  SER A OG   5  
ATOM 9363  H H    . SER A 1 99  ? -7.804  8.690   4.911   1.00 0.00 ? 99  SER A H    5  
ATOM 9364  H HA   . SER A 1 99  ? -5.068  8.761   5.257   1.00 0.00 ? 99  SER A HA   5  
ATOM 9365  H HB2  . SER A 1 99  ? -4.892  8.385   2.980   1.00 0.00 ? 99  SER A HB2  5  
ATOM 9366  H HB3  . SER A 1 99  ? -6.570  7.920   3.257   1.00 0.00 ? 99  SER A HB3  5  
ATOM 9367  H HG   . SER A 1 99  ? -7.069  9.405   1.873   1.00 0.00 ? 99  SER A HG   5  
ATOM 9368  N N    . GLN A 1 100 ? -4.112  11.035  5.007   1.00 0.00 ? 100 GLN A N    5  
ATOM 9369  C CA   . GLN A 1 100 ? -3.573  12.390  5.000   1.00 0.00 ? 100 GLN A CA   5  
ATOM 9370  C C    . GLN A 1 100 ? -2.396  12.502  4.037   1.00 0.00 ? 100 GLN A C    5  
ATOM 9371  O O    . GLN A 1 100 ? -1.282  12.079  4.349   1.00 0.00 ? 100 GLN A O    5  
ATOM 9372  C CB   . GLN A 1 100 ? -3.135  12.795  6.408   1.00 0.00 ? 100 GLN A CB   5  
ATOM 9373  C CG   . GLN A 1 100 ? -4.276  12.832  7.413   1.00 0.00 ? 100 GLN A CG   5  
ATOM 9374  C CD   . GLN A 1 100 ? -4.977  14.176  7.450   1.00 0.00 ? 100 GLN A CD   5  
ATOM 9375  O OE1  . GLN A 1 100 ? -4.598  15.066  8.211   1.00 0.00 ? 100 GLN A OE1  5  
ATOM 9376  N NE2  . GLN A 1 100 ? -6.006  14.330  6.625   1.00 0.00 ? 100 GLN A NE2  5  
ATOM 9377  H H    . GLN A 1 100 ? -3.540  10.295  5.299   1.00 0.00 ? 100 GLN A H    5  
ATOM 9378  H HA   . GLN A 1 100 ? -4.356  13.056  4.670   1.00 0.00 ? 100 GLN A HA   5  
ATOM 9379  H HB2  . GLN A 1 100 ? -2.397  12.090  6.760   1.00 0.00 ? 100 GLN A HB2  5  
ATOM 9380  H HB3  . GLN A 1 100 ? -2.691  13.778  6.365   1.00 0.00 ? 100 GLN A HB3  5  
ATOM 9381  H HG2  . GLN A 1 100 ? -4.998  12.074  7.146   1.00 0.00 ? 100 GLN A HG2  5  
ATOM 9382  H HG3  . GLN A 1 100 ? -3.880  12.621  8.395   1.00 0.00 ? 100 GLN A HG3  5  
ATOM 9383  H HE21 . GLN A 1 100 ? -6.253  13.577  6.048   1.00 0.00 ? 100 GLN A HE21 5  
ATOM 9384  H HE22 . GLN A 1 100 ? -6.478  15.188  6.629   1.00 0.00 ? 100 GLN A HE22 5  
ATOM 9385  N N    . LEU A 1 101 ? -2.649  13.073  2.865   1.00 0.00 ? 101 LEU A N    5  
ATOM 9386  C CA   . LEU A 1 101 ? -1.610  13.241  1.855   1.00 0.00 ? 101 LEU A CA   5  
ATOM 9387  C C    . LEU A 1 101 ? -1.113  14.683  1.819   1.00 0.00 ? 101 LEU A C    5  
ATOM 9388  O O    . LEU A 1 101 ? -0.038  14.967  1.289   1.00 0.00 ? 101 LEU A O    5  
ATOM 9389  C CB   . LEU A 1 101 ? -2.139  12.837  0.478   1.00 0.00 ? 101 LEU A CB   5  
ATOM 9390  C CG   . LEU A 1 101 ? -2.701  11.420  0.363   1.00 0.00 ? 101 LEU A CG   5  
ATOM 9391  C CD1  . LEU A 1 101 ? -3.773  11.355  -0.713  1.00 0.00 ? 101 LEU A CD1  5  
ATOM 9392  C CD2  . LEU A 1 101 ? -1.586  10.427  0.068   1.00 0.00 ? 101 LEU A CD2  5  
ATOM 9393  H H    . LEU A 1 101 ? -3.556  13.390  2.673   1.00 0.00 ? 101 LEU A H    5  
ATOM 9394  H HA   . LEU A 1 101 ? -0.785  12.596  2.118   1.00 0.00 ? 101 LEU A HA   5  
ATOM 9395  H HB2  . LEU A 1 101 ? -2.926  13.527  0.211   1.00 0.00 ? 101 LEU A HB2  5  
ATOM 9396  H HB3  . LEU A 1 101 ? -1.326  12.930  -0.229  1.00 0.00 ? 101 LEU A HB3  5  
ATOM 9397  H HG   . LEU A 1 101 ? -3.156  11.143  1.304   1.00 0.00 ? 101 LEU A HG   5  
ATOM 9398  H HD11 . LEU A 1 101 ? -3.464  10.671  -1.489  1.00 0.00 ? 101 LEU A HD11 5  
ATOM 9399  H HD12 . LEU A 1 101 ? -3.918  12.338  -1.136  1.00 0.00 ? 101 LEU A HD12 5  
ATOM 9400  H HD13 . LEU A 1 101 ? -4.700  11.012  -0.277  1.00 0.00 ? 101 LEU A HD13 5  
ATOM 9401  H HD21 . LEU A 1 101 ? -1.923  9.718   -0.673  1.00 0.00 ? 101 LEU A HD21 5  
ATOM 9402  H HD22 . LEU A 1 101 ? -1.323  9.901   0.975   1.00 0.00 ? 101 LEU A HD22 5  
ATOM 9403  H HD23 . LEU A 1 101 ? -0.722  10.956  -0.306  1.00 0.00 ? 101 LEU A HD23 5  
ATOM 9404  N N    . ASP A 1 102 ? -1.902  15.589  2.386   1.00 0.00 ? 102 ASP A N    5  
ATOM 9405  C CA   . ASP A 1 102 ? -1.541  17.001  2.422   1.00 0.00 ? 102 ASP A CA   5  
ATOM 9406  C C    . ASP A 1 102 ? -0.601  17.293  3.588   1.00 0.00 ? 102 ASP A C    5  
ATOM 9407  O O    . ASP A 1 102 ? -0.440  18.444  3.995   1.00 0.00 ? 102 ASP A O    5  
ATOM 9408  C CB   . ASP A 1 102 ? -2.796  17.868  2.534   1.00 0.00 ? 102 ASP A CB   5  
ATOM 9409  C CG   . ASP A 1 102 ? -3.491  18.054  1.200   1.00 0.00 ? 102 ASP A CG   5  
ATOM 9410  O OD1  . ASP A 1 102 ? -2.878  18.651  0.290   1.00 0.00 ? 102 ASP A OD1  5  
ATOM 9411  O OD2  . ASP A 1 102 ? -4.649  17.605  1.065   1.00 0.00 ? 102 ASP A OD2  5  
ATOM 9412  H H    . ASP A 1 102 ? -2.746  15.301  2.792   1.00 0.00 ? 102 ASP A H    5  
ATOM 9413  H HA   . ASP A 1 102 ? -1.033  17.238  1.499   1.00 0.00 ? 102 ASP A HA   5  
ATOM 9414  H HB2  . ASP A 1 102 ? -3.490  17.399  3.217   1.00 0.00 ? 102 ASP A HB2  5  
ATOM 9415  H HB3  . ASP A 1 102 ? -2.522  18.840  2.916   1.00 0.00 ? 102 ASP A HB3  5  
ATOM 9416  N N    . ILE A 1 103 ? 0.015   16.243  4.121   1.00 0.00 ? 103 ILE A N    5  
ATOM 9417  C CA   . ILE A 1 103 ? 0.938   16.387  5.240   1.00 0.00 ? 103 ILE A CA   5  
ATOM 9418  C C    . ILE A 1 103 ? 2.365   16.050  4.823   1.00 0.00 ? 103 ILE A C    5  
ATOM 9419  O O    . ILE A 1 103 ? 2.592   15.474  3.759   1.00 0.00 ? 103 ILE A O    5  
ATOM 9420  C CB   . ILE A 1 103 ? 0.534   15.486  6.422   1.00 0.00 ? 103 ILE A CB   5  
ATOM 9421  C CG1  . ILE A 1 103 ? 0.378   14.037  5.957   1.00 0.00 ? 103 ILE A CG1  5  
ATOM 9422  C CG2  . ILE A 1 103 ? -0.756  15.987  7.054   1.00 0.00 ? 103 ILE A CG2  5  
ATOM 9423  C CD1  . ILE A 1 103 ? 0.081   13.070  7.081   1.00 0.00 ? 103 ILE A CD1  5  
ATOM 9424  H H    . ILE A 1 103 ? -0.155  15.351  3.753   1.00 0.00 ? 103 ILE A H    5  
ATOM 9425  H HA   . ILE A 1 103 ? 0.904   17.416  5.570   1.00 0.00 ? 103 ILE A HA   5  
ATOM 9426  H HB   . ILE A 1 103 ? 1.314   15.536  7.167   1.00 0.00 ? 103 ILE A HB   5  
ATOM 9427  H HG12 . ILE A 1 103 ? -0.432  13.978  5.248   1.00 0.00 ? 103 ILE A HG12 5  
ATOM 9428  H HG13 . ILE A 1 103 ? 1.294   13.720  5.478   1.00 0.00 ? 103 ILE A HG13 5  
ATOM 9429  H HG21 . ILE A 1 103 ? -1.244  16.674  6.379   1.00 0.00 ? 103 ILE A HG21 5  
ATOM 9430  H HG22 . ILE A 1 103 ? -1.409  15.150  7.250   1.00 0.00 ? 103 ILE A HG22 5  
ATOM 9431  H HG23 . ILE A 1 103 ? -0.530  16.493  7.981   1.00 0.00 ? 103 ILE A HG23 5  
ATOM 9432  H HD11 . ILE A 1 103 ? -0.927  13.227  7.436   1.00 0.00 ? 103 ILE A HD11 5  
ATOM 9433  H HD12 . ILE A 1 103 ? 0.184   12.057  6.722   1.00 0.00 ? 103 ILE A HD12 5  
ATOM 9434  H HD13 . ILE A 1 103 ? 0.777   13.236  7.892   1.00 0.00 ? 103 ILE A HD13 5  
ATOM 9435  N N    . SER A 1 104 ? 3.324   16.412  5.668   1.00 0.00 ? 104 SER A N    5  
ATOM 9436  C CA   . SER A 1 104 ? 4.731   16.150  5.386   1.00 0.00 ? 104 SER A CA   5  
ATOM 9437  C C    . SER A 1 104 ? 4.919   14.745  4.823   1.00 0.00 ? 104 SER A C    5  
ATOM 9438  O O    . SER A 1 104 ? 5.616   14.552  3.827   1.00 0.00 ? 104 SER A O    5  
ATOM 9439  C CB   . SER A 1 104 ? 5.568   16.319  6.656   1.00 0.00 ? 104 SER A CB   5  
ATOM 9440  O OG   . SER A 1 104 ? 5.404   17.615  7.205   1.00 0.00 ? 104 SER A OG   5  
ATOM 9441  H H    . SER A 1 104 ? 3.080   16.869  6.501   1.00 0.00 ? 104 SER A H    5  
ATOM 9442  H HA   . SER A 1 104 ? 5.061   16.867  4.650   1.00 0.00 ? 104 SER A HA   5  
ATOM 9443  H HB2  . SER A 1 104 ? 5.257   15.589  7.388   1.00 0.00 ? 104 SER A HB2  5  
ATOM 9444  H HB3  . SER A 1 104 ? 6.611   16.170  6.419   1.00 0.00 ? 104 SER A HB3  5  
ATOM 9445  H HG   . SER A 1 104 ? 6.228   18.103  7.126   1.00 0.00 ? 104 SER A HG   5  
ATOM 9446  N N    . ASP A 1 105 ? 4.293   13.767  5.469   1.00 0.00 ? 105 ASP A N    5  
ATOM 9447  C CA   . ASP A 1 105 ? 4.390   12.378  5.033   1.00 0.00 ? 105 ASP A CA   5  
ATOM 9448  C C    . ASP A 1 105 ? 3.013   11.820  4.689   1.00 0.00 ? 105 ASP A C    5  
ATOM 9449  O O    . ASP A 1 105 ? 2.224   11.463  5.564   1.00 0.00 ? 105 ASP A O    5  
ATOM 9450  C CB   . ASP A 1 105 ? 5.043   11.524  6.121   1.00 0.00 ? 105 ASP A CB   5  
ATOM 9451  C CG   . ASP A 1 105 ? 5.458   10.158  5.613   1.00 0.00 ? 105 ASP A CG   5  
ATOM 9452  O OD1  . ASP A 1 105 ? 6.548   10.053  5.012   1.00 0.00 ? 105 ASP A OD1  5  
ATOM 9453  O OD2  . ASP A 1 105 ? 4.694   9.192   5.817   1.00 0.00 ? 105 ASP A OD2  5  
ATOM 9454  H H    . ASP A 1 105 ? 3.753   13.984  6.257   1.00 0.00 ? 105 ASP A H    5  
ATOM 9455  H HA   . ASP A 1 105 ? 5.007   12.351  4.148   1.00 0.00 ? 105 ASP A HA   5  
ATOM 9456  H HB2  . ASP A 1 105 ? 5.922   12.033  6.489   1.00 0.00 ? 105 ASP A HB2  5  
ATOM 9457  H HB3  . ASP A 1 105 ? 4.343   11.390  6.932   1.00 0.00 ? 105 ASP A HB3  5  
ATOM 9458  N N    . PRO A 1 106 ? 2.715   11.742  3.383   1.00 0.00 ? 106 PRO A N    5  
ATOM 9459  C CA   . PRO A 1 106 ? 1.433   11.228  2.893   1.00 0.00 ? 106 PRO A CA   5  
ATOM 9460  C C    . PRO A 1 106 ? 1.286   9.727   3.117   1.00 0.00 ? 106 PRO A C    5  
ATOM 9461  O O    . PRO A 1 106 ? 2.264   8.981   3.051   1.00 0.00 ? 106 PRO A O    5  
ATOM 9462  C CB   . PRO A 1 106 ? 1.473   11.544  1.396   1.00 0.00 ? 106 PRO A CB   5  
ATOM 9463  C CG   . PRO A 1 106 ? 2.923   11.607  1.061   1.00 0.00 ? 106 PRO A CG   5  
ATOM 9464  C CD   . PRO A 1 106 ? 3.608   12.148  2.285   1.00 0.00 ? 106 PRO A CD   5  
ATOM 9465  H HA   . PRO A 1 106 ? 0.599   11.742  3.349   1.00 0.00 ? 106 PRO A HA   5  
ATOM 9466  H HB2  . PRO A 1 106 ? 0.973   10.759  0.846   1.00 0.00 ? 106 PRO A HB2  5  
ATOM 9467  H HB3  . PRO A 1 106 ? 0.983   12.489  1.211   1.00 0.00 ? 106 PRO A HB3  5  
ATOM 9468  H HG2  . PRO A 1 106 ? 3.290   10.618  0.832   1.00 0.00 ? 106 PRO A HG2  5  
ATOM 9469  H HG3  . PRO A 1 106 ? 3.077   12.270  0.222   1.00 0.00 ? 106 PRO A HG3  5  
ATOM 9470  H HD2  . PRO A 1 106 ? 4.586   11.704  2.398   1.00 0.00 ? 106 PRO A HD2  5  
ATOM 9471  H HD3  . PRO A 1 106 ? 3.684   13.224  2.230   1.00 0.00 ? 106 PRO A HD3  5  
ATOM 9472  N N    . TYR A 1 107 ? 0.060   9.290   3.381   1.00 0.00 ? 107 TYR A N    5  
ATOM 9473  C CA   . TYR A 1 107 ? -0.214  7.877   3.616   1.00 0.00 ? 107 TYR A CA   5  
ATOM 9474  C C    . TYR A 1 107 ? -1.674  7.548   3.318   1.00 0.00 ? 107 TYR A C    5  
ATOM 9475  O O    . TYR A 1 107 ? -2.561  8.380   3.505   1.00 0.00 ? 107 TYR A O    5  
ATOM 9476  C CB   . TYR A 1 107 ? 0.119   7.505   5.062   1.00 0.00 ? 107 TYR A CB   5  
ATOM 9477  C CG   . TYR A 1 107 ? -0.783  8.165   6.080   1.00 0.00 ? 107 TYR A CG   5  
ATOM 9478  C CD1  . TYR A 1 107 ? -0.504  9.437   6.565   1.00 0.00 ? 107 TYR A CD1  5  
ATOM 9479  C CD2  . TYR A 1 107 ? -1.916  7.516   6.557   1.00 0.00 ? 107 TYR A CD2  5  
ATOM 9480  C CE1  . TYR A 1 107 ? -1.326  10.042  7.495   1.00 0.00 ? 107 TYR A CE1  5  
ATOM 9481  C CE2  . TYR A 1 107 ? -2.744  8.115   7.487   1.00 0.00 ? 107 TYR A CE2  5  
ATOM 9482  C CZ   . TYR A 1 107 ? -2.444  9.378   7.953   1.00 0.00 ? 107 TYR A CZ   5  
ATOM 9483  O OH   . TYR A 1 107 ? -3.266  9.978   8.879   1.00 0.00 ? 107 TYR A OH   5  
ATOM 9484  H H    . TYR A 1 107 ? -0.679  9.932   3.420   1.00 0.00 ? 107 TYR A H    5  
ATOM 9485  H HA   . TYR A 1 107 ? 0.416   7.302   2.953   1.00 0.00 ? 107 TYR A HA   5  
ATOM 9486  H HB2  . TYR A 1 107 ? 0.028   6.437   5.182   1.00 0.00 ? 107 TYR A HB2  5  
ATOM 9487  H HB3  . TYR A 1 107 ? 1.135   7.801   5.278   1.00 0.00 ? 107 TYR A HB3  5  
ATOM 9488  H HD1  . TYR A 1 107 ? 0.372   9.955   6.203   1.00 0.00 ? 107 TYR A HD1  5  
ATOM 9489  H HD2  . TYR A 1 107 ? -2.148  6.526   6.190   1.00 0.00 ? 107 TYR A HD2  5  
ATOM 9490  H HE1  . TYR A 1 107 ? -1.092  11.032  7.860   1.00 0.00 ? 107 TYR A HE1  5  
ATOM 9491  H HE2  . TYR A 1 107 ? -3.620  7.594   7.846   1.00 0.00 ? 107 TYR A HE2  5  
ATOM 9492  H HH   . TYR A 1 107 ? -4.115  10.172  8.475   1.00 0.00 ? 107 TYR A HH   5  
ATOM 9493  N N    . LYS A 1 108 ? -1.915  6.327   2.853   1.00 0.00 ? 108 LYS A N    5  
ATOM 9494  C CA   . LYS A 1 108 ? -3.266  5.884   2.530   1.00 0.00 ? 108 LYS A CA   5  
ATOM 9495  C C    . LYS A 1 108 ? -3.775  4.888   3.568   1.00 0.00 ? 108 LYS A C    5  
ATOM 9496  O O    . LYS A 1 108 ? -3.129  3.876   3.841   1.00 0.00 ? 108 LYS A O    5  
ATOM 9497  C CB   . LYS A 1 108 ? -3.297  5.247   1.139   1.00 0.00 ? 108 LYS A CB   5  
ATOM 9498  C CG   . LYS A 1 108 ? -2.792  6.164   0.039   1.00 0.00 ? 108 LYS A CG   5  
ATOM 9499  C CD   . LYS A 1 108 ? -3.494  5.891   -1.281  1.00 0.00 ? 108 LYS A CD   5  
ATOM 9500  C CE   . LYS A 1 108 ? -3.585  7.146   -2.134  1.00 0.00 ? 108 LYS A CE   5  
ATOM 9501  N NZ   . LYS A 1 108 ? -4.741  8.000   -1.743  1.00 0.00 ? 108 LYS A NZ   5  
ATOM 9502  H H    . LYS A 1 108 ? -1.165  5.707   2.725   1.00 0.00 ? 108 LYS A H    5  
ATOM 9503  H HA   . LYS A 1 108 ? -3.909  6.750   2.534   1.00 0.00 ? 108 LYS A HA   5  
ATOM 9504  H HB2  . LYS A 1 108 ? -2.682  4.359   1.149   1.00 0.00 ? 108 LYS A HB2  5  
ATOM 9505  H HB3  . LYS A 1 108 ? -4.314  4.967   0.907   1.00 0.00 ? 108 LYS A HB3  5  
ATOM 9506  H HG2  . LYS A 1 108 ? -2.974  7.189   0.325   1.00 0.00 ? 108 LYS A HG2  5  
ATOM 9507  H HG3  . LYS A 1 108 ? -1.730  6.007   -0.090  1.00 0.00 ? 108 LYS A HG3  5  
ATOM 9508  H HD2  . LYS A 1 108 ? -2.941  5.139   -1.825  1.00 0.00 ? 108 LYS A HD2  5  
ATOM 9509  H HD3  . LYS A 1 108 ? -4.493  5.530   -1.079  1.00 0.00 ? 108 LYS A HD3  5  
ATOM 9510  H HE2  . LYS A 1 108 ? -2.674  7.713   -2.017  1.00 0.00 ? 108 LYS A HE2  5  
ATOM 9511  H HE3  . LYS A 1 108 ? -3.697  6.855   -3.168  1.00 0.00 ? 108 LYS A HE3  5  
ATOM 9512  H HZ1  . LYS A 1 108 ? -4.801  8.828   -2.370  1.00 0.00 ? 108 LYS A HZ1  5  
ATOM 9513  H HZ2  . LYS A 1 108 ? -4.626  8.330   -0.763  1.00 0.00 ? 108 LYS A HZ2  5  
ATOM 9514  H HZ3  . LYS A 1 108 ? -5.626  7.459   -1.814  1.00 0.00 ? 108 LYS A HZ3  5  
ATOM 9515  N N    . VAL A 1 109 ? -4.937  5.182   4.142   1.00 0.00 ? 109 VAL A N    5  
ATOM 9516  C CA   . VAL A 1 109 ? -5.534  4.311   5.148   1.00 0.00 ? 109 VAL A CA   5  
ATOM 9517  C C    . VAL A 1 109 ? -6.566  3.378   4.525   1.00 0.00 ? 109 VAL A C    5  
ATOM 9518  O O    . VAL A 1 109 ? -7.323  3.776   3.639   1.00 0.00 ? 109 VAL A O    5  
ATOM 9519  C CB   . VAL A 1 109 ? -6.206  5.127   6.269   1.00 0.00 ? 109 VAL A CB   5  
ATOM 9520  C CG1  . VAL A 1 109 ? -6.761  4.203   7.342   1.00 0.00 ? 109 VAL A CG1  5  
ATOM 9521  C CG2  . VAL A 1 109 ? -5.222  6.121   6.867   1.00 0.00 ? 109 VAL A CG2  5  
ATOM 9522  H H    . VAL A 1 109 ? -5.405  6.003   3.883   1.00 0.00 ? 109 VAL A H    5  
ATOM 9523  H HA   . VAL A 1 109 ? -4.745  3.718   5.587   1.00 0.00 ? 109 VAL A HA   5  
ATOM 9524  H HB   . VAL A 1 109 ? -7.029  5.680   5.841   1.00 0.00 ? 109 VAL A HB   5  
ATOM 9525  H HG11 . VAL A 1 109 ? -7.517  4.725   7.911   1.00 0.00 ? 109 VAL A HG11 5  
ATOM 9526  H HG12 . VAL A 1 109 ? -7.197  3.331   6.877   1.00 0.00 ? 109 VAL A HG12 5  
ATOM 9527  H HG13 . VAL A 1 109 ? -5.963  3.897   8.002   1.00 0.00 ? 109 VAL A HG13 5  
ATOM 9528  H HG21 . VAL A 1 109 ? -4.681  5.650   7.674   1.00 0.00 ? 109 VAL A HG21 5  
ATOM 9529  H HG22 . VAL A 1 109 ? -4.526  6.441   6.105   1.00 0.00 ? 109 VAL A HG22 5  
ATOM 9530  H HG23 . VAL A 1 109 ? -5.760  6.977   7.245   1.00 0.00 ? 109 VAL A HG23 5  
ATOM 9531  N N    . TYR A 1 110 ? -6.592  2.136   4.994   1.00 0.00 ? 110 TYR A N    5  
ATOM 9532  C CA   . TYR A 1 110 ? -7.530  1.144   4.481   1.00 0.00 ? 110 TYR A CA   5  
ATOM 9533  C C    . TYR A 1 110 ? -8.075  0.275   5.610   1.00 0.00 ? 110 TYR A C    5  
ATOM 9534  O O    . TYR A 1 110 ? -7.413  0.074   6.628   1.00 0.00 ? 110 TYR A O    5  
ATOM 9535  C CB   . TYR A 1 110 ? -6.852  0.266   3.428   1.00 0.00 ? 110 TYR A CB   5  
ATOM 9536  C CG   . TYR A 1 110 ? -6.883  0.857   2.036   1.00 0.00 ? 110 TYR A CG   5  
ATOM 9537  C CD1  . TYR A 1 110 ? -5.902  1.747   1.616   1.00 0.00 ? 110 TYR A CD1  5  
ATOM 9538  C CD2  . TYR A 1 110 ? -7.894  0.526   1.142   1.00 0.00 ? 110 TYR A CD2  5  
ATOM 9539  C CE1  . TYR A 1 110 ? -5.927  2.289   0.346   1.00 0.00 ? 110 TYR A CE1  5  
ATOM 9540  C CE2  . TYR A 1 110 ? -7.926  1.062   -0.131  1.00 0.00 ? 110 TYR A CE2  5  
ATOM 9541  C CZ   . TYR A 1 110 ? -6.940  1.944   -0.524  1.00 0.00 ? 110 TYR A CZ   5  
ATOM 9542  O OH   . TYR A 1 110 ? -6.969  2.481   -1.790  1.00 0.00 ? 110 TYR A OH   5  
ATOM 9543  H H    . TYR A 1 110 ? -5.963  1.878   5.700   1.00 0.00 ? 110 TYR A H    5  
ATOM 9544  H HA   . TYR A 1 110 ? -8.352  1.673   4.020   1.00 0.00 ? 110 TYR A HA   5  
ATOM 9545  H HB2  . TYR A 1 110 ? -5.819  0.120   3.702   1.00 0.00 ? 110 TYR A HB2  5  
ATOM 9546  H HB3  . TYR A 1 110 ? -7.350  -0.692  3.393   1.00 0.00 ? 110 TYR A HB3  5  
ATOM 9547  H HD1  . TYR A 1 110 ? -5.110  2.016   2.299   1.00 0.00 ? 110 TYR A HD1  5  
ATOM 9548  H HD2  . TYR A 1 110 ? -8.664  -0.165  1.454   1.00 0.00 ? 110 TYR A HD2  5  
ATOM 9549  H HE1  . TYR A 1 110 ? -5.156  2.979   0.037   1.00 0.00 ? 110 TYR A HE1  5  
ATOM 9550  H HE2  . TYR A 1 110 ? -8.719  0.792   -0.812  1.00 0.00 ? 110 TYR A HE2  5  
ATOM 9551  H HH   . TYR A 1 110 ? -6.846  3.432   -1.737  1.00 0.00 ? 110 TYR A HH   5  
ATOM 9552  N N    . ARG A 1 111 ? -9.286  -0.239  5.420   1.00 0.00 ? 111 ARG A N    5  
ATOM 9553  C CA   . ARG A 1 111 ? -9.921  -1.087  6.422   1.00 0.00 ? 111 ARG A CA   5  
ATOM 9554  C C    . ARG A 1 111 ? -10.208 -2.475  5.857   1.00 0.00 ? 111 ARG A C    5  
ATOM 9555  O O    . ARG A 1 111 ? -10.866 -2.611  4.825   1.00 0.00 ? 111 ARG A O    5  
ATOM 9556  C CB   . ARG A 1 111 ? -11.221 -0.446  6.913   1.00 0.00 ? 111 ARG A CB   5  
ATOM 9557  C CG   . ARG A 1 111 ? -12.097 -1.389  7.721   1.00 0.00 ? 111 ARG A CG   5  
ATOM 9558  C CD   . ARG A 1 111 ? -13.568 -1.018  7.606   1.00 0.00 ? 111 ARG A CD   5  
ATOM 9559  N NE   . ARG A 1 111 ? -14.437 -2.185  7.730   1.00 0.00 ? 111 ARG A NE   5  
ATOM 9560  C CZ   . ARG A 1 111 ? -15.737 -2.108  7.993   1.00 0.00 ? 111 ARG A CZ   5  
ATOM 9561  N NH1  . ARG A 1 111 ? -16.314 -0.926  8.159   1.00 0.00 ? 111 ARG A NH1  5  
ATOM 9562  N NH2  . ARG A 1 111 ? -16.462 -3.215  8.090   1.00 0.00 ? 111 ARG A NH2  5  
ATOM 9563  H H    . ARG A 1 111 ? -9.764  -0.043  4.588   1.00 0.00 ? 111 ARG A H    5  
ATOM 9564  H HA   . ARG A 1 111 ? -9.241  -1.184  7.255   1.00 0.00 ? 111 ARG A HA   5  
ATOM 9565  H HB2  . ARG A 1 111 ? -10.977 0.404   7.534   1.00 0.00 ? 111 ARG A HB2  5  
ATOM 9566  H HB3  . ARG A 1 111 ? -11.786 -0.107  6.059   1.00 0.00 ? 111 ARG A HB3  5  
ATOM 9567  H HG2  . ARG A 1 111 ? -11.961 -2.395  7.354   1.00 0.00 ? 111 ARG A HG2  5  
ATOM 9568  H HG3  . ARG A 1 111 ? -11.802 -1.339  8.759   1.00 0.00 ? 111 ARG A HG3  5  
ATOM 9569  H HD2  . ARG A 1 111 ? -13.811 -0.316  8.389   1.00 0.00 ? 111 ARG A HD2  5  
ATOM 9570  H HD3  . ARG A 1 111 ? -13.734 -0.557  6.644   1.00 0.00 ? 111 ARG A HD3  5  
ATOM 9571  H HE   . ARG A 1 111 ? -14.031 -3.068  7.611   1.00 0.00 ? 111 ARG A HE   5  
ATOM 9572  H HH11 . ARG A 1 111 ? -15.771 -0.090  8.085   1.00 0.00 ? 111 ARG A HH11 5  
ATOM 9573  H HH12 . ARG A 1 111 ? -17.294 -0.871  8.356   1.00 0.00 ? 111 ARG A HH12 5  
ATOM 9574  H HH21 . ARG A 1 111 ? -16.030 -4.108  7.965   1.00 0.00 ? 111 ARG A HH21 5  
ATOM 9575  H HH22 . ARG A 1 111 ? -17.440 -3.156  8.288   1.00 0.00 ? 111 ARG A HH22 5  
ATOM 9576  N N    . ILE A 1 112 ? -9.710  -3.500  6.538   1.00 0.00 ? 112 ILE A N    5  
ATOM 9577  C CA   . ILE A 1 112 ? -9.913  -4.877  6.104   1.00 0.00 ? 112 ILE A CA   5  
ATOM 9578  C C    . ILE A 1 112 ? -11.359 -5.313  6.319   1.00 0.00 ? 112 ILE A C    5  
ATOM 9579  O O    . ILE A 1 112 ? -11.763 -5.631  7.438   1.00 0.00 ? 112 ILE A O    5  
ATOM 9580  C CB   . ILE A 1 112 ? -8.980  -5.847  6.852   1.00 0.00 ? 112 ILE A CB   5  
ATOM 9581  C CG1  . ILE A 1 112 ? -7.520  -5.429  6.666   1.00 0.00 ? 112 ILE A CG1  5  
ATOM 9582  C CG2  . ILE A 1 112 ? -9.195  -7.271  6.363   1.00 0.00 ? 112 ILE A CG2  5  
ATOM 9583  C CD1  . ILE A 1 112 ? -6.553  -6.210  7.528   1.00 0.00 ? 112 ILE A CD1  5  
ATOM 9584  H H    . ILE A 1 112 ? -9.194  -3.327  7.353   1.00 0.00 ? 112 ILE A H    5  
ATOM 9585  H HA   . ILE A 1 112 ? -9.685  -4.930  5.050   1.00 0.00 ? 112 ILE A HA   5  
ATOM 9586  H HB   . ILE A 1 112 ? -9.226  -5.811  7.902   1.00 0.00 ? 112 ILE A HB   5  
ATOM 9587  H HG12 . ILE A 1 112 ? -7.238  -5.576  5.636   1.00 0.00 ? 112 ILE A HG12 5  
ATOM 9588  H HG13 . ILE A 1 112 ? -7.418  -4.383  6.917   1.00 0.00 ? 112 ILE A HG13 5  
ATOM 9589  H HG21 . ILE A 1 112 ? -8.606  -7.950  6.963   1.00 0.00 ? 112 ILE A HG21 5  
ATOM 9590  H HG22 . ILE A 1 112 ? -10.239 -7.528  6.452   1.00 0.00 ? 112 ILE A HG22 5  
ATOM 9591  H HG23 . ILE A 1 112 ? -8.891  -7.348  5.330   1.00 0.00 ? 112 ILE A HG23 5  
ATOM 9592  H HD11 . ILE A 1 112 ? -7.105  -6.835  8.214   1.00 0.00 ? 112 ILE A HD11 5  
ATOM 9593  H HD12 . ILE A 1 112 ? -5.928  -6.827  6.900   1.00 0.00 ? 112 ILE A HD12 5  
ATOM 9594  H HD13 . ILE A 1 112 ? -5.934  -5.524  8.088   1.00 0.00 ? 112 ILE A HD13 5  
ATOM 9595  N N    . VAL A 1 113 ? -12.134 -5.327  5.240   1.00 0.00 ? 113 VAL A N    5  
ATOM 9596  C CA   . VAL A 1 113 ? -13.534 -5.727  5.309   1.00 0.00 ? 113 VAL A CA   5  
ATOM 9597  C C    . VAL A 1 113 ? -13.670 -7.245  5.355   1.00 0.00 ? 113 VAL A C    5  
ATOM 9598  O O    . VAL A 1 113 ? -13.204 -7.962  4.469   1.00 0.00 ? 113 VAL A O    5  
ATOM 9599  C CB   . VAL A 1 113 ? -14.332 -5.187  4.107   1.00 0.00 ? 113 VAL A CB   5  
ATOM 9600  C CG1  . VAL A 1 113 ? -15.827 -5.324  4.353   1.00 0.00 ? 113 VAL A CG1  5  
ATOM 9601  C CG2  . VAL A 1 113 ? -13.959 -3.739  3.828   1.00 0.00 ? 113 VAL A CG2  5  
ATOM 9602  H H    . VAL A 1 113 ? -11.754 -5.062  4.376   1.00 0.00 ? 113 VAL A H    5  
ATOM 9603  H HA   . VAL A 1 113 ? -13.957 -5.310  6.211   1.00 0.00 ? 113 VAL A HA   5  
ATOM 9604  H HB   . VAL A 1 113 ? -14.078 -5.776  3.238   1.00 0.00 ? 113 VAL A HB   5  
ATOM 9605  H HG11 . VAL A 1 113 ? -16.010 -6.179  4.987   1.00 0.00 ? 113 VAL A HG11 5  
ATOM 9606  H HG12 . VAL A 1 113 ? -16.195 -4.431  4.837   1.00 0.00 ? 113 VAL A HG12 5  
ATOM 9607  H HG13 . VAL A 1 113 ? -16.336 -5.460  3.411   1.00 0.00 ? 113 VAL A HG13 5  
ATOM 9608  H HG21 . VAL A 1 113 ? -13.825 -3.601  2.765   1.00 0.00 ? 113 VAL A HG21 5  
ATOM 9609  H HG22 . VAL A 1 113 ? -14.749 -3.090  4.178   1.00 0.00 ? 113 VAL A HG22 5  
ATOM 9610  H HG23 . VAL A 1 113 ? -13.041 -3.498  4.341   1.00 0.00 ? 113 VAL A HG23 5  
ATOM 9611  N N    . PRO A 1 114 ? -14.325 -7.748  6.412   1.00 0.00 ? 114 PRO A N    5  
ATOM 9612  C CA   . PRO A 1 114 ? -14.539 -9.186  6.599   1.00 0.00 ? 114 PRO A CA   5  
ATOM 9613  C C    . PRO A 1 114 ? -15.526 -9.761  5.589   1.00 0.00 ? 114 PRO A C    5  
ATOM 9614  O O    . PRO A 1 114 ? -15.974 -9.064  4.680   1.00 0.00 ? 114 PRO A O    5  
ATOM 9615  C CB   . PRO A 1 114 ? -15.109 -9.279  8.016   1.00 0.00 ? 114 PRO A CB   5  
ATOM 9616  C CG   . PRO A 1 114 ? -15.741 -7.952  8.258   1.00 0.00 ? 114 PRO A CG   5  
ATOM 9617  C CD   . PRO A 1 114 ? -14.907 -6.952  7.505   1.00 0.00 ? 114 PRO A CD   5  
ATOM 9618  H HA   . PRO A 1 114 ? -13.610 -9.736  6.545   1.00 0.00 ? 114 PRO A HA   5  
ATOM 9619  H HB2  . PRO A 1 114 ? -15.835 -10.078 8.064   1.00 0.00 ? 114 PRO A HB2  5  
ATOM 9620  H HB3  . PRO A 1 114 ? -14.310 -9.468  8.718   1.00 0.00 ? 114 PRO A HB3  5  
ATOM 9621  H HG2  . PRO A 1 114 ? -16.753 -7.954  7.882   1.00 0.00 ? 114 PRO A HG2  5  
ATOM 9622  H HG3  . PRO A 1 114 ? -15.732 -7.728  9.314   1.00 0.00 ? 114 PRO A HG3  5  
ATOM 9623  H HD2  . PRO A 1 114 ? -15.528 -6.159  7.116   1.00 0.00 ? 114 PRO A HD2  5  
ATOM 9624  H HD3  . PRO A 1 114 ? -14.133 -6.551  8.143   1.00 0.00 ? 114 PRO A HD3  5  
ATOM 9625  N N    . GLU A 1 115 ? -15.861 -11.037 5.756   1.00 0.00 ? 115 GLU A N    5  
ATOM 9626  C CA   . GLU A 1 115 ? -16.796 -11.705 4.858   1.00 0.00 ? 115 GLU A CA   5  
ATOM 9627  C C    . GLU A 1 115 ? -18.171 -11.046 4.917   1.00 0.00 ? 115 GLU A C    5  
ATOM 9628  O O    . GLU A 1 115 ? -18.824 -10.854 3.891   1.00 0.00 ? 115 GLU A O    5  
ATOM 9629  C CB   . GLU A 1 115 ? -16.912 -13.188 5.218   1.00 0.00 ? 115 GLU A CB   5  
ATOM 9630  C CG   . GLU A 1 115 ? -17.339 -13.434 6.655   1.00 0.00 ? 115 GLU A CG   5  
ATOM 9631  C CD   . GLU A 1 115 ? -17.767 -14.868 6.899   1.00 0.00 ? 115 GLU A CD   5  
ATOM 9632  O OE1  . GLU A 1 115 ? -17.033 -15.785 6.478   1.00 0.00 ? 115 GLU A OE1  5  
ATOM 9633  O OE2  . GLU A 1 115 ? -18.837 -15.072 7.510   1.00 0.00 ? 115 GLU A OE2  5  
ATOM 9634  H H    . GLU A 1 115 ? -15.470 -11.541 6.500   1.00 0.00 ? 115 GLU A H    5  
ATOM 9635  H HA   . GLU A 1 115 ? -16.411 -11.617 3.854   1.00 0.00 ? 115 GLU A HA   5  
ATOM 9636  H HB2  . GLU A 1 115 ? -17.638 -13.648 4.564   1.00 0.00 ? 115 GLU A HB2  5  
ATOM 9637  H HB3  . GLU A 1 115 ? -15.953 -13.659 5.064   1.00 0.00 ? 115 GLU A HB3  5  
ATOM 9638  H HG2  . GLU A 1 115 ? -16.509 -13.207 7.307   1.00 0.00 ? 115 GLU A HG2  5  
ATOM 9639  H HG3  . GLU A 1 115 ? -18.167 -12.781 6.888   1.00 0.00 ? 115 GLU A HG3  5  
ATOM 9640  N N    . SER A 1 116 ? -18.606 -10.704 6.126   1.00 0.00 ? 116 SER A N    5  
ATOM 9641  C CA   . SER A 1 116 ? -19.905 -10.071 6.320   1.00 0.00 ? 116 SER A CA   5  
ATOM 9642  C C    . SER A 1 116 ? -19.806 -8.923  7.320   1.00 0.00 ? 116 SER A C    5  
ATOM 9643  O O    . SER A 1 116 ? -18.883 -8.870  8.132   1.00 0.00 ? 116 SER A O    5  
ATOM 9644  C CB   . SER A 1 116 ? -20.929 -11.099 6.806   1.00 0.00 ? 116 SER A CB   5  
ATOM 9645  O OG   . SER A 1 116 ? -21.250 -12.023 5.780   1.00 0.00 ? 116 SER A OG   5  
ATOM 9646  H H    . SER A 1 116 ? -18.040 -10.884 6.905   1.00 0.00 ? 116 SER A H    5  
ATOM 9647  H HA   . SER A 1 116 ? -20.228 -9.677  5.368   1.00 0.00 ? 116 SER A HA   5  
ATOM 9648  H HB2  . SER A 1 116 ? -20.521 -11.640 7.646   1.00 0.00 ? 116 SER A HB2  5  
ATOM 9649  H HB3  . SER A 1 116 ? -21.831 -10.588 7.110   1.00 0.00 ? 116 SER A HB3  5  
ATOM 9650  H HG   . SER A 1 116 ? -21.913 -12.639 6.100   1.00 0.00 ? 116 SER A HG   5  
ATOM 9651  N N    . GLY A 1 117 ? -20.766 -8.006  7.255   1.00 0.00 ? 117 GLY A N    5  
ATOM 9652  C CA   . GLY A 1 117 ? -20.770 -6.870  8.159   1.00 0.00 ? 117 GLY A CA   5  
ATOM 9653  C C    . GLY A 1 117 ? -22.140 -6.233  8.284   1.00 0.00 ? 117 GLY A C    5  
ATOM 9654  O O    . GLY A 1 117 ? -23.074 -6.571  7.557   1.00 0.00 ? 117 GLY A O    5  
ATOM 9655  H H    . GLY A 1 117 ? -21.478 -8.100  6.587   1.00 0.00 ? 117 GLY A H    5  
ATOM 9656  H HA2  . GLY A 1 117 ? -20.447 -7.201  9.135   1.00 0.00 ? 117 GLY A HA2  5  
ATOM 9657  H HA3  . GLY A 1 117 ? -20.074 -6.130  7.792   1.00 0.00 ? 117 GLY A HA3  5  
ATOM 9658  N N    . PRO A 1 118 ? -22.273 -5.289  9.227   1.00 0.00 ? 118 PRO A N    5  
ATOM 9659  C CA   . PRO A 1 118 ? -23.536 -4.584  9.469   1.00 0.00 ? 118 PRO A CA   5  
ATOM 9660  C C    . PRO A 1 118 ? -23.897 -3.637  8.330   1.00 0.00 ? 118 PRO A C    5  
ATOM 9661  O O    . PRO A 1 118 ? -24.863 -2.879  8.423   1.00 0.00 ? 118 PRO A O    5  
ATOM 9662  C CB   . PRO A 1 118 ? -23.263 -3.797  10.753  1.00 0.00 ? 118 PRO A CB   5  
ATOM 9663  C CG   . PRO A 1 118 ? -21.785 -3.609  10.775  1.00 0.00 ? 118 PRO A CG   5  
ATOM 9664  C CD   . PRO A 1 118 ? -21.202 -4.836  10.131  1.00 0.00 ? 118 PRO A CD   5  
ATOM 9665  H HA   . PRO A 1 118 ? -24.350 -5.274  9.634   1.00 0.00 ? 118 PRO A HA   5  
ATOM 9666  H HB2  . PRO A 1 118 ? -23.782 -2.850  10.714  1.00 0.00 ? 118 PRO A HB2  5  
ATOM 9667  H HB3  . PRO A 1 118 ? -23.601 -4.365  11.606  1.00 0.00 ? 118 PRO A HB3  5  
ATOM 9668  H HG2  . PRO A 1 118 ? -21.519 -2.727  10.213  1.00 0.00 ? 118 PRO A HG2  5  
ATOM 9669  H HG3  . PRO A 1 118 ? -21.442 -3.523  11.795  1.00 0.00 ? 118 PRO A HG3  5  
ATOM 9670  H HD2  . PRO A 1 118 ? -20.311 -4.583  9.575   1.00 0.00 ? 118 PRO A HD2  5  
ATOM 9671  H HD3  . PRO A 1 118 ? -20.984 -5.586  10.876  1.00 0.00 ? 118 PRO A HD3  5  
ATOM 9672  N N    . SER A 1 119 ? -23.116 -3.685  7.255   1.00 0.00 ? 119 SER A N    5  
ATOM 9673  C CA   . SER A 1 119 ? -23.353 -2.828  6.099   1.00 0.00 ? 119 SER A CA   5  
ATOM 9674  C C    . SER A 1 119 ? -24.044 -3.603  4.981   1.00 0.00 ? 119 SER A C    5  
ATOM 9675  O O    . SER A 1 119 ? -23.469 -4.525  4.403   1.00 0.00 ? 119 SER A O    5  
ATOM 9676  C CB   . SER A 1 119 ? -22.033 -2.245  5.591   1.00 0.00 ? 119 SER A CB   5  
ATOM 9677  O OG   . SER A 1 119 ? -21.151 -3.271  5.170   1.00 0.00 ? 119 SER A OG   5  
ATOM 9678  H H    . SER A 1 119 ? -22.361 -4.310  7.241   1.00 0.00 ? 119 SER A H    5  
ATOM 9679  H HA   . SER A 1 119 ? -23.997 -2.020  6.412   1.00 0.00 ? 119 SER A HA   5  
ATOM 9680  H HB2  . SER A 1 119 ? -22.229 -1.591  4.756   1.00 0.00 ? 119 SER A HB2  5  
ATOM 9681  H HB3  . SER A 1 119 ? -21.561 -1.684  6.385   1.00 0.00 ? 119 SER A HB3  5  
ATOM 9682  H HG   . SER A 1 119 ? -20.892 -3.118  4.259   1.00 0.00 ? 119 SER A HG   5  
ATOM 9683  N N    . SER A 1 120 ? -25.282 -3.221  4.683   1.00 0.00 ? 120 SER A N    5  
ATOM 9684  C CA   . SER A 1 120 ? -26.054 -3.881  3.637   1.00 0.00 ? 120 SER A CA   5  
ATOM 9685  C C    . SER A 1 120 ? -27.054 -2.916  3.008   1.00 0.00 ? 120 SER A C    5  
ATOM 9686  O O    . SER A 1 120 ? -27.409 -1.899  3.602   1.00 0.00 ? 120 SER A O    5  
ATOM 9687  C CB   . SER A 1 120 ? -26.789 -5.096  4.206   1.00 0.00 ? 120 SER A CB   5  
ATOM 9688  O OG   . SER A 1 120 ? -25.893 -6.167  4.448   1.00 0.00 ? 120 SER A OG   5  
ATOM 9689  H H    . SER A 1 120 ? -25.686 -2.479  5.180   1.00 0.00 ? 120 SER A H    5  
ATOM 9690  H HA   . SER A 1 120 ? -25.364 -4.213  2.875   1.00 0.00 ? 120 SER A HA   5  
ATOM 9691  H HB2  . SER A 1 120 ? -27.264 -4.823  5.136   1.00 0.00 ? 120 SER A HB2  5  
ATOM 9692  H HB3  . SER A 1 120 ? -27.540 -5.422  3.501   1.00 0.00 ? 120 SER A HB3  5  
ATOM 9693  H HG   . SER A 1 120 ? -26.291 -6.990  4.155   1.00 0.00 ? 120 SER A HG   5  
ATOM 9694  N N    . GLY A 1 121 ? -27.505 -3.243  1.801   1.00 0.00 ? 121 GLY A N    5  
ATOM 9695  C CA   . GLY A 1 121 ? -28.459 -2.396  1.110   1.00 0.00 ? 121 GLY A CA   5  
ATOM 9696  C C    . GLY A 1 121 ? -29.859 -2.976  1.115   1.00 0.00 ? 121 GLY A C    5  
ATOM 9697  O O    . GLY A 1 121 ? -30.822 -2.289  1.457   1.00 0.00 ? 121 GLY A O    5  
ATOM 9698  H H    . GLY A 1 121 ? -27.186 -4.067  1.375   1.00 0.00 ? 121 GLY A H    5  
ATOM 9699  H HA2  . GLY A 1 121 ? -28.480 -1.429  1.591   1.00 0.00 ? 121 GLY A HA2  5  
ATOM 9700  H HA3  . GLY A 1 121 ? -28.138 -2.271  0.087   1.00 0.00 ? 121 GLY A HA3  5  
ATOM 9701  N N    . GLY A 1 1   ? 3.823   -27.485 -10.710 1.00 0.00 ? 1   GLY A N    6  
ATOM 9702  C CA   . GLY A 1 1   ? 4.489   -28.069 -9.561  1.00 0.00 ? 1   GLY A CA   6  
ATOM 9703  C C    . GLY A 1 1   ? 3.628   -28.034 -8.313  1.00 0.00 ? 1   GLY A C    6  
ATOM 9704  O O    . GLY A 1 1   ? 3.052   -27.000 -7.977  1.00 0.00 ? 1   GLY A O    6  
ATOM 9705  H H1   . GLY A 1 1   ? 3.714   -28.011 -11.530 1.00 0.00 ? 1   GLY A H1   6  
ATOM 9706  H HA2  . GLY A 1 1   ? 4.738   -29.095 -9.785  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9707  H HA3  . GLY A 1 1   ? 5.400   -27.522 -9.370  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9708  N N    . SER A 1 2   ? 3.540   -29.168 -7.625  1.00 0.00 ? 2   SER A N    6  
ATOM 9709  C CA   . SER A 1 2   ? 2.739   -29.265 -6.410  1.00 0.00 ? 2   SER A CA   6  
ATOM 9710  C C    . SER A 1 2   ? 2.840   -27.983 -5.590  1.00 0.00 ? 2   SER A C    6  
ATOM 9711  O O    . SER A 1 2   ? 1.828   -27.401 -5.200  1.00 0.00 ? 2   SER A O    6  
ATOM 9712  C CB   . SER A 1 2   ? 3.193   -30.460 -5.569  1.00 0.00 ? 2   SER A CB   6  
ATOM 9713  O OG   . SER A 1 2   ? 2.567   -30.455 -4.298  1.00 0.00 ? 2   SER A OG   6  
ATOM 9714  H H    . SER A 1 2   ? 4.024   -29.959 -7.944  1.00 0.00 ? 2   SER A H    6  
ATOM 9715  H HA   . SER A 1 2   ? 1.710   -29.411 -6.703  1.00 0.00 ? 2   SER A HA   6  
ATOM 9716  H HB2  . SER A 1 2   ? 2.936   -31.375 -6.080  1.00 0.00 ? 2   SER A HB2  6  
ATOM 9717  H HB3  . SER A 1 2   ? 4.263   -30.413 -5.430  1.00 0.00 ? 2   SER A HB3  6  
ATOM 9718  H HG   . SER A 1 2   ? 1.676   -30.106 -4.381  1.00 0.00 ? 2   SER A HG   6  
ATOM 9719  N N    . SER A 1 3   ? 4.070   -27.549 -5.331  1.00 0.00 ? 3   SER A N    6  
ATOM 9720  C CA   . SER A 1 3   ? 4.305   -26.338 -4.553  1.00 0.00 ? 3   SER A CA   6  
ATOM 9721  C C    . SER A 1 3   ? 4.409   -25.119 -5.464  1.00 0.00 ? 3   SER A C    6  
ATOM 9722  O O    . SER A 1 3   ? 5.289   -25.042 -6.320  1.00 0.00 ? 3   SER A O    6  
ATOM 9723  C CB   . SER A 1 3   ? 5.582   -26.479 -3.723  1.00 0.00 ? 3   SER A CB   6  
ATOM 9724  O OG   . SER A 1 3   ? 5.389   -27.369 -2.637  1.00 0.00 ? 3   SER A OG   6  
ATOM 9725  H H    . SER A 1 3   ? 4.837   -28.057 -5.669  1.00 0.00 ? 3   SER A H    6  
ATOM 9726  H HA   . SER A 1 3   ? 3.466   -26.204 -3.886  1.00 0.00 ? 3   SER A HA   6  
ATOM 9727  H HB2  . SER A 1 3   ? 6.375   -26.860 -4.349  1.00 0.00 ? 3   SER A HB2  6  
ATOM 9728  H HB3  . SER A 1 3   ? 5.864   -25.511 -3.334  1.00 0.00 ? 3   SER A HB3  6  
ATOM 9729  H HG   . SER A 1 3   ? 6.181   -27.388 -2.094  1.00 0.00 ? 3   SER A HG   6  
ATOM 9730  N N    . GLY A 1 4   ? 3.501   -24.166 -5.273  1.00 0.00 ? 4   GLY A N    6  
ATOM 9731  C CA   . GLY A 1 4   ? 3.507   -22.962 -6.085  1.00 0.00 ? 4   GLY A CA   6  
ATOM 9732  C C    . GLY A 1 4   ? 3.481   -21.699 -5.248  1.00 0.00 ? 4   GLY A C    6  
ATOM 9733  O O    . GLY A 1 4   ? 2.921   -21.684 -4.152  1.00 0.00 ? 4   GLY A O    6  
ATOM 9734  H H    . GLY A 1 4   ? 2.822   -24.281 -4.576  1.00 0.00 ? 4   GLY A H    6  
ATOM 9735  H HA2  . GLY A 1 4   ? 4.397   -22.958 -6.696  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9736  H HA3  . GLY A 1 4   ? 2.640   -22.972 -6.729  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9737  N N    . SER A 1 5   ? 4.089   -20.636 -5.764  1.00 0.00 ? 5   SER A N    6  
ATOM 9738  C CA   . SER A 1 5   ? 4.138   -19.363 -5.055  1.00 0.00 ? 5   SER A CA   6  
ATOM 9739  C C    . SER A 1 5   ? 2.732   -18.822 -4.812  1.00 0.00 ? 5   SER A C    6  
ATOM 9740  O O    . SER A 1 5   ? 1.989   -18.547 -5.754  1.00 0.00 ? 5   SER A O    6  
ATOM 9741  C CB   . SER A 1 5   ? 4.958   -18.344 -5.848  1.00 0.00 ? 5   SER A CB   6  
ATOM 9742  O OG   . SER A 1 5   ? 6.341   -18.474 -5.568  1.00 0.00 ? 5   SER A OG   6  
ATOM 9743  H H    . SER A 1 5   ? 4.518   -20.711 -6.643  1.00 0.00 ? 5   SER A H    6  
ATOM 9744  H HA   . SER A 1 5   ? 4.615   -19.533 -4.101  1.00 0.00 ? 5   SER A HA   6  
ATOM 9745  H HB2  . SER A 1 5   ? 4.801   -18.502 -6.904  1.00 0.00 ? 5   SER A HB2  6  
ATOM 9746  H HB3  . SER A 1 5   ? 4.641   -17.346 -5.582  1.00 0.00 ? 5   SER A HB3  6  
ATOM 9747  H HG   . SER A 1 5   ? 6.809   -18.717 -6.370  1.00 0.00 ? 5   SER A HG   6  
ATOM 9748  N N    . SER A 1 6   ? 2.374   -18.673 -3.541  1.00 0.00 ? 6   SER A N    6  
ATOM 9749  C CA   . SER A 1 6   ? 1.056   -18.169 -3.172  1.00 0.00 ? 6   SER A CA   6  
ATOM 9750  C C    . SER A 1 6   ? 0.797   -16.808 -3.810  1.00 0.00 ? 6   SER A C    6  
ATOM 9751  O O    . SER A 1 6   ? 1.715   -16.158 -4.307  1.00 0.00 ? 6   SER A O    6  
ATOM 9752  C CB   . SER A 1 6   ? 0.934   -18.064 -1.650  1.00 0.00 ? 6   SER A CB   6  
ATOM 9753  O OG   . SER A 1 6   ? 0.654   -19.327 -1.072  1.00 0.00 ? 6   SER A OG   6  
ATOM 9754  H H    . SER A 1 6   ? 3.010   -18.910 -2.834  1.00 0.00 ? 6   SER A H    6  
ATOM 9755  H HA   . SER A 1 6   ? 0.319   -18.870 -3.536  1.00 0.00 ? 6   SER A HA   6  
ATOM 9756  H HB2  . SER A 1 6   ? 1.862   -17.692 -1.243  1.00 0.00 ? 6   SER A HB2  6  
ATOM 9757  H HB3  . SER A 1 6   ? 0.134   -17.382 -1.403  1.00 0.00 ? 6   SER A HB3  6  
ATOM 9758  H HG   . SER A 1 6   ? 1.107   -19.401 -0.229  1.00 0.00 ? 6   SER A HG   6  
ATOM 9759  N N    . GLY A 1 7   ? -0.463  -16.382 -3.791  1.00 0.00 ? 7   GLY A N    6  
ATOM 9760  C CA   . GLY A 1 7   ? -0.822  -15.101 -4.371  1.00 0.00 ? 7   GLY A CA   6  
ATOM 9761  C C    . GLY A 1 7   ? -1.942  -14.416 -3.613  1.00 0.00 ? 7   GLY A C    6  
ATOM 9762  O O    . GLY A 1 7   ? -2.998  -14.128 -4.178  1.00 0.00 ? 7   GLY A O    6  
ATOM 9763  H H    . GLY A 1 7   ? -1.154  -16.943 -3.381  1.00 0.00 ? 7   GLY A H    6  
ATOM 9764  H HA2  . GLY A 1 7   ? 0.047   -14.460 -4.366  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9765  H HA3  . GLY A 1 7   ? -1.136  -15.256 -5.392  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9766  N N    . LYS A 1 8   ? -1.714  -14.155 -2.331  1.00 0.00 ? 8   LYS A N    6  
ATOM 9767  C CA   . LYS A 1 8   ? -2.711  -13.499 -1.494  1.00 0.00 ? 8   LYS A CA   6  
ATOM 9768  C C    . LYS A 1 8   ? -2.195  -12.159 -0.980  1.00 0.00 ? 8   LYS A C    6  
ATOM 9769  O O    . LYS A 1 8   ? -1.167  -12.096 -0.304  1.00 0.00 ? 8   LYS A O    6  
ATOM 9770  C CB   . LYS A 1 8   ? -3.088  -14.399 -0.314  1.00 0.00 ? 8   LYS A CB   6  
ATOM 9771  C CG   . LYS A 1 8   ? -4.256  -15.326 -0.605  1.00 0.00 ? 8   LYS A CG   6  
ATOM 9772  C CD   . LYS A 1 8   ? -5.585  -14.671 -0.267  1.00 0.00 ? 8   LYS A CD   6  
ATOM 9773  C CE   . LYS A 1 8   ? -6.758  -15.505 -0.758  1.00 0.00 ? 8   LYS A CE   6  
ATOM 9774  N NZ   . LYS A 1 8   ? -8.004  -15.211 0.003   1.00 0.00 ? 8   LYS A NZ   6  
ATOM 9775  H H    . LYS A 1 8   ? -0.852  -14.408 -1.938  1.00 0.00 ? 8   LYS A H    6  
ATOM 9776  H HA   . LYS A 1 8   ? -3.589  -13.326 -2.098  1.00 0.00 ? 8   LYS A HA   6  
ATOM 9777  H HB2  . LYS A 1 8   ? -2.233  -15.004 -0.051  1.00 0.00 ? 8   LYS A HB2  6  
ATOM 9778  H HB3  . LYS A 1 8   ? -3.351  -13.776 0.528   1.00 0.00 ? 8   LYS A HB3  6  
ATOM 9779  H HG2  . LYS A 1 8   ? -4.249  -15.581 -1.654  1.00 0.00 ? 8   LYS A HG2  6  
ATOM 9780  H HG3  . LYS A 1 8   ? -4.147  -16.224 -0.013  1.00 0.00 ? 8   LYS A HG3  6  
ATOM 9781  H HD2  . LYS A 1 8   ? -5.660  -14.560 0.804   1.00 0.00 ? 8   LYS A HD2  6  
ATOM 9782  H HD3  . LYS A 1 8   ? -5.626  -13.697 -0.735  1.00 0.00 ? 8   LYS A HD3  6  
ATOM 9783  H HE2  . LYS A 1 8   ? -6.924  -15.290 -1.802  1.00 0.00 ? 8   LYS A HE2  6  
ATOM 9784  H HE3  . LYS A 1 8   ? -6.513  -16.551 -0.641  1.00 0.00 ? 8   LYS A HE3  6  
ATOM 9785  H HZ1  . LYS A 1 8   ? -7.772  -14.743 0.902   1.00 0.00 ? 8   LYS A HZ1  6  
ATOM 9786  H HZ2  . LYS A 1 8   ? -8.515  -16.093 0.206   1.00 0.00 ? 8   LYS A HZ2  6  
ATOM 9787  H HZ3  . LYS A 1 8   ? -8.622  -14.585 -0.552  1.00 0.00 ? 8   LYS A HZ3  6  
ATOM 9788  N N    . LEU A 1 9   ? -2.915  -11.090 -1.302  1.00 0.00 ? 9   LEU A N    6  
ATOM 9789  C CA   . LEU A 1 9   ? -2.530  -9.751  -0.871  1.00 0.00 ? 9   LEU A CA   6  
ATOM 9790  C C    . LEU A 1 9   ? -3.015  -9.475  0.548   1.00 0.00 ? 9   LEU A C    6  
ATOM 9791  O O    . LEU A 1 9   ? -2.275  -8.941  1.375   1.00 0.00 ? 9   LEU A O    6  
ATOM 9792  C CB   . LEU A 1 9   ? -3.099  -8.703  -1.829  1.00 0.00 ? 9   LEU A CB   6  
ATOM 9793  C CG   . LEU A 1 9   ? -2.904  -7.242  -1.419  1.00 0.00 ? 9   LEU A CG   6  
ATOM 9794  C CD1  . LEU A 1 9   ? -1.477  -6.796  -1.698  1.00 0.00 ? 9   LEU A CD1  6  
ATOM 9795  C CD2  . LEU A 1 9   ? -3.897  -6.347  -2.147  1.00 0.00 ? 9   LEU A CD2  6  
ATOM 9796  H H    . LEU A 1 9   ? -3.724  -11.203 -1.842  1.00 0.00 ? 9   LEU A H    6  
ATOM 9797  H HA   . LEU A 1 9   ? -1.452  -9.694  -0.888  1.00 0.00 ? 9   LEU A HA   6  
ATOM 9798  H HB2  . LEU A 1 9   ? -2.627  -8.842  -2.790  1.00 0.00 ? 9   LEU A HB2  6  
ATOM 9799  H HB3  . LEU A 1 9   ? -4.161  -8.882  -1.922  1.00 0.00 ? 9   LEU A HB3  6  
ATOM 9800  H HG   . LEU A 1 9   ? -3.082  -7.147  -0.357  1.00 0.00 ? 9   LEU A HG   6  
ATOM 9801  H HD11 . LEU A 1 9   ? -0.923  -7.613  -2.132  1.00 0.00 ? 9   LEU A HD11 6  
ATOM 9802  H HD12 . LEU A 1 9   ? -1.008  -6.493  -0.774  1.00 0.00 ? 9   LEU A HD12 6  
ATOM 9803  H HD13 . LEU A 1 9   ? -1.489  -5.962  -2.385  1.00 0.00 ? 9   LEU A HD13 6  
ATOM 9804  H HD21 . LEU A 1 9   ? -4.300  -6.875  -2.998  1.00 0.00 ? 9   LEU A HD21 6  
ATOM 9805  H HD22 . LEU A 1 9   ? -3.395  -5.452  -2.483  1.00 0.00 ? 9   LEU A HD22 6  
ATOM 9806  H HD23 . LEU A 1 9   ? -4.699  -6.080  -1.475  1.00 0.00 ? 9   LEU A HD23 6  
ATOM 9807  N N    . ARG A 1 10  ? -4.262  -9.844  0.825   1.00 0.00 ? 10  ARG A N    6  
ATOM 9808  C CA   . ARG A 1 10  ? -4.845  -9.637  2.145   1.00 0.00 ? 10  ARG A CA   6  
ATOM 9809  C C    . ARG A 1 10  ? -3.868  -10.051 3.241   1.00 0.00 ? 10  ARG A C    6  
ATOM 9810  O O    . ARG A 1 10  ? -3.358  -9.209  3.980   1.00 0.00 ? 10  ARG A O    6  
ATOM 9811  C CB   . ARG A 1 10  ? -6.146  -10.430 2.280   1.00 0.00 ? 10  ARG A CB   6  
ATOM 9812  C CG   . ARG A 1 10  ? -6.959  -10.060 3.511   1.00 0.00 ? 10  ARG A CG   6  
ATOM 9813  C CD   . ARG A 1 10  ? -8.355  -10.661 3.457   1.00 0.00 ? 10  ARG A CD   6  
ATOM 9814  N NE   . ARG A 1 10  ? -8.960  -10.760 4.783   1.00 0.00 ? 10  ARG A NE   6  
ATOM 9815  C CZ   . ARG A 1 10  ? -10.161 -11.281 5.006   1.00 0.00 ? 10  ARG A CZ   6  
ATOM 9816  N NH1  . ARG A 1 10  ? -10.882 -11.748 3.996   1.00 0.00 ? 10  ARG A NH1  6  
ATOM 9817  N NH2  . ARG A 1 10  ? -10.643 -11.335 6.241   1.00 0.00 ? 10  ARG A NH2  6  
ATOM 9818  H H    . ARG A 1 10  ? -4.802  -10.264 0.124   1.00 0.00 ? 10  ARG A H    6  
ATOM 9819  H HA   . ARG A 1 10  ? -5.062  -8.585  2.250   1.00 0.00 ? 10  ARG A HA   6  
ATOM 9820  H HB2  . ARG A 1 10  ? -6.756  -10.251 1.407   1.00 0.00 ? 10  ARG A HB2  6  
ATOM 9821  H HB3  . ARG A 1 10  ? -5.909  -11.482 2.335   1.00 0.00 ? 10  ARG A HB3  6  
ATOM 9822  H HG2  . ARG A 1 10  ? -6.453  -10.432 4.390   1.00 0.00 ? 10  ARG A HG2  6  
ATOM 9823  H HG3  . ARG A 1 10  ? -7.041  -8.985  3.567   1.00 0.00 ? 10  ARG A HG3  6  
ATOM 9824  H HD2  . ARG A 1 10  ? -8.977  -10.037 2.834   1.00 0.00 ? 10  ARG A HD2  6  
ATOM 9825  H HD3  . ARG A 1 10  ? -8.291  -11.649 3.026   1.00 0.00 ? 10  ARG A HD3  6  
ATOM 9826  H HE   . ARG A 1 10  ? -8.444  -10.420 5.543   1.00 0.00 ? 10  ARG A HE   6  
ATOM 9827  H HH11 . ARG A 1 10  ? -10.521 -11.709 3.065   1.00 0.00 ? 10  ARG A HH11 6  
ATOM 9828  H HH12 . ARG A 1 10  ? -11.786 -12.140 4.167   1.00 0.00 ? 10  ARG A HH12 6  
ATOM 9829  H HH21 . ARG A 1 10  ? -10.102 -10.984 7.004   1.00 0.00 ? 10  ARG A HH21 6  
ATOM 9830  H HH22 . ARG A 1 10  ? -11.547 -11.727 6.407   1.00 0.00 ? 10  ARG A HH22 6  
ATOM 9831  N N    . GLN A 1 11  ? -3.614  -11.351 3.341   1.00 0.00 ? 11  GLN A N    6  
ATOM 9832  C CA   . GLN A 1 11  ? -2.699  -11.876 4.348   1.00 0.00 ? 11  GLN A CA   6  
ATOM 9833  C C    . GLN A 1 11  ? -1.298  -11.305 4.161   1.00 0.00 ? 11  GLN A C    6  
ATOM 9834  O O    . GLN A 1 11  ? -0.751  -10.667 5.061   1.00 0.00 ? 11  GLN A O    6  
ATOM 9835  C CB   . GLN A 1 11  ? -2.654  -13.403 4.280   1.00 0.00 ? 11  GLN A CB   6  
ATOM 9836  C CG   . GLN A 1 11  ? -1.580  -14.020 5.162   1.00 0.00 ? 11  GLN A CG   6  
ATOM 9837  C CD   . GLN A 1 11  ? -1.806  -13.745 6.636   1.00 0.00 ? 11  GLN A CD   6  
ATOM 9838  O OE1  . GLN A 1 11  ? -2.488  -14.505 7.323   1.00 0.00 ? 11  GLN A OE1  6  
ATOM 9839  N NE2  . GLN A 1 11  ? -1.232  -12.654 7.129   1.00 0.00 ? 11  GLN A NE2  6  
ATOM 9840  H H    . GLN A 1 11  ? -4.052  -11.972 2.723   1.00 0.00 ? 11  GLN A H    6  
ATOM 9841  H HA   . GLN A 1 11  ? -3.069  -11.578 5.318   1.00 0.00 ? 11  GLN A HA   6  
ATOM 9842  H HB2  . GLN A 1 11  ? -3.612  -13.794 4.590   1.00 0.00 ? 11  GLN A HB2  6  
ATOM 9843  H HB3  . GLN A 1 11  ? -2.466  -13.701 3.259   1.00 0.00 ? 11  GLN A HB3  6  
ATOM 9844  H HG2  . GLN A 1 11  ? -1.575  -15.089 5.008   1.00 0.00 ? 11  GLN A HG2  6  
ATOM 9845  H HG3  . GLN A 1 11  ? -0.621  -13.612 4.877   1.00 0.00 ? 11  GLN A HG3  6  
ATOM 9846  H HE21 . GLN A 1 11  ? -0.704  -12.094 6.522   1.00 0.00 ? 11  GLN A HE21 6  
ATOM 9847  H HE22 . GLN A 1 11  ? -1.362  -12.451 8.078   1.00 0.00 ? 11  GLN A HE22 6  
ATOM 9848  N N    . TRP A 1 12  ? -0.721  -11.539 2.987   1.00 0.00 ? 12  TRP A N    6  
ATOM 9849  C CA   . TRP A 1 12  ? 0.618   -11.048 2.682   1.00 0.00 ? 12  TRP A CA   6  
ATOM 9850  C C    . TRP A 1 12  ? 0.847   -9.672  3.298   1.00 0.00 ? 12  TRP A C    6  
ATOM 9851  O O    . TRP A 1 12  ? 1.769   -9.482  4.092   1.00 0.00 ? 12  TRP A O    6  
ATOM 9852  C CB   . TRP A 1 12  ? 0.827   -10.984 1.169   1.00 0.00 ? 12  TRP A CB   6  
ATOM 9853  C CG   . TRP A 1 12  ? 2.145   -10.387 0.776   1.00 0.00 ? 12  TRP A CG   6  
ATOM 9854  C CD1  . TRP A 1 12  ? 3.321   -11.054 0.580   1.00 0.00 ? 12  TRP A CD1  6  
ATOM 9855  C CD2  . TRP A 1 12  ? 2.421   -9.003  0.534   1.00 0.00 ? 12  TRP A CD2  6  
ATOM 9856  N NE1  . TRP A 1 12  ? 4.311   -10.168 0.230   1.00 0.00 ? 12  TRP A NE1  6  
ATOM 9857  C CE2  . TRP A 1 12  ? 3.785   -8.904  0.195   1.00 0.00 ? 12  TRP A CE2  6  
ATOM 9858  C CE3  . TRP A 1 12  ? 1.649   -7.839  0.569   1.00 0.00 ? 12  TRP A CE3  6  
ATOM 9859  C CZ2  . TRP A 1 12  ? 4.389   -7.686  -0.106  1.00 0.00 ? 12  TRP A CZ2  6  
ATOM 9860  C CZ3  . TRP A 1 12  ? 2.251   -6.631  0.271   1.00 0.00 ? 12  TRP A CZ3  6  
ATOM 9861  C CH2  . TRP A 1 12  ? 3.610   -6.562  -0.063  1.00 0.00 ? 12  TRP A CH2  6  
ATOM 9862  H H    . TRP A 1 12  ? -1.208  -12.054 2.309   1.00 0.00 ? 12  TRP A H    6  
ATOM 9863  H HA   . TRP A 1 12  ? 1.329   -11.742 3.106   1.00 0.00 ? 12  TRP A HA   6  
ATOM 9864  H HB2  . TRP A 1 12  ? 0.780   -11.983 0.762   1.00 0.00 ? 12  TRP A HB2  6  
ATOM 9865  H HB3  . TRP A 1 12  ? 0.044   -10.383 0.729   1.00 0.00 ? 12  TRP A HB3  6  
ATOM 9866  H HD1  . TRP A 1 12  ? 3.440   -12.121 0.689   1.00 0.00 ? 12  TRP A HD1  6  
ATOM 9867  H HE1  . TRP A 1 12  ? 5.243   -10.403 0.037   1.00 0.00 ? 12  TRP A HE1  6  
ATOM 9868  H HE3  . TRP A 1 12  ? 0.600   -7.872  0.825   1.00 0.00 ? 12  TRP A HE3  6  
ATOM 9869  H HZ2  . TRP A 1 12  ? 5.436   -7.616  -0.366  1.00 0.00 ? 12  TRP A HZ2  6  
ATOM 9870  H HZ3  . TRP A 1 12  ? 1.670   -5.721  0.294   1.00 0.00 ? 12  TRP A HZ3  6  
ATOM 9871  H HH2  . TRP A 1 12  ? 4.038   -5.598  -0.289  1.00 0.00 ? 12  TRP A HH2  6  
ATOM 9872  N N    . LEU A 1 13  ? 0.003   -8.715  2.928   1.00 0.00 ? 13  LEU A N    6  
ATOM 9873  C CA   . LEU A 1 13  ? 0.113   -7.356  3.446   1.00 0.00 ? 13  LEU A CA   6  
ATOM 9874  C C    . LEU A 1 13  ? 0.037   -7.345  4.969   1.00 0.00 ? 13  LEU A C    6  
ATOM 9875  O O    . LEU A 1 13  ? 0.966   -6.900  5.643   1.00 0.00 ? 13  LEU A O    6  
ATOM 9876  C CB   . LEU A 1 13  ? -0.994  -6.476  2.862   1.00 0.00 ? 13  LEU A CB   6  
ATOM 9877  C CG   . LEU A 1 13  ? -0.836  -4.970  3.074   1.00 0.00 ? 13  LEU A CG   6  
ATOM 9878  C CD1  . LEU A 1 13  ? 0.421   -4.463  2.384   1.00 0.00 ? 13  LEU A CD1  6  
ATOM 9879  C CD2  . LEU A 1 13  ? -2.063  -4.228  2.564   1.00 0.00 ? 13  LEU A CD2  6  
ATOM 9880  H H    . LEU A 1 13  ? -0.712  -8.927  2.293   1.00 0.00 ? 13  LEU A H    6  
ATOM 9881  H HA   . LEU A 1 13  ? 1.072   -6.963  3.142   1.00 0.00 ? 13  LEU A HA   6  
ATOM 9882  H HB2  . LEU A 1 13  ? -1.034  -6.657  1.799   1.00 0.00 ? 13  LEU A HB2  6  
ATOM 9883  H HB3  . LEU A 1 13  ? -1.928  -6.778  3.313   1.00 0.00 ? 13  LEU A HB3  6  
ATOM 9884  H HG   . LEU A 1 13  ? -0.738  -4.770  4.132   1.00 0.00 ? 13  LEU A HG   6  
ATOM 9885  H HD11 . LEU A 1 13  ? 0.331   -4.610  1.318   1.00 0.00 ? 13  LEU A HD11 6  
ATOM 9886  H HD12 . LEU A 1 13  ? 1.278   -5.007  2.751   1.00 0.00 ? 13  LEU A HD12 6  
ATOM 9887  H HD13 . LEU A 1 13  ? 0.547   -3.410  2.593   1.00 0.00 ? 13  LEU A HD13 6  
ATOM 9888  H HD21 . LEU A 1 13  ? -2.938  -4.845  2.701   1.00 0.00 ? 13  LEU A HD21 6  
ATOM 9889  H HD22 . LEU A 1 13  ? -1.939  -4.007  1.514   1.00 0.00 ? 13  LEU A HD22 6  
ATOM 9890  H HD23 . LEU A 1 13  ? -2.181  -3.307  3.115   1.00 0.00 ? 13  LEU A HD23 6  
ATOM 9891  N N    . ILE A 1 14  ? -1.075  -7.839  5.504   1.00 0.00 ? 14  ILE A N    6  
ATOM 9892  C CA   . ILE A 1 14  ? -1.270  -7.889  6.948   1.00 0.00 ? 14  ILE A CA   6  
ATOM 9893  C C    . ILE A 1 14  ? -0.004  -8.355  7.658   1.00 0.00 ? 14  ILE A C    6  
ATOM 9894  O O    . ILE A 1 14  ? 0.367   -7.820  8.703   1.00 0.00 ? 14  ILE A O    6  
ATOM 9895  C CB   . ILE A 1 14  ? -2.432  -8.825  7.326   1.00 0.00 ? 14  ILE A CB   6  
ATOM 9896  C CG1  . ILE A 1 14  ? -3.743  -8.317  6.723   1.00 0.00 ? 14  ILE A CG1  6  
ATOM 9897  C CG2  . ILE A 1 14  ? -2.549  -8.940  8.839   1.00 0.00 ? 14  ILE A CG2  6  
ATOM 9898  C CD1  . ILE A 1 14  ? -4.789  -9.397  6.555   1.00 0.00 ? 14  ILE A CD1  6  
ATOM 9899  H H    . ILE A 1 14  ? -1.779  -8.178  4.914   1.00 0.00 ? 14  ILE A H    6  
ATOM 9900  H HA   . ILE A 1 14  ? -1.513  -6.891  7.285   1.00 0.00 ? 14  ILE A HA   6  
ATOM 9901  H HB   . ILE A 1 14  ? -2.218  -9.806  6.931   1.00 0.00 ? 14  ILE A HB   6  
ATOM 9902  H HG12 . ILE A 1 14  ? -4.155  -7.554  7.363   1.00 0.00 ? 14  ILE A HG12 6  
ATOM 9903  H HG13 . ILE A 1 14  ? -3.542  -7.894  5.749   1.00 0.00 ? 14  ILE A HG13 6  
ATOM 9904  H HG21 . ILE A 1 14  ? -3.045  -9.865  9.093   1.00 0.00 ? 14  ILE A HG21 6  
ATOM 9905  H HG22 . ILE A 1 14  ? -1.562  -8.930  9.277   1.00 0.00 ? 14  ILE A HG22 6  
ATOM 9906  H HG23 . ILE A 1 14  ? -3.121  -8.108  9.220   1.00 0.00 ? 14  ILE A HG23 6  
ATOM 9907  H HD11 . ILE A 1 14  ? -5.770  -8.946  6.517   1.00 0.00 ? 14  ILE A HD11 6  
ATOM 9908  H HD12 . ILE A 1 14  ? -4.606  -9.938  5.639   1.00 0.00 ? 14  ILE A HD12 6  
ATOM 9909  H HD13 . ILE A 1 14  ? -4.740  -10.079 7.391   1.00 0.00 ? 14  ILE A HD13 6  
ATOM 9910  N N    . ASP A 1 15  ? 0.656   -9.354  7.083   1.00 0.00 ? 15  ASP A N    6  
ATOM 9911  C CA   . ASP A 1 15  ? 1.884   -9.891  7.659   1.00 0.00 ? 15  ASP A CA   6  
ATOM 9912  C C    . ASP A 1 15  ? 2.973   -8.825  7.708   1.00 0.00 ? 15  ASP A C    6  
ATOM 9913  O O    . ASP A 1 15  ? 3.751   -8.763  8.660   1.00 0.00 ? 15  ASP A O    6  
ATOM 9914  C CB   . ASP A 1 15  ? 2.368   -11.096 6.850   1.00 0.00 ? 15  ASP A CB   6  
ATOM 9915  C CG   . ASP A 1 15  ? 3.405   -11.914 7.594   1.00 0.00 ? 15  ASP A CG   6  
ATOM 9916  O OD1  . ASP A 1 15  ? 3.022   -12.648 8.529   1.00 0.00 ? 15  ASP A OD1  6  
ATOM 9917  O OD2  . ASP A 1 15  ? 4.600   -11.819 7.242   1.00 0.00 ? 15  ASP A OD2  6  
ATOM 9918  H H    . ASP A 1 15  ? 0.310   -9.739  6.251   1.00 0.00 ? 15  ASP A H    6  
ATOM 9919  H HA   . ASP A 1 15  ? 1.665   -10.211 8.667   1.00 0.00 ? 15  ASP A HA   6  
ATOM 9920  H HB2  . ASP A 1 15  ? 1.525   -11.734 6.628   1.00 0.00 ? 15  ASP A HB2  6  
ATOM 9921  H HB3  . ASP A 1 15  ? 2.804   -10.748 5.926   1.00 0.00 ? 15  ASP A HB3  6  
ATOM 9922  N N    . GLN A 1 16  ? 3.022   -7.988  6.676   1.00 0.00 ? 16  GLN A N    6  
ATOM 9923  C CA   . GLN A 1 16  ? 4.018   -6.926  6.602   1.00 0.00 ? 16  GLN A CA   6  
ATOM 9924  C C    . GLN A 1 16  ? 3.760   -5.863  7.665   1.00 0.00 ? 16  GLN A C    6  
ATOM 9925  O O    . GLN A 1 16  ? 4.696   -5.323  8.256   1.00 0.00 ? 16  GLN A O    6  
ATOM 9926  C CB   . GLN A 1 16  ? 4.010   -6.287  5.212   1.00 0.00 ? 16  GLN A CB   6  
ATOM 9927  C CG   . GLN A 1 16  ? 4.151   -7.291  4.080   1.00 0.00 ? 16  GLN A CG   6  
ATOM 9928  C CD   . GLN A 1 16  ? 5.098   -8.425  4.420   1.00 0.00 ? 16  GLN A CD   6  
ATOM 9929  O OE1  . GLN A 1 16  ? 6.251   -8.197  4.788   1.00 0.00 ? 16  GLN A OE1  6  
ATOM 9930  N NE2  . GLN A 1 16  ? 4.616   -9.656  4.300   1.00 0.00 ? 16  GLN A NE2  6  
ATOM 9931  H H    . GLN A 1 16  ? 2.375   -8.089  5.949   1.00 0.00 ? 16  GLN A H    6  
ATOM 9932  H HA   . GLN A 1 16  ? 4.987   -7.367  6.779   1.00 0.00 ? 16  GLN A HA   6  
ATOM 9933  H HB2  . GLN A 1 16  ? 3.079   -5.755  5.079   1.00 0.00 ? 16  GLN A HB2  6  
ATOM 9934  H HB3  . GLN A 1 16  ? 4.829   -5.586  5.146   1.00 0.00 ? 16  GLN A HB3  6  
ATOM 9935  H HG2  . GLN A 1 16  ? 3.179   -7.709  3.862   1.00 0.00 ? 16  GLN A HG2  6  
ATOM 9936  H HG3  . GLN A 1 16  ? 4.525   -6.779  3.206   1.00 0.00 ? 16  GLN A HG3  6  
ATOM 9937  H HE21 . GLN A 1 16  ? 3.688   -9.762  4.001   1.00 0.00 ? 16  GLN A HE21 6  
ATOM 9938  H HE22 . GLN A 1 16  ? 5.207   -10.408 4.513   1.00 0.00 ? 16  GLN A HE22 6  
ATOM 9939  N N    . ILE A 1 17  ? 2.487   -5.567  7.902   1.00 0.00 ? 17  ILE A N    6  
ATOM 9940  C CA   . ILE A 1 17  ? 2.107   -4.569  8.894   1.00 0.00 ? 17  ILE A CA   6  
ATOM 9941  C C    . ILE A 1 17  ? 2.406   -5.057  10.307  1.00 0.00 ? 17  ILE A C    6  
ATOM 9942  O O    . ILE A 1 17  ? 3.030   -4.351  11.100  1.00 0.00 ? 17  ILE A O    6  
ATOM 9943  C CB   . ILE A 1 17  ? 0.612   -4.214  8.792   1.00 0.00 ? 17  ILE A CB   6  
ATOM 9944  C CG1  . ILE A 1 17  ? 0.229   -3.941  7.336   1.00 0.00 ? 17  ILE A CG1  6  
ATOM 9945  C CG2  . ILE A 1 17  ? 0.293   -3.009  9.664   1.00 0.00 ? 17  ILE A CG2  6  
ATOM 9946  C CD1  . ILE A 1 17  ? -1.210  -4.279  7.016   1.00 0.00 ? 17  ILE A CD1  6  
ATOM 9947  H H    . ILE A 1 17  ? 1.786   -6.031  7.399   1.00 0.00 ? 17  ILE A H    6  
ATOM 9948  H HA   . ILE A 1 17  ? 2.683   -3.675  8.704   1.00 0.00 ? 17  ILE A HA   6  
ATOM 9949  H HB   . ILE A 1 17  ? 0.040   -5.053  9.156   1.00 0.00 ? 17  ILE A HB   6  
ATOM 9950  H HG12 . ILE A 1 17  ? 0.379   -2.895  7.120   1.00 0.00 ? 17  ILE A HG12 6  
ATOM 9951  H HG13 . ILE A 1 17  ? 0.861   -4.532  6.688   1.00 0.00 ? 17  ILE A HG13 6  
ATOM 9952  H HG21 . ILE A 1 17  ? 0.634   -2.109  9.173   1.00 0.00 ? 17  ILE A HG21 6  
ATOM 9953  H HG22 . ILE A 1 17  ? -0.774  -2.950  9.819   1.00 0.00 ? 17  ILE A HG22 6  
ATOM 9954  H HG23 . ILE A 1 17  ? 0.791   -3.111  10.616  1.00 0.00 ? 17  ILE A HG23 6  
ATOM 9955  H HD11 . ILE A 1 17  ? -1.796  -3.372  6.988   1.00 0.00 ? 17  ILE A HD11 6  
ATOM 9956  H HD12 . ILE A 1 17  ? -1.261  -4.772  6.057   1.00 0.00 ? 17  ILE A HD12 6  
ATOM 9957  H HD13 . ILE A 1 17  ? -1.604  -4.936  7.779   1.00 0.00 ? 17  ILE A HD13 6  
ATOM 9958  N N    . ASP A 1 18  ? 1.959   -6.270  10.616  1.00 0.00 ? 18  ASP A N    6  
ATOM 9959  C CA   . ASP A 1 18  ? 2.182   -6.855  11.933  1.00 0.00 ? 18  ASP A CA   6  
ATOM 9960  C C    . ASP A 1 18  ? 3.658   -6.796  12.311  1.00 0.00 ? 18  ASP A C    6  
ATOM 9961  O O    . ASP A 1 18  ? 4.010   -6.391  13.419  1.00 0.00 ? 18  ASP A O    6  
ATOM 9962  C CB   . ASP A 1 18  ? 1.692   -8.303  11.960  1.00 0.00 ? 18  ASP A CB   6  
ATOM 9963  C CG   . ASP A 1 18  ? 1.401   -8.790  13.366  1.00 0.00 ? 18  ASP A CG   6  
ATOM 9964  O OD1  . ASP A 1 18  ? 2.206   -8.496  14.275  1.00 0.00 ? 18  ASP A OD1  6  
ATOM 9965  O OD2  . ASP A 1 18  ? 0.368   -9.464  13.558  1.00 0.00 ? 18  ASP A OD2  6  
ATOM 9966  H H    . ASP A 1 18  ? 1.469   -6.784  9.940   1.00 0.00 ? 18  ASP A H    6  
ATOM 9967  H HA   . ASP A 1 18  ? 1.616   -6.280  12.651  1.00 0.00 ? 18  ASP A HA   6  
ATOM 9968  H HB2  . ASP A 1 18  ? 0.786   -8.382  11.377  1.00 0.00 ? 18  ASP A HB2  6  
ATOM 9969  H HB3  . ASP A 1 18  ? 2.450   -8.941  11.527  1.00 0.00 ? 18  ASP A HB3  6  
ATOM 9970  N N    . SER A 1 19  ? 4.518   -7.204  11.383  1.00 0.00 ? 19  SER A N    6  
ATOM 9971  C CA   . SER A 1 19  ? 5.957   -7.203  11.621  1.00 0.00 ? 19  SER A CA   6  
ATOM 9972  C C    . SER A 1 19  ? 6.469   -5.784  11.845  1.00 0.00 ? 19  SER A C    6  
ATOM 9973  O O    . SER A 1 19  ? 7.387   -5.560  12.633  1.00 0.00 ? 19  SER A O    6  
ATOM 9974  C CB   . SER A 1 19  ? 6.691   -7.843  10.441  1.00 0.00 ? 19  SER A CB   6  
ATOM 9975  O OG   . SER A 1 19  ? 6.251   -7.296  9.210   1.00 0.00 ? 19  SER A OG   6  
ATOM 9976  H H    . SER A 1 19  ? 4.176   -7.516  10.519  1.00 0.00 ? 19  SER A H    6  
ATOM 9977  H HA   . SER A 1 19  ? 6.146   -7.786  12.510  1.00 0.00 ? 19  SER A HA   6  
ATOM 9978  H HB2  . SER A 1 19  ? 7.751   -7.666  10.541  1.00 0.00 ? 19  SER A HB2  6  
ATOM 9979  H HB3  . SER A 1 19  ? 6.502   -8.906  10.437  1.00 0.00 ? 19  SER A HB3  6  
ATOM 9980  H HG   . SER A 1 19  ? 6.285   -6.337  9.255   1.00 0.00 ? 19  SER A HG   6  
ATOM 9981  N N    . GLY A 1 20  ? 5.869   -4.827  11.143  1.00 0.00 ? 20  GLY A N    6  
ATOM 9982  C CA   . GLY A 1 20  ? 6.277   -3.441  11.278  1.00 0.00 ? 20  GLY A CA   6  
ATOM 9983  C C    . GLY A 1 20  ? 7.696   -3.205  10.800  1.00 0.00 ? 20  GLY A C    6  
ATOM 9984  O O    . GLY A 1 20  ? 8.382   -2.306  11.286  1.00 0.00 ? 20  GLY A O    6  
ATOM 9985  H H    . GLY A 1 20  ? 5.142   -5.064  10.529  1.00 0.00 ? 20  GLY A H    6  
ATOM 9986  H HA2  . GLY A 1 20  ? 5.606   -2.822  10.701  1.00 0.00 ? 20  GLY A HA2  6  
ATOM 9987  H HA3  . GLY A 1 20  ? 6.208   -3.157  12.318  1.00 0.00 ? 20  GLY A HA3  6  
ATOM 9988  N N    . LYS A 1 21  ? 8.139   -4.016  9.846   1.00 0.00 ? 21  LYS A N    6  
ATOM 9989  C CA   . LYS A 1 21  ? 9.486   -3.893  9.301   1.00 0.00 ? 21  LYS A CA   6  
ATOM 9990  C C    . LYS A 1 21  ? 9.604   -2.657  8.415   1.00 0.00 ? 21  LYS A C    6  
ATOM 9991  O O    . LYS A 1 21  ? 10.628  -1.974  8.419   1.00 0.00 ? 21  LYS A O    6  
ATOM 9992  C CB   . LYS A 1 21  ? 9.851   -5.145  8.500   1.00 0.00 ? 21  LYS A CB   6  
ATOM 9993  C CG   . LYS A 1 21  ? 9.467   -6.442  9.190   1.00 0.00 ? 21  LYS A CG   6  
ATOM 9994  C CD   . LYS A 1 21  ? 10.412  -7.573  8.818   1.00 0.00 ? 21  LYS A CD   6  
ATOM 9995  C CE   . LYS A 1 21  ? 10.183  -8.043  7.390   1.00 0.00 ? 21  LYS A CE   6  
ATOM 9996  N NZ   . LYS A 1 21  ? 10.921  -7.206  6.405   1.00 0.00 ? 21  LYS A NZ   6  
ATOM 9997  H H    . LYS A 1 21  ? 7.545   -4.715  9.498   1.00 0.00 ? 21  LYS A H    6  
ATOM 9998  H HA   . LYS A 1 21  ? 10.171  -3.794  10.129  1.00 0.00 ? 21  LYS A HA   6  
ATOM 9999  H HB2  . LYS A 1 21  ? 9.347   -5.106  7.545   1.00 0.00 ? 21  LYS A HB2  6  
ATOM 10000 H HB3  . LYS A 1 21  ? 10.919  -5.153  8.333   1.00 0.00 ? 21  LYS A HB3  6  
ATOM 10001 H HG2  . LYS A 1 21  ? 9.503   -6.295  10.259  1.00 0.00 ? 21  LYS A HG2  6  
ATOM 10002 H HG3  . LYS A 1 21  ? 8.463   -6.713  8.895   1.00 0.00 ? 21  LYS A HG3  6  
ATOM 10003 H HD2  . LYS A 1 21  ? 11.430  -7.225  8.911   1.00 0.00 ? 21  LYS A HD2  6  
ATOM 10004 H HD3  . LYS A 1 21  ? 10.250  -8.402  9.492   1.00 0.00 ? 21  LYS A HD3  6  
ATOM 10005 H HE2  . LYS A 1 21  ? 10.519  -9.065  7.304   1.00 0.00 ? 21  LYS A HE2  6  
ATOM 10006 H HE3  . LYS A 1 21  ? 9.126   -7.992  7.174   1.00 0.00 ? 21  LYS A HE3  6  
ATOM 10007 H HZ1  . LYS A 1 21  ? 10.730  -6.198  6.579   1.00 0.00 ? 21  LYS A HZ1  6  
ATOM 10008 H HZ2  . LYS A 1 21  ? 10.619  -7.442  5.438   1.00 0.00 ? 21  LYS A HZ2  6  
ATOM 10009 H HZ3  . LYS A 1 21  ? 11.944  -7.373  6.488   1.00 0.00 ? 21  LYS A HZ3  6  
ATOM 10010 N N    . TYR A 1 22  ? 8.550   -2.375  7.658   1.00 0.00 ? 22  TYR A N    6  
ATOM 10011 C CA   . TYR A 1 22  ? 8.536   -1.222  6.766   1.00 0.00 ? 22  TYR A CA   6  
ATOM 10012 C C    . TYR A 1 22  ? 8.021   0.019   7.488   1.00 0.00 ? 22  TYR A C    6  
ATOM 10013 O O    . TYR A 1 22  ? 7.092   -0.041  8.294   1.00 0.00 ? 22  TYR A O    6  
ATOM 10014 C CB   . TYR A 1 22  ? 7.667   -1.510  5.540   1.00 0.00 ? 22  TYR A CB   6  
ATOM 10015 C CG   . TYR A 1 22  ? 7.858   -2.899  4.975   1.00 0.00 ? 22  TYR A CG   6  
ATOM 10016 C CD1  . TYR A 1 22  ? 7.150   -3.981  5.485   1.00 0.00 ? 22  TYR A CD1  6  
ATOM 10017 C CD2  . TYR A 1 22  ? 8.745   -3.130  3.931   1.00 0.00 ? 22  TYR A CD2  6  
ATOM 10018 C CE1  . TYR A 1 22  ? 7.322   -5.252  4.973   1.00 0.00 ? 22  TYR A CE1  6  
ATOM 10019 C CE2  . TYR A 1 22  ? 8.922   -4.398  3.411   1.00 0.00 ? 22  TYR A CE2  6  
ATOM 10020 C CZ   . TYR A 1 22  ? 8.208   -5.456  3.936   1.00 0.00 ? 22  TYR A CZ   6  
ATOM 10021 O OH   . TYR A 1 22  ? 8.381   -6.720  3.422   1.00 0.00 ? 22  TYR A OH   6  
ATOM 10022 H H    . TYR A 1 22  ? 7.762   -2.958  7.698   1.00 0.00 ? 22  TYR A H    6  
ATOM 10023 H HA   . TYR A 1 22  ? 9.550   -1.041  6.442   1.00 0.00 ? 22  TYR A HA   6  
ATOM 10024 H HB2  . TYR A 1 22  ? 6.628   -1.402  5.810   1.00 0.00 ? 22  TYR A HB2  6  
ATOM 10025 H HB3  . TYR A 1 22  ? 7.908   -0.799  4.762   1.00 0.00 ? 22  TYR A HB3  6  
ATOM 10026 H HD1  . TYR A 1 22  ? 6.456   -3.818  6.297   1.00 0.00 ? 22  TYR A HD1  6  
ATOM 10027 H HD2  . TYR A 1 22  ? 9.302   -2.300  3.522   1.00 0.00 ? 22  TYR A HD2  6  
ATOM 10028 H HE1  . TYR A 1 22  ? 6.763   -6.080  5.383   1.00 0.00 ? 22  TYR A HE1  6  
ATOM 10029 H HE2  . TYR A 1 22  ? 9.616   -4.558  2.599   1.00 0.00 ? 22  TYR A HE2  6  
ATOM 10030 H HH   . TYR A 1 22  ? 7.911   -7.355  3.969   1.00 0.00 ? 22  TYR A HH   6  
ATOM 10031 N N    . PRO A 1 23  ? 8.638   1.173   7.193   1.00 0.00 ? 23  PRO A N    6  
ATOM 10032 C CA   . PRO A 1 23  ? 8.259   2.451   7.802   1.00 0.00 ? 23  PRO A CA   6  
ATOM 10033 C C    . PRO A 1 23  ? 6.898   2.942   7.320   1.00 0.00 ? 23  PRO A C    6  
ATOM 10034 O O    . PRO A 1 23  ? 6.524   2.732   6.166   1.00 0.00 ? 23  PRO A O    6  
ATOM 10035 C CB   . PRO A 1 23  ? 9.364   3.405   7.342   1.00 0.00 ? 23  PRO A CB   6  
ATOM 10036 C CG   . PRO A 1 23  ? 9.878   2.808   6.077   1.00 0.00 ? 23  PRO A CG   6  
ATOM 10037 C CD   . PRO A 1 23  ? 9.752   1.318   6.242   1.00 0.00 ? 23  PRO A CD   6  
ATOM 10038 H HA   . PRO A 1 23  ? 8.257   2.392   8.880   1.00 0.00 ? 23  PRO A HA   6  
ATOM 10039 H HB2  . PRO A 1 23  ? 8.949   4.389   7.175   1.00 0.00 ? 23  PRO A HB2  6  
ATOM 10040 H HB3  . PRO A 1 23  ? 10.136  3.457   8.095   1.00 0.00 ? 23  PRO A HB3  6  
ATOM 10041 H HG2  . PRO A 1 23  ? 9.281   3.145   5.243   1.00 0.00 ? 23  PRO A HG2  6  
ATOM 10042 H HG3  . PRO A 1 23  ? 10.912  3.083   5.935   1.00 0.00 ? 23  PRO A HG3  6  
ATOM 10043 H HD2  . PRO A 1 23  ? 9.516   0.853   5.296   1.00 0.00 ? 23  PRO A HD2  6  
ATOM 10044 H HD3  . PRO A 1 23  ? 10.663  0.906   6.650   1.00 0.00 ? 23  PRO A HD3  6  
ATOM 10045 N N    . GLY A 1 24  ? 6.160   3.598   8.211   1.00 0.00 ? 24  GLY A N    6  
ATOM 10046 C CA   . GLY A 1 24  ? 4.849   4.109   7.857   1.00 0.00 ? 24  GLY A CA   6  
ATOM 10047 C C    . GLY A 1 24  ? 3.751   3.087   8.074   1.00 0.00 ? 24  GLY A C    6  
ATOM 10048 O O    . GLY A 1 24  ? 2.676   3.417   8.577   1.00 0.00 ? 24  GLY A O    6  
ATOM 10049 H H    . GLY A 1 24  ? 6.510   3.736   9.116   1.00 0.00 ? 24  GLY A H    6  
ATOM 10050 H HA2  . GLY A 1 24  ? 4.640   4.981   8.458   1.00 0.00 ? 24  GLY A HA2  6  
ATOM 10051 H HA3  . GLY A 1 24  ? 4.856   4.396   6.815   1.00 0.00 ? 24  GLY A HA3  6  
ATOM 10052 N N    . LEU A 1 25  ? 4.019   1.843   7.693   1.00 0.00 ? 25  LEU A N    6  
ATOM 10053 C CA   . LEU A 1 25  ? 3.044   0.769   7.848   1.00 0.00 ? 25  LEU A CA   6  
ATOM 10054 C C    . LEU A 1 25  ? 2.795   0.467   9.322   1.00 0.00 ? 25  LEU A C    6  
ATOM 10055 O O    . LEU A 1 25  ? 3.603   -0.194  9.976   1.00 0.00 ? 25  LEU A O    6  
ATOM 10056 C CB   . LEU A 1 25  ? 3.528   -0.493  7.131   1.00 0.00 ? 25  LEU A CB   6  
ATOM 10057 C CG   . LEU A 1 25  ? 2.458   -1.540  6.818   1.00 0.00 ? 25  LEU A CG   6  
ATOM 10058 C CD1  . LEU A 1 25  ? 1.398   -0.959  5.895   1.00 0.00 ? 25  LEU A CD1  6  
ATOM 10059 C CD2  . LEU A 1 25  ? 3.089   -2.778  6.197   1.00 0.00 ? 25  LEU A CD2  6  
ATOM 10060 H H    . LEU A 1 25  ? 4.892   1.641   7.299   1.00 0.00 ? 25  LEU A H    6  
ATOM 10061 H HA   . LEU A 1 25  ? 2.118   1.095   7.398   1.00 0.00 ? 25  LEU A HA   6  
ATOM 10062 H HB2  . LEU A 1 25  ? 3.979   -0.191  6.198   1.00 0.00 ? 25  LEU A HB2  6  
ATOM 10063 H HB3  . LEU A 1 25  ? 4.277   -0.960  7.756   1.00 0.00 ? 25  LEU A HB3  6  
ATOM 10064 H HG   . LEU A 1 25  ? 1.973   -1.836  7.738   1.00 0.00 ? 25  LEU A HG   6  
ATOM 10065 H HD11 . LEU A 1 25  ? 1.128   -1.693  5.151   1.00 0.00 ? 25  LEU A HD11 6  
ATOM 10066 H HD12 . LEU A 1 25  ? 1.789   -0.079  5.407   1.00 0.00 ? 25  LEU A HD12 6  
ATOM 10067 H HD13 . LEU A 1 25  ? 0.525   -0.692  6.472   1.00 0.00 ? 25  LEU A HD13 6  
ATOM 10068 H HD21 . LEU A 1 25  ? 4.162   -2.729  6.310   1.00 0.00 ? 25  LEU A HD21 6  
ATOM 10069 H HD22 . LEU A 1 25  ? 2.839   -2.821  5.147   1.00 0.00 ? 25  LEU A HD22 6  
ATOM 10070 H HD23 . LEU A 1 25  ? 2.714   -3.660  6.693   1.00 0.00 ? 25  LEU A HD23 6  
ATOM 10071 N N    . VAL A 1 26  ? 1.672   0.953   9.839   1.00 0.00 ? 26  VAL A N    6  
ATOM 10072 C CA   . VAL A 1 26  ? 1.315   0.733   11.235  1.00 0.00 ? 26  VAL A CA   6  
ATOM 10073 C C    . VAL A 1 26  ? -0.194  0.581   11.400  1.00 0.00 ? 26  VAL A C    6  
ATOM 10074 O O    . VAL A 1 26  ? -0.972  1.206   10.680  1.00 0.00 ? 26  VAL A O    6  
ATOM 10075 C CB   . VAL A 1 26  ? 1.804   1.888   12.129  1.00 0.00 ? 26  VAL A CB   6  
ATOM 10076 C CG1  . VAL A 1 26  ? 3.321   1.988   12.089  1.00 0.00 ? 26  VAL A CG1  6  
ATOM 10077 C CG2  . VAL A 1 26  ? 1.163   3.200   11.702  1.00 0.00 ? 26  VAL A CG2  6  
ATOM 10078 H H    . VAL A 1 26  ? 1.068   1.472   9.268   1.00 0.00 ? 26  VAL A H    6  
ATOM 10079 H HA   . VAL A 1 26  ? 1.796   -0.177  11.564  1.00 0.00 ? 26  VAL A HA   6  
ATOM 10080 H HB   . VAL A 1 26  ? 1.506   1.680   13.146  1.00 0.00 ? 26  VAL A HB   6  
ATOM 10081 H HG11 . VAL A 1 26  ? 3.737   1.038   11.789  1.00 0.00 ? 26  VAL A HG11 6  
ATOM 10082 H HG12 . VAL A 1 26  ? 3.613   2.750   11.380  1.00 0.00 ? 26  VAL A HG12 6  
ATOM 10083 H HG13 . VAL A 1 26  ? 3.691   2.248   13.070  1.00 0.00 ? 26  VAL A HG13 6  
ATOM 10084 H HG21 . VAL A 1 26  ? 1.252   3.311   10.632  1.00 0.00 ? 26  VAL A HG21 6  
ATOM 10085 H HG22 . VAL A 1 26  ? 0.118   3.197   11.978  1.00 0.00 ? 26  VAL A HG22 6  
ATOM 10086 H HG23 . VAL A 1 26  ? 1.662   4.021   12.193  1.00 0.00 ? 26  VAL A HG23 6  
ATOM 10087 N N    . TRP A 1 27  ? -0.598  -0.251  12.352  1.00 0.00 ? 27  TRP A N    6  
ATOM 10088 C CA   . TRP A 1 27  ? -2.015  -0.484  12.611  1.00 0.00 ? 27  TRP A CA   6  
ATOM 10089 C C    . TRP A 1 27  ? -2.617  0.664   13.413  1.00 0.00 ? 27  TRP A C    6  
ATOM 10090 O O    . TRP A 1 27  ? -2.286  0.855   14.583  1.00 0.00 ? 27  TRP A O    6  
ATOM 10091 C CB   . TRP A 1 27  ? -2.206  -1.803  13.362  1.00 0.00 ? 27  TRP A CB   6  
ATOM 10092 C CG   . TRP A 1 27  ? -1.837  -3.008  12.550  1.00 0.00 ? 27  TRP A CG   6  
ATOM 10093 C CD1  . TRP A 1 27  ? -0.698  -3.754  12.663  1.00 0.00 ? 27  TRP A CD1  6  
ATOM 10094 C CD2  . TRP A 1 27  ? -2.607  -3.603  11.500  1.00 0.00 ? 27  TRP A CD2  6  
ATOM 10095 N NE1  . TRP A 1 27  ? -0.715  -4.778  11.746  1.00 0.00 ? 27  TRP A NE1  6  
ATOM 10096 C CE2  . TRP A 1 27  ? -1.875  -4.708  11.022  1.00 0.00 ? 27  TRP A CE2  6  
ATOM 10097 C CE3  . TRP A 1 27  ? -3.844  -3.312  10.920  1.00 0.00 ? 27  TRP A CE3  6  
ATOM 10098 C CZ2  . TRP A 1 27  ? -2.341  -5.518  9.990   1.00 0.00 ? 27  TRP A CZ2  6  
ATOM 10099 C CZ3  . TRP A 1 27  ? -4.305  -4.118  9.896   1.00 0.00 ? 27  TRP A CZ3  6  
ATOM 10100 C CH2  . TRP A 1 27  ? -3.556  -5.210  9.440   1.00 0.00 ? 27  TRP A CH2  6  
ATOM 10101 H H    . TRP A 1 27  ? 0.070   -0.721  12.893  1.00 0.00 ? 27  TRP A H    6  
ATOM 10102 H HA   . TRP A 1 27  ? -2.520  -0.546  11.658  1.00 0.00 ? 27  TRP A HA   6  
ATOM 10103 H HB2  . TRP A 1 27  ? -1.592  -1.798  14.249  1.00 0.00 ? 27  TRP A HB2  6  
ATOM 10104 H HB3  . TRP A 1 27  ? -3.244  -1.899  13.647  1.00 0.00 ? 27  TRP A HB3  6  
ATOM 10105 H HD1  . TRP A 1 27  ? 0.091   -3.556  13.372  1.00 0.00 ? 27  TRP A HD1  6  
ATOM 10106 H HE1  . TRP A 1 27  ? -0.010  -5.450  11.632  1.00 0.00 ? 27  TRP A HE1  6  
ATOM 10107 H HE3  . TRP A 1 27  ? -4.437  -2.475  11.257  1.00 0.00 ? 27  TRP A HE3  6  
ATOM 10108 H HZ2  . TRP A 1 27  ? -1.776  -6.364  9.628   1.00 0.00 ? 27  TRP A HZ2  6  
ATOM 10109 H HZ3  . TRP A 1 27  ? -5.259  -3.908  9.434   1.00 0.00 ? 27  TRP A HZ3  6  
ATOM 10110 H HH2  . TRP A 1 27  ? -3.954  -5.812  8.637   1.00 0.00 ? 27  TRP A HH2  6  
ATOM 10111 N N    . GLU A 1 28  ? -3.503  1.424   12.777  1.00 0.00 ? 28  GLU A N    6  
ATOM 10112 C CA   . GLU A 1 28  ? -4.151  2.553   13.434  1.00 0.00 ? 28  GLU A CA   6  
ATOM 10113 C C    . GLU A 1 28  ? -4.904  2.099   14.681  1.00 0.00 ? 28  GLU A C    6  
ATOM 10114 O O    . GLU A 1 28  ? -5.068  2.862   15.632  1.00 0.00 ? 28  GLU A O    6  
ATOM 10115 C CB   . GLU A 1 28  ? -5.113  3.250   12.469  1.00 0.00 ? 28  GLU A CB   6  
ATOM 10116 C CG   . GLU A 1 28  ? -4.439  3.776   11.213  1.00 0.00 ? 28  GLU A CG   6  
ATOM 10117 C CD   . GLU A 1 28  ? -5.123  5.011   10.658  1.00 0.00 ? 28  GLU A CD   6  
ATOM 10118 O OE1  . GLU A 1 28  ? -6.370  5.024   10.601  1.00 0.00 ? 28  GLU A OE1  6  
ATOM 10119 O OE2  . GLU A 1 28  ? -4.409  5.965   10.282  1.00 0.00 ? 28  GLU A OE2  6  
ATOM 10120 H H    . GLU A 1 28  ? -3.726  1.220   11.845  1.00 0.00 ? 28  GLU A H    6  
ATOM 10121 H HA   . GLU A 1 28  ? -3.382  3.251   13.727  1.00 0.00 ? 28  GLU A HA   6  
ATOM 10122 H HB2  . GLU A 1 28  ? -5.879  2.548   12.174  1.00 0.00 ? 28  GLU A HB2  6  
ATOM 10123 H HB3  . GLU A 1 28  ? -5.576  4.081   12.979  1.00 0.00 ? 28  GLU A HB3  6  
ATOM 10124 H HG2  . GLU A 1 28  ? -3.415  4.025   11.446  1.00 0.00 ? 28  GLU A HG2  6  
ATOM 10125 H HG3  . GLU A 1 28  ? -4.457  3.003   10.458  1.00 0.00 ? 28  GLU A HG3  6  
ATOM 10126 N N    . ASN A 1 29  ? -5.361  0.851   14.667  1.00 0.00 ? 29  ASN A N    6  
ATOM 10127 C CA   . ASN A 1 29  ? -6.098  0.294   15.795  1.00 0.00 ? 29  ASN A CA   6  
ATOM 10128 C C    . ASN A 1 29  ? -5.417  -0.965  16.323  1.00 0.00 ? 29  ASN A C    6  
ATOM 10129 O O    . ASN A 1 29  ? -4.583  -1.561  15.643  1.00 0.00 ? 29  ASN A O    6  
ATOM 10130 C CB   . ASN A 1 29  ? -7.537  -0.026  15.384  1.00 0.00 ? 29  ASN A CB   6  
ATOM 10131 C CG   . ASN A 1 29  ? -7.603  -0.953  14.186  1.00 0.00 ? 29  ASN A CG   6  
ATOM 10132 O OD1  . ASN A 1 29  ? -6.678  -1.726  13.934  1.00 0.00 ? 29  ASN A OD1  6  
ATOM 10133 N ND2  . ASN A 1 29  ? -8.699  -0.880  13.440  1.00 0.00 ? 29  ASN A ND2  6  
ATOM 10134 H H    . ASN A 1 29  ? -5.199  0.291   13.879  1.00 0.00 ? 29  ASN A H    6  
ATOM 10135 H HA   . ASN A 1 29  ? -6.114  1.037   16.579  1.00 0.00 ? 29  ASN A HA   6  
ATOM 10136 H HB2  . ASN A 1 29  ? -8.044  -0.501  16.211  1.00 0.00 ? 29  ASN A HB2  6  
ATOM 10137 H HB3  . ASN A 1 29  ? -8.046  0.893   15.133  1.00 0.00 ? 29  ASN A HB3  6  
ATOM 10138 H HD21 . ASN A 1 29  ? -9.395  -0.241  13.701  1.00 0.00 ? 29  ASN A HD21 6  
ATOM 10139 H HD22 . ASN A 1 29  ? -8.768  -1.469  12.660  1.00 0.00 ? 29  ASN A HD22 6  
ATOM 10140 N N    . GLU A 1 30  ? -5.779  -1.361  17.539  1.00 0.00 ? 30  GLU A N    6  
ATOM 10141 C CA   . GLU A 1 30  ? -5.202  -2.549  18.157  1.00 0.00 ? 30  GLU A CA   6  
ATOM 10142 C C    . GLU A 1 30  ? -5.725  -3.818  17.491  1.00 0.00 ? 30  GLU A C    6  
ATOM 10143 O O    . GLU A 1 30  ? -5.016  -4.820  17.397  1.00 0.00 ? 30  GLU A O    6  
ATOM 10144 C CB   . GLU A 1 30  ? -5.519  -2.577  19.654  1.00 0.00 ? 30  GLU A CB   6  
ATOM 10145 C CG   . GLU A 1 30  ? -5.022  -1.353  20.405  1.00 0.00 ? 30  GLU A CG   6  
ATOM 10146 C CD   . GLU A 1 30  ? -3.540  -1.420  20.714  1.00 0.00 ? 30  GLU A CD   6  
ATOM 10147 O OE1  . GLU A 1 30  ? -2.774  -1.896  19.849  1.00 0.00 ? 30  GLU A OE1  6  
ATOM 10148 O OE2  . GLU A 1 30  ? -3.144  -0.998  21.821  1.00 0.00 ? 30  GLU A OE2  6  
ATOM 10149 H H    . GLU A 1 30  ? -6.449  -0.844  18.032  1.00 0.00 ? 30  GLU A H    6  
ATOM 10150 H HA   . GLU A 1 30  ? -4.131  -2.504  18.027  1.00 0.00 ? 30  GLU A HA   6  
ATOM 10151 H HB2  . GLU A 1 30  ? -6.589  -2.644  19.782  1.00 0.00 ? 30  GLU A HB2  6  
ATOM 10152 H HB3  . GLU A 1 30  ? -5.059  -3.452  20.090  1.00 0.00 ? 30  GLU A HB3  6  
ATOM 10153 H HG2  . GLU A 1 30  ? -5.209  -0.477  19.802  1.00 0.00 ? 30  GLU A HG2  6  
ATOM 10154 H HG3  . GLU A 1 30  ? -5.566  -1.272  21.334  1.00 0.00 ? 30  GLU A HG3  6  
ATOM 10155 N N    . GLU A 1 31  ? -6.971  -3.768  17.032  1.00 0.00 ? 31  GLU A N    6  
ATOM 10156 C CA   . GLU A 1 31  ? -7.590  -4.914  16.376  1.00 0.00 ? 31  GLU A CA   6  
ATOM 10157 C C    . GLU A 1 31  ? -6.757  -5.373  15.182  1.00 0.00 ? 31  GLU A C    6  
ATOM 10158 O O    . GLU A 1 31  ? -6.969  -6.459  14.644  1.00 0.00 ? 31  GLU A O    6  
ATOM 10159 C CB   . GLU A 1 31  ? -9.008  -4.563  15.918  1.00 0.00 ? 31  GLU A CB   6  
ATOM 10160 C CG   . GLU A 1 31  ? -9.086  -3.281  15.107  1.00 0.00 ? 31  GLU A CG   6  
ATOM 10161 C CD   . GLU A 1 31  ? -10.513 -2.851  14.831  1.00 0.00 ? 31  GLU A CD   6  
ATOM 10162 O OE1  . GLU A 1 31  ? -11.307 -3.693  14.363  1.00 0.00 ? 31  GLU A OE1  6  
ATOM 10163 O OE2  . GLU A 1 31  ? -10.837 -1.671  15.085  1.00 0.00 ? 31  GLU A OE2  6  
ATOM 10164 H H    . GLU A 1 31  ? -7.487  -2.941  17.136  1.00 0.00 ? 31  GLU A H    6  
ATOM 10165 H HA   . GLU A 1 31  ? -7.642  -5.718  17.094  1.00 0.00 ? 31  GLU A HA   6  
ATOM 10166 H HB2  . GLU A 1 31  ? -9.388  -5.373  15.312  1.00 0.00 ? 31  GLU A HB2  6  
ATOM 10167 H HB3  . GLU A 1 31  ? -9.636  -4.452  16.789  1.00 0.00 ? 31  GLU A HB3  6  
ATOM 10168 H HG2  . GLU A 1 31  ? -8.588  -2.494  15.653  1.00 0.00 ? 31  GLU A HG2  6  
ATOM 10169 H HG3  . GLU A 1 31  ? -8.584  -3.436  14.163  1.00 0.00 ? 31  GLU A HG3  6  
ATOM 10170 N N    . LYS A 1 32  ? -5.809  -4.536  14.773  1.00 0.00 ? 32  LYS A N    6  
ATOM 10171 C CA   . LYS A 1 32  ? -4.943  -4.854  13.644  1.00 0.00 ? 32  LYS A CA   6  
ATOM 10172 C C    . LYS A 1 32  ? -5.753  -4.994  12.360  1.00 0.00 ? 32  LYS A C    6  
ATOM 10173 O O    . LYS A 1 32  ? -5.409  -5.785  11.481  1.00 0.00 ? 32  LYS A O    6  
ATOM 10174 C CB   . LYS A 1 32  ? -4.170  -6.147  13.916  1.00 0.00 ? 32  LYS A CB   6  
ATOM 10175 C CG   . LYS A 1 32  ? -3.201  -6.042  15.081  1.00 0.00 ? 32  LYS A CG   6  
ATOM 10176 C CD   . LYS A 1 32  ? -1.826  -5.583  14.623  1.00 0.00 ? 32  LYS A CD   6  
ATOM 10177 C CE   . LYS A 1 32  ? -0.732  -6.089  15.551  1.00 0.00 ? 32  LYS A CE   6  
ATOM 10178 N NZ   . LYS A 1 32  ? -0.676  -5.311  16.819  1.00 0.00 ? 32  LYS A NZ   6  
ATOM 10179 H H    . LYS A 1 32  ? -5.689  -3.684  15.243  1.00 0.00 ? 32  LYS A H    6  
ATOM 10180 H HA   . LYS A 1 32  ? -4.241  -4.043  13.526  1.00 0.00 ? 32  LYS A HA   6  
ATOM 10181 H HB2  . LYS A 1 32  ? -4.876  -6.935  14.132  1.00 0.00 ? 32  LYS A HB2  6  
ATOM 10182 H HB3  . LYS A 1 32  ? -3.609  -6.409  13.031  1.00 0.00 ? 32  LYS A HB3  6  
ATOM 10183 H HG2  . LYS A 1 32  ? -3.586  -5.330  15.796  1.00 0.00 ? 32  LYS A HG2  6  
ATOM 10184 H HG3  . LYS A 1 32  ? -3.109  -7.012  15.549  1.00 0.00 ? 32  LYS A HG3  6  
ATOM 10185 H HD2  . LYS A 1 32  ? -1.643  -5.962  13.629  1.00 0.00 ? 32  LYS A HD2  6  
ATOM 10186 H HD3  . LYS A 1 32  ? -1.803  -4.503  14.609  1.00 0.00 ? 32  LYS A HD3  6  
ATOM 10187 H HE2  . LYS A 1 32  ? -0.925  -7.126  15.782  1.00 0.00 ? 32  LYS A HE2  6  
ATOM 10188 H HE3  . LYS A 1 32  ? 0.218   -6.005  15.044  1.00 0.00 ? 32  LYS A HE3  6  
ATOM 10189 H HZ1  . LYS A 1 32  ? 0.309   -5.219  17.138  1.00 0.00 ? 32  LYS A HZ1  6  
ATOM 10190 H HZ2  . LYS A 1 32  ? -1.224  -5.794  17.559  1.00 0.00 ? 32  LYS A HZ2  6  
ATOM 10191 H HZ3  . LYS A 1 32  ? -1.073  -4.361  16.674  1.00 0.00 ? 32  LYS A HZ3  6  
ATOM 10192 N N    . SER A 1 33  ? -6.829  -4.221  12.256  1.00 0.00 ? 33  SER A N    6  
ATOM 10193 C CA   . SER A 1 33  ? -7.689  -4.262  11.080  1.00 0.00 ? 33  SER A CA   6  
ATOM 10194 C C    . SER A 1 33  ? -7.467  -3.034  10.202  1.00 0.00 ? 33  SER A C    6  
ATOM 10195 O O    . SER A 1 33  ? -7.553  -3.110  8.976   1.00 0.00 ? 33  SER A O    6  
ATOM 10196 C CB   . SER A 1 33  ? -9.158  -4.344  11.498  1.00 0.00 ? 33  SER A CB   6  
ATOM 10197 O OG   . SER A 1 33  ? -9.601  -3.117  12.051  1.00 0.00 ? 33  SER A OG   6  
ATOM 10198 H H    . SER A 1 33  ? -7.051  -3.611  12.991  1.00 0.00 ? 33  SER A H    6  
ATOM 10199 H HA   . SER A 1 33  ? -7.435  -5.145  10.513  1.00 0.00 ? 33  SER A HA   6  
ATOM 10200 H HB2  . SER A 1 33  ? -9.764  -4.575  10.635  1.00 0.00 ? 33  SER A HB2  6  
ATOM 10201 H HB3  . SER A 1 33  ? -9.276  -5.122  12.238  1.00 0.00 ? 33  SER A HB3  6  
ATOM 10202 H HG   . SER A 1 33  ? -10.057 -2.607  11.377  1.00 0.00 ? 33  SER A HG   6  
ATOM 10203 N N    . ILE A 1 34  ? -7.180  -1.903  10.839  1.00 0.00 ? 34  ILE A N    6  
ATOM 10204 C CA   . ILE A 1 34  ? -6.944  -0.659  10.117  1.00 0.00 ? 34  ILE A CA   6  
ATOM 10205 C C    . ILE A 1 34  ? -5.485  -0.230  10.224  1.00 0.00 ? 34  ILE A C    6  
ATOM 10206 O O    . ILE A 1 34  ? -4.900  -0.244  11.308  1.00 0.00 ? 34  ILE A O    6  
ATOM 10207 C CB   . ILE A 1 34  ? -7.842  0.476   10.644  1.00 0.00 ? 34  ILE A CB   6  
ATOM 10208 C CG1  . ILE A 1 34  ? -9.315  0.153   10.386  1.00 0.00 ? 34  ILE A CG1  6  
ATOM 10209 C CG2  . ILE A 1 34  ? -7.462  1.797   9.992   1.00 0.00 ? 34  ILE A CG2  6  
ATOM 10210 C CD1  . ILE A 1 34  ? -10.253 0.745   11.414  1.00 0.00 ? 34  ILE A CD1  6  
ATOM 10211 H H    . ILE A 1 34  ? -7.125  -1.906  11.817  1.00 0.00 ? 34  ILE A H    6  
ATOM 10212 H HA   . ILE A 1 34  ? -7.184  -0.827  9.077   1.00 0.00 ? 34  ILE A HA   6  
ATOM 10213 H HB   . ILE A 1 34  ? -7.682  0.568   11.707  1.00 0.00 ? 34  ILE A HB   6  
ATOM 10214 H HG12 . ILE A 1 34  ? -9.598  0.539   9.419   1.00 0.00 ? 34  ILE A HG12 6  
ATOM 10215 H HG13 . ILE A 1 34  ? -9.447  -0.919  10.393  1.00 0.00 ? 34  ILE A HG13 6  
ATOM 10216 H HG21 . ILE A 1 34  ? -7.535  1.703   8.919   1.00 0.00 ? 34  ILE A HG21 6  
ATOM 10217 H HG22 . ILE A 1 34  ? -8.133  2.572   10.331  1.00 0.00 ? 34  ILE A HG22 6  
ATOM 10218 H HG23 . ILE A 1 34  ? -6.449  2.055   10.263  1.00 0.00 ? 34  ILE A HG23 6  
ATOM 10219 H HD11 . ILE A 1 34  ? -10.633 -0.042  12.050  1.00 0.00 ? 34  ILE A HD11 6  
ATOM 10220 H HD12 . ILE A 1 34  ? -9.721  1.468   12.014  1.00 0.00 ? 34  ILE A HD12 6  
ATOM 10221 H HD13 . ILE A 1 34  ? -11.077 1.231   10.912  1.00 0.00 ? 34  ILE A HD13 6  
ATOM 10222 N N    . PHE A 1 35  ? -4.902  0.154   9.093   1.00 0.00 ? 35  PHE A N    6  
ATOM 10223 C CA   . PHE A 1 35  ? -3.511  0.589   9.059   1.00 0.00 ? 35  PHE A CA   6  
ATOM 10224 C C    . PHE A 1 35  ? -3.320  1.725   8.058   1.00 0.00 ? 35  PHE A C    6  
ATOM 10225 O O    . PHE A 1 35  ? -4.226  2.047   7.289   1.00 0.00 ? 35  PHE A O    6  
ATOM 10226 C CB   . PHE A 1 35  ? -2.597  -0.583  8.698   1.00 0.00 ? 35  PHE A CB   6  
ATOM 10227 C CG   . PHE A 1 35  ? -3.007  -1.300  7.444   1.00 0.00 ? 35  PHE A CG   6  
ATOM 10228 C CD1  . PHE A 1 35  ? -4.084  -2.171  7.449   1.00 0.00 ? 35  PHE A CD1  6  
ATOM 10229 C CD2  . PHE A 1 35  ? -2.316  -1.102  6.259   1.00 0.00 ? 35  PHE A CD2  6  
ATOM 10230 C CE1  . PHE A 1 35  ? -4.465  -2.832  6.296   1.00 0.00 ? 35  PHE A CE1  6  
ATOM 10231 C CE2  . PHE A 1 35  ? -2.692  -1.759  5.103   1.00 0.00 ? 35  PHE A CE2  6  
ATOM 10232 C CZ   . PHE A 1 35  ? -3.767  -2.626  5.122   1.00 0.00 ? 35  PHE A CZ   6  
ATOM 10233 H H    . PHE A 1 35  ? -5.421  0.144   8.261   1.00 0.00 ? 35  PHE A H    6  
ATOM 10234 H HA   . PHE A 1 35  ? -3.252  0.946   10.044  1.00 0.00 ? 35  PHE A HA   6  
ATOM 10235 H HB2  . PHE A 1 35  ? -1.591  -0.216  8.556   1.00 0.00 ? 35  PHE A HB2  6  
ATOM 10236 H HB3  . PHE A 1 35  ? -2.603  -1.298  9.508   1.00 0.00 ? 35  PHE A HB3  6  
ATOM 10237 H HD1  . PHE A 1 35  ? -4.631  -2.333  8.367   1.00 0.00 ? 35  PHE A HD1  6  
ATOM 10238 H HD2  . PHE A 1 35  ? -1.474  -0.425  6.243   1.00 0.00 ? 35  PHE A HD2  6  
ATOM 10239 H HE1  . PHE A 1 35  ? -5.306  -3.509  6.314   1.00 0.00 ? 35  PHE A HE1  6  
ATOM 10240 H HE2  . PHE A 1 35  ? -2.145  -1.597  4.187   1.00 0.00 ? 35  PHE A HE2  6  
ATOM 10241 H HZ   . PHE A 1 35  ? -4.064  -3.141  4.220   1.00 0.00 ? 35  PHE A HZ   6  
ATOM 10242 N N    . ARG A 1 36  ? -2.136  2.327   8.074   1.00 0.00 ? 36  ARG A N    6  
ATOM 10243 C CA   . ARG A 1 36  ? -1.826  3.427   7.169   1.00 0.00 ? 36  ARG A CA   6  
ATOM 10244 C C    . ARG A 1 36  ? -0.592  3.110   6.329   1.00 0.00 ? 36  ARG A C    6  
ATOM 10245 O O    . ARG A 1 36  ? 0.409   2.612   6.844   1.00 0.00 ? 36  ARG A O    6  
ATOM 10246 C CB   . ARG A 1 36  ? -1.600  4.717   7.960   1.00 0.00 ? 36  ARG A CB   6  
ATOM 10247 C CG   . ARG A 1 36  ? -1.043  4.487   9.355   1.00 0.00 ? 36  ARG A CG   6  
ATOM 10248 C CD   . ARG A 1 36  ? -0.193  5.661   9.817   1.00 0.00 ? 36  ARG A CD   6  
ATOM 10249 N NE   . ARG A 1 36  ? -0.254  5.844   11.264  1.00 0.00 ? 36  ARG A NE   6  
ATOM 10250 C CZ   . ARG A 1 36  ? 0.701   6.439   11.970  1.00 0.00 ? 36  ARG A CZ   6  
ATOM 10251 N NH1  . ARG A 1 36  ? 1.785   6.906   11.365  1.00 0.00 ? 36  ARG A NH1  6  
ATOM 10252 N NH2  . ARG A 1 36  ? 0.573   6.569   13.285  1.00 0.00 ? 36  ARG A NH2  6  
ATOM 10253 H H    . ARG A 1 36  ? -1.454  2.025   8.710   1.00 0.00 ? 36  ARG A H    6  
ATOM 10254 H HA   . ARG A 1 36  ? -2.670  3.563   6.510   1.00 0.00 ? 36  ARG A HA   6  
ATOM 10255 H HB2  . ARG A 1 36  ? -0.905  5.341   7.417   1.00 0.00 ? 36  ARG A HB2  6  
ATOM 10256 H HB3  . ARG A 1 36  ? -2.541  5.238   8.053   1.00 0.00 ? 36  ARG A HB3  6  
ATOM 10257 H HG2  . ARG A 1 36  ? -1.865  4.359   10.044  1.00 0.00 ? 36  ARG A HG2  6  
ATOM 10258 H HG3  . ARG A 1 36  ? -0.435  3.595   9.347   1.00 0.00 ? 36  ARG A HG3  6  
ATOM 10259 H HD2  . ARG A 1 36  ? 0.832   5.481   9.529   1.00 0.00 ? 36  ARG A HD2  6  
ATOM 10260 H HD3  . ARG A 1 36  ? -0.551  6.558   9.334   1.00 0.00 ? 36  ARG A HD3  6  
ATOM 10261 H HE   . ARG A 1 36  ? -1.046  5.507   11.732  1.00 0.00 ? 36  ARG A HE   6  
ATOM 10262 H HH11 . ARG A 1 36  ? 1.883   6.811   10.374  1.00 0.00 ? 36  ARG A HH11 6  
ATOM 10263 H HH12 . ARG A 1 36  ? 2.502   7.355   11.899  1.00 0.00 ? 36  ARG A HH12 6  
ATOM 10264 H HH21 . ARG A 1 36  ? -0.242  6.219   13.744  1.00 0.00 ? 36  ARG A HH21 6  
ATOM 10265 H HH22 . ARG A 1 36  ? 1.293   7.016   13.815  1.00 0.00 ? 36  ARG A HH22 6  
ATOM 10266 N N    . ILE A 1 37  ? -0.673  3.401   5.036   1.00 0.00 ? 37  ILE A N    6  
ATOM 10267 C CA   . ILE A 1 37  ? 0.437   3.147   4.125   1.00 0.00 ? 37  ILE A CA   6  
ATOM 10268 C C    . ILE A 1 37  ? 1.005   4.450   3.574   1.00 0.00 ? 37  ILE A C    6  
ATOM 10269 O O    . ILE A 1 37  ? 0.276   5.329   3.115   1.00 0.00 ? 37  ILE A O    6  
ATOM 10270 C CB   . ILE A 1 37  ? 0.007   2.250   2.950   1.00 0.00 ? 37  ILE A CB   6  
ATOM 10271 C CG1  . ILE A 1 37  ? 1.155   2.097   1.950   1.00 0.00 ? 37  ILE A CG1  6  
ATOM 10272 C CG2  . ILE A 1 37  ? -1.224  2.825   2.267   1.00 0.00 ? 37  ILE A CG2  6  
ATOM 10273 C CD1  . ILE A 1 37  ? 0.778   1.314   0.712   1.00 0.00 ? 37  ILE A CD1  6  
ATOM 10274 H H    . ILE A 1 37  ? -1.498  3.797   4.685   1.00 0.00 ? 37  ILE A H    6  
ATOM 10275 H HA   . ILE A 1 37  ? 1.211   2.635   4.679   1.00 0.00 ? 37  ILE A HA   6  
ATOM 10276 H HB   . ILE A 1 37  ? -0.250  1.278   3.343   1.00 0.00 ? 37  ILE A HB   6  
ATOM 10277 H HG12 . ILE A 1 37  ? 1.483   3.075   1.636   1.00 0.00 ? 37  ILE A HG12 6  
ATOM 10278 H HG13 . ILE A 1 37  ? 1.976   1.584   2.431   1.00 0.00 ? 37  ILE A HG13 6  
ATOM 10279 H HG21 . ILE A 1 37  ? -1.298  2.429   1.265   1.00 0.00 ? 37  ILE A HG21 6  
ATOM 10280 H HG22 . ILE A 1 37  ? -2.106  2.553   2.827   1.00 0.00 ? 37  ILE A HG22 6  
ATOM 10281 H HG23 . ILE A 1 37  ? -1.143  3.901   2.224   1.00 0.00 ? 37  ILE A HG23 6  
ATOM 10282 H HD11 . ILE A 1 37  ? 0.718   1.983   -0.133  1.00 0.00 ? 37  ILE A HD11 6  
ATOM 10283 H HD12 . ILE A 1 37  ? 1.525   0.558   0.522   1.00 0.00 ? 37  ILE A HD12 6  
ATOM 10284 H HD13 . ILE A 1 37  ? -0.182  0.841   0.864   1.00 0.00 ? 37  ILE A HD13 6  
ATOM 10285 N N    . PRO A 1 38  ? 2.340   4.579   3.618   1.00 0.00 ? 38  PRO A N    6  
ATOM 10286 C CA   . PRO A 1 38  ? 3.036   5.771   3.124   1.00 0.00 ? 38  PRO A CA   6  
ATOM 10287 C C    . PRO A 1 38  ? 2.976   5.891   1.605   1.00 0.00 ? 38  PRO A C    6  
ATOM 10288 O O    . PRO A 1 38  ? 3.621   5.127   0.887   1.00 0.00 ? 38  PRO A O    6  
ATOM 10289 C CB   . PRO A 1 38  ? 4.479   5.556   3.587   1.00 0.00 ? 38  PRO A CB   6  
ATOM 10290 C CG   . PRO A 1 38  ? 4.619   4.078   3.717   1.00 0.00 ? 38  PRO A CG   6  
ATOM 10291 C CD   . PRO A 1 38  ? 3.271   3.572   4.151   1.00 0.00 ? 38  PRO A CD   6  
ATOM 10292 H HA   . PRO A 1 38  ? 2.644   6.673   3.571   1.00 0.00 ? 38  PRO A HA   6  
ATOM 10293 H HB2  . PRO A 1 38  ? 5.160   5.954   2.848   1.00 0.00 ? 38  PRO A HB2  6  
ATOM 10294 H HB3  . PRO A 1 38  ? 4.636   6.051   4.533   1.00 0.00 ? 38  PRO A HB3  6  
ATOM 10295 H HG2  . PRO A 1 38  ? 4.891   3.650   2.764   1.00 0.00 ? 38  PRO A HG2  6  
ATOM 10296 H HG3  . PRO A 1 38  ? 5.365   3.844   4.462   1.00 0.00 ? 38  PRO A HG3  6  
ATOM 10297 H HD2  . PRO A 1 38  ? 3.077   2.600   3.721   1.00 0.00 ? 38  PRO A HD2  6  
ATOM 10298 H HD3  . PRO A 1 38  ? 3.214   3.527   5.229   1.00 0.00 ? 38  PRO A HD3  6  
ATOM 10299 N N    . TRP A 1 39  ? 2.198   6.853   1.123   1.00 0.00 ? 39  TRP A N    6  
ATOM 10300 C CA   . TRP A 1 39  ? 2.055   7.072   -0.312  1.00 0.00 ? 39  TRP A CA   6  
ATOM 10301 C C    . TRP A 1 39  ? 2.998   8.169   -0.792  1.00 0.00 ? 39  TRP A C    6  
ATOM 10302 O O    . TRP A 1 39  ? 2.863   8.675   -1.907  1.00 0.00 ? 39  TRP A O    6  
ATOM 10303 C CB   . TRP A 1 39  ? 0.609   7.440   -0.651  1.00 0.00 ? 39  TRP A CB   6  
ATOM 10304 C CG   . TRP A 1 39  ? 0.133   6.851   -1.943  1.00 0.00 ? 39  TRP A CG   6  
ATOM 10305 C CD1  . TRP A 1 39  ? 0.079   7.473   -3.158  1.00 0.00 ? 39  TRP A CD1  6  
ATOM 10306 C CD2  . TRP A 1 39  ? -0.359  5.522   -2.150  1.00 0.00 ? 39  TRP A CD2  6  
ATOM 10307 N NE1  . TRP A 1 39  ? -0.416  6.611   -4.107  1.00 0.00 ? 39  TRP A NE1  6  
ATOM 10308 C CE2  . TRP A 1 39  ? -0.691  5.408   -3.514  1.00 0.00 ? 39  TRP A CE2  6  
ATOM 10309 C CE3  . TRP A 1 39  ? -0.548  4.417   -1.315  1.00 0.00 ? 39  TRP A CE3  6  
ATOM 10310 C CZ2  . TRP A 1 39  ? -1.203  4.233   -4.059  1.00 0.00 ? 39  TRP A CZ2  6  
ATOM 10311 C CZ3  . TRP A 1 39  ? -1.057  3.252   -1.858  1.00 0.00 ? 39  TRP A CZ3  6  
ATOM 10312 C CH2  . TRP A 1 39  ? -1.379  3.167   -3.219  1.00 0.00 ? 39  TRP A CH2  6  
ATOM 10313 H H    . TRP A 1 39  ? 1.708   7.430   1.746   1.00 0.00 ? 39  TRP A H    6  
ATOM 10314 H HA   . TRP A 1 39  ? 2.308   6.150   -0.814  1.00 0.00 ? 39  TRP A HA   6  
ATOM 10315 H HB2  . TRP A 1 39  ? -0.040  7.086   0.136   1.00 0.00 ? 39  TRP A HB2  6  
ATOM 10316 H HB3  . TRP A 1 39  ? 0.527   8.515   -0.724  1.00 0.00 ? 39  TRP A HB3  6  
ATOM 10317 H HD1  . TRP A 1 39  ? 0.383   8.494   -3.332  1.00 0.00 ? 39  TRP A HD1  6  
ATOM 10318 H HE1  . TRP A 1 39  ? -0.548  6.824   -5.054  1.00 0.00 ? 39  TRP A HE1  6  
ATOM 10319 H HE3  . TRP A 1 39  ? -0.306  4.463   -0.264  1.00 0.00 ? 39  TRP A HE3  6  
ATOM 10320 H HZ2  . TRP A 1 39  ? -1.456  4.152   -5.106  1.00 0.00 ? 39  TRP A HZ2  6  
ATOM 10321 H HZ3  . TRP A 1 39  ? -1.210  2.388   -1.229  1.00 0.00 ? 39  TRP A HZ3  6  
ATOM 10322 H HH2  . TRP A 1 39  ? -1.773  2.238   -3.600  1.00 0.00 ? 39  TRP A HH2  6  
ATOM 10323 N N    . LYS A 1 40  ? 3.954   8.534   0.055   1.00 0.00 ? 40  LYS A N    6  
ATOM 10324 C CA   . LYS A 1 40  ? 4.921   9.571   -0.283  1.00 0.00 ? 40  LYS A CA   6  
ATOM 10325 C C    . LYS A 1 40  ? 5.937   9.058   -1.299  1.00 0.00 ? 40  LYS A C    6  
ATOM 10326 O O    . LYS A 1 40  ? 6.163   7.853   -1.411  1.00 0.00 ? 40  LYS A O    6  
ATOM 10327 C CB   . LYS A 1 40  ? 5.644   10.054  0.977   1.00 0.00 ? 40  LYS A CB   6  
ATOM 10328 C CG   . LYS A 1 40  ? 6.158   11.479  0.876   1.00 0.00 ? 40  LYS A CG   6  
ATOM 10329 C CD   . LYS A 1 40  ? 7.188   11.779  1.952   1.00 0.00 ? 40  LYS A CD   6  
ATOM 10330 C CE   . LYS A 1 40  ? 7.713   13.202  1.840   1.00 0.00 ? 40  LYS A CE   6  
ATOM 10331 N NZ   . LYS A 1 40  ? 9.098   13.325  2.372   1.00 0.00 ? 40  LYS A NZ   6  
ATOM 10332 H H    . LYS A 1 40  ? 4.010   8.095   0.930   1.00 0.00 ? 40  LYS A H    6  
ATOM 10333 H HA   . LYS A 1 40  ? 4.382   10.399  -0.717  1.00 0.00 ? 40  LYS A HA   6  
ATOM 10334 H HB2  . LYS A 1 40  ? 4.962   9.997   1.813   1.00 0.00 ? 40  LYS A HB2  6  
ATOM 10335 H HB3  . LYS A 1 40  ? 6.486   9.403   1.166   1.00 0.00 ? 40  LYS A HB3  6  
ATOM 10336 H HG2  . LYS A 1 40  ? 6.614   11.620  -0.093  1.00 0.00 ? 40  LYS A HG2  6  
ATOM 10337 H HG3  . LYS A 1 40  ? 5.326   12.161  0.986   1.00 0.00 ? 40  LYS A HG3  6  
ATOM 10338 H HD2  . LYS A 1 40  ? 6.730   11.652  2.922   1.00 0.00 ? 40  LYS A HD2  6  
ATOM 10339 H HD3  . LYS A 1 40  ? 8.014   11.090  1.849   1.00 0.00 ? 40  LYS A HD3  6  
ATOM 10340 H HE2  . LYS A 1 40  ? 7.709   13.493  0.801   1.00 0.00 ? 40  LYS A HE2  6  
ATOM 10341 H HE3  . LYS A 1 40  ? 7.062   13.857  2.400   1.00 0.00 ? 40  LYS A HE3  6  
ATOM 10342 H HZ1  . LYS A 1 40  ? 9.492   12.382  2.565   1.00 0.00 ? 40  LYS A HZ1  6  
ATOM 10343 H HZ2  . LYS A 1 40  ? 9.094   13.874  3.256   1.00 0.00 ? 40  LYS A HZ2  6  
ATOM 10344 H HZ3  . LYS A 1 40  ? 9.706   13.807  1.680   1.00 0.00 ? 40  LYS A HZ3  6  
ATOM 10345 N N    . HIS A 1 41  ? 6.547   9.980   -2.037  1.00 0.00 ? 41  HIS A N    6  
ATOM 10346 C CA   . HIS A 1 41  ? 7.540   9.620   -3.042  1.00 0.00 ? 41  HIS A CA   6  
ATOM 10347 C C    . HIS A 1 41  ? 8.948   9.673   -2.458  1.00 0.00 ? 41  HIS A C    6  
ATOM 10348 O O    . HIS A 1 41  ? 9.135   10.022  -1.293  1.00 0.00 ? 41  HIS A O    6  
ATOM 10349 C CB   . HIS A 1 41  ? 7.440   10.557  -4.247  1.00 0.00 ? 41  HIS A CB   6  
ATOM 10350 C CG   . HIS A 1 41  ? 7.924   11.946  -3.968  1.00 0.00 ? 41  HIS A CG   6  
ATOM 10351 N ND1  . HIS A 1 41  ? 8.392   12.792  -4.951  1.00 0.00 ? 41  HIS A ND1  6  
ATOM 10352 C CD2  . HIS A 1 41  ? 8.010   12.637  -2.807  1.00 0.00 ? 41  HIS A CD2  6  
ATOM 10353 C CE1  . HIS A 1 41  ? 8.746   13.942  -4.407  1.00 0.00 ? 41  HIS A CE1  6  
ATOM 10354 N NE2  . HIS A 1 41  ? 8.524   13.875  -3.107  1.00 0.00 ? 41  HIS A NE2  6  
ATOM 10355 H H    . HIS A 1 41  ? 6.324   10.925  -1.901  1.00 0.00 ? 41  HIS A H    6  
ATOM 10356 H HA   . HIS A 1 41  ? 7.335   8.611   -3.365  1.00 0.00 ? 41  HIS A HA   6  
ATOM 10357 H HB2  . HIS A 1 41  ? 8.032   10.156  -5.056  1.00 0.00 ? 41  HIS A HB2  6  
ATOM 10358 H HB3  . HIS A 1 41  ? 6.407   10.621  -4.560  1.00 0.00 ? 41  HIS A HB3  6  
ATOM 10359 H HD1  . HIS A 1 41  ? 8.456   12.580  -5.905  1.00 0.00 ? 41  HIS A HD1  6  
ATOM 10360 H HD2  . HIS A 1 41  ? 7.727   12.281  -1.826  1.00 0.00 ? 41  HIS A HD2  6  
ATOM 10361 H HE1  . HIS A 1 41  ? 9.148   14.794  -4.935  1.00 0.00 ? 41  HIS A HE1  6  
ATOM 10362 N N    . ALA A 1 42  ? 9.936   9.323   -3.276  1.00 0.00 ? 42  ALA A N    6  
ATOM 10363 C CA   . ALA A 1 42  ? 11.327  9.331   -2.840  1.00 0.00 ? 42  ALA A CA   6  
ATOM 10364 C C    . ALA A 1 42  ? 11.750  10.722  -2.381  1.00 0.00 ? 42  ALA A C    6  
ATOM 10365 O O    . ALA A 1 42  ? 12.036  10.938  -1.204  1.00 0.00 ? 42  ALA A O    6  
ATOM 10366 C CB   . ALA A 1 42  ? 12.234  8.845   -3.961  1.00 0.00 ? 42  ALA A CB   6  
ATOM 10367 H H    . ALA A 1 42  ? 9.724   9.053   -4.193  1.00 0.00 ? 42  ALA A H    6  
ATOM 10368 H HA   . ALA A 1 42  ? 11.422  8.645   -2.011  1.00 0.00 ? 42  ALA A HA   6  
ATOM 10369 H HB1  . ALA A 1 42  ? 12.907  9.639   -4.249  1.00 0.00 ? 42  ALA A HB1  6  
ATOM 10370 H HB2  . ALA A 1 42  ? 12.805  7.995   -3.618  1.00 0.00 ? 42  ALA A HB2  6  
ATOM 10371 H HB3  . ALA A 1 42  ? 11.633  8.557   -4.810  1.00 0.00 ? 42  ALA A HB3  6  
ATOM 10372 N N    . GLY A 1 43  ? 11.788  11.664  -3.319  1.00 0.00 ? 43  GLY A N    6  
ATOM 10373 C CA   . GLY A 1 43  ? 12.178  13.023  -2.990  1.00 0.00 ? 43  GLY A CA   6  
ATOM 10374 C C    . GLY A 1 43  ? 13.648  13.135  -2.636  1.00 0.00 ? 43  GLY A C    6  
ATOM 10375 O O    . GLY A 1 43  ? 14.448  13.639  -3.424  1.00 0.00 ? 43  GLY A O    6  
ATOM 10376 H H    . GLY A 1 43  ? 11.550  11.434  -4.241  1.00 0.00 ? 43  GLY A H    6  
ATOM 10377 H HA2  . GLY A 1 43  ? 11.974  13.659  -3.838  1.00 0.00 ? 43  GLY A HA2  6  
ATOM 10378 H HA3  . GLY A 1 43  ? 11.590  13.361  -2.150  1.00 0.00 ? 43  GLY A HA3  6  
ATOM 10379 N N    . LYS A 1 44  ? 14.005  12.664  -1.445  1.00 0.00 ? 44  LYS A N    6  
ATOM 10380 C CA   . LYS A 1 44  ? 15.388  12.713  -0.986  1.00 0.00 ? 44  LYS A CA   6  
ATOM 10381 C C    . LYS A 1 44  ? 16.277  11.818  -1.842  1.00 0.00 ? 44  LYS A C    6  
ATOM 10382 O O    . LYS A 1 44  ? 15.787  10.954  -2.569  1.00 0.00 ? 44  LYS A O    6  
ATOM 10383 C CB   . LYS A 1 44  ? 15.475  12.285  0.481   1.00 0.00 ? 44  LYS A CB   6  
ATOM 10384 C CG   . LYS A 1 44  ? 14.813  13.259  1.439   1.00 0.00 ? 44  LYS A CG   6  
ATOM 10385 C CD   . LYS A 1 44  ? 13.351  12.912  1.666   1.00 0.00 ? 44  LYS A CD   6  
ATOM 10386 C CE   . LYS A 1 44  ? 12.810  13.573  2.924   1.00 0.00 ? 44  LYS A CE   6  
ATOM 10387 N NZ   . LYS A 1 44  ? 12.380  14.977  2.672   1.00 0.00 ? 44  LYS A NZ   6  
ATOM 10388 H H    . LYS A 1 44  ? 13.321  12.274  -0.861  1.00 0.00 ? 44  LYS A H    6  
ATOM 10389 H HA   . LYS A 1 44  ? 15.731  13.733  -1.076  1.00 0.00 ? 44  LYS A HA   6  
ATOM 10390 H HB2  . LYS A 1 44  ? 14.998  11.323  0.591   1.00 0.00 ? 44  LYS A HB2  6  
ATOM 10391 H HB3  . LYS A 1 44  ? 16.516  12.194  0.755   1.00 0.00 ? 44  LYS A HB3  6  
ATOM 10392 H HG2  . LYS A 1 44  ? 15.330  13.226  2.387   1.00 0.00 ? 44  LYS A HG2  6  
ATOM 10393 H HG3  . LYS A 1 44  ? 14.877  14.256  1.026   1.00 0.00 ? 44  LYS A HG3  6  
ATOM 10394 H HD2  . LYS A 1 44  ? 12.774  13.250  0.818   1.00 0.00 ? 44  LYS A HD2  6  
ATOM 10395 H HD3  . LYS A 1 44  ? 13.256  11.840  1.763   1.00 0.00 ? 44  LYS A HD3  6  
ATOM 10396 H HE2  . LYS A 1 44  ? 11.963  13.005  3.278   1.00 0.00 ? 44  LYS A HE2  6  
ATOM 10397 H HE3  . LYS A 1 44  ? 13.584  13.573  3.677   1.00 0.00 ? 44  LYS A HE3  6  
ATOM 10398 H HZ1  . LYS A 1 44  ? 12.175  15.455  3.572   1.00 0.00 ? 44  LYS A HZ1  6  
ATOM 10399 H HZ2  . LYS A 1 44  ? 11.521  14.987  2.084   1.00 0.00 ? 44  LYS A HZ2  6  
ATOM 10400 H HZ3  . LYS A 1 44  ? 13.132  15.498  2.177   1.00 0.00 ? 44  LYS A HZ3  6  
ATOM 10401 N N    . GLN A 1 45  ? 17.586  12.029  -1.749  1.00 0.00 ? 45  GLN A N    6  
ATOM 10402 C CA   . GLN A 1 45  ? 18.543  11.239  -2.515  1.00 0.00 ? 45  GLN A CA   6  
ATOM 10403 C C    . GLN A 1 45  ? 19.352  10.326  -1.600  1.00 0.00 ? 45  GLN A C    6  
ATOM 10404 O O    . GLN A 1 45  ? 19.657  9.187   -1.955  1.00 0.00 ? 45  GLN A O    6  
ATOM 10405 C CB   . GLN A 1 45  ? 19.483  12.157  -3.299  1.00 0.00 ? 45  GLN A CB   6  
ATOM 10406 C CG   . GLN A 1 45  ? 20.108  11.494  -4.515  1.00 0.00 ? 45  GLN A CG   6  
ATOM 10407 C CD   . GLN A 1 45  ? 21.423  10.810  -4.196  1.00 0.00 ? 45  GLN A CD   6  
ATOM 10408 O OE1  . GLN A 1 45  ? 21.598  9.621   -4.463  1.00 0.00 ? 45  GLN A OE1  6  
ATOM 10409 N NE2  . GLN A 1 45  ? 22.356  11.559  -3.620  1.00 0.00 ? 45  GLN A NE2  6  
ATOM 10410 H H    . GLN A 1 45  ? 17.916  12.732  -1.153  1.00 0.00 ? 45  GLN A H    6  
ATOM 10411 H HA   . GLN A 1 45  ? 17.988  10.630  -3.212  1.00 0.00 ? 45  GLN A HA   6  
ATOM 10412 H HB2  . GLN A 1 45  ? 18.928  13.021  -3.632  1.00 0.00 ? 45  GLN A HB2  6  
ATOM 10413 H HB3  . GLN A 1 45  ? 20.279  12.481  -2.644  1.00 0.00 ? 45  GLN A HB3  6  
ATOM 10414 H HG2  . GLN A 1 45  ? 19.420  10.755  -4.900  1.00 0.00 ? 45  GLN A HG2  6  
ATOM 10415 H HG3  . GLN A 1 45  ? 20.284  12.247  -5.269  1.00 0.00 ? 45  GLN A HG3  6  
ATOM 10416 H HE21 . GLN A 1 45  ? 22.145  12.499  -3.435  1.00 0.00 ? 45  GLN A HE21 6  
ATOM 10417 H HE22 . GLN A 1 45  ? 23.214  11.142  -3.402  1.00 0.00 ? 45  GLN A HE22 6  
ATOM 10418 N N    . ASP A 1 46  ? 19.696  10.833  -0.421  1.00 0.00 ? 46  ASP A N    6  
ATOM 10419 C CA   . ASP A 1 46  ? 20.469  10.062  0.546   1.00 0.00 ? 46  ASP A CA   6  
ATOM 10420 C C    . ASP A 1 46  ? 19.733  8.784   0.935   1.00 0.00 ? 46  ASP A C    6  
ATOM 10421 O O    . ASP A 1 46  ? 20.355  7.778   1.279   1.00 0.00 ? 46  ASP A O    6  
ATOM 10422 C CB   . ASP A 1 46  ? 20.751  10.903  1.792   1.00 0.00 ? 46  ASP A CB   6  
ATOM 10423 C CG   . ASP A 1 46  ? 21.668  12.076  1.504   1.00 0.00 ? 46  ASP A CG   6  
ATOM 10424 O OD1  . ASP A 1 46  ? 22.884  11.850  1.336   1.00 0.00 ? 46  ASP A OD1  6  
ATOM 10425 O OD2  . ASP A 1 46  ? 21.169  13.220  1.447   1.00 0.00 ? 46  ASP A OD2  6  
ATOM 10426 H H    . ASP A 1 46  ? 19.424  11.747  -0.196  1.00 0.00 ? 46  ASP A H    6  
ATOM 10427 H HA   . ASP A 1 46  ? 21.408  9.796   0.083   1.00 0.00 ? 46  ASP A HA   6  
ATOM 10428 H HB2  . ASP A 1 46  ? 19.817  11.287  2.178   1.00 0.00 ? 46  ASP A HB2  6  
ATOM 10429 H HB3  . ASP A 1 46  ? 21.217  10.280  2.541   1.00 0.00 ? 46  ASP A HB3  6  
ATOM 10430 N N    . TYR A 1 47  ? 18.407  8.831   0.880   1.00 0.00 ? 47  TYR A N    6  
ATOM 10431 C CA   . TYR A 1 47  ? 17.586  7.678   1.230   1.00 0.00 ? 47  TYR A CA   6  
ATOM 10432 C C    . TYR A 1 47  ? 18.036  6.437   0.466   1.00 0.00 ? 47  TYR A C    6  
ATOM 10433 O O    . TYR A 1 47  ? 18.954  6.496   -0.350  1.00 0.00 ? 47  TYR A O    6  
ATOM 10434 C CB   . TYR A 1 47  ? 16.113  7.966   0.935   1.00 0.00 ? 47  TYR A CB   6  
ATOM 10435 C CG   . TYR A 1 47  ? 15.711  7.664   -0.491  1.00 0.00 ? 47  TYR A CG   6  
ATOM 10436 C CD1  . TYR A 1 47  ? 16.083  8.507   -1.532  1.00 0.00 ? 47  TYR A CD1  6  
ATOM 10437 C CD2  . TYR A 1 47  ? 14.958  6.537   -0.798  1.00 0.00 ? 47  TYR A CD2  6  
ATOM 10438 C CE1  . TYR A 1 47  ? 15.717  8.235   -2.836  1.00 0.00 ? 47  TYR A CE1  6  
ATOM 10439 C CE2  . TYR A 1 47  ? 14.590  6.257   -2.099  1.00 0.00 ? 47  TYR A CE2  6  
ATOM 10440 C CZ   . TYR A 1 47  ? 14.971  7.109   -3.115  1.00 0.00 ? 47  TYR A CZ   6  
ATOM 10441 O OH   . TYR A 1 47  ? 14.605  6.835   -4.412  1.00 0.00 ? 47  TYR A OH   6  
ATOM 10442 H H    . TYR A 1 47  ? 17.969  9.661   0.598   1.00 0.00 ? 47  TYR A H    6  
ATOM 10443 H HA   . TYR A 1 47  ? 17.702  7.498   2.289   1.00 0.00 ? 47  TYR A HA   6  
ATOM 10444 H HB2  . TYR A 1 47  ? 15.498  7.365   1.586   1.00 0.00 ? 47  TYR A HB2  6  
ATOM 10445 H HB3  . TYR A 1 47  ? 15.913  9.011   1.122   1.00 0.00 ? 47  TYR A HB3  6  
ATOM 10446 H HD1  . TYR A 1 47  ? 16.667  9.388   -1.310  1.00 0.00 ? 47  TYR A HD1  6  
ATOM 10447 H HD2  . TYR A 1 47  ? 14.661  5.872   0.000   1.00 0.00 ? 47  TYR A HD2  6  
ATOM 10448 H HE1  . TYR A 1 47  ? 16.016  8.902   -3.632  1.00 0.00 ? 47  TYR A HE1  6  
ATOM 10449 H HE2  . TYR A 1 47  ? 14.005  5.376   -2.318  1.00 0.00 ? 47  TYR A HE2  6  
ATOM 10450 H HH   . TYR A 1 47  ? 13.747  6.404   -4.418  1.00 0.00 ? 47  TYR A HH   6  
ATOM 10451 N N    . ASN A 1 48  ? 17.381  5.313   0.738   1.00 0.00 ? 48  ASN A N    6  
ATOM 10452 C CA   . ASN A 1 48  ? 17.713  4.056   0.077   1.00 0.00 ? 48  ASN A CA   6  
ATOM 10453 C C    . ASN A 1 48  ? 16.472  3.427   -0.549  1.00 0.00 ? 48  ASN A C    6  
ATOM 10454 O O    . ASN A 1 48  ? 15.529  3.059   0.152   1.00 0.00 ? 48  ASN A O    6  
ATOM 10455 C CB   . ASN A 1 48  ? 18.344  3.082   1.075   1.00 0.00 ? 48  ASN A CB   6  
ATOM 10456 C CG   . ASN A 1 48  ? 19.248  3.781   2.071   1.00 0.00 ? 48  ASN A CG   6  
ATOM 10457 O OD1  . ASN A 1 48  ? 20.472  3.761   1.936   1.00 0.00 ? 48  ASN A OD1  6  
ATOM 10458 N ND2  . ASN A 1 48  ? 18.649  4.402   3.080   1.00 0.00 ? 48  ASN A ND2  6  
ATOM 10459 H H    . ASN A 1 48  ? 16.658  5.329   1.399   1.00 0.00 ? 48  ASN A H    6  
ATOM 10460 H HA   . ASN A 1 48  ? 18.426  4.270   -0.704  1.00 0.00 ? 48  ASN A HA   6  
ATOM 10461 H HB2  . ASN A 1 48  ? 17.560  2.578   1.621   1.00 0.00 ? 48  ASN A HB2  6  
ATOM 10462 H HB3  . ASN A 1 48  ? 18.928  2.352   0.536   1.00 0.00 ? 48  ASN A HB3  6  
ATOM 10463 H HD21 . ASN A 1 48  ? 17.670  4.376   3.124   1.00 0.00 ? 48  ASN A HD21 6  
ATOM 10464 H HD22 . ASN A 1 48  ? 19.210  4.863   3.738   1.00 0.00 ? 48  ASN A HD22 6  
ATOM 10465 N N    . ARG A 1 49  ? 16.480  3.306   -1.872  1.00 0.00 ? 49  ARG A N    6  
ATOM 10466 C CA   . ARG A 1 49  ? 15.356  2.722   -2.593  1.00 0.00 ? 49  ARG A CA   6  
ATOM 10467 C C    . ARG A 1 49  ? 15.010  1.343   -2.037  1.00 0.00 ? 49  ARG A C    6  
ATOM 10468 O O    . ARG A 1 49  ? 13.891  1.111   -1.581  1.00 0.00 ? 49  ARG A O    6  
ATOM 10469 C CB   . ARG A 1 49  ? 15.679  2.615   -4.085  1.00 0.00 ? 49  ARG A CB   6  
ATOM 10470 C CG   . ARG A 1 49  ? 15.957  3.956   -4.745  1.00 0.00 ? 49  ARG A CG   6  
ATOM 10471 C CD   . ARG A 1 49  ? 15.654  3.917   -6.234  1.00 0.00 ? 49  ARG A CD   6  
ATOM 10472 N NE   . ARG A 1 49  ? 16.774  3.389   -7.008  1.00 0.00 ? 49  ARG A NE   6  
ATOM 10473 C CZ   . ARG A 1 49  ? 16.979  3.670   -8.290  1.00 0.00 ? 49  ARG A CZ   6  
ATOM 10474 N NH1  . ARG A 1 49  ? 16.144  4.469   -8.939  1.00 0.00 ? 49  ARG A NH1  6  
ATOM 10475 N NH2  . ARG A 1 49  ? 18.022  3.150   -8.925  1.00 0.00 ? 49  ARG A NH2  6  
ATOM 10476 H H    . ARG A 1 49  ? 17.261  3.617   -2.376  1.00 0.00 ? 49  ARG A H    6  
ATOM 10477 H HA   . ARG A 1 49  ? 14.504  3.373   -2.464  1.00 0.00 ? 49  ARG A HA   6  
ATOM 10478 H HB2  . ARG A 1 49  ? 16.550  1.990   -4.209  1.00 0.00 ? 49  ARG A HB2  6  
ATOM 10479 H HB3  . ARG A 1 49  ? 14.842  2.157   -4.590  1.00 0.00 ? 49  ARG A HB3  6  
ATOM 10480 H HG2  . ARG A 1 49  ? 15.338  4.710   -4.282  1.00 0.00 ? 49  ARG A HG2  6  
ATOM 10481 H HG3  . ARG A 1 49  ? 16.998  4.206   -4.604  1.00 0.00 ? 49  ARG A HG3  6  
ATOM 10482 H HD2  . ARG A 1 49  ? 14.790  3.290   -6.396  1.00 0.00 ? 49  ARG A HD2  6  
ATOM 10483 H HD3  . ARG A 1 49  ? 15.438  4.921   -6.570  1.00 0.00 ? 49  ARG A HD3  6  
ATOM 10484 H HE   . ARG A 1 49  ? 17.404  2.796   -6.548  1.00 0.00 ? 49  ARG A HE   6  
ATOM 10485 H HH11 . ARG A 1 49  ? 15.358  4.863   -8.462  1.00 0.00 ? 49  ARG A HH11 6  
ATOM 10486 H HH12 . ARG A 1 49  ? 16.302  4.680   -9.904  1.00 0.00 ? 49  ARG A HH12 6  
ATOM 10487 H HH21 . ARG A 1 49  ? 18.654  2.547   -8.439  1.00 0.00 ? 49  ARG A HH21 6  
ATOM 10488 H HH22 . ARG A 1 49  ? 18.176  3.362   -9.890  1.00 0.00 ? 49  ARG A HH22 6  
ATOM 10489 N N    . GLU A 1 50  ? 15.979  0.434   -2.080  1.00 0.00 ? 50  GLU A N    6  
ATOM 10490 C CA   . GLU A 1 50  ? 15.775  -0.922  -1.582  1.00 0.00 ? 50  GLU A CA   6  
ATOM 10491 C C    . GLU A 1 50  ? 14.848  -0.922  -0.370  1.00 0.00 ? 50  GLU A C    6  
ATOM 10492 O O    . GLU A 1 50  ? 14.065  -1.851  -0.176  1.00 0.00 ? 50  GLU A O    6  
ATOM 10493 C CB   . GLU A 1 50  ? 17.116  -1.560  -1.213  1.00 0.00 ? 50  GLU A CB   6  
ATOM 10494 C CG   . GLU A 1 50  ? 17.886  -0.788  -0.154  1.00 0.00 ? 50  GLU A CG   6  
ATOM 10495 C CD   . GLU A 1 50  ? 19.366  -1.118  -0.152  1.00 0.00 ? 50  GLU A CD   6  
ATOM 10496 O OE1  . GLU A 1 50  ? 20.003  -0.993  -1.220  1.00 0.00 ? 50  GLU A OE1  6  
ATOM 10497 O OE2  . GLU A 1 50  ? 19.888  -1.502  0.915   1.00 0.00 ? 50  GLU A OE2  6  
ATOM 10498 H H    . GLU A 1 50  ? 16.850  0.679   -2.456  1.00 0.00 ? 50  GLU A H    6  
ATOM 10499 H HA   . GLU A 1 50  ? 15.318  -1.500  -2.370  1.00 0.00 ? 50  GLU A HA   6  
ATOM 10500 H HB2  . GLU A 1 50  ? 16.937  -2.558  -0.842  1.00 0.00 ? 50  GLU A HB2  6  
ATOM 10501 H HB3  . GLU A 1 50  ? 17.729  -1.620  -2.100  1.00 0.00 ? 50  GLU A HB3  6  
ATOM 10502 H HG2  . GLU A 1 50  ? 17.769  0.269   -0.341  1.00 0.00 ? 50  GLU A HG2  6  
ATOM 10503 H HG3  . GLU A 1 50  ? 17.478  -1.028  0.817   1.00 0.00 ? 50  GLU A HG3  6  
ATOM 10504 N N    . GLU A 1 51  ? 14.945  0.125   0.443   1.00 0.00 ? 51  GLU A N    6  
ATOM 10505 C CA   . GLU A 1 51  ? 14.117  0.245   1.636   1.00 0.00 ? 51  GLU A CA   6  
ATOM 10506 C C    . GLU A 1 51  ? 12.684  0.621   1.269   1.00 0.00 ? 51  GLU A C    6  
ATOM 10507 O O    . GLU A 1 51  ? 11.760  -0.176  1.434   1.00 0.00 ? 51  GLU A O    6  
ATOM 10508 C CB   . GLU A 1 51  ? 14.702  1.290   2.588   1.00 0.00 ? 51  GLU A CB   6  
ATOM 10509 C CG   . GLU A 1 51  ? 14.168  1.188   4.007   1.00 0.00 ? 51  GLU A CG   6  
ATOM 10510 C CD   . GLU A 1 51  ? 14.071  -0.245  4.492   1.00 0.00 ? 51  GLU A CD   6  
ATOM 10511 O OE1  . GLU A 1 51  ? 13.091  -0.929  4.131   1.00 0.00 ? 51  GLU A OE1  6  
ATOM 10512 O OE2  . GLU A 1 51  ? 14.977  -0.683  5.232   1.00 0.00 ? 51  GLU A OE2  6  
ATOM 10513 H H    . GLU A 1 51  ? 15.589  0.834   0.234   1.00 0.00 ? 51  GLU A H    6  
ATOM 10514 H HA   . GLU A 1 51  ? 14.109  -0.714  2.132   1.00 0.00 ? 51  GLU A HA   6  
ATOM 10515 H HB2  . GLU A 1 51  ? 15.775  1.171   2.619   1.00 0.00 ? 51  GLU A HB2  6  
ATOM 10516 H HB3  . GLU A 1 51  ? 14.469  2.274   2.209   1.00 0.00 ? 51  GLU A HB3  6  
ATOM 10517 H HG2  . GLU A 1 51  ? 14.829  1.731   4.666   1.00 0.00 ? 51  GLU A HG2  6  
ATOM 10518 H HG3  . GLU A 1 51  ? 13.184  1.632   4.041   1.00 0.00 ? 51  GLU A HG3  6  
ATOM 10519 N N    . ASP A 1 52  ? 12.508  1.839   0.770   1.00 0.00 ? 52  ASP A N    6  
ATOM 10520 C CA   . ASP A 1 52  ? 11.189  2.322   0.379   1.00 0.00 ? 52  ASP A CA   6  
ATOM 10521 C C    . ASP A 1 52  ? 10.446  1.270   -0.440  1.00 0.00 ? 52  ASP A C    6  
ATOM 10522 O O    . ASP A 1 52  ? 9.242   1.077   -0.274  1.00 0.00 ? 52  ASP A O    6  
ATOM 10523 C CB   . ASP A 1 52  ? 11.314  3.617   -0.425  1.00 0.00 ? 52  ASP A CB   6  
ATOM 10524 C CG   . ASP A 1 52  ? 11.859  4.763   0.404   1.00 0.00 ? 52  ASP A CG   6  
ATOM 10525 O OD1  . ASP A 1 52  ? 13.015  4.663   0.868   1.00 0.00 ? 52  ASP A OD1  6  
ATOM 10526 O OD2  . ASP A 1 52  ? 11.131  5.760   0.588   1.00 0.00 ? 52  ASP A OD2  6  
ATOM 10527 H H    . ASP A 1 52  ? 13.284  2.428   0.663   1.00 0.00 ? 52  ASP A H    6  
ATOM 10528 H HA   . ASP A 1 52  ? 10.628  2.521   1.279   1.00 0.00 ? 52  ASP A HA   6  
ATOM 10529 H HB2  . ASP A 1 52  ? 11.980  3.452   -1.260  1.00 0.00 ? 52  ASP A HB2  6  
ATOM 10530 H HB3  . ASP A 1 52  ? 10.340  3.897   -0.798  1.00 0.00 ? 52  ASP A HB3  6  
ATOM 10531 N N    . ALA A 1 53  ? 11.173  0.594   -1.323  1.00 0.00 ? 53  ALA A N    6  
ATOM 10532 C CA   . ALA A 1 53  ? 10.583  -0.439  -2.167  1.00 0.00 ? 53  ALA A CA   6  
ATOM 10533 C C    . ALA A 1 53  ? 10.552  -1.783  -1.447  1.00 0.00 ? 53  ALA A C    6  
ATOM 10534 O O    . ALA A 1 53  ? 9.783   -2.673  -1.809  1.00 0.00 ? 53  ALA A O    6  
ATOM 10535 C CB   . ALA A 1 53  ? 11.353  -0.556  -3.474  1.00 0.00 ? 53  ALA A CB   6  
ATOM 10536 H H    . ALA A 1 53  ? 12.128  0.793   -1.409  1.00 0.00 ? 53  ALA A H    6  
ATOM 10537 H HA   . ALA A 1 53  ? 9.571   -0.142  -2.399  1.00 0.00 ? 53  ALA A HA   6  
ATOM 10538 H HB1  . ALA A 1 53  ? 12.229  0.075   -3.432  1.00 0.00 ? 53  ALA A HB1  6  
ATOM 10539 H HB2  . ALA A 1 53  ? 11.654  -1.582  -3.624  1.00 0.00 ? 53  ALA A HB2  6  
ATOM 10540 H HB3  . ALA A 1 53  ? 10.722  -0.242  -4.292  1.00 0.00 ? 53  ALA A HB3  6  
ATOM 10541 N N    . ALA A 1 54  ? 11.392  -1.923  -0.428  1.00 0.00 ? 54  ALA A N    6  
ATOM 10542 C CA   . ALA A 1 54  ? 11.459  -3.159  0.343   1.00 0.00 ? 54  ALA A CA   6  
ATOM 10543 C C    . ALA A 1 54  ? 10.094  -3.834  0.417   1.00 0.00 ? 54  ALA A C    6  
ATOM 10544 O O    . ALA A 1 54  ? 9.989   -5.058  0.323   1.00 0.00 ? 54  ALA A O    6  
ATOM 10545 C CB   . ALA A 1 54  ? 11.988  -2.881  1.742   1.00 0.00 ? 54  ALA A CB   6  
ATOM 10546 H H    . ALA A 1 54  ? 11.980  -1.178  -0.187  1.00 0.00 ? 54  ALA A H    6  
ATOM 10547 H HA   . ALA A 1 54  ? 12.152  -3.824  -0.152  1.00 0.00 ? 54  ALA A HA   6  
ATOM 10548 H HB1  . ALA A 1 54  ? 12.981  -2.460  1.673   1.00 0.00 ? 54  ALA A HB1  6  
ATOM 10549 H HB2  . ALA A 1 54  ? 11.335  -2.181  2.242   1.00 0.00 ? 54  ALA A HB2  6  
ATOM 10550 H HB3  . ALA A 1 54  ? 12.026  -3.803  2.302   1.00 0.00 ? 54  ALA A HB3  6  
ATOM 10551 N N    . LEU A 1 55  ? 9.050   -3.031  0.586   1.00 0.00 ? 55  LEU A N    6  
ATOM 10552 C CA   . LEU A 1 55  ? 7.690   -3.551  0.673   1.00 0.00 ? 55  LEU A CA   6  
ATOM 10553 C C    . LEU A 1 55  ? 7.151   -3.901  -0.710  1.00 0.00 ? 55  LEU A C    6  
ATOM 10554 O O    . LEU A 1 55  ? 6.765   -5.041  -0.968  1.00 0.00 ? 55  LEU A O    6  
ATOM 10555 C CB   . LEU A 1 55  ? 6.773   -2.528  1.347   1.00 0.00 ? 55  LEU A CB   6  
ATOM 10556 C CG   . LEU A 1 55  ? 5.280   -2.856  1.337   1.00 0.00 ? 55  LEU A CG   6  
ATOM 10557 C CD1  . LEU A 1 55  ? 4.975   -3.987  2.307   1.00 0.00 ? 55  LEU A CD1  6  
ATOM 10558 C CD2  . LEU A 1 55  ? 4.460   -1.621  1.681   1.00 0.00 ? 55  LEU A CD2  6  
ATOM 10559 H H    . LEU A 1 55  ? 9.196   -2.064  0.654   1.00 0.00 ? 55  LEU A H    6  
ATOM 10560 H HA   . LEU A 1 55  ? 7.716   -4.448  1.273   1.00 0.00 ? 55  LEU A HA   6  
ATOM 10561 H HB2  . LEU A 1 55  ? 7.084   -2.433  2.376   1.00 0.00 ? 55  LEU A HB2  6  
ATOM 10562 H HB3  . LEU A 1 55  ? 6.909   -1.582  0.842   1.00 0.00 ? 55  LEU A HB3  6  
ATOM 10563 H HG   . LEU A 1 55  ? 4.996   -3.181  0.346   1.00 0.00 ? 55  LEU A HG   6  
ATOM 10564 H HD11 . LEU A 1 55  ? 5.896   -4.473  2.593   1.00 0.00 ? 55  LEU A HD11 6  
ATOM 10565 H HD12 . LEU A 1 55  ? 4.322   -4.703  1.831   1.00 0.00 ? 55  LEU A HD12 6  
ATOM 10566 H HD13 . LEU A 1 55  ? 4.491   -3.587  3.186   1.00 0.00 ? 55  LEU A HD13 6  
ATOM 10567 H HD21 . LEU A 1 55  ? 3.805   -1.383  0.856   1.00 0.00 ? 55  LEU A HD21 6  
ATOM 10568 H HD22 . LEU A 1 55  ? 5.124   -0.788  1.865   1.00 0.00 ? 55  LEU A HD22 6  
ATOM 10569 H HD23 . LEU A 1 55  ? 3.871   -1.814  2.565   1.00 0.00 ? 55  LEU A HD23 6  
ATOM 10570 N N    . PHE A 1 56  ? 7.129   -2.912  -1.598  1.00 0.00 ? 56  PHE A N    6  
ATOM 10571 C CA   . PHE A 1 56  ? 6.639   -3.115  -2.957  1.00 0.00 ? 56  PHE A CA   6  
ATOM 10572 C C    . PHE A 1 56  ? 7.363   -4.279  -3.628  1.00 0.00 ? 56  PHE A C    6  
ATOM 10573 O O    . PHE A 1 56  ? 6.736   -5.235  -4.084  1.00 0.00 ? 56  PHE A O    6  
ATOM 10574 C CB   . PHE A 1 56  ? 6.822   -1.841  -3.783  1.00 0.00 ? 56  PHE A CB   6  
ATOM 10575 C CG   . PHE A 1 56  ? 5.991   -0.687  -3.298  1.00 0.00 ? 56  PHE A CG   6  
ATOM 10576 C CD1  . PHE A 1 56  ? 4.630   -0.640  -3.554  1.00 0.00 ? 56  PHE A CD1  6  
ATOM 10577 C CD2  . PHE A 1 56  ? 6.571   0.350   -2.585  1.00 0.00 ? 56  PHE A CD2  6  
ATOM 10578 C CE1  . PHE A 1 56  ? 3.864   0.421   -3.109  1.00 0.00 ? 56  PHE A CE1  6  
ATOM 10579 C CE2  . PHE A 1 56  ? 5.810   1.413   -2.137  1.00 0.00 ? 56  PHE A CE2  6  
ATOM 10580 C CZ   . PHE A 1 56  ? 4.455   1.448   -2.399  1.00 0.00 ? 56  PHE A CZ   6  
ATOM 10581 H H    . PHE A 1 56  ? 7.450   -2.024  -1.333  1.00 0.00 ? 56  PHE A H    6  
ATOM 10582 H HA   . PHE A 1 56  ? 5.587   -3.348  -2.897  1.00 0.00 ? 56  PHE A HA   6  
ATOM 10583 H HB2  . PHE A 1 56  ? 7.858   -1.542  -3.746  1.00 0.00 ? 56  PHE A HB2  6  
ATOM 10584 H HB3  . PHE A 1 56  ? 6.546   -2.042  -4.807  1.00 0.00 ? 56  PHE A HB3  6  
ATOM 10585 H HD1  . PHE A 1 56  ? 4.167   -1.442  -4.109  1.00 0.00 ? 56  PHE A HD1  6  
ATOM 10586 H HD2  . PHE A 1 56  ? 7.632   0.323   -2.379  1.00 0.00 ? 56  PHE A HD2  6  
ATOM 10587 H HE1  . PHE A 1 56  ? 2.805   0.446   -3.315  1.00 0.00 ? 56  PHE A HE1  6  
ATOM 10588 H HE2  . PHE A 1 56  ? 6.275   2.214   -1.582  1.00 0.00 ? 56  PHE A HE2  6  
ATOM 10589 H HZ   . PHE A 1 56  ? 3.858   2.278   -2.051  1.00 0.00 ? 56  PHE A HZ   6  
ATOM 10590 N N    . LYS A 1 57  ? 8.687   -4.189  -3.686  1.00 0.00 ? 57  LYS A N    6  
ATOM 10591 C CA   . LYS A 1 57  ? 9.499   -5.233  -4.300  1.00 0.00 ? 57  LYS A CA   6  
ATOM 10592 C C    . LYS A 1 57  ? 9.040   -6.616  -3.848  1.00 0.00 ? 57  LYS A C    6  
ATOM 10593 O O    . LYS A 1 57  ? 8.657   -7.451  -4.667  1.00 0.00 ? 57  LYS A O    6  
ATOM 10594 C CB   . LYS A 1 57  ? 10.975  -5.033  -3.948  1.00 0.00 ? 57  LYS A CB   6  
ATOM 10595 C CG   . LYS A 1 57  ? 11.921  -5.855  -4.806  1.00 0.00 ? 57  LYS A CG   6  
ATOM 10596 C CD   . LYS A 1 57  ? 13.370  -5.643  -4.399  1.00 0.00 ? 57  LYS A CD   6  
ATOM 10597 C CE   . LYS A 1 57  ? 14.328  -6.263  -5.404  1.00 0.00 ? 57  LYS A CE   6  
ATOM 10598 N NZ   . LYS A 1 57  ? 14.524  -7.719  -5.157  1.00 0.00 ? 57  LYS A NZ   6  
ATOM 10599 H H    . LYS A 1 57  ? 9.130   -3.401  -3.305  1.00 0.00 ? 57  LYS A H    6  
ATOM 10600 H HA   . LYS A 1 57  ? 9.380   -5.159  -5.370  1.00 0.00 ? 57  LYS A HA   6  
ATOM 10601 H HB2  . LYS A 1 57  ? 11.224  -3.989  -4.072  1.00 0.00 ? 57  LYS A HB2  6  
ATOM 10602 H HB3  . LYS A 1 57  ? 11.127  -5.310  -2.915  1.00 0.00 ? 57  LYS A HB3  6  
ATOM 10603 H HG2  . LYS A 1 57  ? 11.677  -6.901  -4.696  1.00 0.00 ? 57  LYS A HG2  6  
ATOM 10604 H HG3  . LYS A 1 57  ? 11.801  -5.562  -5.840  1.00 0.00 ? 57  LYS A HG3  6  
ATOM 10605 H HD2  . LYS A 1 57  ? 13.567  -4.583  -4.338  1.00 0.00 ? 57  LYS A HD2  6  
ATOM 10606 H HD3  . LYS A 1 57  ? 13.533  -6.097  -3.431  1.00 0.00 ? 57  LYS A HD3  6  
ATOM 10607 H HE2  . LYS A 1 57  ? 13.927  -6.126  -6.396  1.00 0.00 ? 57  LYS A HE2  6  
ATOM 10608 H HE3  . LYS A 1 57  ? 15.282  -5.762  -5.329  1.00 0.00 ? 57  LYS A HE3  6  
ATOM 10609 H HZ1  . LYS A 1 57  ? 14.368  -7.935  -4.152  1.00 0.00 ? 57  LYS A HZ1  6  
ATOM 10610 H HZ2  . LYS A 1 57  ? 15.493  -7.997  -5.413  1.00 0.00 ? 57  LYS A HZ2  6  
ATOM 10611 H HZ3  . LYS A 1 57  ? 13.854  -8.272  -5.728  1.00 0.00 ? 57  LYS A HZ3  6  
ATOM 10612 N N    . ALA A 1 58  ? 9.082   -6.850  -2.541  1.00 0.00 ? 58  ALA A N    6  
ATOM 10613 C CA   . ALA A 1 58  ? 8.667   -8.130  -1.980  1.00 0.00 ? 58  ALA A CA   6  
ATOM 10614 C C    . ALA A 1 58  ? 7.414   -8.652  -2.674  1.00 0.00 ? 58  ALA A C    6  
ATOM 10615 O O    . ALA A 1 58  ? 7.301   -9.845  -2.956  1.00 0.00 ? 58  ALA A O    6  
ATOM 10616 C CB   . ALA A 1 58  ? 8.428   -7.998  -0.483  1.00 0.00 ? 58  ALA A CB   6  
ATOM 10617 H H    . ALA A 1 58  ? 9.397   -6.144  -1.939  1.00 0.00 ? 58  ALA A H    6  
ATOM 10618 H HA   . ALA A 1 58  ? 9.471   -8.836  -2.131  1.00 0.00 ? 58  ALA A HA   6  
ATOM 10619 H HB1  . ALA A 1 58  ? 9.143   -7.304  -0.065  1.00 0.00 ? 58  ALA A HB1  6  
ATOM 10620 H HB2  . ALA A 1 58  ? 7.427   -7.632  -0.310  1.00 0.00 ? 58  ALA A HB2  6  
ATOM 10621 H HB3  . ALA A 1 58  ? 8.546   -8.963  -0.014  1.00 0.00 ? 58  ALA A HB3  6  
ATOM 10622 N N    . TRP A 1 59  ? 6.475   -7.753  -2.945  1.00 0.00 ? 59  TRP A N    6  
ATOM 10623 C CA   . TRP A 1 59  ? 5.229   -8.125  -3.606  1.00 0.00 ? 59  TRP A CA   6  
ATOM 10624 C C    . TRP A 1 59  ? 5.503   -8.902  -4.888  1.00 0.00 ? 59  TRP A C    6  
ATOM 10625 O O    . TRP A 1 59  ? 4.917   -9.958  -5.123  1.00 0.00 ? 59  TRP A O    6  
ATOM 10626 C CB   . TRP A 1 59  ? 4.401   -6.877  -3.918  1.00 0.00 ? 59  TRP A CB   6  
ATOM 10627 C CG   . TRP A 1 59  ? 3.032   -7.188  -4.442  1.00 0.00 ? 59  TRP A CG   6  
ATOM 10628 C CD1  . TRP A 1 59  ? 2.462   -6.703  -5.584  1.00 0.00 ? 59  TRP A CD1  6  
ATOM 10629 C CD2  . TRP A 1 59  ? 2.061   -8.053  -3.843  1.00 0.00 ? 59  TRP A CD2  6  
ATOM 10630 N NE1  . TRP A 1 59  ? 1.195   -7.214  -5.731  1.00 0.00 ? 59  TRP A NE1  6  
ATOM 10631 C CE2  . TRP A 1 59  ? 0.925   -8.045  -4.677  1.00 0.00 ? 59  TRP A CE2  6  
ATOM 10632 C CE3  . TRP A 1 59  ? 2.041   -8.835  -2.685  1.00 0.00 ? 59  TRP A CE3  6  
ATOM 10633 C CZ2  . TRP A 1 59  ? -0.216  -8.788  -4.386  1.00 0.00 ? 59  TRP A CZ2  6  
ATOM 10634 C CZ3  . TRP A 1 59  ? 0.908   -9.572  -2.398  1.00 0.00 ? 59  TRP A CZ3  6  
ATOM 10635 C CH2  . TRP A 1 59  ? -0.208  -9.545  -3.246  1.00 0.00 ? 59  TRP A CH2  6  
ATOM 10636 H H    . TRP A 1 59  ? 6.623   -6.817  -2.696  1.00 0.00 ? 59  TRP A H    6  
ATOM 10637 H HA   . TRP A 1 59  ? 4.671   -8.755  -2.929  1.00 0.00 ? 59  TRP A HA   6  
ATOM 10638 H HB2  . TRP A 1 59  ? 4.288   -6.293  -3.017  1.00 0.00 ? 59  TRP A HB2  6  
ATOM 10639 H HB3  . TRP A 1 59  ? 4.918   -6.288  -4.662  1.00 0.00 ? 59  TRP A HB3  6  
ATOM 10640 H HD1  . TRP A 1 59  ? 2.947   -6.016  -6.262  1.00 0.00 ? 59  TRP A HD1  6  
ATOM 10641 H HE1  . TRP A 1 59  ? 0.584   -7.015  -6.472  1.00 0.00 ? 59  TRP A HE1  6  
ATOM 10642 H HE3  . TRP A 1 59  ? 2.891   -8.869  -2.019  1.00 0.00 ? 59  TRP A HE3  6  
ATOM 10643 H HZ2  . TRP A 1 59  ? -1.083  -8.779  -5.030  1.00 0.00 ? 59  TRP A HZ2  6  
ATOM 10644 H HZ3  . TRP A 1 59  ? 0.874   -10.181 -1.507  1.00 0.00 ? 59  TRP A HZ3  6  
ATOM 10645 H HH2  . TRP A 1 59  ? -1.072  -10.135 -2.982  1.00 0.00 ? 59  TRP A HH2  6  
ATOM 10646 N N    . ALA A 1 60  ? 6.398   -8.372  -5.716  1.00 0.00 ? 60  ALA A N    6  
ATOM 10647 C CA   . ALA A 1 60  ? 6.751   -9.018  -6.974  1.00 0.00 ? 60  ALA A CA   6  
ATOM 10648 C C    . ALA A 1 60  ? 7.426   -10.364 -6.730  1.00 0.00 ? 60  ALA A C    6  
ATOM 10649 O O    . ALA A 1 60  ? 6.937   -11.404 -7.173  1.00 0.00 ? 60  ALA A O    6  
ATOM 10650 C CB   . ALA A 1 60  ? 7.657   -8.113  -7.796  1.00 0.00 ? 60  ALA A CB   6  
ATOM 10651 H H    . ALA A 1 60  ? 6.832   -7.528  -5.474  1.00 0.00 ? 60  ALA A H    6  
ATOM 10652 H HA   . ALA A 1 60  ? 5.841   -9.179  -7.534  1.00 0.00 ? 60  ALA A HA   6  
ATOM 10653 H HB1  . ALA A 1 60  ? 8.435   -7.713  -7.163  1.00 0.00 ? 60  ALA A HB1  6  
ATOM 10654 H HB2  . ALA A 1 60  ? 8.102   -8.682  -8.599  1.00 0.00 ? 60  ALA A HB2  6  
ATOM 10655 H HB3  . ALA A 1 60  ? 7.076   -7.302  -8.209  1.00 0.00 ? 60  ALA A HB3  6  
ATOM 10656 N N    . LEU A 1 61  ? 8.550   -10.337 -6.024  1.00 0.00 ? 61  LEU A N    6  
ATOM 10657 C CA   . LEU A 1 61  ? 9.293   -11.555 -5.721  1.00 0.00 ? 61  LEU A CA   6  
ATOM 10658 C C    . LEU A 1 61  ? 8.365   -12.640 -5.183  1.00 0.00 ? 61  LEU A C    6  
ATOM 10659 O O    . LEU A 1 61  ? 8.515   -13.818 -5.509  1.00 0.00 ? 61  LEU A O    6  
ATOM 10660 C CB   . LEU A 1 61  ? 10.397  -11.263 -4.703  1.00 0.00 ? 61  LEU A CB   6  
ATOM 10661 C CG   . LEU A 1 61  ? 11.469  -10.265 -5.143  1.00 0.00 ? 61  LEU A CG   6  
ATOM 10662 C CD1  . LEU A 1 61  ? 12.000  -9.491  -3.947  1.00 0.00 ? 61  LEU A CD1  6  
ATOM 10663 C CD2  . LEU A 1 61  ? 12.602  -10.981 -5.864  1.00 0.00 ? 61  LEU A CD2  6  
ATOM 10664 H H    . LEU A 1 61  ? 8.890   -9.478  -5.697  1.00 0.00 ? 61  LEU A H    6  
ATOM 10665 H HA   . LEU A 1 61  ? 9.743   -11.905 -6.638  1.00 0.00 ? 61  LEU A HA   6  
ATOM 10666 H HB2  . LEU A 1 61  ? 9.930   -10.876 -3.811  1.00 0.00 ? 61  LEU A HB2  6  
ATOM 10667 H HB3  . LEU A 1 61  ? 10.889  -12.198 -4.473  1.00 0.00 ? 61  LEU A HB3  6  
ATOM 10668 H HG   . LEU A 1 61  ? 11.029  -9.555  -5.831  1.00 0.00 ? 61  LEU A HG   6  
ATOM 10669 H HD11 . LEU A 1 61  ? 11.173  -9.128  -3.356  1.00 0.00 ? 61  LEU A HD11 6  
ATOM 10670 H HD12 . LEU A 1 61  ? 12.590  -8.655  -4.292  1.00 0.00 ? 61  LEU A HD12 6  
ATOM 10671 H HD13 . LEU A 1 61  ? 12.617  -10.141 -3.343  1.00 0.00 ? 61  LEU A HD13 6  
ATOM 10672 H HD21 . LEU A 1 61  ? 13.437  -10.307 -5.979  1.00 0.00 ? 61  LEU A HD21 6  
ATOM 10673 H HD22 . LEU A 1 61  ? 12.262  -11.303 -6.838  1.00 0.00 ? 61  LEU A HD22 6  
ATOM 10674 H HD23 . LEU A 1 61  ? 12.909  -11.840 -5.287  1.00 0.00 ? 61  LEU A HD23 6  
ATOM 10675 N N    . PHE A 1 62  ? 7.403   -12.234 -4.361  1.00 0.00 ? 62  PHE A N    6  
ATOM 10676 C CA   . PHE A 1 62  ? 6.449   -13.171 -3.779  1.00 0.00 ? 62  PHE A CA   6  
ATOM 10677 C C    . PHE A 1 62  ? 5.438   -13.635 -4.823  1.00 0.00 ? 62  PHE A C    6  
ATOM 10678 O O    . PHE A 1 62  ? 5.297   -14.832 -5.079  1.00 0.00 ? 62  PHE A O    6  
ATOM 10679 C CB   . PHE A 1 62  ? 5.720   -12.523 -2.600  1.00 0.00 ? 62  PHE A CB   6  
ATOM 10680 C CG   . PHE A 1 62  ? 4.493   -13.274 -2.168  1.00 0.00 ? 62  PHE A CG   6  
ATOM 10681 C CD1  . PHE A 1 62  ? 3.258   -12.992 -2.731  1.00 0.00 ? 62  PHE A CD1  6  
ATOM 10682 C CD2  . PHE A 1 62  ? 4.574   -14.261 -1.200  1.00 0.00 ? 62  PHE A CD2  6  
ATOM 10683 C CE1  . PHE A 1 62  ? 2.128   -13.681 -2.335  1.00 0.00 ? 62  PHE A CE1  6  
ATOM 10684 C CE2  . PHE A 1 62  ? 3.447   -14.954 -0.800  1.00 0.00 ? 62  PHE A CE2  6  
ATOM 10685 C CZ   . PHE A 1 62  ? 2.222   -14.664 -1.369  1.00 0.00 ? 62  PHE A CZ   6  
ATOM 10686 H H    . PHE A 1 62  ? 7.335   -11.281 -4.139  1.00 0.00 ? 62  PHE A H    6  
ATOM 10687 H HA   . PHE A 1 62  ? 7.001   -14.027 -3.424  1.00 0.00 ? 62  PHE A HA   6  
ATOM 10688 H HB2  . PHE A 1 62  ? 6.391   -12.471 -1.756  1.00 0.00 ? 62  PHE A HB2  6  
ATOM 10689 H HB3  . PHE A 1 62  ? 5.419   -11.524 -2.877  1.00 0.00 ? 62  PHE A HB3  6  
ATOM 10690 H HD1  . PHE A 1 62  ? 3.183   -12.225 -3.487  1.00 0.00 ? 62  PHE A HD1  6  
ATOM 10691 H HD2  . PHE A 1 62  ? 5.532   -14.489 -0.754  1.00 0.00 ? 62  PHE A HD2  6  
ATOM 10692 H HE1  . PHE A 1 62  ? 1.172   -13.453 -2.781  1.00 0.00 ? 62  PHE A HE1  6  
ATOM 10693 H HE2  . PHE A 1 62  ? 3.524   -15.722 -0.044  1.00 0.00 ? 62  PHE A HE2  6  
ATOM 10694 H HZ   . PHE A 1 62  ? 1.340   -15.204 -1.057  1.00 0.00 ? 62  PHE A HZ   6  
ATOM 10695 N N    . LYS A 1 63  ? 4.735   -12.681 -5.424  1.00 0.00 ? 63  LYS A N    6  
ATOM 10696 C CA   . LYS A 1 63  ? 3.737   -12.990 -6.441  1.00 0.00 ? 63  LYS A CA   6  
ATOM 10697 C C    . LYS A 1 63  ? 4.358   -13.778 -7.590  1.00 0.00 ? 63  LYS A C    6  
ATOM 10698 O O    . LYS A 1 63  ? 3.973   -14.917 -7.853  1.00 0.00 ? 63  LYS A O    6  
ATOM 10699 C CB   . LYS A 1 63  ? 3.107   -11.701 -6.974  1.00 0.00 ? 63  LYS A CB   6  
ATOM 10700 C CG   . LYS A 1 63  ? 2.296   -10.946 -5.936  1.00 0.00 ? 63  LYS A CG   6  
ATOM 10701 C CD   . LYS A 1 63  ? 1.022   -11.690 -5.573  1.00 0.00 ? 63  LYS A CD   6  
ATOM 10702 C CE   . LYS A 1 63  ? -0.031  -11.556 -6.662  1.00 0.00 ? 63  LYS A CE   6  
ATOM 10703 N NZ   . LYS A 1 63  ? -1.232  -12.390 -6.379  1.00 0.00 ? 63  LYS A NZ   6  
ATOM 10704 H H    . LYS A 1 63  ? 4.893   -11.745 -5.178  1.00 0.00 ? 63  LYS A H    6  
ATOM 10705 H HA   . LYS A 1 63  ? 2.969   -13.592 -5.980  1.00 0.00 ? 63  LYS A HA   6  
ATOM 10706 H HB2  . LYS A 1 63  ? 3.893   -11.051 -7.330  1.00 0.00 ? 63  LYS A HB2  6  
ATOM 10707 H HB3  . LYS A 1 63  ? 2.455   -11.948 -7.800  1.00 0.00 ? 63  LYS A HB3  6  
ATOM 10708 H HG2  . LYS A 1 63  ? 2.894   -10.822 -5.045  1.00 0.00 ? 63  LYS A HG2  6  
ATOM 10709 H HG3  . LYS A 1 63  ? 2.034   -9.975  -6.333  1.00 0.00 ? 63  LYS A HG3  6  
ATOM 10710 H HD2  . LYS A 1 63  ? 1.253   -12.737 -5.438  1.00 0.00 ? 63  LYS A HD2  6  
ATOM 10711 H HD3  . LYS A 1 63  ? 0.628   -11.285 -4.652  1.00 0.00 ? 63  LYS A HD3  6  
ATOM 10712 H HE2  . LYS A 1 63  ? -0.330  -10.522 -6.730  1.00 0.00 ? 63  LYS A HE2  6  
ATOM 10713 H HE3  . LYS A 1 63  ? 0.400   -11.868 -7.602  1.00 0.00 ? 63  LYS A HE3  6  
ATOM 10714 H HZ1  . LYS A 1 63  ? -1.694  -12.065 -5.506  1.00 0.00 ? 63  LYS A HZ1  6  
ATOM 10715 H HZ2  . LYS A 1 63  ? -0.955  -13.386 -6.261  1.00 0.00 ? 63  LYS A HZ2  6  
ATOM 10716 H HZ3  . LYS A 1 63  ? -1.909  -12.320 -7.164  1.00 0.00 ? 63  LYS A HZ3  6  
ATOM 10717 N N    . GLY A 1 64  ? 5.321   -13.164 -8.271  1.00 0.00 ? 64  GLY A N    6  
ATOM 10718 C CA   . GLY A 1 64  ? 5.979   -13.825 -9.383  1.00 0.00 ? 64  GLY A CA   6  
ATOM 10719 C C    . GLY A 1 64  ? 7.382   -14.282 -9.037  1.00 0.00 ? 64  GLY A C    6  
ATOM 10720 O O    . GLY A 1 64  ? 7.698   -14.513 -7.870  1.00 0.00 ? 64  GLY A O    6  
ATOM 10721 H H    . GLY A 1 64  ? 5.586   -12.256 -8.017  1.00 0.00 ? 64  GLY A H    6  
ATOM 10722 H HA2  . GLY A 1 64  ? 5.394   -14.683 -9.676  1.00 0.00 ? 64  GLY A HA2  6  
ATOM 10723 H HA3  . GLY A 1 64  ? 6.033   -13.137 -10.215 1.00 0.00 ? 64  GLY A HA3  6  
ATOM 10724 N N    . LYS A 1 65  ? 8.227   -14.417 -10.054 1.00 0.00 ? 65  LYS A N    6  
ATOM 10725 C CA   . LYS A 1 65  ? 9.604   -14.850 -9.853  1.00 0.00 ? 65  LYS A CA   6  
ATOM 10726 C C    . LYS A 1 65  ? 10.581  -13.884 -10.515 1.00 0.00 ? 65  LYS A C    6  
ATOM 10727 O O    . LYS A 1 65  ? 10.756  -13.901 -11.734 1.00 0.00 ? 65  LYS A O    6  
ATOM 10728 C CB   . LYS A 1 65  ? 9.804   -16.260 -10.415 1.00 0.00 ? 65  LYS A CB   6  
ATOM 10729 C CG   . LYS A 1 65  ? 8.952   -17.314 -9.730  1.00 0.00 ? 65  LYS A CG   6  
ATOM 10730 C CD   . LYS A 1 65  ? 7.556   -17.377 -10.327 1.00 0.00 ? 65  LYS A CD   6  
ATOM 10731 C CE   . LYS A 1 65  ? 7.564   -18.042 -11.695 1.00 0.00 ? 65  LYS A CE   6  
ATOM 10732 N NZ   . LYS A 1 65  ? 6.191   -18.407 -12.142 1.00 0.00 ? 65  LYS A NZ   6  
ATOM 10733 H H    . LYS A 1 65  ? 7.916   -14.218 -10.963 1.00 0.00 ? 65  LYS A H    6  
ATOM 10734 H HA   . LYS A 1 65  ? 9.796   -14.866 -8.791  1.00 0.00 ? 65  LYS A HA   6  
ATOM 10735 H HB2  . LYS A 1 65  ? 9.556   -16.253 -11.467 1.00 0.00 ? 65  LYS A HB2  6  
ATOM 10736 H HB3  . LYS A 1 65  ? 10.842  -16.536 -10.302 1.00 0.00 ? 65  LYS A HB3  6  
ATOM 10737 H HG2  . LYS A 1 65  ? 9.426   -18.278 -9.847  1.00 0.00 ? 65  LYS A HG2  6  
ATOM 10738 H HG3  . LYS A 1 65  ? 8.875   -17.074 -8.679  1.00 0.00 ? 65  LYS A HG3  6  
ATOM 10739 H HD2  . LYS A 1 65  ? 6.917   -17.945 -9.667  1.00 0.00 ? 65  LYS A HD2  6  
ATOM 10740 H HD3  . LYS A 1 65  ? 7.171   -16.372 -10.426 1.00 0.00 ? 65  LYS A HD3  6  
ATOM 10741 H HE2  . LYS A 1 65  ? 7.996   -17.359 -12.410 1.00 0.00 ? 65  LYS A HE2  6  
ATOM 10742 H HE3  . LYS A 1 65  ? 8.166   -18.937 -11.642 1.00 0.00 ? 65  LYS A HE3  6  
ATOM 10743 H HZ1  . LYS A 1 65  ? 5.553   -17.593 -12.036 1.00 0.00 ? 65  LYS A HZ1  6  
ATOM 10744 H HZ2  . LYS A 1 65  ? 5.827   -19.195 -11.570 1.00 0.00 ? 65  LYS A HZ2  6  
ATOM 10745 H HZ3  . LYS A 1 65  ? 6.205   -18.695 -13.141 1.00 0.00 ? 65  LYS A HZ3  6  
ATOM 10746 N N    . PHE A 1 66  ? 11.217  -13.044 -9.705  1.00 0.00 ? 66  PHE A N    6  
ATOM 10747 C CA   . PHE A 1 66  ? 12.177  -12.071 -10.213 1.00 0.00 ? 66  PHE A CA   6  
ATOM 10748 C C    . PHE A 1 66  ? 13.474  -12.117 -9.410  1.00 0.00 ? 66  PHE A C    6  
ATOM 10749 O O    . PHE A 1 66  ? 13.471  -12.451 -8.225  1.00 0.00 ? 66  PHE A O    6  
ATOM 10750 C CB   . PHE A 1 66  ? 11.582  -10.662 -10.162 1.00 0.00 ? 66  PHE A CB   6  
ATOM 10751 C CG   . PHE A 1 66  ? 12.617  -9.577  -10.083 1.00 0.00 ? 66  PHE A CG   6  
ATOM 10752 C CD1  . PHE A 1 66  ? 13.267  -9.307  -8.889  1.00 0.00 ? 66  PHE A CD1  6  
ATOM 10753 C CD2  . PHE A 1 66  ? 12.941  -8.827  -11.202 1.00 0.00 ? 66  PHE A CD2  6  
ATOM 10754 C CE1  . PHE A 1 66  ? 14.221  -8.309  -8.813  1.00 0.00 ? 66  PHE A CE1  6  
ATOM 10755 C CE2  . PHE A 1 66  ? 13.894  -7.828  -11.132 1.00 0.00 ? 66  PHE A CE2  6  
ATOM 10756 C CZ   . PHE A 1 66  ? 14.533  -7.568  -9.935  1.00 0.00 ? 66  PHE A CZ   6  
ATOM 10757 H H    . PHE A 1 66  ? 11.035  -13.079 -8.742  1.00 0.00 ? 66  PHE A H    6  
ATOM 10758 H HA   . PHE A 1 66  ? 12.393  -12.325 -11.239 1.00 0.00 ? 66  PHE A HA   6  
ATOM 10759 H HB2  . PHE A 1 66  ? 10.995  -10.495 -11.053 1.00 0.00 ? 66  PHE A HB2  6  
ATOM 10760 H HB3  . PHE A 1 66  ? 10.945  -10.579 -9.295  1.00 0.00 ? 66  PHE A HB3  6  
ATOM 10761 H HD1  . PHE A 1 66  ? 13.023  -9.886  -8.010  1.00 0.00 ? 66  PHE A HD1  6  
ATOM 10762 H HD2  . PHE A 1 66  ? 12.441  -9.028  -12.138 1.00 0.00 ? 66  PHE A HD2  6  
ATOM 10763 H HE1  . PHE A 1 66  ? 14.719  -8.109  -7.876  1.00 0.00 ? 66  PHE A HE1  6  
ATOM 10764 H HE2  . PHE A 1 66  ? 14.136  -7.250  -12.011 1.00 0.00 ? 66  PHE A HE2  6  
ATOM 10765 H HZ   . PHE A 1 66  ? 15.278  -6.789  -9.878  1.00 0.00 ? 66  PHE A HZ   6  
ATOM 10766 N N    . ARG A 1 67  ? 14.580  -11.779 -10.064 1.00 0.00 ? 67  ARG A N    6  
ATOM 10767 C CA   . ARG A 1 67  ? 15.884  -11.783 -9.413  1.00 0.00 ? 67  ARG A CA   6  
ATOM 10768 C C    . ARG A 1 67  ? 16.486  -10.381 -9.393  1.00 0.00 ? 67  ARG A C    6  
ATOM 10769 O O    . ARG A 1 67  ? 16.522  -9.696  -10.415 1.00 0.00 ? 67  ARG A O    6  
ATOM 10770 C CB   . ARG A 1 67  ? 16.833  -12.746 -10.129 1.00 0.00 ? 67  ARG A CB   6  
ATOM 10771 C CG   . ARG A 1 67  ? 16.131  -13.945 -10.746 1.00 0.00 ? 67  ARG A CG   6  
ATOM 10772 C CD   . ARG A 1 67  ? 15.915  -15.051 -9.724  1.00 0.00 ? 67  ARG A CD   6  
ATOM 10773 N NE   . ARG A 1 67  ? 17.157  -15.426 -9.054  1.00 0.00 ? 67  ARG A NE   6  
ATOM 10774 C CZ   . ARG A 1 67  ? 17.716  -16.627 -9.161  1.00 0.00 ? 67  ARG A CZ   6  
ATOM 10775 N NH1  . ARG A 1 67  ? 17.146  -17.563 -9.908  1.00 0.00 ? 67  ARG A NH1  6  
ATOM 10776 N NH2  . ARG A 1 67  ? 18.847  -16.893 -8.521  1.00 0.00 ? 67  ARG A NH2  6  
ATOM 10777 H H    . ARG A 1 67  ? 14.518  -11.521 -11.008 1.00 0.00 ? 67  ARG A H    6  
ATOM 10778 H HA   . ARG A 1 67  ? 15.746  -12.117 -8.396  1.00 0.00 ? 67  ARG A HA   6  
ATOM 10779 H HB2  . ARG A 1 67  ? 17.343  -12.211 -10.917 1.00 0.00 ? 67  ARG A HB2  6  
ATOM 10780 H HB3  . ARG A 1 67  ? 17.561  -13.108 -9.420  1.00 0.00 ? 67  ARG A HB3  6  
ATOM 10781 H HG2  . ARG A 1 67  ? 15.171  -13.632 -11.129 1.00 0.00 ? 67  ARG A HG2  6  
ATOM 10782 H HG3  . ARG A 1 67  ? 16.736  -14.327 -11.555 1.00 0.00 ? 67  ARG A HG3  6  
ATOM 10783 H HD2  . ARG A 1 67  ? 15.209  -14.705 -8.984  1.00 0.00 ? 67  ARG A HD2  6  
ATOM 10784 H HD3  . ARG A 1 67  ? 15.513  -15.916 -10.230 1.00 0.00 ? 67  ARG A HD3  6  
ATOM 10785 H HE   . ARG A 1 67  ? 17.595  -14.750 -8.497  1.00 0.00 ? 67  ARG A HE   6  
ATOM 10786 H HH11 . ARG A 1 67  ? 16.294  -17.364 -10.393 1.00 0.00 ? 67  ARG A HH11 6  
ATOM 10787 H HH12 . ARG A 1 67  ? 17.569  -18.465 -9.988  1.00 0.00 ? 67  ARG A HH12 6  
ATOM 10788 H HH21 . ARG A 1 67  ? 19.279  -16.190 -7.957  1.00 0.00 ? 67  ARG A HH21 6  
ATOM 10789 H HH22 . ARG A 1 67  ? 19.266  -17.797 -8.602  1.00 0.00 ? 67  ARG A HH22 6  
ATOM 10790 N N    . GLU A 1 68  ? 16.956  -9.961  -8.223  1.00 0.00 ? 68  GLU A N    6  
ATOM 10791 C CA   . GLU A 1 68  ? 17.555  -8.640  -8.070  1.00 0.00 ? 68  GLU A CA   6  
ATOM 10792 C C    . GLU A 1 68  ? 18.733  -8.463  -9.024  1.00 0.00 ? 68  GLU A C    6  
ATOM 10793 O O    . GLU A 1 68  ? 18.973  -7.370  -9.535  1.00 0.00 ? 68  GLU A O    6  
ATOM 10794 C CB   . GLU A 1 68  ? 18.017  -8.429  -6.627  1.00 0.00 ? 68  GLU A CB   6  
ATOM 10795 C CG   . GLU A 1 68  ? 18.009  -6.973  -6.192  1.00 0.00 ? 68  GLU A CG   6  
ATOM 10796 C CD   . GLU A 1 68  ? 18.813  -6.737  -4.928  1.00 0.00 ? 68  GLU A CD   6  
ATOM 10797 O OE1  . GLU A 1 68  ? 18.589  -7.463  -3.938  1.00 0.00 ? 68  GLU A OE1  6  
ATOM 10798 O OE2  . GLU A 1 68  ? 19.666  -5.825  -4.930  1.00 0.00 ? 68  GLU A OE2  6  
ATOM 10799 H H    . GLU A 1 68  ? 16.899  -10.553 -7.444  1.00 0.00 ? 68  GLU A H    6  
ATOM 10800 H HA   . GLU A 1 68  ? 16.801  -7.905  -8.308  1.00 0.00 ? 68  GLU A HA   6  
ATOM 10801 H HB2  . GLU A 1 68  ? 17.366  -8.984  -5.968  1.00 0.00 ? 68  GLU A HB2  6  
ATOM 10802 H HB3  . GLU A 1 68  ? 19.024  -8.807  -6.525  1.00 0.00 ? 68  GLU A HB3  6  
ATOM 10803 H HG2  . GLU A 1 68  ? 18.428  -6.371  -6.984  1.00 0.00 ? 68  GLU A HG2  6  
ATOM 10804 H HG3  . GLU A 1 68  ? 16.987  -6.670  -6.013  1.00 0.00 ? 68  GLU A HG3  6  
ATOM 10805 N N    . GLY A 1 69  ? 19.466  -9.548  -9.257  1.00 0.00 ? 69  GLY A N    6  
ATOM 10806 C CA   . GLY A 1 69  ? 20.610  -9.492  -10.148 1.00 0.00 ? 69  GLY A CA   6  
ATOM 10807 C C    . GLY A 1 69  ? 20.265  -9.911  -11.563 1.00 0.00 ? 69  GLY A C    6  
ATOM 10808 O O    . GLY A 1 69  ? 20.132  -9.069  -12.452 1.00 0.00 ? 69  GLY A O    6  
ATOM 10809 H H    . GLY A 1 69  ? 19.228  -10.393 -8.821  1.00 0.00 ? 69  GLY A H    6  
ATOM 10810 H HA2  . GLY A 1 69  ? 20.990  -8.481  -10.165 1.00 0.00 ? 69  GLY A HA2  6  
ATOM 10811 H HA3  . GLY A 1 69  ? 21.380  -10.148 -9.768  1.00 0.00 ? 69  GLY A HA3  6  
ATOM 10812 N N    . ILE A 1 70  ? 20.121  -11.215 -11.774 1.00 0.00 ? 70  ILE A N    6  
ATOM 10813 C CA   . ILE A 1 70  ? 19.789  -11.743 -13.091 1.00 0.00 ? 70  ILE A CA   6  
ATOM 10814 C C    . ILE A 1 70  ? 18.855  -10.801 -13.842 1.00 0.00 ? 70  ILE A C    6  
ATOM 10815 O O    . ILE A 1 70  ? 19.106  -10.449 -14.995 1.00 0.00 ? 70  ILE A O    6  
ATOM 10816 C CB   . ILE A 1 70  ? 19.129  -13.131 -12.991 1.00 0.00 ? 70  ILE A CB   6  
ATOM 10817 C CG1  . ILE A 1 70  ? 20.083  -14.127 -12.329 1.00 0.00 ? 70  ILE A CG1  6  
ATOM 10818 C CG2  . ILE A 1 70  ? 18.716  -13.621 -14.371 1.00 0.00 ? 70  ILE A CG2  6  
ATOM 10819 C CD1  . ILE A 1 70  ? 19.820  -14.326 -10.853 1.00 0.00 ? 70  ILE A CD1  6  
ATOM 10820 H H    . ILE A 1 70  ? 20.239  -11.836 -11.026 1.00 0.00 ? 70  ILE A H    6  
ATOM 10821 H HA   . ILE A 1 70  ? 20.708  -11.843 -13.651 1.00 0.00 ? 70  ILE A HA   6  
ATOM 10822 H HB   . ILE A 1 70  ? 18.239  -13.039 -12.387 1.00 0.00 ? 70  ILE A HB   6  
ATOM 10823 H HG12 . ILE A 1 70  ? 19.986  -15.085 -12.814 1.00 0.00 ? 70  ILE A HG12 6  
ATOM 10824 H HG13 . ILE A 1 70  ? 21.097  -13.772 -12.441 1.00 0.00 ? 70  ILE A HG13 6  
ATOM 10825 H HG21 . ILE A 1 70  ? 18.333  -12.793 -14.948 1.00 0.00 ? 70  ILE A HG21 6  
ATOM 10826 H HG22 . ILE A 1 70  ? 19.573  -14.043 -14.874 1.00 0.00 ? 70  ILE A HG22 6  
ATOM 10827 H HG23 . ILE A 1 70  ? 17.950  -14.375 -14.271 1.00 0.00 ? 70  ILE A HG23 6  
ATOM 10828 H HD11 . ILE A 1 70  ? 19.527  -15.350 -10.673 1.00 0.00 ? 70  ILE A HD11 6  
ATOM 10829 H HD12 . ILE A 1 70  ? 20.716  -14.103 -10.294 1.00 0.00 ? 70  ILE A HD12 6  
ATOM 10830 H HD13 . ILE A 1 70  ? 19.025  -13.665 -10.537 1.00 0.00 ? 70  ILE A HD13 6  
ATOM 10831 N N    . ASP A 1 71  ? 17.777  -10.394 -13.181 1.00 0.00 ? 71  ASP A N    6  
ATOM 10832 C CA   . ASP A 1 71  ? 16.805  -9.490  -13.784 1.00 0.00 ? 71  ASP A CA   6  
ATOM 10833 C C    . ASP A 1 71  ? 17.104  -8.042  -13.408 1.00 0.00 ? 71  ASP A C    6  
ATOM 10834 O O    . ASP A 1 71  ? 18.002  -7.768  -12.611 1.00 0.00 ? 71  ASP A O    6  
ATOM 10835 C CB   . ASP A 1 71  ? 15.388  -9.862  -13.345 1.00 0.00 ? 71  ASP A CB   6  
ATOM 10836 C CG   . ASP A 1 71  ? 14.352  -9.550  -14.407 1.00 0.00 ? 71  ASP A CG   6  
ATOM 10837 O OD1  . ASP A 1 71  ? 14.376  -10.206 -15.469 1.00 0.00 ? 71  ASP A OD1  6  
ATOM 10838 O OD2  . ASP A 1 71  ? 13.518  -8.650  -14.176 1.00 0.00 ? 71  ASP A OD2  6  
ATOM 10839 H H    . ASP A 1 71  ? 17.631  -10.710 -12.264 1.00 0.00 ? 71  ASP A H    6  
ATOM 10840 H HA   . ASP A 1 71  ? 16.878  -9.592  -14.856 1.00 0.00 ? 71  ASP A HA   6  
ATOM 10841 H HB2  . ASP A 1 71  ? 15.351  -10.920 -13.132 1.00 0.00 ? 71  ASP A HB2  6  
ATOM 10842 H HB3  . ASP A 1 71  ? 15.139  -9.309  -12.451 1.00 0.00 ? 71  ASP A HB3  6  
ATOM 10843 N N    . LYS A 1 72  ? 16.346  -7.117  -13.988 1.00 0.00 ? 72  LYS A N    6  
ATOM 10844 C CA   . LYS A 1 72  ? 16.529  -5.696  -13.714 1.00 0.00 ? 72  LYS A CA   6  
ATOM 10845 C C    . LYS A 1 72  ? 15.481  -5.193  -12.726 1.00 0.00 ? 72  LYS A C    6  
ATOM 10846 O O    . LYS A 1 72  ? 14.276  -5.275  -12.967 1.00 0.00 ? 72  LYS A O    6  
ATOM 10847 C CB   . LYS A 1 72  ? 16.448  -4.891  -15.014 1.00 0.00 ? 72  LYS A CB   6  
ATOM 10848 C CG   . LYS A 1 72  ? 16.813  -3.427  -14.845 1.00 0.00 ? 72  LYS A CG   6  
ATOM 10849 C CD   . LYS A 1 72  ? 18.297  -3.192  -15.073 1.00 0.00 ? 72  LYS A CD   6  
ATOM 10850 C CE   . LYS A 1 72  ? 18.604  -2.950  -16.543 1.00 0.00 ? 72  LYS A CE   6  
ATOM 10851 N NZ   . LYS A 1 72  ? 19.998  -2.466  -16.746 1.00 0.00 ? 72  LYS A NZ   6  
ATOM 10852 H H    . LYS A 1 72  ? 15.646  -7.397  -14.615 1.00 0.00 ? 72  LYS A H    6  
ATOM 10853 H HA   . LYS A 1 72  ? 17.508  -5.565  -13.280 1.00 0.00 ? 72  LYS A HA   6  
ATOM 10854 H HB2  . LYS A 1 72  ? 17.121  -5.328  -15.736 1.00 0.00 ? 72  LYS A HB2  6  
ATOM 10855 H HB3  . LYS A 1 72  ? 15.438  -4.947  -15.395 1.00 0.00 ? 72  LYS A HB3  6  
ATOM 10856 H HG2  . LYS A 1 72  ? 16.254  -2.841  -15.560 1.00 0.00 ? 72  LYS A HG2  6  
ATOM 10857 H HG3  . LYS A 1 72  ? 16.558  -3.114  -13.842 1.00 0.00 ? 72  LYS A HG3  6  
ATOM 10858 H HD2  . LYS A 1 72  ? 18.608  -2.328  -14.505 1.00 0.00 ? 72  LYS A HD2  6  
ATOM 10859 H HD3  . LYS A 1 72  ? 18.845  -4.061  -14.738 1.00 0.00 ? 72  LYS A HD3  6  
ATOM 10860 H HE2  . LYS A 1 72  ? 18.472  -3.876  -17.082 1.00 0.00 ? 72  LYS A HE2  6  
ATOM 10861 H HE3  . LYS A 1 72  ? 17.916  -2.210  -16.923 1.00 0.00 ? 72  LYS A HE3  6  
ATOM 10862 H HZ1  . LYS A 1 72  ? 20.058  -1.908  -17.622 1.00 0.00 ? 72  LYS A HZ1  6  
ATOM 10863 H HZ2  . LYS A 1 72  ? 20.650  -3.273  -16.817 1.00 0.00 ? 72  LYS A HZ2  6  
ATOM 10864 H HZ3  . LYS A 1 72  ? 20.289  -1.869  -15.946 1.00 0.00 ? 72  LYS A HZ3  6  
ATOM 10865 N N    . PRO A 1 73  ? 15.948  -4.659  -11.588 1.00 0.00 ? 73  PRO A N    6  
ATOM 10866 C CA   . PRO A 1 73  ? 15.068  -4.130  -10.542 1.00 0.00 ? 73  PRO A CA   6  
ATOM 10867 C C    . PRO A 1 73  ? 14.364  -2.848  -10.971 1.00 0.00 ? 73  PRO A C    6  
ATOM 10868 O O    . PRO A 1 73  ? 15.002  -1.813  -11.166 1.00 0.00 ? 73  PRO A O    6  
ATOM 10869 C CB   . PRO A 1 73  ? 16.024  -3.853  -9.380  1.00 0.00 ? 73  PRO A CB   6  
ATOM 10870 C CG   . PRO A 1 73  ? 17.350  -3.638  -10.024 1.00 0.00 ? 73  PRO A CG   6  
ATOM 10871 C CD   . PRO A 1 73  ? 17.372  -4.529  -11.235 1.00 0.00 ? 73  PRO A CD   6  
ATOM 10872 H HA   . PRO A 1 73  ? 14.331  -4.860  -10.238 1.00 0.00 ? 73  PRO A HA   6  
ATOM 10873 H HB2  . PRO A 1 73  ? 15.697  -2.973  -8.844  1.00 0.00 ? 73  PRO A HB2  6  
ATOM 10874 H HB3  . PRO A 1 73  ? 16.042  -4.702  -8.713  1.00 0.00 ? 73  PRO A HB3  6  
ATOM 10875 H HG2  . PRO A 1 73  ? 17.453  -2.604  -10.317 1.00 0.00 ? 73  PRO A HG2  6  
ATOM 10876 H HG3  . PRO A 1 73  ? 18.139  -3.916  -9.341  1.00 0.00 ? 73  PRO A HG3  6  
ATOM 10877 H HD2  . PRO A 1 73  ? 17.927  -4.064  -12.036 1.00 0.00 ? 73  PRO A HD2  6  
ATOM 10878 H HD3  . PRO A 1 73  ? 17.796  -5.491  -10.988 1.00 0.00 ? 73  PRO A HD3  6  
ATOM 10879 N N    . ASP A 1 74  ? 13.045  -2.922  -11.114 1.00 0.00 ? 74  ASP A N    6  
ATOM 10880 C CA   . ASP A 1 74  ? 12.254  -1.765  -11.518 1.00 0.00 ? 74  ASP A CA   6  
ATOM 10881 C C    . ASP A 1 74  ? 11.215  -1.420  -10.456 1.00 0.00 ? 74  ASP A C    6  
ATOM 10882 O O    . ASP A 1 74  ? 10.171  -2.062  -10.342 1.00 0.00 ? 74  ASP A O    6  
ATOM 10883 C CB   . ASP A 1 74  ? 11.563  -2.035  -12.856 1.00 0.00 ? 74  ASP A CB   6  
ATOM 10884 C CG   . ASP A 1 74  ? 11.038  -0.768  -13.502 1.00 0.00 ? 74  ASP A CG   6  
ATOM 10885 O OD1  . ASP A 1 74  ? 11.780  0.236   -13.531 1.00 0.00 ? 74  ASP A OD1  6  
ATOM 10886 O OD2  . ASP A 1 74  ? 9.884   -0.781  -13.979 1.00 0.00 ? 74  ASP A OD2  6  
ATOM 10887 H H    . ASP A 1 74  ? 12.593  -3.774  -10.944 1.00 0.00 ? 74  ASP A H    6  
ATOM 10888 H HA   . ASP A 1 74  ? 12.925  -0.928  -11.633 1.00 0.00 ? 74  ASP A HA   6  
ATOM 10889 H HB2  . ASP A 1 74  ? 12.270  -2.495  -13.532 1.00 0.00 ? 74  ASP A HB2  6  
ATOM 10890 H HB3  . ASP A 1 74  ? 10.734  -2.708  -12.696 1.00 0.00 ? 74  ASP A HB3  6  
ATOM 10891 N N    . PRO A 1 75  ? 11.506  -0.381  -9.659  1.00 0.00 ? 75  PRO A N    6  
ATOM 10892 C CA   . PRO A 1 75  ? 10.609  0.073   -8.591  1.00 0.00 ? 75  PRO A CA   6  
ATOM 10893 C C    . PRO A 1 75  ? 9.168   0.220   -9.068  1.00 0.00 ? 75  PRO A C    6  
ATOM 10894 O O    . PRO A 1 75  ? 8.221   -0.178  -8.390  1.00 0.00 ? 75  PRO A O    6  
ATOM 10895 C CB   . PRO A 1 75  ? 11.186  1.436   -8.200  1.00 0.00 ? 75  PRO A CB   6  
ATOM 10896 C CG   . PRO A 1 75  ? 12.627  1.357   -8.566  1.00 0.00 ? 75  PRO A CG   6  
ATOM 10897 C CD   . PRO A 1 75  ? 12.732  0.430   -9.738  1.00 0.00 ? 75  PRO A CD   6  
ATOM 10898 H HA   . PRO A 1 75  ? 10.639  -0.591  -7.739  1.00 0.00 ? 75  PRO A HA   6  
ATOM 10899 H HB2  . PRO A 1 75  ? 10.679  2.215   -8.752  1.00 0.00 ? 75  PRO A HB2  6  
ATOM 10900 H HB3  . PRO A 1 75  ? 11.056  1.595   -7.140  1.00 0.00 ? 75  PRO A HB3  6  
ATOM 10901 H HG2  . PRO A 1 75  ? 12.991  2.336   -8.839  1.00 0.00 ? 75  PRO A HG2  6  
ATOM 10902 H HG3  . PRO A 1 75  ? 13.195  0.962   -7.736  1.00 0.00 ? 75  PRO A HG3  6  
ATOM 10903 H HD2  . PRO A 1 75  ? 12.761  0.995   -10.658 1.00 0.00 ? 75  PRO A HD2  6  
ATOM 10904 H HD3  . PRO A 1 75  ? 13.611  -0.190  -9.646  1.00 0.00 ? 75  PRO A HD3  6  
ATOM 10905 N N    . PRO A 1 76  ? 8.996   0.806   -10.262 1.00 0.00 ? 76  PRO A N    6  
ATOM 10906 C CA   . PRO A 1 76  ? 7.673   1.019   -10.856 1.00 0.00 ? 76  PRO A CA   6  
ATOM 10907 C C    . PRO A 1 76  ? 6.807   -0.235  -10.805 1.00 0.00 ? 76  PRO A C    6  
ATOM 10908 O O    . PRO A 1 76  ? 5.734   -0.238  -10.200 1.00 0.00 ? 76  PRO A O    6  
ATOM 10909 C CB   . PRO A 1 76  ? 7.991   1.391   -12.306 1.00 0.00 ? 76  PRO A CB   6  
ATOM 10910 C CG   . PRO A 1 76  ? 9.361   1.974   -12.256 1.00 0.00 ? 76  PRO A CG   6  
ATOM 10911 C CD   . PRO A 1 76  ? 10.080  1.306   -11.124 1.00 0.00 ? 76  PRO A CD   6  
ATOM 10912 H HA   . PRO A 1 76  ? 7.151   1.836   -10.379 1.00 0.00 ? 76  PRO A HA   6  
ATOM 10913 H HB2  . PRO A 1 76  ? 7.960   0.504   -12.923 1.00 0.00 ? 76  PRO A HB2  6  
ATOM 10914 H HB3  . PRO A 1 76  ? 7.269   2.110   -12.663 1.00 0.00 ? 76  PRO A HB3  6  
ATOM 10915 H HG2  . PRO A 1 76  ? 9.877   1.779   -13.184 1.00 0.00 ? 76  PRO A HG2  6  
ATOM 10916 H HG3  . PRO A 1 76  ? 9.301   3.037   -12.075 1.00 0.00 ? 76  PRO A HG3  6  
ATOM 10917 H HD2  . PRO A 1 76  ? 10.684  0.492   -11.495 1.00 0.00 ? 76  PRO A HD2  6  
ATOM 10918 H HD3  . PRO A 1 76  ? 10.692  2.023   -10.597 1.00 0.00 ? 76  PRO A HD3  6  
ATOM 10919 N N    . THR A 1 77  ? 7.278   -1.301  -11.445 1.00 0.00 ? 77  THR A N    6  
ATOM 10920 C CA   . THR A 1 77  ? 6.546   -2.561  -11.473 1.00 0.00 ? 77  THR A CA   6  
ATOM 10921 C C    . THR A 1 77  ? 6.131   -2.987  -10.070 1.00 0.00 ? 77  THR A C    6  
ATOM 10922 O O    . THR A 1 77  ? 4.996   -3.410  -9.850  1.00 0.00 ? 77  THR A O    6  
ATOM 10923 C CB   . THR A 1 77  ? 7.385   -3.684  -12.112 1.00 0.00 ? 77  THR A CB   6  
ATOM 10924 O OG1  . THR A 1 77  ? 7.843   -3.277  -13.406 1.00 0.00 ? 77  THR A OG1  6  
ATOM 10925 C CG2  . THR A 1 77  ? 6.573   -4.964  -12.234 1.00 0.00 ? 77  THR A CG2  6  
ATOM 10926 H H    . THR A 1 77  ? 8.139   -1.236  -11.909 1.00 0.00 ? 77  THR A H    6  
ATOM 10927 H HA   . THR A 1 77  ? 5.659   -2.418  -12.073 1.00 0.00 ? 77  THR A HA   6  
ATOM 10928 H HB   . THR A 1 77  ? 8.241   -3.877  -11.480 1.00 0.00 ? 77  THR A HB   6  
ATOM 10929 H HG1  . THR A 1 77  ? 8.426   -3.951  -13.766 1.00 0.00 ? 77  THR A HG1  6  
ATOM 10930 H HG21 . THR A 1 77  ? 7.052   -5.750  -11.669 1.00 0.00 ? 77  THR A HG21 6  
ATOM 10931 H HG22 . THR A 1 77  ? 6.511   -5.253  -13.273 1.00 0.00 ? 77  THR A HG22 6  
ATOM 10932 H HG23 . THR A 1 77  ? 5.579   -4.797  -11.847 1.00 0.00 ? 77  THR A HG23 6  
ATOM 10933 N N    . TRP A 1 78  ? 7.057   -2.873  -9.124  1.00 0.00 ? 78  TRP A N    6  
ATOM 10934 C CA   . TRP A 1 78  ? 6.786   -3.247  -7.741  1.00 0.00 ? 78  TRP A CA   6  
ATOM 10935 C C    . TRP A 1 78  ? 5.693   -2.367  -7.143  1.00 0.00 ? 78  TRP A C    6  
ATOM 10936 O O    . TRP A 1 78  ? 4.815   -2.849  -6.428  1.00 0.00 ? 78  TRP A O    6  
ATOM 10937 C CB   . TRP A 1 78  ? 8.061   -3.139  -6.903  1.00 0.00 ? 78  TRP A CB   6  
ATOM 10938 C CG   . TRP A 1 78  ? 9.209   -3.920  -7.465  1.00 0.00 ? 78  TRP A CG   6  
ATOM 10939 C CD1  . TRP A 1 78  ? 9.136   -5.045  -8.237  1.00 0.00 ? 78  TRP A CD1  6  
ATOM 10940 C CD2  . TRP A 1 78  ? 10.602  -3.636  -7.298  1.00 0.00 ? 78  TRP A CD2  6  
ATOM 10941 N NE1  . TRP A 1 78  ? 10.400  -5.477  -8.560  1.00 0.00 ? 78  TRP A NE1  6  
ATOM 10942 C CE2  . TRP A 1 78  ? 11.317  -4.629  -7.997  1.00 0.00 ? 78  TRP A CE2  6  
ATOM 10943 C CE3  . TRP A 1 78  ? 11.316  -2.639  -6.628  1.00 0.00 ? 78  TRP A CE3  6  
ATOM 10944 C CZ2  . TRP A 1 78  ? 12.708  -4.652  -8.042  1.00 0.00 ? 78  TRP A CZ2  6  
ATOM 10945 C CZ3  . TRP A 1 78  ? 12.697  -2.663  -6.674  1.00 0.00 ? 78  TRP A CZ3  6  
ATOM 10946 C CH2  . TRP A 1 78  ? 13.381  -3.663  -7.377  1.00 0.00 ? 78  TRP A CH2  6  
ATOM 10947 H H    . TRP A 1 78  ? 7.943   -2.529  -9.362  1.00 0.00 ? 78  TRP A H    6  
ATOM 10948 H HA   . TRP A 1 78  ? 6.448   -4.273  -7.736  1.00 0.00 ? 78  TRP A HA   6  
ATOM 10949 H HB2  . TRP A 1 78  ? 8.359   -2.103  -6.844  1.00 0.00 ? 78  TRP A HB2  6  
ATOM 10950 H HB3  . TRP A 1 78  ? 7.860   -3.509  -5.907  1.00 0.00 ? 78  TRP A HB3  6  
ATOM 10951 H HD1  . TRP A 1 78  ? 8.213   -5.515  -8.540  1.00 0.00 ? 78  TRP A HD1  6  
ATOM 10952 H HE1  . TRP A 1 78  ? 10.609  -6.263  -9.106  1.00 0.00 ? 78  TRP A HE1  6  
ATOM 10953 H HE3  . TRP A 1 78  ? 10.807  -1.859  -6.081  1.00 0.00 ? 78  TRP A HE3  6  
ATOM 10954 H HZ2  . TRP A 1 78  ? 13.250  -5.416  -8.580  1.00 0.00 ? 78  TRP A HZ2  6  
ATOM 10955 H HZ3  . TRP A 1 78  ? 13.265  -1.901  -6.162  1.00 0.00 ? 78  TRP A HZ3  6  
ATOM 10956 H HH2  . TRP A 1 78  ? 14.460  -3.643  -7.385  1.00 0.00 ? 78  TRP A HH2  6  
ATOM 10957 N N    . LYS A 1 79  ? 5.754   -1.073  -7.439  1.00 0.00 ? 79  LYS A N    6  
ATOM 10958 C CA   . LYS A 1 79  ? 4.769   -0.124  -6.933  1.00 0.00 ? 79  LYS A CA   6  
ATOM 10959 C C    . LYS A 1 79  ? 3.437   -0.284  -7.658  1.00 0.00 ? 79  LYS A C    6  
ATOM 10960 O O    . LYS A 1 79  ? 2.441   -0.701  -7.065  1.00 0.00 ? 79  LYS A O    6  
ATOM 10961 C CB   . LYS A 1 79  ? 5.281   1.309   -7.094  1.00 0.00 ? 79  LYS A CB   6  
ATOM 10962 C CG   . LYS A 1 79  ? 6.103   1.797   -5.913  1.00 0.00 ? 79  LYS A CG   6  
ATOM 10963 C CD   . LYS A 1 79  ? 6.762   3.134   -6.208  1.00 0.00 ? 79  LYS A CD   6  
ATOM 10964 C CE   . LYS A 1 79  ? 5.850   4.297   -5.848  1.00 0.00 ? 79  LYS A CE   6  
ATOM 10965 N NZ   . LYS A 1 79  ? 6.478   5.611   -6.157  1.00 0.00 ? 79  LYS A NZ   6  
ATOM 10966 H H    . LYS A 1 79  ? 6.479   -0.748  -8.014  1.00 0.00 ? 79  LYS A H    6  
ATOM 10967 H HA   . LYS A 1 79  ? 4.621   -0.329  -5.883  1.00 0.00 ? 79  LYS A HA   6  
ATOM 10968 H HB2  . LYS A 1 79  ? 5.896   1.361   -7.980  1.00 0.00 ? 79  LYS A HB2  6  
ATOM 10969 H HB3  . LYS A 1 79  ? 4.434   1.969   -7.214  1.00 0.00 ? 79  LYS A HB3  6  
ATOM 10970 H HG2  . LYS A 1 79  ? 5.455   1.909   -5.057  1.00 0.00 ? 79  LYS A HG2  6  
ATOM 10971 H HG3  . LYS A 1 79  ? 6.870   1.068   -5.694  1.00 0.00 ? 79  LYS A HG3  6  
ATOM 10972 H HD2  . LYS A 1 79  ? 7.671   3.213   -5.630  1.00 0.00 ? 79  LYS A HD2  6  
ATOM 10973 H HD3  . LYS A 1 79  ? 6.998   3.185   -7.262  1.00 0.00 ? 79  LYS A HD3  6  
ATOM 10974 H HE2  . LYS A 1 79  ? 4.933   4.205   -6.410  1.00 0.00 ? 79  LYS A HE2  6  
ATOM 10975 H HE3  . LYS A 1 79  ? 5.631   4.252   -4.792  1.00 0.00 ? 79  LYS A HE3  6  
ATOM 10976 H HZ1  . LYS A 1 79  ? 7.515   5.525   -6.136  1.00 0.00 ? 79  LYS A HZ1  6  
ATOM 10977 H HZ2  . LYS A 1 79  ? 6.186   6.321   -5.456  1.00 0.00 ? 79  LYS A HZ2  6  
ATOM 10978 H HZ3  . LYS A 1 79  ? 6.187   5.933   -7.102  1.00 0.00 ? 79  LYS A HZ3  6  
ATOM 10979 N N    . THR A 1 80  ? 3.425   0.049   -8.945  1.00 0.00 ? 80  THR A N    6  
ATOM 10980 C CA   . THR A 1 80  ? 2.215   -0.058  -9.751  1.00 0.00 ? 80  THR A CA   6  
ATOM 10981 C C    . THR A 1 80  ? 1.426   -1.313  -9.395  1.00 0.00 ? 80  THR A C    6  
ATOM 10982 O O    . THR A 1 80  ? 0.334   -1.231  -8.833  1.00 0.00 ? 80  THR A O    6  
ATOM 10983 C CB   . THR A 1 80  ? 2.543   -0.082  -11.256 1.00 0.00 ? 80  THR A CB   6  
ATOM 10984 O OG1  . THR A 1 80  ? 3.347   1.052   -11.600 1.00 0.00 ? 80  THR A OG1  6  
ATOM 10985 C CG2  . THR A 1 80  ? 1.270   -0.078  -12.087 1.00 0.00 ? 80  THR A CG2  6  
ATOM 10986 H H    . THR A 1 80  ? 4.250   0.374   -9.361  1.00 0.00 ? 80  THR A H    6  
ATOM 10987 H HA   . THR A 1 80  ? 1.604   0.810   -9.551  1.00 0.00 ? 80  THR A HA   6  
ATOM 10988 H HB   . THR A 1 80  ? 3.096   -0.985  -11.474 1.00 0.00 ? 80  THR A HB   6  
ATOM 10989 H HG1  . THR A 1 80  ? 4.198   0.988   -11.158 1.00 0.00 ? 80  THR A HG1  6  
ATOM 10990 H HG21 . THR A 1 80  ? 0.619   0.714   -11.746 1.00 0.00 ? 80  THR A HG21 6  
ATOM 10991 H HG22 . THR A 1 80  ? 0.767   -1.027  -11.981 1.00 0.00 ? 80  THR A HG22 6  
ATOM 10992 H HG23 . THR A 1 80  ? 1.518   0.084   -13.125 1.00 0.00 ? 80  THR A HG23 6  
ATOM 10993 N N    . ARG A 1 81  ? 1.986   -2.472  -9.724  1.00 0.00 ? 81  ARG A N    6  
ATOM 10994 C CA   . ARG A 1 81  ? 1.334   -3.744  -9.439  1.00 0.00 ? 81  ARG A CA   6  
ATOM 10995 C C    . ARG A 1 81  ? 0.587   -3.686  -8.110  1.00 0.00 ? 81  ARG A C    6  
ATOM 10996 O O    . ARG A 1 81  ? -0.644  -3.723  -8.075  1.00 0.00 ? 81  ARG A O    6  
ATOM 10997 C CB   . ARG A 1 81  ? 2.364   -4.874  -9.408  1.00 0.00 ? 81  ARG A CB   6  
ATOM 10998 C CG   . ARG A 1 81  ? 2.679   -5.449  -10.780 1.00 0.00 ? 81  ARG A CG   6  
ATOM 10999 C CD   . ARG A 1 81  ? 2.856   -4.350  -11.817 1.00 0.00 ? 81  ARG A CD   6  
ATOM 11000 N NE   . ARG A 1 81  ? 2.877   -4.881  -13.177 1.00 0.00 ? 81  ARG A NE   6  
ATOM 11001 C CZ   . ARG A 1 81  ? 2.813   -4.119  -14.264 1.00 0.00 ? 81  ARG A CZ   6  
ATOM 11002 N NH1  . ARG A 1 81  ? 2.725   -2.801  -14.149 1.00 0.00 ? 81  ARG A NH1  6  
ATOM 11003 N NH2  . ARG A 1 81  ? 2.838   -4.676  -15.468 1.00 0.00 ? 81  ARG A NH2  6  
ATOM 11004 H H    . ARG A 1 81  ? 2.859   -2.472  -10.171 1.00 0.00 ? 81  ARG A H    6  
ATOM 11005 H HA   . ARG A 1 81  ? 0.624   -3.937  -10.229 1.00 0.00 ? 81  ARG A HA   6  
ATOM 11006 H HB2  . ARG A 1 81  ? 3.282   -4.498  -8.980  1.00 0.00 ? 81  ARG A HB2  6  
ATOM 11007 H HB3  . ARG A 1 81  ? 1.987   -5.672  -8.786  1.00 0.00 ? 81  ARG A HB3  6  
ATOM 11008 H HG2  . ARG A 1 81  ? 3.594   -6.021  -10.719 1.00 0.00 ? 81  ARG A HG2  6  
ATOM 11009 H HG3  . ARG A 1 81  ? 1.869   -6.093  -11.085 1.00 0.00 ? 81  ARG A HG3  6  
ATOM 11010 H HD2  . ARG A 1 81  ? 2.036   -3.653  -11.725 1.00 0.00 ? 81  ARG A HD2  6  
ATOM 11011 H HD3  . ARG A 1 81  ? 3.787   -3.839  -11.624 1.00 0.00 ? 81  ARG A HD3  6  
ATOM 11012 H HE   . ARG A 1 81  ? 2.942   -5.852  -13.285 1.00 0.00 ? 81  ARG A HE   6  
ATOM 11013 H HH11 . ARG A 1 81  ? 2.707   -2.379  -13.243 1.00 0.00 ? 81  ARG A HH11 6  
ATOM 11014 H HH12 . ARG A 1 81  ? 2.679   -2.230  -14.969 1.00 0.00 ? 81  ARG A HH12 6  
ATOM 11015 H HH21 . ARG A 1 81  ? 2.905   -5.669  -15.558 1.00 0.00 ? 81  ARG A HH21 6  
ATOM 11016 H HH22 . ARG A 1 81  ? 2.790   -4.102  -16.285 1.00 0.00 ? 81  ARG A HH22 6  
ATOM 11017 N N    . LEU A 1 82  ? 1.338   -3.595  -7.018  1.00 0.00 ? 82  LEU A N    6  
ATOM 11018 C CA   . LEU A 1 82  ? 0.748   -3.532  -5.686  1.00 0.00 ? 82  LEU A CA   6  
ATOM 11019 C C    . LEU A 1 82  ? -0.351  -2.476  -5.626  1.00 0.00 ? 82  LEU A C    6  
ATOM 11020 O O    . LEU A 1 82  ? -1.404  -2.694  -5.028  1.00 0.00 ? 82  LEU A O    6  
ATOM 11021 C CB   . LEU A 1 82  ? 1.824   -3.225  -4.644  1.00 0.00 ? 82  LEU A CB   6  
ATOM 11022 C CG   . LEU A 1 82  ? 1.331   -3.013  -3.212  1.00 0.00 ? 82  LEU A CG   6  
ATOM 11023 C CD1  . LEU A 1 82  ? 0.639   -4.265  -2.695  1.00 0.00 ? 82  LEU A CD1  6  
ATOM 11024 C CD2  . LEU A 1 82  ? 2.487   -2.625  -2.301  1.00 0.00 ? 82  LEU A CD2  6  
ATOM 11025 H H    . LEU A 1 82  ? 2.313   -3.570  -7.109  1.00 0.00 ? 82  LEU A H    6  
ATOM 11026 H HA   . LEU A 1 82  ? 0.314   -4.498  -5.470  1.00 0.00 ? 82  LEU A HA   6  
ATOM 11027 H HB2  . LEU A 1 82  ? 2.521   -4.049  -4.635  1.00 0.00 ? 82  LEU A HB2  6  
ATOM 11028 H HB3  . LEU A 1 82  ? 2.337   -2.325  -4.955  1.00 0.00 ? 82  LEU A HB3  6  
ATOM 11029 H HG   . LEU A 1 82  ? 0.611   -2.206  -3.201  1.00 0.00 ? 82  LEU A HG   6  
ATOM 11030 H HD11 . LEU A 1 82  ? 0.097   -4.735  -3.500  1.00 0.00 ? 82  LEU A HD11 6  
ATOM 11031 H HD12 . LEU A 1 82  ? -0.048  -3.997  -1.906  1.00 0.00 ? 82  LEU A HD12 6  
ATOM 11032 H HD13 . LEU A 1 82  ? 1.379   -4.951  -2.309  1.00 0.00 ? 82  LEU A HD13 6  
ATOM 11033 H HD21 . LEU A 1 82  ? 3.422   -2.829  -2.801  1.00 0.00 ? 82  LEU A HD21 6  
ATOM 11034 H HD22 . LEU A 1 82  ? 2.434   -3.200  -1.388  1.00 0.00 ? 82  LEU A HD22 6  
ATOM 11035 H HD23 . LEU A 1 82  ? 2.425   -1.572  -2.069  1.00 0.00 ? 82  LEU A HD23 6  
ATOM 11036 N N    . ARG A 1 83  ? -0.098  -1.331  -6.253  1.00 0.00 ? 83  ARG A N    6  
ATOM 11037 C CA   . ARG A 1 83  ? -1.066  -0.241  -6.272  1.00 0.00 ? 83  ARG A CA   6  
ATOM 11038 C C    . ARG A 1 83  ? -2.385  -0.695  -6.890  1.00 0.00 ? 83  ARG A C    6  
ATOM 11039 O O    . ARG A 1 83  ? -3.462  -0.349  -6.404  1.00 0.00 ? 83  ARG A O    6  
ATOM 11040 C CB   . ARG A 1 83  ? -0.508  0.951   -7.052  1.00 0.00 ? 83  ARG A CB   6  
ATOM 11041 C CG   . ARG A 1 83  ? -1.027  2.294   -6.565  1.00 0.00 ? 83  ARG A CG   6  
ATOM 11042 C CD   . ARG A 1 83  ? -2.275  2.718   -7.323  1.00 0.00 ? 83  ARG A CD   6  
ATOM 11043 N NE   . ARG A 1 83  ? -3.180  3.505   -6.490  1.00 0.00 ? 83  ARG A NE   6  
ATOM 11044 C CZ   . ARG A 1 83  ? -4.063  4.369   -6.978  1.00 0.00 ? 83  ARG A CZ   6  
ATOM 11045 N NH1  . ARG A 1 83  ? -4.160  4.555   -8.287  1.00 0.00 ? 83  ARG A NH1  6  
ATOM 11046 N NH2  . ARG A 1 83  ? -4.853  5.049   -6.156  1.00 0.00 ? 83  ARG A NH2  6  
ATOM 11047 H H    . ARG A 1 83  ? 0.760   -1.216  -6.712  1.00 0.00 ? 83  ARG A H    6  
ATOM 11048 H HA   . ARG A 1 83  ? -1.246  0.061   -5.251  1.00 0.00 ? 83  ARG A HA   6  
ATOM 11049 H HB2  . ARG A 1 83  ? 0.568   0.952   -6.964  1.00 0.00 ? 83  ARG A HB2  6  
ATOM 11050 H HB3  . ARG A 1 83  ? -0.776  0.842   -8.092  1.00 0.00 ? 83  ARG A HB3  6  
ATOM 11051 H HG2  . ARG A 1 83  ? -1.265  2.218   -5.514  1.00 0.00 ? 83  ARG A HG2  6  
ATOM 11052 H HG3  . ARG A 1 83  ? -0.259  3.039   -6.708  1.00 0.00 ? 83  ARG A HG3  6  
ATOM 11053 H HD2  . ARG A 1 83  ? -1.979  3.310   -8.175  1.00 0.00 ? 83  ARG A HD2  6  
ATOM 11054 H HD3  . ARG A 1 83  ? -2.791  1.832   -7.662  1.00 0.00 ? 83  ARG A HD3  6  
ATOM 11055 H HE   . ARG A 1 83  ? -3.126  3.383   -5.519  1.00 0.00 ? 83  ARG A HE   6  
ATOM 11056 H HH11 . ARG A 1 83  ? -3.567  4.044   -8.909  1.00 0.00 ? 83  ARG A HH11 6  
ATOM 11057 H HH12 . ARG A 1 83  ? -4.827  5.205   -8.652  1.00 0.00 ? 83  ARG A HH12 6  
ATOM 11058 H HH21 . ARG A 1 83  ? -4.783  4.911   -5.168  1.00 0.00 ? 83  ARG A HH21 6  
ATOM 11059 H HH22 . ARG A 1 83  ? -5.517  5.699   -6.524  1.00 0.00 ? 83  ARG A HH22 6  
ATOM 11060 N N    . CYS A 1 84  ? -2.292  -1.471  -7.965  1.00 0.00 ? 84  CYS A N    6  
ATOM 11061 C CA   . CYS A 1 84  ? -3.477  -1.971  -8.651  1.00 0.00 ? 84  CYS A CA   6  
ATOM 11062 C C    . CYS A 1 84  ? -4.204  -3.005  -7.797  1.00 0.00 ? 84  CYS A C    6  
ATOM 11063 O O    . CYS A 1 84  ? -5.432  -3.002  -7.713  1.00 0.00 ? 84  CYS A O    6  
ATOM 11064 C CB   . CYS A 1 84  ? -3.091  -2.585  -9.998  1.00 0.00 ? 84  CYS A CB   6  
ATOM 11065 S SG   . CYS A 1 84  ? -4.377  -2.458  -11.263 1.00 0.00 ? 84  CYS A SG   6  
ATOM 11066 H H    . CYS A 1 84  ? -1.405  -1.712  -8.306  1.00 0.00 ? 84  CYS A H    6  
ATOM 11067 H HA   . CYS A 1 84  ? -4.138  -1.135  -8.823  1.00 0.00 ? 84  CYS A HA   6  
ATOM 11068 H HB2  . CYS A 1 84  ? -2.211  -2.085  -10.374 1.00 0.00 ? 84  CYS A HB2  6  
ATOM 11069 H HB3  . CYS A 1 84  ? -2.870  -3.633  -9.857  1.00 0.00 ? 84  CYS A HB3  6  
ATOM 11070 H HG   . CYS A 1 84  ? -4.028  -1.497  -12.105 1.00 0.00 ? 84  CYS A HG   6  
ATOM 11071 N N    . ALA A 1 85  ? -3.438  -3.889  -7.167  1.00 0.00 ? 85  ALA A N    6  
ATOM 11072 C CA   . ALA A 1 85  ? -4.008  -4.928  -6.319  1.00 0.00 ? 85  ALA A CA   6  
ATOM 11073 C C    . ALA A 1 85  ? -4.866  -4.324  -5.213  1.00 0.00 ? 85  ALA A C    6  
ATOM 11074 O O    . ALA A 1 85  ? -6.009  -4.734  -5.005  1.00 0.00 ? 85  ALA A O    6  
ATOM 11075 C CB   . ALA A 1 85  ? -2.904  -5.789  -5.723  1.00 0.00 ? 85  ALA A CB   6  
ATOM 11076 H H    . ALA A 1 85  ? -2.465  -3.840  -7.274  1.00 0.00 ? 85  ALA A H    6  
ATOM 11077 H HA   . ALA A 1 85  ? -4.629  -5.560  -6.938  1.00 0.00 ? 85  ALA A HA   6  
ATOM 11078 H HB1  . ALA A 1 85  ? -2.082  -5.158  -5.419  1.00 0.00 ? 85  ALA A HB1  6  
ATOM 11079 H HB2  . ALA A 1 85  ? -3.286  -6.321  -4.865  1.00 0.00 ? 85  ALA A HB2  6  
ATOM 11080 H HB3  . ALA A 1 85  ? -2.560  -6.496  -6.463  1.00 0.00 ? 85  ALA A HB3  6  
ATOM 11081 N N    . LEU A 1 86  ? -4.308  -3.349  -4.504  1.00 0.00 ? 86  LEU A N    6  
ATOM 11082 C CA   . LEU A 1 86  ? -5.023  -2.688  -3.417  1.00 0.00 ? 86  LEU A CA   6  
ATOM 11083 C C    . LEU A 1 86  ? -6.481  -2.444  -3.792  1.00 0.00 ? 86  LEU A C    6  
ATOM 11084 O O    . LEU A 1 86  ? -7.394  -2.884  -3.095  1.00 0.00 ? 86  LEU A O    6  
ATOM 11085 C CB   . LEU A 1 86  ? -4.345  -1.362  -3.067  1.00 0.00 ? 86  LEU A CB   6  
ATOM 11086 C CG   . LEU A 1 86  ? -4.730  -0.746  -1.721  1.00 0.00 ? 86  LEU A CG   6  
ATOM 11087 C CD1  . LEU A 1 86  ? -4.305  -1.654  -0.577  1.00 0.00 ? 86  LEU A CD1  6  
ATOM 11088 C CD2  . LEU A 1 86  ? -4.108  0.634   -1.569  1.00 0.00 ? 86  LEU A CD2  6  
ATOM 11089 H H    . LEU A 1 86  ? -3.395  -3.066  -4.715  1.00 0.00 ? 86  LEU A H    6  
ATOM 11090 H HA   . LEU A 1 86  ? -4.989  -3.339  -2.555  1.00 0.00 ? 86  LEU A HA   6  
ATOM 11091 H HB2  . LEU A 1 86  ? -3.279  -1.527  -3.062  1.00 0.00 ? 86  LEU A HB2  6  
ATOM 11092 H HB3  . LEU A 1 86  ? -4.594  -0.650  -3.841  1.00 0.00 ? 86  LEU A HB3  6  
ATOM 11093 H HG   . LEU A 1 86  ? -5.805  -0.636  -1.677  1.00 0.00 ? 86  LEU A HG   6  
ATOM 11094 H HD11 . LEU A 1 86  ? -3.937  -1.054  0.241   1.00 0.00 ? 86  LEU A HD11 6  
ATOM 11095 H HD12 . LEU A 1 86  ? -3.524  -2.318  -0.917  1.00 0.00 ? 86  LEU A HD12 6  
ATOM 11096 H HD13 . LEU A 1 86  ? -5.152  -2.236  -0.246  1.00 0.00 ? 86  LEU A HD13 6  
ATOM 11097 H HD21 . LEU A 1 86  ? -4.093  1.129   -2.528  1.00 0.00 ? 86  LEU A HD21 6  
ATOM 11098 H HD22 . LEU A 1 86  ? -3.097  0.534   -1.200  1.00 0.00 ? 86  LEU A HD22 6  
ATOM 11099 H HD23 . LEU A 1 86  ? -4.691  1.216   -0.871  1.00 0.00 ? 86  LEU A HD23 6  
ATOM 11100 N N    . ASN A 1 87  ? -6.691  -1.741  -4.900  1.00 0.00 ? 87  ASN A N    6  
ATOM 11101 C CA   . ASN A 1 87  ? -8.038  -1.440  -5.370  1.00 0.00 ? 87  ASN A CA   6  
ATOM 11102 C C    . ASN A 1 87  ? -8.804  -2.721  -5.685  1.00 0.00 ? 87  ASN A C    6  
ATOM 11103 O O    . ASN A 1 87  ? -9.974  -2.862  -5.329  1.00 0.00 ? 87  ASN A O    6  
ATOM 11104 C CB   . ASN A 1 87  ? -7.981  -0.549  -6.613  1.00 0.00 ? 87  ASN A CB   6  
ATOM 11105 C CG   . ASN A 1 87  ? -9.284  0.186   -6.858  1.00 0.00 ? 87  ASN A CG   6  
ATOM 11106 O OD1  . ASN A 1 87  ? -10.152 -0.293  -7.588  1.00 0.00 ? 87  ASN A OD1  6  
ATOM 11107 N ND2  . ASN A 1 87  ? -9.427  1.357   -6.248  1.00 0.00 ? 87  ASN A ND2  6  
ATOM 11108 H H    . ASN A 1 87  ? -5.922  -1.417  -5.414  1.00 0.00 ? 87  ASN A H    6  
ATOM 11109 H HA   . ASN A 1 87  ? -8.553  -0.911  -4.582  1.00 0.00 ? 87  ASN A HA   6  
ATOM 11110 H HB2  . ASN A 1 87  ? -7.195  0.183   -6.487  1.00 0.00 ? 87  ASN A HB2  6  
ATOM 11111 H HB3  . ASN A 1 87  ? -7.764  -1.159  -7.477  1.00 0.00 ? 87  ASN A HB3  6  
ATOM 11112 H HD21 . ASN A 1 87  ? -8.693  1.677   -5.682  1.00 0.00 ? 87  ASN A HD21 6  
ATOM 11113 H HD22 . ASN A 1 87  ? -10.260 1.854   -6.389  1.00 0.00 ? 87  ASN A HD22 6  
ATOM 11114 N N    . LYS A 1 88  ? -8.135  -3.654  -6.354  1.00 0.00 ? 88  LYS A N    6  
ATOM 11115 C CA   . LYS A 1 88  ? -8.750  -4.926  -6.716  1.00 0.00 ? 88  LYS A CA   6  
ATOM 11116 C C    . LYS A 1 88  ? -9.409  -5.576  -5.503  1.00 0.00 ? 88  LYS A C    6  
ATOM 11117 O O    . LYS A 1 88  ? -10.504 -6.130  -5.602  1.00 0.00 ? 88  LYS A O    6  
ATOM 11118 C CB   . LYS A 1 88  ? -7.704  -5.872  -7.309  1.00 0.00 ? 88  LYS A CB   6  
ATOM 11119 C CG   . LYS A 1 88  ? -7.339  -5.550  -8.748  1.00 0.00 ? 88  LYS A CG   6  
ATOM 11120 C CD   . LYS A 1 88  ? -6.848  -6.782  -9.488  1.00 0.00 ? 88  LYS A CD   6  
ATOM 11121 C CE   . LYS A 1 88  ? -6.349  -6.434  -10.882 1.00 0.00 ? 88  LYS A CE   6  
ATOM 11122 N NZ   . LYS A 1 88  ? -7.473  -6.212  -11.833 1.00 0.00 ? 88  LYS A NZ   6  
ATOM 11123 H H    . LYS A 1 88  ? -7.204  -3.484  -6.610  1.00 0.00 ? 88  LYS A H    6  
ATOM 11124 H HA   . LYS A 1 88  ? -9.507  -4.728  -7.459  1.00 0.00 ? 88  LYS A HA   6  
ATOM 11125 H HB2  . LYS A 1 88  ? -6.806  -5.816  -6.711  1.00 0.00 ? 88  LYS A HB2  6  
ATOM 11126 H HB3  . LYS A 1 88  ? -8.087  -6.881  -7.274  1.00 0.00 ? 88  LYS A HB3  6  
ATOM 11127 H HG2  . LYS A 1 88  ? -8.212  -5.164  -9.253  1.00 0.00 ? 88  LYS A HG2  6  
ATOM 11128 H HG3  . LYS A 1 88  ? -6.558  -4.803  -8.753  1.00 0.00 ? 88  LYS A HG3  6  
ATOM 11129 H HD2  . LYS A 1 88  ? -6.038  -7.228  -8.929  1.00 0.00 ? 88  LYS A HD2  6  
ATOM 11130 H HD3  . LYS A 1 88  ? -7.662  -7.489  -9.572  1.00 0.00 ? 88  LYS A HD3  6  
ATOM 11131 H HE2  . LYS A 1 88  ? -5.755  -5.535  -10.823 1.00 0.00 ? 88  LYS A HE2  6  
ATOM 11132 H HE3  . LYS A 1 88  ? -5.737  -7.246  -11.244 1.00 0.00 ? 88  LYS A HE3  6  
ATOM 11133 H HZ1  . LYS A 1 88  ? -7.130  -5.713  -12.680 1.00 0.00 ? 88  LYS A HZ1  6  
ATOM 11134 H HZ2  . LYS A 1 88  ? -8.214  -5.637  -11.384 1.00 0.00 ? 88  LYS A HZ2  6  
ATOM 11135 H HZ3  . LYS A 1 88  ? -7.882  -7.123  -12.122 1.00 0.00 ? 88  LYS A HZ3  6  
ATOM 11136 N N    . SER A 1 89  ? -8.736  -5.504  -4.360  1.00 0.00 ? 89  SER A N    6  
ATOM 11137 C CA   . SER A 1 89  ? -9.255  -6.088  -3.128  1.00 0.00 ? 89  SER A CA   6  
ATOM 11138 C C    . SER A 1 89  ? -10.677 -5.606  -2.856  1.00 0.00 ? 89  SER A C    6  
ATOM 11139 O O    . SER A 1 89  ? -10.910 -4.418  -2.638  1.00 0.00 ? 89  SER A O    6  
ATOM 11140 C CB   . SER A 1 89  ? -8.349  -5.732  -1.948  1.00 0.00 ? 89  SER A CB   6  
ATOM 11141 O OG   . SER A 1 89  ? -7.179  -6.531  -1.944  1.00 0.00 ? 89  SER A OG   6  
ATOM 11142 H H    . SER A 1 89  ? -7.867  -5.049  -4.344  1.00 0.00 ? 89  SER A H    6  
ATOM 11143 H HA   . SER A 1 89  ? -9.269  -7.161  -3.250  1.00 0.00 ? 89  SER A HA   6  
ATOM 11144 H HB2  . SER A 1 89  ? -8.061  -4.694  -2.019  1.00 0.00 ? 89  SER A HB2  6  
ATOM 11145 H HB3  . SER A 1 89  ? -8.885  -5.895  -1.024  1.00 0.00 ? 89  SER A HB3  6  
ATOM 11146 H HG   . SER A 1 89  ? -6.642  -6.309  -1.180  1.00 0.00 ? 89  SER A HG   6  
ATOM 11147 N N    . ASN A 1 90  ? -11.624 -6.538  -2.871  1.00 0.00 ? 90  ASN A N    6  
ATOM 11148 C CA   . ASN A 1 90  ? -13.024 -6.209  -2.626  1.00 0.00 ? 90  ASN A CA   6  
ATOM 11149 C C    . ASN A 1 90  ? -13.334 -6.225  -1.133  1.00 0.00 ? 90  ASN A C    6  
ATOM 11150 O O    . ASN A 1 90  ? -14.237 -5.530  -0.668  1.00 0.00 ? 90  ASN A O    6  
ATOM 11151 C CB   . ASN A 1 90  ? -13.936 -7.195  -3.358  1.00 0.00 ? 90  ASN A CB   6  
ATOM 11152 C CG   . ASN A 1 90  ? -15.375 -7.113  -2.886  1.00 0.00 ? 90  ASN A CG   6  
ATOM 11153 O OD1  . ASN A 1 90  ? -15.819 -6.076  -2.393  1.00 0.00 ? 90  ASN A OD1  6  
ATOM 11154 N ND2  . ASN A 1 90  ? -16.110 -8.208  -3.034  1.00 0.00 ? 90  ASN A ND2  6  
ATOM 11155 H H    . ASN A 1 90  ? -11.376 -7.469  -3.051  1.00 0.00 ? 90  ASN A H    6  
ATOM 11156 H HA   . ASN A 1 90  ? -13.202 -5.216  -3.009  1.00 0.00 ? 90  ASN A HA   6  
ATOM 11157 H HB2  . ASN A 1 90  ? -13.913 -6.981  -4.417  1.00 0.00 ? 90  ASN A HB2  6  
ATOM 11158 H HB3  . ASN A 1 90  ? -13.579 -8.200  -3.191  1.00 0.00 ? 90  ASN A HB3  6  
ATOM 11159 H HD21 . ASN A 1 90  ? -15.690 -8.998  -3.435  1.00 0.00 ? 90  ASN A HD21 6  
ATOM 11160 H HD22 . ASN A 1 90  ? -17.044 -8.182  -2.738  1.00 0.00 ? 90  ASN A HD22 6  
ATOM 11161 N N    . ASP A 1 91  ? -12.578 -7.023  -0.386  1.00 0.00 ? 91  ASP A N    6  
ATOM 11162 C CA   . ASP A 1 91  ? -12.770 -7.129  1.056   1.00 0.00 ? 91  ASP A CA   6  
ATOM 11163 C C    . ASP A 1 91  ? -12.079 -5.979  1.782   1.00 0.00 ? 91  ASP A C    6  
ATOM 11164 O O    . ASP A 1 91  ? -11.877 -6.029  2.995   1.00 0.00 ? 91  ASP A O    6  
ATOM 11165 C CB   . ASP A 1 91  ? -12.233 -8.467  1.566   1.00 0.00 ? 91  ASP A CB   6  
ATOM 11166 C CG   . ASP A 1 91  ? -13.206 -9.607  1.339   1.00 0.00 ? 91  ASP A CG   6  
ATOM 11167 O OD1  . ASP A 1 91  ? -13.555 -9.864  0.168   1.00 0.00 ? 91  ASP A OD1  6  
ATOM 11168 O OD2  . ASP A 1 91  ? -13.620 -10.241 2.332   1.00 0.00 ? 91  ASP A OD2  6  
ATOM 11169 H H    . ASP A 1 91  ? -11.874 -7.553  -0.815  1.00 0.00 ? 91  ASP A H    6  
ATOM 11170 H HA   . ASP A 1 91  ? -13.830 -7.079  1.254   1.00 0.00 ? 91  ASP A HA   6  
ATOM 11171 H HB2  . ASP A 1 91  ? -11.311 -8.698  1.052   1.00 0.00 ? 91  ASP A HB2  6  
ATOM 11172 H HB3  . ASP A 1 91  ? -12.039 -8.389  2.626   1.00 0.00 ? 91  ASP A HB3  6  
ATOM 11173 N N    . PHE A 1 92  ? -11.719 -4.944  1.031   1.00 0.00 ? 92  PHE A N    6  
ATOM 11174 C CA   . PHE A 1 92  ? -11.049 -3.781  1.603   1.00 0.00 ? 92  PHE A CA   6  
ATOM 11175 C C    . PHE A 1 92  ? -11.939 -2.545  1.520   1.00 0.00 ? 92  PHE A C    6  
ATOM 11176 O O    . PHE A 1 92  ? -12.692 -2.373  0.562   1.00 0.00 ? 92  PHE A O    6  
ATOM 11177 C CB   . PHE A 1 92  ? -9.727  -3.521  0.878   1.00 0.00 ? 92  PHE A CB   6  
ATOM 11178 C CG   . PHE A 1 92  ? -8.563  -4.266  1.468   1.00 0.00 ? 92  PHE A CG   6  
ATOM 11179 C CD1  . PHE A 1 92  ? -8.706  -5.577  1.893   1.00 0.00 ? 92  PHE A CD1  6  
ATOM 11180 C CD2  . PHE A 1 92  ? -7.327  -3.654  1.598   1.00 0.00 ? 92  PHE A CD2  6  
ATOM 11181 C CE1  . PHE A 1 92  ? -7.638  -6.265  2.436   1.00 0.00 ? 92  PHE A CE1  6  
ATOM 11182 C CE2  . PHE A 1 92  ? -6.254  -4.337  2.140   1.00 0.00 ? 92  PHE A CE2  6  
ATOM 11183 C CZ   . PHE A 1 92  ? -6.410  -5.644  2.560   1.00 0.00 ? 92  PHE A CZ   6  
ATOM 11184 H H    . PHE A 1 92  ? -11.908 -4.962  0.069   1.00 0.00 ? 92  PHE A H    6  
ATOM 11185 H HA   . PHE A 1 92  ? -10.845 -3.995  2.641   1.00 0.00 ? 92  PHE A HA   6  
ATOM 11186 H HB2  . PHE A 1 92  ? -9.824  -3.823  -0.154  1.00 0.00 ? 92  PHE A HB2  6  
ATOM 11187 H HB3  . PHE A 1 92  ? -9.503  -2.466  0.921   1.00 0.00 ? 92  PHE A HB3  6  
ATOM 11188 H HD1  . PHE A 1 92  ? -9.667  -6.063  1.796   1.00 0.00 ? 92  PHE A HD1  6  
ATOM 11189 H HD2  . PHE A 1 92  ? -7.203  -2.632  1.271   1.00 0.00 ? 92  PHE A HD2  6  
ATOM 11190 H HE1  . PHE A 1 92  ? -7.763  -7.286  2.763   1.00 0.00 ? 92  PHE A HE1  6  
ATOM 11191 H HE2  . PHE A 1 92  ? -5.296  -3.850  2.236   1.00 0.00 ? 92  PHE A HE2  6  
ATOM 11192 H HZ   . PHE A 1 92  ? -5.574  -6.180  2.983   1.00 0.00 ? 92  PHE A HZ   6  
ATOM 11193 N N    . GLU A 1 93  ? -11.847 -1.688  2.532   1.00 0.00 ? 93  GLU A N    6  
ATOM 11194 C CA   . GLU A 1 93  ? -12.645 -0.468  2.574   1.00 0.00 ? 93  GLU A CA   6  
ATOM 11195 C C    . GLU A 1 93  ? -11.767 0.764   2.376   1.00 0.00 ? 93  GLU A C    6  
ATOM 11196 O O    . GLU A 1 93  ? -10.587 0.760   2.725   1.00 0.00 ? 93  GLU A O    6  
ATOM 11197 C CB   . GLU A 1 93  ? -13.393 -0.367  3.905   1.00 0.00 ? 93  GLU A CB   6  
ATOM 11198 C CG   . GLU A 1 93  ? -14.728 0.349   3.800   1.00 0.00 ? 93  GLU A CG   6  
ATOM 11199 C CD   . GLU A 1 93  ? -15.673 -0.318  2.820   1.00 0.00 ? 93  GLU A CD   6  
ATOM 11200 O OE1  . GLU A 1 93  ? -15.878 -1.545  2.936   1.00 0.00 ? 93  GLU A OE1  6  
ATOM 11201 O OE2  . GLU A 1 93  ? -16.208 0.385   1.938   1.00 0.00 ? 93  GLU A OE2  6  
ATOM 11202 H H    . GLU A 1 93  ? -11.229 -1.880  3.267   1.00 0.00 ? 93  GLU A H    6  
ATOM 11203 H HA   . GLU A 1 93  ? -13.365 -0.515  1.770   1.00 0.00 ? 93  GLU A HA   6  
ATOM 11204 H HB2  . GLU A 1 93  ? -13.570 -1.364  4.281   1.00 0.00 ? 93  GLU A HB2  6  
ATOM 11205 H HB3  . GLU A 1 93  ? -12.775 0.169   4.610   1.00 0.00 ? 93  GLU A HB3  6  
ATOM 11206 H HG2  . GLU A 1 93  ? -15.194 0.361   4.775   1.00 0.00 ? 93  GLU A HG2  6  
ATOM 11207 H HG3  . GLU A 1 93  ? -14.554 1.364   3.475   1.00 0.00 ? 93  GLU A HG3  6  
ATOM 11208 N N    . GLU A 1 94  ? -12.352 1.817   1.813   1.00 0.00 ? 94  GLU A N    6  
ATOM 11209 C CA   . GLU A 1 94  ? -11.622 3.055   1.568   1.00 0.00 ? 94  GLU A CA   6  
ATOM 11210 C C    . GLU A 1 94  ? -11.791 4.026   2.733   1.00 0.00 ? 94  GLU A C    6  
ATOM 11211 O O    . GLU A 1 94  ? -12.872 4.577   2.945   1.00 0.00 ? 94  GLU A O    6  
ATOM 11212 C CB   . GLU A 1 94  ? -12.104 3.709   0.271   1.00 0.00 ? 94  GLU A CB   6  
ATOM 11213 C CG   . GLU A 1 94  ? -11.569 5.115   0.062   1.00 0.00 ? 94  GLU A CG   6  
ATOM 11214 C CD   . GLU A 1 94  ? -11.433 5.476   -1.404  1.00 0.00 ? 94  GLU A CD   6  
ATOM 11215 O OE1  . GLU A 1 94  ? -10.958 4.624   -2.183  1.00 0.00 ? 94  GLU A OE1  6  
ATOM 11216 O OE2  . GLU A 1 94  ? -11.802 6.611   -1.773  1.00 0.00 ? 94  GLU A OE2  6  
ATOM 11217 H H    . GLU A 1 94  ? -13.296 1.759   1.556   1.00 0.00 ? 94  GLU A H    6  
ATOM 11218 H HA   . GLU A 1 94  ? -10.576 2.809   1.468   1.00 0.00 ? 94  GLU A HA   6  
ATOM 11219 H HB2  . GLU A 1 94  ? -11.791 3.098   -0.564  1.00 0.00 ? 94  GLU A HB2  6  
ATOM 11220 H HB3  . GLU A 1 94  ? -13.183 3.756   0.285   1.00 0.00 ? 94  GLU A HB3  6  
ATOM 11221 H HG2  . GLU A 1 94  ? -12.244 5.817   0.529   1.00 0.00 ? 94  GLU A HG2  6  
ATOM 11222 H HG3  . GLU A 1 94  ? -10.596 5.189   0.527   1.00 0.00 ? 94  GLU A HG3  6  
ATOM 11223 N N    . LEU A 1 95  ? -10.715 4.230   3.485   1.00 0.00 ? 95  LEU A N    6  
ATOM 11224 C CA   . LEU A 1 95  ? -10.743 5.134   4.629   1.00 0.00 ? 95  LEU A CA   6  
ATOM 11225 C C    . LEU A 1 95  ? -10.189 6.505   4.254   1.00 0.00 ? 95  LEU A C    6  
ATOM 11226 O O    . LEU A 1 95  ? -9.821  7.297   5.122   1.00 0.00 ? 95  LEU A O    6  
ATOM 11227 C CB   . LEU A 1 95  ? -9.937  4.546   5.789   1.00 0.00 ? 95  LEU A CB   6  
ATOM 11228 C CG   . LEU A 1 95  ? -10.376 3.166   6.279   1.00 0.00 ? 95  LEU A CG   6  
ATOM 11229 C CD1  . LEU A 1 95  ? -9.822  2.892   7.669   1.00 0.00 ? 95  LEU A CD1  6  
ATOM 11230 C CD2  . LEU A 1 95  ? -11.893 3.057   6.276   1.00 0.00 ? 95  LEU A CD2  6  
ATOM 11231 H H    . LEU A 1 95  ? -9.883  3.763   3.266   1.00 0.00 ? 95  LEU A H    6  
ATOM 11232 H HA   . LEU A 1 95  ? -11.772 5.247   4.938   1.00 0.00 ? 95  LEU A HA   6  
ATOM 11233 H HB2  . LEU A 1 95  ? -8.908  4.472   5.472   1.00 0.00 ? 95  LEU A HB2  6  
ATOM 11234 H HB3  . LEU A 1 95  ? -10.007 5.232   6.621   1.00 0.00 ? 95  LEU A HB3  6  
ATOM 11235 H HG   . LEU A 1 95  ? -9.984  2.412   5.610   1.00 0.00 ? 95  LEU A HG   6  
ATOM 11236 H HD11 . LEU A 1 95  ? -8.884  2.366   7.586   1.00 0.00 ? 95  LEU A HD11 6  
ATOM 11237 H HD12 . LEU A 1 95  ? -10.526 2.289   8.224   1.00 0.00 ? 95  LEU A HD12 6  
ATOM 11238 H HD13 . LEU A 1 95  ? -9.667  3.829   8.185   1.00 0.00 ? 95  LEU A HD13 6  
ATOM 11239 H HD21 . LEU A 1 95  ? -12.319 3.959   6.689   1.00 0.00 ? 95  LEU A HD21 6  
ATOM 11240 H HD22 . LEU A 1 95  ? -12.195 2.210   6.876   1.00 0.00 ? 95  LEU A HD22 6  
ATOM 11241 H HD23 . LEU A 1 95  ? -12.243 2.924   5.263   1.00 0.00 ? 95  LEU A HD23 6  
ATOM 11242 N N    . VAL A 1 96  ? -10.134 6.780   2.955   1.00 0.00 ? 96  VAL A N    6  
ATOM 11243 C CA   . VAL A 1 96  ? -9.629  8.057   2.464   1.00 0.00 ? 96  VAL A CA   6  
ATOM 11244 C C    . VAL A 1 96  ? -10.060 9.204   3.371   1.00 0.00 ? 96  VAL A C    6  
ATOM 11245 O O    . VAL A 1 96  ? -9.395  10.237  3.440   1.00 0.00 ? 96  VAL A O    6  
ATOM 11246 C CB   . VAL A 1 96  ? -10.116 8.339   1.030   1.00 0.00 ? 96  VAL A CB   6  
ATOM 11247 C CG1  . VAL A 1 96  ? -11.633 8.444   0.992   1.00 0.00 ? 96  VAL A CG1  6  
ATOM 11248 C CG2  . VAL A 1 96  ? -9.472  9.607   0.490   1.00 0.00 ? 96  VAL A CG2  6  
ATOM 11249 H H    . VAL A 1 96  ? -10.442 6.109   2.311   1.00 0.00 ? 96  VAL A H    6  
ATOM 11250 H HA   . VAL A 1 96  ? -8.550  8.006   2.452   1.00 0.00 ? 96  VAL A HA   6  
ATOM 11251 H HB   . VAL A 1 96  ? -9.818  7.513   0.401   1.00 0.00 ? 96  VAL A HB   6  
ATOM 11252 H HG11 . VAL A 1 96  ? -12.036 8.176   1.957   1.00 0.00 ? 96  VAL A HG11 6  
ATOM 11253 H HG12 . VAL A 1 96  ? -11.918 9.457   0.750   1.00 0.00 ? 96  VAL A HG12 6  
ATOM 11254 H HG13 . VAL A 1 96  ? -12.021 7.771   0.241   1.00 0.00 ? 96  VAL A HG13 6  
ATOM 11255 H HG21 . VAL A 1 96  ? -10.238 10.261  0.101   1.00 0.00 ? 96  VAL A HG21 6  
ATOM 11256 H HG22 . VAL A 1 96  ? -8.940  10.109  1.285   1.00 0.00 ? 96  VAL A HG22 6  
ATOM 11257 H HG23 . VAL A 1 96  ? -8.780  9.352   -0.299  1.00 0.00 ? 96  VAL A HG23 6  
ATOM 11258 N N    . GLU A 1 97  ? -11.178 9.014   4.065   1.00 0.00 ? 97  GLU A N    6  
ATOM 11259 C CA   . GLU A 1 97  ? -11.698 10.034  4.968   1.00 0.00 ? 97  GLU A CA   6  
ATOM 11260 C C    . GLU A 1 97  ? -10.663 10.403  6.027   1.00 0.00 ? 97  GLU A C    6  
ATOM 11261 O O    . GLU A 1 97  ? -10.476 11.577  6.344   1.00 0.00 ? 97  GLU A O    6  
ATOM 11262 C CB   . GLU A 1 97  ? -12.981 9.543   5.643   1.00 0.00 ? 97  GLU A CB   6  
ATOM 11263 C CG   . GLU A 1 97  ? -14.102 9.232   4.665   1.00 0.00 ? 97  GLU A CG   6  
ATOM 11264 C CD   . GLU A 1 97  ? -15.206 8.401   5.290   1.00 0.00 ? 97  GLU A CD   6  
ATOM 11265 O OE1  . GLU A 1 97  ? -14.995 7.186   5.488   1.00 0.00 ? 97  GLU A OE1  6  
ATOM 11266 O OE2  . GLU A 1 97  ? -16.281 8.966   5.579   1.00 0.00 ? 97  GLU A OE2  6  
ATOM 11267 H H    . GLU A 1 97  ? -11.664 8.169   3.968   1.00 0.00 ? 97  GLU A H    6  
ATOM 11268 H HA   . GLU A 1 97  ? -11.924 10.912  4.382   1.00 0.00 ? 97  GLU A HA   6  
ATOM 11269 H HB2  . GLU A 1 97  ? -12.759 8.646   6.202   1.00 0.00 ? 97  GLU A HB2  6  
ATOM 11270 H HB3  . GLU A 1 97  ? -13.328 10.305  6.325   1.00 0.00 ? 97  GLU A HB3  6  
ATOM 11271 H HG2  . GLU A 1 97  ? -14.526 10.162  4.316   1.00 0.00 ? 97  GLU A HG2  6  
ATOM 11272 H HG3  . GLU A 1 97  ? -13.691 8.688   3.828   1.00 0.00 ? 97  GLU A HG3  6  
ATOM 11273 N N    . ARG A 1 98  ? -9.993  9.391   6.569   1.00 0.00 ? 98  ARG A N    6  
ATOM 11274 C CA   . ARG A 1 98  ? -8.978  9.607   7.593   1.00 0.00 ? 98  ARG A CA   6  
ATOM 11275 C C    . ARG A 1 98  ? -7.601  9.790   6.963   1.00 0.00 ? 98  ARG A C    6  
ATOM 11276 O O    . ARG A 1 98  ? -6.710  10.394  7.559   1.00 0.00 ? 98  ARG A O    6  
ATOM 11277 C CB   . ARG A 1 98  ? -8.952  8.432   8.572   1.00 0.00 ? 98  ARG A CB   6  
ATOM 11278 C CG   . ARG A 1 98  ? -10.320 7.820   8.826   1.00 0.00 ? 98  ARG A CG   6  
ATOM 11279 C CD   . ARG A 1 98  ? -10.240 6.672   9.820   1.00 0.00 ? 98  ARG A CD   6  
ATOM 11280 N NE   . ARG A 1 98  ? -11.492 6.494   10.552  1.00 0.00 ? 98  ARG A NE   6  
ATOM 11281 C CZ   . ARG A 1 98  ? -11.805 7.176   11.648  1.00 0.00 ? 98  ARG A CZ   6  
ATOM 11282 N NH1  . ARG A 1 98  ? -10.963 8.076   12.136  1.00 0.00 ? 98  ARG A NH1  6  
ATOM 11283 N NH2  . ARG A 1 98  ? -12.963 6.958   12.258  1.00 0.00 ? 98  ARG A NH2  6  
ATOM 11284 H H    . ARG A 1 98  ? -10.187 8.476   6.274   1.00 0.00 ? 98  ARG A H    6  
ATOM 11285 H HA   . ARG A 1 98  ? -9.237  10.507  8.131   1.00 0.00 ? 98  ARG A HA   6  
ATOM 11286 H HB2  . ARG A 1 98  ? -8.306  7.662   8.175   1.00 0.00 ? 98  ARG A HB2  6  
ATOM 11287 H HB3  . ARG A 1 98  ? -8.554  8.774   9.515   1.00 0.00 ? 98  ARG A HB3  6  
ATOM 11288 H HG2  . ARG A 1 98  ? -10.976 8.580   9.223   1.00 0.00 ? 98  ARG A HG2  6  
ATOM 11289 H HG3  . ARG A 1 98  ? -10.717 7.450   7.892   1.00 0.00 ? 98  ARG A HG3  6  
ATOM 11290 H HD2  . ARG A 1 98  ? -10.017 5.762   9.282   1.00 0.00 ? 98  ARG A HD2  6  
ATOM 11291 H HD3  . ARG A 1 98  ? -9.448  6.878   10.524  1.00 0.00 ? 98  ARG A HD3  6  
ATOM 11292 H HE   . ARG A 1 98  ? -12.129 5.834   10.208  1.00 0.00 ? 98  ARG A HE   6  
ATOM 11293 H HH11 . ARG A 1 98  ? -10.090 8.243   11.678  1.00 0.00 ? 98  ARG A HH11 6  
ATOM 11294 H HH12 . ARG A 1 98  ? -11.202 8.589   12.961  1.00 0.00 ? 98  ARG A HH12 6  
ATOM 11295 H HH21 . ARG A 1 98  ? -13.601 6.280   11.893  1.00 0.00 ? 98  ARG A HH21 6  
ATOM 11296 H HH22 . ARG A 1 98  ? -13.198 7.471   13.083  1.00 0.00 ? 98  ARG A HH22 6  
ATOM 11297 N N    . SER A 1 99  ? -7.434  9.262   5.754   1.00 0.00 ? 99  SER A N    6  
ATOM 11298 C CA   . SER A 1 99  ? -6.164  9.363   5.045   1.00 0.00 ? 99  SER A CA   6  
ATOM 11299 C C    . SER A 1 99  ? -5.687  10.811  4.987   1.00 0.00 ? 99  SER A C    6  
ATOM 11300 O O    . SER A 1 99  ? -6.481  11.728  4.778   1.00 0.00 ? 99  SER A O    6  
ATOM 11301 C CB   . SER A 1 99  ? -6.301  8.801   3.628   1.00 0.00 ? 99  SER A CB   6  
ATOM 11302 O OG   . SER A 1 99  ? -6.830  9.774   2.744   1.00 0.00 ? 99  SER A OG   6  
ATOM 11303 H H    . SER A 1 99  ? -8.183  8.792   5.331   1.00 0.00 ? 99  SER A H    6  
ATOM 11304 H HA   . SER A 1 99  ? -5.435  8.778   5.586   1.00 0.00 ? 99  SER A HA   6  
ATOM 11305 H HB2  . SER A 1 99  ? -5.330  8.496   3.269   1.00 0.00 ? 99  SER A HB2  6  
ATOM 11306 H HB3  . SER A 1 99  ? -6.964  7.948   3.645   1.00 0.00 ? 99  SER A HB3  6  
ATOM 11307 H HG   . SER A 1 99  ? -7.782  9.823   2.854   1.00 0.00 ? 99  SER A HG   6  
ATOM 11308 N N    . GLN A 1 100 ? -4.386  11.007  5.173   1.00 0.00 ? 100 GLN A N    6  
ATOM 11309 C CA   . GLN A 1 100 ? -3.804  12.343  5.142   1.00 0.00 ? 100 GLN A CA   6  
ATOM 11310 C C    . GLN A 1 100 ? -2.665  12.418  4.131   1.00 0.00 ? 100 GLN A C    6  
ATOM 11311 O O    . GLN A 1 100 ? -1.557  11.946  4.391   1.00 0.00 ? 100 GLN A O    6  
ATOM 11312 C CB   . GLN A 1 100 ? -3.294  12.732  6.531   1.00 0.00 ? 100 GLN A CB   6  
ATOM 11313 C CG   . GLN A 1 100 ? -4.399  12.893  7.562   1.00 0.00 ? 100 GLN A CG   6  
ATOM 11314 C CD   . GLN A 1 100 ? -5.189  14.174  7.376   1.00 0.00 ? 100 GLN A CD   6  
ATOM 11315 O OE1  . GLN A 1 100 ? -4.940  15.174  8.050   1.00 0.00 ? 100 GLN A OE1  6  
ATOM 11316 N NE2  . GLN A 1 100 ? -6.148  14.150  6.457   1.00 0.00 ? 100 GLN A NE2  6  
ATOM 11317 H H    . GLN A 1 100 ? -3.805  10.236  5.335   1.00 0.00 ? 100 GLN A H    6  
ATOM 11318 H HA   . GLN A 1 100 ? -4.577  13.035  4.846   1.00 0.00 ? 100 GLN A HA   6  
ATOM 11319 H HB2  . GLN A 1 100 ? -2.615  11.968  6.879   1.00 0.00 ? 100 GLN A HB2  6  
ATOM 11320 H HB3  . GLN A 1 100 ? -2.762  13.669  6.457   1.00 0.00 ? 100 GLN A HB3  6  
ATOM 11321 H HG2  . GLN A 1 100 ? -5.076  12.056  7.479   1.00 0.00 ? 100 GLN A HG2  6  
ATOM 11322 H HG3  . GLN A 1 100 ? -3.957  12.900  8.547   1.00 0.00 ? 100 GLN A HG3  6  
ATOM 11323 H HE21 . GLN A 1 100 ? -6.290  13.317  5.959   1.00 0.00 ? 100 GLN A HE21 6  
ATOM 11324 H HE22 . GLN A 1 100 ? -6.674  14.963  6.316   1.00 0.00 ? 100 GLN A HE22 6  
ATOM 11325 N N    . LEU A 1 101 ? -2.944  13.012  2.976   1.00 0.00 ? 101 LEU A N    6  
ATOM 11326 C CA   . LEU A 1 101 ? -1.943  13.148  1.923   1.00 0.00 ? 101 LEU A CA   6  
ATOM 11327 C C    . LEU A 1 101 ? -1.589  14.614  1.695   1.00 0.00 ? 101 LEU A C    6  
ATOM 11328 O O    . LEU A 1 101 ? -0.974  14.964  0.688   1.00 0.00 ? 101 LEU A O    6  
ATOM 11329 C CB   . LEU A 1 101 ? -2.454  12.526  0.623   1.00 0.00 ? 101 LEU A CB   6  
ATOM 11330 C CG   . LEU A 1 101 ? -2.944  11.081  0.716   1.00 0.00 ? 101 LEU A CG   6  
ATOM 11331 C CD1  . LEU A 1 101 ? -3.990  10.801  -0.352  1.00 0.00 ? 101 LEU A CD1  6  
ATOM 11332 C CD2  . LEU A 1 101 ? -1.777  10.112  0.589   1.00 0.00 ? 101 LEU A CD2  6  
ATOM 11333 H H    . LEU A 1 101 ? -3.844  13.368  2.826   1.00 0.00 ? 101 LEU A H    6  
ATOM 11334 H HA   . LEU A 1 101 ? -1.056  12.620  2.240   1.00 0.00 ? 101 LEU A HA   6  
ATOM 11335 H HB2  . LEU A 1 101 ? -3.274  13.131  0.267   1.00 0.00 ? 101 LEU A HB2  6  
ATOM 11336 H HB3  . LEU A 1 101 ? -1.648  12.557  -0.097  1.00 0.00 ? 101 LEU A HB3  6  
ATOM 11337 H HG   . LEU A 1 101 ? -3.405  10.926  1.683   1.00 0.00 ? 101 LEU A HG   6  
ATOM 11338 H HD11 . LEU A 1 101 ? -4.961  10.705  0.111   1.00 0.00 ? 101 LEU A HD11 6  
ATOM 11339 H HD12 . LEU A 1 101 ? -3.744  9.884   -0.865  1.00 0.00 ? 101 LEU A HD12 6  
ATOM 11340 H HD13 . LEU A 1 101 ? -4.007  11.616  -1.060  1.00 0.00 ? 101 LEU A HD13 6  
ATOM 11341 H HD21 . LEU A 1 101 ? -2.090  9.129   0.907   1.00 0.00 ? 101 LEU A HD21 6  
ATOM 11342 H HD22 . LEU A 1 101 ? -0.961  10.449  1.212   1.00 0.00 ? 101 LEU A HD22 6  
ATOM 11343 H HD23 . LEU A 1 101 ? -1.453  10.073  -0.440  1.00 0.00 ? 101 LEU A HD23 6  
ATOM 11344 N N    . ASP A 1 102 ? -1.979  15.465  2.637   1.00 0.00 ? 102 ASP A N    6  
ATOM 11345 C CA   . ASP A 1 102 ? -1.700  16.893  2.541   1.00 0.00 ? 102 ASP A CA   6  
ATOM 11346 C C    . ASP A 1 102 ? -0.815  17.353  3.695   1.00 0.00 ? 102 ASP A C    6  
ATOM 11347 O O    . ASP A 1 102 ? -0.732  18.546  3.989   1.00 0.00 ? 102 ASP A O    6  
ATOM 11348 C CB   . ASP A 1 102 ? -3.005  17.690  2.533   1.00 0.00 ? 102 ASP A CB   6  
ATOM 11349 C CG   . ASP A 1 102 ? -3.686  17.673  1.179   1.00 0.00 ? 102 ASP A CG   6  
ATOM 11350 O OD1  . ASP A 1 102 ? -3.213  18.384  0.268   1.00 0.00 ? 102 ASP A OD1  6  
ATOM 11351 O OD2  . ASP A 1 102 ? -4.693  16.950  1.030   1.00 0.00 ? 102 ASP A OD2  6  
ATOM 11352 H H    . ASP A 1 102 ? -2.466  15.124  3.417   1.00 0.00 ? 102 ASP A H    6  
ATOM 11353 H HA   . ASP A 1 102 ? -1.178  17.067  1.612   1.00 0.00 ? 102 ASP A HA   6  
ATOM 11354 H HB2  . ASP A 1 102 ? -3.682  17.267  3.261   1.00 0.00 ? 102 ASP A HB2  6  
ATOM 11355 H HB3  . ASP A 1 102 ? -2.794  18.716  2.798   1.00 0.00 ? 102 ASP A HB3  6  
ATOM 11356 N N    . ILE A 1 103 ? -0.157  16.399  4.346   1.00 0.00 ? 103 ILE A N    6  
ATOM 11357 C CA   . ILE A 1 103 ? 0.721   16.707  5.468   1.00 0.00 ? 103 ILE A CA   6  
ATOM 11358 C C    . ILE A 1 103 ? 2.163   16.316  5.161   1.00 0.00 ? 103 ILE A C    6  
ATOM 11359 O O    . ILE A 1 103 ? 2.455   15.770  4.097   1.00 0.00 ? 103 ILE A O    6  
ATOM 11360 C CB   . ILE A 1 103 ? 0.268   15.986  6.751   1.00 0.00 ? 103 ILE A CB   6  
ATOM 11361 C CG1  . ILE A 1 103 ? 0.664   14.509  6.700   1.00 0.00 ? 103 ILE A CG1  6  
ATOM 11362 C CG2  . ILE A 1 103 ? -1.235  16.131  6.938   1.00 0.00 ? 103 ILE A CG2  6  
ATOM 11363 C CD1  . ILE A 1 103 ? 0.172   13.795  5.460   1.00 0.00 ? 103 ILE A CD1  6  
ATOM 11364 H H    . ILE A 1 103 ? -0.264  15.467  4.064   1.00 0.00 ? 103 ILE A H    6  
ATOM 11365 H HA   . ILE A 1 103 ? 0.677   17.772  5.643   1.00 0.00 ? 103 ILE A HA   6  
ATOM 11366 H HB   . ILE A 1 103 ? 0.758   16.454  7.592   1.00 0.00 ? 103 ILE A HB   6  
ATOM 11367 H HG12 . ILE A 1 103 ? 1.739   14.430  6.723   1.00 0.00 ? 103 ILE A HG12 6  
ATOM 11368 H HG13 . ILE A 1 103 ? 0.251   14.003  7.561   1.00 0.00 ? 103 ILE A HG13 6  
ATOM 11369 H HG21 . ILE A 1 103 ? -1.743  15.354  6.387   1.00 0.00 ? 103 ILE A HG21 6  
ATOM 11370 H HG22 . ILE A 1 103 ? -1.477  16.044  7.987   1.00 0.00 ? 103 ILE A HG22 6  
ATOM 11371 H HG23 . ILE A 1 103 ? -1.552  17.097  6.574   1.00 0.00 ? 103 ILE A HG23 6  
ATOM 11372 H HD11 . ILE A 1 103 ? -0.836  14.112  5.237   1.00 0.00 ? 103 ILE A HD11 6  
ATOM 11373 H HD12 . ILE A 1 103 ? 0.818   14.031  4.628   1.00 0.00 ? 103 ILE A HD12 6  
ATOM 11374 H HD13 . ILE A 1 103 ? 0.183   12.728  5.632   1.00 0.00 ? 103 ILE A HD13 6  
ATOM 11375 N N    . SER A 1 104 ? 3.060   16.600  6.100   1.00 0.00 ? 104 SER A N    6  
ATOM 11376 C CA   . SER A 1 104 ? 4.472   16.280  5.929   1.00 0.00 ? 104 SER A CA   6  
ATOM 11377 C C    . SER A 1 104 ? 4.645   14.893  5.317   1.00 0.00 ? 104 SER A C    6  
ATOM 11378 O O    . SER A 1 104 ? 5.218   14.746  4.238   1.00 0.00 ? 104 SER A O    6  
ATOM 11379 C CB   . SER A 1 104 ? 5.199   16.351  7.274   1.00 0.00 ? 104 SER A CB   6  
ATOM 11380 O OG   . SER A 1 104 ? 5.309   17.690  7.724   1.00 0.00 ? 104 SER A OG   6  
ATOM 11381 H H    . SER A 1 104 ? 2.764   17.036  6.926   1.00 0.00 ? 104 SER A H    6  
ATOM 11382 H HA   . SER A 1 104 ? 4.899   17.012  5.260   1.00 0.00 ? 104 SER A HA   6  
ATOM 11383 H HB2  . SER A 1 104 ? 4.650   15.781  8.007   1.00 0.00 ? 104 SER A HB2  6  
ATOM 11384 H HB3  . SER A 1 104 ? 6.191   15.937  7.165   1.00 0.00 ? 104 SER A HB3  6  
ATOM 11385 H HG   . SER A 1 104 ? 4.478   17.964  8.118   1.00 0.00 ? 104 SER A HG   6  
ATOM 11386 N N    . ASP A 1 105 ? 4.145   13.879  6.015   1.00 0.00 ? 105 ASP A N    6  
ATOM 11387 C CA   . ASP A 1 105 ? 4.243   12.503  5.541   1.00 0.00 ? 105 ASP A CA   6  
ATOM 11388 C C    . ASP A 1 105 ? 2.872   11.969  5.138   1.00 0.00 ? 105 ASP A C    6  
ATOM 11389 O O    . ASP A 1 105 ? 2.052   11.597  5.977   1.00 0.00 ? 105 ASP A O    6  
ATOM 11390 C CB   . ASP A 1 105 ? 4.853   11.611  6.623   1.00 0.00 ? 105 ASP A CB   6  
ATOM 11391 C CG   . ASP A 1 105 ? 5.562   10.402  6.044   1.00 0.00 ? 105 ASP A CG   6  
ATOM 11392 O OD1  . ASP A 1 105 ? 5.032   9.808   5.081   1.00 0.00 ? 105 ASP A OD1  6  
ATOM 11393 O OD2  . ASP A 1 105 ? 6.647   10.051  6.552   1.00 0.00 ? 105 ASP A OD2  6  
ATOM 11394 H H    . ASP A 1 105 ? 3.699   14.060  6.869   1.00 0.00 ? 105 ASP A H    6  
ATOM 11395 H HA   . ASP A 1 105 ? 4.887   12.496  4.675   1.00 0.00 ? 105 ASP A HA   6  
ATOM 11396 H HB2  . ASP A 1 105 ? 5.569   12.186  7.193   1.00 0.00 ? 105 ASP A HB2  6  
ATOM 11397 H HB3  . ASP A 1 105 ? 4.069   11.266  7.280   1.00 0.00 ? 105 ASP A HB3  6  
ATOM 11398 N N    . PRO A 1 106 ? 2.615   11.931  3.822   1.00 0.00 ? 106 PRO A N    6  
ATOM 11399 C CA   . PRO A 1 106 ? 1.344   11.445  3.277   1.00 0.00 ? 106 PRO A CA   6  
ATOM 11400 C C    . PRO A 1 106 ? 1.176   9.939   3.453   1.00 0.00 ? 106 PRO A C    6  
ATOM 11401 O O    . PRO A 1 106 ? 2.156   9.196   3.497   1.00 0.00 ? 106 PRO A O    6  
ATOM 11402 C CB   . PRO A 1 106 ? 1.435   11.802  1.791   1.00 0.00 ? 106 PRO A CB   6  
ATOM 11403 C CG   . PRO A 1 106 ? 2.895   11.859  1.504   1.00 0.00 ? 106 PRO A CG   6  
ATOM 11404 C CD   . PRO A 1 106 ? 3.546   12.359  2.764   1.00 0.00 ? 106 PRO A CD   6  
ATOM 11405 H HA   . PRO A 1 106 ? 0.501   11.954  3.721   1.00 0.00 ? 106 PRO A HA   6  
ATOM 11406 H HB2  . PRO A 1 106 ? 0.945   11.038  1.204   1.00 0.00 ? 106 PRO A HB2  6  
ATOM 11407 H HB3  . PRO A 1 106 ? 0.961   12.757  1.617   1.00 0.00 ? 106 PRO A HB3  6  
ATOM 11408 H HG2  . PRO A 1 106 ? 3.260   10.873  1.259   1.00 0.00 ? 106 PRO A HG2  6  
ATOM 11409 H HG3  . PRO A 1 106 ? 3.083   12.543  0.689   1.00 0.00 ? 106 PRO A HG3  6  
ATOM 11410 H HD2  . PRO A 1 106 ? 4.515   11.901  2.895   1.00 0.00 ? 106 PRO A HD2  6  
ATOM 11411 H HD3  . PRO A 1 106 ? 3.635   13.435  2.742   1.00 0.00 ? 106 PRO A HD3  6  
ATOM 11412 N N    . TYR A 1 107 ? -0.073  9.496   3.553   1.00 0.00 ? 107 TYR A N    6  
ATOM 11413 C CA   . TYR A 1 107 ? -0.369  8.079   3.727   1.00 0.00 ? 107 TYR A CA   6  
ATOM 11414 C C    . TYR A 1 107 ? -1.839  7.791   3.440   1.00 0.00 ? 107 TYR A C    6  
ATOM 11415 O O    . TYR A 1 107 ? -2.699  8.657   3.607   1.00 0.00 ? 107 TYR A O    6  
ATOM 11416 C CB   . TYR A 1 107 ? -0.018  7.633   5.147   1.00 0.00 ? 107 TYR A CB   6  
ATOM 11417 C CG   . TYR A 1 107 ? -0.783  8.373   6.220   1.00 0.00 ? 107 TYR A CG   6  
ATOM 11418 C CD1  . TYR A 1 107 ? -0.409  9.653   6.611   1.00 0.00 ? 107 TYR A CD1  6  
ATOM 11419 C CD2  . TYR A 1 107 ? -1.882  7.793   6.843   1.00 0.00 ? 107 TYR A CD2  6  
ATOM 11420 C CE1  . TYR A 1 107 ? -1.106  10.333  7.592   1.00 0.00 ? 107 TYR A CE1  6  
ATOM 11421 C CE2  . TYR A 1 107 ? -2.585  8.466   7.824   1.00 0.00 ? 107 TYR A CE2  6  
ATOM 11422 C CZ   . TYR A 1 107 ? -2.192  9.735   8.195   1.00 0.00 ? 107 TYR A CZ   6  
ATOM 11423 O OH   . TYR A 1 107 ? -2.889  10.409  9.172   1.00 0.00 ? 107 TYR A OH   6  
ATOM 11424 H H    . TYR A 1 107 ? -0.813  10.137  3.511   1.00 0.00 ? 107 TYR A H    6  
ATOM 11425 H HA   . TYR A 1 107 ? 0.238   7.525   3.026   1.00 0.00 ? 107 TYR A HA   6  
ATOM 11426 H HB2  . TYR A 1 107 ? -0.235  6.582   5.251   1.00 0.00 ? 107 TYR A HB2  6  
ATOM 11427 H HB3  . TYR A 1 107 ? 1.036   7.797   5.318   1.00 0.00 ? 107 TYR A HB3  6  
ATOM 11428 H HD1  . TYR A 1 107 ? 0.442   10.119  6.136   1.00 0.00 ? 107 TYR A HD1  6  
ATOM 11429 H HD2  . TYR A 1 107 ? -2.186  6.799   6.550   1.00 0.00 ? 107 TYR A HD2  6  
ATOM 11430 H HE1  . TYR A 1 107 ? -0.799  11.327  7.882   1.00 0.00 ? 107 TYR A HE1  6  
ATOM 11431 H HE2  . TYR A 1 107 ? -3.436  7.998   8.297   1.00 0.00 ? 107 TYR A HE2  6  
ATOM 11432 H HH   . TYR A 1 107 ? -3.673  10.810  8.787   1.00 0.00 ? 107 TYR A HH   6  
ATOM 11433 N N    . LYS A 1 108 ? -2.122  6.567   3.006   1.00 0.00 ? 108 LYS A N    6  
ATOM 11434 C CA   . LYS A 1 108 ? -3.488  6.161   2.697   1.00 0.00 ? 108 LYS A CA   6  
ATOM 11435 C C    . LYS A 1 108 ? -3.998  5.149   3.718   1.00 0.00 ? 108 LYS A C    6  
ATOM 11436 O O    . LYS A 1 108 ? -3.397  4.093   3.915   1.00 0.00 ? 108 LYS A O    6  
ATOM 11437 C CB   . LYS A 1 108 ? -3.557  5.562   1.291   1.00 0.00 ? 108 LYS A CB   6  
ATOM 11438 C CG   . LYS A 1 108 ? -3.128  6.525   0.197   1.00 0.00 ? 108 LYS A CG   6  
ATOM 11439 C CD   . LYS A 1 108 ? -3.843  6.237   -1.112  1.00 0.00 ? 108 LYS A CD   6  
ATOM 11440 C CE   . LYS A 1 108 ? -3.411  7.200   -2.207  1.00 0.00 ? 108 LYS A CE   6  
ATOM 11441 N NZ   . LYS A 1 108 ? -4.466  7.369   -3.245  1.00 0.00 ? 108 LYS A NZ   6  
ATOM 11442 H H    . LYS A 1 108 ? -1.393  5.920   2.892   1.00 0.00 ? 108 LYS A H    6  
ATOM 11443 H HA   . LYS A 1 108 ? -4.112  7.040   2.736   1.00 0.00 ? 108 LYS A HA   6  
ATOM 11444 H HB2  . LYS A 1 108 ? -2.915  4.694   1.250   1.00 0.00 ? 108 LYS A HB2  6  
ATOM 11445 H HB3  . LYS A 1 108 ? -4.575  5.256   1.093   1.00 0.00 ? 108 LYS A HB3  6  
ATOM 11446 H HG2  . LYS A 1 108 ? -3.360  7.533   0.507   1.00 0.00 ? 108 LYS A HG2  6  
ATOM 11447 H HG3  . LYS A 1 108 ? -2.063  6.429   0.044   1.00 0.00 ? 108 LYS A HG3  6  
ATOM 11448 H HD2  . LYS A 1 108 ? -3.612  5.229   -1.424  1.00 0.00 ? 108 LYS A HD2  6  
ATOM 11449 H HD3  . LYS A 1 108 ? -4.909  6.333   -0.959  1.00 0.00 ? 108 LYS A HD3  6  
ATOM 11450 H HE2  . LYS A 1 108 ? -3.201  8.160   -1.761  1.00 0.00 ? 108 LYS A HE2  6  
ATOM 11451 H HE3  . LYS A 1 108 ? -2.516  6.816   -2.674  1.00 0.00 ? 108 LYS A HE3  6  
ATOM 11452 H HZ1  . LYS A 1 108 ? -4.184  6.885   -4.122  1.00 0.00 ? 108 LYS A HZ1  6  
ATOM 11453 H HZ2  . LYS A 1 108 ? -4.607  8.378   -3.450  1.00 0.00 ? 108 LYS A HZ2  6  
ATOM 11454 H HZ3  . LYS A 1 108 ? -5.364  6.964   -2.911  1.00 0.00 ? 108 LYS A HZ3  6  
ATOM 11455 N N    . VAL A 1 109 ? -5.113  5.477   4.364   1.00 0.00 ? 109 VAL A N    6  
ATOM 11456 C CA   . VAL A 1 109 ? -5.706  4.596   5.362   1.00 0.00 ? 109 VAL A CA   6  
ATOM 11457 C C    . VAL A 1 109 ? -6.732  3.662   4.731   1.00 0.00 ? 109 VAL A C    6  
ATOM 11458 O O    . VAL A 1 109 ? -7.492  4.063   3.848   1.00 0.00 ? 109 VAL A O    6  
ATOM 11459 C CB   . VAL A 1 109 ? -6.384  5.399   6.488   1.00 0.00 ? 109 VAL A CB   6  
ATOM 11460 C CG1  . VAL A 1 109 ? -6.919  4.465   7.563   1.00 0.00 ? 109 VAL A CG1  6  
ATOM 11461 C CG2  . VAL A 1 109 ? -5.411  6.407   7.082   1.00 0.00 ? 109 VAL A CG2  6  
ATOM 11462 H H    . VAL A 1 109 ? -5.547  6.333   4.163   1.00 0.00 ? 109 VAL A H    6  
ATOM 11463 H HA   . VAL A 1 109 ? -4.914  4.004   5.797   1.00 0.00 ? 109 VAL A HA   6  
ATOM 11464 H HB   . VAL A 1 109 ? -7.217  5.941   6.065   1.00 0.00 ? 109 VAL A HB   6  
ATOM 11465 H HG11 . VAL A 1 109 ? -6.917  3.451   7.191   1.00 0.00 ? 109 VAL A HG11 6  
ATOM 11466 H HG12 . VAL A 1 109 ? -6.293  4.530   8.441   1.00 0.00 ? 109 VAL A HG12 6  
ATOM 11467 H HG13 . VAL A 1 109 ? -7.928  4.752   7.818   1.00 0.00 ? 109 VAL A HG13 6  
ATOM 11468 H HG21 . VAL A 1 109 ? -4.792  5.918   7.819   1.00 0.00 ? 109 VAL A HG21 6  
ATOM 11469 H HG22 . VAL A 1 109 ? -4.787  6.811   6.298   1.00 0.00 ? 109 VAL A HG22 6  
ATOM 11470 H HG23 . VAL A 1 109 ? -5.964  7.208   7.550   1.00 0.00 ? 109 VAL A HG23 6  
ATOM 11471 N N    . TYR A 1 110 ? -6.750  2.415   5.188   1.00 0.00 ? 110 TYR A N    6  
ATOM 11472 C CA   . TYR A 1 110 ? -7.682  1.423   4.667   1.00 0.00 ? 110 TYR A CA   6  
ATOM 11473 C C    . TYR A 1 110 ? -8.152  0.483   5.773   1.00 0.00 ? 110 TYR A C    6  
ATOM 11474 O O    . TYR A 1 110 ? -7.454  0.277   6.766   1.00 0.00 ? 110 TYR A O    6  
ATOM 11475 C CB   . TYR A 1 110 ? -7.027  0.619   3.542   1.00 0.00 ? 110 TYR A CB   6  
ATOM 11476 C CG   . TYR A 1 110 ? -7.156  1.265   2.181   1.00 0.00 ? 110 TYR A CG   6  
ATOM 11477 C CD1  . TYR A 1 110 ? -6.271  2.256   1.775   1.00 0.00 ? 110 TYR A CD1  6  
ATOM 11478 C CD2  . TYR A 1 110 ? -8.162  0.885   1.302   1.00 0.00 ? 110 TYR A CD2  6  
ATOM 11479 C CE1  . TYR A 1 110 ? -6.385  2.850   0.533   1.00 0.00 ? 110 TYR A CE1  6  
ATOM 11480 C CE2  . TYR A 1 110 ? -8.283  1.472   0.058   1.00 0.00 ? 110 TYR A CE2  6  
ATOM 11481 C CZ   . TYR A 1 110 ? -7.392  2.454   -0.322  1.00 0.00 ? 110 TYR A CZ   6  
ATOM 11482 O OH   . TYR A 1 110 ? -7.510  3.042   -1.561  1.00 0.00 ? 110 TYR A OH   6  
ATOM 11483 H H    . TYR A 1 110 ? -6.120  2.155   5.892   1.00 0.00 ? 110 TYR A H    6  
ATOM 11484 H HA   . TYR A 1 110 ? -8.538  1.948   4.269   1.00 0.00 ? 110 TYR A HA   6  
ATOM 11485 H HB2  . TYR A 1 110 ? -5.976  0.504   3.756   1.00 0.00 ? 110 TYR A HB2  6  
ATOM 11486 H HB3  . TYR A 1 110 ? -7.488  -0.357  3.492   1.00 0.00 ? 110 TYR A HB3  6  
ATOM 11487 H HD1  . TYR A 1 110 ? -5.483  2.564   2.447   1.00 0.00 ? 110 TYR A HD1  6  
ATOM 11488 H HD2  . TYR A 1 110 ? -8.859  0.115   1.603   1.00 0.00 ? 110 TYR A HD2  6  
ATOM 11489 H HE1  . TYR A 1 110 ? -5.688  3.619   0.235   1.00 0.00 ? 110 TYR A HE1  6  
ATOM 11490 H HE2  . TYR A 1 110 ? -9.072  1.162   -0.612  1.00 0.00 ? 110 TYR A HE2  6  
ATOM 11491 H HH   . TYR A 1 110 ? -7.877  2.409   -2.182  1.00 0.00 ? 110 TYR A HH   6  
ATOM 11492 N N    . ARG A 1 111 ? -9.340  -0.086  5.592   1.00 0.00 ? 111 ARG A N    6  
ATOM 11493 C CA   . ARG A 1 111 ? -9.904  -1.004  6.574   1.00 0.00 ? 111 ARG A CA   6  
ATOM 11494 C C    . ARG A 1 111 ? -10.167 -2.371  5.951   1.00 0.00 ? 111 ARG A C    6  
ATOM 11495 O O    . ARG A 1 111 ? -10.832 -2.477  4.919   1.00 0.00 ? 111 ARG A O    6  
ATOM 11496 C CB   . ARG A 1 111 ? -11.203 -0.435  7.147   1.00 0.00 ? 111 ARG A CB   6  
ATOM 11497 C CG   . ARG A 1 111 ? -12.021 -1.450  7.929   1.00 0.00 ? 111 ARG A CG   6  
ATOM 11498 C CD   . ARG A 1 111 ? -13.503 -1.115  7.898   1.00 0.00 ? 111 ARG A CD   6  
ATOM 11499 N NE   . ARG A 1 111 ? -14.337 -2.299  8.087   1.00 0.00 ? 111 ARG A NE   6  
ATOM 11500 C CZ   . ARG A 1 111 ? -15.651 -2.312  7.894   1.00 0.00 ? 111 ARG A CZ   6  
ATOM 11501 N NH1  . ARG A 1 111 ? -16.278 -1.209  7.508   1.00 0.00 ? 111 ARG A NH1  6  
ATOM 11502 N NH2  . ARG A 1 111 ? -16.340 -3.429  8.087   1.00 0.00 ? 111 ARG A NH2  6  
ATOM 11503 H H    . ARG A 1 111 ? -9.849  0.118   4.780   1.00 0.00 ? 111 ARG A H    6  
ATOM 11504 H HA   . ARG A 1 111 ? -9.188  -1.117  7.373   1.00 0.00 ? 111 ARG A HA   6  
ATOM 11505 H HB2  . ARG A 1 111 ? -10.963 0.386   7.808   1.00 0.00 ? 111 ARG A HB2  6  
ATOM 11506 H HB3  . ARG A 1 111 ? -11.810 -0.066  6.334   1.00 0.00 ? 111 ARG A HB3  6  
ATOM 11507 H HG2  . ARG A 1 111 ? -11.875 -2.428  7.493   1.00 0.00 ? 111 ARG A HG2  6  
ATOM 11508 H HG3  . ARG A 1 111 ? -11.683 -1.458  8.954   1.00 0.00 ? 111 ARG A HG3  6  
ATOM 11509 H HD2  . ARG A 1 111 ? -13.715 -0.408  8.686   1.00 0.00 ? 111 ARG A HD2  6  
ATOM 11510 H HD3  . ARG A 1 111 ? -13.738 -0.669  6.943   1.00 0.00 ? 111 ARG A HD3  6  
ATOM 11511 H HE   . ARG A 1 111 ? -13.894 -3.125  8.372   1.00 0.00 ? 111 ARG A HE   6  
ATOM 11512 H HH11 . ARG A 1 111 ? -15.761 -0.366  7.361   1.00 0.00 ? 111 ARG A HH11 6  
ATOM 11513 H HH12 . ARG A 1 111 ? -17.267 -1.221  7.362   1.00 0.00 ? 111 ARG A HH12 6  
ATOM 11514 H HH21 . ARG A 1 111 ? -15.871 -4.262  8.378   1.00 0.00 ? 111 ARG A HH21 6  
ATOM 11515 H HH22 . ARG A 1 111 ? -17.329 -3.437  7.941   1.00 0.00 ? 111 ARG A HH22 6  
ATOM 11516 N N    . ILE A 1 112 ? -9.641  -3.415  6.583   1.00 0.00 ? 112 ILE A N    6  
ATOM 11517 C CA   . ILE A 1 112 ? -9.819  -4.775  6.091   1.00 0.00 ? 112 ILE A CA   6  
ATOM 11518 C C    . ILE A 1 112 ? -11.233 -5.278  6.363   1.00 0.00 ? 112 ILE A C    6  
ATOM 11519 O O    . ILE A 1 112 ? -11.565 -5.648  7.489   1.00 0.00 ? 112 ILE A O    6  
ATOM 11520 C CB   . ILE A 1 112 ? -8.809  -5.744  6.735   1.00 0.00 ? 112 ILE A CB   6  
ATOM 11521 C CG1  . ILE A 1 112 ? -7.377  -5.293  6.438   1.00 0.00 ? 112 ILE A CG1  6  
ATOM 11522 C CG2  . ILE A 1 112 ? -9.039  -7.161  6.231   1.00 0.00 ? 112 ILE A CG2  6  
ATOM 11523 C CD1  . ILE A 1 112 ? -6.329  -6.067  7.206   1.00 0.00 ? 112 ILE A CD1  6  
ATOM 11524 H H    . ILE A 1 112 ? -9.121  -3.266  7.400   1.00 0.00 ? 112 ILE A H    6  
ATOM 11525 H HA   . ILE A 1 112 ? -9.651  -4.768  5.024   1.00 0.00 ? 112 ILE A HA   6  
ATOM 11526 H HB   . ILE A 1 112 ? -8.968  -5.737  7.802   1.00 0.00 ? 112 ILE A HB   6  
ATOM 11527 H HG12 . ILE A 1 112 ? -7.177  -5.419  5.386   1.00 0.00 ? 112 ILE A HG12 6  
ATOM 11528 H HG13 . ILE A 1 112 ? -7.276  -4.249  6.697   1.00 0.00 ? 112 ILE A HG13 6  
ATOM 11529 H HG21 . ILE A 1 112 ? -8.425  -7.337  5.360   1.00 0.00 ? 112 ILE A HG21 6  
ATOM 11530 H HG22 . ILE A 1 112 ? -8.774  -7.865  7.005   1.00 0.00 ? 112 ILE A HG22 6  
ATOM 11531 H HG23 . ILE A 1 112 ? -10.079 -7.286  5.970   1.00 0.00 ? 112 ILE A HG23 6  
ATOM 11532 H HD11 . ILE A 1 112 ? -5.793  -5.396  7.861   1.00 0.00 ? 112 ILE A HD11 6  
ATOM 11533 H HD12 . ILE A 1 112 ? -6.807  -6.838  7.792   1.00 0.00 ? 112 ILE A HD12 6  
ATOM 11534 H HD13 . ILE A 1 112 ? -5.636  -6.521  6.512   1.00 0.00 ? 112 ILE A HD13 6  
ATOM 11535 N N    . VAL A 1 113 ? -12.062 -5.289  5.324   1.00 0.00 ? 113 VAL A N    6  
ATOM 11536 C CA   . VAL A 1 113 ? -13.440 -5.748  5.450   1.00 0.00 ? 113 VAL A CA   6  
ATOM 11537 C C    . VAL A 1 113 ? -13.511 -7.271  5.466   1.00 0.00 ? 113 VAL A C    6  
ATOM 11538 O O    . VAL A 1 113 ? -13.045 -7.949  4.550   1.00 0.00 ? 113 VAL A O    6  
ATOM 11539 C CB   . VAL A 1 113 ? -14.316 -5.216  4.302   1.00 0.00 ? 113 VAL A CB   6  
ATOM 11540 C CG1  . VAL A 1 113 ? -15.791 -5.397  4.627   1.00 0.00 ? 113 VAL A CG1  6  
ATOM 11541 C CG2  . VAL A 1 113 ? -13.999 -3.755  4.023   1.00 0.00 ? 113 VAL A CG2  6  
ATOM 11542 H H    . VAL A 1 113 ? -11.739 -4.981  4.452   1.00 0.00 ? 113 VAL A H    6  
ATOM 11543 H HA   . VAL A 1 113 ? -13.834 -5.369  6.