data_2DMT
# 
_entry.id   2DMT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DMT         
RCSB  RCSB025599   
WWPDB D_1000025599 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsg002001013.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DMT 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-24 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ohnishi, S.'                                            1 
'Yoneyama, M.'                                           2 
'Koshiba, S.'                                            3 
'Inoue, M.'                                              4 
'Kigawa, T.'                                             5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the homeobox domain of Homeobox protein BarH-like 1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ohnishi, S.'  1 
primary 'Yoneyama, M.' 2 
primary 'Koshiba, S.'  3 
primary 'Inoue, M.'    4 
primary 'Kigawa, T.'   5 
primary 'Yokoyama, S.' 6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Homeobox protein BarH-like 1' 
_entity.formula_weight             8980.239 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'homeobox domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsg002001013.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  GLY n 
1 9  GLU n 
1 10 PRO n 
1 11 GLY n 
1 12 THR n 
1 13 LYS n 
1 14 ALA n 
1 15 LYS n 
1 16 LYS n 
1 17 GLY n 
1 18 ARG n 
1 19 ARG n 
1 20 SER n 
1 21 ARG n 
1 22 THR n 
1 23 VAL n 
1 24 PHE n 
1 25 THR n 
1 26 GLU n 
1 27 LEU n 
1 28 GLN n 
1 29 LEU n 
1 30 MET n 
1 31 GLY n 
1 32 LEU n 
1 33 GLU n 
1 34 LYS n 
1 35 ARG n 
1 36 PHE n 
1 37 GLU n 
1 38 LYS n 
1 39 GLN n 
1 40 LYS n 
1 41 TYR n 
1 42 LEU n 
1 43 SER n 
1 44 THR n 
1 45 PRO n 
1 46 ASP n 
1 47 ARG n 
1 48 ILE n 
1 49 ASP n 
1 50 LEU n 
1 51 ALA n 
1 52 GLU n 
1 53 SER n 
1 54 LEU n 
1 55 GLY n 
1 56 LEU n 
1 57 SER n 
1 58 GLN n 
1 59 LEU n 
1 60 GLN n 
1 61 VAL n 
1 62 LYS n 
1 63 THR n 
1 64 TRP n 
1 65 TYR n 
1 66 GLN n 
1 67 ASN n 
1 68 ARG n 
1 69 ARG n 
1 70 MET n 
1 71 LYS n 
1 72 TRP n 
1 73 LYS n 
1 74 LYS n 
1 75 SER n 
1 76 GLY n 
1 77 PRO n 
1 78 SER n 
1 79 SER n 
1 80 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 BARX1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell free synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050919-24 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BARX1_HUMAN 
_struct_ref.pdbx_db_accession          Q9HBU1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           104 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DMT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 74 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9HBU1 
_struct_ref_seq.db_align_beg                  104 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  170 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       74 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DMT GLY A 1  ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 1  1  
1 2DMT SER A 2  ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 2  2  
1 2DMT SER A 3  ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 3  3  
1 2DMT GLY A 4  ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 4  4  
1 2DMT SER A 5  ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 5  5  
1 2DMT SER A 6  ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 6  6  
1 2DMT GLY A 7  ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 7  7  
1 2DMT SER A 75 ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 75 8  
1 2DMT GLY A 76 ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 76 9  
1 2DMT PRO A 77 ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 77 10 
1 2DMT SER A 78 ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 78 11 
1 2DMT SER A 79 ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 79 12 
1 2DMT GLY A 80 ? UNP Q9HBU1 ? ? 'CLONING ARTIFACT' 80 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1.0mM protein U-15N, 13C; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 
0.02% NaN3; 10% D2O, 90% H2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DMT 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DMT 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DMT 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.965    'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2DMT 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DMT 
_struct.title                     'Solution structure of the homeobox domain of Homeobox protein BarH-like 1' 
_struct.pdbx_descriptor           'Homeobox protein BarH-like 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DMT 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
;homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 25 ? GLN A 39 ? THR A 25 GLN A 39 1 ? 15 
HELX_P HELX_P2 2 SER A 43 ? GLY A 55 ? SER A 43 GLY A 55 1 ? 13 
HELX_P HELX_P3 3 SER A 57 ? LYS A 73 ? SER A 57 LYS A 73 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2DMT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DMT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 36.695  9.962   -19.565 1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? 35.439  9.828   -18.850 1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? 34.660  8.598   -19.270 1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? 35.029  7.919   -20.229 1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? 37.085  9.184   -20.016 1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1  ? 35.645  9.767   -17.791 1.00 0.00 ? 1  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1  ? 34.835  10.704  -19.039 1.00 0.00 ? 1  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2  ? 33.580  8.308   -18.551 1.00 0.00 ? 2  SER A N    1  
ATOM 9     C CA   . SER A 1 2  ? 32.750  7.147   -18.852 1.00 0.00 ? 2  SER A CA   1  
ATOM 10    C C    . SER A 1 2  ? 31.422  7.222   -18.106 1.00 0.00 ? 2  SER A C    1  
ATOM 11    O O    . SER A 1 2  ? 31.367  7.021   -16.893 1.00 0.00 ? 2  SER A O    1  
ATOM 12    C CB   . SER A 1 2  ? 33.486  5.858   -18.481 1.00 0.00 ? 2  SER A CB   1  
ATOM 13    O OG   . SER A 1 2  ? 33.915  5.887   -17.130 1.00 0.00 ? 2  SER A OG   1  
ATOM 14    H H    . SER A 1 2  ? 33.338  8.888   -17.799 1.00 0.00 ? 2  SER A H    1  
ATOM 15    H HA   . SER A 1 2  ? 32.554  7.147   -19.914 1.00 0.00 ? 2  SER A HA   1  
ATOM 16    H HB2  . SER A 1 2  ? 32.823  5.017   -18.618 1.00 0.00 ? 2  SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2  ? 34.350  5.744   -19.119 1.00 0.00 ? 2  SER A HB3  1  
ATOM 18    H HG   . SER A 1 2  ? 34.817  5.563   -17.074 1.00 0.00 ? 2  SER A HG   1  
ATOM 19    N N    . SER A 1 3  ? 30.353  7.511   -18.841 1.00 0.00 ? 3  SER A N    1  
ATOM 20    C CA   . SER A 1 3  ? 29.024  7.616   -18.249 1.00 0.00 ? 3  SER A CA   1  
ATOM 21    C C    . SER A 1 3  ? 28.005  6.821   -19.059 1.00 0.00 ? 3  SER A C    1  
ATOM 22    O O    . SER A 1 3  ? 28.214  6.543   -20.239 1.00 0.00 ? 3  SER A O    1  
ATOM 23    C CB   . SER A 1 3  ? 28.594  9.082   -18.165 1.00 0.00 ? 3  SER A CB   1  
ATOM 24    O OG   . SER A 1 3  ? 28.223  9.579   -19.440 1.00 0.00 ? 3  SER A OG   1  
ATOM 25    H H    . SER A 1 3  ? 30.461  7.661   -19.804 1.00 0.00 ? 3  SER A H    1  
ATOM 26    H HA   . SER A 1 3  ? 29.072  7.206   -17.251 1.00 0.00 ? 3  SER A HA   1  
ATOM 27    H HB2  . SER A 1 3  ? 27.750  9.170   -17.498 1.00 0.00 ? 3  SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3  ? 29.415  9.674   -17.786 1.00 0.00 ? 3  SER A HB3  1  
ATOM 29    H HG   . SER A 1 3  ? 29.003  9.653   -19.994 1.00 0.00 ? 3  SER A HG   1  
ATOM 30    N N    . GLY A 1 4  ? 26.899  6.459   -18.415 1.00 0.00 ? 4  GLY A N    1  
ATOM 31    C CA   . GLY A 1 4  ? 25.863  5.700   -19.090 1.00 0.00 ? 4  GLY A CA   1  
ATOM 32    C C    . GLY A 1 4  ? 25.470  6.310   -20.421 1.00 0.00 ? 4  GLY A C    1  
ATOM 33    O O    . GLY A 1 4  ? 25.727  7.487   -20.672 1.00 0.00 ? 4  GLY A O    1  
ATOM 34    H H    . GLY A 1 4  ? 26.786  6.709   -17.474 1.00 0.00 ? 4  GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4  ? 26.220  4.694   -19.258 1.00 0.00 ? 4  GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4  ? 24.990  5.659   -18.454 1.00 0.00 ? 4  GLY A HA3  1  
ATOM 37    N N    . SER A 1 5  ? 24.846  5.507   -21.277 1.00 0.00 ? 5  SER A N    1  
ATOM 38    C CA   . SER A 1 5  ? 24.422  5.974   -22.592 1.00 0.00 ? 5  SER A CA   1  
ATOM 39    C C    . SER A 1 5  ? 22.901  5.967   -22.706 1.00 0.00 ? 5  SER A C    1  
ATOM 40    O O    . SER A 1 5  ? 22.290  6.972   -23.071 1.00 0.00 ? 5  SER A O    1  
ATOM 41    C CB   . SER A 1 5  ? 25.031  5.097   -23.688 1.00 0.00 ? 5  SER A CB   1  
ATOM 42    O OG   . SER A 1 5  ? 24.657  3.741   -23.523 1.00 0.00 ? 5  SER A OG   1  
ATOM 43    H H    . SER A 1 5  ? 24.669  4.578   -21.019 1.00 0.00 ? 5  SER A H    1  
ATOM 44    H HA   . SER A 1 5  ? 24.776  6.986   -22.714 1.00 0.00 ? 5  SER A HA   1  
ATOM 45    H HB2  . SER A 1 5  ? 24.685  5.439   -24.652 1.00 0.00 ? 5  SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5  ? 26.108  5.170   -23.646 1.00 0.00 ? 5  SER A HB3  1  
ATOM 47    H HG   . SER A 1 5  ? 25.349  3.173   -23.870 1.00 0.00 ? 5  SER A HG   1  
ATOM 48    N N    . SER A 1 6  ? 22.295  4.826   -22.392 1.00 0.00 ? 6  SER A N    1  
ATOM 49    C CA   . SER A 1 6  ? 20.845  4.686   -22.462 1.00 0.00 ? 6  SER A CA   1  
ATOM 50    C C    . SER A 1 6  ? 20.384  3.433   -21.723 1.00 0.00 ? 6  SER A C    1  
ATOM 51    O O    . SER A 1 6  ? 20.761  2.317   -22.076 1.00 0.00 ? 6  SER A O    1  
ATOM 52    C CB   . SER A 1 6  ? 20.388  4.629   -23.921 1.00 0.00 ? 6  SER A CB   1  
ATOM 53    O OG   . SER A 1 6  ? 19.047  5.070   -24.053 1.00 0.00 ? 6  SER A OG   1  
ATOM 54    H H    . SER A 1 6  ? 22.837  4.060   -22.108 1.00 0.00 ? 6  SER A H    1  
ATOM 55    H HA   . SER A 1 6  ? 20.405  5.551   -21.989 1.00 0.00 ? 6  SER A HA   1  
ATOM 56    H HB2  . SER A 1 6  ? 21.023  5.263   -24.520 1.00 0.00 ? 6  SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6  ? 20.456  3.611   -24.277 1.00 0.00 ? 6  SER A HB3  1  
ATOM 58    H HG   . SER A 1 6  ? 18.560  4.857   -23.253 1.00 0.00 ? 6  SER A HG   1  
ATOM 59    N N    . GLY A 1 7  ? 19.565  3.628   -20.694 1.00 0.00 ? 7  GLY A N    1  
ATOM 60    C CA   . GLY A 1 7  ? 19.065  2.507   -19.921 1.00 0.00 ? 7  GLY A CA   1  
ATOM 61    C C    . GLY A 1 7  ? 17.552  2.483   -19.846 1.00 0.00 ? 7  GLY A C    1  
ATOM 62    O O    . GLY A 1 7  ? 16.965  2.918   -18.856 1.00 0.00 ? 7  GLY A O    1  
ATOM 63    H H    . GLY A 1 7  ? 19.298  4.542   -20.458 1.00 0.00 ? 7  GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7  ? 19.407  1.589   -20.376 1.00 0.00 ? 7  GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7  ? 19.463  2.570   -18.919 1.00 0.00 ? 7  GLY A HA3  1  
ATOM 66    N N    . GLY A 1 8  ? 16.916  1.974   -20.897 1.00 0.00 ? 8  GLY A N    1  
ATOM 67    C CA   . GLY A 1 8  ? 15.467  1.906   -20.926 1.00 0.00 ? 8  GLY A CA   1  
ATOM 68    C C    . GLY A 1 8  ? 14.941  0.550   -20.499 1.00 0.00 ? 8  GLY A C    1  
ATOM 69    O O    . GLY A 1 8  ? 15.591  -0.472  -20.719 1.00 0.00 ? 8  GLY A O    1  
ATOM 70    H H    . GLY A 1 8  ? 17.436  1.641   -21.658 1.00 0.00 ? 8  GLY A H    1  
ATOM 71    H HA2  . GLY A 1 8  ? 15.068  2.660   -20.263 1.00 0.00 ? 8  GLY A HA2  1  
ATOM 72    H HA3  . GLY A 1 8  ? 15.128  2.110   -21.931 1.00 0.00 ? 8  GLY A HA3  1  
ATOM 73    N N    . GLU A 1 9  ? 13.761  0.540   -19.887 1.00 0.00 ? 9  GLU A N    1  
ATOM 74    C CA   . GLU A 1 9  ? 13.150  -0.701  -19.426 1.00 0.00 ? 9  GLU A CA   1  
ATOM 75    C C    . GLU A 1 9  ? 12.719  -1.566  -20.608 1.00 0.00 ? 9  GLU A C    1  
ATOM 76    O O    . GLU A 1 9  ? 12.273  -1.070  -21.643 1.00 0.00 ? 9  GLU A O    1  
ATOM 77    C CB   . GLU A 1 9  ? 11.945  -0.402  -18.533 1.00 0.00 ? 9  GLU A CB   1  
ATOM 78    C CG   . GLU A 1 9  ? 12.301  -0.238  -17.065 1.00 0.00 ? 9  GLU A CG   1  
ATOM 79    C CD   . GLU A 1 9  ? 13.407  0.776   -16.843 1.00 0.00 ? 9  GLU A CD   1  
ATOM 80    O OE1  . GLU A 1 9  ? 14.550  0.510   -17.273 1.00 0.00 ? 9  GLU A OE1  1  
ATOM 81    O OE2  . GLU A 1 9  ? 13.131  1.834   -16.240 1.00 0.00 ? 9  GLU A OE2  1  
ATOM 82    H H    . GLU A 1 9  ? 13.291  1.387   -19.741 1.00 0.00 ? 9  GLU A H    1  
ATOM 83    H HA   . GLU A 1 9  ? 13.888  -1.240  -18.851 1.00 0.00 ? 9  GLU A HA   1  
ATOM 84    H HB2  . GLU A 1 9  ? 11.477  0.510   -18.873 1.00 0.00 ? 9  GLU A HB2  1  
ATOM 85    H HB3  . GLU A 1 9  ? 11.237  -1.213  -18.621 1.00 0.00 ? 9  GLU A HB3  1  
ATOM 86    H HG2  . GLU A 1 9  ? 11.423  0.088   -16.528 1.00 0.00 ? 9  GLU A HG2  1  
ATOM 87    H HG3  . GLU A 1 9  ? 12.625  -1.192  -16.677 1.00 0.00 ? 9  GLU A HG3  1  
ATOM 88    N N    . PRO A 1 10 ? 12.855  -2.891  -20.451 1.00 0.00 ? 10 PRO A N    1  
ATOM 89    C CA   . PRO A 1 10 ? 12.486  -3.854  -21.493 1.00 0.00 ? 10 PRO A CA   1  
ATOM 90    C C    . PRO A 1 10 ? 10.977  -3.934  -21.699 1.00 0.00 ? 10 PRO A C    1  
ATOM 91    O O    . PRO A 1 10 ? 10.506  -4.425  -22.724 1.00 0.00 ? 10 PRO A O    1  
ATOM 92    C CB   . PRO A 1 10 ? 13.023  -5.182  -20.956 1.00 0.00 ? 10 PRO A CB   1  
ATOM 93    C CG   . PRO A 1 10 ? 13.065  -5.004  -19.477 1.00 0.00 ? 10 PRO A CG   1  
ATOM 94    C CD   . PRO A 1 10 ? 13.379  -3.552  -19.244 1.00 0.00 ? 10 PRO A CD   1  
ATOM 95    H HA   . PRO A 1 10 ? 12.965  -3.624  -22.433 1.00 0.00 ? 10 PRO A HA   1  
ATOM 96    H HB2  . PRO A 1 10 ? 12.357  -5.985  -21.239 1.00 0.00 ? 10 PRO A HB2  1  
ATOM 97    H HB3  . PRO A 1 10 ? 14.008  -5.366  -21.359 1.00 0.00 ? 10 PRO A HB3  1  
ATOM 98    H HG2  . PRO A 1 10 ? 12.105  -5.253  -19.050 1.00 0.00 ? 10 PRO A HG2  1  
ATOM 99    H HG3  . PRO A 1 10 ? 13.839  -5.627  -19.054 1.00 0.00 ? 10 PRO A HG3  1  
ATOM 100   H HD2  . PRO A 1 10 ? 12.875  -3.194  -18.358 1.00 0.00 ? 10 PRO A HD2  1  
ATOM 101   H HD3  . PRO A 1 10 ? 14.446  -3.406  -19.158 1.00 0.00 ? 10 PRO A HD3  1  
ATOM 102   N N    . GLY A 1 11 ? 10.223  -3.448  -20.718 1.00 0.00 ? 11 GLY A N    1  
ATOM 103   C CA   . GLY A 1 11 ? 8.775   -3.474  -20.812 1.00 0.00 ? 11 GLY A CA   1  
ATOM 104   C C    . GLY A 1 11 ? 8.105   -3.467  -19.452 1.00 0.00 ? 11 GLY A C    1  
ATOM 105   O O    . GLY A 1 11 ? 8.376   -4.326  -18.613 1.00 0.00 ? 11 GLY A O    1  
ATOM 106   H H    . GLY A 1 11 ? 10.654  -3.068  -19.923 1.00 0.00 ? 11 GLY A H    1  
ATOM 107   H HA2  . GLY A 1 11 ? 8.446   -2.610  -21.369 1.00 0.00 ? 11 GLY A HA2  1  
ATOM 108   H HA3  . GLY A 1 11 ? 8.476   -4.367  -21.342 1.00 0.00 ? 11 GLY A HA3  1  
ATOM 109   N N    . THR A 1 12 ? 7.228   -2.492  -19.231 1.00 0.00 ? 12 THR A N    1  
ATOM 110   C CA   . THR A 1 12 ? 6.520   -2.375  -17.963 1.00 0.00 ? 12 THR A CA   1  
ATOM 111   C C    . THR A 1 12 ? 5.013   -2.303  -18.179 1.00 0.00 ? 12 THR A C    1  
ATOM 112   O O    . THR A 1 12 ? 4.545   -2.107  -19.301 1.00 0.00 ? 12 THR A O    1  
ATOM 113   C CB   . THR A 1 12 ? 6.975   -1.129  -17.179 1.00 0.00 ? 12 THR A CB   1  
ATOM 114   O OG1  . THR A 1 12 ? 6.902   0.030   -18.017 1.00 0.00 ? 12 THR A OG1  1  
ATOM 115   C CG2  . THR A 1 12 ? 8.396   -1.301  -16.666 1.00 0.00 ? 12 THR A CG2  1  
ATOM 116   H H    . THR A 1 12 ? 7.055   -1.838  -19.939 1.00 0.00 ? 12 THR A H    1  
ATOM 117   H HA   . THR A 1 12 ? 6.748   -3.249  -17.371 1.00 0.00 ? 12 THR A HA   1  
ATOM 118   H HB   . THR A 1 12 ? 6.316   -0.994  -16.333 1.00 0.00 ? 12 THR A HB   1  
ATOM 119   H HG1  . THR A 1 12 ? 7.310   -0.161  -18.865 1.00 0.00 ? 12 THR A HG1  1  
ATOM 120   H HG21 . THR A 1 12 ? 8.418   -2.084  -15.922 1.00 0.00 ? 12 THR A HG21 1  
ATOM 121   H HG22 . THR A 1 12 ? 8.734   -0.376  -16.225 1.00 0.00 ? 12 THR A HG22 1  
ATOM 122   H HG23 . THR A 1 12 ? 9.045   -1.567  -17.487 1.00 0.00 ? 12 THR A HG23 1  
ATOM 123   N N    . LYS A 1 13 ? 4.256   -2.461  -17.099 1.00 0.00 ? 13 LYS A N    1  
ATOM 124   C CA   . LYS A 1 13 ? 2.801   -2.412  -17.169 1.00 0.00 ? 13 LYS A CA   1  
ATOM 125   C C    . LYS A 1 13 ? 2.207   -1.951  -15.841 1.00 0.00 ? 13 LYS A C    1  
ATOM 126   O O    . LYS A 1 13 ? 2.800   -2.153  -14.782 1.00 0.00 ? 13 LYS A O    1  
ATOM 127   C CB   . LYS A 1 13 ? 2.241   -3.787  -17.540 1.00 0.00 ? 13 LYS A CB   1  
ATOM 128   C CG   . LYS A 1 13 ? 2.419   -4.831  -16.451 1.00 0.00 ? 13 LYS A CG   1  
ATOM 129   C CD   . LYS A 1 13 ? 3.804   -5.454  -16.496 1.00 0.00 ? 13 LYS A CD   1  
ATOM 130   C CE   . LYS A 1 13 ? 3.853   -6.760  -15.718 1.00 0.00 ? 13 LYS A CE   1  
ATOM 131   N NZ   . LYS A 1 13 ? 5.231   -7.074  -15.249 1.00 0.00 ? 13 LYS A NZ   1  
ATOM 132   H H    . LYS A 1 13 ? 4.688   -2.614  -16.231 1.00 0.00 ? 13 LYS A H    1  
ATOM 133   H HA   . LYS A 1 13 ? 2.529   -1.703  -17.936 1.00 0.00 ? 13 LYS A HA   1  
ATOM 134   H HB2  . LYS A 1 13 ? 1.186   -3.689  -17.747 1.00 0.00 ? 13 LYS A HB2  1  
ATOM 135   H HB3  . LYS A 1 13 ? 2.743   -4.138  -18.431 1.00 0.00 ? 13 LYS A HB3  1  
ATOM 136   H HG2  . LYS A 1 13 ? 2.279   -4.361  -15.489 1.00 0.00 ? 13 LYS A HG2  1  
ATOM 137   H HG3  . LYS A 1 13 ? 1.680   -5.608  -16.585 1.00 0.00 ? 13 LYS A HG3  1  
ATOM 138   H HD2  . LYS A 1 13 ? 4.067   -5.651  -17.525 1.00 0.00 ? 13 LYS A HD2  1  
ATOM 139   H HD3  . LYS A 1 13 ? 4.515   -4.762  -16.067 1.00 0.00 ? 13 LYS A HD3  1  
ATOM 140   H HE2  . LYS A 1 13 ? 3.201   -6.679  -14.863 1.00 0.00 ? 13 LYS A HE2  1  
ATOM 141   H HE3  . LYS A 1 13 ? 3.510   -7.558  -16.359 1.00 0.00 ? 13 LYS A HE3  1  
ATOM 142   H HZ1  . LYS A 1 13 ? 5.792   -6.201  -15.176 1.00 0.00 ? 13 LYS A HZ1  1  
ATOM 143   H HZ2  . LYS A 1 13 ? 5.699   -7.717  -15.919 1.00 0.00 ? 13 LYS A HZ2  1  
ATOM 144   H HZ3  . LYS A 1 13 ? 5.196   -7.529  -14.315 1.00 0.00 ? 13 LYS A HZ3  1  
ATOM 145   N N    . ALA A 1 14 ? 1.032   -1.333  -15.907 1.00 0.00 ? 14 ALA A N    1  
ATOM 146   C CA   . ALA A 1 14 ? 0.357   -0.847  -14.710 1.00 0.00 ? 14 ALA A CA   1  
ATOM 147   C C    . ALA A 1 14 ? -1.098  -1.300  -14.678 1.00 0.00 ? 14 ALA A C    1  
ATOM 148   O O    . ALA A 1 14 ? -1.784  -1.292  -15.701 1.00 0.00 ? 14 ALA A O    1  
ATOM 149   C CB   . ALA A 1 14 ? 0.442   0.670   -14.635 1.00 0.00 ? 14 ALA A CB   1  
ATOM 150   H H    . ALA A 1 14 ? 0.609   -1.202  -16.781 1.00 0.00 ? 14 ALA A H    1  
ATOM 151   H HA   . ALA A 1 14 ? 0.869   -1.255  -13.849 1.00 0.00 ? 14 ALA A HA   1  
ATOM 152   H HB1  . ALA A 1 14 ? -0.534  1.094   -14.824 1.00 0.00 ? 14 ALA A HB1  1  
ATOM 153   H HB2  . ALA A 1 14 ? 0.778   0.963   -13.652 1.00 0.00 ? 14 ALA A HB2  1  
ATOM 154   H HB3  . ALA A 1 14 ? 1.140   1.028   -15.376 1.00 0.00 ? 14 ALA A HB3  1  
ATOM 155   N N    . LYS A 1 15 ? -1.565  -1.695  -13.499 1.00 0.00 ? 15 LYS A N    1  
ATOM 156   C CA   . LYS A 1 15 ? -2.940  -2.151  -13.333 1.00 0.00 ? 15 LYS A CA   1  
ATOM 157   C C    . LYS A 1 15 ? -3.711  -1.227  -12.396 1.00 0.00 ? 15 LYS A C    1  
ATOM 158   O O    . LYS A 1 15 ? -3.135  -0.625  -11.489 1.00 0.00 ? 15 LYS A O    1  
ATOM 159   C CB   . LYS A 1 15 ? -2.963  -3.582  -12.789 1.00 0.00 ? 15 LYS A CB   1  
ATOM 160   C CG   . LYS A 1 15 ? -2.264  -3.734  -11.449 1.00 0.00 ? 15 LYS A CG   1  
ATOM 161   C CD   . LYS A 1 15 ? -2.588  -5.069  -10.800 1.00 0.00 ? 15 LYS A CD   1  
ATOM 162   C CE   . LYS A 1 15 ? -1.879  -6.217  -11.502 1.00 0.00 ? 15 LYS A CE   1  
ATOM 163   N NZ   . LYS A 1 15 ? -0.406  -6.168  -11.295 1.00 0.00 ? 15 LYS A NZ   1  
ATOM 164   H H    . LYS A 1 15 ? -0.970  -1.679  -12.720 1.00 0.00 ? 15 LYS A H    1  
ATOM 165   H HA   . LYS A 1 15 ? -3.414  -2.137  -14.303 1.00 0.00 ? 15 LYS A HA   1  
ATOM 166   H HB2  . LYS A 1 15 ? -3.990  -3.894  -12.674 1.00 0.00 ? 15 LYS A HB2  1  
ATOM 167   H HB3  . LYS A 1 15 ? -2.476  -4.233  -13.501 1.00 0.00 ? 15 LYS A HB3  1  
ATOM 168   H HG2  . LYS A 1 15 ? -1.197  -3.669  -11.600 1.00 0.00 ? 15 LYS A HG2  1  
ATOM 169   H HG3  . LYS A 1 15 ? -2.586  -2.937  -10.793 1.00 0.00 ? 15 LYS A HG3  1  
ATOM 170   H HD2  . LYS A 1 15 ? -2.273  -5.044  -9.767  1.00 0.00 ? 15 LYS A HD2  1  
ATOM 171   H HD3  . LYS A 1 15 ? -3.656  -5.233  -10.848 1.00 0.00 ? 15 LYS A HD3  1  
ATOM 172   H HE2  . LYS A 1 15 ? -2.259  -7.149  -11.112 1.00 0.00 ? 15 LYS A HE2  1  
ATOM 173   H HE3  . LYS A 1 15 ? -2.088  -6.158  -12.560 1.00 0.00 ? 15 LYS A HE3  1  
ATOM 174   H HZ1  . LYS A 1 15 ? -0.155  -5.350  -10.704 1.00 0.00 ? 15 LYS A HZ1  1  
ATOM 175   H HZ2  . LYS A 1 15 ? 0.081   -6.082  -12.210 1.00 0.00 ? 15 LYS A HZ2  1  
ATOM 176   H HZ3  . LYS A 1 15 ? -0.082  -7.036  -10.822 1.00 0.00 ? 15 LYS A HZ3  1  
ATOM 177   N N    . LYS A 1 16 ? -5.016  -1.121  -12.619 1.00 0.00 ? 16 LYS A N    1  
ATOM 178   C CA   . LYS A 1 16 ? -5.867  -0.273  -11.792 1.00 0.00 ? 16 LYS A CA   1  
ATOM 179   C C    . LYS A 1 16 ? -7.000  -1.082  -11.169 1.00 0.00 ? 16 LYS A C    1  
ATOM 180   O O    . LYS A 1 16 ? -7.647  -1.883  -11.842 1.00 0.00 ? 16 LYS A O    1  
ATOM 181   C CB   . LYS A 1 16 ? -6.444  0.873   -12.627 1.00 0.00 ? 16 LYS A CB   1  
ATOM 182   C CG   . LYS A 1 16 ? -7.190  1.909   -11.804 1.00 0.00 ? 16 LYS A CG   1  
ATOM 183   C CD   . LYS A 1 16 ? -8.028  2.821   -12.683 1.00 0.00 ? 16 LYS A CD   1  
ATOM 184   C CE   . LYS A 1 16 ? -7.158  3.776   -13.486 1.00 0.00 ? 16 LYS A CE   1  
ATOM 185   N NZ   . LYS A 1 16 ? -7.973  4.772   -14.236 1.00 0.00 ? 16 LYS A NZ   1  
ATOM 186   H H    . LYS A 1 16 ? -5.418  -1.626  -13.357 1.00 0.00 ? 16 LYS A H    1  
ATOM 187   H HA   . LYS A 1 16 ? -5.258  0.139   -11.002 1.00 0.00 ? 16 LYS A HA   1  
ATOM 188   H HB2  . LYS A 1 16 ? -5.635  1.369   -13.143 1.00 0.00 ? 16 LYS A HB2  1  
ATOM 189   H HB3  . LYS A 1 16 ? -7.127  0.463   -13.356 1.00 0.00 ? 16 LYS A HB3  1  
ATOM 190   H HG2  . LYS A 1 16 ? -7.840  1.402   -11.107 1.00 0.00 ? 16 LYS A HG2  1  
ATOM 191   H HG3  . LYS A 1 16 ? -6.473  2.508   -11.260 1.00 0.00 ? 16 LYS A HG3  1  
ATOM 192   H HD2  . LYS A 1 16 ? -8.606  2.217   -13.367 1.00 0.00 ? 16 LYS A HD2  1  
ATOM 193   H HD3  . LYS A 1 16 ? -8.696  3.396   -12.057 1.00 0.00 ? 16 LYS A HD3  1  
ATOM 194   H HE2  . LYS A 1 16 ? -6.500  4.299   -12.808 1.00 0.00 ? 16 LYS A HE2  1  
ATOM 195   H HE3  . LYS A 1 16 ? -6.571  3.203   -14.187 1.00 0.00 ? 16 LYS A HE3  1  
ATOM 196   H HZ1  . LYS A 1 16 ? -8.936  4.407   -14.384 1.00 0.00 ? 16 LYS A HZ1  1  
ATOM 197   H HZ2  . LYS A 1 16 ? -7.541  4.963   -15.162 1.00 0.00 ? 16 LYS A HZ2  1  
ATOM 198   H HZ3  . LYS A 1 16 ? -8.030  5.662   -13.701 1.00 0.00 ? 16 LYS A HZ3  1  
ATOM 199   N N    . GLY A 1 17 ? -7.236  -0.865  -9.878  1.00 0.00 ? 17 GLY A N    1  
ATOM 200   C CA   . GLY A 1 17 ? -8.292  -1.580  -9.187  1.00 0.00 ? 17 GLY A CA   1  
ATOM 201   C C    . GLY A 1 17 ? -9.314  -0.648  -8.566  1.00 0.00 ? 17 GLY A C    1  
ATOM 202   O O    . GLY A 1 17 ? -9.699  -0.820  -7.410  1.00 0.00 ? 17 GLY A O    1  
ATOM 203   H H    . GLY A 1 17 ? -6.688  -0.214  -9.392  1.00 0.00 ? 17 GLY A H    1  
ATOM 204   H HA2  . GLY A 1 17 ? -8.793  -2.229  -9.890  1.00 0.00 ? 17 GLY A HA2  1  
ATOM 205   H HA3  . GLY A 1 17 ? -7.852  -2.183  -8.406  1.00 0.00 ? 17 GLY A HA3  1  
ATOM 206   N N    . ARG A 1 18 ? -9.752  0.343   -9.336  1.00 0.00 ? 18 ARG A N    1  
ATOM 207   C CA   . ARG A 1 18 ? -10.733 1.308   -8.853  1.00 0.00 ? 18 ARG A CA   1  
ATOM 208   C C    . ARG A 1 18 ? -12.075 0.632   -8.588  1.00 0.00 ? 18 ARG A C    1  
ATOM 209   O O    . ARG A 1 18 ? -12.996 0.717   -9.402  1.00 0.00 ? 18 ARG A O    1  
ATOM 210   C CB   . ARG A 1 18 ? -10.911 2.438   -9.869  1.00 0.00 ? 18 ARG A CB   1  
ATOM 211   C CG   . ARG A 1 18 ? -11.680 3.631   -9.325  1.00 0.00 ? 18 ARG A CG   1  
ATOM 212   C CD   . ARG A 1 18 ? -10.797 4.513   -8.456  1.00 0.00 ? 18 ARG A CD   1  
ATOM 213   N NE   . ARG A 1 18 ? -11.568 5.231   -7.444  1.00 0.00 ? 18 ARG A NE   1  
ATOM 214   C CZ   . ARG A 1 18 ? -11.040 6.123   -6.614  1.00 0.00 ? 18 ARG A CZ   1  
ATOM 215   N NH1  . ARG A 1 18 ? -9.747  6.407   -6.676  1.00 0.00 ? 18 ARG A NH1  1  
ATOM 216   N NH2  . ARG A 1 18 ? -11.807 6.735   -5.721  1.00 0.00 ? 18 ARG A NH2  1  
ATOM 217   H H    . ARG A 1 18 ? -9.408  0.428   -10.249 1.00 0.00 ? 18 ARG A H    1  
ATOM 218   H HA   . ARG A 1 18 ? -10.363 1.723   -7.928  1.00 0.00 ? 18 ARG A HA   1  
ATOM 219   H HB2  . ARG A 1 18 ? -9.936  2.780   -10.184 1.00 0.00 ? 18 ARG A HB2  1  
ATOM 220   H HB3  . ARG A 1 18 ? -11.443 2.054   -10.726 1.00 0.00 ? 18 ARG A HB3  1  
ATOM 221   H HG2  . ARG A 1 18 ? -12.050 4.216   -10.153 1.00 0.00 ? 18 ARG A HG2  1  
ATOM 222   H HG3  . ARG A 1 18 ? -12.510 3.273   -8.735  1.00 0.00 ? 18 ARG A HG3  1  
ATOM 223   H HD2  . ARG A 1 18 ? -10.065 3.891   -7.962  1.00 0.00 ? 18 ARG A HD2  1  
ATOM 224   H HD3  . ARG A 1 18 ? -10.294 5.229   -9.088  1.00 0.00 ? 18 ARG A HD3  1  
ATOM 225   H HE   . ARG A 1 18 ? -12.526 5.036   -7.381  1.00 0.00 ? 18 ARG A HE   1  
ATOM 226   H HH11 . ARG A 1 18 ? -9.167  5.948   -7.349  1.00 0.00 ? 18 ARG A HH11 1  
ATOM 227   H HH12 . ARG A 1 18 ? -9.352  7.080   -6.051  1.00 0.00 ? 18 ARG A HH12 1  
ATOM 228   H HH21 . ARG A 1 18 ? -12.783 6.524   -5.672  1.00 0.00 ? 18 ARG A HH21 1  
ATOM 229   H HH22 . ARG A 1 18 ? -11.409 7.407   -5.097  1.00 0.00 ? 18 ARG A HH22 1  
ATOM 230   N N    . ARG A 1 19 ? -12.179 -0.039  -7.446  1.00 0.00 ? 19 ARG A N    1  
ATOM 231   C CA   . ARG A 1 19 ? -13.408 -0.730  -7.074  1.00 0.00 ? 19 ARG A CA   1  
ATOM 232   C C    . ARG A 1 19 ? -13.896 -0.272  -5.704  1.00 0.00 ? 19 ARG A C    1  
ATOM 233   O O    . ARG A 1 19 ? -13.166 -0.346  -4.716  1.00 0.00 ? 19 ARG A O    1  
ATOM 234   C CB   . ARG A 1 19 ? -13.184 -2.244  -7.068  1.00 0.00 ? 19 ARG A CB   1  
ATOM 235   C CG   . ARG A 1 19 ? -13.214 -2.869  -8.453  1.00 0.00 ? 19 ARG A CG   1  
ATOM 236   C CD   . ARG A 1 19 ? -13.080 -4.382  -8.384  1.00 0.00 ? 19 ARG A CD   1  
ATOM 237   N NE   . ARG A 1 19 ? -11.713 -4.798  -8.078  1.00 0.00 ? 19 ARG A NE   1  
ATOM 238   C CZ   . ARG A 1 19 ? -11.325 -6.067  -8.027  1.00 0.00 ? 19 ARG A CZ   1  
ATOM 239   N NH1  . ARG A 1 19 ? -12.195 -7.040  -8.259  1.00 0.00 ? 19 ARG A NH1  1  
ATOM 240   N NH2  . ARG A 1 19 ? -10.064 -6.365  -7.742  1.00 0.00 ? 19 ARG A NH2  1  
ATOM 241   H H    . ARG A 1 19 ? -11.411 -0.070  -6.838  1.00 0.00 ? 19 ARG A H    1  
ATOM 242   H HA   . ARG A 1 19 ? -14.160 -0.489  -7.811  1.00 0.00 ? 19 ARG A HA   1  
ATOM 243   H HB2  . ARG A 1 19 ? -12.222 -2.452  -6.624  1.00 0.00 ? 19 ARG A HB2  1  
ATOM 244   H HB3  . ARG A 1 19 ? -13.956 -2.706  -6.471  1.00 0.00 ? 19 ARG A HB3  1  
ATOM 245   H HG2  . ARG A 1 19 ? -14.152 -2.624  -8.929  1.00 0.00 ? 19 ARG A HG2  1  
ATOM 246   H HG3  . ARG A 1 19 ? -12.397 -2.470  -9.035  1.00 0.00 ? 19 ARG A HG3  1  
ATOM 247   H HD2  . ARG A 1 19 ? -13.739 -4.754  -7.613  1.00 0.00 ? 19 ARG A HD2  1  
ATOM 248   H HD3  . ARG A 1 19 ? -13.369 -4.800  -9.336  1.00 0.00 ? 19 ARG A HD3  1  
ATOM 249   H HE   . ARG A 1 19 ? -11.054 -4.095  -7.903  1.00 0.00 ? 19 ARG A HE   1  
ATOM 250   H HH11 . ARG A 1 19 ? -13.146 -6.818  -8.474  1.00 0.00 ? 19 ARG A HH11 1  
ATOM 251   H HH12 . ARG A 1 19 ? -11.900 -7.995  -8.220  1.00 0.00 ? 19 ARG A HH12 1  
ATOM 252   H HH21 . ARG A 1 19 ? -9.405  -5.634  -7.567  1.00 0.00 ? 19 ARG A HH21 1  
ATOM 253   H HH22 . ARG A 1 19 ? -9.772  -7.320  -7.703  1.00 0.00 ? 19 ARG A HH22 1  
ATOM 254   N N    . SER A 1 20 ? -15.137 0.203   -5.652  1.00 0.00 ? 20 SER A N    1  
ATOM 255   C CA   . SER A 1 20 ? -15.722 0.678   -4.403  1.00 0.00 ? 20 SER A CA   1  
ATOM 256   C C    . SER A 1 20 ? -16.428 -0.457  -3.668  1.00 0.00 ? 20 SER A C    1  
ATOM 257   O O    . SER A 1 20 ? -17.582 -0.325  -3.261  1.00 0.00 ? 20 SER A O    1  
ATOM 258   C CB   . SER A 1 20 ? -16.709 1.815   -4.678  1.00 0.00 ? 20 SER A CB   1  
ATOM 259   O OG   . SER A 1 20 ? -17.754 1.387   -5.533  1.00 0.00 ? 20 SER A OG   1  
ATOM 260   H H    . SER A 1 20 ? -15.670 0.237   -6.474  1.00 0.00 ? 20 SER A H    1  
ATOM 261   H HA   . SER A 1 20 ? -14.921 1.050   -3.782  1.00 0.00 ? 20 SER A HA   1  
ATOM 262   H HB2  . SER A 1 20 ? -17.137 2.149   -3.745  1.00 0.00 ? 20 SER A HB2  1  
ATOM 263   H HB3  . SER A 1 20 ? -16.187 2.635   -5.149  1.00 0.00 ? 20 SER A HB3  1  
ATOM 264   H HG   . SER A 1 20 ? -17.940 2.072   -6.179  1.00 0.00 ? 20 SER A HG   1  
ATOM 265   N N    . ARG A 1 21 ? -15.725 -1.573  -3.502  1.00 0.00 ? 21 ARG A N    1  
ATOM 266   C CA   . ARG A 1 21 ? -16.284 -2.732  -2.817  1.00 0.00 ? 21 ARG A CA   1  
ATOM 267   C C    . ARG A 1 21 ? -15.519 -3.024  -1.529  1.00 0.00 ? 21 ARG A C    1  
ATOM 268   O O    . ARG A 1 21 ? -16.104 -3.087  -0.447  1.00 0.00 ? 21 ARG A O    1  
ATOM 269   C CB   . ARG A 1 21 ? -16.248 -3.958  -3.732  1.00 0.00 ? 21 ARG A CB   1  
ATOM 270   C CG   . ARG A 1 21 ? -17.344 -3.963  -4.786  1.00 0.00 ? 21 ARG A CG   1  
ATOM 271   C CD   . ARG A 1 21 ? -17.655 -5.374  -5.259  1.00 0.00 ? 21 ARG A CD   1  
ATOM 272   N NE   . ARG A 1 21 ? -16.548 -5.954  -6.015  1.00 0.00 ? 21 ARG A NE   1  
ATOM 273   C CZ   . ARG A 1 21 ? -16.556 -7.193  -6.495  1.00 0.00 ? 21 ARG A CZ   1  
ATOM 274   N NH1  . ARG A 1 21 ? -17.607 -7.976  -6.300  1.00 0.00 ? 21 ARG A NH1  1  
ATOM 275   N NH2  . ARG A 1 21 ? -15.510 -7.649  -7.173  1.00 0.00 ? 21 ARG A NH2  1  
ATOM 276   H H    . ARG A 1 21 ? -14.810 -1.618  -3.848  1.00 0.00 ? 21 ARG A H    1  
ATOM 277   H HA   . ARG A 1 21 ? -17.311 -2.509  -2.569  1.00 0.00 ? 21 ARG A HA   1  
ATOM 278   H HB2  . ARG A 1 21 ? -15.294 -3.989  -4.236  1.00 0.00 ? 21 ARG A HB2  1  
ATOM 279   H HB3  . ARG A 1 21 ? -16.356 -4.846  -3.128  1.00 0.00 ? 21 ARG A HB3  1  
ATOM 280   H HG2  . ARG A 1 21 ? -18.239 -3.531  -4.364  1.00 0.00 ? 21 ARG A HG2  1  
ATOM 281   H HG3  . ARG A 1 21 ? -17.020 -3.372  -5.630  1.00 0.00 ? 21 ARG A HG3  1  
ATOM 282   H HD2  . ARG A 1 21 ? -17.853 -5.993  -4.397  1.00 0.00 ? 21 ARG A HD2  1  
ATOM 283   H HD3  . ARG A 1 21 ? -18.531 -5.342  -5.889  1.00 0.00 ? 21 ARG A HD3  1  
ATOM 284   H HE   . ARG A 1 21 ? -15.761 -5.392  -6.170  1.00 0.00 ? 21 ARG A HE   1  
ATOM 285   H HH11 . ARG A 1 21 ? -18.397 -7.635  -5.791  1.00 0.00 ? 21 ARG A HH11 1  
ATOM 286   H HH12 . ARG A 1 21 ? -17.611 -8.908  -6.664  1.00 0.00 ? 21 ARG A HH12 1  
ATOM 287   H HH21 . ARG A 1 21 ? -14.716 -7.061  -7.322  1.00 0.00 ? 21 ARG A HH21 1  
ATOM 288   H HH22 . ARG A 1 21 ? -15.517 -8.581  -7.534  1.00 0.00 ? 21 ARG A HH22 1  
ATOM 289   N N    . THR A 1 22 ? -14.207 -3.202  -1.653  1.00 0.00 ? 22 THR A N    1  
ATOM 290   C CA   . THR A 1 22 ? -13.362 -3.488  -0.500  1.00 0.00 ? 22 THR A CA   1  
ATOM 291   C C    . THR A 1 22 ? -13.651 -2.525  0.646   1.00 0.00 ? 22 THR A C    1  
ATOM 292   O O    . THR A 1 22 ? -13.589 -1.307  0.478   1.00 0.00 ? 22 THR A O    1  
ATOM 293   C CB   . THR A 1 22 ? -11.868 -3.402  -0.864  1.00 0.00 ? 22 THR A CB   1  
ATOM 294   O OG1  . THR A 1 22 ? -11.558 -2.092  -1.353  1.00 0.00 ? 22 THR A OG1  1  
ATOM 295   C CG2  . THR A 1 22 ? -11.506 -4.440  -1.915  1.00 0.00 ? 22 THR A CG2  1  
ATOM 296   H H    . THR A 1 22 ? -13.800 -3.139  -2.542  1.00 0.00 ? 22 THR A H    1  
ATOM 297   H HA   . THR A 1 22 ? -13.574 -4.496  -0.174  1.00 0.00 ? 22 THR A HA   1  
ATOM 298   H HB   . THR A 1 22 ? -11.285 -3.593  0.026   1.00 0.00 ? 22 THR A HB   1  
ATOM 299   H HG1  . THR A 1 22 ? -12.301 -1.754  -1.858  1.00 0.00 ? 22 THR A HG1  1  
ATOM 300   H HG21 . THR A 1 22 ? -11.046 -3.951  -2.761  1.00 0.00 ? 22 THR A HG21 1  
ATOM 301   H HG22 . THR A 1 22 ? -12.400 -4.953  -2.237  1.00 0.00 ? 22 THR A HG22 1  
ATOM 302   H HG23 . THR A 1 22 ? -10.814 -5.153  -1.492  1.00 0.00 ? 22 THR A HG23 1  
ATOM 303   N N    . VAL A 1 23 ? -13.967 -3.079  1.812   1.00 0.00 ? 23 VAL A N    1  
ATOM 304   C CA   . VAL A 1 23 ? -14.264 -2.269  2.988   1.00 0.00 ? 23 VAL A CA   1  
ATOM 305   C C    . VAL A 1 23 ? -13.447 -2.726  4.191   1.00 0.00 ? 23 VAL A C    1  
ATOM 306   O O    . VAL A 1 23 ? -13.322 -3.923  4.451   1.00 0.00 ? 23 VAL A O    1  
ATOM 307   C CB   . VAL A 1 23 ? -15.761 -2.327  3.346   1.00 0.00 ? 23 VAL A CB   1  
ATOM 308   C CG1  . VAL A 1 23 ? -16.590 -1.602  2.295   1.00 0.00 ? 23 VAL A CG1  1  
ATOM 309   C CG2  . VAL A 1 23 ? -16.218 -3.770  3.494   1.00 0.00 ? 23 VAL A CG2  1  
ATOM 310   H H    . VAL A 1 23 ? -14.001 -4.056  1.884   1.00 0.00 ? 23 VAL A H    1  
ATOM 311   H HA   . VAL A 1 23 ? -14.009 -1.244  2.760   1.00 0.00 ? 23 VAL A HA   1  
ATOM 312   H HB   . VAL A 1 23 ? -15.904 -1.827  4.292   1.00 0.00 ? 23 VAL A HB   1  
ATOM 313   H HG11 . VAL A 1 23 ? -17.432 -2.217  2.015   1.00 0.00 ? 23 VAL A HG11 1  
ATOM 314   H HG12 . VAL A 1 23 ? -16.945 -0.666  2.700   1.00 0.00 ? 23 VAL A HG12 1  
ATOM 315   H HG13 . VAL A 1 23 ? -15.979 -1.411  1.425   1.00 0.00 ? 23 VAL A HG13 1  
ATOM 316   H HG21 . VAL A 1 23 ? -15.941 -4.135  4.472   1.00 0.00 ? 23 VAL A HG21 1  
ATOM 317   H HG22 . VAL A 1 23 ? -17.291 -3.822  3.381   1.00 0.00 ? 23 VAL A HG22 1  
ATOM 318   H HG23 . VAL A 1 23 ? -15.746 -4.377  2.736   1.00 0.00 ? 23 VAL A HG23 1  
ATOM 319   N N    . PHE A 1 24 ? -12.893 -1.765  4.923   1.00 0.00 ? 24 PHE A N    1  
ATOM 320   C CA   . PHE A 1 24 ? -12.087 -2.069  6.099   1.00 0.00 ? 24 PHE A CA   1  
ATOM 321   C C    . PHE A 1 24 ? -12.773 -1.577  7.370   1.00 0.00 ? 24 PHE A C    1  
ATOM 322   O O    . PHE A 1 24 ? -13.338 -0.483  7.402   1.00 0.00 ? 24 PHE A O    1  
ATOM 323   C CB   . PHE A 1 24 ? -10.702 -1.431  5.974   1.00 0.00 ? 24 PHE A CB   1  
ATOM 324   C CG   . PHE A 1 24 ? -9.866  -2.024  4.876   1.00 0.00 ? 24 PHE A CG   1  
ATOM 325   C CD1  . PHE A 1 24 ? -9.160  -3.198  5.083   1.00 0.00 ? 24 PHE A CD1  1  
ATOM 326   C CD2  . PHE A 1 24 ? -9.786  -1.409  3.638   1.00 0.00 ? 24 PHE A CD2  1  
ATOM 327   C CE1  . PHE A 1 24 ? -8.389  -3.746  4.076   1.00 0.00 ? 24 PHE A CE1  1  
ATOM 328   C CE2  . PHE A 1 24 ? -9.017  -1.952  2.626   1.00 0.00 ? 24 PHE A CE2  1  
ATOM 329   C CZ   . PHE A 1 24 ? -8.319  -3.123  2.845   1.00 0.00 ? 24 PHE A CZ   1  
ATOM 330   H H    . PHE A 1 24 ? -13.029 -0.830  4.665   1.00 0.00 ? 24 PHE A H    1  
ATOM 331   H HA   . PHE A 1 24 ? -11.976 -3.141  6.157   1.00 0.00 ? 24 PHE A HA   1  
ATOM 332   H HB2  . PHE A 1 24 ? -10.817 -0.377  5.770   1.00 0.00 ? 24 PHE A HB2  1  
ATOM 333   H HB3  . PHE A 1 24 ? -10.170 -1.558  6.904   1.00 0.00 ? 24 PHE A HB3  1  
ATOM 334   H HD1  . PHE A 1 24 ? -9.214  -3.688  6.045   1.00 0.00 ? 24 PHE A HD1  1  
ATOM 335   H HD2  . PHE A 1 24 ? -10.333 -0.493  3.465   1.00 0.00 ? 24 PHE A HD2  1  
ATOM 336   H HE1  . PHE A 1 24 ? -7.843  -4.662  4.249   1.00 0.00 ? 24 PHE A HE1  1  
ATOM 337   H HE2  . PHE A 1 24 ? -8.965  -1.463  1.665   1.00 0.00 ? 24 PHE A HE2  1  
ATOM 338   H HZ   . PHE A 1 24 ? -7.717  -3.549  2.056   1.00 0.00 ? 24 PHE A HZ   1  
ATOM 339   N N    . THR A 1 25 ? -12.720 -2.393  8.419   1.00 0.00 ? 25 THR A N    1  
ATOM 340   C CA   . THR A 1 25 ? -13.337 -2.043  9.692   1.00 0.00 ? 25 THR A CA   1  
ATOM 341   C C    . THR A 1 25 ? -12.445 -1.103  10.495  1.00 0.00 ? 25 THR A C    1  
ATOM 342   O O    . THR A 1 25 ? -11.220 -1.208  10.451  1.00 0.00 ? 25 THR A O    1  
ATOM 343   C CB   . THR A 1 25 ? -13.633 -3.297  10.536  1.00 0.00 ? 25 THR A CB   1  
ATOM 344   O OG1  . THR A 1 25 ? -12.413 -3.981  10.842  1.00 0.00 ? 25 THR A OG1  1  
ATOM 345   C CG2  . THR A 1 25 ? -14.576 -4.235  9.798   1.00 0.00 ? 25 THR A CG2  1  
ATOM 346   H H    . THR A 1 25 ? -12.255 -3.251  8.332   1.00 0.00 ? 25 THR A H    1  
ATOM 347   H HA   . THR A 1 25 ? -14.273 -1.545  9.483   1.00 0.00 ? 25 THR A HA   1  
ATOM 348   H HB   . THR A 1 25 ? -14.105 -2.988  11.458  1.00 0.00 ? 25 THR A HB   1  
ATOM 349   H HG1  . THR A 1 25 ? -11.775 -3.826  10.142  1.00 0.00 ? 25 THR A HG1  1  
ATOM 350   H HG21 . THR A 1 25 ? -14.939 -3.751  8.904   1.00 0.00 ? 25 THR A HG21 1  
ATOM 351   H HG22 . THR A 1 25 ? -15.410 -4.484  10.437  1.00 0.00 ? 25 THR A HG22 1  
ATOM 352   H HG23 . THR A 1 25 ? -14.047 -5.137  9.529   1.00 0.00 ? 25 THR A HG23 1  
ATOM 353   N N    . GLU A 1 26 ? -13.068 -0.185  11.227  1.00 0.00 ? 26 GLU A N    1  
ATOM 354   C CA   . GLU A 1 26 ? -12.329 0.774   12.040  1.00 0.00 ? 26 GLU A CA   1  
ATOM 355   C C    . GLU A 1 26 ? -11.101 0.121   12.669  1.00 0.00 ? 26 GLU A C    1  
ATOM 356   O O    . GLU A 1 26 ? -10.024 0.716   12.718  1.00 0.00 ? 26 GLU A O    1  
ATOM 357   C CB   . GLU A 1 26 ? -13.230 1.351   13.133  1.00 0.00 ? 26 GLU A CB   1  
ATOM 358   C CG   . GLU A 1 26 ? -14.208 2.398   12.626  1.00 0.00 ? 26 GLU A CG   1  
ATOM 359   C CD   . GLU A 1 26 ? -13.515 3.655   12.135  1.00 0.00 ? 26 GLU A CD   1  
ATOM 360   O OE1  . GLU A 1 26 ? -12.993 4.413   12.979  1.00 0.00 ? 26 GLU A OE1  1  
ATOM 361   O OE2  . GLU A 1 26 ? -13.495 3.879   10.907  1.00 0.00 ? 26 GLU A OE2  1  
ATOM 362   H H    . GLU A 1 26 ? -14.047 -0.151  11.220  1.00 0.00 ? 26 GLU A H    1  
ATOM 363   H HA   . GLU A 1 26 ? -12.004 1.575   11.394  1.00 0.00 ? 26 GLU A HA   1  
ATOM 364   H HB2  . GLU A 1 26 ? -13.795 0.547   13.580  1.00 0.00 ? 26 GLU A HB2  1  
ATOM 365   H HB3  . GLU A 1 26 ? -12.609 1.807   13.891  1.00 0.00 ? 26 GLU A HB3  1  
ATOM 366   H HG2  . GLU A 1 26 ? -14.775 1.977   11.810  1.00 0.00 ? 26 GLU A HG2  1  
ATOM 367   H HG3  . GLU A 1 26 ? -14.879 2.665   13.430  1.00 0.00 ? 26 GLU A HG3  1  
ATOM 368   N N    . LEU A 1 27 ? -11.272 -1.105  13.151  1.00 0.00 ? 27 LEU A N    1  
ATOM 369   C CA   . LEU A 1 27 ? -10.179 -1.840  13.778  1.00 0.00 ? 27 LEU A CA   1  
ATOM 370   C C    . LEU A 1 27 ? -9.083  -2.154  12.766  1.00 0.00 ? 27 LEU A C    1  
ATOM 371   O O    . LEU A 1 27 ? -7.918  -1.818  12.975  1.00 0.00 ? 27 LEU A O    1  
ATOM 372   C CB   . LEU A 1 27 ? -10.701 -3.135  14.402  1.00 0.00 ? 27 LEU A CB   1  
ATOM 373   C CG   . LEU A 1 27 ? -9.812  -3.772  15.470  1.00 0.00 ? 27 LEU A CG   1  
ATOM 374   C CD1  . LEU A 1 27 ? -10.083 -3.150  16.831  1.00 0.00 ? 27 LEU A CD1  1  
ATOM 375   C CD2  . LEU A 1 27 ? -10.030 -5.278  15.517  1.00 0.00 ? 27 LEU A CD2  1  
ATOM 376   H H    . LEU A 1 27 ? -12.154 -1.527  13.084  1.00 0.00 ? 27 LEU A H    1  
ATOM 377   H HA   . LEU A 1 27 ? -9.765  -1.216  14.557  1.00 0.00 ? 27 LEU A HA   1  
ATOM 378   H HB2  . LEU A 1 27 ? -11.659 -2.923  14.852  1.00 0.00 ? 27 LEU A HB2  1  
ATOM 379   H HB3  . LEU A 1 27 ? -10.832 -3.855  13.606  1.00 0.00 ? 27 LEU A HB3  1  
ATOM 380   H HG   . LEU A 1 27 ? -8.775  -3.591  15.221  1.00 0.00 ? 27 LEU A HG   1  
ATOM 381   H HD11 . LEU A 1 27 ? -9.159  -2.779  17.247  1.00 0.00 ? 27 LEU A HD11 1  
ATOM 382   H HD12 . LEU A 1 27 ? -10.502 -3.895  17.490  1.00 0.00 ? 27 LEU A HD12 1  
ATOM 383   H HD13 . LEU A 1 27 ? -10.782 -2.333  16.720  1.00 0.00 ? 27 LEU A HD13 1  
ATOM 384   H HD21 . LEU A 1 27 ? -9.093  -5.770  15.734  1.00 0.00 ? 27 LEU A HD21 1  
ATOM 385   H HD22 . LEU A 1 27 ? -10.402 -5.618  14.562  1.00 0.00 ? 27 LEU A HD22 1  
ATOM 386   H HD23 . LEU A 1 27 ? -10.748 -5.513  16.288  1.00 0.00 ? 27 LEU A HD23 1  
ATOM 387   N N    . GLN A 1 28 ? -9.465  -2.800  11.669  1.00 0.00 ? 28 GLN A N    1  
ATOM 388   C CA   . GLN A 1 28 ? -8.514  -3.159  10.623  1.00 0.00 ? 28 GLN A CA   1  
ATOM 389   C C    . GLN A 1 28 ? -7.739  -1.934  10.149  1.00 0.00 ? 28 GLN A C    1  
ATOM 390   O O    . GLN A 1 28 ? -6.508  -1.937  10.121  1.00 0.00 ? 28 GLN A O    1  
ATOM 391   C CB   . GLN A 1 28 ? -9.241  -3.805  9.443   1.00 0.00 ? 28 GLN A CB   1  
ATOM 392   C CG   . GLN A 1 28 ? -9.823  -5.173  9.762   1.00 0.00 ? 28 GLN A CG   1  
ATOM 393   C CD   . GLN A 1 28 ? -10.788 -5.660  8.699   1.00 0.00 ? 28 GLN A CD   1  
ATOM 394   O OE1  . GLN A 1 28 ? -11.349 -4.866  7.944   1.00 0.00 ? 28 GLN A OE1  1  
ATOM 395   N NE2  . GLN A 1 28 ? -10.986 -6.971  8.635   1.00 0.00 ? 28 GLN A NE2  1  
ATOM 396   H H    . GLN A 1 28 ? -10.408 -3.041  11.560  1.00 0.00 ? 28 GLN A H    1  
ATOM 397   H HA   . GLN A 1 28 ? -7.818  -3.871  11.039  1.00 0.00 ? 28 GLN A HA   1  
ATOM 398   H HB2  . GLN A 1 28 ? -10.048 -3.158  9.134   1.00 0.00 ? 28 GLN A HB2  1  
ATOM 399   H HB3  . GLN A 1 28 ? -8.546  -3.916  8.625   1.00 0.00 ? 28 GLN A HB3  1  
ATOM 400   H HG2  . GLN A 1 28 ? -9.014  -5.884  9.844   1.00 0.00 ? 28 GLN A HG2  1  
ATOM 401   H HG3  . GLN A 1 28 ? -10.347 -5.116  10.705  1.00 0.00 ? 28 GLN A HG3  1  
ATOM 402   H HE21 . GLN A 1 28 ? -10.505 -7.543  9.270   1.00 0.00 ? 28 GLN A HE21 1  
ATOM 403   H HE22 . GLN A 1 28 ? -11.605 -7.313  7.958   1.00 0.00 ? 28 GLN A HE22 1  
ATOM 404   N N    . LEU A 1 29 ? -8.468  -0.887  9.777   1.00 0.00 ? 29 LEU A N    1  
ATOM 405   C CA   . LEU A 1 29 ? -7.849  0.346   9.303   1.00 0.00 ? 29 LEU A CA   1  
ATOM 406   C C    . LEU A 1 29 ? -6.836  0.871   10.316  1.00 0.00 ? 29 LEU A C    1  
ATOM 407   O O    . LEU A 1 29 ? -5.707  1.209   9.961   1.00 0.00 ? 29 LEU A O    1  
ATOM 408   C CB   . LEU A 1 29 ? -8.918  1.407   9.037   1.00 0.00 ? 29 LEU A CB   1  
ATOM 409   C CG   . LEU A 1 29 ? -9.565  1.376   7.652   1.00 0.00 ? 29 LEU A CG   1  
ATOM 410   C CD1  . LEU A 1 29 ? -10.644 2.442   7.543   1.00 0.00 ? 29 LEU A CD1  1  
ATOM 411   C CD2  . LEU A 1 29 ? -8.513  1.566   6.568   1.00 0.00 ? 29 LEU A CD2  1  
ATOM 412   H H    . LEU A 1 29 ? -9.445  -0.943  9.822   1.00 0.00 ? 29 LEU A H    1  
ATOM 413   H HA   . LEU A 1 29 ? -7.335  0.125   8.380   1.00 0.00 ? 29 LEU A HA   1  
ATOM 414   H HB2  . LEU A 1 29 ? -9.700  1.280   9.770   1.00 0.00 ? 29 LEU A HB2  1  
ATOM 415   H HB3  . LEU A 1 29 ? -8.459  2.378   9.168   1.00 0.00 ? 29 LEU A HB3  1  
ATOM 416   H HG   . LEU A 1 29 ? -10.032 0.412   7.501   1.00 0.00 ? 29 LEU A HG   1  
ATOM 417   H HD11 . LEU A 1 29 ? -11.147 2.544   8.492   1.00 0.00 ? 29 LEU A HD11 1  
ATOM 418   H HD12 . LEU A 1 29 ? -11.358 2.154   6.786   1.00 0.00 ? 29 LEU A HD12 1  
ATOM 419   H HD13 . LEU A 1 29 ? -10.192 3.385   7.271   1.00 0.00 ? 29 LEU A HD13 1  
ATOM 420   H HD21 . LEU A 1 29 ? -7.686  2.135   6.966   1.00 0.00 ? 29 LEU A HD21 1  
ATOM 421   H HD22 . LEU A 1 29 ? -8.948  2.098   5.734   1.00 0.00 ? 29 LEU A HD22 1  
ATOM 422   H HD23 . LEU A 1 29 ? -8.161  0.601   6.236   1.00 0.00 ? 29 LEU A HD23 1  
ATOM 423   N N    . MET A 1 30 ? -7.247  0.935   11.578  1.00 0.00 ? 30 MET A N    1  
ATOM 424   C CA   . MET A 1 30 ? -6.374  1.416   12.642  1.00 0.00 ? 30 MET A CA   1  
ATOM 425   C C    . MET A 1 30 ? -5.010  0.736   12.576  1.00 0.00 ? 30 MET A C    1  
ATOM 426   O O    . MET A 1 30 ? -3.974  1.393   12.662  1.00 0.00 ? 30 MET A O    1  
ATOM 427   C CB   . MET A 1 30 ? -7.015  1.166   14.009  1.00 0.00 ? 30 MET A CB   1  
ATOM 428   C CG   . MET A 1 30 ? -6.092  1.467   15.178  1.00 0.00 ? 30 MET A CG   1  
ATOM 429   S SD   . MET A 1 30 ? -6.990  1.919   16.674  1.00 0.00 ? 30 MET A SD   1  
ATOM 430   C CE   . MET A 1 30 ? -6.722  0.463   17.683  1.00 0.00 ? 30 MET A CE   1  
ATOM 431   H H    . MET A 1 30 ? -8.159  0.652   11.799  1.00 0.00 ? 30 MET A H    1  
ATOM 432   H HA   . MET A 1 30 ? -6.240  2.479   12.506  1.00 0.00 ? 30 MET A HA   1  
ATOM 433   H HB2  . MET A 1 30 ? -7.892  1.789   14.101  1.00 0.00 ? 30 MET A HB2  1  
ATOM 434   H HB3  . MET A 1 30 ? -7.312  0.130   14.070  1.00 0.00 ? 30 MET A HB3  1  
ATOM 435   H HG2  . MET A 1 30 ? -5.496  0.590   15.384  1.00 0.00 ? 30 MET A HG2  1  
ATOM 436   H HG3  . MET A 1 30 ? -5.442  2.285   14.903  1.00 0.00 ? 30 MET A HG3  1  
ATOM 437   H HE1  . MET A 1 30 ? -5.740  0.062   17.482  1.00 0.00 ? 30 MET A HE1  1  
ATOM 438   H HE2  . MET A 1 30 ? -6.796  0.730   18.726  1.00 0.00 ? 30 MET A HE2  1  
ATOM 439   H HE3  . MET A 1 30 ? -7.470  -0.280  17.447  1.00 0.00 ? 30 MET A HE3  1  
ATOM 440   N N    . GLY A 1 31 ? -5.019  -0.585  12.422  1.00 0.00 ? 31 GLY A N    1  
ATOM 441   C CA   . GLY A 1 31 ? -3.777  -1.331  12.347  1.00 0.00 ? 31 GLY A CA   1  
ATOM 442   C C    . GLY A 1 31 ? -3.027  -1.081  11.053  1.00 0.00 ? 31 GLY A C    1  
ATOM 443   O O    . GLY A 1 31 ? -1.807  -0.913  11.057  1.00 0.00 ? 31 GLY A O    1  
ATOM 444   H H    . GLY A 1 31 ? -5.877  -1.056  12.359  1.00 0.00 ? 31 GLY A H    1  
ATOM 445   H HA2  . GLY A 1 31 ? -3.148  -1.046  13.177  1.00 0.00 ? 31 GLY A HA2  1  
ATOM 446   H HA3  . GLY A 1 31 ? -3.999  -2.386  12.422  1.00 0.00 ? 31 GLY A HA3  1  
ATOM 447   N N    . LEU A 1 32 ? -3.757  -1.057  9.944   1.00 0.00 ? 32 LEU A N    1  
ATOM 448   C CA   . LEU A 1 32 ? -3.153  -0.826  8.636   1.00 0.00 ? 32 LEU A CA   1  
ATOM 449   C C    . LEU A 1 32 ? -2.395  0.497   8.612   1.00 0.00 ? 32 LEU A C    1  
ATOM 450   O O    . LEU A 1 32 ? -1.291  0.580   8.075   1.00 0.00 ? 32 LEU A O    1  
ATOM 451   C CB   . LEU A 1 32 ? -4.229  -0.831  7.548   1.00 0.00 ? 32 LEU A CB   1  
ATOM 452   C CG   . LEU A 1 32 ? -4.727  -2.206  7.102   1.00 0.00 ? 32 LEU A CG   1  
ATOM 453   C CD1  . LEU A 1 32 ? -5.983  -2.071  6.257   1.00 0.00 ? 32 LEU A CD1  1  
ATOM 454   C CD2  . LEU A 1 32 ? -3.640  -2.943  6.332   1.00 0.00 ? 32 LEU A CD2  1  
ATOM 455   H H    . LEU A 1 32 ? -4.725  -1.197  10.004  1.00 0.00 ? 32 LEU A H    1  
ATOM 456   H HA   . LEU A 1 32 ? -2.457  -1.630  8.446   1.00 0.00 ? 32 LEU A HA   1  
ATOM 457   H HB2  . LEU A 1 32 ? -5.077  -0.277  7.919   1.00 0.00 ? 32 LEU A HB2  1  
ATOM 458   H HB3  . LEU A 1 32 ? -3.824  -0.328  6.681   1.00 0.00 ? 32 LEU A HB3  1  
ATOM 459   H HG   . LEU A 1 32 ? -4.974  -2.793  7.976   1.00 0.00 ? 32 LEU A HG   1  
ATOM 460   H HD11 . LEU A 1 32 ? -6.215  -3.022  5.801   1.00 0.00 ? 32 LEU A HD11 1  
ATOM 461   H HD12 . LEU A 1 32 ? -5.821  -1.332  5.486   1.00 0.00 ? 32 LEU A HD12 1  
ATOM 462   H HD13 . LEU A 1 32 ? -6.807  -1.761  6.884   1.00 0.00 ? 32 LEU A HD13 1  
ATOM 463   H HD21 . LEU A 1 32 ? -2.858  -2.249  6.062   1.00 0.00 ? 32 LEU A HD21 1  
ATOM 464   H HD22 . LEU A 1 32 ? -4.064  -3.374  5.436   1.00 0.00 ? 32 LEU A HD22 1  
ATOM 465   H HD23 . LEU A 1 32 ? -3.229  -3.727  6.950   1.00 0.00 ? 32 LEU A HD23 1  
ATOM 466   N N    . GLU A 1 33 ? -2.995  1.528   9.198   1.00 0.00 ? 33 GLU A N    1  
ATOM 467   C CA   . GLU A 1 33 ? -2.375  2.847   9.245   1.00 0.00 ? 33 GLU A CA   1  
ATOM 468   C C    . GLU A 1 33 ? -1.140  2.836   10.140  1.00 0.00 ? 33 GLU A C    1  
ATOM 469   O O    . GLU A 1 33 ? -0.135  3.481   9.841   1.00 0.00 ? 33 GLU A O    1  
ATOM 470   C CB   . GLU A 1 33 ? -3.376  3.888   9.750   1.00 0.00 ? 33 GLU A CB   1  
ATOM 471   C CG   . GLU A 1 33 ? -4.532  4.134   8.796   1.00 0.00 ? 33 GLU A CG   1  
ATOM 472   C CD   . GLU A 1 33 ? -5.476  5.214   9.288   1.00 0.00 ? 33 GLU A CD   1  
ATOM 473   O OE1  . GLU A 1 33 ? -6.417  4.881   10.038  1.00 0.00 ? 33 GLU A OE1  1  
ATOM 474   O OE2  . GLU A 1 33 ? -5.273  6.391   8.924   1.00 0.00 ? 33 GLU A OE2  1  
ATOM 475   H H    . GLU A 1 33 ? -3.876  1.399   9.609   1.00 0.00 ? 33 GLU A H    1  
ATOM 476   H HA   . GLU A 1 33 ? -2.074  3.107   8.241   1.00 0.00 ? 33 GLU A HA   1  
ATOM 477   H HB2  . GLU A 1 33 ? -3.779  3.554   10.694  1.00 0.00 ? 33 GLU A HB2  1  
ATOM 478   H HB3  . GLU A 1 33 ? -2.857  4.824   9.901   1.00 0.00 ? 33 GLU A HB3  1  
ATOM 479   H HG2  . GLU A 1 33 ? -4.135  4.434   7.838   1.00 0.00 ? 33 GLU A HG2  1  
ATOM 480   H HG3  . GLU A 1 33 ? -5.089  3.215   8.681   1.00 0.00 ? 33 GLU A HG3  1  
ATOM 481   N N    . LYS A 1 34 ? -1.222  2.098   11.243  1.00 0.00 ? 34 LYS A N    1  
ATOM 482   C CA   . LYS A 1 34 ? -0.112  2.001   12.184  1.00 0.00 ? 34 LYS A CA   1  
ATOM 483   C C    . LYS A 1 34 ? 1.112   1.379   11.519  1.00 0.00 ? 34 LYS A C    1  
ATOM 484   O O    . LYS A 1 34 ? 2.210   1.932   11.578  1.00 0.00 ? 34 LYS A O    1  
ATOM 485   C CB   . LYS A 1 34 ? -0.522  1.171   13.402  1.00 0.00 ? 34 LYS A CB   1  
ATOM 486   C CG   . LYS A 1 34 ? 0.203   1.565   14.678  1.00 0.00 ? 34 LYS A CG   1  
ATOM 487   C CD   . LYS A 1 34 ? -0.308  2.889   15.223  1.00 0.00 ? 34 LYS A CD   1  
ATOM 488   C CE   . LYS A 1 34 ? -1.600  2.708   16.005  1.00 0.00 ? 34 LYS A CE   1  
ATOM 489   N NZ   . LYS A 1 34 ? -1.766  3.753   17.052  1.00 0.00 ? 34 LYS A NZ   1  
ATOM 490   H H    . LYS A 1 34 ? -2.050  1.606   11.427  1.00 0.00 ? 34 LYS A H    1  
ATOM 491   H HA   . LYS A 1 34 ? 0.137   3.000   12.507  1.00 0.00 ? 34 LYS A HA   1  
ATOM 492   H HB2  . LYS A 1 34 ? -1.583  1.290   13.564  1.00 0.00 ? 34 LYS A HB2  1  
ATOM 493   H HB3  . LYS A 1 34 ? -0.311  0.130   13.201  1.00 0.00 ? 34 LYS A HB3  1  
ATOM 494   H HG2  . LYS A 1 34 ? 0.047   0.798   15.422  1.00 0.00 ? 34 LYS A HG2  1  
ATOM 495   H HG3  . LYS A 1 34 ? 1.259   1.656   14.468  1.00 0.00 ? 34 LYS A HG3  1  
ATOM 496   H HD2  . LYS A 1 34 ? 0.439   3.311   15.878  1.00 0.00 ? 34 LYS A HD2  1  
ATOM 497   H HD3  . LYS A 1 34 ? -0.488  3.562   14.397  1.00 0.00 ? 34 LYS A HD3  1  
ATOM 498   H HE2  . LYS A 1 34 ? -2.432  2.764   15.319  1.00 0.00 ? 34 LYS A HE2  1  
ATOM 499   H HE3  . LYS A 1 34 ? -1.587  1.736   16.476  1.00 0.00 ? 34 LYS A HE3  1  
ATOM 500   H HZ1  . LYS A 1 34 ? -1.543  3.358   17.988  1.00 0.00 ? 34 LYS A HZ1  1  
ATOM 501   H HZ2  . LYS A 1 34 ? -2.746  4.101   17.059  1.00 0.00 ? 34 LYS A HZ2  1  
ATOM 502   H HZ3  . LYS A 1 34 ? -1.127  4.552   16.864  1.00 0.00 ? 34 LYS A HZ3  1  
ATOM 503   N N    . ARG A 1 35 ? 0.914   0.227   10.886  1.00 0.00 ? 35 ARG A N    1  
ATOM 504   C CA   . ARG A 1 35 ? 2.002   -0.470  10.211  1.00 0.00 ? 35 ARG A CA   1  
ATOM 505   C C    . ARG A 1 35 ? 2.587   0.390   9.093   1.00 0.00 ? 35 ARG A C    1  
ATOM 506   O O    . ARG A 1 35 ? 3.745   0.802   9.154   1.00 0.00 ? 35 ARG A O    1  
ATOM 507   C CB   . ARG A 1 35 ? 1.508   -1.800  9.640   1.00 0.00 ? 35 ARG A CB   1  
ATOM 508   C CG   . ARG A 1 35 ? 1.386   -2.901  10.681  1.00 0.00 ? 35 ARG A CG   1  
ATOM 509   C CD   . ARG A 1 35 ? 2.729   -3.560  10.954  1.00 0.00 ? 35 ARG A CD   1  
ATOM 510   N NE   . ARG A 1 35 ? 2.581   -4.958  11.352  1.00 0.00 ? 35 ARG A NE   1  
ATOM 511   C CZ   . ARG A 1 35 ? 2.330   -5.346  12.597  1.00 0.00 ? 35 ARG A CZ   1  
ATOM 512   N NH1  . ARG A 1 35 ? 2.199   -4.445  13.561  1.00 0.00 ? 35 ARG A NH1  1  
ATOM 513   N NH2  . ARG A 1 35 ? 2.210   -6.636  12.880  1.00 0.00 ? 35 ARG A NH2  1  
ATOM 514   H H    . ARG A 1 35 ? 0.016   -0.164  10.874  1.00 0.00 ? 35 ARG A H    1  
ATOM 515   H HA   . ARG A 1 35 ? 2.774   -0.665  10.939  1.00 0.00 ? 35 ARG A HA   1  
ATOM 516   H HB2  . ARG A 1 35 ? 0.536   -1.648  9.193   1.00 0.00 ? 35 ARG A HB2  1  
ATOM 517   H HB3  . ARG A 1 35 ? 2.198   -2.130  8.878   1.00 0.00 ? 35 ARG A HB3  1  
ATOM 518   H HG2  . ARG A 1 35 ? 1.013   -2.475  11.601  1.00 0.00 ? 35 ARG A HG2  1  
ATOM 519   H HG3  . ARG A 1 35 ? 0.694   -3.648  10.321  1.00 0.00 ? 35 ARG A HG3  1  
ATOM 520   H HD2  . ARG A 1 35 ? 3.328   -3.513  10.057  1.00 0.00 ? 35 ARG A HD2  1  
ATOM 521   H HD3  . ARG A 1 35 ? 3.224   -3.021  11.747  1.00 0.00 ? 35 ARG A HD3  1  
ATOM 522   H HE   . ARG A 1 35 ? 2.674   -5.640  10.655  1.00 0.00 ? 35 ARG A HE   1  
ATOM 523   H HH11 . ARG A 1 35 ? 2.289   -3.472  13.351  1.00 0.00 ? 35 ARG A HH11 1  
ATOM 524   H HH12 . ARG A 1 35 ? 2.009   -4.739  14.498  1.00 0.00 ? 35 ARG A HH12 1  
ATOM 525   H HH21 . ARG A 1 35 ? 2.308   -7.318  12.156  1.00 0.00 ? 35 ARG A HH21 1  
ATOM 526   H HH22 . ARG A 1 35 ? 2.021   -6.927  13.818  1.00 0.00 ? 35 ARG A HH22 1  
ATOM 527   N N    . PHE A 1 36 ? 1.777   0.655   8.073   1.00 0.00 ? 36 PHE A N    1  
ATOM 528   C CA   . PHE A 1 36 ? 2.214   1.464   6.941   1.00 0.00 ? 36 PHE A CA   1  
ATOM 529   C C    . PHE A 1 36 ? 3.035   2.660   7.412   1.00 0.00 ? 36 PHE A C    1  
ATOM 530   O O    . PHE A 1 36 ? 4.181   2.840   7.001   1.00 0.00 ? 36 PHE A O    1  
ATOM 531   C CB   . PHE A 1 36 ? 1.006   1.945   6.135   1.00 0.00 ? 36 PHE A CB   1  
ATOM 532   C CG   . PHE A 1 36 ? 1.377   2.631   4.851   1.00 0.00 ? 36 PHE A CG   1  
ATOM 533   C CD1  . PHE A 1 36 ? 2.085   3.823   4.867   1.00 0.00 ? 36 PHE A CD1  1  
ATOM 534   C CD2  . PHE A 1 36 ? 1.019   2.085   3.629   1.00 0.00 ? 36 PHE A CD2  1  
ATOM 535   C CE1  . PHE A 1 36 ? 2.426   4.457   3.687   1.00 0.00 ? 36 PHE A CE1  1  
ATOM 536   C CE2  . PHE A 1 36 ? 1.358   2.715   2.446   1.00 0.00 ? 36 PHE A CE2  1  
ATOM 537   C CZ   . PHE A 1 36 ? 2.064   3.901   2.475   1.00 0.00 ? 36 PHE A CZ   1  
ATOM 538   H H    . PHE A 1 36 ? 0.864   0.298   8.082   1.00 0.00 ? 36 PHE A H    1  
ATOM 539   H HA   . PHE A 1 36 ? 2.833   0.843   6.311   1.00 0.00 ? 36 PHE A HA   1  
ATOM 540   H HB2  . PHE A 1 36 ? 0.385   1.097   5.889   1.00 0.00 ? 36 PHE A HB2  1  
ATOM 541   H HB3  . PHE A 1 36 ? 0.438   2.641   6.733   1.00 0.00 ? 36 PHE A HB3  1  
ATOM 542   H HD1  . PHE A 1 36 ? 2.370   4.258   5.813   1.00 0.00 ? 36 PHE A HD1  1  
ATOM 543   H HD2  . PHE A 1 36 ? 0.467   1.156   3.606   1.00 0.00 ? 36 PHE A HD2  1  
ATOM 544   H HE1  . PHE A 1 36 ? 2.978   5.384   3.712   1.00 0.00 ? 36 PHE A HE1  1  
ATOM 545   H HE2  . PHE A 1 36 ? 1.073   2.277   1.501   1.00 0.00 ? 36 PHE A HE2  1  
ATOM 546   H HZ   . PHE A 1 36 ? 2.329   4.395   1.552   1.00 0.00 ? 36 PHE A HZ   1  
ATOM 547   N N    . GLU A 1 37 ? 2.439   3.476   8.276   1.00 0.00 ? 37 GLU A N    1  
ATOM 548   C CA   . GLU A 1 37 ? 3.115   4.657   8.801   1.00 0.00 ? 37 GLU A CA   1  
ATOM 549   C C    . GLU A 1 37 ? 4.536   4.319   9.242   1.00 0.00 ? 37 GLU A C    1  
ATOM 550   O O    . GLU A 1 37 ? 5.500   4.949   8.806   1.00 0.00 ? 37 GLU A O    1  
ATOM 551   C CB   . GLU A 1 37 ? 2.329   5.240   9.978   1.00 0.00 ? 37 GLU A CB   1  
ATOM 552   C CG   . GLU A 1 37 ? 1.144   6.092   9.555   1.00 0.00 ? 37 GLU A CG   1  
ATOM 553   C CD   . GLU A 1 37 ? 1.561   7.451   9.027   1.00 0.00 ? 37 GLU A CD   1  
ATOM 554   O OE1  . GLU A 1 37 ? 2.199   8.211   9.785   1.00 0.00 ? 37 GLU A OE1  1  
ATOM 555   O OE2  . GLU A 1 37 ? 1.250   7.754   7.856   1.00 0.00 ? 37 GLU A OE2  1  
ATOM 556   H H    . GLU A 1 37 ? 1.524   3.280   8.566   1.00 0.00 ? 37 GLU A H    1  
ATOM 557   H HA   . GLU A 1 37 ? 3.161   5.392   8.012   1.00 0.00 ? 37 GLU A HA   1  
ATOM 558   H HB2  . GLU A 1 37 ? 1.964   4.428   10.589  1.00 0.00 ? 37 GLU A HB2  1  
ATOM 559   H HB3  . GLU A 1 37 ? 2.993   5.853   10.569  1.00 0.00 ? 37 GLU A HB3  1  
ATOM 560   H HG2  . GLU A 1 37 ? 0.602   5.572   8.779   1.00 0.00 ? 37 GLU A HG2  1  
ATOM 561   H HG3  . GLU A 1 37 ? 0.498   6.236   10.409  1.00 0.00 ? 37 GLU A HG3  1  
ATOM 562   N N    . LYS A 1 38 ? 4.658   3.321   10.111  1.00 0.00 ? 38 LYS A N    1  
ATOM 563   C CA   . LYS A 1 38 ? 5.960   2.897   10.612  1.00 0.00 ? 38 LYS A CA   1  
ATOM 564   C C    . LYS A 1 38 ? 6.871   2.467   9.466   1.00 0.00 ? 38 LYS A C    1  
ATOM 565   O O    . LYS A 1 38 ? 8.019   2.901   9.378   1.00 0.00 ? 38 LYS A O    1  
ATOM 566   C CB   . LYS A 1 38 ? 5.797   1.745   11.606  1.00 0.00 ? 38 LYS A CB   1  
ATOM 567   C CG   . LYS A 1 38 ? 5.068   2.140   12.879  1.00 0.00 ? 38 LYS A CG   1  
ATOM 568   C CD   . LYS A 1 38 ? 4.736   0.926   13.731  1.00 0.00 ? 38 LYS A CD   1  
ATOM 569   C CE   . LYS A 1 38 ? 4.362   1.326   15.150  1.00 0.00 ? 38 LYS A CE   1  
ATOM 570   N NZ   . LYS A 1 38 ? 5.536   1.837   15.910  1.00 0.00 ? 38 LYS A NZ   1  
ATOM 571   H H    . LYS A 1 38 ? 3.852   2.857   10.422  1.00 0.00 ? 38 LYS A H    1  
ATOM 572   H HA   . LYS A 1 38 ? 6.411   3.737   11.118  1.00 0.00 ? 38 LYS A HA   1  
ATOM 573   H HB2  . LYS A 1 38 ? 5.242   0.950   11.130  1.00 0.00 ? 38 LYS A HB2  1  
ATOM 574   H HB3  . LYS A 1 38 ? 6.776   1.377   11.877  1.00 0.00 ? 38 LYS A HB3  1  
ATOM 575   H HG2  . LYS A 1 38 ? 5.696   2.807   13.451  1.00 0.00 ? 38 LYS A HG2  1  
ATOM 576   H HG3  . LYS A 1 38 ? 4.149   2.645   12.615  1.00 0.00 ? 38 LYS A HG3  1  
ATOM 577   H HD2  . LYS A 1 38 ? 3.904   0.401   13.286  1.00 0.00 ? 38 LYS A HD2  1  
ATOM 578   H HD3  . LYS A 1 38 ? 5.598   0.275   13.765  1.00 0.00 ? 38 LYS A HD3  1  
ATOM 579   H HE2  . LYS A 1 38 ? 3.609   2.099   15.105  1.00 0.00 ? 38 LYS A HE2  1  
ATOM 580   H HE3  . LYS A 1 38 ? 3.961   0.463   15.660  1.00 0.00 ? 38 LYS A HE3  1  
ATOM 581   H HZ1  . LYS A 1 38 ? 5.473   1.541   16.905  1.00 0.00 ? 38 LYS A HZ1  1  
ATOM 582   H HZ2  . LYS A 1 38 ? 5.563   2.876   15.871  1.00 0.00 ? 38 LYS A HZ2  1  
ATOM 583   H HZ3  . LYS A 1 38 ? 6.416   1.462   15.503  1.00 0.00 ? 38 LYS A HZ3  1  
ATOM 584   N N    . GLN A 1 39 ? 6.350   1.614   8.590   1.00 0.00 ? 39 GLN A N    1  
ATOM 585   C CA   . GLN A 1 39 ? 7.117   1.127   7.449   1.00 0.00 ? 39 GLN A CA   1  
ATOM 586   C C    . GLN A 1 39 ? 6.332   1.298   6.153   1.00 0.00 ? 39 GLN A C    1  
ATOM 587   O O    . GLN A 1 39 ? 5.469   0.483   5.825   1.00 0.00 ? 39 GLN A O    1  
ATOM 588   C CB   . GLN A 1 39 ? 7.486   -0.344  7.646   1.00 0.00 ? 39 GLN A CB   1  
ATOM 589   C CG   . GLN A 1 39 ? 8.750   -0.758  6.911   1.00 0.00 ? 39 GLN A CG   1  
ATOM 590   C CD   . GLN A 1 39 ? 9.342   -2.047  7.447   1.00 0.00 ? 39 GLN A CD   1  
ATOM 591   O OE1  . GLN A 1 39 ? 10.497  -2.084  7.871   1.00 0.00 ? 39 GLN A OE1  1  
ATOM 592   N NE2  . GLN A 1 39 ? 8.551   -3.114  7.431   1.00 0.00 ? 39 GLN A NE2  1  
ATOM 593   H H    . GLN A 1 39 ? 5.429   1.304   8.714   1.00 0.00 ? 39 GLN A H    1  
ATOM 594   H HA   . GLN A 1 39 ? 8.023   1.710   7.386   1.00 0.00 ? 39 GLN A HA   1  
ATOM 595   H HB2  . GLN A 1 39 ? 7.631   -0.529  8.700   1.00 0.00 ? 39 GLN A HB2  1  
ATOM 596   H HB3  . GLN A 1 39 ? 6.671   -0.958  7.291   1.00 0.00 ? 39 GLN A HB3  1  
ATOM 597   H HG2  . GLN A 1 39 ? 8.514   -0.896  5.866   1.00 0.00 ? 39 GLN A HG2  1  
ATOM 598   H HG3  . GLN A 1 39 ? 9.483   0.028   7.012   1.00 0.00 ? 39 GLN A HG3  1  
ATOM 599   H HE21 . GLN A 1 39 ? 7.642   -3.010  7.077   1.00 0.00 ? 39 GLN A HE21 1  
ATOM 600   H HE22 . GLN A 1 39 ? 8.908   -3.960  7.771   1.00 0.00 ? 39 GLN A HE22 1  
ATOM 601   N N    . LYS A 1 40 ? 6.636   2.362   5.419   1.00 0.00 ? 40 LYS A N    1  
ATOM 602   C CA   . LYS A 1 40 ? 5.960   2.640   4.157   1.00 0.00 ? 40 LYS A CA   1  
ATOM 603   C C    . LYS A 1 40 ? 5.718   1.354   3.374   1.00 0.00 ? 40 LYS A C    1  
ATOM 604   O O    . LYS A 1 40 ? 4.631   1.137   2.838   1.00 0.00 ? 40 LYS A O    1  
ATOM 605   C CB   . LYS A 1 40 ? 6.788   3.614   3.315   1.00 0.00 ? 40 LYS A CB   1  
ATOM 606   C CG   . LYS A 1 40 ? 6.460   5.074   3.575   1.00 0.00 ? 40 LYS A CG   1  
ATOM 607   C CD   . LYS A 1 40 ? 6.594   5.423   5.048   1.00 0.00 ? 40 LYS A CD   1  
ATOM 608   C CE   . LYS A 1 40 ? 6.763   6.920   5.253   1.00 0.00 ? 40 LYS A CE   1  
ATOM 609   N NZ   . LYS A 1 40 ? 6.809   7.280   6.697   1.00 0.00 ? 40 LYS A NZ   1  
ATOM 610   H H    . LYS A 1 40 ? 7.334   2.976   5.733   1.00 0.00 ? 40 LYS A H    1  
ATOM 611   H HA   . LYS A 1 40 ? 5.008   3.094   4.384   1.00 0.00 ? 40 LYS A HA   1  
ATOM 612   H HB2  . LYS A 1 40 ? 7.835   3.458   3.532   1.00 0.00 ? 40 LYS A HB2  1  
ATOM 613   H HB3  . LYS A 1 40 ? 6.611   3.408   2.269   1.00 0.00 ? 40 LYS A HB3  1  
ATOM 614   H HG2  . LYS A 1 40 ? 7.138   5.693   3.006   1.00 0.00 ? 40 LYS A HG2  1  
ATOM 615   H HG3  . LYS A 1 40 ? 5.444   5.266   3.260   1.00 0.00 ? 40 LYS A HG3  1  
ATOM 616   H HD2  . LYS A 1 40 ? 5.705   5.098   5.568   1.00 0.00 ? 40 LYS A HD2  1  
ATOM 617   H HD3  . LYS A 1 40 ? 7.457   4.912   5.452   1.00 0.00 ? 40 LYS A HD3  1  
ATOM 618   H HE2  . LYS A 1 40 ? 7.683   7.233   4.783   1.00 0.00 ? 40 LYS A HE2  1  
ATOM 619   H HE3  . LYS A 1 40 ? 5.931   7.430   4.790   1.00 0.00 ? 40 LYS A HE3  1  
ATOM 620   H HZ1  . LYS A 1 40 ? 7.774   7.562   6.964   1.00 0.00 ? 40 LYS A HZ1  1  
ATOM 621   H HZ2  . LYS A 1 40 ? 6.525   6.466   7.278   1.00 0.00 ? 40 LYS A HZ2  1  
ATOM 622   H HZ3  . LYS A 1 40 ? 6.163   8.072   6.889   1.00 0.00 ? 40 LYS A HZ3  1  
ATOM 623   N N    . TYR A 1 41 ? 6.737   0.504   3.313   1.00 0.00 ? 41 TYR A N    1  
ATOM 624   C CA   . TYR A 1 41 ? 6.635   -0.761  2.595   1.00 0.00 ? 41 TYR A CA   1  
ATOM 625   C C    . TYR A 1 41 ? 7.076   -1.926  3.476   1.00 0.00 ? 41 TYR A C    1  
ATOM 626   O O    . TYR A 1 41 ? 8.209   -1.961  3.958   1.00 0.00 ? 41 TYR A O    1  
ATOM 627   C CB   . TYR A 1 41 ? 7.484   -0.720  1.323   1.00 0.00 ? 41 TYR A CB   1  
ATOM 628   C CG   . TYR A 1 41 ? 7.525   0.642   0.666   1.00 0.00 ? 41 TYR A CG   1  
ATOM 629   C CD1  . TYR A 1 41 ? 6.353   1.313   0.341   1.00 0.00 ? 41 TYR A CD1  1  
ATOM 630   C CD2  . TYR A 1 41 ? 8.736   1.256   0.370   1.00 0.00 ? 41 TYR A CD2  1  
ATOM 631   C CE1  . TYR A 1 41 ? 6.385   2.557   -0.259  1.00 0.00 ? 41 TYR A CE1  1  
ATOM 632   C CE2  . TYR A 1 41 ? 8.778   2.500   -0.229  1.00 0.00 ? 41 TYR A CE2  1  
ATOM 633   C CZ   . TYR A 1 41 ? 7.600   3.146   -0.542  1.00 0.00 ? 41 TYR A CZ   1  
ATOM 634   O OH   . TYR A 1 41 ? 7.638   4.385   -1.141  1.00 0.00 ? 41 TYR A OH   1  
ATOM 635   H H    . TYR A 1 41 ? 7.579   0.732   3.760   1.00 0.00 ? 41 TYR A H    1  
ATOM 636   H HA   . TYR A 1 41 ? 5.600   -0.904  2.320   1.00 0.00 ? 41 TYR A HA   1  
ATOM 637   H HB2  . TYR A 1 41 ? 8.498   -1.001  1.566   1.00 0.00 ? 41 TYR A HB2  1  
ATOM 638   H HB3  . TYR A 1 41 ? 7.083   -1.422  0.607   1.00 0.00 ? 41 TYR A HB3  1  
ATOM 639   H HD1  . TYR A 1 41 ? 5.403   0.849   0.564   1.00 0.00 ? 41 TYR A HD1  1  
ATOM 640   H HD2  . TYR A 1 41 ? 9.656   0.746   0.616   1.00 0.00 ? 41 TYR A HD2  1  
ATOM 641   H HE1  . TYR A 1 41 ? 5.464   3.064   -0.504  1.00 0.00 ? 41 TYR A HE1  1  
ATOM 642   H HE2  . TYR A 1 41 ? 9.729   2.961   -0.451  1.00 0.00 ? 41 TYR A HE2  1  
ATOM 643   H HH   . TYR A 1 41 ? 8.457   4.827   -0.908  1.00 0.00 ? 41 TYR A HH   1  
ATOM 644   N N    . LEU A 1 42 ? 6.172   -2.877  3.684   1.00 0.00 ? 42 LEU A N    1  
ATOM 645   C CA   . LEU A 1 42 ? 6.466   -4.045  4.507   1.00 0.00 ? 42 LEU A CA   1  
ATOM 646   C C    . LEU A 1 42 ? 7.254   -5.084  3.716   1.00 0.00 ? 42 LEU A C    1  
ATOM 647   O O    . LEU A 1 42 ? 7.430   -4.955  2.505   1.00 0.00 ? 42 LEU A O    1  
ATOM 648   C CB   . LEU A 1 42 ? 5.169   -4.663  5.032   1.00 0.00 ? 42 LEU A CB   1  
ATOM 649   C CG   . LEU A 1 42 ? 4.241   -3.722  5.801   1.00 0.00 ? 42 LEU A CG   1  
ATOM 650   C CD1  . LEU A 1 42 ? 2.852   -4.329  5.929   1.00 0.00 ? 42 LEU A CD1  1  
ATOM 651   C CD2  . LEU A 1 42 ? 4.817   -3.410  7.175   1.00 0.00 ? 42 LEU A CD2  1  
ATOM 652   H H    . LEU A 1 42 ? 5.286   -2.793  3.274   1.00 0.00 ? 42 LEU A H    1  
ATOM 653   H HA   . LEU A 1 42 ? 7.064   -3.718  5.344   1.00 0.00 ? 42 LEU A HA   1  
ATOM 654   H HB2  . LEU A 1 42 ? 4.621   -5.049  4.186   1.00 0.00 ? 42 LEU A HB2  1  
ATOM 655   H HB3  . LEU A 1 42 ? 5.434   -5.478  5.689   1.00 0.00 ? 42 LEU A HB3  1  
ATOM 656   H HG   . LEU A 1 42 ? 4.149   -2.792  5.257   1.00 0.00 ? 42 LEU A HG   1  
ATOM 657   H HD11 . LEU A 1 42 ? 2.583   -4.396  6.972   1.00 0.00 ? 42 LEU A HD11 1  
ATOM 658   H HD12 . LEU A 1 42 ? 2.849   -5.317  5.493   1.00 0.00 ? 42 LEU A HD12 1  
ATOM 659   H HD13 . LEU A 1 42 ? 2.138   -3.705  5.411   1.00 0.00 ? 42 LEU A HD13 1  
ATOM 660   H HD21 . LEU A 1 42 ? 5.185   -4.320  7.625   1.00 0.00 ? 42 LEU A HD21 1  
ATOM 661   H HD22 . LEU A 1 42 ? 4.045   -2.985  7.801   1.00 0.00 ? 42 LEU A HD22 1  
ATOM 662   H HD23 . LEU A 1 42 ? 5.628   -2.705  7.073   1.00 0.00 ? 42 LEU A HD23 1  
ATOM 663   N N    . SER A 1 43 ? 7.725   -6.116  4.410   1.00 0.00 ? 43 SER A N    1  
ATOM 664   C CA   . SER A 1 43 ? 8.495   -7.177  3.772   1.00 0.00 ? 43 SER A CA   1  
ATOM 665   C C    . SER A 1 43 ? 7.587   -8.325  3.343   1.00 0.00 ? 43 SER A C    1  
ATOM 666   O O    . SER A 1 43 ? 6.391   -8.330  3.636   1.00 0.00 ? 43 SER A O    1  
ATOM 667   C CB   . SER A 1 43 ? 9.575   -7.695  4.725   1.00 0.00 ? 43 SER A CB   1  
ATOM 668   O OG   . SER A 1 43 ? 10.439  -6.648  5.134   1.00 0.00 ? 43 SER A OG   1  
ATOM 669   H H    . SER A 1 43 ? 7.551   -6.163  5.373   1.00 0.00 ? 43 SER A H    1  
ATOM 670   H HA   . SER A 1 43 ? 8.970   -6.762  2.896   1.00 0.00 ? 43 SER A HA   1  
ATOM 671   H HB2  . SER A 1 43 ? 9.106   -8.120  5.599   1.00 0.00 ? 43 SER A HB2  1  
ATOM 672   H HB3  . SER A 1 43 ? 10.159  -8.454  4.224   1.00 0.00 ? 43 SER A HB3  1  
ATOM 673   H HG   . SER A 1 43 ? 10.666  -6.763  6.059   1.00 0.00 ? 43 SER A HG   1  
ATOM 674   N N    . THR A 1 44 ? 8.164   -9.299  2.646   1.00 0.00 ? 44 THR A N    1  
ATOM 675   C CA   . THR A 1 44 ? 7.408   -10.453 2.174   1.00 0.00 ? 44 THR A CA   1  
ATOM 676   C C    . THR A 1 44 ? 6.688   -11.146 3.325   1.00 0.00 ? 44 THR A C    1  
ATOM 677   O O    . THR A 1 44 ? 5.463   -11.275 3.335   1.00 0.00 ? 44 THR A O    1  
ATOM 678   C CB   . THR A 1 44 ? 8.322   -11.472 1.467   1.00 0.00 ? 44 THR A CB   1  
ATOM 679   O OG1  . THR A 1 44 ? 8.369   -11.196 0.063   1.00 0.00 ? 44 THR A OG1  1  
ATOM 680   C CG2  . THR A 1 44 ? 7.825   -12.892 1.694   1.00 0.00 ? 44 THR A CG2  1  
ATOM 681   H H    . THR A 1 44 ? 9.121   -9.239  2.444   1.00 0.00 ? 44 THR A H    1  
ATOM 682   H HA   . THR A 1 44 ? 6.675   -10.103 1.462   1.00 0.00 ? 44 THR A HA   1  
ATOM 683   H HB   . THR A 1 44 ? 9.318   -11.385 1.877   1.00 0.00 ? 44 THR A HB   1  
ATOM 684   H HG1  . THR A 1 44 ? 8.320   -10.247 -0.079  1.00 0.00 ? 44 THR A HG1  1  
ATOM 685   H HG21 . THR A 1 44 ? 8.416   -13.578 1.106   1.00 0.00 ? 44 THR A HG21 1  
ATOM 686   H HG22 . THR A 1 44 ? 6.789   -12.963 1.397   1.00 0.00 ? 44 THR A HG22 1  
ATOM 687   H HG23 . THR A 1 44 ? 7.918   -13.143 2.740   1.00 0.00 ? 44 THR A HG23 1  
ATOM 688   N N    . PRO A 1 45 ? 7.463   -11.603 4.320   1.00 0.00 ? 45 PRO A N    1  
ATOM 689   C CA   . PRO A 1 45 ? 6.919   -12.290 5.495   1.00 0.00 ? 45 PRO A CA   1  
ATOM 690   C C    . PRO A 1 45 ? 6.136   -11.350 6.405   1.00 0.00 ? 45 PRO A C    1  
ATOM 691   O O    . PRO A 1 45 ? 5.050   -11.689 6.877   1.00 0.00 ? 45 PRO A O    1  
ATOM 692   C CB   . PRO A 1 45 ? 8.168   -12.810 6.211   1.00 0.00 ? 45 PRO A CB   1  
ATOM 693   C CG   . PRO A 1 45 ? 9.260   -11.892 5.783   1.00 0.00 ? 45 PRO A CG   1  
ATOM 694   C CD   . PRO A 1 45 ? 8.929   -11.484 4.374   1.00 0.00 ? 45 PRO A CD   1  
ATOM 695   H HA   . PRO A 1 45 ? 6.291   -13.122 5.213   1.00 0.00 ? 45 PRO A HA   1  
ATOM 696   H HB2  . PRO A 1 45 ? 8.015   -12.772 7.281   1.00 0.00 ? 45 PRO A HB2  1  
ATOM 697   H HB3  . PRO A 1 45 ? 8.365   -13.827 5.906   1.00 0.00 ? 45 PRO A HB3  1  
ATOM 698   H HG2  . PRO A 1 45 ? 9.286   -11.027 6.428   1.00 0.00 ? 45 PRO A HG2  1  
ATOM 699   H HG3  . PRO A 1 45 ? 10.207  -12.411 5.810   1.00 0.00 ? 45 PRO A HG3  1  
ATOM 700   H HD2  . PRO A 1 45 ? 9.241   -10.465 4.194   1.00 0.00 ? 45 PRO A HD2  1  
ATOM 701   H HD3  . PRO A 1 45 ? 9.396   -12.154 3.668   1.00 0.00 ? 45 PRO A HD3  1  
ATOM 702   N N    . ASP A 1 46 ? 6.693   -10.168 6.647   1.00 0.00 ? 46 ASP A N    1  
ATOM 703   C CA   . ASP A 1 46 ? 6.045   -9.178  7.500   1.00 0.00 ? 46 ASP A CA   1  
ATOM 704   C C    . ASP A 1 46 ? 4.587   -8.983  7.095   1.00 0.00 ? 46 ASP A C    1  
ATOM 705   O O    . ASP A 1 46 ? 3.675   -9.246  7.879   1.00 0.00 ? 46 ASP A O    1  
ATOM 706   C CB   . ASP A 1 46 ? 6.791   -7.845  7.427   1.00 0.00 ? 46 ASP A CB   1  
ATOM 707   C CG   . ASP A 1 46 ? 7.914   -7.753  8.441   1.00 0.00 ? 46 ASP A CG   1  
ATOM 708   O OD1  . ASP A 1 46 ? 8.754   -8.677  8.480   1.00 0.00 ? 46 ASP A OD1  1  
ATOM 709   O OD2  . ASP A 1 46 ? 7.954   -6.759  9.195   1.00 0.00 ? 46 ASP A OD2  1  
ATOM 710   H H    . ASP A 1 46 ? 7.560   -9.956  6.242   1.00 0.00 ? 46 ASP A H    1  
ATOM 711   H HA   . ASP A 1 46 ? 6.078   -9.543  8.516   1.00 0.00 ? 46 ASP A HA   1  
ATOM 712   H HB2  . ASP A 1 46 ? 7.212   -7.729  6.439   1.00 0.00 ? 46 ASP A HB2  1  
ATOM 713   H HB3  . ASP A 1 46 ? 6.095   -7.040  7.613   1.00 0.00 ? 46 ASP A HB3  1  
ATOM 714   N N    . ARG A 1 47 ? 4.376   -8.519  5.868   1.00 0.00 ? 47 ARG A N    1  
ATOM 715   C CA   . ARG A 1 47 ? 3.029   -8.285  5.361   1.00 0.00 ? 47 ARG A CA   1  
ATOM 716   C C    . ARG A 1 47 ? 2.095   -9.426  5.753   1.00 0.00 ? 47 ARG A C    1  
ATOM 717   O O    . ARG A 1 47 ? 0.920   -9.206  6.047   1.00 0.00 ? 47 ARG A O    1  
ATOM 718   C CB   . ARG A 1 47 ? 3.054   -8.133  3.839   1.00 0.00 ? 47 ARG A CB   1  
ATOM 719   C CG   . ARG A 1 47 ? 1.674   -7.993  3.218   1.00 0.00 ? 47 ARG A CG   1  
ATOM 720   C CD   . ARG A 1 47 ? 1.760   -7.720  1.724   1.00 0.00 ? 47 ARG A CD   1  
ATOM 721   N NE   . ARG A 1 47 ? 2.500   -6.495  1.433   1.00 0.00 ? 47 ARG A NE   1  
ATOM 722   C CZ   . ARG A 1 47 ? 3.824   -6.443  1.331   1.00 0.00 ? 47 ARG A CZ   1  
ATOM 723   N NH1  . ARG A 1 47 ? 4.548   -7.541  1.495   1.00 0.00 ? 47 ARG A NH1  1  
ATOM 724   N NH2  . ARG A 1 47 ? 4.425   -5.291  1.063   1.00 0.00 ? 47 ARG A NH2  1  
ATOM 725   H H    . ARG A 1 47 ? 5.144   -8.327  5.290   1.00 0.00 ? 47 ARG A H    1  
ATOM 726   H HA   . ARG A 1 47 ? 2.664   -7.369  5.799   1.00 0.00 ? 47 ARG A HA   1  
ATOM 727   H HB2  . ARG A 1 47 ? 3.630   -7.255  3.585   1.00 0.00 ? 47 ARG A HB2  1  
ATOM 728   H HB3  . ARG A 1 47 ? 3.531   -9.002  3.410   1.00 0.00 ? 47 ARG A HB3  1  
ATOM 729   H HG2  . ARG A 1 47 ? 1.124   -8.909  3.374   1.00 0.00 ? 47 ARG A HG2  1  
ATOM 730   H HG3  . ARG A 1 47 ? 1.157   -7.174  3.695   1.00 0.00 ? 47 ARG A HG3  1  
ATOM 731   H HD2  . ARG A 1 47 ? 2.258   -8.552  1.248   1.00 0.00 ? 47 ARG A HD2  1  
ATOM 732   H HD3  . ARG A 1 47 ? 0.759   -7.627  1.331   1.00 0.00 ? 47 ARG A HD3  1  
ATOM 733   H HE   . ARG A 1 47 ? 1.984   -5.672  1.308   1.00 0.00 ? 47 ARG A HE   1  
ATOM 734   H HH11 . ARG A 1 47 ? 4.098   -8.411  1.696   1.00 0.00 ? 47 ARG A HH11 1  
ATOM 735   H HH12 . ARG A 1 47 ? 5.545   -7.499  1.416   1.00 0.00 ? 47 ARG A HH12 1  
ATOM 736   H HH21 . ARG A 1 47 ? 3.881   -4.461  0.939   1.00 0.00 ? 47 ARG A HH21 1  
ATOM 737   H HH22 . ARG A 1 47 ? 5.420   -5.252  0.987   1.00 0.00 ? 47 ARG A HH22 1  
ATOM 738   N N    . ILE A 1 48 ? 2.626   -10.645 5.755   1.00 0.00 ? 48 ILE A N    1  
ATOM 739   C CA   . ILE A 1 48 ? 1.840   -11.819 6.112   1.00 0.00 ? 48 ILE A CA   1  
ATOM 740   C C    . ILE A 1 48 ? 1.493   -11.817 7.597   1.00 0.00 ? 48 ILE A C    1  
ATOM 741   O O    . ILE A 1 48 ? 0.323   -11.906 7.971   1.00 0.00 ? 48 ILE A O    1  
ATOM 742   C CB   . ILE A 1 48 ? 2.589   -13.122 5.773   1.00 0.00 ? 48 ILE A CB   1  
ATOM 743   C CG1  . ILE A 1 48 ? 2.962   -13.150 4.289   1.00 0.00 ? 48 ILE A CG1  1  
ATOM 744   C CG2  . ILE A 1 48 ? 1.738   -14.330 6.134   1.00 0.00 ? 48 ILE A CG2  1  
ATOM 745   C CD1  . ILE A 1 48 ? 3.822   -14.333 3.905   1.00 0.00 ? 48 ILE A CD1  1  
ATOM 746   H H    . ILE A 1 48 ? 3.569   -10.756 5.511   1.00 0.00 ? 48 ILE A H    1  
ATOM 747   H HA   . ILE A 1 48 ? 0.925   -11.794 5.539   1.00 0.00 ? 48 ILE A HA   1  
ATOM 748   H HB   . ILE A 1 48 ? 3.491   -13.157 6.365   1.00 0.00 ? 48 ILE A HB   1  
ATOM 749   H HG12 . ILE A 1 48 ? 2.061   -13.189 3.698   1.00 0.00 ? 48 ILE A HG12 1  
ATOM 750   H HG13 . ILE A 1 48 ? 3.508   -12.249 4.046   1.00 0.00 ? 48 ILE A HG13 1  
ATOM 751   H HG21 . ILE A 1 48 ? 1.219   -14.681 5.254   1.00 0.00 ? 48 ILE A HG21 1  
ATOM 752   H HG22 . ILE A 1 48 ? 2.374   -15.117 6.513   1.00 0.00 ? 48 ILE A HG22 1  
ATOM 753   H HG23 . ILE A 1 48 ? 1.019   -14.052 6.889   1.00 0.00 ? 48 ILE A HG23 1  
ATOM 754   H HD11 . ILE A 1 48 ? 4.835   -14.168 4.243   1.00 0.00 ? 48 ILE A HD11 1  
ATOM 755   H HD12 . ILE A 1 48 ? 3.430   -15.228 4.363   1.00 0.00 ? 48 ILE A HD12 1  
ATOM 756   H HD13 . ILE A 1 48 ? 3.817   -14.448 2.830   1.00 0.00 ? 48 ILE A HD13 1  
ATOM 757   N N    . ASP A 1 49 ? 2.515   -11.714 8.438   1.00 0.00 ? 49 ASP A N    1  
ATOM 758   C CA   . ASP A 1 49 ? 2.318   -11.698 9.883   1.00 0.00 ? 49 ASP A CA   1  
ATOM 759   C C    . ASP A 1 49 ? 1.195   -10.740 10.267  1.00 0.00 ? 49 ASP A C    1  
ATOM 760   O O    . ASP A 1 49 ? 0.367   -11.049 11.125  1.00 0.00 ? 49 ASP A O    1  
ATOM 761   C CB   . ASP A 1 49 ? 3.613   -11.296 10.591  1.00 0.00 ? 49 ASP A CB   1  
ATOM 762   C CG   . ASP A 1 49 ? 3.652   -11.760 12.034  1.00 0.00 ? 49 ASP A CG   1  
ATOM 763   O OD1  . ASP A 1 49 ? 3.026   -12.796 12.340  1.00 0.00 ? 49 ASP A OD1  1  
ATOM 764   O OD2  . ASP A 1 49 ? 4.308   -11.088 12.856  1.00 0.00 ? 49 ASP A OD2  1  
ATOM 765   H H    . ASP A 1 49 ? 3.425   -11.647 8.079   1.00 0.00 ? 49 ASP A H    1  
ATOM 766   H HA   . ASP A 1 49 ? 2.045   -12.695 10.192  1.00 0.00 ? 49 ASP A HA   1  
ATOM 767   H HB2  . ASP A 1 49 ? 4.452   -11.733 10.069  1.00 0.00 ? 49 ASP A HB2  1  
ATOM 768   H HB3  . ASP A 1 49 ? 3.705   -10.220 10.575  1.00 0.00 ? 49 ASP A HB3  1  
ATOM 769   N N    . LEU A 1 50 ? 1.173   -9.576  9.628   1.00 0.00 ? 50 LEU A N    1  
ATOM 770   C CA   . LEU A 1 50 ? 0.152   -8.571  9.903   1.00 0.00 ? 50 LEU A CA   1  
ATOM 771   C C    . LEU A 1 50 ? -1.228  -9.068  9.485   1.00 0.00 ? 50 LEU A C    1  
ATOM 772   O O    . LEU A 1 50 ? -2.150  -9.127  10.298  1.00 0.00 ? 50 LEU A O    1  
ATOM 773   C CB   . LEU A 1 50 ? 0.480   -7.268  9.172   1.00 0.00 ? 50 LEU A CB   1  
ATOM 774   C CG   . LEU A 1 50 ? -0.691  -6.311  8.947   1.00 0.00 ? 50 LEU A CG   1  
ATOM 775   C CD1  . LEU A 1 50 ? -1.114  -5.667  10.258  1.00 0.00 ? 50 LEU A CD1  1  
ATOM 776   C CD2  . LEU A 1 50 ? -0.322  -5.248  7.923   1.00 0.00 ? 50 LEU A CD2  1  
ATOM 777   H H    . LEU A 1 50 ? 1.859   -9.386  8.955   1.00 0.00 ? 50 LEU A H    1  
ATOM 778   H HA   . LEU A 1 50 ? 0.148   -8.386  10.967  1.00 0.00 ? 50 LEU A HA   1  
ATOM 779   H HB2  . LEU A 1 50 ? 1.228   -6.745  9.748   1.00 0.00 ? 50 LEU A HB2  1  
ATOM 780   H HB3  . LEU A 1 50 ? 0.888   -7.526  8.205   1.00 0.00 ? 50 LEU A HB3  1  
ATOM 781   H HG   . LEU A 1 50 ? -1.534  -6.869  8.563   1.00 0.00 ? 50 LEU A HG   1  
ATOM 782   H HD11 . LEU A 1 50 ? -0.282  -5.672  10.946  1.00 0.00 ? 50 LEU A HD11 1  
ATOM 783   H HD12 . LEU A 1 50 ? -1.936  -6.222  10.684  1.00 0.00 ? 50 LEU A HD12 1  
ATOM 784   H HD13 . LEU A 1 50 ? -1.424  -4.648  10.075  1.00 0.00 ? 50 LEU A HD13 1  
ATOM 785   H HD21 . LEU A 1 50 ? -1.203  -4.965  7.365   1.00 0.00 ? 50 LEU A HD21 1  
ATOM 786   H HD22 . LEU A 1 50 ? 0.421   -5.643  7.246   1.00 0.00 ? 50 LEU A HD22 1  
ATOM 787   H HD23 . LEU A 1 50 ? 0.076   -4.382  8.430   1.00 0.00 ? 50 LEU A HD23 1  
ATOM 788   N N    . ALA A 1 51 ? -1.362  -9.426  8.213   1.00 0.00 ? 51 ALA A N    1  
ATOM 789   C CA   . ALA A 1 51 ? -2.628  -9.923  7.688   1.00 0.00 ? 51 ALA A CA   1  
ATOM 790   C C    . ALA A 1 51 ? -3.220  -10.991 8.601   1.00 0.00 ? 51 ALA A C    1  
ATOM 791   O O    . ALA A 1 51 ? -4.430  -11.215 8.605   1.00 0.00 ? 51 ALA A O    1  
ATOM 792   C CB   . ALA A 1 51 ? -2.437  -10.474 6.283   1.00 0.00 ? 51 ALA A CB   1  
ATOM 793   H H    . ALA A 1 51 ? -0.590  -9.356  7.613   1.00 0.00 ? 51 ALA A H    1  
ATOM 794   H HA   . ALA A 1 51 ? -3.315  -9.091  7.631   1.00 0.00 ? 51 ALA A HA   1  
ATOM 795   H HB1  . ALA A 1 51 ? -2.409  -11.554 6.321   1.00 0.00 ? 51 ALA A HB1  1  
ATOM 796   H HB2  . ALA A 1 51 ? -3.257  -10.157 5.657   1.00 0.00 ? 51 ALA A HB2  1  
ATOM 797   H HB3  . ALA A 1 51 ? -1.508  -10.105 5.875   1.00 0.00 ? 51 ALA A HB3  1  
ATOM 798   N N    . GLU A 1 52 ? -2.359  -11.647 9.373   1.00 0.00 ? 52 GLU A N    1  
ATOM 799   C CA   . GLU A 1 52 ? -2.798  -12.693 10.289  1.00 0.00 ? 52 GLU A CA   1  
ATOM 800   C C    . GLU A 1 52 ? -3.219  -12.099 11.631  1.00 0.00 ? 52 GLU A C    1  
ATOM 801   O O    . GLU A 1 52 ? -4.104  -12.626 12.304  1.00 0.00 ? 52 GLU A O    1  
ATOM 802   C CB   . GLU A 1 52 ? -1.682  -13.718 10.500  1.00 0.00 ? 52 GLU A CB   1  
ATOM 803   C CG   . GLU A 1 52 ? -1.717  -14.868 9.507   1.00 0.00 ? 52 GLU A CG   1  
ATOM 804   C CD   . GLU A 1 52 ? -1.157  -16.154 10.084  1.00 0.00 ? 52 GLU A CD   1  
ATOM 805   O OE1  . GLU A 1 52 ? -0.201  -16.078 10.883  1.00 0.00 ? 52 GLU A OE1  1  
ATOM 806   O OE2  . GLU A 1 52 ? -1.676  -17.235 9.736   1.00 0.00 ? 52 GLU A OE2  1  
ATOM 807   H H    . GLU A 1 52 ? -1.406  -11.422 9.324   1.00 0.00 ? 52 GLU A H    1  
ATOM 808   H HA   . GLU A 1 52 ? -3.649  -13.186 9.845   1.00 0.00 ? 52 GLU A HA   1  
ATOM 809   H HB2  . GLU A 1 52 ? -0.729  -13.219 10.409  1.00 0.00 ? 52 GLU A HB2  1  
ATOM 810   H HB3  . GLU A 1 52 ? -1.771  -14.128 11.496  1.00 0.00 ? 52 GLU A HB3  1  
ATOM 811   H HG2  . GLU A 1 52 ? -2.740  -15.040 9.210   1.00 0.00 ? 52 GLU A HG2  1  
ATOM 812   H HG3  . GLU A 1 52 ? -1.133  -14.595 8.640   1.00 0.00 ? 52 GLU A HG3  1  
ATOM 813   N N    . SER A 1 53 ? -2.576  -11.000 12.012  1.00 0.00 ? 53 SER A N    1  
ATOM 814   C CA   . SER A 1 53 ? -2.880  -10.336 13.275  1.00 0.00 ? 53 SER A CA   1  
ATOM 815   C C    . SER A 1 53 ? -4.220  -9.612  13.199  1.00 0.00 ? 53 SER A C    1  
ATOM 816   O O    . SER A 1 53 ? -5.036  -9.693  14.119  1.00 0.00 ? 53 SER A O    1  
ATOM 817   C CB   . SER A 1 53 ? -1.771  -9.345  13.634  1.00 0.00 ? 53 SER A CB   1  
ATOM 818   O OG   . SER A 1 53 ? -0.700  -9.996  14.296  1.00 0.00 ? 53 SER A OG   1  
ATOM 819   H H    . SER A 1 53 ? -1.879  -10.628 11.432  1.00 0.00 ? 53 SER A H    1  
ATOM 820   H HA   . SER A 1 53 ? -2.936  -11.094 14.042  1.00 0.00 ? 53 SER A HA   1  
ATOM 821   H HB2  . SER A 1 53 ? -1.395  -8.887  12.732  1.00 0.00 ? 53 SER A HB2  1  
ATOM 822   H HB3  . SER A 1 53 ? -2.171  -8.583  14.286  1.00 0.00 ? 53 SER A HB3  1  
ATOM 823   H HG   . SER A 1 53 ? -0.033  -9.350  14.538  1.00 0.00 ? 53 SER A HG   1  
ATOM 824   N N    . LEU A 1 54 ? -4.441  -8.903  12.097  1.00 0.00 ? 54 LEU A N    1  
ATOM 825   C CA   . LEU A 1 54 ? -5.682  -8.163  11.900  1.00 0.00 ? 54 LEU A CA   1  
ATOM 826   C C    . LEU A 1 54 ? -6.740  -9.041  11.237  1.00 0.00 ? 54 LEU A C    1  
ATOM 827   O O    . LEU A 1 54 ? -7.937  -8.786  11.358  1.00 0.00 ? 54 LEU A O    1  
ATOM 828   C CB   . LEU A 1 54 ? -5.428  -6.920  11.046  1.00 0.00 ? 54 LEU A CB   1  
ATOM 829   C CG   . LEU A 1 54 ? -4.531  -5.850  11.670  1.00 0.00 ? 54 LEU A CG   1  
ATOM 830   C CD1  . LEU A 1 54 ? -4.032  -4.885  10.606  1.00 0.00 ? 54 LEU A CD1  1  
ATOM 831   C CD2  . LEU A 1 54 ? -5.277  -5.100  12.764  1.00 0.00 ? 54 LEU A CD2  1  
ATOM 832   H H    . LEU A 1 54 ? -3.754  -8.877  11.400  1.00 0.00 ? 54 LEU A H    1  
ATOM 833   H HA   . LEU A 1 54 ? -6.043  -7.856  12.870  1.00 0.00 ? 54 LEU A HA   1  
ATOM 834   H HB2  . LEU A 1 54 ? -4.967  -7.240  10.124  1.00 0.00 ? 54 LEU A HB2  1  
ATOM 835   H HB3  . LEU A 1 54 ? -6.384  -6.466  10.830  1.00 0.00 ? 54 LEU A HB3  1  
ATOM 836   H HG   . LEU A 1 54 ? -3.670  -6.327  12.117  1.00 0.00 ? 54 LEU A HG   1  
ATOM 837   H HD11 . LEU A 1 54 ? -4.855  -4.284  10.250  1.00 0.00 ? 54 LEU A HD11 1  
ATOM 838   H HD12 . LEU A 1 54 ? -3.612  -5.443  9.782   1.00 0.00 ? 54 LEU A HD12 1  
ATOM 839   H HD13 . LEU A 1 54 ? -3.273  -4.243  11.029  1.00 0.00 ? 54 LEU A HD13 1  
ATOM 840   H HD21 . LEU A 1 54 ? -5.562  -4.124  12.401  1.00 0.00 ? 54 LEU A HD21 1  
ATOM 841   H HD22 . LEU A 1 54 ? -4.635  -4.990  13.627  1.00 0.00 ? 54 LEU A HD22 1  
ATOM 842   H HD23 . LEU A 1 54 ? -6.161  -5.654  13.041  1.00 0.00 ? 54 LEU A HD23 1  
ATOM 843   N N    . GLY A 1 55 ? -6.288  -10.078 10.538  1.00 0.00 ? 55 GLY A N    1  
ATOM 844   C CA   . GLY A 1 55 ? -7.208  -10.979 9.869   1.00 0.00 ? 55 GLY A CA   1  
ATOM 845   C C    . GLY A 1 55 ? -7.477  -10.572 8.434   1.00 0.00 ? 55 GLY A C    1  
ATOM 846   O O    . GLY A 1 55 ? -8.476  -10.982 7.841   1.00 0.00 ? 55 GLY A O    1  
ATOM 847   H H    . GLY A 1 55 ? -5.322  -10.232 10.477  1.00 0.00 ? 55 GLY A H    1  
ATOM 848   H HA2  . GLY A 1 55 ? -6.791  -11.974 9.878   1.00 0.00 ? 55 GLY A HA2  1  
ATOM 849   H HA3  . GLY A 1 55 ? -8.143  -10.986 10.410  1.00 0.00 ? 55 GLY A HA3  1  
ATOM 850   N N    . LEU A 1 56 ? -6.585  -9.762  7.873   1.00 0.00 ? 56 LEU A N    1  
ATOM 851   C CA   . LEU A 1 56 ? -6.732  -9.298  6.498   1.00 0.00 ? 56 LEU A CA   1  
ATOM 852   C C    . LEU A 1 56 ? -5.983  -10.211 5.532   1.00 0.00 ? 56 LEU A C    1  
ATOM 853   O O    . LEU A 1 56 ? -5.293  -11.141 5.950   1.00 0.00 ? 56 LEU A O    1  
ATOM 854   C CB   . LEU A 1 56 ? -6.215  -7.864  6.366   1.00 0.00 ? 56 LEU A CB   1  
ATOM 855   C CG   . LEU A 1 56 ? -7.013  -6.792  7.108   1.00 0.00 ? 56 LEU A CG   1  
ATOM 856   C CD1  . LEU A 1 56 ? -6.281  -5.460  7.071   1.00 0.00 ? 56 LEU A CD1  1  
ATOM 857   C CD2  . LEU A 1 56 ? -8.406  -6.654  6.511   1.00 0.00 ? 56 LEU A CD2  1  
ATOM 858   H H    . LEU A 1 56 ? -5.810  -9.469  8.395   1.00 0.00 ? 56 LEU A H    1  
ATOM 859   H HA   . LEU A 1 56 ? -7.783  -9.318  6.252   1.00 0.00 ? 56 LEU A HA   1  
ATOM 860   H HB2  . LEU A 1 56 ? -5.203  -7.841  6.740   1.00 0.00 ? 56 LEU A HB2  1  
ATOM 861   H HB3  . LEU A 1 56 ? -6.215  -7.609  5.315   1.00 0.00 ? 56 LEU A HB3  1  
ATOM 862   H HG   . LEU A 1 56 ? -7.120  -7.084  8.144   1.00 0.00 ? 56 LEU A HG   1  
ATOM 863   H HD11 . LEU A 1 56 ? -5.629  -5.383  7.928   1.00 0.00 ? 56 LEU A HD11 1  
ATOM 864   H HD12 . LEU A 1 56 ? -6.999  -4.653  7.092   1.00 0.00 ? 56 LEU A HD12 1  
ATOM 865   H HD13 . LEU A 1 56 ? -5.695  -5.396  6.166   1.00 0.00 ? 56 LEU A HD13 1  
ATOM 866   H HD21 . LEU A 1 56 ? -8.912  -7.607  6.554   1.00 0.00 ? 56 LEU A HD21 1  
ATOM 867   H HD22 . LEU A 1 56 ? -8.326  -6.335  5.481   1.00 0.00 ? 56 LEU A HD22 1  
ATOM 868   H HD23 . LEU A 1 56 ? -8.968  -5.922  7.072   1.00 0.00 ? 56 LEU A HD23 1  
ATOM 869   N N    . SER A 1 57 ? -6.123  -9.938  4.239   1.00 0.00 ? 57 SER A N    1  
ATOM 870   C CA   . SER A 1 57 ? -5.462  -10.736 3.213   1.00 0.00 ? 57 SER A CA   1  
ATOM 871   C C    . SER A 1 57 ? -4.205  -10.036 2.707   1.00 0.00 ? 57 SER A C    1  
ATOM 872   O O    . SER A 1 57 ? -4.224  -8.841  2.413   1.00 0.00 ? 57 SER A O    1  
ATOM 873   C CB   . SER A 1 57 ? -6.417  -11.001 2.048   1.00 0.00 ? 57 SER A CB   1  
ATOM 874   O OG   . SER A 1 57 ? -7.409  -11.947 2.406   1.00 0.00 ? 57 SER A OG   1  
ATOM 875   H H    . SER A 1 57 ? -6.687  -9.183  3.969   1.00 0.00 ? 57 SER A H    1  
ATOM 876   H HA   . SER A 1 57 ? -5.180  -11.679 3.658   1.00 0.00 ? 57 SER A HA   1  
ATOM 877   H HB2  . SER A 1 57 ? -6.902  -10.078 1.767   1.00 0.00 ? 57 SER A HB2  1  
ATOM 878   H HB3  . SER A 1 57 ? -5.857  -11.384 1.207   1.00 0.00 ? 57 SER A HB3  1  
ATOM 879   H HG   . SER A 1 57 ? -7.909  -12.198 1.626   1.00 0.00 ? 57 SER A HG   1  
ATOM 880   N N    . GLN A 1 58 ? -3.115  -10.789 2.607   1.00 0.00 ? 58 GLN A N    1  
ATOM 881   C CA   . GLN A 1 58 ? -1.848  -10.241 2.136   1.00 0.00 ? 58 GLN A CA   1  
ATOM 882   C C    . GLN A 1 58 ? -2.078  -9.188  1.057   1.00 0.00 ? 58 GLN A C    1  
ATOM 883   O O    . GLN A 1 58 ? -1.446  -8.131  1.061   1.00 0.00 ? 58 GLN A O    1  
ATOM 884   C CB   . GLN A 1 58 ? -0.955  -11.358 1.593   1.00 0.00 ? 58 GLN A CB   1  
ATOM 885   C CG   . GLN A 1 58 ? -0.603  -12.413 2.630   1.00 0.00 ? 58 GLN A CG   1  
ATOM 886   C CD   . GLN A 1 58 ? -0.081  -13.692 2.006   1.00 0.00 ? 58 GLN A CD   1  
ATOM 887   O OE1  . GLN A 1 58 ? -0.801  -14.686 1.905   1.00 0.00 ? 58 GLN A OE1  1  
ATOM 888   N NE2  . GLN A 1 58 ? 1.177   -13.675 1.582   1.00 0.00 ? 58 GLN A NE2  1  
ATOM 889   H H    . GLN A 1 58 ? -3.163  -11.735 2.855   1.00 0.00 ? 58 GLN A H    1  
ATOM 890   H HA   . GLN A 1 58 ? -1.356  -9.775  2.977   1.00 0.00 ? 58 GLN A HA   1  
ATOM 891   H HB2  . GLN A 1 58 ? -1.464  -11.844 0.774   1.00 0.00 ? 58 GLN A HB2  1  
ATOM 892   H HB3  . GLN A 1 58 ? -0.036  -10.923 1.229   1.00 0.00 ? 58 GLN A HB3  1  
ATOM 893   H HG2  . GLN A 1 58 ? 0.157   -12.015 3.286   1.00 0.00 ? 58 GLN A HG2  1  
ATOM 894   H HG3  . GLN A 1 58 ? -1.488  -12.644 3.204   1.00 0.00 ? 58 GLN A HG3  1  
ATOM 895   H HE21 . GLN A 1 58 ? 1.692   -12.848 1.696   1.00 0.00 ? 58 GLN A HE21 1  
ATOM 896   H HE22 . GLN A 1 58 ? 1.540   -14.488 1.176   1.00 0.00 ? 58 GLN A HE22 1  
ATOM 897   N N    . LEU A 1 59 ? -2.987  -9.483  0.134   1.00 0.00 ? 59 LEU A N    1  
ATOM 898   C CA   . LEU A 1 59 ? -3.300  -8.562  -0.953  1.00 0.00 ? 59 LEU A CA   1  
ATOM 899   C C    . LEU A 1 59 ? -3.704  -7.195  -0.409  1.00 0.00 ? 59 LEU A C    1  
ATOM 900   O O    . LEU A 1 59 ? -3.240  -6.163  -0.893  1.00 0.00 ? 59 LEU A O    1  
ATOM 901   C CB   . LEU A 1 59 ? -4.425  -9.130  -1.821  1.00 0.00 ? 59 LEU A CB   1  
ATOM 902   C CG   . LEU A 1 59 ? -4.883  -8.251  -2.985  1.00 0.00 ? 59 LEU A CG   1  
ATOM 903   C CD1  . LEU A 1 59 ? -3.774  -8.108  -4.015  1.00 0.00 ? 59 LEU A CD1  1  
ATOM 904   C CD2  . LEU A 1 59 ? -6.137  -8.827  -3.626  1.00 0.00 ? 59 LEU A CD2  1  
ATOM 905   H H    . LEU A 1 59 ? -3.458  -10.341 0.183   1.00 0.00 ? 59 LEU A H    1  
ATOM 906   H HA   . LEU A 1 59 ? -2.413  -8.448  -1.557  1.00 0.00 ? 59 LEU A HA   1  
ATOM 907   H HB2  . LEU A 1 59 ? -4.084  -10.069 -2.230  1.00 0.00 ? 59 LEU A HB2  1  
ATOM 908   H HB3  . LEU A 1 59 ? -5.278  -9.306  -1.182  1.00 0.00 ? 59 LEU A HB3  1  
ATOM 909   H HG   . LEU A 1 59 ? -5.120  -7.264  -2.611  1.00 0.00 ? 59 LEU A HG   1  
ATOM 910   H HD11 . LEU A 1 59 ? -2.839  -8.433  -3.585  1.00 0.00 ? 59 LEU A HD11 1  
ATOM 911   H HD12 . LEU A 1 59 ? -3.692  -7.073  -4.314  1.00 0.00 ? 59 LEU A HD12 1  
ATOM 912   H HD13 . LEU A 1 59 ? -4.004  -8.714  -4.879  1.00 0.00 ? 59 LEU A HD13 1  
ATOM 913   H HD21 . LEU A 1 59 ? -6.806  -9.179  -2.855  1.00 0.00 ? 59 LEU A HD21 1  
ATOM 914   H HD22 . LEU A 1 59 ? -5.866  -9.651  -4.271  1.00 0.00 ? 59 LEU A HD22 1  
ATOM 915   H HD23 . LEU A 1 59 ? -6.629  -8.061  -4.208  1.00 0.00 ? 59 LEU A HD23 1  
ATOM 916   N N    . GLN A 1 60 ? -4.568  -7.198  0.601   1.00 0.00 ? 60 GLN A N    1  
ATOM 917   C CA   . GLN A 1 60 ? -5.032  -5.958  1.212   1.00 0.00 ? 60 GLN A CA   1  
ATOM 918   C C    . GLN A 1 60 ? -3.871  -4.995  1.440   1.00 0.00 ? 60 GLN A C    1  
ATOM 919   O O    . GLN A 1 60 ? -3.818  -3.918  0.846   1.00 0.00 ? 60 GLN A O    1  
ATOM 920   C CB   . GLN A 1 60 ? -5.735  -6.250  2.539   1.00 0.00 ? 60 GLN A CB   1  
ATOM 921   C CG   . GLN A 1 60 ? -7.044  -7.006  2.379   1.00 0.00 ? 60 GLN A CG   1  
ATOM 922   C CD   . GLN A 1 60 ? -8.185  -6.110  1.939   1.00 0.00 ? 60 GLN A CD   1  
ATOM 923   O OE1  . GLN A 1 60 ? -8.118  -5.470  0.889   1.00 0.00 ? 60 GLN A OE1  1  
ATOM 924   N NE2  . GLN A 1 60 ? -9.243  -6.060  2.740   1.00 0.00 ? 60 GLN A NE2  1  
ATOM 925   H H    . GLN A 1 60 ? -4.901  -8.053  0.943   1.00 0.00 ? 60 GLN A H    1  
ATOM 926   H HA   . GLN A 1 60 ? -5.736  -5.498  0.535   1.00 0.00 ? 60 GLN A HA   1  
ATOM 927   H HB2  . GLN A 1 60 ? -5.077  -6.839  3.159   1.00 0.00 ? 60 GLN A HB2  1  
ATOM 928   H HB3  . GLN A 1 60 ? -5.943  -5.314  3.036   1.00 0.00 ? 60 GLN A HB3  1  
ATOM 929   H HG2  . GLN A 1 60 ? -6.910  -7.781  1.640   1.00 0.00 ? 60 GLN A HG2  1  
ATOM 930   H HG3  . GLN A 1 60 ? -7.303  -7.454  3.327   1.00 0.00 ? 60 GLN A HG3  1  
ATOM 931   H HE21 . GLN A 1 60 ? -9.226  -6.596  3.561   1.00 0.00 ? 60 GLN A HE21 1  
ATOM 932   H HE22 . GLN A 1 60 ? -9.994  -5.489  2.480   1.00 0.00 ? 60 GLN A HE22 1  
ATOM 933   N N    . VAL A 1 61 ? -2.941  -5.391  2.304   1.00 0.00 ? 61 VAL A N    1  
ATOM 934   C CA   . VAL A 1 61 ? -1.780  -4.564  2.610   1.00 0.00 ? 61 VAL A CA   1  
ATOM 935   C C    . VAL A 1 61 ? -1.103  -4.074  1.334   1.00 0.00 ? 61 VAL A C    1  
ATOM 936   O O    . VAL A 1 61 ? -0.887  -2.875  1.154   1.00 0.00 ? 61 VAL A O    1  
ATOM 937   C CB   . VAL A 1 61 ? -0.752  -5.332  3.461   1.00 0.00 ? 61 VAL A CB   1  
ATOM 938   C CG1  . VAL A 1 61 ? 0.352   -4.400  3.936   1.00 0.00 ? 61 VAL A CG1  1  
ATOM 939   C CG2  . VAL A 1 61 ? -1.436  -6.008  4.640   1.00 0.00 ? 61 VAL A CG2  1  
ATOM 940   H H    . VAL A 1 61 ? -3.039  -6.260  2.746   1.00 0.00 ? 61 VAL A H    1  
ATOM 941   H HA   . VAL A 1 61 ? -2.119  -3.709  3.177   1.00 0.00 ? 61 VAL A HA   1  
ATOM 942   H HB   . VAL A 1 61 ? -0.305  -6.098  2.844   1.00 0.00 ? 61 VAL A HB   1  
ATOM 943   H HG11 . VAL A 1 61 ? 1.296   -4.925  3.925   1.00 0.00 ? 61 VAL A HG11 1  
ATOM 944   H HG12 . VAL A 1 61 ? 0.407   -3.543  3.281   1.00 0.00 ? 61 VAL A HG12 1  
ATOM 945   H HG13 . VAL A 1 61 ? 0.136   -4.071  4.942   1.00 0.00 ? 61 VAL A HG13 1  
ATOM 946   H HG21 . VAL A 1 61 ? -1.577  -7.056  4.422   1.00 0.00 ? 61 VAL A HG21 1  
ATOM 947   H HG22 . VAL A 1 61 ? -0.820  -5.904  5.522   1.00 0.00 ? 61 VAL A HG22 1  
ATOM 948   H HG23 . VAL A 1 61 ? -2.395  -5.543  4.815   1.00 0.00 ? 61 VAL A HG23 1  
ATOM 949   N N    . LYS A 1 62 ? -0.771  -5.009  0.451   1.00 0.00 ? 62 LYS A N    1  
ATOM 950   C CA   . LYS A 1 62 ? -0.120  -4.674  -0.810  1.00 0.00 ? 62 LYS A CA   1  
ATOM 951   C C    . LYS A 1 62 ? -0.870  -3.558  -1.530  1.00 0.00 ? 62 LYS A C    1  
ATOM 952   O O    . LYS A 1 62 ? -0.326  -2.477  -1.760  1.00 0.00 ? 62 LYS A O    1  
ATOM 953   C CB   . LYS A 1 62 ? -0.037  -5.910  -1.709  1.00 0.00 ? 62 LYS A CB   1  
ATOM 954   C CG   . LYS A 1 62 ? 1.162   -5.904  -2.641  1.00 0.00 ? 62 LYS A CG   1  
ATOM 955   C CD   . LYS A 1 62 ? 1.040   -6.974  -3.713  1.00 0.00 ? 62 LYS A CD   1  
ATOM 956   C CE   . LYS A 1 62 ? 0.159   -6.513  -4.864  1.00 0.00 ? 62 LYS A CE   1  
ATOM 957   N NZ   . LYS A 1 62 ? -0.405  -7.661  -5.625  1.00 0.00 ? 62 LYS A NZ   1  
ATOM 958   H H    . LYS A 1 62 ? -0.970  -5.948  0.651   1.00 0.00 ? 62 LYS A H    1  
ATOM 959   H HA   . LYS A 1 62 ? 0.880   -4.334  -0.587  1.00 0.00 ? 62 LYS A HA   1  
ATOM 960   H HB2  . LYS A 1 62 ? 0.022   -6.790  -1.086  1.00 0.00 ? 62 LYS A HB2  1  
ATOM 961   H HB3  . LYS A 1 62 ? -0.933  -5.964  -2.310  1.00 0.00 ? 62 LYS A HB3  1  
ATOM 962   H HG2  . LYS A 1 62 ? 1.232   -4.938  -3.119  1.00 0.00 ? 62 LYS A HG2  1  
ATOM 963   H HG3  . LYS A 1 62 ? 2.057   -6.087  -2.063  1.00 0.00 ? 62 LYS A HG3  1  
ATOM 964   H HD2  . LYS A 1 62 ? 2.024   -7.201  -4.097  1.00 0.00 ? 62 LYS A HD2  1  
ATOM 965   H HD3  . LYS A 1 62 ? 0.609   -7.863  -3.274  1.00 0.00 ? 62 LYS A HD3  1  
ATOM 966   H HE2  . LYS A 1 62 ? -0.652  -5.924  -4.464  1.00 0.00 ? 62 LYS A HE2  1  
ATOM 967   H HE3  . LYS A 1 62 ? 0.751   -5.904  -5.531  1.00 0.00 ? 62 LYS A HE3  1  
ATOM 968   H HZ1  . LYS A 1 62 ? 0.150   -7.823  -6.491  1.00 0.00 ? 62 LYS A HZ1  1  
ATOM 969   H HZ2  . LYS A 1 62 ? -1.391  -7.464  -5.891  1.00 0.00 ? 62 LYS A HZ2  1  
ATOM 970   H HZ3  . LYS A 1 62 ? -0.380  -8.523  -5.044  1.00 0.00 ? 62 LYS A HZ3  1  
ATOM 971   N N    . THR A 1 63 ? -2.124  -3.825  -1.883  1.00 0.00 ? 63 THR A N    1  
ATOM 972   C CA   . THR A 1 63 ? -2.948  -2.844  -2.576  1.00 0.00 ? 63 THR A CA   1  
ATOM 973   C C    . THR A 1 63 ? -3.148  -1.594  -1.726  1.00 0.00 ? 63 THR A C    1  
ATOM 974   O O    . THR A 1 63 ? -2.683  -0.511  -2.081  1.00 0.00 ? 63 THR A O    1  
ATOM 975   C CB   . THR A 1 63 ? -4.326  -3.427  -2.943  1.00 0.00 ? 63 THR A CB   1  
ATOM 976   O OG1  . THR A 1 63 ? -4.164  -4.588  -3.765  1.00 0.00 ? 63 THR A OG1  1  
ATOM 977   C CG2  . THR A 1 63 ? -5.173  -2.396  -3.674  1.00 0.00 ? 63 THR A CG2  1  
ATOM 978   H H    . THR A 1 63 ? -2.501  -4.705  -1.672  1.00 0.00 ? 63 THR A H    1  
ATOM 979   H HA   . THR A 1 63 ? -2.442  -2.569  -3.490  1.00 0.00 ? 63 THR A HA   1  
ATOM 980   H HB   . THR A 1 63 ? -4.835  -3.708  -2.032  1.00 0.00 ? 63 THR A HB   1  
ATOM 981   H HG1  . THR A 1 63 ? -4.427  -5.369  -3.273  1.00 0.00 ? 63 THR A HG1  1  
ATOM 982   H HG21 . THR A 1 63 ? -5.164  -2.608  -4.733  1.00 0.00 ? 63 THR A HG21 1  
ATOM 983   H HG22 . THR A 1 63 ? -4.769  -1.410  -3.500  1.00 0.00 ? 63 THR A HG22 1  
ATOM 984   H HG23 . THR A 1 63 ? -6.187  -2.439  -3.307  1.00 0.00 ? 63 THR A HG23 1  
ATOM 985   N N    . TRP A 1 64 ? -3.840  -1.753  -0.604  1.00 0.00 ? 64 TRP A N    1  
ATOM 986   C CA   . TRP A 1 64 ? -4.100  -0.636  0.297   1.00 0.00 ? 64 TRP A CA   1  
ATOM 987   C C    . TRP A 1 64 ? -2.892  0.291   0.379   1.00 0.00 ? 64 TRP A C    1  
ATOM 988   O O    . TRP A 1 64 ? -3.028  1.512   0.297   1.00 0.00 ? 64 TRP A O    1  
ATOM 989   C CB   . TRP A 1 64 ? -4.458  -1.152  1.692   1.00 0.00 ? 64 TRP A CB   1  
ATOM 990   C CG   . TRP A 1 64 ? -4.997  -0.087  2.599   1.00 0.00 ? 64 TRP A CG   1  
ATOM 991   C CD1  . TRP A 1 64 ? -6.248  0.461   2.566   1.00 0.00 ? 64 TRP A CD1  1  
ATOM 992   C CD2  . TRP A 1 64 ? -4.302  0.558   3.671   1.00 0.00 ? 64 TRP A CD2  1  
ATOM 993   N NE1  . TRP A 1 64 ? -6.372  1.409   3.553   1.00 0.00 ? 64 TRP A NE1  1  
ATOM 994   C CE2  . TRP A 1 64 ? -5.192  1.486   4.246   1.00 0.00 ? 64 TRP A CE2  1  
ATOM 995   C CE3  . TRP A 1 64 ? -3.016  0.440   4.204   1.00 0.00 ? 64 TRP A CE3  1  
ATOM 996   C CZ2  . TRP A 1 64 ? -4.835  2.291   5.324   1.00 0.00 ? 64 TRP A CZ2  1  
ATOM 997   C CZ3  . TRP A 1 64 ? -2.662  1.240   5.274   1.00 0.00 ? 64 TRP A CZ3  1  
ATOM 998   C CH2  . TRP A 1 64 ? -3.569  2.155   5.825   1.00 0.00 ? 64 TRP A CH2  1  
ATOM 999   H H    . TRP A 1 64 ? -4.185  -2.641  -0.376  1.00 0.00 ? 64 TRP A H    1  
ATOM 1000  H HA   . TRP A 1 64 ? -4.939  -0.081  -0.097  1.00 0.00 ? 64 TRP A HA   1  
ATOM 1001  H HB2  . TRP A 1 64 ? -5.207  -1.924  1.602   1.00 0.00 ? 64 TRP A HB2  1  
ATOM 1002  H HB3  . TRP A 1 64 ? -3.572  -1.565  2.152   1.00 0.00 ? 64 TRP A HB3  1  
ATOM 1003  H HD1  . TRP A 1 64 ? -7.015  0.183   1.860   1.00 0.00 ? 64 TRP A HD1  1  
ATOM 1004  H HE1  . TRP A 1 64 ? -7.175  1.941   3.733   1.00 0.00 ? 64 TRP A HE1  1  
ATOM 1005  H HE3  . TRP A 1 64 ? -2.303  -0.259  3.793   1.00 0.00 ? 64 TRP A HE3  1  
ATOM 1006  H HZ2  . TRP A 1 64 ? -5.522  3.001   5.761   1.00 0.00 ? 64 TRP A HZ2  1  
ATOM 1007  H HZ3  . TRP A 1 64 ? -1.672  1.164   5.698   1.00 0.00 ? 64 TRP A HZ3  1  
ATOM 1008  H HH2  . TRP A 1 64 ? -3.249  2.759   6.660   1.00 0.00 ? 64 TRP A HH2  1  
ATOM 1009  N N    . TYR A 1 65 ? -1.712  -0.297  0.539   1.00 0.00 ? 65 TYR A N    1  
ATOM 1010  C CA   . TYR A 1 65 ? -0.479  0.477   0.634   1.00 0.00 ? 65 TYR A CA   1  
ATOM 1011  C C    . TYR A 1 65 ? -0.287  1.348   -0.603  1.00 0.00 ? 65 TYR A C    1  
ATOM 1012  O O    . TYR A 1 65 ? -0.393  2.573   -0.536  1.00 0.00 ? 65 TYR A O    1  
ATOM 1013  C CB   . TYR A 1 65 ? 0.721   -0.455  0.807   1.00 0.00 ? 65 TYR A CB   1  
ATOM 1014  C CG   . TYR A 1 65 ? 1.049   -0.758  2.251   1.00 0.00 ? 65 TYR A CG   1  
ATOM 1015  C CD1  . TYR A 1 65 ? 0.067   -1.197  3.130   1.00 0.00 ? 65 TYR A CD1  1  
ATOM 1016  C CD2  . TYR A 1 65 ? 2.342   -0.606  2.737   1.00 0.00 ? 65 TYR A CD2  1  
ATOM 1017  C CE1  . TYR A 1 65 ? 0.362   -1.474  4.451   1.00 0.00 ? 65 TYR A CE1  1  
ATOM 1018  C CE2  . TYR A 1 65 ? 2.647   -0.883  4.056   1.00 0.00 ? 65 TYR A CE2  1  
ATOM 1019  C CZ   . TYR A 1 65 ? 1.654   -1.316  4.909   1.00 0.00 ? 65 TYR A CZ   1  
ATOM 1020  O OH   . TYR A 1 65 ? 1.952   -1.593  6.223   1.00 0.00 ? 65 TYR A OH   1  
ATOM 1021  H H    . TYR A 1 65 ? -1.667  -1.274  0.598   1.00 0.00 ? 65 TYR A H    1  
ATOM 1022  H HA   . TYR A 1 65 ? -0.555  1.116   1.502   1.00 0.00 ? 65 TYR A HA   1  
ATOM 1023  H HB2  . TYR A 1 65 ? 0.516   -1.391  0.311   1.00 0.00 ? 65 TYR A HB2  1  
ATOM 1024  H HB3  . TYR A 1 65 ? 1.591   0.002   0.358   1.00 0.00 ? 65 TYR A HB3  1  
ATOM 1025  H HD1  . TYR A 1 65 ? -0.944  -1.320  2.768   1.00 0.00 ? 65 TYR A HD1  1  
ATOM 1026  H HD2  . TYR A 1 65 ? 3.118   -0.267  2.066   1.00 0.00 ? 65 TYR A HD2  1  
ATOM 1027  H HE1  . TYR A 1 65 ? -0.415  -1.814  5.119   1.00 0.00 ? 65 TYR A HE1  1  
ATOM 1028  H HE2  . TYR A 1 65 ? 3.658   -0.759  4.415   1.00 0.00 ? 65 TYR A HE2  1  
ATOM 1029  H HH   . TYR A 1 65 ? 1.168   -1.925  6.666   1.00 0.00 ? 65 TYR A HH   1  
ATOM 1030  N N    . GLN A 1 66 ? -0.004  0.707   -1.733  1.00 0.00 ? 66 GLN A N    1  
ATOM 1031  C CA   . GLN A 1 66 ? 0.204   1.423   -2.986  1.00 0.00 ? 66 GLN A CA   1  
ATOM 1032  C C    . GLN A 1 66 ? -0.723  2.630   -3.083  1.00 0.00 ? 66 GLN A C    1  
ATOM 1033  O O    . GLN A 1 66 ? -0.277  3.749   -3.333  1.00 0.00 ? 66 GLN A O    1  
ATOM 1034  C CB   . GLN A 1 66 ? -0.029  0.489   -4.175  1.00 0.00 ? 66 GLN A CB   1  
ATOM 1035  C CG   . GLN A 1 66 ? 1.208   -0.296  -4.583  1.00 0.00 ? 66 GLN A CG   1  
ATOM 1036  C CD   . GLN A 1 66 ? 0.924   -1.302  -5.681  1.00 0.00 ? 66 GLN A CD   1  
ATOM 1037  O OE1  . GLN A 1 66 ? 0.971   -0.973  -6.867  1.00 0.00 ? 66 GLN A OE1  1  
ATOM 1038  N NE2  . GLN A 1 66 ? 0.628   -2.536  -5.291  1.00 0.00 ? 66 GLN A NE2  1  
ATOM 1039  H H    . GLN A 1 66 ? 0.068   -0.270  -1.722  1.00 0.00 ? 66 GLN A H    1  
ATOM 1040  H HA   . GLN A 1 66 ? 1.226   1.767   -3.005  1.00 0.00 ? 66 GLN A HA   1  
ATOM 1041  H HB2  . GLN A 1 66 ? -0.807  -0.214  -3.919  1.00 0.00 ? 66 GLN A HB2  1  
ATOM 1042  H HB3  . GLN A 1 66 ? -0.350  1.078   -5.022  1.00 0.00 ? 66 GLN A HB3  1  
ATOM 1043  H HG2  . GLN A 1 66 ? 1.958   0.396   -4.936  1.00 0.00 ? 66 GLN A HG2  1  
ATOM 1044  H HG3  . GLN A 1 66 ? 1.584   -0.824  -3.719  1.00 0.00 ? 66 GLN A HG3  1  
ATOM 1045  H HE21 . GLN A 1 66 ? 0.608   -2.725  -4.329  1.00 0.00 ? 66 GLN A HE21 1  
ATOM 1046  H HE22 . GLN A 1 66 ? 0.440   -3.206  -5.980  1.00 0.00 ? 66 GLN A HE22 1  
ATOM 1047  N N    . ASN A 1 67 ? -2.016  2.395   -2.884  1.00 0.00 ? 67 ASN A N    1  
ATOM 1048  C CA   . ASN A 1 67 ? -3.006  3.463   -2.951  1.00 0.00 ? 67 ASN A CA   1  
ATOM 1049  C C    . ASN A 1 67 ? -2.649  4.596   -1.993  1.00 0.00 ? 67 ASN A C    1  
ATOM 1050  O O    . ASN A 1 67 ? -2.716  5.771   -2.353  1.00 0.00 ? 67 ASN A O    1  
ATOM 1051  C CB   . ASN A 1 67 ? -4.397  2.919   -2.619  1.00 0.00 ? 67 ASN A CB   1  
ATOM 1052  C CG   . ASN A 1 67 ? -4.983  2.100   -3.753  1.00 0.00 ? 67 ASN A CG   1  
ATOM 1053  O OD1  . ASN A 1 67 ? -4.678  2.332   -4.923  1.00 0.00 ? 67 ASN A OD1  1  
ATOM 1054  N ND2  . ASN A 1 67 ? -5.829  1.136   -3.411  1.00 0.00 ? 67 ASN A ND2  1  
ATOM 1055  H H    . ASN A 1 67 ? -2.311  1.481   -2.688  1.00 0.00 ? 67 ASN A H    1  
ATOM 1056  H HA   . ASN A 1 67 ? -3.011  3.849   -3.959  1.00 0.00 ? 67 ASN A HA   1  
ATOM 1057  H HB2  . ASN A 1 67 ? -4.332  2.290   -1.743  1.00 0.00 ? 67 ASN A HB2  1  
ATOM 1058  H HB3  . ASN A 1 67 ? -5.062  3.745   -2.415  1.00 0.00 ? 67 ASN A HB3  1  
ATOM 1059  H HD21 . ASN A 1 67 ? -6.026  1.008   -2.459  1.00 0.00 ? 67 ASN A HD21 1  
ATOM 1060  H HD22 . ASN A 1 67 ? -6.222  0.591   -4.124  1.00 0.00 ? 67 ASN A HD22 1  
ATOM 1061  N N    . ARG A 1 68 ? -2.270  4.233   -0.772  1.00 0.00 ? 68 ARG A N    1  
ATOM 1062  C CA   . ARG A 1 68 ? -1.903  5.219   0.238   1.00 0.00 ? 68 ARG A CA   1  
ATOM 1063  C C    . ARG A 1 68 ? -0.708  6.049   -0.221  1.00 0.00 ? 68 ARG A C    1  
ATOM 1064  O O    . ARG A 1 68 ? -0.722  7.277   -0.132  1.00 0.00 ? 68 ARG A O    1  
ATOM 1065  C CB   . ARG A 1 68 ? -1.577  4.526   1.563   1.00 0.00 ? 68 ARG A CB   1  
ATOM 1066  C CG   . ARG A 1 68 ? -2.804  4.029   2.309   1.00 0.00 ? 68 ARG A CG   1  
ATOM 1067  C CD   . ARG A 1 68 ? -3.521  5.166   3.020   1.00 0.00 ? 68 ARG A CD   1  
ATOM 1068  N NE   . ARG A 1 68 ? -4.862  4.782   3.453   1.00 0.00 ? 68 ARG A NE   1  
ATOM 1069  C CZ   . ARG A 1 68 ? -5.644  5.556   4.197   1.00 0.00 ? 68 ARG A CZ   1  
ATOM 1070  N NH1  . ARG A 1 68 ? -5.221  6.750   4.589   1.00 0.00 ? 68 ARG A NH1  1  
ATOM 1071  N NH2  . ARG A 1 68 ? -6.852  5.137   4.551   1.00 0.00 ? 68 ARG A NH2  1  
ATOM 1072  H H    . ARG A 1 68 ? -2.236  3.281   -0.544  1.00 0.00 ? 68 ARG A H    1  
ATOM 1073  H HA   . ARG A 1 68 ? -2.748  5.875   0.384   1.00 0.00 ? 68 ARG A HA   1  
ATOM 1074  H HB2  . ARG A 1 68 ? -0.937  3.678   1.364   1.00 0.00 ? 68 ARG A HB2  1  
ATOM 1075  H HB3  . ARG A 1 68 ? -1.052  5.222   2.200   1.00 0.00 ? 68 ARG A HB3  1  
ATOM 1076  H HG2  . ARG A 1 68 ? -3.485  3.576   1.603   1.00 0.00 ? 68 ARG A HG2  1  
ATOM 1077  H HG3  . ARG A 1 68 ? -2.498  3.295   3.039   1.00 0.00 ? 68 ARG A HG3  1  
ATOM 1078  H HD2  . ARG A 1 68 ? -2.943  5.453   3.886   1.00 0.00 ? 68 ARG A HD2  1  
ATOM 1079  H HD3  . ARG A 1 68 ? -3.597  6.005   2.344   1.00 0.00 ? 68 ARG A HD3  1  
ATOM 1080  H HE   . ARG A 1 68 ? -5.195  3.904   3.175   1.00 0.00 ? 68 ARG A HE   1  
ATOM 1081  H HH11 . ARG A 1 68 ? -4.312  7.070   4.323   1.00 0.00 ? 68 ARG A HH11 1  
ATOM 1082  H HH12 . ARG A 1 68 ? -5.812  7.332   5.148   1.00 0.00 ? 68 ARG A HH12 1  
ATOM 1083  H HH21 . ARG A 1 68 ? -7.175  4.237   4.258   1.00 0.00 ? 68 ARG A HH21 1  
ATOM 1084  H HH22 . ARG A 1 68 ? -7.440  5.720   5.111   1.00 0.00 ? 68 ARG A HH22 1  
ATOM 1085  N N    . ARG A 1 69 ? 0.324   5.371   -0.712  1.00 0.00 ? 69 ARG A N    1  
ATOM 1086  C CA   . ARG A 1 69 ? 1.527   6.046   -1.183  1.00 0.00 ? 69 ARG A CA   1  
ATOM 1087  C C    . ARG A 1 69 ? 1.172   7.304   -1.970  1.00 0.00 ? 69 ARG A C    1  
ATOM 1088  O O    . ARG A 1 69 ? 1.654   8.395   -1.666  1.00 0.00 ? 69 ARG A O    1  
ATOM 1089  C CB   . ARG A 1 69 ? 2.357   5.103   -2.056  1.00 0.00 ? 69 ARG A CB   1  
ATOM 1090  C CG   . ARG A 1 69 ? 2.939   3.923   -1.296  1.00 0.00 ? 69 ARG A CG   1  
ATOM 1091  C CD   . ARG A 1 69 ? 3.675   2.970   -2.225  1.00 0.00 ? 69 ARG A CD   1  
ATOM 1092  N NE   . ARG A 1 69 ? 4.922   3.544   -2.723  1.00 0.00 ? 69 ARG A NE   1  
ATOM 1093  C CZ   . ARG A 1 69 ? 5.735   2.917   -3.565  1.00 0.00 ? 69 ARG A CZ   1  
ATOM 1094  N NH1  . ARG A 1 69 ? 5.434   1.702   -4.002  1.00 0.00 ? 69 ARG A NH1  1  
ATOM 1095  N NH2  . ARG A 1 69 ? 6.852   3.505   -3.973  1.00 0.00 ? 69 ARG A NH2  1  
ATOM 1096  H H    . ARG A 1 69 ? 0.276   4.393   -0.757  1.00 0.00 ? 69 ARG A H    1  
ATOM 1097  H HA   . ARG A 1 69 ? 2.110   6.328   -0.319  1.00 0.00 ? 69 ARG A HA   1  
ATOM 1098  H HB2  . ARG A 1 69 ? 1.731   4.719   -2.848  1.00 0.00 ? 69 ARG A HB2  1  
ATOM 1099  H HB3  . ARG A 1 69 ? 3.173   5.660   -2.492  1.00 0.00 ? 69 ARG A HB3  1  
ATOM 1100  H HG2  . ARG A 1 69 ? 3.632   4.291   -0.554  1.00 0.00 ? 69 ARG A HG2  1  
ATOM 1101  H HG3  . ARG A 1 69 ? 2.137   3.390   -0.809  1.00 0.00 ? 69 ARG A HG3  1  
ATOM 1102  H HD2  . ARG A 1 69 ? 3.899   2.062   -1.684  1.00 0.00 ? 69 ARG A HD2  1  
ATOM 1103  H HD3  . ARG A 1 69 ? 3.035   2.740   -3.063  1.00 0.00 ? 69 ARG A HD3  1  
ATOM 1104  H HE   . ARG A 1 69 ? 5.164   4.441   -2.413  1.00 0.00 ? 69 ARG A HE   1  
ATOM 1105  H HH11 . ARG A 1 69 ? 4.592   1.256   -3.697  1.00 0.00 ? 69 ARG A HH11 1  
ATOM 1106  H HH12 . ARG A 1 69 ? 6.047   1.232   -4.637  1.00 0.00 ? 69 ARG A HH12 1  
ATOM 1107  H HH21 . ARG A 1 69 ? 7.082   4.422   -3.646  1.00 0.00 ? 69 ARG A HH21 1  
ATOM 1108  H HH22 . ARG A 1 69 ? 7.464   3.033   -4.607  1.00 0.00 ? 69 ARG A HH22 1  
ATOM 1109  N N    . MET A 1 70 ? 0.326   7.144   -2.982  1.00 0.00 ? 70 MET A N    1  
ATOM 1110  C CA   . MET A 1 70 ? -0.094  8.267   -3.812  1.00 0.00 ? 70 MET A CA   1  
ATOM 1111  C C    . MET A 1 70 ? -0.242  9.535   -2.976  1.00 0.00 ? 70 MET A C    1  
ATOM 1112  O O    . MET A 1 70 ? 0.466   10.518  -3.190  1.00 0.00 ? 70 MET A O    1  
ATOM 1113  C CB   . MET A 1 70 ? -1.416  7.946   -4.511  1.00 0.00 ? 70 MET A CB   1  
ATOM 1114  C CG   . MET A 1 70 ? -1.284  6.908   -5.613  1.00 0.00 ? 70 MET A CG   1  
ATOM 1115  S SD   . MET A 1 70 ? -0.810  7.631   -7.196  1.00 0.00 ? 70 MET A SD   1  
ATOM 1116  C CE   . MET A 1 70 ? 0.011   6.240   -7.971  1.00 0.00 ? 70 MET A CE   1  
ATOM 1117  H H    . MET A 1 70 ? -0.025  6.249   -3.176  1.00 0.00 ? 70 MET A H    1  
ATOM 1118  H HA   . MET A 1 70 ? 0.668   8.430   -4.559  1.00 0.00 ? 70 MET A HA   1  
ATOM 1119  H HB2  . MET A 1 70 ? -2.117  7.574   -3.778  1.00 0.00 ? 70 MET A HB2  1  
ATOM 1120  H HB3  . MET A 1 70 ? -1.810  8.853   -4.946  1.00 0.00 ? 70 MET A HB3  1  
ATOM 1121  H HG2  . MET A 1 70 ? -0.533  6.188   -5.324  1.00 0.00 ? 70 MET A HG2  1  
ATOM 1122  H HG3  . MET A 1 70 ? -2.233  6.406   -5.732  1.00 0.00 ? 70 MET A HG3  1  
ATOM 1123  H HE1  . MET A 1 70 ? 1.080   6.346   -7.860  1.00 0.00 ? 70 MET A HE1  1  
ATOM 1124  H HE2  . MET A 1 70 ? -0.312  5.324   -7.499  1.00 0.00 ? 70 MET A HE2  1  
ATOM 1125  H HE3  . MET A 1 70 ? -0.242  6.214   -9.021  1.00 0.00 ? 70 MET A HE3  1  
ATOM 1126  N N    . LYS A 1 71 ? -1.168  9.505   -2.023  1.00 0.00 ? 71 LYS A N    1  
ATOM 1127  C CA   . LYS A 1 71 ? -1.409  10.650  -1.153  1.00 0.00 ? 71 LYS A CA   1  
ATOM 1128  C C    . LYS A 1 71 ? -0.151  11.014  -0.372  1.00 0.00 ? 71 LYS A C    1  
ATOM 1129  O O    . LYS A 1 71 ? 0.206   12.187  -0.264  1.00 0.00 ? 71 LYS A O    1  
ATOM 1130  C CB   . LYS A 1 71 ? -2.555  10.349  -0.185  1.00 0.00 ? 71 LYS A CB   1  
ATOM 1131  C CG   . LYS A 1 71 ? -2.936  11.529  0.692   1.00 0.00 ? 71 LYS A CG   1  
ATOM 1132  C CD   . LYS A 1 71 ? -3.559  11.073  2.001   1.00 0.00 ? 71 LYS A CD   1  
ATOM 1133  C CE   . LYS A 1 71 ? -4.134  12.245  2.782   1.00 0.00 ? 71 LYS A CE   1  
ATOM 1134  N NZ   . LYS A 1 71 ? -3.082  12.976  3.540   1.00 0.00 ? 71 LYS A NZ   1  
ATOM 1135  H H    . LYS A 1 71 ? -1.701  8.691   -1.900  1.00 0.00 ? 71 LYS A H    1  
ATOM 1136  H HA   . LYS A 1 71 ? -1.686  11.487  -1.777  1.00 0.00 ? 71 LYS A HA   1  
ATOM 1137  H HB2  . LYS A 1 71 ? -3.424  10.055  -0.755  1.00 0.00 ? 71 LYS A HB2  1  
ATOM 1138  H HB3  . LYS A 1 71 ? -2.262  9.530   0.457   1.00 0.00 ? 71 LYS A HB3  1  
ATOM 1139  H HG2  . LYS A 1 71 ? -2.050  12.106  0.909   1.00 0.00 ? 71 LYS A HG2  1  
ATOM 1140  H HG3  . LYS A 1 71 ? -3.648  12.145  0.161   1.00 0.00 ? 71 LYS A HG3  1  
ATOM 1141  H HD2  . LYS A 1 71 ? -4.352  10.373  1.788   1.00 0.00 ? 71 LYS A HD2  1  
ATOM 1142  H HD3  . LYS A 1 71 ? -2.800  10.590  2.601   1.00 0.00 ? 71 LYS A HD3  1  
ATOM 1143  H HE2  . LYS A 1 71 ? -4.606  12.925  2.090   1.00 0.00 ? 71 LYS A HE2  1  
ATOM 1144  H HE3  . LYS A 1 71 ? -4.871  11.869  3.477   1.00 0.00 ? 71 LYS A HE3  1  
ATOM 1145  H HZ1  . LYS A 1 71 ? -2.139  12.693  3.206   1.00 0.00 ? 71 LYS A HZ1  1  
ATOM 1146  H HZ2  . LYS A 1 71 ? -3.158  12.761  4.555   1.00 0.00 ? 71 LYS A HZ2  1  
ATOM 1147  H HZ3  . LYS A 1 71 ? -3.192  14.002  3.405   1.00 0.00 ? 71 LYS A HZ3  1  
ATOM 1148  N N    . TRP A 1 72 ? 0.517   10.002  0.170   1.00 0.00 ? 72 TRP A N    1  
ATOM 1149  C CA   . TRP A 1 72 ? 1.736   10.217  0.941   1.00 0.00 ? 72 TRP A CA   1  
ATOM 1150  C C    . TRP A 1 72 ? 2.716   11.100  0.176   1.00 0.00 ? 72 TRP A C    1  
ATOM 1151  O O    . TRP A 1 72 ? 3.320   12.010  0.743   1.00 0.00 ? 72 TRP A O    1  
ATOM 1152  C CB   . TRP A 1 72 ? 2.393   8.877   1.278   1.00 0.00 ? 72 TRP A CB   1  
ATOM 1153  C CG   . TRP A 1 72 ? 3.855   8.994   1.589   1.00 0.00 ? 72 TRP A CG   1  
ATOM 1154  C CD1  . TRP A 1 72 ? 4.416   9.624   2.663   1.00 0.00 ? 72 TRP A CD1  1  
ATOM 1155  C CD2  . TRP A 1 72 ? 4.940   8.469   0.817   1.00 0.00 ? 72 TRP A CD2  1  
ATOM 1156  N NE1  . TRP A 1 72 ? 5.785   9.522   2.606   1.00 0.00 ? 72 TRP A NE1  1  
ATOM 1157  C CE2  . TRP A 1 72 ? 6.132   8.817   1.483   1.00 0.00 ? 72 TRP A CE2  1  
ATOM 1158  C CE3  . TRP A 1 72 ? 5.022   7.738   -0.371  1.00 0.00 ? 72 TRP A CE3  1  
ATOM 1159  C CZ2  . TRP A 1 72 ? 7.387   8.459   0.998   1.00 0.00 ? 72 TRP A CZ2  1  
ATOM 1160  C CZ3  . TRP A 1 72 ? 6.268   7.383   -0.850  1.00 0.00 ? 72 TRP A CZ3  1  
ATOM 1161  C CH2  . TRP A 1 72 ? 7.437   7.743   -0.167  1.00 0.00 ? 72 TRP A CH2  1  
ATOM 1162  H H    . TRP A 1 72 ? 0.182   9.089   0.050   1.00 0.00 ? 72 TRP A H    1  
ATOM 1163  H HA   . TRP A 1 72 ? 1.463   10.714  1.860   1.00 0.00 ? 72 TRP A HA   1  
ATOM 1164  H HB2  . TRP A 1 72 ? 1.903   8.448   2.139   1.00 0.00 ? 72 TRP A HB2  1  
ATOM 1165  H HB3  . TRP A 1 72 ? 2.284   8.209   0.435   1.00 0.00 ? 72 TRP A HB3  1  
ATOM 1166  H HD1  . TRP A 1 72 ? 3.854   10.125  3.436   1.00 0.00 ? 72 TRP A HD1  1  
ATOM 1167  H HE1  . TRP A 1 72 ? 6.411   9.892   3.263   1.00 0.00 ? 72 TRP A HE1  1  
ATOM 1168  H HE3  . TRP A 1 72 ? 4.132   7.451   -0.912  1.00 0.00 ? 72 TRP A HE3  1  
ATOM 1169  H HZ2  . TRP A 1 72 ? 8.297   8.728   1.514   1.00 0.00 ? 72 TRP A HZ2  1  
ATOM 1170  H HZ3  . TRP A 1 72 ? 6.351   6.818   -1.767  1.00 0.00 ? 72 TRP A HZ3  1  
ATOM 1171  H HH2  . TRP A 1 72 ? 8.389   7.445   -0.578  1.00 0.00 ? 72 TRP A HH2  1  
ATOM 1172  N N    . LYS A 1 73 ? 2.868   10.825  -1.115  1.00 0.00 ? 73 LYS A N    1  
ATOM 1173  C CA   . LYS A 1 73 ? 3.773   11.596  -1.960  1.00 0.00 ? 73 LYS A CA   1  
ATOM 1174  C C    . LYS A 1 73 ? 3.341   13.057  -2.030  1.00 0.00 ? 73 LYS A C    1  
ATOM 1175  O O    . LYS A 1 73 ? 2.296   13.432  -1.497  1.00 0.00 ? 73 LYS A O    1  
ATOM 1176  C CB   . LYS A 1 73 ? 3.822   10.999  -3.368  1.00 0.00 ? 73 LYS A CB   1  
ATOM 1177  C CG   . LYS A 1 73 ? 4.610   9.703   -3.453  1.00 0.00 ? 73 LYS A CG   1  
ATOM 1178  C CD   . LYS A 1 73 ? 5.178   9.486   -4.845  1.00 0.00 ? 73 LYS A CD   1  
ATOM 1179  C CE   . LYS A 1 73 ? 4.104   9.031   -5.821  1.00 0.00 ? 73 LYS A CE   1  
ATOM 1180  N NZ   . LYS A 1 73 ? 3.387   10.183  -6.434  1.00 0.00 ? 73 LYS A NZ   1  
ATOM 1181  H H    . LYS A 1 73 ? 2.358   10.087  -1.510  1.00 0.00 ? 73 LYS A H    1  
ATOM 1182  H HA   . LYS A 1 73 ? 4.759   11.545  -1.522  1.00 0.00 ? 73 LYS A HA   1  
ATOM 1183  H HB2  . LYS A 1 73 ? 2.813   10.804  -3.699  1.00 0.00 ? 73 LYS A HB2  1  
ATOM 1184  H HB3  . LYS A 1 73 ? 4.278   11.717  -4.035  1.00 0.00 ? 73 LYS A HB3  1  
ATOM 1185  H HG2  . LYS A 1 73 ? 5.425   9.741   -2.745  1.00 0.00 ? 73 LYS A HG2  1  
ATOM 1186  H HG3  . LYS A 1 73 ? 3.956   8.878   -3.208  1.00 0.00 ? 73 LYS A HG3  1  
ATOM 1187  H HD2  . LYS A 1 73 ? 5.602   10.413  -5.201  1.00 0.00 ? 73 LYS A HD2  1  
ATOM 1188  H HD3  . LYS A 1 73 ? 5.950   8.731   -4.795  1.00 0.00 ? 73 LYS A HD3  1  
ATOM 1189  H HE2  . LYS A 1 73 ? 4.568   8.450   -6.602  1.00 0.00 ? 73 LYS A HE2  1  
ATOM 1190  H HE3  . LYS A 1 73 ? 3.392   8.416   -5.290  1.00 0.00 ? 73 LYS A HE3  1  
ATOM 1191  H HZ1  . LYS A 1 73 ? 3.448   11.014  -5.810  1.00 0.00 ? 73 LYS A HZ1  1  
ATOM 1192  H HZ2  . LYS A 1 73 ? 2.385   9.945   -6.577  1.00 0.00 ? 73 LYS A HZ2  1  
ATOM 1193  H HZ3  . LYS A 1 73 ? 3.812   10.421  -7.353  1.00 0.00 ? 73 LYS A HZ3  1  
ATOM 1194  N N    . LYS A 1 74 ? 4.150   13.877  -2.692  1.00 0.00 ? 74 LYS A N    1  
ATOM 1195  C CA   . LYS A 1 74 ? 3.850   15.297  -2.835  1.00 0.00 ? 74 LYS A CA   1  
ATOM 1196  C C    . LYS A 1 74 ? 4.473   15.859  -4.109  1.00 0.00 ? 74 LYS A C    1  
ATOM 1197  O O    . LYS A 1 74 ? 5.677   15.731  -4.331  1.00 0.00 ? 74 LYS A O    1  
ATOM 1198  C CB   . LYS A 1 74 ? 4.362   16.072  -1.619  1.00 0.00 ? 74 LYS A CB   1  
ATOM 1199  C CG   . LYS A 1 74 ? 3.686   17.419  -1.428  1.00 0.00 ? 74 LYS A CG   1  
ATOM 1200  C CD   . LYS A 1 74 ? 2.448   17.302  -0.554  1.00 0.00 ? 74 LYS A CD   1  
ATOM 1201  C CE   . LYS A 1 74 ? 2.814   17.109  0.909   1.00 0.00 ? 74 LYS A CE   1  
ATOM 1202  N NZ   . LYS A 1 74 ? 3.184   18.395  1.562   1.00 0.00 ? 74 LYS A NZ   1  
ATOM 1203  H H    . LYS A 1 74 ? 4.968   13.518  -3.095  1.00 0.00 ? 74 LYS A H    1  
ATOM 1204  H HA   . LYS A 1 74 ? 2.778   15.405  -2.895  1.00 0.00 ? 74 LYS A HA   1  
ATOM 1205  H HB2  . LYS A 1 74 ? 4.195   15.479  -0.732  1.00 0.00 ? 74 LYS A HB2  1  
ATOM 1206  H HB3  . LYS A 1 74 ? 5.423   16.240  -1.735  1.00 0.00 ? 74 LYS A HB3  1  
ATOM 1207  H HG2  . LYS A 1 74 ? 4.382   18.098  -0.957  1.00 0.00 ? 74 LYS A HG2  1  
ATOM 1208  H HG3  . LYS A 1 74 ? 3.398   17.808  -2.394  1.00 0.00 ? 74 LYS A HG3  1  
ATOM 1209  H HD2  . LYS A 1 74 ? 1.862   18.204  -0.652  1.00 0.00 ? 74 LYS A HD2  1  
ATOM 1210  H HD3  . LYS A 1 74 ? 1.864   16.454  -0.885  1.00 0.00 ? 74 LYS A HD3  1  
ATOM 1211  H HE2  . LYS A 1 74 ? 1.967   16.684  1.426   1.00 0.00 ? 74 LYS A HE2  1  
ATOM 1212  H HE3  . LYS A 1 74 ? 3.651   16.430  0.971   1.00 0.00 ? 74 LYS A HE3  1  
ATOM 1213  H HZ1  . LYS A 1 74 ? 3.617   18.213  2.490   1.00 0.00 ? 74 LYS A HZ1  1  
ATOM 1214  H HZ2  . LYS A 1 74 ? 2.337   18.984  1.698   1.00 0.00 ? 74 LYS A HZ2  1  
ATOM 1215  H HZ3  . LYS A 1 74 ? 3.863   18.915  0.970   1.00 0.00 ? 74 LYS A HZ3  1  
ATOM 1216  N N    . SER A 1 75 ? 3.646   16.483  -4.942  1.00 0.00 ? 75 SER A N    1  
ATOM 1217  C CA   . SER A 1 75 ? 4.115   17.062  -6.194  1.00 0.00 ? 75 SER A CA   1  
ATOM 1218  C C    . SER A 1 75 ? 3.842   18.563  -6.235  1.00 0.00 ? 75 SER A C    1  
ATOM 1219  O O    . SER A 1 75 ? 2.695   18.999  -6.149  1.00 0.00 ? 75 SER A O    1  
ATOM 1220  C CB   . SER A 1 75 ? 3.439   16.377  -7.383  1.00 0.00 ? 75 SER A CB   1  
ATOM 1221  O OG   . SER A 1 75 ? 4.043   15.126  -7.662  1.00 0.00 ? 75 SER A OG   1  
ATOM 1222  H H    . SER A 1 75 ? 2.696   16.552  -4.709  1.00 0.00 ? 75 SER A H    1  
ATOM 1223  H HA   . SER A 1 75 ? 5.181   16.900  -6.255  1.00 0.00 ? 75 SER A HA   1  
ATOM 1224  H HB2  . SER A 1 75 ? 2.396   16.217  -7.158  1.00 0.00 ? 75 SER A HB2  1  
ATOM 1225  H HB3  . SER A 1 75 ? 3.526   17.008  -8.256  1.00 0.00 ? 75 SER A HB3  1  
ATOM 1226  H HG   . SER A 1 75 ? 4.974   15.160  -7.427  1.00 0.00 ? 75 SER A HG   1  
ATOM 1227  N N    . GLY A 1 76 ? 4.907   19.348  -6.367  1.00 0.00 ? 76 GLY A N    1  
ATOM 1228  C CA   . GLY A 1 76 ? 4.762   20.792  -6.416  1.00 0.00 ? 76 GLY A CA   1  
ATOM 1229  C C    . GLY A 1 76 ? 5.453   21.403  -7.619  1.00 0.00 ? 76 GLY A C    1  
ATOM 1230  O O    . GLY A 1 76 ? 6.569   21.914  -7.527  1.00 0.00 ? 76 GLY A O    1  
ATOM 1231  H H    . GLY A 1 76 ? 5.798   18.945  -6.430  1.00 0.00 ? 76 GLY A H    1  
ATOM 1232  H HA2  . GLY A 1 76 ? 3.711   21.036  -6.455  1.00 0.00 ? 76 GLY A HA2  1  
ATOM 1233  H HA3  . GLY A 1 76 ? 5.186   21.216  -5.518  1.00 0.00 ? 76 GLY A HA3  1  
ATOM 1234  N N    . PRO A 1 77 ? 4.783   21.353  -8.780  1.00 0.00 ? 77 PRO A N    1  
ATOM 1235  C CA   . PRO A 1 77 ? 5.321   21.900  -10.029 1.00 0.00 ? 77 PRO A CA   1  
ATOM 1236  C C    . PRO A 1 77 ? 5.380   23.424  -10.016 1.00 0.00 ? 77 PRO A C    1  
ATOM 1237  O O    . PRO A 1 77 ? 6.358   24.020  -10.468 1.00 0.00 ? 77 PRO A O    1  
ATOM 1238  C CB   . PRO A 1 77 ? 4.328   21.412  -11.087 1.00 0.00 ? 77 PRO A CB   1  
ATOM 1239  C CG   . PRO A 1 77 ? 3.054   21.205  -10.344 1.00 0.00 ? 77 PRO A CG   1  
ATOM 1240  C CD   . PRO A 1 77 ? 3.448   20.758  -8.963  1.00 0.00 ? 77 PRO A CD   1  
ATOM 1241  H HA   . PRO A 1 77 ? 6.303   21.505  -10.245 1.00 0.00 ? 77 PRO A HA   1  
ATOM 1242  H HB2  . PRO A 1 77 ? 4.220   22.164  -11.856 1.00 0.00 ? 77 PRO A HB2  1  
ATOM 1243  H HB3  . PRO A 1 77 ? 4.685   20.492  -11.523 1.00 0.00 ? 77 PRO A HB3  1  
ATOM 1244  H HG2  . PRO A 1 77 ? 2.502   22.131  -10.295 1.00 0.00 ? 77 PRO A HG2  1  
ATOM 1245  H HG3  . PRO A 1 77 ? 2.466   20.441  -10.830 1.00 0.00 ? 77 PRO A HG3  1  
ATOM 1246  H HD2  . PRO A 1 77 ? 2.752   21.140  -8.230  1.00 0.00 ? 77 PRO A HD2  1  
ATOM 1247  H HD3  . PRO A 1 77 ? 3.497   19.680  -8.915  1.00 0.00 ? 77 PRO A HD3  1  
ATOM 1248  N N    . SER A 1 78 ? 4.329   24.048  -9.495  1.00 0.00 ? 78 SER A N    1  
ATOM 1249  C CA   . SER A 1 78 ? 4.260   25.503  -9.426  1.00 0.00 ? 78 SER A CA   1  
ATOM 1250  C C    . SER A 1 78 ? 3.011   25.953  -8.675  1.00 0.00 ? 78 SER A C    1  
ATOM 1251  O O    . SER A 1 78 ? 1.897   25.859  -9.189  1.00 0.00 ? 78 SER A O    1  
ATOM 1252  C CB   . SER A 1 78 ? 4.266   26.102  -10.834 1.00 0.00 ? 78 SER A CB   1  
ATOM 1253  O OG   . SER A 1 78 ? 4.098   27.508  -10.791 1.00 0.00 ? 78 SER A OG   1  
ATOM 1254  H H    . SER A 1 78 ? 3.580   23.517  -9.151  1.00 0.00 ? 78 SER A H    1  
ATOM 1255  H HA   . SER A 1 78 ? 5.132   25.851  -8.893  1.00 0.00 ? 78 SER A HA   1  
ATOM 1256  H HB2  . SER A 1 78 ? 5.206   25.878  -11.314 1.00 0.00 ? 78 SER A HB2  1  
ATOM 1257  H HB3  . SER A 1 78 ? 3.457   25.672  -11.408 1.00 0.00 ? 78 SER A HB3  1  
ATOM 1258  H HG   . SER A 1 78 ? 4.205   27.871  -11.673 1.00 0.00 ? 78 SER A HG   1  
ATOM 1259  N N    . SER A 1 79 ? 3.207   26.442  -7.454  1.00 0.00 ? 79 SER A N    1  
ATOM 1260  C CA   . SER A 1 79 ? 2.097   26.903  -6.629  1.00 0.00 ? 79 SER A CA   1  
ATOM 1261  C C    . SER A 1 79 ? 1.921   28.414  -6.750  1.00 0.00 ? 79 SER A C    1  
ATOM 1262  O O    . SER A 1 79 ? 2.781   29.186  -6.329  1.00 0.00 ? 79 SER A O    1  
ATOM 1263  C CB   . SER A 1 79 ? 2.328   26.521  -5.166  1.00 0.00 ? 79 SER A CB   1  
ATOM 1264  O OG   . SER A 1 79 ? 1.224   26.896  -4.360  1.00 0.00 ? 79 SER A OG   1  
ATOM 1265  H H    . SER A 1 79 ? 4.119   26.491  -7.100  1.00 0.00 ? 79 SER A H    1  
ATOM 1266  H HA   . SER A 1 79 ? 1.198   26.419  -6.981  1.00 0.00 ? 79 SER A HA   1  
ATOM 1267  H HB2  . SER A 1 79 ? 2.466   25.453  -5.093  1.00 0.00 ? 79 SER A HB2  1  
ATOM 1268  H HB3  . SER A 1 79 ? 3.212   27.024  -4.801  1.00 0.00 ? 79 SER A HB3  1  
ATOM 1269  H HG   . SER A 1 79 ? 0.936   26.141  -3.841  1.00 0.00 ? 79 SER A HG   1  
ATOM 1270  N N    . GLY A 1 80 ? 0.798   28.829  -7.330  1.00 0.00 ? 80 GLY A N    1  
ATOM 1271  C CA   . GLY A 1 80 ? 0.529   30.245  -7.497  1.00 0.00 ? 80 GLY A CA   1  
ATOM 1272  C C    . GLY A 1 80 ? -0.368  30.528  -8.686  1.00 0.00 ? 80 GLY A C    1  
ATOM 1273  O O    . GLY A 1 80 ? -0.446  29.727  -9.617  1.00 0.00 ? 80 GLY A O    1  
ATOM 1274  H H    . GLY A 1 80 ? 0.148   28.167  -7.647  1.00 0.00 ? 80 GLY A H    1  
ATOM 1275  H HA2  . GLY A 1 80 ? 0.052   30.617  -6.603  1.00 0.00 ? 80 GLY A HA2  1  
ATOM 1276  H HA3  . GLY A 1 80 ? 1.466   30.764  -7.637  1.00 0.00 ? 80 GLY A HA3  1  
ATOM 1277  N N    . GLY A 1 1  ? 14.168  46.481  19.307  1.00 0.00 ? 1  GLY A N    2  
ATOM 1278  C CA   . GLY A 1 1  ? 12.968  45.966  18.674  1.00 0.00 ? 1  GLY A CA   2  
ATOM 1279  C C    . GLY A 1 1  ? 11.713  46.667  19.156  1.00 0.00 ? 1  GLY A C    2  
ATOM 1280  O O    . GLY A 1 1  ? 11.498  47.842  18.862  1.00 0.00 ? 1  GLY A O    2  
ATOM 1281  H H1   . GLY A 1 1  ? 14.581  45.986  20.046  1.00 0.00 ? 1  GLY A H1   2  
ATOM 1282  H HA2  . GLY A 1 1  ? 13.053  46.097  17.606  1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1283  H HA3  . GLY A 1 1  ? 12.884  44.912  18.892  1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1284  N N    . SER A 1 2  ? 10.880  45.942  19.897  1.00 0.00 ? 2  SER A N    2  
ATOM 1285  C CA   . SER A 1 2  ? 9.637   46.500  20.416  1.00 0.00 ? 2  SER A CA   2  
ATOM 1286  C C    . SER A 1 2  ? 8.619   46.693  19.296  1.00 0.00 ? 2  SER A C    2  
ATOM 1287  O O    . SER A 1 2  ? 7.930   47.712  19.236  1.00 0.00 ? 2  SER A O    2  
ATOM 1288  C CB   . SER A 1 2  ? 9.903   47.835  21.113  1.00 0.00 ? 2  SER A CB   2  
ATOM 1289  O OG   . SER A 1 2  ? 8.963   48.067  22.148  1.00 0.00 ? 2  SER A OG   2  
ATOM 1290  H H    . SER A 1 2  ? 11.107  45.010  20.098  1.00 0.00 ? 2  SER A H    2  
ATOM 1291  H HA   . SER A 1 2  ? 9.235   45.802  21.135  1.00 0.00 ? 2  SER A HA   2  
ATOM 1292  H HB2  . SER A 1 2  ? 10.895  47.824  21.540  1.00 0.00 ? 2  SER A HB2  2  
ATOM 1293  H HB3  . SER A 1 2  ? 9.832   48.636  20.392  1.00 0.00 ? 2  SER A HB3  2  
ATOM 1294  H HG   . SER A 1 2  ? 9.268   47.649  22.957  1.00 0.00 ? 2  SER A HG   2  
ATOM 1295  N N    . SER A 1 3  ? 8.530   45.707  18.409  1.00 0.00 ? 3  SER A N    2  
ATOM 1296  C CA   . SER A 1 3  ? 7.600   45.768  17.288  1.00 0.00 ? 3  SER A CA   2  
ATOM 1297  C C    . SER A 1 3  ? 6.603   44.615  17.345  1.00 0.00 ? 3  SER A C    2  
ATOM 1298  O O    . SER A 1 3  ? 6.753   43.688  18.140  1.00 0.00 ? 3  SER A O    2  
ATOM 1299  C CB   . SER A 1 3  ? 8.363   45.733  15.962  1.00 0.00 ? 3  SER A CB   2  
ATOM 1300  O OG   . SER A 1 3  ? 8.947   46.992  15.676  1.00 0.00 ? 3  SER A OG   2  
ATOM 1301  H H    . SER A 1 3  ? 9.106   44.920  18.510  1.00 0.00 ? 3  SER A H    2  
ATOM 1302  H HA   . SER A 1 3  ? 7.059   46.700  17.357  1.00 0.00 ? 3  SER A HA   2  
ATOM 1303  H HB2  . SER A 1 3  ? 9.145   44.991  16.020  1.00 0.00 ? 3  SER A HB2  2  
ATOM 1304  H HB3  . SER A 1 3  ? 7.681   45.476  15.164  1.00 0.00 ? 3  SER A HB3  2  
ATOM 1305  H HG   . SER A 1 3  ? 9.842   47.016  16.024  1.00 0.00 ? 3  SER A HG   2  
ATOM 1306  N N    . GLY A 1 4  ? 5.583   44.680  16.494  1.00 0.00 ? 4  GLY A N    2  
ATOM 1307  C CA   . GLY A 1 4  ? 4.575   43.636  16.464  1.00 0.00 ? 4  GLY A CA   2  
ATOM 1308  C C    . GLY A 1 4  ? 3.537   43.864  15.383  1.00 0.00 ? 4  GLY A C    2  
ATOM 1309  O O    . GLY A 1 4  ? 3.694   44.745  14.538  1.00 0.00 ? 4  GLY A O    2  
ATOM 1310  H H    . GLY A 1 4  ? 5.514   45.443  15.883  1.00 0.00 ? 4  GLY A H    2  
ATOM 1311  H HA2  . GLY A 1 4  ? 5.061   42.687  16.288  1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1312  H HA3  . GLY A 1 4  ? 4.079   43.603  17.422  1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1313  N N    . SER A 1 5  ? 2.474   43.066  15.407  1.00 0.00 ? 5  SER A N    2  
ATOM 1314  C CA   . SER A 1 5  ? 1.409   43.181  14.419  1.00 0.00 ? 5  SER A CA   2  
ATOM 1315  C C    . SER A 1 5  ? 0.207   42.328  14.813  1.00 0.00 ? 5  SER A C    2  
ATOM 1316  O O    . SER A 1 5  ? 0.234   41.630  15.827  1.00 0.00 ? 5  SER A O    2  
ATOM 1317  C CB   . SER A 1 5  ? 1.917   42.760  13.039  1.00 0.00 ? 5  SER A CB   2  
ATOM 1318  O OG   . SER A 1 5  ? 2.024   41.350  12.943  1.00 0.00 ? 5  SER A OG   2  
ATOM 1319  H H    . SER A 1 5  ? 2.407   42.381  16.106  1.00 0.00 ? 5  SER A H    2  
ATOM 1320  H HA   . SER A 1 5  ? 1.103   44.216  14.380  1.00 0.00 ? 5  SER A HA   2  
ATOM 1321  H HB2  . SER A 1 5  ? 1.230   43.108  12.283  1.00 0.00 ? 5  SER A HB2  2  
ATOM 1322  H HB3  . SER A 1 5  ? 2.891   43.195  12.868  1.00 0.00 ? 5  SER A HB3  2  
ATOM 1323  H HG   . SER A 1 5  ? 2.519   41.014  13.695  1.00 0.00 ? 5  SER A HG   2  
ATOM 1324  N N    . SER A 1 6  ? -0.846  42.390  14.004  1.00 0.00 ? 6  SER A N    2  
ATOM 1325  C CA   . SER A 1 6  ? -2.059  41.626  14.269  1.00 0.00 ? 6  SER A CA   2  
ATOM 1326  C C    . SER A 1 6  ? -3.017  41.699  13.084  1.00 0.00 ? 6  SER A C    2  
ATOM 1327  O O    . SER A 1 6  ? -2.883  42.560  12.216  1.00 0.00 ? 6  SER A O    2  
ATOM 1328  C CB   . SER A 1 6  ? -2.750  42.148  15.531  1.00 0.00 ? 6  SER A CB   2  
ATOM 1329  O OG   . SER A 1 6  ? -3.121  43.508  15.383  1.00 0.00 ? 6  SER A OG   2  
ATOM 1330  H H    . SER A 1 6  ? -0.806  42.965  13.211  1.00 0.00 ? 6  SER A H    2  
ATOM 1331  H HA   . SER A 1 6  ? -1.776  40.596  14.425  1.00 0.00 ? 6  SER A HA   2  
ATOM 1332  H HB2  . SER A 1 6  ? -3.638  41.564  15.720  1.00 0.00 ? 6  SER A HB2  2  
ATOM 1333  H HB3  . SER A 1 6  ? -2.075  42.061  16.370  1.00 0.00 ? 6  SER A HB3  2  
ATOM 1334  H HG   . SER A 1 6  ? -2.421  43.984  14.931  1.00 0.00 ? 6  SER A HG   2  
ATOM 1335  N N    . GLY A 1 7  ? -3.985  40.788  13.056  1.00 0.00 ? 7  GLY A N    2  
ATOM 1336  C CA   . GLY A 1 7  ? -4.951  40.765  11.973  1.00 0.00 ? 7  GLY A CA   2  
ATOM 1337  C C    . GLY A 1 7  ? -4.379  40.180  10.697  1.00 0.00 ? 7  GLY A C    2  
ATOM 1338  O O    . GLY A 1 7  ? -3.230  40.446  10.345  1.00 0.00 ? 7  GLY A O    2  
ATOM 1339  H H    . GLY A 1 7  ? -4.042  40.125  13.776  1.00 0.00 ? 7  GLY A H    2  
ATOM 1340  H HA2  . GLY A 1 7  ? -5.802  40.175  12.278  1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1341  H HA3  . GLY A 1 7  ? -5.278  41.776  11.777  1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1342  N N    . GLY A 1 8  ? -5.182  39.380  10.002  1.00 0.00 ? 8  GLY A N    2  
ATOM 1343  C CA   . GLY A 1 8  ? -4.730  38.767  8.767   1.00 0.00 ? 8  GLY A CA   2  
ATOM 1344  C C    . GLY A 1 8  ? -4.985  37.273  8.734   1.00 0.00 ? 8  GLY A C    2  
ATOM 1345  O O    . GLY A 1 8  ? -5.484  36.745  7.741   1.00 0.00 ? 8  GLY A O    2  
ATOM 1346  H H    . GLY A 1 8  ? -6.088  39.204  10.332  1.00 0.00 ? 8  GLY A H    2  
ATOM 1347  H HA2  . GLY A 1 8  ? -5.247  39.229  7.939   1.00 0.00 ? 8  GLY A HA2  2  
ATOM 1348  H HA3  . GLY A 1 8  ? -3.670  38.942  8.658   1.00 0.00 ? 8  GLY A HA3  2  
ATOM 1349  N N    . GLU A 1 9  ? -4.640  36.591  9.821   1.00 0.00 ? 9  GLU A N    2  
ATOM 1350  C CA   . GLU A 1 9  ? -4.833  35.149  9.911   1.00 0.00 ? 9  GLU A CA   2  
ATOM 1351  C C    . GLU A 1 9  ? -6.171  34.740  9.302   1.00 0.00 ? 9  GLU A C    2  
ATOM 1352  O O    . GLU A 1 9  ? -7.172  35.449  9.406   1.00 0.00 ? 9  GLU A O    2  
ATOM 1353  C CB   . GLU A 1 9  ? -4.763  34.692  11.369  1.00 0.00 ? 9  GLU A CB   2  
ATOM 1354  C CG   . GLU A 1 9  ? -3.345  34.485  11.875  1.00 0.00 ? 9  GLU A CG   2  
ATOM 1355  C CD   . GLU A 1 9  ? -2.496  35.736  11.758  1.00 0.00 ? 9  GLU A CD   2  
ATOM 1356  O OE1  . GLU A 1 9  ? -2.000  36.014  10.647  1.00 0.00 ? 9  GLU A OE1  2  
ATOM 1357  O OE2  . GLU A 1 9  ? -2.328  36.437  12.778  1.00 0.00 ? 9  GLU A OE2  2  
ATOM 1358  H H    . GLU A 1 9  ? -4.247  37.069  10.581  1.00 0.00 ? 9  GLU A H    2  
ATOM 1359  H HA   . GLU A 1 9  ? -4.039  34.673  9.356   1.00 0.00 ? 9  GLU A HA   2  
ATOM 1360  H HB2  . GLU A 1 9  ? -5.240  35.435  11.990  1.00 0.00 ? 9  GLU A HB2  2  
ATOM 1361  H HB3  . GLU A 1 9  ? -5.297  33.758  11.467  1.00 0.00 ? 9  GLU A HB3  2  
ATOM 1362  H HG2  . GLU A 1 9  ? -3.386  34.192  12.913  1.00 0.00 ? 9  GLU A HG2  2  
ATOM 1363  H HG3  . GLU A 1 9  ? -2.882  33.698  11.298  1.00 0.00 ? 9  GLU A HG3  2  
ATOM 1364  N N    . PRO A 1 10 ? -6.191  33.568  8.649   1.00 0.00 ? 10 PRO A N    2  
ATOM 1365  C CA   . PRO A 1 10 ? -7.398  33.037  8.011   1.00 0.00 ? 10 PRO A CA   2  
ATOM 1366  C C    . PRO A 1 10 ? -8.448  32.600  9.027   1.00 0.00 ? 10 PRO A C    2  
ATOM 1367  O O    . PRO A 1 10 ? -8.299  32.832  10.226  1.00 0.00 ? 10 PRO A O    2  
ATOM 1368  C CB   . PRO A 1 10 ? -6.882  31.831  7.223   1.00 0.00 ? 10 PRO A CB   2  
ATOM 1369  C CG   . PRO A 1 10 ? -5.647  31.410  7.941   1.00 0.00 ? 10 PRO A CG   2  
ATOM 1370  C CD   . PRO A 1 10 ? -5.035  32.670  8.486   1.00 0.00 ? 10 PRO A CD   2  
ATOM 1371  H HA   . PRO A 1 10 ? -7.835  33.754  7.330   1.00 0.00 ? 10 PRO A HA   2  
ATOM 1372  H HB2  . PRO A 1 10 ? -7.629  31.049  7.227   1.00 0.00 ? 10 PRO A HB2  2  
ATOM 1373  H HB3  . PRO A 1 10 ? -6.667  32.125  6.207   1.00 0.00 ? 10 PRO A HB3  2  
ATOM 1374  H HG2  . PRO A 1 10 ? -5.901  30.738  8.746   1.00 0.00 ? 10 PRO A HG2  2  
ATOM 1375  H HG3  . PRO A 1 10 ? -4.967  30.931  7.252   1.00 0.00 ? 10 PRO A HG3  2  
ATOM 1376  H HD2  . PRO A 1 10 ? -4.558  32.479  9.436   1.00 0.00 ? 10 PRO A HD2  2  
ATOM 1377  H HD3  . PRO A 1 10 ? -4.326  33.080  7.782   1.00 0.00 ? 10 PRO A HD3  2  
ATOM 1378  N N    . GLY A 1 11 ? -9.509  31.966  8.540   1.00 0.00 ? 11 GLY A N    2  
ATOM 1379  C CA   . GLY A 1 11 ? -10.568 31.506  9.420   1.00 0.00 ? 11 GLY A CA   2  
ATOM 1380  C C    . GLY A 1 11 ? -10.435 30.037  9.768   1.00 0.00 ? 11 GLY A C    2  
ATOM 1381  O O    . GLY A 1 11 ? -11.429 29.312  9.825   1.00 0.00 ? 11 GLY A O    2  
ATOM 1382  H H    . GLY A 1 11 ? -9.575  31.808  7.575   1.00 0.00 ? 11 GLY A H    2  
ATOM 1383  H HA2  . GLY A 1 11 ? -10.540 32.085  10.331  1.00 0.00 ? 11 GLY A HA2  2  
ATOM 1384  H HA3  . GLY A 1 11 ? -11.519 31.664  8.933   1.00 0.00 ? 11 GLY A HA3  2  
ATOM 1385  N N    . THR A 1 12 ? -9.203  29.594  10.000  1.00 0.00 ? 12 THR A N    2  
ATOM 1386  C CA   . THR A 1 12 ? -8.944  28.201  10.341  1.00 0.00 ? 12 THR A CA   2  
ATOM 1387  C C    . THR A 1 12 ? -9.884  27.266  9.589   1.00 0.00 ? 12 THR A C    2  
ATOM 1388  O O    . THR A 1 12 ? -10.433 26.326  10.164  1.00 0.00 ? 12 THR A O    2  
ATOM 1389  C CB   . THR A 1 12 ? -9.096  27.955  11.854  1.00 0.00 ? 12 THR A CB   2  
ATOM 1390  O OG1  . THR A 1 12 ? -8.382  28.957  12.588  1.00 0.00 ? 12 THR A OG1  2  
ATOM 1391  C CG2  . THR A 1 12 ? -8.578  26.576  12.234  1.00 0.00 ? 12 THR A CG2  2  
ATOM 1392  H H    . THR A 1 12 ? -8.452  30.220  9.939   1.00 0.00 ? 12 THR A H    2  
ATOM 1393  H HA   . THR A 1 12 ? -7.925  27.973  10.062  1.00 0.00 ? 12 THR A HA   2  
ATOM 1394  H HB   . THR A 1 12 ? -10.144 28.012  12.109  1.00 0.00 ? 12 THR A HB   2  
ATOM 1395  H HG1  . THR A 1 12 ? -8.763  29.044  13.465  1.00 0.00 ? 12 THR A HG1  2  
ATOM 1396  H HG21 . THR A 1 12 ? -8.310  26.567  13.280  1.00 0.00 ? 12 THR A HG21 2  
ATOM 1397  H HG22 . THR A 1 12 ? -7.709  26.342  11.637  1.00 0.00 ? 12 THR A HG22 2  
ATOM 1398  H HG23 . THR A 1 12 ? -9.347  25.841  12.053  1.00 0.00 ? 12 THR A HG23 2  
ATOM 1399  N N    . LYS A 1 13 ? -10.065 27.529  8.299   1.00 0.00 ? 13 LYS A N    2  
ATOM 1400  C CA   . LYS A 1 13 ? -10.938 26.710  7.466   1.00 0.00 ? 13 LYS A CA   2  
ATOM 1401  C C    . LYS A 1 13 ? -10.193 25.490  6.933   1.00 0.00 ? 13 LYS A C    2  
ATOM 1402  O O    . LYS A 1 13 ? -8.971  25.510  6.793   1.00 0.00 ? 13 LYS A O    2  
ATOM 1403  C CB   . LYS A 1 13 ? -11.486 27.536  6.301   1.00 0.00 ? 13 LYS A CB   2  
ATOM 1404  C CG   . LYS A 1 13 ? -12.832 27.050  5.792   1.00 0.00 ? 13 LYS A CG   2  
ATOM 1405  C CD   . LYS A 1 13 ? -13.614 28.170  5.126   1.00 0.00 ? 13 LYS A CD   2  
ATOM 1406  C CE   . LYS A 1 13 ? -15.047 27.752  4.834   1.00 0.00 ? 13 LYS A CE   2  
ATOM 1407  N NZ   . LYS A 1 13 ? -15.874 27.704  6.071   1.00 0.00 ? 13 LYS A NZ   2  
ATOM 1408  H H    . LYS A 1 13 ? -9.599  28.292  7.897   1.00 0.00 ? 13 LYS A H    2  
ATOM 1409  H HA   . LYS A 1 13 ? -11.761 26.375  8.078   1.00 0.00 ? 13 LYS A HA   2  
ATOM 1410  H HB2  . LYS A 1 13 ? -11.595 28.561  6.622   1.00 0.00 ? 13 LYS A HB2  2  
ATOM 1411  H HB3  . LYS A 1 13 ? -10.780 27.496  5.484   1.00 0.00 ? 13 LYS A HB3  2  
ATOM 1412  H HG2  . LYS A 1 13 ? -12.671 26.261  5.072   1.00 0.00 ? 13 LYS A HG2  2  
ATOM 1413  H HG3  . LYS A 1 13 ? -13.406 26.668  6.625   1.00 0.00 ? 13 LYS A HG3  2  
ATOM 1414  H HD2  . LYS A 1 13 ? -13.628 29.027  5.782   1.00 0.00 ? 13 LYS A HD2  2  
ATOM 1415  H HD3  . LYS A 1 13 ? -13.128 28.433  4.197   1.00 0.00 ? 13 LYS A HD3  2  
ATOM 1416  H HE2  . LYS A 1 13 ? -15.483 28.462  4.148   1.00 0.00 ? 13 LYS A HE2  2  
ATOM 1417  H HE3  . LYS A 1 13 ? -15.037 26.772  4.379   1.00 0.00 ? 13 LYS A HE3  2  
ATOM 1418  H HZ1  . LYS A 1 13 ? -16.869 27.523  5.829   1.00 0.00 ? 13 LYS A HZ1  2  
ATOM 1419  H HZ2  . LYS A 1 13 ? -15.812 28.610  6.578   1.00 0.00 ? 13 LYS A HZ2  2  
ATOM 1420  H HZ3  . LYS A 1 13 ? -15.537 26.945  6.697   1.00 0.00 ? 13 LYS A HZ3  2  
ATOM 1421  N N    . ALA A 1 14 ? -10.938 24.430  6.636   1.00 0.00 ? 14 ALA A N    2  
ATOM 1422  C CA   . ALA A 1 14 ? -10.348 23.204  6.115   1.00 0.00 ? 14 ALA A CA   2  
ATOM 1423  C C    . ALA A 1 14 ? -11.424 22.255  5.596   1.00 0.00 ? 14 ALA A C    2  
ATOM 1424  O O    . ALA A 1 14 ? -12.615 22.463  5.829   1.00 0.00 ? 14 ALA A O    2  
ATOM 1425  C CB   . ALA A 1 14 ? -9.514  22.521  7.189   1.00 0.00 ? 14 ALA A CB   2  
ATOM 1426  H H    . ALA A 1 14 ? -11.908 24.476  6.770   1.00 0.00 ? 14 ALA A H    2  
ATOM 1427  H HA   . ALA A 1 14 ? -9.692  23.469  5.299   1.00 0.00 ? 14 ALA A HA   2  
ATOM 1428  H HB1  . ALA A 1 14 ? -9.331  21.496  6.903   1.00 0.00 ? 14 ALA A HB1  2  
ATOM 1429  H HB2  . ALA A 1 14 ? -8.573  23.039  7.296   1.00 0.00 ? 14 ALA A HB2  2  
ATOM 1430  H HB3  . ALA A 1 14 ? -10.047 22.544  8.127   1.00 0.00 ? 14 ALA A HB3  2  
ATOM 1431  N N    . LYS A 1 15 ? -10.997 21.213  4.890   1.00 0.00 ? 15 LYS A N    2  
ATOM 1432  C CA   . LYS A 1 15 ? -11.922 20.232  4.338   1.00 0.00 ? 15 LYS A CA   2  
ATOM 1433  C C    . LYS A 1 15 ? -12.029 19.012  5.248   1.00 0.00 ? 15 LYS A C    2  
ATOM 1434  O O    . LYS A 1 15 ? -11.046 18.591  5.857   1.00 0.00 ? 15 LYS A O    2  
ATOM 1435  C CB   . LYS A 1 15 ? -11.467 19.801  2.942   1.00 0.00 ? 15 LYS A CB   2  
ATOM 1436  C CG   . LYS A 1 15 ? -12.488 18.951  2.204   1.00 0.00 ? 15 LYS A CG   2  
ATOM 1437  C CD   . LYS A 1 15 ? -13.529 19.810  1.507   1.00 0.00 ? 15 LYS A CD   2  
ATOM 1438  C CE   . LYS A 1 15 ? -13.004 20.364  0.192   1.00 0.00 ? 15 LYS A CE   2  
ATOM 1439  N NZ   . LYS A 1 15 ? -12.274 21.648  0.383   1.00 0.00 ? 15 LYS A NZ   2  
ATOM 1440  H H    . LYS A 1 15 ? -10.034 21.102  4.738   1.00 0.00 ? 15 LYS A H    2  
ATOM 1441  H HA   . LYS A 1 15 ? -12.894 20.697  4.263   1.00 0.00 ? 15 LYS A HA   2  
ATOM 1442  H HB2  . LYS A 1 15 ? -11.271 20.684  2.351   1.00 0.00 ? 15 LYS A HB2  2  
ATOM 1443  H HB3  . LYS A 1 15 ? -10.554 19.230  3.034   1.00 0.00 ? 15 LYS A HB3  2  
ATOM 1444  H HG2  . LYS A 1 15 ? -11.978 18.352  1.465   1.00 0.00 ? 15 LYS A HG2  2  
ATOM 1445  H HG3  . LYS A 1 15 ? -12.985 18.305  2.914   1.00 0.00 ? 15 LYS A HG3  2  
ATOM 1446  H HD2  . LYS A 1 15 ? -14.404 19.210  1.308   1.00 0.00 ? 15 LYS A HD2  2  
ATOM 1447  H HD3  . LYS A 1 15 ? -13.796 20.634  2.154   1.00 0.00 ? 15 LYS A HD3  2  
ATOM 1448  H HE2  . LYS A 1 15 ? -12.334 19.641  -0.247  1.00 0.00 ? 15 LYS A HE2  2  
ATOM 1449  H HE3  . LYS A 1 15 ? -13.839 20.530  -0.473  1.00 0.00 ? 15 LYS A HE3  2  
ATOM 1450  H HZ1  . LYS A 1 15 ? -12.694 22.390  -0.214  1.00 0.00 ? 15 LYS A HZ1  2  
ATOM 1451  H HZ2  . LYS A 1 15 ? -11.274 21.533  0.121   1.00 0.00 ? 15 LYS A HZ2  2  
ATOM 1452  H HZ3  . LYS A 1 15 ? -12.329 21.946  1.377   1.00 0.00 ? 15 LYS A HZ3  2  
ATOM 1453  N N    . LYS A 1 16 ? -13.229 18.448  5.335   1.00 0.00 ? 16 LYS A N    2  
ATOM 1454  C CA   . LYS A 1 16 ? -13.465 17.275  6.168   1.00 0.00 ? 16 LYS A CA   2  
ATOM 1455  C C    . LYS A 1 16 ? -14.165 16.176  5.375   1.00 0.00 ? 16 LYS A C    2  
ATOM 1456  O O    . LYS A 1 16 ? -13.957 14.990  5.624   1.00 0.00 ? 16 LYS A O    2  
ATOM 1457  C CB   . LYS A 1 16 ? -14.307 17.653  7.389   1.00 0.00 ? 16 LYS A CB   2  
ATOM 1458  C CG   . LYS A 1 16 ? -13.607 18.610  8.338   1.00 0.00 ? 16 LYS A CG   2  
ATOM 1459  C CD   . LYS A 1 16 ? -14.555 19.128  9.407   1.00 0.00 ? 16 LYS A CD   2  
ATOM 1460  C CE   . LYS A 1 16 ? -14.118 20.489  9.926   1.00 0.00 ? 16 LYS A CE   2  
ATOM 1461  N NZ   . LYS A 1 16 ? -12.860 20.404  10.718  1.00 0.00 ? 16 LYS A NZ   2  
ATOM 1462  H H    . LYS A 1 16 ? -13.975 18.830  4.825   1.00 0.00 ? 16 LYS A H    2  
ATOM 1463  H HA   . LYS A 1 16 ? -12.507 16.907  6.502   1.00 0.00 ? 16 LYS A HA   2  
ATOM 1464  H HB2  . LYS A 1 16 ? -15.221 18.118  7.051   1.00 0.00 ? 16 LYS A HB2  2  
ATOM 1465  H HB3  . LYS A 1 16 ? -14.552 16.753  7.935   1.00 0.00 ? 16 LYS A HB3  2  
ATOM 1466  H HG2  . LYS A 1 16 ? -12.789 18.093  8.818   1.00 0.00 ? 16 LYS A HG2  2  
ATOM 1467  H HG3  . LYS A 1 16 ? -13.224 19.447  7.773   1.00 0.00 ? 16 LYS A HG3  2  
ATOM 1468  H HD2  . LYS A 1 16 ? -15.545 19.217  8.986   1.00 0.00 ? 16 LYS A HD2  2  
ATOM 1469  H HD3  . LYS A 1 16 ? -14.573 18.427  10.230  1.00 0.00 ? 16 LYS A HD3  2  
ATOM 1470  H HE2  . LYS A 1 16 ? -13.960 21.147  9.086   1.00 0.00 ? 16 LYS A HE2  2  
ATOM 1471  H HE3  . LYS A 1 16 ? -14.902 20.889  10.553  1.00 0.00 ? 16 LYS A HE3  2  
ATOM 1472  H HZ1  . LYS A 1 16 ? -12.263 21.235  10.530  1.00 0.00 ? 16 LYS A HZ1  2  
ATOM 1473  H HZ2  . LYS A 1 16 ? -12.332 19.546  10.458  1.00 0.00 ? 16 LYS A HZ2  2  
ATOM 1474  H HZ3  . LYS A 1 16 ? -13.078 20.369  11.734  1.00 0.00 ? 16 LYS A HZ3  2  
ATOM 1475  N N    . GLY A 1 17 ? -14.995 16.580  4.418   1.00 0.00 ? 17 GLY A N    2  
ATOM 1476  C CA   . GLY A 1 17 ? -15.711 15.617  3.602   1.00 0.00 ? 17 GLY A CA   2  
ATOM 1477  C C    . GLY A 1 17 ? -14.780 14.682  2.856   1.00 0.00 ? 17 GLY A C    2  
ATOM 1478  O O    . GLY A 1 17 ? -14.319 14.999  1.760   1.00 0.00 ? 17 GLY A O    2  
ATOM 1479  H H    . GLY A 1 17 ? -15.122 17.540  4.265   1.00 0.00 ? 17 GLY A H    2  
ATOM 1480  H HA2  . GLY A 1 17 ? -16.358 15.032  4.240   1.00 0.00 ? 17 GLY A HA2  2  
ATOM 1481  H HA3  . GLY A 1 17 ? -16.317 16.150  2.885   1.00 0.00 ? 17 GLY A HA3  2  
ATOM 1482  N N    . ARG A 1 18 ? -14.501 13.528  3.453   1.00 0.00 ? 18 ARG A N    2  
ATOM 1483  C CA   . ARG A 1 18 ? -13.616 12.545  2.839   1.00 0.00 ? 18 ARG A CA   2  
ATOM 1484  C C    . ARG A 1 18 ? -14.393 11.302  2.417   1.00 0.00 ? 18 ARG A C    2  
ATOM 1485  O O    . ARG A 1 18 ? -15.510 11.070  2.878   1.00 0.00 ? 18 ARG A O    2  
ATOM 1486  C CB   . ARG A 1 18 ? -12.499 12.157  3.810   1.00 0.00 ? 18 ARG A CB   2  
ATOM 1487  C CG   . ARG A 1 18 ? -11.339 13.139  3.829   1.00 0.00 ? 18 ARG A CG   2  
ATOM 1488  C CD   . ARG A 1 18 ? -10.291 12.784  2.786   1.00 0.00 ? 18 ARG A CD   2  
ATOM 1489  N NE   . ARG A 1 18 ? -10.566 13.412  1.497   1.00 0.00 ? 18 ARG A NE   2  
ATOM 1490  C CZ   . ARG A 1 18 ? -10.427 14.714  1.269   1.00 0.00 ? 18 ARG A CZ   2  
ATOM 1491  N NH1  . ARG A 1 18 ? -10.018 15.520  2.239   1.00 0.00 ? 18 ARG A NH1  2  
ATOM 1492  N NH2  . ARG A 1 18 ? -10.698 15.211  0.069   1.00 0.00 ? 18 ARG A NH2  2  
ATOM 1493  H H    . ARG A 1 18 ? -14.899 13.332  4.327   1.00 0.00 ? 18 ARG A H    2  
ATOM 1494  H HA   . ARG A 1 18 ? -13.177 12.996  1.961   1.00 0.00 ? 18 ARG A HA   2  
ATOM 1495  H HB2  . ARG A 1 18 ? -12.909 12.098  4.807   1.00 0.00 ? 18 ARG A HB2  2  
ATOM 1496  H HB3  . ARG A 1 18 ? -12.116 11.187  3.529   1.00 0.00 ? 18 ARG A HB3  2  
ATOM 1497  H HG2  . ARG A 1 18 ? -11.715 14.130  3.622   1.00 0.00 ? 18 ARG A HG2  2  
ATOM 1498  H HG3  . ARG A 1 18 ? -10.882 13.122  4.807   1.00 0.00 ? 18 ARG A HG3  2  
ATOM 1499  H HD2  . ARG A 1 18 ? -9.325  13.115  3.138   1.00 0.00 ? 18 ARG A HD2  2  
ATOM 1500  H HD3  . ARG A 1 18 ? -10.279 11.712  2.658   1.00 0.00 ? 18 ARG A HD3  2  
ATOM 1501  H HE   . ARG A 1 18 ? -10.870 12.835  0.766   1.00 0.00 ? 18 ARG A HE   2  
ATOM 1502  H HH11 . ARG A 1 18 ? -9.813  15.148  3.144   1.00 0.00 ? 18 ARG A HH11 2  
ATOM 1503  H HH12 . ARG A 1 18 ? -9.913  16.499  2.065   1.00 0.00 ? 18 ARG A HH12 2  
ATOM 1504  H HH21 . ARG A 1 18 ? -11.006 14.607  -0.665  1.00 0.00 ? 18 ARG A HH21 2  
ATOM 1505  H HH22 . ARG A 1 18 ? -10.593 16.191  -0.101  1.00 0.00 ? 18 ARG A HH22 2  
ATOM 1506  N N    . ARG A 1 19 ? -13.794 10.506  1.537   1.00 0.00 ? 19 ARG A N    2  
ATOM 1507  C CA   . ARG A 1 19 ? -14.430 9.288   1.051   1.00 0.00 ? 19 ARG A CA   2  
ATOM 1508  C C    . ARG A 1 19 ? -13.387 8.231   0.703   1.00 0.00 ? 19 ARG A C    2  
ATOM 1509  O O    . ARG A 1 19 ? -12.368 8.532   0.081   1.00 0.00 ? 19 ARG A O    2  
ATOM 1510  C CB   . ARG A 1 19 ? -15.293 9.592   -0.175  1.00 0.00 ? 19 ARG A CB   2  
ATOM 1511  C CG   . ARG A 1 19 ? -14.487 9.931   -1.418  1.00 0.00 ? 19 ARG A CG   2  
ATOM 1512  C CD   . ARG A 1 19 ? -15.387 10.361  -2.565  1.00 0.00 ? 19 ARG A CD   2  
ATOM 1513  N NE   . ARG A 1 19 ? -14.701 11.256  -3.494  1.00 0.00 ? 19 ARG A NE   2  
ATOM 1514  C CZ   . ARG A 1 19 ? -15.308 11.879  -4.498  1.00 0.00 ? 19 ARG A CZ   2  
ATOM 1515  N NH1  . ARG A 1 19 ? -16.606 11.705  -4.703  1.00 0.00 ? 19 ARG A NH1  2  
ATOM 1516  N NH2  . ARG A 1 19 ? -14.615 12.677  -5.300  1.00 0.00 ? 19 ARG A NH2  2  
ATOM 1517  H H    . ARG A 1 19 ? -12.903 10.744  1.206   1.00 0.00 ? 19 ARG A H    2  
ATOM 1518  H HA   . ARG A 1 19 ? -15.062 8.907   1.839   1.00 0.00 ? 19 ARG A HA   2  
ATOM 1519  H HB2  . ARG A 1 19 ? -15.904 8.728   -0.394  1.00 0.00 ? 19 ARG A HB2  2  
ATOM 1520  H HB3  . ARG A 1 19 ? -15.936 10.430  0.051   1.00 0.00 ? 19 ARG A HB3  2  
ATOM 1521  H HG2  . ARG A 1 19 ? -13.808 10.738  -1.186  1.00 0.00 ? 19 ARG A HG2  2  
ATOM 1522  H HG3  . ARG A 1 19 ? -13.925 9.060   -1.720  1.00 0.00 ? 19 ARG A HG3  2  
ATOM 1523  H HD2  . ARG A 1 19 ? -15.711 9.481   -3.101  1.00 0.00 ? 19 ARG A HD2  2  
ATOM 1524  H HD3  . ARG A 1 19 ? -16.248 10.871  -2.158  1.00 0.00 ? 19 ARG A HD3  2  
ATOM 1525  H HE   . ARG A 1 19 ? -13.741 11.398  -3.361  1.00 0.00 ? 19 ARG A HE   2  
ATOM 1526  H HH11 . ARG A 1 19 ? -17.131 11.105  -4.099  1.00 0.00 ? 19 ARG A HH11 2  
ATOM 1527  H HH12 . ARG A 1 19 ? -17.061 12.176  -5.459  1.00 0.00 ? 19 ARG A HH12 2  
ATOM 1528  H HH21 . ARG A 1 19 ? -13.636 12.811  -5.149  1.00 0.00 ? 19 ARG A HH21 2  
ATOM 1529  H HH22 . ARG A 1 19 ? -15.073 13.145  -6.056  1.00 0.00 ? 19 ARG A HH22 2  
ATOM 1530  N N    . SER A 1 20 ? -13.648 6.992   1.108   1.00 0.00 ? 20 SER A N    2  
ATOM 1531  C CA   . SER A 1 20 ? -12.729 5.891   0.842   1.00 0.00 ? 20 SER A CA   2  
ATOM 1532  C C    . SER A 1 20 ? -13.493 4.594   0.596   1.00 0.00 ? 20 SER A C    2  
ATOM 1533  O O    . SER A 1 20 ? -14.130 4.054   1.502   1.00 0.00 ? 20 SER A O    2  
ATOM 1534  C CB   . SER A 1 20 ? -11.762 5.713   2.013   1.00 0.00 ? 20 SER A CB   2  
ATOM 1535  O OG   . SER A 1 20 ? -10.601 5.005   1.613   1.00 0.00 ? 20 SER A OG   2  
ATOM 1536  H H    . SER A 1 20 ? -14.477 6.815   1.599   1.00 0.00 ? 20 SER A H    2  
ATOM 1537  H HA   . SER A 1 20 ? -12.165 6.137   -0.045  1.00 0.00 ? 20 SER A HA   2  
ATOM 1538  H HB2  . SER A 1 20 ? -11.467 6.683   2.384   1.00 0.00 ? 20 SER A HB2  2  
ATOM 1539  H HB3  . SER A 1 20 ? -12.253 5.160   2.801   1.00 0.00 ? 20 SER A HB3  2  
ATOM 1540  H HG   . SER A 1 20 ? -9.879  5.208   2.212   1.00 0.00 ? 20 SER A HG   2  
ATOM 1541  N N    . ARG A 1 21 ? -13.425 4.098   -0.635  1.00 0.00 ? 21 ARG A N    2  
ATOM 1542  C CA   . ARG A 1 21 ? -14.110 2.865   -1.001  1.00 0.00 ? 21 ARG A CA   2  
ATOM 1543  C C    . ARG A 1 21 ? -13.337 1.645   -0.507  1.00 0.00 ? 21 ARG A C    2  
ATOM 1544  O O    . ARG A 1 21 ? -12.527 1.072   -1.237  1.00 0.00 ? 21 ARG A O    2  
ATOM 1545  C CB   . ARG A 1 21 ? -14.290 2.787   -2.518  1.00 0.00 ? 21 ARG A CB   2  
ATOM 1546  C CG   . ARG A 1 21 ? -15.013 1.533   -2.983  1.00 0.00 ? 21 ARG A CG   2  
ATOM 1547  C CD   . ARG A 1 21 ? -14.699 1.216   -4.437  1.00 0.00 ? 21 ARG A CD   2  
ATOM 1548  N NE   . ARG A 1 21 ? -14.880 -0.201  -4.739  1.00 0.00 ? 21 ARG A NE   2  
ATOM 1549  C CZ   . ARG A 1 21 ? -14.728 -0.719  -5.953  1.00 0.00 ? 21 ARG A CZ   2  
ATOM 1550  N NH1  . ARG A 1 21 ? -14.392 0.060   -6.972  1.00 0.00 ? 21 ARG A NH1  2  
ATOM 1551  N NH2  . ARG A 1 21 ? -14.910 -2.019  -6.149  1.00 0.00 ? 21 ARG A NH2  2  
ATOM 1552  H H    . ARG A 1 21 ? -12.901 4.573   -1.313  1.00 0.00 ? 21 ARG A H    2  
ATOM 1553  H HA   . ARG A 1 21 ? -15.083 2.874   -0.532  1.00 0.00 ? 21 ARG A HA   2  
ATOM 1554  H HB2  . ARG A 1 21 ? -14.859 3.646   -2.846  1.00 0.00 ? 21 ARG A HB2  2  
ATOM 1555  H HB3  . ARG A 1 21 ? -13.317 2.810   -2.985  1.00 0.00 ? 21 ARG A HB3  2  
ATOM 1556  H HG2  . ARG A 1 21 ? -14.701 0.701   -2.369  1.00 0.00 ? 21 ARG A HG2  2  
ATOM 1557  H HG3  . ARG A 1 21 ? -16.077 1.682   -2.877  1.00 0.00 ? 21 ARG A HG3  2  
ATOM 1558  H HD2  . ARG A 1 21 ? -15.356 1.796   -5.068  1.00 0.00 ? 21 ARG A HD2  2  
ATOM 1559  H HD3  . ARG A 1 21 ? -13.674 1.489   -4.637  1.00 0.00 ? 21 ARG A HD3  2  
ATOM 1560  H HE   . ARG A 1 21 ? -15.129 -0.795  -4.000  1.00 0.00 ? 21 ARG A HE   2  
ATOM 1561  H HH11 . ARG A 1 21 ? -14.253 1.039   -6.827  1.00 0.00 ? 21 ARG A HH11 2  
ATOM 1562  H HH12 . ARG A 1 21 ? -14.276 -0.333  -7.885  1.00 0.00 ? 21 ARG A HH12 2  
ATOM 1563  H HH21 . ARG A 1 21 ? -15.163 -2.609  -5.383  1.00 0.00 ? 21 ARG A HH21 2  
ATOM 1564  H HH22 . ARG A 1 21 ? -14.795 -2.407  -7.062  1.00 0.00 ? 21 ARG A HH22 2  
ATOM 1565  N N    . THR A 1 22 ? -13.592 1.254   0.737   1.00 0.00 ? 22 THR A N    2  
ATOM 1566  C CA   . THR A 1 22 ? -12.919 0.104   1.330   1.00 0.00 ? 22 THR A CA   2  
ATOM 1567  C C    . THR A 1 22 ? -13.820 -0.601  2.336   1.00 0.00 ? 22 THR A C    2  
ATOM 1568  O O    . THR A 1 22 ? -14.702 0.015   2.935   1.00 0.00 ? 22 THR A O    2  
ATOM 1569  C CB   . THR A 1 22 ? -11.612 0.518   2.031   1.00 0.00 ? 22 THR A CB   2  
ATOM 1570  O OG1  . THR A 1 22 ? -11.886 1.494   3.042   1.00 0.00 ? 22 THR A OG1  2  
ATOM 1571  C CG2  . THR A 1 22 ? -10.617 1.085   1.029   1.00 0.00 ? 22 THR A CG2  2  
ATOM 1572  H H    . THR A 1 22 ? -14.248 1.751   1.269   1.00 0.00 ? 22 THR A H    2  
ATOM 1573  H HA   . THR A 1 22 ? -12.674 -0.585  0.535   1.00 0.00 ? 22 THR A HA   2  
ATOM 1574  H HB   . THR A 1 22 ? -11.176 -0.356  2.493   1.00 0.00 ? 22 THR A HB   2  
ATOM 1575  H HG1  . THR A 1 22 ? -12.228 1.056   3.825   1.00 0.00 ? 22 THR A HG1  2  
ATOM 1576  H HG21 . THR A 1 22 ? -11.052 1.939   0.532   1.00 0.00 ? 22 THR A HG21 2  
ATOM 1577  H HG22 . THR A 1 22 ? -10.373 0.329   0.297   1.00 0.00 ? 22 THR A HG22 2  
ATOM 1578  H HG23 . THR A 1 22 ? -9.719  1.388   1.546   1.00 0.00 ? 22 THR A HG23 2  
ATOM 1579  N N    . VAL A 1 23 ? -13.593 -1.898  2.520   1.00 0.00 ? 23 VAL A N    2  
ATOM 1580  C CA   . VAL A 1 23 ? -14.384 -2.688  3.456   1.00 0.00 ? 23 VAL A CA   2  
ATOM 1581  C C    . VAL A 1 23 ? -13.596 -2.984  4.727   1.00 0.00 ? 23 VAL A C    2  
ATOM 1582  O O    . VAL A 1 23 ? -13.710 -4.067  5.302   1.00 0.00 ? 23 VAL A O    2  
ATOM 1583  C CB   . VAL A 1 23 ? -14.838 -4.018  2.825   1.00 0.00 ? 23 VAL A CB   2  
ATOM 1584  C CG1  . VAL A 1 23 ? -16.083 -4.544  3.524   1.00 0.00 ? 23 VAL A CG1  2  
ATOM 1585  C CG2  . VAL A 1 23 ? -15.088 -3.842  1.335   1.00 0.00 ? 23 VAL A CG2  2  
ATOM 1586  H H    . VAL A 1 23 ? -12.876 -2.334  2.013   1.00 0.00 ? 23 VAL A H    2  
ATOM 1587  H HA   . VAL A 1 23 ? -15.264 -2.117  3.714   1.00 0.00 ? 23 VAL A HA   2  
ATOM 1588  H HB   . VAL A 1 23 ? -14.047 -4.742  2.953   1.00 0.00 ? 23 VAL A HB   2  
ATOM 1589  H HG11 . VAL A 1 23 ? -16.145 -5.614  3.391   1.00 0.00 ? 23 VAL A HG11 2  
ATOM 1590  H HG12 . VAL A 1 23 ? -16.028 -4.313  4.578   1.00 0.00 ? 23 VAL A HG12 2  
ATOM 1591  H HG13 . VAL A 1 23 ? -16.959 -4.077  3.098   1.00 0.00 ? 23 VAL A HG13 2  
ATOM 1592  H HG21 . VAL A 1 23 ? -15.358 -4.793  0.901   1.00 0.00 ? 23 VAL A HG21 2  
ATOM 1593  H HG22 . VAL A 1 23 ? -15.893 -3.137  1.185   1.00 0.00 ? 23 VAL A HG22 2  
ATOM 1594  H HG23 . VAL A 1 23 ? -14.192 -3.471  0.860   1.00 0.00 ? 23 VAL A HG23 2  
ATOM 1595  N N    . PHE A 1 24 ? -12.798 -2.015  5.161   1.00 0.00 ? 24 PHE A N    2  
ATOM 1596  C CA   . PHE A 1 24 ? -11.990 -2.171  6.365   1.00 0.00 ? 24 PHE A CA   2  
ATOM 1597  C C    . PHE A 1 24 ? -12.637 -1.460  7.550   1.00 0.00 ? 24 PHE A C    2  
ATOM 1598  O O    . PHE A 1 24 ? -13.035 -0.299  7.452   1.00 0.00 ? 24 PHE A O    2  
ATOM 1599  C CB   . PHE A 1 24 ? -10.581 -1.622  6.134   1.00 0.00 ? 24 PHE A CB   2  
ATOM 1600  C CG   . PHE A 1 24 ? -9.835  -2.327  5.037   1.00 0.00 ? 24 PHE A CG   2  
ATOM 1601  C CD1  . PHE A 1 24 ? -9.817  -3.711  4.971   1.00 0.00 ? 24 PHE A CD1  2  
ATOM 1602  C CD2  . PHE A 1 24 ? -9.153  -1.605  4.070   1.00 0.00 ? 24 PHE A CD2  2  
ATOM 1603  C CE1  . PHE A 1 24 ? -9.131  -4.361  3.963   1.00 0.00 ? 24 PHE A CE1  2  
ATOM 1604  C CE2  . PHE A 1 24 ? -8.466  -2.250  3.059   1.00 0.00 ? 24 PHE A CE2  2  
ATOM 1605  C CZ   . PHE A 1 24 ? -8.456  -3.630  3.005   1.00 0.00 ? 24 PHE A CZ   2  
ATOM 1606  H H    . PHE A 1 24 ? -12.751 -1.174  4.659   1.00 0.00 ? 24 PHE A H    2  
ATOM 1607  H HA   . PHE A 1 24 ? -11.925 -3.226  6.585   1.00 0.00 ? 24 PHE A HA   2  
ATOM 1608  H HB2  . PHE A 1 24 ? -10.648 -0.577  5.871   1.00 0.00 ? 24 PHE A HB2  2  
ATOM 1609  H HB3  . PHE A 1 24 ? -10.009 -1.724  7.044   1.00 0.00 ? 24 PHE A HB3  2  
ATOM 1610  H HD1  . PHE A 1 24 ? -10.346 -4.284  5.719   1.00 0.00 ? 24 PHE A HD1  2  
ATOM 1611  H HD2  . PHE A 1 24 ? -9.161  -0.525  4.112   1.00 0.00 ? 24 PHE A HD2  2  
ATOM 1612  H HE1  . PHE A 1 24 ? -9.125  -5.440  3.923   1.00 0.00 ? 24 PHE A HE1  2  
ATOM 1613  H HE2  . PHE A 1 24 ? -7.939  -1.675  2.312   1.00 0.00 ? 24 PHE A HE2  2  
ATOM 1614  H HZ   . PHE A 1 24 ? -7.920  -4.136  2.217   1.00 0.00 ? 24 PHE A HZ   2  
ATOM 1615  N N    . THR A 1 25 ? -12.739 -2.166  8.672   1.00 0.00 ? 25 THR A N    2  
ATOM 1616  C CA   . THR A 1 25 ? -13.339 -1.605  9.876   1.00 0.00 ? 25 THR A CA   2  
ATOM 1617  C C    . THR A 1 25 ? -12.324 -0.784  10.664  1.00 0.00 ? 25 THR A C    2  
ATOM 1618  O O    . THR A 1 25 ? -11.119 -1.008  10.563  1.00 0.00 ? 25 THR A O    2  
ATOM 1619  C CB   . THR A 1 25 ? -13.908 -2.710  10.787  1.00 0.00 ? 25 THR A CB   2  
ATOM 1620  O OG1  . THR A 1 25 ? -12.850 -3.324  11.532  1.00 0.00 ? 25 THR A OG1  2  
ATOM 1621  C CG2  . THR A 1 25 ? -14.637 -3.764  9.969   1.00 0.00 ? 25 THR A CG2  2  
ATOM 1622  H H    . THR A 1 25 ? -12.403 -3.087  8.689   1.00 0.00 ? 25 THR A H    2  
ATOM 1623  H HA   . THR A 1 25 ? -14.152 -0.962  9.575   1.00 0.00 ? 25 THR A HA   2  
ATOM 1624  H HB   . THR A 1 25 ? -14.609 -2.261  11.477  1.00 0.00 ? 25 THR A HB   2  
ATOM 1625  H HG1  . THR A 1 25 ? -12.949 -3.113  12.463  1.00 0.00 ? 25 THR A HG1  2  
ATOM 1626  H HG21 . THR A 1 25 ? -14.921 -3.346  9.015   1.00 0.00 ? 25 THR A HG21 2  
ATOM 1627  H HG22 . THR A 1 25 ? -15.522 -4.083  10.500  1.00 0.00 ? 25 THR A HG22 2  
ATOM 1628  H HG23 . THR A 1 25 ? -13.987 -4.611  9.811   1.00 0.00 ? 25 THR A HG23 2  
ATOM 1629  N N    . GLU A 1 26 ? -12.821 0.166   11.450  1.00 0.00 ? 26 GLU A N    2  
ATOM 1630  C CA   . GLU A 1 26 ? -11.956 1.020   12.255  1.00 0.00 ? 26 GLU A CA   2  
ATOM 1631  C C    . GLU A 1 26 ? -10.770 0.232   12.803  1.00 0.00 ? 26 GLU A C    2  
ATOM 1632  O O    . GLU A 1 26 ? -9.622  0.667   12.705  1.00 0.00 ? 26 GLU A O    2  
ATOM 1633  C CB   . GLU A 1 26 ? -12.747 1.641   13.409  1.00 0.00 ? 26 GLU A CB   2  
ATOM 1634  C CG   . GLU A 1 26 ? -13.624 2.807   12.988  1.00 0.00 ? 26 GLU A CG   2  
ATOM 1635  C CD   . GLU A 1 26 ? -14.282 3.498   14.167  1.00 0.00 ? 26 GLU A CD   2  
ATOM 1636  O OE1  . GLU A 1 26 ? -13.565 4.174   14.933  1.00 0.00 ? 26 GLU A OE1  2  
ATOM 1637  O OE2  . GLU A 1 26 ? -15.514 3.362   14.323  1.00 0.00 ? 26 GLU A OE2  2  
ATOM 1638  H H    . GLU A 1 26 ? -13.792 0.296   11.488  1.00 0.00 ? 26 GLU A H    2  
ATOM 1639  H HA   . GLU A 1 26 ? -11.586 1.810   11.620  1.00 0.00 ? 26 GLU A HA   2  
ATOM 1640  H HB2  . GLU A 1 26 ? -13.378 0.881   13.847  1.00 0.00 ? 26 GLU A HB2  2  
ATOM 1641  H HB3  . GLU A 1 26 ? -12.051 1.993   14.157  1.00 0.00 ? 26 GLU A HB3  2  
ATOM 1642  H HG2  . GLU A 1 26 ? -13.016 3.528   12.463  1.00 0.00 ? 26 GLU A HG2  2  
ATOM 1643  H HG3  . GLU A 1 26 ? -14.396 2.440   12.328  1.00 0.00 ? 26 GLU A HG3  2  
ATOM 1644  N N    . LEU A 1 27 ? -11.056 -0.931  13.379  1.00 0.00 ? 27 LEU A N    2  
ATOM 1645  C CA   . LEU A 1 27 ? -10.013 -1.781  13.943  1.00 0.00 ? 27 LEU A CA   2  
ATOM 1646  C C    . LEU A 1 27 ? -8.963  -2.126  12.892  1.00 0.00 ? 27 LEU A C    2  
ATOM 1647  O O    . LEU A 1 27 ? -7.780  -1.833  13.064  1.00 0.00 ? 27 LEU A O    2  
ATOM 1648  C CB   . LEU A 1 27 ? -10.625 -3.064  14.509  1.00 0.00 ? 27 LEU A CB   2  
ATOM 1649  C CG   . LEU A 1 27 ? -9.750  -3.851  15.485  1.00 0.00 ? 27 LEU A CG   2  
ATOM 1650  C CD1  . LEU A 1 27 ? -9.866  -3.276  16.889  1.00 0.00 ? 27 LEU A CD1  2  
ATOM 1651  C CD2  . LEU A 1 27 ? -10.134 -5.324  15.477  1.00 0.00 ? 27 LEU A CD2  2  
ATOM 1652  H H    . LEU A 1 27 ? -11.989 -1.225  13.427  1.00 0.00 ? 27 LEU A H    2  
ATOM 1653  H HA   . LEU A 1 27 ? -9.538  -1.235  14.744  1.00 0.00 ? 27 LEU A HA   2  
ATOM 1654  H HB2  . LEU A 1 27 ? -11.536 -2.797  15.023  1.00 0.00 ? 27 LEU A HB2  2  
ATOM 1655  H HB3  . LEU A 1 27 ? -10.860 -3.713  13.677  1.00 0.00 ? 27 LEU A HB3  2  
ATOM 1656  H HG   . LEU A 1 27 ? -8.717  -3.772  15.177  1.00 0.00 ? 27 LEU A HG   2  
ATOM 1657  H HD11 . LEU A 1 27 ? -9.411  -2.298  16.915  1.00 0.00 ? 27 LEU A HD11 2  
ATOM 1658  H HD12 . LEU A 1 27 ? -9.362  -3.927  17.587  1.00 0.00 ? 27 LEU A HD12 2  
ATOM 1659  H HD13 . LEU A 1 27 ? -10.909 -3.197  17.160  1.00 0.00 ? 27 LEU A HD13 2  
ATOM 1660  H HD21 . LEU A 1 27 ? -10.453 -5.606  14.485  1.00 0.00 ? 27 LEU A HD21 2  
ATOM 1661  H HD22 . LEU A 1 27 ? -10.941 -5.489  16.175  1.00 0.00 ? 27 LEU A HD22 2  
ATOM 1662  H HD23 . LEU A 1 27 ? -9.280  -5.919  15.765  1.00 0.00 ? 27 LEU A HD23 2  
ATOM 1663  N N    . GLN A 1 28 ? -9.405  -2.747  11.803  1.00 0.00 ? 28 GLN A N    2  
ATOM 1664  C CA   . GLN A 1 28 ? -8.503  -3.130  10.723  1.00 0.00 ? 28 GLN A CA   2  
ATOM 1665  C C    . GLN A 1 28 ? -7.723  -1.923  10.212  1.00 0.00 ? 28 GLN A C    2  
ATOM 1666  O O    . GLN A 1 28 ? -6.496  -1.960  10.112  1.00 0.00 ? 28 GLN A O    2  
ATOM 1667  C CB   . GLN A 1 28 ? -9.288  -3.768  9.576   1.00 0.00 ? 28 GLN A CB   2  
ATOM 1668  C CG   . GLN A 1 28 ? -10.060 -5.012  9.985   1.00 0.00 ? 28 GLN A CG   2  
ATOM 1669  C CD   . GLN A 1 28 ? -10.859 -5.605  8.842   1.00 0.00 ? 28 GLN A CD   2  
ATOM 1670  O OE1  . GLN A 1 28 ? -11.686 -4.929  8.230   1.00 0.00 ? 28 GLN A OE1  2  
ATOM 1671  N NE2  . GLN A 1 28 ? -10.616 -6.877  8.547   1.00 0.00 ? 28 GLN A NE2  2  
ATOM 1672  H H    . GLN A 1 28 ? -10.359 -2.953  11.724  1.00 0.00 ? 28 GLN A H    2  
ATOM 1673  H HA   . GLN A 1 28 ? -7.805  -3.854  11.116  1.00 0.00 ? 28 GLN A HA   2  
ATOM 1674  H HB2  . GLN A 1 28 ? -9.991  -3.045  9.191   1.00 0.00 ? 28 GLN A HB2  2  
ATOM 1675  H HB3  . GLN A 1 28 ? -8.598  -4.041  8.792   1.00 0.00 ? 28 GLN A HB3  2  
ATOM 1676  H HG2  . GLN A 1 28 ? -9.360  -5.755  10.338  1.00 0.00 ? 28 GLN A HG2  2  
ATOM 1677  H HG3  . GLN A 1 28 ? -10.740 -4.752  10.784  1.00 0.00 ? 28 GLN A HG3  2  
ATOM 1678  H HE21 . GLN A 1 28 ? -9.944  -7.355  9.078   1.00 0.00 ? 28 GLN A HE21 2  
ATOM 1679  H HE22 . GLN A 1 28 ? -11.119 -7.286  7.813   1.00 0.00 ? 28 GLN A HE22 2  
ATOM 1680  N N    . LEU A 1 29 ? -8.443  -0.854  9.889   1.00 0.00 ? 29 LEU A N    2  
ATOM 1681  C CA   . LEU A 1 29 ? -7.818  0.365   9.387   1.00 0.00 ? 29 LEU A CA   2  
ATOM 1682  C C    . LEU A 1 29 ? -6.791  0.899   10.380  1.00 0.00 ? 29 LEU A C    2  
ATOM 1683  O O    . LEU A 1 29 ? -5.723  1.371   9.990   1.00 0.00 ? 29 LEU A O    2  
ATOM 1684  C CB   . LEU A 1 29 ? -8.881  1.431   9.114   1.00 0.00 ? 29 LEU A CB   2  
ATOM 1685  C CG   . LEU A 1 29 ? -9.609  1.324   7.773   1.00 0.00 ? 29 LEU A CG   2  
ATOM 1686  C CD1  . LEU A 1 29 ? -10.772 2.303   7.718   1.00 0.00 ? 29 LEU A CD1  2  
ATOM 1687  C CD2  . LEU A 1 29 ? -8.645  1.573   6.622   1.00 0.00 ? 29 LEU A CD2  2  
ATOM 1688  H H    . LEU A 1 29 ? -9.417  -0.884  9.991   1.00 0.00 ? 29 LEU A H    2  
ATOM 1689  H HA   . LEU A 1 29 ? -7.316  0.124   8.463   1.00 0.00 ? 29 LEU A HA   2  
ATOM 1690  H HB2  . LEU A 1 29 ? -9.621  1.369   9.897   1.00 0.00 ? 29 LEU A HB2  2  
ATOM 1691  H HB3  . LEU A 1 29 ? -8.398  2.397   9.153   1.00 0.00 ? 29 LEU A HB3  2  
ATOM 1692  H HG   . LEU A 1 29 ? -10.009 0.325   7.666   1.00 0.00 ? 29 LEU A HG   2  
ATOM 1693  H HD11 . LEU A 1 29 ? -10.664 2.941   6.854   1.00 0.00 ? 29 LEU A HD11 2  
ATOM 1694  H HD12 . LEU A 1 29 ? -10.777 2.907   8.613   1.00 0.00 ? 29 LEU A HD12 2  
ATOM 1695  H HD13 . LEU A 1 29 ? -11.700 1.755   7.648   1.00 0.00 ? 29 LEU A HD13 2  
ATOM 1696  H HD21 . LEU A 1 29 ? -8.840  0.863   5.832   1.00 0.00 ? 29 LEU A HD21 2  
ATOM 1697  H HD22 . LEU A 1 29 ? -7.630  1.453   6.971   1.00 0.00 ? 29 LEU A HD22 2  
ATOM 1698  H HD23 . LEU A 1 29 ? -8.783  2.576   6.248   1.00 0.00 ? 29 LEU A HD23 2  
ATOM 1699  N N    . MET A 1 30 ? -7.120  0.819   11.665  1.00 0.00 ? 30 MET A N    2  
ATOM 1700  C CA   . MET A 1 30 ? -6.223  1.291   12.714  1.00 0.00 ? 30 MET A CA   2  
ATOM 1701  C C    . MET A 1 30 ? -4.860  0.615   12.610  1.00 0.00 ? 30 MET A C    2  
ATOM 1702  O O    . MET A 1 30 ? -3.823  1.268   12.710  1.00 0.00 ? 30 MET A O    2  
ATOM 1703  C CB   . MET A 1 30 ? -6.832  1.027   14.092  1.00 0.00 ? 30 MET A CB   2  
ATOM 1704  C CG   . MET A 1 30 ? -5.875  1.296   15.242  1.00 0.00 ? 30 MET A CG   2  
ATOM 1705  S SD   . MET A 1 30 ? -6.724  1.803   16.749  1.00 0.00 ? 30 MET A SD   2  
ATOM 1706  C CE   . MET A 1 30 ? -6.744  0.262   17.662  1.00 0.00 ? 30 MET A CE   2  
ATOM 1707  H H    . MET A 1 30 ? -7.985  0.433   11.915  1.00 0.00 ? 30 MET A H    2  
ATOM 1708  H HA   . MET A 1 30 ? -6.095  2.355   12.585  1.00 0.00 ? 30 MET A HA   2  
ATOM 1709  H HB2  . MET A 1 30 ? -7.698  1.660   14.218  1.00 0.00 ? 30 MET A HB2  2  
ATOM 1710  H HB3  . MET A 1 30 ? -7.141  -0.006  14.145  1.00 0.00 ? 30 MET A HB3  2  
ATOM 1711  H HG2  . MET A 1 30 ? -5.316  0.394   15.447  1.00 0.00 ? 30 MET A HG2  2  
ATOM 1712  H HG3  . MET A 1 30 ? -5.192  2.080   14.947  1.00 0.00 ? 30 MET A HG3  2  
ATOM 1713  H HE1  . MET A 1 30 ? -6.918  0.465   18.708  1.00 0.00 ? 30 MET A HE1  2  
ATOM 1714  H HE2  . MET A 1 30 ? -7.532  -0.371  17.281  1.00 0.00 ? 30 MET A HE2  2  
ATOM 1715  H HE3  . MET A 1 30 ? -5.792  -0.237  17.545  1.00 0.00 ? 30 MET A HE3  2  
ATOM 1716  N N    . GLY A 1 31 ? -4.870  -0.700  12.408  1.00 0.00 ? 31 GLY A N    2  
ATOM 1717  C CA   . GLY A 1 31 ? -3.629  -1.442  12.294  1.00 0.00 ? 31 GLY A CA   2  
ATOM 1718  C C    . GLY A 1 31 ? -2.936  -1.213  10.965  1.00 0.00 ? 31 GLY A C    2  
ATOM 1719  O O    . GLY A 1 31 ? -1.707  -1.170  10.897  1.00 0.00 ? 31 GLY A O    2  
ATOM 1720  H H    . GLY A 1 31 ? -5.728  -1.169  12.336  1.00 0.00 ? 31 GLY A H    2  
ATOM 1721  H HA2  . GLY A 1 31 ? -2.966  -1.139  13.091  1.00 0.00 ? 31 GLY A HA2  2  
ATOM 1722  H HA3  . GLY A 1 31 ? -3.842  -2.496  12.397  1.00 0.00 ? 31 GLY A HA3  2  
ATOM 1723  N N    . LEU A 1 32 ? -3.724  -1.066  9.906   1.00 0.00 ? 32 LEU A N    2  
ATOM 1724  C CA   . LEU A 1 32 ? -3.179  -0.841  8.572   1.00 0.00 ? 32 LEU A CA   2  
ATOM 1725  C C    . LEU A 1 32 ? -2.381  0.458   8.522   1.00 0.00 ? 32 LEU A C    2  
ATOM 1726  O O    . LEU A 1 32 ? -1.294  0.507   7.948   1.00 0.00 ? 32 LEU A O    2  
ATOM 1727  C CB   . LEU A 1 32 ? -4.307  -0.800  7.539   1.00 0.00 ? 32 LEU A CB   2  
ATOM 1728  C CG   . LEU A 1 32 ? -4.753  -2.151  6.978   1.00 0.00 ? 32 LEU A CG   2  
ATOM 1729  C CD1  . LEU A 1 32 ? -6.082  -2.014  6.251   1.00 0.00 ? 32 LEU A CD1  2  
ATOM 1730  C CD2  . LEU A 1 32 ? -3.691  -2.720  6.050   1.00 0.00 ? 32 LEU A CD2  2  
ATOM 1731  H H    . LEU A 1 32 ? -4.696  -1.110  10.023  1.00 0.00 ? 32 LEU A H    2  
ATOM 1732  H HA   . LEU A 1 32 ? -2.520  -1.664  8.340   1.00 0.00 ? 32 LEU A HA   2  
ATOM 1733  H HB2  . LEU A 1 32 ? -5.164  -0.336  8.003   1.00 0.00 ? 32 LEU A HB2  2  
ATOM 1734  H HB3  . LEU A 1 32 ? -3.974  -0.191  6.711   1.00 0.00 ? 32 LEU A HB3  2  
ATOM 1735  H HG   . LEU A 1 32 ? -4.891  -2.845  7.796   1.00 0.00 ? 32 LEU A HG   2  
ATOM 1736  H HD11 . LEU A 1 32 ? -6.784  -1.489  6.880   1.00 0.00 ? 32 LEU A HD11 2  
ATOM 1737  H HD12 . LEU A 1 32 ? -6.469  -2.996  6.022   1.00 0.00 ? 32 LEU A HD12 2  
ATOM 1738  H HD13 . LEU A 1 32 ? -5.935  -1.462  5.334   1.00 0.00 ? 32 LEU A HD13 2  
ATOM 1739  H HD21 . LEU A 1 32 ? -3.180  -3.534  6.544   1.00 0.00 ? 32 LEU A HD21 2  
ATOM 1740  H HD22 . LEU A 1 32 ? -2.979  -1.947  5.801   1.00 0.00 ? 32 LEU A HD22 2  
ATOM 1741  H HD23 . LEU A 1 32 ? -4.159  -3.083  5.147   1.00 0.00 ? 32 LEU A HD23 2  
ATOM 1742  N N    . GLU A 1 33 ? -2.928  1.507   9.128   1.00 0.00 ? 33 GLU A N    2  
ATOM 1743  C CA   . GLU A 1 33 ? -2.265  2.805   9.153   1.00 0.00 ? 33 GLU A CA   2  
ATOM 1744  C C    . GLU A 1 33 ? -1.052  2.779   10.078  1.00 0.00 ? 33 GLU A C    2  
ATOM 1745  O O    . GLU A 1 33 ? -0.046  3.441   9.821   1.00 0.00 ? 33 GLU A O    2  
ATOM 1746  C CB   . GLU A 1 33 ? -3.242  3.893   9.605   1.00 0.00 ? 33 GLU A CB   2  
ATOM 1747  C CG   . GLU A 1 33 ? -4.385  4.126   8.633   1.00 0.00 ? 33 GLU A CG   2  
ATOM 1748  C CD   . GLU A 1 33 ? -5.463  5.027   9.205   1.00 0.00 ? 33 GLU A CD   2  
ATOM 1749  O OE1  . GLU A 1 33 ? -5.130  5.898   10.035  1.00 0.00 ? 33 GLU A OE1  2  
ATOM 1750  O OE2  . GLU A 1 33 ? -6.640  4.859   8.822   1.00 0.00 ? 33 GLU A OE2  2  
ATOM 1751  H H    . GLU A 1 33 ? -3.797  1.405   9.569   1.00 0.00 ? 33 GLU A H    2  
ATOM 1752  H HA   . GLU A 1 33 ? -1.933  3.027   8.150   1.00 0.00 ? 33 GLU A HA   2  
ATOM 1753  H HB2  . GLU A 1 33 ? -3.660  3.610   10.560  1.00 0.00 ? 33 GLU A HB2  2  
ATOM 1754  H HB3  . GLU A 1 33 ? -2.700  4.820   9.721   1.00 0.00 ? 33 GLU A HB3  2  
ATOM 1755  H HG2  . GLU A 1 33 ? -3.992  4.586   7.738   1.00 0.00 ? 33 GLU A HG2  2  
ATOM 1756  H HG3  . GLU A 1 33 ? -4.828  3.174   8.382   1.00 0.00 ? 33 GLU A HG3  2  
ATOM 1757  N N    . LYS A 1 34 ? -1.154  2.010   11.157  1.00 0.00 ? 34 LYS A N    2  
ATOM 1758  C CA   . LYS A 1 34 ? -0.067  1.895   12.121  1.00 0.00 ? 34 LYS A CA   2  
ATOM 1759  C C    . LYS A 1 34 ? 1.173   1.288   11.474  1.00 0.00 ? 34 LYS A C    2  
ATOM 1760  O O    . LYS A 1 34 ? 2.261   1.861   11.535  1.00 0.00 ? 34 LYS A O    2  
ATOM 1761  C CB   . LYS A 1 34 ? -0.503  1.041   13.314  1.00 0.00 ? 34 LYS A CB   2  
ATOM 1762  C CG   . LYS A 1 34 ? 0.316   1.285   14.569  1.00 0.00 ? 34 LYS A CG   2  
ATOM 1763  C CD   . LYS A 1 34 ? -0.237  2.447   15.378  1.00 0.00 ? 34 LYS A CD   2  
ATOM 1764  C CE   . LYS A 1 34 ? 0.735   2.883   16.464  1.00 0.00 ? 34 LYS A CE   2  
ATOM 1765  N NZ   . LYS A 1 34 ? 0.937   1.820   17.487  1.00 0.00 ? 34 LYS A NZ   2  
ATOM 1766  H H    . LYS A 1 34 ? -1.982  1.506   11.307  1.00 0.00 ? 34 LYS A H    2  
ATOM 1767  H HA   . LYS A 1 34 ? 0.174   2.888   12.470  1.00 0.00 ? 34 LYS A HA   2  
ATOM 1768  H HB2  . LYS A 1 34 ? -1.538  1.256   13.536  1.00 0.00 ? 34 LYS A HB2  2  
ATOM 1769  H HB3  . LYS A 1 34 ? -0.411  -0.002  13.046  1.00 0.00 ? 34 LYS A HB3  2  
ATOM 1770  H HG2  . LYS A 1 34 ? 0.297   0.394   15.180  1.00 0.00 ? 34 LYS A HG2  2  
ATOM 1771  H HG3  . LYS A 1 34 ? 1.335   1.508   14.286  1.00 0.00 ? 34 LYS A HG3  2  
ATOM 1772  H HD2  . LYS A 1 34 ? -0.418  3.281   14.717  1.00 0.00 ? 34 LYS A HD2  2  
ATOM 1773  H HD3  . LYS A 1 34 ? -1.166  2.143   15.840  1.00 0.00 ? 34 LYS A HD3  2  
ATOM 1774  H HE2  . LYS A 1 34 ? 1.685   3.115   16.006  1.00 0.00 ? 34 LYS A HE2  2  
ATOM 1775  H HE3  . LYS A 1 34 ? 0.343   3.765   16.946  1.00 0.00 ? 34 LYS A HE3  2  
ATOM 1776  H HZ1  . LYS A 1 34 ? 0.555   0.916   17.143  1.00 0.00 ? 34 LYS A HZ1  2  
ATOM 1777  H HZ2  . LYS A 1 34 ? 0.450   2.076   18.369  1.00 0.00 ? 34 LYS A HZ2  2  
ATOM 1778  H HZ3  . LYS A 1 34 ? 1.951   1.702   17.685  1.00 0.00 ? 34 LYS A HZ3  2  
ATOM 1779  N N    . ARG A 1 35 ? 1.002   0.125   10.853  1.00 0.00 ? 35 ARG A N    2  
ATOM 1780  C CA   . ARG A 1 35 ? 2.107   -0.560  10.194  1.00 0.00 ? 35 ARG A CA   2  
ATOM 1781  C C    . ARG A 1 35 ? 2.628   0.258   9.016   1.00 0.00 ? 35 ARG A C    2  
ATOM 1782  O O    . ARG A 1 35 ? 3.837   0.405   8.834   1.00 0.00 ? 35 ARG A O    2  
ATOM 1783  C CB   . ARG A 1 35 ? 1.664   -1.942  9.712   1.00 0.00 ? 35 ARG A CB   2  
ATOM 1784  C CG   . ARG A 1 35 ? 1.676   -3.000  10.804  1.00 0.00 ? 35 ARG A CG   2  
ATOM 1785  C CD   . ARG A 1 35 ? 3.027   -3.694  10.893  1.00 0.00 ? 35 ARG A CD   2  
ATOM 1786  N NE   . ARG A 1 35 ? 2.914   -5.041  11.444  1.00 0.00 ? 35 ARG A NE   2  
ATOM 1787  C CZ   . ARG A 1 35 ? 3.938   -5.712  11.960  1.00 0.00 ? 35 ARG A CZ   2  
ATOM 1788  N NH1  . ARG A 1 35 ? 5.144   -5.163  11.996  1.00 0.00 ? 35 ARG A NH1  2  
ATOM 1789  N NH2  . ARG A 1 35 ? 3.757   -6.935  12.442  1.00 0.00 ? 35 ARG A NH2  2  
ATOM 1790  H H    . ARG A 1 35 ? 0.111   -0.283  10.839  1.00 0.00 ? 35 ARG A H    2  
ATOM 1791  H HA   . ARG A 1 35 ? 2.902   -0.677  10.915  1.00 0.00 ? 35 ARG A HA   2  
ATOM 1792  H HB2  . ARG A 1 35 ? 0.660   -1.871  9.323   1.00 0.00 ? 35 ARG A HB2  2  
ATOM 1793  H HB3  . ARG A 1 35 ? 2.326   -2.264  8.922   1.00 0.00 ? 35 ARG A HB3  2  
ATOM 1794  H HG2  . ARG A 1 35 ? 1.463   -2.528  11.752  1.00 0.00 ? 35 ARG A HG2  2  
ATOM 1795  H HG3  . ARG A 1 35 ? 0.917   -3.736  10.587  1.00 0.00 ? 35 ARG A HG3  2  
ATOM 1796  H HD2  . ARG A 1 35 ? 3.451   -3.755  9.902   1.00 0.00 ? 35 ARG A HD2  2  
ATOM 1797  H HD3  . ARG A 1 35 ? 3.676   -3.108  11.527  1.00 0.00 ? 35 ARG A HD3  2  
ATOM 1798  H HE   . ARG A 1 35 ? 2.032   -5.467  11.428  1.00 0.00 ? 35 ARG A HE   2  
ATOM 1799  H HH11 . ARG A 1 35 ? 5.284   -4.241  11.634  1.00 0.00 ? 35 ARG A HH11 2  
ATOM 1800  H HH12 . ARG A 1 35 ? 5.914   -5.669  12.386  1.00 0.00 ? 35 ARG A HH12 2  
ATOM 1801  H HH21 . ARG A 1 35 ? 2.849   -7.352  12.417  1.00 0.00 ? 35 ARG A HH21 2  
ATOM 1802  H HH22 . ARG A 1 35 ? 4.528   -7.439  12.830  1.00 0.00 ? 35 ARG A HH22 2  
ATOM 1803  N N    . PHE A 1 36 ? 1.708   0.788   8.217   1.00 0.00 ? 36 PHE A N    2  
ATOM 1804  C CA   . PHE A 1 36 ? 2.074   1.590   7.055   1.00 0.00 ? 36 PHE A CA   2  
ATOM 1805  C C    . PHE A 1 36 ? 2.834   2.844   7.477   1.00 0.00 ? 36 PHE A C    2  
ATOM 1806  O O    . PHE A 1 36 ? 3.814   3.231   6.841   1.00 0.00 ? 36 PHE A O    2  
ATOM 1807  C CB   . PHE A 1 36 ? 0.823   1.980   6.264   1.00 0.00 ? 36 PHE A CB   2  
ATOM 1808  C CG   . PHE A 1 36 ? 1.121   2.790   5.035   1.00 0.00 ? 36 PHE A CG   2  
ATOM 1809  C CD1  . PHE A 1 36 ? 1.643   4.069   5.141   1.00 0.00 ? 36 PHE A CD1  2  
ATOM 1810  C CD2  . PHE A 1 36 ? 0.878   2.272   3.772   1.00 0.00 ? 36 PHE A CD2  2  
ATOM 1811  C CE1  . PHE A 1 36 ? 1.917   4.816   4.011   1.00 0.00 ? 36 PHE A CE1  2  
ATOM 1812  C CE2  . PHE A 1 36 ? 1.150   3.015   2.639   1.00 0.00 ? 36 PHE A CE2  2  
ATOM 1813  C CZ   . PHE A 1 36 ? 1.671   4.288   2.758   1.00 0.00 ? 36 PHE A CZ   2  
ATOM 1814  H H    . PHE A 1 36 ? 0.759   0.636   8.413   1.00 0.00 ? 36 PHE A H    2  
ATOM 1815  H HA   . PHE A 1 36 ? 2.714   0.989   6.427   1.00 0.00 ? 36 PHE A HA   2  
ATOM 1816  H HB2  . PHE A 1 36 ? 0.308   1.084   5.954   1.00 0.00 ? 36 PHE A HB2  2  
ATOM 1817  H HB3  . PHE A 1 36 ? 0.173   2.564   6.898   1.00 0.00 ? 36 PHE A HB3  2  
ATOM 1818  H HD1  . PHE A 1 36 ? 1.837   4.483   6.119   1.00 0.00 ? 36 PHE A HD1  2  
ATOM 1819  H HD2  . PHE A 1 36 ? 0.471   1.275   3.678   1.00 0.00 ? 36 PHE A HD2  2  
ATOM 1820  H HE1  . PHE A 1 36 ? 2.324   5.812   4.107   1.00 0.00 ? 36 PHE A HE1  2  
ATOM 1821  H HE2  . PHE A 1 36 ? 0.957   2.599   1.661   1.00 0.00 ? 36 PHE A HE2  2  
ATOM 1822  H HZ   . PHE A 1 36 ? 1.884   4.871   1.874   1.00 0.00 ? 36 PHE A HZ   2  
ATOM 1823  N N    . GLU A 1 37 ? 2.374   3.473   8.554   1.00 0.00 ? 37 GLU A N    2  
ATOM 1824  C CA   . GLU A 1 37 ? 3.010   4.684   9.060   1.00 0.00 ? 37 GLU A CA   2  
ATOM 1825  C C    . GLU A 1 37 ? 4.429   4.393   9.542   1.00 0.00 ? 37 GLU A C    2  
ATOM 1826  O O    . GLU A 1 37 ? 5.388   5.029   9.105   1.00 0.00 ? 37 GLU A O    2  
ATOM 1827  C CB   . GLU A 1 37 ? 2.185   5.281   10.202  1.00 0.00 ? 37 GLU A CB   2  
ATOM 1828  C CG   . GLU A 1 37 ? 1.101   6.237   9.734   1.00 0.00 ? 37 GLU A CG   2  
ATOM 1829  C CD   . GLU A 1 37 ? 0.780   7.304   10.762  1.00 0.00 ? 37 GLU A CD   2  
ATOM 1830  O OE1  . GLU A 1 37 ? 1.565   8.267   10.883  1.00 0.00 ? 37 GLU A OE1  2  
ATOM 1831  O OE2  . GLU A 1 37 ? -0.258  7.176   11.445  1.00 0.00 ? 37 GLU A OE2  2  
ATOM 1832  H H    . GLU A 1 37 ? 1.589   3.116   9.018   1.00 0.00 ? 37 GLU A H    2  
ATOM 1833  H HA   . GLU A 1 37 ? 3.057   5.397   8.251   1.00 0.00 ? 37 GLU A HA   2  
ATOM 1834  H HB2  . GLU A 1 37 ? 1.716   4.477   10.750  1.00 0.00 ? 37 GLU A HB2  2  
ATOM 1835  H HB3  . GLU A 1 37 ? 2.847   5.818   10.865  1.00 0.00 ? 37 GLU A HB3  2  
ATOM 1836  H HG2  . GLU A 1 37 ? 1.432   6.721   8.827   1.00 0.00 ? 37 GLU A HG2  2  
ATOM 1837  H HG3  . GLU A 1 37 ? 0.203   5.671   9.531   1.00 0.00 ? 37 GLU A HG3  2  
ATOM 1838  N N    . LYS A 1 38 ? 4.554   3.427   10.446  1.00 0.00 ? 38 LYS A N    2  
ATOM 1839  C CA   . LYS A 1 38 ? 5.854   3.049   10.988  1.00 0.00 ? 38 LYS A CA   2  
ATOM 1840  C C    . LYS A 1 38 ? 6.774   2.534   9.886   1.00 0.00 ? 38 LYS A C    2  
ATOM 1841  O O    . LYS A 1 38 ? 7.962   2.853   9.858   1.00 0.00 ? 38 LYS A O    2  
ATOM 1842  C CB   . LYS A 1 38 ? 5.687   1.979   12.069  1.00 0.00 ? 38 LYS A CB   2  
ATOM 1843  C CG   . LYS A 1 38 ? 4.796   2.412   13.220  1.00 0.00 ? 38 LYS A CG   2  
ATOM 1844  C CD   . LYS A 1 38 ? 5.523   3.355   14.164  1.00 0.00 ? 38 LYS A CD   2  
ATOM 1845  C CE   . LYS A 1 38 ? 4.631   3.784   15.320  1.00 0.00 ? 38 LYS A CE   2  
ATOM 1846  N NZ   . LYS A 1 38 ? 5.356   4.655   16.286  1.00 0.00 ? 38 LYS A NZ   2  
ATOM 1847  H H    . LYS A 1 38 ? 3.751   2.956   10.755  1.00 0.00 ? 38 LYS A H    2  
ATOM 1848  H HA   . LYS A 1 38 ? 6.297   3.929   11.429  1.00 0.00 ? 38 LYS A HA   2  
ATOM 1849  H HB2  . LYS A 1 38 ? 5.257   1.095   11.621  1.00 0.00 ? 38 LYS A HB2  2  
ATOM 1850  H HB3  . LYS A 1 38 ? 6.660   1.733   12.468  1.00 0.00 ? 38 LYS A HB3  2  
ATOM 1851  H HG2  . LYS A 1 38 ? 3.928   2.917   12.822  1.00 0.00 ? 38 LYS A HG2  2  
ATOM 1852  H HG3  . LYS A 1 38 ? 4.484   1.536   13.771  1.00 0.00 ? 38 LYS A HG3  2  
ATOM 1853  H HD2  . LYS A 1 38 ? 6.392   2.853   14.563  1.00 0.00 ? 38 LYS A HD2  2  
ATOM 1854  H HD3  . LYS A 1 38 ? 5.832   4.232   13.615  1.00 0.00 ? 38 LYS A HD3  2  
ATOM 1855  H HE2  . LYS A 1 38 ? 3.786   4.326   14.923  1.00 0.00 ? 38 LYS A HE2  2  
ATOM 1856  H HE3  . LYS A 1 38 ? 4.282   2.901   15.835  1.00 0.00 ? 38 LYS A HE3  2  
ATOM 1857  H HZ1  . LYS A 1 38 ? 6.339   4.791   15.976  1.00 0.00 ? 38 LYS A HZ1  2  
ATOM 1858  H HZ2  . LYS A 1 38 ? 5.359   4.217   17.229  1.00 0.00 ? 38 LYS A HZ2  2  
ATOM 1859  H HZ3  . LYS A 1 38 ? 4.892   5.583   16.348  1.00 0.00 ? 38 LYS A HZ3  2  
ATOM 1860  N N    . GLN A 1 39 ? 6.216   1.737   8.979   1.00 0.00 ? 39 GLN A N    2  
ATOM 1861  C CA   . GLN A 1 39 ? 6.988   1.180   7.875   1.00 0.00 ? 39 GLN A CA   2  
ATOM 1862  C C    . GLN A 1 39 ? 6.235   1.325   6.557   1.00 0.00 ? 39 GLN A C    2  
ATOM 1863  O O    . GLN A 1 39 ? 5.449   0.456   6.179   1.00 0.00 ? 39 GLN A O    2  
ATOM 1864  C CB   . GLN A 1 39 ? 7.301   -0.295  8.137   1.00 0.00 ? 39 GLN A CB   2  
ATOM 1865  C CG   . GLN A 1 39 ? 8.545   -0.790  7.418   1.00 0.00 ? 39 GLN A CG   2  
ATOM 1866  C CD   . GLN A 1 39 ? 8.814   -2.262  7.663   1.00 0.00 ? 39 GLN A CD   2  
ATOM 1867  O OE1  . GLN A 1 39 ? 8.372   -2.827  8.664   1.00 0.00 ? 39 GLN A OE1  2  
ATOM 1868  N NE2  . GLN A 1 39 ? 9.542   -2.891  6.748   1.00 0.00 ? 39 GLN A NE2  2  
ATOM 1869  H H    . GLN A 1 39 ? 5.264   1.520   9.056   1.00 0.00 ? 39 GLN A H    2  
ATOM 1870  H HA   . GLN A 1 39 ? 7.915   1.728   7.808   1.00 0.00 ? 39 GLN A HA   2  
ATOM 1871  H HB2  . GLN A 1 39 ? 7.443   -0.437  9.198   1.00 0.00 ? 39 GLN A HB2  2  
ATOM 1872  H HB3  . GLN A 1 39 ? 6.462   -0.892  7.812   1.00 0.00 ? 39 GLN A HB3  2  
ATOM 1873  H HG2  . GLN A 1 39 ? 8.417   -0.635  6.357   1.00 0.00 ? 39 GLN A HG2  2  
ATOM 1874  H HG3  . GLN A 1 39 ? 9.395   -0.221  7.764   1.00 0.00 ? 39 GLN A HG3  2  
ATOM 1875  H HE21 . GLN A 1 39 ? 9.861   -2.376  5.977   1.00 0.00 ? 39 GLN A HE21 2  
ATOM 1876  H HE22 . GLN A 1 39 ? 9.731   -3.842  6.881   1.00 0.00 ? 39 GLN A HE22 2  
ATOM 1877  N N    . LYS A 1 40 ? 6.479   2.430   5.860   1.00 0.00 ? 40 LYS A N    2  
ATOM 1878  C CA   . LYS A 1 40 ? 5.826   2.690   4.583   1.00 0.00 ? 40 LYS A CA   2  
ATOM 1879  C C    . LYS A 1 40 ? 5.669   1.403   3.780   1.00 0.00 ? 40 LYS A C    2  
ATOM 1880  O O    . LYS A 1 40 ? 4.744   1.269   2.978   1.00 0.00 ? 40 LYS A O    2  
ATOM 1881  C CB   . LYS A 1 40 ? 6.628   3.713   3.776   1.00 0.00 ? 40 LYS A CB   2  
ATOM 1882  C CG   . LYS A 1 40 ? 6.560   5.121   4.341   1.00 0.00 ? 40 LYS A CG   2  
ATOM 1883  C CD   . LYS A 1 40 ? 5.327   5.861   3.850   1.00 0.00 ? 40 LYS A CD   2  
ATOM 1884  C CE   . LYS A 1 40 ? 4.923   6.969   4.811   1.00 0.00 ? 40 LYS A CE   2  
ATOM 1885  N NZ   . LYS A 1 40 ? 4.388   6.427   6.090   1.00 0.00 ? 40 LYS A NZ   2  
ATOM 1886  H H    . LYS A 1 40 ? 7.116   3.086   6.214   1.00 0.00 ? 40 LYS A H    2  
ATOM 1887  H HA   . LYS A 1 40 ? 4.846   3.094   4.788   1.00 0.00 ? 40 LYS A HA   2  
ATOM 1888  H HB2  . LYS A 1 40 ? 7.663   3.406   3.754   1.00 0.00 ? 40 LYS A HB2  2  
ATOM 1889  H HB3  . LYS A 1 40 ? 6.246   3.735   2.765   1.00 0.00 ? 40 LYS A HB3  2  
ATOM 1890  H HG2  . LYS A 1 40 ? 6.529   5.066   5.419   1.00 0.00 ? 40 LYS A HG2  2  
ATOM 1891  H HG3  . LYS A 1 40 ? 7.442   5.666   4.032   1.00 0.00 ? 40 LYS A HG3  2  
ATOM 1892  H HD2  . LYS A 1 40 ? 5.538   6.296   2.885   1.00 0.00 ? 40 LYS A HD2  2  
ATOM 1893  H HD3  . LYS A 1 40 ? 4.510   5.159   3.760   1.00 0.00 ? 40 LYS A HD3  2  
ATOM 1894  H HE2  . LYS A 1 40 ? 5.788   7.578   5.022   1.00 0.00 ? 40 LYS A HE2  2  
ATOM 1895  H HE3  . LYS A 1 40 ? 4.162   7.575   4.340   1.00 0.00 ? 40 LYS A HE3  2  
ATOM 1896  H HZ1  . LYS A 1 40 ? 3.475   6.873   6.313   1.00 0.00 ? 40 LYS A HZ1  2  
ATOM 1897  H HZ2  . LYS A 1 40 ? 5.054   6.618   6.866   1.00 0.00 ? 40 LYS A HZ2  2  
ATOM 1898  H HZ3  . LYS A 1 40 ? 4.249   5.399   6.013   1.00 0.00 ? 40 LYS A HZ3  2  
ATOM 1899  N N    . TYR A 1 41 ? 6.577   0.459   4.001   1.00 0.00 ? 41 TYR A N    2  
ATOM 1900  C CA   . TYR A 1 41 ? 6.540   -0.817  3.297   1.00 0.00 ? 41 TYR A CA   2  
ATOM 1901  C C    . TYR A 1 41 ? 6.501   -1.982  4.281   1.00 0.00 ? 41 TYR A C    2  
ATOM 1902  O O    . TYR A 1 41 ? 6.498   -1.783  5.497   1.00 0.00 ? 41 TYR A O    2  
ATOM 1903  C CB   . TYR A 1 41 ? 7.755   -0.952  2.378   1.00 0.00 ? 41 TYR A CB   2  
ATOM 1904  C CG   . TYR A 1 41 ? 8.259   0.369   1.842   1.00 0.00 ? 41 TYR A CG   2  
ATOM 1905  C CD1  . TYR A 1 41 ? 7.449   1.175   1.052   1.00 0.00 ? 41 TYR A CD1  2  
ATOM 1906  C CD2  . TYR A 1 41 ? 9.545   0.811   2.126   1.00 0.00 ? 41 TYR A CD2  2  
ATOM 1907  C CE1  . TYR A 1 41 ? 7.905   2.383   0.560   1.00 0.00 ? 41 TYR A CE1  2  
ATOM 1908  C CE2  . TYR A 1 41 ? 10.009  2.018   1.639   1.00 0.00 ? 41 TYR A CE2  2  
ATOM 1909  C CZ   . TYR A 1 41 ? 9.186   2.800   0.857   1.00 0.00 ? 41 TYR A CZ   2  
ATOM 1910  O OH   . TYR A 1 41 ? 9.645   4.002   0.369   1.00 0.00 ? 41 TYR A OH   2  
ATOM 1911  H H    . TYR A 1 41 ? 7.291   0.624   4.652   1.00 0.00 ? 41 TYR A H    2  
ATOM 1912  H HA   . TYR A 1 41 ? 5.643   -0.839  2.696   1.00 0.00 ? 41 TYR A HA   2  
ATOM 1913  H HB2  . TYR A 1 41 ? 8.561   -1.417  2.924   1.00 0.00 ? 41 TYR A HB2  2  
ATOM 1914  H HB3  . TYR A 1 41 ? 7.493   -1.574  1.534   1.00 0.00 ? 41 TYR A HB3  2  
ATOM 1915  H HD1  . TYR A 1 41 ? 6.446   0.845   0.821   1.00 0.00 ? 41 TYR A HD1  2  
ATOM 1916  H HD2  . TYR A 1 41 ? 10.188  0.196   2.739   1.00 0.00 ? 41 TYR A HD2  2  
ATOM 1917  H HE1  . TYR A 1 41 ? 7.260   2.995   -0.053  1.00 0.00 ? 41 TYR A HE1  2  
ATOM 1918  H HE2  . TYR A 1 41 ? 11.012  2.345   1.871   1.00 0.00 ? 41 TYR A HE2  2  
ATOM 1919  H HH   . TYR A 1 41 ? 9.977   4.535   1.095   1.00 0.00 ? 41 TYR A HH   2  
ATOM 1920  N N    . LEU A 1 42 ? 6.472   -3.198  3.748   1.00 0.00 ? 42 LEU A N    2  
ATOM 1921  C CA   . LEU A 1 42 ? 6.434   -4.397  4.578   1.00 0.00 ? 42 LEU A CA   2  
ATOM 1922  C C    . LEU A 1 42 ? 7.169   -5.550  3.903   1.00 0.00 ? 42 LEU A C    2  
ATOM 1923  O O    . LEU A 1 42 ? 6.961   -5.826  2.721   1.00 0.00 ? 42 LEU A O    2  
ATOM 1924  C CB   . LEU A 1 42 ? 4.986   -4.798  4.864   1.00 0.00 ? 42 LEU A CB   2  
ATOM 1925  C CG   . LEU A 1 42 ? 4.201   -3.865  5.786   1.00 0.00 ? 42 LEU A CG   2  
ATOM 1926  C CD1  . LEU A 1 42 ? 2.746   -4.300  5.873   1.00 0.00 ? 42 LEU A CD1  2  
ATOM 1927  C CD2  . LEU A 1 42 ? 4.832   -3.829  7.171   1.00 0.00 ? 42 LEU A CD2  2  
ATOM 1928  H H    . LEU A 1 42 ? 6.476   -3.293  2.773   1.00 0.00 ? 42 LEU A H    2  
ATOM 1929  H HA   . LEU A 1 42 ? 6.927   -4.169  5.511   1.00 0.00 ? 42 LEU A HA   2  
ATOM 1930  H HB2  . LEU A 1 42 ? 4.464   -4.846  3.920   1.00 0.00 ? 42 LEU A HB2  2  
ATOM 1931  H HB3  . LEU A 1 42 ? 4.998   -5.779  5.316   1.00 0.00 ? 42 LEU A HB3  2  
ATOM 1932  H HG   . LEU A 1 42 ? 4.225   -2.863  5.381   1.00 0.00 ? 42 LEU A HG   2  
ATOM 1933  H HD11 . LEU A 1 42 ? 2.642   -5.293  5.462   1.00 0.00 ? 42 LEU A HD11 2  
ATOM 1934  H HD12 . LEU A 1 42 ? 2.131   -3.612  5.313   1.00 0.00 ? 42 LEU A HD12 2  
ATOM 1935  H HD13 . LEU A 1 42 ? 2.433   -4.303  6.907   1.00 0.00 ? 42 LEU A HD13 2  
ATOM 1936  H HD21 . LEU A 1 42 ? 5.787   -3.328  7.117   1.00 0.00 ? 42 LEU A HD21 2  
ATOM 1937  H HD22 . LEU A 1 42 ? 4.975   -4.839  7.527   1.00 0.00 ? 42 LEU A HD22 2  
ATOM 1938  H HD23 . LEU A 1 42 ? 4.183   -3.296  7.849   1.00 0.00 ? 42 LEU A HD23 2  
ATOM 1939  N N    . SER A 1 43 ? 8.028   -6.223  4.661   1.00 0.00 ? 43 SER A N    2  
ATOM 1940  C CA   . SER A 1 43 ? 8.796   -7.346  4.136   1.00 0.00 ? 43 SER A CA   2  
ATOM 1941  C C    . SER A 1 43 ? 7.875   -8.498  3.746   1.00 0.00 ? 43 SER A C    2  
ATOM 1942  O O    . SER A 1 43 ? 6.675   -8.472  4.024   1.00 0.00 ? 43 SER A O    2  
ATOM 1943  C CB   . SER A 1 43 ? 9.817   -7.822  5.171   1.00 0.00 ? 43 SER A CB   2  
ATOM 1944  O OG   . SER A 1 43 ? 10.864  -8.552  4.556   1.00 0.00 ? 43 SER A OG   2  
ATOM 1945  H H    . SER A 1 43 ? 8.151   -5.956  5.596   1.00 0.00 ? 43 SER A H    2  
ATOM 1946  H HA   . SER A 1 43 ? 9.320   -7.006  3.255   1.00 0.00 ? 43 SER A HA   2  
ATOM 1947  H HB2  . SER A 1 43 ? 10.239  -6.967  5.676   1.00 0.00 ? 43 SER A HB2  2  
ATOM 1948  H HB3  . SER A 1 43 ? 9.325   -8.460  5.891   1.00 0.00 ? 43 SER A HB3  2  
ATOM 1949  H HG   . SER A 1 43 ? 11.707  -8.269  4.917   1.00 0.00 ? 43 SER A HG   2  
ATOM 1950  N N    . THR A 1 44 ? 8.445   -9.511  3.100   1.00 0.00 ? 44 THR A N    2  
ATOM 1951  C CA   . THR A 1 44 ? 7.677   -10.672 2.670   1.00 0.00 ? 44 THR A CA   2  
ATOM 1952  C C    . THR A 1 44 ? 6.947   -11.314 3.844   1.00 0.00 ? 44 THR A C    2  
ATOM 1953  O O    . THR A 1 44 ? 5.721   -11.429 3.857   1.00 0.00 ? 44 THR A O    2  
ATOM 1954  C CB   . THR A 1 44 ? 8.579   -11.727 2.003   1.00 0.00 ? 44 THR A CB   2  
ATOM 1955  O OG1  . THR A 1 44 ? 8.632   -11.504 0.589   1.00 0.00 ? 44 THR A OG1  2  
ATOM 1956  C CG2  . THR A 1 44 ? 8.067   -13.132 2.281   1.00 0.00 ? 44 THR A CG2  2  
ATOM 1957  H H    . THR A 1 44 ? 9.405   -9.473  2.907   1.00 0.00 ? 44 THR A H    2  
ATOM 1958  H HA   . THR A 1 44 ? 6.949   -10.341 1.944   1.00 0.00 ? 44 THR A HA   2  
ATOM 1959  H HB   . THR A 1 44 ? 9.576   -11.636 2.411   1.00 0.00 ? 44 THR A HB   2  
ATOM 1960  H HG1  . THR A 1 44 ? 8.882   -10.593 0.418   1.00 0.00 ? 44 THR A HG1  2  
ATOM 1961  H HG21 . THR A 1 44 ? 7.029   -13.201 1.989   1.00 0.00 ? 44 THR A HG21 2  
ATOM 1962  H HG22 . THR A 1 44 ? 8.160   -13.347 3.335   1.00 0.00 ? 44 THR A HG22 2  
ATOM 1963  H HG23 . THR A 1 44 ? 8.647   -13.845 1.715   1.00 0.00 ? 44 THR A HG23 2  
ATOM 1964  N N    . PRO A 1 45 ? 7.715   -11.743 4.857   1.00 0.00 ? 45 PRO A N    2  
ATOM 1965  C CA   . PRO A 1 45 ? 7.162   -12.379 6.056   1.00 0.00 ? 45 PRO A CA   2  
ATOM 1966  C C    . PRO A 1 45 ? 6.389   -11.397 6.929   1.00 0.00 ? 45 PRO A C    2  
ATOM 1967  O O    . PRO A 1 45 ? 5.593   -11.800 7.778   1.00 0.00 ? 45 PRO A O    2  
ATOM 1968  C CB   . PRO A 1 45 ? 8.404   -12.887 6.793   1.00 0.00 ? 45 PRO A CB   2  
ATOM 1969  C CG   . PRO A 1 45 ? 9.507   -11.998 6.333   1.00 0.00 ? 45 PRO A CG   2  
ATOM 1970  C CD   . PRO A 1 45 ? 9.183   -11.638 4.909   1.00 0.00 ? 45 PRO A CD   2  
ATOM 1971  H HA   . PRO A 1 45 ? 6.525   -13.214 5.804   1.00 0.00 ? 45 PRO A HA   2  
ATOM 1972  H HB2  . PRO A 1 45 ? 8.250   -12.807 7.860   1.00 0.00 ? 45 PRO A HB2  2  
ATOM 1973  H HB3  . PRO A 1 45 ? 8.590   -13.916 6.526   1.00 0.00 ? 45 PRO A HB3  2  
ATOM 1974  H HG2  . PRO A 1 45 ? 9.543   -11.109 6.945   1.00 0.00 ? 45 PRO A HG2  2  
ATOM 1975  H HG3  . PRO A 1 45 ? 10.448  -12.526 6.381   1.00 0.00 ? 45 PRO A HG3  2  
ATOM 1976  H HD2  . PRO A 1 45 ? 9.506   -10.631 4.692   1.00 0.00 ? 45 PRO A HD2  2  
ATOM 1977  H HD3  . PRO A 1 45 ? 9.643   -12.339 4.229   1.00 0.00 ? 45 PRO A HD3  2  
ATOM 1978  N N    . ASP A 1 46 ? 6.627   -10.108 6.715   1.00 0.00 ? 46 ASP A N    2  
ATOM 1979  C CA   . ASP A 1 46 ? 5.951   -9.068  7.482   1.00 0.00 ? 46 ASP A CA   2  
ATOM 1980  C C    . ASP A 1 46 ? 4.496   -8.928  7.044   1.00 0.00 ? 46 ASP A C    2  
ATOM 1981  O O    . ASP A 1 46 ? 3.577   -9.201  7.815   1.00 0.00 ? 46 ASP A O    2  
ATOM 1982  C CB   . ASP A 1 46 ? 6.676   -7.731  7.319   1.00 0.00 ? 46 ASP A CB   2  
ATOM 1983  C CG   . ASP A 1 46 ? 7.975   -7.678  8.099   1.00 0.00 ? 46 ASP A CG   2  
ATOM 1984  O OD1  . ASP A 1 46 ? 8.144   -8.498  9.026   1.00 0.00 ? 46 ASP A OD1  2  
ATOM 1985  O OD2  . ASP A 1 46 ? 8.823   -6.817  7.783   1.00 0.00 ? 46 ASP A OD2  2  
ATOM 1986  H H    . ASP A 1 46 ? 7.272   -9.849  6.024   1.00 0.00 ? 46 ASP A H    2  
ATOM 1987  H HA   . ASP A 1 46 ? 5.974   -9.355  8.522   1.00 0.00 ? 46 ASP A HA   2  
ATOM 1988  H HB2  . ASP A 1 46 ? 6.900   -7.575  6.273   1.00 0.00 ? 46 ASP A HB2  2  
ATOM 1989  H HB3  . ASP A 1 46 ? 6.034   -6.936  7.668   1.00 0.00 ? 46 ASP A HB3  2  
ATOM 1990  N N    . ARG A 1 47 ? 4.296   -8.500  5.802   1.00 0.00 ? 47 ARG A N    2  
ATOM 1991  C CA   . ARG A 1 47 ? 2.954   -8.322  5.262   1.00 0.00 ? 47 ARG A CA   2  
ATOM 1992  C C    . ARG A 1 47 ? 2.059   -9.502  5.630   1.00 0.00 ? 47 ARG A C    2  
ATOM 1993  O O    . ARG A 1 47 ? 0.865   -9.333  5.880   1.00 0.00 ? 47 ARG A O    2  
ATOM 1994  C CB   . ARG A 1 47 ? 3.009   -8.165  3.741   1.00 0.00 ? 47 ARG A CB   2  
ATOM 1995  C CG   . ARG A 1 47 ? 1.640   -8.049  3.091   1.00 0.00 ? 47 ARG A CG   2  
ATOM 1996  C CD   . ARG A 1 47 ? 1.754   -7.767  1.601   1.00 0.00 ? 47 ARG A CD   2  
ATOM 1997  N NE   . ARG A 1 47 ? 2.502   -6.542  1.331   1.00 0.00 ? 47 ARG A NE   2  
ATOM 1998  C CZ   . ARG A 1 47 ? 3.826   -6.492  1.249   1.00 0.00 ? 47 ARG A CZ   2  
ATOM 1999  N NH1  . ARG A 1 47 ? 4.546   -7.594  1.415   1.00 0.00 ? 47 ARG A NH1  2  
ATOM 2000  N NH2  . ARG A 1 47 ? 4.434   -5.340  1.001   1.00 0.00 ? 47 ARG A NH2  2  
ATOM 2001  H H    . ARG A 1 47 ? 5.070   -8.299  5.235   1.00 0.00 ? 47 ARG A H    2  
ATOM 2002  H HA   . ARG A 1 47 ? 2.539   -7.423  5.693   1.00 0.00 ? 47 ARG A HA   2  
ATOM 2003  H HB2  . ARG A 1 47 ? 3.573   -7.275  3.503   1.00 0.00 ? 47 ARG A HB2  2  
ATOM 2004  H HB3  . ARG A 1 47 ? 3.512   -9.023  3.321   1.00 0.00 ? 47 ARG A HB3  2  
ATOM 2005  H HG2  . ARG A 1 47 ? 1.106   -8.978  3.230   1.00 0.00 ? 47 ARG A HG2  2  
ATOM 2006  H HG3  . ARG A 1 47 ? 1.096   -7.244  3.561   1.00 0.00 ? 47 ARG A HG3  2  
ATOM 2007  H HD2  . ARG A 1 47 ? 2.258   -8.596  1.128   1.00 0.00 ? 47 ARG A HD2  2  
ATOM 2008  H HD3  . ARG A 1 47 ? 0.760   -7.669  1.190   1.00 0.00 ? 47 ARG A HD3  2  
ATOM 2009  H HE   . ARG A 1 47 ? 1.990   -5.716  1.206   1.00 0.00 ? 47 ARG A HE   2  
ATOM 2010  H HH11 . ARG A 1 47 ? 4.090   -8.464  1.601   1.00 0.00 ? 47 ARG A HH11 2  
ATOM 2011  H HH12 . ARG A 1 47 ? 5.543   -7.554  1.352   1.00 0.00 ? 47 ARG A HH12 2  
ATOM 2012  H HH21 . ARG A 1 47 ? 3.896   -4.507  0.875   1.00 0.00 ? 47 ARG A HH21 2  
ATOM 2013  H HH22 . ARG A 1 47 ? 5.431   -5.303  0.940   1.00 0.00 ? 47 ARG A HH22 2  
ATOM 2014  N N    . ILE A 1 48 ? 2.643   -10.695 5.660   1.00 0.00 ? 48 ILE A N    2  
ATOM 2015  C CA   . ILE A 1 48 ? 1.899   -11.901 5.998   1.00 0.00 ? 48 ILE A CA   2  
ATOM 2016  C C    . ILE A 1 48 ? 1.499   -11.907 7.469   1.00 0.00 ? 48 ILE A C    2  
ATOM 2017  O O    . ILE A 1 48 ? 0.320   -12.022 7.802   1.00 0.00 ? 48 ILE A O    2  
ATOM 2018  C CB   . ILE A 1 48 ? 2.717   -13.171 5.695   1.00 0.00 ? 48 ILE A CB   2  
ATOM 2019  C CG1  . ILE A 1 48 ? 3.103   -13.214 4.215   1.00 0.00 ? 48 ILE A CG1  2  
ATOM 2020  C CG2  . ILE A 1 48 ? 1.928   -14.414 6.079   1.00 0.00 ? 48 ILE A CG2  2  
ATOM 2021  C CD1  . ILE A 1 48 ? 4.141   -14.266 3.892   1.00 0.00 ? 48 ILE A CD1  2  
ATOM 2022  H H    . ILE A 1 48 ? 3.598   -10.765 5.451   1.00 0.00 ? 48 ILE A H    2  
ATOM 2023  H HA   . ILE A 1 48 ? 1.004   -11.921 5.393   1.00 0.00 ? 48 ILE A HA   2  
ATOM 2024  H HB   . ILE A 1 48 ? 3.615   -13.145 6.293   1.00 0.00 ? 48 ILE A HB   2  
ATOM 2025  H HG12 . ILE A 1 48 ? 2.224   -13.424 3.626   1.00 0.00 ? 48 ILE A HG12 2  
ATOM 2026  H HG13 . ILE A 1 48 ? 3.503   -12.252 3.927   1.00 0.00 ? 48 ILE A HG13 2  
ATOM 2027  H HG21 . ILE A 1 48 ? 1.418   -14.799 5.208   1.00 0.00 ? 48 ILE A HG21 2  
ATOM 2028  H HG22 . ILE A 1 48 ? 2.603   -15.165 6.460   1.00 0.00 ? 48 ILE A HG22 2  
ATOM 2029  H HG23 . ILE A 1 48 ? 1.204   -14.160 6.838   1.00 0.00 ? 48 ILE A HG23 2  
ATOM 2030  H HD11 . ILE A 1 48 ? 4.910   -13.834 3.268   1.00 0.00 ? 48 ILE A HD11 2  
ATOM 2031  H HD12 . ILE A 1 48 ? 4.582   -14.631 4.807   1.00 0.00 ? 48 ILE A HD12 2  
ATOM 2032  H HD13 . ILE A 1 48 ? 3.672   -15.085 3.367   1.00 0.00 ? 48 ILE A HD13 2  
ATOM 2033  N N    . ASP A 1 49 ? 2.489   -11.780 8.346   1.00 0.00 ? 49 ASP A N    2  
ATOM 2034  C CA   . ASP A 1 49 ? 2.241   -11.767 9.783   1.00 0.00 ? 49 ASP A CA   2  
ATOM 2035  C C    . ASP A 1 49 ? 1.089   -10.829 10.127  1.00 0.00 ? 49 ASP A C    2  
ATOM 2036  O O    . ASP A 1 49 ? 0.164   -11.203 10.848  1.00 0.00 ? 49 ASP A O    2  
ATOM 2037  C CB   . ASP A 1 49 ? 3.503   -11.344 10.536  1.00 0.00 ? 49 ASP A CB   2  
ATOM 2038  C CG   . ASP A 1 49 ? 3.361   -11.499 12.038  1.00 0.00 ? 49 ASP A CG   2  
ATOM 2039  O OD1  . ASP A 1 49 ? 2.759   -12.501 12.476  1.00 0.00 ? 49 ASP A OD1  2  
ATOM 2040  O OD2  . ASP A 1 49 ? 3.851   -10.618 12.775  1.00 0.00 ? 49 ASP A OD2  2  
ATOM 2041  H H    . ASP A 1 49 ? 3.409   -11.692 8.019   1.00 0.00 ? 49 ASP A H    2  
ATOM 2042  H HA   . ASP A 1 49 ? 1.974   -12.770 10.082  1.00 0.00 ? 49 ASP A HA   2  
ATOM 2043  H HB2  . ASP A 1 49 ? 4.333   -11.953 10.207  1.00 0.00 ? 49 ASP A HB2  2  
ATOM 2044  H HB3  . ASP A 1 49 ? 3.714   -10.308 10.318  1.00 0.00 ? 49 ASP A HB3  2  
ATOM 2045  N N    . LEU A 1 50 ? 1.153   -9.607  9.608   1.00 0.00 ? 50 LEU A N    2  
ATOM 2046  C CA   . LEU A 1 50 ? 0.115   -8.614  9.861   1.00 0.00 ? 50 LEU A CA   2  
ATOM 2047  C C    . LEU A 1 50 ? -1.237  -9.095  9.346   1.00 0.00 ? 50 LEU A C    2  
ATOM 2048  O O    . LEU A 1 50 ? -2.180  -9.269  10.117  1.00 0.00 ? 50 LEU A O    2  
ATOM 2049  C CB   . LEU A 1 50 ? 0.483   -7.284  9.199   1.00 0.00 ? 50 LEU A CB   2  
ATOM 2050  C CG   . LEU A 1 50 ? -0.664  -6.292  9.005   1.00 0.00 ? 50 LEU A CG   2  
ATOM 2051  C CD1  . LEU A 1 50 ? -1.120  -5.734  10.345  1.00 0.00 ? 50 LEU A CD1  2  
ATOM 2052  C CD2  . LEU A 1 50 ? -0.243  -5.166  8.072   1.00 0.00 ? 50 LEU A CD2  2  
ATOM 2053  H H    . LEU A 1 50 ? 1.915   -9.367  9.042   1.00 0.00 ? 50 LEU A H    2  
ATOM 2054  H HA   . LEU A 1 50 ? 0.049   -8.468  10.929  1.00 0.00 ? 50 LEU A HA   2  
ATOM 2055  H HB2  . LEU A 1 50 ? 1.233   -6.807  9.811   1.00 0.00 ? 50 LEU A HB2  2  
ATOM 2056  H HB3  . LEU A 1 50 ? 0.900   -7.504  8.227   1.00 0.00 ? 50 LEU A HB3  2  
ATOM 2057  H HG   . LEU A 1 50 ? -1.503  -6.804  8.555   1.00 0.00 ? 50 LEU A HG   2  
ATOM 2058  H HD11 . LEU A 1 50 ? -1.678  -6.488  10.878  1.00 0.00 ? 50 LEU A HD11 2  
ATOM 2059  H HD12 . LEU A 1 50 ? -1.747  -4.870  10.180  1.00 0.00 ? 50 LEU A HD12 2  
ATOM 2060  H HD13 . LEU A 1 50 ? -0.256  -5.445  10.927  1.00 0.00 ? 50 LEU A HD13 2  
ATOM 2061  H HD21 . LEU A 1 50 ? -1.039  -4.964  7.371   1.00 0.00 ? 50 LEU A HD21 2  
ATOM 2062  H HD22 . LEU A 1 50 ? 0.645   -5.460  7.532   1.00 0.00 ? 50 LEU A HD22 2  
ATOM 2063  H HD23 . LEU A 1 50 ? -0.037  -4.278  8.650   1.00 0.00 ? 50 LEU A HD23 2  
ATOM 2064  N N    . ALA A 1 51 ? -1.323  -9.310  8.038   1.00 0.00 ? 51 ALA A N    2  
ATOM 2065  C CA   . ALA A 1 51 ? -2.559  -9.776  7.420   1.00 0.00 ? 51 ALA A CA   2  
ATOM 2066  C C    . ALA A 1 51 ? -3.231  -10.845 8.274   1.00 0.00 ? 51 ALA A C    2  
ATOM 2067  O O    . ALA A 1 51 ? -4.449  -11.011 8.231   1.00 0.00 ? 51 ALA A O    2  
ATOM 2068  C CB   . ALA A 1 51 ? -2.281  -10.312 6.023   1.00 0.00 ? 51 ALA A CB   2  
ATOM 2069  H H    . ALA A 1 51 ? -0.537  -9.154  7.475   1.00 0.00 ? 51 ALA A H    2  
ATOM 2070  H HA   . ALA A 1 51 ? -3.225  -8.931  7.328   1.00 0.00 ? 51 ALA A HA   2  
ATOM 2071  H HB1  . ALA A 1 51 ? -2.147  -11.383 6.069   1.00 0.00 ? 51 ALA A HB1  2  
ATOM 2072  H HB2  . ALA A 1 51 ? -3.114  -10.080 5.377   1.00 0.00 ? 51 ALA A HB2  2  
ATOM 2073  H HB3  . ALA A 1 51 ? -1.384  -9.853  5.633   1.00 0.00 ? 51 ALA A HB3  2  
ATOM 2074  N N    . GLU A 1 52 ? -2.428  -11.568 9.050   1.00 0.00 ? 52 GLU A N    2  
ATOM 2075  C CA   . GLU A 1 52 ? -2.947  -12.622 9.913   1.00 0.00 ? 52 GLU A CA   2  
ATOM 2076  C C    . GLU A 1 52 ? -3.459  -12.045 11.229  1.00 0.00 ? 52 GLU A C    2  
ATOM 2077  O O    . GLU A 1 52 ? -4.511  -12.444 11.727  1.00 0.00 ? 52 GLU A O    2  
ATOM 2078  C CB   . GLU A 1 52 ? -1.863  -13.666 10.188  1.00 0.00 ? 52 GLU A CB   2  
ATOM 2079  C CG   . GLU A 1 52 ? -1.828  -14.791 9.167   1.00 0.00 ? 52 GLU A CG   2  
ATOM 2080  C CD   . GLU A 1 52 ? -1.276  -16.082 9.741   1.00 0.00 ? 52 GLU A CD   2  
ATOM 2081  O OE1  . GLU A 1 52 ? -0.083  -16.105 10.110  1.00 0.00 ? 52 GLU A OE1  2  
ATOM 2082  O OE2  . GLU A 1 52 ? -2.037  -17.069 9.820   1.00 0.00 ? 52 GLU A OE2  2  
ATOM 2083  H H    . GLU A 1 52 ? -1.465  -11.388 9.040   1.00 0.00 ? 52 GLU A H    2  
ATOM 2084  H HA   . GLU A 1 52 ? -3.769  -13.097 9.399   1.00 0.00 ? 52 GLU A HA   2  
ATOM 2085  H HB2  . GLU A 1 52 ? -0.900  -13.176 10.188  1.00 0.00 ? 52 GLU A HB2  2  
ATOM 2086  H HB3  . GLU A 1 52 ? -2.036  -14.098 11.163  1.00 0.00 ? 52 GLU A HB3  2  
ATOM 2087  H HG2  . GLU A 1 52 ? -2.832  -14.972 8.815   1.00 0.00 ? 52 GLU A HG2  2  
ATOM 2088  H HG3  . GLU A 1 52 ? -1.205  -14.488 8.338   1.00 0.00 ? 52 GLU A HG3  2  
ATOM 2089  N N    . SER A 1 53 ? -2.706  -11.103 11.788  1.00 0.00 ? 53 SER A N    2  
ATOM 2090  C CA   . SER A 1 53 ? -3.080  -10.473 13.049  1.00 0.00 ? 53 SER A CA   2  
ATOM 2091  C C    . SER A 1 53 ? -4.456  -9.823  12.944  1.00 0.00 ? 53 SER A C    2  
ATOM 2092  O O    . SER A 1 53 ? -5.345  -10.089 13.755  1.00 0.00 ? 53 SER A O    2  
ATOM 2093  C CB   . SER A 1 53 ? -2.038  -9.427  13.450  1.00 0.00 ? 53 SER A CB   2  
ATOM 2094  O OG   . SER A 1 53 ? -0.846  -10.043 13.907  1.00 0.00 ? 53 SER A OG   2  
ATOM 2095  H H    . SER A 1 53 ? -1.877  -10.827 11.343  1.00 0.00 ? 53 SER A H    2  
ATOM 2096  H HA   . SER A 1 53 ? -3.115  -11.242 13.806  1.00 0.00 ? 53 SER A HA   2  
ATOM 2097  H HB2  . SER A 1 53 ? -1.805  -8.809  12.596  1.00 0.00 ? 53 SER A HB2  2  
ATOM 2098  H HB3  . SER A 1 53 ? -2.437  -8.810  14.242  1.00 0.00 ? 53 SER A HB3  2  
ATOM 2099  H HG   . SER A 1 53 ? -0.157  -9.936  13.247  1.00 0.00 ? 53 SER A HG   2  
ATOM 2100  N N    . LEU A 1 54 ? -4.625  -8.969  11.941  1.00 0.00 ? 54 LEU A N    2  
ATOM 2101  C CA   . LEU A 1 54 ? -5.892  -8.279  11.728  1.00 0.00 ? 54 LEU A CA   2  
ATOM 2102  C C    . LEU A 1 54 ? -6.884  -9.176  10.993  1.00 0.00 ? 54 LEU A C    2  
ATOM 2103  O O    . LEU A 1 54 ? -8.096  -8.997  11.101  1.00 0.00 ? 54 LEU A O    2  
ATOM 2104  C CB   . LEU A 1 54 ? -5.668  -6.991  10.934  1.00 0.00 ? 54 LEU A CB   2  
ATOM 2105  C CG   . LEU A 1 54 ? -4.563  -6.068  11.451  1.00 0.00 ? 54 LEU A CG   2  
ATOM 2106  C CD1  . LEU A 1 54 ? -4.348  -4.905  10.495  1.00 0.00 ? 54 LEU A CD1  2  
ATOM 2107  C CD2  . LEU A 1 54 ? -4.902  -5.560  12.845  1.00 0.00 ? 54 LEU A CD2  2  
ATOM 2108  H H    . LEU A 1 54 ? -3.880  -8.798  11.328  1.00 0.00 ? 54 LEU A H    2  
ATOM 2109  H HA   . LEU A 1 54 ? -6.300  -8.029  12.696  1.00 0.00 ? 54 LEU A HA   2  
ATOM 2110  H HB2  . LEU A 1 54 ? -5.421  -7.266  9.920   1.00 0.00 ? 54 LEU A HB2  2  
ATOM 2111  H HB3  . LEU A 1 54 ? -6.594  -6.435  10.939  1.00 0.00 ? 54 LEU A HB3  2  
ATOM 2112  H HG   . LEU A 1 54 ? -3.638  -6.624  11.513  1.00 0.00 ? 54 LEU A HG   2  
ATOM 2113  H HD11 . LEU A 1 54 ? -3.768  -4.139  10.985  1.00 0.00 ? 54 LEU A HD11 2  
ATOM 2114  H HD12 . LEU A 1 54 ? -5.305  -4.499  10.201  1.00 0.00 ? 54 LEU A HD12 2  
ATOM 2115  H HD13 . LEU A 1 54 ? -3.821  -5.252  9.619   1.00 0.00 ? 54 LEU A HD13 2  
ATOM 2116  H HD21 . LEU A 1 54 ? -4.428  -6.191  13.582  1.00 0.00 ? 54 LEU A HD21 2  
ATOM 2117  H HD22 . LEU A 1 54 ? -5.973  -5.583  12.986  1.00 0.00 ? 54 LEU A HD22 2  
ATOM 2118  H HD23 . LEU A 1 54 ? -4.545  -4.546  12.955  1.00 0.00 ? 54 LEU A HD23 2  
ATOM 2119  N N    . GLY A 1 55 ? -6.359  -10.143 10.247  1.00 0.00 ? 55 GLY A N    2  
ATOM 2120  C CA   . GLY A 1 55 ? -7.211  -11.055 9.508   1.00 0.00 ? 55 GLY A CA   2  
ATOM 2121  C C    . GLY A 1 55 ? -7.344  -10.670 8.048   1.00 0.00 ? 55 GLY A C    2  
ATOM 2122  O O    . GLY A 1 55 ? -8.088  -11.301 7.296   1.00 0.00 ? 55 GLY A O    2  
ATOM 2123  H H    . GLY A 1 55 ? -5.384  -10.238 10.199  1.00 0.00 ? 55 GLY A H    2  
ATOM 2124  H HA2  . GLY A 1 55 ? -6.796  -12.050 9.570   1.00 0.00 ? 55 GLY A HA2  2  
ATOM 2125  H HA3  . GLY A 1 55 ? -8.193  -11.057 9.958   1.00 0.00 ? 55 GLY A HA3  2  
ATOM 2126  N N    . LEU A 1 56 ? -6.623  -9.630  7.644   1.00 0.00 ? 56 LEU A N    2  
ATOM 2127  C CA   . LEU A 1 56 ? -6.665  -9.159  6.264   1.00 0.00 ? 56 LEU A CA   2  
ATOM 2128  C C    . LEU A 1 56 ? -5.866  -10.082 5.350   1.00 0.00 ? 56 LEU A C    2  
ATOM 2129  O O    . LEU A 1 56 ? -5.155  -10.972 5.817   1.00 0.00 ? 56 LEU A O    2  
ATOM 2130  C CB   . LEU A 1 56 ? -6.116  -7.734  6.174   1.00 0.00 ? 56 LEU A CB   2  
ATOM 2131  C CG   . LEU A 1 56 ? -6.801  -6.693  7.060   1.00 0.00 ? 56 LEU A CG   2  
ATOM 2132  C CD1  . LEU A 1 56 ? -5.851  -5.547  7.370   1.00 0.00 ? 56 LEU A CD1  2  
ATOM 2133  C CD2  . LEU A 1 56 ? -8.066  -6.173  6.392   1.00 0.00 ? 56 LEU A CD2  2  
ATOM 2134  H H    . LEU A 1 56 ? -6.049  -9.167  8.289   1.00 0.00 ? 56 LEU A H    2  
ATOM 2135  H HA   . LEU A 1 56 ? -7.696  -9.159  5.945   1.00 0.00 ? 56 LEU A HA   2  
ATOM 2136  H HB2  . LEU A 1 56 ? -5.072  -7.764  6.446   1.00 0.00 ? 56 LEU A HB2  2  
ATOM 2137  H HB3  . LEU A 1 56 ? -6.209  -7.409  5.147   1.00 0.00 ? 56 LEU A HB3  2  
ATOM 2138  H HG   . LEU A 1 56 ? -7.082  -7.156  7.996   1.00 0.00 ? 56 LEU A HG   2  
ATOM 2139  H HD11 . LEU A 1 56 ? -5.865  -4.837  6.557   1.00 0.00 ? 56 LEU A HD11 2  
ATOM 2140  H HD12 . LEU A 1 56 ? -4.850  -5.933  7.494   1.00 0.00 ? 56 LEU A HD12 2  
ATOM 2141  H HD13 . LEU A 1 56 ? -6.162  -5.058  8.282   1.00 0.00 ? 56 LEU A HD13 2  
ATOM 2142  H HD21 . LEU A 1 56 ? -8.058  -6.445  5.347   1.00 0.00 ? 56 LEU A HD21 2  
ATOM 2143  H HD22 . LEU A 1 56 ? -8.105  -5.098  6.483   1.00 0.00 ? 56 LEU A HD22 2  
ATOM 2144  H HD23 . LEU A 1 56 ? -8.930  -6.608  6.871   1.00 0.00 ? 56 LEU A HD23 2  
ATOM 2145  N N    . SER A 1 57 ? -5.988  -9.864  4.044   1.00 0.00 ? 57 SER A N    2  
ATOM 2146  C CA   . SER A 1 57 ? -5.279  -10.678 3.063   1.00 0.00 ? 57 SER A CA   2  
ATOM 2147  C C    . SER A 1 57 ? -4.071  -9.930  2.509   1.00 0.00 ? 57 SER A C    2  
ATOM 2148  O O    . SER A 1 57 ? -4.127  -8.722  2.281   1.00 0.00 ? 57 SER A O    2  
ATOM 2149  C CB   . SER A 1 57 ? -6.218  -11.071 1.921   1.00 0.00 ? 57 SER A CB   2  
ATOM 2150  O OG   . SER A 1 57 ? -6.988  -12.210 2.263   1.00 0.00 ? 57 SER A OG   2  
ATOM 2151  H H    . SER A 1 57 ? -6.571  -9.140  3.733   1.00 0.00 ? 57 SER A H    2  
ATOM 2152  H HA   . SER A 1 57 ? -4.937  -11.573 3.561   1.00 0.00 ? 57 SER A HA   2  
ATOM 2153  H HB2  . SER A 1 57 ? -6.887  -10.250 1.710   1.00 0.00 ? 57 SER A HB2  2  
ATOM 2154  H HB3  . SER A 1 57 ? -5.635  -11.296 1.040   1.00 0.00 ? 57 SER A HB3  2  
ATOM 2155  H HG   . SER A 1 57 ? -7.325  -12.621 1.464   1.00 0.00 ? 57 SER A HG   2  
ATOM 2156  N N    . GLN A 1 58 ? -2.980  -10.658 2.295   1.00 0.00 ? 58 GLN A N    2  
ATOM 2157  C CA   . GLN A 1 58 ? -1.757  -10.064 1.767   1.00 0.00 ? 58 GLN A CA   2  
ATOM 2158  C C    . GLN A 1 58 ? -2.076  -8.979  0.744   1.00 0.00 ? 58 GLN A C    2  
ATOM 2159  O O    . GLN A 1 58 ? -1.462  -7.911  0.744   1.00 0.00 ? 58 GLN A O    2  
ATOM 2160  C CB   . GLN A 1 58 ? -0.876  -11.139 1.130   1.00 0.00 ? 58 GLN A CB   2  
ATOM 2161  C CG   . GLN A 1 58 ? -0.425  -12.214 2.106   1.00 0.00 ? 58 GLN A CG   2  
ATOM 2162  C CD   . GLN A 1 58 ? 0.471   -13.251 1.459   1.00 0.00 ? 58 GLN A CD   2  
ATOM 2163  O OE1  . GLN A 1 58 ? 0.016   -14.327 1.072   1.00 0.00 ? 58 GLN A OE1  2  
ATOM 2164  N NE2  . GLN A 1 58 ? 1.755   -12.932 1.339   1.00 0.00 ? 58 GLN A NE2  2  
ATOM 2165  H H    . GLN A 1 58 ? -2.997  -11.616 2.496   1.00 0.00 ? 58 GLN A H    2  
ATOM 2166  H HA   . GLN A 1 58 ? -1.223  -9.617  2.592   1.00 0.00 ? 58 GLN A HA   2  
ATOM 2167  H HB2  . GLN A 1 58 ? -1.428  -11.615 0.334   1.00 0.00 ? 58 GLN A HB2  2  
ATOM 2168  H HB3  . GLN A 1 58 ? 0.004   -10.668 0.716   1.00 0.00 ? 58 GLN A HB3  2  
ATOM 2169  H HG2  . GLN A 1 58 ? 0.118   -11.745 2.913   1.00 0.00 ? 58 GLN A HG2  2  
ATOM 2170  H HG3  . GLN A 1 58 ? -1.299  -12.711 2.502   1.00 0.00 ? 58 GLN A HG3  2  
ATOM 2171  H HE21 . GLN A 1 58 ? 2.047   -12.057 1.672   1.00 0.00 ? 58 GLN A HE21 2  
ATOM 2172  H HE22 . GLN A 1 58 ? 2.357   -13.584 0.926   1.00 0.00 ? 58 GLN A HE22 2  
ATOM 2173  N N    . LEU A 1 59 ? -3.039  -9.259  -0.127  1.00 0.00 ? 59 LEU A N    2  
ATOM 2174  C CA   . LEU A 1 59 ? -3.440  -8.307  -1.157  1.00 0.00 ? 59 LEU A CA   2  
ATOM 2175  C C    . LEU A 1 59 ? -3.822  -6.966  -0.539  1.00 0.00 ? 59 LEU A C    2  
ATOM 2176  O O    . LEU A 1 59 ? -3.408  -5.911  -1.020  1.00 0.00 ? 59 LEU A O    2  
ATOM 2177  C CB   . LEU A 1 59 ? -4.615  -8.863  -1.963  1.00 0.00 ? 59 LEU A CB   2  
ATOM 2178  C CG   . LEU A 1 59 ? -5.224  -7.918  -3.000  1.00 0.00 ? 59 LEU A CG   2  
ATOM 2179  C CD1  . LEU A 1 59 ? -4.258  -7.698  -4.154  1.00 0.00 ? 59 LEU A CD1  2  
ATOM 2180  C CD2  . LEU A 1 59 ? -6.549  -8.468  -3.509  1.00 0.00 ? 59 LEU A CD2  2  
ATOM 2181  H H    . LEU A 1 59 ? -3.492  -10.126 -0.077  1.00 0.00 ? 59 LEU A H    2  
ATOM 2182  H HA   . LEU A 1 59 ? -2.599  -8.159  -1.817  1.00 0.00 ? 59 LEU A HA   2  
ATOM 2183  H HB2  . LEU A 1 59 ? -4.272  -9.745  -2.481  1.00 0.00 ? 59 LEU A HB2  2  
ATOM 2184  H HB3  . LEU A 1 59 ? -5.394  -9.137  -1.266  1.00 0.00 ? 59 LEU A HB3  2  
ATOM 2185  H HG   . LEU A 1 59 ? -5.414  -6.960  -2.537  1.00 0.00 ? 59 LEU A HG   2  
ATOM 2186  H HD11 . LEU A 1 59 ? -3.498  -8.464  -4.138  1.00 0.00 ? 59 LEU A HD11 2  
ATOM 2187  H HD12 . LEU A 1 59 ? -3.795  -6.728  -4.055  1.00 0.00 ? 59 LEU A HD12 2  
ATOM 2188  H HD13 . LEU A 1 59 ? -4.798  -7.745  -5.089  1.00 0.00 ? 59 LEU A HD13 2  
ATOM 2189  H HD21 . LEU A 1 59 ? -6.985  -9.108  -2.756  1.00 0.00 ? 59 LEU A HD21 2  
ATOM 2190  H HD22 . LEU A 1 59 ? -6.380  -9.037  -4.412  1.00 0.00 ? 59 LEU A HD22 2  
ATOM 2191  H HD23 . LEU A 1 59 ? -7.221  -7.649  -3.719  1.00 0.00 ? 59 LEU A HD23 2  
ATOM 2192  N N    . GLN A 1 60 ? -4.612  -7.015  0.528   1.00 0.00 ? 60 GLN A N    2  
ATOM 2193  C CA   . GLN A 1 60 ? -5.048  -5.803  1.212   1.00 0.00 ? 60 GLN A CA   2  
ATOM 2194  C C    . GLN A 1 60 ? -3.877  -4.852  1.435   1.00 0.00 ? 60 GLN A C    2  
ATOM 2195  O O    . GLN A 1 60 ? -3.843  -3.752  0.884   1.00 0.00 ? 60 GLN A O    2  
ATOM 2196  C CB   . GLN A 1 60 ? -5.698  -6.154  2.552   1.00 0.00 ? 60 GLN A CB   2  
ATOM 2197  C CG   . GLN A 1 60 ? -6.786  -7.210  2.442   1.00 0.00 ? 60 GLN A CG   2  
ATOM 2198  C CD   . GLN A 1 60 ? -7.863  -6.837  1.443   1.00 0.00 ? 60 GLN A CD   2  
ATOM 2199  O OE1  . GLN A 1 60 ? -7.578  -6.568  0.276   1.00 0.00 ? 60 GLN A OE1  2  
ATOM 2200  N NE2  . GLN A 1 60 ? -9.111  -6.819  1.897   1.00 0.00 ? 60 GLN A NE2  2  
ATOM 2201  H H    . GLN A 1 60 ? -4.909  -7.886  0.864   1.00 0.00 ? 60 GLN A H    2  
ATOM 2202  H HA   . GLN A 1 60 ? -5.778  -5.314  0.586   1.00 0.00 ? 60 GLN A HA   2  
ATOM 2203  H HB2  . GLN A 1 60 ? -4.936  -6.520  3.223   1.00 0.00 ? 60 GLN A HB2  2  
ATOM 2204  H HB3  . GLN A 1 60 ? -6.136  -5.260  2.971   1.00 0.00 ? 60 GLN A HB3  2  
ATOM 2205  H HG2  . GLN A 1 60 ? -6.336  -8.141  2.131   1.00 0.00 ? 60 GLN A HG2  2  
ATOM 2206  H HG3  . GLN A 1 60 ? -7.243  -7.339  3.412   1.00 0.00 ? 60 GLN A HG3  2  
ATOM 2207  H HE21 . GLN A 1 60 ? -9.264  -7.044  2.839   1.00 0.00 ? 60 GLN A HE21 2  
ATOM 2208  H HE22 . GLN A 1 60 ? -9.827  -6.581  1.273   1.00 0.00 ? 60 GLN A HE22 2  
ATOM 2209  N N    . VAL A 1 61 ? -2.917  -5.284  2.247   1.00 0.00 ? 61 VAL A N    2  
ATOM 2210  C CA   . VAL A 1 61 ? -1.743  -4.472  2.543   1.00 0.00 ? 61 VAL A CA   2  
ATOM 2211  C C    . VAL A 1 61 ? -1.063  -4.002  1.262   1.00 0.00 ? 61 VAL A C    2  
ATOM 2212  O O    . VAL A 1 61 ? -0.844  -2.807  1.064   1.00 0.00 ? 61 VAL A O    2  
ATOM 2213  C CB   . VAL A 1 61 ? -0.723  -5.249  3.397   1.00 0.00 ? 61 VAL A CB   2  
ATOM 2214  C CG1  . VAL A 1 61 ? 0.454   -4.359  3.765   1.00 0.00 ? 61 VAL A CG1  2  
ATOM 2215  C CG2  . VAL A 1 61 ? -1.390  -5.809  4.644   1.00 0.00 ? 61 VAL A CG2  2  
ATOM 2216  H H    . VAL A 1 61 ? -3.000  -6.171  2.656   1.00 0.00 ? 61 VAL A H    2  
ATOM 2217  H HA   . VAL A 1 61 ? -2.067  -3.608  3.105   1.00 0.00 ? 61 VAL A HA   2  
ATOM 2218  H HB   . VAL A 1 61 ? -0.350  -6.077  2.811   1.00 0.00 ? 61 VAL A HB   2  
ATOM 2219  H HG11 . VAL A 1 61 ? 0.243   -3.851  4.695   1.00 0.00 ? 61 VAL A HG11 2  
ATOM 2220  H HG12 . VAL A 1 61 ? 1.342   -4.963  3.877   1.00 0.00 ? 61 VAL A HG12 2  
ATOM 2221  H HG13 . VAL A 1 61 ? 0.611   -3.629  2.985   1.00 0.00 ? 61 VAL A HG13 2  
ATOM 2222  H HG21 . VAL A 1 61 ? -0.697  -5.769  5.471   1.00 0.00 ? 61 VAL A HG21 2  
ATOM 2223  H HG22 . VAL A 1 61 ? -2.265  -5.221  4.879   1.00 0.00 ? 61 VAL A HG22 2  
ATOM 2224  H HG23 . VAL A 1 61 ? -1.682  -6.833  4.468   1.00 0.00 ? 61 VAL A HG23 2  
ATOM 2225  N N    . LYS A 1 62 ? -0.731  -4.951  0.392   1.00 0.00 ? 62 LYS A N    2  
ATOM 2226  C CA   . LYS A 1 62 ? -0.077  -4.635  -0.872  1.00 0.00 ? 62 LYS A CA   2  
ATOM 2227  C C    . LYS A 1 62 ? -0.782  -3.480  -1.576  1.00 0.00 ? 62 LYS A C    2  
ATOM 2228  O O    . LYS A 1 62 ? -0.203  -2.410  -1.768  1.00 0.00 ? 62 LYS A O    2  
ATOM 2229  C CB   . LYS A 1 62 ? -0.059  -5.866  -1.782  1.00 0.00 ? 62 LYS A CB   2  
ATOM 2230  C CG   . LYS A 1 62 ? 0.921   -5.755  -2.937  1.00 0.00 ? 62 LYS A CG   2  
ATOM 2231  C CD   . LYS A 1 62 ? 1.295   -7.122  -3.484  1.00 0.00 ? 62 LYS A CD   2  
ATOM 2232  C CE   . LYS A 1 62 ? 1.756   -7.036  -4.931  1.00 0.00 ? 62 LYS A CE   2  
ATOM 2233  N NZ   . LYS A 1 62 ? 2.548   -8.231  -5.333  1.00 0.00 ? 62 LYS A NZ   2  
ATOM 2234  H H    . LYS A 1 62 ? -0.931  -5.886  0.606   1.00 0.00 ? 62 LYS A H    2  
ATOM 2235  H HA   . LYS A 1 62 ? 0.940   -4.343  -0.656  1.00 0.00 ? 62 LYS A HA   2  
ATOM 2236  H HB2  . LYS A 1 62 ? 0.208   -6.731  -1.192  1.00 0.00 ? 62 LYS A HB2  2  
ATOM 2237  H HB3  . LYS A 1 62 ? -1.049  -6.011  -2.190  1.00 0.00 ? 62 LYS A HB3  2  
ATOM 2238  H HG2  . LYS A 1 62 ? 0.468   -5.174  -3.727  1.00 0.00 ? 62 LYS A HG2  2  
ATOM 2239  H HG3  . LYS A 1 62 ? 1.816   -5.258  -2.590  1.00 0.00 ? 62 LYS A HG3  2  
ATOM 2240  H HD2  . LYS A 1 62 ? 2.096   -7.532  -2.887  1.00 0.00 ? 62 LYS A HD2  2  
ATOM 2241  H HD3  . LYS A 1 62 ? 0.433   -7.771  -3.428  1.00 0.00 ? 62 LYS A HD3  2  
ATOM 2242  H HE2  . LYS A 1 62 ? 0.888   -6.959  -5.567  1.00 0.00 ? 62 LYS A HE2  2  
ATOM 2243  H HE3  . LYS A 1 62 ? 2.367   -6.153  -5.048  1.00 0.00 ? 62 LYS A HE3  2  
ATOM 2244  H HZ1  . LYS A 1 62 ? 1.913   -9.032  -5.525  1.00 0.00 ? 62 LYS A HZ1  2  
ATOM 2245  H HZ2  . LYS A 1 62 ? 3.203   -8.499  -4.571  1.00 0.00 ? 62 LYS A HZ2  2  
ATOM 2246  H HZ3  . LYS A 1 62 ? 3.097   -8.024  -6.191  1.00 0.00 ? 62 LYS A HZ3  2  
ATOM 2247  N N    . THR A 1 63 ? -2.036  -3.702  -1.957  1.00 0.00 ? 63 THR A N    2  
ATOM 2248  C CA   . THR A 1 63 ? -2.820  -2.680  -2.639  1.00 0.00 ? 63 THR A CA   2  
ATOM 2249  C C    . THR A 1 63 ? -3.022  -1.458  -1.750  1.00 0.00 ? 63 THR A C    2  
ATOM 2250  O O    . THR A 1 63 ? -2.558  -0.364  -2.069  1.00 0.00 ? 63 THR A O    2  
ATOM 2251  C CB   . THR A 1 63 ? -4.196  -3.222  -3.070  1.00 0.00 ? 63 THR A CB   2  
ATOM 2252  O OG1  . THR A 1 63 ? -4.029  -4.349  -3.936  1.00 0.00 ? 63 THR A OG1  2  
ATOM 2253  C CG2  . THR A 1 63 ? -5.003  -2.145  -3.780  1.00 0.00 ? 63 THR A CG2  2  
ATOM 2254  H H    . THR A 1 63 ? -2.442  -4.575  -1.776  1.00 0.00 ? 63 THR A H    2  
ATOM 2255  H HA   . THR A 1 63 ? -2.280  -2.382  -3.526  1.00 0.00 ? 63 THR A HA   2  
ATOM 2256  H HB   . THR A 1 63 ? -4.736  -3.532  -2.187  1.00 0.00 ? 63 THR A HB   2  
ATOM 2257  H HG1  . THR A 1 63 ? -4.844  -4.504  -4.421  1.00 0.00 ? 63 THR A HG1  2  
ATOM 2258  H HG21 . THR A 1 63 ? -4.936  -2.291  -4.848  1.00 0.00 ? 63 THR A HG21 2  
ATOM 2259  H HG22 . THR A 1 63 ? -4.610  -1.173  -3.523  1.00 0.00 ? 63 THR A HG22 2  
ATOM 2260  H HG23 . THR A 1 63 ? -6.036  -2.209  -3.472  1.00 0.00 ? 63 THR A HG23 2  
ATOM 2261  N N    . TRP A 1 64 ? -3.718  -1.653  -0.636  1.00 0.00 ? 64 TRP A N    2  
ATOM 2262  C CA   . TRP A 1 64 ? -3.981  -0.566  0.300   1.00 0.00 ? 64 TRP A CA   2  
ATOM 2263  C C    . TRP A 1 64 ? -2.774  0.359   0.414   1.00 0.00 ? 64 TRP A C    2  
ATOM 2264  O O    . TRP A 1 64 ? -2.908  1.581   0.344   1.00 0.00 ? 64 TRP A O    2  
ATOM 2265  C CB   . TRP A 1 64 ? -4.341  -1.126  1.677   1.00 0.00 ? 64 TRP A CB   2  
ATOM 2266  C CG   . TRP A 1 64 ? -4.933  -0.104  2.599   1.00 0.00 ? 64 TRP A CG   2  
ATOM 2267  C CD1  . TRP A 1 64 ? -6.212  0.377   2.576   1.00 0.00 ? 64 TRP A CD1  2  
ATOM 2268  C CD2  . TRP A 1 64 ? -4.270  0.566   3.676   1.00 0.00 ? 64 TRP A CD2  2  
ATOM 2269  N NE1  . TRP A 1 64 ? -6.383  1.304   3.576   1.00 0.00 ? 64 TRP A NE1  2  
ATOM 2270  C CE2  . TRP A 1 64 ? -5.207  1.437   4.265   1.00 0.00 ? 64 TRP A CE2  2  
ATOM 2271  C CE3  . TRP A 1 64 ? -2.977  0.512   4.203   1.00 0.00 ? 64 TRP A CE3  2  
ATOM 2272  C CZ2  . TRP A 1 64 ? -4.889  2.248   5.352   1.00 0.00 ? 64 TRP A CZ2  2  
ATOM 2273  C CZ3  . TRP A 1 64 ? -2.662  1.317   5.281   1.00 0.00 ? 64 TRP A CZ3  2  
ATOM 2274  C CH2  . TRP A 1 64 ? -3.615  2.175   5.847   1.00 0.00 ? 64 TRP A CH2  2  
ATOM 2275  H H    . TRP A 1 64 ? -4.062  -2.549  -0.437  1.00 0.00 ? 64 TRP A H    2  
ATOM 2276  H HA   . TRP A 1 64 ? -4.819  0.000   -0.078  1.00 0.00 ? 64 TRP A HA   2  
ATOM 2277  H HB2  . TRP A 1 64 ? -5.059  -1.924  1.558   1.00 0.00 ? 64 TRP A HB2  2  
ATOM 2278  H HB3  . TRP A 1 64 ? -3.448  -1.518  2.143   1.00 0.00 ? 64 TRP A HB3  2  
ATOM 2279  H HD1  . TRP A 1 64 ? -6.966  0.065   1.870   1.00 0.00 ? 64 TRP A HD1  2  
ATOM 2280  H HE1  . TRP A 1 64 ? -7.213  1.790   3.764   1.00 0.00 ? 64 TRP A HE1  2  
ATOM 2281  H HE3  . TRP A 1 64 ? -2.229  -0.143  3.781   1.00 0.00 ? 64 TRP A HE3  2  
ATOM 2282  H HZ2  . TRP A 1 64 ? -5.612  2.914   5.799   1.00 0.00 ? 64 TRP A HZ2  2  
ATOM 2283  H HZ3  . TRP A 1 64 ? -1.668  1.289   5.701   1.00 0.00 ? 64 TRP A HZ3  2  
ATOM 2284  H HH2  . TRP A 1 64 ? -3.325  2.786   6.688   1.00 0.00 ? 64 TRP A HH2  2  
ATOM 2285  N N    . TYR A 1 65 ? -1.597  -0.231  0.589   1.00 0.00 ? 65 TYR A N    2  
ATOM 2286  C CA   . TYR A 1 65 ? -0.366  0.541   0.715   1.00 0.00 ? 65 TYR A CA   2  
ATOM 2287  C C    . TYR A 1 65 ? -0.110  1.366   -0.543  1.00 0.00 ? 65 TYR A C    2  
ATOM 2288  O O    . TYR A 1 65 ? -0.122  2.596   -0.504  1.00 0.00 ? 65 TYR A O    2  
ATOM 2289  C CB   . TYR A 1 65 ? 0.819   -0.388  0.979   1.00 0.00 ? 65 TYR A CB   2  
ATOM 2290  C CG   . TYR A 1 65 ? 1.027   -0.705  2.443   1.00 0.00 ? 65 TYR A CG   2  
ATOM 2291  C CD1  . TYR A 1 65 ? -0.009  -1.211  3.218   1.00 0.00 ? 65 TYR A CD1  2  
ATOM 2292  C CD2  . TYR A 1 65 ? 2.259   -0.498  3.050   1.00 0.00 ? 65 TYR A CD2  2  
ATOM 2293  C CE1  . TYR A 1 65 ? 0.176   -1.500  4.556   1.00 0.00 ? 65 TYR A CE1  2  
ATOM 2294  C CE2  . TYR A 1 65 ? 2.454   -0.786  4.387   1.00 0.00 ? 65 TYR A CE2  2  
ATOM 2295  C CZ   . TYR A 1 65 ? 1.409   -1.287  5.136   1.00 0.00 ? 65 TYR A CZ   2  
ATOM 2296  O OH   . TYR A 1 65 ? 1.598   -1.575  6.468   1.00 0.00 ? 65 TYR A OH   2  
ATOM 2297  H H    . TYR A 1 65 ? -1.554  -1.209  0.637   1.00 0.00 ? 65 TYR A H    2  
ATOM 2298  H HA   . TYR A 1 65 ? -0.479  1.212   1.554   1.00 0.00 ? 65 TYR A HA   2  
ATOM 2299  H HB2  . TYR A 1 65 ? 0.660   -1.320  0.458   1.00 0.00 ? 65 TYR A HB2  2  
ATOM 2300  H HB3  . TYR A 1 65 ? 1.722   0.076   0.608   1.00 0.00 ? 65 TYR A HB3  2  
ATOM 2301  H HD1  . TYR A 1 65 ? -0.974  -1.377  2.760   1.00 0.00 ? 65 TYR A HD1  2  
ATOM 2302  H HD2  . TYR A 1 65 ? 3.076   -0.106  2.461   1.00 0.00 ? 65 TYR A HD2  2  
ATOM 2303  H HE1  . TYR A 1 65 ? -0.642  -1.892  5.142   1.00 0.00 ? 65 TYR A HE1  2  
ATOM 2304  H HE2  . TYR A 1 65 ? 3.419   -0.619  4.842   1.00 0.00 ? 65 TYR A HE2  2  
ATOM 2305  H HH   . TYR A 1 65 ? 2.259   -0.983  6.833   1.00 0.00 ? 65 TYR A HH   2  
ATOM 2306  N N    . GLN A 1 66 ? 0.121   0.679   -1.657  1.00 0.00 ? 66 GLN A N    2  
ATOM 2307  C CA   . GLN A 1 66 ? 0.380   1.347   -2.926  1.00 0.00 ? 66 GLN A CA   2  
ATOM 2308  C C    . GLN A 1 66 ? -0.430  2.634   -3.039  1.00 0.00 ? 66 GLN A C    2  
ATOM 2309  O O    . GLN A 1 66 ? 0.128   3.716   -3.218  1.00 0.00 ? 66 GLN A O    2  
ATOM 2310  C CB   . GLN A 1 66 ? 0.047   0.416   -4.094  1.00 0.00 ? 66 GLN A CB   2  
ATOM 2311  C CG   . GLN A 1 66 ? 1.114   -0.633  -4.359  1.00 0.00 ? 66 GLN A CG   2  
ATOM 2312  C CD   . GLN A 1 66 ? 0.730   -1.587  -5.473  1.00 0.00 ? 66 GLN A CD   2  
ATOM 2313  O OE1  . GLN A 1 66 ? 0.035   -2.578  -5.245  1.00 0.00 ? 66 GLN A OE1  2  
ATOM 2314  N NE2  . GLN A 1 66 ? 1.183   -1.294  -6.686  1.00 0.00 ? 66 GLN A NE2  2  
ATOM 2315  H H    . GLN A 1 66 ? 0.118   -0.300  -1.623  1.00 0.00 ? 66 GLN A H    2  
ATOM 2316  H HA   . GLN A 1 66 ? 1.431   1.593   -2.963  1.00 0.00 ? 66 GLN A HA   2  
ATOM 2317  H HB2  . GLN A 1 66 ? -0.882  -0.091  -3.880  1.00 0.00 ? 66 GLN A HB2  2  
ATOM 2318  H HB3  . GLN A 1 66 ? -0.074  1.010   -4.988  1.00 0.00 ? 66 GLN A HB3  2  
ATOM 2319  H HG2  . GLN A 1 66 ? 2.031   -0.134  -4.635  1.00 0.00 ? 66 GLN A HG2  2  
ATOM 2320  H HG3  . GLN A 1 66 ? 1.273   -1.202  -3.456  1.00 0.00 ? 66 GLN A HG3  2  
ATOM 2321  H HE21 . GLN A 1 66 ? 1.733   -0.489  -6.793  1.00 0.00 ? 66 GLN A HE21 2  
ATOM 2322  H HE22 . GLN A 1 66 ? 0.950   -1.894  -7.425  1.00 0.00 ? 66 GLN A HE22 2  
ATOM 2323  N N    . ASN A 1 67 ? -1.749  2.508   -2.935  1.00 0.00 ? 67 ASN A N    2  
ATOM 2324  C CA   . ASN A 1 67 ? -2.636  3.662   -3.027  1.00 0.00 ? 67 ASN A CA   2  
ATOM 2325  C C    . ASN A 1 67 ? -2.287  4.702   -1.967  1.00 0.00 ? 67 ASN A C    2  
ATOM 2326  O O    . ASN A 1 67 ? -2.037  5.866   -2.282  1.00 0.00 ? 67 ASN A O    2  
ATOM 2327  C CB   . ASN A 1 67 ? -4.094  3.225   -2.868  1.00 0.00 ? 67 ASN A CB   2  
ATOM 2328  C CG   . ASN A 1 67 ? -4.571  2.372   -4.027  1.00 0.00 ? 67 ASN A CG   2  
ATOM 2329  O OD1  . ASN A 1 67 ? -4.814  2.875   -5.124  1.00 0.00 ? 67 ASN A OD1  2  
ATOM 2330  N ND2  . ASN A 1 67 ? -4.708  1.073   -3.788  1.00 0.00 ? 67 ASN A ND2  2  
ATOM 2331  H H    . ASN A 1 67 ? -2.135  1.619   -2.794  1.00 0.00 ? 67 ASN A H    2  
ATOM 2332  H HA   . ASN A 1 67 ? -2.506  4.103   -4.003  1.00 0.00 ? 67 ASN A HA   2  
ATOM 2333  H HB2  . ASN A 1 67 ? -4.194  2.650   -1.958  1.00 0.00 ? 67 ASN A HB2  2  
ATOM 2334  H HB3  . ASN A 1 67 ? -4.722  4.101   -2.806  1.00 0.00 ? 67 ASN A HB3  2  
ATOM 2335  H HD21 . ASN A 1 67 ? -4.497  0.742   -2.890  1.00 0.00 ? 67 ASN A HD21 2  
ATOM 2336  H HD22 . ASN A 1 67 ? -5.015  0.498   -4.520  1.00 0.00 ? 67 ASN A HD22 2  
ATOM 2337  N N    . ARG A 1 68 ? -2.272  4.275   -0.708  1.00 0.00 ? 68 ARG A N    2  
ATOM 2338  C CA   . ARG A 1 68 ? -1.954  5.169   0.399   1.00 0.00 ? 68 ARG A CA   2  
ATOM 2339  C C    . ARG A 1 68 ? -0.665  5.938   0.124   1.00 0.00 ? 68 ARG A C    2  
ATOM 2340  O O    . ARG A 1 68 ? -0.516  7.087   0.539   1.00 0.00 ? 68 ARG A O    2  
ATOM 2341  C CB   . ARG A 1 68 ? -1.820  4.376   1.700   1.00 0.00 ? 68 ARG A CB   2  
ATOM 2342  C CG   . ARG A 1 68 ? -3.147  3.882   2.252   1.00 0.00 ? 68 ARG A CG   2  
ATOM 2343  C CD   . ARG A 1 68 ? -3.926  5.006   2.918   1.00 0.00 ? 68 ARG A CD   2  
ATOM 2344  N NE   . ARG A 1 68 ? -5.229  4.557   3.401   1.00 0.00 ? 68 ARG A NE   2  
ATOM 2345  C CZ   . ARG A 1 68 ? -6.118  5.362   3.972   1.00 0.00 ? 68 ARG A CZ   2  
ATOM 2346  N NH1  . ARG A 1 68 ? -5.846  6.650   4.131   1.00 0.00 ? 68 ARG A NH1  2  
ATOM 2347  N NH2  . ARG A 1 68 ? -7.283  4.879   4.386   1.00 0.00 ? 68 ARG A NH2  2  
ATOM 2348  H H    . ARG A 1 68 ? -2.480  3.336   -0.520  1.00 0.00 ? 68 ARG A H    2  
ATOM 2349  H HA   . ARG A 1 68 ? -2.765  5.874   0.499   1.00 0.00 ? 68 ARG A HA   2  
ATOM 2350  H HB2  . ARG A 1 68 ? -1.188  3.518   1.522   1.00 0.00 ? 68 ARG A HB2  2  
ATOM 2351  H HB3  . ARG A 1 68 ? -1.357  5.005   2.445   1.00 0.00 ? 68 ARG A HB3  2  
ATOM 2352  H HG2  . ARG A 1 68 ? -3.737  3.482   1.441   1.00 0.00 ? 68 ARG A HG2  2  
ATOM 2353  H HG3  . ARG A 1 68 ? -2.957  3.107   2.979   1.00 0.00 ? 68 ARG A HG3  2  
ATOM 2354  H HD2  . ARG A 1 68 ? -3.352  5.377   3.754   1.00 0.00 ? 68 ARG A HD2  2  
ATOM 2355  H HD3  . ARG A 1 68 ? -4.071  5.799   2.201   1.00 0.00 ? 68 ARG A HD3  2  
ATOM 2356  H HE   . ARG A 1 68 ? -5.451  3.609   3.294   1.00 0.00 ? 68 ARG A HE   2  
ATOM 2357  H HH11 . ARG A 1 68 ? -4.969  7.017   3.819   1.00 0.00 ? 68 ARG A HH11 2  
ATOM 2358  H HH12 . ARG A 1 68 ? -6.517  7.254   4.560   1.00 0.00 ? 68 ARG A HH12 2  
ATOM 2359  H HH21 . ARG A 1 68 ? -7.492  3.909   4.268   1.00 0.00 ? 68 ARG A HH21 2  
ATOM 2360  H HH22 . ARG A 1 68 ? -7.951  5.485   4.816   1.00 0.00 ? 68 ARG A HH22 2  
ATOM 2361  N N    . ARG A 1 69 ? 0.263   5.295   -0.577  1.00 0.00 ? 69 ARG A N    2  
ATOM 2362  C CA   . ARG A 1 69 ? 1.540   5.917   -0.906  1.00 0.00 ? 69 ARG A CA   2  
ATOM 2363  C C    . ARG A 1 69 ? 1.352   7.042   -1.921  1.00 0.00 ? 69 ARG A C    2  
ATOM 2364  O O    . ARG A 1 69 ? 1.948   8.111   -1.795  1.00 0.00 ? 69 ARG A O    2  
ATOM 2365  C CB   . ARG A 1 69 ? 2.513   4.874   -1.460  1.00 0.00 ? 69 ARG A CB   2  
ATOM 2366  C CG   . ARG A 1 69 ? 3.142   3.999   -0.388  1.00 0.00 ? 69 ARG A CG   2  
ATOM 2367  C CD   . ARG A 1 69 ? 4.389   3.297   -0.903  1.00 0.00 ? 69 ARG A CD   2  
ATOM 2368  N NE   . ARG A 1 69 ? 4.073   2.026   -1.550  1.00 0.00 ? 69 ARG A NE   2  
ATOM 2369  C CZ   . ARG A 1 69 ? 4.979   1.263   -2.152  1.00 0.00 ? 69 ARG A CZ   2  
ATOM 2370  N NH1  . ARG A 1 69 ? 6.250   1.640   -2.189  1.00 0.00 ? 69 ARG A NH1  2  
ATOM 2371  N NH2  . ARG A 1 69 ? 4.614   0.120   -2.718  1.00 0.00 ? 69 ARG A NH2  2  
ATOM 2372  H H    . ARG A 1 69 ? 0.086   4.380   -0.880  1.00 0.00 ? 69 ARG A H    2  
ATOM 2373  H HA   . ARG A 1 69 ? 1.950   6.333   0.002   1.00 0.00 ? 69 ARG A HA   2  
ATOM 2374  H HB2  . ARG A 1 69 ? 1.982   4.235   -2.150  1.00 0.00 ? 69 ARG A HB2  2  
ATOM 2375  H HB3  . ARG A 1 69 ? 3.304   5.383   -1.989  1.00 0.00 ? 69 ARG A HB3  2  
ATOM 2376  H HG2  . ARG A 1 69 ? 3.413   4.618   0.455   1.00 0.00 ? 69 ARG A HG2  2  
ATOM 2377  H HG3  . ARG A 1 69 ? 2.424   3.256   -0.076  1.00 0.00 ? 69 ARG A HG3  2  
ATOM 2378  H HD2  . ARG A 1 69 ? 4.879   3.942   -1.618  1.00 0.00 ? 69 ARG A HD2  2  
ATOM 2379  H HD3  . ARG A 1 69 ? 5.051   3.113   -0.071  1.00 0.00 ? 69 ARG A HD3  2  
ATOM 2380  H HE   . ARG A 1 69 ? 3.140   1.728   -1.535  1.00 0.00 ? 69 ARG A HE   2  
ATOM 2381  H HH11 . ARG A 1 69 ? 6.527   2.501   -1.762  1.00 0.00 ? 69 ARG A HH11 2  
ATOM 2382  H HH12 . ARG A 1 69 ? 6.930   1.063   -2.641  1.00 0.00 ? 69 ARG A HH12 2  
ATOM 2383  H HH21 . ARG A 1 69 ? 3.658   -0.168  -2.692  1.00 0.00 ? 69 ARG A HH21 2  
ATOM 2384  H HH22 . ARG A 1 69 ? 5.296   -0.454  -3.170  1.00 0.00 ? 69 ARG A HH22 2  
ATOM 2385  N N    . MET A 1 70 ? 0.519   6.791   -2.925  1.00 0.00 ? 70 MET A N    2  
ATOM 2386  C CA   . MET A 1 70 ? 0.251   7.783   -3.961  1.00 0.00 ? 70 MET A CA   2  
ATOM 2387  C C    . MET A 1 70 ? -0.409  9.023   -3.368  1.00 0.00 ? 70 MET A C    2  
ATOM 2388  O O    . MET A 1 70 ? -0.131  10.148  -3.786  1.00 0.00 ? 70 MET A O    2  
ATOM 2389  C CB   . MET A 1 70 ? -0.642  7.186   -5.050  1.00 0.00 ? 70 MET A CB   2  
ATOM 2390  C CG   . MET A 1 70 ? -0.047  5.957   -5.718  1.00 0.00 ? 70 MET A CG   2  
ATOM 2391  S SD   . MET A 1 70 ? -0.587  5.766   -7.428  1.00 0.00 ? 70 MET A SD   2  
ATOM 2392  C CE   . MET A 1 70 ? -2.269  5.199   -7.190  1.00 0.00 ? 70 MET A CE   2  
ATOM 2393  H H    . MET A 1 70 ? 0.072   5.920   -2.972  1.00 0.00 ? 70 MET A H    2  
ATOM 2394  H HA   . MET A 1 70 ? 1.196   8.067   -4.399  1.00 0.00 ? 70 MET A HA   2  
ATOM 2395  H HB2  . MET A 1 70 ? -1.588  6.908   -4.611  1.00 0.00 ? 70 MET A HB2  2  
ATOM 2396  H HB3  . MET A 1 70 ? -0.813  7.935   -5.809  1.00 0.00 ? 70 MET A HB3  2  
ATOM 2397  H HG2  . MET A 1 70 ? 1.030   6.041   -5.704  1.00 0.00 ? 70 MET A HG2  2  
ATOM 2398  H HG3  . MET A 1 70 ? -0.345  5.082   -5.161  1.00 0.00 ? 70 MET A HG3  2  
ATOM 2399  H HE1  . MET A 1 70 ? -2.315  4.131   -7.347  1.00 0.00 ? 70 MET A HE1  2  
ATOM 2400  H HE2  . MET A 1 70 ? -2.588  5.429   -6.184  1.00 0.00 ? 70 MET A HE2  2  
ATOM 2401  H HE3  . MET A 1 70 ? -2.919  5.695   -7.897  1.00 0.00 ? 70 MET A HE3  2  
ATOM 2402  N N    . LYS A 1 71 ? -1.286  8.812   -2.392  1.00 0.00 ? 71 LYS A N    2  
ATOM 2403  C CA   . LYS A 1 71 ? -1.986  9.913   -1.741  1.00 0.00 ? 71 LYS A CA   2  
ATOM 2404  C C    . LYS A 1 71 ? -1.120  10.541  -0.654  1.00 0.00 ? 71 LYS A C    2  
ATOM 2405  O O    . LYS A 1 71 ? -1.323  11.695  -0.275  1.00 0.00 ? 71 LYS A O    2  
ATOM 2406  C CB   . LYS A 1 71 ? -3.303  9.420   -1.137  1.00 0.00 ? 71 LYS A CB   2  
ATOM 2407  C CG   . LYS A 1 71 ? -4.107  10.514  -0.456  1.00 0.00 ? 71 LYS A CG   2  
ATOM 2408  C CD   . LYS A 1 71 ? -5.263  9.940   0.346   1.00 0.00 ? 71 LYS A CD   2  
ATOM 2409  C CE   . LYS A 1 71 ? -6.429  9.558   -0.553  1.00 0.00 ? 71 LYS A CE   2  
ATOM 2410  N NZ   . LYS A 1 71 ? -7.573  9.008   0.227   1.00 0.00 ? 71 LYS A NZ   2  
ATOM 2411  H H    . LYS A 1 71 ? -1.466  7.893   -2.102  1.00 0.00 ? 71 LYS A H    2  
ATOM 2412  H HA   . LYS A 1 71 ? -2.201  10.659  -2.490  1.00 0.00 ? 71 LYS A HA   2  
ATOM 2413  H HB2  . LYS A 1 71 ? -3.909  8.993   -1.923  1.00 0.00 ? 71 LYS A HB2  2  
ATOM 2414  H HB3  . LYS A 1 71 ? -3.086  8.655   -0.406  1.00 0.00 ? 71 LYS A HB3  2  
ATOM 2415  H HG2  . LYS A 1 71 ? -3.459  11.064  0.210   1.00 0.00 ? 71 LYS A HG2  2  
ATOM 2416  H HG3  . LYS A 1 71 ? -4.500  11.181  -1.210  1.00 0.00 ? 71 LYS A HG3  2  
ATOM 2417  H HD2  . LYS A 1 71 ? -4.924  9.059   0.870   1.00 0.00 ? 71 LYS A HD2  2  
ATOM 2418  H HD3  . LYS A 1 71 ? -5.597  10.680  1.060   1.00 0.00 ? 71 LYS A HD3  2  
ATOM 2419  H HE2  . LYS A 1 71 ? -6.758  10.436  -1.087  1.00 0.00 ? 71 LYS A HE2  2  
ATOM 2420  H HE3  . LYS A 1 71 ? -6.094  8.812   -1.258  1.00 0.00 ? 71 LYS A HE3  2  
ATOM 2421  H HZ1  . LYS A 1 71 ? -7.462  9.239   1.235   1.00 0.00 ? 71 LYS A HZ1  2  
ATOM 2422  H HZ2  . LYS A 1 71 ? -7.612  7.974   0.122   1.00 0.00 ? 71 LYS A HZ2  2  
ATOM 2423  H HZ3  . LYS A 1 71 ? -8.467  9.415   -0.114  1.00 0.00 ? 71 LYS A HZ3  2  
ATOM 2424  N N    . TRP A 1 72 ? -0.154  9.776   -0.158  1.00 0.00 ? 72 TRP A N    2  
ATOM 2425  C CA   . TRP A 1 72 ? 0.744   10.260  0.885   1.00 0.00 ? 72 TRP A CA   2  
ATOM 2426  C C    . TRP A 1 72 ? 1.897   11.056  0.284   1.00 0.00 ? 72 TRP A C    2  
ATOM 2427  O O    . TRP A 1 72 ? 2.470   11.928  0.938   1.00 0.00 ? 72 TRP A O    2  
ATOM 2428  C CB   . TRP A 1 72 ? 1.288   9.087   1.702   1.00 0.00 ? 72 TRP A CB   2  
ATOM 2429  C CG   . TRP A 1 72 ? 2.586   9.392   2.388   1.00 0.00 ? 72 TRP A CG   2  
ATOM 2430  C CD1  . TRP A 1 72 ? 2.761   10.149  3.511   1.00 0.00 ? 72 TRP A CD1  2  
ATOM 2431  C CD2  . TRP A 1 72 ? 3.889   8.950   1.992   1.00 0.00 ? 72 TRP A CD2  2  
ATOM 2432  N NE1  . TRP A 1 72 ? 4.094   10.203  3.838   1.00 0.00 ? 72 TRP A NE1  2  
ATOM 2433  C CE2  . TRP A 1 72 ? 4.807   9.475   2.923   1.00 0.00 ? 72 TRP A CE2  2  
ATOM 2434  C CE3  . TRP A 1 72 ? 4.369   8.160   0.944   1.00 0.00 ? 72 TRP A CE3  2  
ATOM 2435  C CZ2  . TRP A 1 72 ? 6.175   9.235   2.834   1.00 0.00 ? 72 TRP A CZ2  2  
ATOM 2436  C CZ3  . TRP A 1 72 ? 5.728   7.923   0.857   1.00 0.00 ? 72 TRP A CZ3  2  
ATOM 2437  C CH2  . TRP A 1 72 ? 6.618   8.458   1.798   1.00 0.00 ? 72 TRP A CH2  2  
ATOM 2438  H H    . TRP A 1 72 ? -0.042  8.865   -0.500  1.00 0.00 ? 72 TRP A H    2  
ATOM 2439  H HA   . TRP A 1 72 ? 0.175   10.908  1.536   1.00 0.00 ? 72 TRP A HA   2  
ATOM 2440  H HB2  . TRP A 1 72 ? 0.567   8.818   2.459   1.00 0.00 ? 72 TRP A HB2  2  
ATOM 2441  H HB3  . TRP A 1 72 ? 1.448   8.244   1.045   1.00 0.00 ? 72 TRP A HB3  2  
ATOM 2442  H HD1  . TRP A 1 72 ? 1.959   10.629  4.052   1.00 0.00 ? 72 TRP A HD1  2  
ATOM 2443  H HE1  . TRP A 1 72 ? 4.472   10.684  4.604   1.00 0.00 ? 72 TRP A HE1  2  
ATOM 2444  H HE3  . TRP A 1 72 ? 3.698   7.739   0.210   1.00 0.00 ? 72 TRP A HE3  2  
ATOM 2445  H HZ2  . TRP A 1 72 ? 6.874   9.640   3.551   1.00 0.00 ? 72 TRP A HZ2  2  
ATOM 2446  H HZ3  . TRP A 1 72 ? 6.117   7.315   0.054   1.00 0.00 ? 72 TRP A HZ3  2  
ATOM 2447  H HH2  . TRP A 1 72 ? 7.671   8.248   1.690   1.00 0.00 ? 72 TRP A HH2  2  
ATOM 2448  N N    . LYS A 1 73 ? 2.233   10.751  -0.965  1.00 0.00 ? 73 LYS A N    2  
ATOM 2449  C CA   . LYS A 1 73 ? 3.318   11.439  -1.655  1.00 0.00 ? 73 LYS A CA   2  
ATOM 2450  C C    . LYS A 1 73 ? 2.915   12.866  -2.014  1.00 0.00 ? 73 LYS A C    2  
ATOM 2451  O O    . LYS A 1 73 ? 2.186   13.093  -2.979  1.00 0.00 ? 73 LYS A O    2  
ATOM 2452  C CB   . LYS A 1 73 ? 3.709   10.675  -2.922  1.00 0.00 ? 73 LYS A CB   2  
ATOM 2453  C CG   . LYS A 1 73 ? 4.534   9.428   -2.649  1.00 0.00 ? 73 LYS A CG   2  
ATOM 2454  C CD   . LYS A 1 73 ? 5.997   9.767   -2.420  1.00 0.00 ? 73 LYS A CD   2  
ATOM 2455  C CE   . LYS A 1 73 ? 6.888   8.550   -2.618  1.00 0.00 ? 73 LYS A CE   2  
ATOM 2456  N NZ   . LYS A 1 73 ? 8.265   8.781   -2.099  1.00 0.00 ? 73 LYS A NZ   2  
ATOM 2457  H H    . LYS A 1 73 ? 1.739   10.046  -1.434  1.00 0.00 ? 73 LYS A H    2  
ATOM 2458  H HA   . LYS A 1 73 ? 4.166   11.474  -0.989  1.00 0.00 ? 73 LYS A HA   2  
ATOM 2459  H HB2  . LYS A 1 73 ? 2.810   10.380  -3.442  1.00 0.00 ? 73 LYS A HB2  2  
ATOM 2460  H HB3  . LYS A 1 73 ? 4.286   11.330  -3.559  1.00 0.00 ? 73 LYS A HB3  2  
ATOM 2461  H HG2  . LYS A 1 73 ? 4.147   8.937   -1.769  1.00 0.00 ? 73 LYS A HG2  2  
ATOM 2462  H HG3  . LYS A 1 73 ? 4.456   8.764   -3.499  1.00 0.00 ? 73 LYS A HG3  2  
ATOM 2463  H HD2  . LYS A 1 73 ? 6.294   10.534  -3.119  1.00 0.00 ? 73 LYS A HD2  2  
ATOM 2464  H HD3  . LYS A 1 73 ? 6.119   10.131  -1.409  1.00 0.00 ? 73 LYS A HD3  2  
ATOM 2465  H HE2  . LYS A 1 73 ? 6.452   7.712   -2.096  1.00 0.00 ? 73 LYS A HE2  2  
ATOM 2466  H HE3  . LYS A 1 73 ? 6.942   8.328   -3.673  1.00 0.00 ? 73 LYS A HE3  2  
ATOM 2467  H HZ1  . LYS A 1 73 ? 8.551   9.766   -2.271  1.00 0.00 ? 73 LYS A HZ1  2  
ATOM 2468  H HZ2  . LYS A 1 73 ? 8.938   8.148   -2.578  1.00 0.00 ? 73 LYS A HZ2  2  
ATOM 2469  H HZ3  . LYS A 1 73 ? 8.298   8.595   -1.077  1.00 0.00 ? 73 LYS A HZ3  2  
ATOM 2470  N N    . LYS A 1 74 ? 3.397   13.826  -1.231  1.00 0.00 ? 74 LYS A N    2  
ATOM 2471  C CA   . LYS A 1 74 ? 3.090   15.232  -1.467  1.00 0.00 ? 74 LYS A CA   2  
ATOM 2472  C C    . LYS A 1 74 ? 1.676   15.396  -2.013  1.00 0.00 ? 74 LYS A C    2  
ATOM 2473  O O    . LYS A 1 74 ? 1.450   16.144  -2.964  1.00 0.00 ? 74 LYS A O    2  
ATOM 2474  C CB   . LYS A 1 74 ? 4.099   15.838  -2.445  1.00 0.00 ? 74 LYS A CB   2  
ATOM 2475  C CG   . LYS A 1 74 ? 5.325   16.425  -1.767  1.00 0.00 ? 74 LYS A CG   2  
ATOM 2476  C CD   . LYS A 1 74 ? 4.990   17.705  -1.020  1.00 0.00 ? 74 LYS A CD   2  
ATOM 2477  C CE   . LYS A 1 74 ? 6.077   18.067  -0.019  1.00 0.00 ? 74 LYS A CE   2  
ATOM 2478  N NZ   . LYS A 1 74 ? 6.017   17.213  1.199   1.00 0.00 ? 74 LYS A NZ   2  
ATOM 2479  H H    . LYS A 1 74 ? 3.973   13.583  -0.476  1.00 0.00 ? 74 LYS A H    2  
ATOM 2480  H HA   . LYS A 1 74 ? 3.161   15.750  -0.522  1.00 0.00 ? 74 LYS A HA   2  
ATOM 2481  H HB2  . LYS A 1 74 ? 4.426   15.069  -3.129  1.00 0.00 ? 74 LYS A HB2  2  
ATOM 2482  H HB3  . LYS A 1 74 ? 3.613   16.623  -3.005  1.00 0.00 ? 74 LYS A HB3  2  
ATOM 2483  H HG2  . LYS A 1 74 ? 5.718   15.704  -1.066  1.00 0.00 ? 74 LYS A HG2  2  
ATOM 2484  H HG3  . LYS A 1 74 ? 6.071   16.642  -2.518  1.00 0.00 ? 74 LYS A HG3  2  
ATOM 2485  H HD2  . LYS A 1 74 ? 4.888   18.511  -1.731  1.00 0.00 ? 74 LYS A HD2  2  
ATOM 2486  H HD3  . LYS A 1 74 ? 4.057   17.569  -0.491  1.00 0.00 ? 74 LYS A HD3  2  
ATOM 2487  H HE2  . LYS A 1 74 ? 7.039   17.940  -0.491  1.00 0.00 ? 74 LYS A HE2  2  
ATOM 2488  H HE3  . LYS A 1 74 ? 5.952   19.100  0.270   1.00 0.00 ? 74 LYS A HE3  2  
ATOM 2489  H HZ1  . LYS A 1 74 ? 5.616   17.751  1.993   1.00 0.00 ? 74 LYS A HZ1  2  
ATOM 2490  H HZ2  . LYS A 1 74 ? 6.972   16.893  1.459   1.00 0.00 ? 74 LYS A HZ2  2  
ATOM 2491  H HZ3  . LYS A 1 74 ? 5.421   16.379  1.022   1.00 0.00 ? 74 LYS A HZ3  2  
ATOM 2492  N N    . SER A 1 75 ? 0.726   14.693  -1.405  1.00 0.00 ? 75 SER A N    2  
ATOM 2493  C CA   . SER A 1 75 ? -0.667  14.759  -1.832  1.00 0.00 ? 75 SER A CA   2  
ATOM 2494  C C    . SER A 1 75 ? -1.607  14.460  -0.669  1.00 0.00 ? 75 SER A C    2  
ATOM 2495  O O    . SER A 1 75 ? -1.167  14.241  0.459   1.00 0.00 ? 75 SER A O    2  
ATOM 2496  C CB   . SER A 1 75 ? -0.920  13.773  -2.974  1.00 0.00 ? 75 SER A CB   2  
ATOM 2497  O OG   . SER A 1 75 ? -2.103  14.103  -3.680  1.00 0.00 ? 75 SER A OG   2  
ATOM 2498  H H    . SER A 1 75 ? 0.968   14.114  -0.652  1.00 0.00 ? 75 SER A H    2  
ATOM 2499  H HA   . SER A 1 75 ? -0.858  15.762  -2.185  1.00 0.00 ? 75 SER A HA   2  
ATOM 2500  H HB2  . SER A 1 75 ? -0.087  13.799  -3.660  1.00 0.00 ? 75 SER A HB2  2  
ATOM 2501  H HB3  . SER A 1 75 ? -1.022  12.777  -2.569  1.00 0.00 ? 75 SER A HB3  2  
ATOM 2502  H HG   . SER A 1 75 ? -2.733  13.383  -3.603  1.00 0.00 ? 75 SER A HG   2  
ATOM 2503  N N    . GLY A 1 76 ? -2.906  14.451  -0.953  1.00 0.00 ? 76 GLY A N    2  
ATOM 2504  C CA   . GLY A 1 76 ? -3.889  14.177  0.079   1.00 0.00 ? 76 GLY A CA   2  
ATOM 2505  C C    . GLY A 1 76 ? -5.312  14.265  -0.437  1.00 0.00 ? 76 GLY A C    2  
ATOM 2506  O O    . GLY A 1 76 ? -5.945  13.257  -0.750  1.00 0.00 ? 76 GLY A O    2  
ATOM 2507  H H    . GLY A 1 76 ? -3.199  14.632  -1.870  1.00 0.00 ? 76 GLY A H    2  
ATOM 2508  H HA2  . GLY A 1 76 ? -3.719  13.185  0.469   1.00 0.00 ? 76 GLY A HA2  2  
ATOM 2509  H HA3  . GLY A 1 76 ? -3.764  14.893  0.879   1.00 0.00 ? 76 GLY A HA3  2  
ATOM 2510  N N    . PRO A 1 77 ? -5.836  15.496  -0.530  1.00 0.00 ? 77 PRO A N    2  
ATOM 2511  C CA   . PRO A 1 77 ? -7.199  15.741  -1.011  1.00 0.00 ? 77 PRO A CA   2  
ATOM 2512  C C    . PRO A 1 77 ? -7.348  15.458  -2.502  1.00 0.00 ? 77 PRO A C    2  
ATOM 2513  O O    . PRO A 1 77 ? -6.357  15.330  -3.221  1.00 0.00 ? 77 PRO A O    2  
ATOM 2514  C CB   . PRO A 1 77 ? -7.414  17.229  -0.725  1.00 0.00 ? 77 PRO A CB   2  
ATOM 2515  C CG   . PRO A 1 77 ? -6.044  17.815  -0.716  1.00 0.00 ? 77 PRO A CG   2  
ATOM 2516  C CD   . PRO A 1 77 ? -5.139  16.743  -0.175  1.00 0.00 ? 77 PRO A CD   2  
ATOM 2517  H HA   . PRO A 1 77 ? -7.925  15.159  -0.461  1.00 0.00 ? 77 PRO A HA   2  
ATOM 2518  H HB2  . PRO A 1 77 ? -8.025  17.664  -1.504  1.00 0.00 ? 77 PRO A HB2  2  
ATOM 2519  H HB3  . PRO A 1 77 ? -7.900  17.350  0.231   1.00 0.00 ? 77 PRO A HB3  2  
ATOM 2520  H HG2  . PRO A 1 77 ? -5.752  18.080  -1.721  1.00 0.00 ? 77 PRO A HG2  2  
ATOM 2521  H HG3  . PRO A 1 77 ? -6.021  18.684  -0.076  1.00 0.00 ? 77 PRO A HG3  2  
ATOM 2522  H HD2  . PRO A 1 77 ? -4.170  16.792  -0.649  1.00 0.00 ? 77 PRO A HD2  2  
ATOM 2523  H HD3  . PRO A 1 77 ? -5.042  16.838  0.897   1.00 0.00 ? 77 PRO A HD3  2  
ATOM 2524  N N    . SER A 1 78 ? -8.592  15.363  -2.960  1.00 0.00 ? 78 SER A N    2  
ATOM 2525  C CA   . SER A 1 78 ? -8.870  15.092  -4.366  1.00 0.00 ? 78 SER A CA   2  
ATOM 2526  C C    . SER A 1 78 ? -9.199  16.381  -5.113  1.00 0.00 ? 78 SER A C    2  
ATOM 2527  O O    . SER A 1 78 ? -8.547  16.724  -6.099  1.00 0.00 ? 78 SER A O    2  
ATOM 2528  C CB   . SER A 1 78 ? -10.030 14.103  -4.497  1.00 0.00 ? 78 SER A CB   2  
ATOM 2529  O OG   . SER A 1 78 ? -10.072 13.536  -5.795  1.00 0.00 ? 78 SER A OG   2  
ATOM 2530  H H    . SER A 1 78 ? -9.341  15.475  -2.338  1.00 0.00 ? 78 SER A H    2  
ATOM 2531  H HA   . SER A 1 78 ? -7.984  14.654  -4.801  1.00 0.00 ? 78 SER A HA   2  
ATOM 2532  H HB2  . SER A 1 78 ? -9.906  13.310  -3.775  1.00 0.00 ? 78 SER A HB2  2  
ATOM 2533  H HB3  . SER A 1 78 ? -10.961 14.618  -4.311  1.00 0.00 ? 78 SER A HB3  2  
ATOM 2534  H HG   . SER A 1 78 ? -10.671 12.785  -5.797  1.00 0.00 ? 78 SER A HG   2  
ATOM 2535  N N    . SER A 1 79 ? -10.217 17.091  -4.635  1.00 0.00 ? 79 SER A N    2  
ATOM 2536  C CA   . SER A 1 79 ? -10.636 18.340  -5.259  1.00 0.00 ? 79 SER A CA   2  
ATOM 2537  C C    . SER A 1 79 ? -9.816  19.513  -4.731  1.00 0.00 ? 79 SER A C    2  
ATOM 2538  O O    . SER A 1 79 ? -9.594  19.639  -3.528  1.00 0.00 ? 79 SER A O    2  
ATOM 2539  C CB   . SER A 1 79 ? -12.124 18.588  -5.003  1.00 0.00 ? 79 SER A CB   2  
ATOM 2540  O OG   . SER A 1 79 ? -12.420 18.530  -3.619  1.00 0.00 ? 79 SER A OG   2  
ATOM 2541  H H    . SER A 1 79 ? -10.698 16.765  -3.846  1.00 0.00 ? 79 SER A H    2  
ATOM 2542  H HA   . SER A 1 79 ? -10.473 18.251  -6.323  1.00 0.00 ? 79 SER A HA   2  
ATOM 2543  H HB2  . SER A 1 79 ? -12.394 19.564  -5.376  1.00 0.00 ? 79 SER A HB2  2  
ATOM 2544  H HB3  . SER A 1 79 ? -12.705 17.834  -5.515  1.00 0.00 ? 79 SER A HB3  2  
ATOM 2545  H HG   . SER A 1 79 ? -12.165 19.356  -3.202  1.00 0.00 ? 79 SER A HG   2  
ATOM 2546  N N    . GLY A 1 80 ? -9.368  20.371  -5.643  1.00 0.00 ? 80 GLY A N    2  
ATOM 2547  C CA   . GLY A 1 80 ? -8.576  21.523  -5.252  1.00 0.00 ? 80 GLY A CA   2  
ATOM 2548  C C    . GLY A 1 80 ? -8.123  22.346  -6.441  1.00 0.00 ? 80 GLY A C    2  
ATOM 2549  O O    . GLY A 1 80 ? -8.866  23.193  -6.937  1.00 0.00 ? 80 GLY A O    2  
ATOM 2550  H H    . GLY A 1 80 ? -9.575  20.221  -6.589  1.00 0.00 ? 80 GLY A H    2  
ATOM 2551  H HA2  . GLY A 1 80 ? -9.168  22.148  -4.599  1.00 0.00 ? 80 GLY A HA2  2  
ATOM 2552  H HA3  . GLY A 1 80 ? -7.705  21.181  -4.713  1.00 0.00 ? 80 GLY A HA3  2  
ATOM 2553  N N    . GLY A 1 1  ? -26.127 11.756  -39.741 1.00 0.00 ? 1  GLY A N    3  
ATOM 2554  C CA   . GLY A 1 1  ? -26.236 12.439  -38.465 1.00 0.00 ? 1  GLY A CA   3  
ATOM 2555  C C    . GLY A 1 1  ? -26.868 11.572  -37.395 1.00 0.00 ? 1  GLY A C    3  
ATOM 2556  O O    . GLY A 1 1  ? -27.153 10.397  -37.626 1.00 0.00 ? 1  GLY A O    3  
ATOM 2557  H H1   . GLY A 1 1  ? -26.620 10.922  -39.891 1.00 0.00 ? 1  GLY A H1   3  
ATOM 2558  H HA2  . GLY A 1 1  ? -25.248 12.730  -38.140 1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2559  H HA3  . GLY A 1 1  ? -26.837 13.326  -38.595 1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2560  N N    . SER A 1 2  ? -27.088 12.152  -36.219 1.00 0.00 ? 2  SER A N    3  
ATOM 2561  C CA   . SER A 1 2  ? -27.686 11.422  -35.107 1.00 0.00 ? 2  SER A CA   3  
ATOM 2562  C C    . SER A 1 2  ? -28.278 12.385  -34.082 1.00 0.00 ? 2  SER A C    3  
ATOM 2563  O O    . SER A 1 2  ? -28.178 13.603  -34.228 1.00 0.00 ? 2  SER A O    3  
ATOM 2564  C CB   . SER A 1 2  ? -26.643 10.525  -34.438 1.00 0.00 ? 2  SER A CB   3  
ATOM 2565  O OG   . SER A 1 2  ? -26.159 9.546   -35.341 1.00 0.00 ? 2  SER A OG   3  
ATOM 2566  H H    . SER A 1 2  ? -26.839 13.092  -36.096 1.00 0.00 ? 2  SER A H    3  
ATOM 2567  H HA   . SER A 1 2  ? -28.479 10.805  -35.503 1.00 0.00 ? 2  SER A HA   3  
ATOM 2568  H HB2  . SER A 1 2  ? -25.814 11.129  -34.102 1.00 0.00 ? 2  SER A HB2  3  
ATOM 2569  H HB3  . SER A 1 2  ? -27.092 10.026  -33.591 1.00 0.00 ? 2  SER A HB3  3  
ATOM 2570  H HG   . SER A 1 2  ? -25.360 9.868   -35.764 1.00 0.00 ? 2  SER A HG   3  
ATOM 2571  N N    . SER A 1 3  ? -28.896 11.828  -33.045 1.00 0.00 ? 3  SER A N    3  
ATOM 2572  C CA   . SER A 1 3  ? -29.508 12.636  -31.996 1.00 0.00 ? 3  SER A CA   3  
ATOM 2573  C C    . SER A 1 3  ? -29.390 11.946  -30.641 1.00 0.00 ? 3  SER A C    3  
ATOM 2574  O O    . SER A 1 3  ? -28.889 10.827  -30.542 1.00 0.00 ? 3  SER A O    3  
ATOM 2575  C CB   . SER A 1 3  ? -30.979 12.901  -32.321 1.00 0.00 ? 3  SER A CB   3  
ATOM 2576  O OG   . SER A 1 3  ? -31.126 14.073  -33.102 1.00 0.00 ? 3  SER A OG   3  
ATOM 2577  H H    . SER A 1 3  ? -28.943 10.851  -32.985 1.00 0.00 ? 3  SER A H    3  
ATOM 2578  H HA   . SER A 1 3  ? -28.982 13.578  -31.954 1.00 0.00 ? 3  SER A HA   3  
ATOM 2579  H HB2  . SER A 1 3  ? -31.380 12.063  -32.871 1.00 0.00 ? 3  SER A HB2  3  
ATOM 2580  H HB3  . SER A 1 3  ? -31.532 13.024  -31.400 1.00 0.00 ? 3  SER A HB3  3  
ATOM 2581  H HG   . SER A 1 3  ? -31.646 13.874  -33.885 1.00 0.00 ? 3  SER A HG   3  
ATOM 2582  N N    . GLY A 1 4  ? -29.857 12.624  -29.596 1.00 0.00 ? 4  GLY A N    3  
ATOM 2583  C CA   . GLY A 1 4  ? -29.796 12.062  -28.260 1.00 0.00 ? 4  GLY A CA   3  
ATOM 2584  C C    . GLY A 1 4  ? -30.715 12.775  -27.288 1.00 0.00 ? 4  GLY A C    3  
ATOM 2585  O O    . GLY A 1 4  ? -31.502 13.634  -27.684 1.00 0.00 ? 4  GLY A O    3  
ATOM 2586  H H    . GLY A 1 4  ? -30.247 13.512  -29.734 1.00 0.00 ? 4  GLY A H    3  
ATOM 2587  H HA2  . GLY A 1 4  ? -30.076 11.020  -28.305 1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2588  H HA3  . GLY A 1 4  ? -28.781 12.135  -27.897 1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2589  N N    . SER A 1 5  ? -30.615 12.418  -26.011 1.00 0.00 ? 5  SER A N    3  
ATOM 2590  C CA   . SER A 1 5  ? -31.448 13.026  -24.980 1.00 0.00 ? 5  SER A CA   3  
ATOM 2591  C C    . SER A 1 5  ? -30.833 12.828  -23.598 1.00 0.00 ? 5  SER A C    3  
ATOM 2592  O O    . SER A 1 5  ? -29.842 12.115  -23.444 1.00 0.00 ? 5  SER A O    3  
ATOM 2593  C CB   . SER A 1 5  ? -32.856 12.430  -25.015 1.00 0.00 ? 5  SER A CB   3  
ATOM 2594  O OG   . SER A 1 5  ? -33.667 13.091  -25.971 1.00 0.00 ? 5  SER A OG   3  
ATOM 2595  H H    . SER A 1 5  ? -29.968 11.727  -25.757 1.00 0.00 ? 5  SER A H    3  
ATOM 2596  H HA   . SER A 1 5  ? -31.510 14.085  -25.186 1.00 0.00 ? 5  SER A HA   3  
ATOM 2597  H HB2  . SER A 1 5  ? -32.795 11.384  -25.274 1.00 0.00 ? 5  SER A HB2  3  
ATOM 2598  H HB3  . SER A 1 5  ? -33.312 12.534  -24.041 1.00 0.00 ? 5  SER A HB3  3  
ATOM 2599  H HG   . SER A 1 5  ? -34.567 13.151  -25.641 1.00 0.00 ? 5  SER A HG   3  
ATOM 2600  N N    . SER A 1 6  ? -31.430 13.465  -22.595 1.00 0.00 ? 6  SER A N    3  
ATOM 2601  C CA   . SER A 1 6  ? -30.940 13.363  -21.226 1.00 0.00 ? 6  SER A CA   3  
ATOM 2602  C C    . SER A 1 6  ? -31.952 13.940  -20.242 1.00 0.00 ? 6  SER A C    3  
ATOM 2603  O O    . SER A 1 6  ? -32.997 14.454  -20.639 1.00 0.00 ? 6  SER A O    3  
ATOM 2604  C CB   . SER A 1 6  ? -29.602 14.091  -21.085 1.00 0.00 ? 6  SER A CB   3  
ATOM 2605  O OG   . SER A 1 6  ? -29.691 15.420  -21.570 1.00 0.00 ? 6  SER A OG   3  
ATOM 2606  H H    . SER A 1 6  ? -32.217 14.018  -22.782 1.00 0.00 ? 6  SER A H    3  
ATOM 2607  H HA   . SER A 1 6  ? -30.795 12.316  -21.003 1.00 0.00 ? 6  SER A HA   3  
ATOM 2608  H HB2  . SER A 1 6  ? -29.318 14.119  -20.044 1.00 0.00 ? 6  SER A HB2  3  
ATOM 2609  H HB3  . SER A 1 6  ? -28.847 13.564  -21.650 1.00 0.00 ? 6  SER A HB3  3  
ATOM 2610  H HG   . SER A 1 6  ? -29.645 15.414  -22.529 1.00 0.00 ? 6  SER A HG   3  
ATOM 2611  N N    . GLY A 1 7  ? -31.634 13.852  -18.954 1.00 0.00 ? 7  GLY A N    3  
ATOM 2612  C CA   . GLY A 1 7  ? -32.525 14.369  -17.932 1.00 0.00 ? 7  GLY A CA   3  
ATOM 2613  C C    . GLY A 1 7  ? -31.786 14.789  -16.677 1.00 0.00 ? 7  GLY A C    3  
ATOM 2614  O O    . GLY A 1 7  ? -30.595 15.092  -16.721 1.00 0.00 ? 7  GLY A O    3  
ATOM 2615  H H    . GLY A 1 7  ? -30.786 13.432  -18.695 1.00 0.00 ? 7  GLY A H    3  
ATOM 2616  H HA2  . GLY A 1 7  ? -33.053 15.223  -18.329 1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2617  H HA3  . GLY A 1 7  ? -33.241 13.603  -17.674 1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2618  N N    . GLY A 1 8  ? -32.496 14.809  -15.552 1.00 0.00 ? 8  GLY A N    3  
ATOM 2619  C CA   . GLY A 1 8  ? -31.884 15.199  -14.296 1.00 0.00 ? 8  GLY A CA   3  
ATOM 2620  C C    . GLY A 1 8  ? -32.903 15.399  -13.192 1.00 0.00 ? 8  GLY A C    3  
ATOM 2621  O O    . GLY A 1 8  ? -34.107 15.291  -13.424 1.00 0.00 ? 8  GLY A O    3  
ATOM 2622  H H    . GLY A 1 8  ? -33.443 14.557  -15.577 1.00 0.00 ? 8  GLY A H    3  
ATOM 2623  H HA2  . GLY A 1 8  ? -31.188 14.430  -13.993 1.00 0.00 ? 8  GLY A HA2  3  
ATOM 2624  H HA3  . GLY A 1 8  ? -31.343 16.122  -14.443 1.00 0.00 ? 8  GLY A HA3  3  
ATOM 2625  N N    . GLU A 1 9  ? -32.420 15.691  -11.988 1.00 0.00 ? 9  GLU A N    3  
ATOM 2626  C CA   . GLU A 1 9  ? -33.299 15.905  -10.845 1.00 0.00 ? 9  GLU A CA   3  
ATOM 2627  C C    . GLU A 1 9  ? -32.507 16.383  -9.631  1.00 0.00 ? 9  GLU A C    3  
ATOM 2628  O O    . GLU A 1 9  ? -31.351 16.013  -9.428  1.00 0.00 ? 9  GLU A O    3  
ATOM 2629  C CB   . GLU A 1 9  ? -34.049 14.616  -10.502 1.00 0.00 ? 9  GLU A CB   3  
ATOM 2630  C CG   . GLU A 1 9  ? -33.137 13.468  -10.104 1.00 0.00 ? 9  GLU A CG   3  
ATOM 2631  C CD   . GLU A 1 9  ? -32.851 13.440  -8.615  1.00 0.00 ? 9  GLU A CD   3  
ATOM 2632  O OE1  . GLU A 1 9  ? -33.818 13.426  -7.824  1.00 0.00 ? 9  GLU A OE1  3  
ATOM 2633  O OE2  . GLU A 1 9  ? -31.659 13.431  -8.240  1.00 0.00 ? 9  GLU A OE2  3  
ATOM 2634  H H    . GLU A 1 9  ? -31.451 15.764  -11.867 1.00 0.00 ? 9  GLU A H    3  
ATOM 2635  H HA   . GLU A 1 9  ? -34.016 16.666  -11.114 1.00 0.00 ? 9  GLU A HA   3  
ATOM 2636  H HB2  . GLU A 1 9  ? -34.725 14.813  -9.682  1.00 0.00 ? 9  GLU A HB2  3  
ATOM 2637  H HB3  . GLU A 1 9  ? -34.624 14.308  -11.363 1.00 0.00 ? 9  GLU A HB3  3  
ATOM 2638  H HG2  . GLU A 1 9  ? -33.608 12.537  -10.382 1.00 0.00 ? 9  GLU A HG2  3  
ATOM 2639  H HG3  . GLU A 1 9  ? -32.201 13.569  -10.633 1.00 0.00 ? 9  GLU A HG3  3  
ATOM 2640  N N    . PRO A 1 10 ? -33.143 17.227  -8.805  1.00 0.00 ? 10 PRO A N    3  
ATOM 2641  C CA   . PRO A 1 10 ? -32.517 17.774  -7.598  1.00 0.00 ? 10 PRO A CA   3  
ATOM 2642  C C    . PRO A 1 10 ? -32.314 16.716  -6.519  1.00 0.00 ? 10 PRO A C    3  
ATOM 2643  O O    . PRO A 1 10 ? -32.519 15.526  -6.756  1.00 0.00 ? 10 PRO A O    3  
ATOM 2644  C CB   . PRO A 1 10 ? -33.519 18.832  -7.127  1.00 0.00 ? 10 PRO A CB   3  
ATOM 2645  C CG   . PRO A 1 10 ? -34.830 18.382  -7.676  1.00 0.00 ? 10 PRO A CG   3  
ATOM 2646  C CD   . PRO A 1 10 ? -34.522 17.711  -8.985  1.00 0.00 ? 10 PRO A CD   3  
ATOM 2647  H HA   . PRO A 1 10 ? -31.571 18.246  -7.820  1.00 0.00 ? 10 PRO A HA   3  
ATOM 2648  H HB2  . PRO A 1 10 ? -33.532 18.864  -6.047  1.00 0.00 ? 10 PRO A HB2  3  
ATOM 2649  H HB3  . PRO A 1 10 ? -33.239 19.798  -7.518  1.00 0.00 ? 10 PRO A HB3  3  
ATOM 2650  H HG2  . PRO A 1 10 ? -35.292 17.684  -6.995  1.00 0.00 ? 10 PRO A HG2  3  
ATOM 2651  H HG3  . PRO A 1 10 ? -35.473 19.235  -7.834  1.00 0.00 ? 10 PRO A HG3  3  
ATOM 2652  H HD2  . PRO A 1 10 ? -35.200 16.888  -9.156  1.00 0.00 ? 10 PRO A HD2  3  
ATOM 2653  H HD3  . PRO A 1 10 ? -34.577 18.422  -9.796  1.00 0.00 ? 10 PRO A HD3  3  
ATOM 2654  N N    . GLY A 1 11 ? -31.910 17.157  -5.331  1.00 0.00 ? 11 GLY A N    3  
ATOM 2655  C CA   . GLY A 1 11 ? -31.687 16.235  -4.234  1.00 0.00 ? 11 GLY A CA   3  
ATOM 2656  C C    . GLY A 1 11 ? -31.005 16.894  -3.052  1.00 0.00 ? 11 GLY A C    3  
ATOM 2657  O O    . GLY A 1 11 ? -30.964 18.121  -2.953  1.00 0.00 ? 11 GLY A O    3  
ATOM 2658  H H    . GLY A 1 11 ? -31.763 18.117  -5.200  1.00 0.00 ? 11 GLY A H    3  
ATOM 2659  H HA2  . GLY A 1 11 ? -32.638 15.838  -3.912  1.00 0.00 ? 11 GLY A HA2  3  
ATOM 2660  H HA3  . GLY A 1 11 ? -31.068 15.421  -4.583  1.00 0.00 ? 11 GLY A HA3  3  
ATOM 2661  N N    . THR A 1 12 ? -30.469 16.079  -2.149  1.00 0.00 ? 12 THR A N    3  
ATOM 2662  C CA   . THR A 1 12 ? -29.788 16.590  -0.966  1.00 0.00 ? 12 THR A CA   3  
ATOM 2663  C C    . THR A 1 12 ? -28.753 15.594  -0.454  1.00 0.00 ? 12 THR A C    3  
ATOM 2664  O O    . THR A 1 12 ? -29.015 14.394  -0.380  1.00 0.00 ? 12 THR A O    3  
ATOM 2665  C CB   . THR A 1 12 ? -30.786 16.904  0.165   1.00 0.00 ? 12 THR A CB   3  
ATOM 2666  O OG1  . THR A 1 12 ? -30.111 17.553  1.248   1.00 0.00 ? 12 THR A OG1  3  
ATOM 2667  C CG2  . THR A 1 12 ? -31.453 15.632  0.666   1.00 0.00 ? 12 THR A CG2  3  
ATOM 2668  H H    . THR A 1 12 ? -30.534 15.110  -2.283  1.00 0.00 ? 12 THR A H    3  
ATOM 2669  H HA   . THR A 1 12 ? -29.286 17.507  -1.240  1.00 0.00 ? 12 THR A HA   3  
ATOM 2670  H HB   . THR A 1 12 ? -31.548 17.565  -0.222  1.00 0.00 ? 12 THR A HB   3  
ATOM 2671  H HG1  . THR A 1 12 ? -30.572 18.365  1.472   1.00 0.00 ? 12 THR A HG1  3  
ATOM 2672  H HG21 . THR A 1 12 ? -30.696 14.916  0.949   1.00 0.00 ? 12 THR A HG21 3  
ATOM 2673  H HG22 . THR A 1 12 ? -32.068 15.215  -0.118  1.00 0.00 ? 12 THR A HG22 3  
ATOM 2674  H HG23 . THR A 1 12 ? -32.069 15.862  1.522   1.00 0.00 ? 12 THR A HG23 3  
ATOM 2675  N N    . LYS A 1 13 ? -27.577 16.100  -0.099  1.00 0.00 ? 13 LYS A N    3  
ATOM 2676  C CA   . LYS A 1 13 ? -26.502 15.256  0.409   1.00 0.00 ? 13 LYS A CA   3  
ATOM 2677  C C    . LYS A 1 13 ? -25.356 16.103  0.952   1.00 0.00 ? 13 LYS A C    3  
ATOM 2678  O O    . LYS A 1 13 ? -24.796 16.936  0.241   1.00 0.00 ? 13 LYS A O    3  
ATOM 2679  C CB   . LYS A 1 13 ? -25.987 14.330  -0.696  1.00 0.00 ? 13 LYS A CB   3  
ATOM 2680  C CG   . LYS A 1 13 ? -25.355 15.069  -1.863  1.00 0.00 ? 13 LYS A CG   3  
ATOM 2681  C CD   . LYS A 1 13 ? -24.988 14.120  -2.991  1.00 0.00 ? 13 LYS A CD   3  
ATOM 2682  C CE   . LYS A 1 13 ? -24.593 14.876  -4.250  1.00 0.00 ? 13 LYS A CE   3  
ATOM 2683  N NZ   . LYS A 1 13 ? -25.783 15.354  -5.007  1.00 0.00 ? 13 LYS A NZ   3  
ATOM 2684  H H    . LYS A 1 13 ? -27.428 17.066  -0.181  1.00 0.00 ? 13 LYS A H    3  
ATOM 2685  H HA   . LYS A 1 13 ? -26.903 14.656  1.212   1.00 0.00 ? 13 LYS A HA   3  
ATOM 2686  H HB2  . LYS A 1 13 ? -25.249 13.664  -0.276  1.00 0.00 ? 13 LYS A HB2  3  
ATOM 2687  H HB3  . LYS A 1 13 ? -26.814 13.746  -1.073  1.00 0.00 ? 13 LYS A HB3  3  
ATOM 2688  H HG2  . LYS A 1 13 ? -26.055 15.801  -2.236  1.00 0.00 ? 13 LYS A HG2  3  
ATOM 2689  H HG3  . LYS A 1 13 ? -24.460 15.568  -1.518  1.00 0.00 ? 13 LYS A HG3  3  
ATOM 2690  H HD2  . LYS A 1 13 ? -24.156 13.506  -2.677  1.00 0.00 ? 13 LYS A HD2  3  
ATOM 2691  H HD3  . LYS A 1 13 ? -25.839 13.491  -3.211  1.00 0.00 ? 13 LYS A HD3  3  
ATOM 2692  H HE2  . LYS A 1 13 ? -23.991 15.727  -3.969  1.00 0.00 ? 13 LYS A HE2  3  
ATOM 2693  H HE3  . LYS A 1 13 ? -24.014 14.219  -4.882  1.00 0.00 ? 13 LYS A HE3  3  
ATOM 2694  H HZ1  . LYS A 1 13 ? -26.344 16.003  -4.418  1.00 0.00 ? 13 LYS A HZ1  3  
ATOM 2695  H HZ2  . LYS A 1 13 ? -26.380 14.547  -5.279  1.00 0.00 ? 13 LYS A HZ2  3  
ATOM 2696  H HZ3  . LYS A 1 13 ? -25.482 15.855  -5.867  1.00 0.00 ? 13 LYS A HZ3  3  
ATOM 2697  N N    . ALA A 1 14 ? -25.011 15.882  2.217   1.00 0.00 ? 14 ALA A N    3  
ATOM 2698  C CA   . ALA A 1 14 ? -23.929 16.622  2.854   1.00 0.00 ? 14 ALA A CA   3  
ATOM 2699  C C    . ALA A 1 14 ? -22.596 16.346  2.167   1.00 0.00 ? 14 ALA A C    3  
ATOM 2700  O O    . ALA A 1 14 ? -21.913 17.268  1.720   1.00 0.00 ? 14 ALA A O    3  
ATOM 2701  C CB   . ALA A 1 14 ? -23.847 16.269  4.332   1.00 0.00 ? 14 ALA A CB   3  
ATOM 2702  H H    . ALA A 1 14 ? -25.495 15.204  2.733   1.00 0.00 ? 14 ALA A H    3  
ATOM 2703  H HA   . ALA A 1 14 ? -24.153 17.676  2.773   1.00 0.00 ? 14 ALA A HA   3  
ATOM 2704  H HB1  . ALA A 1 14 ? -24.843 16.235  4.749   1.00 0.00 ? 14 ALA A HB1  3  
ATOM 2705  H HB2  . ALA A 1 14 ? -23.375 15.305  4.445   1.00 0.00 ? 14 ALA A HB2  3  
ATOM 2706  H HB3  . ALA A 1 14 ? -23.266 17.018  4.848   1.00 0.00 ? 14 ALA A HB3  3  
ATOM 2707  N N    . LYS A 1 15 ? -22.230 15.072  2.086   1.00 0.00 ? 15 LYS A N    3  
ATOM 2708  C CA   . LYS A 1 15 ? -20.979 14.673  1.453   1.00 0.00 ? 15 LYS A CA   3  
ATOM 2709  C C    . LYS A 1 15 ? -21.078 14.781  -0.065  1.00 0.00 ? 15 LYS A C    3  
ATOM 2710  O O    . LYS A 1 15 ? -21.758 13.983  -0.711  1.00 0.00 ? 15 LYS A O    3  
ATOM 2711  C CB   . LYS A 1 15 ? -20.616 13.240  1.851   1.00 0.00 ? 15 LYS A CB   3  
ATOM 2712  C CG   . LYS A 1 15 ? -19.766 13.154  3.106   1.00 0.00 ? 15 LYS A CG   3  
ATOM 2713  C CD   . LYS A 1 15 ? -20.519 13.657  4.326   1.00 0.00 ? 15 LYS A CD   3  
ATOM 2714  C CE   . LYS A 1 15 ? -20.311 15.149  4.533   1.00 0.00 ? 15 LYS A CE   3  
ATOM 2715  N NZ   . LYS A 1 15 ? -20.673 15.573  5.914   1.00 0.00 ? 15 LYS A NZ   3  
ATOM 2716  H H    . LYS A 1 15 ? -22.817 14.381  2.461   1.00 0.00 ? 15 LYS A H    3  
ATOM 2717  H HA   . LYS A 1 15 ? -20.204 15.340  1.800   1.00 0.00 ? 15 LYS A HA   3  
ATOM 2718  H HB2  . LYS A 1 15 ? -21.527 12.685  2.019   1.00 0.00 ? 15 LYS A HB2  3  
ATOM 2719  H HB3  . LYS A 1 15 ? -20.070 12.782  1.039   1.00 0.00 ? 15 LYS A HB3  3  
ATOM 2720  H HG2  . LYS A 1 15 ? -19.485 12.124  3.270   1.00 0.00 ? 15 LYS A HG2  3  
ATOM 2721  H HG3  . LYS A 1 15 ? -18.877 13.754  2.970   1.00 0.00 ? 15 LYS A HG3  3  
ATOM 2722  H HD2  . LYS A 1 15 ? -21.574 13.468  4.190   1.00 0.00 ? 15 LYS A HD2  3  
ATOM 2723  H HD3  . LYS A 1 15 ? -20.166 13.128  5.200   1.00 0.00 ? 15 LYS A HD3  3  
ATOM 2724  H HE2  . LYS A 1 15 ? -19.272 15.382  4.355   1.00 0.00 ? 15 LYS A HE2  3  
ATOM 2725  H HE3  . LYS A 1 15 ? -20.927 15.687  3.827   1.00 0.00 ? 15 LYS A HE3  3  
ATOM 2726  H HZ1  . LYS A 1 15 ? -20.379 14.848  6.599   1.00 0.00 ? 15 LYS A HZ1  3  
ATOM 2727  H HZ2  . LYS A 1 15 ? -21.702 15.706  5.988   1.00 0.00 ? 15 LYS A HZ2  3  
ATOM 2728  H HZ3  . LYS A 1 15 ? -20.201 16.469  6.149   1.00 0.00 ? 15 LYS A HZ3  3  
ATOM 2729  N N    . LYS A 1 16 ? -20.396 15.771  -0.629  1.00 0.00 ? 16 LYS A N    3  
ATOM 2730  C CA   . LYS A 1 16 ? -20.405 15.983  -2.072  1.00 0.00 ? 16 LYS A CA   3  
ATOM 2731  C C    . LYS A 1 16 ? -19.188 15.334  -2.724  1.00 0.00 ? 16 LYS A C    3  
ATOM 2732  O O    . LYS A 1 16 ? -18.105 15.298  -2.143  1.00 0.00 ? 16 LYS A O    3  
ATOM 2733  C CB   . LYS A 1 16 ? -20.428 17.480  -2.388  1.00 0.00 ? 16 LYS A CB   3  
ATOM 2734  C CG   . LYS A 1 16 ? -20.609 17.786  -3.865  1.00 0.00 ? 16 LYS A CG   3  
ATOM 2735  C CD   . LYS A 1 16 ? -20.362 19.256  -4.164  1.00 0.00 ? 16 LYS A CD   3  
ATOM 2736  C CE   . LYS A 1 16 ? -21.637 20.074  -4.030  1.00 0.00 ? 16 LYS A CE   3  
ATOM 2737  N NZ   . LYS A 1 16 ? -21.352 21.531  -3.918  1.00 0.00 ? 16 LYS A NZ   3  
ATOM 2738  H H    . LYS A 1 16 ? -19.872 16.375  -0.061  1.00 0.00 ? 16 LYS A H    3  
ATOM 2739  H HA   . LYS A 1 16 ? -21.298 15.525  -2.469  1.00 0.00 ? 16 LYS A HA   3  
ATOM 2740  H HB2  . LYS A 1 16 ? -21.241 17.938  -1.845  1.00 0.00 ? 16 LYS A HB2  3  
ATOM 2741  H HB3  . LYS A 1 16 ? -19.496 17.919  -2.062  1.00 0.00 ? 16 LYS A HB3  3  
ATOM 2742  H HG2  . LYS A 1 16 ? -19.910 17.192  -4.435  1.00 0.00 ? 16 LYS A HG2  3  
ATOM 2743  H HG3  . LYS A 1 16 ? -21.619 17.534  -4.155  1.00 0.00 ? 16 LYS A HG3  3  
ATOM 2744  H HD2  . LYS A 1 16 ? -19.628 19.637  -3.469  1.00 0.00 ? 16 LYS A HD2  3  
ATOM 2745  H HD3  . LYS A 1 16 ? -19.987 19.351  -5.173  1.00 0.00 ? 16 LYS A HD3  3  
ATOM 2746  H HE2  . LYS A 1 16 ? -22.252 19.902  -4.900  1.00 0.00 ? 16 LYS A HE2  3  
ATOM 2747  H HE3  . LYS A 1 16 ? -22.165 19.750  -3.146  1.00 0.00 ? 16 LYS A HE3  3  
ATOM 2748  H HZ1  . LYS A 1 16 ? -20.536 21.688  -3.291  1.00 0.00 ? 16 LYS A HZ1  3  
ATOM 2749  H HZ2  . LYS A 1 16 ? -22.177 22.027  -3.525  1.00 0.00 ? 16 LYS A HZ2  3  
ATOM 2750  H HZ3  . LYS A 1 16 ? -21.136 21.927  -4.855  1.00 0.00 ? 16 LYS A HZ3  3  
ATOM 2751  N N    . GLY A 1 17 ? -19.375 14.822  -3.937  1.00 0.00 ? 17 GLY A N    3  
ATOM 2752  C CA   . GLY A 1 17 ? -18.284 14.182  -4.649  1.00 0.00 ? 17 GLY A CA   3  
ATOM 2753  C C    . GLY A 1 17 ? -17.610 13.102  -3.826  1.00 0.00 ? 17 GLY A C    3  
ATOM 2754  O O    . GLY A 1 17 ? -16.591 13.350  -3.180  1.00 0.00 ? 17 GLY A O    3  
ATOM 2755  H H    . GLY A 1 17 ? -20.261 14.879  -4.352  1.00 0.00 ? 17 GLY A H    3  
ATOM 2756  H HA2  . GLY A 1 17 ? -18.670 13.741  -5.556  1.00 0.00 ? 17 GLY A HA2  3  
ATOM 2757  H HA3  . GLY A 1 17 ? -17.550 14.931  -4.908  1.00 0.00 ? 17 GLY A HA3  3  
ATOM 2758  N N    . ARG A 1 18 ? -18.179 11.902  -3.848  1.00 0.00 ? 18 ARG A N    3  
ATOM 2759  C CA   . ARG A 1 18 ? -17.627 10.781  -3.096  1.00 0.00 ? 18 ARG A CA   3  
ATOM 2760  C C    . ARG A 1 18 ? -17.483 9.549   -3.985  1.00 0.00 ? 18 ARG A C    3  
ATOM 2761  O O    . ARG A 1 18 ? -18.475 8.934   -4.376  1.00 0.00 ? 18 ARG A O    3  
ATOM 2762  C CB   . ARG A 1 18 ? -18.519 10.456  -1.897  1.00 0.00 ? 18 ARG A CB   3  
ATOM 2763  C CG   . ARG A 1 18 ? -18.232 11.312  -0.674  1.00 0.00 ? 18 ARG A CG   3  
ATOM 2764  C CD   . ARG A 1 18 ? -16.914 10.927  -0.022  1.00 0.00 ? 18 ARG A CD   3  
ATOM 2765  N NE   . ARG A 1 18 ? -16.979 9.613   0.611   1.00 0.00 ? 18 ARG A NE   3  
ATOM 2766  C CZ   . ARG A 1 18 ? -17.525 9.397   1.802   1.00 0.00 ? 18 ARG A CZ   3  
ATOM 2767  N NH1  . ARG A 1 18 ? -18.050 10.403  2.487   1.00 0.00 ? 18 ARG A NH1  3  
ATOM 2768  N NH2  . ARG A 1 18 ? -17.546 8.171   2.311   1.00 0.00 ? 18 ARG A NH2  3  
ATOM 2769  H H    . ARG A 1 18 ? -18.989 11.766  -4.382  1.00 0.00 ? 18 ARG A H    3  
ATOM 2770  H HA   . ARG A 1 18 ? -16.650 11.069  -2.739  1.00 0.00 ? 18 ARG A HA   3  
ATOM 2771  H HB2  . ARG A 1 18 ? -19.551 10.605  -2.179  1.00 0.00 ? 18 ARG A HB2  3  
ATOM 2772  H HB3  . ARG A 1 18 ? -18.375 9.421   -1.626  1.00 0.00 ? 18 ARG A HB3  3  
ATOM 2773  H HG2  . ARG A 1 18 ? -18.183 12.348  -0.975  1.00 0.00 ? 18 ARG A HG2  3  
ATOM 2774  H HG3  . ARG A 1 18 ? -19.030 11.181  0.041   1.00 0.00 ? 18 ARG A HG3  3  
ATOM 2775  H HD2  . ARG A 1 18 ? -16.143 10.914  -0.778  1.00 0.00 ? 18 ARG A HD2  3  
ATOM 2776  H HD3  . ARG A 1 18 ? -16.670 11.665  0.728   1.00 0.00 ? 18 ARG A HD3  3  
ATOM 2777  H HE   . ARG A 1 18 ? -16.597 8.855   0.122   1.00 0.00 ? 18 ARG A HE   3  
ATOM 2778  H HH11 . ARG A 1 18 ? -18.036 11.327  2.106   1.00 0.00 ? 18 ARG A HH11 3  
ATOM 2779  H HH12 . ARG A 1 18 ? -18.461 10.238  3.384   1.00 0.00 ? 18 ARG A HH12 3  
ATOM 2780  H HH21 . ARG A 1 18 ? -17.152 7.410   1.798   1.00 0.00 ? 18 ARG A HH21 3  
ATOM 2781  H HH22 . ARG A 1 18 ? -17.957 8.010   3.208   1.00 0.00 ? 18 ARG A HH22 3  
ATOM 2782  N N    . ARG A 1 19 ? -16.241 9.194   -4.299  1.00 0.00 ? 19 ARG A N    3  
ATOM 2783  C CA   . ARG A 1 19 ? -15.967 8.037   -5.142  1.00 0.00 ? 19 ARG A CA   3  
ATOM 2784  C C    . ARG A 1 19 ? -14.954 7.109   -4.479  1.00 0.00 ? 19 ARG A C    3  
ATOM 2785  O O    . ARG A 1 19 ? -14.040 6.603   -5.130  1.00 0.00 ? 19 ARG A O    3  
ATOM 2786  C CB   . ARG A 1 19 ? -15.444 8.487   -6.508  1.00 0.00 ? 19 ARG A CB   3  
ATOM 2787  C CG   . ARG A 1 19 ? -14.194 9.348   -6.428  1.00 0.00 ? 19 ARG A CG   3  
ATOM 2788  C CD   . ARG A 1 19 ? -13.962 10.115  -7.720  1.00 0.00 ? 19 ARG A CD   3  
ATOM 2789  N NE   . ARG A 1 19 ? -13.281 9.302   -8.725  1.00 0.00 ? 19 ARG A NE   3  
ATOM 2790  C CZ   . ARG A 1 19 ? -12.606 9.812   -9.748  1.00 0.00 ? 19 ARG A CZ   3  
ATOM 2791  N NH1  . ARG A 1 19 ? -12.521 11.126  -9.902  1.00 0.00 ? 19 ARG A NH1  3  
ATOM 2792  N NH2  . ARG A 1 19 ? -12.013 9.007   -10.621 1.00 0.00 ? 19 ARG A NH2  3  
ATOM 2793  H H    . ARG A 1 19 ? -15.491 9.724   -3.956  1.00 0.00 ? 19 ARG A H    3  
ATOM 2794  H HA   . ARG A 1 19 ? -16.893 7.500   -5.280  1.00 0.00 ? 19 ARG A HA   3  
ATOM 2795  H HB2  . ARG A 1 19 ? -15.215 7.613   -7.099  1.00 0.00 ? 19 ARG A HB2  3  
ATOM 2796  H HB3  . ARG A 1 19 ? -16.215 9.056   -7.005  1.00 0.00 ? 19 ARG A HB3  3  
ATOM 2797  H HG2  . ARG A 1 19 ? -14.305 10.054  -5.618  1.00 0.00 ? 19 ARG A HG2  3  
ATOM 2798  H HG3  . ARG A 1 19 ? -13.342 8.712   -6.239  1.00 0.00 ? 19 ARG A HG3  3  
ATOM 2799  H HD2  . ARG A 1 19 ? -14.917 10.429  -8.113  1.00 0.00 ? 19 ARG A HD2  3  
ATOM 2800  H HD3  . ARG A 1 19 ? -13.358 10.984  -7.504  1.00 0.00 ? 19 ARG A HD3  3  
ATOM 2801  H HE   . ARG A 1 19 ? -13.331 8.328   -8.630  1.00 0.00 ? 19 ARG A HE   3  
ATOM 2802  H HH11 . ARG A 1 19 ? -12.966 11.735  -9.246  1.00 0.00 ? 19 ARG A HH11 3  
ATOM 2803  H HH12 . ARG A 1 19 ? -12.011 11.508  -10.673 1.00 0.00 ? 19 ARG A HH12 3  
ATOM 2804  H HH21 . ARG A 1 19 ? -12.075 8.016   -10.508 1.00 0.00 ? 19 ARG A HH21 3  
ATOM 2805  H HH22 . ARG A 1 19 ? -11.506 9.392   -11.391 1.00 0.00 ? 19 ARG A HH22 3  
ATOM 2806  N N    . SER A 1 20 ? -15.122 6.890   -3.178  1.00 0.00 ? 20 SER A N    3  
ATOM 2807  C CA   . SER A 1 20 ? -14.221 6.026   -2.425  1.00 0.00 ? 20 SER A CA   3  
ATOM 2808  C C    . SER A 1 20 ? -14.986 4.879   -1.773  1.00 0.00 ? 20 SER A C    3  
ATOM 2809  O O    . SER A 1 20 ? -15.998 5.093   -1.105  1.00 0.00 ? 20 SER A O    3  
ATOM 2810  C CB   . SER A 1 20 ? -13.481 6.833   -1.357  1.00 0.00 ? 20 SER A CB   3  
ATOM 2811  O OG   . SER A 1 20 ? -14.391 7.460   -0.469  1.00 0.00 ? 20 SER A OG   3  
ATOM 2812  H H    . SER A 1 20 ? -15.870 7.322   -2.714  1.00 0.00 ? 20 SER A H    3  
ATOM 2813  H HA   . SER A 1 20 ? -13.500 5.616   -3.117  1.00 0.00 ? 20 SER A HA   3  
ATOM 2814  H HB2  . SER A 1 20 ? -12.841 6.174   -0.790  1.00 0.00 ? 20 SER A HB2  3  
ATOM 2815  H HB3  . SER A 1 20 ? -12.881 7.594   -1.835  1.00 0.00 ? 20 SER A HB3  3  
ATOM 2816  H HG   . SER A 1 20 ? -14.091 7.341   0.435   1.00 0.00 ? 20 SER A HG   3  
ATOM 2817  N N    . ARG A 1 21 ? -14.495 3.660   -1.972  1.00 0.00 ? 21 ARG A N    3  
ATOM 2818  C CA   . ARG A 1 21 ? -15.132 2.478   -1.405  1.00 0.00 ? 21 ARG A CA   3  
ATOM 2819  C C    . ARG A 1 21 ? -14.123 1.634   -0.632  1.00 0.00 ? 21 ARG A C    3  
ATOM 2820  O O    . ARG A 1 21 ? -13.311 0.921   -1.223  1.00 0.00 ? 21 ARG A O    3  
ATOM 2821  C CB   . ARG A 1 21 ? -15.774 1.638   -2.511  1.00 0.00 ? 21 ARG A CB   3  
ATOM 2822  C CG   . ARG A 1 21 ? -16.661 0.520   -1.990  1.00 0.00 ? 21 ARG A CG   3  
ATOM 2823  C CD   . ARG A 1 21 ? -18.088 0.998   -1.767  1.00 0.00 ? 21 ARG A CD   3  
ATOM 2824  N NE   . ARG A 1 21 ? -19.044 -0.106  -1.784  1.00 0.00 ? 21 ARG A NE   3  
ATOM 2825  C CZ   . ARG A 1 21 ? -20.346 0.046   -1.567  1.00 0.00 ? 21 ARG A CZ   3  
ATOM 2826  N NH1  . ARG A 1 21 ? -20.843 1.249   -1.317  1.00 0.00 ? 21 ARG A NH1  3  
ATOM 2827  N NH2  . ARG A 1 21 ? -21.152 -1.007  -1.600  1.00 0.00 ? 21 ARG A NH2  3  
ATOM 2828  H H    . ARG A 1 21 ? -13.685 3.553   -2.514  1.00 0.00 ? 21 ARG A H    3  
ATOM 2829  H HA   . ARG A 1 21 ? -15.902 2.810   -0.725  1.00 0.00 ? 21 ARG A HA   3  
ATOM 2830  H HB2  . ARG A 1 21 ? -16.376 2.284   -3.134  1.00 0.00 ? 21 ARG A HB2  3  
ATOM 2831  H HB3  . ARG A 1 21 ? -14.993 1.198   -3.112  1.00 0.00 ? 21 ARG A HB3  3  
ATOM 2832  H HG2  . ARG A 1 21 ? -16.672 -0.285  -2.711  1.00 0.00 ? 21 ARG A HG2  3  
ATOM 2833  H HG3  . ARG A 1 21 ? -16.260 0.161   -1.054  1.00 0.00 ? 21 ARG A HG3  3  
ATOM 2834  H HD2  . ARG A 1 21 ? -18.141 1.492   -0.808  1.00 0.00 ? 21 ARG A HD2  3  
ATOM 2835  H HD3  . ARG A 1 21 ? -18.345 1.697   -2.548  1.00 0.00 ? 21 ARG A HD3  3  
ATOM 2836  H HE   . ARG A 1 21 ? -18.698 -1.004  -1.967  1.00 0.00 ? 21 ARG A HE   3  
ATOM 2837  H HH11 . ARG A 1 21 ? -20.238 2.044   -1.293  1.00 0.00 ? 21 ARG A HH11 3  
ATOM 2838  H HH12 . ARG A 1 21 ? -21.824 1.361   -1.155  1.00 0.00 ? 21 ARG A HH12 3  
ATOM 2839  H HH21 . ARG A 1 21 ? -20.781 -1.916  -1.788  1.00 0.00 ? 21 ARG A HH21 3  
ATOM 2840  H HH22 . ARG A 1 21 ? -22.131 -0.892  -1.436  1.00 0.00 ? 21 ARG A HH22 3  
ATOM 2841  N N    . THR A 1 22 ? -14.179 1.720   0.693   1.00 0.00 ? 22 THR A N    3  
ATOM 2842  C CA   . THR A 1 22 ? -13.270 0.966   1.547   1.00 0.00 ? 22 THR A CA   3  
ATOM 2843  C C    . THR A 1 22 ? -14.021 -0.083  2.359   1.00 0.00 ? 22 THR A C    3  
ATOM 2844  O O    . THR A 1 22 ? -14.989 0.230   3.053   1.00 0.00 ? 22 THR A O    3  
ATOM 2845  C CB   . THR A 1 22 ? -12.505 1.894   2.510   1.00 0.00 ? 22 THR A CB   3  
ATOM 2846  O OG1  . THR A 1 22 ? -13.427 2.594   3.352   1.00 0.00 ? 22 THR A OG1  3  
ATOM 2847  C CG2  . THR A 1 22 ? -11.655 2.892   1.738   1.00 0.00 ? 22 THR A CG2  3  
ATOM 2848  H H    . THR A 1 22 ? -14.848 2.305   1.105   1.00 0.00 ? 22 THR A H    3  
ATOM 2849  H HA   . THR A 1 22 ? -12.551 0.469   0.912   1.00 0.00 ? 22 THR A HA   3  
ATOM 2850  H HB   . THR A 1 22 ? -11.853 1.290   3.126   1.00 0.00 ? 22 THR A HB   3  
ATOM 2851  H HG1  . THR A 1 22 ? -14.242 2.754   2.870   1.00 0.00 ? 22 THR A HG1  3  
ATOM 2852  H HG21 . THR A 1 22 ? -11.307 2.437   0.823   1.00 0.00 ? 22 THR A HG21 3  
ATOM 2853  H HG22 . THR A 1 22 ? -10.808 3.185   2.340   1.00 0.00 ? 22 THR A HG22 3  
ATOM 2854  H HG23 . THR A 1 22 ? -12.249 3.763   1.503   1.00 0.00 ? 22 THR A HG23 3  
ATOM 2855  N N    . VAL A 1 23 ? -13.568 -1.330  2.270   1.00 0.00 ? 23 VAL A N    3  
ATOM 2856  C CA   . VAL A 1 23 ? -14.196 -2.425  2.999   1.00 0.00 ? 23 VAL A CA   3  
ATOM 2857  C C    . VAL A 1 23 ? -13.367 -2.823  4.215   1.00 0.00 ? 23 VAL A C    3  
ATOM 2858  O O    . VAL A 1 23 ? -13.250 -4.005  4.540   1.00 0.00 ? 23 VAL A O    3  
ATOM 2859  C CB   . VAL A 1 23 ? -14.391 -3.659  2.098   1.00 0.00 ? 23 VAL A CB   3  
ATOM 2860  C CG1  . VAL A 1 23 ? -15.607 -4.458  2.542   1.00 0.00 ? 23 VAL A CG1  3  
ATOM 2861  C CG2  . VAL A 1 23 ? -14.522 -3.240  0.642   1.00 0.00 ? 23 VAL A CG2  3  
ATOM 2862  H H    . VAL A 1 23 ? -12.792 -1.517  1.701   1.00 0.00 ? 23 VAL A H    3  
ATOM 2863  H HA   . VAL A 1 23 ? -15.168 -2.091  3.331   1.00 0.00 ? 23 VAL A HA   3  
ATOM 2864  H HB   . VAL A 1 23 ? -13.520 -4.290  2.193   1.00 0.00 ? 23 VAL A HB   3  
ATOM 2865  H HG11 . VAL A 1 23 ? -16.463 -4.169  1.950   1.00 0.00 ? 23 VAL A HG11 3  
ATOM 2866  H HG12 . VAL A 1 23 ? -15.415 -5.512  2.409   1.00 0.00 ? 23 VAL A HG12 3  
ATOM 2867  H HG13 . VAL A 1 23 ? -15.808 -4.257  3.585   1.00 0.00 ? 23 VAL A HG13 3  
ATOM 2868  H HG21 . VAL A 1 23 ? -13.538 -3.127  0.211   1.00 0.00 ? 23 VAL A HG21 3  
ATOM 2869  H HG22 . VAL A 1 23 ? -15.068 -3.996  0.096   1.00 0.00 ? 23 VAL A HG22 3  
ATOM 2870  H HG23 . VAL A 1 23 ? -15.051 -2.301  0.583   1.00 0.00 ? 23 VAL A HG23 3  
ATOM 2871  N N    . PHE A 1 24 ? -12.794 -1.828  4.884   1.00 0.00 ? 24 PHE A N    3  
ATOM 2872  C CA   . PHE A 1 24 ? -11.975 -2.074  6.066   1.00 0.00 ? 24 PHE A CA   3  
ATOM 2873  C C    . PHE A 1 24 ? -12.687 -1.601  7.329   1.00 0.00 ? 24 PHE A C    3  
ATOM 2874  O O    . PHE A 1 24 ? -13.295 -0.530  7.350   1.00 0.00 ? 24 PHE A O    3  
ATOM 2875  C CB   . PHE A 1 24 ? -10.625 -1.367  5.932   1.00 0.00 ? 24 PHE A CB   3  
ATOM 2876  C CG   . PHE A 1 24 ? -9.837  -1.801  4.729   1.00 0.00 ? 24 PHE A CG   3  
ATOM 2877  C CD1  . PHE A 1 24 ? -9.017  -2.917  4.788   1.00 0.00 ? 24 PHE A CD1  3  
ATOM 2878  C CD2  . PHE A 1 24 ? -9.916  -1.094  3.540   1.00 0.00 ? 24 PHE A CD2  3  
ATOM 2879  C CE1  . PHE A 1 24 ? -8.291  -3.318  3.682   1.00 0.00 ? 24 PHE A CE1  3  
ATOM 2880  C CE2  . PHE A 1 24 ? -9.192  -1.491  2.432   1.00 0.00 ? 24 PHE A CE2  3  
ATOM 2881  C CZ   . PHE A 1 24 ? -8.379  -2.605  2.503   1.00 0.00 ? 24 PHE A CZ   3  
ATOM 2882  H H    . PHE A 1 24 ? -12.925 -0.907  4.576   1.00 0.00 ? 24 PHE A H    3  
ATOM 2883  H HA   . PHE A 1 24 ? -11.809 -3.138  6.137   1.00 0.00 ? 24 PHE A HA   3  
ATOM 2884  H HB2  . PHE A 1 24 ? -10.790 -0.303  5.853   1.00 0.00 ? 24 PHE A HB2  3  
ATOM 2885  H HB3  . PHE A 1 24 ? -10.031 -1.571  6.811   1.00 0.00 ? 24 PHE A HB3  3  
ATOM 2886  H HD1  . PHE A 1 24 ? -8.948  -3.476  5.709   1.00 0.00 ? 24 PHE A HD1  3  
ATOM 2887  H HD2  . PHE A 1 24 ? -10.553 -0.222  3.484   1.00 0.00 ? 24 PHE A HD2  3  
ATOM 2888  H HE1  . PHE A 1 24 ? -7.656  -4.190  3.740   1.00 0.00 ? 24 PHE A HE1  3  
ATOM 2889  H HE2  . PHE A 1 24 ? -9.264  -0.931  1.511   1.00 0.00 ? 24 PHE A HE2  3  
ATOM 2890  H HZ   . PHE A 1 24 ? -7.812  -2.917  1.638   1.00 0.00 ? 24 PHE A HZ   3  
ATOM 2891  N N    . THR A 1 25 ? -12.608 -2.407  8.383   1.00 0.00 ? 25 THR A N    3  
ATOM 2892  C CA   . THR A 1 25 ? -13.245 -2.073  9.651   1.00 0.00 ? 25 THR A CA   3  
ATOM 2893  C C    . THR A 1 25 ? -12.342 -1.191  10.505  1.00 0.00 ? 25 THR A C    3  
ATOM 2894  O O    . THR A 1 25 ? -11.118 -1.252  10.396  1.00 0.00 ? 25 THR A O    3  
ATOM 2895  C CB   . THR A 1 25 ? -13.608 -3.340  10.448  1.00 0.00 ? 25 THR A CB   3  
ATOM 2896  O OG1  . THR A 1 25 ? -12.458 -3.824  11.150  1.00 0.00 ? 25 THR A OG1  3  
ATOM 2897  C CG2  . THR A 1 25 ? -14.139 -4.427  9.525   1.00 0.00 ? 25 THR A CG2  3  
ATOM 2898  H H    . THR A 1 25 ? -12.109 -3.247  8.305   1.00 0.00 ? 25 THR A H    3  
ATOM 2899  H HA   . THR A 1 25 ? -14.157 -1.536  9.434   1.00 0.00 ? 25 THR A HA   3  
ATOM 2900  H HB   . THR A 1 25 ? -14.378 -3.089  11.164  1.00 0.00 ? 25 THR A HB   3  
ATOM 2901  H HG1  . THR A 1 25 ? -12.629 -3.807  12.095  1.00 0.00 ? 25 THR A HG1  3  
ATOM 2902  H HG21 . THR A 1 25 ? -14.429 -3.988  8.582   1.00 0.00 ? 25 THR A HG21 3  
ATOM 2903  H HG22 . THR A 1 25 ? -14.996 -4.900  9.981   1.00 0.00 ? 25 THR A HG22 3  
ATOM 2904  H HG23 . THR A 1 25 ? -13.369 -5.164  9.357   1.00 0.00 ? 25 THR A HG23 3  
ATOM 2905  N N    . GLU A 1 26 ? -12.954 -0.372  11.354  1.00 0.00 ? 26 GLU A N    3  
ATOM 2906  C CA   . GLU A 1 26 ? -12.203 0.523   12.227  1.00 0.00 ? 26 GLU A CA   3  
ATOM 2907  C C    . GLU A 1 26 ? -10.929 -0.150  12.730  1.00 0.00 ? 26 GLU A C    3  
ATOM 2908  O O    . GLU A 1 26 ? -9.882  0.488   12.849  1.00 0.00 ? 26 GLU A O    3  
ATOM 2909  C CB   . GLU A 1 26 ? -13.066 0.958   13.413  1.00 0.00 ? 26 GLU A CB   3  
ATOM 2910  C CG   . GLU A 1 26 ? -14.340 1.680   13.007  1.00 0.00 ? 26 GLU A CG   3  
ATOM 2911  C CD   . GLU A 1 26 ? -15.059 2.304   14.187  1.00 0.00 ? 26 GLU A CD   3  
ATOM 2912  O OE1  . GLU A 1 26 ? -14.487 3.222   14.812  1.00 0.00 ? 26 GLU A OE1  3  
ATOM 2913  O OE2  . GLU A 1 26 ? -16.192 1.875   14.487  1.00 0.00 ? 26 GLU A OE2  3  
ATOM 2914  H H    . GLU A 1 26 ? -13.933 -0.369  11.395  1.00 0.00 ? 26 GLU A H    3  
ATOM 2915  H HA   . GLU A 1 26 ? -11.932 1.396   11.652  1.00 0.00 ? 26 GLU A HA   3  
ATOM 2916  H HB2  . GLU A 1 26 ? -13.339 0.083   13.984  1.00 0.00 ? 26 GLU A HB2  3  
ATOM 2917  H HB3  . GLU A 1 26 ? -12.487 1.620   14.040  1.00 0.00 ? 26 GLU A HB3  3  
ATOM 2918  H HG2  . GLU A 1 26 ? -14.088 2.461   12.305  1.00 0.00 ? 26 GLU A HG2  3  
ATOM 2919  H HG3  . GLU A 1 26 ? -15.004 0.973   12.532  1.00 0.00 ? 26 GLU A HG3  3  
ATOM 2920  N N    . LEU A 1 27 ? -11.027 -1.441  13.024  1.00 0.00 ? 27 LEU A N    3  
ATOM 2921  C CA   . LEU A 1 27 ? -9.883  -2.202  13.516  1.00 0.00 ? 27 LEU A CA   3  
ATOM 2922  C C    . LEU A 1 27 ? -8.805  -2.319  12.443  1.00 0.00 ? 27 LEU A C    3  
ATOM 2923  O O    . LEU A 1 27 ? -7.712  -1.773  12.587  1.00 0.00 ? 27 LEU A O    3  
ATOM 2924  C CB   . LEU A 1 27 ? -10.327 -3.596  13.963  1.00 0.00 ? 27 LEU A CB   3  
ATOM 2925  C CG   . LEU A 1 27 ? -9.450  -4.275  15.015  1.00 0.00 ? 27 LEU A CG   3  
ATOM 2926  C CD1  . LEU A 1 27 ? -9.839  -3.815  16.412  1.00 0.00 ? 27 LEU A CD1  3  
ATOM 2927  C CD2  . LEU A 1 27 ? -9.555  -5.788  14.902  1.00 0.00 ? 27 LEU A CD2  3  
ATOM 2928  H H    . LEU A 1 27 ? -11.887 -1.895  12.909  1.00 0.00 ? 27 LEU A H    3  
ATOM 2929  H HA   . LEU A 1 27 ? -9.474  -1.674  14.364  1.00 0.00 ? 27 LEU A HA   3  
ATOM 2930  H HB2  . LEU A 1 27 ? -11.324 -3.512  14.368  1.00 0.00 ? 27 LEU A HB2  3  
ATOM 2931  H HB3  . LEU A 1 27 ? -10.348 -4.232  13.089  1.00 0.00 ? 27 LEU A HB3  3  
ATOM 2932  H HG   . LEU A 1 27 ? -8.418  -3.996  14.849  1.00 0.00 ? 27 LEU A HG   3  
ATOM 2933  H HD11 . LEU A 1 27 ? -9.688  -4.622  17.112  1.00 0.00 ? 27 LEU A HD11 3  
ATOM 2934  H HD12 . LEU A 1 27 ? -10.879 -3.523  16.418  1.00 0.00 ? 27 LEU A HD12 3  
ATOM 2935  H HD13 . LEU A 1 27 ? -9.228  -2.970  16.696  1.00 0.00 ? 27 LEU A HD13 3  
ATOM 2936  H HD21 . LEU A 1 27 ? -9.148  -6.107  13.953  1.00 0.00 ? 27 LEU A HD21 3  
ATOM 2937  H HD22 . LEU A 1 27 ? -10.592 -6.083  14.966  1.00 0.00 ? 27 LEU A HD22 3  
ATOM 2938  H HD23 . LEU A 1 27 ? -8.999  -6.249  15.705  1.00 0.00 ? 27 LEU A HD23 3  
ATOM 2939  N N    . GLN A 1 28 ? -9.123  -3.033  11.367  1.00 0.00 ? 28 GLN A N    3  
ATOM 2940  C CA   . GLN A 1 28 ? -8.182  -3.219  10.269  1.00 0.00 ? 28 GLN A CA   3  
ATOM 2941  C C    . GLN A 1 28 ? -7.543  -1.893  9.869   1.00 0.00 ? 28 GLN A C    3  
ATOM 2942  O O    . GLN A 1 28 ? -6.356  -1.837  9.546   1.00 0.00 ? 28 GLN A O    3  
ATOM 2943  C CB   . GLN A 1 28 ? -8.888  -3.843  9.065   1.00 0.00 ? 28 GLN A CB   3  
ATOM 2944  C CG   . GLN A 1 28 ? -9.577  -5.162  9.379   1.00 0.00 ? 28 GLN A CG   3  
ATOM 2945  C CD   . GLN A 1 28 ? -10.459 -5.644  8.244   1.00 0.00 ? 28 GLN A CD   3  
ATOM 2946  O OE1  . GLN A 1 28 ? -11.016 -4.844  7.492   1.00 0.00 ? 28 GLN A OE1  3  
ATOM 2947  N NE2  . GLN A 1 28 ? -10.591 -6.959  8.115   1.00 0.00 ? 28 GLN A NE2  3  
ATOM 2948  H H    . GLN A 1 28 ? -10.010 -3.443  11.311  1.00 0.00 ? 28 GLN A H    3  
ATOM 2949  H HA   . GLN A 1 28 ? -7.407  -3.890  10.608  1.00 0.00 ? 28 GLN A HA   3  
ATOM 2950  H HB2  . GLN A 1 28 ? -9.632  -3.151  8.700   1.00 0.00 ? 28 GLN A HB2  3  
ATOM 2951  H HB3  . GLN A 1 28 ? -8.159  -4.020  8.287   1.00 0.00 ? 28 GLN A HB3  3  
ATOM 2952  H HG2  . GLN A 1 28 ? -8.823  -5.910  9.571   1.00 0.00 ? 28 GLN A HG2  3  
ATOM 2953  H HG3  . GLN A 1 28 ? -10.187 -5.032  10.261  1.00 0.00 ? 28 GLN A HG3  3  
ATOM 2954  H HE21 . GLN A 1 28 ? -10.119 -7.536  8.752   1.00 0.00 ? 28 GLN A HE21 3  
ATOM 2955  H HE22 . GLN A 1 28 ? -11.156 -7.299  7.391   1.00 0.00 ? 28 GLN A HE22 3  
ATOM 2956  N N    . LEU A 1 29 ? -8.338  -0.829  9.890   1.00 0.00 ? 29 LEU A N    3  
ATOM 2957  C CA   . LEU A 1 29 ? -7.850  0.497   9.529   1.00 0.00 ? 29 LEU A CA   3  
ATOM 2958  C C    . LEU A 1 29 ? -6.906  1.040   10.597  1.00 0.00 ? 29 LEU A C    3  
ATOM 2959  O O    . LEU A 1 29 ? -5.884  1.650   10.283  1.00 0.00 ? 29 LEU A O    3  
ATOM 2960  C CB   . LEU A 1 29 ? -9.024  1.458   9.335   1.00 0.00 ? 29 LEU A CB   3  
ATOM 2961  C CG   . LEU A 1 29 ? -9.830  1.282   8.047   1.00 0.00 ? 29 LEU A CG   3  
ATOM 2962  C CD1  . LEU A 1 29 ? -11.052 2.187   8.054   1.00 0.00 ? 29 LEU A CD1  3  
ATOM 2963  C CD2  . LEU A 1 29 ? -8.960  1.567   6.831   1.00 0.00 ? 29 LEU A CD2  3  
ATOM 2964  H H    . LEU A 1 29 ? -9.274  -0.937  10.156  1.00 0.00 ? 29 LEU A H    3  
ATOM 2965  H HA   . LEU A 1 29 ? -7.310  0.409   8.598   1.00 0.00 ? 29 LEU A HA   3  
ATOM 2966  H HB2  . LEU A 1 29 ? -9.699  1.328   10.167  1.00 0.00 ? 29 LEU A HB2  3  
ATOM 2967  H HB3  . LEU A 1 29 ? -8.632  2.465   9.346   1.00 0.00 ? 29 LEU A HB3  3  
ATOM 2968  H HG   . LEU A 1 29 ? -10.173 0.259   7.981   1.00 0.00 ? 29 LEU A HG   3  
ATOM 2969  H HD11 . LEU A 1 29 ? -11.924 1.617   7.771   1.00 0.00 ? 29 LEU A HD11 3  
ATOM 2970  H HD12 . LEU A 1 29 ? -10.906 2.994   7.351   1.00 0.00 ? 29 LEU A HD12 3  
ATOM 2971  H HD13 . LEU A 1 29 ? -11.193 2.594   9.044   1.00 0.00 ? 29 LEU A HD13 3  
ATOM 2972  H HD21 . LEU A 1 29 ? -9.590  1.774   5.979   1.00 0.00 ? 29 LEU A HD21 3  
ATOM 2973  H HD22 . LEU A 1 29 ? -8.343  0.705   6.621   1.00 0.00 ? 29 LEU A HD22 3  
ATOM 2974  H HD23 . LEU A 1 29 ? -8.331  2.421   7.030   1.00 0.00 ? 29 LEU A HD23 3  
ATOM 2975  N N    . MET A 1 30 ? -7.254  0.811   11.859  1.00 0.00 ? 30 MET A N    3  
ATOM 2976  C CA   . MET A 1 30 ? -6.434  1.275   12.973  1.00 0.00 ? 30 MET A CA   3  
ATOM 2977  C C    . MET A 1 30 ? -5.059  0.616   12.947  1.00 0.00 ? 30 MET A C    3  
ATOM 2978  O O    . MET A 1 30 ? -4.051  1.249   13.261  1.00 0.00 ? 30 MET A O    3  
ATOM 2979  C CB   . MET A 1 30 ? -7.130  0.978   14.303  1.00 0.00 ? 30 MET A CB   3  
ATOM 2980  C CG   . MET A 1 30 ? -6.311  1.379   15.519  1.00 0.00 ? 30 MET A CG   3  
ATOM 2981  S SD   . MET A 1 30 ? -7.339  1.811   16.936  1.00 0.00 ? 30 MET A SD   3  
ATOM 2982  C CE   . MET A 1 30 ? -7.130  0.358   17.962  1.00 0.00 ? 30 MET A CE   3  
ATOM 2983  H H    . MET A 1 30 ? -8.080  0.319   12.046  1.00 0.00 ? 30 MET A H    3  
ATOM 2984  H HA   . MET A 1 30 ? -6.312  2.342   12.872  1.00 0.00 ? 30 MET A HA   3  
ATOM 2985  H HB2  . MET A 1 30 ? -8.067  1.513   14.333  1.00 0.00 ? 30 MET A HB2  3  
ATOM 2986  H HB3  . MET A 1 30 ? -7.327  -0.082  14.364  1.00 0.00 ? 30 MET A HB3  3  
ATOM 2987  H HG2  . MET A 1 30 ? -5.672  0.554   15.795  1.00 0.00 ? 30 MET A HG2  3  
ATOM 2988  H HG3  . MET A 1 30 ? -5.702  2.233   15.260  1.00 0.00 ? 30 MET A HG3  3  
ATOM 2989  H HE1  . MET A 1 30 ? -7.949  -0.325  17.791  1.00 0.00 ? 30 MET A HE1  3  
ATOM 2990  H HE2  . MET A 1 30 ? -6.198  -0.128  17.711  1.00 0.00 ? 30 MET A HE2  3  
ATOM 2991  H HE3  . MET A 1 30 ? -7.116  0.650   19.002  1.00 0.00 ? 30 MET A HE3  3  
ATOM 2992  N N    . GLY A 1 31 ? -5.024  -0.658  12.570  1.00 0.00 ? 31 GLY A N    3  
ATOM 2993  C CA   . GLY A 1 31 ? -3.767  -1.381  12.510  1.00 0.00 ? 31 GLY A CA   3  
ATOM 2994  C C    . GLY A 1 31 ? -3.009  -1.119  11.224  1.00 0.00 ? 31 GLY A C    3  
ATOM 2995  O O    . GLY A 1 31 ? -1.784  -0.987  11.232  1.00 0.00 ? 31 GLY A O    3  
ATOM 2996  H H    . GLY A 1 31 ? -5.860  -1.112  12.330  1.00 0.00 ? 31 GLY A H    3  
ATOM 2997  H HA2  . GLY A 1 31 ? -3.152  -1.081  13.346  1.00 0.00 ? 31 GLY A HA2  3  
ATOM 2998  H HA3  . GLY A 1 31 ? -3.969  -2.439  12.586  1.00 0.00 ? 31 GLY A HA3  3  
ATOM 2999  N N    . LEU A 1 32 ? -3.736  -1.046  10.115  1.00 0.00 ? 32 LEU A N    3  
ATOM 3000  C CA   . LEU A 1 32 ? -3.124  -0.800  8.813   1.00 0.00 ? 32 LEU A CA   3  
ATOM 3001  C C    . LEU A 1 32 ? -2.343  0.511   8.818   1.00 0.00 ? 32 LEU A C    3  
ATOM 3002  O O    . LEU A 1 32 ? -1.211  0.571   8.340   1.00 0.00 ? 32 LEU A O    3  
ATOM 3003  C CB   . LEU A 1 32 ? -4.195  -0.765  7.722   1.00 0.00 ? 32 LEU A CB   3  
ATOM 3004  C CG   . LEU A 1 32 ? -4.596  -2.117  7.132   1.00 0.00 ? 32 LEU A CG   3  
ATOM 3005  C CD1  . LEU A 1 32 ? -5.839  -1.976  6.268   1.00 0.00 ? 32 LEU A CD1  3  
ATOM 3006  C CD2  . LEU A 1 32 ? -3.448  -2.708  6.325   1.00 0.00 ? 32 LEU A CD2  3  
ATOM 3007  H H    . LEU A 1 32 ? -4.707  -1.159  10.171  1.00 0.00 ? 32 LEU A H    3  
ATOM 3008  H HA   . LEU A 1 32 ? -2.440  -1.611  8.610   1.00 0.00 ? 32 LEU A HA   3  
ATOM 3009  H HB2  . LEU A 1 32 ? -5.080  -0.313  8.142   1.00 0.00 ? 32 LEU A HB2  3  
ATOM 3010  H HB3  . LEU A 1 32 ? -3.825  -0.147  6.916   1.00 0.00 ? 32 LEU A HB3  3  
ATOM 3011  H HG   . LEU A 1 32 ? -4.826  -2.801  7.937   1.00 0.00 ? 32 LEU A HG   3  
ATOM 3012  H HD11 . LEU A 1 32 ? -5.883  -2.792  5.563   1.00 0.00 ? 32 LEU A HD11 3  
ATOM 3013  H HD12 . LEU A 1 32 ? -5.800  -1.039  5.731   1.00 0.00 ? 32 LEU A HD12 3  
ATOM 3014  H HD13 . LEU A 1 32 ? -6.718  -1.993  6.896   1.00 0.00 ? 32 LEU A HD13 3  
ATOM 3015  H HD21 . LEU A 1 32 ? -2.548  -2.142  6.513   1.00 0.00 ? 32 LEU A HD21 3  
ATOM 3016  H HD22 . LEU A 1 32 ? -3.688  -2.664  5.273   1.00 0.00 ? 32 LEU A HD22 3  
ATOM 3017  H HD23 . LEU A 1 32 ? -3.295  -3.736  6.618   1.00 0.00 ? 32 LEU A HD23 3  
ATOM 3018  N N    . GLU A 1 33 ? -2.957  1.557   9.362   1.00 0.00 ? 33 GLU A N    3  
ATOM 3019  C CA   . GLU A 1 33 ? -2.318  2.866   9.430   1.00 0.00 ? 33 GLU A CA   3  
ATOM 3020  C C    . GLU A 1 33 ? -1.083  2.824   10.326  1.00 0.00 ? 33 GLU A C    3  
ATOM 3021  O O    . GLU A 1 33 ? -0.044  3.397   9.999   1.00 0.00 ? 33 GLU A O    3  
ATOM 3022  C CB   . GLU A 1 33 ? -3.304  3.913   9.951   1.00 0.00 ? 33 GLU A CB   3  
ATOM 3023  C CG   . GLU A 1 33 ? -4.378  4.292   8.945   1.00 0.00 ? 33 GLU A CG   3  
ATOM 3024  C CD   . GLU A 1 33 ? -5.284  5.400   9.447   1.00 0.00 ? 33 GLU A CD   3  
ATOM 3025  O OE1  . GLU A 1 33 ? -6.200  5.101   10.241  1.00 0.00 ? 33 GLU A OE1  3  
ATOM 3026  O OE2  . GLU A 1 33 ? -5.076  6.564   9.047   1.00 0.00 ? 33 GLU A OE2  3  
ATOM 3027  H H    . GLU A 1 33 ? -3.859  1.446   9.727   1.00 0.00 ? 33 GLU A H    3  
ATOM 3028  H HA   . GLU A 1 33 ? -2.013  3.138   8.431   1.00 0.00 ? 33 GLU A HA   3  
ATOM 3029  H HB2  . GLU A 1 33 ? -3.789  3.526   10.835  1.00 0.00 ? 33 GLU A HB2  3  
ATOM 3030  H HB3  . GLU A 1 33 ? -2.756  4.806   10.214  1.00 0.00 ? 33 GLU A HB3  3  
ATOM 3031  H HG2  . GLU A 1 33 ? -3.900  4.624   8.035   1.00 0.00 ? 33 GLU A HG2  3  
ATOM 3032  H HG3  . GLU A 1 33 ? -4.981  3.421   8.736   1.00 0.00 ? 33 GLU A HG3  3  
ATOM 3033  N N    . LYS A 1 34 ? -1.205  2.141   11.459  1.00 0.00 ? 34 LYS A N    3  
ATOM 3034  C CA   . LYS A 1 34 ? -0.101  2.021   12.404  1.00 0.00 ? 34 LYS A CA   3  
ATOM 3035  C C    . LYS A 1 34 ? 1.133   1.435   11.727  1.00 0.00 ? 34 LYS A C    3  
ATOM 3036  O O    . LYS A 1 34 ? 2.218   2.015   11.783  1.00 0.00 ? 34 LYS A O    3  
ATOM 3037  C CB   . LYS A 1 34 ? -0.510  1.145   13.590  1.00 0.00 ? 34 LYS A CB   3  
ATOM 3038  C CG   . LYS A 1 34 ? 0.292   1.415   14.851  1.00 0.00 ? 34 LYS A CG   3  
ATOM 3039  C CD   . LYS A 1 34 ? -0.330  2.527   15.679  1.00 0.00 ? 34 LYS A CD   3  
ATOM 3040  C CE   . LYS A 1 34 ? -1.342  1.981   16.676  1.00 0.00 ? 34 LYS A CE   3  
ATOM 3041  N NZ   . LYS A 1 34 ? -2.688  1.810   16.062  1.00 0.00 ? 34 LYS A NZ   3  
ATOM 3042  H H    . LYS A 1 34 ? -2.060  1.705   11.664  1.00 0.00 ? 34 LYS A H    3  
ATOM 3043  H HA   . LYS A 1 34 ? 0.136   3.011   12.764  1.00 0.00 ? 34 LYS A HA   3  
ATOM 3044  H HB2  . LYS A 1 34 ? -1.554  1.318   13.807  1.00 0.00 ? 34 LYS A HB2  3  
ATOM 3045  H HB3  . LYS A 1 34 ? -0.376  0.107   13.318  1.00 0.00 ? 34 LYS A HB3  3  
ATOM 3046  H HG2  . LYS A 1 34 ? 0.326   0.514   15.445  1.00 0.00 ? 34 LYS A HG2  3  
ATOM 3047  H HG3  . LYS A 1 34 ? 1.295   1.704   14.573  1.00 0.00 ? 34 LYS A HG3  3  
ATOM 3048  H HD2  . LYS A 1 34 ? 0.450   3.041   16.221  1.00 0.00 ? 34 LYS A HD2  3  
ATOM 3049  H HD3  . LYS A 1 34 ? -0.829  3.222   15.018  1.00 0.00 ? 34 LYS A HD3  3  
ATOM 3050  H HE2  . LYS A 1 34 ? -0.994  1.024   17.033  1.00 0.00 ? 34 LYS A HE2  3  
ATOM 3051  H HE3  . LYS A 1 34 ? -1.418  2.669   17.504  1.00 0.00 ? 34 LYS A HE3  3  
ATOM 3052  H HZ1  . LYS A 1 34 ? -2.726  0.917   15.530  1.00 0.00 ? 34 LYS A HZ1  3  
ATOM 3053  H HZ2  . LYS A 1 34 ? -2.887  2.596   15.412  1.00 0.00 ? 34 LYS A HZ2  3  
ATOM 3054  H HZ3  . LYS A 1 34 ? -3.418  1.792   16.802  1.00 0.00 ? 34 LYS A HZ3  3  
ATOM 3055  N N    . ARG A 1 35 ? 0.961   0.284   11.086  1.00 0.00 ? 35 ARG A N    3  
ATOM 3056  C CA   . ARG A 1 35 ? 2.061   -0.380  10.398  1.00 0.00 ? 35 ARG A CA   3  
ATOM 3057  C C    . ARG A 1 35 ? 2.530   0.443   9.201   1.00 0.00 ? 35 ARG A C    3  
ATOM 3058  O O    . ARG A 1 35 ? 3.672   0.902   9.159   1.00 0.00 ? 35 ARG A O    3  
ATOM 3059  C CB   . ARG A 1 35 ? 1.634   -1.775  9.935   1.00 0.00 ? 35 ARG A CB   3  
ATOM 3060  C CG   . ARG A 1 35 ? 1.854   -2.857  10.980  1.00 0.00 ? 35 ARG A CG   3  
ATOM 3061  C CD   . ARG A 1 35 ? 1.076   -2.568  12.253  1.00 0.00 ? 35 ARG A CD   3  
ATOM 3062  N NE   . ARG A 1 35 ? 1.138   -3.681  13.197  1.00 0.00 ? 35 ARG A NE   3  
ATOM 3063  C CZ   . ARG A 1 35 ? 2.191   -3.933  13.967  1.00 0.00 ? 35 ARG A CZ   3  
ATOM 3064  N NH1  . ARG A 1 35 ? 3.264   -3.156  13.905  1.00 0.00 ? 35 ARG A NH1  3  
ATOM 3065  N NH2  . ARG A 1 35 ? 2.173   -4.965  14.801  1.00 0.00 ? 35 ARG A NH2  3  
ATOM 3066  H H    . ARG A 1 35 ? 0.072   -0.130  11.076  1.00 0.00 ? 35 ARG A H    3  
ATOM 3067  H HA   . ARG A 1 35 ? 2.879   -0.477  11.096  1.00 0.00 ? 35 ARG A HA   3  
ATOM 3068  H HB2  . ARG A 1 35 ? 0.583   -1.753  9.687   1.00 0.00 ? 35 ARG A HB2  3  
ATOM 3069  H HB3  . ARG A 1 35 ? 2.199   -2.036  9.053   1.00 0.00 ? 35 ARG A HB3  3  
ATOM 3070  H HG2  . ARG A 1 35 ? 1.526   -3.804  10.578  1.00 0.00 ? 35 ARG A HG2  3  
ATOM 3071  H HG3  . ARG A 1 35 ? 2.907   -2.908  11.215  1.00 0.00 ? 35 ARG A HG3  3  
ATOM 3072  H HD2  . ARG A 1 35 ? 1.491   -1.688  12.721  1.00 0.00 ? 35 ARG A HD2  3  
ATOM 3073  H HD3  . ARG A 1 35 ? 0.044   -2.385  11.995  1.00 0.00 ? 35 ARG A HD3  3  
ATOM 3074  H HE   . ARG A 1 35 ? 0.357   -4.268  13.260  1.00 0.00 ? 35 ARG A HE   3  
ATOM 3075  H HH11 . ARG A 1 35 ? 3.280   -2.377  13.278  1.00 0.00 ? 35 ARG A HH11 3  
ATOM 3076  H HH12 . ARG A 1 35 ? 4.055   -3.347  14.486  1.00 0.00 ? 35 ARG A HH12 3  
ATOM 3077  H HH21 . ARG A 1 35 ? 1.366   -5.553  14.851  1.00 0.00 ? 35 ARG A HH21 3  
ATOM 3078  H HH22 . ARG A 1 35 ? 2.966   -5.154  15.380  1.00 0.00 ? 35 ARG A HH22 3  
ATOM 3079  N N    . PHE A 1 36 ? 1.641   0.625   8.231   1.00 0.00 ? 36 PHE A N    3  
ATOM 3080  C CA   . PHE A 1 36 ? 1.964   1.392   7.033   1.00 0.00 ? 36 PHE A CA   3  
ATOM 3081  C C    . PHE A 1 36 ? 2.810   2.613   7.380   1.00 0.00 ? 36 PHE A C    3  
ATOM 3082  O O    . PHE A 1 36 ? 3.761   2.943   6.672   1.00 0.00 ? 36 PHE A O    3  
ATOM 3083  C CB   . PHE A 1 36 ? 0.682   1.831   6.321   1.00 0.00 ? 36 PHE A CB   3  
ATOM 3084  C CG   . PHE A 1 36 ? 0.929   2.702   5.123   1.00 0.00 ? 36 PHE A CG   3  
ATOM 3085  C CD1  . PHE A 1 36 ? 1.450   3.977   5.274   1.00 0.00 ? 36 PHE A CD1  3  
ATOM 3086  C CD2  . PHE A 1 36 ? 0.642   2.246   3.847   1.00 0.00 ? 36 PHE A CD2  3  
ATOM 3087  C CE1  . PHE A 1 36 ? 1.678   4.781   4.173   1.00 0.00 ? 36 PHE A CE1  3  
ATOM 3088  C CE2  . PHE A 1 36 ? 0.868   3.045   2.742   1.00 0.00 ? 36 PHE A CE2  3  
ATOM 3089  C CZ   . PHE A 1 36 ? 1.388   4.314   2.906   1.00 0.00 ? 36 PHE A CZ   3  
ATOM 3090  H H    . PHE A 1 36 ? 0.746   0.235   8.322   1.00 0.00 ? 36 PHE A H    3  
ATOM 3091  H HA   . PHE A 1 36 ? 2.530   0.752   6.374   1.00 0.00 ? 36 PHE A HA   3  
ATOM 3092  H HB2  . PHE A 1 36 ? 0.145   0.955   5.989   1.00 0.00 ? 36 PHE A HB2  3  
ATOM 3093  H HB3  . PHE A 1 36 ? 0.066   2.384   7.014   1.00 0.00 ? 36 PHE A HB3  3  
ATOM 3094  H HD1  . PHE A 1 36 ? 1.679   4.343   6.264   1.00 0.00 ? 36 PHE A HD1  3  
ATOM 3095  H HD2  . PHE A 1 36 ? 0.235   1.252   3.718   1.00 0.00 ? 36 PHE A HD2  3  
ATOM 3096  H HE1  . PHE A 1 36 ? 2.085   5.773   4.303   1.00 0.00 ? 36 PHE A HE1  3  
ATOM 3097  H HE2  . PHE A 1 36 ? 0.639   2.677   1.753   1.00 0.00 ? 36 PHE A HE2  3  
ATOM 3098  H HZ   . PHE A 1 36 ? 1.565   4.941   2.044   1.00 0.00 ? 36 PHE A HZ   3  
ATOM 3099  N N    . GLU A 1 37 ? 2.455   3.280   8.474   1.00 0.00 ? 37 GLU A N    3  
ATOM 3100  C CA   . GLU A 1 37 ? 3.180   4.465   8.914   1.00 0.00 ? 37 GLU A CA   3  
ATOM 3101  C C    . GLU A 1 37 ? 4.591   4.102   9.368   1.00 0.00 ? 37 GLU A C    3  
ATOM 3102  O O    . GLU A 1 37 ? 5.575   4.662   8.884   1.00 0.00 ? 37 GLU A O    3  
ATOM 3103  C CB   . GLU A 1 37 ? 2.429   5.157   10.054  1.00 0.00 ? 37 GLU A CB   3  
ATOM 3104  C CG   . GLU A 1 37 ? 1.401   6.170   9.578   1.00 0.00 ? 37 GLU A CG   3  
ATOM 3105  C CD   . GLU A 1 37 ? 2.027   7.491   9.175   1.00 0.00 ? 37 GLU A CD   3  
ATOM 3106  O OE1  . GLU A 1 37 ? 3.181   7.480   8.698   1.00 0.00 ? 37 GLU A OE1  3  
ATOM 3107  O OE2  . GLU A 1 37 ? 1.362   8.536   9.337   1.00 0.00 ? 37 GLU A OE2  3  
ATOM 3108  H H    . GLU A 1 37 ? 1.687   2.967   8.997   1.00 0.00 ? 37 GLU A H    3  
ATOM 3109  H HA   . GLU A 1 37 ? 3.248   5.143   8.077   1.00 0.00 ? 37 GLU A HA   3  
ATOM 3110  H HB2  . GLU A 1 37 ? 1.920   4.407   10.641  1.00 0.00 ? 37 GLU A HB2  3  
ATOM 3111  H HB3  . GLU A 1 37 ? 3.143   5.669   10.681  1.00 0.00 ? 37 GLU A HB3  3  
ATOM 3112  H HG2  . GLU A 1 37 ? 0.880   5.762   8.725   1.00 0.00 ? 37 GLU A HG2  3  
ATOM 3113  H HG3  . GLU A 1 37 ? 0.696   6.351   10.376  1.00 0.00 ? 37 GLU A HG3  3  
ATOM 3114  N N    . LYS A 1 38 ? 4.682   3.162   10.302  1.00 0.00 ? 38 LYS A N    3  
ATOM 3115  C CA   . LYS A 1 38 ? 5.971   2.722   10.823  1.00 0.00 ? 38 LYS A CA   3  
ATOM 3116  C C    . LYS A 1 38 ? 6.894   2.282   9.690   1.00 0.00 ? 38 LYS A C    3  
ATOM 3117  O O    . LYS A 1 38 ? 8.076   2.623   9.674   1.00 0.00 ? 38 LYS A O    3  
ATOM 3118  C CB   . LYS A 1 38 ? 5.779   1.572   11.814  1.00 0.00 ? 38 LYS A CB   3  
ATOM 3119  C CG   . LYS A 1 38 ? 5.369   2.028   13.203  1.00 0.00 ? 38 LYS A CG   3  
ATOM 3120  C CD   . LYS A 1 38 ? 6.565   2.514   14.005  1.00 0.00 ? 38 LYS A CD   3  
ATOM 3121  C CE   . LYS A 1 38 ? 7.424   1.354   14.484  1.00 0.00 ? 38 LYS A CE   3  
ATOM 3122  N NZ   . LYS A 1 38 ? 8.251   1.726   15.665  1.00 0.00 ? 38 LYS A NZ   3  
ATOM 3123  H H    . LYS A 1 38 ? 3.862   2.752   10.649  1.00 0.00 ? 38 LYS A H    3  
ATOM 3124  H HA   . LYS A 1 38 ? 6.424   3.556   11.336  1.00 0.00 ? 38 LYS A HA   3  
ATOM 3125  H HB2  . LYS A 1 38 ? 5.014   0.910   11.435  1.00 0.00 ? 38 LYS A HB2  3  
ATOM 3126  H HB3  . LYS A 1 38 ? 6.707   1.024   11.896  1.00 0.00 ? 38 LYS A HB3  3  
ATOM 3127  H HG2  . LYS A 1 38 ? 4.658   2.836   13.112  1.00 0.00 ? 38 LYS A HG2  3  
ATOM 3128  H HG3  . LYS A 1 38 ? 4.911   1.199   13.724  1.00 0.00 ? 38 LYS A HG3  3  
ATOM 3129  H HD2  . LYS A 1 38 ? 7.167   3.160   13.383  1.00 0.00 ? 38 LYS A HD2  3  
ATOM 3130  H HD3  . LYS A 1 38 ? 6.211   3.067   14.864  1.00 0.00 ? 38 LYS A HD3  3  
ATOM 3131  H HE2  . LYS A 1 38 ? 6.778   0.532   14.753  1.00 0.00 ? 38 LYS A HE2  3  
ATOM 3132  H HE3  . LYS A 1 38 ? 8.076   1.050   13.679  1.00 0.00 ? 38 LYS A HE3  3  
ATOM 3133  H HZ1  . LYS A 1 38 ? 8.532   2.726   15.603  1.00 0.00 ? 38 LYS A HZ1  3  
ATOM 3134  H HZ2  . LYS A 1 38 ? 9.109   1.139   15.700  1.00 0.00 ? 38 LYS A HZ2  3  
ATOM 3135  H HZ3  . LYS A 1 38 ? 7.709   1.583   16.541  1.00 0.00 ? 38 LYS A HZ3  3  
ATOM 3136  N N    . GLN A 1 39 ? 6.345   1.525   8.746   1.00 0.00 ? 39 GLN A N    3  
ATOM 3137  C CA   . GLN A 1 39 ? 7.120   1.040   7.610   1.00 0.00 ? 39 GLN A CA   3  
ATOM 3138  C C    . GLN A 1 39 ? 6.365   1.258   6.303   1.00 0.00 ? 39 GLN A C    3  
ATOM 3139  O O    . GLN A 1 39 ? 5.452   0.502   5.967   1.00 0.00 ? 39 GLN A O    3  
ATOM 3140  C CB   . GLN A 1 39 ? 7.445   -0.445  7.784   1.00 0.00 ? 39 GLN A CB   3  
ATOM 3141  C CG   . GLN A 1 39 ? 8.747   -0.864  7.121   1.00 0.00 ? 39 GLN A CG   3  
ATOM 3142  C CD   . GLN A 1 39 ? 9.368   -2.083  7.774   1.00 0.00 ? 39 GLN A CD   3  
ATOM 3143  O OE1  . GLN A 1 39 ? 9.775   -2.040  8.935   1.00 0.00 ? 39 GLN A OE1  3  
ATOM 3144  N NE2  . GLN A 1 39 ? 9.445   -3.180  7.029   1.00 0.00 ? 39 GLN A NE2  3  
ATOM 3145  H H    . GLN A 1 39 ? 5.398   1.286   8.815   1.00 0.00 ? 39 GLN A H    3  
ATOM 3146  H HA   . GLN A 1 39 ? 8.043   1.599   7.575   1.00 0.00 ? 39 GLN A HA   3  
ATOM 3147  H HB2  . GLN A 1 39 ? 7.515   -0.665  8.838   1.00 0.00 ? 39 GLN A HB2  3  
ATOM 3148  H HB3  . GLN A 1 39 ? 6.644   -1.029  7.355   1.00 0.00 ? 39 GLN A HB3  3  
ATOM 3149  H HG2  . GLN A 1 39 ? 8.551   -1.092  6.083   1.00 0.00 ? 39 GLN A HG2  3  
ATOM 3150  H HG3  . GLN A 1 39 ? 9.447   -0.045  7.182   1.00 0.00 ? 39 GLN A HG3  3  
ATOM 3151  H HE21 . GLN A 1 39 ? 9.102   -3.141  6.111   1.00 0.00 ? 39 GLN A HE21 3  
ATOM 3152  H HE22 . GLN A 1 39 ? 9.842   -3.982  7.426   1.00 0.00 ? 39 GLN A HE22 3  
ATOM 3153  N N    . LYS A 1 40 ? 6.750   2.296   5.569   1.00 0.00 ? 40 LYS A N    3  
ATOM 3154  C CA   . LYS A 1 40 ? 6.111   2.614   4.298   1.00 0.00 ? 40 LYS A CA   3  
ATOM 3155  C C    . LYS A 1 40 ? 5.739   1.342   3.542   1.00 0.00 ? 40 LYS A C    3  
ATOM 3156  O O    . LYS A 1 40 ? 4.712   1.289   2.865   1.00 0.00 ? 40 LYS A O    3  
ATOM 3157  C CB   . LYS A 1 40 ? 7.038   3.477   3.439   1.00 0.00 ? 40 LYS A CB   3  
ATOM 3158  C CG   . LYS A 1 40 ? 7.179   4.904   3.941   1.00 0.00 ? 40 LYS A CG   3  
ATOM 3159  C CD   . LYS A 1 40 ? 5.904   5.701   3.721   1.00 0.00 ? 40 LYS A CD   3  
ATOM 3160  C CE   . LYS A 1 40 ? 5.921   7.006   4.501   1.00 0.00 ? 40 LYS A CE   3  
ATOM 3161  N NZ   . LYS A 1 40 ? 4.548   7.535   4.727   1.00 0.00 ? 40 LYS A NZ   3  
ATOM 3162  H H    . LYS A 1 40 ? 7.484   2.862   5.890   1.00 0.00 ? 40 LYS A H    3  
ATOM 3163  H HA   . LYS A 1 40 ? 5.210   3.169   4.509   1.00 0.00 ? 40 LYS A HA   3  
ATOM 3164  H HB2  . LYS A 1 40 ? 8.018   3.025   3.423   1.00 0.00 ? 40 LYS A HB2  3  
ATOM 3165  H HB3  . LYS A 1 40 ? 6.649   3.509   2.431   1.00 0.00 ? 40 LYS A HB3  3  
ATOM 3166  H HG2  . LYS A 1 40 ? 7.400   4.884   4.997   1.00 0.00 ? 40 LYS A HG2  3  
ATOM 3167  H HG3  . LYS A 1 40 ? 7.989   5.384   3.410   1.00 0.00 ? 40 LYS A HG3  3  
ATOM 3168  H HD2  . LYS A 1 40 ? 5.806   5.924   2.669   1.00 0.00 ? 40 LYS A HD2  3  
ATOM 3169  H HD3  . LYS A 1 40 ? 5.059   5.109   4.045   1.00 0.00 ? 40 LYS A HD3  3  
ATOM 3170  H HE2  . LYS A 1 40 ? 6.393   6.834   5.456   1.00 0.00 ? 40 LYS A HE2  3  
ATOM 3171  H HE3  . LYS A 1 40 ? 6.491   7.735   3.944   1.00 0.00 ? 40 LYS A HE3  3  
ATOM 3172  H HZ1  . LYS A 1 40 ? 4.587   8.553   4.938   1.00 0.00 ? 40 LYS A HZ1  3  
ATOM 3173  H HZ2  . LYS A 1 40 ? 4.103   7.044   5.529   1.00 0.00 ? 40 LYS A HZ2  3  
ATOM 3174  H HZ3  . LYS A 1 40 ? 3.964   7.390   3.879   1.00 0.00 ? 40 LYS A HZ3  3  
ATOM 3175  N N    . TYR A 1 41 ? 6.578   0.320   3.665   1.00 0.00 ? 41 TYR A N    3  
ATOM 3176  C CA   . TYR A 1 41 ? 6.337   -0.951  2.993   1.00 0.00 ? 41 TYR A CA   3  
ATOM 3177  C C    . TYR A 1 41 ? 6.421   -2.113  3.978   1.00 0.00 ? 41 TYR A C    3  
ATOM 3178  O O    . TYR A 1 41 ? 6.613   -1.912  5.178   1.00 0.00 ? 41 TYR A O    3  
ATOM 3179  C CB   . TYR A 1 41 ? 7.347   -1.154  1.862   1.00 0.00 ? 41 TYR A CB   3  
ATOM 3180  C CG   . TYR A 1 41 ? 7.567   0.082   1.019   1.00 0.00 ? 41 TYR A CG   3  
ATOM 3181  C CD1  . TYR A 1 41 ? 8.296   1.159   1.506   1.00 0.00 ? 41 TYR A CD1  3  
ATOM 3182  C CD2  . TYR A 1 41 ? 7.046   0.172   -0.267  1.00 0.00 ? 41 TYR A CD2  3  
ATOM 3183  C CE1  . TYR A 1 41 ? 8.499   2.290   0.740   1.00 0.00 ? 41 TYR A CE1  3  
ATOM 3184  C CE2  . TYR A 1 41 ? 7.246   1.298   -1.041  1.00 0.00 ? 41 TYR A CE2  3  
ATOM 3185  C CZ   . TYR A 1 41 ? 7.972   2.355   -0.533  1.00 0.00 ? 41 TYR A CZ   3  
ATOM 3186  O OH   . TYR A 1 41 ? 8.173   3.479   -1.301  1.00 0.00 ? 41 TYR A OH   3  
ATOM 3187  H H    . TYR A 1 41 ? 7.380   0.423   4.219   1.00 0.00 ? 41 TYR A H    3  
ATOM 3188  H HA   . TYR A 1 41 ? 5.343   -0.922  2.573   1.00 0.00 ? 41 TYR A HA   3  
ATOM 3189  H HB2  . TYR A 1 41 ? 8.298   -1.440  2.284   1.00 0.00 ? 41 TYR A HB2  3  
ATOM 3190  H HB3  . TYR A 1 41 ? 6.996   -1.941  1.211   1.00 0.00 ? 41 TYR A HB3  3  
ATOM 3191  H HD1  . TYR A 1 41 ? 8.708   1.105   2.504   1.00 0.00 ? 41 TYR A HD1  3  
ATOM 3192  H HD2  . TYR A 1 41 ? 6.478   -0.658  -0.662  1.00 0.00 ? 41 TYR A HD2  3  
ATOM 3193  H HE1  . TYR A 1 41 ? 9.069   3.118   1.137   1.00 0.00 ? 41 TYR A HE1  3  
ATOM 3194  H HE2  . TYR A 1 41 ? 6.833   1.350   -2.038  1.00 0.00 ? 41 TYR A HE2  3  
ATOM 3195  H HH   . TYR A 1 41 ? 8.543   4.177   -0.755  1.00 0.00 ? 41 TYR A HH   3  
ATOM 3196  N N    . LEU A 1 42 ? 6.277   -3.329  3.463   1.00 0.00 ? 42 LEU A N    3  
ATOM 3197  C CA   . LEU A 1 42 ? 6.337   -4.525  4.296   1.00 0.00 ? 42 LEU A CA   3  
ATOM 3198  C C    . LEU A 1 42 ? 7.020   -5.671  3.555   1.00 0.00 ? 42 LEU A C    3  
ATOM 3199  O O    . LEU A 1 42 ? 6.768   -5.895  2.371   1.00 0.00 ? 42 LEU A O    3  
ATOM 3200  C CB   . LEU A 1 42 ? 4.930   -4.945  4.722   1.00 0.00 ? 42 LEU A CB   3  
ATOM 3201  C CG   . LEU A 1 42 ? 4.198   -3.985  5.660   1.00 0.00 ? 42 LEU A CG   3  
ATOM 3202  C CD1  . LEU A 1 42 ? 2.727   -4.356  5.762   1.00 0.00 ? 42 LEU A CD1  3  
ATOM 3203  C CD2  . LEU A 1 42 ? 4.847   -3.986  7.037   1.00 0.00 ? 42 LEU A CD2  3  
ATOM 3204  H H    . LEU A 1 42 ? 6.127   -3.426  2.500   1.00 0.00 ? 42 LEU A H    3  
ATOM 3205  H HA   . LEU A 1 42 ? 6.915   -4.287  5.176   1.00 0.00 ? 42 LEU A HA   3  
ATOM 3206  H HB2  . LEU A 1 42 ? 4.333   -5.054  3.830   1.00 0.00 ? 42 LEU A HB2  3  
ATOM 3207  H HB3  . LEU A 1 42 ? 5.007   -5.901  5.220   1.00 0.00 ? 42 LEU A HB3  3  
ATOM 3208  H HG   . LEU A 1 42 ? 4.262   -2.982  5.260   1.00 0.00 ? 42 LEU A HG   3  
ATOM 3209  H HD11 . LEU A 1 42 ? 2.458   -4.481  6.800   1.00 0.00 ? 42 LEU A HD11 3  
ATOM 3210  H HD12 . LEU A 1 42 ? 2.550   -5.279  5.231   1.00 0.00 ? 42 LEU A HD12 3  
ATOM 3211  H HD13 . LEU A 1 42 ? 2.126   -3.570  5.327   1.00 0.00 ? 42 LEU A HD13 3  
ATOM 3212  H HD21 . LEU A 1 42 ? 5.627   -3.239  7.067   1.00 0.00 ? 42 LEU A HD21 3  
ATOM 3213  H HD22 . LEU A 1 42 ? 5.273   -4.959  7.233   1.00 0.00 ? 42 LEU A HD22 3  
ATOM 3214  H HD23 . LEU A 1 42 ? 4.102   -3.760  7.786   1.00 0.00 ? 42 LEU A HD23 3  
ATOM 3215  N N    . SER A 1 43 ? 7.883   -6.394  4.261   1.00 0.00 ? 43 SER A N    3  
ATOM 3216  C CA   . SER A 1 43 ? 8.603   -7.516  3.670   1.00 0.00 ? 43 SER A CA   3  
ATOM 3217  C C    . SER A 1 43 ? 7.651   -8.666  3.353   1.00 0.00 ? 43 SER A C    3  
ATOM 3218  O O    . SER A 1 43 ? 6.457   -8.599  3.648   1.00 0.00 ? 43 SER A O    3  
ATOM 3219  C CB   . SER A 1 43 ? 9.704   -7.998  4.617   1.00 0.00 ? 43 SER A CB   3  
ATOM 3220  O OG   . SER A 1 43 ? 10.661  -6.978  4.846   1.00 0.00 ? 43 SER A OG   3  
ATOM 3221  H H    . SER A 1 43 ? 8.041   -6.166  5.201   1.00 0.00 ? 43 SER A H    3  
ATOM 3222  H HA   . SER A 1 43 ? 9.054   -7.173  2.751   1.00 0.00 ? 43 SER A HA   3  
ATOM 3223  H HB2  . SER A 1 43 ? 9.266   -8.282  5.561   1.00 0.00 ? 43 SER A HB2  3  
ATOM 3224  H HB3  . SER A 1 43 ? 10.203  -8.851  4.180   1.00 0.00 ? 43 SER A HB3  3  
ATOM 3225  H HG   . SER A 1 43 ? 10.239  -6.119  4.770   1.00 0.00 ? 43 SER A HG   3  
ATOM 3226  N N    . THR A 1 44 ? 8.189   -9.720  2.748   1.00 0.00 ? 44 THR A N    3  
ATOM 3227  C CA   . THR A 1 44 ? 7.389   -10.885 2.388   1.00 0.00 ? 44 THR A CA   3  
ATOM 3228  C C    . THR A 1 44 ? 6.647   -11.438 3.600   1.00 0.00 ? 44 THR A C    3  
ATOM 3229  O O    . THR A 1 44 ? 5.419   -11.520 3.621   1.00 0.00 ? 44 THR A O    3  
ATOM 3230  C CB   . THR A 1 44 ? 8.261   -12.000 1.781   1.00 0.00 ? 44 THR A CB   3  
ATOM 3231  O OG1  . THR A 1 44 ? 8.314   -11.860 0.357   1.00 0.00 ? 44 THR A OG1  3  
ATOM 3232  C CG2  . THR A 1 44 ? 7.714   -13.372 2.142   1.00 0.00 ? 44 THR A CG2  3  
ATOM 3233  H H    . THR A 1 44 ? 9.146   -9.714  2.538   1.00 0.00 ? 44 THR A H    3  
ATOM 3234  H HA   . THR A 1 44 ? 6.667   -10.577 1.646   1.00 0.00 ? 44 THR A HA   3  
ATOM 3235  H HB   . THR A 1 44 ? 9.262   -11.911 2.181   1.00 0.00 ? 44 THR A HB   3  
ATOM 3236  H HG1  . THR A 1 44 ? 8.892   -12.534 -0.009  1.00 0.00 ? 44 THR A HG1  3  
ATOM 3237  H HG21 . THR A 1 44 ? 8.280   -14.133 1.625   1.00 0.00 ? 44 THR A HG21 3  
ATOM 3238  H HG22 . THR A 1 44 ? 6.676   -13.434 1.849   1.00 0.00 ? 44 THR A HG22 3  
ATOM 3239  H HG23 . THR A 1 44 ? 7.797   -13.524 3.207   1.00 0.00 ? 44 THR A HG23 3  
ATOM 3240  N N    . PRO A 1 45 ? 7.408   -11.827 4.633   1.00 0.00 ? 45 PRO A N    3  
ATOM 3241  C CA   . PRO A 1 45 ? 6.844   -12.378 5.869   1.00 0.00 ? 45 PRO A CA   3  
ATOM 3242  C C    . PRO A 1 45 ? 6.099   -11.327 6.685   1.00 0.00 ? 45 PRO A C    3  
ATOM 3243  O O    . PRO A 1 45 ? 5.037   -11.600 7.244   1.00 0.00 ? 45 PRO A O    3  
ATOM 3244  C CB   . PRO A 1 45 ? 8.075   -12.874 6.631   1.00 0.00 ? 45 PRO A CB   3  
ATOM 3245  C CG   . PRO A 1 45 ? 9.199   -12.042 6.118   1.00 0.00 ? 45 PRO A CG   3  
ATOM 3246  C CD   . PRO A 1 45 ? 8.879   -11.757 4.676   1.00 0.00 ? 45 PRO A CD   3  
ATOM 3247  H HA   . PRO A 1 45 ? 6.184   -13.209 5.667   1.00 0.00 ? 45 PRO A HA   3  
ATOM 3248  H HB2  . PRO A 1 45 ? 7.927   -12.728 7.692   1.00 0.00 ? 45 PRO A HB2  3  
ATOM 3249  H HB3  . PRO A 1 45 ? 8.233   -13.921 6.425   1.00 0.00 ? 45 PRO A HB3  3  
ATOM 3250  H HG2  . PRO A 1 45 ? 9.260   -11.121 6.677   1.00 0.00 ? 45 PRO A HG2  3  
ATOM 3251  H HG3  . PRO A 1 45 ? 10.126  -12.590 6.194   1.00 0.00 ? 45 PRO A HG3  3  
ATOM 3252  H HD2  . PRO A 1 45 ? 9.227   -10.773 4.400   1.00 0.00 ? 45 PRO A HD2  3  
ATOM 3253  H HD3  . PRO A 1 45 ? 9.318   -12.508 4.037   1.00 0.00 ? 45 PRO A HD3  3  
ATOM 3254  N N    . ASP A 1 46 ? 6.662   -10.126 6.749   1.00 0.00 ? 46 ASP A N    3  
ATOM 3255  C CA   . ASP A 1 46 ? 6.050   -9.033  7.496   1.00 0.00 ? 46 ASP A CA   3  
ATOM 3256  C C    . ASP A 1 46 ? 4.602   -8.825  7.066   1.00 0.00 ? 46 ASP A C    3  
ATOM 3257  O O    . ASP A 1 46 ? 3.687   -8.875  7.887   1.00 0.00 ? 46 ASP A O    3  
ATOM 3258  C CB   . ASP A 1 46 ? 6.846   -7.742  7.296   1.00 0.00 ? 46 ASP A CB   3  
ATOM 3259  C CG   . ASP A 1 46 ? 7.972   -7.594  8.300   1.00 0.00 ? 46 ASP A CG   3  
ATOM 3260  O OD1  . ASP A 1 46 ? 7.700   -7.156  9.437   1.00 0.00 ? 46 ASP A OD1  3  
ATOM 3261  O OD2  . ASP A 1 46 ? 9.126   -7.918  7.948   1.00 0.00 ? 46 ASP A OD2  3  
ATOM 3262  H H    . ASP A 1 46 ? 7.510   -9.970  6.282   1.00 0.00 ? 46 ASP A H    3  
ATOM 3263  H HA   . ASP A 1 46 ? 6.067   -9.297  8.543   1.00 0.00 ? 46 ASP A HA   3  
ATOM 3264  H HB2  . ASP A 1 46 ? 7.271   -7.739  6.303   1.00 0.00 ? 46 ASP A HB2  3  
ATOM 3265  H HB3  . ASP A 1 46 ? 6.181   -6.897  7.401   1.00 0.00 ? 46 ASP A HB3  3  
ATOM 3266  N N    . ARG A 1 47 ? 4.402   -8.590  5.773   1.00 0.00 ? 47 ARG A N    3  
ATOM 3267  C CA   . ARG A 1 47 ? 3.065   -8.371  5.234   1.00 0.00 ? 47 ARG A CA   3  
ATOM 3268  C C    . ARG A 1 47 ? 2.107   -9.464  5.698   1.00 0.00 ? 47 ARG A C    3  
ATOM 3269  O O    . ARG A 1 47 ? 0.952   -9.191  6.030   1.00 0.00 ? 47 ARG A O    3  
ATOM 3270  C CB   . ARG A 1 47 ? 3.109   -8.332  3.705   1.00 0.00 ? 47 ARG A CB   3  
ATOM 3271  C CG   . ARG A 1 47 ? 1.761   -8.044  3.065   1.00 0.00 ? 47 ARG A CG   3  
ATOM 3272  C CD   . ARG A 1 47 ? 1.874   -7.937  1.552   1.00 0.00 ? 47 ARG A CD   3  
ATOM 3273  N NE   . ARG A 1 47 ? 2.388   -9.167  0.954   1.00 0.00 ? 47 ARG A NE   3  
ATOM 3274  C CZ   . ARG A 1 47 ? 2.804   -9.253  -0.305  1.00 0.00 ? 47 ARG A CZ   3  
ATOM 3275  N NH1  . ARG A 1 47 ? 2.766   -8.189  -1.094  1.00 0.00 ? 47 ARG A NH1  3  
ATOM 3276  N NH2  . ARG A 1 47 ? 3.259   -10.407 -0.777  1.00 0.00 ? 47 ARG A NH2  3  
ATOM 3277  H H    . ARG A 1 47 ? 5.172   -8.562  5.167   1.00 0.00 ? 47 ARG A H    3  
ATOM 3278  H HA   . ARG A 1 47 ? 2.711   -7.419  5.600   1.00 0.00 ? 47 ARG A HA   3  
ATOM 3279  H HB2  . ARG A 1 47 ? 3.801   -7.563  3.396   1.00 0.00 ? 47 ARG A HB2  3  
ATOM 3280  H HB3  . ARG A 1 47 ? 3.459   -9.287  3.343   1.00 0.00 ? 47 ARG A HB3  3  
ATOM 3281  H HG2  . ARG A 1 47 ? 1.078   -8.845  3.308   1.00 0.00 ? 47 ARG A HG2  3  
ATOM 3282  H HG3  . ARG A 1 47 ? 1.379   -7.112  3.455   1.00 0.00 ? 47 ARG A HG3  3  
ATOM 3283  H HD2  . ARG A 1 47 ? 0.895   -7.733  1.145   1.00 0.00 ? 47 ARG A HD2  3  
ATOM 3284  H HD3  . ARG A 1 47 ? 2.542   -7.124  1.311   1.00 0.00 ? 47 ARG A HD3  3  
ATOM 3285  H HE   . ARG A 1 47 ? 2.425   -9.966  1.519   1.00 0.00 ? 47 ARG A HE   3  
ATOM 3286  H HH11 . ARG A 1 47 ? 2.425   -7.318  -0.741  1.00 0.00 ? 47 ARG A HH11 3  
ATOM 3287  H HH12 . ARG A 1 47 ? 3.080   -8.256  -2.041  1.00 0.00 ? 47 ARG A HH12 3  
ATOM 3288  H HH21 . ARG A 1 47 ? 3.289   -11.212 -0.185  1.00 0.00 ? 47 ARG A HH21 3  
ATOM 3289  H HH22 . ARG A 1 47 ? 3.571   -10.472 -1.724  1.00 0.00 ? 47 ARG A HH22 3  
ATOM 3290  N N    . ILE A 1 48 ? 2.592   -10.700 5.719   1.00 0.00 ? 48 ILE A N    3  
ATOM 3291  C CA   . ILE A 1 48 ? 1.779   -11.833 6.143   1.00 0.00 ? 48 ILE A CA   3  
ATOM 3292  C C    . ILE A 1 48 ? 1.457   -11.752 7.631   1.00 0.00 ? 48 ILE A C    3  
ATOM 3293  O O    . ILE A 1 48 ? 0.293   -11.650 8.020   1.00 0.00 ? 48 ILE A O    3  
ATOM 3294  C CB   . ILE A 1 48 ? 2.484   -13.172 5.853   1.00 0.00 ? 48 ILE A CB   3  
ATOM 3295  C CG1  . ILE A 1 48 ? 2.833   -13.278 4.367   1.00 0.00 ? 48 ILE A CG1  3  
ATOM 3296  C CG2  . ILE A 1 48 ? 1.604   -14.337 6.281   1.00 0.00 ? 48 ILE A CG2  3  
ATOM 3297  C CD1  . ILE A 1 48 ? 3.880   -14.328 4.067   1.00 0.00 ? 48 ILE A CD1  3  
ATOM 3298  H H    . ILE A 1 48 ? 3.520   -10.854 5.443   1.00 0.00 ? 48 ILE A H    3  
ATOM 3299  H HA   . ILE A 1 48 ? 0.855   -11.807 5.583   1.00 0.00 ? 48 ILE A HA   3  
ATOM 3300  H HB   . ILE A 1 48 ? 3.393   -13.207 6.433   1.00 0.00 ? 48 ILE A HB   3  
ATOM 3301  H HG12 . ILE A 1 48 ? 1.943   -13.530 3.812   1.00 0.00 ? 48 ILE A HG12 3  
ATOM 3302  H HG13 . ILE A 1 48 ? 3.210   -12.325 4.025   1.00 0.00 ? 48 ILE A HG13 3  
ATOM 3303  H HG21 . ILE A 1 48 ? 1.367   -14.242 7.331   1.00 0.00 ? 48 ILE A HG21 3  
ATOM 3304  H HG22 . ILE A 1 48 ? 0.691   -14.329 5.705   1.00 0.00 ? 48 ILE A HG22 3  
ATOM 3305  H HG23 . ILE A 1 48 ? 2.128   -15.265 6.113   1.00 0.00 ? 48 ILE A HG23 3  
ATOM 3306  H HD11 . ILE A 1 48 ? 4.864   -13.896 4.172   1.00 0.00 ? 48 ILE A HD11 3  
ATOM 3307  H HD12 . ILE A 1 48 ? 3.772   -15.152 4.755   1.00 0.00 ? 48 ILE A HD12 3  
ATOM 3308  H HD13 . ILE A 1 48 ? 3.751   -14.685 3.055   1.00 0.00 ? 48 ILE A HD13 3  
ATOM 3309  N N    . ASP A 1 49 ? 2.495   -11.797 8.458   1.00 0.00 ? 49 ASP A N    3  
ATOM 3310  C CA   . ASP A 1 49 ? 2.324   -11.726 9.905   1.00 0.00 ? 49 ASP A CA   3  
ATOM 3311  C C    . ASP A 1 49 ? 1.221   -10.738 10.273  1.00 0.00 ? 49 ASP A C    3  
ATOM 3312  O O    . ASP A 1 49 ? 0.331   -11.052 11.065  1.00 0.00 ? 49 ASP A O    3  
ATOM 3313  C CB   . ASP A 1 49 ? 3.636   -11.319 10.576  1.00 0.00 ? 49 ASP A CB   3  
ATOM 3314  C CG   . ASP A 1 49 ? 3.514   -11.238 12.085  1.00 0.00 ? 49 ASP A CG   3  
ATOM 3315  O OD1  . ASP A 1 49 ? 3.495   -12.303 12.736  1.00 0.00 ? 49 ASP A OD1  3  
ATOM 3316  O OD2  . ASP A 1 49 ? 3.437   -10.109 12.615  1.00 0.00 ? 49 ASP A OD2  3  
ATOM 3317  H H    . ASP A 1 49 ? 3.399   -11.880 8.087   1.00 0.00 ? 49 ASP A H    3  
ATOM 3318  H HA   . ASP A 1 49 ? 2.041   -12.708 10.254  1.00 0.00 ? 49 ASP A HA   3  
ATOM 3319  H HB2  . ASP A 1 49 ? 4.398   -12.045 10.334  1.00 0.00 ? 49 ASP A HB2  3  
ATOM 3320  H HB3  . ASP A 1 49 ? 3.937   -10.350 10.204  1.00 0.00 ? 49 ASP A HB3  3  
ATOM 3321  N N    . LEU A 1 50 ? 1.287   -9.544  9.696   1.00 0.00 ? 50 LEU A N    3  
ATOM 3322  C CA   . LEU A 1 50 ? 0.294   -8.509  9.964   1.00 0.00 ? 50 LEU A CA   3  
ATOM 3323  C C    . LEU A 1 50 ? -1.095  -8.959  9.523   1.00 0.00 ? 50 LEU A C    3  
ATOM 3324  O O    . LEU A 1 50 ? -2.023  -9.020  10.329  1.00 0.00 ? 50 LEU A O    3  
ATOM 3325  C CB   . LEU A 1 50 ? 0.675   -7.212  9.247   1.00 0.00 ? 50 LEU A CB   3  
ATOM 3326  C CG   . LEU A 1 50 ? -0.453  -6.199  9.050   1.00 0.00 ? 50 LEU A CG   3  
ATOM 3327  C CD1  . LEU A 1 50 ? -0.839  -5.565  10.377  1.00 0.00 ? 50 LEU A CD1  3  
ATOM 3328  C CD2  . LEU A 1 50 ? -0.042  -5.131  8.046   1.00 0.00 ? 50 LEU A CD2  3  
ATOM 3329  H H    . LEU A 1 50 ? 2.019   -9.353  9.074   1.00 0.00 ? 50 LEU A H    3  
ATOM 3330  H HA   . LEU A 1 50 ? 0.281   -8.331  11.029  1.00 0.00 ? 50 LEU A HA   3  
ATOM 3331  H HB2  . LEU A 1 50 ? 1.453   -6.733  9.820   1.00 0.00 ? 50 LEU A HB2  3  
ATOM 3332  H HB3  . LEU A 1 50 ? 1.059   -7.475  8.271   1.00 0.00 ? 50 LEU A HB3  3  
ATOM 3333  H HG   . LEU A 1 50 ? -1.323  -6.709  8.659   1.00 0.00 ? 50 LEU A HG   3  
ATOM 3334  H HD11 . LEU A 1 50 ? -1.585  -4.803  10.209  1.00 0.00 ? 50 LEU A HD11 3  
ATOM 3335  H HD12 . LEU A 1 50 ? 0.035   -5.120  10.830  1.00 0.00 ? 50 LEU A HD12 3  
ATOM 3336  H HD13 . LEU A 1 50 ? -1.239  -6.322  11.035  1.00 0.00 ? 50 LEU A HD13 3  
ATOM 3337  H HD21 . LEU A 1 50 ? 0.256   -4.237  8.574   1.00 0.00 ? 50 LEU A HD21 3  
ATOM 3338  H HD22 . LEU A 1 50 ? -0.877  -4.906  7.398   1.00 0.00 ? 50 LEU A HD22 3  
ATOM 3339  H HD23 . LEU A 1 50 ? 0.786   -5.493  7.455   1.00 0.00 ? 50 LEU A HD23 3  
ATOM 3340  N N    . ALA A 1 51 ? -1.229  -9.275  8.239   1.00 0.00 ? 51 ALA A N    3  
ATOM 3341  C CA   . ALA A 1 51 ? -2.503  -9.724  7.692   1.00 0.00 ? 51 ALA A CA   3  
ATOM 3342  C C    . ALA A 1 51 ? -3.160  -10.755 8.604   1.00 0.00 ? 51 ALA A C    3  
ATOM 3343  O O    . ALA A 1 51 ? -4.385  -10.845 8.672   1.00 0.00 ? 51 ALA A O    3  
ATOM 3344  C CB   . ALA A 1 51 ? -2.306  -10.300 6.298   1.00 0.00 ? 51 ALA A CB   3  
ATOM 3345  H H    . ALA A 1 51 ? -0.452  -9.207  7.646   1.00 0.00 ? 51 ALA A H    3  
ATOM 3346  H HA   . ALA A 1 51 ? -3.153  -8.864  7.611   1.00 0.00 ? 51 ALA A HA   3  
ATOM 3347  H HB1  . ALA A 1 51 ? -2.607  -11.338 6.292   1.00 0.00 ? 51 ALA A HB1  3  
ATOM 3348  H HB2  . ALA A 1 51 ? -2.906  -9.747  5.592   1.00 0.00 ? 51 ALA A HB2  3  
ATOM 3349  H HB3  . ALA A 1 51 ? -1.264  -10.226 6.022   1.00 0.00 ? 51 ALA A HB3  3  
ATOM 3350  N N    . GLU A 1 52 ? -2.336  -11.530 9.303   1.00 0.00 ? 52 GLU A N    3  
ATOM 3351  C CA   . GLU A 1 52 ? -2.839  -12.556 10.210  1.00 0.00 ? 52 GLU A CA   3  
ATOM 3352  C C    . GLU A 1 52 ? -3.379  -11.930 11.492  1.00 0.00 ? 52 GLU A C    3  
ATOM 3353  O O    . GLU A 1 52 ? -4.344  -12.423 12.077  1.00 0.00 ? 52 GLU A O    3  
ATOM 3354  C CB   . GLU A 1 52 ? -1.732  -13.558 10.545  1.00 0.00 ? 52 GLU A CB   3  
ATOM 3355  C CG   . GLU A 1 52 ? -1.635  -14.710 9.559   1.00 0.00 ? 52 GLU A CG   3  
ATOM 3356  C CD   . GLU A 1 52 ? -2.649  -15.803 9.837   1.00 0.00 ? 52 GLU A CD   3  
ATOM 3357  O OE1  . GLU A 1 52 ? -2.802  -16.183 11.017  1.00 0.00 ? 52 GLU A OE1  3  
ATOM 3358  O OE2  . GLU A 1 52 ? -3.288  -16.278 8.875   1.00 0.00 ? 52 GLU A OE2  3  
ATOM 3359  H H    . GLU A 1 52 ? -1.368  -11.410 9.206   1.00 0.00 ? 52 GLU A H    3  
ATOM 3360  H HA   . GLU A 1 52 ? -3.642  -13.075 9.710   1.00 0.00 ? 52 GLU A HA   3  
ATOM 3361  H HB2  . GLU A 1 52 ? -0.785  -13.039 10.557  1.00 0.00 ? 52 GLU A HB2  3  
ATOM 3362  H HB3  . GLU A 1 52 ? -1.920  -13.967 11.527  1.00 0.00 ? 52 GLU A HB3  3  
ATOM 3363  H HG2  . GLU A 1 52 ? -1.803  -14.329 8.563   1.00 0.00 ? 52 GLU A HG2  3  
ATOM 3364  H HG3  . GLU A 1 52 ? -0.644  -15.135 9.618   1.00 0.00 ? 52 GLU A HG3  3  
ATOM 3365  N N    . SER A 1 53 ? -2.750  -10.842 11.924  1.00 0.00 ? 53 SER A N    3  
ATOM 3366  C CA   . SER A 1 53 ? -3.165  -10.151 13.139  1.00 0.00 ? 53 SER A CA   3  
ATOM 3367  C C    . SER A 1 53 ? -4.509  -9.457  12.938  1.00 0.00 ? 53 SER A C    3  
ATOM 3368  O O    . SER A 1 53 ? -5.377  -9.495  13.811  1.00 0.00 ? 53 SER A O    3  
ATOM 3369  C CB   . SER A 1 53 ? -2.107  -9.127  13.555  1.00 0.00 ? 53 SER A CB   3  
ATOM 3370  O OG   . SER A 1 53 ? -2.251  -8.769  14.918  1.00 0.00 ? 53 SER A OG   3  
ATOM 3371  H H    . SER A 1 53 ? -1.988  -10.497 11.413  1.00 0.00 ? 53 SER A H    3  
ATOM 3372  H HA   . SER A 1 53 ? -3.267  -10.888 13.921  1.00 0.00 ? 53 SER A HA   3  
ATOM 3373  H HB2  . SER A 1 53 ? -1.124  -9.548  13.408  1.00 0.00 ? 53 SER A HB2  3  
ATOM 3374  H HB3  . SER A 1 53 ? -2.212  -8.238  12.948  1.00 0.00 ? 53 SER A HB3  3  
ATOM 3375  H HG   . SER A 1 53 ? -3.176  -8.829  15.169  1.00 0.00 ? 53 SER A HG   3  
ATOM 3376  N N    . LEU A 1 54 ? -4.674  -8.824  11.782  1.00 0.00 ? 54 LEU A N    3  
ATOM 3377  C CA   . LEU A 1 54 ? -5.912  -8.121  11.465  1.00 0.00 ? 54 LEU A CA   3  
ATOM 3378  C C    . LEU A 1 54 ? -6.902  -9.049  10.768  1.00 0.00 ? 54 LEU A C    3  
ATOM 3379  O O    . LEU A 1 54 ? -8.114  -8.869  10.870  1.00 0.00 ? 54 LEU A O    3  
ATOM 3380  C CB   . LEU A 1 54 ? -5.620  -6.909  10.578  1.00 0.00 ? 54 LEU A CB   3  
ATOM 3381  C CG   . LEU A 1 54 ? -4.784  -5.798  11.213  1.00 0.00 ? 54 LEU A CG   3  
ATOM 3382  C CD1  . LEU A 1 54 ? -4.360  -4.782  10.163  1.00 0.00 ? 54 LEU A CD1  3  
ATOM 3383  C CD2  . LEU A 1 54 ? -5.560  -5.119  12.332  1.00 0.00 ? 54 LEU A CD2  3  
ATOM 3384  H H    . LEU A 1 54 ? -3.946  -8.828  11.126  1.00 0.00 ? 54 LEU A H    3  
ATOM 3385  H HA   . LEU A 1 54 ? -6.347  -7.781  12.393  1.00 0.00 ? 54 LEU A HA   3  
ATOM 3386  H HB2  . LEU A 1 54 ? -5.095  -7.259  9.702   1.00 0.00 ? 54 LEU A HB2  3  
ATOM 3387  H HB3  . LEU A 1 54 ? -6.568  -6.483  10.280  1.00 0.00 ? 54 LEU A HB3  3  
ATOM 3388  H HG   . LEU A 1 54 ? -3.888  -6.229  11.639  1.00 0.00 ? 54 LEU A HG   3  
ATOM 3389  H HD11 . LEU A 1 54 ? -3.882  -5.293  9.341   1.00 0.00 ? 54 LEU A HD11 3  
ATOM 3390  H HD12 . LEU A 1 54 ? -3.668  -4.079  10.602  1.00 0.00 ? 54 LEU A HD12 3  
ATOM 3391  H HD13 . LEU A 1 54 ? -5.230  -4.254  9.802   1.00 0.00 ? 54 LEU A HD13 3  
ATOM 3392  H HD21 . LEU A 1 54 ? -6.610  -5.101  12.081  1.00 0.00 ? 54 LEU A HD21 3  
ATOM 3393  H HD22 . LEU A 1 54 ? -5.202  -4.107  12.455  1.00 0.00 ? 54 LEU A HD22 3  
ATOM 3394  H HD23 . LEU A 1 54 ? -5.419  -5.666  13.251  1.00 0.00 ? 54 LEU A HD23 3  
ATOM 3395  N N    . GLY A 1 55 ? -6.375  -10.045 10.062  1.00 0.00 ? 55 GLY A N    3  
ATOM 3396  C CA   . GLY A 1 55 ? -7.227  -10.988 9.361   1.00 0.00 ? 55 GLY A CA   3  
ATOM 3397  C C    . GLY A 1 55 ? -7.458  -10.596 7.915   1.00 0.00 ? 55 GLY A C    3  
ATOM 3398  O O    . GLY A 1 55 ? -8.443  -11.010 7.302   1.00 0.00 ? 55 GLY A O    3  
ATOM 3399  H H    . GLY A 1 55 ? -5.401  -10.140 10.016  1.00 0.00 ? 55 GLY A H    3  
ATOM 3400  H HA2  . GLY A 1 55 ? -6.765  -11.964 9.389   1.00 0.00 ? 55 GLY A HA2  3  
ATOM 3401  H HA3  . GLY A 1 55 ? -8.181  -11.038 9.865   1.00 0.00 ? 55 GLY A HA3  3  
ATOM 3402  N N    . LEU A 1 56 ? -6.550  -9.795  7.368   1.00 0.00 ? 56 LEU A N    3  
ATOM 3403  C CA   . LEU A 1 56 ? -6.661  -9.346  5.985   1.00 0.00 ? 56 LEU A CA   3  
ATOM 3404  C C    . LEU A 1 56 ? -5.807  -10.209 5.062   1.00 0.00 ? 56 LEU A C    3  
ATOM 3405  O O    . LEU A 1 56 ? -4.978  -10.994 5.521   1.00 0.00 ? 56 LEU A O    3  
ATOM 3406  C CB   . LEU A 1 56 ? -6.236  -7.881  5.868   1.00 0.00 ? 56 LEU A CB   3  
ATOM 3407  C CG   . LEU A 1 56 ? -7.157  -6.859  6.537   1.00 0.00 ? 56 LEU A CG   3  
ATOM 3408  C CD1  . LEU A 1 56 ? -6.441  -5.530  6.714   1.00 0.00 ? 56 LEU A CD1  3  
ATOM 3409  C CD2  . LEU A 1 56 ? -8.430  -6.677  5.723   1.00 0.00 ? 56 LEU A CD2  3  
ATOM 3410  H H    . LEU A 1 56 ? -5.788  -9.498  7.907   1.00 0.00 ? 56 LEU A H    3  
ATOM 3411  H HA   . LEU A 1 56 ? -7.695  -9.437  5.688   1.00 0.00 ? 56 LEU A HA   3  
ATOM 3412  H HB2  . LEU A 1 56 ? -5.257  -7.784  6.313   1.00 0.00 ? 56 LEU A HB2  3  
ATOM 3413  H HB3  . LEU A 1 56 ? -6.177  -7.637  4.817   1.00 0.00 ? 56 LEU A HB3  3  
ATOM 3414  H HG   . LEU A 1 56 ? -7.434  -7.222  7.517   1.00 0.00 ? 56 LEU A HG   3  
ATOM 3415  H HD11 . LEU A 1 56 ? -5.413  -5.630  6.399   1.00 0.00 ? 56 LEU A HD11 3  
ATOM 3416  H HD12 . LEU A 1 56 ? -6.472  -5.239  7.753   1.00 0.00 ? 56 LEU A HD12 3  
ATOM 3417  H HD13 . LEU A 1 56 ? -6.929  -4.775  6.115   1.00 0.00 ? 56 LEU A HD13 3  
ATOM 3418  H HD21 . LEU A 1 56 ? -9.067  -5.954  6.210   1.00 0.00 ? 56 LEU A HD21 3  
ATOM 3419  H HD22 . LEU A 1 56 ? -8.949  -7.622  5.651   1.00 0.00 ? 56 LEU A HD22 3  
ATOM 3420  H HD23 . LEU A 1 56 ? -8.178  -6.327  4.734   1.00 0.00 ? 56 LEU A HD23 3  
ATOM 3421  N N    . SER A 1 57 ? -6.016  -10.058 3.758   1.00 0.00 ? 57 SER A N    3  
ATOM 3422  C CA   . SER A 1 57 ? -5.266  -10.825 2.770   1.00 0.00 ? 57 SER A CA   3  
ATOM 3423  C C    . SER A 1 57 ? -4.040  -10.050 2.296   1.00 0.00 ? 57 SER A C    3  
ATOM 3424  O O    . SER A 1 57 ? -4.104  -8.841  2.078   1.00 0.00 ? 57 SER A O    3  
ATOM 3425  C CB   . SER A 1 57 ? -6.159  -11.168 1.576   1.00 0.00 ? 57 SER A CB   3  
ATOM 3426  O OG   . SER A 1 57 ? -7.201  -12.050 1.955   1.00 0.00 ? 57 SER A OG   3  
ATOM 3427  H H    . SER A 1 57 ? -6.691  -9.416  3.453   1.00 0.00 ? 57 SER A H    3  
ATOM 3428  H HA   . SER A 1 57 ? -4.940  -11.741 3.239   1.00 0.00 ? 57 SER A HA   3  
ATOM 3429  H HB2  . SER A 1 57 ? -6.596  -10.262 1.183   1.00 0.00 ? 57 SER A HB2  3  
ATOM 3430  H HB3  . SER A 1 57 ? -5.563  -11.642 0.809   1.00 0.00 ? 57 SER A HB3  3  
ATOM 3431  H HG   . SER A 1 57 ? -6.856  -12.716 2.555   1.00 0.00 ? 57 SER A HG   3  
ATOM 3432  N N    . GLN A 1 58 ? -2.925  -10.757 2.140   1.00 0.00 ? 58 GLN A N    3  
ATOM 3433  C CA   . GLN A 1 58 ? -1.684  -10.137 1.693   1.00 0.00 ? 58 GLN A CA   3  
ATOM 3434  C C    . GLN A 1 58 ? -1.960  -9.052  0.657   1.00 0.00 ? 58 GLN A C    3  
ATOM 3435  O O    . GLN A 1 58 ? -1.222  -8.071  0.558   1.00 0.00 ? 58 GLN A O    3  
ATOM 3436  C CB   . GLN A 1 58 ? -0.744  -11.191 1.107   1.00 0.00 ? 58 GLN A CB   3  
ATOM 3437  C CG   . GLN A 1 58 ? -0.335  -12.263 2.104   1.00 0.00 ? 58 GLN A CG   3  
ATOM 3438  C CD   . GLN A 1 58 ? 0.906   -13.019 1.672   1.00 0.00 ? 58 GLN A CD   3  
ATOM 3439  O OE1  . GLN A 1 58 ? 1.995   -12.450 1.585   1.00 0.00 ? 58 GLN A OE1  3  
ATOM 3440  N NE2  . GLN A 1 58 ? 0.749   -14.309 1.398   1.00 0.00 ? 58 GLN A NE2  3  
ATOM 3441  H H    . GLN A 1 58 ? -2.938  -11.718 2.330   1.00 0.00 ? 58 GLN A H    3  
ATOM 3442  H HA   . GLN A 1 58 ? -1.212  -9.685  2.552   1.00 0.00 ? 58 GLN A HA   3  
ATOM 3443  H HB2  . GLN A 1 58 ? -1.236  -11.672 0.275   1.00 0.00 ? 58 GLN A HB2  3  
ATOM 3444  H HB3  . GLN A 1 58 ? 0.150   -10.701 0.751   1.00 0.00 ? 58 GLN A HB3  3  
ATOM 3445  H HG2  . GLN A 1 58 ? -0.138  -11.794 3.057   1.00 0.00 ? 58 GLN A HG2  3  
ATOM 3446  H HG3  . GLN A 1 58 ? -1.148  -12.966 2.211   1.00 0.00 ? 58 GLN A HG3  3  
ATOM 3447  H HE21 . GLN A 1 58 ? -0.148  -14.694 1.488   1.00 0.00 ? 58 GLN A HE21 3  
ATOM 3448  H HE22 . GLN A 1 58 ? 1.534   -14.821 1.115   1.00 0.00 ? 58 GLN A HE22 3  
ATOM 3449  N N    . LEU A 1 59 ? -3.027  -9.234  -0.113  1.00 0.00 ? 59 LEU A N    3  
ATOM 3450  C CA   . LEU A 1 59 ? -3.400  -8.271  -1.143  1.00 0.00 ? 59 LEU A CA   3  
ATOM 3451  C C    . LEU A 1 59 ? -3.787  -6.933  -0.522  1.00 0.00 ? 59 LEU A C    3  
ATOM 3452  O O    . LEU A 1 59 ? -3.224  -5.893  -0.864  1.00 0.00 ? 59 LEU A O    3  
ATOM 3453  C CB   . LEU A 1 59 ? -4.561  -8.813  -1.979  1.00 0.00 ? 59 LEU A CB   3  
ATOM 3454  C CG   . LEU A 1 59 ? -5.109  -7.875  -3.055  1.00 0.00 ? 59 LEU A CG   3  
ATOM 3455  C CD1  . LEU A 1 59 ? -4.084  -7.675  -4.161  1.00 0.00 ? 59 LEU A CD1  3  
ATOM 3456  C CD2  . LEU A 1 59 ? -6.411  -8.418  -3.624  1.00 0.00 ? 59 LEU A CD2  3  
ATOM 3457  H H    . LEU A 1 59 ? -3.576  -10.035 0.012   1.00 0.00 ? 59 LEU A H    3  
ATOM 3458  H HA   . LEU A 1 59 ? -2.544  -8.123  -1.784  1.00 0.00 ? 59 LEU A HA   3  
ATOM 3459  H HB2  . LEU A 1 59 ? -4.224  -9.715  -2.467  1.00 0.00 ? 59 LEU A HB2  3  
ATOM 3460  H HB3  . LEU A 1 59 ? -5.371  -9.052  -1.304  1.00 0.00 ? 59 LEU A HB3  3  
ATOM 3461  H HG   . LEU A 1 59 ? -5.313  -6.910  -2.613  1.00 0.00 ? 59 LEU A HG   3  
ATOM 3462  H HD11 . LEU A 1 59 ? -4.575  -7.294  -5.043  1.00 0.00 ? 59 LEU A HD11 3  
ATOM 3463  H HD12 . LEU A 1 59 ? -3.614  -8.620  -4.391  1.00 0.00 ? 59 LEU A HD12 3  
ATOM 3464  H HD13 . LEU A 1 59 ? -3.333  -6.971  -3.833  1.00 0.00 ? 59 LEU A HD13 3  
ATOM 3465  H HD21 . LEU A 1 59 ? -6.199  -9.259  -4.268  1.00 0.00 ? 59 LEU A HD21 3  
ATOM 3466  H HD22 . LEU A 1 59 ? -6.906  -7.645  -4.194  1.00 0.00 ? 59 LEU A HD22 3  
ATOM 3467  H HD23 . LEU A 1 59 ? -7.052  -8.737  -2.816  1.00 0.00 ? 59 LEU A HD23 3  
ATOM 3468  N N    . GLN A 1 60 ? -4.751  -6.967  0.393   1.00 0.00 ? 60 GLN A N    3  
ATOM 3469  C CA   . GLN A 1 60 ? -5.211  -5.757  1.063   1.00 0.00 ? 60 GLN A CA   3  
ATOM 3470  C C    . GLN A 1 60 ? -4.046  -4.816  1.349   1.00 0.00 ? 60 GLN A C    3  
ATOM 3471  O O    . GLN A 1 60 ? -4.033  -3.671  0.897   1.00 0.00 ? 60 GLN A O    3  
ATOM 3472  C CB   . GLN A 1 60 ? -5.928  -6.111  2.367   1.00 0.00 ? 60 GLN A CB   3  
ATOM 3473  C CG   . GLN A 1 60 ? -7.234  -6.861  2.159   1.00 0.00 ? 60 GLN A CG   3  
ATOM 3474  C CD   . GLN A 1 60 ? -8.413  -5.932  1.949   1.00 0.00 ? 60 GLN A CD   3  
ATOM 3475  O OE1  . GLN A 1 60 ? -9.181  -5.666  2.875   1.00 0.00 ? 60 GLN A OE1  3  
ATOM 3476  N NE2  . GLN A 1 60 ? -8.563  -5.432  0.728   1.00 0.00 ? 60 GLN A NE2  3  
ATOM 3477  H H    . GLN A 1 60 ? -5.161  -7.826  0.623   1.00 0.00 ? 60 GLN A H    3  
ATOM 3478  H HA   . GLN A 1 60 ? -5.907  -5.258  0.405   1.00 0.00 ? 60 GLN A HA   3  
ATOM 3479  H HB2  . GLN A 1 60 ? -5.275  -6.728  2.967   1.00 0.00 ? 60 GLN A HB2  3  
ATOM 3480  H HB3  . GLN A 1 60 ? -6.143  -5.200  2.905   1.00 0.00 ? 60 GLN A HB3  3  
ATOM 3481  H HG2  . GLN A 1 60 ? -7.136  -7.495  1.290   1.00 0.00 ? 60 GLN A HG2  3  
ATOM 3482  H HG3  . GLN A 1 60 ? -7.425  -7.472  3.029   1.00 0.00 ? 60 GLN A HG3  3  
ATOM 3483  H HE21 . GLN A 1 60 ? -7.913  -5.688  0.041   1.00 0.00 ? 60 GLN A HE21 3  
ATOM 3484  H HE22 . GLN A 1 60 ? -9.317  -4.829  0.565   1.00 0.00 ? 60 GLN A HE22 3  
ATOM 3485  N N    . VAL A 1 61 ? -3.067  -5.306  2.102   1.00 0.00 ? 61 VAL A N    3  
ATOM 3486  C CA   . VAL A 1 61 ? -1.896  -4.510  2.448   1.00 0.00 ? 61 VAL A CA   3  
ATOM 3487  C C    . VAL A 1 61 ? -1.182  -4.010  1.197   1.00 0.00 ? 61 VAL A C    3  
ATOM 3488  O O    . VAL A 1 61 ? -0.984  -2.807  1.021   1.00 0.00 ? 61 VAL A O    3  
ATOM 3489  C CB   . VAL A 1 61 ? -0.902  -5.315  3.306   1.00 0.00 ? 61 VAL A CB   3  
ATOM 3490  C CG1  . VAL A 1 61 ? 0.337   -4.486  3.609   1.00 0.00 ? 61 VAL A CG1  3  
ATOM 3491  C CG2  . VAL A 1 61 ? -1.566  -5.786  4.590   1.00 0.00 ? 61 VAL A CG2  3  
ATOM 3492  H H    . VAL A 1 61 ? -3.133  -6.226  2.433   1.00 0.00 ? 61 VAL A H    3  
ATOM 3493  H HA   . VAL A 1 61 ? -2.229  -3.659  3.025   1.00 0.00 ? 61 VAL A HA   3  
ATOM 3494  H HB   . VAL A 1 61 ? -0.596  -6.186  2.744   1.00 0.00 ? 61 VAL A HB   3  
ATOM 3495  H HG11 . VAL A 1 61 ? 0.329   -3.592  3.003   1.00 0.00 ? 61 VAL A HG11 3  
ATOM 3496  H HG12 . VAL A 1 61 ? 0.340   -4.213  4.655   1.00 0.00 ? 61 VAL A HG12 3  
ATOM 3497  H HG13 . VAL A 1 61 ? 1.221   -5.064  3.385   1.00 0.00 ? 61 VAL A HG13 3  
ATOM 3498  H HG21 . VAL A 1 61 ? -2.637  -5.817  4.451   1.00 0.00 ? 61 VAL A HG21 3  
ATOM 3499  H HG22 . VAL A 1 61 ? -1.208  -6.774  4.841   1.00 0.00 ? 61 VAL A HG22 3  
ATOM 3500  H HG23 . VAL A 1 61 ? -1.327  -5.103  5.391   1.00 0.00 ? 61 VAL A HG23 3  
ATOM 3501  N N    . LYS A 1 62 ? -0.798  -4.940  0.330   1.00 0.00 ? 62 LYS A N    3  
ATOM 3502  C CA   . LYS A 1 62 ? -0.107  -4.596  -0.907  1.00 0.00 ? 62 LYS A CA   3  
ATOM 3503  C C    . LYS A 1 62 ? -0.796  -3.429  -1.608  1.00 0.00 ? 62 LYS A C    3  
ATOM 3504  O O    . LYS A 1 62 ? -0.207  -2.362  -1.786  1.00 0.00 ? 62 LYS A O    3  
ATOM 3505  C CB   . LYS A 1 62 ? -0.055  -5.807  -1.840  1.00 0.00 ? 62 LYS A CB   3  
ATOM 3506  C CG   . LYS A 1 62 ? 0.857   -5.612  -3.039  1.00 0.00 ? 62 LYS A CG   3  
ATOM 3507  C CD   . LYS A 1 62 ? 0.557   -6.618  -4.138  1.00 0.00 ? 62 LYS A CD   3  
ATOM 3508  C CE   . LYS A 1 62 ? 0.877   -6.054  -5.513  1.00 0.00 ? 62 LYS A CE   3  
ATOM 3509  N NZ   . LYS A 1 62 ? 0.652   -7.056  -6.591  1.00 0.00 ? 62 LYS A NZ   3  
ATOM 3510  H H    . LYS A 1 62 ? -0.984  -5.883  0.527   1.00 0.00 ? 62 LYS A H    3  
ATOM 3511  H HA   . LYS A 1 62 ? 0.901   -4.303  -0.654  1.00 0.00 ? 62 LYS A HA   3  
ATOM 3512  H HB2  . LYS A 1 62 ? 0.296   -6.662  -1.282  1.00 0.00 ? 62 LYS A HB2  3  
ATOM 3513  H HB3  . LYS A 1 62 ? -1.053  -6.010  -2.203  1.00 0.00 ? 62 LYS A HB3  3  
ATOM 3514  H HG2  . LYS A 1 62 ? 0.715   -4.616  -3.430  1.00 0.00 ? 62 LYS A HG2  3  
ATOM 3515  H HG3  . LYS A 1 62 ? 1.883   -5.734  -2.722  1.00 0.00 ? 62 LYS A HG3  3  
ATOM 3516  H HD2  . LYS A 1 62 ? 1.153   -7.504  -3.976  1.00 0.00 ? 62 LYS A HD2  3  
ATOM 3517  H HD3  . LYS A 1 62 ? -0.492  -6.877  -4.100  1.00 0.00 ? 62 LYS A HD3  3  
ATOM 3518  H HE2  . LYS A 1 62 ? 0.246   -5.197  -5.692  1.00 0.00 ? 62 LYS A HE2  3  
ATOM 3519  H HE3  . LYS A 1 62 ? 1.913   -5.747  -5.529  1.00 0.00 ? 62 LYS A HE3  3  
ATOM 3520  H HZ1  . LYS A 1 62 ? 1.054   -7.975  -6.313  1.00 0.00 ? 62 LYS A HZ1  3  
ATOM 3521  H HZ2  . LYS A 1 62 ? 1.107   -6.743  -7.471  1.00 0.00 ? 62 LYS A HZ2  3  
ATOM 3522  H HZ3  . LYS A 1 62 ? -0.367  -7.173  -6.762  1.00 0.00 ? 62 LYS A HZ3  3  
ATOM 3523  N N    . THR A 1 63 ? -2.048  -3.638  -2.003  1.00 0.00 ? 63 THR A N    3  
ATOM 3524  C CA   . THR A 1 63 ? -2.818  -2.604  -2.684  1.00 0.00 ? 63 THR A CA   3  
ATOM 3525  C C    . THR A 1 63 ? -3.077  -1.417  -1.764  1.00 0.00 ? 63 THR A C    3  
ATOM 3526  O O    . THR A 1 63 ? -2.626  -0.303  -2.031  1.00 0.00 ? 63 THR A O    3  
ATOM 3527  C CB   . THR A 1 63 ? -4.166  -3.150  -3.192  1.00 0.00 ? 63 THR A CB   3  
ATOM 3528  O OG1  . THR A 1 63 ? -3.954  -4.340  -3.960  1.00 0.00 ? 63 THR A OG1  3  
ATOM 3529  C CG2  . THR A 1 63 ? -4.884  -2.112  -4.041  1.00 0.00 ? 63 THR A CG2  3  
ATOM 3530  H H    . THR A 1 63 ? -2.463  -4.509  -1.832  1.00 0.00 ? 63 THR A H    3  
ATOM 3531  H HA   . THR A 1 63 ? -2.244  -2.269  -3.536  1.00 0.00 ? 63 THR A HA   3  
ATOM 3532  H HB   . THR A 1 63 ? -4.785  -3.387  -2.339  1.00 0.00 ? 63 THR A HB   3  
ATOM 3533  H HG1  . THR A 1 63 ? -3.136  -4.259  -4.457  1.00 0.00 ? 63 THR A HG1  3  
ATOM 3534  H HG21 . THR A 1 63 ? -4.971  -2.475  -5.055  1.00 0.00 ? 63 THR A HG21 3  
ATOM 3535  H HG22 . THR A 1 63 ? -4.321  -1.191  -4.036  1.00 0.00 ? 63 THR A HG22 3  
ATOM 3536  H HG23 . THR A 1 63 ? -5.868  -1.935  -3.636  1.00 0.00 ? 63 THR A HG23 3  
ATOM 3537  N N    . TRP A 1 64 ? -3.805  -1.661  -0.681  1.00 0.00 ? 64 TRP A N    3  
ATOM 3538  C CA   . TRP A 1 64 ? -4.124  -0.610  0.279   1.00 0.00 ? 64 TRP A CA   3  
ATOM 3539  C C    . TRP A 1 64 ? -2.943  0.336   0.462   1.00 0.00 ? 64 TRP A C    3  
ATOM 3540  O O    . TRP A 1 64 ? -3.109  1.556   0.477   1.00 0.00 ? 64 TRP A O    3  
ATOM 3541  C CB   . TRP A 1 64 ? -4.517  -1.222  1.624   1.00 0.00 ? 64 TRP A CB   3  
ATOM 3542  C CG   . TRP A 1 64 ? -5.022  -0.214  2.611   1.00 0.00 ? 64 TRP A CG   3  
ATOM 3543  C CD1  . TRP A 1 64 ? -6.325  0.130   2.836   1.00 0.00 ? 64 TRP A CD1  3  
ATOM 3544  C CD2  . TRP A 1 64 ? -4.235  0.582   3.503   1.00 0.00 ? 64 TRP A CD2  3  
ATOM 3545  N NE1  . TRP A 1 64 ? -6.394  1.092   3.815   1.00 0.00 ? 64 TRP A NE1  3  
ATOM 3546  C CE2  . TRP A 1 64 ? -5.126  1.386   4.241   1.00 0.00 ? 64 TRP A CE2  3  
ATOM 3547  C CE3  . TRP A 1 64 ? -2.864  0.692   3.752   1.00 0.00 ? 64 TRP A CE3  3  
ATOM 3548  C CZ2  . TRP A 1 64 ? -4.688  2.287   5.208   1.00 0.00 ? 64 TRP A CZ2  3  
ATOM 3549  C CZ3  . TRP A 1 64 ? -2.432  1.587   4.712   1.00 0.00 ? 64 TRP A CZ3  3  
ATOM 3550  C CH2  . TRP A 1 64 ? -3.341  2.374   5.431   1.00 0.00 ? 64 TRP A CH2  3  
ATOM 3551  H H    . TRP A 1 64 ? -4.137  -2.570  -0.523  1.00 0.00 ? 64 TRP A H    3  
ATOM 3552  H HA   . TRP A 1 64 ? -4.962  -0.051  -0.110  1.00 0.00 ? 64 TRP A HA   3  
ATOM 3553  H HB2  . TRP A 1 64 ? -5.295  -1.954  1.467   1.00 0.00 ? 64 TRP A HB2  3  
ATOM 3554  H HB3  . TRP A 1 64 ? -3.653  -1.708  2.056   1.00 0.00 ? 64 TRP A HB3  3  
ATOM 3555  H HD1  . TRP A 1 64 ? -7.166  -0.297  2.313   1.00 0.00 ? 64 TRP A HD1  3  
ATOM 3556  H HE1  . TRP A 1 64 ? -7.219  1.501   4.154   1.00 0.00 ? 64 TRP A HE1  3  
ATOM 3557  H HE3  . TRP A 1 64 ? -2.148  0.094   3.209   1.00 0.00 ? 64 TRP A HE3  3  
ATOM 3558  H HZ2  . TRP A 1 64 ? -5.376  2.900   5.771   1.00 0.00 ? 64 TRP A HZ2  3  
ATOM 3559  H HZ3  . TRP A 1 64 ? -1.376  1.686   4.918   1.00 0.00 ? 64 TRP A HZ3  3  
ATOM 3560  H HH2  . TRP A 1 64 ? -2.958  3.060   6.172   1.00 0.00 ? 64 TRP A HH2  3  
ATOM 3561  N N    . TYR A 1 65 ? -1.751  -0.233  0.601   1.00 0.00 ? 65 TYR A N    3  
ATOM 3562  C CA   . TYR A 1 65 ? -0.542  0.561   0.785   1.00 0.00 ? 65 TYR A CA   3  
ATOM 3563  C C    . TYR A 1 65 ? -0.292  1.461   -0.421  1.00 0.00 ? 65 TYR A C    3  
ATOM 3564  O O    . TYR A 1 65 ? -0.221  2.683   -0.292  1.00 0.00 ? 65 TYR A O    3  
ATOM 3565  C CB   . TYR A 1 65 ? 0.664   -0.353  1.012   1.00 0.00 ? 65 TYR A CB   3  
ATOM 3566  C CG   . TYR A 1 65 ? 0.912   -0.679  2.467   1.00 0.00 ? 65 TYR A CG   3  
ATOM 3567  C CD1  . TYR A 1 65 ? -0.074  -1.275  3.244   1.00 0.00 ? 65 TYR A CD1  3  
ATOM 3568  C CD2  . TYR A 1 65 ? 2.132   -0.390  3.066   1.00 0.00 ? 65 TYR A CD2  3  
ATOM 3569  C CE1  . TYR A 1 65 ? 0.148   -1.574  4.574   1.00 0.00 ? 65 TYR A CE1  3  
ATOM 3570  C CE2  . TYR A 1 65 ? 2.363   -0.687  4.395   1.00 0.00 ? 65 TYR A CE2  3  
ATOM 3571  C CZ   . TYR A 1 65 ? 1.368   -1.278  5.145   1.00 0.00 ? 65 TYR A CZ   3  
ATOM 3572  O OH   . TYR A 1 65 ? 1.593   -1.576  6.470   1.00 0.00 ? 65 TYR A OH   3  
ATOM 3573  H H    . TYR A 1 65 ? -1.682  -1.210  0.580   1.00 0.00 ? 65 TYR A H    3  
ATOM 3574  H HA   . TYR A 1 65 ? -0.681  1.180   1.660   1.00 0.00 ? 65 TYR A HA   3  
ATOM 3575  H HB2  . TYR A 1 65 ? 0.507   -1.282  0.487   1.00 0.00 ? 65 TYR A HB2  3  
ATOM 3576  H HB3  . TYR A 1 65 ? 1.550   0.129   0.624   1.00 0.00 ? 65 TYR A HB3  3  
ATOM 3577  H HD1  . TYR A 1 65 ? -1.028  -1.506  2.793   1.00 0.00 ? 65 TYR A HD1  3  
ATOM 3578  H HD2  . TYR A 1 65 ? 2.910   0.073   2.476   1.00 0.00 ? 65 TYR A HD2  3  
ATOM 3579  H HE1  . TYR A 1 65 ? -0.631  -2.038  5.161   1.00 0.00 ? 65 TYR A HE1  3  
ATOM 3580  H HE2  . TYR A 1 65 ? 3.319   -0.455  4.843   1.00 0.00 ? 65 TYR A HE2  3  
ATOM 3581  H HH   . TYR A 1 65 ? 0.940   -1.129  7.013   1.00 0.00 ? 65 TYR A HH   3  
ATOM 3582  N N    . GLN A 1 66 ? -0.160  0.848   -1.592  1.00 0.00 ? 66 GLN A N    3  
ATOM 3583  C CA   . GLN A 1 66 ? 0.081   1.593   -2.822  1.00 0.00 ? 66 GLN A CA   3  
ATOM 3584  C C    . GLN A 1 66 ? -0.912  2.741   -2.967  1.00 0.00 ? 66 GLN A C    3  
ATOM 3585  O O    . GLN A 1 66 ? -0.527  3.877   -3.238  1.00 0.00 ? 66 GLN A O    3  
ATOM 3586  C CB   . GLN A 1 66 ? -0.014  0.664   -4.033  1.00 0.00 ? 66 GLN A CB   3  
ATOM 3587  C CG   . GLN A 1 66 ? 0.786   1.145   -5.233  1.00 0.00 ? 66 GLN A CG   3  
ATOM 3588  C CD   . GLN A 1 66 ? 0.578   2.619   -5.521  1.00 0.00 ? 66 GLN A CD   3  
ATOM 3589  O OE1  . GLN A 1 66 ? 1.406   3.456   -5.160  1.00 0.00 ? 66 GLN A OE1  3  
ATOM 3590  N NE2  . GLN A 1 66 ? -0.531  2.945   -6.174  1.00 0.00 ? 66 GLN A NE2  3  
ATOM 3591  H H    . GLN A 1 66 ? -0.227  -0.129  -1.630  1.00 0.00 ? 66 GLN A H    3  
ATOM 3592  H HA   . GLN A 1 66 ? 1.079   2.002   -2.771  1.00 0.00 ? 66 GLN A HA   3  
ATOM 3593  H HB2  . GLN A 1 66 ? 0.350   -0.313  -3.753  1.00 0.00 ? 66 GLN A HB2  3  
ATOM 3594  H HB3  . GLN A 1 66 ? -1.050  0.583   -4.329  1.00 0.00 ? 66 GLN A HB3  3  
ATOM 3595  H HG2  . GLN A 1 66 ? 1.835   0.976   -5.041  1.00 0.00 ? 66 GLN A HG2  3  
ATOM 3596  H HG3  . GLN A 1 66 ? 0.484   0.578   -6.101  1.00 0.00 ? 66 GLN A HG3  3  
ATOM 3597  H HE21 . GLN A 1 66 ? -1.146  2.224   -6.429  1.00 0.00 ? 66 GLN A HE21 3  
ATOM 3598  H HE22 . GLN A 1 66 ? -0.691  3.890   -6.372  1.00 0.00 ? 66 GLN A HE22 3  
ATOM 3599  N N    . ASN A 1 67 ? -2.193  2.436   -2.783  1.00 0.00 ? 67 ASN A N    3  
ATOM 3600  C CA   . ASN A 1 67 ? -3.242  3.442   -2.895  1.00 0.00 ? 67 ASN A CA   3  
ATOM 3601  C C    . ASN A 1 67 ? -3.030  4.563   -1.882  1.00 0.00 ? 67 ASN A C    3  
ATOM 3602  O O    . ASN A 1 67 ? -3.580  5.656   -2.025  1.00 0.00 ? 67 ASN A O    3  
ATOM 3603  C CB   . ASN A 1 67 ? -4.616  2.802   -2.685  1.00 0.00 ? 67 ASN A CB   3  
ATOM 3604  C CG   . ASN A 1 67 ? -5.221  2.294   -3.979  1.00 0.00 ? 67 ASN A CG   3  
ATOM 3605  O OD1  . ASN A 1 67 ? -6.128  2.910   -4.538  1.00 0.00 ? 67 ASN A OD1  3  
ATOM 3606  N ND2  . ASN A 1 67 ? -4.720  1.162   -4.461  1.00 0.00 ? 67 ASN A ND2  3  
ATOM 3607  H H    . ASN A 1 67 ? -2.438  1.512   -2.569  1.00 0.00 ? 67 ASN A H    3  
ATOM 3608  H HA   . ASN A 1 67 ? -3.197  3.859   -3.890  1.00 0.00 ? 67 ASN A HA   3  
ATOM 3609  H HB2  . ASN A 1 67 ? -4.518  1.969   -2.004  1.00 0.00 ? 67 ASN A HB2  3  
ATOM 3610  H HB3  . ASN A 1 67 ? -5.286  3.534   -2.258  1.00 0.00 ? 67 ASN A HB3  3  
ATOM 3611  H HD21 . ASN A 1 67 ? -3.998  0.725   -3.963  1.00 0.00 ? 67 ASN A HD21 3  
ATOM 3612  H HD22 . ASN A 1 67 ? -5.092  0.811   -5.297  1.00 0.00 ? 67 ASN A HD22 3  
ATOM 3613  N N    . ARG A 1 68 ? -2.230  4.284   -0.858  1.00 0.00 ? 68 ARG A N    3  
ATOM 3614  C CA   . ARG A 1 68 ? -1.946  5.268   0.180   1.00 0.00 ? 68 ARG A CA   3  
ATOM 3615  C C    . ARG A 1 68 ? -0.691  6.067   -0.157  1.00 0.00 ? 68 ARG A C    3  
ATOM 3616  O O    . ARG A 1 68 ? -0.686  7.296   -0.083  1.00 0.00 ? 68 ARG A O    3  
ATOM 3617  C CB   . ARG A 1 68 ? -1.777  4.578   1.535   1.00 0.00 ? 68 ARG A CB   3  
ATOM 3618  C CG   . ARG A 1 68 ? -3.068  4.000   2.090   1.00 0.00 ? 68 ARG A CG   3  
ATOM 3619  C CD   . ARG A 1 68 ? -3.931  5.077   2.728   1.00 0.00 ? 68 ARG A CD   3  
ATOM 3620  N NE   . ARG A 1 68 ? -5.214  4.550   3.185   1.00 0.00 ? 68 ARG A NE   3  
ATOM 3621  C CZ   . ARG A 1 68 ? -6.118  5.277   3.834   1.00 0.00 ? 68 ARG A CZ   3  
ATOM 3622  N NH1  . ARG A 1 68 ? -5.880  6.554   4.100   1.00 0.00 ? 68 ARG A NH1  3  
ATOM 3623  N NH2  . ARG A 1 68 ? -7.263  4.726   4.217   1.00 0.00 ? 68 ARG A NH2  3  
ATOM 3624  H H    . ARG A 1 68 ? -1.822  3.395   -0.798  1.00 0.00 ? 68 ARG A H    3  
ATOM 3625  H HA   . ARG A 1 68 ? -2.786  5.945   0.234   1.00 0.00 ? 68 ARG A HA   3  
ATOM 3626  H HB2  . ARG A 1 68 ? -1.064  3.773   1.429   1.00 0.00 ? 68 ARG A HB2  3  
ATOM 3627  H HB3  . ARG A 1 68 ? -1.394  5.295   2.245   1.00 0.00 ? 68 ARG A HB3  3  
ATOM 3628  H HG2  . ARG A 1 68 ? -3.622  3.541   1.284   1.00 0.00 ? 68 ARG A HG2  3  
ATOM 3629  H HG3  . ARG A 1 68 ? -2.827  3.255   2.834   1.00 0.00 ? 68 ARG A HG3  3  
ATOM 3630  H HD2  . ARG A 1 68 ? -3.401  5.490   3.573   1.00 0.00 ? 68 ARG A HD2  3  
ATOM 3631  H HD3  . ARG A 1 68 ? -4.110  5.854   2.000   1.00 0.00 ? 68 ARG A HD3  3  
ATOM 3632  H HE   . ARG A 1 68 ? -5.411  3.609   2.999   1.00 0.00 ? 68 ARG A HE   3  
ATOM 3633  H HH11 . ARG A 1 68 ? -5.019  6.972   3.811   1.00 0.00 ? 68 ARG A HH11 3  
ATOM 3634  H HH12 . ARG A 1 68 ? -6.563  7.099   4.587   1.00 0.00 ? 68 ARG A HH12 3  
ATOM 3635  H HH21 . ARG A 1 68 ? -7.446  3.764   4.019   1.00 0.00 ? 68 ARG A HH21 3  
ATOM 3636  H HH22 . ARG A 1 68 ? -7.942  5.273   4.705   1.00 0.00 ? 68 ARG A HH22 3  
ATOM 3637  N N    . ARG A 1 69 ? 0.372   5.360   -0.527  1.00 0.00 ? 69 ARG A N    3  
ATOM 3638  C CA   . ARG A 1 69 ? 1.634   6.002   -0.873  1.00 0.00 ? 69 ARG A CA   3  
ATOM 3639  C C    . ARG A 1 69 ? 1.420   7.096   -1.916  1.00 0.00 ? 69 ARG A C    3  
ATOM 3640  O O    . ARG A 1 69 ? 1.980   8.186   -1.811  1.00 0.00 ? 69 ARG A O    3  
ATOM 3641  C CB   . ARG A 1 69 ? 2.630   4.968   -1.401  1.00 0.00 ? 69 ARG A CB   3  
ATOM 3642  C CG   . ARG A 1 69 ? 3.484   4.335   -0.315  1.00 0.00 ? 69 ARG A CG   3  
ATOM 3643  C CD   . ARG A 1 69 ? 4.543   3.415   -0.903  1.00 0.00 ? 69 ARG A CD   3  
ATOM 3644  N NE   . ARG A 1 69 ? 5.400   4.109   -1.860  1.00 0.00 ? 69 ARG A NE   3  
ATOM 3645  C CZ   . ARG A 1 69 ? 5.096   4.261   -3.144  1.00 0.00 ? 69 ARG A CZ   3  
ATOM 3646  N NH1  . ARG A 1 69 ? 3.961   3.770   -3.623  1.00 0.00 ? 69 ARG A NH1  3  
ATOM 3647  N NH2  . ARG A 1 69 ? 5.928   4.905   -3.953  1.00 0.00 ? 69 ARG A NH2  3  
ATOM 3648  H H    . ARG A 1 69 ? 0.307   4.383   -0.566  1.00 0.00 ? 69 ARG A H    3  
ATOM 3649  H HA   . ARG A 1 69 ? 2.036   6.451   0.023   1.00 0.00 ? 69 ARG A HA   3  
ATOM 3650  H HB2  . ARG A 1 69 ? 2.083   4.182   -1.902  1.00 0.00 ? 69 ARG A HB2  3  
ATOM 3651  H HB3  . ARG A 1 69 ? 3.286   5.448   -2.111  1.00 0.00 ? 69 ARG A HB3  3  
ATOM 3652  H HG2  . ARG A 1 69 ? 3.975   5.117   0.246   1.00 0.00 ? 69 ARG A HG2  3  
ATOM 3653  H HG3  . ARG A 1 69 ? 2.847   3.763   0.343   1.00 0.00 ? 69 ARG A HG3  3  
ATOM 3654  H HD2  . ARG A 1 69 ? 5.153   3.031   -0.100  1.00 0.00 ? 69 ARG A HD2  3  
ATOM 3655  H HD3  . ARG A 1 69 ? 4.049   2.596   -1.404  1.00 0.00 ? 69 ARG A HD3  3  
ATOM 3656  H HE   . ARG A 1 69 ? 6.244   4.480   -1.528  1.00 0.00 ? 69 ARG A HE   3  
ATOM 3657  H HH11 . ARG A 1 69 ? 3.332   3.285   -3.016  1.00 0.00 ? 69 ARG A HH11 3  
ATOM 3658  H HH12 . ARG A 1 69 ? 3.734   3.886   -4.590  1.00 0.00 ? 69 ARG A HH12 3  
ATOM 3659  H HH21 . ARG A 1 69 ? 6.785   5.276   -3.596  1.00 0.00 ? 69 ARG A HH21 3  
ATOM 3660  H HH22 . ARG A 1 69 ? 5.699   5.018   -4.919  1.00 0.00 ? 69 ARG A HH22 3  
ATOM 3661  N N    . MET A 1 70 ? 0.605   6.795   -2.922  1.00 0.00 ? 70 MET A N    3  
ATOM 3662  C CA   . MET A 1 70 ? 0.316   7.752   -3.983  1.00 0.00 ? 70 MET A CA   3  
ATOM 3663  C C    . MET A 1 70 ? -0.067  9.109   -3.402  1.00 0.00 ? 70 MET A C    3  
ATOM 3664  O O    . MET A 1 70 ? 0.512   10.135  -3.759  1.00 0.00 ? 70 MET A O    3  
ATOM 3665  C CB   . MET A 1 70 ? -0.812  7.231   -4.876  1.00 0.00 ? 70 MET A CB   3  
ATOM 3666  C CG   . MET A 1 70 ? -2.112  6.979   -4.129  1.00 0.00 ? 70 MET A CG   3  
ATOM 3667  S SD   . MET A 1 70 ? -3.343  6.137   -5.143  1.00 0.00 ? 70 MET A SD   3  
ATOM 3668  C CE   . MET A 1 70 ? -3.887  7.478   -6.197  1.00 0.00 ? 70 MET A CE   3  
ATOM 3669  H H    . MET A 1 70 ? 0.187   5.909   -2.951  1.00 0.00 ? 70 MET A H    3  
ATOM 3670  H HA   . MET A 1 70 ? 1.209   7.867   -4.578  1.00 0.00 ? 70 MET A HA   3  
ATOM 3671  H HB2  . MET A 1 70 ? -1.003  7.955   -5.654  1.00 0.00 ? 70 MET A HB2  3  
ATOM 3672  H HB3  . MET A 1 70 ? -0.497  6.303   -5.329  1.00 0.00 ? 70 MET A HB3  3  
ATOM 3673  H HG2  . MET A 1 70 ? -1.902  6.369   -3.263  1.00 0.00 ? 70 MET A HG2  3  
ATOM 3674  H HG3  . MET A 1 70 ? -2.516  7.927   -3.809  1.00 0.00 ? 70 MET A HG3  3  
ATOM 3675  H HE1  . MET A 1 70 ? -3.262  8.343   -6.032  1.00 0.00 ? 70 MET A HE1  3  
ATOM 3676  H HE2  . MET A 1 70 ? -3.816  7.174   -7.231  1.00 0.00 ? 70 MET A HE2  3  
ATOM 3677  H HE3  . MET A 1 70 ? -4.913  7.725   -5.964  1.00 0.00 ? 70 MET A HE3  3  
ATOM 3678  N N    . LYS A 1 71 ? -1.046  9.108   -2.503  1.00 0.00 ? 71 LYS A N    3  
ATOM 3679  C CA   . LYS A 1 71 ? -1.506  10.339  -1.871  1.00 0.00 ? 71 LYS A CA   3  
ATOM 3680  C C    . LYS A 1 71 ? -0.436  10.906  -0.943  1.00 0.00 ? 71 LYS A C    3  
ATOM 3681  O O    . LYS A 1 71 ? -0.320  12.122  -0.785  1.00 0.00 ? 71 LYS A O    3  
ATOM 3682  C CB   . LYS A 1 71 ? -2.794  10.083  -1.085  1.00 0.00 ? 71 LYS A CB   3  
ATOM 3683  C CG   . LYS A 1 71 ? -4.007  9.845   -1.968  1.00 0.00 ? 71 LYS A CG   3  
ATOM 3684  C CD   . LYS A 1 71 ? -5.152  9.222   -1.186  1.00 0.00 ? 71 LYS A CD   3  
ATOM 3685  C CE   . LYS A 1 71 ? -6.017  10.283  -0.524  1.00 0.00 ? 71 LYS A CE   3  
ATOM 3686  N NZ   . LYS A 1 71 ? -7.370  9.762   -0.184  1.00 0.00 ? 71 LYS A NZ   3  
ATOM 3687  H H    . LYS A 1 71 ? -1.469  8.258   -2.259  1.00 0.00 ? 71 LYS A H    3  
ATOM 3688  H HA   . LYS A 1 71 ? -1.707  11.058  -2.651  1.00 0.00 ? 71 LYS A HA   3  
ATOM 3689  H HB2  . LYS A 1 71 ? -2.653  9.213   -0.460  1.00 0.00 ? 71 LYS A HB2  3  
ATOM 3690  H HB3  . LYS A 1 71 ? -2.995  10.939  -0.457  1.00 0.00 ? 71 LYS A HB3  3  
ATOM 3691  H HG2  . LYS A 1 71 ? -4.336  10.789  -2.375  1.00 0.00 ? 71 LYS A HG2  3  
ATOM 3692  H HG3  . LYS A 1 71 ? -3.730  9.180   -2.774  1.00 0.00 ? 71 LYS A HG3  3  
ATOM 3693  H HD2  . LYS A 1 71 ? -5.764  8.643   -1.861  1.00 0.00 ? 71 LYS A HD2  3  
ATOM 3694  H HD3  . LYS A 1 71 ? -4.744  8.574   -0.423  1.00 0.00 ? 71 LYS A HD3  3  
ATOM 3695  H HE2  . LYS A 1 71 ? -5.530  10.613  0.380   1.00 0.00 ? 71 LYS A HE2  3  
ATOM 3696  H HE3  . LYS A 1 71 ? -6.122  11.117  -1.202  1.00 0.00 ? 71 LYS A HE3  3  
ATOM 3697  H HZ1  . LYS A 1 71 ? -8.084  10.184  -0.813  1.00 0.00 ? 71 LYS A HZ1  3  
ATOM 3698  H HZ2  . LYS A 1 71 ? -7.608  10.000  0.800   1.00 0.00 ? 71 LYS A HZ2  3  
ATOM 3699  H HZ3  . LYS A 1 71 ? -7.394  8.729   -0.296  1.00 0.00 ? 71 LYS A HZ3  3  
ATOM 3700  N N    . TRP A 1 72 ? 0.342   10.020  -0.333  1.00 0.00 ? 72 TRP A N    3  
ATOM 3701  C CA   . TRP A 1 72 ? 1.403   10.433  0.579   1.00 0.00 ? 72 TRP A CA   3  
ATOM 3702  C C    . TRP A 1 72 ? 2.511   11.164  -0.172  1.00 0.00 ? 72 TRP A C    3  
ATOM 3703  O O    . TRP A 1 72 ? 3.111   12.104  0.349   1.00 0.00 ? 72 TRP A O    3  
ATOM 3704  C CB   . TRP A 1 72 ? 1.979   9.218   1.308   1.00 0.00 ? 72 TRP A CB   3  
ATOM 3705  C CG   . TRP A 1 72 ? 3.378   9.430   1.801   1.00 0.00 ? 72 TRP A CG   3  
ATOM 3706  C CD1  . TRP A 1 72 ? 3.757   10.112  2.922   1.00 0.00 ? 72 TRP A CD1  3  
ATOM 3707  C CD2  . TRP A 1 72 ? 4.583   8.958   1.189   1.00 0.00 ? 72 TRP A CD2  3  
ATOM 3708  N NE1  . TRP A 1 72 ? 5.126   10.093  3.043   1.00 0.00 ? 72 TRP A NE1  3  
ATOM 3709  C CE2  . TRP A 1 72 ? 5.656   9.391   1.993   1.00 0.00 ? 72 TRP A CE2  3  
ATOM 3710  C CE3  . TRP A 1 72 ? 4.861   8.211   0.041   1.00 0.00 ? 72 TRP A CE3  3  
ATOM 3711  C CZ2  . TRP A 1 72 ? 6.982   9.101   1.684   1.00 0.00 ? 72 TRP A CZ2  3  
ATOM 3712  C CZ3  . TRP A 1 72 ? 6.177   7.925   -0.265  1.00 0.00 ? 72 TRP A CZ3  3  
ATOM 3713  C CH2  . TRP A 1 72 ? 7.224   8.368   0.554   1.00 0.00 ? 72 TRP A CH2  3  
ATOM 3714  H H    . TRP A 1 72 ? 0.200   9.064   -0.499  1.00 0.00 ? 72 TRP A H    3  
ATOM 3715  H HA   . TRP A 1 72 ? 0.971   11.106  1.305   1.00 0.00 ? 72 TRP A HA   3  
ATOM 3716  H HB2  . TRP A 1 72 ? 1.356   8.989   2.160   1.00 0.00 ? 72 TRP A HB2  3  
ATOM 3717  H HB3  . TRP A 1 72 ? 1.986   8.374   0.634   1.00 0.00 ? 72 TRP A HB3  3  
ATOM 3718  H HD1  . TRP A 1 72 ? 3.071   10.593  3.603   1.00 0.00 ? 72 TRP A HD1  3  
ATOM 3719  H HE1  . TRP A 1 72 ? 5.639   10.513  3.766   1.00 0.00 ? 72 TRP A HE1  3  
ATOM 3720  H HE3  . TRP A 1 72 ? 4.067   7.861   -0.602  1.00 0.00 ? 72 TRP A HE3  3  
ATOM 3721  H HZ2  . TRP A 1 72 ? 7.800   9.435   2.305   1.00 0.00 ? 72 TRP A HZ2  3  
ATOM 3722  H HZ3  . TRP A 1 72 ? 6.411   7.349   -1.148  1.00 0.00 ? 72 TRP A HZ3  3  
ATOM 3723  H HH2  . TRP A 1 72 ? 8.237   8.121   0.276   1.00 0.00 ? 72 TRP A HH2  3  
ATOM 3724  N N    . LYS A 1 73 ? 2.778   10.726  -1.397  1.00 0.00 ? 73 LYS A N    3  
ATOM 3725  C CA   . LYS A 1 73 ? 3.813   11.339  -2.221  1.00 0.00 ? 73 LYS A CA   3  
ATOM 3726  C C    . LYS A 1 73 ? 3.622   12.850  -2.299  1.00 0.00 ? 73 LYS A C    3  
ATOM 3727  O O    . LYS A 1 73 ? 4.574   13.616  -2.147  1.00 0.00 ? 73 LYS A O    3  
ATOM 3728  C CB   . LYS A 1 73 ? 3.796   10.739  -3.628  1.00 0.00 ? 73 LYS A CB   3  
ATOM 3729  C CG   . LYS A 1 73 ? 4.476   9.383   -3.720  1.00 0.00 ? 73 LYS A CG   3  
ATOM 3730  C CD   . LYS A 1 73 ? 4.671   8.953   -5.164  1.00 0.00 ? 73 LYS A CD   3  
ATOM 3731  C CE   . LYS A 1 73 ? 5.262   7.555   -5.254  1.00 0.00 ? 73 LYS A CE   3  
ATOM 3732  N NZ   . LYS A 1 73 ? 6.750   7.576   -5.200  1.00 0.00 ? 73 LYS A NZ   3  
ATOM 3733  H H    . LYS A 1 73 ? 2.264   9.972   -1.758  1.00 0.00 ? 73 LYS A H    3  
ATOM 3734  H HA   . LYS A 1 73 ? 4.768   11.132  -1.762  1.00 0.00 ? 73 LYS A HA   3  
ATOM 3735  H HB2  . LYS A 1 73 ? 2.770   10.626  -3.946  1.00 0.00 ? 73 LYS A HB2  3  
ATOM 3736  H HB3  . LYS A 1 73 ? 4.300   11.417  -4.302  1.00 0.00 ? 73 LYS A HB3  3  
ATOM 3737  H HG2  . LYS A 1 73 ? 5.441   9.442   -3.239  1.00 0.00 ? 73 LYS A HG2  3  
ATOM 3738  H HG3  . LYS A 1 73 ? 3.864   8.649   -3.215  1.00 0.00 ? 73 LYS A HG3  3  
ATOM 3739  H HD2  . LYS A 1 73 ? 3.715   8.961   -5.665  1.00 0.00 ? 73 LYS A HD2  3  
ATOM 3740  H HD3  . LYS A 1 73 ? 5.340   9.649   -5.650  1.00 0.00 ? 73 LYS A HD3  3  
ATOM 3741  H HE2  . LYS A 1 73 ? 4.889   6.967   -4.430  1.00 0.00 ? 73 LYS A HE2  3  
ATOM 3742  H HE3  . LYS A 1 73 ? 4.951   7.106   -6.186  1.00 0.00 ? 73 LYS A HE3  3  
ATOM 3743  H HZ1  . LYS A 1 73 ? 7.101   6.734   -4.701  1.00 0.00 ? 73 LYS A HZ1  3  
ATOM 3744  H HZ2  . LYS A 1 73 ? 7.077   8.425   -4.695  1.00 0.00 ? 73 LYS A HZ2  3  
ATOM 3745  H HZ3  . LYS A 1 73 ? 7.143   7.585   -6.162  1.00 0.00 ? 73 LYS A HZ3  3  
ATOM 3746  N N    . LYS A 1 74 ? 2.385   13.274  -2.537  1.00 0.00 ? 74 LYS A N    3  
ATOM 3747  C CA   . LYS A 1 74 ? 2.068   14.694  -2.632  1.00 0.00 ? 74 LYS A CA   3  
ATOM 3748  C C    . LYS A 1 74 ? 1.630   15.246  -1.280  1.00 0.00 ? 74 LYS A C    3  
ATOM 3749  O O    . LYS A 1 74 ? 0.937   14.572  -0.518  1.00 0.00 ? 74 LYS A O    3  
ATOM 3750  C CB   . LYS A 1 74 ? 0.965   14.922  -3.669  1.00 0.00 ? 74 LYS A CB   3  
ATOM 3751  C CG   . LYS A 1 74 ? 0.621   16.387  -3.879  1.00 0.00 ? 74 LYS A CG   3  
ATOM 3752  C CD   . LYS A 1 74 ? 0.108   16.643  -5.286  1.00 0.00 ? 74 LYS A CD   3  
ATOM 3753  C CE   . LYS A 1 74 ? 0.144   18.124  -5.632  1.00 0.00 ? 74 LYS A CE   3  
ATOM 3754  N NZ   . LYS A 1 74 ? -1.063  18.839  -5.133  1.00 0.00 ? 74 LYS A NZ   3  
ATOM 3755  H H    . LYS A 1 74 ? 1.668   12.615  -2.649  1.00 0.00 ? 74 LYS A H    3  
ATOM 3756  H HA   . LYS A 1 74 ? 2.960   15.213  -2.948  1.00 0.00 ? 74 LYS A HA   3  
ATOM 3757  H HB2  . LYS A 1 74 ? 1.285   14.510  -4.614  1.00 0.00 ? 74 LYS A HB2  3  
ATOM 3758  H HB3  . LYS A 1 74 ? 0.072   14.407  -3.346  1.00 0.00 ? 74 LYS A HB3  3  
ATOM 3759  H HG2  . LYS A 1 74 ? -0.142  16.673  -3.171  1.00 0.00 ? 74 LYS A HG2  3  
ATOM 3760  H HG3  . LYS A 1 74 ? 1.508   16.982  -3.715  1.00 0.00 ? 74 LYS A HG3  3  
ATOM 3761  H HD2  . LYS A 1 74 ? 0.726   16.106  -5.989  1.00 0.00 ? 74 LYS A HD2  3  
ATOM 3762  H HD3  . LYS A 1 74 ? -0.911  16.290  -5.357  1.00 0.00 ? 74 LYS A HD3  3  
ATOM 3763  H HE2  . LYS A 1 74 ? 1.022   18.563  -5.184  1.00 0.00 ? 74 LYS A HE2  3  
ATOM 3764  H HE3  . LYS A 1 74 ? 0.196   18.228  -6.705  1.00 0.00 ? 74 LYS A HE3  3  
ATOM 3765  H HZ1  . LYS A 1 74 ? -0.871  19.256  -4.200  1.00 0.00 ? 74 LYS A HZ1  3  
ATOM 3766  H HZ2  . LYS A 1 74 ? -1.861  18.178  -5.048  1.00 0.00 ? 74 LYS A HZ2  3  
ATOM 3767  H HZ3  . LYS A 1 74 ? -1.326  19.599  -5.793  1.00 0.00 ? 74 LYS A HZ3  3  
ATOM 3768  N N    . SER A 1 75 ? 2.039   16.477  -0.988  1.00 0.00 ? 75 SER A N    3  
ATOM 3769  C CA   . SER A 1 75 ? 1.691   17.119  0.275   1.00 0.00 ? 75 SER A CA   3  
ATOM 3770  C C    . SER A 1 75 ? 0.288   17.715  0.212   1.00 0.00 ? 75 SER A C    3  
ATOM 3771  O O    . SER A 1 75 ? -0.556  17.435  1.062   1.00 0.00 ? 75 SER A O    3  
ATOM 3772  C CB   . SER A 1 75 ? 2.707   18.211  0.613   1.00 0.00 ? 75 SER A CB   3  
ATOM 3773  O OG   . SER A 1 75 ? 2.740   19.207  -0.395  1.00 0.00 ? 75 SER A OG   3  
ATOM 3774  H H    . SER A 1 75 ? 2.590   16.964  -1.636  1.00 0.00 ? 75 SER A H    3  
ATOM 3775  H HA   . SER A 1 75 ? 1.715   16.365  1.047   1.00 0.00 ? 75 SER A HA   3  
ATOM 3776  H HB2  . SER A 1 75 ? 2.436   18.673  1.550   1.00 0.00 ? 75 SER A HB2  3  
ATOM 3777  H HB3  . SER A 1 75 ? 3.690   17.770  0.700   1.00 0.00 ? 75 SER A HB3  3  
ATOM 3778  H HG   . SER A 1 75 ? 3.009   20.044  -0.009  1.00 0.00 ? 75 SER A HG   3  
ATOM 3779  N N    . GLY A 1 76 ? 0.047   18.541  -0.802  1.00 0.00 ? 76 GLY A N    3  
ATOM 3780  C CA   . GLY A 1 76 ? -1.254  19.165  -0.958  1.00 0.00 ? 76 GLY A CA   3  
ATOM 3781  C C    . GLY A 1 76 ? -1.304  20.557  -0.360  1.00 0.00 ? 76 GLY A C    3  
ATOM 3782  O O    . GLY A 1 76 ? -1.733  20.752  0.777   1.00 0.00 ? 76 GLY A O    3  
ATOM 3783  H H    . GLY A 1 76 ? 0.759   18.728  -1.450  1.00 0.00 ? 76 GLY A H    3  
ATOM 3784  H HA2  . GLY A 1 76 ? -1.487  19.227  -2.010  1.00 0.00 ? 76 GLY A HA2  3  
ATOM 3785  H HA3  . GLY A 1 76 ? -1.996  18.549  -0.471  1.00 0.00 ? 76 GLY A HA3  3  
ATOM 3786  N N    . PRO A 1 77 ? -0.857  21.555  -1.136  1.00 0.00 ? 77 PRO A N    3  
ATOM 3787  C CA   . PRO A 1 77 ? -0.841  22.953  -0.697  1.00 0.00 ? 77 PRO A CA   3  
ATOM 3788  C C    . PRO A 1 77 ? -2.244  23.540  -0.583  1.00 0.00 ? 77 PRO A C    3  
ATOM 3789  O O    . PRO A 1 77 ? -2.464  24.512  0.140   1.00 0.00 ? 77 PRO A O    3  
ATOM 3790  C CB   . PRO A 1 77 ? -0.053  23.663  -1.801  1.00 0.00 ? 77 PRO A CB   3  
ATOM 3791  C CG   . PRO A 1 77 ? -0.237  22.808  -3.007  1.00 0.00 ? 77 PRO A CG   3  
ATOM 3792  C CD   . PRO A 1 77 ? -0.331  21.395  -2.503  1.00 0.00 ? 77 PRO A CD   3  
ATOM 3793  H HA   . PRO A 1 77 ? -0.327  23.068  0.245   1.00 0.00 ? 77 PRO A HA   3  
ATOM 3794  H HB2  . PRO A 1 77 ? -0.455  24.655  -1.953  1.00 0.00 ? 77 PRO A HB2  3  
ATOM 3795  H HB3  . PRO A 1 77 ? 0.987   23.730  -1.519  1.00 0.00 ? 77 PRO A HB3  3  
ATOM 3796  H HG2  . PRO A 1 77 ? -1.146  23.086  -3.519  1.00 0.00 ? 77 PRO A HG2  3  
ATOM 3797  H HG3  . PRO A 1 77 ? 0.613   22.915  -3.665  1.00 0.00 ? 77 PRO A HG3  3  
ATOM 3798  H HD2  . PRO A 1 77 ? -1.013  20.821  -3.113  1.00 0.00 ? 77 PRO A HD2  3  
ATOM 3799  H HD3  . PRO A 1 77 ? 0.645   20.934  -2.488  1.00 0.00 ? 77 PRO A HD3  3  
ATOM 3800  N N    . SER A 1 78 ? -3.191  22.944  -1.301  1.00 0.00 ? 78 SER A N    3  
ATOM 3801  C CA   . SER A 1 78 ? -4.572  23.410  -1.282  1.00 0.00 ? 78 SER A CA   3  
ATOM 3802  C C    . SER A 1 78 ? -5.054  23.623  0.150   1.00 0.00 ? 78 SER A C    3  
ATOM 3803  O O    . SER A 1 78 ? -5.649  24.653  0.470   1.00 0.00 ? 78 SER A O    3  
ATOM 3804  C CB   . SER A 1 78 ? -5.481  22.407  -1.994  1.00 0.00 ? 78 SER A CB   3  
ATOM 3805  O OG   . SER A 1 78 ? -5.585  22.704  -3.376  1.00 0.00 ? 78 SER A OG   3  
ATOM 3806  H H    . SER A 1 78 ? -2.953  22.173  -1.858  1.00 0.00 ? 78 SER A H    3  
ATOM 3807  H HA   . SER A 1 78 ? -4.611  24.353  -1.807  1.00 0.00 ? 78 SER A HA   3  
ATOM 3808  H HB2  . SER A 1 78 ? -5.074  21.413  -1.882  1.00 0.00 ? 78 SER A HB2  3  
ATOM 3809  H HB3  . SER A 1 78 ? -6.467  22.444  -1.555  1.00 0.00 ? 78 SER A HB3  3  
ATOM 3810  H HG   . SER A 1 78 ? -4.823  22.346  -3.839  1.00 0.00 ? 78 SER A HG   3  
ATOM 3811  N N    . SER A 1 79 ? -4.793  22.642  1.007   1.00 0.00 ? 79 SER A N    3  
ATOM 3812  C CA   . SER A 1 79 ? -5.204  22.719  2.405   1.00 0.00 ? 79 SER A CA   3  
ATOM 3813  C C    . SER A 1 79 ? -4.157  22.081  3.314   1.00 0.00 ? 79 SER A C    3  
ATOM 3814  O O    . SER A 1 79 ? -3.375  21.236  2.881   1.00 0.00 ? 79 SER A O    3  
ATOM 3815  C CB   . SER A 1 79 ? -6.555  22.029  2.600   1.00 0.00 ? 79 SER A CB   3  
ATOM 3816  O OG   . SER A 1 79 ? -7.582  22.711  1.902   1.00 0.00 ? 79 SER A OG   3  
ATOM 3817  H H    . SER A 1 79 ? -4.316  21.846  0.692   1.00 0.00 ? 79 SER A H    3  
ATOM 3818  H HA   . SER A 1 79 ? -5.301  23.762  2.665   1.00 0.00 ? 79 SER A HA   3  
ATOM 3819  H HB2  . SER A 1 79 ? -6.496  21.016  2.230   1.00 0.00 ? 79 SER A HB2  3  
ATOM 3820  H HB3  . SER A 1 79 ? -6.799  22.014  3.652   1.00 0.00 ? 79 SER A HB3  3  
ATOM 3821  H HG   . SER A 1 79 ? -8.252  23.004  2.524   1.00 0.00 ? 79 SER A HG   3  
ATOM 3822  N N    . GLY A 1 80 ? -4.151  22.493  4.578   1.00 0.00 ? 80 GLY A N    3  
ATOM 3823  C CA   . GLY A 1 80 ? -3.197  21.952  5.529   1.00 0.00 ? 80 GLY A CA   3  
ATOM 3824  C C    . GLY A 1 80 ? -3.838  21.605  6.859   1.00 0.00 ? 80 GLY A C    3  
ATOM 3825  O O    . GLY A 1 80 ? -3.143  21.329  7.836   1.00 0.00 ? 80 GLY A O    3  
ATOM 3826  H H    . GLY A 1 80 ? -4.798  23.169  4.867   1.00 0.00 ? 80 GLY A H    3  
ATOM 3827  H HA2  . GLY A 1 80 ? -2.755  21.060  5.111   1.00 0.00 ? 80 GLY A HA2  3  
ATOM 3828  H HA3  . GLY A 1 80 ? -2.420  22.683  5.697   1.00 0.00 ? 80 GLY A HA3  3  
ATOM 3829  N N    . GLY A 1 1  ? 3.266   31.035  -41.528 1.00 0.00 ? 1  GLY A N    4  
ATOM 3830  C CA   . GLY A 1 1  ? 3.565   31.812  -40.339 1.00 0.00 ? 1  GLY A CA   4  
ATOM 3831  C C    . GLY A 1 1  ? 4.144   30.964  -39.224 1.00 0.00 ? 1  GLY A C    4  
ATOM 3832  O O    . GLY A 1 1  ? 4.540   29.819  -39.447 1.00 0.00 ? 1  GLY A O    4  
ATOM 3833  H H1   . GLY A 1 1  ? 2.736   30.214  -41.454 1.00 0.00 ? 1  GLY A H1   4  
ATOM 3834  H HA2  . GLY A 1 1  ? 4.275   32.584  -40.596 1.00 0.00 ? 1  GLY A HA2  4  
ATOM 3835  H HA3  . GLY A 1 1  ? 2.655   32.275  -39.987 1.00 0.00 ? 1  GLY A HA3  4  
ATOM 3836  N N    . SER A 1 2  ? 4.196   31.526  -38.021 1.00 0.00 ? 2  SER A N    4  
ATOM 3837  C CA   . SER A 1 2  ? 4.736   30.816  -36.868 1.00 0.00 ? 2  SER A CA   4  
ATOM 3838  C C    . SER A 1 2  ? 4.136   31.350  -35.571 1.00 0.00 ? 2  SER A C    4  
ATOM 3839  O O    . SER A 1 2  ? 3.968   32.558  -35.403 1.00 0.00 ? 2  SER A O    4  
ATOM 3840  C CB   . SER A 1 2  ? 6.260   30.947  -36.830 1.00 0.00 ? 2  SER A CB   4  
ATOM 3841  O OG   . SER A 1 2  ? 6.873   30.033  -37.723 1.00 0.00 ? 2  SER A OG   4  
ATOM 3842  H H    . SER A 1 2  ? 3.865   32.442  -37.907 1.00 0.00 ? 2  SER A H    4  
ATOM 3843  H HA   . SER A 1 2  ? 4.475   29.773  -36.969 1.00 0.00 ? 2  SER A HA   4  
ATOM 3844  H HB2  . SER A 1 2  ? 6.540   31.950  -37.113 1.00 0.00 ? 2  SER A HB2  4  
ATOM 3845  H HB3  . SER A 1 2  ? 6.611   30.744  -35.828 1.00 0.00 ? 2  SER A HB3  4  
ATOM 3846  H HG   . SER A 1 2  ? 7.825   30.058  -37.604 1.00 0.00 ? 2  SER A HG   4  
ATOM 3847  N N    . SER A 1 3  ? 3.816   30.441  -34.656 1.00 0.00 ? 3  SER A N    4  
ATOM 3848  C CA   . SER A 1 3  ? 3.230   30.819  -33.375 1.00 0.00 ? 3  SER A CA   4  
ATOM 3849  C C    . SER A 1 3  ? 3.087   29.604  -32.464 1.00 0.00 ? 3  SER A C    4  
ATOM 3850  O O    . SER A 1 3  ? 3.156   28.462  -32.917 1.00 0.00 ? 3  SER A O    4  
ATOM 3851  C CB   . SER A 1 3  ? 1.865   31.476  -33.587 1.00 0.00 ? 3  SER A CB   4  
ATOM 3852  O OG   . SER A 1 3  ? 0.876   30.508  -33.892 1.00 0.00 ? 3  SER A OG   4  
ATOM 3853  H H    . SER A 1 3  ? 3.974   29.493  -34.849 1.00 0.00 ? 3  SER A H    4  
ATOM 3854  H HA   . SER A 1 3  ? 3.893   31.530  -32.905 1.00 0.00 ? 3  SER A HA   4  
ATOM 3855  H HB2  . SER A 1 3  ? 1.576   31.998  -32.688 1.00 0.00 ? 3  SER A HB2  4  
ATOM 3856  H HB3  . SER A 1 3  ? 1.930   32.177  -34.407 1.00 0.00 ? 3  SER A HB3  4  
ATOM 3857  H HG   . SER A 1 3  ? 0.746   30.470  -34.842 1.00 0.00 ? 3  SER A HG   4  
ATOM 3858  N N    . GLY A 1 4  ? 2.887   29.859  -31.174 1.00 0.00 ? 4  GLY A N    4  
ATOM 3859  C CA   . GLY A 1 4  ? 2.736   28.777  -30.218 1.00 0.00 ? 4  GLY A CA   4  
ATOM 3860  C C    . GLY A 1 4  ? 1.352   28.161  -30.253 1.00 0.00 ? 4  GLY A C    4  
ATOM 3861  O O    . GLY A 1 4  ? 0.351   28.872  -30.349 1.00 0.00 ? 4  GLY A O    4  
ATOM 3862  H H    . GLY A 1 4  ? 2.840   30.790  -30.869 1.00 0.00 ? 4  GLY A H    4  
ATOM 3863  H HA2  . GLY A 1 4  ? 3.465   28.012  -30.440 1.00 0.00 ? 4  GLY A HA2  4  
ATOM 3864  H HA3  . GLY A 1 4  ? 2.922   29.161  -29.226 1.00 0.00 ? 4  GLY A HA3  4  
ATOM 3865  N N    . SER A 1 5  ? 1.293   26.836  -30.175 1.00 0.00 ? 5  SER A N    4  
ATOM 3866  C CA   . SER A 1 5  ? 0.021   26.124  -30.204 1.00 0.00 ? 5  SER A CA   4  
ATOM 3867  C C    . SER A 1 5  ? -0.424  25.751  -28.793 1.00 0.00 ? 5  SER A C    4  
ATOM 3868  O O    . SER A 1 5  ? 0.345   25.185  -28.017 1.00 0.00 ? 5  SER A O    4  
ATOM 3869  C CB   . SER A 1 5  ? 0.137   24.864  -31.064 1.00 0.00 ? 5  SER A CB   4  
ATOM 3870  O OG   . SER A 1 5  ? 0.255   25.193  -32.437 1.00 0.00 ? 5  SER A OG   4  
ATOM 3871  H H    . SER A 1 5  ? 2.126   26.325  -30.100 1.00 0.00 ? 5  SER A H    4  
ATOM 3872  H HA   . SER A 1 5  ? -0.717  26.781  -30.640 1.00 0.00 ? 5  SER A HA   4  
ATOM 3873  H HB2  . SER A 1 5  ? 1.010   24.305  -30.764 1.00 0.00 ? 5  SER A HB2  4  
ATOM 3874  H HB3  . SER A 1 5  ? -0.746  24.255  -30.927 1.00 0.00 ? 5  SER A HB3  4  
ATOM 3875  H HG   . SER A 1 5  ? 0.343   24.389  -32.953 1.00 0.00 ? 5  SER A HG   4  
ATOM 3876  N N    . SER A 1 6  ? -1.672  26.072  -28.469 1.00 0.00 ? 6  SER A N    4  
ATOM 3877  C CA   . SER A 1 6  ? -2.221  25.775  -27.151 1.00 0.00 ? 6  SER A CA   4  
ATOM 3878  C C    . SER A 1 6  ? -2.668  24.319  -27.064 1.00 0.00 ? 6  SER A C    4  
ATOM 3879  O O    . SER A 1 6  ? -3.290  23.793  -27.986 1.00 0.00 ? 6  SER A O    4  
ATOM 3880  C CB   . SER A 1 6  ? -3.399  26.701  -26.844 1.00 0.00 ? 6  SER A CB   4  
ATOM 3881  O OG   . SER A 1 6  ? -3.981  26.389  -25.591 1.00 0.00 ? 6  SER A OG   4  
ATOM 3882  H H    . SER A 1 6  ? -2.237  26.523  -29.132 1.00 0.00 ? 6  SER A H    4  
ATOM 3883  H HA   . SER A 1 6  ? -1.442  25.944  -26.422 1.00 0.00 ? 6  SER A HA   4  
ATOM 3884  H HB2  . SER A 1 6  ? -3.054  27.724  -26.822 1.00 0.00 ? 6  SER A HB2  4  
ATOM 3885  H HB3  . SER A 1 6  ? -4.149  26.592  -27.614 1.00 0.00 ? 6  SER A HB3  4  
ATOM 3886  H HG   . SER A 1 6  ? -3.288  26.253  -24.941 1.00 0.00 ? 6  SER A HG   4  
ATOM 3887  N N    . GLY A 1 7  ? -2.346  23.673  -25.947 1.00 0.00 ? 7  GLY A N    4  
ATOM 3888  C CA   . GLY A 1 7  ? -2.721  22.284  -25.760 1.00 0.00 ? 7  GLY A CA   4  
ATOM 3889  C C    . GLY A 1 7  ? -4.101  22.133  -25.150 1.00 0.00 ? 7  GLY A C    4  
ATOM 3890  O O    . GLY A 1 7  ? -4.820  23.116  -24.974 1.00 0.00 ? 7  GLY A O    4  
ATOM 3891  H H    . GLY A 1 7  ? -1.849  24.143  -25.246 1.00 0.00 ? 7  GLY A H    4  
ATOM 3892  H HA2  . GLY A 1 7  ? -2.706  21.785  -26.717 1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3893  H HA3  . GLY A 1 7  ? -2.000  21.813  -25.108 1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3894  N N    . GLY A 1 8  ? -4.473  20.898  -24.829 1.00 0.00 ? 8  GLY A N    4  
ATOM 3895  C CA   . GLY A 1 8  ? -5.776  20.645  -24.241 1.00 0.00 ? 8  GLY A CA   4  
ATOM 3896  C C    . GLY A 1 8  ? -6.230  19.212  -24.434 1.00 0.00 ? 8  GLY A C    4  
ATOM 3897  O O    . GLY A 1 8  ? -6.110  18.658  -25.527 1.00 0.00 ? 8  GLY A O    4  
ATOM 3898  H H    . GLY A 1 8  ? -3.858  20.152  -24.992 1.00 0.00 ? 8  GLY A H    4  
ATOM 3899  H HA2  . GLY A 1 8  ? -5.729  20.858  -23.184 1.00 0.00 ? 8  GLY A HA2  4  
ATOM 3900  H HA3  . GLY A 1 8  ? -6.499  21.304  -24.699 1.00 0.00 ? 8  GLY A HA3  4  
ATOM 3901  N N    . GLU A 1 9  ? -6.753  18.610  -23.371 1.00 0.00 ? 9  GLU A N    4  
ATOM 3902  C CA   . GLU A 1 9  ? -7.225  17.231  -23.428 1.00 0.00 ? 9  GLU A CA   4  
ATOM 3903  C C    . GLU A 1 9  ? -7.879  16.936  -24.775 1.00 0.00 ? 9  GLU A C    4  
ATOM 3904  O O    . GLU A 1 9  ? -8.434  17.819  -25.431 1.00 0.00 ? 9  GLU A O    4  
ATOM 3905  C CB   . GLU A 1 9  ? -8.217  16.960  -22.296 1.00 0.00 ? 9  GLU A CB   4  
ATOM 3906  C CG   . GLU A 1 9  ? -7.555  16.737  -20.947 1.00 0.00 ? 9  GLU A CG   4  
ATOM 3907  C CD   . GLU A 1 9  ? -7.255  18.035  -20.222 1.00 0.00 ? 9  GLU A CD   4  
ATOM 3908  O OE1  . GLU A 1 9  ? -8.186  18.850  -20.054 1.00 0.00 ? 9  GLU A OE1  4  
ATOM 3909  O OE2  . GLU A 1 9  ? -6.089  18.235  -19.822 1.00 0.00 ? 9  GLU A OE2  4  
ATOM 3910  H H    . GLU A 1 9  ? -6.823  19.104  -22.527 1.00 0.00 ? 9  GLU A H    4  
ATOM 3911  H HA   . GLU A 1 9  ? -6.370  16.583  -23.308 1.00 0.00 ? 9  GLU A HA   4  
ATOM 3912  H HB2  . GLU A 1 9  ? -8.886  17.804  -22.211 1.00 0.00 ? 9  GLU A HB2  4  
ATOM 3913  H HB3  . GLU A 1 9  ? -8.792  16.080  -22.541 1.00 0.00 ? 9  GLU A HB3  4  
ATOM 3914  H HG2  . GLU A 1 9  ? -8.213  16.143  -20.331 1.00 0.00 ? 9  GLU A HG2  4  
ATOM 3915  H HG3  . GLU A 1 9  ? -6.628  16.204  -21.099 1.00 0.00 ? 9  GLU A HG3  4  
ATOM 3916  N N    . PRO A 1 10 ? -7.814  15.665  -25.198 1.00 0.00 ? 10 PRO A N    4  
ATOM 3917  C CA   . PRO A 1 10 ? -8.395  15.224  -26.470 1.00 0.00 ? 10 PRO A CA   4  
ATOM 3918  C C    . PRO A 1 10 ? -9.919  15.241  -26.448 1.00 0.00 ? 10 PRO A C    4  
ATOM 3919  O O    . PRO A 1 10 ? -10.564 15.309  -27.493 1.00 0.00 ? 10 PRO A O    4  
ATOM 3920  C CB   . PRO A 1 10 ? -7.878  13.790  -26.617 1.00 0.00 ? 10 PRO A CB   4  
ATOM 3921  C CG   . PRO A 1 10 ? -7.613  13.339  -25.222 1.00 0.00 ? 10 PRO A CG   4  
ATOM 3922  C CD   . PRO A 1 10 ? -7.169  14.561  -24.468 1.00 0.00 ? 10 PRO A CD   4  
ATOM 3923  H HA   . PRO A 1 10 ? -8.041  15.822  -27.297 1.00 0.00 ? 10 PRO A HA   4  
ATOM 3924  H HB2  . PRO A 1 10 ? -8.633  13.180  -27.094 1.00 0.00 ? 10 PRO A HB2  4  
ATOM 3925  H HB3  . PRO A 1 10 ? -6.977  13.788  -27.211 1.00 0.00 ? 10 PRO A HB3  4  
ATOM 3926  H HG2  . PRO A 1 10 ? -8.515  12.937  -24.788 1.00 0.00 ? 10 PRO A HG2  4  
ATOM 3927  H HG3  . PRO A 1 10 ? -6.831  12.593  -25.221 1.00 0.00 ? 10 PRO A HG3  4  
ATOM 3928  H HD2  . PRO A 1 10 ? -7.514  14.521  -23.446 1.00 0.00 ? 10 PRO A HD2  4  
ATOM 3929  H HD3  . PRO A 1 10 ? -6.093  14.655  -24.501 1.00 0.00 ? 10 PRO A HD3  4  
ATOM 3930  N N    . GLY A 1 11 ? -10.490 15.179  -25.248 1.00 0.00 ? 11 GLY A N    4  
ATOM 3931  C CA   . GLY A 1 11 ? -11.935 15.189  -25.113 1.00 0.00 ? 11 GLY A CA   4  
ATOM 3932  C C    . GLY A 1 11 ? -12.382 15.124  -23.666 1.00 0.00 ? 11 GLY A C    4  
ATOM 3933  O O    . GLY A 1 11 ? -13.102 16.003  -23.190 1.00 0.00 ? 11 GLY A O    4  
ATOM 3934  H H    . GLY A 1 11 ? -9.926  15.126  -24.449 1.00 0.00 ? 11 GLY A H    4  
ATOM 3935  H HA2  . GLY A 1 11 ? -12.321 16.094  -25.558 1.00 0.00 ? 11 GLY A HA2  4  
ATOM 3936  H HA3  . GLY A 1 11 ? -12.340 14.339  -25.642 1.00 0.00 ? 11 GLY A HA3  4  
ATOM 3937  N N    . THR A 1 12 ? -11.958 14.078  -22.964 1.00 0.00 ? 12 THR A N    4  
ATOM 3938  C CA   . THR A 1 12 ? -12.321 13.900  -21.564 1.00 0.00 ? 12 THR A CA   4  
ATOM 3939  C C    . THR A 1 12 ? -11.206 13.205  -20.790 1.00 0.00 ? 12 THR A C    4  
ATOM 3940  O O    . THR A 1 12 ? -10.372 12.511  -21.372 1.00 0.00 ? 12 THR A O    4  
ATOM 3941  C CB   . THR A 1 12 ? -13.618 13.080  -21.420 1.00 0.00 ? 12 THR A CB   4  
ATOM 3942  O OG1  . THR A 1 12 ? -13.497 11.844  -22.134 1.00 0.00 ? 12 THR A OG1  4  
ATOM 3943  C CG2  . THR A 1 12 ? -14.813 13.861  -21.945 1.00 0.00 ? 12 THR A CG2  4  
ATOM 3944  H H    . THR A 1 12 ? -11.387 13.411  -23.399 1.00 0.00 ? 12 THR A H    4  
ATOM 3945  H HA   . THR A 1 12 ? -12.489 14.877  -21.135 1.00 0.00 ? 12 THR A HA   4  
ATOM 3946  H HB   . THR A 1 12 ? -13.777 12.868  -20.372 1.00 0.00 ? 12 THR A HB   4  
ATOM 3947  H HG1  . THR A 1 12 ? -14.047 11.178  -21.714 1.00 0.00 ? 12 THR A HG1  4  
ATOM 3948  H HG21 . THR A 1 12 ? -15.704 13.256  -21.860 1.00 0.00 ? 12 THR A HG21 4  
ATOM 3949  H HG22 . THR A 1 12 ? -14.648 14.116  -22.982 1.00 0.00 ? 12 THR A HG22 4  
ATOM 3950  H HG23 . THR A 1 12 ? -14.934 14.764  -21.367 1.00 0.00 ? 12 THR A HG23 4  
ATOM 3951  N N    . LYS A 1 13 ? -11.197 13.396  -19.475 1.00 0.00 ? 13 LYS A N    4  
ATOM 3952  C CA   . LYS A 1 13 ? -10.185 12.786  -18.621 1.00 0.00 ? 13 LYS A CA   4  
ATOM 3953  C C    . LYS A 1 13 ? -10.450 11.294  -18.443 1.00 0.00 ? 13 LYS A C    4  
ATOM 3954  O O    . LYS A 1 13 ? -11.063 10.876  -17.462 1.00 0.00 ? 13 LYS A O    4  
ATOM 3955  C CB   . LYS A 1 13 ? -10.159 13.476  -17.255 1.00 0.00 ? 13 LYS A CB   4  
ATOM 3956  C CG   . LYS A 1 13 ? -11.488 13.425  -16.522 1.00 0.00 ? 13 LYS A CG   4  
ATOM 3957  C CD   . LYS A 1 13 ? -11.617 14.560  -15.519 1.00 0.00 ? 13 LYS A CD   4  
ATOM 3958  C CE   . LYS A 1 13 ? -11.919 15.881  -16.209 1.00 0.00 ? 13 LYS A CE   4  
ATOM 3959  N NZ   . LYS A 1 13 ? -12.046 16.999  -15.234 1.00 0.00 ? 13 LYS A NZ   4  
ATOM 3960  H H    . LYS A 1 13 ? -11.889 13.960  -19.070 1.00 0.00 ? 13 LYS A H    4  
ATOM 3961  H HA   . LYS A 1 13 ? -9.226  12.915  -19.098 1.00 0.00 ? 13 LYS A HA   4  
ATOM 3962  H HB2  . LYS A 1 13 ? -9.413  12.998  -16.638 1.00 0.00 ? 13 LYS A HB2  4  
ATOM 3963  H HB3  . LYS A 1 13 ? -9.889  14.513  -17.394 1.00 0.00 ? 13 LYS A HB3  4  
ATOM 3964  H HG2  . LYS A 1 13 ? -12.290 13.503  -17.242 1.00 0.00 ? 13 LYS A HG2  4  
ATOM 3965  H HG3  . LYS A 1 13 ? -11.564 12.483  -15.997 1.00 0.00 ? 13 LYS A HG3  4  
ATOM 3966  H HD2  . LYS A 1 13 ? -12.419 14.333  -14.833 1.00 0.00 ? 13 LYS A HD2  4  
ATOM 3967  H HD3  . LYS A 1 13 ? -10.689 14.653  -14.973 1.00 0.00 ? 13 LYS A HD3  4  
ATOM 3968  H HE2  . LYS A 1 13 ? -11.119 16.104  -16.898 1.00 0.00 ? 13 LYS A HE2  4  
ATOM 3969  H HE3  . LYS A 1 13 ? -12.846 15.783  -16.755 1.00 0.00 ? 13 LYS A HE3  4  
ATOM 3970  H HZ1  . LYS A 1 13 ? -11.117 17.223  -14.824 1.00 0.00 ? 13 LYS A HZ1  4  
ATOM 3971  H HZ2  . LYS A 1 13 ? -12.696 16.732  -14.467 1.00 0.00 ? 13 LYS A HZ2  4  
ATOM 3972  H HZ3  . LYS A 1 13 ? -12.417 17.847  -15.709 1.00 0.00 ? 13 LYS A HZ3  4  
ATOM 3973  N N    . ALA A 1 14 ? -9.982  10.497  -19.398 1.00 0.00 ? 14 ALA A N    4  
ATOM 3974  C CA   . ALA A 1 14 ? -10.165 9.052   -19.345 1.00 0.00 ? 14 ALA A CA   4  
ATOM 3975  C C    . ALA A 1 14 ? -9.279  8.426   -18.274 1.00 0.00 ? 14 ALA A C    4  
ATOM 3976  O O    . ALA A 1 14 ? -8.100  8.760   -18.154 1.00 0.00 ? 14 ALA A O    4  
ATOM 3977  C CB   . ALA A 1 14 ? -9.872  8.433   -20.704 1.00 0.00 ? 14 ALA A CB   4  
ATOM 3978  H H    . ALA A 1 14 ? -9.501  10.891  -20.156 1.00 0.00 ? 14 ALA A H    4  
ATOM 3979  H HA   . ALA A 1 14 ? -11.200 8.856   -19.103 1.00 0.00 ? 14 ALA A HA   4  
ATOM 3980  H HB1  . ALA A 1 14 ? -9.033  8.941   -21.157 1.00 0.00 ? 14 ALA A HB1  4  
ATOM 3981  H HB2  . ALA A 1 14 ? -9.635  7.387   -20.579 1.00 0.00 ? 14 ALA A HB2  4  
ATOM 3982  H HB3  . ALA A 1 14 ? -10.739 8.533   -21.339 1.00 0.00 ? 14 ALA A HB3  4  
ATOM 3983  N N    . LYS A 1 15 ? -9.854  7.515   -17.495 1.00 0.00 ? 15 LYS A N    4  
ATOM 3984  C CA   . LYS A 1 15 ? -9.117  6.841   -16.433 1.00 0.00 ? 15 LYS A CA   4  
ATOM 3985  C C    . LYS A 1 15 ? -9.899  5.641   -15.906 1.00 0.00 ? 15 LYS A C    4  
ATOM 3986  O O    . LYS A 1 15 ? -11.108 5.721   -15.691 1.00 0.00 ? 15 LYS A O    4  
ATOM 3987  C CB   . LYS A 1 15 ? -8.825  7.814   -15.290 1.00 0.00 ? 15 LYS A CB   4  
ATOM 3988  C CG   . LYS A 1 15 ? -8.071  7.184   -14.132 1.00 0.00 ? 15 LYS A CG   4  
ATOM 3989  C CD   . LYS A 1 15 ? -6.586  7.065   -14.431 1.00 0.00 ? 15 LYS A CD   4  
ATOM 3990  C CE   . LYS A 1 15 ? -5.834  8.324   -14.029 1.00 0.00 ? 15 LYS A CE   4  
ATOM 3991  N NZ   . LYS A 1 15 ? -5.959  9.397   -15.054 1.00 0.00 ? 15 LYS A NZ   4  
ATOM 3992  H H    . LYS A 1 15 ? -10.798 7.291   -17.639 1.00 0.00 ? 15 LYS A H    4  
ATOM 3993  H HA   . LYS A 1 15 ? -8.183  6.493   -16.847 1.00 0.00 ? 15 LYS A HA   4  
ATOM 3994  H HB2  . LYS A 1 15 ? -8.234  8.634   -15.673 1.00 0.00 ? 15 LYS A HB2  4  
ATOM 3995  H HB3  . LYS A 1 15 ? -9.761  8.202   -14.914 1.00 0.00 ? 15 LYS A HB3  4  
ATOM 3996  H HG2  . LYS A 1 15 ? -8.202  7.796   -13.252 1.00 0.00 ? 15 LYS A HG2  4  
ATOM 3997  H HG3  . LYS A 1 15 ? -8.472  6.197   -13.948 1.00 0.00 ? 15 LYS A HG3  4  
ATOM 3998  H HD2  . LYS A 1 15 ? -6.182  6.227   -13.882 1.00 0.00 ? 15 LYS A HD2  4  
ATOM 3999  H HD3  . LYS A 1 15 ? -6.454  6.900   -15.491 1.00 0.00 ? 15 LYS A HD3  4  
ATOM 4000  H HE2  . LYS A 1 15 ? -6.234  8.683   -13.093 1.00 0.00 ? 15 LYS A HE2  4  
ATOM 4001  H HE3  . LYS A 1 15 ? -4.789  8.079   -13.903 1.00 0.00 ? 15 LYS A HE3  4  
ATOM 4002  H HZ1  . LYS A 1 15 ? -6.233  8.985   -15.969 1.00 0.00 ? 15 LYS A HZ1  4  
ATOM 4003  H HZ2  . LYS A 1 15 ? -5.052  9.891   -15.167 1.00 0.00 ? 15 LYS A HZ2  4  
ATOM 4004  H HZ3  . LYS A 1 15 ? -6.683  10.085  -14.765 1.00 0.00 ? 15 LYS A HZ3  4  
ATOM 4005  N N    . LYS A 1 16 ? -9.200  4.531   -15.699 1.00 0.00 ? 16 LYS A N    4  
ATOM 4006  C CA   . LYS A 1 16 ? -9.826  3.315   -15.194 1.00 0.00 ? 16 LYS A CA   4  
ATOM 4007  C C    . LYS A 1 16 ? -9.597  3.167   -13.693 1.00 0.00 ? 16 LYS A C    4  
ATOM 4008  O O    . LYS A 1 16 ? -8.529  3.502   -13.182 1.00 0.00 ? 16 LYS A O    4  
ATOM 4009  C CB   . LYS A 1 16 ? -9.275  2.090   -15.928 1.00 0.00 ? 16 LYS A CB   4  
ATOM 4010  C CG   . LYS A 1 16 ? -9.605  2.069   -17.410 1.00 0.00 ? 16 LYS A CG   4  
ATOM 4011  C CD   . LYS A 1 16 ? -10.958 1.428   -17.671 1.00 0.00 ? 16 LYS A CD   4  
ATOM 4012  C CE   . LYS A 1 16 ? -10.831 -0.073  -17.883 1.00 0.00 ? 16 LYS A CE   4  
ATOM 4013  N NZ   . LYS A 1 16 ? -10.081 -0.728  -16.776 1.00 0.00 ? 16 LYS A NZ   4  
ATOM 4014  H H    . LYS A 1 16 ? -8.237  4.529   -15.889 1.00 0.00 ? 16 LYS A H    4  
ATOM 4015  H HA   . LYS A 1 16 ? -10.887 3.387   -15.379 1.00 0.00 ? 16 LYS A HA   4  
ATOM 4016  H HB2  . LYS A 1 16 ? -8.200  2.074   -15.819 1.00 0.00 ? 16 LYS A HB2  4  
ATOM 4017  H HB3  . LYS A 1 16 ? -9.687  1.199   -15.476 1.00 0.00 ? 16 LYS A HB3  4  
ATOM 4018  H HG2  . LYS A 1 16 ? -9.622  3.083   -17.780 1.00 0.00 ? 16 LYS A HG2  4  
ATOM 4019  H HG3  . LYS A 1 16 ? -8.843  1.507   -17.931 1.00 0.00 ? 16 LYS A HG3  4  
ATOM 4020  H HD2  . LYS A 1 16 ? -11.601 1.607   -16.823 1.00 0.00 ? 16 LYS A HD2  4  
ATOM 4021  H HD3  . LYS A 1 16 ? -11.392 1.872   -18.555 1.00 0.00 ? 16 LYS A HD3  4  
ATOM 4022  H HE2  . LYS A 1 16 ? -11.821 -0.500  -17.937 1.00 0.00 ? 16 LYS A HE2  4  
ATOM 4023  H HE3  . LYS A 1 16 ? -10.311 -0.250  -18.813 1.00 0.00 ? 16 LYS A HE3  4  
ATOM 4024  H HZ1  . LYS A 1 16 ? -10.617 -0.653  -15.887 1.00 0.00 ? 16 LYS A HZ1  4  
ATOM 4025  H HZ2  . LYS A 1 16 ? -9.157  -0.268  -16.649 1.00 0.00 ? 16 LYS A HZ2  4  
ATOM 4026  H HZ3  . LYS A 1 16 ? -9.929  -1.734  -16.992 1.00 0.00 ? 16 LYS A HZ3  4  
ATOM 4027  N N    . GLY A 1 17 ? -10.607 2.662   -12.992 1.00 0.00 ? 17 GLY A N    4  
ATOM 4028  C CA   . GLY A 1 17 ? -10.495 2.477   -11.557 1.00 0.00 ? 17 GLY A CA   4  
ATOM 4029  C C    . GLY A 1 17 ? -10.930 1.095   -11.114 1.00 0.00 ? 17 GLY A C    4  
ATOM 4030  O O    . GLY A 1 17 ? -11.760 0.460   -11.765 1.00 0.00 ? 17 GLY A O    4  
ATOM 4031  H H    . GLY A 1 17 ? -11.436 2.412   -13.452 1.00 0.00 ? 17 GLY A H    4  
ATOM 4032  H HA2  . GLY A 1 17 ? -9.467  2.631   -11.264 1.00 0.00 ? 17 GLY A HA2  4  
ATOM 4033  H HA3  . GLY A 1 17 ? -11.113 3.212   -11.061 1.00 0.00 ? 17 GLY A HA3  4  
ATOM 4034  N N    . ARG A 1 18 ? -10.368 0.626   -10.004 1.00 0.00 ? 18 ARG A N    4  
ATOM 4035  C CA   . ARG A 1 18 ? -10.701 -0.691  -9.477  1.00 0.00 ? 18 ARG A CA   4  
ATOM 4036  C C    . ARG A 1 18 ? -11.706 -0.582  -8.333  1.00 0.00 ? 18 ARG A C    4  
ATOM 4037  O O    . ARG A 1 18 ? -11.571 0.271   -7.455  1.00 0.00 ? 18 ARG A O    4  
ATOM 4038  C CB   . ARG A 1 18 ? -9.438  -1.405  -8.993  1.00 0.00 ? 18 ARG A CB   4  
ATOM 4039  C CG   . ARG A 1 18 ? -8.452  -1.721  -10.106 1.00 0.00 ? 18 ARG A CG   4  
ATOM 4040  C CD   . ARG A 1 18 ? -8.765  -3.056  -10.764 1.00 0.00 ? 18 ARG A CD   4  
ATOM 4041  N NE   . ARG A 1 18 ? -8.173  -4.176  -10.036 1.00 0.00 ? 18 ARG A NE   4  
ATOM 4042  C CZ   . ARG A 1 18 ? -8.623  -5.423  -10.116 1.00 0.00 ? 18 ARG A CZ   4  
ATOM 4043  N NH1  . ARG A 1 18 ? -9.663  -5.709  -10.888 1.00 0.00 ? 18 ARG A NH1  4  
ATOM 4044  N NH2  . ARG A 1 18 ? -8.032  -6.389  -9.424  1.00 0.00 ? 18 ARG A NH2  4  
ATOM 4045  H H    . ARG A 1 18 ? -9.714  1.180   -9.529  1.00 0.00 ? 18 ARG A H    4  
ATOM 4046  H HA   . ARG A 1 18 ? -11.145 -1.266  -10.276 1.00 0.00 ? 18 ARG A HA   4  
ATOM 4047  H HB2  . ARG A 1 18 ? -8.939  -0.777  -8.268  1.00 0.00 ? 18 ARG A HB2  4  
ATOM 4048  H HB3  . ARG A 1 18 ? -9.722  -2.332  -8.519  1.00 0.00 ? 18 ARG A HB3  4  
ATOM 4049  H HG2  . ARG A 1 18 ? -8.506  -0.943  -10.853 1.00 0.00 ? 18 ARG A HG2  4  
ATOM 4050  H HG3  . ARG A 1 18 ? -7.456  -1.757  -9.692  1.00 0.00 ? 18 ARG A HG3  4  
ATOM 4051  H HD2  . ARG A 1 18 ? -9.836  -3.185  -10.795 1.00 0.00 ? 18 ARG A HD2  4  
ATOM 4052  H HD3  . ARG A 1 18 ? -8.374  -3.046  -11.770 1.00 0.00 ? 18 ARG A HD3  4  
ATOM 4053  H HE   . ARG A 1 18 ? -7.404  -3.988  -9.460  1.00 0.00 ? 18 ARG A HE   4  
ATOM 4054  H HH11 . ARG A 1 18 ? -10.110 -4.984  -11.411 1.00 0.00 ? 18 ARG A HH11 4  
ATOM 4055  H HH12 . ARG A 1 18 ? -9.999  -6.649  -10.947 1.00 0.00 ? 18 ARG A HH12 4  
ATOM 4056  H HH21 . ARG A 1 18 ? -7.248  -6.177  -8.841  1.00 0.00 ? 18 ARG A HH21 4  
ATOM 4057  H HH22 . ARG A 1 18 ? -8.371  -7.327  -9.484  1.00 0.00 ? 18 ARG A HH22 4  
ATOM 4058  N N    . ARG A 1 19 ? -12.713 -1.449  -8.352  1.00 0.00 ? 19 ARG A N    4  
ATOM 4059  C CA   . ARG A 1 19 ? -13.741 -1.448  -7.318  1.00 0.00 ? 19 ARG A CA   4  
ATOM 4060  C C    . ARG A 1 19 ? -13.284 -2.239  -6.096  1.00 0.00 ? 19 ARG A C    4  
ATOM 4061  O O    . ARG A 1 19 ? -12.648 -3.286  -6.224  1.00 0.00 ? 19 ARG A O    4  
ATOM 4062  C CB   . ARG A 1 19 ? -15.043 -2.038  -7.863  1.00 0.00 ? 19 ARG A CB   4  
ATOM 4063  C CG   . ARG A 1 19 ? -14.962 -3.528  -8.152  1.00 0.00 ? 19 ARG A CG   4  
ATOM 4064  C CD   . ARG A 1 19 ? -16.344 -4.160  -8.210  1.00 0.00 ? 19 ARG A CD   4  
ATOM 4065  N NE   . ARG A 1 19 ? -17.162 -3.792  -7.057  1.00 0.00 ? 19 ARG A NE   4  
ATOM 4066  C CZ   . ARG A 1 19 ? -18.491 -3.806  -7.064  1.00 0.00 ? 19 ARG A CZ   4  
ATOM 4067  N NH1  . ARG A 1 19 ? -19.147 -4.167  -8.158  1.00 0.00 ? 19 ARG A NH1  4  
ATOM 4068  N NH2  . ARG A 1 19 ? -19.165 -3.457  -5.976  1.00 0.00 ? 19 ARG A NH2  4  
ATOM 4069  H H    . ARG A 1 19 ? -12.766 -2.104  -9.078  1.00 0.00 ? 19 ARG A H    4  
ATOM 4070  H HA   . ARG A 1 19 ? -13.915 -0.424  -7.024  1.00 0.00 ? 19 ARG A HA   4  
ATOM 4071  H HB2  . ARG A 1 19 ? -15.829 -1.876  -7.140  1.00 0.00 ? 19 ARG A HB2  4  
ATOM 4072  H HB3  . ARG A 1 19 ? -15.298 -1.529  -8.780  1.00 0.00 ? 19 ARG A HB3  4  
ATOM 4073  H HG2  . ARG A 1 19 ? -14.472 -3.675  -9.104  1.00 0.00 ? 19 ARG A HG2  4  
ATOM 4074  H HG3  . ARG A 1 19 ? -14.389 -4.006  -7.372  1.00 0.00 ? 19 ARG A HG3  4  
ATOM 4075  H HD2  . ARG A 1 19 ? -16.840 -3.829  -9.110  1.00 0.00 ? 19 ARG A HD2  4  
ATOM 4076  H HD3  . ARG A 1 19 ? -16.234 -5.233  -8.233  1.00 0.00 ? 19 ARG A HD3  4  
ATOM 4077  H HE   . ARG A 1 19 ? -16.698 -3.521  -6.238  1.00 0.00 ? 19 ARG A HE   4  
ATOM 4078  H HH11 . ARG A 1 19 ? -18.642 -4.431  -8.979  1.00 0.00 ? 19 ARG A HH11 4  
ATOM 4079  H HH12 . ARG A 1 19 ? -20.148 -4.178  -8.160  1.00 0.00 ? 19 ARG A HH12 4  
ATOM 4080  H HH21 . ARG A 1 19 ? -18.673 -3.184  -5.149  1.00 0.00 ? 19 ARG A HH21 4  
ATOM 4081  H HH22 . ARG A 1 19 ? -20.164 -3.468  -5.982  1.00 0.00 ? 19 ARG A HH22 4  
ATOM 4082  N N    . SER A 1 20 ? -13.612 -1.732  -4.912  1.00 0.00 ? 20 SER A N    4  
ATOM 4083  C CA   . SER A 1 20 ? -13.231 -2.389  -3.667  1.00 0.00 ? 20 SER A CA   4  
ATOM 4084  C C    . SER A 1 20 ? -14.210 -3.507  -3.322  1.00 0.00 ? 20 SER A C    4  
ATOM 4085  O O    . SER A 1 20 ? -15.356 -3.505  -3.771  1.00 0.00 ? 20 SER A O    4  
ATOM 4086  C CB   . SER A 1 20 ? -13.178 -1.372  -2.525  1.00 0.00 ? 20 SER A CB   4  
ATOM 4087  O OG   . SER A 1 20 ? -14.418 -0.700  -2.382  1.00 0.00 ? 20 SER A OG   4  
ATOM 4088  H H    . SER A 1 20 ? -14.120 -0.894  -4.876  1.00 0.00 ? 20 SER A H    4  
ATOM 4089  H HA   . SER A 1 20 ? -12.249 -2.815  -3.804  1.00 0.00 ? 20 SER A HA   4  
ATOM 4090  H HB2  . SER A 1 20 ? -12.951 -1.883  -1.602  1.00 0.00 ? 20 SER A HB2  4  
ATOM 4091  H HB3  . SER A 1 20 ? -12.408 -0.643  -2.732  1.00 0.00 ? 20 SER A HB3  4  
ATOM 4092  H HG   . SER A 1 20 ? -15.126 -1.263  -2.703  1.00 0.00 ? 20 SER A HG   4  
ATOM 4093  N N    . ARG A 1 21 ? -13.748 -4.462  -2.521  1.00 0.00 ? 21 ARG A N    4  
ATOM 4094  C CA   . ARG A 1 21 ? -14.581 -5.588  -2.116  1.00 0.00 ? 21 ARG A CA   4  
ATOM 4095  C C    . ARG A 1 21 ? -15.336 -5.271  -0.829  1.00 0.00 ? 21 ARG A C    4  
ATOM 4096  O O    . ARG A 1 21 ? -16.557 -5.416  -0.759  1.00 0.00 ? 21 ARG A O    4  
ATOM 4097  C CB   . ARG A 1 21 ? -13.724 -6.840  -1.921  1.00 0.00 ? 21 ARG A CB   4  
ATOM 4098  C CG   . ARG A 1 21 ? -14.535 -8.119  -1.788  1.00 0.00 ? 21 ARG A CG   4  
ATOM 4099  C CD   . ARG A 1 21 ? -13.646 -9.312  -1.476  1.00 0.00 ? 21 ARG A CD   4  
ATOM 4100  N NE   . ARG A 1 21 ? -13.448 -9.487  -0.040  1.00 0.00 ? 21 ARG A NE   4  
ATOM 4101  C CZ   . ARG A 1 21 ? -14.353 -10.033 0.765   1.00 0.00 ? 21 ARG A CZ   4  
ATOM 4102  N NH1  . ARG A 1 21 ? -15.510 -10.456 0.277   1.00 0.00 ? 21 ARG A NH1  4  
ATOM 4103  N NH2  . ARG A 1 21 ? -14.099 -10.157 2.062   1.00 0.00 ? 21 ARG A NH2  4  
ATOM 4104  H H    . ARG A 1 21 ? -12.826 -4.409  -2.195  1.00 0.00 ? 21 ARG A H    4  
ATOM 4105  H HA   . ARG A 1 21 ? -15.297 -5.772  -2.903  1.00 0.00 ? 21 ARG A HA   4  
ATOM 4106  H HB2  . ARG A 1 21 ? -13.063 -6.946  -2.770  1.00 0.00 ? 21 ARG A HB2  4  
ATOM 4107  H HB3  . ARG A 1 21 ? -13.132 -6.720  -1.027  1.00 0.00 ? 21 ARG A HB3  4  
ATOM 4108  H HG2  . ARG A 1 21 ? -15.251 -7.999  -0.989  1.00 0.00 ? 21 ARG A HG2  4  
ATOM 4109  H HG3  . ARG A 1 21 ? -15.056 -8.302  -2.716  1.00 0.00 ? 21 ARG A HG3  4  
ATOM 4110  H HD2  . ARG A 1 21 ? -14.107 -10.203 -1.877  1.00 0.00 ? 21 ARG A HD2  4  
ATOM 4111  H HD3  . ARG A 1 21 ? -12.686 -9.161  -1.947  1.00 0.00 ? 21 ARG A HD3  4  
ATOM 4112  H HE   . ARG A 1 21 ? -12.599 -9.181  0.342   1.00 0.00 ? 21 ARG A HE   4  
ATOM 4113  H HH11 . ARG A 1 21 ? -15.703 -10.364 -0.700  1.00 0.00 ? 21 ARG A HH11 4  
ATOM 4114  H HH12 . ARG A 1 21 ? -16.189 -10.868 0.885   1.00 0.00 ? 21 ARG A HH12 4  
ATOM 4115  H HH21 . ARG A 1 21 ? -13.228 -9.840  2.434   1.00 0.00 ? 21 ARG A HH21 4  
ATOM 4116  H HH22 . ARG A 1 21 ? -14.781 -10.568 2.667   1.00 0.00 ? 21 ARG A HH22 4  
ATOM 4117  N N    . THR A 1 22 ? -14.602 -4.836  0.191   1.00 0.00 ? 22 THR A N    4  
ATOM 4118  C CA   . THR A 1 22 ? -15.200 -4.499  1.476   1.00 0.00 ? 22 THR A CA   4  
ATOM 4119  C C    . THR A 1 22 ? -14.407 -3.407  2.183   1.00 0.00 ? 22 THR A C    4  
ATOM 4120  O O    . THR A 1 22 ? -13.204 -3.546  2.408   1.00 0.00 ? 22 THR A O    4  
ATOM 4121  C CB   . THR A 1 22 ? -15.287 -5.732  2.395   1.00 0.00 ? 22 THR A CB   4  
ATOM 4122  O OG1  . THR A 1 22 ? -15.895 -5.373  3.641   1.00 0.00 ? 22 THR A OG1  4  
ATOM 4123  C CG2  . THR A 1 22 ? -13.906 -6.316  2.649   1.00 0.00 ? 22 THR A CG2  4  
ATOM 4124  H H    . THR A 1 22 ? -13.633 -4.741  0.074   1.00 0.00 ? 22 THR A H    4  
ATOM 4125  H HA   . THR A 1 22 ? -16.203 -4.141  1.293   1.00 0.00 ? 22 THR A HA   4  
ATOM 4126  H HB   . THR A 1 22 ? -15.895 -6.482  1.910   1.00 0.00 ? 22 THR A HB   4  
ATOM 4127  H HG1  . THR A 1 22 ? -16.753 -4.974  3.475   1.00 0.00 ? 22 THR A HG1  4  
ATOM 4128  H HG21 . THR A 1 22 ? -13.201 -5.892  1.949   1.00 0.00 ? 22 THR A HG21 4  
ATOM 4129  H HG22 . THR A 1 22 ? -13.939 -7.388  2.522   1.00 0.00 ? 22 THR A HG22 4  
ATOM 4130  H HG23 . THR A 1 22 ? -13.596 -6.082  3.657   1.00 0.00 ? 22 THR A HG23 4  
ATOM 4131  N N    . VAL A 1 23 ? -15.087 -2.320  2.533   1.00 0.00 ? 23 VAL A N    4  
ATOM 4132  C CA   . VAL A 1 23 ? -14.445 -1.203  3.217   1.00 0.00 ? 23 VAL A CA   4  
ATOM 4133  C C    . VAL A 1 23 ? -13.782 -1.660  4.511   1.00 0.00 ? 23 VAL A C    4  
ATOM 4134  O O    . VAL A 1 23 ? -14.317 -2.503  5.232   1.00 0.00 ? 23 VAL A O    4  
ATOM 4135  C CB   . VAL A 1 23 ? -15.455 -0.085  3.537   1.00 0.00 ? 23 VAL A CB   4  
ATOM 4136  C CG1  . VAL A 1 23 ? -14.787 1.027   4.330   1.00 0.00 ? 23 VAL A CG1  4  
ATOM 4137  C CG2  . VAL A 1 23 ? -16.071 0.458   2.256   1.00 0.00 ? 23 VAL A CG2  4  
ATOM 4138  H H    . VAL A 1 23 ? -16.043 -2.267  2.326   1.00 0.00 ? 23 VAL A H    4  
ATOM 4139  H HA   . VAL A 1 23 ? -13.689 -0.799  2.559   1.00 0.00 ? 23 VAL A HA   4  
ATOM 4140  H HB   . VAL A 1 23 ? -16.246 -0.505  4.142   1.00 0.00 ? 23 VAL A HB   4  
ATOM 4141  H HG11 . VAL A 1 23 ? -14.916 0.842   5.387   1.00 0.00 ? 23 VAL A HG11 4  
ATOM 4142  H HG12 . VAL A 1 23 ? -13.734 1.056   4.094   1.00 0.00 ? 23 VAL A HG12 4  
ATOM 4143  H HG13 . VAL A 1 23 ? -15.240 1.974   4.074   1.00 0.00 ? 23 VAL A HG13 4  
ATOM 4144  H HG21 . VAL A 1 23 ? -15.542 0.057   1.405   1.00 0.00 ? 23 VAL A HG21 4  
ATOM 4145  H HG22 . VAL A 1 23 ? -17.110 0.166   2.204   1.00 0.00 ? 23 VAL A HG22 4  
ATOM 4146  H HG23 . VAL A 1 23 ? -16.000 1.535   2.251   1.00 0.00 ? 23 VAL A HG23 4  
ATOM 4147  N N    . PHE A 1 24 ? -12.614 -1.097  4.802   1.00 0.00 ? 24 PHE A N    4  
ATOM 4148  C CA   . PHE A 1 24 ? -11.877 -1.447  6.010   1.00 0.00 ? 24 PHE A CA   4  
ATOM 4149  C C    . PHE A 1 24 ? -12.502 -0.791  7.238   1.00 0.00 ? 24 PHE A C    4  
ATOM 4150  O O    . PHE A 1 24 ? -12.802 0.403   7.234   1.00 0.00 ? 24 PHE A O    4  
ATOM 4151  C CB   . PHE A 1 24 ? -10.413 -1.021  5.881   1.00 0.00 ? 24 PHE A CB   4  
ATOM 4152  C CG   . PHE A 1 24 ? -9.690  -1.696  4.751   1.00 0.00 ? 24 PHE A CG   4  
ATOM 4153  C CD1  . PHE A 1 24 ? -9.069  -2.920  4.941   1.00 0.00 ? 24 PHE A CD1  4  
ATOM 4154  C CD2  . PHE A 1 24 ? -9.631  -1.107  3.498   1.00 0.00 ? 24 PHE A CD2  4  
ATOM 4155  C CE1  . PHE A 1 24 ? -8.402  -3.543  3.902   1.00 0.00 ? 24 PHE A CE1  4  
ATOM 4156  C CE2  . PHE A 1 24 ? -8.966  -1.725  2.456   1.00 0.00 ? 24 PHE A CE2  4  
ATOM 4157  C CZ   . PHE A 1 24 ? -8.352  -2.945  2.658   1.00 0.00 ? 24 PHE A CZ   4  
ATOM 4158  H H    . PHE A 1 24 ? -12.238 -0.431  4.188   1.00 0.00 ? 24 PHE A H    4  
ATOM 4159  H HA   . PHE A 1 24 ? -11.922 -2.519  6.127   1.00 0.00 ? 24 PHE A HA   4  
ATOM 4160  H HB2  . PHE A 1 24 ? -10.369 0.044   5.713   1.00 0.00 ? 24 PHE A HB2  4  
ATOM 4161  H HB3  . PHE A 1 24 ? -9.894  -1.259  6.798   1.00 0.00 ? 24 PHE A HB3  4  
ATOM 4162  H HD1  . PHE A 1 24 ? -9.108  -3.389  5.913   1.00 0.00 ? 24 PHE A HD1  4  
ATOM 4163  H HD2  . PHE A 1 24 ? -10.112 -0.152  3.339   1.00 0.00 ? 24 PHE A HD2  4  
ATOM 4164  H HE1  . PHE A 1 24 ? -7.923  -4.497  4.063   1.00 0.00 ? 24 PHE A HE1  4  
ATOM 4165  H HE2  . PHE A 1 24 ? -8.929  -1.254  1.485   1.00 0.00 ? 24 PHE A HE2  4  
ATOM 4166  H HZ   . PHE A 1 24 ? -7.831  -3.429  1.846   1.00 0.00 ? 24 PHE A HZ   4  
ATOM 4167  N N    . THR A 1 25 ? -12.698 -1.582  8.289   1.00 0.00 ? 25 THR A N    4  
ATOM 4168  C CA   . THR A 1 25 ? -13.289 -1.080  9.523   1.00 0.00 ? 25 THR A CA   4  
ATOM 4169  C C    . THR A 1 25 ? -12.265 -0.311  10.350  1.00 0.00 ? 25 THR A C    4  
ATOM 4170  O O    . THR A 1 25 ? -11.060 -0.431  10.131  1.00 0.00 ? 25 THR A O    4  
ATOM 4171  C CB   . THR A 1 25 ? -13.864 -2.226  10.376  1.00 0.00 ? 25 THR A CB   4  
ATOM 4172  O OG1  . THR A 1 25 ? -12.820 -2.844  11.136  1.00 0.00 ? 25 THR A OG1  4  
ATOM 4173  C CG2  . THR A 1 25 ? -14.543 -3.267  9.498   1.00 0.00 ? 25 THR A CG2  4  
ATOM 4174  H H    . THR A 1 25 ? -12.438 -2.525  8.231   1.00 0.00 ? 25 THR A H    4  
ATOM 4175  H HA   . THR A 1 25 ? -14.098 -0.415  9.259   1.00 0.00 ? 25 THR A HA   4  
ATOM 4176  H HB   . THR A 1 25 ? -14.599 -1.816  11.055  1.00 0.00 ? 25 THR A HB   4  
ATOM 4177  H HG1  . THR A 1 25 ? -12.849 -2.522  12.041  1.00 0.00 ? 25 THR A HG1  4  
ATOM 4178  H HG21 . THR A 1 25 ? -15.443 -3.614  9.982   1.00 0.00 ? 25 THR A HG21 4  
ATOM 4179  H HG22 . THR A 1 25 ? -13.872 -4.099  9.344   1.00 0.00 ? 25 THR A HG22 4  
ATOM 4180  H HG23 . THR A 1 25 ? -14.793 -2.825  8.546   1.00 0.00 ? 25 THR A HG23 4  
ATOM 4181  N N    . GLU A 1 26 ? -12.753 0.479   11.302  1.00 0.00 ? 26 GLU A N    4  
ATOM 4182  C CA   . GLU A 1 26 ? -11.879 1.268   12.162  1.00 0.00 ? 26 GLU A CA   4  
ATOM 4183  C C    . GLU A 1 26 ? -10.715 0.424   12.675  1.00 0.00 ? 26 GLU A C    4  
ATOM 4184  O O    . GLU A 1 26 ? -9.566  0.869   12.682  1.00 0.00 ? 26 GLU A O    4  
ATOM 4185  C CB   . GLU A 1 26 ? -12.668 1.840   13.341  1.00 0.00 ? 26 GLU A CB   4  
ATOM 4186  C CG   . GLU A 1 26 ? -13.468 3.084   12.993  1.00 0.00 ? 26 GLU A CG   4  
ATOM 4187  C CD   . GLU A 1 26 ? -14.316 3.575   14.149  1.00 0.00 ? 26 GLU A CD   4  
ATOM 4188  O OE1  . GLU A 1 26 ? -15.468 3.111   14.280  1.00 0.00 ? 26 GLU A OE1  4  
ATOM 4189  O OE2  . GLU A 1 26 ? -13.827 4.423   14.925  1.00 0.00 ? 26 GLU A OE2  4  
ATOM 4190  H H    . GLU A 1 26 ? -13.723 0.532   11.428  1.00 0.00 ? 26 GLU A H    4  
ATOM 4191  H HA   . GLU A 1 26 ? -11.485 2.083   11.575  1.00 0.00 ? 26 GLU A HA   4  
ATOM 4192  H HB2  . GLU A 1 26 ? -13.352 1.085   13.701  1.00 0.00 ? 26 GLU A HB2  4  
ATOM 4193  H HB3  . GLU A 1 26 ? -11.976 2.092   14.132  1.00 0.00 ? 26 GLU A HB3  4  
ATOM 4194  H HG2  . GLU A 1 26 ? -12.783 3.869   12.710  1.00 0.00 ? 26 GLU A HG2  4  
ATOM 4195  H HG3  . GLU A 1 26 ? -14.117 2.857   12.160  1.00 0.00 ? 26 GLU A HG3  4  
ATOM 4196  N N    . LEU A 1 27 ? -11.020 -0.795  13.105  1.00 0.00 ? 27 LEU A N    4  
ATOM 4197  C CA   . LEU A 1 27 ? -10.001 -1.702  13.621  1.00 0.00 ? 27 LEU A CA   4  
ATOM 4198  C C    . LEU A 1 27 ? -8.967  -2.026  12.548  1.00 0.00 ? 27 LEU A C    4  
ATOM 4199  O O    . LEU A 1 27 ? -7.794  -1.674  12.677  1.00 0.00 ? 27 LEU A O    4  
ATOM 4200  C CB   . LEU A 1 27 ? -10.648 -2.992  14.128  1.00 0.00 ? 27 LEU A CB   4  
ATOM 4201  C CG   . LEU A 1 27 ? -9.867  -3.760  15.196  1.00 0.00 ? 27 LEU A CG   4  
ATOM 4202  C CD1  . LEU A 1 27 ? -10.237 -3.265  16.586  1.00 0.00 ? 27 LEU A CD1  4  
ATOM 4203  C CD2  . LEU A 1 27 ? -10.125 -5.254  15.074  1.00 0.00 ? 27 LEU A CD2  4  
ATOM 4204  H H    . LEU A 1 27 ? -11.953 -1.093  13.075  1.00 0.00 ? 27 LEU A H    4  
ATOM 4205  H HA   . LEU A 1 27 ? -9.506  -1.209  14.445  1.00 0.00 ? 27 LEU A HA   4  
ATOM 4206  H HB2  . LEU A 1 27 ? -11.612 -2.738  14.542  1.00 0.00 ? 27 LEU A HB2  4  
ATOM 4207  H HB3  . LEU A 1 27 ? -10.783 -3.648  13.280  1.00 0.00 ? 27 LEU A HB3  4  
ATOM 4208  H HG   . LEU A 1 27 ? -8.809  -3.588  15.052  1.00 0.00 ? 27 LEU A HG   4  
ATOM 4209  H HD11 . LEU A 1 27 ? -10.131 -2.192  16.626  1.00 0.00 ? 27 LEU A HD11 4  
ATOM 4210  H HD12 . LEU A 1 27 ? -9.583  -3.720  17.315  1.00 0.00 ? 27 LEU A HD12 4  
ATOM 4211  H HD13 . LEU A 1 27 ? -11.260 -3.535  16.803  1.00 0.00 ? 27 LEU A HD13 4  
ATOM 4212  H HD21 . LEU A 1 27 ? -10.849 -5.556  15.816  1.00 0.00 ? 27 LEU A HD21 4  
ATOM 4213  H HD22 . LEU A 1 27 ? -9.201  -5.793  15.232  1.00 0.00 ? 27 LEU A HD22 4  
ATOM 4214  H HD23 . LEU A 1 27 ? -10.506 -5.474  14.088  1.00 0.00 ? 27 LEU A HD23 4  
ATOM 4215  N N    . GLN A 1 28 ? -9.410  -2.695  11.489  1.00 0.00 ? 28 GLN A N    4  
ATOM 4216  C CA   . GLN A 1 28 ? -8.522  -3.065  10.393  1.00 0.00 ? 28 GLN A CA   4  
ATOM 4217  C C    . GLN A 1 28 ? -7.671  -1.876  9.958   1.00 0.00 ? 28 GLN A C    4  
ATOM 4218  O O    . GLN A 1 28 ? -6.456  -1.996  9.795   1.00 0.00 ? 28 GLN A O    4  
ATOM 4219  C CB   . GLN A 1 28 ? -9.333  -3.588  9.206   1.00 0.00 ? 28 GLN A CB   4  
ATOM 4220  C CG   . GLN A 1 28 ? -10.077 -4.881  9.501   1.00 0.00 ? 28 GLN A CG   4  
ATOM 4221  C CD   . GLN A 1 28 ? -10.757 -5.455  8.274   1.00 0.00 ? 28 GLN A CD   4  
ATOM 4222  O OE1  . GLN A 1 28 ? -11.354 -4.725  7.482   1.00 0.00 ? 28 GLN A OE1  4  
ATOM 4223  N NE2  . GLN A 1 28 ? -10.671 -6.770  8.110   1.00 0.00 ? 28 GLN A NE2  4  
ATOM 4224  H H    . GLN A 1 28 ? -10.355 -2.947  11.444  1.00 0.00 ? 28 GLN A H    4  
ATOM 4225  H HA   . GLN A 1 28 ? -7.869  -3.849  10.745  1.00 0.00 ? 28 GLN A HA   4  
ATOM 4226  H HB2  . GLN A 1 28 ? -10.055 -2.839  8.920   1.00 0.00 ? 28 GLN A HB2  4  
ATOM 4227  H HB3  . GLN A 1 28 ? -8.663  -3.765  8.378   1.00 0.00 ? 28 GLN A HB3  4  
ATOM 4228  H HG2  . GLN A 1 28 ? -9.374  -5.609  9.877   1.00 0.00 ? 28 GLN A HG2  4  
ATOM 4229  H HG3  . GLN A 1 28 ? -10.827 -4.685  10.253  1.00 0.00 ? 28 GLN A HG3  4  
ATOM 4230  H HE21 . GLN A 1 28 ? -10.180 -7.289  8.782   1.00 0.00 ? 28 GLN A HE21 4  
ATOM 4231  H HE22 . GLN A 1 28 ? -11.102 -7.168  7.326   1.00 0.00 ? 28 GLN A HE22 4  
ATOM 4232  N N    . LEU A 1 29 ? -8.316  -0.730  9.770   1.00 0.00 ? 29 LEU A N    4  
ATOM 4233  C CA   . LEU A 1 29 ? -7.618  0.481   9.353   1.00 0.00 ? 29 LEU A CA   4  
ATOM 4234  C C    . LEU A 1 29 ? -6.611  0.921   10.410  1.00 0.00 ? 29 LEU A C    4  
ATOM 4235  O O    . LEU A 1 29 ? -5.461  1.228   10.097  1.00 0.00 ? 29 LEU A O    4  
ATOM 4236  C CB   . LEU A 1 29 ? -8.621  1.605   9.088   1.00 0.00 ? 29 LEU A CB   4  
ATOM 4237  C CG   . LEU A 1 29 ? -9.322  1.574   7.730   1.00 0.00 ? 29 LEU A CG   4  
ATOM 4238  C CD1  . LEU A 1 29 ? -10.346 2.695   7.631   1.00 0.00 ? 29 LEU A CD1  4  
ATOM 4239  C CD2  . LEU A 1 29 ? -8.305  1.678   6.602   1.00 0.00 ? 29 LEU A CD2  4  
ATOM 4240  H H    . LEU A 1 29 ? -9.284  -0.697  9.915   1.00 0.00 ? 29 LEU A H    4  
ATOM 4241  H HA   . LEU A 1 29 ? -7.089  0.260   8.438   1.00 0.00 ? 29 LEU A HA   4  
ATOM 4242  H HB2  . LEU A 1 29 ? -9.381  1.557   9.853   1.00 0.00 ? 29 LEU A HB2  4  
ATOM 4243  H HB3  . LEU A 1 29 ? -8.092  2.545   9.168   1.00 0.00 ? 29 LEU A HB3  4  
ATOM 4244  H HG   . LEU A 1 29 ? -9.846  0.634   7.623   1.00 0.00 ? 29 LEU A HG   4  
ATOM 4245  H HD11 . LEU A 1 29 ? -10.671 2.973   8.622   1.00 0.00 ? 29 LEU A HD11 4  
ATOM 4246  H HD12 . LEU A 1 29 ? -11.194 2.357   7.055   1.00 0.00 ? 29 LEU A HD12 4  
ATOM 4247  H HD13 . LEU A 1 29 ? -9.898  3.549   7.145   1.00 0.00 ? 29 LEU A HD13 4  
ATOM 4248  H HD21 . LEU A 1 29 ? -7.321  1.835   7.020   1.00 0.00 ? 29 LEU A HD21 4  
ATOM 4249  H HD22 . LEU A 1 29 ? -8.560  2.510   5.962   1.00 0.00 ? 29 LEU A HD22 4  
ATOM 4250  H HD23 . LEU A 1 29 ? -8.311  0.765   6.027   1.00 0.00 ? 29 LEU A HD23 4  
ATOM 4251  N N    . MET A 1 30 ? -7.051  0.946   11.664  1.00 0.00 ? 30 MET A N    4  
ATOM 4252  C CA   . MET A 1 30 ? -6.186  1.345   12.769  1.00 0.00 ? 30 MET A CA   4  
ATOM 4253  C C    . MET A 1 30 ? -4.831  0.649   12.677  1.00 0.00 ? 30 MET A C    4  
ATOM 4254  O O    . MET A 1 30 ? -3.791  1.261   12.916  1.00 0.00 ? 30 MET A O    4  
ATOM 4255  C CB   . MET A 1 30 ? -6.850  1.020   14.108  1.00 0.00 ? 30 MET A CB   4  
ATOM 4256  C CG   . MET A 1 30 ? -5.918  1.166   15.300  1.00 0.00 ? 30 MET A CG   4  
ATOM 4257  S SD   . MET A 1 30 ? -6.796  1.579   16.820  1.00 0.00 ? 30 MET A SD   4  
ATOM 4258  C CE   . MET A 1 30 ? -7.102  -0.054  17.488  1.00 0.00 ? 30 MET A CE   4  
ATOM 4259  H H    . MET A 1 30 ? -7.978  0.691   11.852  1.00 0.00 ? 30 MET A H    4  
ATOM 4260  H HA   . MET A 1 30 ? -6.035  2.412   12.702  1.00 0.00 ? 30 MET A HA   4  
ATOM 4261  H HB2  . MET A 1 30 ? -7.690  1.683   14.250  1.00 0.00 ? 30 MET A HB2  4  
ATOM 4262  H HB3  . MET A 1 30 ? -7.207  0.001   14.081  1.00 0.00 ? 30 MET A HB3  4  
ATOM 4263  H HG2  . MET A 1 30 ? -5.393  0.235   15.447  1.00 0.00 ? 30 MET A HG2  4  
ATOM 4264  H HG3  . MET A 1 30 ? -5.206  1.950   15.087  1.00 0.00 ? 30 MET A HG3  4  
ATOM 4265  H HE1  . MET A 1 30 ? -6.160  -0.543  17.692  1.00 0.00 ? 30 MET A HE1  4  
ATOM 4266  H HE2  . MET A 1 30 ? -7.668  0.032   18.404  1.00 0.00 ? 30 MET A HE2  4  
ATOM 4267  H HE3  . MET A 1 30 ? -7.662  -0.637  16.771  1.00 0.00 ? 30 MET A HE3  4  
ATOM 4268  N N    . GLY A 1 31 ? -4.852  -0.634  12.330  1.00 0.00 ? 31 GLY A N    4  
ATOM 4269  C CA   . GLY A 1 31 ? -3.620  -1.391  12.213  1.00 0.00 ? 31 GLY A CA   4  
ATOM 4270  C C    . GLY A 1 31 ? -2.905  -1.138  10.901  1.00 0.00 ? 31 GLY A C    4  
ATOM 4271  O O    . GLY A 1 31 ? -1.678  -1.040  10.862  1.00 0.00 ? 31 GLY A O    4  
ATOM 4272  H H    . GLY A 1 31 ? -5.712  -1.070  12.151  1.00 0.00 ? 31 GLY A H    4  
ATOM 4273  H HA2  . GLY A 1 31 ? -2.964  -1.118  13.027  1.00 0.00 ? 31 GLY A HA2  4  
ATOM 4274  H HA3  . GLY A 1 31 ? -3.849  -2.444  12.287  1.00 0.00 ? 31 GLY A HA3  4  
ATOM 4275  N N    . LEU A 1 32 ? -3.673  -1.033  9.822   1.00 0.00 ? 32 LEU A N    4  
ATOM 4276  C CA   . LEU A 1 32 ? -3.106  -0.791  8.500   1.00 0.00 ? 32 LEU A CA   4  
ATOM 4277  C C    . LEU A 1 32 ? -2.325  0.519   8.473   1.00 0.00 ? 32 LEU A C    4  
ATOM 4278  O O    . LEU A 1 32 ? -1.245  0.596   7.888   1.00 0.00 ? 32 LEU A O    4  
ATOM 4279  C CB   . LEU A 1 32 ? -4.215  -0.758  7.446   1.00 0.00 ? 32 LEU A CB   4  
ATOM 4280  C CG   . LEU A 1 32 ? -4.782  -2.115  7.026   1.00 0.00 ? 32 LEU A CG   4  
ATOM 4281  C CD1  . LEU A 1 32 ? -5.985  -1.931  6.114   1.00 0.00 ? 32 LEU A CD1  4  
ATOM 4282  C CD2  . LEU A 1 32 ? -3.712  -2.950  6.338   1.00 0.00 ? 32 LEU A CD2  4  
ATOM 4283  H H    . LEU A 1 32 ? -4.644  -1.120  9.915   1.00 0.00 ? 32 LEU A H    4  
ATOM 4284  H HA   . LEU A 1 32 ? -2.431  -1.604  8.275   1.00 0.00 ? 32 LEU A HA   4  
ATOM 4285  H HB2  . LEU A 1 32 ? -5.028  -0.168  7.840   1.00 0.00 ? 32 LEU A HB2  4  
ATOM 4286  H HB3  . LEU A 1 32 ? -3.817  -0.277  6.564   1.00 0.00 ? 32 LEU A HB3  4  
ATOM 4287  H HG   . LEU A 1 32 ? -5.110  -2.649  7.906   1.00 0.00 ? 32 LEU A HG   4  
ATOM 4288  H HD11 . LEU A 1 32 ? -5.665  -1.499  5.178   1.00 0.00 ? 32 LEU A HD11 4  
ATOM 4289  H HD12 . LEU A 1 32 ? -6.699  -1.274  6.588   1.00 0.00 ? 32 LEU A HD12 4  
ATOM 4290  H HD13 . LEU A 1 32 ? -6.447  -2.890  5.930   1.00 0.00 ? 32 LEU A HD13 4  
ATOM 4291  H HD21 . LEU A 1 32 ? -4.108  -3.356  5.419   1.00 0.00 ? 32 LEU A HD21 4  
ATOM 4292  H HD22 . LEU A 1 32 ? -3.413  -3.759  6.989   1.00 0.00 ? 32 LEU A HD22 4  
ATOM 4293  H HD23 . LEU A 1 32 ? -2.856  -2.329  6.118   1.00 0.00 ? 32 LEU A HD23 4  
ATOM 4294  N N    . GLU A 1 33 ? -2.878  1.544   9.113   1.00 0.00 ? 33 GLU A N    4  
ATOM 4295  C CA   . GLU A 1 33 ? -2.231  2.850   9.164   1.00 0.00 ? 33 GLU A CA   4  
ATOM 4296  C C    . GLU A 1 33 ? -0.953  2.793   9.997   1.00 0.00 ? 33 GLU A C    4  
ATOM 4297  O O    . GLU A 1 33 ? 0.064   3.386   9.637   1.00 0.00 ? 33 GLU A O    4  
ATOM 4298  C CB   . GLU A 1 33 ? -3.186  3.895   9.746   1.00 0.00 ? 33 GLU A CB   4  
ATOM 4299  C CG   . GLU A 1 33 ? -4.422  4.130   8.895   1.00 0.00 ? 33 GLU A CG   4  
ATOM 4300  C CD   . GLU A 1 33 ? -5.040  5.495   9.127   1.00 0.00 ? 33 GLU A CD   4  
ATOM 4301  O OE1  . GLU A 1 33 ? -4.853  6.050   10.230  1.00 0.00 ? 33 GLU A OE1  4  
ATOM 4302  O OE2  . GLU A 1 33 ? -5.709  6.009   8.206   1.00 0.00 ? 33 GLU A OE2  4  
ATOM 4303  H H    . GLU A 1 33 ? -3.740  1.420   9.561   1.00 0.00 ? 33 GLU A H    4  
ATOM 4304  H HA   . GLU A 1 33 ? -1.975  3.133   8.154   1.00 0.00 ? 33 GLU A HA   4  
ATOM 4305  H HB2  . GLU A 1 33 ? -3.504  3.569   10.725  1.00 0.00 ? 33 GLU A HB2  4  
ATOM 4306  H HB3  . GLU A 1 33 ? -2.658  4.832   9.842   1.00 0.00 ? 33 GLU A HB3  4  
ATOM 4307  H HG2  . GLU A 1 33 ? -4.149  4.048   7.854   1.00 0.00 ? 33 GLU A HG2  4  
ATOM 4308  H HG3  . GLU A 1 33 ? -5.156  3.374   9.133   1.00 0.00 ? 33 GLU A HG3  4  
ATOM 4309  N N    . LYS A 1 34 ? -1.014  2.075   11.113  1.00 0.00 ? 34 LYS A N    4  
ATOM 4310  C CA   . LYS A 1 34 ? 0.136   1.938   11.999  1.00 0.00 ? 34 LYS A CA   4  
ATOM 4311  C C    . LYS A 1 34 ? 1.288   1.234   11.290  1.00 0.00 ? 34 LYS A C    4  
ATOM 4312  O O    . LYS A 1 34 ? 2.379   1.788   11.155  1.00 0.00 ? 34 LYS A O    4  
ATOM 4313  C CB   . LYS A 1 34 ? -0.253  1.161   13.258  1.00 0.00 ? 34 LYS A CB   4  
ATOM 4314  C CG   . LYS A 1 34 ? 0.554   1.547   14.485  1.00 0.00 ? 34 LYS A CG   4  
ATOM 4315  C CD   . LYS A 1 34 ? 1.844   0.750   14.578  1.00 0.00 ? 34 LYS A CD   4  
ATOM 4316  C CE   . LYS A 1 34 ? 1.589   -0.671  15.058  1.00 0.00 ? 34 LYS A CE   4  
ATOM 4317  N NZ   . LYS A 1 34 ? 1.164   -0.706  16.485  1.00 0.00 ? 34 LYS A NZ   4  
ATOM 4318  H H    . LYS A 1 34 ? -1.853  1.625   11.347  1.00 0.00 ? 34 LYS A H    4  
ATOM 4319  H HA   . LYS A 1 34 ? 0.456   2.929   12.283  1.00 0.00 ? 34 LYS A HA   4  
ATOM 4320  H HB2  . LYS A 1 34 ? -1.298  1.340   13.469  1.00 0.00 ? 34 LYS A HB2  4  
ATOM 4321  H HB3  . LYS A 1 34 ? -0.108  0.106   13.075  1.00 0.00 ? 34 LYS A HB3  4  
ATOM 4322  H HG2  . LYS A 1 34 ? 0.796   2.598   14.430  1.00 0.00 ? 34 LYS A HG2  4  
ATOM 4323  H HG3  . LYS A 1 34 ? -0.039  1.358   15.369  1.00 0.00 ? 34 LYS A HG3  4  
ATOM 4324  H HD2  . LYS A 1 34 ? 2.304   0.710   13.601  1.00 0.00 ? 34 LYS A HD2  4  
ATOM 4325  H HD3  . LYS A 1 34 ? 2.512   1.241   15.272  1.00 0.00 ? 34 LYS A HD3  4  
ATOM 4326  H HE2  . LYS A 1 34 ? 0.813   -1.108  14.449  1.00 0.00 ? 34 LYS A HE2  4  
ATOM 4327  H HE3  . LYS A 1 34 ? 2.498   -1.243  14.947  1.00 0.00 ? 34 LYS A HE3  4  
ATOM 4328  H HZ1  . LYS A 1 34 ? 1.630   -1.495  16.976  1.00 0.00 ? 34 LYS A HZ1  4  
ATOM 4329  H HZ2  . LYS A 1 34 ? 0.134   -0.833  16.548  1.00 0.00 ? 34 LYS A HZ2  4  
ATOM 4330  H HZ3  . LYS A 1 34 ? 1.422   0.184   16.957  1.00 0.00 ? 34 LYS A HZ3  4  
ATOM 4331  N N    . ARG A 1 35 ? 1.038   0.009   10.837  1.00 0.00 ? 35 ARG A N    4  
ATOM 4332  C CA   . ARG A 1 35 ? 2.054   -0.770  10.141  1.00 0.00 ? 35 ARG A CA   4  
ATOM 4333  C C    . ARG A 1 35 ? 2.585   -0.012  8.928   1.00 0.00 ? 35 ARG A C    4  
ATOM 4334  O O    . ARG A 1 35 ? 3.794   0.063   8.710   1.00 0.00 ? 35 ARG A O    4  
ATOM 4335  C CB   . ARG A 1 35 ? 1.481   -2.119  9.702   1.00 0.00 ? 35 ARG A CB   4  
ATOM 4336  C CG   . ARG A 1 35 ? 1.280   -3.097  10.848  1.00 0.00 ? 35 ARG A CG   4  
ATOM 4337  C CD   . ARG A 1 35 ? 2.603   -3.670  11.331  1.00 0.00 ? 35 ARG A CD   4  
ATOM 4338  N NE   . ARG A 1 35 ? 2.968   -4.887  10.611  1.00 0.00 ? 35 ARG A NE   4  
ATOM 4339  C CZ   . ARG A 1 35 ? 4.177   -5.435  10.658  1.00 0.00 ? 35 ARG A CZ   4  
ATOM 4340  N NH1  . ARG A 1 35 ? 5.133   -4.877  11.388  1.00 0.00 ? 35 ARG A NH1  4  
ATOM 4341  N NH2  . ARG A 1 35 ? 4.432   -6.544  9.976   1.00 0.00 ? 35 ARG A NH2  4  
ATOM 4342  H H    . ARG A 1 35 ? 0.149   -0.379  10.974  1.00 0.00 ? 35 ARG A H    4  
ATOM 4343  H HA   . ARG A 1 35 ? 2.869   -0.942  10.828  1.00 0.00 ? 35 ARG A HA   4  
ATOM 4344  H HB2  . ARG A 1 35 ? 0.525   -1.954  9.227   1.00 0.00 ? 35 ARG A HB2  4  
ATOM 4345  H HB3  . ARG A 1 35 ? 2.156   -2.568  8.989   1.00 0.00 ? 35 ARG A HB3  4  
ATOM 4346  H HG2  . ARG A 1 35 ? 0.802   -2.582  11.669  1.00 0.00 ? 35 ARG A HG2  4  
ATOM 4347  H HG3  . ARG A 1 35 ? 0.648   -3.906  10.512  1.00 0.00 ? 35 ARG A HG3  4  
ATOM 4348  H HD2  . ARG A 1 35 ? 3.376   -2.930  11.182  1.00 0.00 ? 35 ARG A HD2  4  
ATOM 4349  H HD3  . ARG A 1 35 ? 2.519   -3.896  12.383  1.00 0.00 ? 35 ARG A HD3  4  
ATOM 4350  H HE   . ARG A 1 35 ? 2.276   -5.316  10.066  1.00 0.00 ? 35 ARG A HE   4  
ATOM 4351  H HH11 . ARG A 1 35 ? 4.943   -4.042  11.904  1.00 0.00 ? 35 ARG A HH11 4  
ATOM 4352  H HH12 . ARG A 1 35 ? 6.042   -5.292  11.423  1.00 0.00 ? 35 ARG A HH12 4  
ATOM 4353  H HH21 . ARG A 1 35 ? 3.713   -6.968  9.425   1.00 0.00 ? 35 ARG A HH21 4  
ATOM 4354  H HH22 . ARG A 1 35 ? 5.342   -6.955  10.012  1.00 0.00 ? 35 ARG A HH22 4  
ATOM 4355  N N    . PHE A 1 36 ? 1.673   0.548   8.141   1.00 0.00 ? 36 PHE A N    4  
ATOM 4356  C CA   . PHE A 1 36 ? 2.048   1.299   6.948   1.00 0.00 ? 36 PHE A CA   4  
ATOM 4357  C C    . PHE A 1 36 ? 2.903   2.509   7.315   1.00 0.00 ? 36 PHE A C    4  
ATOM 4358  O O    . PHE A 1 36 ? 3.946   2.750   6.709   1.00 0.00 ? 36 PHE A O    4  
ATOM 4359  C CB   . PHE A 1 36 ? 0.799   1.754   6.191   1.00 0.00 ? 36 PHE A CB   4  
ATOM 4360  C CG   . PHE A 1 36 ? 1.102   2.596   4.985   1.00 0.00 ? 36 PHE A CG   4  
ATOM 4361  C CD1  . PHE A 1 36 ? 1.651   3.861   5.128   1.00 0.00 ? 36 PHE A CD1  4  
ATOM 4362  C CD2  . PHE A 1 36 ? 0.839   2.124   3.710   1.00 0.00 ? 36 PHE A CD2  4  
ATOM 4363  C CE1  . PHE A 1 36 ? 1.930   4.638   4.020   1.00 0.00 ? 36 PHE A CE1  4  
ATOM 4364  C CE2  . PHE A 1 36 ? 1.117   2.896   2.598   1.00 0.00 ? 36 PHE A CE2  4  
ATOM 4365  C CZ   . PHE A 1 36 ? 1.664   4.155   2.753   1.00 0.00 ? 36 PHE A CZ   4  
ATOM 4366  H H    . PHE A 1 36 ? 0.723   0.453   8.367   1.00 0.00 ? 36 PHE A H    4  
ATOM 4367  H HA   . PHE A 1 36 ? 2.625   0.644   6.314   1.00 0.00 ? 36 PHE A HA   4  
ATOM 4368  H HB2  . PHE A 1 36 ? 0.252   0.884   5.859   1.00 0.00 ? 36 PHE A HB2  4  
ATOM 4369  H HB3  . PHE A 1 36 ? 0.176   2.334   6.855   1.00 0.00 ? 36 PHE A HB3  4  
ATOM 4370  H HD1  . PHE A 1 36 ? 1.860   4.239   6.117   1.00 0.00 ? 36 PHE A HD1  4  
ATOM 4371  H HD2  . PHE A 1 36 ? 0.411   1.138   3.587   1.00 0.00 ? 36 PHE A HD2  4  
ATOM 4372  H HE1  . PHE A 1 36 ? 2.357   5.622   4.143   1.00 0.00 ? 36 PHE A HE1  4  
ATOM 4373  H HE2  . PHE A 1 36 ? 0.907   2.515   1.609   1.00 0.00 ? 36 PHE A HE2  4  
ATOM 4374  H HZ   . PHE A 1 36 ? 1.880   4.761   1.886   1.00 0.00 ? 36 PHE A HZ   4  
ATOM 4375  N N    . GLU A 1 37 ? 2.451   3.266   8.310   1.00 0.00 ? 37 GLU A N    4  
ATOM 4376  C CA   . GLU A 1 37 ? 3.174   4.451   8.756   1.00 0.00 ? 37 GLU A CA   4  
ATOM 4377  C C    . GLU A 1 37 ? 4.573   4.084   9.242   1.00 0.00 ? 37 GLU A C    4  
ATOM 4378  O O    . GLU A 1 37 ? 5.570   4.632   8.771   1.00 0.00 ? 37 GLU A O    4  
ATOM 4379  C CB   . GLU A 1 37 ? 2.402   5.156   9.874   1.00 0.00 ? 37 GLU A CB   4  
ATOM 4380  C CG   . GLU A 1 37 ? 1.284   6.052   9.370   1.00 0.00 ? 37 GLU A CG   4  
ATOM 4381  C CD   . GLU A 1 37 ? 1.787   7.400   8.891   1.00 0.00 ? 37 GLU A CD   4  
ATOM 4382  O OE1  . GLU A 1 37 ? 2.578   7.430   7.926   1.00 0.00 ? 37 GLU A OE1  4  
ATOM 4383  O OE2  . GLU A 1 37 ? 1.388   8.425   9.483   1.00 0.00 ? 37 GLU A OE2  4  
ATOM 4384  H H    . GLU A 1 37 ? 1.613   3.021   8.754   1.00 0.00 ? 37 GLU A H    4  
ATOM 4385  H HA   . GLU A 1 37 ? 3.263   5.121   7.915   1.00 0.00 ? 37 GLU A HA   4  
ATOM 4386  H HB2  . GLU A 1 37 ? 1.972   4.408   10.524  1.00 0.00 ? 37 GLU A HB2  4  
ATOM 4387  H HB3  . GLU A 1 37 ? 3.091   5.762   10.443  1.00 0.00 ? 37 GLU A HB3  4  
ATOM 4388  H HG2  . GLU A 1 37 ? 0.787   5.558   8.548   1.00 0.00 ? 37 GLU A HG2  4  
ATOM 4389  H HG3  . GLU A 1 37 ? 0.578   6.211   10.172  1.00 0.00 ? 37 GLU A HG3  4  
ATOM 4390  N N    . LYS A 1 38 ? 4.640   3.154   10.188  1.00 0.00 ? 38 LYS A N    4  
ATOM 4391  C CA   . LYS A 1 38 ? 5.915   2.712   10.739  1.00 0.00 ? 38 LYS A CA   4  
ATOM 4392  C C    . LYS A 1 38 ? 6.844   2.220   9.634   1.00 0.00 ? 38 LYS A C    4  
ATOM 4393  O O    . LYS A 1 38 ? 7.985   2.667   9.526   1.00 0.00 ? 38 LYS A O    4  
ATOM 4394  C CB   . LYS A 1 38 ? 5.692   1.600   11.766  1.00 0.00 ? 38 LYS A CB   4  
ATOM 4395  C CG   . LYS A 1 38 ? 4.945   2.058   13.007  1.00 0.00 ? 38 LYS A CG   4  
ATOM 4396  C CD   . LYS A 1 38 ? 5.792   2.993   13.854  1.00 0.00 ? 38 LYS A CD   4  
ATOM 4397  C CE   . LYS A 1 38 ? 4.965   3.664   14.940  1.00 0.00 ? 38 LYS A CE   4  
ATOM 4398  N NZ   . LYS A 1 38 ? 4.767   2.773   16.117  1.00 0.00 ? 38 LYS A NZ   4  
ATOM 4399  H H    . LYS A 1 38 ? 3.810   2.754   10.524  1.00 0.00 ? 38 LYS A H    4  
ATOM 4400  H HA   . LYS A 1 38 ? 6.375   3.557   11.230  1.00 0.00 ? 38 LYS A HA   4  
ATOM 4401  H HB2  . LYS A 1 38 ? 5.125   0.806   11.303  1.00 0.00 ? 38 LYS A HB2  4  
ATOM 4402  H HB3  . LYS A 1 38 ? 6.653   1.212   12.073  1.00 0.00 ? 38 LYS A HB3  4  
ATOM 4403  H HG2  . LYS A 1 38 ? 4.048   2.577   12.705  1.00 0.00 ? 38 LYS A HG2  4  
ATOM 4404  H HG3  . LYS A 1 38 ? 4.681   1.192   13.597  1.00 0.00 ? 38 LYS A HG3  4  
ATOM 4405  H HD2  . LYS A 1 38 ? 6.584   2.425   14.320  1.00 0.00 ? 38 LYS A HD2  4  
ATOM 4406  H HD3  . LYS A 1 38 ? 6.219   3.754   13.217  1.00 0.00 ? 38 LYS A HD3  4  
ATOM 4407  H HE2  . LYS A 1 38 ? 5.473   4.560   15.260  1.00 0.00 ? 38 LYS A HE2  4  
ATOM 4408  H HE3  . LYS A 1 38 ? 4.000   3.924   14.530  1.00 0.00 ? 38 LYS A HE3  4  
ATOM 4409  H HZ1  . LYS A 1 38 ? 4.203   1.942   15.846  1.00 0.00 ? 38 LYS A HZ1  4  
ATOM 4410  H HZ2  . LYS A 1 38 ? 4.269   3.284   16.873  1.00 0.00 ? 38 LYS A HZ2  4  
ATOM 4411  H HZ3  . LYS A 1 38 ? 5.687   2.450   16.479  1.00 0.00 ? 38 LYS A HZ3  4  
ATOM 4412  N N    . GLN A 1 39 ? 6.346   1.299   8.816   1.00 0.00 ? 39 GLN A N    4  
ATOM 4413  C CA   . GLN A 1 39 ? 7.132   0.747   7.719   1.00 0.00 ? 39 GLN A CA   4  
ATOM 4414  C C    . GLN A 1 39 ? 6.434   0.973   6.382   1.00 0.00 ? 39 GLN A C    4  
ATOM 4415  O O    . GLN A 1 39 ? 5.568   0.194   5.982   1.00 0.00 ? 39 GLN A O    4  
ATOM 4416  C CB   . GLN A 1 39 ? 7.372   -0.748  7.936   1.00 0.00 ? 39 GLN A CB   4  
ATOM 4417  C CG   . GLN A 1 39 ? 8.676   -1.249  7.336   1.00 0.00 ? 39 GLN A CG   4  
ATOM 4418  C CD   . GLN A 1 39 ? 9.176   -2.516  8.002   1.00 0.00 ? 39 GLN A CD   4  
ATOM 4419  O OE1  . GLN A 1 39 ? 9.335   -2.568  9.222   1.00 0.00 ? 39 GLN A OE1  4  
ATOM 4420  N NE2  . GLN A 1 39 ? 9.427   -3.545  7.202   1.00 0.00 ? 39 GLN A NE2  4  
ATOM 4421  H H    . GLN A 1 39 ? 5.429   0.982   8.953   1.00 0.00 ? 39 GLN A H    4  
ATOM 4422  H HA   . GLN A 1 39 ? 8.084   1.256   7.704   1.00 0.00 ? 39 GLN A HA   4  
ATOM 4423  H HB2  . GLN A 1 39 ? 7.389   -0.947  8.997   1.00 0.00 ? 39 GLN A HB2  4  
ATOM 4424  H HB3  . GLN A 1 39 ? 6.559   -1.300  7.487   1.00 0.00 ? 39 GLN A HB3  4  
ATOM 4425  H HG2  . GLN A 1 39 ? 8.521   -1.450  6.286   1.00 0.00 ? 39 GLN A HG2  4  
ATOM 4426  H HG3  . GLN A 1 39 ? 9.427   -0.480  7.447   1.00 0.00 ? 39 GLN A HG3  4  
ATOM 4427  H HE21 . GLN A 1 39 ? 9.278   -3.430  6.240   1.00 0.00 ? 39 GLN A HE21 4  
ATOM 4428  H HE22 . GLN A 1 39 ? 9.752   -4.376  7.605   1.00 0.00 ? 39 GLN A HE22 4  
ATOM 4429  N N    . LYS A 1 40 ? 6.816   2.044   5.694   1.00 0.00 ? 40 LYS A N    4  
ATOM 4430  C CA   . LYS A 1 40 ? 6.228   2.373   4.401   1.00 0.00 ? 40 LYS A CA   4  
ATOM 4431  C C    . LYS A 1 40 ? 5.883   1.107   3.622   1.00 0.00 ? 40 LYS A C    4  
ATOM 4432  O O    . LYS A 1 40 ? 4.833   1.027   2.985   1.00 0.00 ? 40 LYS A O    4  
ATOM 4433  C CB   . LYS A 1 40 ? 7.191   3.239   3.585   1.00 0.00 ? 40 LYS A CB   4  
ATOM 4434  C CG   . LYS A 1 40 ? 7.503   4.577   4.233   1.00 0.00 ? 40 LYS A CG   4  
ATOM 4435  C CD   . LYS A 1 40 ? 6.298   5.502   4.210   1.00 0.00 ? 40 LYS A CD   4  
ATOM 4436  C CE   . LYS A 1 40 ? 6.137   6.174   2.856   1.00 0.00 ? 40 LYS A CE   4  
ATOM 4437  N NZ   . LYS A 1 40 ? 4.711   6.480   2.555   1.00 0.00 ? 40 LYS A NZ   4  
ATOM 4438  H H    . LYS A 1 40 ? 7.512   2.627   6.065   1.00 0.00 ? 40 LYS A H    4  
ATOM 4439  H HA   . LYS A 1 40 ? 5.321   2.930   4.581   1.00 0.00 ? 40 LYS A HA   4  
ATOM 4440  H HB2  . LYS A 1 40 ? 8.119   2.700   3.455   1.00 0.00 ? 40 LYS A HB2  4  
ATOM 4441  H HB3  . LYS A 1 40 ? 6.755   3.426   2.615   1.00 0.00 ? 40 LYS A HB3  4  
ATOM 4442  H HG2  . LYS A 1 40 ? 7.797   4.410   5.259   1.00 0.00 ? 40 LYS A HG2  4  
ATOM 4443  H HG3  . LYS A 1 40 ? 8.316   5.046   3.696   1.00 0.00 ? 40 LYS A HG3  4  
ATOM 4444  H HD2  . LYS A 1 40 ? 5.409   4.926   4.422   1.00 0.00 ? 40 LYS A HD2  4  
ATOM 4445  H HD3  . LYS A 1 40 ? 6.425   6.263   4.968   1.00 0.00 ? 40 LYS A HD3  4  
ATOM 4446  H HE2  . LYS A 1 40 ? 6.701   7.094   2.855   1.00 0.00 ? 40 LYS A HE2  4  
ATOM 4447  H HE3  . LYS A 1 40 ? 6.523   5.514   2.093   1.00 0.00 ? 40 LYS A HE3  4  
ATOM 4448  H HZ1  . LYS A 1 40 ? 4.107   5.680   2.833   1.00 0.00 ? 40 LYS A HZ1  4  
ATOM 4449  H HZ2  . LYS A 1 40 ? 4.589   6.652   1.536   1.00 0.00 ? 40 LYS A HZ2  4  
ATOM 4450  H HZ3  . LYS A 1 40 ? 4.409   7.327   3.077   1.00 0.00 ? 40 LYS A HZ3  4  
ATOM 4451  N N    . TYR A 1 41 ? 6.771   0.122   3.680   1.00 0.00 ? 41 TYR A N    4  
ATOM 4452  C CA   . TYR A 1 41 ? 6.560   -1.140  2.980   1.00 0.00 ? 41 TYR A CA   4  
ATOM 4453  C C    . TYR A 1 41 ? 6.993   -2.321  3.843   1.00 0.00 ? 41 TYR A C    4  
ATOM 4454  O O    . TYR A 1 41 ? 8.130   -2.379  4.312   1.00 0.00 ? 41 TYR A O    4  
ATOM 4455  C CB   . TYR A 1 41 ? 7.331   -1.149  1.659   1.00 0.00 ? 41 TYR A CB   4  
ATOM 4456  C CG   . TYR A 1 41 ? 7.489   0.222   1.040   1.00 0.00 ? 41 TYR A CG   4  
ATOM 4457  C CD1  . TYR A 1 41 ? 8.571   1.031   1.363   1.00 0.00 ? 41 TYR A CD1  4  
ATOM 4458  C CD2  . TYR A 1 41 ? 6.556   0.707   0.132   1.00 0.00 ? 41 TYR A CD2  4  
ATOM 4459  C CE1  . TYR A 1 41 ? 8.719   2.284   0.801   1.00 0.00 ? 41 TYR A CE1  4  
ATOM 4460  C CE2  . TYR A 1 41 ? 6.697   1.958   -0.436  1.00 0.00 ? 41 TYR A CE2  4  
ATOM 4461  C CZ   . TYR A 1 41 ? 7.779   2.743   -0.098  1.00 0.00 ? 41 TYR A CZ   4  
ATOM 4462  O OH   . TYR A 1 41 ? 7.924   3.990   -0.662  1.00 0.00 ? 41 TYR A OH   4  
ATOM 4463  H H    . TYR A 1 41 ? 7.589   0.245   4.205   1.00 0.00 ? 41 TYR A H    4  
ATOM 4464  H HA   . TYR A 1 41 ? 5.504   -1.230  2.770   1.00 0.00 ? 41 TYR A HA   4  
ATOM 4465  H HB2  . TYR A 1 41 ? 8.318   -1.551  1.829   1.00 0.00 ? 41 TYR A HB2  4  
ATOM 4466  H HB3  . TYR A 1 41 ? 6.809   -1.775  0.950   1.00 0.00 ? 41 TYR A HB3  4  
ATOM 4467  H HD1  . TYR A 1 41 ? 9.306   0.668   2.068   1.00 0.00 ? 41 TYR A HD1  4  
ATOM 4468  H HD2  . TYR A 1 41 ? 5.709   0.090   -0.131  1.00 0.00 ? 41 TYR A HD2  4  
ATOM 4469  H HE1  . TYR A 1 41 ? 9.567   2.898   1.065   1.00 0.00 ? 41 TYR A HE1  4  
ATOM 4470  H HE2  . TYR A 1 41 ? 5.961   2.319   -1.140  1.00 0.00 ? 41 TYR A HE2  4  
ATOM 4471  H HH   . TYR A 1 41 ? 7.071   4.430   -0.687  1.00 0.00 ? 41 TYR A HH   4  
ATOM 4472  N N    . LEU A 1 42 ? 6.078   -3.262  4.047   1.00 0.00 ? 42 LEU A N    4  
ATOM 4473  C CA   . LEU A 1 42 ? 6.363   -4.445  4.853   1.00 0.00 ? 42 LEU A CA   4  
ATOM 4474  C C    . LEU A 1 42 ? 7.072   -5.511  4.023   1.00 0.00 ? 42 LEU A C    4  
ATOM 4475  O O    . LEU A 1 42 ? 6.847   -5.626  2.819   1.00 0.00 ? 42 LEU A O    4  
ATOM 4476  C CB   . LEU A 1 42 ? 5.068   -5.013  5.435   1.00 0.00 ? 42 LEU A CB   4  
ATOM 4477  C CG   . LEU A 1 42 ? 4.156   -4.013  6.146   1.00 0.00 ? 42 LEU A CG   4  
ATOM 4478  C CD1  . LEU A 1 42 ? 2.700   -4.436  6.021   1.00 0.00 ? 42 LEU A CD1  4  
ATOM 4479  C CD2  . LEU A 1 42 ? 4.550   -3.877  7.609   1.00 0.00 ? 42 LEU A CD2  4  
ATOM 4480  H H    . LEU A 1 42 ? 5.189   -3.161  3.647   1.00 0.00 ? 42 LEU A H    4  
ATOM 4481  H HA   . LEU A 1 42 ? 7.012   -4.145  5.662   1.00 0.00 ? 42 LEU A HA   4  
ATOM 4482  H HB2  . LEU A 1 42 ? 4.508   -5.455  4.626   1.00 0.00 ? 42 LEU A HB2  4  
ATOM 4483  H HB3  . LEU A 1 42 ? 5.336   -5.782  6.147   1.00 0.00 ? 42 LEU A HB3  4  
ATOM 4484  H HG   . LEU A 1 42 ? 4.262   -3.044  5.678   1.00 0.00 ? 42 LEU A HG   4  
ATOM 4485  H HD11 . LEU A 1 42 ? 2.640   -5.355  5.457   1.00 0.00 ? 42 LEU A HD11 4  
ATOM 4486  H HD12 . LEU A 1 42 ? 2.143   -3.664  5.511   1.00 0.00 ? 42 LEU A HD12 4  
ATOM 4487  H HD13 . LEU A 1 42 ? 2.284   -4.589  7.006   1.00 0.00 ? 42 LEU A HD13 4  
ATOM 4488  H HD21 . LEU A 1 42 ? 4.516   -4.848  8.082   1.00 0.00 ? 42 LEU A HD21 4  
ATOM 4489  H HD22 . LEU A 1 42 ? 3.861   -3.210  8.107   1.00 0.00 ? 42 LEU A HD22 4  
ATOM 4490  H HD23 . LEU A 1 42 ? 5.551   -3.478  7.677   1.00 0.00 ? 42 LEU A HD23 4  
ATOM 4491  N N    . SER A 1 43 ? 7.928   -6.289  4.677   1.00 0.00 ? 43 SER A N    4  
ATOM 4492  C CA   . SER A 1 43 ? 8.672   -7.345  4.000   1.00 0.00 ? 43 SER A CA   4  
ATOM 4493  C C    . SER A 1 43 ? 7.754   -8.508  3.637   1.00 0.00 ? 43 SER A C    4  
ATOM 4494  O O    . SER A 1 43 ? 6.543   -8.452  3.855   1.00 0.00 ? 43 SER A O    4  
ATOM 4495  C CB   . SER A 1 43 ? 9.816   -7.841  4.886   1.00 0.00 ? 43 SER A CB   4  
ATOM 4496  O OG   . SER A 1 43 ? 10.639  -6.766  5.306   1.00 0.00 ? 43 SER A OG   4  
ATOM 4497  H H    . SER A 1 43 ? 8.065   -6.148  5.638   1.00 0.00 ? 43 SER A H    4  
ATOM 4498  H HA   . SER A 1 43 ? 9.085   -6.930  3.092   1.00 0.00 ? 43 SER A HA   4  
ATOM 4499  H HB2  . SER A 1 43 ? 9.408   -8.328  5.759   1.00 0.00 ? 43 SER A HB2  4  
ATOM 4500  H HB3  . SER A 1 43 ? 10.419  -8.545  4.331   1.00 0.00 ? 43 SER A HB3  4  
ATOM 4501  H HG   . SER A 1 43 ? 11.486  -7.108  5.601   1.00 0.00 ? 43 SER A HG   4  
ATOM 4502  N N    . THR A 1 44 ? 8.339   -9.564  3.080   1.00 0.00 ? 44 THR A N    4  
ATOM 4503  C CA   . THR A 1 44 ? 7.576   -10.741 2.685   1.00 0.00 ? 44 THR A CA   4  
ATOM 4504  C C    . THR A 1 44 ? 6.815   -11.326 3.869   1.00 0.00 ? 44 THR A C    4  
ATOM 4505  O O    . THR A 1 44 ? 5.589   -11.436 3.856   1.00 0.00 ? 44 THR A O    4  
ATOM 4506  C CB   . THR A 1 44 ? 8.490   -11.829 2.089   1.00 0.00 ? 44 THR A CB   4  
ATOM 4507  O OG1  . THR A 1 44 ? 8.578   -11.670 0.668   1.00 0.00 ? 44 THR A OG1  4  
ATOM 4508  C CG2  . THR A 1 44 ? 7.963   -13.218 2.417   1.00 0.00 ? 44 THR A CG2  4  
ATOM 4509  H H    . THR A 1 44 ? 9.308   -9.550  2.932   1.00 0.00 ? 44 THR A H    4  
ATOM 4510  H HA   . THR A 1 44 ? 6.868   -10.440 1.927   1.00 0.00 ? 44 THR A HA   4  
ATOM 4511  H HB   . THR A 1 44 ? 9.476   -11.724 2.517   1.00 0.00 ? 44 THR A HB   4  
ATOM 4512  H HG1  . THR A 1 44 ? 7.729   -11.380 0.325   1.00 0.00 ? 44 THR A HG1  4  
ATOM 4513  H HG21 . THR A 1 44 ? 8.039   -13.390 3.480   1.00 0.00 ? 44 THR A HG21 4  
ATOM 4514  H HG22 . THR A 1 44 ? 8.545   -13.958 1.889   1.00 0.00 ? 44 THR A HG22 4  
ATOM 4515  H HG23 . THR A 1 44 ? 6.929   -13.291 2.115   1.00 0.00 ? 44 THR A HG23 4  
ATOM 4516  N N    . PRO A 1 45 ? 7.556   -11.711 4.919   1.00 0.00 ? 45 PRO A N    4  
ATOM 4517  C CA   . PRO A 1 45 ? 6.970   -12.290 6.131   1.00 0.00 ? 45 PRO A CA   4  
ATOM 4518  C C    . PRO A 1 45 ? 6.180   -11.266 6.939   1.00 0.00 ? 45 PRO A C    4  
ATOM 4519  O O    . PRO A 1 45 ? 5.053   -11.529 7.359   1.00 0.00 ? 45 PRO A O    4  
ATOM 4520  C CB   . PRO A 1 45 ? 8.191   -12.768 6.921   1.00 0.00 ? 45 PRO A CB   4  
ATOM 4521  C CG   . PRO A 1 45 ? 9.310   -11.904 6.449   1.00 0.00 ? 45 PRO A CG   4  
ATOM 4522  C CD   . PRO A 1 45 ? 9.023   -11.609 5.003   1.00 0.00 ? 45 PRO A CD   4  
ATOM 4523  H HA   . PRO A 1 45 ? 6.336   -13.133 5.902   1.00 0.00 ? 45 PRO A HA   4  
ATOM 4524  H HB2  . PRO A 1 45 ? 8.011   -12.639 7.979   1.00 0.00 ? 45 PRO A HB2  4  
ATOM 4525  H HB3  . PRO A 1 45 ? 8.379   -13.809 6.707   1.00 0.00 ? 45 PRO A HB3  4  
ATOM 4526  H HG2  . PRO A 1 45 ? 9.334   -10.989 7.021   1.00 0.00 ? 45 PRO A HG2  4  
ATOM 4527  H HG3  . PRO A 1 45 ? 10.247  -12.433 6.544   1.00 0.00 ? 45 PRO A HG3  4  
ATOM 4528  H HD2  . PRO A 1 45 ? 9.355   -10.614 4.747   1.00 0.00 ? 45 PRO A HD2  4  
ATOM 4529  H HD3  . PRO A 1 45 ? 9.496   -12.342 4.367   1.00 0.00 ? 45 PRO A HD3  4  
ATOM 4530  N N    . ASP A 1 46 ? 6.778   -10.099 7.153   1.00 0.00 ? 46 ASP A N    4  
ATOM 4531  C CA   . ASP A 1 46 ? 6.129   -9.035  7.910   1.00 0.00 ? 46 ASP A CA   4  
ATOM 4532  C C    . ASP A 1 46 ? 4.698   -8.820  7.427   1.00 0.00 ? 46 ASP A C    4  
ATOM 4533  O O    . ASP A 1 46 ? 3.749   -8.913  8.206   1.00 0.00 ? 46 ASP A O    4  
ATOM 4534  C CB   . ASP A 1 46 ? 6.923   -7.734  7.785   1.00 0.00 ? 46 ASP A CB   4  
ATOM 4535  C CG   . ASP A 1 46 ? 8.077   -7.663  8.767   1.00 0.00 ? 46 ASP A CG   4  
ATOM 4536  O OD1  . ASP A 1 46 ? 9.002   -8.494  8.654   1.00 0.00 ? 46 ASP A OD1  4  
ATOM 4537  O OD2  . ASP A 1 46 ? 8.053   -6.779  9.648   1.00 0.00 ? 46 ASP A OD2  4  
ATOM 4538  H H    . ASP A 1 46 ? 7.677   -9.950  6.793   1.00 0.00 ? 46 ASP A H    4  
ATOM 4539  H HA   . ASP A 1 46 ? 6.105   -9.333  8.947   1.00 0.00 ? 46 ASP A HA   4  
ATOM 4540  H HB2  . ASP A 1 46 ? 7.322   -7.658  6.784   1.00 0.00 ? 46 ASP A HB2  4  
ATOM 4541  H HB3  . ASP A 1 46 ? 6.264   -6.898  7.971   1.00 0.00 ? 46 ASP A HB3  4  
ATOM 4542  N N    . ARG A 1 47 ? 4.550   -8.532  6.139   1.00 0.00 ? 47 ARG A N    4  
ATOM 4543  C CA   . ARG A 1 47 ? 3.235   -8.301  5.553   1.00 0.00 ? 47 ARG A CA   4  
ATOM 4544  C C    . ARG A 1 47 ? 2.269   -9.420  5.929   1.00 0.00 ? 47 ARG A C    4  
ATOM 4545  O O    . ARG A 1 47 ? 1.133   -9.164  6.330   1.00 0.00 ? 47 ARG A O    4  
ATOM 4546  C CB   . ARG A 1 47 ? 3.343   -8.196  4.030   1.00 0.00 ? 47 ARG A CB   4  
ATOM 4547  C CG   . ARG A 1 47 ? 2.000   -8.055  3.333   1.00 0.00 ? 47 ARG A CG   4  
ATOM 4548  C CD   . ARG A 1 47 ? 2.168   -7.873  1.833   1.00 0.00 ? 47 ARG A CD   4  
ATOM 4549  N NE   . ARG A 1 47 ? 2.353   -9.148  1.144   1.00 0.00 ? 47 ARG A NE   4  
ATOM 4550  C CZ   . ARG A 1 47 ? 2.432   -9.265  -0.176  1.00 0.00 ? 47 ARG A CZ   4  
ATOM 4551  N NH1  . ARG A 1 47 ? 2.342   -8.190  -0.947  1.00 0.00 ? 47 ARG A NH1  4  
ATOM 4552  N NH2  . ARG A 1 47 ? 2.602   -10.459 -0.729  1.00 0.00 ? 47 ARG A NH2  4  
ATOM 4553  H H    . ARG A 1 47 ? 5.345   -8.471  5.568   1.00 0.00 ? 47 ARG A H    4  
ATOM 4554  H HA   . ARG A 1 47 ? 2.857   -7.368  5.943   1.00 0.00 ? 47 ARG A HA   4  
ATOM 4555  H HB2  . ARG A 1 47 ? 3.945   -7.334  3.782   1.00 0.00 ? 47 ARG A HB2  4  
ATOM 4556  H HB3  . ARG A 1 47 ? 3.828   -9.084  3.654   1.00 0.00 ? 47 ARG A HB3  4  
ATOM 4557  H HG2  . ARG A 1 47 ? 1.415   -8.945  3.513   1.00 0.00 ? 47 ARG A HG2  4  
ATOM 4558  H HG3  . ARG A 1 47 ? 1.485   -7.195  3.736   1.00 0.00 ? 47 ARG A HG3  4  
ATOM 4559  H HD2  . ARG A 1 47 ? 1.285   -7.389  1.441   1.00 0.00 ? 47 ARG A HD2  4  
ATOM 4560  H HD3  . ARG A 1 47 ? 3.030   -7.248  1.654   1.00 0.00 ? 47 ARG A HD3  4  
ATOM 4561  H HE   . ARG A 1 47 ? 2.422   -9.955  1.695   1.00 0.00 ? 47 ARG A HE   4  
ATOM 4562  H HH11 . ARG A 1 47 ? 2.215   -7.288  -0.534  1.00 0.00 ? 47 ARG A HH11 4  
ATOM 4563  H HH12 . ARG A 1 47 ? 2.403   -8.281  -1.942  1.00 0.00 ? 47 ARG A HH12 4  
ATOM 4564  H HH21 . ARG A 1 47 ? 2.670   -11.272 -0.151  1.00 0.00 ? 47 ARG A HH21 4  
ATOM 4565  H HH22 . ARG A 1 47 ? 2.661   -10.547 -1.723  1.00 0.00 ? 47 ARG A HH22 4  
ATOM 4566  N N    . ILE A 1 48 ? 2.727   -10.660 5.796   1.00 0.00 ? 48 ILE A N    4  
ATOM 4567  C CA   . ILE A 1 48 ? 1.903   -11.817 6.123   1.00 0.00 ? 48 ILE A CA   4  
ATOM 4568  C C    . ILE A 1 48 ? 1.493   -11.803 7.591   1.00 0.00 ? 48 ILE A C    4  
ATOM 4569  O O    . ILE A 1 48 ? 0.307   -11.743 7.914   1.00 0.00 ? 48 ILE A O    4  
ATOM 4570  C CB   . ILE A 1 48 ? 2.639   -13.136 5.819   1.00 0.00 ? 48 ILE A CB   4  
ATOM 4571  C CG1  . ILE A 1 48 ? 3.040   -13.194 4.344   1.00 0.00 ? 48 ILE A CG1  4  
ATOM 4572  C CG2  . ILE A 1 48 ? 1.765   -14.326 6.183   1.00 0.00 ? 48 ILE A CG2  4  
ATOM 4573  C CD1  . ILE A 1 48 ? 4.085   -14.246 4.042   1.00 0.00 ? 48 ILE A CD1  4  
ATOM 4574  H H    . ILE A 1 48 ? 3.641   -10.800 5.471   1.00 0.00 ? 48 ILE A H    4  
ATOM 4575  H HA   . ILE A 1 48 ? 1.013   -11.776 5.511   1.00 0.00 ? 48 ILE A HA   4  
ATOM 4576  H HB   . ILE A 1 48 ? 3.529   -13.174 6.429   1.00 0.00 ? 48 ILE A HB   4  
ATOM 4577  H HG12 . ILE A 1 48 ? 2.168   -13.413 3.748   1.00 0.00 ? 48 ILE A HG12 4  
ATOM 4578  H HG13 . ILE A 1 48 ? 3.440   -12.234 4.050   1.00 0.00 ? 48 ILE A HG13 4  
ATOM 4579  H HG21 . ILE A 1 48 ? 2.389   -15.147 6.503   1.00 0.00 ? 48 ILE A HG21 4  
ATOM 4580  H HG22 . ILE A 1 48 ? 1.097   -14.050 6.985   1.00 0.00 ? 48 ILE A HG22 4  
ATOM 4581  H HG23 . ILE A 1 48 ? 1.188   -14.627 5.321   1.00 0.00 ? 48 ILE A HG23 4  
ATOM 4582  H HD11 . ILE A 1 48 ? 4.172   -14.370 2.973   1.00 0.00 ? 48 ILE A HD11 4  
ATOM 4583  H HD12 . ILE A 1 48 ? 5.036   -13.937 4.449   1.00 0.00 ? 48 ILE A HD12 4  
ATOM 4584  H HD13 . ILE A 1 48 ? 3.790   -15.184 4.490   1.00 0.00 ? 48 ILE A HD13 4  
ATOM 4585  N N    . ASP A 1 49 ? 2.482   -11.858 8.476   1.00 0.00 ? 49 ASP A N    4  
ATOM 4586  C CA   . ASP A 1 49 ? 2.225   -11.849 9.912   1.00 0.00 ? 49 ASP A CA   4  
ATOM 4587  C C    . ASP A 1 49 ? 1.075   -10.906 10.252  1.00 0.00 ? 49 ASP A C    4  
ATOM 4588  O O    . ASP A 1 49 ? 0.154   -11.271 10.984  1.00 0.00 ? 49 ASP A O    4  
ATOM 4589  C CB   . ASP A 1 49 ? 3.484   -11.434 10.674  1.00 0.00 ? 49 ASP A CB   4  
ATOM 4590  C CG   . ASP A 1 49 ? 3.534   -12.019 12.072  1.00 0.00 ? 49 ASP A CG   4  
ATOM 4591  O OD1  . ASP A 1 49 ? 3.514   -13.262 12.195  1.00 0.00 ? 49 ASP A OD1  4  
ATOM 4592  O OD2  . ASP A 1 49 ? 3.592   -11.235 13.042  1.00 0.00 ? 49 ASP A OD2  4  
ATOM 4593  H H    . ASP A 1 49 ? 3.408   -11.905 8.157   1.00 0.00 ? 49 ASP A H    4  
ATOM 4594  H HA   . ASP A 1 49 ? 1.951   -12.851 10.206  1.00 0.00 ? 49 ASP A HA   4  
ATOM 4595  H HB2  . ASP A 1 49 ? 4.354   -11.772 10.131  1.00 0.00 ? 49 ASP A HB2  4  
ATOM 4596  H HB3  . ASP A 1 49 ? 3.510   -10.357 10.753  1.00 0.00 ? 49 ASP A HB3  4  
ATOM 4597  N N    . LEU A 1 50 ? 1.135   -9.692  9.717   1.00 0.00 ? 50 LEU A N    4  
ATOM 4598  C CA   . LEU A 1 50 ? 0.098   -8.695  9.964   1.00 0.00 ? 50 LEU A CA   4  
ATOM 4599  C C    . LEU A 1 50 ? -1.255  -9.178  9.453   1.00 0.00 ? 50 LEU A C    4  
ATOM 4600  O O    . LEU A 1 50 ? -2.179  -9.406  10.234  1.00 0.00 ? 50 LEU A O    4  
ATOM 4601  C CB   . LEU A 1 50 ? 0.466   -7.371  9.292   1.00 0.00 ? 50 LEU A CB   4  
ATOM 4602  C CG   . LEU A 1 50 ? -0.690  -6.403  9.038   1.00 0.00 ? 50 LEU A CG   4  
ATOM 4603  C CD1  . LEU A 1 50 ? -1.057  -5.662  10.314  1.00 0.00 ? 50 LEU A CD1  4  
ATOM 4604  C CD2  . LEU A 1 50 ? -0.330  -5.420  7.933   1.00 0.00 ? 50 LEU A CD2  4  
ATOM 4605  H H    . LEU A 1 50 ? 1.893   -9.459  9.142   1.00 0.00 ? 50 LEU A H    4  
ATOM 4606  H HA   . LEU A 1 50 ? 0.033   -8.542  11.031  1.00 0.00 ? 50 LEU A HA   4  
ATOM 4607  H HB2  . LEU A 1 50 ? 1.185   -6.869  9.922   1.00 0.00 ? 50 LEU A HB2  4  
ATOM 4608  H HB3  . LEU A 1 50 ? 0.923   -7.600  8.340   1.00 0.00 ? 50 LEU A HB3  4  
ATOM 4609  H HG   . LEU A 1 50 ? -1.557  -6.964  8.718   1.00 0.00 ? 50 LEU A HG   4  
ATOM 4610  H HD11 . LEU A 1 50 ? -1.292  -4.635  10.079  1.00 0.00 ? 50 LEU A HD11 4  
ATOM 4611  H HD12 . LEU A 1 50 ? -0.223  -5.692  11.000  1.00 0.00 ? 50 LEU A HD12 4  
ATOM 4612  H HD13 . LEU A 1 50 ? -1.914  -6.134  10.770  1.00 0.00 ? 50 LEU A HD13 4  
ATOM 4613  H HD21 . LEU A 1 50 ? 0.071   -4.518  8.371   1.00 0.00 ? 50 LEU A HD21 4  
ATOM 4614  H HD22 . LEU A 1 50 ? -1.215  -5.180  7.362   1.00 0.00 ? 50 LEU A HD22 4  
ATOM 4615  H HD23 . LEU A 1 50 ? 0.409   -5.864  7.283   1.00 0.00 ? 50 LEU A HD23 4  
ATOM 4616  N N    . ALA A 1 51 ? -1.364  -9.335  8.138   1.00 0.00 ? 51 ALA A N    4  
ATOM 4617  C CA   . ALA A 1 51 ? -2.603  -9.796  7.523   1.00 0.00 ? 51 ALA A CA   4  
ATOM 4618  C C    . ALA A 1 51 ? -3.297  -10.834 8.399   1.00 0.00 ? 51 ALA A C    4  
ATOM 4619  O O    . ALA A 1 51 ? -4.525  -10.884 8.461   1.00 0.00 ? 51 ALA A O    4  
ATOM 4620  C CB   . ALA A 1 51 ? -2.326  -10.368 6.141   1.00 0.00 ? 51 ALA A CB   4  
ATOM 4621  H H    . ALA A 1 51 ? -0.592  -9.137  7.568   1.00 0.00 ? 51 ALA A H    4  
ATOM 4622  H HA   . ALA A 1 51 ? -3.256  -8.942  7.408   1.00 0.00 ? 51 ALA A HA   4  
ATOM 4623  H HB1  . ALA A 1 51 ? -2.279  -11.446 6.202   1.00 0.00 ? 51 ALA A HB1  4  
ATOM 4624  H HB2  . ALA A 1 51 ? -3.117  -10.079 5.467   1.00 0.00 ? 51 ALA A HB2  4  
ATOM 4625  H HB3  . ALA A 1 51 ? -1.384  -9.987  5.777   1.00 0.00 ? 51 ALA A HB3  4  
ATOM 4626  N N    . GLU A 1 52 ? -2.502  -11.660 9.072   1.00 0.00 ? 52 GLU A N    4  
ATOM 4627  C CA   . GLU A 1 52 ? -3.042  -12.697 9.943   1.00 0.00 ? 52 GLU A CA   4  
ATOM 4628  C C    . GLU A 1 52 ? -3.517  -12.105 11.266  1.00 0.00 ? 52 GLU A C    4  
ATOM 4629  O O    . GLU A 1 52 ? -4.583  -12.459 11.771  1.00 0.00 ? 52 GLU A O    4  
ATOM 4630  C CB   . GLU A 1 52 ? -1.988  -13.775 10.203  1.00 0.00 ? 52 GLU A CB   4  
ATOM 4631  C CG   . GLU A 1 52 ? -2.012  -14.907 9.189   1.00 0.00 ? 52 GLU A CG   4  
ATOM 4632  C CD   . GLU A 1 52 ? -3.230  -15.798 9.338   1.00 0.00 ? 52 GLU A CD   4  
ATOM 4633  O OE1  . GLU A 1 52 ? -3.208  -16.692 10.209  1.00 0.00 ? 52 GLU A OE1  4  
ATOM 4634  O OE2  . GLU A 1 52 ? -4.205  -15.601 8.583   1.00 0.00 ? 52 GLU A OE2  4  
ATOM 4635  H H    . GLU A 1 52 ? -1.531  -11.569 8.981   1.00 0.00 ? 52 GLU A H    4  
ATOM 4636  H HA   . GLU A 1 52 ? -3.886  -13.146 9.440   1.00 0.00 ? 52 GLU A HA   4  
ATOM 4637  H HB2  . GLU A 1 52 ? -1.010  -13.318 10.179  1.00 0.00 ? 52 GLU A HB2  4  
ATOM 4638  H HB3  . GLU A 1 52 ? -2.155  -14.196 11.184  1.00 0.00 ? 52 GLU A HB3  4  
ATOM 4639  H HG2  . GLU A 1 52 ? -2.014  -14.484 8.196   1.00 0.00 ? 52 GLU A HG2  4  
ATOM 4640  H HG3  . GLU A 1 52 ? -1.125  -15.510 9.321   1.00 0.00 ? 52 GLU A HG3  4  
ATOM 4641  N N    . SER A 1 53 ? -2.718  -11.201 11.824  1.00 0.00 ? 53 SER A N    4  
ATOM 4642  C CA   . SER A 1 53 ? -3.053  -10.562 13.091  1.00 0.00 ? 53 SER A CA   4  
ATOM 4643  C C    . SER A 1 53 ? -4.380  -9.817  12.989  1.00 0.00 ? 53 SER A C    4  
ATOM 4644  O O    . SER A 1 53 ? -5.226  -9.906  13.880  1.00 0.00 ? 53 SER A O    4  
ATOM 4645  C CB   . SER A 1 53 ? -1.943  -9.595  13.508  1.00 0.00 ? 53 SER A CB   4  
ATOM 4646  O OG   . SER A 1 53 ? -2.253  -8.962  14.737  1.00 0.00 ? 53 SER A OG   4  
ATOM 4647  H H    . SER A 1 53 ? -1.881  -10.960 11.373  1.00 0.00 ? 53 SER A H    4  
ATOM 4648  H HA   . SER A 1 53 ? -3.144  -11.336 13.839  1.00 0.00 ? 53 SER A HA   4  
ATOM 4649  H HB2  . SER A 1 53 ? -1.018  -10.140 13.622  1.00 0.00 ? 53 SER A HB2  4  
ATOM 4650  H HB3  . SER A 1 53 ? -1.823  -8.838  12.747  1.00 0.00 ? 53 SER A HB3  4  
ATOM 4651  H HG   . SER A 1 53 ? -3.206  -8.923  14.846  1.00 0.00 ? 53 SER A HG   4  
ATOM 4652  N N    . LEU A 1 54 ? -4.555  -9.080  11.897  1.00 0.00 ? 54 LEU A N    4  
ATOM 4653  C CA   . LEU A 1 54 ? -5.780  -8.318  11.677  1.00 0.00 ? 54 LEU A CA   4  
ATOM 4654  C C    . LEU A 1 54 ? -6.836  -9.173  10.983  1.00 0.00 ? 54 LEU A C    4  
ATOM 4655  O O    . LEU A 1 54 ? -8.034  -8.931  11.122  1.00 0.00 ? 54 LEU A O    4  
ATOM 4656  C CB   . LEU A 1 54 ? -5.484  -7.073  10.839  1.00 0.00 ? 54 LEU A CB   4  
ATOM 4657  C CG   . LEU A 1 54 ? -4.562  -6.035  11.481  1.00 0.00 ? 54 LEU A CG   4  
ATOM 4658  C CD1  . LEU A 1 54 ? -4.236  -4.927  10.492  1.00 0.00 ? 54 LEU A CD1  4  
ATOM 4659  C CD2  . LEU A 1 54 ? -5.199  -5.461  12.738  1.00 0.00 ? 54 LEU A CD2  4  
ATOM 4660  H H    . LEU A 1 54 ? -3.846  -9.048  11.223  1.00 0.00 ? 54 LEU A H    4  
ATOM 4661  H HA   . LEU A 1 54 ? -6.157  -8.012  12.641  1.00 0.00 ? 54 LEU A HA   4  
ATOM 4662  H HB2  . LEU A 1 54 ? -5.027  -7.395  9.917   1.00 0.00 ? 54 LEU A HB2  4  
ATOM 4663  H HB3  . LEU A 1 54 ? -6.427  -6.590  10.623  1.00 0.00 ? 54 LEU A HB3  4  
ATOM 4664  H HG   . LEU A 1 54 ? -3.634  -6.514  11.763  1.00 0.00 ? 54 LEU A HG   4  
ATOM 4665  H HD11 . LEU A 1 54 ? -4.363  -5.294  9.485   1.00 0.00 ? 54 LEU A HD11 4  
ATOM 4666  H HD12 . LEU A 1 54 ? -3.214  -4.608  10.634  1.00 0.00 ? 54 LEU A HD12 4  
ATOM 4667  H HD13 . LEU A 1 54 ? -4.900  -4.091  10.658  1.00 0.00 ? 54 LEU A HD13 4  
ATOM 4668  H HD21 . LEU A 1 54 ? -6.083  -6.029  12.985  1.00 0.00 ? 54 LEU A HD21 4  
ATOM 4669  H HD22 . LEU A 1 54 ? -5.470  -4.430  12.565  1.00 0.00 ? 54 LEU A HD22 4  
ATOM 4670  H HD23 . LEU A 1 54 ? -4.495  -5.517  13.556  1.00 0.00 ? 54 LEU A HD23 4  
ATOM 4671  N N    . GLY A 1 55 ? -6.382  -10.176 10.238  1.00 0.00 ? 55 GLY A N    4  
ATOM 4672  C CA   . GLY A 1 55 ? -7.301  -11.053 9.535   1.00 0.00 ? 55 GLY A CA   4  
ATOM 4673  C C    . GLY A 1 55 ? -7.323  -10.793 8.042   1.00 0.00 ? 55 GLY A C    4  
ATOM 4674  O O    . GLY A 1 55 ? -7.976  -11.516 7.288   1.00 0.00 ? 55 GLY A O    4  
ATOM 4675  H H    . GLY A 1 55 ? -5.415  -10.321 10.164  1.00 0.00 ? 55 GLY A H    4  
ATOM 4676  H HA2  . GLY A 1 55 ? -7.006  -12.077 9.708   1.00 0.00 ? 55 GLY A HA2  4  
ATOM 4677  H HA3  . GLY A 1 55 ? -8.295  -10.904 9.930   1.00 0.00 ? 55 GLY A HA3  4  
ATOM 4678  N N    . LEU A 1 56 ? -6.611  -9.756  7.613   1.00 0.00 ? 56 LEU A N    4  
ATOM 4679  C CA   . LEU A 1 56 ? -6.553  -9.401  6.199   1.00 0.00 ? 56 LEU A CA   4  
ATOM 4680  C C    . LEU A 1 56 ? -5.610  -10.331 5.442   1.00 0.00 ? 56 LEU A C    4  
ATOM 4681  O O    . LEU A 1 56 ? -4.942  -11.174 6.040   1.00 0.00 ? 56 LEU A O    4  
ATOM 4682  C CB   . LEU A 1 56 ? -6.097  -7.950  6.036   1.00 0.00 ? 56 LEU A CB   4  
ATOM 4683  C CG   . LEU A 1 56 ? -6.879  -6.907  6.836   1.00 0.00 ? 56 LEU A CG   4  
ATOM 4684  C CD1  . LEU A 1 56 ? -6.140  -5.578  6.844   1.00 0.00 ? 56 LEU A CD1  4  
ATOM 4685  C CD2  . LEU A 1 56 ? -8.279  -6.737  6.266   1.00 0.00 ? 56 LEU A CD2  4  
ATOM 4686  H H    . LEU A 1 56 ? -6.112  -9.217  8.261   1.00 0.00 ? 56 LEU A H    4  
ATOM 4687  H HA   . LEU A 1 56 ? -7.547  -9.505  5.791   1.00 0.00 ? 56 LEU A HA   4  
ATOM 4688  H HB2  . LEU A 1 56 ? -5.063  -7.893  6.340   1.00 0.00 ? 56 LEU A HB2  4  
ATOM 4689  H HB3  . LEU A 1 56 ? -6.178  -7.695  4.989   1.00 0.00 ? 56 LEU A HB3  4  
ATOM 4690  H HG   . LEU A 1 56 ? -6.972  -7.243  7.860   1.00 0.00 ? 56 LEU A HG   4  
ATOM 4691  H HD11 . LEU A 1 56 ? -6.710  -4.846  6.292   1.00 0.00 ? 56 LEU A HD11 4  
ATOM 4692  H HD12 . LEU A 1 56 ? -5.171  -5.701  6.384   1.00 0.00 ? 56 LEU A HD12 4  
ATOM 4693  H HD13 . LEU A 1 56 ? -6.014  -5.243  7.864   1.00 0.00 ? 56 LEU A HD13 4  
ATOM 4694  H HD21 . LEU A 1 56 ? -8.774  -7.697  6.237   1.00 0.00 ? 56 LEU A HD21 4  
ATOM 4695  H HD22 . LEU A 1 56 ? -8.214  -6.336  5.265   1.00 0.00 ? 56 LEU A HD22 4  
ATOM 4696  H HD23 . LEU A 1 56 ? -8.842  -6.060  6.890   1.00 0.00 ? 56 LEU A HD23 4  
ATOM 4697  N N    . SER A 1 57 ? -5.560  -10.168 4.124   1.00 0.00 ? 57 SER A N    4  
ATOM 4698  C CA   . SER A 1 57 ? -4.700  -10.994 3.285   1.00 0.00 ? 57 SER A CA   4  
ATOM 4699  C C    . SER A 1 57 ? -3.505  -10.193 2.776   1.00 0.00 ? 57 SER A C    4  
ATOM 4700  O O    . SER A 1 57 ? -3.558  -8.966  2.694   1.00 0.00 ? 57 SER A O    4  
ATOM 4701  C CB   . SER A 1 57 ? -5.492  -11.556 2.103   1.00 0.00 ? 57 SER A CB   4  
ATOM 4702  O OG   . SER A 1 57 ? -4.704  -12.456 1.342   1.00 0.00 ? 57 SER A OG   4  
ATOM 4703  H H    . SER A 1 57 ? -6.117  -9.479  3.706   1.00 0.00 ? 57 SER A H    4  
ATOM 4704  H HA   . SER A 1 57 ? -4.338  -11.814 3.887   1.00 0.00 ? 57 SER A HA   4  
ATOM 4705  H HB2  . SER A 1 57 ? -6.361  -12.080 2.471   1.00 0.00 ? 57 SER A HB2  4  
ATOM 4706  H HB3  . SER A 1 57 ? -5.805  -10.742 1.464   1.00 0.00 ? 57 SER A HB3  4  
ATOM 4707  H HG   . SER A 1 57 ? -4.270  -11.979 0.631   1.00 0.00 ? 57 SER A HG   4  
ATOM 4708  N N    . GLN A 1 58 ? -2.430  -10.896 2.437   1.00 0.00 ? 58 GLN A N    4  
ATOM 4709  C CA   . GLN A 1 58 ? -1.222  -10.250 1.937   1.00 0.00 ? 58 GLN A CA   4  
ATOM 4710  C C    . GLN A 1 58 ? -1.558  -9.234  0.850   1.00 0.00 ? 58 GLN A C    4  
ATOM 4711  O O    . GLN A 1 58 ? -0.857  -8.235  0.682   1.00 0.00 ? 58 GLN A O    4  
ATOM 4712  C CB   . GLN A 1 58 ? -0.248  -11.296 1.391   1.00 0.00 ? 58 GLN A CB   4  
ATOM 4713  C CG   . GLN A 1 58 ? 0.137   -12.358 2.408   1.00 0.00 ? 58 GLN A CG   4  
ATOM 4714  C CD   . GLN A 1 58 ? 0.519   -13.674 1.760   1.00 0.00 ? 58 GLN A CD   4  
ATOM 4715  O OE1  . GLN A 1 58 ? -0.267  -14.622 1.743   1.00 0.00 ? 58 GLN A OE1  4  
ATOM 4716  N NE2  . GLN A 1 58 ? 1.732   -13.741 1.223   1.00 0.00 ? 58 GLN A NE2  4  
ATOM 4717  H H    . GLN A 1 58 ? -2.449  -11.871 2.524   1.00 0.00 ? 58 GLN A H    4  
ATOM 4718  H HA   . GLN A 1 58 ? -0.756  -9.734  2.763   1.00 0.00 ? 58 GLN A HA   4  
ATOM 4719  H HB2  . GLN A 1 58 ? -0.703  -11.787 0.544   1.00 0.00 ? 58 GLN A HB2  4  
ATOM 4720  H HB3  . GLN A 1 58 ? 0.653   -10.796 1.066   1.00 0.00 ? 58 GLN A HB3  4  
ATOM 4721  H HG2  . GLN A 1 58 ? 0.979   -12.000 2.982   1.00 0.00 ? 58 GLN A HG2  4  
ATOM 4722  H HG3  . GLN A 1 58 ? -0.701  -12.527 3.067   1.00 0.00 ? 58 GLN A HG3  4  
ATOM 4723  H HE21 . GLN A 1 58 ? 2.305   -12.946 1.275   1.00 0.00 ? 58 GLN A HE21 4  
ATOM 4724  H HE22 . GLN A 1 58 ? 2.005   -14.580 0.799   1.00 0.00 ? 58 GLN A HE22 4  
ATOM 4725  N N    . LEU A 1 59 ? -2.632  -9.496  0.114   1.00 0.00 ? 59 LEU A N    4  
ATOM 4726  C CA   . LEU A 1 59 ? -3.061  -8.604  -0.958  1.00 0.00 ? 59 LEU A CA   4  
ATOM 4727  C C    . LEU A 1 59 ? -3.461  -7.240  -0.404  1.00 0.00 ? 59 LEU A C    4  
ATOM 4728  O O    . LEU A 1 59 ? -2.860  -6.222  -0.744  1.00 0.00 ? 59 LEU A O    4  
ATOM 4729  C CB   . LEU A 1 59 ? -4.233  -9.221  -1.723  1.00 0.00 ? 59 LEU A CB   4  
ATOM 4730  C CG   . LEU A 1 59 ? -4.790  -8.392  -2.880  1.00 0.00 ? 59 LEU A CG   4  
ATOM 4731  C CD1  . LEU A 1 59 ? -3.715  -8.146  -3.927  1.00 0.00 ? 59 LEU A CD1  4  
ATOM 4732  C CD2  . LEU A 1 59 ? -5.994  -9.085  -3.502  1.00 0.00 ? 59 LEU A CD2  4  
ATOM 4733  H H    . LEU A 1 59 ? -3.150  -10.308 0.295   1.00 0.00 ? 59 LEU A H    4  
ATOM 4734  H HA   . LEU A 1 59 ? -2.229  -8.475  -1.634  1.00 0.00 ? 59 LEU A HA   4  
ATOM 4735  H HB2  . LEU A 1 59 ? -3.905  -10.168 -2.123  1.00 0.00 ? 59 LEU A HB2  4  
ATOM 4736  H HB3  . LEU A 1 59 ? -5.036  -9.388  -1.018  1.00 0.00 ? 59 LEU A HB3  4  
ATOM 4737  H HG   . LEU A 1 59 ? -5.114  -7.431  -2.503  1.00 0.00 ? 59 LEU A HG   4  
ATOM 4738  H HD11 . LEU A 1 59 ? -4.093  -8.413  -4.902  1.00 0.00 ? 59 LEU A HD11 4  
ATOM 4739  H HD12 . LEU A 1 59 ? -2.847  -8.748  -3.700  1.00 0.00 ? 59 LEU A HD12 4  
ATOM 4740  H HD13 . LEU A 1 59 ? -3.439  -7.101  -3.921  1.00 0.00 ? 59 LEU A HD13 4  
ATOM 4741  H HD21 . LEU A 1 59 ? -6.625  -8.350  -3.979  1.00 0.00 ? 59 LEU A HD21 4  
ATOM 4742  H HD22 . LEU A 1 59 ? -6.554  -9.595  -2.732  1.00 0.00 ? 59 LEU A HD22 4  
ATOM 4743  H HD23 . LEU A 1 59 ? -5.657  -9.801  -4.237  1.00 0.00 ? 59 LEU A HD23 4  
ATOM 4744  N N    . GLN A 1 60 ? -4.479  -7.230  0.451   1.00 0.00 ? 60 GLN A N    4  
ATOM 4745  C CA   . GLN A 1 60 ? -4.958  -5.991  1.053   1.00 0.00 ? 60 GLN A CA   4  
ATOM 4746  C C    . GLN A 1 60 ? -3.803  -5.028  1.307   1.00 0.00 ? 60 GLN A C    4  
ATOM 4747  O O    . GLN A 1 60 ? -3.785  -3.913  0.784   1.00 0.00 ? 60 GLN A O    4  
ATOM 4748  C CB   . GLN A 1 60 ? -5.690  -6.286  2.363   1.00 0.00 ? 60 GLN A CB   4  
ATOM 4749  C CG   . GLN A 1 60 ? -6.927  -7.151  2.187   1.00 0.00 ? 60 GLN A CG   4  
ATOM 4750  C CD   . GLN A 1 60 ? -7.988  -6.487  1.332   1.00 0.00 ? 60 GLN A CD   4  
ATOM 4751  O OE1  . GLN A 1 60 ? -7.919  -6.516  0.103   1.00 0.00 ? 60 GLN A OE1  4  
ATOM 4752  N NE2  . GLN A 1 60 ? -8.977  -5.882  1.980   1.00 0.00 ? 60 GLN A NE2  4  
ATOM 4753  H H    . GLN A 1 60 ? -4.917  -8.075  0.682   1.00 0.00 ? 60 GLN A H    4  
ATOM 4754  H HA   . GLN A 1 60 ? -5.648  -5.532  0.361   1.00 0.00 ? 60 GLN A HA   4  
ATOM 4755  H HB2  . GLN A 1 60 ? -5.013  -6.794  3.033   1.00 0.00 ? 60 GLN A HB2  4  
ATOM 4756  H HB3  . GLN A 1 60 ? -5.992  -5.351  2.811   1.00 0.00 ? 60 GLN A HB3  4  
ATOM 4757  H HG2  . GLN A 1 60 ? -6.638  -8.080  1.717   1.00 0.00 ? 60 GLN A HG2  4  
ATOM 4758  H HG3  . GLN A 1 60 ? -7.347  -7.358  3.161   1.00 0.00 ? 60 GLN A HG3  4  
ATOM 4759  H HE21 . GLN A 1 60 ? -8.966  -5.898  2.960   1.00 0.00 ? 60 GLN A HE21 4  
ATOM 4760  H HE22 . GLN A 1 60 ? -9.676  -5.443  1.452   1.00 0.00 ? 60 GLN A HE22 4  
ATOM 4761  N N    . VAL A 1 61 ? -2.841  -5.464  2.113   1.00 0.00 ? 61 VAL A N    4  
ATOM 4762  C CA   . VAL A 1 61 ? -1.682  -4.641  2.436   1.00 0.00 ? 61 VAL A CA   4  
ATOM 4763  C C    . VAL A 1 61 ? -1.012  -4.115  1.172   1.00 0.00 ? 61 VAL A C    4  
ATOM 4764  O O    . VAL A 1 61 ? -0.842  -2.907  1.003   1.00 0.00 ? 61 VAL A O    4  
ATOM 4765  C CB   . VAL A 1 61 ? -0.648  -5.427  3.263   1.00 0.00 ? 61 VAL A CB   4  
ATOM 4766  C CG1  . VAL A 1 61 ? 0.521   -4.532  3.648   1.00 0.00 ? 61 VAL A CG1  4  
ATOM 4767  C CG2  . VAL A 1 61 ? -1.300  -6.028  4.500   1.00 0.00 ? 61 VAL A CG2  4  
ATOM 4768  H H    . VAL A 1 61 ? -2.912  -6.362  2.499   1.00 0.00 ? 61 VAL A H    4  
ATOM 4769  H HA   . VAL A 1 61 ? -2.022  -3.803  3.027   1.00 0.00 ? 61 VAL A HA   4  
ATOM 4770  H HB   . VAL A 1 61 ? -0.268  -6.235  2.654   1.00 0.00 ? 61 VAL A HB   4  
ATOM 4771  H HG11 . VAL A 1 61 ? 0.415   -4.226  4.678   1.00 0.00 ? 61 VAL A HG11 4  
ATOM 4772  H HG12 . VAL A 1 61 ? 1.446   -5.076  3.525   1.00 0.00 ? 61 VAL A HG12 4  
ATOM 4773  H HG13 . VAL A 1 61 ? 0.529   -3.659  3.012   1.00 0.00 ? 61 VAL A HG13 4  
ATOM 4774  H HG21 . VAL A 1 61 ? -0.865  -6.995  4.701   1.00 0.00 ? 61 VAL A HG21 4  
ATOM 4775  H HG22 . VAL A 1 61 ? -1.136  -5.376  5.346   1.00 0.00 ? 61 VAL A HG22 4  
ATOM 4776  H HG23 . VAL A 1 61 ? -2.360  -6.137  4.331   1.00 0.00 ? 61 VAL A HG23 4  
ATOM 4777  N N    . LYS A 1 62 ? -0.633  -5.029  0.285   1.00 0.00 ? 62 LYS A N    4  
ATOM 4778  C CA   . LYS A 1 62 ? 0.017   -4.659  -0.966  1.00 0.00 ? 62 LYS A CA   4  
ATOM 4779  C C    . LYS A 1 62 ? -0.723  -3.510  -1.644  1.00 0.00 ? 62 LYS A C    4  
ATOM 4780  O O    . LYS A 1 62 ? -0.185  -2.412  -1.792  1.00 0.00 ? 62 LYS A O    4  
ATOM 4781  C CB   . LYS A 1 62 ? 0.082   -5.864  -1.907  1.00 0.00 ? 62 LYS A CB   4  
ATOM 4782  C CG   . LYS A 1 62 ? 1.119   -5.721  -3.008  1.00 0.00 ? 62 LYS A CG   4  
ATOM 4783  C CD   . LYS A 1 62 ? 0.722   -6.498  -4.252  1.00 0.00 ? 62 LYS A CD   4  
ATOM 4784  C CE   . LYS A 1 62 ? 1.257   -7.922  -4.213  1.00 0.00 ? 62 LYS A CE   4  
ATOM 4785  N NZ   . LYS A 1 62 ? 0.432   -8.800  -3.338  1.00 0.00 ? 62 LYS A NZ   4  
ATOM 4786  H H    . LYS A 1 62 ? -0.796  -5.977  0.477   1.00 0.00 ? 62 LYS A H    4  
ATOM 4787  H HA   . LYS A 1 62 ? 1.022   -4.338  -0.735  1.00 0.00 ? 62 LYS A HA   4  
ATOM 4788  H HB2  . LYS A 1 62 ? 0.321   -6.744  -1.328  1.00 0.00 ? 62 LYS A HB2  4  
ATOM 4789  H HB3  . LYS A 1 62 ? -0.886  -5.998  -2.368  1.00 0.00 ? 62 LYS A HB3  4  
ATOM 4790  H HG2  . LYS A 1 62 ? 1.215   -4.676  -3.265  1.00 0.00 ? 62 LYS A HG2  4  
ATOM 4791  H HG3  . LYS A 1 62 ? 2.067   -6.094  -2.648  1.00 0.00 ? 62 LYS A HG3  4  
ATOM 4792  H HD2  . LYS A 1 62 ? -0.355  -6.532  -4.316  1.00 0.00 ? 62 LYS A HD2  4  
ATOM 4793  H HD3  . LYS A 1 62 ? 1.121   -5.997  -5.122  1.00 0.00 ? 62 LYS A HD3  4  
ATOM 4794  H HE2  . LYS A 1 62 ? 1.253   -8.321  -5.216  1.00 0.00 ? 62 LYS A HE2  4  
ATOM 4795  H HE3  . LYS A 1 62 ? 2.269   -7.902  -3.838  1.00 0.00 ? 62 LYS A HE3  4  
ATOM 4796  H HZ1  . LYS A 1 62 ? -0.556  -8.800  -3.662  1.00 0.00 ? 62 LYS A HZ1  4  
ATOM 4797  H HZ2  . LYS A 1 62 ? 0.463   -8.458  -2.357  1.00 0.00 ? 62 LYS A HZ2  4  
ATOM 4798  H HZ3  . LYS A 1 62 ? 0.795   -9.775  -3.365  1.00 0.00 ? 62 LYS A HZ3  4  
ATOM 4799  N N    . THR A 1 63 ? -1.960  -3.770  -2.055  1.00 0.00 ? 63 THR A N    4  
ATOM 4800  C CA   . THR A 1 63 ? -2.773  -2.758  -2.718  1.00 0.00 ? 63 THR A CA   4  
ATOM 4801  C C    . THR A 1 63 ? -2.996  -1.552  -1.812  1.00 0.00 ? 63 THR A C    4  
ATOM 4802  O O    . THR A 1 63 ? -2.546  -0.447  -2.113  1.00 0.00 ? 63 THR A O    4  
ATOM 4803  C CB   . THR A 1 63 ? -4.141  -3.326  -3.143  1.00 0.00 ? 63 THR A CB   4  
ATOM 4804  O OG1  . THR A 1 63 ? -3.957  -4.517  -3.916  1.00 0.00 ? 63 THR A OG1  4  
ATOM 4805  C CG2  . THR A 1 63 ? -4.923  -2.304  -3.954  1.00 0.00 ? 63 THR A CG2  4  
ATOM 4806  H H    . THR A 1 63 ? -2.333  -4.664  -1.910  1.00 0.00 ? 63 THR A H    4  
ATOM 4807  H HA   . THR A 1 63 ? -2.248  -2.437  -3.606  1.00 0.00 ? 63 THR A HA   4  
ATOM 4808  H HB   . THR A 1 63 ? -4.705  -3.567  -2.254  1.00 0.00 ? 63 THR A HB   4  
ATOM 4809  H HG1  . THR A 1 63 ? -4.267  -5.275  -3.415  1.00 0.00 ? 63 THR A HG1  4  
ATOM 4810  H HG21 . THR A 1 63 ? -5.058  -2.670  -4.960  1.00 0.00 ? 63 THR A HG21 4  
ATOM 4811  H HG22 . THR A 1 63 ? -4.378  -1.372  -3.980  1.00 0.00 ? 63 THR A HG22 4  
ATOM 4812  H HG23 . THR A 1 63 ? -5.888  -2.144  -3.496  1.00 0.00 ? 63 THR A HG23 4  
ATOM 4813  N N    . TRP A 1 64 ? -3.692  -1.772  -0.703  1.00 0.00 ? 64 TRP A N    4  
ATOM 4814  C CA   . TRP A 1 64 ? -3.973  -0.702  0.248   1.00 0.00 ? 64 TRP A CA   4  
ATOM 4815  C C    . TRP A 1 64 ? -2.778  0.234   0.383   1.00 0.00 ? 64 TRP A C    4  
ATOM 4816  O O    . TRP A 1 64 ? -2.931  1.456   0.381   1.00 0.00 ? 64 TRP A O    4  
ATOM 4817  C CB   . TRP A 1 64 ? -4.335  -1.288  1.614   1.00 0.00 ? 64 TRP A CB   4  
ATOM 4818  C CG   . TRP A 1 64 ? -4.954  -0.288  2.543   1.00 0.00 ? 64 TRP A CG   4  
ATOM 4819  C CD1  . TRP A 1 64 ? -6.252  0.135   2.546   1.00 0.00 ? 64 TRP A CD1  4  
ATOM 4820  C CD2  . TRP A 1 64 ? -4.299  0.415   3.605   1.00 0.00 ? 64 TRP A CD2  4  
ATOM 4821  N NE1  . TRP A 1 64 ? -6.444  1.058   3.545   1.00 0.00 ? 64 TRP A NE1  4  
ATOM 4822  C CE2  . TRP A 1 64 ? -5.261  1.247   4.209   1.00 0.00 ? 64 TRP A CE2  4  
ATOM 4823  C CE3  . TRP A 1 64 ? -2.993  0.422   4.104   1.00 0.00 ? 64 TRP A CE3  4  
ATOM 4824  C CZ2  . TRP A 1 64 ? -4.957  2.076   5.286   1.00 0.00 ? 64 TRP A CZ2  4  
ATOM 4825  C CZ3  . TRP A 1 64 ? -2.693  1.245   5.172   1.00 0.00 ? 64 TRP A CZ3  4  
ATOM 4826  C CH2  . TRP A 1 64 ? -3.671  2.063   5.754   1.00 0.00 ? 64 TRP A CH2  4  
ATOM 4827  H H    . TRP A 1 64 ? -4.024  -2.676  -0.517  1.00 0.00 ? 64 TRP A H    4  
ATOM 4828  H HA   . TRP A 1 64 ? -4.816  -0.140  -0.127  1.00 0.00 ? 64 TRP A HA   4  
ATOM 4829  H HB2  . TRP A 1 64 ? -5.038  -2.096  1.478   1.00 0.00 ? 64 TRP A HB2  4  
ATOM 4830  H HB3  . TRP A 1 64 ? -3.439  -1.670  2.082   1.00 0.00 ? 64 TRP A HB3  4  
ATOM 4831  H HD1  . TRP A 1 64 ? -7.006  -0.214  1.857   1.00 0.00 ? 64 TRP A HD1  4  
ATOM 4832  H HE1  . TRP A 1 64 ? -7.291  1.507   3.749   1.00 0.00 ? 64 TRP A HE1  4  
ATOM 4833  H HE3  . TRP A 1 64 ? -2.226  -0.201  3.669   1.00 0.00 ? 64 TRP A HE3  4  
ATOM 4834  H HZ2  . TRP A 1 64 ? -5.700  2.712   5.746   1.00 0.00 ? 64 TRP A HZ2  4  
ATOM 4835  H HZ3  . TRP A 1 64 ? -1.690  1.264   5.571   1.00 0.00 ? 64 TRP A HZ3  4  
ATOM 4836  H HH2  . TRP A 1 64 ? -3.392  2.690   6.587   1.00 0.00 ? 64 TRP A HH2  4  
ATOM 4837  N N    . TYR A 1 65 ? -1.588  -0.345  0.500   1.00 0.00 ? 65 TYR A N    4  
ATOM 4838  C CA   . TYR A 1 65 ? -0.366  0.439   0.638   1.00 0.00 ? 65 TYR A CA   4  
ATOM 4839  C C    . TYR A 1 65 ? -0.132  1.304   -0.596  1.00 0.00 ? 65 TYR A C    4  
ATOM 4840  O O    . TYR A 1 65 ? -0.110  2.532   -0.511  1.00 0.00 ? 65 TYR A O    4  
ATOM 4841  C CB   . TYR A 1 65 ? 0.833   -0.483  0.864   1.00 0.00 ? 65 TYR A CB   4  
ATOM 4842  C CG   . TYR A 1 65 ? 1.107   -0.775  2.322   1.00 0.00 ? 65 TYR A CG   4  
ATOM 4843  C CD1  . TYR A 1 65 ? 0.098   -1.233  3.161   1.00 0.00 ? 65 TYR A CD1  4  
ATOM 4844  C CD2  . TYR A 1 65 ? 2.375   -0.594  2.861   1.00 0.00 ? 65 TYR A CD2  4  
ATOM 4845  C CE1  . TYR A 1 65 ? 0.344   -1.500  4.493   1.00 0.00 ? 65 TYR A CE1  4  
ATOM 4846  C CE2  . TYR A 1 65 ? 2.630   -0.860  4.192   1.00 0.00 ? 65 TYR A CE2  4  
ATOM 4847  C CZ   . TYR A 1 65 ? 1.611   -1.312  5.004   1.00 0.00 ? 65 TYR A CZ   4  
ATOM 4848  O OH   . TYR A 1 65 ? 1.860   -1.578  6.331   1.00 0.00 ? 65 TYR A OH   4  
ATOM 4849  H H    . TYR A 1 65 ? -1.530  -1.323  0.495   1.00 0.00 ? 65 TYR A H    4  
ATOM 4850  H HA   . TYR A 1 65 ? -0.481  1.082   1.499   1.00 0.00 ? 65 TYR A HA   4  
ATOM 4851  H HB2  . TYR A 1 65 ? 0.655   -1.424  0.366   1.00 0.00 ? 65 TYR A HB2  4  
ATOM 4852  H HB3  . TYR A 1 65 ? 1.716   -0.022  0.446   1.00 0.00 ? 65 TYR A HB3  4  
ATOM 4853  H HD1  . TYR A 1 65 ? -0.893  -1.379  2.757   1.00 0.00 ? 65 TYR A HD1  4  
ATOM 4854  H HD2  . TYR A 1 65 ? 3.171   -0.240  2.222   1.00 0.00 ? 65 TYR A HD2  4  
ATOM 4855  H HE1  . TYR A 1 65 ? -0.454  -1.854  5.130   1.00 0.00 ? 65 TYR A HE1  4  
ATOM 4856  H HE2  . TYR A 1 65 ? 3.622   -0.713  4.593   1.00 0.00 ? 65 TYR A HE2  4  
ATOM 4857  H HH   . TYR A 1 65 ? 1.199   -1.142  6.875   1.00 0.00 ? 65 TYR A HH   4  
ATOM 4858  N N    . GLN A 1 66 ? 0.042   0.654   -1.742  1.00 0.00 ? 66 GLN A N    4  
ATOM 4859  C CA   . GLN A 1 66 ? 0.275   1.364   -2.994  1.00 0.00 ? 66 GLN A CA   4  
ATOM 4860  C C    . GLN A 1 66 ? -0.678  2.547   -3.135  1.00 0.00 ? 66 GLN A C    4  
ATOM 4861  O O    . GLN A 1 66 ? -0.250  3.675   -3.378  1.00 0.00 ? 66 GLN A O    4  
ATOM 4862  C CB   . GLN A 1 66 ? 0.106   0.415   -4.182  1.00 0.00 ? 66 GLN A CB   4  
ATOM 4863  C CG   . GLN A 1 66 ? 0.386   1.067   -5.527  1.00 0.00 ? 66 GLN A CG   4  
ATOM 4864  C CD   . GLN A 1 66 ? -0.367  0.405   -6.664  1.00 0.00 ? 66 GLN A CD   4  
ATOM 4865  O OE1  . GLN A 1 66 ? -1.134  -0.535  -6.452  1.00 0.00 ? 66 GLN A OE1  4  
ATOM 4866  N NE2  . GLN A 1 66 ? -0.151  0.892   -7.880  1.00 0.00 ? 66 GLN A NE2  4  
ATOM 4867  H H    . GLN A 1 66 ? 0.013   -0.325  -1.746  1.00 0.00 ? 66 GLN A H    4  
ATOM 4868  H HA   . GLN A 1 66 ? 1.289   1.734   -2.982  1.00 0.00 ? 66 GLN A HA   4  
ATOM 4869  H HB2  . GLN A 1 66 ? 0.784   -0.417  -4.062  1.00 0.00 ? 66 GLN A HB2  4  
ATOM 4870  H HB3  . GLN A 1 66 ? -0.908  0.044   -4.190  1.00 0.00 ? 66 GLN A HB3  4  
ATOM 4871  H HG2  . GLN A 1 66 ? 0.091   2.105   -5.477  1.00 0.00 ? 66 GLN A HG2  4  
ATOM 4872  H HG3  . GLN A 1 66 ? 1.445   1.003   -5.729  1.00 0.00 ? 66 GLN A HG3  4  
ATOM 4873  H HE21 . GLN A 1 66 ? 0.474   1.642   -7.973  1.00 0.00 ? 66 GLN A HE21 4  
ATOM 4874  H HE22 . GLN A 1 66 ? -0.624  0.483   -8.633  1.00 0.00 ? 66 GLN A HE22 4  
ATOM 4875  N N    . ASN A 1 67 ? -1.971  2.281   -2.981  1.00 0.00 ? 67 ASN A N    4  
ATOM 4876  C CA   . ASN A 1 67 ? -2.984  3.324   -3.092  1.00 0.00 ? 67 ASN A CA   4  
ATOM 4877  C C    . ASN A 1 67 ? -2.729  4.439   -2.082  1.00 0.00 ? 67 ASN A C    4  
ATOM 4878  O O    . ASN A 1 67 ? -2.681  5.616   -2.441  1.00 0.00 ? 67 ASN A O    4  
ATOM 4879  C CB   . ASN A 1 67 ? -4.379  2.734   -2.876  1.00 0.00 ? 67 ASN A CB   4  
ATOM 4880  C CG   . ASN A 1 67 ? -4.957  2.137   -4.144  1.00 0.00 ? 67 ASN A CG   4  
ATOM 4881  O OD1  . ASN A 1 67 ? -4.298  2.101   -5.183  1.00 0.00 ? 67 ASN A OD1  4  
ATOM 4882  N ND2  . ASN A 1 67 ? -6.195  1.663   -4.064  1.00 0.00 ? 67 ASN A ND2  4  
ATOM 4883  H H    . ASN A 1 67 ? -2.250  1.362   -2.789  1.00 0.00 ? 67 ASN A H    4  
ATOM 4884  H HA   . ASN A 1 67 ? -2.928  3.736   -4.088  1.00 0.00 ? 67 ASN A HA   4  
ATOM 4885  H HB2  . ASN A 1 67 ? -4.322  1.956   -2.128  1.00 0.00 ? 67 ASN A HB2  4  
ATOM 4886  H HB3  . ASN A 1 67 ? -5.043  3.512   -2.530  1.00 0.00 ? 67 ASN A HB3  4  
ATOM 4887  H HD21 . ASN A 1 67 ? -6.660  1.725   -3.204  1.00 0.00 ? 67 ASN A HD21 4  
ATOM 4888  H HD22 . ASN A 1 67 ? -6.593  1.271   -4.869  1.00 0.00 ? 67 ASN A HD22 4  
ATOM 4889  N N    . ARG A 1 68 ? -2.567  4.060   -0.819  1.00 0.00 ? 68 ARG A N    4  
ATOM 4890  C CA   . ARG A 1 68 ? -2.318  5.028   0.243   1.00 0.00 ? 68 ARG A CA   4  
ATOM 4891  C C    . ARG A 1 68 ? -1.205  5.995   -0.152  1.00 0.00 ? 68 ARG A C    4  
ATOM 4892  O O    . ARG A 1 68 ? -1.354  7.211   -0.030  1.00 0.00 ? 68 ARG A O    4  
ATOM 4893  C CB   . ARG A 1 68 ? -1.945  4.308   1.541   1.00 0.00 ? 68 ARG A CB   4  
ATOM 4894  C CG   . ARG A 1 68 ? -3.146  3.796   2.319   1.00 0.00 ? 68 ARG A CG   4  
ATOM 4895  C CD   . ARG A 1 68 ? -3.934  4.937   2.943   1.00 0.00 ? 68 ARG A CD   4  
ATOM 4896  N NE   . ARG A 1 68 ? -5.340  4.593   3.132   1.00 0.00 ? 68 ARG A NE   4  
ATOM 4897  C CZ   . ARG A 1 68 ? -6.298  5.493   3.324   1.00 0.00 ? 68 ARG A CZ   4  
ATOM 4898  N NH1  . ARG A 1 68 ? -6.002  6.785   3.352   1.00 0.00 ? 68 ARG A NH1  4  
ATOM 4899  N NH2  . ARG A 1 68 ? -7.555  5.101   3.487   1.00 0.00 ? 68 ARG A NH2  4  
ATOM 4900  H H    . ARG A 1 68 ? -2.616  3.107   -0.595  1.00 0.00 ? 68 ARG A H    4  
ATOM 4901  H HA   . ARG A 1 68 ? -3.227  5.589   0.401   1.00 0.00 ? 68 ARG A HA   4  
ATOM 4902  H HB2  . ARG A 1 68 ? -1.312  3.466   1.303   1.00 0.00 ? 68 ARG A HB2  4  
ATOM 4903  H HB3  . ARG A 1 68 ? -1.399  4.992   2.173   1.00 0.00 ? 68 ARG A HB3  4  
ATOM 4904  H HG2  . ARG A 1 68 ? -3.793  3.252   1.647   1.00 0.00 ? 68 ARG A HG2  4  
ATOM 4905  H HG3  . ARG A 1 68 ? -2.801  3.137   3.102   1.00 0.00 ? 68 ARG A HG3  4  
ATOM 4906  H HD2  . ARG A 1 68 ? -3.499  5.174   3.903   1.00 0.00 ? 68 ARG A HD2  4  
ATOM 4907  H HD3  . ARG A 1 68 ? -3.867  5.799   2.296   1.00 0.00 ? 68 ARG A HD3  4  
ATOM 4908  H HE   . ARG A 1 68 ? -5.581  3.643   3.114   1.00 0.00 ? 68 ARG A HE   4  
ATOM 4909  H HH11 . ARG A 1 68 ? -5.056  7.083   3.228   1.00 0.00 ? 68 ARG A HH11 4  
ATOM 4910  H HH12 . ARG A 1 68 ? -6.725  7.461   3.495   1.00 0.00 ? 68 ARG A HH12 4  
ATOM 4911  H HH21 . ARG A 1 68 ? -7.782  4.128   3.466   1.00 0.00 ? 68 ARG A HH21 4  
ATOM 4912  H HH22 . ARG A 1 68 ? -8.275  5.779   3.632   1.00 0.00 ? 68 ARG A HH22 4  
ATOM 4913  N N    . ARG A 1 69 ? -0.092  5.445   -0.626  1.00 0.00 ? 69 ARG A N    4  
ATOM 4914  C CA   . ARG A 1 69 ? 1.046   6.259   -1.038  1.00 0.00 ? 69 ARG A CA   4  
ATOM 4915  C C    . ARG A 1 69 ? 0.585   7.473   -1.838  1.00 0.00 ? 69 ARG A C    4  
ATOM 4916  O O    . ARG A 1 69 ? 0.905   8.611   -1.496  1.00 0.00 ? 69 ARG A O    4  
ATOM 4917  C CB   . ARG A 1 69 ? 2.021   5.425   -1.872  1.00 0.00 ? 69 ARG A CB   4  
ATOM 4918  C CG   . ARG A 1 69 ? 3.073   4.707   -1.042  1.00 0.00 ? 69 ARG A CG   4  
ATOM 4919  C CD   . ARG A 1 69 ? 4.252   4.268   -1.896  1.00 0.00 ? 69 ARG A CD   4  
ATOM 4920  N NE   . ARG A 1 69 ? 3.983   3.017   -2.599  1.00 0.00 ? 69 ARG A NE   4  
ATOM 4921  C CZ   . ARG A 1 69 ? 4.874   2.398   -3.365  1.00 0.00 ? 69 ARG A CZ   4  
ATOM 4922  N NH1  . ARG A 1 69 ? 6.086   2.911   -3.525  1.00 0.00 ? 69 ARG A NH1  4  
ATOM 4923  N NH2  . ARG A 1 69 ? 4.554   1.262   -3.972  1.00 0.00 ? 69 ARG A NH2  4  
ATOM 4924  H H    . ARG A 1 69 ? -0.033  4.470   -0.700  1.00 0.00 ? 69 ARG A H    4  
ATOM 4925  H HA   . ARG A 1 69 ? 1.550   6.600   -0.146  1.00 0.00 ? 69 ARG A HA   4  
ATOM 4926  H HB2  . ARG A 1 69 ? 1.462   4.684   -2.423  1.00 0.00 ? 69 ARG A HB2  4  
ATOM 4927  H HB3  . ARG A 1 69 ? 2.526   6.076   -2.569  1.00 0.00 ? 69 ARG A HB3  4  
ATOM 4928  H HG2  . ARG A 1 69 ? 3.430   5.376   -0.273  1.00 0.00 ? 69 ARG A HG2  4  
ATOM 4929  H HG3  . ARG A 1 69 ? 2.626   3.837   -0.586  1.00 0.00 ? 69 ARG A HG3  4  
ATOM 4930  H HD2  . ARG A 1 69 ? 4.461   5.040   -2.622  1.00 0.00 ? 69 ARG A HD2  4  
ATOM 4931  H HD3  . ARG A 1 69 ? 5.112   4.134   -1.257  1.00 0.00 ? 69 ARG A HD3  4  
ATOM 4932  H HE   . ARG A 1 69 ? 3.093   2.620   -2.494  1.00 0.00 ? 69 ARG A HE   4  
ATOM 4933  H HH11 . ARG A 1 69 ? 6.330   3.766   -3.069  1.00 0.00 ? 69 ARG A HH11 4  
ATOM 4934  H HH12 . ARG A 1 69 ? 6.755   2.442   -4.102  1.00 0.00 ? 69 ARG A HH12 4  
ATOM 4935  H HH21 . ARG A 1 69 ? 3.641   0.871   -3.853  1.00 0.00 ? 69 ARG A HH21 4  
ATOM 4936  H HH22 . ARG A 1 69 ? 5.225   0.797   -4.548  1.00 0.00 ? 69 ARG A HH22 4  
ATOM 4937  N N    . MET A 1 70 ? -0.167  7.222   -2.904  1.00 0.00 ? 70 MET A N    4  
ATOM 4938  C CA   . MET A 1 70 ? -0.673  8.295   -3.752  1.00 0.00 ? 70 MET A CA   4  
ATOM 4939  C C    . MET A 1 70 ? -1.024  9.526   -2.921  1.00 0.00 ? 70 MET A C    4  
ATOM 4940  O O    . MET A 1 70 ? -0.868  10.659  -3.375  1.00 0.00 ? 70 MET A O    4  
ATOM 4941  C CB   . MET A 1 70 ? -1.903  7.823   -4.530  1.00 0.00 ? 70 MET A CB   4  
ATOM 4942  C CG   . MET A 1 70 ? -1.630  6.632   -5.433  1.00 0.00 ? 70 MET A CG   4  
ATOM 4943  S SD   . MET A 1 70 ? -3.140  5.897   -6.089  1.00 0.00 ? 70 MET A SD   4  
ATOM 4944  C CE   . MET A 1 70 ? -3.572  7.086   -7.357  1.00 0.00 ? 70 MET A CE   4  
ATOM 4945  H H    . MET A 1 70 ? -0.389  6.294   -3.126  1.00 0.00 ? 70 MET A H    4  
ATOM 4946  H HA   . MET A 1 70 ? 0.106   8.558   -4.452  1.00 0.00 ? 70 MET A HA   4  
ATOM 4947  H HB2  . MET A 1 70 ? -2.674  7.546   -3.827  1.00 0.00 ? 70 MET A HB2  4  
ATOM 4948  H HB3  . MET A 1 70 ? -2.261  8.637   -5.143  1.00 0.00 ? 70 MET A HB3  4  
ATOM 4949  H HG2  . MET A 1 70 ? -1.016  6.956   -6.260  1.00 0.00 ? 70 MET A HG2  4  
ATOM 4950  H HG3  . MET A 1 70 ? -1.098  5.882   -4.866  1.00 0.00 ? 70 MET A HG3  4  
ATOM 4951  H HE1  . MET A 1 70 ? -3.614  8.075   -6.925  1.00 0.00 ? 70 MET A HE1  4  
ATOM 4952  H HE2  . MET A 1 70 ? -2.826  7.067   -8.138  1.00 0.00 ? 70 MET A HE2  4  
ATOM 4953  H HE3  . MET A 1 70 ? -4.536  6.834   -7.774  1.00 0.00 ? 70 MET A HE3  4  
ATOM 4954  N N    . LYS A 1 71 ? -1.498  9.295   -1.702  1.00 0.00 ? 71 LYS A N    4  
ATOM 4955  C CA   . LYS A 1 71 ? -1.871  10.384  -0.807  1.00 0.00 ? 71 LYS A CA   4  
ATOM 4956  C C    . LYS A 1 71 ? -0.661  10.879  -0.020  1.00 0.00 ? 71 LYS A C    4  
ATOM 4957  O O    . LYS A 1 71 ? -0.436  12.084  0.095   1.00 0.00 ? 71 LYS A O    4  
ATOM 4958  C CB   . LYS A 1 71 ? -2.967  9.926   0.159   1.00 0.00 ? 71 LYS A CB   4  
ATOM 4959  C CG   . LYS A 1 71 ? -3.386  10.994  1.154   1.00 0.00 ? 71 LYS A CG   4  
ATOM 4960  C CD   . LYS A 1 71 ? -4.793  10.750  1.673   1.00 0.00 ? 71 LYS A CD   4  
ATOM 4961  C CE   . LYS A 1 71 ? -5.843  11.157  0.650   1.00 0.00 ? 71 LYS A CE   4  
ATOM 4962  N NZ   . LYS A 1 71 ? -6.109  12.621  0.680   1.00 0.00 ? 71 LYS A NZ   4  
ATOM 4963  H H    . LYS A 1 71 ? -1.600  8.369   -1.396  1.00 0.00 ? 71 LYS A H    4  
ATOM 4964  H HA   . LYS A 1 71 ? -2.250  11.194  -1.410  1.00 0.00 ? 71 LYS A HA   4  
ATOM 4965  H HB2  . LYS A 1 71 ? -3.835  9.635   -0.414  1.00 0.00 ? 71 LYS A HB2  4  
ATOM 4966  H HB3  . LYS A 1 71 ? -2.608  9.069   0.711   1.00 0.00 ? 71 LYS A HB3  4  
ATOM 4967  H HG2  . LYS A 1 71 ? -2.700  10.985  1.988   1.00 0.00 ? 71 LYS A HG2  4  
ATOM 4968  H HG3  . LYS A 1 71 ? -3.353  11.958  0.668   1.00 0.00 ? 71 LYS A HG3  4  
ATOM 4969  H HD2  . LYS A 1 71 ? -4.910  9.700   1.894   1.00 0.00 ? 71 LYS A HD2  4  
ATOM 4970  H HD3  . LYS A 1 71 ? -4.939  11.328  2.575   1.00 0.00 ? 71 LYS A HD3  4  
ATOM 4971  H HE2  . LYS A 1 71 ? -5.493  10.883  -0.333  1.00 0.00 ? 71 LYS A HE2  4  
ATOM 4972  H HE3  . LYS A 1 71 ? -6.760  10.628  0.866   1.00 0.00 ? 71 LYS A HE3  4  
ATOM 4973  H HZ1  . LYS A 1 71 ? -5.269  13.130  1.024   1.00 0.00 ? 71 LYS A HZ1  4  
ATOM 4974  H HZ2  . LYS A 1 71 ? -6.907  12.827  1.314   1.00 0.00 ? 71 LYS A HZ2  4  
ATOM 4975  H HZ3  . LYS A 1 71 ? -6.341  12.962  -0.274  1.00 0.00 ? 71 LYS A HZ3  4  
ATOM 4976  N N    . TRP A 1 72 ? 0.113   9.944   0.517   1.00 0.00 ? 72 TRP A N    4  
ATOM 4977  C CA   . TRP A 1 72 ? 1.301   10.287  1.290   1.00 0.00 ? 72 TRP A CA   4  
ATOM 4978  C C    . TRP A 1 72 ? 2.291   11.082  0.446   1.00 0.00 ? 72 TRP A C    4  
ATOM 4979  O O    . TRP A 1 72 ? 2.725   12.166  0.835   1.00 0.00 ? 72 TRP A O    4  
ATOM 4980  C CB   . TRP A 1 72 ? 1.971   9.019   1.824   1.00 0.00 ? 72 TRP A CB   4  
ATOM 4981  C CG   . TRP A 1 72 ? 3.443   9.178   2.057   1.00 0.00 ? 72 TRP A CG   4  
ATOM 4982  C CD1  . TRP A 1 72 ? 4.050   9.604   3.203   1.00 0.00 ? 72 TRP A CD1  4  
ATOM 4983  C CD2  . TRP A 1 72 ? 4.492   8.914   1.119   1.00 0.00 ? 72 TRP A CD2  4  
ATOM 4984  N NE1  . TRP A 1 72 ? 5.414   9.621   3.034   1.00 0.00 ? 72 TRP A NE1  4  
ATOM 4985  C CE2  . TRP A 1 72 ? 5.710   9.201   1.764   1.00 0.00 ? 72 TRP A CE2  4  
ATOM 4986  C CE3  . TRP A 1 72 ? 4.520   8.461   -0.203  1.00 0.00 ? 72 TRP A CE3  4  
ATOM 4987  C CZ2  . TRP A 1 72 ? 6.941   9.050   1.131   1.00 0.00 ? 72 TRP A CZ2  4  
ATOM 4988  C CZ3  . TRP A 1 72 ? 5.743   8.312   -0.830  1.00 0.00 ? 72 TRP A CZ3  4  
ATOM 4989  C CH2  . TRP A 1 72 ? 6.940   8.605   -0.163  1.00 0.00 ? 72 TRP A CH2  4  
ATOM 4990  H H    . TRP A 1 72 ? -0.119  9.000   0.390   1.00 0.00 ? 72 TRP A H    4  
ATOM 4991  H HA   . TRP A 1 72 ? 0.987   10.896  2.125   1.00 0.00 ? 72 TRP A HA   4  
ATOM 4992  H HB2  . TRP A 1 72 ? 1.513   8.746   2.763   1.00 0.00 ? 72 TRP A HB2  4  
ATOM 4993  H HB3  . TRP A 1 72 ? 1.829   8.219   1.112   1.00 0.00 ? 72 TRP A HB3  4  
ATOM 4994  H HD1  . TRP A 1 72 ? 3.523   9.885   4.102   1.00 0.00 ? 72 TRP A HD1  4  
ATOM 4995  H HE1  . TRP A 1 72 ? 6.068   9.889   3.714   1.00 0.00 ? 72 TRP A HE1  4  
ATOM 4996  H HE3  . TRP A 1 72 ? 3.609   8.229   -0.734  1.00 0.00 ? 72 TRP A HE3  4  
ATOM 4997  H HZ2  . TRP A 1 72 ? 7.872   9.272   1.633   1.00 0.00 ? 72 TRP A HZ2  4  
ATOM 4998  H HZ3  . TRP A 1 72 ? 5.785   7.964   -1.851  1.00 0.00 ? 72 TRP A HZ3  4  
ATOM 4999  H HH2  . TRP A 1 72 ? 7.871   8.475   -0.691  1.00 0.00 ? 72 TRP A HH2  4  
ATOM 5000  N N    . LYS A 1 73 ? 2.644   10.537  -0.714  1.00 0.00 ? 73 LYS A N    4  
ATOM 5001  C CA   . LYS A 1 73 ? 3.581   11.195  -1.615  1.00 0.00 ? 73 LYS A CA   4  
ATOM 5002  C C    . LYS A 1 73 ? 3.269   12.684  -1.732  1.00 0.00 ? 73 LYS A C    4  
ATOM 5003  O O    . LYS A 1 73 ? 2.106   13.088  -1.719  1.00 0.00 ? 73 LYS A O    4  
ATOM 5004  C CB   . LYS A 1 73 ? 3.534   10.544  -2.999  1.00 0.00 ? 73 LYS A CB   4  
ATOM 5005  C CG   . LYS A 1 73 ? 2.232   10.788  -3.742  1.00 0.00 ? 73 LYS A CG   4  
ATOM 5006  C CD   . LYS A 1 73 ? 2.405   10.617  -5.242  1.00 0.00 ? 73 LYS A CD   4  
ATOM 5007  C CE   . LYS A 1 73 ? 1.431   11.489  -6.019  1.00 0.00 ? 73 LYS A CE   4  
ATOM 5008  N NZ   . LYS A 1 73 ? 0.036   10.976  -5.934  1.00 0.00 ? 73 LYS A NZ   4  
ATOM 5009  H H    . LYS A 1 73 ? 2.263   9.670   -0.970  1.00 0.00 ? 73 LYS A H    4  
ATOM 5010  H HA   . LYS A 1 73 ? 4.573   11.079  -1.206  1.00 0.00 ? 73 LYS A HA   4  
ATOM 5011  H HB2  . LYS A 1 73 ? 4.344   10.935  -3.596  1.00 0.00 ? 73 LYS A HB2  4  
ATOM 5012  H HB3  . LYS A 1 73 ? 3.664   9.477   -2.886  1.00 0.00 ? 73 LYS A HB3  4  
ATOM 5013  H HG2  . LYS A 1 73 ? 1.491   10.085  -3.394  1.00 0.00 ? 73 LYS A HG2  4  
ATOM 5014  H HG3  . LYS A 1 73 ? 1.897   11.796  -3.541  1.00 0.00 ? 73 LYS A HG3  4  
ATOM 5015  H HD2  . LYS A 1 73 ? 3.413   10.892  -5.513  1.00 0.00 ? 73 LYS A HD2  4  
ATOM 5016  H HD3  . LYS A 1 73 ? 2.231   9.581   -5.499  1.00 0.00 ? 73 LYS A HD3  4  
ATOM 5017  H HE2  . LYS A 1 73 ? 1.463   12.489  -5.615  1.00 0.00 ? 73 LYS A HE2  4  
ATOM 5018  H HE3  . LYS A 1 73 ? 1.735   11.510  -7.055  1.00 0.00 ? 73 LYS A HE3  4  
ATOM 5019  H HZ1  . LYS A 1 73 ? -0.074  10.380  -5.088  1.00 0.00 ? 73 LYS A HZ1  4  
ATOM 5020  H HZ2  . LYS A 1 73 ? -0.188  10.408  -6.775  1.00 0.00 ? 73 LYS A HZ2  4  
ATOM 5021  H HZ3  . LYS A 1 73 ? -0.634  11.769  -5.875  1.00 0.00 ? 73 LYS A HZ3  4  
ATOM 5022  N N    . LYS A 1 74 ? 4.315   13.496  -1.848  1.00 0.00 ? 74 LYS A N    4  
ATOM 5023  C CA   . LYS A 1 74 ? 4.153   14.940  -1.970  1.00 0.00 ? 74 LYS A CA   4  
ATOM 5024  C C    . LYS A 1 74 ? 4.849   15.461  -3.223  1.00 0.00 ? 74 LYS A C    4  
ATOM 5025  O O    . LYS A 1 74 ? 4.225   16.095  -4.073  1.00 0.00 ? 74 LYS A O    4  
ATOM 5026  C CB   . LYS A 1 74 ? 4.714   15.643  -0.732  1.00 0.00 ? 74 LYS A CB   4  
ATOM 5027  C CG   . LYS A 1 74 ? 4.623   17.158  -0.799  1.00 0.00 ? 74 LYS A CG   4  
ATOM 5028  C CD   . LYS A 1 74 ? 5.112   17.803  0.487   1.00 0.00 ? 74 LYS A CD   4  
ATOM 5029  C CE   . LYS A 1 74 ? 4.824   19.297  0.505   1.00 0.00 ? 74 LYS A CE   4  
ATOM 5030  N NZ   . LYS A 1 74 ? 5.731   20.025  1.435   1.00 0.00 ? 74 LYS A NZ   4  
ATOM 5031  H H    . LYS A 1 74 ? 5.218   13.114  -1.852  1.00 0.00 ? 74 LYS A H    4  
ATOM 5032  H HA   . LYS A 1 74 ? 3.097   15.150  -2.045  1.00 0.00 ? 74 LYS A HA   4  
ATOM 5033  H HB2  . LYS A 1 74 ? 4.166   15.308  0.137   1.00 0.00 ? 74 LYS A HB2  4  
ATOM 5034  H HB3  . LYS A 1 74 ? 5.753   15.370  -0.618  1.00 0.00 ? 74 LYS A HB3  4  
ATOM 5035  H HG2  . LYS A 1 74 ? 5.230   17.510  -1.619  1.00 0.00 ? 74 LYS A HG2  4  
ATOM 5036  H HG3  . LYS A 1 74 ? 3.593   17.440  -0.964  1.00 0.00 ? 74 LYS A HG3  4  
ATOM 5037  H HD2  . LYS A 1 74 ? 4.611   17.342  1.325   1.00 0.00 ? 74 LYS A HD2  4  
ATOM 5038  H HD3  . LYS A 1 74 ? 6.178   17.649  0.574   1.00 0.00 ? 74 LYS A HD3  4  
ATOM 5039  H HE2  . LYS A 1 74 ? 4.957   19.688  -0.492  1.00 0.00 ? 74 LYS A HE2  4  
ATOM 5040  H HE3  . LYS A 1 74 ? 3.802   19.449  0.818   1.00 0.00 ? 74 LYS A HE3  4  
ATOM 5041  H HZ1  . LYS A 1 74 ? 5.628   19.650  2.400   1.00 0.00 ? 74 LYS A HZ1  4  
ATOM 5042  H HZ2  . LYS A 1 74 ? 5.496   21.038  1.443   1.00 0.00 ? 74 LYS A HZ2  4  
ATOM 5043  H HZ3  . LYS A 1 74 ? 6.720   19.911  1.134   1.00 0.00 ? 74 LYS A HZ3  4  
ATOM 5044  N N    . SER A 1 75 ? 6.146   15.188  -3.331  1.00 0.00 ? 75 SER A N    4  
ATOM 5045  C CA   . SER A 1 75 ? 6.927   15.632  -4.479  1.00 0.00 ? 75 SER A CA   4  
ATOM 5046  C C    . SER A 1 75 ? 6.827   14.629  -5.625  1.00 0.00 ? 75 SER A C    4  
ATOM 5047  O O    . SER A 1 75 ? 6.504   13.461  -5.415  1.00 0.00 ? 75 SER A O    4  
ATOM 5048  C CB   . SER A 1 75 ? 8.392   15.825  -4.082  1.00 0.00 ? 75 SER A CB   4  
ATOM 5049  O OG   . SER A 1 75 ? 9.071   14.583  -4.019  1.00 0.00 ? 75 SER A OG   4  
ATOM 5050  H H    . SER A 1 75 ? 6.588   14.678  -2.620  1.00 0.00 ? 75 SER A H    4  
ATOM 5051  H HA   . SER A 1 75 ? 6.525   16.578  -4.808  1.00 0.00 ? 75 SER A HA   4  
ATOM 5052  H HB2  . SER A 1 75 ? 8.881   16.452  -4.812  1.00 0.00 ? 75 SER A HB2  4  
ATOM 5053  H HB3  . SER A 1 75 ? 8.440   16.298  -3.112  1.00 0.00 ? 75 SER A HB3  4  
ATOM 5054  H HG   . SER A 1 75 ? 9.405   14.356  -4.890  1.00 0.00 ? 75 SER A HG   4  
ATOM 5055  N N    . GLY A 1 76 ? 7.108   15.096  -6.838  1.00 0.00 ? 76 GLY A N    4  
ATOM 5056  C CA   . GLY A 1 76 ? 7.044   14.228  -7.999  1.00 0.00 ? 76 GLY A CA   4  
ATOM 5057  C C    . GLY A 1 76 ? 5.630   13.779  -8.310  1.00 0.00 ? 76 GLY A C    4  
ATOM 5058  O O    . GLY A 1 76 ? 5.195   12.701  -7.904  1.00 0.00 ? 76 GLY A O    4  
ATOM 5059  H H    . GLY A 1 76 ? 7.360   16.037  -6.945  1.00 0.00 ? 76 GLY A H    4  
ATOM 5060  H HA2  . GLY A 1 76 ? 7.438   14.759  -8.853  1.00 0.00 ? 76 GLY A HA2  4  
ATOM 5061  H HA3  . GLY A 1 76 ? 7.654   13.356  -7.817  1.00 0.00 ? 76 GLY A HA3  4  
ATOM 5062  N N    . PRO A 1 77 ? 4.886   14.618  -9.046  1.00 0.00 ? 77 PRO A N    4  
ATOM 5063  C CA   . PRO A 1 77 ? 3.502   14.323  -9.426  1.00 0.00 ? 77 PRO A CA   4  
ATOM 5064  C C    . PRO A 1 77 ? 3.409   13.191  -10.444 1.00 0.00 ? 77 PRO A C    4  
ATOM 5065  O O    . PRO A 1 77 ? 2.527   12.337  -10.358 1.00 0.00 ? 77 PRO A O    4  
ATOM 5066  C CB   . PRO A 1 77 ? 3.015   15.637  -10.042 1.00 0.00 ? 77 PRO A CB   4  
ATOM 5067  C CG   . PRO A 1 77 ? 4.253   16.310  -10.527 1.00 0.00 ? 77 PRO A CG   4  
ATOM 5068  C CD   . PRO A 1 77 ? 5.340   15.919  -9.565  1.00 0.00 ? 77 PRO A CD   4  
ATOM 5069  H HA   . PRO A 1 77 ? 2.897   14.081  -8.565  1.00 0.00 ? 77 PRO A HA   4  
ATOM 5070  H HB2  . PRO A 1 77 ? 2.334   15.427  -10.855 1.00 0.00 ? 77 PRO A HB2  4  
ATOM 5071  H HB3  . PRO A 1 77 ? 2.514   16.228  -9.289  1.00 0.00 ? 77 PRO A HB3  4  
ATOM 5072  H HG2  . PRO A 1 77 ? 4.491   15.966  -11.522 1.00 0.00 ? 77 PRO A HG2  4  
ATOM 5073  H HG3  . PRO A 1 77 ? 4.115   17.381  -10.521 1.00 0.00 ? 77 PRO A HG3  4  
ATOM 5074  H HD2  . PRO A 1 77 ? 6.284   15.821  -10.081 1.00 0.00 ? 77 PRO A HD2  4  
ATOM 5075  H HD3  . PRO A 1 77 ? 5.418   16.645  -8.768  1.00 0.00 ? 77 PRO A HD3  4  
ATOM 5076  N N    . SER A 1 78 ? 4.324   13.192  -11.408 1.00 0.00 ? 78 SER A N    4  
ATOM 5077  C CA   . SER A 1 78 ? 4.343   12.167  -12.445 1.00 0.00 ? 78 SER A CA   4  
ATOM 5078  C C    . SER A 1 78 ? 4.373   10.771  -11.829 1.00 0.00 ? 78 SER A C    4  
ATOM 5079  O O    . SER A 1 78 ? 3.659   9.871   -12.270 1.00 0.00 ? 78 SER A O    4  
ATOM 5080  C CB   . SER A 1 78 ? 5.554   12.359  -13.360 1.00 0.00 ? 78 SER A CB   4  
ATOM 5081  O OG   . SER A 1 78 ? 6.765   12.153  -12.653 1.00 0.00 ? 78 SER A OG   4  
ATOM 5082  H H    . SER A 1 78 ? 5.002   13.900  -11.423 1.00 0.00 ? 78 SER A H    4  
ATOM 5083  H HA   . SER A 1 78 ? 3.441   12.270  -13.030 1.00 0.00 ? 78 SER A HA   4  
ATOM 5084  H HB2  . SER A 1 78 ? 5.502   11.653  -14.174 1.00 0.00 ? 78 SER A HB2  4  
ATOM 5085  H HB3  . SER A 1 78 ? 5.548   13.365  -13.754 1.00 0.00 ? 78 SER A HB3  4  
ATOM 5086  H HG   . SER A 1 78 ? 7.013   11.227  -12.705 1.00 0.00 ? 78 SER A HG   4  
ATOM 5087  N N    . SER A 1 79 ? 5.204   10.601  -10.806 1.00 0.00 ? 79 SER A N    4  
ATOM 5088  C CA   . SER A 1 79 ? 5.332   9.315   -10.131 1.00 0.00 ? 79 SER A CA   4  
ATOM 5089  C C    . SER A 1 79 ? 5.639   9.507   -8.649  1.00 0.00 ? 79 SER A C    4  
ATOM 5090  O O    . SER A 1 79 ? 6.352   10.434  -8.267  1.00 0.00 ? 79 SER A O    4  
ATOM 5091  C CB   . SER A 1 79 ? 6.431   8.477   -10.787 1.00 0.00 ? 79 SER A CB   4  
ATOM 5092  O OG   . SER A 1 79 ? 7.691   9.118   -10.684 1.00 0.00 ? 79 SER A OG   4  
ATOM 5093  H H    . SER A 1 79 ? 5.747   11.358  -10.501 1.00 0.00 ? 79 SER A H    4  
ATOM 5094  H HA   . SER A 1 79 ? 4.390   8.795   -10.227 1.00 0.00 ? 79 SER A HA   4  
ATOM 5095  H HB2  . SER A 1 79 ? 6.488   7.516   -10.297 1.00 0.00 ? 79 SER A HB2  4  
ATOM 5096  H HB3  . SER A 1 79 ? 6.197   8.335   -11.832 1.00 0.00 ? 79 SER A HB3  4  
ATOM 5097  H HG   . SER A 1 79 ? 7.709   9.663   -9.894  1.00 0.00 ? 79 SER A HG   4  
ATOM 5098  N N    . GLY A 1 80 ? 5.094   8.623   -7.818  1.00 0.00 ? 80 GLY A N    4  
ATOM 5099  C CA   . GLY A 1 80 ? 5.321   8.713   -6.388  1.00 0.00 ? 80 GLY A CA   4  
ATOM 5100  C C    . GLY A 1 80 ? 6.683   8.185   -5.982  1.00 0.00 ? 80 GLY A C    4  
ATOM 5101  O O    . GLY A 1 80 ? 7.348   8.762   -5.122  1.00 0.00 ? 80 GLY A O    4  
ATOM 5102  H H    . GLY A 1 80 ? 4.534   7.905   -8.180  1.00 0.00 ? 80 GLY A H    4  
ATOM 5103  H HA2  . GLY A 1 80 ? 5.242   9.746   -6.085  1.00 0.00 ? 80 GLY A HA2  4  
ATOM 5104  H HA3  . GLY A 1 80 ? 4.560   8.140   -5.878  1.00 0.00 ? 80 GLY A HA3  4  
ATOM 5105  N N    . GLY A 1 1  ? 29.765  -6.706  -2.797  1.00 0.00 ? 1  GLY A N    5  
ATOM 5106  C CA   . GLY A 1 1  ? 29.224  -5.838  -3.827  1.00 0.00 ? 1  GLY A CA   5  
ATOM 5107  C C    . GLY A 1 1  ? 27.748  -5.555  -3.629  1.00 0.00 ? 1  GLY A C    5  
ATOM 5108  O O    . GLY A 1 1  ? 27.165  -5.940  -2.616  1.00 0.00 ? 1  GLY A O    5  
ATOM 5109  H H1   . GLY A 1 1  ? 29.297  -7.534  -2.561  1.00 0.00 ? 1  GLY A H1   5  
ATOM 5110  H HA2  . GLY A 1 1  ? 29.764  -4.903  -3.815  1.00 0.00 ? 1  GLY A HA2  5  
ATOM 5111  H HA3  . GLY A 1 1  ? 29.363  -6.310  -4.788  1.00 0.00 ? 1  GLY A HA3  5  
ATOM 5112  N N    . SER A 1 2  ? 27.142  -4.880  -4.600  1.00 0.00 ? 2  SER A N    5  
ATOM 5113  C CA   . SER A 1 2  ? 25.725  -4.541  -4.526  1.00 0.00 ? 2  SER A CA   5  
ATOM 5114  C C    . SER A 1 2  ? 25.184  -4.165  -5.903  1.00 0.00 ? 2  SER A C    5  
ATOM 5115  O O    . SER A 1 2  ? 25.934  -3.741  -6.782  1.00 0.00 ? 2  SER A O    5  
ATOM 5116  C CB   . SER A 1 2  ? 25.506  -3.386  -3.547  1.00 0.00 ? 2  SER A CB   5  
ATOM 5117  O OG   . SER A 1 2  ? 25.352  -3.864  -2.222  1.00 0.00 ? 2  SER A OG   5  
ATOM 5118  H H    . SER A 1 2  ? 27.660  -4.601  -5.384  1.00 0.00 ? 2  SER A H    5  
ATOM 5119  H HA   . SER A 1 2  ? 25.194  -5.410  -4.169  1.00 0.00 ? 2  SER A HA   5  
ATOM 5120  H HB2  . SER A 1 2  ? 26.357  -2.723  -3.581  1.00 0.00 ? 2  SER A HB2  5  
ATOM 5121  H HB3  . SER A 1 2  ? 24.615  -2.844  -3.828  1.00 0.00 ? 2  SER A HB3  5  
ATOM 5122  H HG   . SER A 1 2  ? 24.487  -4.270  -2.126  1.00 0.00 ? 2  SER A HG   5  
ATOM 5123  N N    . SER A 1 3  ? 23.877  -4.323  -6.081  1.00 0.00 ? 3  SER A N    5  
ATOM 5124  C CA   . SER A 1 3  ? 23.234  -4.005  -7.350  1.00 0.00 ? 3  SER A CA   5  
ATOM 5125  C C    . SER A 1 3  ? 21.717  -3.955  -7.194  1.00 0.00 ? 3  SER A C    5  
ATOM 5126  O O    . SER A 1 3  ? 21.175  -4.348  -6.162  1.00 0.00 ? 3  SER A O    5  
ATOM 5127  C CB   . SER A 1 3  ? 23.615  -5.038  -8.412  1.00 0.00 ? 3  SER A CB   5  
ATOM 5128  O OG   . SER A 1 3  ? 23.317  -4.565  -9.714  1.00 0.00 ? 3  SER A OG   5  
ATOM 5129  H H    . SER A 1 3  ? 23.332  -4.665  -5.341  1.00 0.00 ? 3  SER A H    5  
ATOM 5130  H HA   . SER A 1 3  ? 23.584  -3.033  -7.664  1.00 0.00 ? 3  SER A HA   5  
ATOM 5131  H HB2  . SER A 1 3  ? 24.673  -5.242  -8.350  1.00 0.00 ? 3  SER A HB2  5  
ATOM 5132  H HB3  . SER A 1 3  ? 23.062  -5.950  -8.238  1.00 0.00 ? 3  SER A HB3  5  
ATOM 5133  H HG   . SER A 1 3  ? 23.493  -5.257  -10.355 1.00 0.00 ? 3  SER A HG   5  
ATOM 5134  N N    . GLY A 1 4  ? 21.038  -3.468  -8.228  1.00 0.00 ? 4  GLY A N    5  
ATOM 5135  C CA   . GLY A 1 4  ? 19.590  -3.374  -8.186  1.00 0.00 ? 4  GLY A CA   5  
ATOM 5136  C C    . GLY A 1 4  ? 18.941  -3.851  -9.471  1.00 0.00 ? 4  GLY A C    5  
ATOM 5137  O O    . GLY A 1 4  ? 18.586  -5.023  -9.597  1.00 0.00 ? 4  GLY A O    5  
ATOM 5138  H H    . GLY A 1 4  ? 21.523  -3.169  -9.025  1.00 0.00 ? 4  GLY A H    5  
ATOM 5139  H HA2  . GLY A 1 4  ? 19.225  -3.974  -7.366  1.00 0.00 ? 4  GLY A HA2  5  
ATOM 5140  H HA3  . GLY A 1 4  ? 19.312  -2.344  -8.017  1.00 0.00 ? 4  GLY A HA3  5  
ATOM 5141  N N    . SER A 1 5  ? 18.784  -2.940  -10.426 1.00 0.00 ? 5  SER A N    5  
ATOM 5142  C CA   . SER A 1 5  ? 18.168  -3.272  -11.705 1.00 0.00 ? 5  SER A CA   5  
ATOM 5143  C C    . SER A 1 5  ? 17.019  -4.258  -11.515 1.00 0.00 ? 5  SER A C    5  
ATOM 5144  O O    . SER A 1 5  ? 16.966  -5.300  -12.167 1.00 0.00 ? 5  SER A O    5  
ATOM 5145  C CB   . SER A 1 5  ? 19.209  -3.863  -12.658 1.00 0.00 ? 5  SER A CB   5  
ATOM 5146  O OG   . SER A 1 5  ? 20.315  -2.991  -12.810 1.00 0.00 ? 5  SER A OG   5  
ATOM 5147  H H    . SER A 1 5  ? 19.087  -2.022  -10.265 1.00 0.00 ? 5  SER A H    5  
ATOM 5148  H HA   . SER A 1 5  ? 17.778  -2.360  -12.132 1.00 0.00 ? 5  SER A HA   5  
ATOM 5149  H HB2  . SER A 1 5  ? 19.560  -4.805  -12.265 1.00 0.00 ? 5  SER A HB2  5  
ATOM 5150  H HB3  . SER A 1 5  ? 18.757  -4.024  -13.626 1.00 0.00 ? 5  SER A HB3  5  
ATOM 5151  H HG   . SER A 1 5  ? 21.125  -3.505  -12.851 1.00 0.00 ? 5  SER A HG   5  
ATOM 5152  N N    . SER A 1 6  ? 16.100  -3.919  -10.616 1.00 0.00 ? 6  SER A N    5  
ATOM 5153  C CA   . SER A 1 6  ? 14.953  -4.774  -10.336 1.00 0.00 ? 6  SER A CA   5  
ATOM 5154  C C    . SER A 1 6  ? 13.917  -4.676  -11.452 1.00 0.00 ? 6  SER A C    5  
ATOM 5155  O O    . SER A 1 6  ? 14.115  -3.969  -12.439 1.00 0.00 ? 6  SER A O    5  
ATOM 5156  C CB   . SER A 1 6  ? 14.317  -4.389  -8.999  1.00 0.00 ? 6  SER A CB   5  
ATOM 5157  O OG   . SER A 1 6  ? 13.827  -3.060  -9.032  1.00 0.00 ? 6  SER A OG   5  
ATOM 5158  H H    . SER A 1 6  ? 16.197  -3.074  -10.128 1.00 0.00 ? 6  SER A H    5  
ATOM 5159  H HA   . SER A 1 6  ? 15.305  -5.793  -10.277 1.00 0.00 ? 6  SER A HA   5  
ATOM 5160  H HB2  . SER A 1 6  ? 13.495  -5.057  -8.789  1.00 0.00 ? 6  SER A HB2  5  
ATOM 5161  H HB3  . SER A 1 6  ? 15.056  -4.469  -8.216  1.00 0.00 ? 6  SER A HB3  5  
ATOM 5162  H HG   . SER A 1 6  ? 13.013  -3.006  -8.527  1.00 0.00 ? 6  SER A HG   5  
ATOM 5163  N N    . GLY A 1 7  ? 12.809  -5.393  -11.288 1.00 0.00 ? 7  GLY A N    5  
ATOM 5164  C CA   . GLY A 1 7  ? 11.758  -5.374  -12.288 1.00 0.00 ? 7  GLY A CA   5  
ATOM 5165  C C    . GLY A 1 7  ? 10.382  -5.583  -11.687 1.00 0.00 ? 7  GLY A C    5  
ATOM 5166  O O    . GLY A 1 7  ? 10.251  -6.135  -10.595 1.00 0.00 ? 7  GLY A O    5  
ATOM 5167  H H    . GLY A 1 7  ? 12.705  -5.940  -10.481 1.00 0.00 ? 7  GLY A H    5  
ATOM 5168  H HA2  . GLY A 1 7  ? 11.776  -4.422  -12.796 1.00 0.00 ? 7  GLY A HA2  5  
ATOM 5169  H HA3  . GLY A 1 7  ? 11.946  -6.158  -13.006 1.00 0.00 ? 7  GLY A HA3  5  
ATOM 5170  N N    . GLY A 1 8  ? 9.352   -5.138  -12.401 1.00 0.00 ? 8  GLY A N    5  
ATOM 5171  C CA   . GLY A 1 8  ? 7.993   -5.286  -11.914 1.00 0.00 ? 8  GLY A CA   5  
ATOM 5172  C C    . GLY A 1 8  ? 7.193   -4.004  -12.029 1.00 0.00 ? 8  GLY A C    5  
ATOM 5173  O O    . GLY A 1 8  ? 7.027   -3.279  -11.048 1.00 0.00 ? 8  GLY A O    5  
ATOM 5174  H H    . GLY A 1 8  ? 9.517   -4.705  -13.265 1.00 0.00 ? 8  GLY A H    5  
ATOM 5175  H HA2  . GLY A 1 8  ? 7.500   -6.058  -12.485 1.00 0.00 ? 8  GLY A HA2  5  
ATOM 5176  H HA3  . GLY A 1 8  ? 8.025   -5.585  -10.876 1.00 0.00 ? 8  GLY A HA3  5  
ATOM 5177  N N    . GLU A 1 9  ? 6.697   -3.722  -13.230 1.00 0.00 ? 9  GLU A N    5  
ATOM 5178  C CA   . GLU A 1 9  ? 5.913   -2.517  -13.468 1.00 0.00 ? 9  GLU A CA   5  
ATOM 5179  C C    . GLU A 1 9  ? 4.437   -2.857  -13.660 1.00 0.00 ? 9  GLU A C    5  
ATOM 5180  O O    . GLU A 1 9  ? 3.937   -2.954  -14.780 1.00 0.00 ? 9  GLU A O    5  
ATOM 5181  C CB   . GLU A 1 9  ? 6.440   -1.773  -14.698 1.00 0.00 ? 9  GLU A CB   5  
ATOM 5182  C CG   . GLU A 1 9  ? 7.917   -1.431  -14.615 1.00 0.00 ? 9  GLU A CG   5  
ATOM 5183  C CD   . GLU A 1 9  ? 8.263   -0.637  -13.370 1.00 0.00 ? 9  GLU A CD   5  
ATOM 5184  O OE1  . GLU A 1 9  ? 8.031   0.590   -13.366 1.00 0.00 ? 9  GLU A OE1  5  
ATOM 5185  O OE2  . GLU A 1 9  ? 8.766   -1.243  -12.400 1.00 0.00 ? 9  GLU A OE2  5  
ATOM 5186  H H    . GLU A 1 9  ? 6.864   -4.339  -13.972 1.00 0.00 ? 9  GLU A H    5  
ATOM 5187  H HA   . GLU A 1 9  ? 6.013   -1.879  -12.603 1.00 0.00 ? 9  GLU A HA   5  
ATOM 5188  H HB2  . GLU A 1 9  ? 6.282   -2.389  -15.571 1.00 0.00 ? 9  GLU A HB2  5  
ATOM 5189  H HB3  . GLU A 1 9  ? 5.885   -0.854  -14.812 1.00 0.00 ? 9  GLU A HB3  5  
ATOM 5190  H HG2  . GLU A 1 9  ? 8.487   -2.348  -14.608 1.00 0.00 ? 9  GLU A HG2  5  
ATOM 5191  H HG3  . GLU A 1 9  ? 8.188   -0.847  -15.483 1.00 0.00 ? 9  GLU A HG3  5  
ATOM 5192  N N    . PRO A 1 10 ? 3.723   -3.043  -12.540 1.00 0.00 ? 10 PRO A N    5  
ATOM 5193  C CA   . PRO A 1 10 ? 2.296   -3.375  -12.557 1.00 0.00 ? 10 PRO A CA   5  
ATOM 5194  C C    . PRO A 1 10 ? 1.435   -2.208  -13.028 1.00 0.00 ? 10 PRO A C    5  
ATOM 5195  O O    . PRO A 1 10 ? 1.951   -1.181  -13.467 1.00 0.00 ? 10 PRO A O    5  
ATOM 5196  C CB   . PRO A 1 10 ? 1.991   -3.707  -11.094 1.00 0.00 ? 10 PRO A CB   5  
ATOM 5197  C CG   . PRO A 1 10 ? 3.019   -2.962  -10.314 1.00 0.00 ? 10 PRO A CG   5  
ATOM 5198  C CD   . PRO A 1 10 ? 4.255   -2.943  -11.170 1.00 0.00 ? 10 PRO A CD   5  
ATOM 5199  H HA   . PRO A 1 10 ? 2.097   -4.240  -13.173 1.00 0.00 ? 10 PRO A HA   5  
ATOM 5200  H HB2  . PRO A 1 10 ? 0.991   -3.378  -10.848 1.00 0.00 ? 10 PRO A HB2  5  
ATOM 5201  H HB3  . PRO A 1 10 ? 2.074   -4.772  -10.938 1.00 0.00 ? 10 PRO A HB3  5  
ATOM 5202  H HG2  . PRO A 1 10 ? 2.678   -1.955  -10.126 1.00 0.00 ? 10 PRO A HG2  5  
ATOM 5203  H HG3  . PRO A 1 10 ? 3.215   -3.473  -9.384  1.00 0.00 ? 10 PRO A HG3  5  
ATOM 5204  H HD2  . PRO A 1 10 ? 4.795   -2.018  -11.032 1.00 0.00 ? 10 PRO A HD2  5  
ATOM 5205  H HD3  . PRO A 1 10 ? 4.886   -3.789  -10.940 1.00 0.00 ? 10 PRO A HD3  5  
ATOM 5206  N N    . GLY A 1 11 ? 0.119   -2.374  -12.935 1.00 0.00 ? 11 GLY A N    5  
ATOM 5207  C CA   . GLY A 1 11 ? -0.793  -1.326  -13.355 1.00 0.00 ? 11 GLY A CA   5  
ATOM 5208  C C    . GLY A 1 11 ? -1.934  -1.854  -14.201 1.00 0.00 ? 11 GLY A C    5  
ATOM 5209  O O    . GLY A 1 11 ? -2.113  -1.439  -15.346 1.00 0.00 ? 11 GLY A O    5  
ATOM 5210  H H    . GLY A 1 11 ? -0.236  -3.215  -12.577 1.00 0.00 ? 11 GLY A H    5  
ATOM 5211  H HA2  . GLY A 1 11 ? -1.200  -0.845  -12.479 1.00 0.00 ? 11 GLY A HA2  5  
ATOM 5212  H HA3  . GLY A 1 11 ? -0.242  -0.595  -13.931 1.00 0.00 ? 11 GLY A HA3  5  
ATOM 5213  N N    . THR A 1 12 ? -2.708  -2.777  -13.638 1.00 0.00 ? 12 THR A N    5  
ATOM 5214  C CA   . THR A 1 12 ? -3.836  -3.365  -14.348 1.00 0.00 ? 12 THR A CA   5  
ATOM 5215  C C    . THR A 1 12 ? -5.056  -3.485  -13.441 1.00 0.00 ? 12 THR A C    5  
ATOM 5216  O O    . THR A 1 12 ? -4.969  -3.261  -12.233 1.00 0.00 ? 12 THR A O    5  
ATOM 5217  C CB   . THR A 1 12 ? -3.485  -4.759  -14.903 1.00 0.00 ? 12 THR A CB   5  
ATOM 5218  O OG1  . THR A 1 12 ? -2.973  -5.589  -13.855 1.00 0.00 ? 12 THR A OG1  5  
ATOM 5219  C CG2  . THR A 1 12 ? -2.459  -4.653  -16.021 1.00 0.00 ? 12 THR A CG2  5  
ATOM 5220  H H    . THR A 1 12 ? -2.514  -3.067  -12.722 1.00 0.00 ? 12 THR A H    5  
ATOM 5221  H HA   . THR A 1 12 ? -4.080  -2.720  -15.180 1.00 0.00 ? 12 THR A HA   5  
ATOM 5222  H HB   . THR A 1 12 ? -4.384  -5.208  -15.301 1.00 0.00 ? 12 THR A HB   5  
ATOM 5223  H HG1  . THR A 1 12 ? -3.680  -5.803  -13.241 1.00 0.00 ? 12 THR A HG1  5  
ATOM 5224  H HG21 . THR A 1 12 ? -2.025  -3.664  -16.019 1.00 0.00 ? 12 THR A HG21 5  
ATOM 5225  H HG22 . THR A 1 12 ? -2.940  -4.834  -16.970 1.00 0.00 ? 12 THR A HG22 5  
ATOM 5226  H HG23 . THR A 1 12 ? -1.682  -5.386  -15.866 1.00 0.00 ? 12 THR A HG23 5  
ATOM 5227  N N    . LYS A 1 13 ? -6.193  -3.839  -14.030 1.00 0.00 ? 13 LYS A N    5  
ATOM 5228  C CA   . LYS A 1 13 ? -7.431  -3.991  -13.275 1.00 0.00 ? 13 LYS A CA   5  
ATOM 5229  C C    . LYS A 1 13 ? -7.954  -2.636  -12.810 1.00 0.00 ? 13 LYS A C    5  
ATOM 5230  O O    . LYS A 1 13 ? -8.443  -2.500  -11.689 1.00 0.00 ? 13 LYS A O    5  
ATOM 5231  C CB   . LYS A 1 13 ? -7.208  -4.905  -12.068 1.00 0.00 ? 13 LYS A CB   5  
ATOM 5232  C CG   . LYS A 1 13 ? -8.472  -5.595  -11.586 1.00 0.00 ? 13 LYS A CG   5  
ATOM 5233  C CD   . LYS A 1 13 ? -8.831  -6.779  -12.468 1.00 0.00 ? 13 LYS A CD   5  
ATOM 5234  C CE   . LYS A 1 13 ? -8.003  -8.006  -12.118 1.00 0.00 ? 13 LYS A CE   5  
ATOM 5235  N NZ   . LYS A 1 13 ? -6.714  -8.036  -12.862 1.00 0.00 ? 13 LYS A NZ   5  
ATOM 5236  H H    . LYS A 1 13 ? -6.199  -4.004  -14.997 1.00 0.00 ? 13 LYS A H    5  
ATOM 5237  H HA   . LYS A 1 13 ? -8.164  -4.443  -13.927 1.00 0.00 ? 13 LYS A HA   5  
ATOM 5238  H HB2  . LYS A 1 13 ? -6.487  -5.664  -12.334 1.00 0.00 ? 13 LYS A HB2  5  
ATOM 5239  H HB3  . LYS A 1 13 ? -6.812  -4.315  -11.253 1.00 0.00 ? 13 LYS A HB3  5  
ATOM 5240  H HG2  . LYS A 1 13 ? -8.317  -5.946  -10.576 1.00 0.00 ? 13 LYS A HG2  5  
ATOM 5241  H HG3  . LYS A 1 13 ? -9.287  -4.886  -11.601 1.00 0.00 ? 13 LYS A HG3  5  
ATOM 5242  H HD2  . LYS A 1 13 ? -9.877  -7.014  -12.332 1.00 0.00 ? 13 LYS A HD2  5  
ATOM 5243  H HD3  . LYS A 1 13 ? -8.650  -6.516  -13.500 1.00 0.00 ? 13 LYS A HD3  5  
ATOM 5244  H HE2  . LYS A 1 13 ? -7.798  -7.996  -11.059 1.00 0.00 ? 13 LYS A HE2  5  
ATOM 5245  H HE3  . LYS A 1 13 ? -8.572  -8.891  -12.366 1.00 0.00 ? 13 LYS A HE3  5  
ATOM 5246  H HZ1  . LYS A 1 13 ? -6.653  -8.901  -13.437 1.00 0.00 ? 13 LYS A HZ1  5  
ATOM 5247  H HZ2  . LYS A 1 13 ? -5.916  -8.020  -12.195 1.00 0.00 ? 13 LYS A HZ2  5  
ATOM 5248  H HZ3  . LYS A 1 13 ? -6.644  -7.210  -13.490 1.00 0.00 ? 13 LYS A HZ3  5  
ATOM 5249  N N    . ALA A 1 14 ? -7.850  -1.637  -13.680 1.00 0.00 ? 14 ALA A N    5  
ATOM 5250  C CA   . ALA A 1 14 ? -8.316  -0.293  -13.360 1.00 0.00 ? 14 ALA A CA   5  
ATOM 5251  C C    . ALA A 1 14 ? -9.813  -0.156  -13.617 1.00 0.00 ? 14 ALA A C    5  
ATOM 5252  O O    . ALA A 1 14 ? -10.247 -0.022  -14.762 1.00 0.00 ? 14 ALA A O    5  
ATOM 5253  C CB   . ALA A 1 14 ? -7.543  0.740   -14.166 1.00 0.00 ? 14 ALA A CB   5  
ATOM 5254  H H    . ALA A 1 14 ? -7.451  -1.807  -14.559 1.00 0.00 ? 14 ALA A H    5  
ATOM 5255  H HA   . ALA A 1 14 ? -8.124  -0.114  -12.312 1.00 0.00 ? 14 ALA A HA   5  
ATOM 5256  H HB1  . ALA A 1 14 ? -8.183  1.585   -14.375 1.00 0.00 ? 14 ALA A HB1  5  
ATOM 5257  H HB2  . ALA A 1 14 ? -6.685  1.069   -13.599 1.00 0.00 ? 14 ALA A HB2  5  
ATOM 5258  H HB3  . ALA A 1 14 ? -7.214  0.299   -15.095 1.00 0.00 ? 14 ALA A HB3  5  
ATOM 5259  N N    . LYS A 1 15 ? -10.598 -0.190  -12.546 1.00 0.00 ? 15 LYS A N    5  
ATOM 5260  C CA   . LYS A 1 15 ? -12.047 -0.068  -12.655 1.00 0.00 ? 15 LYS A CA   5  
ATOM 5261  C C    . LYS A 1 15 ? -12.585 0.948   -11.652 1.00 0.00 ? 15 LYS A C    5  
ATOM 5262  O O    . LYS A 1 15 ? -12.014 1.138   -10.578 1.00 0.00 ? 15 LYS A O    5  
ATOM 5263  C CB   . LYS A 1 15 ? -12.712 -1.427  -12.426 1.00 0.00 ? 15 LYS A CB   5  
ATOM 5264  C CG   . LYS A 1 15 ? -12.304 -2.482  -13.440 1.00 0.00 ? 15 LYS A CG   5  
ATOM 5265  C CD   . LYS A 1 15 ? -12.881 -3.844  -13.091 1.00 0.00 ? 15 LYS A CD   5  
ATOM 5266  C CE   . LYS A 1 15 ? -12.130 -4.965  -13.793 1.00 0.00 ? 15 LYS A CE   5  
ATOM 5267  N NZ   . LYS A 1 15 ? -12.625 -6.307  -13.381 1.00 0.00 ? 15 LYS A NZ   5  
ATOM 5268  H H    . LYS A 1 15 ? -10.193 -0.298  -11.660 1.00 0.00 ? 15 LYS A H    5  
ATOM 5269  H HA   . LYS A 1 15 ? -12.278 0.273   -13.653 1.00 0.00 ? 15 LYS A HA   5  
ATOM 5270  H HB2  . LYS A 1 15 ? -12.448 -1.783  -11.441 1.00 0.00 ? 15 LYS A HB2  5  
ATOM 5271  H HB3  . LYS A 1 15 ? -13.785 -1.303  -12.480 1.00 0.00 ? 15 LYS A HB3  5  
ATOM 5272  H HG2  . LYS A 1 15 ? -12.664 -2.190  -14.415 1.00 0.00 ? 15 LYS A HG2  5  
ATOM 5273  H HG3  . LYS A 1 15 ? -11.226 -2.553  -13.458 1.00 0.00 ? 15 LYS A HG3  5  
ATOM 5274  H HD2  . LYS A 1 15 ? -12.812 -3.992  -12.023 1.00 0.00 ? 15 LYS A HD2  5  
ATOM 5275  H HD3  . LYS A 1 15 ? -13.919 -3.873  -13.393 1.00 0.00 ? 15 LYS A HD3  5  
ATOM 5276  H HE2  . LYS A 1 15 ? -12.258 -4.854  -14.858 1.00 0.00 ? 15 LYS A HE2  5  
ATOM 5277  H HE3  . LYS A 1 15 ? -11.081 -4.886  -13.546 1.00 0.00 ? 15 LYS A HE3  5  
ATOM 5278  H HZ1  . LYS A 1 15 ? -12.312 -6.522  -12.413 1.00 0.00 ? 15 LYS A HZ1  5  
ATOM 5279  H HZ2  . LYS A 1 15 ? -12.255 -7.037  -14.023 1.00 0.00 ? 15 LYS A HZ2  5  
ATOM 5280  H HZ3  . LYS A 1 15 ? -13.665 -6.330  -13.411 1.00 0.00 ? 15 LYS A HZ3  5  
ATOM 5281  N N    . LYS A 1 16 ? -13.687 1.598   -12.009 1.00 0.00 ? 16 LYS A N    5  
ATOM 5282  C CA   . LYS A 1 16 ? -14.305 2.593   -11.140 1.00 0.00 ? 16 LYS A CA   5  
ATOM 5283  C C    . LYS A 1 16 ? -15.661 2.109   -10.636 1.00 0.00 ? 16 LYS A C    5  
ATOM 5284  O O    . LYS A 1 16 ? -15.889 2.018   -9.431  1.00 0.00 ? 16 LYS A O    5  
ATOM 5285  C CB   . LYS A 1 16 ? -14.470 3.919   -11.886 1.00 0.00 ? 16 LYS A CB   5  
ATOM 5286  C CG   . LYS A 1 16 ? -15.028 5.037   -11.022 1.00 0.00 ? 16 LYS A CG   5  
ATOM 5287  C CD   . LYS A 1 16 ? -15.259 6.303   -11.830 1.00 0.00 ? 16 LYS A CD   5  
ATOM 5288  C CE   . LYS A 1 16 ? -13.962 7.065   -12.056 1.00 0.00 ? 16 LYS A CE   5  
ATOM 5289  N NZ   . LYS A 1 16 ? -14.041 7.951   -13.250 1.00 0.00 ? 16 LYS A NZ   5  
ATOM 5290  H H    . LYS A 1 16 ? -14.097 1.403   -12.879 1.00 0.00 ? 16 LYS A H    5  
ATOM 5291  H HA   . LYS A 1 16 ? -13.653 2.745   -10.294 1.00 0.00 ? 16 LYS A HA   5  
ATOM 5292  H HB2  . LYS A 1 16 ? -13.506 4.230   -12.262 1.00 0.00 ? 16 LYS A HB2  5  
ATOM 5293  H HB3  . LYS A 1 16 ? -15.141 3.768   -12.720 1.00 0.00 ? 16 LYS A HB3  5  
ATOM 5294  H HG2  . LYS A 1 16 ? -15.968 4.717   -10.597 1.00 0.00 ? 16 LYS A HG2  5  
ATOM 5295  H HG3  . LYS A 1 16 ? -14.326 5.250   -10.228 1.00 0.00 ? 16 LYS A HG3  5  
ATOM 5296  H HD2  . LYS A 1 16 ? -15.679 6.037   -12.788 1.00 0.00 ? 16 LYS A HD2  5  
ATOM 5297  H HD3  . LYS A 1 16 ? -15.952 6.939   -11.296 1.00 0.00 ? 16 LYS A HD3  5  
ATOM 5298  H HE2  . LYS A 1 16 ? -13.757 7.667   -11.184 1.00 0.00 ? 16 LYS A HE2  5  
ATOM 5299  H HE3  . LYS A 1 16 ? -13.163 6.353   -12.198 1.00 0.00 ? 16 LYS A HE3  5  
ATOM 5300  H HZ1  . LYS A 1 16 ? -13.849 7.403   -14.114 1.00 0.00 ? 16 LYS A HZ1  5  
ATOM 5301  H HZ2  . LYS A 1 16 ? -13.339 8.714   -13.175 1.00 0.00 ? 16 LYS A HZ2  5  
ATOM 5302  H HZ3  . LYS A 1 16 ? -14.989 8.372   -13.322 1.00 0.00 ? 16 LYS A HZ3  5  
ATOM 5303  N N    . GLY A 1 17 ? -16.557 1.797   -11.568 1.00 0.00 ? 17 GLY A N    5  
ATOM 5304  C CA   . GLY A 1 17 ? -17.878 1.324   -11.197 1.00 0.00 ? 17 GLY A CA   5  
ATOM 5305  C C    . GLY A 1 17 ? -18.390 1.972   -9.927  1.00 0.00 ? 17 GLY A C    5  
ATOM 5306  O O    . GLY A 1 17 ? -18.671 3.171   -9.902  1.00 0.00 ? 17 GLY A O    5  
ATOM 5307  H H    . GLY A 1 17 ? -16.319 1.889   -12.514 1.00 0.00 ? 17 GLY A H    5  
ATOM 5308  H HA2  . GLY A 1 17 ? -18.564 1.541   -12.002 1.00 0.00 ? 17 GLY A HA2  5  
ATOM 5309  H HA3  . GLY A 1 17 ? -17.837 0.255   -11.051 1.00 0.00 ? 17 GLY A HA3  5  
ATOM 5310  N N    . ARG A 1 18 ? -18.515 1.179   -8.868  1.00 0.00 ? 18 ARG A N    5  
ATOM 5311  C CA   . ARG A 1 18 ? -19.000 1.682   -7.588  1.00 0.00 ? 18 ARG A CA   5  
ATOM 5312  C C    . ARG A 1 18 ? -17.876 1.719   -6.557  1.00 0.00 ? 18 ARG A C    5  
ATOM 5313  O O    . ARG A 1 18 ? -16.966 0.890   -6.586  1.00 0.00 ? 18 ARG A O    5  
ATOM 5314  C CB   . ARG A 1 18 ? -20.148 0.810   -7.076  1.00 0.00 ? 18 ARG A CB   5  
ATOM 5315  C CG   . ARG A 1 18 ? -21.054 1.519   -6.082  1.00 0.00 ? 18 ARG A CG   5  
ATOM 5316  C CD   . ARG A 1 18 ? -22.387 0.803   -5.935  1.00 0.00 ? 18 ARG A CD   5  
ATOM 5317  N NE   . ARG A 1 18 ? -22.252 -0.467  -5.228  1.00 0.00 ? 18 ARG A NE   5  
ATOM 5318  C CZ   . ARG A 1 18 ? -23.215 -1.380  -5.165  1.00 0.00 ? 18 ARG A CZ   5  
ATOM 5319  N NH1  . ARG A 1 18 ? -24.378 -1.164  -5.766  1.00 0.00 ? 18 ARG A NH1  5  
ATOM 5320  N NH2  . ARG A 1 18 ? -23.016 -2.512  -4.502  1.00 0.00 ? 18 ARG A NH2  5  
ATOM 5321  H H    . ARG A 1 18 ? -18.275 0.232   -8.949  1.00 0.00 ? 18 ARG A H    5  
ATOM 5322  H HA   . ARG A 1 18 ? -19.364 2.686   -7.743  1.00 0.00 ? 18 ARG A HA   5  
ATOM 5323  H HB2  . ARG A 1 18 ? -20.749 0.496   -7.916  1.00 0.00 ? 18 ARG A HB2  5  
ATOM 5324  H HB3  . ARG A 1 18 ? -19.734 -0.062  -6.594  1.00 0.00 ? 18 ARG A HB3  5  
ATOM 5325  H HG2  . ARG A 1 18 ? -20.565 1.546   -5.119  1.00 0.00 ? 18 ARG A HG2  5  
ATOM 5326  H HG3  . ARG A 1 18 ? -21.231 2.526   -6.426  1.00 0.00 ? 18 ARG A HG3  5  
ATOM 5327  H HD2  . ARG A 1 18 ? -23.064 1.440   -5.385  1.00 0.00 ? 18 ARG A HD2  5  
ATOM 5328  H HD3  . ARG A 1 18 ? -22.790 0.615   -6.920  1.00 0.00 ? 18 ARG A HD3  5  
ATOM 5329  H HE   . ARG A 1 18 ? -21.401 -0.647  -4.777  1.00 0.00 ? 18 ARG A HE   5  
ATOM 5330  H HH11 . ARG A 1 18 ? -24.530 -0.313  -6.267  1.00 0.00 ? 18 ARG A HH11 5  
ATOM 5331  H HH12 . ARG A 1 18 ? -25.101 -1.854  -5.718  1.00 0.00 ? 18 ARG A HH12 5  
ATOM 5332  H HH21 . ARG A 1 18 ? -22.141 -2.678  -4.049  1.00 0.00 ? 18 ARG A HH21 5  
ATOM 5333  H HH22 . ARG A 1 18 ? -23.742 -3.198  -4.456  1.00 0.00 ? 18 ARG A HH22 5  
ATOM 5334  N N    . ARG A 1 19 ? -17.945 2.686   -5.648  1.00 0.00 ? 19 ARG A N    5  
ATOM 5335  C CA   . ARG A 1 19 ? -16.933 2.833   -4.610  1.00 0.00 ? 19 ARG A CA   5  
ATOM 5336  C C    . ARG A 1 19 ? -17.223 1.905   -3.433  1.00 0.00 ? 19 ARG A C    5  
ATOM 5337  O O    . ARG A 1 19 ? -17.034 2.277   -2.275  1.00 0.00 ? 19 ARG A O    5  
ATOM 5338  C CB   . ARG A 1 19 ? -16.873 4.283   -4.127  1.00 0.00 ? 19 ARG A CB   5  
ATOM 5339  C CG   . ARG A 1 19 ? -18.095 4.710   -3.330  1.00 0.00 ? 19 ARG A CG   5  
ATOM 5340  C CD   . ARG A 1 19 ? -19.174 5.290   -4.231  1.00 0.00 ? 19 ARG A CD   5  
ATOM 5341  N NE   . ARG A 1 19 ? -19.987 6.287   -3.540  1.00 0.00 ? 19 ARG A NE   5  
ATOM 5342  C CZ   . ARG A 1 19 ? -21.032 5.982   -2.779  1.00 0.00 ? 19 ARG A CZ   5  
ATOM 5343  N NH1  . ARG A 1 19 ? -21.389 4.716   -2.611  1.00 0.00 ? 19 ARG A NH1  5  
ATOM 5344  N NH2  . ARG A 1 19 ? -21.723 6.946   -2.182  1.00 0.00 ? 19 ARG A NH2  5  
ATOM 5345  H H    . ARG A 1 19 ? -18.695 3.317   -5.678  1.00 0.00 ? 19 ARG A H    5  
ATOM 5346  H HA   . ARG A 1 19 ? -15.978 2.565   -5.037  1.00 0.00 ? 19 ARG A HA   5  
ATOM 5347  H HB2  . ARG A 1 19 ? -16.002 4.406   -3.501  1.00 0.00 ? 19 ARG A HB2  5  
ATOM 5348  H HB3  . ARG A 1 19 ? -16.786 4.932   -4.985  1.00 0.00 ? 19 ARG A HB3  5  
ATOM 5349  H HG2  . ARG A 1 19 ? -18.496 3.850   -2.815  1.00 0.00 ? 19 ARG A HG2  5  
ATOM 5350  H HG3  . ARG A 1 19 ? -17.799 5.458   -2.609  1.00 0.00 ? 19 ARG A HG3  5  
ATOM 5351  H HD2  . ARG A 1 19 ? -18.701 5.754   -5.083  1.00 0.00 ? 19 ARG A HD2  5  
ATOM 5352  H HD3  . ARG A 1 19 ? -19.813 4.487   -4.567  1.00 0.00 ? 19 ARG A HD3  5  
ATOM 5353  H HE   . ARG A 1 19 ? -19.741 7.228   -3.650  1.00 0.00 ? 19 ARG A HE   5  
ATOM 5354  H HH11 . ARG A 1 19 ? -20.870 3.988   -3.059  1.00 0.00 ? 19 ARG A HH11 5  
ATOM 5355  H HH12 . ARG A 1 19 ? -22.176 4.490   -2.037  1.00 0.00 ? 19 ARG A HH12 5  
ATOM 5356  H HH21 . ARG A 1 19 ? -21.457 7.901   -2.306  1.00 0.00 ? 19 ARG A HH21 5  
ATOM 5357  H HH22 . ARG A 1 19 ? -22.510 6.716   -1.610  1.00 0.00 ? 19 ARG A HH22 5  
ATOM 5358  N N    . SER A 1 20 ? -17.684 0.696   -3.739  1.00 0.00 ? 20 SER A N    5  
ATOM 5359  C CA   . SER A 1 20 ? -18.005 -0.283  -2.707  1.00 0.00 ? 20 SER A CA   5  
ATOM 5360  C C    . SER A 1 20 ? -17.060 -1.479  -2.781  1.00 0.00 ? 20 SER A C    5  
ATOM 5361  O O    . SER A 1 20 ? -17.491 -2.630  -2.707  1.00 0.00 ? 20 SER A O    5  
ATOM 5362  C CB   . SER A 1 20 ? -19.453 -0.753  -2.853  1.00 0.00 ? 20 SER A CB   5  
ATOM 5363  O OG   . SER A 1 20 ? -20.359 0.246   -2.417  1.00 0.00 ? 20 SER A OG   5  
ATOM 5364  H H    . SER A 1 20 ? -17.814 0.459   -4.681  1.00 0.00 ? 20 SER A H    5  
ATOM 5365  H HA   . SER A 1 20 ? -17.885 0.196   -1.747  1.00 0.00 ? 20 SER A HA   5  
ATOM 5366  H HB2  . SER A 1 20 ? -19.654 -0.977  -3.889  1.00 0.00 ? 20 SER A HB2  5  
ATOM 5367  H HB3  . SER A 1 20 ? -19.602 -1.642  -2.257  1.00 0.00 ? 20 SER A HB3  5  
ATOM 5368  H HG   . SER A 1 20 ? -21.177 0.176   -2.916  1.00 0.00 ? 20 SER A HG   5  
ATOM 5369  N N    . ARG A 1 21 ? -15.770 -1.198  -2.929  1.00 0.00 ? 21 ARG A N    5  
ATOM 5370  C CA   . ARG A 1 21 ? -14.763 -2.249  -3.014  1.00 0.00 ? 21 ARG A CA   5  
ATOM 5371  C C    . ARG A 1 21 ? -14.137 -2.515  -1.649  1.00 0.00 ? 21 ARG A C    5  
ATOM 5372  O O    . ARG A 1 21 ? -14.168 -3.639  -1.147  1.00 0.00 ? 21 ARG A O    5  
ATOM 5373  C CB   . ARG A 1 21 ? -13.676 -1.864  -4.020  1.00 0.00 ? 21 ARG A CB   5  
ATOM 5374  C CG   . ARG A 1 21 ? -14.200 -1.648  -5.430  1.00 0.00 ? 21 ARG A CG   5  
ATOM 5375  C CD   . ARG A 1 21 ? -14.239 -2.950  -6.215  1.00 0.00 ? 21 ARG A CD   5  
ATOM 5376  N NE   . ARG A 1 21 ? -12.905 -3.513  -6.409  1.00 0.00 ? 21 ARG A NE   5  
ATOM 5377  C CZ   . ARG A 1 21 ? -12.677 -4.800  -6.646  1.00 0.00 ? 21 ARG A CZ   5  
ATOM 5378  N NH1  . ARG A 1 21 ? -13.690 -5.653  -6.719  1.00 0.00 ? 21 ARG A NH1  5  
ATOM 5379  N NH2  . ARG A 1 21 ? -11.435 -5.235  -6.812  1.00 0.00 ? 21 ARG A NH2  5  
ATOM 5380  H H    . ARG A 1 21 ? -15.487 -0.261  -2.982  1.00 0.00 ? 21 ARG A H    5  
ATOM 5381  H HA   . ARG A 1 21 ? -15.252 -3.150  -3.354  1.00 0.00 ? 21 ARG A HA   5  
ATOM 5382  H HB2  . ARG A 1 21 ? -13.206 -0.948  -3.691  1.00 0.00 ? 21 ARG A HB2  5  
ATOM 5383  H HB3  . ARG A 1 21 ? -12.936 -2.649  -4.050  1.00 0.00 ? 21 ARG A HB3  5  
ATOM 5384  H HG2  . ARG A 1 21 ? -15.200 -1.244  -5.375  1.00 0.00 ? 21 ARG A HG2  5  
ATOM 5385  H HG3  . ARG A 1 21 ? -13.555 -0.949  -5.941  1.00 0.00 ? 21 ARG A HG3  5  
ATOM 5386  H HD2  . ARG A 1 21 ? -14.844 -3.663  -5.674  1.00 0.00 ? 21 ARG A HD2  5  
ATOM 5387  H HD3  . ARG A 1 21 ? -14.683 -2.760  -7.180  1.00 0.00 ? 21 ARG A HD3  5  
ATOM 5388  H HE   . ARG A 1 21 ? -12.143 -2.900  -6.359  1.00 0.00 ? 21 ARG A HE   5  
ATOM 5389  H HH11 . ARG A 1 21 ? -14.627 -5.327  -6.596  1.00 0.00 ? 21 ARG A HH11 5  
ATOM 5390  H HH12 . ARG A 1 21 ? -13.515 -6.621  -6.900  1.00 0.00 ? 21 ARG A HH12 5  
ATOM 5391  H HH21 . ARG A 1 21 ? -10.669 -4.595  -6.758  1.00 0.00 ? 21 ARG A HH21 5  
ATOM 5392  H HH22 . ARG A 1 21 ? -11.265 -6.204  -6.991  1.00 0.00 ? 21 ARG A HH22 5  
ATOM 5393  N N    . THR A 1 22 ? -13.568 -1.472  -1.051  1.00 0.00 ? 22 THR A N    5  
ATOM 5394  C CA   . THR A 1 22 ? -12.933 -1.592  0.255   1.00 0.00 ? 22 THR A CA   5  
ATOM 5395  C C    . THR A 1 22 ? -13.950 -1.958  1.329   1.00 0.00 ? 22 THR A C    5  
ATOM 5396  O O    . THR A 1 22 ? -14.962 -1.278  1.498   1.00 0.00 ? 22 THR A O    5  
ATOM 5397  C CB   . THR A 1 22 ? -12.225 -0.285  0.658   1.00 0.00 ? 22 THR A CB   5  
ATOM 5398  O OG1  . THR A 1 22 ? -13.173 0.786   0.722   1.00 0.00 ? 22 THR A OG1  5  
ATOM 5399  C CG2  . THR A 1 22 ? -11.125 0.063   -0.334  1.00 0.00 ? 22 THR A CG2  5  
ATOM 5400  H H    . THR A 1 22 ? -13.576 -0.602  -1.502  1.00 0.00 ? 22 THR A H    5  
ATOM 5401  H HA   . THR A 1 22 ? -12.190 -2.375  0.194   1.00 0.00 ? 22 THR A HA   5  
ATOM 5402  H HB   . THR A 1 22 ? -11.780 -0.420  1.634   1.00 0.00 ? 22 THR A HB   5  
ATOM 5403  H HG1  . THR A 1 22 ? -12.792 1.523   1.204   1.00 0.00 ? 22 THR A HG1  5  
ATOM 5404  H HG21 . THR A 1 22 ? -11.568 0.360   -1.273  1.00 0.00 ? 22 THR A HG21 5  
ATOM 5405  H HG22 . THR A 1 22 ? -10.495 -0.800  -0.490  1.00 0.00 ? 22 THR A HG22 5  
ATOM 5406  H HG23 . THR A 1 22 ? -10.532 0.876   0.058   1.00 0.00 ? 22 THR A HG23 5  
ATOM 5407  N N    . VAL A 1 23 ? -13.675 -3.038  2.055   1.00 0.00 ? 23 VAL A N    5  
ATOM 5408  C CA   . VAL A 1 23 ? -14.567 -3.493  3.115   1.00 0.00 ? 23 VAL A CA   5  
ATOM 5409  C C    . VAL A 1 23 ? -13.829 -3.598  4.446   1.00 0.00 ? 23 VAL A C    5  
ATOM 5410  O O    . VAL A 1 23 ? -14.097 -4.493  5.247   1.00 0.00 ? 23 VAL A O    5  
ATOM 5411  C CB   . VAL A 1 23 ? -15.189 -4.861  2.777   1.00 0.00 ? 23 VAL A CB   5  
ATOM 5412  C CG1  . VAL A 1 23 ? -16.501 -5.050  3.523   1.00 0.00 ? 23 VAL A CG1  5  
ATOM 5413  C CG2  . VAL A 1 23 ? -15.396 -4.994  1.276   1.00 0.00 ? 23 VAL A CG2  5  
ATOM 5414  H H    . VAL A 1 23 ? -12.853 -3.539  1.874   1.00 0.00 ? 23 VAL A H    5  
ATOM 5415  H HA   . VAL A 1 23 ? -15.365 -2.772  3.213   1.00 0.00 ? 23 VAL A HA   5  
ATOM 5416  H HB   . VAL A 1 23 ? -14.505 -5.634  3.095   1.00 0.00 ? 23 VAL A HB   5  
ATOM 5417  H HG11 . VAL A 1 23 ? -16.386 -4.715  4.543   1.00 0.00 ? 23 VAL A HG11 5  
ATOM 5418  H HG12 . VAL A 1 23 ? -17.277 -4.475  3.039   1.00 0.00 ? 23 VAL A HG12 5  
ATOM 5419  H HG13 . VAL A 1 23 ? -16.770 -6.096  3.517   1.00 0.00 ? 23 VAL A HG13 5  
ATOM 5420  H HG21 . VAL A 1 23 ? -16.320 -5.519  1.086   1.00 0.00 ? 23 VAL A HG21 5  
ATOM 5421  H HG22 . VAL A 1 23 ? -15.443 -4.011  0.829   1.00 0.00 ? 23 VAL A HG22 5  
ATOM 5422  H HG23 . VAL A 1 23 ? -14.573 -5.545  0.846   1.00 0.00 ? 23 VAL A HG23 5  
ATOM 5423  N N    . PHE A 1 24 ? -12.899 -2.677  4.675   1.00 0.00 ? 24 PHE A N    5  
ATOM 5424  C CA   . PHE A 1 24 ? -12.122 -2.666  5.908   1.00 0.00 ? 24 PHE A CA   5  
ATOM 5425  C C    . PHE A 1 24 ? -12.948 -2.114  7.067   1.00 0.00 ? 24 PHE A C    5  
ATOM 5426  O O    . PHE A 1 24 ? -13.849 -1.299  6.870   1.00 0.00 ? 24 PHE A O    5  
ATOM 5427  C CB   . PHE A 1 24 ? -10.853 -1.830  5.729   1.00 0.00 ? 24 PHE A CB   5  
ATOM 5428  C CG   . PHE A 1 24 ? -10.010 -2.262  4.563   1.00 0.00 ? 24 PHE A CG   5  
ATOM 5429  C CD1  . PHE A 1 24 ? -9.220  -3.397  4.645   1.00 0.00 ? 24 PHE A CD1  5  
ATOM 5430  C CD2  . PHE A 1 24 ? -10.009 -1.534  3.384   1.00 0.00 ? 24 PHE A CD2  5  
ATOM 5431  C CE1  . PHE A 1 24 ? -8.444  -3.797  3.574   1.00 0.00 ? 24 PHE A CE1  5  
ATOM 5432  C CE2  . PHE A 1 24 ? -9.235  -1.928  2.310   1.00 0.00 ? 24 PHE A CE2  5  
ATOM 5433  C CZ   . PHE A 1 24 ? -8.452  -3.062  2.404   1.00 0.00 ? 24 PHE A CZ   5  
ATOM 5434  H H    . PHE A 1 24 ? -12.731 -1.988  3.997   1.00 0.00 ? 24 PHE A H    5  
ATOM 5435  H HA   . PHE A 1 24 ? -11.844 -3.684  6.133   1.00 0.00 ? 24 PHE A HA   5  
ATOM 5436  H HB2  . PHE A 1 24 ? -11.129 -0.798  5.574   1.00 0.00 ? 24 PHE A HB2  5  
ATOM 5437  H HB3  . PHE A 1 24 ? -10.251 -1.907  6.622   1.00 0.00 ? 24 PHE A HB3  5  
ATOM 5438  H HD1  . PHE A 1 24 ? -9.213  -3.974  5.559   1.00 0.00 ? 24 PHE A HD1  5  
ATOM 5439  H HD2  . PHE A 1 24 ? -10.622 -0.646  3.309   1.00 0.00 ? 24 PHE A HD2  5  
ATOM 5440  H HE1  . PHE A 1 24 ? -7.832  -4.684  3.651   1.00 0.00 ? 24 PHE A HE1  5  
ATOM 5441  H HE2  . PHE A 1 24 ? -9.244  -1.351  1.397   1.00 0.00 ? 24 PHE A HE2  5  
ATOM 5442  H HZ   . PHE A 1 24 ? -7.846  -3.372  1.566   1.00 0.00 ? 24 PHE A HZ   5  
ATOM 5443  N N    . THR A 1 25 ? -12.634 -2.566  8.277   1.00 0.00 ? 25 THR A N    5  
ATOM 5444  C CA   . THR A 1 25 ? -13.347 -2.120  9.468   1.00 0.00 ? 25 THR A CA   5  
ATOM 5445  C C    . THR A 1 25 ? -12.520 -1.114  10.260  1.00 0.00 ? 25 THR A C    5  
ATOM 5446  O O    . THR A 1 25 ? -11.291 -1.182  10.274  1.00 0.00 ? 25 THR A O    5  
ATOM 5447  C CB   . THR A 1 25 ? -13.708 -3.305  10.383  1.00 0.00 ? 25 THR A CB   5  
ATOM 5448  O OG1  . THR A 1 25 ? -12.515 -3.935  10.862  1.00 0.00 ? 25 THR A OG1  5  
ATOM 5449  C CG2  . THR A 1 25 ? -14.562 -4.322  9.640   1.00 0.00 ? 25 THR A CG2  5  
ATOM 5450  H H    . THR A 1 25 ? -11.906 -3.215  8.370   1.00 0.00 ? 25 THR A H    5  
ATOM 5451  H HA   . THR A 1 25 ? -14.264 -1.646  9.149   1.00 0.00 ? 25 THR A HA   5  
ATOM 5452  H HB   . THR A 1 25 ? -14.272 -2.931  11.226  1.00 0.00 ? 25 THR A HB   5  
ATOM 5453  H HG1  . THR A 1 25 ? -12.353 -3.666  11.769  1.00 0.00 ? 25 THR A HG1  5  
ATOM 5454  H HG21 . THR A 1 25 ? -13.939 -5.138  9.304   1.00 0.00 ? 25 THR A HG21 5  
ATOM 5455  H HG22 . THR A 1 25 ? -15.026 -3.848  8.788   1.00 0.00 ? 25 THR A HG22 5  
ATOM 5456  H HG23 . THR A 1 25 ? -15.326 -4.702  10.302  1.00 0.00 ? 25 THR A HG23 5  
ATOM 5457  N N    . GLU A 1 26 ? -13.201 -0.183  10.919  1.00 0.00 ? 26 GLU A N    5  
ATOM 5458  C CA   . GLU A 1 26 ? -12.527 0.837   11.714  1.00 0.00 ? 26 GLU A CA   5  
ATOM 5459  C C    . GLU A 1 26 ? -11.289 0.264   12.398  1.00 0.00 ? 26 GLU A C    5  
ATOM 5460  O O    . GLU A 1 26 ? -10.242 0.910   12.454  1.00 0.00 ? 26 GLU A O    5  
ATOM 5461  C CB   . GLU A 1 26 ? -13.482 1.412   12.762  1.00 0.00 ? 26 GLU A CB   5  
ATOM 5462  C CG   . GLU A 1 26 ? -14.399 2.496   12.221  1.00 0.00 ? 26 GLU A CG   5  
ATOM 5463  C CD   . GLU A 1 26 ? -15.461 2.914   13.219  1.00 0.00 ? 26 GLU A CD   5  
ATOM 5464  O OE1  . GLU A 1 26 ? -16.043 2.024   13.875  1.00 0.00 ? 26 GLU A OE1  5  
ATOM 5465  O OE2  . GLU A 1 26 ? -15.710 4.131   13.345  1.00 0.00 ? 26 GLU A OE2  5  
ATOM 5466  H H    . GLU A 1 26 ? -14.180 -0.181  10.869  1.00 0.00 ? 26 GLU A H    5  
ATOM 5467  H HA   . GLU A 1 26 ? -12.221 1.629   11.047  1.00 0.00 ? 26 GLU A HA   5  
ATOM 5468  H HB2  . GLU A 1 26 ? -14.094 0.612   13.152  1.00 0.00 ? 26 GLU A HB2  5  
ATOM 5469  H HB3  . GLU A 1 26 ? -12.900 1.832   13.569  1.00 0.00 ? 26 GLU A HB3  5  
ATOM 5470  H HG2  . GLU A 1 26 ? -13.803 3.361   11.970  1.00 0.00 ? 26 GLU A HG2  5  
ATOM 5471  H HG3  . GLU A 1 26 ? -14.887 2.126   11.332  1.00 0.00 ? 26 GLU A HG3  5  
ATOM 5472  N N    . LEU A 1 27 ? -11.417 -0.952  12.917  1.00 0.00 ? 27 LEU A N    5  
ATOM 5473  C CA   . LEU A 1 27 ? -10.310 -1.614  13.598  1.00 0.00 ? 27 LEU A CA   5  
ATOM 5474  C C    . LEU A 1 27 ? -9.189  -1.946  12.618  1.00 0.00 ? 27 LEU A C    5  
ATOM 5475  O O    . LEU A 1 27 ? -8.053  -1.503  12.786  1.00 0.00 ? 27 LEU A O    5  
ATOM 5476  C CB   . LEU A 1 27 ? -10.797 -2.890  14.285  1.00 0.00 ? 27 LEU A CB   5  
ATOM 5477  C CG   . LEU A 1 27 ? -9.813  -3.550  15.252  1.00 0.00 ? 27 LEU A CG   5  
ATOM 5478  C CD1  . LEU A 1 27 ? -10.553 -4.428  16.250  1.00 0.00 ? 27 LEU A CD1  5  
ATOM 5479  C CD2  . LEU A 1 27 ? -8.778  -4.362  14.489  1.00 0.00 ? 27 LEU A CD2  5  
ATOM 5480  H H    . LEU A 1 27 ? -12.276 -1.417  12.841  1.00 0.00 ? 27 LEU A H    5  
ATOM 5481  H HA   . LEU A 1 27 ? -9.928  -0.935  14.346  1.00 0.00 ? 27 LEU A HA   5  
ATOM 5482  H HB2  . LEU A 1 27 ? -11.691 -2.647  14.838  1.00 0.00 ? 27 LEU A HB2  5  
ATOM 5483  H HB3  . LEU A 1 27 ? -11.037 -3.609  13.514  1.00 0.00 ? 27 LEU A HB3  5  
ATOM 5484  H HG   . LEU A 1 27 ? -9.294  -2.780  15.807  1.00 0.00 ? 27 LEU A HG   5  
ATOM 5485  H HD11 . LEU A 1 27 ? -9.963  -5.306  16.463  1.00 0.00 ? 27 LEU A HD11 5  
ATOM 5486  H HD12 . LEU A 1 27 ? -11.504 -4.725  15.832  1.00 0.00 ? 27 LEU A HD12 5  
ATOM 5487  H HD13 . LEU A 1 27 ? -10.719 -3.874  17.163  1.00 0.00 ? 27 LEU A HD13 5  
ATOM 5488  H HD21 . LEU A 1 27 ? -7.788  -4.026  14.758  1.00 0.00 ? 27 LEU A HD21 5  
ATOM 5489  H HD22 . LEU A 1 27 ? -8.927  -4.229  13.427  1.00 0.00 ? 27 LEU A HD22 5  
ATOM 5490  H HD23 . LEU A 1 27 ? -8.885  -5.407  14.739  1.00 0.00 ? 27 LEU A HD23 5  
ATOM 5491  N N    . GLN A 1 28 ? -9.517  -2.728  11.594  1.00 0.00 ? 28 GLN A N    5  
ATOM 5492  C CA   . GLN A 1 28 ? -8.538  -3.118  10.587  1.00 0.00 ? 28 GLN A CA   5  
ATOM 5493  C C    . GLN A 1 28 ? -7.790  -1.900  10.054  1.00 0.00 ? 28 GLN A C    5  
ATOM 5494  O O    . GLN A 1 28 ? -6.567  -1.922  9.912   1.00 0.00 ? 28 GLN A O    5  
ATOM 5495  C CB   . GLN A 1 28 ? -9.225  -3.854  9.435   1.00 0.00 ? 28 GLN A CB   5  
ATOM 5496  C CG   . GLN A 1 28 ? -9.808  -5.200  9.835   1.00 0.00 ? 28 GLN A CG   5  
ATOM 5497  C CD   . GLN A 1 28 ? -10.618 -5.838  8.724   1.00 0.00 ? 28 GLN A CD   5  
ATOM 5498  O OE1  . GLN A 1 28 ? -11.279 -5.149  7.947   1.00 0.00 ? 28 GLN A OE1  5  
ATOM 5499  N NE2  . GLN A 1 28 ? -10.569 -7.163  8.642   1.00 0.00 ? 28 GLN A NE2  5  
ATOM 5500  H H    . GLN A 1 28 ? -10.439 -3.050  11.515  1.00 0.00 ? 28 GLN A H    5  
ATOM 5501  H HA   . GLN A 1 28 ? -7.828  -3.784  11.055  1.00 0.00 ? 28 GLN A HA   5  
ATOM 5502  H HB2  . GLN A 1 28 ? -10.025 -3.237  9.056   1.00 0.00 ? 28 GLN A HB2  5  
ATOM 5503  H HB3  . GLN A 1 28 ? -8.504  -4.019  8.648   1.00 0.00 ? 28 GLN A HB3  5  
ATOM 5504  H HG2  . GLN A 1 28 ? -8.999  -5.865  10.098  1.00 0.00 ? 28 GLN A HG2  5  
ATOM 5505  H HG3  . GLN A 1 28 ? -10.450 -5.058  10.693  1.00 0.00 ? 28 GLN A HG3  5  
ATOM 5506  H HE21 . GLN A 1 28 ? -10.022 -7.647  9.296   1.00 0.00 ? 28 GLN A HE21 5  
ATOM 5507  H HE22 . GLN A 1 28 ? -11.083 -7.602  7.933   1.00 0.00 ? 28 GLN A HE22 5  
ATOM 5508  N N    . LEU A 1 29 ? -8.533  -0.839  9.759   1.00 0.00 ? 29 LEU A N    5  
ATOM 5509  C CA   . LEU A 1 29 ? -7.941  0.389   9.241   1.00 0.00 ? 29 LEU A CA   5  
ATOM 5510  C C    . LEU A 1 29 ? -6.969  0.994   10.250  1.00 0.00 ? 29 LEU A C    5  
ATOM 5511  O O    . LEU A 1 29 ? -5.852  1.372   9.901   1.00 0.00 ? 29 LEU A O    5  
ATOM 5512  C CB   . LEU A 1 29 ? -9.035  1.402   8.900   1.00 0.00 ? 29 LEU A CB   5  
ATOM 5513  C CG   . LEU A 1 29 ? -9.779  1.169   7.584   1.00 0.00 ? 29 LEU A CG   5  
ATOM 5514  C CD1  . LEU A 1 29 ? -10.930 2.153   7.440   1.00 0.00 ? 29 LEU A CD1  5  
ATOM 5515  C CD2  . LEU A 1 29 ? -8.825  1.284   6.404   1.00 0.00 ? 29 LEU A CD2  5  
ATOM 5516  H H    . LEU A 1 29 ? -9.502  -0.881  9.893   1.00 0.00 ? 29 LEU A H    5  
ATOM 5517  H HA   . LEU A 1 29 ? -7.398  0.141   8.341   1.00 0.00 ? 29 LEU A HA   5  
ATOM 5518  H HB2  . LEU A 1 29 ? -9.761  1.385   9.698   1.00 0.00 ? 29 LEU A HB2  5  
ATOM 5519  H HB3  . LEU A 1 29 ? -8.577  2.380   8.853   1.00 0.00 ? 29 LEU A HB3  5  
ATOM 5520  H HG   . LEU A 1 29 ? -10.193 0.170   7.585   1.00 0.00 ? 29 LEU A HG   5  
ATOM 5521  H HD11 . LEU A 1 29 ? -10.593 3.024   6.899   1.00 0.00 ? 29 LEU A HD11 5  
ATOM 5522  H HD12 . LEU A 1 29 ? -11.275 2.449   8.420   1.00 0.00 ? 29 LEU A HD12 5  
ATOM 5523  H HD13 . LEU A 1 29 ? -11.739 1.683   6.900   1.00 0.00 ? 29 LEU A HD13 5  
ATOM 5524  H HD21 . LEU A 1 29 ? -9.223  1.987   5.688   1.00 0.00 ? 29 LEU A HD21 5  
ATOM 5525  H HD22 . LEU A 1 29 ? -8.715  0.317   5.935   1.00 0.00 ? 29 LEU A HD22 5  
ATOM 5526  H HD23 . LEU A 1 29 ? -7.863  1.628   6.752   1.00 0.00 ? 29 LEU A HD23 5  
ATOM 5527  N N    . MET A 1 30 ? -7.403  1.079   11.503  1.00 0.00 ? 30 MET A N    5  
ATOM 5528  C CA   . MET A 1 30 ? -6.571  1.634   12.564  1.00 0.00 ? 30 MET A CA   5  
ATOM 5529  C C    . MET A 1 30 ? -5.213  0.941   12.608  1.00 0.00 ? 30 MET A C    5  
ATOM 5530  O O    . MET A 1 30 ? -4.179  1.589   12.765  1.00 0.00 ? 30 MET A O    5  
ATOM 5531  C CB   . MET A 1 30 ? -7.271  1.496   13.917  1.00 0.00 ? 30 MET A CB   5  
ATOM 5532  C CG   . MET A 1 30 ? -6.423  1.959   15.090  1.00 0.00 ? 30 MET A CG   5  
ATOM 5533  S SD   . MET A 1 30 ? -7.414  2.408   16.528  1.00 0.00 ? 30 MET A SD   5  
ATOM 5534  C CE   . MET A 1 30 ? -7.833  0.789   17.170  1.00 0.00 ? 30 MET A CE   5  
ATOM 5535  H H    . MET A 1 30 ? -8.305  0.761   11.721  1.00 0.00 ? 30 MET A H    5  
ATOM 5536  H HA   . MET A 1 30 ? -6.420  2.682   12.352  1.00 0.00 ? 30 MET A HA   5  
ATOM 5537  H HB2  . MET A 1 30 ? -8.177  2.082   13.901  1.00 0.00 ? 30 MET A HB2  5  
ATOM 5538  H HB3  . MET A 1 30 ? -7.526  0.458   14.073  1.00 0.00 ? 30 MET A HB3  5  
ATOM 5539  H HG2  . MET A 1 30 ? -5.751  1.161   15.370  1.00 0.00 ? 30 MET A HG2  5  
ATOM 5540  H HG3  . MET A 1 30 ? -5.848  2.820   14.783  1.00 0.00 ? 30 MET A HG3  5  
ATOM 5541  H HE1  . MET A 1 30 ? -8.012  0.858   18.233  1.00 0.00 ? 30 MET A HE1  5  
ATOM 5542  H HE2  . MET A 1 30 ? -8.723  0.427   16.678  1.00 0.00 ? 30 MET A HE2  5  
ATOM 5543  H HE3  . MET A 1 30 ? -7.016  0.107   16.986  1.00 0.00 ? 30 MET A HE3  5  
ATOM 5544  N N    . GLY A 1 31 ? -5.223  -0.382  12.469  1.00 0.00 ? 31 GLY A N    5  
ATOM 5545  C CA   . GLY A 1 31 ? -3.987  -1.141  12.496  1.00 0.00 ? 31 GLY A CA   5  
ATOM 5546  C C    . GLY A 1 31 ? -3.129  -0.895  11.271  1.00 0.00 ? 31 GLY A C    5  
ATOM 5547  O O    . GLY A 1 31 ? -1.964  -0.511  11.386  1.00 0.00 ? 31 GLY A O    5  
ATOM 5548  H H    . GLY A 1 31 ? -6.078  -0.846  12.347  1.00 0.00 ? 31 GLY A H    5  
ATOM 5549  H HA2  . GLY A 1 31 ? -3.426  -0.864  13.376  1.00 0.00 ? 31 GLY A HA2  5  
ATOM 5550  H HA3  . GLY A 1 31 ? -4.224  -2.193  12.549  1.00 0.00 ? 31 GLY A HA3  5  
ATOM 5551  N N    . LEU A 1 32 ? -3.703  -1.119  10.094  1.00 0.00 ? 32 LEU A N    5  
ATOM 5552  C CA   . LEU A 1 32 ? -2.983  -0.921  8.841   1.00 0.00 ? 32 LEU A CA   5  
ATOM 5553  C C    . LEU A 1 32 ? -2.199  0.387   8.864   1.00 0.00 ? 32 LEU A C    5  
ATOM 5554  O O    . LEU A 1 32 ? -1.022  0.423   8.506   1.00 0.00 ? 32 LEU A O    5  
ATOM 5555  C CB   . LEU A 1 32 ? -3.959  -0.923  7.663   1.00 0.00 ? 32 LEU A CB   5  
ATOM 5556  C CG   . LEU A 1 32 ? -4.454  -2.295  7.204   1.00 0.00 ? 32 LEU A CG   5  
ATOM 5557  C CD1  . LEU A 1 32 ? -5.626  -2.146  6.246   1.00 0.00 ? 32 LEU A CD1  5  
ATOM 5558  C CD2  . LEU A 1 32 ? -3.325  -3.079  6.552   1.00 0.00 ? 32 LEU A CD2  5  
ATOM 5559  H H    . LEU A 1 32 ? -4.634  -1.424  10.066  1.00 0.00 ? 32 LEU A H    5  
ATOM 5560  H HA   . LEU A 1 32 ? -2.289  -1.740  8.725   1.00 0.00 ? 32 LEU A HA   5  
ATOM 5561  H HB2  . LEU A 1 32 ? -4.820  -0.338  7.946   1.00 0.00 ? 32 LEU A HB2  5  
ATOM 5562  H HB3  . LEU A 1 32 ? -3.465  -0.451  6.825   1.00 0.00 ? 32 LEU A HB3  5  
ATOM 5563  H HG   . LEU A 1 32 ? -4.797  -2.853  8.065   1.00 0.00 ? 32 LEU A HG   5  
ATOM 5564  H HD11 . LEU A 1 32 ? -6.506  -1.852  6.797   1.00 0.00 ? 32 LEU A HD11 5  
ATOM 5565  H HD12 . LEU A 1 32 ? -5.808  -3.089  5.752   1.00 0.00 ? 32 LEU A HD12 5  
ATOM 5566  H HD13 . LEU A 1 32 ? -5.394  -1.393  5.508   1.00 0.00 ? 32 LEU A HD13 5  
ATOM 5567  H HD21 . LEU A 1 32 ? -2.491  -2.420  6.364   1.00 0.00 ? 32 LEU A HD21 5  
ATOM 5568  H HD22 . LEU A 1 32 ? -3.671  -3.497  5.617   1.00 0.00 ? 32 LEU A HD22 5  
ATOM 5569  H HD23 . LEU A 1 32 ? -3.013  -3.876  7.210   1.00 0.00 ? 32 LEU A HD23 5  
ATOM 5570  N N    . GLU A 1 33 ? -2.859  1.460   9.290   1.00 0.00 ? 33 GLU A N    5  
ATOM 5571  C CA   . GLU A 1 33 ? -2.222  2.770   9.362   1.00 0.00 ? 33 GLU A CA   5  
ATOM 5572  C C    . GLU A 1 33 ? -1.000  2.731   10.274  1.00 0.00 ? 33 GLU A C    5  
ATOM 5573  O O    . GLU A 1 33 ? 0.039   3.314   9.964   1.00 0.00 ? 33 GLU A O    5  
ATOM 5574  C CB   . GLU A 1 33 ? -3.216  3.818   9.866   1.00 0.00 ? 33 GLU A CB   5  
ATOM 5575  C CG   . GLU A 1 33 ? -4.408  4.019   8.945   1.00 0.00 ? 33 GLU A CG   5  
ATOM 5576  C CD   . GLU A 1 33 ? -5.417  5.004   9.504   1.00 0.00 ? 33 GLU A CD   5  
ATOM 5577  O OE1  . GLU A 1 33 ? -5.134  6.220   9.482   1.00 0.00 ? 33 GLU A OE1  5  
ATOM 5578  O OE2  . GLU A 1 33 ? -6.490  4.558   9.962   1.00 0.00 ? 33 GLU A OE2  5  
ATOM 5579  H H    . GLU A 1 33 ? -3.796  1.368   9.563   1.00 0.00 ? 33 GLU A H    5  
ATOM 5580  H HA   . GLU A 1 33 ? -1.905  3.038   8.366   1.00 0.00 ? 33 GLU A HA   5  
ATOM 5581  H HB2  . GLU A 1 33 ? -3.583  3.512   10.835  1.00 0.00 ? 33 GLU A HB2  5  
ATOM 5582  H HB3  . GLU A 1 33 ? -2.703  4.763   9.968   1.00 0.00 ? 33 GLU A HB3  5  
ATOM 5583  H HG2  . GLU A 1 33 ? -4.054  4.389   7.995   1.00 0.00 ? 33 GLU A HG2  5  
ATOM 5584  H HG3  . GLU A 1 33 ? -4.899  3.068   8.799   1.00 0.00 ? 33 GLU A HG3  5  
ATOM 5585  N N    . LYS A 1 34 ? -1.132  2.041   11.402  1.00 0.00 ? 34 LYS A N    5  
ATOM 5586  C CA   . LYS A 1 34 ? -0.040  1.925   12.361  1.00 0.00 ? 34 LYS A CA   5  
ATOM 5587  C C    . LYS A 1 34 ? 1.217   1.379   11.690  1.00 0.00 ? 34 LYS A C    5  
ATOM 5588  O O    . LYS A 1 34 ? 2.292   1.972   11.789  1.00 0.00 ? 34 LYS A O    5  
ATOM 5589  C CB   . LYS A 1 34 ? -0.447  1.015   13.522  1.00 0.00 ? 34 LYS A CB   5  
ATOM 5590  C CG   . LYS A 1 34 ? 0.416   1.185   14.760  1.00 0.00 ? 34 LYS A CG   5  
ATOM 5591  C CD   . LYS A 1 34 ? 0.068   2.459   15.511  1.00 0.00 ? 34 LYS A CD   5  
ATOM 5592  C CE   . LYS A 1 34 ? -1.177  2.280   16.366  1.00 0.00 ? 34 LYS A CE   5  
ATOM 5593  N NZ   . LYS A 1 34 ? -0.854  1.716   17.706  1.00 0.00 ? 34 LYS A NZ   5  
ATOM 5594  H H    . LYS A 1 34 ? -1.985  1.598   11.594  1.00 0.00 ? 34 LYS A H    5  
ATOM 5595  H HA   . LYS A 1 34 ? 0.171   2.912   12.744  1.00 0.00 ? 34 LYS A HA   5  
ATOM 5596  H HB2  . LYS A 1 34 ? -1.471  1.231   13.789  1.00 0.00 ? 34 LYS A HB2  5  
ATOM 5597  H HB3  . LYS A 1 34 ? -0.378  -0.013  13.198  1.00 0.00 ? 34 LYS A HB3  5  
ATOM 5598  H HG2  . LYS A 1 34 ? 0.261   0.340   15.414  1.00 0.00 ? 34 LYS A HG2  5  
ATOM 5599  H HG3  . LYS A 1 34 ? 1.454   1.226   14.461  1.00 0.00 ? 34 LYS A HG3  5  
ATOM 5600  H HD2  . LYS A 1 34 ? 0.895   2.726   16.152  1.00 0.00 ? 34 LYS A HD2  5  
ATOM 5601  H HD3  . LYS A 1 34 ? -0.107  3.252   14.797  1.00 0.00 ? 34 LYS A HD3  5  
ATOM 5602  H HE2  . LYS A 1 34 ? -1.651  3.241   16.495  1.00 0.00 ? 34 LYS A HE2  5  
ATOM 5603  H HE3  . LYS A 1 34 ? -1.854  1.610   15.857  1.00 0.00 ? 34 LYS A HE3  5  
ATOM 5604  H HZ1  . LYS A 1 34 ? -1.719  1.635   18.278  1.00 0.00 ? 34 LYS A HZ1  5  
ATOM 5605  H HZ2  . LYS A 1 34 ? -0.181  2.335   18.201  1.00 0.00 ? 34 LYS A HZ2  5  
ATOM 5606  H HZ3  . LYS A 1 34 ? -0.429  0.772   17.604  1.00 0.00 ? 34 LYS A HZ3  5  
ATOM 5607  N N    . ARG A 1 35 ? 1.074   0.248   11.008  1.00 0.00 ? 35 ARG A N    5  
ATOM 5608  C CA   . ARG A 1 35 ? 2.198   -0.377  10.321  1.00 0.00 ? 35 ARG A CA   5  
ATOM 5609  C C    . ARG A 1 35 ? 2.670   0.485   9.154   1.00 0.00 ? 35 ARG A C    5  
ATOM 5610  O O    . ARG A 1 35 ? 3.791   0.993   9.157   1.00 0.00 ? 35 ARG A O    5  
ATOM 5611  C CB   . ARG A 1 35 ? 1.806   -1.767  9.817   1.00 0.00 ? 35 ARG A CB   5  
ATOM 5612  C CG   . ARG A 1 35 ? 2.047   -2.874  10.831  1.00 0.00 ? 35 ARG A CG   5  
ATOM 5613  C CD   . ARG A 1 35 ? 1.736   -2.410  12.246  1.00 0.00 ? 35 ARG A CD   5  
ATOM 5614  N NE   . ARG A 1 35 ? 1.547   -3.533  13.161  1.00 0.00 ? 35 ARG A NE   5  
ATOM 5615  C CZ   . ARG A 1 35 ? 0.899   -3.438  14.316  1.00 0.00 ? 35 ARG A CZ   5  
ATOM 5616  N NH1  . ARG A 1 35 ? 0.379   -2.279  14.696  1.00 0.00 ? 35 ARG A NH1  5  
ATOM 5617  N NH2  . ARG A 1 35 ? 0.769   -4.505  15.095  1.00 0.00 ? 35 ARG A NH2  5  
ATOM 5618  H H    . ARG A 1 35 ? 0.192   -0.178  10.966  1.00 0.00 ? 35 ARG A H    5  
ATOM 5619  H HA   . ARG A 1 35 ? 3.007   -0.476  11.030  1.00 0.00 ? 35 ARG A HA   5  
ATOM 5620  H HB2  . ARG A 1 35 ? 0.756   -1.763  9.565   1.00 0.00 ? 35 ARG A HB2  5  
ATOM 5621  H HB3  . ARG A 1 35 ? 2.380   -1.991  8.931   1.00 0.00 ? 35 ARG A HB3  5  
ATOM 5622  H HG2  . ARG A 1 35 ? 1.412   -3.714  10.592  1.00 0.00 ? 35 ARG A HG2  5  
ATOM 5623  H HG3  . ARG A 1 35 ? 3.082   -3.176  10.781  1.00 0.00 ? 35 ARG A HG3  5  
ATOM 5624  H HD2  . ARG A 1 35 ? 2.555   -1.803  12.600  1.00 0.00 ? 35 ARG A HD2  5  
ATOM 5625  H HD3  . ARG A 1 35 ? 0.832   -1.819  12.225  1.00 0.00 ? 35 ARG A HD3  5  
ATOM 5626  H HE   . ARG A 1 35 ? 1.924   -4.399  12.900  1.00 0.00 ? 35 ARG A HE   5  
ATOM 5627  H HH11 . ARG A 1 35 ? 0.474   -1.474  14.111  1.00 0.00 ? 35 ARG A HH11 5  
ATOM 5628  H HH12 . ARG A 1 35 ? -0.110  -2.211  15.566  1.00 0.00 ? 35 ARG A HH12 5  
ATOM 5629  H HH21 . ARG A 1 35 ? 1.160   -5.381  14.812  1.00 0.00 ? 35 ARG A HH21 5  
ATOM 5630  H HH22 . ARG A 1 35 ? 0.281   -4.433  15.964  1.00 0.00 ? 35 ARG A HH22 5  
ATOM 5631  N N    . PHE A 1 36 ? 1.806   0.645   8.157   1.00 0.00 ? 36 PHE A N    5  
ATOM 5632  C CA   . PHE A 1 36 ? 2.134   1.444   6.982   1.00 0.00 ? 36 PHE A CA   5  
ATOM 5633  C C    . PHE A 1 36 ? 2.955   2.670   7.370   1.00 0.00 ? 36 PHE A C    5  
ATOM 5634  O O    . PHE A 1 36 ? 3.945   2.998   6.717   1.00 0.00 ? 36 PHE A O    5  
ATOM 5635  C CB   . PHE A 1 36 ? 0.856   1.879   6.262   1.00 0.00 ? 36 PHE A CB   5  
ATOM 5636  C CG   . PHE A 1 36 ? 1.112   2.701   5.031   1.00 0.00 ? 36 PHE A CG   5  
ATOM 5637  C CD1  . PHE A 1 36 ? 1.671   3.965   5.131   1.00 0.00 ? 36 PHE A CD1  5  
ATOM 5638  C CD2  . PHE A 1 36 ? 0.793   2.211   3.775   1.00 0.00 ? 36 PHE A CD2  5  
ATOM 5639  C CE1  . PHE A 1 36 ? 1.907   4.724   4.000   1.00 0.00 ? 36 PHE A CE1  5  
ATOM 5640  C CE2  . PHE A 1 36 ? 1.026   2.965   2.641   1.00 0.00 ? 36 PHE A CE2  5  
ATOM 5641  C CZ   . PHE A 1 36 ? 1.585   4.223   2.754   1.00 0.00 ? 36 PHE A CZ   5  
ATOM 5642  H H    . PHE A 1 36 ? 0.927   0.214   8.212   1.00 0.00 ? 36 PHE A H    5  
ATOM 5643  H HA   . PHE A 1 36 ? 2.720   0.829   6.317   1.00 0.00 ? 36 PHE A HA   5  
ATOM 5644  H HB2  . PHE A 1 36 ? 0.302   1.001   5.964   1.00 0.00 ? 36 PHE A HB2  5  
ATOM 5645  H HB3  . PHE A 1 36 ? 0.254   2.468   6.937   1.00 0.00 ? 36 PHE A HB3  5  
ATOM 5646  H HD1  . PHE A 1 36 ? 1.924   4.358   6.105   1.00 0.00 ? 36 PHE A HD1  5  
ATOM 5647  H HD2  . PHE A 1 36 ? 0.355   1.226   3.686   1.00 0.00 ? 36 PHE A HD2  5  
ATOM 5648  H HE1  . PHE A 1 36 ? 2.344   5.707   4.091   1.00 0.00 ? 36 PHE A HE1  5  
ATOM 5649  H HE2  . PHE A 1 36 ? 0.773   2.570   1.668   1.00 0.00 ? 36 PHE A HE2  5  
ATOM 5650  H HZ   . PHE A 1 36 ? 1.768   4.815   1.869   1.00 0.00 ? 36 PHE A HZ   5  
ATOM 5651  N N    . GLU A 1 37 ? 2.535   3.342   8.437   1.00 0.00 ? 37 GLU A N    5  
ATOM 5652  C CA   . GLU A 1 37 ? 3.231   4.533   8.912   1.00 0.00 ? 37 GLU A CA   5  
ATOM 5653  C C    . GLU A 1 37 ? 4.652   4.193   9.352   1.00 0.00 ? 37 GLU A C    5  
ATOM 5654  O O    . GLU A 1 37 ? 5.612   4.854   8.955   1.00 0.00 ? 37 GLU A O    5  
ATOM 5655  C CB   . GLU A 1 37 ? 2.464   5.170   10.072  1.00 0.00 ? 37 GLU A CB   5  
ATOM 5656  C CG   . GLU A 1 37 ? 1.356   6.110   9.626   1.00 0.00 ? 37 GLU A CG   5  
ATOM 5657  C CD   . GLU A 1 37 ? 1.847   7.175   8.664   1.00 0.00 ? 37 GLU A CD   5  
ATOM 5658  O OE1  . GLU A 1 37 ? 2.959   7.700   8.878   1.00 0.00 ? 37 GLU A OE1  5  
ATOM 5659  O OE2  . GLU A 1 37 ? 1.118   7.482   7.697   1.00 0.00 ? 37 GLU A OE2  5  
ATOM 5660  H H    . GLU A 1 37 ? 1.739   3.031   8.916   1.00 0.00 ? 37 GLU A H    5  
ATOM 5661  H HA   . GLU A 1 37 ? 3.279   5.236   8.094   1.00 0.00 ? 37 GLU A HA   5  
ATOM 5662  H HB2  . GLU A 1 37 ? 2.024   4.387   10.671  1.00 0.00 ? 37 GLU A HB2  5  
ATOM 5663  H HB3  . GLU A 1 37 ? 3.158   5.730   10.682  1.00 0.00 ? 37 GLU A HB3  5  
ATOM 5664  H HG2  . GLU A 1 37 ? 0.586   5.532   9.137   1.00 0.00 ? 37 GLU A HG2  5  
ATOM 5665  H HG3  . GLU A 1 37 ? 0.942   6.596   10.497  1.00 0.00 ? 37 GLU A HG3  5  
ATOM 5666  N N    . LYS A 1 38 ? 4.778   3.159   10.176  1.00 0.00 ? 38 LYS A N    5  
ATOM 5667  C CA   . LYS A 1 38 ? 6.080   2.729   10.672  1.00 0.00 ? 38 LYS A CA   5  
ATOM 5668  C C    . LYS A 1 38 ? 6.989   2.310   9.521   1.00 0.00 ? 38 LYS A C    5  
ATOM 5669  O O    . LYS A 1 38 ? 8.132   2.758   9.426   1.00 0.00 ? 38 LYS A O    5  
ATOM 5670  C CB   . LYS A 1 38 ? 5.917   1.568   11.655  1.00 0.00 ? 38 LYS A CB   5  
ATOM 5671  C CG   . LYS A 1 38 ? 5.497   2.005   13.048  1.00 0.00 ? 38 LYS A CG   5  
ATOM 5672  C CD   . LYS A 1 38 ? 6.668   2.579   13.829  1.00 0.00 ? 38 LYS A CD   5  
ATOM 5673  C CE   . LYS A 1 38 ? 6.428   2.503   15.329  1.00 0.00 ? 38 LYS A CE   5  
ATOM 5674  N NZ   . LYS A 1 38 ? 7.512   3.172   16.099  1.00 0.00 ? 38 LYS A NZ   5  
ATOM 5675  H H    . LYS A 1 38 ? 3.975   2.671   10.457  1.00 0.00 ? 38 LYS A H    5  
ATOM 5676  H HA   . LYS A 1 38 ? 6.532   3.564   11.185  1.00 0.00 ? 38 LYS A HA   5  
ATOM 5677  H HB2  . LYS A 1 38 ? 5.169   0.890   11.272  1.00 0.00 ? 38 LYS A HB2  5  
ATOM 5678  H HB3  . LYS A 1 38 ? 6.859   1.044   11.734  1.00 0.00 ? 38 LYS A HB3  5  
ATOM 5679  H HG2  . LYS A 1 38 ? 4.731   2.761   12.962  1.00 0.00 ? 38 LYS A HG2  5  
ATOM 5680  H HG3  . LYS A 1 38 ? 5.105   1.150   13.580  1.00 0.00 ? 38 LYS A HG3  5  
ATOM 5681  H HD2  . LYS A 1 38 ? 7.559   2.018   13.590  1.00 0.00 ? 38 LYS A HD2  5  
ATOM 5682  H HD3  . LYS A 1 38 ? 6.805   3.613   13.547  1.00 0.00 ? 38 LYS A HD3  5  
ATOM 5683  H HE2  . LYS A 1 38 ? 5.488   2.984   15.555  1.00 0.00 ? 38 LYS A HE2  5  
ATOM 5684  H HE3  . LYS A 1 38 ? 6.379   1.464   15.620  1.00 0.00 ? 38 LYS A HE3  5  
ATOM 5685  H HZ1  . LYS A 1 38 ? 8.435   2.764   15.845  1.00 0.00 ? 38 LYS A HZ1  5  
ATOM 5686  H HZ2  . LYS A 1 38 ? 7.358   3.044   17.119  1.00 0.00 ? 38 LYS A HZ2  5  
ATOM 5687  H HZ3  . LYS A 1 38 ? 7.526   4.190   15.887  1.00 0.00 ? 38 LYS A HZ3  5  
ATOM 5688  N N    . GLN A 1 39 ? 6.473   1.451   8.648   1.00 0.00 ? 39 GLN A N    5  
ATOM 5689  C CA   . GLN A 1 39 ? 7.240   0.973   7.503   1.00 0.00 ? 39 GLN A CA   5  
ATOM 5690  C C    . GLN A 1 39 ? 6.472   1.194   6.204   1.00 0.00 ? 39 GLN A C    5  
ATOM 5691  O O    . GLN A 1 39 ? 5.593   0.408   5.848   1.00 0.00 ? 39 GLN A O    5  
ATOM 5692  C CB   . GLN A 1 39 ? 7.571   -0.511  7.667   1.00 0.00 ? 39 GLN A CB   5  
ATOM 5693  C CG   . GLN A 1 39 ? 8.873   -0.922  6.998   1.00 0.00 ? 39 GLN A CG   5  
ATOM 5694  C CD   . GLN A 1 39 ? 9.440   -2.208  7.565   1.00 0.00 ? 39 GLN A CD   5  
ATOM 5695  O OE1  . GLN A 1 39 ? 10.119  -2.201  8.592   1.00 0.00 ? 39 GLN A OE1  5  
ATOM 5696  N NE2  . GLN A 1 39 ? 9.164   -3.322  6.897   1.00 0.00 ? 39 GLN A NE2  5  
ATOM 5697  H H    . GLN A 1 39 ? 5.557   1.130   8.777   1.00 0.00 ? 39 GLN A H    5  
ATOM 5698  H HA   . GLN A 1 39 ? 8.160   1.536   7.462   1.00 0.00 ? 39 GLN A HA   5  
ATOM 5699  H HB2  . GLN A 1 39 ? 7.646   -0.736  8.721   1.00 0.00 ? 39 GLN A HB2  5  
ATOM 5700  H HB3  . GLN A 1 39 ? 6.771   -1.096  7.238   1.00 0.00 ? 39 GLN A HB3  5  
ATOM 5701  H HG2  . GLN A 1 39 ? 8.692   -1.061  5.943   1.00 0.00 ? 39 GLN A HG2  5  
ATOM 5702  H HG3  . GLN A 1 39 ? 9.598   -0.133  7.137   1.00 0.00 ? 39 GLN A HG3  5  
ATOM 5703  H HE21 . GLN A 1 39 ? 8.618   -3.251  6.086   1.00 0.00 ? 39 GLN A HE21 5  
ATOM 5704  H HE22 . GLN A 1 39 ? 9.518   -4.168  7.240   1.00 0.00 ? 39 GLN A HE22 5  
ATOM 5705  N N    . LYS A 1 40 ? 6.808   2.268   5.498   1.00 0.00 ? 40 LYS A N    5  
ATOM 5706  C CA   . LYS A 1 40 ? 6.151   2.593   4.238   1.00 0.00 ? 40 LYS A CA   5  
ATOM 5707  C C    . LYS A 1 40 ? 5.818   1.327   3.456   1.00 0.00 ? 40 LYS A C    5  
ATOM 5708  O O    . LYS A 1 40 ? 4.828   1.279   2.725   1.00 0.00 ? 40 LYS A O    5  
ATOM 5709  C CB   . LYS A 1 40 ? 7.045   3.506   3.394   1.00 0.00 ? 40 LYS A CB   5  
ATOM 5710  C CG   . LYS A 1 40 ? 7.218   4.897   3.979   1.00 0.00 ? 40 LYS A CG   5  
ATOM 5711  C CD   . LYS A 1 40 ? 5.987   5.756   3.748   1.00 0.00 ? 40 LYS A CD   5  
ATOM 5712  C CE   . LYS A 1 40 ? 5.855   6.838   4.810   1.00 0.00 ? 40 LYS A CE   5  
ATOM 5713  N NZ   . LYS A 1 40 ? 4.433   7.209   5.050   1.00 0.00 ? 40 LYS A NZ   5  
ATOM 5714  H H    . LYS A 1 40 ? 7.516   2.858   5.834   1.00 0.00 ? 40 LYS A H    5  
ATOM 5715  H HA   . LYS A 1 40 ? 5.233   3.113   4.466   1.00 0.00 ? 40 LYS A HA   5  
ATOM 5716  H HB2  . LYS A 1 40 ? 8.020   3.051   3.304   1.00 0.00 ? 40 LYS A HB2  5  
ATOM 5717  H HB3  . LYS A 1 40 ? 6.610   3.604   2.409   1.00 0.00 ? 40 LYS A HB3  5  
ATOM 5718  H HG2  . LYS A 1 40 ? 7.391   4.811   5.042   1.00 0.00 ? 40 LYS A HG2  5  
ATOM 5719  H HG3  . LYS A 1 40 ? 8.070   5.370   3.511   1.00 0.00 ? 40 LYS A HG3  5  
ATOM 5720  H HD2  . LYS A 1 40 ? 6.063   6.227   2.779   1.00 0.00 ? 40 LYS A HD2  5  
ATOM 5721  H HD3  . LYS A 1 40 ? 5.109   5.127   3.777   1.00 0.00 ? 40 LYS A HD3  5  
ATOM 5722  H HE2  . LYS A 1 40 ? 6.284   6.474   5.731   1.00 0.00 ? 40 LYS A HE2  5  
ATOM 5723  H HE3  . LYS A 1 40 ? 6.397   7.713   4.482   1.00 0.00 ? 40 LYS A HE3  5  
ATOM 5724  H HZ1  . LYS A 1 40 ? 4.374   7.933   5.795   1.00 0.00 ? 40 LYS A HZ1  5  
ATOM 5725  H HZ2  . LYS A 1 40 ? 3.892   6.373   5.352   1.00 0.00 ? 40 LYS A HZ2  5  
ATOM 5726  H HZ3  . LYS A 1 40 ? 4.010   7.587   4.179   1.00 0.00 ? 40 LYS A HZ3  5  
ATOM 5727  N N    . TYR A 1 41 ? 6.648   0.302   3.616   1.00 0.00 ? 41 TYR A N    5  
ATOM 5728  C CA   . TYR A 1 41 ? 6.441   -0.965  2.924   1.00 0.00 ? 41 TYR A CA   5  
ATOM 5729  C C    . TYR A 1 41 ? 6.569   -2.139  3.889   1.00 0.00 ? 41 TYR A C    5  
ATOM 5730  O O    . TYR A 1 41 ? 6.790   -1.954  5.087   1.00 0.00 ? 41 TYR A O    5  
ATOM 5731  C CB   . TYR A 1 41 ? 7.448   -1.116  1.783   1.00 0.00 ? 41 TYR A CB   5  
ATOM 5732  C CG   . TYR A 1 41 ? 7.338   -0.036  0.731   1.00 0.00 ? 41 TYR A CG   5  
ATOM 5733  C CD1  . TYR A 1 41 ? 7.773   1.258   0.988   1.00 0.00 ? 41 TYR A CD1  5  
ATOM 5734  C CD2  . TYR A 1 41 ? 6.799   -0.309  -0.521  1.00 0.00 ? 41 TYR A CD2  5  
ATOM 5735  C CE1  . TYR A 1 41 ? 7.674   2.249   0.030   1.00 0.00 ? 41 TYR A CE1  5  
ATOM 5736  C CE2  . TYR A 1 41 ? 6.697   0.675   -1.485  1.00 0.00 ? 41 TYR A CE2  5  
ATOM 5737  C CZ   . TYR A 1 41 ? 7.135   1.952   -1.205  1.00 0.00 ? 41 TYR A CZ   5  
ATOM 5738  O OH   . TYR A 1 41 ? 7.036   2.936   -2.162  1.00 0.00 ? 41 TYR A OH   5  
ATOM 5739  H H    . TYR A 1 41 ? 7.420   0.400   4.212   1.00 0.00 ? 41 TYR A H    5  
ATOM 5740  H HA   . TYR A 1 41 ? 5.443   -0.958  2.512   1.00 0.00 ? 41 TYR A HA   5  
ATOM 5741  H HB2  . TYR A 1 41 ? 8.448   -1.084  2.186   1.00 0.00 ? 41 TYR A HB2  5  
ATOM 5742  H HB3  . TYR A 1 41 ? 7.291   -2.069  1.298   1.00 0.00 ? 41 TYR A HB3  5  
ATOM 5743  H HD1  . TYR A 1 41 ? 8.195   1.487   1.956   1.00 0.00 ? 41 TYR A HD1  5  
ATOM 5744  H HD2  . TYR A 1 41 ? 6.457   -1.311  -0.737  1.00 0.00 ? 41 TYR A HD2  5  
ATOM 5745  H HE1  . TYR A 1 41 ? 8.017   3.249   0.249   1.00 0.00 ? 41 TYR A HE1  5  
ATOM 5746  H HE2  . TYR A 1 41 ? 6.275   0.443   -2.452  1.00 0.00 ? 41 TYR A HE2  5  
ATOM 5747  H HH   . TYR A 1 41 ? 6.308   2.733   -2.755  1.00 0.00 ? 41 TYR A HH   5  
ATOM 5748  N N    . LEU A 1 42 ? 6.429   -3.349  3.359   1.00 0.00 ? 42 LEU A N    5  
ATOM 5749  C CA   . LEU A 1 42 ? 6.530   -4.557  4.172   1.00 0.00 ? 42 LEU A CA   5  
ATOM 5750  C C    . LEU A 1 42 ? 7.174   -5.692  3.383   1.00 0.00 ? 42 LEU A C    5  
ATOM 5751  O O    . LEU A 1 42 ? 6.928   -5.848  2.187   1.00 0.00 ? 42 LEU A O    5  
ATOM 5752  C CB   . LEU A 1 42 ? 5.144   -4.982  4.661   1.00 0.00 ? 42 LEU A CB   5  
ATOM 5753  C CG   . LEU A 1 42 ? 4.481   -4.059  5.684   1.00 0.00 ? 42 LEU A CG   5  
ATOM 5754  C CD1  . LEU A 1 42 ? 2.987   -4.333  5.760   1.00 0.00 ? 42 LEU A CD1  5  
ATOM 5755  C CD2  . LEU A 1 42 ? 5.126   -4.227  7.052   1.00 0.00 ? 42 LEU A CD2  5  
ATOM 5756  H H    . LEU A 1 42 ? 6.255   -3.434  2.399   1.00 0.00 ? 42 LEU A H    5  
ATOM 5757  H HA   . LEU A 1 42 ? 7.150   -4.331  5.026   1.00 0.00 ? 42 LEU A HA   5  
ATOM 5758  H HB2  . LEU A 1 42 ? 4.495   -5.044  3.802   1.00 0.00 ? 42 LEU A HB2  5  
ATOM 5759  H HB3  . LEU A 1 42 ? 5.239   -5.961  5.110   1.00 0.00 ? 42 LEU A HB3  5  
ATOM 5760  H HG   . LEU A 1 42 ? 4.616   -3.032  5.373   1.00 0.00 ? 42 LEU A HG   5  
ATOM 5761  H HD11 . LEU A 1 42 ? 2.460   -3.634  5.128   1.00 0.00 ? 42 LEU A HD11 5  
ATOM 5762  H HD12 . LEU A 1 42 ? 2.651   -4.220  6.780   1.00 0.00 ? 42 LEU A HD12 5  
ATOM 5763  H HD13 . LEU A 1 42 ? 2.788   -5.341  5.426   1.00 0.00 ? 42 LEU A HD13 5  
ATOM 5764  H HD21 . LEU A 1 42 ? 4.866   -3.386  7.677   1.00 0.00 ? 42 LEU A HD21 5  
ATOM 5765  H HD22 . LEU A 1 42 ? 6.199   -4.274  6.940   1.00 0.00 ? 42 LEU A HD22 5  
ATOM 5766  H HD23 . LEU A 1 42 ? 4.771   -5.139  7.507   1.00 0.00 ? 42 LEU A HD23 5  
ATOM 5767  N N    . SER A 1 43 ? 7.998   -6.484  4.061   1.00 0.00 ? 43 SER A N    5  
ATOM 5768  C CA   . SER A 1 43 ? 8.678   -7.605  3.423   1.00 0.00 ? 43 SER A CA   5  
ATOM 5769  C C    . SER A 1 43 ? 7.687   -8.705  3.055   1.00 0.00 ? 43 SER A C    5  
ATOM 5770  O O    . SER A 1 43 ? 6.477   -8.551  3.228   1.00 0.00 ? 43 SER A O    5  
ATOM 5771  C CB   . SER A 1 43 ? 9.759   -8.167  4.349   1.00 0.00 ? 43 SER A CB   5  
ATOM 5772  O OG   . SER A 1 43 ? 10.580  -7.132  4.861   1.00 0.00 ? 43 SER A OG   5  
ATOM 5773  H H    . SER A 1 43 ? 8.153   -6.309  5.013   1.00 0.00 ? 43 SER A H    5  
ATOM 5774  H HA   . SER A 1 43 ? 9.144   -7.240  2.521   1.00 0.00 ? 43 SER A HA   5  
ATOM 5775  H HB2  . SER A 1 43 ? 9.291   -8.680  5.175   1.00 0.00 ? 43 SER A HB2  5  
ATOM 5776  H HB3  . SER A 1 43 ? 10.376  -8.861  3.798   1.00 0.00 ? 43 SER A HB3  5  
ATOM 5777  H HG   . SER A 1 43 ? 11.169  -6.819  4.171   1.00 0.00 ? 43 SER A HG   5  
ATOM 5778  N N    . THR A 1 44 ? 8.208   -9.816  2.545   1.00 0.00 ? 44 THR A N    5  
ATOM 5779  C CA   . THR A 1 44 ? 7.371   -10.942 2.151   1.00 0.00 ? 44 THR A CA   5  
ATOM 5780  C C    . THR A 1 44 ? 6.638   -11.530 3.351   1.00 0.00 ? 44 THR A C    5  
ATOM 5781  O O    . THR A 1 44 ? 5.409   -11.581 3.395   1.00 0.00 ? 44 THR A O    5  
ATOM 5782  C CB   . THR A 1 44 ? 8.201   -12.051 1.476   1.00 0.00 ? 44 THR A CB   5  
ATOM 5783  O OG1  . THR A 1 44 ? 8.228   -11.848 0.059   1.00 0.00 ? 44 THR A OG1  5  
ATOM 5784  C CG2  . THR A 1 44 ? 7.623   -13.423 1.786   1.00 0.00 ? 44 THR A CG2  5  
ATOM 5785  H H    . THR A 1 44 ? 9.179   -9.879  2.431   1.00 0.00 ? 44 THR A H    5  
ATOM 5786  H HA   . THR A 1 44 ? 6.642   -10.582 1.438   1.00 0.00 ? 44 THR A HA   5  
ATOM 5787  H HB   . THR A 1 44 ? 9.210   -12.006 1.859   1.00 0.00 ? 44 THR A HB   5  
ATOM 5788  H HG1  . THR A 1 44 ? 8.150   -10.911 -0.132  1.00 0.00 ? 44 THR A HG1  5  
ATOM 5789  H HG21 . THR A 1 44 ? 6.575   -13.440 1.528   1.00 0.00 ? 44 THR A HG21 5  
ATOM 5790  H HG22 . THR A 1 44 ? 7.738   -13.633 2.839   1.00 0.00 ? 44 THR A HG22 5  
ATOM 5791  H HG23 . THR A 1 44 ? 8.147   -14.172 1.211   1.00 0.00 ? 44 THR A HG23 5  
ATOM 5792  N N    . PRO A 1 45 ? 7.409   -11.985 4.351   1.00 0.00 ? 45 PRO A N    5  
ATOM 5793  C CA   . PRO A 1 45 ? 6.854   -12.577 5.572   1.00 0.00 ? 45 PRO A CA   5  
ATOM 5794  C C    . PRO A 1 45 ? 6.154   -11.545 6.450   1.00 0.00 ? 45 PRO A C    5  
ATOM 5795  O O    . PRO A 1 45 ? 5.066   -11.793 6.968   1.00 0.00 ? 45 PRO A O    5  
ATOM 5796  C CB   . PRO A 1 45 ? 8.087   -13.138 6.285   1.00 0.00 ? 45 PRO A CB   5  
ATOM 5797  C CG   . PRO A 1 45 ? 9.222   -12.313 5.786   1.00 0.00 ? 45 PRO A CG   5  
ATOM 5798  C CD   . PRO A 1 45 ? 8.881   -11.956 4.366   1.00 0.00 ? 45 PRO A CD   5  
ATOM 5799  H HA   . PRO A 1 45 ? 6.169   -13.381 5.347   1.00 0.00 ? 45 PRO A HA   5  
ATOM 5800  H HB2  . PRO A 1 45 ? 7.964   -13.037 7.354   1.00 0.00 ? 45 PRO A HB2  5  
ATOM 5801  H HB3  . PRO A 1 45 ? 8.212   -14.179 6.028   1.00 0.00 ? 45 PRO A HB3  5  
ATOM 5802  H HG2  . PRO A 1 45 ? 9.319   -11.421 6.385   1.00 0.00 ? 45 PRO A HG2  5  
ATOM 5803  H HG3  . PRO A 1 45 ? 10.135  -12.889 5.818   1.00 0.00 ? 45 PRO A HG3  5  
ATOM 5804  H HD2  . PRO A 1 45 ? 9.250   -10.969 4.126   1.00 0.00 ? 45 PRO A HD2  5  
ATOM 5805  H HD3  . PRO A 1 45 ? 9.288   -12.688 3.684   1.00 0.00 ? 45 PRO A HD3  5  
ATOM 5806  N N    . ASP A 1 46 ? 6.785   -10.387 6.612   1.00 0.00 ? 46 ASP A N    5  
ATOM 5807  C CA   . ASP A 1 46 ? 6.222   -9.317  7.426   1.00 0.00 ? 46 ASP A CA   5  
ATOM 5808  C C    . ASP A 1 46 ? 4.747   -9.105  7.101   1.00 0.00 ? 46 ASP A C    5  
ATOM 5809  O O    . ASP A 1 46 ? 3.884   -9.243  7.968   1.00 0.00 ? 46 ASP A O    5  
ATOM 5810  C CB   . ASP A 1 46 ? 6.997   -8.017  7.205   1.00 0.00 ? 46 ASP A CB   5  
ATOM 5811  C CG   . ASP A 1 46 ? 8.242   -7.932  8.066   1.00 0.00 ? 46 ASP A CG   5  
ATOM 5812  O OD1  . ASP A 1 46 ? 9.120   -8.809  7.927   1.00 0.00 ? 46 ASP A OD1  5  
ATOM 5813  O OD2  . ASP A 1 46 ? 8.339   -6.989  8.879   1.00 0.00 ? 46 ASP A OD2  5  
ATOM 5814  H H    . ASP A 1 46 ? 7.651   -10.249 6.172   1.00 0.00 ? 46 ASP A H    5  
ATOM 5815  H HA   . ASP A 1 46 ? 6.311   -9.606  8.462   1.00 0.00 ? 46 ASP A HA   5  
ATOM 5816  H HB2  . ASP A 1 46 ? 7.294   -7.954  6.168   1.00 0.00 ? 46 ASP A HB2  5  
ATOM 5817  H HB3  . ASP A 1 46 ? 6.358   -7.180  7.443   1.00 0.00 ? 46 ASP A HB3  5  
ATOM 5818  N N    . ARG A 1 47 ? 4.465   -8.769  5.846   1.00 0.00 ? 47 ARG A N    5  
ATOM 5819  C CA   . ARG A 1 47 ? 3.095   -8.536  5.407   1.00 0.00 ? 47 ARG A CA   5  
ATOM 5820  C C    . ARG A 1 47 ? 2.170   -9.647  5.897   1.00 0.00 ? 47 ARG A C    5  
ATOM 5821  O O    . ARG A 1 47 ? 1.051   -9.387  6.339   1.00 0.00 ? 47 ARG A O    5  
ATOM 5822  C CB   . ARG A 1 47 ? 3.034   -8.444  3.881   1.00 0.00 ? 47 ARG A CB   5  
ATOM 5823  C CG   . ARG A 1 47 ? 1.633   -8.212  3.340   1.00 0.00 ? 47 ARG A CG   5  
ATOM 5824  C CD   . ARG A 1 47 ? 1.628   -8.136  1.821   1.00 0.00 ? 47 ARG A CD   5  
ATOM 5825  N NE   . ARG A 1 47 ? 1.905   -9.432  1.208   1.00 0.00 ? 47 ARG A NE   5  
ATOM 5826  C CZ   . ARG A 1 47 ? 2.305   -9.578  -0.051  1.00 0.00 ? 47 ARG A CZ   5  
ATOM 5827  N NH1  . ARG A 1 47 ? 2.474   -8.515  -0.824  1.00 0.00 ? 47 ARG A NH1  5  
ATOM 5828  N NH2  . ARG A 1 47 ? 2.537   -10.791 -0.537  1.00 0.00 ? 47 ARG A NH2  5  
ATOM 5829  H H    . ARG A 1 47 ? 5.196   -8.675  5.200   1.00 0.00 ? 47 ARG A H    5  
ATOM 5830  H HA   . ARG A 1 47 ? 2.766   -7.598  5.829   1.00 0.00 ? 47 ARG A HA   5  
ATOM 5831  H HB2  . ARG A 1 47 ? 3.662   -7.627  3.556   1.00 0.00 ? 47 ARG A HB2  5  
ATOM 5832  H HB3  . ARG A 1 47 ? 3.410   -9.365  3.462   1.00 0.00 ? 47 ARG A HB3  5  
ATOM 5833  H HG2  . ARG A 1 47 ? 0.997   -9.028  3.651   1.00 0.00 ? 47 ARG A HG2  5  
ATOM 5834  H HG3  . ARG A 1 47 ? 1.252   -7.284  3.740   1.00 0.00 ? 47 ARG A HG3  5  
ATOM 5835  H HD2  . ARG A 1 47 ? 0.657   -7.794  1.494   1.00 0.00 ? 47 ARG A HD2  5  
ATOM 5836  H HD3  . ARG A 1 47 ? 2.382   -7.430  1.507   1.00 0.00 ? 47 ARG A HD3  5  
ATOM 5837  H HE   . ARG A 1 47 ? 1.786   -10.231 1.761   1.00 0.00 ? 47 ARG A HE   5  
ATOM 5838  H HH11 . ARG A 1 47 ? 2.301   -7.600  -0.460  1.00 0.00 ? 47 ARG A HH11 5  
ATOM 5839  H HH12 . ARG A 1 47 ? 2.777   -8.628  -1.771  1.00 0.00 ? 47 ARG A HH12 5  
ATOM 5840  H HH21 . ARG A 1 47 ? 2.411   -11.595 0.043   1.00 0.00 ? 47 ARG A HH21 5  
ATOM 5841  H HH22 . ARG A 1 47 ? 2.838   -10.900 -1.484  1.00 0.00 ? 47 ARG A HH22 5  
ATOM 5842  N N    . ILE A 1 48 ? 2.647   -10.885 5.815   1.00 0.00 ? 48 ILE A N    5  
ATOM 5843  C CA   . ILE A 1 48 ? 1.863   -12.035 6.250   1.00 0.00 ? 48 ILE A CA   5  
ATOM 5844  C C    . ILE A 1 48 ? 1.568   -11.964 7.745   1.00 0.00 ? 48 ILE A C    5  
ATOM 5845  O O    . ILE A 1 48 ? 0.409   -11.978 8.160   1.00 0.00 ? 48 ILE A O    5  
ATOM 5846  C CB   . ILE A 1 48 ? 2.588   -13.358 5.943   1.00 0.00 ? 48 ILE A CB   5  
ATOM 5847  C CG1  . ILE A 1 48 ? 2.977   -13.421 4.465   1.00 0.00 ? 48 ILE A CG1  5  
ATOM 5848  C CG2  . ILE A 1 48 ? 1.709   -14.543 6.317   1.00 0.00 ? 48 ILE A CG2  5  
ATOM 5849  C CD1  . ILE A 1 48 ? 3.955   -14.530 4.144   1.00 0.00 ? 48 ILE A CD1  5  
ATOM 5850  H H    . ILE A 1 48 ? 3.546   -11.028 5.454   1.00 0.00 ? 48 ILE A H    5  
ATOM 5851  H HA   . ILE A 1 48 ? 0.929   -12.025 5.708   1.00 0.00 ? 48 ILE A HA   5  
ATOM 5852  H HB   . ILE A 1 48 ? 3.483   -13.401 6.546   1.00 0.00 ? 48 ILE A HB   5  
ATOM 5853  H HG12 . ILE A 1 48 ? 2.090   -13.581 3.872   1.00 0.00 ? 48 ILE A HG12 5  
ATOM 5854  H HG13 . ILE A 1 48 ? 3.431   -12.484 4.180   1.00 0.00 ? 48 ILE A HG13 5  
ATOM 5855  H HG21 . ILE A 1 48 ? 1.060   -14.265 7.134   1.00 0.00 ? 48 ILE A HG21 5  
ATOM 5856  H HG22 . ILE A 1 48 ? 1.110   -14.828 5.465   1.00 0.00 ? 48 ILE A HG22 5  
ATOM 5857  H HG23 . ILE A 1 48 ? 2.331   -15.373 6.615   1.00 0.00 ? 48 ILE A HG23 5  
ATOM 5858  H HD11 . ILE A 1 48 ? 4.899   -14.101 3.840   1.00 0.00 ? 48 ILE A HD11 5  
ATOM 5859  H HD12 . ILE A 1 48 ? 4.103   -15.145 5.019   1.00 0.00 ? 48 ILE A HD12 5  
ATOM 5860  H HD13 . ILE A 1 48 ? 3.562   -15.136 3.340   1.00 0.00 ? 48 ILE A HD13 5  
ATOM 5861  N N    . ASP A 1 49 ? 2.623   -11.888 8.548   1.00 0.00 ? 49 ASP A N    5  
ATOM 5862  C CA   . ASP A 1 49 ? 2.478   -11.812 9.997   1.00 0.00 ? 49 ASP A CA   5  
ATOM 5863  C C    . ASP A 1 49 ? 1.383   -10.821 10.382  1.00 0.00 ? 49 ASP A C    5  
ATOM 5864  O O    . ASP A 1 49 ? 0.513   -11.128 11.197  1.00 0.00 ? 49 ASP A O    5  
ATOM 5865  C CB   . ASP A 1 49 ? 3.803   -11.404 10.643  1.00 0.00 ? 49 ASP A CB   5  
ATOM 5866  C CG   . ASP A 1 49 ? 3.854   -11.743 12.120  1.00 0.00 ? 49 ASP A CG   5  
ATOM 5867  O OD1  . ASP A 1 49 ? 3.179   -12.709 12.531  1.00 0.00 ? 49 ASP A OD1  5  
ATOM 5868  O OD2  . ASP A 1 49 ? 4.570   -11.040 12.865  1.00 0.00 ? 49 ASP A OD2  5  
ATOM 5869  H H    . ASP A 1 49 ? 3.522   -11.881 8.156   1.00 0.00 ? 49 ASP A H    5  
ATOM 5870  H HA   . ASP A 1 49 ? 2.200   -12.792 10.354  1.00 0.00 ? 49 ASP A HA   5  
ATOM 5871  H HB2  . ASP A 1 49 ? 4.612   -11.920 10.147  1.00 0.00 ? 49 ASP A HB2  5  
ATOM 5872  H HB3  . ASP A 1 49 ? 3.937   -10.339 10.531  1.00 0.00 ? 49 ASP A HB3  5  
ATOM 5873  N N    . LEU A 1 50 ? 1.434   -9.633  9.791   1.00 0.00 ? 50 LEU A N    5  
ATOM 5874  C CA   . LEU A 1 50 ? 0.448   -8.596  10.073  1.00 0.00 ? 50 LEU A CA   5  
ATOM 5875  C C    . LEU A 1 50 ? -0.944  -9.033  9.628   1.00 0.00 ? 50 LEU A C    5  
ATOM 5876  O O    . LEU A 1 50 ? -1.862  -9.138  10.441  1.00 0.00 ? 50 LEU A O    5  
ATOM 5877  C CB   . LEU A 1 50 ? 0.834   -7.293  9.371   1.00 0.00 ? 50 LEU A CB   5  
ATOM 5878  C CG   . LEU A 1 50 ? -0.290  -6.272  9.186   1.00 0.00 ? 50 LEU A CG   5  
ATOM 5879  C CD1  . LEU A 1 50 ? -0.733  -5.716  10.530  1.00 0.00 ? 50 LEU A CD1  5  
ATOM 5880  C CD2  . LEU A 1 50 ? 0.158   -5.147  8.263   1.00 0.00 ? 50 LEU A CD2  5  
ATOM 5881  H H    . LEU A 1 50 ? 2.151   -9.447  9.150   1.00 0.00 ? 50 LEU A H    5  
ATOM 5882  H HA   . LEU A 1 50 ? 0.436   -8.431  11.140  1.00 0.00 ? 50 LEU A HA   5  
ATOM 5883  H HB2  . LEU A 1 50 ? 1.614   -6.824  9.950   1.00 0.00 ? 50 LEU A HB2  5  
ATOM 5884  H HB3  . LEU A 1 50 ? 1.217   -7.546  8.392   1.00 0.00 ? 50 LEU A HB3  5  
ATOM 5885  H HG   . LEU A 1 50 ? -1.140  -6.760  8.730   1.00 0.00 ? 50 LEU A HG   5  
ATOM 5886  H HD11 . LEU A 1 50 ? -1.015  -6.530  11.181  1.00 0.00 ? 50 LEU A HD11 5  
ATOM 5887  H HD12 . LEU A 1 50 ? -1.578  -5.059  10.387  1.00 0.00 ? 50 LEU A HD12 5  
ATOM 5888  H HD13 . LEU A 1 50 ? 0.081   -5.163  10.977  1.00 0.00 ? 50 LEU A HD13 5  
ATOM 5889  H HD21 . LEU A 1 50 ? 0.369   -4.265  8.849   1.00 0.00 ? 50 LEU A HD21 5  
ATOM 5890  H HD22 . LEU A 1 50 ? -0.627  -4.930  7.554   1.00 0.00 ? 50 LEU A HD22 5  
ATOM 5891  H HD23 . LEU A 1 50 ? 1.049   -5.450  7.733   1.00 0.00 ? 50 LEU A HD23 5  
ATOM 5892  N N    . ALA A 1 51 ? -1.093  -9.289  8.332   1.00 0.00 ? 51 ALA A N    5  
ATOM 5893  C CA   . ALA A 1 51 ? -2.371  -9.719  7.780   1.00 0.00 ? 51 ALA A CA   5  
ATOM 5894  C C    . ALA A 1 51 ? -3.031  -10.765 8.673   1.00 0.00 ? 51 ALA A C    5  
ATOM 5895  O O    . ALA A 1 51 ? -4.256  -10.861 8.729   1.00 0.00 ? 51 ALA A O    5  
ATOM 5896  C CB   . ALA A 1 51 ? -2.181  -10.268 6.374   1.00 0.00 ? 51 ALA A CB   5  
ATOM 5897  H H    . ALA A 1 51 ? -0.324  -9.187  7.734   1.00 0.00 ? 51 ALA A H    5  
ATOM 5898  H HA   . ALA A 1 51 ? -3.016  -8.854  7.719   1.00 0.00 ? 51 ALA A HA   5  
ATOM 5899  H HB1  . ALA A 1 51 ? -2.931  -9.847  5.720   1.00 0.00 ? 51 ALA A HB1  5  
ATOM 5900  H HB2  . ALA A 1 51 ? -1.199  -10.001 6.014   1.00 0.00 ? 51 ALA A HB2  5  
ATOM 5901  H HB3  . ALA A 1 51 ? -2.280  -11.342 6.391   1.00 0.00 ? 51 ALA A HB3  5  
ATOM 5902  N N    . GLU A 1 52 ? -2.210  -11.545 9.369   1.00 0.00 ? 52 GLU A N    5  
ATOM 5903  C CA   . GLU A 1 52 ? -2.715  -12.585 10.257  1.00 0.00 ? 52 GLU A CA   5  
ATOM 5904  C C    . GLU A 1 52 ? -3.205  -11.985 11.572  1.00 0.00 ? 52 GLU A C    5  
ATOM 5905  O O    . GLU A 1 52 ? -4.179  -12.458 12.158  1.00 0.00 ? 52 GLU A O    5  
ATOM 5906  C CB   . GLU A 1 52 ? -1.627  -13.625 10.532  1.00 0.00 ? 52 GLU A CB   5  
ATOM 5907  C CG   . GLU A 1 52 ? -1.599  -14.758 9.520   1.00 0.00 ? 52 GLU A CG   5  
ATOM 5908  C CD   . GLU A 1 52 ? -2.879  -15.570 9.516   1.00 0.00 ? 52 GLU A CD   5  
ATOM 5909  O OE1  . GLU A 1 52 ? -3.254  -16.091 10.588  1.00 0.00 ? 52 GLU A OE1  5  
ATOM 5910  O OE2  . GLU A 1 52 ? -3.507  -15.684 8.443   1.00 0.00 ? 52 GLU A OE2  5  
ATOM 5911  H H    . GLU A 1 52 ? -1.242  -11.420 9.281   1.00 0.00 ? 52 GLU A H    5  
ATOM 5912  H HA   . GLU A 1 52 ? -3.545  -13.068 9.765   1.00 0.00 ? 52 GLU A HA   5  
ATOM 5913  H HB2  . GLU A 1 52 ? -0.665  -13.134 10.521  1.00 0.00 ? 52 GLU A HB2  5  
ATOM 5914  H HB3  . GLU A 1 52 ? -1.792  -14.050 11.511  1.00 0.00 ? 52 GLU A HB3  5  
ATOM 5915  H HG2  . GLU A 1 52 ? -1.453  -14.340 8.535   1.00 0.00 ? 52 GLU A HG2  5  
ATOM 5916  H HG3  . GLU A 1 52 ? -0.774  -15.414 9.757   1.00 0.00 ? 52 GLU A HG3  5  
ATOM 5917  N N    . SER A 1 53 ? -2.522  -10.942 12.031  1.00 0.00 ? 53 SER A N    5  
ATOM 5918  C CA   . SER A 1 53 ? -2.883  -10.280 13.279  1.00 0.00 ? 53 SER A CA   5  
ATOM 5919  C C    . SER A 1 53 ? -4.217  -9.551  13.140  1.00 0.00 ? 53 SER A C    5  
ATOM 5920  O O    . SER A 1 53 ? -5.061  -9.601  14.036  1.00 0.00 ? 53 SER A O    5  
ATOM 5921  C CB   . SER A 1 53 ? -1.790  -9.293  13.693  1.00 0.00 ? 53 SER A CB   5  
ATOM 5922  O OG   . SER A 1 53 ? -2.013  -8.806  15.005  1.00 0.00 ? 53 SER A OG   5  
ATOM 5923  H H    . SER A 1 53 ? -1.754  -10.611 11.519  1.00 0.00 ? 53 SER A H    5  
ATOM 5924  H HA   . SER A 1 53 ? -2.979  -11.039 14.041  1.00 0.00 ? 53 SER A HA   5  
ATOM 5925  H HB2  . SER A 1 53 ? -0.832  -9.789  13.664  1.00 0.00 ? 53 SER A HB2  5  
ATOM 5926  H HB3  . SER A 1 53 ? -1.785  -8.458  13.008  1.00 0.00 ? 53 SER A HB3  5  
ATOM 5927  H HG   . SER A 1 53 ? -2.351  -9.515  15.557  1.00 0.00 ? 53 SER A HG   5  
ATOM 5928  N N    . LEU A 1 54 ? -4.399  -8.874  12.012  1.00 0.00 ? 54 LEU A N    5  
ATOM 5929  C CA   . LEU A 1 54 ? -5.629  -8.133  11.754  1.00 0.00 ? 54 LEU A CA   5  
ATOM 5930  C C    . LEU A 1 54 ? -6.668  -9.022  11.078  1.00 0.00 ? 54 LEU A C    5  
ATOM 5931  O O    . LEU A 1 54 ? -7.870  -8.788  11.194  1.00 0.00 ? 54 LEU A O    5  
ATOM 5932  C CB   . LEU A 1 54 ? -5.338  -6.912  10.880  1.00 0.00 ? 54 LEU A CB   5  
ATOM 5933  C CG   . LEU A 1 54 ? -4.467  -5.826  11.512  1.00 0.00 ? 54 LEU A CG   5  
ATOM 5934  C CD1  . LEU A 1 54 ? -4.173  -4.725  10.505  1.00 0.00 ? 54 LEU A CD1  5  
ATOM 5935  C CD2  . LEU A 1 54 ? -5.142  -5.253  12.749  1.00 0.00 ? 54 LEU A CD2  5  
ATOM 5936  H H    . LEU A 1 54 ? -3.690  -8.871  11.336  1.00 0.00 ? 54 LEU A H    5  
ATOM 5937  H HA   . LEU A 1 54 ? -6.021  -7.801  12.704  1.00 0.00 ? 54 LEU A HA   5  
ATOM 5938  H HB2  . LEU A 1 54 ? -4.841  -7.256  9.986   1.00 0.00 ? 54 LEU A HB2  5  
ATOM 5939  H HB3  . LEU A 1 54 ? -6.286  -6.465  10.613  1.00 0.00 ? 54 LEU A HB3  5  
ATOM 5940  H HG   . LEU A 1 54 ? -3.524  -6.260  11.815  1.00 0.00 ? 54 LEU A HG   5  
ATOM 5941  H HD11 . LEU A 1 54 ? -3.356  -4.118  10.863  1.00 0.00 ? 54 LEU A HD11 5  
ATOM 5942  H HD12 . LEU A 1 54 ? -5.051  -4.108  10.379  1.00 0.00 ? 54 LEU A HD12 5  
ATOM 5943  H HD13 . LEU A 1 54 ? -3.906  -5.166  9.556   1.00 0.00 ? 54 LEU A HD13 5  
ATOM 5944  H HD21 . LEU A 1 54 ? -4.963  -5.906  13.591  1.00 0.00 ? 54 LEU A HD21 5  
ATOM 5945  H HD22 . LEU A 1 54 ? -6.206  -5.175  12.575  1.00 0.00 ? 54 LEU A HD22 5  
ATOM 5946  H HD23 . LEU A 1 54 ? -4.738  -4.274  12.960  1.00 0.00 ? 54 LEU A HD23 5  
ATOM 5947  N N    . GLY A 1 55 ? -6.195  -10.044 10.372  1.00 0.00 ? 55 GLY A N    5  
ATOM 5948  C CA   . GLY A 1 55 ? -7.096  -10.954 9.689   1.00 0.00 ? 55 GLY A CA   5  
ATOM 5949  C C    . GLY A 1 55 ? -7.417  -10.502 8.278   1.00 0.00 ? 55 GLY A C    5  
ATOM 5950  O O    . GLY A 1 55 ? -8.514  -10.748 7.774   1.00 0.00 ? 55 GLY A O    5  
ATOM 5951  H H    . GLY A 1 55 ? -5.226  -10.182 10.314  1.00 0.00 ? 55 GLY A H    5  
ATOM 5952  H HA2  . GLY A 1 55 ? -6.639  -11.932 9.647   1.00 0.00 ? 55 GLY A HA2  5  
ATOM 5953  H HA3  . GLY A 1 55 ? -8.016  -11.021 10.251  1.00 0.00 ? 55 GLY A HA3  5  
ATOM 5954  N N    . LEU A 1 56 ? -6.461  -9.837  7.639   1.00 0.00 ? 56 LEU A N    5  
ATOM 5955  C CA   . LEU A 1 56 ? -6.648  -9.347  6.278   1.00 0.00 ? 56 LEU A CA   5  
ATOM 5956  C C    . LEU A 1 56 ? -5.916  -10.233 5.275   1.00 0.00 ? 56 LEU A C    5  
ATOM 5957  O O    . LEU A 1 56 ? -5.218  -11.173 5.656   1.00 0.00 ? 56 LEU A O    5  
ATOM 5958  C CB   . LEU A 1 56 ? -6.150  -7.905  6.161   1.00 0.00 ? 56 LEU A CB   5  
ATOM 5959  C CG   . LEU A 1 56 ? -6.960  -6.852  6.918   1.00 0.00 ? 56 LEU A CG   5  
ATOM 5960  C CD1  . LEU A 1 56 ? -6.198  -5.537  6.981   1.00 0.00 ? 56 LEU A CD1  5  
ATOM 5961  C CD2  . LEU A 1 56 ? -8.319  -6.652  6.263   1.00 0.00 ? 56 LEU A CD2  5  
ATOM 5962  H H    . LEU A 1 56 ? -5.609  -9.671  8.093   1.00 0.00 ? 56 LEU A H    5  
ATOM 5963  H HA   . LEU A 1 56 ? -7.705  -9.373  6.059   1.00 0.00 ? 56 LEU A HA   5  
ATOM 5964  H HB2  . LEU A 1 56 ? -5.138  -7.874  6.533   1.00 0.00 ? 56 LEU A HB2  5  
ATOM 5965  H HB3  . LEU A 1 56 ? -6.155  -7.639  5.114   1.00 0.00 ? 56 LEU A HB3  5  
ATOM 5966  H HG   . LEU A 1 56 ? -7.123  -7.192  7.931   1.00 0.00 ? 56 LEU A HG   5  
ATOM 5967  H HD11 . LEU A 1 56 ? -6.771  -4.765  6.490   1.00 0.00 ? 56 LEU A HD11 5  
ATOM 5968  H HD12 . LEU A 1 56 ? -5.245  -5.649  6.486   1.00 0.00 ? 56 LEU A HD12 5  
ATOM 5969  H HD13 . LEU A 1 56 ? -6.037  -5.265  8.014   1.00 0.00 ? 56 LEU A HD13 5  
ATOM 5970  H HD21 . LEU A 1 56 ? -8.941  -6.046  6.904   1.00 0.00 ? 56 LEU A HD21 5  
ATOM 5971  H HD22 . LEU A 1 56 ? -8.789  -7.613  6.110   1.00 0.00 ? 56 LEU A HD22 5  
ATOM 5972  H HD23 . LEU A 1 56 ? -8.191  -6.157  5.312   1.00 0.00 ? 56 LEU A HD23 5  
ATOM 5973  N N    . SER A 1 57 ? -6.079  -9.925  3.992   1.00 0.00 ? 57 SER A N    5  
ATOM 5974  C CA   . SER A 1 57 ? -5.435  -10.694 2.934   1.00 0.00 ? 57 SER A CA   5  
ATOM 5975  C C    . SER A 1 57 ? -4.176  -9.988  2.438   1.00 0.00 ? 57 SER A C    5  
ATOM 5976  O O    . SER A 1 57 ? -4.172  -8.774  2.239   1.00 0.00 ? 57 SER A O    5  
ATOM 5977  C CB   . SER A 1 57 ? -6.404  -10.912 1.770   1.00 0.00 ? 57 SER A CB   5  
ATOM 5978  O OG   . SER A 1 57 ? -7.262  -12.011 2.020   1.00 0.00 ? 57 SER A OG   5  
ATOM 5979  H H    . SER A 1 57 ? -6.648  -9.164  3.752   1.00 0.00 ? 57 SER A H    5  
ATOM 5980  H HA   . SER A 1 57 ? -5.157  -11.654 3.344   1.00 0.00 ? 57 SER A HA   5  
ATOM 5981  H HB2  . SER A 1 57 ? -7.005  -10.025 1.635   1.00 0.00 ? 57 SER A HB2  5  
ATOM 5982  H HB3  . SER A 1 57 ? -5.841  -11.106 0.869   1.00 0.00 ? 57 SER A HB3  5  
ATOM 5983  H HG   . SER A 1 57 ? -8.113  -11.854 1.605   1.00 0.00 ? 57 SER A HG   5  
ATOM 5984  N N    . GLN A 1 58 ? -3.111  -10.759 2.242   1.00 0.00 ? 58 GLN A N    5  
ATOM 5985  C CA   . GLN A 1 58 ? -1.847  -10.208 1.770   1.00 0.00 ? 58 GLN A CA   5  
ATOM 5986  C C    . GLN A 1 58 ? -2.083  -9.107  0.740   1.00 0.00 ? 58 GLN A C    5  
ATOM 5987  O O    . GLN A 1 58 ? -1.432  -8.062  0.773   1.00 0.00 ? 58 GLN A O    5  
ATOM 5988  C CB   . GLN A 1 58 ? -0.979  -11.312 1.163   1.00 0.00 ? 58 GLN A CB   5  
ATOM 5989  C CG   . GLN A 1 58 ? -0.715  -12.469 2.114   1.00 0.00 ? 58 GLN A CG   5  
ATOM 5990  C CD   . GLN A 1 58 ? 0.163   -13.540 1.499   1.00 0.00 ? 58 GLN A CD   5  
ATOM 5991  O OE1  . GLN A 1 58 ? 0.381   -13.560 0.287   1.00 0.00 ? 58 GLN A OE1  5  
ATOM 5992  N NE2  . GLN A 1 58 ? 0.673   -14.439 2.333   1.00 0.00 ? 58 GLN A NE2  5  
ATOM 5993  H H    . GLN A 1 58 ? -3.178  -11.720 2.418   1.00 0.00 ? 58 GLN A H    5  
ATOM 5994  H HA   . GLN A 1 58 ? -1.332  -9.784  2.619   1.00 0.00 ? 58 GLN A HA   5  
ATOM 5995  H HB2  . GLN A 1 58 ? -1.474  -11.701 0.286   1.00 0.00 ? 58 GLN A HB2  5  
ATOM 5996  H HB3  . GLN A 1 58 ? -0.029  -10.888 0.874   1.00 0.00 ? 58 GLN A HB3  5  
ATOM 5997  H HG2  . GLN A 1 58 ? -0.225  -12.087 2.997   1.00 0.00 ? 58 GLN A HG2  5  
ATOM 5998  H HG3  . GLN A 1 58 ? -1.659  -12.913 2.391   1.00 0.00 ? 58 GLN A HG3  5  
ATOM 5999  H HE21 . GLN A 1 58 ? 0.456   -14.361 3.286   1.00 0.00 ? 58 GLN A HE21 5  
ATOM 6000  H HE22 . GLN A 1 58 ? 1.244   -15.143 1.962   1.00 0.00 ? 58 GLN A HE22 5  
ATOM 6001  N N    . LEU A 1 59 ? -3.017  -9.349  -0.172  1.00 0.00 ? 59 LEU A N    5  
ATOM 6002  C CA   . LEU A 1 59 ? -3.340  -8.378  -1.213  1.00 0.00 ? 59 LEU A CA   5  
ATOM 6003  C C    . LEU A 1 59 ? -3.747  -7.041  -0.602  1.00 0.00 ? 59 LEU A C    5  
ATOM 6004  O O    . LEU A 1 59 ? -3.321  -5.982  -1.064  1.00 0.00 ? 59 LEU A O    5  
ATOM 6005  C CB   . LEU A 1 59 ? -4.465  -8.909  -2.102  1.00 0.00 ? 59 LEU A CB   5  
ATOM 6006  C CG   . LEU A 1 59 ? -5.081  -7.905  -3.077  1.00 0.00 ? 59 LEU A CG   5  
ATOM 6007  C CD1  . LEU A 1 59 ? -4.080  -7.528  -4.159  1.00 0.00 ? 59 LEU A CD1  5  
ATOM 6008  C CD2  . LEU A 1 59 ? -6.350  -8.472  -3.696  1.00 0.00 ? 59 LEU A CD2  5  
ATOM 6009  H H    . LEU A 1 59 ? -3.503  -10.199 -0.147  1.00 0.00 ? 59 LEU A H    5  
ATOM 6010  H HA   . LEU A 1 59 ? -2.455  -8.231  -1.814  1.00 0.00 ? 59 LEU A HA   5  
ATOM 6011  H HB2  . LEU A 1 59 ? -4.069  -9.730  -2.680  1.00 0.00 ? 59 LEU A HB2  5  
ATOM 6012  H HB3  . LEU A 1 59 ? -5.252  -9.272  -1.457  1.00 0.00 ? 59 LEU A HB3  5  
ATOM 6013  H HG   . LEU A 1 59 ? -5.344  -7.005  -2.538  1.00 0.00 ? 59 LEU A HG   5  
ATOM 6014  H HD11 . LEU A 1 59 ? -3.078  -7.698  -3.796  1.00 0.00 ? 59 LEU A HD11 5  
ATOM 6015  H HD12 . LEU A 1 59 ? -4.200  -6.485  -4.412  1.00 0.00 ? 59 LEU A HD12 5  
ATOM 6016  H HD13 . LEU A 1 59 ? -4.254  -8.133  -5.036  1.00 0.00 ? 59 LEU A HD13 5  
ATOM 6017  H HD21 . LEU A 1 59 ? -6.991  -8.855  -2.915  1.00 0.00 ? 59 LEU A HD21 5  
ATOM 6018  H HD22 . LEU A 1 59 ? -6.093  -9.272  -4.375  1.00 0.00 ? 59 LEU A HD22 5  
ATOM 6019  H HD23 . LEU A 1 59 ? -6.866  -7.693  -4.236  1.00 0.00 ? 59 LEU A HD23 5  
ATOM 6020  N N    . GLN A 1 60 ? -4.572  -7.098  0.439   1.00 0.00 ? 60 GLN A N    5  
ATOM 6021  C CA   . GLN A 1 60 ? -5.035  -5.891  1.113   1.00 0.00 ? 60 GLN A CA   5  
ATOM 6022  C C    . GLN A 1 60 ? -3.880  -4.923  1.350   1.00 0.00 ? 60 GLN A C    5  
ATOM 6023  O O    . GLN A 1 60 ? -3.906  -3.784  0.883   1.00 0.00 ? 60 GLN A O    5  
ATOM 6024  C CB   . GLN A 1 60 ? -5.698  -6.248  2.444   1.00 0.00 ? 60 GLN A CB   5  
ATOM 6025  C CG   . GLN A 1 60 ? -6.971  -7.064  2.290   1.00 0.00 ? 60 GLN A CG   5  
ATOM 6026  C CD   . GLN A 1 60 ? -8.098  -6.273  1.655   1.00 0.00 ? 60 GLN A CD   5  
ATOM 6027  O OE1  . GLN A 1 60 ? -7.999  -5.841  0.507   1.00 0.00 ? 60 GLN A OE1  5  
ATOM 6028  N NE2  . GLN A 1 60 ? -9.179  -6.079  2.402   1.00 0.00 ? 60 GLN A NE2  5  
ATOM 6029  H H    . GLN A 1 60 ? -4.876  -7.972  0.760   1.00 0.00 ? 60 GLN A H    5  
ATOM 6030  H HA   . GLN A 1 60 ? -5.763  -5.414  0.475   1.00 0.00 ? 60 GLN A HA   5  
ATOM 6031  H HB2  . GLN A 1 60 ? -5.000  -6.817  3.039   1.00 0.00 ? 60 GLN A HB2  5  
ATOM 6032  H HB3  . GLN A 1 60 ? -5.943  -5.334  2.967   1.00 0.00 ? 60 GLN A HB3  5  
ATOM 6033  H HG2  . GLN A 1 60 ? -6.761  -7.922  1.669   1.00 0.00 ? 60 GLN A HG2  5  
ATOM 6034  H HG3  . GLN A 1 60 ? -7.290  -7.397  3.267   1.00 0.00 ? 60 GLN A HG3  5  
ATOM 6035  H HE21 . GLN A 1 60 ? -9.188  -6.452  3.309   1.00 0.00 ? 60 GLN A HE21 5  
ATOM 6036  H HE22 . GLN A 1 60 ? -9.922  -5.571  2.017   1.00 0.00 ? 60 GLN A HE22 5  
ATOM 6037  N N    . VAL A 1 61 ? -2.868  -5.383  2.078   1.00 0.00 ? 61 VAL A N    5  
ATOM 6038  C CA   . VAL A 1 61 ? -1.704  -4.558  2.377   1.00 0.00 ? 61 VAL A CA   5  
ATOM 6039  C C    . VAL A 1 61 ? -1.068  -4.022  1.099   1.00 0.00 ? 61 VAL A C    5  
ATOM 6040  O O    . VAL A 1 61 ? -0.882  -2.815  0.944   1.00 0.00 ? 61 VAL A O    5  
ATOM 6041  C CB   . VAL A 1 61 ? -0.646  -5.347  3.171   1.00 0.00 ? 61 VAL A CB   5  
ATOM 6042  C CG1  . VAL A 1 61 ? 0.596   -4.498  3.398   1.00 0.00 ? 61 VAL A CG1  5  
ATOM 6043  C CG2  . VAL A 1 61 ? -1.222  -5.827  4.494   1.00 0.00 ? 61 VAL A CG2  5  
ATOM 6044  H H    . VAL A 1 61 ? -2.905  -6.300  2.423   1.00 0.00 ? 61 VAL A H    5  
ATOM 6045  H HA   . VAL A 1 61 ? -2.031  -3.725  2.982   1.00 0.00 ? 61 VAL A HA   5  
ATOM 6046  H HB   . VAL A 1 61 ? -0.361  -6.213  2.591   1.00 0.00 ? 61 VAL A HB   5  
ATOM 6047  H HG11 . VAL A 1 61 ? 0.525   -3.594  2.810   1.00 0.00 ? 61 VAL A HG11 5  
ATOM 6048  H HG12 . VAL A 1 61 ? 0.672   -4.243  4.444   1.00 0.00 ? 61 VAL A HG12 5  
ATOM 6049  H HG13 . VAL A 1 61 ? 1.472   -5.054  3.098   1.00 0.00 ? 61 VAL A HG13 5  
ATOM 6050  H HG21 . VAL A 1 61 ? -2.015  -5.163  4.803   1.00 0.00 ? 61 VAL A HG21 5  
ATOM 6051  H HG22 . VAL A 1 61 ? -1.616  -6.827  4.375   1.00 0.00 ? 61 VAL A HG22 5  
ATOM 6052  H HG23 . VAL A 1 61 ? -0.446  -5.834  5.245   1.00 0.00 ? 61 VAL A HG23 5  
ATOM 6053  N N    . LYS A 1 62 ? -0.737  -4.927  0.184   1.00 0.00 ? 62 LYS A N    5  
ATOM 6054  C CA   . LYS A 1 62 ? -0.124  -4.546  -1.082  1.00 0.00 ? 62 LYS A CA   5  
ATOM 6055  C C    . LYS A 1 62 ? -0.860  -3.368  -1.711  1.00 0.00 ? 62 LYS A C    5  
ATOM 6056  O O    . LYS A 1 62 ? -0.309  -2.274  -1.839  1.00 0.00 ? 62 LYS A O    5  
ATOM 6057  C CB   . LYS A 1 62 ? -0.120  -5.733  -2.048  1.00 0.00 ? 62 LYS A CB   5  
ATOM 6058  C CG   . LYS A 1 62 ? 0.724   -5.505  -3.290  1.00 0.00 ? 62 LYS A CG   5  
ATOM 6059  C CD   . LYS A 1 62 ? 0.535   -6.619  -4.305  1.00 0.00 ? 62 LYS A CD   5  
ATOM 6060  C CE   . LYS A 1 62 ? 1.516   -7.758  -4.072  1.00 0.00 ? 62 LYS A CE   5  
ATOM 6061  N NZ   . LYS A 1 62 ? 1.568   -8.692  -5.230  1.00 0.00 ? 62 LYS A NZ   5  
ATOM 6062  H H    . LYS A 1 62 ? -0.910  -5.875  0.366   1.00 0.00 ? 62 LYS A H    5  
ATOM 6063  H HA   . LYS A 1 62 ? 0.896   -4.253  -0.883  1.00 0.00 ? 62 LYS A HA   5  
ATOM 6064  H HB2  . LYS A 1 62 ? 0.263   -6.601  -1.532  1.00 0.00 ? 62 LYS A HB2  5  
ATOM 6065  H HB3  . LYS A 1 62 ? -1.136  -5.931  -2.360  1.00 0.00 ? 62 LYS A HB3  5  
ATOM 6066  H HG2  . LYS A 1 62 ? 0.436   -4.567  -3.743  1.00 0.00 ? 62 LYS A HG2  5  
ATOM 6067  H HG3  . LYS A 1 62 ? 1.765   -5.463  -3.003  1.00 0.00 ? 62 LYS A HG3  5  
ATOM 6068  H HD2  . LYS A 1 62 ? -0.470  -7.003  -4.223  1.00 0.00 ? 62 LYS A HD2  5  
ATOM 6069  H HD3  . LYS A 1 62 ? 0.690   -6.220  -5.298  1.00 0.00 ? 62 LYS A HD3  5  
ATOM 6070  H HE2  . LYS A 1 62 ? 2.499   -7.342  -3.912  1.00 0.00 ? 62 LYS A HE2  5  
ATOM 6071  H HE3  . LYS A 1 62 ? 1.210   -8.305  -3.192  1.00 0.00 ? 62 LYS A HE3  5  
ATOM 6072  H HZ1  . LYS A 1 62 ? 2.126   -8.274  -6.002  1.00 0.00 ? 62 LYS A HZ1  5  
ATOM 6073  H HZ2  . LYS A 1 62 ? 0.607   -8.884  -5.578  1.00 0.00 ? 62 LYS A HZ2  5  
ATOM 6074  H HZ3  . LYS A 1 62 ? 2.008   -9.590  -4.946  1.00 0.00 ? 62 LYS A HZ3  5  
ATOM 6075  N N    . THR A 1 63 ? -2.110  -3.597  -2.102  1.00 0.00 ? 63 THR A N    5  
ATOM 6076  C CA   . THR A 1 63 ? -2.922  -2.555  -2.717  1.00 0.00 ? 63 THR A CA   5  
ATOM 6077  C C    . THR A 1 63 ? -3.175  -1.409  -1.744  1.00 0.00 ? 63 THR A C    5  
ATOM 6078  O O    . THR A 1 63 ? -2.779  -0.271  -1.995  1.00 0.00 ? 63 THR A O    5  
ATOM 6079  C CB   . THR A 1 63 ? -4.275  -3.109  -3.201  1.00 0.00 ? 63 THR A CB   5  
ATOM 6080  O OG1  . THR A 1 63 ? -4.064  -4.224  -4.074  1.00 0.00 ? 63 THR A OG1  5  
ATOM 6081  C CG2  . THR A 1 63 ? -5.072  -2.035  -3.926  1.00 0.00 ? 63 THR A CG2  5  
ATOM 6082  H H    . THR A 1 63 ? -2.494  -4.490  -1.974  1.00 0.00 ? 63 THR A H    5  
ATOM 6083  H HA   . THR A 1 63 ? -2.385  -2.175  -3.574  1.00 0.00 ? 63 THR A HA   5  
ATOM 6084  H HB   . THR A 1 63 ? -4.841  -3.438  -2.341  1.00 0.00 ? 63 THR A HB   5  
ATOM 6085  H HG1  . THR A 1 63 ? -4.909  -4.538  -4.404  1.00 0.00 ? 63 THR A HG1  5  
ATOM 6086  H HG21 . THR A 1 63 ? -4.996  -2.188  -4.992  1.00 0.00 ? 63 THR A HG21 5  
ATOM 6087  H HG22 . THR A 1 63 ? -4.678  -1.062  -3.672  1.00 0.00 ? 63 THR A HG22 5  
ATOM 6088  H HG23 . THR A 1 63 ? -6.108  -2.093  -3.627  1.00 0.00 ? 63 THR A HG23 5  
ATOM 6089  N N    . TRP A 1 64 ? -3.834  -1.716  -0.633  1.00 0.00 ? 64 TRP A N    5  
ATOM 6090  C CA   . TRP A 1 64 ? -4.139  -0.710  0.378   1.00 0.00 ? 64 TRP A CA   5  
ATOM 6091  C C    . TRP A 1 64 ? -2.984  0.273   0.532   1.00 0.00 ? 64 TRP A C    5  
ATOM 6092  O O    . TRP A 1 64 ? -3.189  1.487   0.552   1.00 0.00 ? 64 TRP A O    5  
ATOM 6093  C CB   . TRP A 1 64 ? -4.436  -1.381  1.720   1.00 0.00 ? 64 TRP A CB   5  
ATOM 6094  C CG   . TRP A 1 64 ? -4.921  -0.425  2.767   1.00 0.00 ? 64 TRP A CG   5  
ATOM 6095  C CD1  . TRP A 1 64 ? -6.220  -0.162  3.099   1.00 0.00 ? 64 TRP A CD1  5  
ATOM 6096  C CD2  . TRP A 1 64 ? -4.114  0.397   3.618   1.00 0.00 ? 64 TRP A CD2  5  
ATOM 6097  N NE1  . TRP A 1 64 ? -6.269  0.773   4.104   1.00 0.00 ? 64 TRP A NE1  5  
ATOM 6098  C CE2  . TRP A 1 64 ? -4.990  1.132   4.441   1.00 0.00 ? 64 TRP A CE2  5  
ATOM 6099  C CE3  . TRP A 1 64 ? -2.737  0.582   3.766   1.00 0.00 ? 64 TRP A CE3  5  
ATOM 6100  C CZ2  . TRP A 1 64 ? -4.532  2.036   5.395   1.00 0.00 ? 64 TRP A CZ2  5  
ATOM 6101  C CZ3  . TRP A 1 64 ? -2.284  1.481   4.713   1.00 0.00 ? 64 TRP A CZ3  5  
ATOM 6102  C CH2  . TRP A 1 64 ? -3.179  2.198   5.518   1.00 0.00 ? 64 TRP A CH2  5  
ATOM 6103  H H    . TRP A 1 64 ? -4.124  -2.642  -0.490  1.00 0.00 ? 64 TRP A H    5  
ATOM 6104  H HA   . TRP A 1 64 ? -5.016  -0.170  0.054   1.00 0.00 ? 64 TRP A HA   5  
ATOM 6105  H HB2  . TRP A 1 64 ? -5.197  -2.134  1.579   1.00 0.00 ? 64 TRP A HB2  5  
ATOM 6106  H HB3  . TRP A 1 64 ? -3.534  -1.849  2.088   1.00 0.00 ? 64 TRP A HB3  5  
ATOM 6107  H HD1  . TRP A 1 64 ? -7.073  -0.628  2.630   1.00 0.00 ? 64 TRP A HD1  5  
ATOM 6108  H HE1  . TRP A 1 64 ? -7.087  1.125   4.515   1.00 0.00 ? 64 TRP A HE1  5  
ATOM 6109  H HE3  . TRP A 1 64 ? -2.032  0.039   3.154   1.00 0.00 ? 64 TRP A HE3  5  
ATOM 6110  H HZ2  . TRP A 1 64 ? -5.209  2.596   6.024   1.00 0.00 ? 64 TRP A HZ2  5  
ATOM 6111  H HZ3  . TRP A 1 64 ? -1.223  1.637   4.841   1.00 0.00 ? 64 TRP A HZ3  5  
ATOM 6112  H HH2  . TRP A 1 64 ? -2.780  2.889   6.244   1.00 0.00 ? 64 TRP A HH2  5  
ATOM 6113  N N    . TYR A 1 65 ? -1.771  -0.257  0.640   1.00 0.00 ? 65 TYR A N    5  
ATOM 6114  C CA   . TYR A 1 65 ? -0.584  0.575   0.794   1.00 0.00 ? 65 TYR A CA   5  
ATOM 6115  C C    . TYR A 1 65 ? -0.425  1.522   -0.391  1.00 0.00 ? 65 TYR A C    5  
ATOM 6116  O O    . TYR A 1 65 ? -0.339  2.738   -0.220  1.00 0.00 ? 65 TYR A O    5  
ATOM 6117  C CB   . TYR A 1 65 ? 0.663   -0.300  0.934   1.00 0.00 ? 65 TYR A CB   5  
ATOM 6118  C CG   . TYR A 1 65 ? 0.989   -0.666  2.364   1.00 0.00 ? 65 TYR A CG   5  
ATOM 6119  C CD1  . TYR A 1 65 ? 0.059   -1.318  3.164   1.00 0.00 ? 65 TYR A CD1  5  
ATOM 6120  C CD2  . TYR A 1 65 ? 2.228   -0.362  2.914   1.00 0.00 ? 65 TYR A CD2  5  
ATOM 6121  C CE1  . TYR A 1 65 ? 0.353   -1.654  4.472   1.00 0.00 ? 65 TYR A CE1  5  
ATOM 6122  C CE2  . TYR A 1 65 ? 2.531   -0.695  4.220   1.00 0.00 ? 65 TYR A CE2  5  
ATOM 6123  C CZ   . TYR A 1 65 ? 1.590   -1.340  4.995   1.00 0.00 ? 65 TYR A CZ   5  
ATOM 6124  O OH   . TYR A 1 65 ? 1.886   -1.675  6.297   1.00 0.00 ? 65 TYR A OH   5  
ATOM 6125  H H    . TYR A 1 65 ? -1.671  -1.232  0.617   1.00 0.00 ? 65 TYR A H    5  
ATOM 6126  H HA   . TYR A 1 65 ? -0.704  1.160   1.695   1.00 0.00 ? 65 TYR A HA   5  
ATOM 6127  H HB2  . TYR A 1 65 ? 0.516   -1.216  0.383   1.00 0.00 ? 65 TYR A HB2  5  
ATOM 6128  H HB3  . TYR A 1 65 ? 1.512   0.228   0.524   1.00 0.00 ? 65 TYR A HB3  5  
ATOM 6129  H HD1  . TYR A 1 65 ? -0.909  -1.562  2.751   1.00 0.00 ? 65 TYR A HD1  5  
ATOM 6130  H HD2  . TYR A 1 65 ? 2.963   0.144   2.305   1.00 0.00 ? 65 TYR A HD2  5  
ATOM 6131  H HE1  . TYR A 1 65 ? -0.384  -2.160  5.078   1.00 0.00 ? 65 TYR A HE1  5  
ATOM 6132  H HE2  . TYR A 1 65 ? 3.499   -0.450  4.631   1.00 0.00 ? 65 TYR A HE2  5  
ATOM 6133  H HH   . TYR A 1 65 ? 1.513   -1.018  6.889   1.00 0.00 ? 65 TYR A HH   5  
ATOM 6134  N N    . GLN A 1 66 ? -0.386  0.955   -1.592  1.00 0.00 ? 66 GLN A N    5  
ATOM 6135  C CA   . GLN A 1 66 ? -0.238  1.748   -2.807  1.00 0.00 ? 66 GLN A CA   5  
ATOM 6136  C C    . GLN A 1 66 ? -1.198  2.933   -2.804  1.00 0.00 ? 66 GLN A C    5  
ATOM 6137  O O    . GLN A 1 66 ? -0.789  4.076   -3.009  1.00 0.00 ? 66 GLN A O    5  
ATOM 6138  C CB   . GLN A 1 66 ? -0.484  0.880   -4.042  1.00 0.00 ? 66 GLN A CB   5  
ATOM 6139  C CG   . GLN A 1 66 ? -0.277  1.617   -5.355  1.00 0.00 ? 66 GLN A CG   5  
ATOM 6140  C CD   . GLN A 1 66 ? 1.062   2.325   -5.422  1.00 0.00 ? 66 GLN A CD   5  
ATOM 6141  O OE1  . GLN A 1 66 ? 1.208   3.449   -4.941  1.00 0.00 ? 66 GLN A OE1  5  
ATOM 6142  N NE2  . GLN A 1 66 ? 2.049   1.669   -6.021  1.00 0.00 ? 66 GLN A NE2  5  
ATOM 6143  H H    . GLN A 1 66 ? -0.460  -0.019  -1.664  1.00 0.00 ? 66 GLN A H    5  
ATOM 6144  H HA   . GLN A 1 66 ? 0.775   2.121   -2.837  1.00 0.00 ? 66 GLN A HA   5  
ATOM 6145  H HB2  . GLN A 1 66 ? 0.191   0.038   -4.016  1.00 0.00 ? 66 GLN A HB2  5  
ATOM 6146  H HB3  . GLN A 1 66 ? -1.501  0.517   -4.014  1.00 0.00 ? 66 GLN A HB3  5  
ATOM 6147  H HG2  . GLN A 1 66 ? -0.332  0.905   -6.165  1.00 0.00 ? 66 GLN A HG2  5  
ATOM 6148  H HG3  . GLN A 1 66 ? -1.062  2.351   -5.468  1.00 0.00 ? 66 GLN A HG3  5  
ATOM 6149  H HE21 . GLN A 1 66 ? 1.859   0.777   -6.383  1.00 0.00 ? 66 GLN A HE21 5  
ATOM 6150  H HE22 . GLN A 1 66 ? 2.924   2.103   -6.080  1.00 0.00 ? 66 GLN A HE22 5  
ATOM 6151  N N    . ASN A 1 67 ? -2.476  2.653   -2.571  1.00 0.00 ? 67 ASN A N    5  
ATOM 6152  C CA   . ASN A 1 67 ? -3.494  3.696   -2.542  1.00 0.00 ? 67 ASN A CA   5  
ATOM 6153  C C    . ASN A 1 67 ? -3.146  4.769   -1.515  1.00 0.00 ? 67 ASN A C    5  
ATOM 6154  O O    . ASN A 1 67 ? -3.638  5.895   -1.587  1.00 0.00 ? 67 ASN A O    5  
ATOM 6155  C CB   . ASN A 1 67 ? -4.863  3.093   -2.221  1.00 0.00 ? 67 ASN A CB   5  
ATOM 6156  C CG   . ASN A 1 67 ? -5.501  2.432   -3.428  1.00 0.00 ? 67 ASN A CG   5  
ATOM 6157  O OD1  . ASN A 1 67 ? -6.232  3.071   -4.185  1.00 0.00 ? 67 ASN A OD1  5  
ATOM 6158  N ND2  . ASN A 1 67 ? -5.227  1.146   -3.612  1.00 0.00 ? 67 ASN A ND2  5  
ATOM 6159  H H    . ASN A 1 67 ? -2.740  1.722   -2.414  1.00 0.00 ? 67 ASN A H    5  
ATOM 6160  H HA   . ASN A 1 67 ? -3.531  4.150   -3.521  1.00 0.00 ? 67 ASN A HA   5  
ATOM 6161  H HB2  . ASN A 1 67 ? -4.749  2.348   -1.446  1.00 0.00 ? 67 ASN A HB2  5  
ATOM 6162  H HB3  . ASN A 1 67 ? -5.521  3.873   -1.871  1.00 0.00 ? 67 ASN A HB3  5  
ATOM 6163  H HD21 . ASN A 1 67 ? -4.636  0.701   -2.969  1.00 0.00 ? 67 ASN A HD21 5  
ATOM 6164  H HD22 . ASN A 1 67 ? -5.625  0.694   -4.385  1.00 0.00 ? 67 ASN A HD22 5  
ATOM 6165  N N    . ARG A 1 68 ? -2.293  4.412   -0.560  1.00 0.00 ? 68 ARG A N    5  
ATOM 6166  C CA   . ARG A 1 68 ? -1.878  5.343   0.482   1.00 0.00 ? 68 ARG A CA   5  
ATOM 6167  C C    . ARG A 1 68 ? -0.610  6.086   0.073   1.00 0.00 ? 68 ARG A C    5  
ATOM 6168  O O    . ARG A 1 68 ? -0.486  7.291   0.295   1.00 0.00 ? 68 ARG A O    5  
ATOM 6169  C CB   . ARG A 1 68 ? -1.645  4.598   1.797   1.00 0.00 ? 68 ARG A CB   5  
ATOM 6170  C CG   . ARG A 1 68 ? -2.918  4.053   2.423   1.00 0.00 ? 68 ARG A CG   5  
ATOM 6171  C CD   . ARG A 1 68 ? -3.783  5.169   2.989   1.00 0.00 ? 68 ARG A CD   5  
ATOM 6172  N NE   . ARG A 1 68 ? -4.704  5.707   1.991   1.00 0.00 ? 68 ARG A NE   5  
ATOM 6173  C CZ   . ARG A 1 68 ? -5.503  6.745   2.212   1.00 0.00 ? 68 ARG A CZ   5  
ATOM 6174  N NH1  . ARG A 1 68 ? -5.494  7.353   3.390   1.00 0.00 ? 68 ARG A NH1  5  
ATOM 6175  N NH2  . ARG A 1 68 ? -6.313  7.176   1.254   1.00 0.00 ? 68 ARG A NH2  5  
ATOM 6176  H H    . ARG A 1 68 ? -1.934  3.500   -0.556  1.00 0.00 ? 68 ARG A H    5  
ATOM 6177  H HA   . ARG A 1 68 ? -2.673  6.061   0.621   1.00 0.00 ? 68 ARG A HA   5  
ATOM 6178  H HB2  . ARG A 1 68 ? -0.976  3.770   1.615   1.00 0.00 ? 68 ARG A HB2  5  
ATOM 6179  H HB3  . ARG A 1 68 ? -1.184  5.274   2.502   1.00 0.00 ? 68 ARG A HB3  5  
ATOM 6180  H HG2  . ARG A 1 68 ? -3.481  3.524   1.669   1.00 0.00 ? 68 ARG A HG2  5  
ATOM 6181  H HG3  . ARG A 1 68 ? -2.654  3.375   3.220   1.00 0.00 ? 68 ARG A HG3  5  
ATOM 6182  H HD2  . ARG A 1 68 ? -4.354  4.779   3.818   1.00 0.00 ? 68 ARG A HD2  5  
ATOM 6183  H HD3  . ARG A 1 68 ? -3.139  5.963   3.337   1.00 0.00 ? 68 ARG A HD3  5  
ATOM 6184  H HE   . ARG A 1 68 ? -4.727  5.272   1.113   1.00 0.00 ? 68 ARG A HE   5  
ATOM 6185  H HH11 . ARG A 1 68 ? -4.883  7.031   4.113   1.00 0.00 ? 68 ARG A HH11 5  
ATOM 6186  H HH12 . ARG A 1 68 ? -6.096  8.135   3.554   1.00 0.00 ? 68 ARG A HH12 5  
ATOM 6187  H HH21 . ARG A 1 68 ? -6.322  6.720   0.365   1.00 0.00 ? 68 ARG A HH21 5  
ATOM 6188  H HH22 . ARG A 1 68 ? -6.914  7.956   1.421   1.00 0.00 ? 68 ARG A HH22 5  
ATOM 6189  N N    . ARG A 1 69 ? 0.329   5.360   -0.524  1.00 0.00 ? 69 ARG A N    5  
ATOM 6190  C CA   . ARG A 1 69 ? 1.589   5.950   -0.961  1.00 0.00 ? 69 ARG A CA   5  
ATOM 6191  C C    . ARG A 1 69 ? 1.348   7.026   -2.016  1.00 0.00 ? 69 ARG A C    5  
ATOM 6192  O O    . ARG A 1 69 ? 2.083   8.010   -2.092  1.00 0.00 ? 69 ARG A O    5  
ATOM 6193  C CB   . ARG A 1 69 ? 2.515   4.870   -1.523  1.00 0.00 ? 69 ARG A CB   5  
ATOM 6194  C CG   . ARG A 1 69 ? 2.979   3.864   -0.481  1.00 0.00 ? 69 ARG A CG   5  
ATOM 6195  C CD   . ARG A 1 69 ? 4.269   3.179   -0.904  1.00 0.00 ? 69 ARG A CD   5  
ATOM 6196  N NE   . ARG A 1 69 ? 4.422   1.867   -0.283  1.00 0.00 ? 69 ARG A NE   5  
ATOM 6197  C CZ   . ARG A 1 69 ? 3.658   0.821   -0.578  1.00 0.00 ? 69 ARG A CZ   5  
ATOM 6198  N NH1  . ARG A 1 69 ? 2.695   0.933   -1.482  1.00 0.00 ? 69 ARG A NH1  5  
ATOM 6199  N NH2  . ARG A 1 69 ? 3.859   -0.341  0.031   1.00 0.00 ? 69 ARG A NH2  5  
ATOM 6200  H H    . ARG A 1 69 ? 0.172   4.404   -0.673  1.00 0.00 ? 69 ARG A H    5  
ATOM 6201  H HA   . ARG A 1 69 ? 2.059   6.404   -0.102  1.00 0.00 ? 69 ARG A HA   5  
ATOM 6202  H HB2  . ARG A 1 69 ? 1.993   4.333   -2.301  1.00 0.00 ? 69 ARG A HB2  5  
ATOM 6203  H HB3  . ARG A 1 69 ? 3.387   5.345   -1.946  1.00 0.00 ? 69 ARG A HB3  5  
ATOM 6204  H HG2  . ARG A 1 69 ? 3.148   4.379   0.453   1.00 0.00 ? 69 ARG A HG2  5  
ATOM 6205  H HG3  . ARG A 1 69 ? 2.211   3.117   -0.349  1.00 0.00 ? 69 ARG A HG3  5  
ATOM 6206  H HD2  . ARG A 1 69 ? 4.263   3.060   -1.978  1.00 0.00 ? 69 ARG A HD2  5  
ATOM 6207  H HD3  . ARG A 1 69 ? 5.103   3.803   -0.617  1.00 0.00 ? 69 ARG A HD3  5  
ATOM 6208  H HE   . ARG A 1 69 ? 5.128   1.762   0.388   1.00 0.00 ? 69 ARG A HE   5  
ATOM 6209  H HH11 . ARG A 1 69 ? 2.542   1.807   -1.943  1.00 0.00 ? 69 ARG A HH11 5  
ATOM 6210  H HH12 . ARG A 1 69 ? 2.122   0.143   -1.704  1.00 0.00 ? 69 ARG A HH12 5  
ATOM 6211  H HH21 . ARG A 1 69 ? 4.584   -0.430  0.712   1.00 0.00 ? 69 ARG A HH21 5  
ATOM 6212  H HH22 . ARG A 1 69 ? 3.284   -1.128  -0.192  1.00 0.00 ? 69 ARG A HH22 5  
ATOM 6213  N N    . MET A 1 70 ? 0.313   6.832   -2.827  1.00 0.00 ? 70 MET A N    5  
ATOM 6214  C CA   . MET A 1 70 ? -0.025  7.786   -3.876  1.00 0.00 ? 70 MET A CA   5  
ATOM 6215  C C    . MET A 1 70 ? -0.332  9.158   -3.285  1.00 0.00 ? 70 MET A C    5  
ATOM 6216  O O    . MET A 1 70 ? 0.138   10.181  -3.784  1.00 0.00 ? 70 MET A O    5  
ATOM 6217  C CB   . MET A 1 70 ? -1.225  7.286   -4.683  1.00 0.00 ? 70 MET A CB   5  
ATOM 6218  C CG   . MET A 1 70 ? -2.414  6.891   -3.823  1.00 0.00 ? 70 MET A CG   5  
ATOM 6219  S SD   . MET A 1 70 ? -3.850  6.409   -4.801  1.00 0.00 ? 70 MET A SD   5  
ATOM 6220  C CE   . MET A 1 70 ? -4.765  7.949   -4.840  1.00 0.00 ? 70 MET A CE   5  
ATOM 6221  H H    . MET A 1 70 ? -0.237  6.028   -2.717  1.00 0.00 ? 70 MET A H    5  
ATOM 6222  H HA   . MET A 1 70 ? 0.828   7.873   -4.532  1.00 0.00 ? 70 MET A HA   5  
ATOM 6223  H HB2  . MET A 1 70 ? -1.540  8.066   -5.359  1.00 0.00 ? 70 MET A HB2  5  
ATOM 6224  H HB3  . MET A 1 70 ? -0.923  6.423   -5.258  1.00 0.00 ? 70 MET A HB3  5  
ATOM 6225  H HG2  . MET A 1 70 ? -2.129  6.059   -3.196  1.00 0.00 ? 70 MET A HG2  5  
ATOM 6226  H HG3  . MET A 1 70 ? -2.685  7.731   -3.200  1.00 0.00 ? 70 MET A HG3  5  
ATOM 6227  H HE1  . MET A 1 70 ? -4.130  8.736   -5.219  1.00 0.00 ? 70 MET A HE1  5  
ATOM 6228  H HE2  . MET A 1 70 ? -5.626  7.839   -5.482  1.00 0.00 ? 70 MET A HE2  5  
ATOM 6229  H HE3  . MET A 1 70 ? -5.090  8.199   -3.840  1.00 0.00 ? 70 MET A HE3  5  
ATOM 6230  N N    . LYS A 1 71 ? -1.125  9.174   -2.218  1.00 0.00 ? 71 LYS A N    5  
ATOM 6231  C CA   . LYS A 1 71 ? -1.495  10.420  -1.558  1.00 0.00 ? 71 LYS A CA   5  
ATOM 6232  C C    . LYS A 1 71 ? -0.358  10.926  -0.675  1.00 0.00 ? 71 LYS A C    5  
ATOM 6233  O O    . LYS A 1 71 ? -0.230  12.128  -0.441  1.00 0.00 ? 71 LYS A O    5  
ATOM 6234  C CB   . LYS A 1 71 ? -2.757  10.220  -0.716  1.00 0.00 ? 71 LYS A CB   5  
ATOM 6235  C CG   . LYS A 1 71 ? -3.994  9.906   -1.541  1.00 0.00 ? 71 LYS A CG   5  
ATOM 6236  C CD   . LYS A 1 71 ? -5.137  9.416   -0.667  1.00 0.00 ? 71 LYS A CD   5  
ATOM 6237  C CE   . LYS A 1 71 ? -5.886  10.575  -0.027  1.00 0.00 ? 71 LYS A CE   5  
ATOM 6238  N NZ   . LYS A 1 71 ? -5.078  11.241  1.032   1.00 0.00 ? 71 LYS A NZ   5  
ATOM 6239  H H    . LYS A 1 71 ? -1.469  8.326   -1.866  1.00 0.00 ? 71 LYS A H    5  
ATOM 6240  H HA   . LYS A 1 71 ? -1.695  11.155  -2.323  1.00 0.00 ? 71 LYS A HA   5  
ATOM 6241  H HB2  . LYS A 1 71 ? -2.592  9.404   -0.029  1.00 0.00 ? 71 LYS A HB2  5  
ATOM 6242  H HB3  . LYS A 1 71 ? -2.946  11.122  -0.152  1.00 0.00 ? 71 LYS A HB3  5  
ATOM 6243  H HG2  . LYS A 1 71 ? -4.308  10.801  -2.057  1.00 0.00 ? 71 LYS A HG2  5  
ATOM 6244  H HG3  . LYS A 1 71 ? -3.750  9.139   -2.262  1.00 0.00 ? 71 LYS A HG3  5  
ATOM 6245  H HD2  . LYS A 1 71 ? -5.826  8.849   -1.275  1.00 0.00 ? 71 LYS A HD2  5  
ATOM 6246  H HD3  . LYS A 1 71 ? -4.737  8.783   0.112   1.00 0.00 ? 71 LYS A HD3  5  
ATOM 6247  H HE2  . LYS A 1 71 ? -6.126  11.298  -0.792  1.00 0.00 ? 71 LYS A HE2  5  
ATOM 6248  H HE3  . LYS A 1 71 ? -6.798  10.198  0.411   1.00 0.00 ? 71 LYS A HE3  5  
ATOM 6249  H HZ1  . LYS A 1 71 ? -5.634  11.321  1.907   1.00 0.00 ? 71 LYS A HZ1  5  
ATOM 6250  H HZ2  . LYS A 1 71 ? -4.800  12.194  0.723   1.00 0.00 ? 71 LYS A HZ2  5  
ATOM 6251  H HZ3  . LYS A 1 71 ? -4.220  10.687  1.228   1.00 0.00 ? 71 LYS A HZ3  5  
ATOM 6252  N N    . TRP A 1 72 ? 0.464   10.003  -0.190  1.00 0.00 ? 72 TRP A N    5  
ATOM 6253  C CA   . TRP A 1 72 ? 1.591   10.357  0.665   1.00 0.00 ? 72 TRP A CA   5  
ATOM 6254  C C    . TRP A 1 72 ? 2.691   11.041  -0.139  1.00 0.00 ? 72 TRP A C    5  
ATOM 6255  O O    . TRP A 1 72 ? 3.272   12.032  0.304   1.00 0.00 ? 72 TRP A O    5  
ATOM 6256  C CB   . TRP A 1 72 ? 2.146   9.109   1.354   1.00 0.00 ? 72 TRP A CB   5  
ATOM 6257  C CG   . TRP A 1 72 ? 3.593   9.231   1.727   1.00 0.00 ? 72 TRP A CG   5  
ATOM 6258  C CD1  . TRP A 1 72 ? 4.111   9.929   2.780   1.00 0.00 ? 72 TRP A CD1  5  
ATOM 6259  C CD2  . TRP A 1 72 ? 4.706   8.639   1.048   1.00 0.00 ? 72 TRP A CD2  5  
ATOM 6260  N NE1  . TRP A 1 72 ? 5.480   9.807   2.797   1.00 0.00 ? 72 TRP A NE1  5  
ATOM 6261  C CE2  . TRP A 1 72 ? 5.869   9.020   1.745   1.00 0.00 ? 72 TRP A CE2  5  
ATOM 6262  C CE3  . TRP A 1 72 ? 4.833   7.824   -0.080  1.00 0.00 ? 72 TRP A CE3  5  
ATOM 6263  C CZ2  . TRP A 1 72 ? 7.141   8.613   1.349   1.00 0.00 ? 72 TRP A CZ2  5  
ATOM 6264  C CZ3  . TRP A 1 72 ? 6.096   7.421   -0.471  1.00 0.00 ? 72 TRP A CZ3  5  
ATOM 6265  C CH2  . TRP A 1 72 ? 7.236   7.815   0.242   1.00 0.00 ? 72 TRP A CH2  5  
ATOM 6266  H H    . TRP A 1 72 ? 0.309   9.060   -0.412  1.00 0.00 ? 72 TRP A H    5  
ATOM 6267  H HA   . TRP A 1 72 ? 1.232   11.042  1.419   1.00 0.00 ? 72 TRP A HA   5  
ATOM 6268  H HB2  . TRP A 1 72 ? 1.584   8.922   2.256   1.00 0.00 ? 72 TRP A HB2  5  
ATOM 6269  H HB3  . TRP A 1 72 ? 2.043   8.264   0.688   1.00 0.00 ? 72 TRP A HB3  5  
ATOM 6270  H HD1  . TRP A 1 72 ? 3.521   10.491  3.487   1.00 0.00 ? 72 TRP A HD1  5  
ATOM 6271  H HE1  . TRP A 1 72 ? 6.079   10.216  3.456   1.00 0.00 ? 72 TRP A HE1  5  
ATOM 6272  H HE3  . TRP A 1 72 ? 3.966   7.509   -0.642  1.00 0.00 ? 72 TRP A HE3  5  
ATOM 6273  H HZ2  . TRP A 1 72 ? 8.029   8.908   1.888   1.00 0.00 ? 72 TRP A HZ2  5  
ATOM 6274  H HZ3  . TRP A 1 72 ? 6.214   6.791   -1.341  1.00 0.00 ? 72 TRP A HZ3  5  
ATOM 6275  H HH2  . TRP A 1 72 ? 8.202   7.478   -0.101  1.00 0.00 ? 72 TRP A HH2  5  
ATOM 6276  N N    . LYS A 1 73 ? 2.972   10.507  -1.322  1.00 0.00 ? 73 LYS A N    5  
ATOM 6277  C CA   . LYS A 1 73 ? 4.002   11.067  -2.190  1.00 0.00 ? 73 LYS A CA   5  
ATOM 6278  C C    . LYS A 1 73 ? 3.704   12.527  -2.514  1.00 0.00 ? 73 LYS A C    5  
ATOM 6279  O O    . LYS A 1 73 ? 4.603   13.369  -2.520  1.00 0.00 ? 73 LYS A O    5  
ATOM 6280  C CB   . LYS A 1 73 ? 4.104   10.256  -3.484  1.00 0.00 ? 73 LYS A CB   5  
ATOM 6281  C CG   . LYS A 1 73 ? 5.056   9.077   -3.389  1.00 0.00 ? 73 LYS A CG   5  
ATOM 6282  C CD   . LYS A 1 73 ? 4.847   8.098   -4.532  1.00 0.00 ? 73 LYS A CD   5  
ATOM 6283  C CE   . LYS A 1 73 ? 5.543   6.773   -4.266  1.00 0.00 ? 73 LYS A CE   5  
ATOM 6284  N NZ   . LYS A 1 73 ? 5.697   5.968   -5.510  1.00 0.00 ? 73 LYS A NZ   5  
ATOM 6285  H H    . LYS A 1 73 ? 2.474   9.716   -1.620  1.00 0.00 ? 73 LYS A H    5  
ATOM 6286  H HA   . LYS A 1 73 ? 4.943   11.012  -1.665  1.00 0.00 ? 73 LYS A HA   5  
ATOM 6287  H HB2  . LYS A 1 73 ? 3.123   9.882   -3.738  1.00 0.00 ? 73 LYS A HB2  5  
ATOM 6288  H HB3  . LYS A 1 73 ? 4.448   10.907  -4.275  1.00 0.00 ? 73 LYS A HB3  5  
ATOM 6289  H HG2  . LYS A 1 73 ? 6.071   9.441   -3.422  1.00 0.00 ? 73 LYS A HG2  5  
ATOM 6290  H HG3  . LYS A 1 73 ? 4.886   8.564   -2.453  1.00 0.00 ? 73 LYS A HG3  5  
ATOM 6291  H HD2  . LYS A 1 73 ? 3.789   7.918   -4.652  1.00 0.00 ? 73 LYS A HD2  5  
ATOM 6292  H HD3  . LYS A 1 73 ? 5.245   8.529   -5.440  1.00 0.00 ? 73 LYS A HD3  5  
ATOM 6293  H HE2  . LYS A 1 73 ? 6.520   6.971   -3.853  1.00 0.00 ? 73 LYS A HE2  5  
ATOM 6294  H HE3  . LYS A 1 73 ? 4.959   6.211   -3.554  1.00 0.00 ? 73 LYS A HE3  5  
ATOM 6295  H HZ1  . LYS A 1 73 ? 6.004   6.578   -6.295  1.00 0.00 ? 73 LYS A HZ1  5  
ATOM 6296  H HZ2  . LYS A 1 73 ? 4.791   5.525   -5.763  1.00 0.00 ? 73 LYS A HZ2  5  
ATOM 6297  H HZ3  . LYS A 1 73 ? 6.408   5.222   -5.367  1.00 0.00 ? 73 LYS A HZ3  5  
ATOM 6298  N N    . LYS A 1 74 ? 2.437   12.823  -2.783  1.00 0.00 ? 74 LYS A N    5  
ATOM 6299  C CA   . LYS A 1 74 ? 2.019   14.182  -3.106  1.00 0.00 ? 74 LYS A CA   5  
ATOM 6300  C C    . LYS A 1 74 ? 1.382   14.857  -1.896  1.00 0.00 ? 74 LYS A C    5  
ATOM 6301  O O    . LYS A 1 74 ? 0.174   14.761  -1.684  1.00 0.00 ? 74 LYS A O    5  
ATOM 6302  C CB   . LYS A 1 74 ? 1.032   14.170  -4.275  1.00 0.00 ? 74 LYS A CB   5  
ATOM 6303  C CG   . LYS A 1 74 ? 0.708   15.553  -4.812  1.00 0.00 ? 74 LYS A CG   5  
ATOM 6304  C CD   . LYS A 1 74 ? -0.221  15.482  -6.012  1.00 0.00 ? 74 LYS A CD   5  
ATOM 6305  C CE   . LYS A 1 74 ? 0.542   15.162  -7.289  1.00 0.00 ? 74 LYS A CE   5  
ATOM 6306  N NZ   . LYS A 1 74 ? 1.465   16.265  -7.675  1.00 0.00 ? 74 LYS A NZ   5  
ATOM 6307  H H    . LYS A 1 74 ? 1.765   12.108  -2.763  1.00 0.00 ? 74 LYS A H    5  
ATOM 6308  H HA   . LYS A 1 74 ? 2.898   14.739  -3.393  1.00 0.00 ? 74 LYS A HA   5  
ATOM 6309  H HB2  . LYS A 1 74 ? 1.451   13.584  -5.079  1.00 0.00 ? 74 LYS A HB2  5  
ATOM 6310  H HB3  . LYS A 1 74 ? 0.111   13.709  -3.948  1.00 0.00 ? 74 LYS A HB3  5  
ATOM 6311  H HG2  . LYS A 1 74 ? 0.229   16.129  -4.034  1.00 0.00 ? 74 LYS A HG2  5  
ATOM 6312  H HG3  . LYS A 1 74 ? 1.627   16.039  -5.107  1.00 0.00 ? 74 LYS A HG3  5  
ATOM 6313  H HD2  . LYS A 1 74 ? -0.956  14.710  -5.843  1.00 0.00 ? 74 LYS A HD2  5  
ATOM 6314  H HD3  . LYS A 1 74 ? -0.717  16.435  -6.129  1.00 0.00 ? 74 LYS A HD3  5  
ATOM 6315  H HE2  . LYS A 1 74 ? 1.116   14.261  -7.133  1.00 0.00 ? 74 LYS A HE2  5  
ATOM 6316  H HE3  . LYS A 1 74 ? -0.169  15.002  -8.086  1.00 0.00 ? 74 LYS A HE3  5  
ATOM 6317  H HZ1  . LYS A 1 74 ? 1.421   17.029  -6.972  1.00 0.00 ? 74 LYS A HZ1  5  
ATOM 6318  H HZ2  . LYS A 1 74 ? 1.195   16.648  -8.604  1.00 0.00 ? 74 LYS A HZ2  5  
ATOM 6319  H HZ3  . LYS A 1 74 ? 2.441   15.912  -7.729  1.00 0.00 ? 74 LYS A HZ3  5  
ATOM 6320  N N    . SER A 1 75 ? 2.203   15.542  -1.106  1.00 0.00 ? 75 SER A N    5  
ATOM 6321  C CA   . SER A 1 75 ? 1.720   16.232  0.085   1.00 0.00 ? 75 SER A CA   5  
ATOM 6322  C C    . SER A 1 75 ? 1.203   17.624  -0.266  1.00 0.00 ? 75 SER A C    5  
ATOM 6323  O O    . SER A 1 75 ? 1.936   18.608  -0.188  1.00 0.00 ? 75 SER A O    5  
ATOM 6324  C CB   . SER A 1 75 ? 2.835   16.337  1.127   1.00 0.00 ? 75 SER A CB   5  
ATOM 6325  O OG   . SER A 1 75 ? 2.482   17.238  2.163   1.00 0.00 ? 75 SER A OG   5  
ATOM 6326  H H    . SER A 1 75 ? 3.157   15.582  -1.328  1.00 0.00 ? 75 SER A H    5  
ATOM 6327  H HA   . SER A 1 75 ? 0.907   15.652  0.497   1.00 0.00 ? 75 SER A HA   5  
ATOM 6328  H HB2  . SER A 1 75 ? 3.015   15.364  1.558   1.00 0.00 ? 75 SER A HB2  5  
ATOM 6329  H HB3  . SER A 1 75 ? 3.737   16.692  0.650   1.00 0.00 ? 75 SER A HB3  5  
ATOM 6330  H HG   . SER A 1 75 ? 1.974   16.773  2.832   1.00 0.00 ? 75 SER A HG   5  
ATOM 6331  N N    . GLY A 1 76 ? -0.067  17.696  -0.653  1.00 0.00 ? 76 GLY A N    5  
ATOM 6332  C CA   . GLY A 1 76 ? -0.661  18.971  -1.011  1.00 0.00 ? 76 GLY A CA   5  
ATOM 6333  C C    . GLY A 1 76 ? -0.697  19.941  0.153   1.00 0.00 ? 76 GLY A C    5  
ATOM 6334  O O    . GLY A 1 76 ? -0.682  19.546  1.319   1.00 0.00 ? 76 GLY A O    5  
ATOM 6335  H H    . GLY A 1 76 ? -0.604  16.878  -0.697  1.00 0.00 ? 76 GLY A H    5  
ATOM 6336  H HA2  . GLY A 1 76 ? -0.089  19.410  -1.815  1.00 0.00 ? 76 GLY A HA2  5  
ATOM 6337  H HA3  . GLY A 1 76 ? -1.672  18.801  -1.353  1.00 0.00 ? 76 GLY A HA3  5  
ATOM 6338  N N    . PRO A 1 77 ? -0.744  21.245  -0.159  1.00 0.00 ? 77 PRO A N    5  
ATOM 6339  C CA   . PRO A 1 77 ? -0.781  22.301  0.856   1.00 0.00 ? 77 PRO A CA   5  
ATOM 6340  C C    . PRO A 1 77 ? -2.106  22.334  1.610   1.00 0.00 ? 77 PRO A C    5  
ATOM 6341  O O    . PRO A 1 77 ? -2.164  22.757  2.765   1.00 0.00 ? 77 PRO A O    5  
ATOM 6342  C CB   . PRO A 1 77 ? -0.598  23.584  0.041   1.00 0.00 ? 77 PRO A CB   5  
ATOM 6343  C CG   . PRO A 1 77 ? -1.094  23.240  -1.321  1.00 0.00 ? 77 PRO A CG   5  
ATOM 6344  C CD   . PRO A 1 77 ? -0.764  21.788  -1.528  1.00 0.00 ? 77 PRO A CD   5  
ATOM 6345  H HA   . PRO A 1 77 ? 0.031   22.202  1.562   1.00 0.00 ? 77 PRO A HA   5  
ATOM 6346  H HB2  . PRO A 1 77 ? -1.178  24.381  0.484   1.00 0.00 ? 77 PRO A HB2  5  
ATOM 6347  H HB3  . PRO A 1 77 ? 0.446   23.858  0.024   1.00 0.00 ? 77 PRO A HB3  5  
ATOM 6348  H HG2  . PRO A 1 77 ? -2.161  23.394  -1.374  1.00 0.00 ? 77 PRO A HG2  5  
ATOM 6349  H HG3  . PRO A 1 77 ? -0.589  23.847  -2.059  1.00 0.00 ? 77 PRO A HG3  5  
ATOM 6350  H HD2  . PRO A 1 77 ? -1.529  21.308  -2.121  1.00 0.00 ? 77 PRO A HD2  5  
ATOM 6351  H HD3  . PRO A 1 77 ? 0.202   21.683  -1.998  1.00 0.00 ? 77 PRO A HD3  5  
ATOM 6352  N N    . SER A 1 78 ? -3.168  21.884  0.950   1.00 0.00 ? 78 SER A N    5  
ATOM 6353  C CA   . SER A 1 78 ? -4.494  21.865  1.558   1.00 0.00 ? 78 SER A CA   5  
ATOM 6354  C C    . SER A 1 78 ? -4.702  20.589  2.368   1.00 0.00 ? 78 SER A C    5  
ATOM 6355  O O    . SER A 1 78 ? -4.252  19.512  1.977   1.00 0.00 ? 78 SER A O    5  
ATOM 6356  C CB   . SER A 1 78 ? -5.574  21.981  0.480   1.00 0.00 ? 78 SER A CB   5  
ATOM 6357  O OG   . SER A 1 78 ? -5.349  23.109  -0.348  1.00 0.00 ? 78 SER A OG   5  
ATOM 6358  H H    . SER A 1 78 ? -3.058  21.560  0.032   1.00 0.00 ? 78 SER A H    5  
ATOM 6359  H HA   . SER A 1 78 ? -4.567  22.714  2.221   1.00 0.00 ? 78 SER A HA   5  
ATOM 6360  H HB2  . SER A 1 78 ? -5.564  21.092  -0.132  1.00 0.00 ? 78 SER A HB2  5  
ATOM 6361  H HB3  . SER A 1 78 ? -6.540  22.083  0.953   1.00 0.00 ? 78 SER A HB3  5  
ATOM 6362  H HG   . SER A 1 78 ? -4.423  23.141  -0.600  1.00 0.00 ? 78 SER A HG   5  
ATOM 6363  N N    . SER A 1 79 ? -5.388  20.719  3.499   1.00 0.00 ? 79 SER A N    5  
ATOM 6364  C CA   . SER A 1 79 ? -5.654  19.578  4.367   1.00 0.00 ? 79 SER A CA   5  
ATOM 6365  C C    . SER A 1 79 ? -7.148  19.277  4.427   1.00 0.00 ? 79 SER A C    5  
ATOM 6366  O O    . SER A 1 79 ? -7.979  20.181  4.340   1.00 0.00 ? 79 SER A O    5  
ATOM 6367  C CB   . SER A 1 79 ? -5.119  19.845  5.775   1.00 0.00 ? 79 SER A CB   5  
ATOM 6368  O OG   . SER A 1 79 ? -3.704  19.771  5.805   1.00 0.00 ? 79 SER A OG   5  
ATOM 6369  H H    . SER A 1 79 ? -5.721  21.604  3.757   1.00 0.00 ? 79 SER A H    5  
ATOM 6370  H HA   . SER A 1 79 ? -5.143  18.721  3.954   1.00 0.00 ? 79 SER A HA   5  
ATOM 6371  H HB2  . SER A 1 79 ? -5.422  20.832  6.091   1.00 0.00 ? 79 SER A HB2  5  
ATOM 6372  H HB3  . SER A 1 79 ? -5.521  19.109  6.456   1.00 0.00 ? 79 SER A HB3  5  
ATOM 6373  H HG   . SER A 1 79 ? -3.399  19.185  5.109   1.00 0.00 ? 79 SER A HG   5  
ATOM 6374  N N    . GLY A 1 80 ? -7.483  17.999  4.577   1.00 0.00 ? 80 GLY A N    5  
ATOM 6375  C CA   . GLY A 1 80 ? -8.877  17.601  4.647   1.00 0.00 ? 80 GLY A CA   5  
ATOM 6376  C C    . GLY A 1 80 ? -9.533  17.545  3.281   1.00 0.00 ? 80 GLY A C    5  
ATOM 6377  O O    . GLY A 1 80 ? -8.999  18.074  2.307   1.00 0.00 ? 80 GLY A O    5  
ATOM 6378  H H    . GLY A 1 80 ? -6.778  17.321  4.641   1.00 0.00 ? 80 GLY A H    5  
ATOM 6379  H HA2  . GLY A 1 80 ? -8.939  16.625  5.105   1.00 0.00 ? 80 GLY A HA2  5  
ATOM 6380  H HA3  . GLY A 1 80 ? -9.412  18.310  5.261   1.00 0.00 ? 80 GLY A HA3  5  
ATOM 6381  N N    . GLY A 1 1  ? 43.753  -6.073  -16.669 1.00 0.00 ? 1  GLY A N    6  
ATOM 6382  C CA   . GLY A 1 1  ? 42.752  -7.085  -16.951 1.00 0.00 ? 1  GLY A CA   6  
ATOM 6383  C C    . GLY A 1 1  ? 41.652  -7.119  -15.908 1.00 0.00 ? 1  GLY A C    6  
ATOM 6384  O O    . GLY A 1 1  ? 41.882  -6.800  -14.742 1.00 0.00 ? 1  GLY A O    6  
ATOM 6385  H H1   . GLY A 1 1  ? 43.485  -5.135  -16.576 1.00 0.00 ? 1  GLY A H1   6  
ATOM 6386  H HA2  . GLY A 1 1  ? 42.313  -6.882  -17.916 1.00 0.00 ? 1  GLY A HA2  6  
ATOM 6387  H HA3  . GLY A 1 1  ? 43.232  -8.052  -16.981 1.00 0.00 ? 1  GLY A HA3  6  
ATOM 6388  N N    . SER A 1 2  ? 40.451  -7.505  -16.329 1.00 0.00 ? 2  SER A N    6  
ATOM 6389  C CA   . SER A 1 2  ? 39.310  -7.574  -15.424 1.00 0.00 ? 2  SER A CA   6  
ATOM 6390  C C    . SER A 1 2  ? 38.107  -8.210  -16.115 1.00 0.00 ? 2  SER A C    6  
ATOM 6391  O O    . SER A 1 2  ? 38.153  -8.520  -17.305 1.00 0.00 ? 2  SER A O    6  
ATOM 6392  C CB   . SER A 1 2  ? 38.944  -6.176  -14.923 1.00 0.00 ? 2  SER A CB   6  
ATOM 6393  O OG   . SER A 1 2  ? 39.675  -5.846  -13.754 1.00 0.00 ? 2  SER A OG   6  
ATOM 6394  H H    . SER A 1 2  ? 40.331  -7.747  -17.271 1.00 0.00 ? 2  SER A H    6  
ATOM 6395  H HA   . SER A 1 2  ? 39.592  -8.188  -14.581 1.00 0.00 ? 2  SER A HA   6  
ATOM 6396  H HB2  . SER A 1 2  ? 39.170  -5.451  -15.690 1.00 0.00 ? 2  SER A HB2  6  
ATOM 6397  H HB3  . SER A 1 2  ? 37.889  -6.143  -14.695 1.00 0.00 ? 2  SER A HB3  6  
ATOM 6398  H HG   . SER A 1 2  ? 39.787  -6.632  -13.214 1.00 0.00 ? 2  SER A HG   6  
ATOM 6399  N N    . SER A 1 3  ? 37.031  -8.401  -15.358 1.00 0.00 ? 3  SER A N    6  
ATOM 6400  C CA   . SER A 1 3  ? 35.816  -9.003  -15.895 1.00 0.00 ? 3  SER A CA   6  
ATOM 6401  C C    . SER A 1 3  ? 34.627  -8.738  -14.977 1.00 0.00 ? 3  SER A C    6  
ATOM 6402  O O    . SER A 1 3  ? 34.782  -8.200  -13.882 1.00 0.00 ? 3  SER A O    6  
ATOM 6403  C CB   . SER A 1 3  ? 36.007  -10.510 -16.079 1.00 0.00 ? 3  SER A CB   6  
ATOM 6404  O OG   . SER A 1 3  ? 36.140  -11.164 -14.828 1.00 0.00 ? 3  SER A OG   6  
ATOM 6405  H H    . SER A 1 3  ? 37.056  -8.133  -14.416 1.00 0.00 ? 3  SER A H    6  
ATOM 6406  H HA   . SER A 1 3  ? 35.621  -8.554  -16.857 1.00 0.00 ? 3  SER A HA   6  
ATOM 6407  H HB2  . SER A 1 3  ? 35.151  -10.918 -16.595 1.00 0.00 ? 3  SER A HB2  6  
ATOM 6408  H HB3  . SER A 1 3  ? 36.899  -10.689 -16.662 1.00 0.00 ? 3  SER A HB3  6  
ATOM 6409  H HG   . SER A 1 3  ? 35.284  -11.202 -14.394 1.00 0.00 ? 3  SER A HG   6  
ATOM 6410  N N    . GLY A 1 4  ? 33.438  -9.119  -15.434 1.00 0.00 ? 4  GLY A N    6  
ATOM 6411  C CA   . GLY A 1 4  ? 32.239  -8.915  -14.643 1.00 0.00 ? 4  GLY A CA   6  
ATOM 6412  C C    . GLY A 1 4  ? 31.148  -9.914  -14.974 1.00 0.00 ? 4  GLY A C    6  
ATOM 6413  O O    . GLY A 1 4  ? 31.356  -10.829 -15.771 1.00 0.00 ? 4  GLY A O    6  
ATOM 6414  H H    . GLY A 1 4  ? 33.375  -9.544  -16.315 1.00 0.00 ? 4  GLY A H    6  
ATOM 6415  H HA2  . GLY A 1 4  ? 32.491  -9.006  -13.597 1.00 0.00 ? 4  GLY A HA2  6  
ATOM 6416  H HA3  . GLY A 1 4  ? 31.866  -7.918  -14.827 1.00 0.00 ? 4  GLY A HA3  6  
ATOM 6417  N N    . SER A 1 5  ? 29.982  -9.740  -14.359 1.00 0.00 ? 5  SER A N    6  
ATOM 6418  C CA   . SER A 1 5  ? 28.856  -10.638 -14.589 1.00 0.00 ? 5  SER A CA   6  
ATOM 6419  C C    . SER A 1 5  ? 27.545  -9.983  -14.166 1.00 0.00 ? 5  SER A C    6  
ATOM 6420  O O    . SER A 1 5  ? 27.538  -9.021  -13.397 1.00 0.00 ? 5  SER A O    6  
ATOM 6421  C CB   . SER A 1 5  ? 29.056  -11.947 -13.823 1.00 0.00 ? 5  SER A CB   6  
ATOM 6422  O OG   . SER A 1 5  ? 30.208  -12.634 -14.280 1.00 0.00 ? 5  SER A OG   6  
ATOM 6423  H H    . SER A 1 5  ? 29.878  -8.992  -13.735 1.00 0.00 ? 5  SER A H    6  
ATOM 6424  H HA   . SER A 1 5  ? 28.813  -10.852 -15.646 1.00 0.00 ? 5  SER A HA   6  
ATOM 6425  H HB2  . SER A 1 5  ? 29.173  -11.732 -12.772 1.00 0.00 ? 5  SER A HB2  6  
ATOM 6426  H HB3  . SER A 1 5  ? 28.192  -12.580 -13.968 1.00 0.00 ? 5  SER A HB3  6  
ATOM 6427  H HG   . SER A 1 5  ? 30.622  -13.090 -13.544 1.00 0.00 ? 5  SER A HG   6  
ATOM 6428  N N    . SER A 1 6  ? 26.436  -10.511 -14.674 1.00 0.00 ? 6  SER A N    6  
ATOM 6429  C CA   . SER A 1 6  ? 25.118  -9.977  -14.353 1.00 0.00 ? 6  SER A CA   6  
ATOM 6430  C C    . SER A 1 6  ? 24.185  -11.084 -13.872 1.00 0.00 ? 6  SER A C    6  
ATOM 6431  O O    . SER A 1 6  ? 24.527  -12.265 -13.923 1.00 0.00 ? 6  SER A O    6  
ATOM 6432  C CB   . SER A 1 6  ? 24.515  -9.281  -15.575 1.00 0.00 ? 6  SER A CB   6  
ATOM 6433  O OG   . SER A 1 6  ? 24.436  -10.166 -16.679 1.00 0.00 ? 6  SER A OG   6  
ATOM 6434  H H    . SER A 1 6  ? 26.506  -11.277 -15.282 1.00 0.00 ? 6  SER A H    6  
ATOM 6435  H HA   . SER A 1 6  ? 25.237  -9.254  -13.560 1.00 0.00 ? 6  SER A HA   6  
ATOM 6436  H HB2  . SER A 1 6  ? 23.521  -8.934  -15.334 1.00 0.00 ? 6  SER A HB2  6  
ATOM 6437  H HB3  . SER A 1 6  ? 25.134  -8.438  -15.847 1.00 0.00 ? 6  SER A HB3  6  
ATOM 6438  H HG   . SER A 1 6  ? 25.321  -10.421 -16.948 1.00 0.00 ? 6  SER A HG   6  
ATOM 6439  N N    . GLY A 1 7  ? 23.003  -10.693 -13.405 1.00 0.00 ? 7  GLY A N    6  
ATOM 6440  C CA   . GLY A 1 7  ? 22.038  -11.663 -12.922 1.00 0.00 ? 7  GLY A CA   6  
ATOM 6441  C C    . GLY A 1 7  ? 20.606  -11.215 -13.141 1.00 0.00 ? 7  GLY A C    6  
ATOM 6442  O O    . GLY A 1 7  ? 20.335  -10.377 -13.999 1.00 0.00 ? 7  GLY A O    6  
ATOM 6443  H H    . GLY A 1 7  ? 22.784  -9.737  -13.389 1.00 0.00 ? 7  GLY A H    6  
ATOM 6444  H HA2  . GLY A 1 7  ? 22.195  -12.598 -13.439 1.00 0.00 ? 7  GLY A HA2  6  
ATOM 6445  H HA3  . GLY A 1 7  ? 22.197  -11.816 -11.865 1.00 0.00 ? 7  GLY A HA3  6  
ATOM 6446  N N    . GLY A 1 8  ? 19.687  -11.777 -12.362 1.00 0.00 ? 8  GLY A N    6  
ATOM 6447  C CA   . GLY A 1 8  ? 18.286  -11.420 -12.491 1.00 0.00 ? 8  GLY A CA   6  
ATOM 6448  C C    . GLY A 1 8  ? 17.548  -11.477 -11.168 1.00 0.00 ? 8  GLY A C    6  
ATOM 6449  O O    . GLY A 1 8  ? 18.163  -11.641 -10.115 1.00 0.00 ? 8  GLY A O    6  
ATOM 6450  H H    . GLY A 1 8  ? 19.961  -12.440 -11.694 1.00 0.00 ? 8  GLY A H    6  
ATOM 6451  H HA2  . GLY A 1 8  ? 18.217  -10.417 -12.887 1.00 0.00 ? 8  GLY A HA2  6  
ATOM 6452  H HA3  . GLY A 1 8  ? 17.815  -12.102 -13.183 1.00 0.00 ? 8  GLY A HA3  6  
ATOM 6453  N N    . GLU A 1 9  ? 16.227  -11.340 -11.223 1.00 0.00 ? 9  GLU A N    6  
ATOM 6454  C CA   . GLU A 1 9  ? 15.406  -11.375 -10.018 1.00 0.00 ? 9  GLU A CA   6  
ATOM 6455  C C    . GLU A 1 9  ? 13.952  -11.685 -10.360 1.00 0.00 ? 9  GLU A C    6  
ATOM 6456  O O    . GLU A 1 9  ? 13.502  -11.507 -11.492 1.00 0.00 ? 9  GLU A O    6  
ATOM 6457  C CB   . GLU A 1 9  ? 15.494  -10.039 -9.276  1.00 0.00 ? 9  GLU A CB   6  
ATOM 6458  C CG   . GLU A 1 9  ? 16.684  -9.942  -8.336  1.00 0.00 ? 9  GLU A CG   6  
ATOM 6459  C CD   . GLU A 1 9  ? 16.583  -8.764  -7.387  1.00 0.00 ? 9  GLU A CD   6  
ATOM 6460  O OE1  . GLU A 1 9  ? 16.164  -7.676  -7.835  1.00 0.00 ? 9  GLU A OE1  6  
ATOM 6461  O OE2  . GLU A 1 9  ? 16.922  -8.929  -6.197  1.00 0.00 ? 9  GLU A OE2  6  
ATOM 6462  H H    . GLU A 1 9  ? 15.795  -11.212 -12.093 1.00 0.00 ? 9  GLU A H    6  
ATOM 6463  H HA   . GLU A 1 9  ? 15.788  -12.157 -9.379  1.00 0.00 ? 9  GLU A HA   6  
ATOM 6464  H HB2  . GLU A 1 9  ? 15.567  -9.242  -10.001 1.00 0.00 ? 9  GLU A HB2  6  
ATOM 6465  H HB3  . GLU A 1 9  ? 14.592  -9.904  -8.696  1.00 0.00 ? 9  GLU A HB3  6  
ATOM 6466  H HG2  . GLU A 1 9  ? 16.741  -10.850 -7.754  1.00 0.00 ? 9  GLU A HG2  6  
ATOM 6467  H HG3  . GLU A 1 9  ? 17.583  -9.836  -8.924  1.00 0.00 ? 9  GLU A HG3  6  
ATOM 6468  N N    . PRO A 1 10 ? 13.197  -12.160 -9.358  1.00 0.00 ? 10 PRO A N    6  
ATOM 6469  C CA   . PRO A 1 10 ? 11.783  -12.506 -9.527  1.00 0.00 ? 10 PRO A CA   6  
ATOM 6470  C C    . PRO A 1 10 ? 10.906  -11.275 -9.733  1.00 0.00 ? 10 PRO A C    6  
ATOM 6471  O O    . PRO A 1 10 ? 11.406  -10.155 -9.836  1.00 0.00 ? 10 PRO A O    6  
ATOM 6472  C CB   . PRO A 1 10 ? 11.427  -13.201 -8.211  1.00 0.00 ? 10 PRO A CB   6  
ATOM 6473  C CG   . PRO A 1 10 ? 12.397  -12.655 -7.220  1.00 0.00 ? 10 PRO A CG   6  
ATOM 6474  C CD   . PRO A 1 10 ? 13.667  -12.398 -7.983  1.00 0.00 ? 10 PRO A CD   6  
ATOM 6475  H HA   . PRO A 1 10 ? 11.637  -13.191 -10.349 1.00 0.00 ? 10 PRO A HA   6  
ATOM 6476  H HB2  . PRO A 1 10 ? 10.408  -12.964 -7.939  1.00 0.00 ? 10 PRO A HB2  6  
ATOM 6477  H HB3  . PRO A 1 10 ? 11.537  -14.269 -8.322  1.00 0.00 ? 10 PRO A HB3  6  
ATOM 6478  H HG2  . PRO A 1 10 ? 12.017  -11.735 -6.803  1.00 0.00 ? 10 PRO A HG2  6  
ATOM 6479  H HG3  . PRO A 1 10 ? 12.570  -13.380 -6.439  1.00 0.00 ? 10 PRO A HG3  6  
ATOM 6480  H HD2  . PRO A 1 10 ? 14.172  -11.526 -7.592  1.00 0.00 ? 10 PRO A HD2  6  
ATOM 6481  H HD3  . PRO A 1 10 ? 14.314  -13.261 -7.941  1.00 0.00 ? 10 PRO A HD3  6  
ATOM 6482  N N    . GLY A 1 11 ? 9.595   -11.490 -9.792  1.00 0.00 ? 11 GLY A N    6  
ATOM 6483  C CA   . GLY A 1 11 ? 8.670   -10.389 -9.985  1.00 0.00 ? 11 GLY A CA   6  
ATOM 6484  C C    . GLY A 1 11 ? 7.357   -10.601 -9.259  1.00 0.00 ? 11 GLY A C    6  
ATOM 6485  O O    . GLY A 1 11 ? 7.293   -11.340 -8.276  1.00 0.00 ? 11 GLY A O    6  
ATOM 6486  H H    . GLY A 1 11 ? 9.254   -12.405 -9.703  1.00 0.00 ? 11 GLY A H    6  
ATOM 6487  H HA2  . GLY A 1 11 ? 9.128   -9.481  -9.621  1.00 0.00 ? 11 GLY A HA2  6  
ATOM 6488  H HA3  . GLY A 1 11 ? 8.472   -10.282 -11.041 1.00 0.00 ? 11 GLY A HA3  6  
ATOM 6489  N N    . THR A 1 12 ? 6.303   -9.951  -9.744  1.00 0.00 ? 12 THR A N    6  
ATOM 6490  C CA   . THR A 1 12 ? 4.985   -10.069 -9.134  1.00 0.00 ? 12 THR A CA   6  
ATOM 6491  C C    . THR A 1 12 ? 3.922   -10.389 -10.178 1.00 0.00 ? 12 THR A C    6  
ATOM 6492  O O    . THR A 1 12 ? 4.045   -10.006 -11.342 1.00 0.00 ? 12 THR A O    6  
ATOM 6493  C CB   . THR A 1 12 ? 4.589   -8.777  -8.395  1.00 0.00 ? 12 THR A CB   6  
ATOM 6494  O OG1  . THR A 1 12 ? 4.602   -7.670  -9.304  1.00 0.00 ? 12 THR A OG1  6  
ATOM 6495  C CG2  . THR A 1 12 ? 5.539   -8.501  -7.239  1.00 0.00 ? 12 THR A CG2  6  
ATOM 6496  H H    . THR A 1 12 ? 6.417   -9.377  -10.530 1.00 0.00 ? 12 THR A H    6  
ATOM 6497  H HA   . THR A 1 12 ? 5.022   -10.874 -8.413  1.00 0.00 ? 12 THR A HA   6  
ATOM 6498  H HB   . THR A 1 12 ? 3.591   -8.897  -8.000  1.00 0.00 ? 12 THR A HB   6  
ATOM 6499  H HG1  . THR A 1 12 ? 3.715   -7.310  -9.382  1.00 0.00 ? 12 THR A HG1  6  
ATOM 6500  H HG21 . THR A 1 12 ? 6.506   -8.217  -7.628  1.00 0.00 ? 12 THR A HG21 6  
ATOM 6501  H HG22 . THR A 1 12 ? 5.641   -9.392  -6.637  1.00 0.00 ? 12 THR A HG22 6  
ATOM 6502  H HG23 . THR A 1 12 ? 5.146   -7.699  -6.634  1.00 0.00 ? 12 THR A HG23 6  
ATOM 6503  N N    . LYS A 1 13 ? 2.878   -11.095 -9.757  1.00 0.00 ? 13 LYS A N    6  
ATOM 6504  C CA   . LYS A 1 13 ? 1.791   -11.465 -10.655 1.00 0.00 ? 13 LYS A CA   6  
ATOM 6505  C C    . LYS A 1 13 ? 0.449   -11.425 -9.932  1.00 0.00 ? 13 LYS A C    6  
ATOM 6506  O O    . LYS A 1 13 ? 0.232   -12.155 -8.966  1.00 0.00 ? 13 LYS A O    6  
ATOM 6507  C CB   . LYS A 1 13 ? 2.031   -12.864 -11.229 1.00 0.00 ? 13 LYS A CB   6  
ATOM 6508  C CG   . LYS A 1 13 ? 0.989   -13.290 -12.248 1.00 0.00 ? 13 LYS A CG   6  
ATOM 6509  C CD   . LYS A 1 13 ? 1.180   -14.737 -12.670 1.00 0.00 ? 13 LYS A CD   6  
ATOM 6510  C CE   . LYS A 1 13 ? 0.761   -15.699 -11.569 1.00 0.00 ? 13 LYS A CE   6  
ATOM 6511  N NZ   . LYS A 1 13 ? -0.697  -15.609 -11.280 1.00 0.00 ? 13 LYS A NZ   6  
ATOM 6512  H H    . LYS A 1 13 ? 2.837   -11.372 -8.817  1.00 0.00 ? 13 LYS A H    6  
ATOM 6513  H HA   . LYS A 1 13 ? 1.772   -10.752 -11.465 1.00 0.00 ? 13 LYS A HA   6  
ATOM 6514  H HB2  . LYS A 1 13 ? 3.000   -12.883 -11.707 1.00 0.00 ? 13 LYS A HB2  6  
ATOM 6515  H HB3  . LYS A 1 13 ? 2.025   -13.578 -10.419 1.00 0.00 ? 13 LYS A HB3  6  
ATOM 6516  H HG2  . LYS A 1 13 ? 0.007   -13.180 -11.813 1.00 0.00 ? 13 LYS A HG2  6  
ATOM 6517  H HG3  . LYS A 1 13 ? 1.071   -12.657 -13.120 1.00 0.00 ? 13 LYS A HG3  6  
ATOM 6518  H HD2  . LYS A 1 13 ? 0.582   -14.930 -13.548 1.00 0.00 ? 13 LYS A HD2  6  
ATOM 6519  H HD3  . LYS A 1 13 ? 2.224   -14.901 -12.901 1.00 0.00 ? 13 LYS A HD3  6  
ATOM 6520  H HE2  . LYS A 1 13 ? 0.996   -16.705 -11.879 1.00 0.00 ? 13 LYS A HE2  6  
ATOM 6521  H HE3  . LYS A 1 13 ? 1.312   -15.460 -10.672 1.00 0.00 ? 13 LYS A HE3  6  
ATOM 6522  H HZ1  . LYS A 1 13 ? -0.874  -14.884 -10.556 1.00 0.00 ? 13 LYS A HZ1  6  
ATOM 6523  H HZ2  . LYS A 1 13 ? -1.049  -16.524 -10.932 1.00 0.00 ? 13 LYS A HZ2  6  
ATOM 6524  H HZ3  . LYS A 1 13 ? -1.218  -15.356 -12.144 1.00 0.00 ? 13 LYS A HZ3  6  
ATOM 6525  N N    . ALA A 1 14 ? -0.448  -10.567 -10.407 1.00 0.00 ? 14 ALA A N    6  
ATOM 6526  C CA   . ALA A 1 14 ? -1.770  -10.435 -9.807  1.00 0.00 ? 14 ALA A CA   6  
ATOM 6527  C C    . ALA A 1 14 ? -2.817  -10.081 -10.858 1.00 0.00 ? 14 ALA A C    6  
ATOM 6528  O O    . ALA A 1 14 ? -2.559  -9.288  -11.764 1.00 0.00 ? 14 ALA A O    6  
ATOM 6529  C CB   . ALA A 1 14 ? -1.748  -9.384  -8.707  1.00 0.00 ? 14 ALA A CB   6  
ATOM 6530  H H    . ALA A 1 14 ? -0.216  -10.012 -11.180 1.00 0.00 ? 14 ALA A H    6  
ATOM 6531  H HA   . ALA A 1 14 ? -2.031  -11.383 -9.360  1.00 0.00 ? 14 ALA A HA   6  
ATOM 6532  H HB1  . ALA A 1 14 ? -2.016  -8.423  -9.123  1.00 0.00 ? 14 ALA A HB1  6  
ATOM 6533  H HB2  . ALA A 1 14 ? -2.455  -9.654  -7.937  1.00 0.00 ? 14 ALA A HB2  6  
ATOM 6534  H HB3  . ALA A 1 14 ? -0.757  -9.329  -8.283  1.00 0.00 ? 14 ALA A HB3  6  
ATOM 6535  N N    . LYS A 1 15 ? -3.999  -10.674 -10.732 1.00 0.00 ? 15 LYS A N    6  
ATOM 6536  C CA   . LYS A 1 15 ? -5.087  -10.421 -11.670 1.00 0.00 ? 15 LYS A CA   6  
ATOM 6537  C C    . LYS A 1 15 ? -5.557  -8.973  -11.580 1.00 0.00 ? 15 LYS A C    6  
ATOM 6538  O O    . LYS A 1 15 ? -5.220  -8.257  -10.637 1.00 0.00 ? 15 LYS A O    6  
ATOM 6539  C CB   . LYS A 1 15 ? -6.257  -11.367 -11.393 1.00 0.00 ? 15 LYS A CB   6  
ATOM 6540  C CG   . LYS A 1 15 ? -6.881  -11.178 -10.021 1.00 0.00 ? 15 LYS A CG   6  
ATOM 6541  C CD   . LYS A 1 15 ? -8.028  -12.147 -9.792  1.00 0.00 ? 15 LYS A CD   6  
ATOM 6542  C CE   . LYS A 1 15 ? -9.277  -11.721 -10.549 1.00 0.00 ? 15 LYS A CE   6  
ATOM 6543  N NZ   . LYS A 1 15 ? -10.191 -12.869 -10.803 1.00 0.00 ? 15 LYS A NZ   6  
ATOM 6544  H H    . LYS A 1 15 ? -4.145  -11.296 -9.988  1.00 0.00 ? 15 LYS A H    6  
ATOM 6545  H HA   . LYS A 1 15 ? -4.714  -10.605 -12.667 1.00 0.00 ? 15 LYS A HA   6  
ATOM 6546  H HB2  . LYS A 1 15 ? -7.021  -11.203 -12.139 1.00 0.00 ? 15 LYS A HB2  6  
ATOM 6547  H HB3  . LYS A 1 15 ? -5.906  -12.386 -11.468 1.00 0.00 ? 15 LYS A HB3  6  
ATOM 6548  H HG2  . LYS A 1 15 ? -6.127  -11.345 -9.267  1.00 0.00 ? 15 LYS A HG2  6  
ATOM 6549  H HG3  . LYS A 1 15 ? -7.254  -10.167 -9.942  1.00 0.00 ? 15 LYS A HG3  6  
ATOM 6550  H HD2  . LYS A 1 15 ? -7.733  -13.128 -10.132 1.00 0.00 ? 15 LYS A HD2  6  
ATOM 6551  H HD3  . LYS A 1 15 ? -8.253  -12.182 -8.735  1.00 0.00 ? 15 LYS A HD3  6  
ATOM 6552  H HE2  . LYS A 1 15 ? -9.800  -10.979 -9.965  1.00 0.00 ? 15 LYS A HE2  6  
ATOM 6553  H HE3  . LYS A 1 15 ? -8.980  -11.292 -11.494 1.00 0.00 ? 15 LYS A HE3  6  
ATOM 6554  H HZ1  . LYS A 1 15 ? -9.811  -13.732 -10.363 1.00 0.00 ? 15 LYS A HZ1  6  
ATOM 6555  H HZ2  . LYS A 1 15 ? -10.287 -13.029 -11.826 1.00 0.00 ? 15 LYS A HZ2  6  
ATOM 6556  H HZ3  . LYS A 1 15 ? -11.130 -12.674 -10.403 1.00 0.00 ? 15 LYS A HZ3  6  
ATOM 6557  N N    . LYS A 1 16 ? -6.340  -8.548  -12.566 1.00 0.00 ? 16 LYS A N    6  
ATOM 6558  C CA   . LYS A 1 16 ? -6.860  -7.186  -12.598 1.00 0.00 ? 16 LYS A CA   6  
ATOM 6559  C C    . LYS A 1 16 ? -7.389  -6.774  -11.228 1.00 0.00 ? 16 LYS A C    6  
ATOM 6560  O O    . LYS A 1 16 ? -8.160  -7.502  -10.604 1.00 0.00 ? 16 LYS A O    6  
ATOM 6561  C CB   . LYS A 1 16 ? -7.972  -7.067  -13.643 1.00 0.00 ? 16 LYS A CB   6  
ATOM 6562  C CG   . LYS A 1 16 ? -7.460  -6.827  -15.052 1.00 0.00 ? 16 LYS A CG   6  
ATOM 6563  C CD   . LYS A 1 16 ? -8.486  -7.235  -16.096 1.00 0.00 ? 16 LYS A CD   6  
ATOM 6564  C CE   . LYS A 1 16 ? -8.552  -8.747  -16.251 1.00 0.00 ? 16 LYS A CE   6  
ATOM 6565  N NZ   . LYS A 1 16 ? -9.480  -9.152  -17.342 1.00 0.00 ? 16 LYS A NZ   6  
ATOM 6566  H H    . LYS A 1 16 ? -6.574  -9.166  -13.291 1.00 0.00 ? 16 LYS A H    6  
ATOM 6567  H HA   . LYS A 1 16 ? -6.050  -6.527  -12.871 1.00 0.00 ? 16 LYS A HA   6  
ATOM 6568  H HB2  . LYS A 1 16 ? -8.549  -7.980  -13.642 1.00 0.00 ? 16 LYS A HB2  6  
ATOM 6569  H HB3  . LYS A 1 16 ? -8.617  -6.244  -13.372 1.00 0.00 ? 16 LYS A HB3  6  
ATOM 6570  H HG2  . LYS A 1 16 ? -7.239  -5.777  -15.171 1.00 0.00 ? 16 LYS A HG2  6  
ATOM 6571  H HG3  . LYS A 1 16 ? -6.558  -7.405  -15.201 1.00 0.00 ? 16 LYS A HG3  6  
ATOM 6572  H HD2  . LYS A 1 16 ? -9.457  -6.873  -15.794 1.00 0.00 ? 16 LYS A HD2  6  
ATOM 6573  H HD3  . LYS A 1 16 ? -8.215  -6.796  -17.045 1.00 0.00 ? 16 LYS A HD3  6  
ATOM 6574  H HE2  . LYS A 1 16 ? -7.563  -9.116  -16.476 1.00 0.00 ? 16 LYS A HE2  6  
ATOM 6575  H HE3  . LYS A 1 16 ? -8.893  -9.176  -15.321 1.00 0.00 ? 16 LYS A HE3  6  
ATOM 6576  H HZ1  . LYS A 1 16 ? -9.279  -10.129 -17.638 1.00 0.00 ? 16 LYS A HZ1  6  
ATOM 6577  H HZ2  . LYS A 1 16 ? -9.365  -8.523  -18.162 1.00 0.00 ? 16 LYS A HZ2  6  
ATOM 6578  H HZ3  . LYS A 1 16 ? -10.465 -9.098  -17.012 1.00 0.00 ? 16 LYS A HZ3  6  
ATOM 6579  N N    . GLY A 1 17 ? -6.970  -5.599  -10.766 1.00 0.00 ? 17 GLY A N    6  
ATOM 6580  C CA   . GLY A 1 17 ? -7.413  -5.110  -9.473  1.00 0.00 ? 17 GLY A CA   6  
ATOM 6581  C C    . GLY A 1 17 ? -7.138  -3.631  -9.288  1.00 0.00 ? 17 GLY A C    6  
ATOM 6582  O O    . GLY A 1 17 ? -6.152  -3.251  -8.656  1.00 0.00 ? 17 GLY A O    6  
ATOM 6583  H H    . GLY A 1 17 ? -6.355  -5.061  -11.307 1.00 0.00 ? 17 GLY A H    6  
ATOM 6584  H HA2  . GLY A 1 17 ? -8.475  -5.283  -9.380  1.00 0.00 ? 17 GLY A HA2  6  
ATOM 6585  H HA3  . GLY A 1 17 ? -6.900  -5.660  -8.698  1.00 0.00 ? 17 GLY A HA3  6  
ATOM 6586  N N    . ARG A 1 18 ? -8.011  -2.795  -9.840  1.00 0.00 ? 18 ARG A N    6  
ATOM 6587  C CA   . ARG A 1 18 ? -7.856  -1.349  -9.735  1.00 0.00 ? 18 ARG A CA   6  
ATOM 6588  C C    . ARG A 1 18 ? -9.123  -0.705  -9.179  1.00 0.00 ? 18 ARG A C    6  
ATOM 6589  O O    . ARG A 1 18 ? -9.232  0.519   -9.115  1.00 0.00 ? 18 ARG A O    6  
ATOM 6590  C CB   . ARG A 1 18 ? -7.524  -0.749  -11.102 1.00 0.00 ? 18 ARG A CB   6  
ATOM 6591  C CG   . ARG A 1 18 ? -8.567  -1.047  -12.167 1.00 0.00 ? 18 ARG A CG   6  
ATOM 6592  C CD   . ARG A 1 18 ? -9.661  0.009   -12.186 1.00 0.00 ? 18 ARG A CD   6  
ATOM 6593  N NE   . ARG A 1 18 ? -9.186  1.279   -12.728 1.00 0.00 ? 18 ARG A NE   6  
ATOM 6594  C CZ   . ARG A 1 18 ? -9.952  2.357   -12.853 1.00 0.00 ? 18 ARG A CZ   6  
ATOM 6595  N NH1  . ARG A 1 18 ? -11.223 2.319   -12.475 1.00 0.00 ? 18 ARG A NH1  6  
ATOM 6596  N NH2  . ARG A 1 18 ? -9.448  3.477   -13.356 1.00 0.00 ? 18 ARG A NH2  6  
ATOM 6597  H H    . ARG A 1 18 ? -8.778  -3.159  -10.331 1.00 0.00 ? 18 ARG A H    6  
ATOM 6598  H HA   . ARG A 1 18 ? -7.039  -1.152  -9.057  1.00 0.00 ? 18 ARG A HA   6  
ATOM 6599  H HB2  . ARG A 1 18 ? -7.440  0.323   -11.002 1.00 0.00 ? 18 ARG A HB2  6  
ATOM 6600  H HB3  . ARG A 1 18 ? -6.577  -1.147  -11.435 1.00 0.00 ? 18 ARG A HB3  6  
ATOM 6601  H HG2  . ARG A 1 18 ? -8.085  -1.067  -13.134 1.00 0.00 ? 18 ARG A HG2  6  
ATOM 6602  H HG3  . ARG A 1 18 ? -9.011  -2.010  -11.963 1.00 0.00 ? 18 ARG A HG3  6  
ATOM 6603  H HD2  . ARG A 1 18 ? -10.478 -0.348  -12.795 1.00 0.00 ? 18 ARG A HD2  6  
ATOM 6604  H HD3  . ARG A 1 18 ? -10.008 0.167   -11.175 1.00 0.00 ? 18 ARG A HD3  6  
ATOM 6605  H HE   . ARG A 1 18 ? -8.250  1.330   -13.014 1.00 0.00 ? 18 ARG A HE   6  
ATOM 6606  H HH11 . ARG A 1 18 ? -11.605 1.477   -12.095 1.00 0.00 ? 18 ARG A HH11 6  
ATOM 6607  H HH12 . ARG A 1 18 ? -11.797 3.133   -12.569 1.00 0.00 ? 18 ARG A HH12 6  
ATOM 6608  H HH21 . ARG A 1 18 ? -8.490  3.509   -13.641 1.00 0.00 ? 18 ARG A HH21 6  
ATOM 6609  H HH22 . ARG A 1 18 ? -10.025 4.287   -13.449 1.00 0.00 ? 18 ARG A HH22 6  
ATOM 6610  N N    . ARG A 1 19 ? -10.078 -1.539  -8.780  1.00 0.00 ? 19 ARG A N    6  
ATOM 6611  C CA   . ARG A 1 19 ? -11.338 -1.051  -8.231  1.00 0.00 ? 19 ARG A CA   6  
ATOM 6612  C C    . ARG A 1 19 ? -11.490 -1.462  -6.770  1.00 0.00 ? 19 ARG A C    6  
ATOM 6613  O O    . ARG A 1 19 ? -10.924 -2.465  -6.334  1.00 0.00 ? 19 ARG A O    6  
ATOM 6614  C CB   . ARG A 1 19 ? -12.515 -1.587  -9.048  1.00 0.00 ? 19 ARG A CB   6  
ATOM 6615  C CG   . ARG A 1 19 ? -12.619 -3.103  -9.044  1.00 0.00 ? 19 ARG A CG   6  
ATOM 6616  C CD   . ARG A 1 19 ? -13.864 -3.578  -9.778  1.00 0.00 ? 19 ARG A CD   6  
ATOM 6617  N NE   . ARG A 1 19 ? -15.086 -3.039  -9.187  1.00 0.00 ? 19 ARG A NE   6  
ATOM 6618  C CZ   . ARG A 1 19 ? -15.591 -1.851  -9.498  1.00 0.00 ? 19 ARG A CZ   6  
ATOM 6619  N NH1  . ARG A 1 19 ? -14.982 -1.081  -10.390 1.00 0.00 ? 19 ARG A NH1  6  
ATOM 6620  N NH2  . ARG A 1 19 ? -16.708 -1.430  -8.918  1.00 0.00 ? 19 ARG A NH2  6  
ATOM 6621  H H    . ARG A 1 19 ? -9.932  -2.505  -8.856  1.00 0.00 ? 19 ARG A H    6  
ATOM 6622  H HA   . ARG A 1 19 ? -11.330 0.027   -8.291  1.00 0.00 ? 19 ARG A HA   6  
ATOM 6623  H HB2  . ARG A 1 19 ? -13.432 -1.184  -8.643  1.00 0.00 ? 19 ARG A HB2  6  
ATOM 6624  H HB3  . ARG A 1 19 ? -12.407 -1.258  -10.070 1.00 0.00 ? 19 ARG A HB3  6  
ATOM 6625  H HG2  . ARG A 1 19 ? -11.749 -3.516  -9.532  1.00 0.00 ? 19 ARG A HG2  6  
ATOM 6626  H HG3  . ARG A 1 19 ? -12.660 -3.449  -8.022  1.00 0.00 ? 19 ARG A HG3  6  
ATOM 6627  H HD2  . ARG A 1 19 ? -13.803 -3.259  -10.807 1.00 0.00 ? 19 ARG A HD2  6  
ATOM 6628  H HD3  . ARG A 1 19 ? -13.900 -4.656  -9.737  1.00 0.00 ? 19 ARG A HD3  6  
ATOM 6629  H HE   . ARG A 1 19 ? -15.552 -3.591  -8.526  1.00 0.00 ? 19 ARG A HE   6  
ATOM 6630  H HH11 . ARG A 1 19 ? -14.142 -1.396  -10.830 1.00 0.00 ? 19 ARG A HH11 6  
ATOM 6631  H HH12 . ARG A 1 19 ? -15.365 -0.187  -10.624 1.00 0.00 ? 19 ARG A HH12 6  
ATOM 6632  H HH21 . ARG A 1 19 ? -17.170 -2.008  -8.245  1.00 0.00 ? 19 ARG A HH21 6  
ATOM 6633  H HH22 . ARG A 1 19 ? -17.087 -0.536  -9.153  1.00 0.00 ? 19 ARG A HH22 6  
ATOM 6634  N N    . SER A 1 20 ? -12.258 -0.680  -6.017  1.00 0.00 ? 20 SER A N    6  
ATOM 6635  C CA   . SER A 1 20 ? -12.481 -0.960  -4.604  1.00 0.00 ? 20 SER A CA   6  
ATOM 6636  C C    . SER A 1 20 ? -13.649 -1.923  -4.419  1.00 0.00 ? 20 SER A C    6  
ATOM 6637  O O    . SER A 1 20 ? -14.722 -1.732  -4.991  1.00 0.00 ? 20 SER A O    6  
ATOM 6638  C CB   . SER A 1 20 ? -12.750 0.339   -3.841  1.00 0.00 ? 20 SER A CB   6  
ATOM 6639  O OG   . SER A 1 20 ? -13.225 0.073   -2.533  1.00 0.00 ? 20 SER A OG   6  
ATOM 6640  H H    . SER A 1 20 ? -12.682 0.105   -6.423  1.00 0.00 ? 20 SER A H    6  
ATOM 6641  H HA   . SER A 1 20 ? -11.585 -1.419  -4.211  1.00 0.00 ? 20 SER A HA   6  
ATOM 6642  H HB2  . SER A 1 20 ? -11.836 0.908   -3.771  1.00 0.00 ? 20 SER A HB2  6  
ATOM 6643  H HB3  . SER A 1 20 ? -13.494 0.916   -4.371  1.00 0.00 ? 20 SER A HB3  6  
ATOM 6644  H HG   . SER A 1 20 ? -12.621 0.452   -1.890  1.00 0.00 ? 20 SER A HG   6  
ATOM 6645  N N    . ARG A 1 21 ? -13.432 -2.959  -3.615  1.00 0.00 ? 21 ARG A N    6  
ATOM 6646  C CA   . ARG A 1 21 ? -14.465 -3.954  -3.355  1.00 0.00 ? 21 ARG A CA   6  
ATOM 6647  C C    . ARG A 1 21 ? -14.721 -4.093  -1.857  1.00 0.00 ? 21 ARG A C    6  
ATOM 6648  O O    . ARG A 1 21 ? -15.822 -3.824  -1.376  1.00 0.00 ? 21 ARG A O    6  
ATOM 6649  C CB   . ARG A 1 21 ? -14.060 -5.308  -3.942  1.00 0.00 ? 21 ARG A CB   6  
ATOM 6650  C CG   . ARG A 1 21 ? -14.026 -5.327  -5.461  1.00 0.00 ? 21 ARG A CG   6  
ATOM 6651  C CD   . ARG A 1 21 ? -14.010 -6.749  -6.000  1.00 0.00 ? 21 ARG A CD   6  
ATOM 6652  N NE   . ARG A 1 21 ? -12.651 -7.265  -6.140  1.00 0.00 ? 21 ARG A NE   6  
ATOM 6653  C CZ   . ARG A 1 21 ? -12.367 -8.455  -6.660  1.00 0.00 ? 21 ARG A CZ   6  
ATOM 6654  N NH1  . ARG A 1 21 ? -13.342 -9.246  -7.086  1.00 0.00 ? 21 ARG A NH1  6  
ATOM 6655  N NH2  . ARG A 1 21 ? -11.105 -8.855  -6.754  1.00 0.00 ? 21 ARG A NH2  6  
ATOM 6656  H H    . ARG A 1 21 ? -12.555 -3.058  -3.188  1.00 0.00 ? 21 ARG A H    6  
ATOM 6657  H HA   . ARG A 1 21 ? -15.374 -3.622  -3.834  1.00 0.00 ? 21 ARG A HA   6  
ATOM 6658  H HB2  . ARG A 1 21 ? -13.075 -5.564  -3.579  1.00 0.00 ? 21 ARG A HB2  6  
ATOM 6659  H HB3  . ARG A 1 21 ? -14.764 -6.056  -3.609  1.00 0.00 ? 21 ARG A HB3  6  
ATOM 6660  H HG2  . ARG A 1 21 ? -14.903 -4.821  -5.838  1.00 0.00 ? 21 ARG A HG2  6  
ATOM 6661  H HG3  . ARG A 1 21 ? -13.138 -4.813  -5.798  1.00 0.00 ? 21 ARG A HG3  6  
ATOM 6662  H HD2  . ARG A 1 21 ? -14.558 -7.384  -5.320  1.00 0.00 ? 21 ARG A HD2  6  
ATOM 6663  H HD3  . ARG A 1 21 ? -14.491 -6.758  -6.967  1.00 0.00 ? 21 ARG A HD3  6  
ATOM 6664  H HE   . ARG A 1 21 ? -11.915 -6.697  -5.832  1.00 0.00 ? 21 ARG A HE   6  
ATOM 6665  H HH11 . ARG A 1 21 ? -14.294 -8.946  -7.017  1.00 0.00 ? 21 ARG A HH11 6  
ATOM 6666  H HH12 . ARG A 1 21 ? -13.126 -10.140 -7.477  1.00 0.00 ? 21 ARG A HH12 6  
ATOM 6667  H HH21 . ARG A 1 21 ? -10.368 -8.261  -6.434  1.00 0.00 ? 21 ARG A HH21 6  
ATOM 6668  H HH22 . ARG A 1 21 ? -10.893 -9.750  -7.144  1.00 0.00 ? 21 ARG A HH22 6  
ATOM 6669  N N    . THR A 1 22 ? -13.696 -4.517  -1.124  1.00 0.00 ? 22 THR A N    6  
ATOM 6670  C CA   . THR A 1 22 ? -13.809 -4.694  0.319   1.00 0.00 ? 22 THR A CA   6  
ATOM 6671  C C    . THR A 1 22 ? -13.327 -3.455  1.064   1.00 0.00 ? 22 THR A C    6  
ATOM 6672  O O    . THR A 1 22 ? -12.185 -3.025  0.901   1.00 0.00 ? 22 THR A O    6  
ATOM 6673  C CB   . THR A 1 22 ? -13.004 -5.915  0.800   1.00 0.00 ? 22 THR A CB   6  
ATOM 6674  O OG1  . THR A 1 22 ? -11.629 -5.775  0.423   1.00 0.00 ? 22 THR A OG1  6  
ATOM 6675  C CG2  . THR A 1 22 ? -13.567 -7.201  0.212   1.00 0.00 ? 22 THR A CG2  6  
ATOM 6676  H H    . THR A 1 22 ? -12.844 -4.716  -1.565  1.00 0.00 ? 22 THR A H    6  
ATOM 6677  H HA   . THR A 1 22 ? -14.851 -4.861  0.553   1.00 0.00 ? 22 THR A HA   6  
ATOM 6678  H HB   . THR A 1 22 ? -13.070 -5.970  1.877   1.00 0.00 ? 22 THR A HB   6  
ATOM 6679  H HG1  . THR A 1 22 ? -11.079 -5.790  1.210   1.00 0.00 ? 22 THR A HG1  6  
ATOM 6680  H HG21 . THR A 1 22 ? -12.776 -7.749  -0.279  1.00 0.00 ? 22 THR A HG21 6  
ATOM 6681  H HG22 . THR A 1 22 ? -14.338 -6.961  -0.504  1.00 0.00 ? 22 THR A HG22 6  
ATOM 6682  H HG23 . THR A 1 22 ? -13.985 -7.804  1.004   1.00 0.00 ? 22 THR A HG23 6  
ATOM 6683  N N    . VAL A 1 23 ? -14.203 -2.884  1.884   1.00 0.00 ? 23 VAL A N    6  
ATOM 6684  C CA   . VAL A 1 23 ? -13.865 -1.695  2.657   1.00 0.00 ? 23 VAL A CA   6  
ATOM 6685  C C    . VAL A 1 23 ? -13.241 -2.069  3.996   1.00 0.00 ? 23 VAL A C    6  
ATOM 6686  O O    . VAL A 1 23 ? -13.632 -3.054  4.623   1.00 0.00 ? 23 VAL A O    6  
ATOM 6687  C CB   . VAL A 1 23 ? -15.106 -0.818  2.909   1.00 0.00 ? 23 VAL A CB   6  
ATOM 6688  C CG1  . VAL A 1 23 ? -15.705 -0.350  1.592   1.00 0.00 ? 23 VAL A CG1  6  
ATOM 6689  C CG2  . VAL A 1 23 ? -16.136 -1.577  3.732   1.00 0.00 ? 23 VAL A CG2  6  
ATOM 6690  H H    . VAL A 1 23 ? -15.099 -3.273  1.972   1.00 0.00 ? 23 VAL A H    6  
ATOM 6691  H HA   . VAL A 1 23 ? -13.152 -1.118  2.087   1.00 0.00 ? 23 VAL A HA   6  
ATOM 6692  H HB   . VAL A 1 23 ? -14.799 0.053   3.469   1.00 0.00 ? 23 VAL A HB   6  
ATOM 6693  H HG11 . VAL A 1 23 ? -15.529 -1.096  0.831   1.00 0.00 ? 23 VAL A HG11 6  
ATOM 6694  H HG12 . VAL A 1 23 ? -16.768 -0.200  1.712   1.00 0.00 ? 23 VAL A HG12 6  
ATOM 6695  H HG13 . VAL A 1 23 ? -15.242 0.580   1.296   1.00 0.00 ? 23 VAL A HG13 6  
ATOM 6696  H HG21 . VAL A 1 23 ? -17.109 -1.132  3.589   1.00 0.00 ? 23 VAL A HG21 6  
ATOM 6697  H HG22 . VAL A 1 23 ? -16.162 -2.609  3.415   1.00 0.00 ? 23 VAL A HG22 6  
ATOM 6698  H HG23 . VAL A 1 23 ? -15.868 -1.528  4.777   1.00 0.00 ? 23 VAL A HG23 6  
ATOM 6699  N N    . PHE A 1 24 ? -12.267 -1.276  4.431   1.00 0.00 ? 24 PHE A N    6  
ATOM 6700  C CA   . PHE A 1 24 ? -11.587 -1.523  5.697   1.00 0.00 ? 24 PHE A CA   6  
ATOM 6701  C C    . PHE A 1 24 ? -12.336 -0.868  6.854   1.00 0.00 ? 24 PHE A C    6  
ATOM 6702  O O    . PHE A 1 24 ? -12.845 0.246   6.728   1.00 0.00 ? 24 PHE A O    6  
ATOM 6703  C CB   . PHE A 1 24 ? -10.152 -0.997  5.641   1.00 0.00 ? 24 PHE A CB   6  
ATOM 6704  C CG   . PHE A 1 24 ? -9.363  -1.529  4.478   1.00 0.00 ? 24 PHE A CG   6  
ATOM 6705  C CD1  . PHE A 1 24 ? -9.561  -1.028  3.202   1.00 0.00 ? 24 PHE A CD1  6  
ATOM 6706  C CD2  . PHE A 1 24 ? -8.425  -2.532  4.662   1.00 0.00 ? 24 PHE A CD2  6  
ATOM 6707  C CE1  . PHE A 1 24 ? -8.837  -1.515  2.130   1.00 0.00 ? 24 PHE A CE1  6  
ATOM 6708  C CE2  . PHE A 1 24 ? -7.697  -3.023  3.594   1.00 0.00 ? 24 PHE A CE2  6  
ATOM 6709  C CZ   . PHE A 1 24 ? -7.905  -2.515  2.327   1.00 0.00 ? 24 PHE A CZ   6  
ATOM 6710  H H    . PHE A 1 24 ? -12.000 -0.505  3.887   1.00 0.00 ? 24 PHE A H    6  
ATOM 6711  H HA   . PHE A 1 24 ? -11.564 -2.590  5.857   1.00 0.00 ? 24 PHE A HA   6  
ATOM 6712  H HB2  . PHE A 1 24 ? -10.173 0.079   5.561   1.00 0.00 ? 24 PHE A HB2  6  
ATOM 6713  H HB3  . PHE A 1 24 ? -9.638  -1.276  6.548   1.00 0.00 ? 24 PHE A HB3  6  
ATOM 6714  H HD1  . PHE A 1 24 ? -10.291 -0.245  3.047   1.00 0.00 ? 24 PHE A HD1  6  
ATOM 6715  H HD2  . PHE A 1 24 ? -8.262  -2.931  5.652   1.00 0.00 ? 24 PHE A HD2  6  
ATOM 6716  H HE1  . PHE A 1 24 ? -9.001  -1.115  1.141   1.00 0.00 ? 24 PHE A HE1  6  
ATOM 6717  H HE2  . PHE A 1 24 ? -6.969  -3.805  3.750   1.00 0.00 ? 24 PHE A HE2  6  
ATOM 6718  H HZ   . PHE A 1 24 ? -7.337  -2.897  1.491   1.00 0.00 ? 24 PHE A HZ   6  
ATOM 6719  N N    . THR A 1 25 ? -12.399 -1.569  7.982   1.00 0.00 ? 25 THR A N    6  
ATOM 6720  C CA   . THR A 1 25 ? -13.087 -1.058  9.162   1.00 0.00 ? 25 THR A CA   6  
ATOM 6721  C C    . THR A 1 25 ? -12.141 -0.247  10.041  1.00 0.00 ? 25 THR A C    6  
ATOM 6722  O O    . THR A 1 25 ? -10.927 -0.262  9.840   1.00 0.00 ? 25 THR A O    6  
ATOM 6723  C CB   . THR A 1 25 ? -13.694 -2.201  9.997   1.00 0.00 ? 25 THR A CB   6  
ATOM 6724  O OG1  . THR A 1 25 ? -12.734 -2.676  10.948  1.00 0.00 ? 25 THR A OG1  6  
ATOM 6725  C CG2  . THR A 1 25 ? -14.139 -3.347  9.102   1.00 0.00 ? 25 THR A CG2  6  
ATOM 6726  H H    . THR A 1 25 ? -11.974 -2.451  8.021   1.00 0.00 ? 25 THR A H    6  
ATOM 6727  H HA   . THR A 1 25 ? -13.890 -0.418  8.828   1.00 0.00 ? 25 THR A HA   6  
ATOM 6728  H HB   . THR A 1 25 ? -14.556 -1.820  10.526  1.00 0.00 ? 25 THR A HB   6  
ATOM 6729  H HG1  . THR A 1 25 ? -13.119 -2.655  11.828  1.00 0.00 ? 25 THR A HG1  6  
ATOM 6730  H HG21 . THR A 1 25 ? -14.418 -2.961  8.133   1.00 0.00 ? 25 THR A HG21 6  
ATOM 6731  H HG22 . THR A 1 25 ? -14.988 -3.844  9.550   1.00 0.00 ? 25 THR A HG22 6  
ATOM 6732  H HG23 . THR A 1 25 ? -13.328 -4.051  8.989   1.00 0.00 ? 25 THR A HG23 6  
ATOM 6733  N N    . GLU A 1 26 ? -12.706 0.458   11.016  1.00 0.00 ? 26 GLU A N    6  
ATOM 6734  C CA   . GLU A 1 26 ? -11.911 1.275   11.926  1.00 0.00 ? 26 GLU A CA   6  
ATOM 6735  C C    . GLU A 1 26 ? -10.813 0.444   12.584  1.00 0.00 ? 26 GLU A C    6  
ATOM 6736  O O    . GLU A 1 26 ? -9.710  0.935   12.828  1.00 0.00 ? 26 GLU A O    6  
ATOM 6737  C CB   . GLU A 1 26 ? -12.806 1.900   12.999  1.00 0.00 ? 26 GLU A CB   6  
ATOM 6738  C CG   . GLU A 1 26 ? -13.604 3.095   12.505  1.00 0.00 ? 26 GLU A CG   6  
ATOM 6739  C CD   . GLU A 1 26 ? -14.478 2.760   11.312  1.00 0.00 ? 26 GLU A CD   6  
ATOM 6740  O OE1  . GLU A 1 26 ? -15.536 2.128   11.512  1.00 0.00 ? 26 GLU A OE1  6  
ATOM 6741  O OE2  . GLU A 1 26 ? -14.104 3.130   10.180  1.00 0.00 ? 26 GLU A OE2  6  
ATOM 6742  H H    . GLU A 1 26 ? -13.679 0.429   11.125  1.00 0.00 ? 26 GLU A H    6  
ATOM 6743  H HA   . GLU A 1 26 ? -11.453 2.063   11.349  1.00 0.00 ? 26 GLU A HA   6  
ATOM 6744  H HB2  . GLU A 1 26 ? -13.499 1.151   13.353  1.00 0.00 ? 26 GLU A HB2  6  
ATOM 6745  H HB3  . GLU A 1 26 ? -12.186 2.223   13.822  1.00 0.00 ? 26 GLU A HB3  6  
ATOM 6746  H HG2  . GLU A 1 26 ? -14.235 3.446   13.307  1.00 0.00 ? 26 GLU A HG2  6  
ATOM 6747  H HG3  . GLU A 1 26 ? -12.916 3.878   12.221  1.00 0.00 ? 26 GLU A HG3  6  
ATOM 6748  N N    . LEU A 1 27 ? -11.123 -0.816  12.869  1.00 0.00 ? 27 LEU A N    6  
ATOM 6749  C CA   . LEU A 1 27 ? -10.164 -1.716  13.500  1.00 0.00 ? 27 LEU A CA   6  
ATOM 6750  C C    . LEU A 1 27 ? -9.045  -2.085  12.531  1.00 0.00 ? 27 LEU A C    6  
ATOM 6751  O O    . LEU A 1 27 ? -7.871  -1.828  12.797  1.00 0.00 ? 27 LEU A O    6  
ATOM 6752  C CB   . LEU A 1 27 ? -10.868 -2.982  13.989  1.00 0.00 ? 27 LEU A CB   6  
ATOM 6753  C CG   . LEU A 1 27 ? -10.179 -3.737  15.126  1.00 0.00 ? 27 LEU A CG   6  
ATOM 6754  C CD1  . LEU A 1 27 ? -10.551 -3.132  16.471  1.00 0.00 ? 27 LEU A CD1  6  
ATOM 6755  C CD2  . LEU A 1 27 ? -10.543 -5.214  15.084  1.00 0.00 ? 27 LEU A CD2  6  
ATOM 6756  H H    . LEU A 1 27 ? -12.018 -1.150  12.651  1.00 0.00 ? 27 LEU A H    6  
ATOM 6757  H HA   . LEU A 1 27 ? -9.735  -1.202  14.347  1.00 0.00 ? 27 LEU A HA   6  
ATOM 6758  H HB2  . LEU A 1 27 ? -11.854 -2.702  14.328  1.00 0.00 ? 27 LEU A HB2  6  
ATOM 6759  H HB3  . LEU A 1 27 ? -10.957 -3.656  13.149  1.00 0.00 ? 27 LEU A HB3  6  
ATOM 6760  H HG   . LEU A 1 27 ? -9.107  -3.652  15.008  1.00 0.00 ? 27 LEU A HG   6  
ATOM 6761  H HD11 . LEU A 1 27 ? -11.324 -2.391  16.331  1.00 0.00 ? 27 LEU A HD11 6  
ATOM 6762  H HD12 . LEU A 1 27 ? -9.681  -2.667  16.910  1.00 0.00 ? 27 LEU A HD12 6  
ATOM 6763  H HD13 . LEU A 1 27 ? -10.912 -3.910  17.128  1.00 0.00 ? 27 LEU A HD13 6  
ATOM 6764  H HD21 . LEU A 1 27 ? -11.533 -5.328  14.667  1.00 0.00 ? 27 LEU A HD21 6  
ATOM 6765  H HD22 . LEU A 1 27 ? -10.526 -5.617  16.087  1.00 0.00 ? 27 LEU A HD22 6  
ATOM 6766  H HD23 . LEU A 1 27 ? -9.830  -5.743  14.470  1.00 0.00 ? 27 LEU A HD23 6  
ATOM 6767  N N    . GLN A 1 28 ? -9.418  -2.687  11.406  1.00 0.00 ? 28 GLN A N    6  
ATOM 6768  C CA   . GLN A 1 28 ? -8.446  -3.089  10.397  1.00 0.00 ? 28 GLN A CA   6  
ATOM 6769  C C    . GLN A 1 28 ? -7.577  -1.909  9.977   1.00 0.00 ? 28 GLN A C    6  
ATOM 6770  O O    . GLN A 1 28 ? -6.353  -2.024  9.890   1.00 0.00 ? 28 GLN A O    6  
ATOM 6771  C CB   . GLN A 1 28 ? -9.158  -3.673  9.176   1.00 0.00 ? 28 GLN A CB   6  
ATOM 6772  C CG   . GLN A 1 28 ? -10.085 -4.832  9.508   1.00 0.00 ? 28 GLN A CG   6  
ATOM 6773  C CD   . GLN A 1 28 ? -9.471  -5.806  10.494  1.00 0.00 ? 28 GLN A CD   6  
ATOM 6774  O OE1  . GLN A 1 28 ? -9.137  -5.439  11.621  1.00 0.00 ? 28 GLN A OE1  6  
ATOM 6775  N NE2  . GLN A 1 28 ? -9.318  -7.056  10.074  1.00 0.00 ? 28 GLN A NE2  6  
ATOM 6776  H H    . GLN A 1 28 ? -10.369 -2.865  11.252  1.00 0.00 ? 28 GLN A H    6  
ATOM 6777  H HA   . GLN A 1 28 ? -7.813  -3.849  10.831  1.00 0.00 ? 28 GLN A HA   6  
ATOM 6778  H HB2  . GLN A 1 28 ? -9.743  -2.895  8.709   1.00 0.00 ? 28 GLN A HB2  6  
ATOM 6779  H HB3  . GLN A 1 28 ? -8.416  -4.025  8.475   1.00 0.00 ? 28 GLN A HB3  6  
ATOM 6780  H HG2  . GLN A 1 28 ? -10.995 -4.437  9.936   1.00 0.00 ? 28 GLN A HG2  6  
ATOM 6781  H HG3  . GLN A 1 28 ? -10.318 -5.362  8.597   1.00 0.00 ? 28 GLN A HG3  6  
ATOM 6782  H HE21 . GLN A 1 28 ? -9.605  -7.276  9.163   1.00 0.00 ? 28 GLN A HE21 6  
ATOM 6783  H HE22 . GLN A 1 28 ? -8.923  -7.707  10.690  1.00 0.00 ? 28 GLN A HE22 6  
ATOM 6784  N N    . LEU A 1 29 ? -8.215  -0.774  9.716   1.00 0.00 ? 29 LEU A N    6  
ATOM 6785  C CA   . LEU A 1 29 ? -7.501  0.430   9.304   1.00 0.00 ? 29 LEU A CA   6  
ATOM 6786  C C    . LEU A 1 29 ? -6.515  0.873   10.381  1.00 0.00 ? 29 LEU A C    6  
ATOM 6787  O O    . LEU A 1 29 ? -5.349  1.145   10.094  1.00 0.00 ? 29 LEU A O    6  
ATOM 6788  C CB   . LEU A 1 29 ? -8.490  1.558   9.007   1.00 0.00 ? 29 LEU A CB   6  
ATOM 6789  C CG   . LEU A 1 29 ? -9.177  1.506   7.642   1.00 0.00 ? 29 LEU A CG   6  
ATOM 6790  C CD1  . LEU A 1 29 ? -10.301 2.528   7.571   1.00 0.00 ? 29 LEU A CD1  6  
ATOM 6791  C CD2  . LEU A 1 29 ? -8.167  1.743   6.528   1.00 0.00 ? 29 LEU A CD2  6  
ATOM 6792  H H    . LEU A 1 29 ? -9.191  -0.742  9.803   1.00 0.00 ? 29 LEU A H    6  
ATOM 6793  H HA   . LEU A 1 29 ? -6.952  0.197   8.404   1.00 0.00 ? 29 LEU A HA   6  
ATOM 6794  H HB2  . LEU A 1 29 ? -9.258  1.532   9.765   1.00 0.00 ? 29 LEU A HB2  6  
ATOM 6795  H HB3  . LEU A 1 29 ? -7.953  2.494   9.074   1.00 0.00 ? 29 LEU A HB3  6  
ATOM 6796  H HG   . LEU A 1 29 ? -9.609  0.525   7.500   1.00 0.00 ? 29 LEU A HG   6  
ATOM 6797  H HD11 . LEU A 1 29 ? -10.101 3.229   6.775   1.00 0.00 ? 29 LEU A HD11 6  
ATOM 6798  H HD12 . LEU A 1 29 ? -10.365 3.058   8.510   1.00 0.00 ? 29 LEU A HD12 6  
ATOM 6799  H HD13 . LEU A 1 29 ? -11.236 2.022   7.379   1.00 0.00 ? 29 LEU A HD13 6  
ATOM 6800  H HD21 . LEU A 1 29 ? -8.419  1.126   5.678   1.00 0.00 ? 29 LEU A HD21 6  
ATOM 6801  H HD22 . LEU A 1 29 ? -7.178  1.487   6.879   1.00 0.00 ? 29 LEU A HD22 6  
ATOM 6802  H HD23 . LEU A 1 29 ? -8.189  2.783   6.238   1.00 0.00 ? 29 LEU A HD23 6  
ATOM 6803  N N    . MET A 1 30 ? -6.990  0.940   11.620  1.00 0.00 ? 30 MET A N    6  
ATOM 6804  C CA   . MET A 1 30 ? -6.149  1.347   12.740  1.00 0.00 ? 30 MET A CA   6  
ATOM 6805  C C    . MET A 1 30 ? -4.804  0.630   12.697  1.00 0.00 ? 30 MET A C    6  
ATOM 6806  O O    . MET A 1 30 ? -3.759  1.235   12.934  1.00 0.00 ? 30 MET A O    6  
ATOM 6807  C CB   . MET A 1 30 ? -6.854  1.056   14.066  1.00 0.00 ? 30 MET A CB   6  
ATOM 6808  C CG   . MET A 1 30 ? -5.940  1.162   15.276  1.00 0.00 ? 30 MET A CG   6  
ATOM 6809  S SD   . MET A 1 30 ? -6.840  1.518   16.798  1.00 0.00 ? 30 MET A SD   6  
ATOM 6810  C CE   . MET A 1 30 ? -6.951  -0.120  17.515  1.00 0.00 ? 30 MET A CE   6  
ATOM 6811  H H    . MET A 1 30 ? -7.929  0.711   11.786  1.00 0.00 ? 30 MET A H    6  
ATOM 6812  H HA   . MET A 1 30 ? -5.980  2.410   12.658  1.00 0.00 ? 30 MET A HA   6  
ATOM 6813  H HB2  . MET A 1 30 ? -7.664  1.758   14.191  1.00 0.00 ? 30 MET A HB2  6  
ATOM 6814  H HB3  . MET A 1 30 ? -7.257  0.055   14.035  1.00 0.00 ? 30 MET A HB3  6  
ATOM 6815  H HG2  . MET A 1 30 ? -5.413  0.227   15.397  1.00 0.00 ? 30 MET A HG2  6  
ATOM 6816  H HG3  . MET A 1 30 ? -5.227  1.954   15.102  1.00 0.00 ? 30 MET A HG3  6  
ATOM 6817  H HE1  . MET A 1 30 ? -7.952  -0.504  17.381  1.00 0.00 ? 30 MET A HE1  6  
ATOM 6818  H HE2  . MET A 1 30 ? -6.246  -0.775  17.027  1.00 0.00 ? 30 MET A HE2  6  
ATOM 6819  H HE3  . MET A 1 30 ? -6.724  -0.066  18.570  1.00 0.00 ? 30 MET A HE3  6  
ATOM 6820  N N    . GLY A 1 31 ? -4.837  -0.665  12.394  1.00 0.00 ? 31 GLY A N    6  
ATOM 6821  C CA   . GLY A 1 31 ? -3.613  -1.442  12.327  1.00 0.00 ? 31 GLY A CA   6  
ATOM 6822  C C    . GLY A 1 31 ? -2.850  -1.213  11.038  1.00 0.00 ? 31 GLY A C    6  
ATOM 6823  O O    . GLY A 1 31 ? -1.646  -0.956  11.058  1.00 0.00 ? 31 GLY A O    6  
ATOM 6824  H H    . GLY A 1 31 ? -5.699  -1.095  12.215  1.00 0.00 ? 31 GLY A H    6  
ATOM 6825  H HA2  . GLY A 1 31 ? -2.982  -1.172  13.160  1.00 0.00 ? 31 GLY A HA2  6  
ATOM 6826  H HA3  . GLY A 1 31 ? -3.862  -2.491  12.402  1.00 0.00 ? 31 GLY A HA3  6  
ATOM 6827  N N    . LEU A 1 32 ? -3.551  -1.306  9.913   1.00 0.00 ? 32 LEU A N    6  
ATOM 6828  C CA   . LEU A 1 32 ? -2.932  -1.108  8.607   1.00 0.00 ? 32 LEU A CA   6  
ATOM 6829  C C    . LEU A 1 32 ? -2.203  0.231   8.548   1.00 0.00 ? 32 LEU A C    6  
ATOM 6830  O O    . LEU A 1 32 ? -1.179  0.361   7.878   1.00 0.00 ? 32 LEU A O    6  
ATOM 6831  C CB   . LEU A 1 32 ? -3.989  -1.175  7.504   1.00 0.00 ? 32 LEU A CB   6  
ATOM 6832  C CG   . LEU A 1 32 ? -4.368  -2.576  7.022   1.00 0.00 ? 32 LEU A CG   6  
ATOM 6833  C CD1  . LEU A 1 32 ? -5.643  -2.528  6.194   1.00 0.00 ? 32 LEU A CD1  6  
ATOM 6834  C CD2  . LEU A 1 32 ? -3.231  -3.190  6.219   1.00 0.00 ? 32 LEU A CD2  6  
ATOM 6835  H H    . LEU A 1 32 ? -4.507  -1.513  9.961   1.00 0.00 ? 32 LEU A H    6  
ATOM 6836  H HA   . LEU A 1 32 ? -2.215  -1.901  8.457   1.00 0.00 ? 32 LEU A HA   6  
ATOM 6837  H HB2  . LEU A 1 32 ? -4.884  -0.699  7.874   1.00 0.00 ? 32 LEU A HB2  6  
ATOM 6838  H HB3  . LEU A 1 32 ? -3.615  -0.622  6.654   1.00 0.00 ? 32 LEU A HB3  6  
ATOM 6839  H HG   . LEU A 1 32 ? -4.552  -3.207  7.880   1.00 0.00 ? 32 LEU A HG   6  
ATOM 6840  H HD11 . LEU A 1 32 ? -5.529  -1.807  5.399   1.00 0.00 ? 32 LEU A HD11 6  
ATOM 6841  H HD12 . LEU A 1 32 ? -6.472  -2.243  6.824   1.00 0.00 ? 32 LEU A HD12 6  
ATOM 6842  H HD13 . LEU A 1 32 ? -5.833  -3.504  5.770   1.00 0.00 ? 32 LEU A HD13 6  
ATOM 6843  H HD21 . LEU A 1 32 ? -3.464  -4.221  5.996   1.00 0.00 ? 32 LEU A HD21 6  
ATOM 6844  H HD22 . LEU A 1 32 ? -2.318  -3.144  6.796   1.00 0.00 ? 32 LEU A HD22 6  
ATOM 6845  H HD23 . LEU A 1 32 ? -3.103  -2.641  5.298   1.00 0.00 ? 32 LEU A HD23 6  
ATOM 6846  N N    . GLU A 1 33 ? -2.737  1.222   9.255   1.00 0.00 ? 33 GLU A N    6  
ATOM 6847  C CA   . GLU A 1 33 ? -2.135  2.550   9.283   1.00 0.00 ? 33 GLU A CA   6  
ATOM 6848  C C    . GLU A 1 33 ? -0.902  2.570   10.182  1.00 0.00 ? 33 GLU A C    6  
ATOM 6849  O O    . GLU A 1 33 ? 0.087   3.240   9.885   1.00 0.00 ? 33 GLU A O    6  
ATOM 6850  C CB   . GLU A 1 33 ? -3.152  3.584   9.770   1.00 0.00 ? 33 GLU A CB   6  
ATOM 6851  C CG   . GLU A 1 33 ? -4.292  3.823   8.794   1.00 0.00 ? 33 GLU A CG   6  
ATOM 6852  C CD   . GLU A 1 33 ? -5.336  4.778   9.340   1.00 0.00 ? 33 GLU A CD   6  
ATOM 6853  O OE1  . GLU A 1 33 ? -4.984  5.618   10.193  1.00 0.00 ? 33 GLU A OE1  6  
ATOM 6854  O OE2  . GLU A 1 33 ? -6.506  4.684   8.912   1.00 0.00 ? 33 GLU A OE2  6  
ATOM 6855  H H    . GLU A 1 33 ? -3.554  1.056   9.769   1.00 0.00 ? 33 GLU A H    6  
ATOM 6856  H HA   . GLU A 1 33 ? -1.835  2.799   8.276   1.00 0.00 ? 33 GLU A HA   6  
ATOM 6857  H HB2  . GLU A 1 33 ? -3.571  3.247   10.706  1.00 0.00 ? 33 GLU A HB2  6  
ATOM 6858  H HB3  . GLU A 1 33 ? -2.642  4.523   9.931   1.00 0.00 ? 33 GLU A HB3  6  
ATOM 6859  H HG2  . GLU A 1 33 ? -3.888  4.238   7.883   1.00 0.00 ? 33 GLU A HG2  6  
ATOM 6860  H HG3  . GLU A 1 33 ? -4.768  2.877   8.578   1.00 0.00 ? 33 GLU A HG3  6  
ATOM 6861  N N    . LYS A 1 34 ? -0.969  1.831   11.284  1.00 0.00 ? 34 LYS A N    6  
ATOM 6862  C CA   . LYS A 1 34 ? 0.140   1.761   12.228  1.00 0.00 ? 34 LYS A CA   6  
ATOM 6863  C C    . LYS A 1 34 ? 1.351   1.082   11.596  1.00 0.00 ? 34 LYS A C    6  
ATOM 6864  O O    . LYS A 1 34 ? 2.492   1.471   11.844  1.00 0.00 ? 34 LYS A O    6  
ATOM 6865  C CB   . LYS A 1 34 ? -0.283  1.004   13.489  1.00 0.00 ? 34 LYS A CB   6  
ATOM 6866  C CG   . LYS A 1 34 ? 0.442   1.458   14.744  1.00 0.00 ? 34 LYS A CG   6  
ATOM 6867  C CD   . LYS A 1 34 ? -0.247  2.651   15.385  1.00 0.00 ? 34 LYS A CD   6  
ATOM 6868  C CE   . LYS A 1 34 ? 0.130   2.789   16.853  1.00 0.00 ? 34 LYS A CE   6  
ATOM 6869  N NZ   . LYS A 1 34 ? -0.367  4.067   17.435  1.00 0.00 ? 34 LYS A NZ   6  
ATOM 6870  H H    . LYS A 1 34 ? -1.785  1.318   11.467  1.00 0.00 ? 34 LYS A H    6  
ATOM 6871  H HA   . LYS A 1 34 ? 0.409   2.771   12.498  1.00 0.00 ? 34 LYS A HA   6  
ATOM 6872  H HB2  . LYS A 1 34 ? -1.343  1.144   13.640  1.00 0.00 ? 34 LYS A HB2  6  
ATOM 6873  H HB3  . LYS A 1 34 ? -0.085  -0.049  13.345  1.00 0.00 ? 34 LYS A HB3  6  
ATOM 6874  H HG2  . LYS A 1 34 ? 0.463   0.644   15.452  1.00 0.00 ? 34 LYS A HG2  6  
ATOM 6875  H HG3  . LYS A 1 34 ? 1.454   1.736   14.483  1.00 0.00 ? 34 LYS A HG3  6  
ATOM 6876  H HD2  . LYS A 1 34 ? 0.047   3.549   14.864  1.00 0.00 ? 34 LYS A HD2  6  
ATOM 6877  H HD3  . LYS A 1 34 ? -1.317  2.521   15.308  1.00 0.00 ? 34 LYS A HD3  6  
ATOM 6878  H HE2  . LYS A 1 34 ? -0.298  1.964   17.400  1.00 0.00 ? 34 LYS A HE2  6  
ATOM 6879  H HE3  . LYS A 1 34 ? 1.206   2.758   16.938  1.00 0.00 ? 34 LYS A HE3  6  
ATOM 6880  H HZ1  . LYS A 1 34 ? 0.309   4.833   17.242  1.00 0.00 ? 34 LYS A HZ1  6  
ATOM 6881  H HZ2  . LYS A 1 34 ? -0.479  3.970   18.464  1.00 0.00 ? 34 LYS A HZ2  6  
ATOM 6882  H HZ3  . LYS A 1 34 ? -1.286  4.316   17.018  1.00 0.00 ? 34 LYS A HZ3  6  
ATOM 6883  N N    . ARG A 1 35 ? 1.094   0.067   10.778  1.00 0.00 ? 35 ARG A N    6  
ATOM 6884  C CA   . ARG A 1 35 ? 2.163   -0.666  10.110  1.00 0.00 ? 35 ARG A CA   6  
ATOM 6885  C C    . ARG A 1 35 ? 2.715   0.131   8.932   1.00 0.00 ? 35 ARG A C    6  
ATOM 6886  O O    . ARG A 1 35 ? 3.928   0.291   8.791   1.00 0.00 ? 35 ARG A O    6  
ATOM 6887  C CB   . ARG A 1 35 ? 1.653   -2.025  9.626   1.00 0.00 ? 35 ARG A CB   6  
ATOM 6888  C CG   . ARG A 1 35 ? 1.784   -3.129  10.663  1.00 0.00 ? 35 ARG A CG   6  
ATOM 6889  C CD   . ARG A 1 35 ? 3.242   -3.442  10.962  1.00 0.00 ? 35 ARG A CD   6  
ATOM 6890  N NE   . ARG A 1 35 ? 3.406   -4.761  11.567  1.00 0.00 ? 35 ARG A NE   6  
ATOM 6891  C CZ   . ARG A 1 35 ? 3.273   -4.995  12.867  1.00 0.00 ? 35 ARG A CZ   6  
ATOM 6892  N NH1  . ARG A 1 35 ? 2.977   -4.004  13.696  1.00 0.00 ? 35 ARG A NH1  6  
ATOM 6893  N NH2  . ARG A 1 35 ? 3.438   -6.224  13.342  1.00 0.00 ? 35 ARG A NH2  6  
ATOM 6894  H H    . ARG A 1 35 ? 0.163   -0.197  10.620  1.00 0.00 ? 35 ARG A H    6  
ATOM 6895  H HA   . ARG A 1 35 ? 2.955   -0.823  10.827  1.00 0.00 ? 35 ARG A HA   6  
ATOM 6896  H HB2  . ARG A 1 35 ? 0.610   -1.932  9.361   1.00 0.00 ? 35 ARG A HB2  6  
ATOM 6897  H HB3  . ARG A 1 35 ? 2.214   -2.315  8.751   1.00 0.00 ? 35 ARG A HB3  6  
ATOM 6898  H HG2  . ARG A 1 35 ? 1.301   -2.812  11.575  1.00 0.00 ? 35 ARG A HG2  6  
ATOM 6899  H HG3  . ARG A 1 35 ? 1.303   -4.020  10.288  1.00 0.00 ? 35 ARG A HG3  6  
ATOM 6900  H HD2  . ARG A 1 35 ? 3.801   -3.407  10.039  1.00 0.00 ? 35 ARG A HD2  6  
ATOM 6901  H HD3  . ARG A 1 35 ? 3.624   -2.695  11.642  1.00 0.00 ? 35 ARG A HD3  6  
ATOM 6902  H HE   . ARG A 1 35 ? 3.625   -5.508  10.972  1.00 0.00 ? 35 ARG A HE   6  
ATOM 6903  H HH11 . ARG A 1 35 ? 2.851   -3.077  13.341  1.00 0.00 ? 35 ARG A HH11 6  
ATOM 6904  H HH12 . ARG A 1 35 ? 2.876   -4.183  14.675  1.00 0.00 ? 35 ARG A HH12 6  
ATOM 6905  H HH21 . ARG A 1 35 ? 3.661   -6.974  12.720  1.00 0.00 ? 35 ARG A HH21 6  
ATOM 6906  H HH22 . ARG A 1 35 ? 3.338   -6.399  14.321  1.00 0.00 ? 35 ARG A HH22 6  
ATOM 6907  N N    . PHE A 1 36 ? 1.817   0.630   8.089   1.00 0.00 ? 36 PHE A N    6  
ATOM 6908  C CA   . PHE A 1 36 ? 2.214   1.409   6.922   1.00 0.00 ? 36 PHE A CA   6  
ATOM 6909  C C    . PHE A 1 36 ? 3.005   2.646   7.338   1.00 0.00 ? 36 PHE A C    6  
ATOM 6910  O O    . PHE A 1 36 ? 4.015   2.985   6.723   1.00 0.00 ? 36 PHE A O    6  
ATOM 6911  C CB   . PHE A 1 36 ? 0.982   1.825   6.117   1.00 0.00 ? 36 PHE A CB   6  
ATOM 6912  C CG   . PHE A 1 36 ? 1.312   2.595   4.870   1.00 0.00 ? 36 PHE A CG   6  
ATOM 6913  C CD1  . PHE A 1 36 ? 1.886   3.854   4.950   1.00 0.00 ? 36 PHE A CD1  6  
ATOM 6914  C CD2  . PHE A 1 36 ? 1.049   2.061   3.619   1.00 0.00 ? 36 PHE A CD2  6  
ATOM 6915  C CE1  . PHE A 1 36 ? 2.190   4.565   3.804   1.00 0.00 ? 36 PHE A CE1  6  
ATOM 6916  C CE2  . PHE A 1 36 ? 1.351   2.767   2.470   1.00 0.00 ? 36 PHE A CE2  6  
ATOM 6917  C CZ   . PHE A 1 36 ? 1.924   4.021   2.563   1.00 0.00 ? 36 PHE A CZ   6  
ATOM 6918  H H    . PHE A 1 36 ? 0.864   0.469   8.255   1.00 0.00 ? 36 PHE A H    6  
ATOM 6919  H HA   . PHE A 1 36 ? 2.843   0.785   6.306   1.00 0.00 ? 36 PHE A HA   6  
ATOM 6920  H HB2  . PHE A 1 36 ? 0.436   0.940   5.824   1.00 0.00 ? 36 PHE A HB2  6  
ATOM 6921  H HB3  . PHE A 1 36 ? 0.349   2.445   6.734   1.00 0.00 ? 36 PHE A HB3  6  
ATOM 6922  H HD1  . PHE A 1 36 ? 2.096   4.281   5.919   1.00 0.00 ? 36 PHE A HD1  6  
ATOM 6923  H HD2  . PHE A 1 36 ? 0.601   1.079   3.546   1.00 0.00 ? 36 PHE A HD2  6  
ATOM 6924  H HE1  . PHE A 1 36 ? 2.637   5.545   3.880   1.00 0.00 ? 36 PHE A HE1  6  
ATOM 6925  H HE2  . PHE A 1 36 ? 1.142   2.338   1.502   1.00 0.00 ? 36 PHE A HE2  6  
ATOM 6926  H HZ   . PHE A 1 36 ? 2.160   4.575   1.667   1.00 0.00 ? 36 PHE A HZ   6  
ATOM 6927  N N    . GLU A 1 37 ? 2.536   3.316   8.386   1.00 0.00 ? 37 GLU A N    6  
ATOM 6928  C CA   . GLU A 1 37 ? 3.198   4.516   8.883   1.00 0.00 ? 37 GLU A CA   6  
ATOM 6929  C C    . GLU A 1 37 ? 4.579   4.184   9.442   1.00 0.00 ? 37 GLU A C    6  
ATOM 6930  O O    . GLU A 1 37 ? 5.504   4.992   9.363   1.00 0.00 ? 37 GLU A O    6  
ATOM 6931  C CB   . GLU A 1 37 ? 2.346   5.186   9.964   1.00 0.00 ? 37 GLU A CB   6  
ATOM 6932  C CG   . GLU A 1 37 ? 2.452   4.516   11.324  1.00 0.00 ? 37 GLU A CG   6  
ATOM 6933  C CD   . GLU A 1 37 ? 1.799   5.327   12.426  1.00 0.00 ? 37 GLU A CD   6  
ATOM 6934  O OE1  . GLU A 1 37 ? 0.563   5.498   12.385  1.00 0.00 ? 37 GLU A OE1  6  
ATOM 6935  O OE2  . GLU A 1 37 ? 2.525   5.792   13.330  1.00 0.00 ? 37 GLU A OE2  6  
ATOM 6936  H H    . GLU A 1 37 ? 1.726   2.996   8.835   1.00 0.00 ? 37 GLU A H    6  
ATOM 6937  H HA   . GLU A 1 37 ? 3.313   5.199   8.055   1.00 0.00 ? 37 GLU A HA   6  
ATOM 6938  H HB2  . GLU A 1 37 ? 2.659   6.214   10.067  1.00 0.00 ? 37 GLU A HB2  6  
ATOM 6939  H HB3  . GLU A 1 37 ? 1.312   5.163   9.654   1.00 0.00 ? 37 GLU A HB3  6  
ATOM 6940  H HG2  . GLU A 1 37 ? 1.969   3.551   11.274  1.00 0.00 ? 37 GLU A HG2  6  
ATOM 6941  H HG3  . GLU A 1 37 ? 3.496   4.382   11.565  1.00 0.00 ? 37 GLU A HG3  6  
ATOM 6942  N N    . LYS A 1 38 ? 4.710   2.989   10.008  1.00 0.00 ? 38 LYS A N    6  
ATOM 6943  C CA   . LYS A 1 38 ? 5.976   2.547   10.580  1.00 0.00 ? 38 LYS A CA   6  
ATOM 6944  C C    . LYS A 1 38 ? 6.962   2.156   9.483   1.00 0.00 ? 38 LYS A C    6  
ATOM 6945  O O    . LYS A 1 38 ? 8.075   2.678   9.423   1.00 0.00 ? 38 LYS A O    6  
ATOM 6946  C CB   . LYS A 1 38 ? 5.748   1.363   11.521  1.00 0.00 ? 38 LYS A CB   6  
ATOM 6947  C CG   . LYS A 1 38 ? 5.134   1.755   12.854  1.00 0.00 ? 38 LYS A CG   6  
ATOM 6948  C CD   . LYS A 1 38 ? 4.563   0.549   13.581  1.00 0.00 ? 38 LYS A CD   6  
ATOM 6949  C CE   . LYS A 1 38 ? 5.646   -0.222  14.319  1.00 0.00 ? 38 LYS A CE   6  
ATOM 6950  N NZ   . LYS A 1 38 ? 5.964   0.393   15.638  1.00 0.00 ? 38 LYS A NZ   6  
ATOM 6951  H H    . LYS A 1 38 ? 3.935   2.389   10.040  1.00 0.00 ? 38 LYS A H    6  
ATOM 6952  H HA   . LYS A 1 38 ? 6.390   3.370   11.143  1.00 0.00 ? 38 LYS A HA   6  
ATOM 6953  H HB2  . LYS A 1 38 ? 5.089   0.656   11.039  1.00 0.00 ? 38 LYS A HB2  6  
ATOM 6954  H HB3  . LYS A 1 38 ? 6.697   0.883   11.713  1.00 0.00 ? 38 LYS A HB3  6  
ATOM 6955  H HG2  . LYS A 1 38 ? 5.896   2.206   13.472  1.00 0.00 ? 38 LYS A HG2  6  
ATOM 6956  H HG3  . LYS A 1 38 ? 4.341   2.467   12.679  1.00 0.00 ? 38 LYS A HG3  6  
ATOM 6957  H HD2  . LYS A 1 38 ? 3.826   0.885   14.295  1.00 0.00 ? 38 LYS A HD2  6  
ATOM 6958  H HD3  . LYS A 1 38 ? 4.094   -0.106  12.860  1.00 0.00 ? 38 LYS A HD3  6  
ATOM 6959  H HE2  . LYS A 1 38 ? 5.306   -1.234  14.476  1.00 0.00 ? 38 LYS A HE2  6  
ATOM 6960  H HE3  . LYS A 1 38 ? 6.539   -0.233  13.712  1.00 0.00 ? 38 LYS A HE3  6  
ATOM 6961  H HZ1  . LYS A 1 38 ? 5.444   -0.097  16.394  1.00 0.00 ? 38 LYS A HZ1  6  
ATOM 6962  H HZ2  . LYS A 1 38 ? 5.690   1.396   15.639  1.00 0.00 ? 38 LYS A HZ2  6  
ATOM 6963  H HZ3  . LYS A 1 38 ? 6.983   0.322   15.829  1.00 0.00 ? 38 LYS A HZ3  6  
ATOM 6964  N N    . GLN A 1 39 ? 6.544   1.237   8.619   1.00 0.00 ? 39 GLN A N    6  
ATOM 6965  C CA   . GLN A 1 39 ? 7.390   0.778   7.524   1.00 0.00 ? 39 GLN A CA   6  
ATOM 6966  C C    . GLN A 1 39 ? 6.689   0.955   6.181   1.00 0.00 ? 39 GLN A C    6  
ATOM 6967  O O    . GLN A 1 39 ? 5.734   0.243   5.869   1.00 0.00 ? 39 GLN A O    6  
ATOM 6968  C CB   . GLN A 1 39 ? 7.769   -0.690  7.725   1.00 0.00 ? 39 GLN A CB   6  
ATOM 6969  C CG   . GLN A 1 39 ? 9.072   -1.081  7.048   1.00 0.00 ? 39 GLN A CG   6  
ATOM 6970  C CD   . GLN A 1 39 ? 9.516   -2.487  7.403   1.00 0.00 ? 39 GLN A CD   6  
ATOM 6971  O OE1  . GLN A 1 39 ? 10.680  -2.718  7.732   1.00 0.00 ? 39 GLN A OE1  6  
ATOM 6972  N NE2  . GLN A 1 39 ? 8.588   -3.435  7.338   1.00 0.00 ? 39 GLN A NE2  6  
ATOM 6973  H H    . GLN A 1 39 ? 5.646   0.859   8.719   1.00 0.00 ? 39 GLN A H    6  
ATOM 6974  H HA   . GLN A 1 39 ? 8.290   1.376   7.527   1.00 0.00 ? 39 GLN A HA   6  
ATOM 6975  H HB2  . GLN A 1 39 ? 7.865   -0.883  8.783   1.00 0.00 ? 39 GLN A HB2  6  
ATOM 6976  H HB3  . GLN A 1 39 ? 6.980   -1.311  7.325   1.00 0.00 ? 39 GLN A HB3  6  
ATOM 6977  H HG2  . GLN A 1 39 ? 8.939   -1.022  5.978   1.00 0.00 ? 39 GLN A HG2  6  
ATOM 6978  H HG3  . GLN A 1 39 ? 9.843   -0.388  7.353   1.00 0.00 ? 39 GLN A HG3  6  
ATOM 6979  H HE21 . GLN A 1 39 ? 7.682   -3.177  7.067   1.00 0.00 ? 39 GLN A HE21 6  
ATOM 6980  H HE22 . GLN A 1 39 ? 8.847   -4.352  7.561   1.00 0.00 ? 39 GLN A HE22 6  
ATOM 6981  N N    . LYS A 1 40 ? 7.167   1.910   5.391   1.00 0.00 ? 40 LYS A N    6  
ATOM 6982  C CA   . LYS A 1 40 ? 6.587   2.182   4.081   1.00 0.00 ? 40 LYS A CA   6  
ATOM 6983  C C    . LYS A 1 40 ? 6.140   0.889   3.406   1.00 0.00 ? 40 LYS A C    6  
ATOM 6984  O O    . LYS A 1 40 ? 5.076   0.836   2.788   1.00 0.00 ? 40 LYS A O    6  
ATOM 6985  C CB   . LYS A 1 40 ? 7.599   2.910   3.193   1.00 0.00 ? 40 LYS A CB   6  
ATOM 6986  C CG   . LYS A 1 40 ? 7.983   4.285   3.711   1.00 0.00 ? 40 LYS A CG   6  
ATOM 6987  C CD   . LYS A 1 40 ? 6.846   5.280   3.548   1.00 0.00 ? 40 LYS A CD   6  
ATOM 6988  C CE   . LYS A 1 40 ? 6.907   6.373   4.604   1.00 0.00 ? 40 LYS A CE   6  
ATOM 6989  N NZ   . LYS A 1 40 ? 6.251   5.954   5.874   1.00 0.00 ? 40 LYS A NZ   6  
ATOM 6990  H H    . LYS A 1 40 ? 7.930   2.445   5.696   1.00 0.00 ? 40 LYS A H    6  
ATOM 6991  H HA   . LYS A 1 40 ? 5.725   2.816   4.225   1.00 0.00 ? 40 LYS A HA   6  
ATOM 6992  H HB2  . LYS A 1 40 ? 8.495   2.311   3.124   1.00 0.00 ? 40 LYS A HB2  6  
ATOM 6993  H HB3  . LYS A 1 40 ? 7.176   3.025   2.206   1.00 0.00 ? 40 LYS A HB3  6  
ATOM 6994  H HG2  . LYS A 1 40 ? 8.233   4.209   4.758   1.00 0.00 ? 40 LYS A HG2  6  
ATOM 6995  H HG3  . LYS A 1 40 ? 8.842   4.640   3.159   1.00 0.00 ? 40 LYS A HG3  6  
ATOM 6996  H HD2  . LYS A 1 40 ? 6.914   5.735   2.571   1.00 0.00 ? 40 LYS A HD2  6  
ATOM 6997  H HD3  . LYS A 1 40 ? 5.905   4.756   3.638   1.00 0.00 ? 40 LYS A HD3  6  
ATOM 6998  H HE2  . LYS A 1 40 ? 7.941   6.606   4.803   1.00 0.00 ? 40 LYS A HE2  6  
ATOM 6999  H HE3  . LYS A 1 40 ? 6.407   7.251   4.223   1.00 0.00 ? 40 LYS A HE3  6  
ATOM 7000  H HZ1  . LYS A 1 40 ? 6.327   4.924   5.992   1.00 0.00 ? 40 LYS A HZ1  6  
ATOM 7001  H HZ2  . LYS A 1 40 ? 5.245   6.217   5.860   1.00 0.00 ? 40 LYS A HZ2  6  
ATOM 7002  H HZ3  . LYS A 1 40 ? 6.709   6.420   6.683   1.00 0.00 ? 40 LYS A HZ3  6  
ATOM 7003  N N    . TYR A 1 41 ? 6.957   -0.150  3.528   1.00 0.00 ? 41 TYR A N    6  
ATOM 7004  C CA   . TYR A 1 41 ? 6.646   -1.442  2.928   1.00 0.00 ? 41 TYR A CA   6  
ATOM 7005  C C    . TYR A 1 41 ? 6.900   -2.577  3.916   1.00 0.00 ? 41 TYR A C    6  
ATOM 7006  O O    . TYR A 1 41 ? 7.855   -2.537  4.693   1.00 0.00 ? 41 TYR A O    6  
ATOM 7007  C CB   . TYR A 1 41 ? 7.480   -1.656  1.663   1.00 0.00 ? 41 TYR A CB   6  
ATOM 7008  C CG   . TYR A 1 41 ? 7.430   -0.490  0.702   1.00 0.00 ? 41 TYR A CG   6  
ATOM 7009  C CD1  . TYR A 1 41 ? 6.277   -0.210  -0.022  1.00 0.00 ? 41 TYR A CD1  6  
ATOM 7010  C CD2  . TYR A 1 41 ? 8.536   0.330   0.516   1.00 0.00 ? 41 TYR A CD2  6  
ATOM 7011  C CE1  . TYR A 1 41 ? 6.227   0.854   -0.902  1.00 0.00 ? 41 TYR A CE1  6  
ATOM 7012  C CE2  . TYR A 1 41 ? 8.494   1.397   -0.361  1.00 0.00 ? 41 TYR A CE2  6  
ATOM 7013  C CZ   . TYR A 1 41 ? 7.338   1.654   -1.068  1.00 0.00 ? 41 TYR A CZ   6  
ATOM 7014  O OH   . TYR A 1 41 ? 7.293   2.715   -1.944  1.00 0.00 ? 41 TYR A OH   6  
ATOM 7015  H H    . TYR A 1 41 ? 7.791   -0.046  4.032   1.00 0.00 ? 41 TYR A H    6  
ATOM 7016  H HA   . TYR A 1 41 ? 5.599   -1.441  2.661   1.00 0.00 ? 41 TYR A HA   6  
ATOM 7017  H HB2  . TYR A 1 41 ? 8.510   -1.811  1.942   1.00 0.00 ? 41 TYR A HB2  6  
ATOM 7018  H HB3  . TYR A 1 41 ? 7.116   -2.530  1.144   1.00 0.00 ? 41 TYR A HB3  6  
ATOM 7019  H HD1  . TYR A 1 41 ? 5.409   -0.838  0.111   1.00 0.00 ? 41 TYR A HD1  6  
ATOM 7020  H HD2  . TYR A 1 41 ? 9.440   0.125   1.070   1.00 0.00 ? 41 TYR A HD2  6  
ATOM 7021  H HE1  . TYR A 1 41 ? 5.322   1.056   -1.455  1.00 0.00 ? 41 TYR A HE1  6  
ATOM 7022  H HE2  . TYR A 1 41 ? 9.364   2.023   -0.492  1.00 0.00 ? 41 TYR A HE2  6  
ATOM 7023  H HH   . TYR A 1 41 ? 6.391   2.844   -2.244  1.00 0.00 ? 41 TYR A HH   6  
ATOM 7024  N N    . LEU A 1 42 ? 6.040   -3.588  3.880   1.00 0.00 ? 42 LEU A N    6  
ATOM 7025  C CA   . LEU A 1 42 ? 6.170   -4.736  4.770   1.00 0.00 ? 42 LEU A CA   6  
ATOM 7026  C C    . LEU A 1 42 ? 6.879   -5.891  4.071   1.00 0.00 ? 42 LEU A C    6  
ATOM 7027  O O    . LEU A 1 42 ? 6.464   -6.328  2.997   1.00 0.00 ? 42 LEU A O    6  
ATOM 7028  C CB   . LEU A 1 42 ? 4.791   -5.188  5.256   1.00 0.00 ? 42 LEU A CB   6  
ATOM 7029  C CG   . LEU A 1 42 ? 3.986   -4.156  6.046   1.00 0.00 ? 42 LEU A CG   6  
ATOM 7030  C CD1  . LEU A 1 42 ? 2.518   -4.550  6.098   1.00 0.00 ? 42 LEU A CD1  6  
ATOM 7031  C CD2  . LEU A 1 42 ? 4.549   -4.003  7.452   1.00 0.00 ? 42 LEU A CD2  6  
ATOM 7032  H H    . LEU A 1 42 ? 5.299   -3.563  3.239   1.00 0.00 ? 42 LEU A H    6  
ATOM 7033  H HA   . LEU A 1 42 ? 6.760   -4.430  5.621   1.00 0.00 ? 42 LEU A HA   6  
ATOM 7034  H HB2  . LEU A 1 42 ? 4.211   -5.468  4.390   1.00 0.00 ? 42 LEU A HB2  6  
ATOM 7035  H HB3  . LEU A 1 42 ? 4.932   -6.054  5.888   1.00 0.00 ? 42 LEU A HB3  6  
ATOM 7036  H HG   . LEU A 1 42 ? 4.057   -3.198  5.551   1.00 0.00 ? 42 LEU A HG   6  
ATOM 7037  H HD11 . LEU A 1 42 ? 1.920   -3.768  5.655   1.00 0.00 ? 42 LEU A HD11 6  
ATOM 7038  H HD12 . LEU A 1 42 ? 2.220   -4.693  7.126   1.00 0.00 ? 42 LEU A HD12 6  
ATOM 7039  H HD13 . LEU A 1 42 ? 2.373   -5.470  5.550   1.00 0.00 ? 42 LEU A HD13 6  
ATOM 7040  H HD21 . LEU A 1 42 ? 4.615   -4.974  7.920   1.00 0.00 ? 42 LEU A HD21 6  
ATOM 7041  H HD22 . LEU A 1 42 ? 3.897   -3.367  8.033   1.00 0.00 ? 42 LEU A HD22 6  
ATOM 7042  H HD23 . LEU A 1 42 ? 5.533   -3.561  7.400   1.00 0.00 ? 42 LEU A HD23 6  
ATOM 7043  N N    . SER A 1 43 ? 7.950   -6.381  4.687   1.00 0.00 ? 43 SER A N    6  
ATOM 7044  C CA   . SER A 1 43 ? 8.718   -7.485  4.122   1.00 0.00 ? 43 SER A CA   6  
ATOM 7045  C C    . SER A 1 43 ? 7.812   -8.670  3.803   1.00 0.00 ? 43 SER A C    6  
ATOM 7046  O O    . SER A 1 43 ? 6.697   -8.771  4.315   1.00 0.00 ? 43 SER A O    6  
ATOM 7047  C CB   . SER A 1 43 ? 9.819   -7.916  5.093   1.00 0.00 ? 43 SER A CB   6  
ATOM 7048  O OG   . SER A 1 43 ? 10.824  -8.660  4.425   1.00 0.00 ? 43 SER A OG   6  
ATOM 7049  H H    . SER A 1 43 ? 8.231   -5.990  5.540   1.00 0.00 ? 43 SER A H    6  
ATOM 7050  H HA   . SER A 1 43 ? 9.173   -7.138  3.206   1.00 0.00 ? 43 SER A HA   6  
ATOM 7051  H HB2  . SER A 1 43 ? 10.270  -7.041  5.534   1.00 0.00 ? 43 SER A HB2  6  
ATOM 7052  H HB3  . SER A 1 43 ? 9.389   -8.531  5.870   1.00 0.00 ? 43 SER A HB3  6  
ATOM 7053  H HG   . SER A 1 43 ? 10.956  -8.302  3.545   1.00 0.00 ? 43 SER A HG   6  
ATOM 7054  N N    . THR A 1 44 ? 8.300   -9.568  2.952   1.00 0.00 ? 44 THR A N    6  
ATOM 7055  C CA   . THR A 1 44 ? 7.536   -10.746 2.563   1.00 0.00 ? 44 THR A CA   6  
ATOM 7056  C C    . THR A 1 44 ? 6.779   -11.328 3.751   1.00 0.00 ? 44 THR A C    6  
ATOM 7057  O O    . THR A 1 44 ? 5.553   -11.438 3.744   1.00 0.00 ? 44 THR A O    6  
ATOM 7058  C CB   . THR A 1 44 ? 8.447   -11.834 1.965   1.00 0.00 ? 44 THR A CB   6  
ATOM 7059  O OG1  . THR A 1 44 ? 8.529   -11.680 0.544   1.00 0.00 ? 44 THR A OG1  6  
ATOM 7060  C CG2  . THR A 1 44 ? 7.923   -13.223 2.300   1.00 0.00 ? 44 THR A CG2  6  
ATOM 7061  H H    . THR A 1 44 ? 9.195   -9.432  2.577   1.00 0.00 ? 44 THR A H    6  
ATOM 7062  H HA   . THR A 1 44 ? 6.824   -10.447 1.807   1.00 0.00 ? 44 THR A HA   6  
ATOM 7063  H HB   . THR A 1 44 ? 9.436   -11.727 2.389   1.00 0.00 ? 44 THR A HB   6  
ATOM 7064  H HG1  . THR A 1 44 ? 9.439   -11.506 0.293   1.00 0.00 ? 44 THR A HG1  6  
ATOM 7065  H HG21 . THR A 1 44 ? 6.894   -13.305 1.985   1.00 0.00 ? 44 THR A HG21 6  
ATOM 7066  H HG22 . THR A 1 44 ? 7.987   -13.384 3.366   1.00 0.00 ? 44 THR A HG22 6  
ATOM 7067  H HG23 . THR A 1 44 ? 8.517   -13.964 1.787   1.00 0.00 ? 44 THR A HG23 6  
ATOM 7068  N N    . PRO A 1 45 ? 7.525   -11.711 4.798   1.00 0.00 ? 45 PRO A N    6  
ATOM 7069  C CA   . PRO A 1 45 ? 6.945   -12.288 6.014   1.00 0.00 ? 45 PRO A CA   6  
ATOM 7070  C C    . PRO A 1 45 ? 6.159   -11.262 6.824   1.00 0.00 ? 45 PRO A C    6  
ATOM 7071  O O    . PRO A 1 45 ? 5.059   -11.545 7.300   1.00 0.00 ? 45 PRO A O    6  
ATOM 7072  C CB   . PRO A 1 45 ? 8.169   -12.764 6.800   1.00 0.00 ? 45 PRO A CB   6  
ATOM 7073  C CG   . PRO A 1 45 ? 9.286   -11.902 6.321   1.00 0.00 ? 45 PRO A CG   6  
ATOM 7074  C CD   . PRO A 1 45 ? 8.992   -11.610 4.875   1.00 0.00 ? 45 PRO A CD   6  
ATOM 7075  H HA   . PRO A 1 45 ? 6.309   -13.131 5.789   1.00 0.00 ? 45 PRO A HA   6  
ATOM 7076  H HB2  . PRO A 1 45 ? 7.994   -12.634 7.859   1.00 0.00 ? 45 PRO A HB2  6  
ATOM 7077  H HB3  . PRO A 1 45 ? 8.356   -13.806 6.586   1.00 0.00 ? 45 PRO A HB3  6  
ATOM 7078  H HG2  . PRO A 1 45 ? 9.313   -10.986 6.891   1.00 0.00 ? 45 PRO A HG2  6  
ATOM 7079  H HG3  . PRO A 1 45 ? 10.223  -12.431 6.413   1.00 0.00 ? 45 PRO A HG3  6  
ATOM 7080  H HD2  . PRO A 1 45 ? 9.324   -10.615 4.617   1.00 0.00 ? 45 PRO A HD2  6  
ATOM 7081  H HD3  . PRO A 1 45 ? 9.463   -12.344 4.238   1.00 0.00 ? 45 PRO A HD3  6  
ATOM 7082  N N    . ASP A 1 46 ? 6.729   -10.072 6.976   1.00 0.00 ? 46 ASP A N    6  
ATOM 7083  C CA   . ASP A 1 46 ? 6.080   -9.004  7.727   1.00 0.00 ? 46 ASP A CA   6  
ATOM 7084  C C    . ASP A 1 46 ? 4.622   -8.851  7.306   1.00 0.00 ? 46 ASP A C    6  
ATOM 7085  O O    . ASP A 1 46 ? 3.711   -9.008  8.118   1.00 0.00 ? 46 ASP A O    6  
ATOM 7086  C CB   . ASP A 1 46 ? 6.825   -7.683  7.523   1.00 0.00 ? 46 ASP A CB   6  
ATOM 7087  C CG   . ASP A 1 46 ? 7.927   -7.476  8.544   1.00 0.00 ? 46 ASP A CG   6  
ATOM 7088  O OD1  . ASP A 1 46 ? 7.658   -7.647  9.751   1.00 0.00 ? 46 ASP A OD1  6  
ATOM 7089  O OD2  . ASP A 1 46 ? 9.059   -7.145  8.134   1.00 0.00 ? 46 ASP A OD2  6  
ATOM 7090  H H    . ASP A 1 46 ? 7.607   -9.908  6.573   1.00 0.00 ? 46 ASP A H    6  
ATOM 7091  H HA   . ASP A 1 46 ? 6.113   -9.267  8.774   1.00 0.00 ? 46 ASP A HA   6  
ATOM 7092  H HB2  . ASP A 1 46 ? 7.266   -7.675  6.537   1.00 0.00 ? 46 ASP A HB2  6  
ATOM 7093  H HB3  . ASP A 1 46 ? 6.123   -6.866  7.606   1.00 0.00 ? 46 ASP A HB3  6  
ATOM 7094  N N    . ARG A 1 47 ? 4.410   -8.542  6.030   1.00 0.00 ? 47 ARG A N    6  
ATOM 7095  C CA   . ARG A 1 47 ? 3.063   -8.366  5.501   1.00 0.00 ? 47 ARG A CA   6  
ATOM 7096  C C    . ARG A 1 47 ? 2.154   -9.512  5.934   1.00 0.00 ? 47 ARG A C    6  
ATOM 7097  O O    . ARG A 1 47 ? 0.980   -9.305  6.242   1.00 0.00 ? 47 ARG A O    6  
ATOM 7098  C CB   . ARG A 1 47 ? 3.099   -8.277  3.975   1.00 0.00 ? 47 ARG A CB   6  
ATOM 7099  C CG   . ARG A 1 47 ? 1.722   -8.192  3.336   1.00 0.00 ? 47 ARG A CG   6  
ATOM 7100  C CD   . ARG A 1 47 ? 1.812   -7.817  1.865   1.00 0.00 ? 47 ARG A CD   6  
ATOM 7101  N NE   . ARG A 1 47 ? 2.677   -6.661  1.647   1.00 0.00 ? 47 ARG A NE   6  
ATOM 7102  C CZ   . ARG A 1 47 ? 3.247   -6.379  0.481   1.00 0.00 ? 47 ARG A CZ   6  
ATOM 7103  N NH1  . ARG A 1 47 ? 3.045   -7.166  -0.567  1.00 0.00 ? 47 ARG A NH1  6  
ATOM 7104  N NH2  . ARG A 1 47 ? 4.022   -5.308  0.361   1.00 0.00 ? 47 ARG A NH2  6  
ATOM 7105  H H    . ARG A 1 47 ? 5.177   -8.430  5.431   1.00 0.00 ? 47 ARG A H    6  
ATOM 7106  H HA   . ARG A 1 47 ? 2.669   -7.441  5.897   1.00 0.00 ? 47 ARG A HA   6  
ATOM 7107  H HB2  . ARG A 1 47 ? 3.659   -7.398  3.690   1.00 0.00 ? 47 ARG A HB2  6  
ATOM 7108  H HB3  . ARG A 1 47 ? 3.598   -9.153  3.587   1.00 0.00 ? 47 ARG A HB3  6  
ATOM 7109  H HG2  . ARG A 1 47 ? 1.236   -9.152  3.422   1.00 0.00 ? 47 ARG A HG2  6  
ATOM 7110  H HG3  . ARG A 1 47 ? 1.141   -7.444  3.855   1.00 0.00 ? 47 ARG A HG3  6  
ATOM 7111  H HD2  . ARG A 1 47 ? 2.208   -8.659  1.317   1.00 0.00 ? 47 ARG A HD2  6  
ATOM 7112  H HD3  . ARG A 1 47 ? 0.821   -7.587  1.505   1.00 0.00 ? 47 ARG A HD3  6  
ATOM 7113  H HE   . ARG A 1 47 ? 2.840   -6.066  2.408   1.00 0.00 ? 47 ARG A HE   6  
ATOM 7114  H HH11 . ARG A 1 47 ? 2.461   -7.973  -0.480  1.00 0.00 ? 47 ARG A HH11 6  
ATOM 7115  H HH12 . ARG A 1 47 ? 3.475   -6.951  -1.444  1.00 0.00 ? 47 ARG A HH12 6  
ATOM 7116  H HH21 . ARG A 1 47 ? 4.176   -4.713  1.149   1.00 0.00 ? 47 ARG A HH21 6  
ATOM 7117  H HH22 . ARG A 1 47 ? 4.450   -5.097  -0.517  1.00 0.00 ? 47 ARG A HH22 6  
ATOM 7118  N N    . ILE A 1 48 ? 2.705   -10.722 5.953   1.00 0.00 ? 48 ILE A N    6  
ATOM 7119  C CA   . ILE A 1 48 ? 1.944   -11.901 6.348   1.00 0.00 ? 48 ILE A CA   6  
ATOM 7120  C C    . ILE A 1 48 ? 1.561   -11.839 7.822   1.00 0.00 ? 48 ILE A C    6  
ATOM 7121  O O    . ILE A 1 48 ? 0.381   -11.891 8.170   1.00 0.00 ? 48 ILE A O    6  
ATOM 7122  C CB   . ILE A 1 48 ? 2.737   -13.195 6.089   1.00 0.00 ? 48 ILE A CB   6  
ATOM 7123  C CG1  . ILE A 1 48 ? 3.147   -13.282 4.617   1.00 0.00 ? 48 ILE A CG1  6  
ATOM 7124  C CG2  . ILE A 1 48 ? 1.913   -14.410 6.488   1.00 0.00 ? 48 ILE A CG2  6  
ATOM 7125  C CD1  . ILE A 1 48 ? 4.148   -14.380 4.333   1.00 0.00 ? 48 ILE A CD1  6  
ATOM 7126  H H    . ILE A 1 48 ? 3.645   -10.823 5.697   1.00 0.00 ? 48 ILE A H    6  
ATOM 7127  H HA   . ILE A 1 48 ? 1.042   -11.930 5.753   1.00 0.00 ? 48 ILE A HA   6  
ATOM 7128  H HB   . ILE A 1 48 ? 3.625   -13.175 6.702   1.00 0.00 ? 48 ILE A HB   6  
ATOM 7129  H HG12 . ILE A 1 48 ? 2.271   -13.469 4.017   1.00 0.00 ? 48 ILE A HG12 6  
ATOM 7130  H HG13 . ILE A 1 48 ? 3.589   -12.343 4.318   1.00 0.00 ? 48 ILE A HG13 6  
ATOM 7131  H HG21 . ILE A 1 48 ? 1.332   -14.177 7.368   1.00 0.00 ? 48 ILE A HG21 6  
ATOM 7132  H HG22 . ILE A 1 48 ? 1.249   -14.675 5.679   1.00 0.00 ? 48 ILE A HG22 6  
ATOM 7133  H HG23 . ILE A 1 48 ? 2.572   -15.239 6.700   1.00 0.00 ? 48 ILE A HG23 6  
ATOM 7134  H HD11 . ILE A 1 48 ? 3.635   -15.329 4.274   1.00 0.00 ? 48 ILE A HD11 6  
ATOM 7135  H HD12 . ILE A 1 48 ? 4.645   -14.180 3.396   1.00 0.00 ? 48 ILE A HD12 6  
ATOM 7136  H HD13 . ILE A 1 48 ? 4.879   -14.416 5.128   1.00 0.00 ? 48 ILE A HD13 6  
ATOM 7137  N N    . ASP A 1 49 ? 2.565   -11.726 8.685   1.00 0.00 ? 49 ASP A N    6  
ATOM 7138  C CA   . ASP A 1 49 ? 2.333   -11.654 10.123  1.00 0.00 ? 49 ASP A CA   6  
ATOM 7139  C C    . ASP A 1 49 ? 1.181   -10.706 10.441  1.00 0.00 ? 49 ASP A C    6  
ATOM 7140  O O    . ASP A 1 49 ? 0.348   -10.991 11.302  1.00 0.00 ? 49 ASP A O    6  
ATOM 7141  C CB   . ASP A 1 49 ? 3.602   -11.194 10.843  1.00 0.00 ? 49 ASP A CB   6  
ATOM 7142  C CG   . ASP A 1 49 ? 3.565   -11.494 12.329  1.00 0.00 ? 49 ASP A CG   6  
ATOM 7143  O OD1  . ASP A 1 49 ? 2.914   -12.486 12.717  1.00 0.00 ? 49 ASP A OD1  6  
ATOM 7144  O OD2  . ASP A 1 49 ? 4.187   -10.736 13.103  1.00 0.00 ? 49 ASP A OD2  6  
ATOM 7145  H H    . ASP A 1 49 ? 3.484   -11.689 8.346   1.00 0.00 ? 49 ASP A H    6  
ATOM 7146  H HA   . ASP A 1 49 ? 2.073   -12.643 10.467  1.00 0.00 ? 49 ASP A HA   6  
ATOM 7147  H HB2  . ASP A 1 49 ? 4.455   -11.700 10.414  1.00 0.00 ? 49 ASP A HB2  6  
ATOM 7148  H HB3  . ASP A 1 49 ? 3.717   -10.129 10.711  1.00 0.00 ? 49 ASP A HB3  6  
ATOM 7149  N N    . LEU A 1 50 ? 1.141   -9.576  9.742   1.00 0.00 ? 50 LEU A N    6  
ATOM 7150  C CA   . LEU A 1 50 ? 0.092   -8.585  9.950   1.00 0.00 ? 50 LEU A CA   6  
ATOM 7151  C C    . LEU A 1 50 ? -1.260  -9.116  9.484   1.00 0.00 ? 50 LEU A C    6  
ATOM 7152  O O    . LEU A 1 50 ? -2.183  -9.277  10.281  1.00 0.00 ? 50 LEU A O    6  
ATOM 7153  C CB   . LEU A 1 50 ? 0.430   -7.292  9.206   1.00 0.00 ? 50 LEU A CB   6  
ATOM 7154  C CG   . LEU A 1 50 ? -0.739  -6.341  8.948   1.00 0.00 ? 50 LEU A CG   6  
ATOM 7155  C CD1  . LEU A 1 50 ? -1.170  -5.663  10.239  1.00 0.00 ? 50 LEU A CD1  6  
ATOM 7156  C CD2  . LEU A 1 50 ? -0.363  -5.304  7.899   1.00 0.00 ? 50 LEU A CD2  6  
ATOM 7157  H H    . LEU A 1 50 ? 1.833   -9.405  9.070   1.00 0.00 ? 50 LEU A H    6  
ATOM 7158  H HA   . LEU A 1 50 ? 0.038   -8.377  11.009  1.00 0.00 ? 50 LEU A HA   6  
ATOM 7159  H HB2  . LEU A 1 50 ? 1.167   -6.759  9.786   1.00 0.00 ? 50 LEU A HB2  6  
ATOM 7160  H HB3  . LEU A 1 50 ? 0.854   -7.563  8.249   1.00 0.00 ? 50 LEU A HB3  6  
ATOM 7161  H HG   . LEU A 1 50 ? -1.580  -6.907  8.573   1.00 0.00 ? 50 LEU A HG   6  
ATOM 7162  H HD11 . LEU A 1 50 ? -0.343  -5.099  10.644  1.00 0.00 ? 50 LEU A HD11 6  
ATOM 7163  H HD12 . LEU A 1 50 ? -1.479  -6.411  10.954  1.00 0.00 ? 50 LEU A HD12 6  
ATOM 7164  H HD13 . LEU A 1 50 ? -1.996  -4.996  10.038  1.00 0.00 ? 50 LEU A HD13 6  
ATOM 7165  H HD21 . LEU A 1 50 ? -1.260  -4.889  7.466   1.00 0.00 ? 50 LEU A HD21 6  
ATOM 7166  H HD22 . LEU A 1 50 ? 0.227   -5.774  7.125   1.00 0.00 ? 50 LEU A HD22 6  
ATOM 7167  H HD23 . LEU A 1 50 ? 0.212   -4.516  8.362   1.00 0.00 ? 50 LEU A HD23 6  
ATOM 7168  N N    . ALA A 1 51 ? -1.367  -9.388  8.187   1.00 0.00 ? 51 ALA A N    6  
ATOM 7169  C CA   . ALA A 1 51 ? -2.604  -9.905  7.615   1.00 0.00 ? 51 ALA A CA   6  
ATOM 7170  C C    . ALA A 1 51 ? -3.242  -10.942 8.533   1.00 0.00 ? 51 ALA A C    6  
ATOM 7171  O O    . ALA A 1 51 ? -4.459  -11.122 8.529   1.00 0.00 ? 51 ALA A O    6  
ATOM 7172  C CB   . ALA A 1 51 ? -2.340  -10.503 6.241   1.00 0.00 ? 51 ALA A CB   6  
ATOM 7173  H H    . ALA A 1 51 ? -0.595  -9.238  7.602   1.00 0.00 ? 51 ALA A H    6  
ATOM 7174  H HA   . ALA A 1 51 ? -3.287  -9.077  7.494   1.00 0.00 ? 51 ALA A HA   6  
ATOM 7175  H HB1  . ALA A 1 51 ? -1.398  -10.133 5.863   1.00 0.00 ? 51 ALA A HB1  6  
ATOM 7176  H HB2  . ALA A 1 51 ? -2.299  -11.579 6.320   1.00 0.00 ? 51 ALA A HB2  6  
ATOM 7177  H HB3  . ALA A 1 51 ? -3.135  -10.221 5.567   1.00 0.00 ? 51 ALA A HB3  6  
ATOM 7178  N N    . GLU A 1 52 ? -2.411  -11.622 9.317   1.00 0.00 ? 52 GLU A N    6  
ATOM 7179  C CA   . GLU A 1 52 ? -2.896  -12.643 10.238  1.00 0.00 ? 52 GLU A CA   6  
ATOM 7180  C C    . GLU A 1 52 ? -3.470  -12.007 11.501  1.00 0.00 ? 52 GLU A C    6  
ATOM 7181  O O    . GLU A 1 52 ? -4.496  -12.448 12.019  1.00 0.00 ? 52 GLU A O    6  
ATOM 7182  C CB   . GLU A 1 52 ? -1.766  -13.607 10.607  1.00 0.00 ? 52 GLU A CB   6  
ATOM 7183  C CG   . GLU A 1 52 ? -1.651  -14.797 9.671   1.00 0.00 ? 52 GLU A CG   6  
ATOM 7184  C CD   . GLU A 1 52 ? -2.889  -15.673 9.686   1.00 0.00 ? 52 GLU A CD   6  
ATOM 7185  O OE1  . GLU A 1 52 ? -3.824  -15.394 8.906   1.00 0.00 ? 52 GLU A OE1  6  
ATOM 7186  O OE2  . GLU A 1 52 ? -2.922  -16.638 10.478  1.00 0.00 ? 52 GLU A OE2  6  
ATOM 7187  H H    . GLU A 1 52 ? -1.451  -11.434 9.274   1.00 0.00 ? 52 GLU A H    6  
ATOM 7188  H HA   . GLU A 1 52 ? -3.679  -13.195 9.740   1.00 0.00 ? 52 GLU A HA   6  
ATOM 7189  H HB2  . GLU A 1 52 ? -0.830  -13.068 10.589  1.00 0.00 ? 52 GLU A HB2  6  
ATOM 7190  H HB3  . GLU A 1 52 ? -1.938  -13.977 11.607  1.00 0.00 ? 52 GLU A HB3  6  
ATOM 7191  H HG2  . GLU A 1 52 ? -1.498  -14.435 8.665   1.00 0.00 ? 52 GLU A HG2  6  
ATOM 7192  H HG3  . GLU A 1 52 ? -0.802  -15.394 9.970   1.00 0.00 ? 52 GLU A HG3  6  
ATOM 7193  N N    . SER A 1 53 ? -2.799  -10.970 11.992  1.00 0.00 ? 53 SER A N    6  
ATOM 7194  C CA   . SER A 1 53 ? -3.239  -10.276 13.196  1.00 0.00 ? 53 SER A CA   6  
ATOM 7195  C C    . SER A 1 53 ? -4.658  -9.740  13.027  1.00 0.00 ? 53 SER A C    6  
ATOM 7196  O O    . SER A 1 53 ? -5.519  -9.950  13.882  1.00 0.00 ? 53 SER A O    6  
ATOM 7197  C CB   . SER A 1 53 ? -2.284  -9.127  13.526  1.00 0.00 ? 53 SER A CB   6  
ATOM 7198  O OG   . SER A 1 53 ? -1.175  -9.586  14.280  1.00 0.00 ? 53 SER A OG   6  
ATOM 7199  H H    . SER A 1 53 ? -1.988  -10.666 11.534  1.00 0.00 ? 53 SER A H    6  
ATOM 7200  H HA   . SER A 1 53 ? -3.230  -10.985 14.010  1.00 0.00 ? 53 SER A HA   6  
ATOM 7201  H HB2  . SER A 1 53 ? -1.923  -8.688  12.609  1.00 0.00 ? 53 SER A HB2  6  
ATOM 7202  H HB3  . SER A 1 53 ? -2.811  -8.379  14.101  1.00 0.00 ? 53 SER A HB3  6  
ATOM 7203  H HG   . SER A 1 53 ? -1.470  -9.852  15.154  1.00 0.00 ? 53 SER A HG   6  
ATOM 7204  N N    . LEU A 1 54 ? -4.893  -9.047  11.919  1.00 0.00 ? 54 LEU A N    6  
ATOM 7205  C CA   . LEU A 1 54 ? -6.208  -8.480  11.636  1.00 0.00 ? 54 LEU A CA   6  
ATOM 7206  C C    . LEU A 1 54 ? -7.083  -9.482  10.890  1.00 0.00 ? 54 LEU A C    6  
ATOM 7207  O O    . LEU A 1 54 ? -8.308  -9.455  11.002  1.00 0.00 ? 54 LEU A O    6  
ATOM 7208  C CB   . LEU A 1 54 ? -6.065  -7.198  10.813  1.00 0.00 ? 54 LEU A CB   6  
ATOM 7209  C CG   . LEU A 1 54 ? -5.068  -6.168  11.343  1.00 0.00 ? 54 LEU A CG   6  
ATOM 7210  C CD1  . LEU A 1 54 ? -4.809  -5.091  10.301  1.00 0.00 ? 54 LEU A CD1  6  
ATOM 7211  C CD2  . LEU A 1 54 ? -5.578  -5.549  12.637  1.00 0.00 ? 54 LEU A CD2  6  
ATOM 7212  H H    . LEU A 1 54 ? -4.168  -8.913  11.275  1.00 0.00 ? 54 LEU A H    6  
ATOM 7213  H HA   . LEU A 1 54 ? -6.676  -8.243  12.579  1.00 0.00 ? 54 LEU A HA   6  
ATOM 7214  H HB2  . LEU A 1 54 ? -5.755  -7.477  9.818   1.00 0.00 ? 54 LEU A HB2  6  
ATOM 7215  H HB3  . LEU A 1 54 ? -7.037  -6.727  10.766  1.00 0.00 ? 54 LEU A HB3  6  
ATOM 7216  H HG   . LEU A 1 54 ? -4.129  -6.660  11.555  1.00 0.00 ? 54 LEU A HG   6  
ATOM 7217  H HD11 . LEU A 1 54 ? -5.747  -4.659  9.988   1.00 0.00 ? 54 LEU A HD11 6  
ATOM 7218  H HD12 . LEU A 1 54 ? -4.311  -5.528  9.448   1.00 0.00 ? 54 LEU A HD12 6  
ATOM 7219  H HD13 . LEU A 1 54 ? -4.182  -4.321  10.728  1.00 0.00 ? 54 LEU A HD13 6  
ATOM 7220  H HD21 . LEU A 1 54 ? -5.151  -4.564  12.757  1.00 0.00 ? 54 LEU A HD21 6  
ATOM 7221  H HD22 . LEU A 1 54 ? -5.288  -6.170  13.472  1.00 0.00 ? 54 LEU A HD22 6  
ATOM 7222  H HD23 . LEU A 1 54 ? -6.654  -5.473  12.600  1.00 0.00 ? 54 LEU A HD23 6  
ATOM 7223  N N    . GLY A 1 55 ? -6.446  -10.368 10.131  1.00 0.00 ? 55 GLY A N    6  
ATOM 7224  C CA   . GLY A 1 55 ? -7.183  -11.367 9.379   1.00 0.00 ? 55 GLY A CA   6  
ATOM 7225  C C    . GLY A 1 55 ? -7.463  -10.932 7.955   1.00 0.00 ? 55 GLY A C    6  
ATOM 7226  O O    . GLY A 1 55 ? -8.461  -11.338 7.359   1.00 0.00 ? 55 GLY A O    6  
ATOM 7227  H H    . GLY A 1 55 ? -5.467  -10.342 10.080  1.00 0.00 ? 55 GLY A H    6  
ATOM 7228  H HA2  . GLY A 1 55 ? -6.609  -12.282 9.359   1.00 0.00 ? 55 GLY A HA2  6  
ATOM 7229  H HA3  . GLY A 1 55 ? -8.122  -11.555 9.878   1.00 0.00 ? 55 GLY A HA3  6  
ATOM 7230  N N    . LEU A 1 56 ? -6.582  -10.102 7.407   1.00 0.00 ? 56 LEU A N    6  
ATOM 7231  C CA   . LEU A 1 56 ? -6.740  -9.610  6.043   1.00 0.00 ? 56 LEU A CA   6  
ATOM 7232  C C    . LEU A 1 56 ? -5.974  -10.484 5.056   1.00 0.00 ? 56 LEU A C    6  
ATOM 7233  O O    . LEU A 1 56 ? -5.352  -11.474 5.441   1.00 0.00 ? 56 LEU A O    6  
ATOM 7234  C CB   . LEU A 1 56 ? -6.255  -8.162  5.943   1.00 0.00 ? 56 LEU A CB   6  
ATOM 7235  C CG   . LEU A 1 56 ? -6.870  -7.178  6.938   1.00 0.00 ? 56 LEU A CG   6  
ATOM 7236  C CD1  . LEU A 1 56 ? -6.173  -5.829  6.855   1.00 0.00 ? 56 LEU A CD1  6  
ATOM 7237  C CD2  . LEU A 1 56 ? -8.363  -7.025  6.684   1.00 0.00 ? 56 LEU A CD2  6  
ATOM 7238  H H    . LEU A 1 56 ? -5.807  -9.813  7.932   1.00 0.00 ? 56 LEU A H    6  
ATOM 7239  H HA   . LEU A 1 56 ? -7.791  -9.646  5.798   1.00 0.00 ? 56 LEU A HA   6  
ATOM 7240  H HB2  . LEU A 1 56 ? -5.186  -8.161  6.095   1.00 0.00 ? 56 LEU A HB2  6  
ATOM 7241  H HB3  . LEU A 1 56 ? -6.476  -7.808  4.946   1.00 0.00 ? 56 LEU A HB3  6  
ATOM 7242  H HG   . LEU A 1 56 ? -6.738  -7.559  7.941   1.00 0.00 ? 56 LEU A HG   6  
ATOM 7243  H HD11 . LEU A 1 56 ? -5.300  -5.913  6.227   1.00 0.00 ? 56 LEU A HD11 6  
ATOM 7244  H HD12 . LEU A 1 56 ? -5.876  -5.515  7.845   1.00 0.00 ? 56 LEU A HD12 6  
ATOM 7245  H HD13 . LEU A 1 56 ? -6.851  -5.099  6.435   1.00 0.00 ? 56 LEU A HD13 6  
ATOM 7246  H HD21 . LEU A 1 56 ? -8.792  -7.994  6.471   1.00 0.00 ? 56 LEU A HD21 6  
ATOM 7247  H HD22 . LEU A 1 56 ? -8.519  -6.369  5.840   1.00 0.00 ? 56 LEU A HD22 6  
ATOM 7248  H HD23 . LEU A 1 56 ? -8.836  -6.606  7.559   1.00 0.00 ? 56 LEU A HD23 6  
ATOM 7249  N N    . SER A 1 57 ? -6.023  -10.111 3.781   1.00 0.00 ? 57 SER A N    6  
ATOM 7250  C CA   . SER A 1 57 ? -5.334  -10.862 2.738   1.00 0.00 ? 57 SER A CA   6  
ATOM 7251  C C    . SER A 1 57 ? -4.064  -10.141 2.298   1.00 0.00 ? 57 SER A C    6  
ATOM 7252  O O    . SER A 1 57 ? -4.064  -8.926  2.102   1.00 0.00 ? 57 SER A O    6  
ATOM 7253  C CB   . SER A 1 57 ? -6.258  -11.071 1.537   1.00 0.00 ? 57 SER A CB   6  
ATOM 7254  O OG   . SER A 1 57 ? -5.652  -11.906 0.566   1.00 0.00 ? 57 SER A OG   6  
ATOM 7255  H H    . SER A 1 57 ? -6.536  -9.312  3.537   1.00 0.00 ? 57 SER A H    6  
ATOM 7256  H HA   . SER A 1 57 ? -5.065  -11.825 3.146   1.00 0.00 ? 57 SER A HA   6  
ATOM 7257  H HB2  . SER A 1 57 ? -7.177  -11.532 1.868   1.00 0.00 ? 57 SER A HB2  6  
ATOM 7258  H HB3  . SER A 1 57 ? -6.478  -10.114 1.085   1.00 0.00 ? 57 SER A HB3  6  
ATOM 7259  H HG   . SER A 1 57 ? -4.698  -11.808 0.609   1.00 0.00 ? 57 SER A HG   6  
ATOM 7260  N N    . GLN A 1 58 ? -2.984  -10.900 2.144   1.00 0.00 ? 58 GLN A N    6  
ATOM 7261  C CA   . GLN A 1 58 ? -1.706  -10.334 1.728   1.00 0.00 ? 58 GLN A CA   6  
ATOM 7262  C C    . GLN A 1 58 ? -1.909  -9.242  0.683   1.00 0.00 ? 58 GLN A C    6  
ATOM 7263  O O    . GLN A 1 58 ? -1.120  -8.301  0.592   1.00 0.00 ? 58 GLN A O    6  
ATOM 7264  C CB   . GLN A 1 58 ? -0.797  -11.430 1.168   1.00 0.00 ? 58 GLN A CB   6  
ATOM 7265  C CG   . GLN A 1 58 ? -0.567  -12.582 2.133   1.00 0.00 ? 58 GLN A CG   6  
ATOM 7266  C CD   . GLN A 1 58 ? 0.322   -13.663 1.551   1.00 0.00 ? 58 GLN A CD   6  
ATOM 7267  O OE1  . GLN A 1 58 ? 0.492   -13.755 0.335   1.00 0.00 ? 58 GLN A OE1  6  
ATOM 7268  N NE2  . GLN A 1 58 ? 0.897   -14.488 2.418   1.00 0.00 ? 58 GLN A NE2  6  
ATOM 7269  H H    . GLN A 1 58 ? -3.047  -11.862 2.316   1.00 0.00 ? 58 GLN A H    6  
ATOM 7270  H HA   . GLN A 1 58 ? -1.237  -9.900  2.598   1.00 0.00 ? 58 GLN A HA   6  
ATOM 7271  H HB2  . GLN A 1 58 ? -1.243  -11.826 0.268   1.00 0.00 ? 58 GLN A HB2  6  
ATOM 7272  H HB3  . GLN A 1 58 ? 0.162   -10.996 0.925   1.00 0.00 ? 58 GLN A HB3  6  
ATOM 7273  H HG2  . GLN A 1 58 ? -0.101  -12.198 3.028   1.00 0.00 ? 58 GLN A HG2  6  
ATOM 7274  H HG3  . GLN A 1 58 ? -1.522  -13.019 2.386   1.00 0.00 ? 58 GLN A HG3  6  
ATOM 7275  H HE21 . GLN A 1 58 ? 0.715   -14.355 3.373   1.00 0.00 ? 58 GLN A HE21 6  
ATOM 7276  H HE22 . GLN A 1 58 ? 1.476   -15.196 2.069   1.00 0.00 ? 58 GLN A HE22 6  
ATOM 7277  N N    . LEU A 1 59 ? -2.970  -9.374  -0.105  1.00 0.00 ? 59 LEU A N    6  
ATOM 7278  C CA   . LEU A 1 59 ? -3.277  -8.398  -1.145  1.00 0.00 ? 59 LEU A CA   6  
ATOM 7279  C C    . LEU A 1 59 ? -3.669  -7.057  -0.534  1.00 0.00 ? 59 LEU A C    6  
ATOM 7280  O O    . LEU A 1 59 ? -3.132  -6.014  -0.908  1.00 0.00 ? 59 LEU A O    6  
ATOM 7281  C CB   . LEU A 1 59 ? -4.407  -8.914  -2.038  1.00 0.00 ? 59 LEU A CB   6  
ATOM 7282  C CG   . LEU A 1 59 ? -4.907  -7.949  -3.113  1.00 0.00 ? 59 LEU A CG   6  
ATOM 7283  C CD1  . LEU A 1 59 ? -3.893  -7.834  -4.241  1.00 0.00 ? 59 LEU A CD1  6  
ATOM 7284  C CD2  . LEU A 1 59 ? -6.257  -8.401  -3.650  1.00 0.00 ? 59 LEU A CD2  6  
ATOM 7285  H H    . LEU A 1 59 ? -3.562  -10.146 0.015   1.00 0.00 ? 59 LEU A H    6  
ATOM 7286  H HA   . LEU A 1 59 ? -2.389  -8.263  -1.744  1.00 0.00 ? 59 LEU A HA   6  
ATOM 7287  H HB2  . LEU A 1 59 ? -4.056  -9.807  -2.533  1.00 0.00 ? 59 LEU A HB2  6  
ATOM 7288  H HB3  . LEU A 1 59 ? -5.244  -9.163  -1.401  1.00 0.00 ? 59 LEU A HB3  6  
ATOM 7289  H HG   . LEU A 1 59 ? -5.032  -6.967  -2.676  1.00 0.00 ? 59 LEU A HG   6  
ATOM 7290  H HD11 . LEU A 1 59 ? -3.812  -6.803  -4.549  1.00 0.00 ? 59 LEU A HD11 6  
ATOM 7291  H HD12 . LEU A 1 59 ? -4.216  -8.436  -5.077  1.00 0.00 ? 59 LEU A HD12 6  
ATOM 7292  H HD13 . LEU A 1 59 ? -2.931  -8.185  -3.897  1.00 0.00 ? 59 LEU A HD13 6  
ATOM 7293  H HD21 . LEU A 1 59 ? -6.951  -8.513  -2.830  1.00 0.00 ? 59 LEU A HD21 6  
ATOM 7294  H HD22 . LEU A 1 59 ? -6.143  -9.348  -4.157  1.00 0.00 ? 59 LEU A HD22 6  
ATOM 7295  H HD23 . LEU A 1 59 ? -6.633  -7.664  -4.344  1.00 0.00 ? 59 LEU A HD23 6  
ATOM 7296  N N    . GLN A 1 60 ? -4.605  -7.092  0.408   1.00 0.00 ? 60 GLN A N    6  
ATOM 7297  C CA   . GLN A 1 60 ? -5.067  -5.878  1.072   1.00 0.00 ? 60 GLN A CA   6  
ATOM 7298  C C    . GLN A 1 60 ? -3.903  -4.932  1.347   1.00 0.00 ? 60 GLN A C    6  
ATOM 7299  O O    . GLN A 1 60 ? -3.870  -3.809  0.844   1.00 0.00 ? 60 GLN A O    6  
ATOM 7300  C CB   . GLN A 1 60 ? -5.777  -6.226  2.381   1.00 0.00 ? 60 GLN A CB   6  
ATOM 7301  C CG   . GLN A 1 60 ? -7.122  -6.907  2.181   1.00 0.00 ? 60 GLN A CG   6  
ATOM 7302  C CD   . GLN A 1 60 ? -8.067  -6.686  3.346   1.00 0.00 ? 60 GLN A CD   6  
ATOM 7303  O OE1  . GLN A 1 60 ? -8.306  -5.552  3.760   1.00 0.00 ? 60 GLN A OE1  6  
ATOM 7304  N NE2  . GLN A 1 60 ? -8.610  -7.773  3.882   1.00 0.00 ? 60 GLN A NE2  6  
ATOM 7305  H H    . GLN A 1 60 ? -4.995  -7.953  0.663   1.00 0.00 ? 60 GLN A H    6  
ATOM 7306  H HA   . GLN A 1 60 ? -5.766  -5.386  0.413   1.00 0.00 ? 60 GLN A HA   6  
ATOM 7307  H HB2  . GLN A 1 60 ? -5.145  -6.886  2.955   1.00 0.00 ? 60 GLN A HB2  6  
ATOM 7308  H HB3  . GLN A 1 60 ? -5.939  -5.317  2.941   1.00 0.00 ? 60 GLN A HB3  6  
ATOM 7309  H HG2  . GLN A 1 60 ? -7.581  -6.514  1.286   1.00 0.00 ? 60 GLN A HG2  6  
ATOM 7310  H HG3  . GLN A 1 60 ? -6.959  -7.968  2.064   1.00 0.00 ? 60 GLN A HG3  6  
ATOM 7311  H HE21 . GLN A 1 60 ? -8.372  -8.645  3.501   1.00 0.00 ? 60 GLN A HE21 6  
ATOM 7312  H HE22 . GLN A 1 60 ? -9.223  -7.660  4.636   1.00 0.00 ? 60 GLN A HE22 6  
ATOM 7313  N N    . VAL A 1 61 ? -2.948  -5.394  2.149   1.00 0.00 ? 61 VAL A N    6  
ATOM 7314  C CA   . VAL A 1 61 ? -1.781  -4.589  2.490   1.00 0.00 ? 61 VAL A CA   6  
ATOM 7315  C C    . VAL A 1 61 ? -1.049  -4.123  1.237   1.00 0.00 ? 61 VAL A C    6  
ATOM 7316  O O    . VAL A 1 61 ? -0.775  -2.934  1.070   1.00 0.00 ? 61 VAL A O    6  
ATOM 7317  C CB   . VAL A 1 61 ? -0.801  -5.372  3.383   1.00 0.00 ? 61 VAL A CB   6  
ATOM 7318  C CG1  . VAL A 1 61 ? 0.320   -4.466  3.869   1.00 0.00 ? 61 VAL A CG1  6  
ATOM 7319  C CG2  . VAL A 1 61 ? -1.536  -6.001  4.557   1.00 0.00 ? 61 VAL A CG2  6  
ATOM 7320  H H    . VAL A 1 61 ? -3.030  -6.297  2.518   1.00 0.00 ? 61 VAL A H    6  
ATOM 7321  H HA   . VAL A 1 61 ? -2.122  -3.723  3.040   1.00 0.00 ? 61 VAL A HA   6  
ATOM 7322  H HB   . VAL A 1 61 ? -0.363  -6.165  2.793   1.00 0.00 ? 61 VAL A HB   6  
ATOM 7323  H HG11 . VAL A 1 61 ? 1.256   -5.004  3.836   1.00 0.00 ? 61 VAL A HG11 6  
ATOM 7324  H HG12 . VAL A 1 61 ? 0.380   -3.595  3.233   1.00 0.00 ? 61 VAL A HG12 6  
ATOM 7325  H HG13 . VAL A 1 61 ? 0.118   -4.158  4.885   1.00 0.00 ? 61 VAL A HG13 6  
ATOM 7326  H HG21 . VAL A 1 61 ? -2.596  -6.014  4.352   1.00 0.00 ? 61 VAL A HG21 6  
ATOM 7327  H HG22 . VAL A 1 61 ? -1.186  -7.013  4.702   1.00 0.00 ? 61 VAL A HG22 6  
ATOM 7328  H HG23 . VAL A 1 61 ? -1.349  -5.425  5.450   1.00 0.00 ? 61 VAL A HG23 6  
ATOM 7329  N N    . LYS A 1 62 ? -0.735  -5.067  0.357   1.00 0.00 ? 62 LYS A N    6  
ATOM 7330  C CA   . LYS A 1 62 ? -0.035  -4.755  -0.884  1.00 0.00 ? 62 LYS A CA   6  
ATOM 7331  C C    . LYS A 1 62 ? -0.720  -3.608  -1.621  1.00 0.00 ? 62 LYS A C    6  
ATOM 7332  O O    . LYS A 1 62 ? -0.143  -2.533  -1.792  1.00 0.00 ? 62 LYS A O    6  
ATOM 7333  C CB   . LYS A 1 62 ? 0.024   -5.990  -1.785  1.00 0.00 ? 62 LYS A CB   6  
ATOM 7334  C CG   . LYS A 1 62 ? 0.974   -5.841  -2.961  1.00 0.00 ? 62 LYS A CG   6  
ATOM 7335  C CD   . LYS A 1 62 ? 0.747   -6.924  -4.002  1.00 0.00 ? 62 LYS A CD   6  
ATOM 7336  C CE   . LYS A 1 62 ? 1.369   -8.245  -3.575  1.00 0.00 ? 62 LYS A CE   6  
ATOM 7337  N NZ   . LYS A 1 62 ? 1.500   -9.191  -4.718  1.00 0.00 ? 62 LYS A NZ   6  
ATOM 7338  H H    . LYS A 1 62 ? -0.980  -5.997  0.546   1.00 0.00 ? 62 LYS A H    6  
ATOM 7339  H HA   . LYS A 1 62 ? 0.970   -4.455  -0.631  1.00 0.00 ? 62 LYS A HA   6  
ATOM 7340  H HB2  . LYS A 1 62 ? 0.345   -6.836  -1.195  1.00 0.00 ? 62 LYS A HB2  6  
ATOM 7341  H HB3  . LYS A 1 62 ? -0.966  -6.187  -2.172  1.00 0.00 ? 62 LYS A HB3  6  
ATOM 7342  H HG2  . LYS A 1 62 ? 0.815   -4.876  -3.420  1.00 0.00 ? 62 LYS A HG2  6  
ATOM 7343  H HG3  . LYS A 1 62 ? 1.991   -5.906  -2.601  1.00 0.00 ? 62 LYS A HG3  6  
ATOM 7344  H HD2  . LYS A 1 62 ? -0.314  -7.066  -4.137  1.00 0.00 ? 62 LYS A HD2  6  
ATOM 7345  H HD3  . LYS A 1 62 ? 1.192   -6.612  -4.936  1.00 0.00 ? 62 LYS A HD3  6  
ATOM 7346  H HE2  . LYS A 1 62 ? 2.348   -8.052  -3.166  1.00 0.00 ? 62 LYS A HE2  6  
ATOM 7347  H HE3  . LYS A 1 62 ? 0.744   -8.694  -2.817  1.00 0.00 ? 62 LYS A HE3  6  
ATOM 7348  H HZ1  . LYS A 1 62 ? 1.316   -10.164 -4.399  1.00 0.00 ? 62 LYS A HZ1  6  
ATOM 7349  H HZ2  . LYS A 1 62 ? 2.460   -9.143  -5.113  1.00 0.00 ? 62 LYS A HZ2  6  
ATOM 7350  H HZ3  . LYS A 1 62 ? 0.817   -8.948  -5.464  1.00 0.00 ? 62 LYS A HZ3  6  
ATOM 7351  N N    . THR A 1 63 ? -1.955  -3.842  -2.054  1.00 0.00 ? 63 THR A N    6  
ATOM 7352  C CA   . THR A 1 63 ? -2.718  -2.828  -2.772  1.00 0.00 ? 63 THR A CA   6  
ATOM 7353  C C    . THR A 1 63 ? -2.952  -1.599  -1.902  1.00 0.00 ? 63 THR A C    6  
ATOM 7354  O O    . THR A 1 63 ? -2.519  -0.497  -2.239  1.00 0.00 ? 63 THR A O    6  
ATOM 7355  C CB   . THR A 1 63 ? -4.078  -3.378  -3.242  1.00 0.00 ? 63 THR A CB   6  
ATOM 7356  O OG1  . THR A 1 63 ? -3.887  -4.587  -3.986  1.00 0.00 ? 63 THR A OG1  6  
ATOM 7357  C CG2  . THR A 1 63 ? -4.805  -2.356  -4.103  1.00 0.00 ? 63 THR A CG2  6  
ATOM 7358  H H    . THR A 1 63 ? -2.360  -4.718  -1.887  1.00 0.00 ? 63 THR A H    6  
ATOM 7359  H HA   . THR A 1 63 ? -2.149  -2.538  -3.643  1.00 0.00 ? 63 THR A HA   6  
ATOM 7360  H HB   . THR A 1 63 ? -4.683  -3.591  -2.373  1.00 0.00 ? 63 THR A HB   6  
ATOM 7361  H HG1  . THR A 1 63 ? -4.660  -4.753  -4.531  1.00 0.00 ? 63 THR A HG1  6  
ATOM 7362  H HG21 . THR A 1 63 ? -5.522  -2.862  -4.733  1.00 0.00 ? 63 THR A HG21 6  
ATOM 7363  H HG22 . THR A 1 63 ? -4.091  -1.831  -4.720  1.00 0.00 ? 63 THR A HG22 6  
ATOM 7364  H HG23 . THR A 1 63 ? -5.319  -1.651  -3.467  1.00 0.00 ? 63 THR A HG23 6  
ATOM 7365  N N    . TRP A 1 64 ? -3.640  -1.794  -0.783  1.00 0.00 ? 64 TRP A N    6  
ATOM 7366  C CA   . TRP A 1 64 ? -3.931  -0.700  0.136   1.00 0.00 ? 64 TRP A CA   6  
ATOM 7367  C C    . TRP A 1 64 ? -2.748  0.256   0.237   1.00 0.00 ? 64 TRP A C    6  
ATOM 7368  O O    . TRP A 1 64 ? -2.912  1.474   0.156   1.00 0.00 ? 64 TRP A O    6  
ATOM 7369  C CB   . TRP A 1 64 ? -4.279  -1.248  1.521   1.00 0.00 ? 64 TRP A CB   6  
ATOM 7370  C CG   . TRP A 1 64 ? -4.822  -0.207  2.453   1.00 0.00 ? 64 TRP A CG   6  
ATOM 7371  C CD1  . TRP A 1 64 ? -6.059  0.370   2.406   1.00 0.00 ? 64 TRP A CD1  6  
ATOM 7372  C CD2  . TRP A 1 64 ? -4.144  0.382   3.568   1.00 0.00 ? 64 TRP A CD2  6  
ATOM 7373  N NE1  . TRP A 1 64 ? -6.191  1.282   3.425   1.00 0.00 ? 64 TRP A NE1  6  
ATOM 7374  C CE2  . TRP A 1 64 ? -5.031  1.307   4.153   1.00 0.00 ? 64 TRP A CE2  6  
ATOM 7375  C CE3  . TRP A 1 64 ? -2.876  0.216   4.131   1.00 0.00 ? 64 TRP A CE3  6  
ATOM 7376  C CZ2  . TRP A 1 64 ? -4.687  2.063   5.271   1.00 0.00 ? 64 TRP A CZ2  6  
ATOM 7377  C CZ3  . TRP A 1 64 ? -2.536  0.967   5.240   1.00 0.00 ? 64 TRP A CZ3  6  
ATOM 7378  C CH2  . TRP A 1 64 ? -3.438  1.880   5.801   1.00 0.00 ? 64 TRP A CH2  6  
ATOM 7379  H H    . TRP A 1 64 ? -3.959  -2.696  -0.569  1.00 0.00 ? 64 TRP A H    6  
ATOM 7380  H HA   . TRP A 1 64 ? -4.783  -0.160  -0.252  1.00 0.00 ? 64 TRP A HA   6  
ATOM 7381  H HB2  . TRP A 1 64 ? -5.024  -2.023  1.417   1.00 0.00 ? 64 TRP A HB2  6  
ATOM 7382  H HB3  . TRP A 1 64 ? -3.389  -1.666  1.968   1.00 0.00 ? 64 TRP A HB3  6  
ATOM 7383  H HD1  . TRP A 1 64 ? -6.812  0.135   1.669   1.00 0.00 ? 64 TRP A HD1  6  
ATOM 7384  H HE1  . TRP A 1 64 ? -6.988  1.825   3.603   1.00 0.00 ? 64 TRP A HE1  6  
ATOM 7385  H HE3  . TRP A 1 64 ? -2.167  -0.483  3.713   1.00 0.00 ? 64 TRP A HE3  6  
ATOM 7386  H HZ2  . TRP A 1 64 ? -5.371  2.770   5.715   1.00 0.00 ? 64 TRP A HZ2  6  
ATOM 7387  H HZ3  . TRP A 1 64 ? -1.560  0.852   5.688   1.00 0.00 ? 64 TRP A HZ3  6  
ATOM 7388  H HH2  . TRP A 1 64 ? -3.130  2.445   6.667   1.00 0.00 ? 64 TRP A HH2  6  
ATOM 7389  N N    . TYR A 1 65 ? -1.555  -0.302  0.414   1.00 0.00 ? 65 TYR A N    6  
ATOM 7390  C CA   . TYR A 1 65 ? -0.344  0.502   0.528   1.00 0.00 ? 65 TYR A CA   6  
ATOM 7391  C C    . TYR A 1 65 ? -0.183  1.418   -0.681  1.00 0.00 ? 65 TYR A C    6  
ATOM 7392  O O    . TYR A 1 65 ? -0.317  2.636   -0.572  1.00 0.00 ? 65 TYR A O    6  
ATOM 7393  C CB   . TYR A 1 65 ? 0.882   -0.402  0.665   1.00 0.00 ? 65 TYR A CB   6  
ATOM 7394  C CG   . TYR A 1 65 ? 1.246   -0.716  2.098   1.00 0.00 ? 65 TYR A CG   6  
ATOM 7395  C CD1  . TYR A 1 65 ? 0.295   -1.199  2.988   1.00 0.00 ? 65 TYR A CD1  6  
ATOM 7396  C CD2  . TYR A 1 65 ? 2.543   -0.530  2.563   1.00 0.00 ? 65 TYR A CD2  6  
ATOM 7397  C CE1  . TYR A 1 65 ? 0.623   -1.486  4.299   1.00 0.00 ? 65 TYR A CE1  6  
ATOM 7398  C CE2  . TYR A 1 65 ? 2.881   -0.816  3.871   1.00 0.00 ? 65 TYR A CE2  6  
ATOM 7399  C CZ   . TYR A 1 65 ? 1.917   -1.293  4.736   1.00 0.00 ? 65 TYR A CZ   6  
ATOM 7400  O OH   . TYR A 1 65 ? 2.249   -1.579  6.040   1.00 0.00 ? 65 TYR A OH   6  
ATOM 7401  H H    . TYR A 1 65 ? -1.488  -1.278  0.471   1.00 0.00 ? 65 TYR A H    6  
ATOM 7402  H HA   . TYR A 1 65 ? -0.432  1.109   1.417   1.00 0.00 ? 65 TYR A HA   6  
ATOM 7403  H HB2  . TYR A 1 65 ? 0.690   -1.337  0.160   1.00 0.00 ? 65 TYR A HB2  6  
ATOM 7404  H HB3  . TYR A 1 65 ? 1.731   0.082   0.205   1.00 0.00 ? 65 TYR A HB3  6  
ATOM 7405  H HD1  . TYR A 1 65 ? -0.718  -1.349  2.643   1.00 0.00 ? 65 TYR A HD1  6  
ATOM 7406  H HD2  . TYR A 1 65 ? 3.295   -0.156  1.883   1.00 0.00 ? 65 TYR A HD2  6  
ATOM 7407  H HE1  . TYR A 1 65 ? -0.131  -1.860  4.976   1.00 0.00 ? 65 TYR A HE1  6  
ATOM 7408  H HE2  . TYR A 1 65 ? 3.894   -0.665  4.214   1.00 0.00 ? 65 TYR A HE2  6  
ATOM 7409  H HH   . TYR A 1 65 ? 1.451   -1.608  6.574   1.00 0.00 ? 65 TYR A HH   6  
ATOM 7410  N N    . GLN A 1 66 ? 0.107   0.821   -1.833  1.00 0.00 ? 66 GLN A N    6  
ATOM 7411  C CA   . GLN A 1 66 ? 0.287   1.583   -3.063  1.00 0.00 ? 66 GLN A CA   6  
ATOM 7412  C C    . GLN A 1 66 ? -0.743  2.702   -3.167  1.00 0.00 ? 66 GLN A C    6  
ATOM 7413  O O    . GLN A 1 66 ? -0.406  3.843   -3.480  1.00 0.00 ? 66 GLN A O    6  
ATOM 7414  C CB   . GLN A 1 66 ? 0.180   0.661   -4.279  1.00 0.00 ? 66 GLN A CB   6  
ATOM 7415  C CG   . GLN A 1 66 ? 1.394   -0.233  -4.474  1.00 0.00 ? 66 GLN A CG   6  
ATOM 7416  C CD   . GLN A 1 66 ? 1.363   -0.980  -5.793  1.00 0.00 ? 66 GLN A CD   6  
ATOM 7417  O OE1  . GLN A 1 66 ? 0.963   -2.143  -5.851  1.00 0.00 ? 66 GLN A OE1  6  
ATOM 7418  N NE2  . GLN A 1 66 ? 1.788   -0.315  -6.860  1.00 0.00 ? 66 GLN A NE2  6  
ATOM 7419  H H    . GLN A 1 66 ? 0.202   -0.153  -1.856  1.00 0.00 ? 66 GLN A H    6  
ATOM 7420  H HA   . GLN A 1 66 ? 1.274   2.020   -3.040  1.00 0.00 ? 66 GLN A HA   6  
ATOM 7421  H HB2  . GLN A 1 66 ? -0.689  0.031   -4.163  1.00 0.00 ? 66 GLN A HB2  6  
ATOM 7422  H HB3  . GLN A 1 66 ? 0.060   1.266   -5.165  1.00 0.00 ? 66 GLN A HB3  6  
ATOM 7423  H HG2  . GLN A 1 66 ? 2.284   0.379   -4.446  1.00 0.00 ? 66 GLN A HG2  6  
ATOM 7424  H HG3  . GLN A 1 66 ? 1.428   -0.953  -3.669  1.00 0.00 ? 66 GLN A HG3  6  
ATOM 7425  H HE21 . GLN A 1 66 ? 2.094   0.609   -6.738  1.00 0.00 ? 66 GLN A HE21 6  
ATOM 7426  H HE22 . GLN A 1 66 ? 1.780   -0.774  -7.725  1.00 0.00 ? 66 GLN A HE22 6  
ATOM 7427  N N    . ASN A 1 67 ? -2.002  2.367   -2.901  1.00 0.00 ? 67 ASN A N    6  
ATOM 7428  C CA   . ASN A 1 67 ? -3.083  3.344   -2.965  1.00 0.00 ? 67 ASN A CA   6  
ATOM 7429  C C    . ASN A 1 67 ? -2.881  4.447   -1.930  1.00 0.00 ? 67 ASN A C    6  
ATOM 7430  O O    . ASN A 1 67 ? -3.213  5.608   -2.172  1.00 0.00 ? 67 ASN A O    6  
ATOM 7431  C CB   . ASN A 1 67 ? -4.432  2.659   -2.739  1.00 0.00 ? 67 ASN A CB   6  
ATOM 7432  C CG   . ASN A 1 67 ? -4.935  1.950   -3.982  1.00 0.00 ? 67 ASN A CG   6  
ATOM 7433  O OD1  . ASN A 1 67 ? -5.150  2.572   -5.022  1.00 0.00 ? 67 ASN A OD1  6  
ATOM 7434  N ND2  . ASN A 1 67 ? -5.125  0.639   -3.879  1.00 0.00 ? 67 ASN A ND2  6  
ATOM 7435  H H    . ASN A 1 67 ? -2.209  1.441   -2.656  1.00 0.00 ? 67 ASN A H    6  
ATOM 7436  H HA   . ASN A 1 67 ? -3.073  3.785   -3.950  1.00 0.00 ? 67 ASN A HA   6  
ATOM 7437  H HB2  . ASN A 1 67 ? -4.331  1.930   -1.948  1.00 0.00 ? 67 ASN A HB2  6  
ATOM 7438  H HB3  . ASN A 1 67 ? -5.162  3.400   -2.450  1.00 0.00 ? 67 ASN A HB3  6  
ATOM 7439  H HD21 . ASN A 1 67 ? -4.933  0.210   -3.019  1.00 0.00 ? 67 ASN A HD21 6  
ATOM 7440  H HD22 . ASN A 1 67 ? -5.449  0.156   -4.667  1.00 0.00 ? 67 ASN A HD22 6  
ATOM 7441  N N    . ARG A 1 68 ? -2.333  4.077   -0.777  1.00 0.00 ? 68 ARG A N    6  
ATOM 7442  C CA   . ARG A 1 68 ? -2.088  5.034   0.294   1.00 0.00 ? 68 ARG A CA   6  
ATOM 7443  C C    . ARG A 1 68 ? -0.925  5.958   -0.058  1.00 0.00 ? 68 ARG A C    6  
ATOM 7444  O O    . ARG A 1 68 ? -0.916  7.131   0.316   1.00 0.00 ? 68 ARG A O    6  
ATOM 7445  C CB   . ARG A 1 68 ? -1.792  4.301   1.604   1.00 0.00 ? 68 ARG A CB   6  
ATOM 7446  C CG   . ARG A 1 68 ? -3.039  3.828   2.332   1.00 0.00 ? 68 ARG A CG   6  
ATOM 7447  C CD   . ARG A 1 68 ? -3.775  4.987   2.987   1.00 0.00 ? 68 ARG A CD   6  
ATOM 7448  N NE   . ARG A 1 68 ? -5.108  4.602   3.442   1.00 0.00 ? 68 ARG A NE   6  
ATOM 7449  C CZ   . ARG A 1 68 ? -6.103  5.464   3.617   1.00 0.00 ? 68 ARG A CZ   6  
ATOM 7450  N NH1  . ARG A 1 68 ? -5.915  6.755   3.377   1.00 0.00 ? 68 ARG A NH1  6  
ATOM 7451  N NH2  . ARG A 1 68 ? -7.288  5.037   4.034   1.00 0.00 ? 68 ARG A NH2  6  
ATOM 7452  H H    . ARG A 1 68 ? -2.090  3.137   -0.644  1.00 0.00 ? 68 ARG A H    6  
ATOM 7453  H HA   . ARG A 1 68 ? -2.980  5.629   0.419   1.00 0.00 ? 68 ARG A HA   6  
ATOM 7454  H HB2  . ARG A 1 68 ? -1.178  3.438   1.390   1.00 0.00 ? 68 ARG A HB2  6  
ATOM 7455  H HB3  . ARG A 1 68 ? -1.249  4.965   2.259   1.00 0.00 ? 68 ARG A HB3  6  
ATOM 7456  H HG2  . ARG A 1 68 ? -3.700  3.351   1.624   1.00 0.00 ? 68 ARG A HG2  6  
ATOM 7457  H HG3  . ARG A 1 68 ? -2.752  3.118   3.094   1.00 0.00 ? 68 ARG A HG3  6  
ATOM 7458  H HD2  . ARG A 1 68 ? -3.200  5.327   3.836   1.00 0.00 ? 68 ARG A HD2  6  
ATOM 7459  H HD3  . ARG A 1 68 ? -3.867  5.788   2.270   1.00 0.00 ? 68 ARG A HD3  6  
ATOM 7460  H HE   . ARG A 1 68 ? -5.269  3.653   3.625   1.00 0.00 ? 68 ARG A HE   6  
ATOM 7461  H HH11 . ARG A 1 68 ? -5.024  7.080   3.062   1.00 0.00 ? 68 ARG A HH11 6  
ATOM 7462  H HH12 . ARG A 1 68 ? -6.666  7.402   3.508   1.00 0.00 ? 68 ARG A HH12 6  
ATOM 7463  H HH21 . ARG A 1 68 ? -7.433  4.065   4.216   1.00 0.00 ? 68 ARG A HH21 6  
ATOM 7464  H HH22 . ARG A 1 68 ? -8.036  5.687   4.165   1.00 0.00 ? 68 ARG A HH22 6  
ATOM 7465  N N    . ARG A 1 69 ? 0.054   5.420   -0.778  1.00 0.00 ? 69 ARG A N    6  
ATOM 7466  C CA   . ARG A 1 69 ? 1.222   6.195   -1.179  1.00 0.00 ? 69 ARG A CA   6  
ATOM 7467  C C    . ARG A 1 69 ? 0.818   7.363   -2.074  1.00 0.00 ? 69 ARG A C    6  
ATOM 7468  O O    . ARG A 1 69 ? 1.467   8.409   -2.077  1.00 0.00 ? 69 ARG A O    6  
ATOM 7469  C CB   . ARG A 1 69 ? 2.227   5.303   -1.909  1.00 0.00 ? 69 ARG A CB   6  
ATOM 7470  C CG   . ARG A 1 69 ? 3.074   4.451   -0.978  1.00 0.00 ? 69 ARG A CG   6  
ATOM 7471  C CD   . ARG A 1 69 ? 4.108   3.644   -1.748  1.00 0.00 ? 69 ARG A CD   6  
ATOM 7472  N NE   . ARG A 1 69 ? 4.913   4.485   -2.630  1.00 0.00 ? 69 ARG A NE   6  
ATOM 7473  C CZ   . ARG A 1 69 ? 5.875   5.293   -2.198  1.00 0.00 ? 69 ARG A CZ   6  
ATOM 7474  N NH1  . ARG A 1 69 ? 6.151   5.367   -0.903  1.00 0.00 ? 69 ARG A NH1  6  
ATOM 7475  N NH2  . ARG A 1 69 ? 6.564   6.027   -3.062  1.00 0.00 ? 69 ARG A NH2  6  
ATOM 7476  H H    . ARG A 1 69 ? -0.010  4.479   -1.046  1.00 0.00 ? 69 ARG A H    6  
ATOM 7477  H HA   . ARG A 1 69 ? 1.684   6.585   -0.285  1.00 0.00 ? 69 ARG A HA   6  
ATOM 7478  H HB2  . ARG A 1 69 ? 1.688   4.643   -2.574  1.00 0.00 ? 69 ARG A HB2  6  
ATOM 7479  H HB3  . ARG A 1 69 ? 2.887   5.927   -2.492  1.00 0.00 ? 69 ARG A HB3  6  
ATOM 7480  H HG2  . ARG A 1 69 ? 3.585   5.096   -0.280  1.00 0.00 ? 69 ARG A HG2  6  
ATOM 7481  H HG3  . ARG A 1 69 ? 2.429   3.773   -0.440  1.00 0.00 ? 69 ARG A HG3  6  
ATOM 7482  H HD2  . ARG A 1 69 ? 4.760   3.152   -1.042  1.00 0.00 ? 69 ARG A HD2  6  
ATOM 7483  H HD3  . ARG A 1 69 ? 3.596   2.902   -2.343  1.00 0.00 ? 69 ARG A HD3  6  
ATOM 7484  H HE   . ARG A 1 69 ? 4.726   4.445   -3.591  1.00 0.00 ? 69 ARG A HE   6  
ATOM 7485  H HH11 . ARG A 1 69 ? 5.634   4.814   -0.250  1.00 0.00 ? 69 ARG A HH11 6  
ATOM 7486  H HH12 . ARG A 1 69 ? 6.877   5.975   -0.581  1.00 0.00 ? 69 ARG A HH12 6  
ATOM 7487  H HH21 . ARG A 1 69 ? 6.359   5.973   -4.039  1.00 0.00 ? 69 ARG A HH21 6  
ATOM 7488  H HH22 . ARG A 1 69 ? 7.288   6.635   -2.736  1.00 0.00 ? 69 ARG A HH22 6  
ATOM 7489  N N    . MET A 1 70 ? -0.257  7.177   -2.832  1.00 0.00 ? 70 MET A N    6  
ATOM 7490  C CA   . MET A 1 70 ? -0.747  8.215   -3.731  1.00 0.00 ? 70 MET A CA   6  
ATOM 7491  C C    . MET A 1 70 ? -1.102  9.481   -2.957  1.00 0.00 ? 70 MET A C    6  
ATOM 7492  O O    . MET A 1 70 ? -0.877  10.595  -3.432  1.00 0.00 ? 70 MET A O    6  
ATOM 7493  C CB   . MET A 1 70 ? -1.970  7.716   -4.503  1.00 0.00 ? 70 MET A CB   6  
ATOM 7494  C CG   . MET A 1 70 ? -1.634  6.705   -5.587  1.00 0.00 ? 70 MET A CG   6  
ATOM 7495  S SD   . MET A 1 70 ? -0.410  7.322   -6.758  1.00 0.00 ? 70 MET A SD   6  
ATOM 7496  C CE   . MET A 1 70 ? 0.601   5.862   -6.993  1.00 0.00 ? 70 MET A CE   6  
ATOM 7497  H H    . MET A 1 70 ? -0.733  6.321   -2.787  1.00 0.00 ? 70 MET A H    6  
ATOM 7498  H HA   . MET A 1 70 ? 0.041   8.445   -4.433  1.00 0.00 ? 70 MET A HA   6  
ATOM 7499  H HB2  . MET A 1 70 ? -2.655  7.253   -3.808  1.00 0.00 ? 70 MET A HB2  6  
ATOM 7500  H HB3  . MET A 1 70 ? -2.457  8.560   -4.968  1.00 0.00 ? 70 MET A HB3  6  
ATOM 7501  H HG2  . MET A 1 70 ? -1.245  5.812   -5.120  1.00 0.00 ? 70 MET A HG2  6  
ATOM 7502  H HG3  . MET A 1 70 ? -2.538  6.462   -6.125  1.00 0.00 ? 70 MET A HG3  6  
ATOM 7503  H HE1  . MET A 1 70 ? 1.099   5.920   -7.949  1.00 0.00 ? 70 MET A HE1  6  
ATOM 7504  H HE2  . MET A 1 70 ? 1.338   5.805   -6.206  1.00 0.00 ? 70 MET A HE2  6  
ATOM 7505  H HE3  . MET A 1 70 ? -0.026  4.983   -6.965  1.00 0.00 ? 70 MET A HE3  6  
ATOM 7506  N N    . LYS A 1 71 ? -1.658  9.303   -1.764  1.00 0.00 ? 71 LYS A N    6  
ATOM 7507  C CA   . LYS A 1 71 ? -2.043  10.430  -0.923  1.00 0.00 ? 71 LYS A CA   6  
ATOM 7508  C C    . LYS A 1 71 ? -0.877  10.880  -0.048  1.00 0.00 ? 71 LYS A C    6  
ATOM 7509  O O    . LYS A 1 71 ? -0.556  12.067  0.012   1.00 0.00 ? 71 LYS A O    6  
ATOM 7510  C CB   . LYS A 1 71 ? -3.237  10.053  -0.044  1.00 0.00 ? 71 LYS A CB   6  
ATOM 7511  C CG   . LYS A 1 71 ? -4.041  11.249  0.437   1.00 0.00 ? 71 LYS A CG   6  
ATOM 7512  C CD   . LYS A 1 71 ? -5.064  10.848  1.487   1.00 0.00 ? 71 LYS A CD   6  
ATOM 7513  C CE   . LYS A 1 71 ? -5.700  12.066  2.139   1.00 0.00 ? 71 LYS A CE   6  
ATOM 7514  N NZ   . LYS A 1 71 ? -6.748  12.674  1.274   1.00 0.00 ? 71 LYS A NZ   6  
ATOM 7515  H H    . LYS A 1 71 ? -1.812  8.390   -1.440  1.00 0.00 ? 71 LYS A H    6  
ATOM 7516  H HA   . LYS A 1 71 ? -2.327  11.246  -1.571  1.00 0.00 ? 71 LYS A HA   6  
ATOM 7517  H HB2  . LYS A 1 71 ? -3.894  9.407   -0.608  1.00 0.00 ? 71 LYS A HB2  6  
ATOM 7518  H HB3  . LYS A 1 71 ? -2.877  9.517   0.822   1.00 0.00 ? 71 LYS A HB3  6  
ATOM 7519  H HG2  . LYS A 1 71 ? -3.367  11.976  0.865   1.00 0.00 ? 71 LYS A HG2  6  
ATOM 7520  H HG3  . LYS A 1 71 ? -4.557  11.687  -0.406  1.00 0.00 ? 71 LYS A HG3  6  
ATOM 7521  H HD2  . LYS A 1 71 ? -5.838  10.260  1.017   1.00 0.00 ? 71 LYS A HD2  6  
ATOM 7522  H HD3  . LYS A 1 71 ? -4.573  10.258  2.248   1.00 0.00 ? 71 LYS A HD3  6  
ATOM 7523  H HE2  . LYS A 1 71 ? -6.146  11.765  3.074   1.00 0.00 ? 71 LYS A HE2  6  
ATOM 7524  H HE3  . LYS A 1 71 ? -4.930  12.800  2.327   1.00 0.00 ? 71 LYS A HE3  6  
ATOM 7525  H HZ1  . LYS A 1 71 ? -6.905  12.082  0.433   1.00 0.00 ? 71 LYS A HZ1  6  
ATOM 7526  H HZ2  . LYS A 1 71 ? -6.452  13.622  0.966   1.00 0.00 ? 71 LYS A HZ2  6  
ATOM 7527  H HZ3  . LYS A 1 71 ? -7.642  12.755  1.799   1.00 0.00 ? 71 LYS A HZ3  6  
ATOM 7528  N N    . TRP A 1 72 ? -0.246  9.925   0.626   1.00 0.00 ? 72 TRP A N    6  
ATOM 7529  C CA   . TRP A 1 72 ? 0.885   10.224  1.496   1.00 0.00 ? 72 TRP A CA   6  
ATOM 7530  C C    . TRP A 1 72 ? 1.912   11.091  0.776   1.00 0.00 ? 72 TRP A C    6  
ATOM 7531  O O    . TRP A 1 72 ? 2.475   12.018  1.358   1.00 0.00 ? 72 TRP A O    6  
ATOM 7532  C CB   . TRP A 1 72 ? 1.541   8.928   1.976   1.00 0.00 ? 72 TRP A CB   6  
ATOM 7533  C CG   . TRP A 1 72 ? 2.957   9.113   2.431   1.00 0.00 ? 72 TRP A CG   6  
ATOM 7534  C CD1  . TRP A 1 72 ? 3.374   9.618   3.630   1.00 0.00 ? 72 TRP A CD1  6  
ATOM 7535  C CD2  . TRP A 1 72 ? 4.143   8.796   1.694   1.00 0.00 ? 72 TRP A CD2  6  
ATOM 7536  N NE1  . TRP A 1 72 ? 4.747   9.634   3.682   1.00 0.00 ? 72 TRP A NE1  6  
ATOM 7537  C CE2  . TRP A 1 72 ? 5.242   9.134   2.507   1.00 0.00 ? 72 TRP A CE2  6  
ATOM 7538  C CE3  . TRP A 1 72 ? 4.383   8.258   0.427   1.00 0.00 ? 72 TRP A CE3  6  
ATOM 7539  C CZ2  . TRP A 1 72 ? 6.559   8.952   2.091   1.00 0.00 ? 72 TRP A CZ2  6  
ATOM 7540  C CZ3  . TRP A 1 72 ? 5.690   8.078   0.016   1.00 0.00 ? 72 TRP A CZ3  6  
ATOM 7541  C CH2  . TRP A 1 72 ? 6.764   8.423   0.846   1.00 0.00 ? 72 TRP A CH2  6  
ATOM 7542  H H    . TRP A 1 72 ? -0.549  8.997   0.537   1.00 0.00 ? 72 TRP A H    6  
ATOM 7543  H HA   . TRP A 1 72 ? 0.510   10.766  2.352   1.00 0.00 ? 72 TRP A HA   6  
ATOM 7544  H HB2  . TRP A 1 72 ? 0.974   8.531   2.805   1.00 0.00 ? 72 TRP A HB2  6  
ATOM 7545  H HB3  . TRP A 1 72 ? 1.541   8.212   1.168   1.00 0.00 ? 72 TRP A HB3  6  
ATOM 7546  H HD1  . TRP A 1 72 ? 2.710   9.953   4.412   1.00 0.00 ? 72 TRP A HD1  6  
ATOM 7547  H HE1  . TRP A 1 72 ? 5.284   9.951   4.439   1.00 0.00 ? 72 TRP A HE1  6  
ATOM 7548  H HE3  . TRP A 1 72 ? 3.568   7.985   -0.228  1.00 0.00 ? 72 TRP A HE3  6  
ATOM 7549  H HZ2  . TRP A 1 72 ? 7.398   9.213   2.720   1.00 0.00 ? 72 TRP A HZ2  6  
ATOM 7550  H HZ3  . TRP A 1 72 ? 5.894   7.664   -0.961  1.00 0.00 ? 72 TRP A HZ3  6  
ATOM 7551  H HH2  . TRP A 1 72 ? 7.768   8.266   0.484   1.00 0.00 ? 72 TRP A HH2  6  
ATOM 7552  N N    . LYS A 1 73 ? 2.151   10.785  -0.495  1.00 0.00 ? 73 LYS A N    6  
ATOM 7553  C CA   . LYS A 1 73 ? 3.109   11.538  -1.297  1.00 0.00 ? 73 LYS A CA   6  
ATOM 7554  C C    . LYS A 1 73 ? 2.652   12.982  -1.476  1.00 0.00 ? 73 LYS A C    6  
ATOM 7555  O O    . LYS A 1 73 ? 1.471   13.248  -1.701  1.00 0.00 ? 73 LYS A O    6  
ATOM 7556  C CB   . LYS A 1 73 ? 3.292   10.876  -2.664  1.00 0.00 ? 73 LYS A CB   6  
ATOM 7557  C CG   . LYS A 1 73 ? 4.338   9.776   -2.672  1.00 0.00 ? 73 LYS A CG   6  
ATOM 7558  C CD   . LYS A 1 73 ? 4.878   9.529   -4.071  1.00 0.00 ? 73 LYS A CD   6  
ATOM 7559  C CE   . LYS A 1 73 ? 3.937   8.655   -4.886  1.00 0.00 ? 73 LYS A CE   6  
ATOM 7560  N NZ   . LYS A 1 73 ? 4.348   8.579   -6.315  1.00 0.00 ? 73 LYS A NZ   6  
ATOM 7561  H H    . LYS A 1 73 ? 1.670   10.035  -0.905  1.00 0.00 ? 73 LYS A H    6  
ATOM 7562  H HA   . LYS A 1 73 ? 4.053   11.534  -0.775  1.00 0.00 ? 73 LYS A HA   6  
ATOM 7563  H HB2  . LYS A 1 73 ? 2.349   10.450  -2.974  1.00 0.00 ? 73 LYS A HB2  6  
ATOM 7564  H HB3  . LYS A 1 73 ? 3.587   11.631  -3.379  1.00 0.00 ? 73 LYS A HB3  6  
ATOM 7565  H HG2  . LYS A 1 73 ? 5.156   10.064  -2.029  1.00 0.00 ? 73 LYS A HG2  6  
ATOM 7566  H HG3  . LYS A 1 73 ? 3.891   8.864   -2.303  1.00 0.00 ? 73 LYS A HG3  6  
ATOM 7567  H HD2  . LYS A 1 73 ? 4.995   10.477  -4.575  1.00 0.00 ? 73 LYS A HD2  6  
ATOM 7568  H HD3  . LYS A 1 73 ? 5.838   9.038   -3.996  1.00 0.00 ? 73 LYS A HD3  6  
ATOM 7569  H HE2  . LYS A 1 73 ? 3.938   7.660   -4.466  1.00 0.00 ? 73 LYS A HE2  6  
ATOM 7570  H HE3  . LYS A 1 73 ? 2.941   9.068   -4.827  1.00 0.00 ? 73 LYS A HE3  6  
ATOM 7571  H HZ1  . LYS A 1 73 ? 4.117   7.642   -6.703  1.00 0.00 ? 73 LYS A HZ1  6  
ATOM 7572  H HZ2  . LYS A 1 73 ? 5.372   8.734   -6.401  1.00 0.00 ? 73 LYS A HZ2  6  
ATOM 7573  H HZ3  . LYS A 1 73 ? 3.850   9.304   -6.869  1.00 0.00 ? 73 LYS A HZ3  6  
ATOM 7574  N N    . LYS A 1 74 ? 3.595   13.913  -1.377  1.00 0.00 ? 74 LYS A N    6  
ATOM 7575  C CA   . LYS A 1 74 ? 3.292   15.330  -1.531  1.00 0.00 ? 74 LYS A CA   6  
ATOM 7576  C C    . LYS A 1 74 ? 2.862   15.643  -2.961  1.00 0.00 ? 74 LYS A C    6  
ATOM 7577  O O    . LYS A 1 74 ? 3.699   15.853  -3.839  1.00 0.00 ? 74 LYS A O    6  
ATOM 7578  C CB   . LYS A 1 74 ? 4.510   16.178  -1.157  1.00 0.00 ? 74 LYS A CB   6  
ATOM 7579  C CG   . LYS A 1 74 ? 4.744   16.278  0.341   1.00 0.00 ? 74 LYS A CG   6  
ATOM 7580  C CD   . LYS A 1 74 ? 5.598   15.128  0.849   1.00 0.00 ? 74 LYS A CD   6  
ATOM 7581  C CE   . LYS A 1 74 ? 5.663   15.111  2.369   1.00 0.00 ? 74 LYS A CE   6  
ATOM 7582  N NZ   . LYS A 1 74 ? 6.823   14.321  2.866   1.00 0.00 ? 74 LYS A NZ   6  
ATOM 7583  H H    . LYS A 1 74 ? 4.520   13.639  -1.197  1.00 0.00 ? 74 LYS A H    6  
ATOM 7584  H HA   . LYS A 1 74 ? 2.478   15.570  -0.863  1.00 0.00 ? 74 LYS A HA   6  
ATOM 7585  H HB2  . LYS A 1 74 ? 5.388   15.743  -1.610  1.00 0.00 ? 74 LYS A HB2  6  
ATOM 7586  H HB3  . LYS A 1 74 ? 4.371   17.177  -1.545  1.00 0.00 ? 74 LYS A HB3  6  
ATOM 7587  H HG2  . LYS A 1 74 ? 5.248   17.208  0.556   1.00 0.00 ? 74 LYS A HG2  6  
ATOM 7588  H HG3  . LYS A 1 74 ? 3.790   16.257  0.848   1.00 0.00 ? 74 LYS A HG3  6  
ATOM 7589  H HD2  . LYS A 1 74 ? 5.172   14.196  0.508   1.00 0.00 ? 74 LYS A HD2  6  
ATOM 7590  H HD3  . LYS A 1 74 ? 6.599   15.233  0.456   1.00 0.00 ? 74 LYS A HD3  6  
ATOM 7591  H HE2  . LYS A 1 74 ? 5.752   16.127  2.723   1.00 0.00 ? 74 LYS A HE2  6  
ATOM 7592  H HE3  . LYS A 1 74 ? 4.751   14.676  2.750   1.00 0.00 ? 74 LYS A HE3  6  
ATOM 7593  H HZ1  . LYS A 1 74 ? 7.088   13.598  2.166   1.00 0.00 ? 74 LYS A HZ1  6  
ATOM 7594  H HZ2  . LYS A 1 74 ? 6.576   13.848  3.759   1.00 0.00 ? 74 LYS A HZ2  6  
ATOM 7595  H HZ3  . LYS A 1 74 ? 7.637   14.946  3.030   1.00 0.00 ? 74 LYS A HZ3  6  
ATOM 7596  N N    . SER A 1 75 ? 1.552   15.672  -3.187  1.00 0.00 ? 75 SER A N    6  
ATOM 7597  C CA   . SER A 1 75 ? 1.012   15.957  -4.512  1.00 0.00 ? 75 SER A CA   6  
ATOM 7598  C C    . SER A 1 75 ? -0.374  16.585  -4.409  1.00 0.00 ? 75 SER A C    6  
ATOM 7599  O O    . SER A 1 75 ? -0.985  16.598  -3.341  1.00 0.00 ? 75 SER A O    6  
ATOM 7600  C CB   . SER A 1 75 ? 0.943   14.675  -5.344  1.00 0.00 ? 75 SER A CB   6  
ATOM 7601  O OG   . SER A 1 75 ? 0.692   14.965  -6.708  1.00 0.00 ? 75 SER A OG   6  
ATOM 7602  H H    . SER A 1 75 ? 0.935   15.496  -2.446  1.00 0.00 ? 75 SER A H    6  
ATOM 7603  H HA   . SER A 1 75 ? 1.676   16.656  -4.997  1.00 0.00 ? 75 SER A HA   6  
ATOM 7604  H HB2  . SER A 1 75 ? 1.882   14.148  -5.267  1.00 0.00 ? 75 SER A HB2  6  
ATOM 7605  H HB3  . SER A 1 75 ? 0.147   14.048  -4.969  1.00 0.00 ? 75 SER A HB3  6  
ATOM 7606  H HG   . SER A 1 75 ? 1.004   14.239  -7.253  1.00 0.00 ? 75 SER A HG   6  
ATOM 7607  N N    . GLY A 1 76 ? -0.865  17.107  -5.529  1.00 0.00 ? 76 GLY A N    6  
ATOM 7608  C CA   . GLY A 1 76 ? -2.176  17.730  -5.545  1.00 0.00 ? 76 GLY A CA   6  
ATOM 7609  C C    . GLY A 1 76 ? -2.100  19.242  -5.462  1.00 0.00 ? 76 GLY A C    6  
ATOM 7610  O O    . GLY A 1 76 ? -1.103  19.811  -5.016  1.00 0.00 ? 76 GLY A O    6  
ATOM 7611  H H    . GLY A 1 76 ? -0.333  17.068  -6.352  1.00 0.00 ? 76 GLY A H    6  
ATOM 7612  H HA2  . GLY A 1 76 ? -2.682  17.455  -6.458  1.00 0.00 ? 76 GLY A HA2  6  
ATOM 7613  H HA3  . GLY A 1 76 ? -2.746  17.364  -4.705  1.00 0.00 ? 76 GLY A HA3  6  
ATOM 7614  N N    . PRO A 1 77 ? -3.172  19.917  -5.901  1.00 0.00 ? 77 PRO A N    6  
ATOM 7615  C CA   . PRO A 1 77 ? -3.246  21.381  -5.886  1.00 0.00 ? 77 PRO A CA   6  
ATOM 7616  C C    . PRO A 1 77 ? -3.351  21.942  -4.472  1.00 0.00 ? 77 PRO A C    6  
ATOM 7617  O O    . PRO A 1 77 ? -2.934  23.069  -4.208  1.00 0.00 ? 77 PRO A O    6  
ATOM 7618  C CB   . PRO A 1 77 ? -4.524  21.680  -6.675  1.00 0.00 ? 77 PRO A CB   6  
ATOM 7619  C CG   . PRO A 1 77 ? -5.358  20.456  -6.522  1.00 0.00 ? 77 PRO A CG   6  
ATOM 7620  C CD   . PRO A 1 77 ? -4.395  19.304  -6.447  1.00 0.00 ? 77 PRO A CD   6  
ATOM 7621  H HA   . PRO A 1 77 ? -2.399  21.827  -6.387  1.00 0.00 ? 77 PRO A HA   6  
ATOM 7622  H HB2  . PRO A 1 77 ? -5.013  22.548  -6.257  1.00 0.00 ? 77 PRO A HB2  6  
ATOM 7623  H HB3  . PRO A 1 77 ? -4.277  21.862  -7.710  1.00 0.00 ? 77 PRO A HB3  6  
ATOM 7624  H HG2  . PRO A 1 77 ? -5.939  20.518  -5.615  1.00 0.00 ? 77 PRO A HG2  6  
ATOM 7625  H HG3  . PRO A 1 77 ? -6.008  20.345  -7.378  1.00 0.00 ? 77 PRO A HG3  6  
ATOM 7626  H HD2  . PRO A 1 77 ? -4.771  18.539  -5.783  1.00 0.00 ? 77 PRO A HD2  6  
ATOM 7627  H HD3  . PRO A 1 77 ? -4.215  18.897  -7.431  1.00 0.00 ? 77 PRO A HD3  6  
ATOM 7628  N N    . SER A 1 78 ? -3.910  21.147  -3.565  1.00 0.00 ? 78 SER A N    6  
ATOM 7629  C CA   . SER A 1 78 ? -4.073  21.565  -2.178  1.00 0.00 ? 78 SER A CA   6  
ATOM 7630  C C    . SER A 1 78 ? -2.730  21.955  -1.567  1.00 0.00 ? 78 SER A C    6  
ATOM 7631  O O    . SER A 1 78 ? -2.562  23.067  -1.067  1.00 0.00 ? 78 SER A O    6  
ATOM 7632  C CB   . SER A 1 78 ? -4.713  20.444  -1.356  1.00 0.00 ? 78 SER A CB   6  
ATOM 7633  O OG   . SER A 1 78 ? -6.127  20.528  -1.395  1.00 0.00 ? 78 SER A OG   6  
ATOM 7634  H H    . SER A 1 78 ? -4.224  20.258  -3.837  1.00 0.00 ? 78 SER A H    6  
ATOM 7635  H HA   . SER A 1 78 ? -4.724  22.426  -2.165  1.00 0.00 ? 78 SER A HA   6  
ATOM 7636  H HB2  . SER A 1 78 ? -4.410  19.489  -1.758  1.00 0.00 ? 78 SER A HB2  6  
ATOM 7637  H HB3  . SER A 1 78 ? -4.387  20.523  -0.329  1.00 0.00 ? 78 SER A HB3  6  
ATOM 7638  H HG   . SER A 1 78 ? -6.456  20.794  -0.533  1.00 0.00 ? 78 SER A HG   6  
ATOM 7639  N N    . SER A 1 79 ? -1.776  21.031  -1.613  1.00 0.00 ? 79 SER A N    6  
ATOM 7640  C CA   . SER A 1 79 ? -0.448  21.275  -1.061  1.00 0.00 ? 79 SER A CA   6  
ATOM 7641  C C    . SER A 1 79 ? 0.171   22.530  -1.669  1.00 0.00 ? 79 SER A C    6  
ATOM 7642  O O    . SER A 1 79 ? 0.261   22.663  -2.889  1.00 0.00 ? 79 SER A O    6  
ATOM 7643  C CB   . SER A 1 79 ? 0.461   20.071  -1.313  1.00 0.00 ? 79 SER A CB   6  
ATOM 7644  O OG   . SER A 1 79 ? 1.815   20.386  -1.035  1.00 0.00 ? 79 SER A OG   6  
ATOM 7645  H H    . SER A 1 79 ? -1.970  20.163  -2.025  1.00 0.00 ? 79 SER A H    6  
ATOM 7646  H HA   . SER A 1 79 ? -0.553  21.419  0.004   1.00 0.00 ? 79 SER A HA   6  
ATOM 7647  H HB2  . SER A 1 79 ? 0.157   19.253  -0.677  1.00 0.00 ? 79 SER A HB2  6  
ATOM 7648  H HB3  . SER A 1 79 ? 0.379   19.771  -2.348  1.00 0.00 ? 79 SER A HB3  6  
ATOM 7649  H HG   . SER A 1 79 ? 2.351   20.212  -1.812  1.00 0.00 ? 79 SER A HG   6  
ATOM 7650  N N    . GLY A 1 80 ? 0.596   23.449  -0.808  1.00 0.00 ? 80 GLY A N    6  
ATOM 7651  C CA   . GLY A 1 80 ? 1.201   24.682  -1.278  1.00 0.00 ? 80 GLY A CA   6  
ATOM 7652  C C    . GLY A 1 80 ? 0.242   25.855  -1.225  1.00 0.00 ? 80 GLY A C    6  
ATOM 7653  O O    . GLY A 1 80 ? -0.138  26.306  -0.145  1.00 0.00 ? 80 GLY A O    6  
ATOM 7654  H H    . GLY A 1 80 ? 0.498   23.289  0.154   1.00 0.00 ? 80 GLY A H    6  
ATOM 7655  H HA2  . GLY A 1 80 ? 2.060   24.905  -0.664  1.00 0.00 ? 80 GLY A HA2  6  
ATOM 7656  H HA3  . GLY A 1 80 ? 1.526   24.544  -2.298  1.00 0.00 ? 80 GLY A HA3  6  
ATOM 7657  N N    . GLY A 1 1  ? 20.107  -30.015 12.659  1.00 0.00 ? 1  GLY A N    7  
ATOM 7658  C CA   . GLY A 1 1  ? 19.222  -31.132 12.385  1.00 0.00 ? 1  GLY A CA   7  
ATOM 7659  C C    . GLY A 1 1  ? 18.084  -30.756 11.456  1.00 0.00 ? 1  GLY A C    7  
ATOM 7660  O O    . GLY A 1 1  ? 16.918  -30.789 11.848  1.00 0.00 ? 1  GLY A O    7  
ATOM 7661  H H1   . GLY A 1 1  ? 19.896  -29.127 12.304  1.00 0.00 ? 1  GLY A H1   7  
ATOM 7662  H HA2  . GLY A 1 1  ? 19.794  -31.928 11.932  1.00 0.00 ? 1  GLY A HA2  7  
ATOM 7663  H HA3  . GLY A 1 1  ? 18.808  -31.486 13.317  1.00 0.00 ? 1  GLY A HA3  7  
ATOM 7664  N N    . SER A 1 2  ? 18.424  -30.396 10.223  1.00 0.00 ? 2  SER A N    7  
ATOM 7665  C CA   . SER A 1 2  ? 17.422  -30.006 9.237   1.00 0.00 ? 2  SER A CA   7  
ATOM 7666  C C    . SER A 1 2  ? 18.034  -29.927 7.842   1.00 0.00 ? 2  SER A C    7  
ATOM 7667  O O    . SER A 1 2  ? 19.254  -29.981 7.683   1.00 0.00 ? 2  SER A O    7  
ATOM 7668  C CB   . SER A 1 2  ? 16.805  -28.657 9.613   1.00 0.00 ? 2  SER A CB   7  
ATOM 7669  O OG   . SER A 1 2  ? 15.650  -28.391 8.835   1.00 0.00 ? 2  SER A OG   7  
ATOM 7670  H H    . SER A 1 2  ? 19.371  -30.389 9.970   1.00 0.00 ? 2  SER A H    7  
ATOM 7671  H HA   . SER A 1 2  ? 16.648  -30.759 9.236   1.00 0.00 ? 2  SER A HA   7  
ATOM 7672  H HB2  . SER A 1 2  ? 16.527  -28.669 10.655  1.00 0.00 ? 2  SER A HB2  7  
ATOM 7673  H HB3  . SER A 1 2  ? 17.528  -27.873 9.441   1.00 0.00 ? 2  SER A HB3  7  
ATOM 7674  H HG   . SER A 1 2  ? 14.935  -28.966 9.117   1.00 0.00 ? 2  SER A HG   7  
ATOM 7675  N N    . SER A 1 3  ? 17.178  -29.800 6.833   1.00 0.00 ? 3  SER A N    7  
ATOM 7676  C CA   . SER A 1 3  ? 17.633  -29.717 5.450   1.00 0.00 ? 3  SER A CA   7  
ATOM 7677  C C    . SER A 1 3  ? 16.537  -29.154 4.551   1.00 0.00 ? 3  SER A C    7  
ATOM 7678  O O    . SER A 1 3  ? 15.356  -29.191 4.894   1.00 0.00 ? 3  SER A O    7  
ATOM 7679  C CB   . SER A 1 3  ? 18.061  -31.098 4.949   1.00 0.00 ? 3  SER A CB   7  
ATOM 7680  O OG   . SER A 1 3  ? 18.895  -30.990 3.808   1.00 0.00 ? 3  SER A OG   7  
ATOM 7681  H H    . SER A 1 3  ? 16.217  -29.762 7.024   1.00 0.00 ? 3  SER A H    7  
ATOM 7682  H HA   . SER A 1 3  ? 18.484  -29.053 5.420   1.00 0.00 ? 3  SER A HA   7  
ATOM 7683  H HB2  . SER A 1 3  ? 18.604  -31.609 5.730   1.00 0.00 ? 3  SER A HB2  7  
ATOM 7684  H HB3  . SER A 1 3  ? 17.183  -31.670 4.686   1.00 0.00 ? 3  SER A HB3  7  
ATOM 7685  H HG   . SER A 1 3  ? 18.439  -30.495 3.124   1.00 0.00 ? 3  SER A HG   7  
ATOM 7686  N N    . GLY A 1 4  ? 16.938  -28.633 3.395   1.00 0.00 ? 4  GLY A N    7  
ATOM 7687  C CA   . GLY A 1 4  ? 15.979  -28.069 2.463   1.00 0.00 ? 4  GLY A CA   7  
ATOM 7688  C C    . GLY A 1 4  ? 16.633  -27.572 1.189   1.00 0.00 ? 4  GLY A C    7  
ATOM 7689  O O    . GLY A 1 4  ? 17.092  -26.432 1.122   1.00 0.00 ? 4  GLY A O    7  
ATOM 7690  H H    . GLY A 1 4  ? 17.893  -28.631 3.174   1.00 0.00 ? 4  GLY A H    7  
ATOM 7691  H HA2  . GLY A 1 4  ? 15.252  -28.826 2.211   1.00 0.00 ? 4  GLY A HA2  7  
ATOM 7692  H HA3  . GLY A 1 4  ? 15.474  -27.243 2.940   1.00 0.00 ? 4  GLY A HA3  7  
ATOM 7693  N N    . SER A 1 5  ? 16.677  -28.430 0.175   1.00 0.00 ? 5  SER A N    7  
ATOM 7694  C CA   . SER A 1 5  ? 17.284  -28.074 -1.102  1.00 0.00 ? 5  SER A CA   7  
ATOM 7695  C C    . SER A 1 5  ? 16.898  -26.655 -1.510  1.00 0.00 ? 5  SER A C    7  
ATOM 7696  O O    . SER A 1 5  ? 17.755  -25.842 -1.858  1.00 0.00 ? 5  SER A O    7  
ATOM 7697  C CB   . SER A 1 5  ? 16.857  -29.063 -2.188  1.00 0.00 ? 5  SER A CB   7  
ATOM 7698  O OG   . SER A 1 5  ? 17.193  -28.581 -3.478  1.00 0.00 ? 5  SER A OG   7  
ATOM 7699  H H    . SER A 1 5  ? 16.294  -29.325 0.289   1.00 0.00 ? 5  SER A H    7  
ATOM 7700  H HA   . SER A 1 5  ? 18.357  -28.122 -0.985  1.00 0.00 ? 5  SER A HA   7  
ATOM 7701  H HB2  . SER A 1 5  ? 17.356  -30.007 -2.028  1.00 0.00 ? 5  SER A HB2  7  
ATOM 7702  H HB3  . SER A 1 5  ? 15.788  -29.208 -2.139  1.00 0.00 ? 5  SER A HB3  7  
ATOM 7703  H HG   . SER A 1 5  ? 17.865  -29.148 -3.866  1.00 0.00 ? 5  SER A HG   7  
ATOM 7704  N N    . SER A 1 6  ? 15.602  -26.366 -1.466  1.00 0.00 ? 6  SER A N    7  
ATOM 7705  C CA   . SER A 1 6  ? 15.100  -25.047 -1.834  1.00 0.00 ? 6  SER A CA   7  
ATOM 7706  C C    . SER A 1 6  ? 14.624  -24.283 -0.602  1.00 0.00 ? 6  SER A C    7  
ATOM 7707  O O    . SER A 1 6  ? 14.010  -24.855 0.298   1.00 0.00 ? 6  SER A O    7  
ATOM 7708  C CB   . SER A 1 6  ? 13.956  -25.176 -2.842  1.00 0.00 ? 6  SER A CB   7  
ATOM 7709  O OG   . SER A 1 6  ? 13.518  -23.903 -3.283  1.00 0.00 ? 6  SER A OG   7  
ATOM 7710  H H    . SER A 1 6  ? 14.967  -27.056 -1.180  1.00 0.00 ? 6  SER A H    7  
ATOM 7711  H HA   . SER A 1 6  ? 15.911  -24.500 -2.291  1.00 0.00 ? 6  SER A HA   7  
ATOM 7712  H HB2  . SER A 1 6  ? 14.294  -25.743 -3.696  1.00 0.00 ? 6  SER A HB2  7  
ATOM 7713  H HB3  . SER A 1 6  ? 13.126  -25.688 -2.376  1.00 0.00 ? 6  SER A HB3  7  
ATOM 7714  H HG   . SER A 1 6  ? 14.244  -23.277 -3.225  1.00 0.00 ? 6  SER A HG   7  
ATOM 7715  N N    . GLY A 1 7  ? 14.912  -22.986 -0.570  1.00 0.00 ? 7  GLY A N    7  
ATOM 7716  C CA   . GLY A 1 7  ? 14.507  -22.163 0.555   1.00 0.00 ? 7  GLY A CA   7  
ATOM 7717  C C    . GLY A 1 7  ? 14.227  -20.729 0.154   1.00 0.00 ? 7  GLY A C    7  
ATOM 7718  O O    . GLY A 1 7  ? 15.097  -19.866 0.258   1.00 0.00 ? 7  GLY A O    7  
ATOM 7719  H H    . GLY A 1 7  ? 15.405  -22.583 -1.316  1.00 0.00 ? 7  GLY A H    7  
ATOM 7720  H HA2  . GLY A 1 7  ? 13.615  -22.585 0.992   1.00 0.00 ? 7  GLY A HA2  7  
ATOM 7721  H HA3  . GLY A 1 7  ? 15.295  -22.170 1.294   1.00 0.00 ? 7  GLY A HA3  7  
ATOM 7722  N N    . GLY A 1 8  ? 13.006  -20.473 -0.308  1.00 0.00 ? 8  GLY A N    7  
ATOM 7723  C CA   . GLY A 1 8  ? 12.636  -19.132 -0.722  1.00 0.00 ? 8  GLY A CA   7  
ATOM 7724  C C    . GLY A 1 8  ? 11.351  -19.108 -1.526  1.00 0.00 ? 8  GLY A C    7  
ATOM 7725  O O    . GLY A 1 8  ? 10.659  -20.120 -1.633  1.00 0.00 ? 8  GLY A O    7  
ATOM 7726  H H    . GLY A 1 8  ? 12.352  -21.201 -0.369  1.00 0.00 ? 8  GLY A H    7  
ATOM 7727  H HA2  . GLY A 1 8  ? 12.510  -18.518 0.157   1.00 0.00 ? 8  GLY A HA2  7  
ATOM 7728  H HA3  . GLY A 1 8  ? 13.432  -18.721 -1.325  1.00 0.00 ? 8  GLY A HA3  7  
ATOM 7729  N N    . GLU A 1 9  ? 11.030  -17.948 -2.091  1.00 0.00 ? 9  GLU A N    7  
ATOM 7730  C CA   . GLU A 1 9  ? 9.818   -17.796 -2.887  1.00 0.00 ? 9  GLU A CA   7  
ATOM 7731  C C    . GLU A 1 9  ? 10.008  -16.741 -3.972  1.00 0.00 ? 9  GLU A C    7  
ATOM 7732  O O    . GLU A 1 9  ? 10.745  -15.769 -3.806  1.00 0.00 ? 9  GLU A O    7  
ATOM 7733  C CB   . GLU A 1 9  ? 8.637   -17.415 -1.991  1.00 0.00 ? 9  GLU A CB   7  
ATOM 7734  C CG   . GLU A 1 9  ? 8.771   -16.039 -1.361  1.00 0.00 ? 9  GLU A CG   7  
ATOM 7735  C CD   . GLU A 1 9  ? 7.644   -15.726 -0.396  1.00 0.00 ? 9  GLU A CD   7  
ATOM 7736  O OE1  . GLU A 1 9  ? 7.594   -16.353 0.683   1.00 0.00 ? 9  GLU A OE1  7  
ATOM 7737  O OE2  . GLU A 1 9  ? 6.811   -14.854 -0.721  1.00 0.00 ? 9  GLU A OE2  7  
ATOM 7738  H H    . GLU A 1 9  ? 11.622  -17.176 -1.969  1.00 0.00 ? 9  GLU A H    7  
ATOM 7739  H HA   . GLU A 1 9  ? 9.609   -18.745 -3.357  1.00 0.00 ? 9  GLU A HA   7  
ATOM 7740  H HB2  . GLU A 1 9  ? 7.733   -17.432 -2.581  1.00 0.00 ? 9  GLU A HB2  7  
ATOM 7741  H HB3  . GLU A 1 9  ? 8.553   -18.143 -1.198  1.00 0.00 ? 9  GLU A HB3  7  
ATOM 7742  H HG2  . GLU A 1 9  ? 9.707   -15.992 -0.824  1.00 0.00 ? 9  GLU A HG2  7  
ATOM 7743  H HG3  . GLU A 1 9  ? 8.770   -15.296 -2.145  1.00 0.00 ? 9  GLU A HG3  7  
ATOM 7744  N N    . PRO A 1 10 ? 9.329   -16.937 -5.112  1.00 0.00 ? 10 PRO A N    7  
ATOM 7745  C CA   . PRO A 1 10 ? 9.407   -16.013 -6.248  1.00 0.00 ? 10 PRO A CA   7  
ATOM 7746  C C    . PRO A 1 10 ? 8.728   -14.679 -5.958  1.00 0.00 ? 10 PRO A C    7  
ATOM 7747  O O    . PRO A 1 10 ? 8.092   -14.508 -4.919  1.00 0.00 ? 10 PRO A O    7  
ATOM 7748  C CB   . PRO A 1 10 ? 8.667   -16.758 -7.362  1.00 0.00 ? 10 PRO A CB   7  
ATOM 7749  C CG   . PRO A 1 10 ? 7.733   -17.674 -6.650  1.00 0.00 ? 10 PRO A CG   7  
ATOM 7750  C CD   . PRO A 1 10 ? 8.433   -18.074 -5.380  1.00 0.00 ? 10 PRO A CD   7  
ATOM 7751  H HA   . PRO A 1 10 ? 10.430  -15.838 -6.548  1.00 0.00 ? 10 PRO A HA   7  
ATOM 7752  H HB2  . PRO A 1 10 ? 8.132   -16.050 -7.979  1.00 0.00 ? 10 PRO A HB2  7  
ATOM 7753  H HB3  . PRO A 1 10 ? 9.375   -17.307 -7.965  1.00 0.00 ? 10 PRO A HB3  7  
ATOM 7754  H HG2  . PRO A 1 10 ? 6.813   -17.158 -6.424  1.00 0.00 ? 10 PRO A HG2  7  
ATOM 7755  H HG3  . PRO A 1 10 ? 7.537   -18.545 -7.259  1.00 0.00 ? 10 PRO A HG3  7  
ATOM 7756  H HD2  . PRO A 1 10 ? 7.719   -18.199 -4.579  1.00 0.00 ? 10 PRO A HD2  7  
ATOM 7757  H HD3  . PRO A 1 10 ? 8.998   -18.982 -5.530  1.00 0.00 ? 10 PRO A HD3  7  
ATOM 7758  N N    . GLY A 1 11 ? 8.867   -13.735 -6.884  1.00 0.00 ? 11 GLY A N    7  
ATOM 7759  C CA   . GLY A 1 11 ? 8.262   -12.428 -6.709  1.00 0.00 ? 11 GLY A CA   7  
ATOM 7760  C C    . GLY A 1 11 ? 7.701   -11.870 -8.002  1.00 0.00 ? 11 GLY A C    7  
ATOM 7761  O O    . GLY A 1 11 ? 8.067   -10.773 -8.425  1.00 0.00 ? 11 GLY A O    7  
ATOM 7762  H H    . GLY A 1 11 ? 9.386   -13.928 -7.694  1.00 0.00 ? 11 GLY A H    7  
ATOM 7763  H HA2  . GLY A 1 11 ? 7.463   -12.508 -5.987  1.00 0.00 ? 11 GLY A HA2  7  
ATOM 7764  H HA3  . GLY A 1 11 ? 9.009   -11.746 -6.330  1.00 0.00 ? 11 GLY A HA3  7  
ATOM 7765  N N    . THR A 1 12 ? 6.811   -12.629 -8.635  1.00 0.00 ? 12 THR A N    7  
ATOM 7766  C CA   . THR A 1 12 ? 6.201   -12.205 -9.889  1.00 0.00 ? 12 THR A CA   7  
ATOM 7767  C C    . THR A 1 12 ? 4.774   -11.716 -9.669  1.00 0.00 ? 12 THR A C    7  
ATOM 7768  O O    . THR A 1 12 ? 3.947   -12.420 -9.089  1.00 0.00 ? 12 THR A O    7  
ATOM 7769  C CB   . THR A 1 12 ? 6.185   -13.350 -10.920 1.00 0.00 ? 12 THR A CB   7  
ATOM 7770  O OG1  . THR A 1 12 ? 5.618   -12.891 -12.153 1.00 0.00 ? 12 THR A OG1  7  
ATOM 7771  C CG2  . THR A 1 12 ? 5.388   -14.536 -10.400 1.00 0.00 ? 12 THR A CG2  7  
ATOM 7772  H H    . THR A 1 12 ? 6.560   -13.493 -8.248  1.00 0.00 ? 12 THR A H    7  
ATOM 7773  H HA   . THR A 1 12 ? 6.792   -11.395 -10.291 1.00 0.00 ? 12 THR A HA   7  
ATOM 7774  H HB   . THR A 1 12 ? 7.203   -13.668 -11.097 1.00 0.00 ? 12 THR A HB   7  
ATOM 7775  H HG1  . THR A 1 12 ? 5.997   -13.386 -12.883 1.00 0.00 ? 12 THR A HG1  7  
ATOM 7776  H HG21 . THR A 1 12 ? 5.466   -15.356 -11.099 1.00 0.00 ? 12 THR A HG21 7  
ATOM 7777  H HG22 . THR A 1 12 ? 4.352   -14.253 -10.291 1.00 0.00 ? 12 THR A HG22 7  
ATOM 7778  H HG23 . THR A 1 12 ? 5.781   -14.841 -9.442  1.00 0.00 ? 12 THR A HG23 7  
ATOM 7779  N N    . LYS A 1 13 ? 4.491   -10.504 -10.136 1.00 0.00 ? 13 LYS A N    7  
ATOM 7780  C CA   . LYS A 1 13 ? 3.163   -9.920  -9.992  1.00 0.00 ? 13 LYS A CA   7  
ATOM 7781  C C    . LYS A 1 13 ? 2.311   -10.194 -11.227 1.00 0.00 ? 13 LYS A C    7  
ATOM 7782  O O    . LYS A 1 13 ? 2.577   -9.664  -12.306 1.00 0.00 ? 13 LYS A O    7  
ATOM 7783  C CB   . LYS A 1 13 ? 3.269   -8.412  -9.757  1.00 0.00 ? 13 LYS A CB   7  
ATOM 7784  C CG   . LYS A 1 13 ? 3.992   -8.046  -8.472  1.00 0.00 ? 13 LYS A CG   7  
ATOM 7785  C CD   . LYS A 1 13 ? 4.612   -6.661  -8.556  1.00 0.00 ? 13 LYS A CD   7  
ATOM 7786  C CE   . LYS A 1 13 ? 5.884   -6.670  -9.391  1.00 0.00 ? 13 LYS A CE   7  
ATOM 7787  N NZ   . LYS A 1 13 ? 6.954   -7.492  -8.762  1.00 0.00 ? 13 LYS A NZ   7  
ATOM 7788  H H    . LYS A 1 13 ? 5.192   -9.991  -10.589 1.00 0.00 ? 13 LYS A H    7  
ATOM 7789  H HA   . LYS A 1 13 ? 2.690   -10.377 -9.135  1.00 0.00 ? 13 LYS A HA   7  
ATOM 7790  H HB2  . LYS A 1 13 ? 3.803   -7.967  -10.585 1.00 0.00 ? 13 LYS A HB2  7  
ATOM 7791  H HB3  . LYS A 1 13 ? 2.273   -7.994  -9.717  1.00 0.00 ? 13 LYS A HB3  7  
ATOM 7792  H HG2  . LYS A 1 13 ? 3.286   -8.063  -7.655  1.00 0.00 ? 13 LYS A HG2  7  
ATOM 7793  H HG3  . LYS A 1 13 ? 4.773   -8.770  -8.291  1.00 0.00 ? 13 LYS A HG3  7  
ATOM 7794  H HD2  . LYS A 1 13 ? 3.903   -5.985  -9.009  1.00 0.00 ? 13 LYS A HD2  7  
ATOM 7795  H HD3  . LYS A 1 13 ? 4.850   -6.321  -7.558  1.00 0.00 ? 13 LYS A HD3  7  
ATOM 7796  H HE2  . LYS A 1 13 ? 5.657   -7.074  -10.365 1.00 0.00 ? 13 LYS A HE2  7  
ATOM 7797  H HE3  . LYS A 1 13 ? 6.236   -5.654  -9.496  1.00 0.00 ? 13 LYS A HE3  7  
ATOM 7798  H HZ1  . LYS A 1 13 ? 6.929   -7.381  -7.728  1.00 0.00 ? 13 LYS A HZ1  7  
ATOM 7799  H HZ2  . LYS A 1 13 ? 7.887   -7.190  -9.109  1.00 0.00 ? 13 LYS A HZ2  7  
ATOM 7800  H HZ3  . LYS A 1 13 ? 6.818   -8.496  -8.995  1.00 0.00 ? 13 LYS A HZ3  7  
ATOM 7801  N N    . ALA A 1 14 ? 1.286   -11.023 -11.062 1.00 0.00 ? 14 ALA A N    7  
ATOM 7802  C CA   . ALA A 1 14 ? 0.393   -11.364 -12.163 1.00 0.00 ? 14 ALA A CA   7  
ATOM 7803  C C    . ALA A 1 14 ? -1.035  -10.918 -11.870 1.00 0.00 ? 14 ALA A C    7  
ATOM 7804  O O    . ALA A 1 14 ? -1.780  -11.606 -11.171 1.00 0.00 ? 14 ALA A O    7  
ATOM 7805  C CB   . ALA A 1 14 ? 0.437   -12.860 -12.434 1.00 0.00 ? 14 ALA A CB   7  
ATOM 7806  H H    . ALA A 1 14 ? 1.125   -11.414 -10.178 1.00 0.00 ? 14 ALA A H    7  
ATOM 7807  H HA   . ALA A 1 14 ? 0.745   -10.852 -13.048 1.00 0.00 ? 14 ALA A HA   7  
ATOM 7808  H HB1  . ALA A 1 14 ? -0.503  -13.174 -12.866 1.00 0.00 ? 14 ALA A HB1  7  
ATOM 7809  H HB2  . ALA A 1 14 ? 1.240   -13.078 -13.121 1.00 0.00 ? 14 ALA A HB2  7  
ATOM 7810  H HB3  . ALA A 1 14 ? 0.602   -13.389 -11.507 1.00 0.00 ? 14 ALA A HB3  7  
ATOM 7811  N N    . LYS A 1 15 ? -1.412  -9.763  -12.407 1.00 0.00 ? 15 LYS A N    7  
ATOM 7812  C CA   . LYS A 1 15 ? -2.752  -9.225  -12.204 1.00 0.00 ? 15 LYS A CA   7  
ATOM 7813  C C    . LYS A 1 15 ? -3.142  -8.293  -13.347 1.00 0.00 ? 15 LYS A C    7  
ATOM 7814  O O    . LYS A 1 15 ? -2.283  -7.753  -14.044 1.00 0.00 ? 15 LYS A O    7  
ATOM 7815  C CB   . LYS A 1 15 ? -2.826  -8.475  -10.872 1.00 0.00 ? 15 LYS A CB   7  
ATOM 7816  C CG   . LYS A 1 15 ? -1.755  -7.410  -10.713 1.00 0.00 ? 15 LYS A CG   7  
ATOM 7817  C CD   . LYS A 1 15 ? -2.197  -6.082  -11.304 1.00 0.00 ? 15 LYS A CD   7  
ATOM 7818  C CE   . LYS A 1 15 ? -1.012  -5.279  -11.818 1.00 0.00 ? 15 LYS A CE   7  
ATOM 7819  N NZ   . LYS A 1 15 ? -1.444  -4.027  -12.499 1.00 0.00 ? 15 LYS A NZ   7  
ATOM 7820  H H    . LYS A 1 15 ? -0.773  -9.260  -12.955 1.00 0.00 ? 15 LYS A H    7  
ATOM 7821  H HA   . LYS A 1 15 ? -3.442  -10.054 -12.180 1.00 0.00 ? 15 LYS A HA   7  
ATOM 7822  H HB2  . LYS A 1 15 ? -3.792  -7.999  -10.794 1.00 0.00 ? 15 LYS A HB2  7  
ATOM 7823  H HB3  . LYS A 1 15 ? -2.719  -9.187  -10.066 1.00 0.00 ? 15 LYS A HB3  7  
ATOM 7824  H HG2  . LYS A 1 15 ? -1.549  -7.273  -9.662  1.00 0.00 ? 15 LYS A HG2  7  
ATOM 7825  H HG3  . LYS A 1 15 ? -0.857  -7.738  -11.217 1.00 0.00 ? 15 LYS A HG3  7  
ATOM 7826  H HD2  . LYS A 1 15 ? -2.873  -6.270  -12.125 1.00 0.00 ? 15 LYS A HD2  7  
ATOM 7827  H HD3  . LYS A 1 15 ? -2.704  -5.509  -10.541 1.00 0.00 ? 15 LYS A HD3  7  
ATOM 7828  H HE2  . LYS A 1 15 ? -0.377  -5.025  -10.984 1.00 0.00 ? 15 LYS A HE2  7  
ATOM 7829  H HE3  . LYS A 1 15 ? -0.459  -5.887  -12.519 1.00 0.00 ? 15 LYS A HE3  7  
ATOM 7830  H HZ1  . LYS A 1 15 ? -0.928  -3.911  -13.394 1.00 0.00 ? 15 LYS A HZ1  7  
ATOM 7831  H HZ2  . LYS A 1 15 ? -1.249  -3.205  -11.891 1.00 0.00 ? 15 LYS A HZ2  7  
ATOM 7832  H HZ3  . LYS A 1 15 ? -2.463  -4.062  -12.700 1.00 0.00 ? 15 LYS A HZ3  7  
ATOM 7833  N N    . LYS A 1 16 ? -4.445  -8.106  -13.533 1.00 0.00 ? 16 LYS A N    7  
ATOM 7834  C CA   . LYS A 1 16 ? -4.950  -7.237  -14.588 1.00 0.00 ? 16 LYS A CA   7  
ATOM 7835  C C    . LYS A 1 16 ? -5.313  -5.862  -14.035 1.00 0.00 ? 16 LYS A C    7  
ATOM 7836  O O    . LYS A 1 16 ? -4.746  -4.849  -14.441 1.00 0.00 ? 16 LYS A O    7  
ATOM 7837  C CB   . LYS A 1 16 ? -6.174  -7.869  -15.255 1.00 0.00 ? 16 LYS A CB   7  
ATOM 7838  C CG   . LYS A 1 16 ? -5.902  -9.239  -15.851 1.00 0.00 ? 16 LYS A CG   7  
ATOM 7839  C CD   . LYS A 1 16 ? -7.193  -9.970  -16.182 1.00 0.00 ? 16 LYS A CD   7  
ATOM 7840  C CE   . LYS A 1 16 ? -7.846  -9.408  -17.435 1.00 0.00 ? 16 LYS A CE   7  
ATOM 7841  N NZ   . LYS A 1 16 ? -8.587  -8.146  -17.156 1.00 0.00 ? 16 LYS A NZ   7  
ATOM 7842  H H    . LYS A 1 16 ? -5.082  -8.563  -12.944 1.00 0.00 ? 16 LYS A H    7  
ATOM 7843  H HA   . LYS A 1 16 ? -4.170  -7.120  -15.325 1.00 0.00 ? 16 LYS A HA   7  
ATOM 7844  H HB2  . LYS A 1 16 ? -6.959  -7.968  -14.520 1.00 0.00 ? 16 LYS A HB2  7  
ATOM 7845  H HB3  . LYS A 1 16 ? -6.515  -7.217  -16.047 1.00 0.00 ? 16 LYS A HB3  7  
ATOM 7846  H HG2  . LYS A 1 16 ? -5.326  -9.120  -16.757 1.00 0.00 ? 16 LYS A HG2  7  
ATOM 7847  H HG3  . LYS A 1 16 ? -5.339  -9.826  -15.139 1.00 0.00 ? 16 LYS A HG3  7  
ATOM 7848  H HD2  . LYS A 1 16 ? -6.974  -11.015 -16.341 1.00 0.00 ? 16 LYS A HD2  7  
ATOM 7849  H HD3  . LYS A 1 16 ? -7.878  -9.866  -15.352 1.00 0.00 ? 16 LYS A HD3  7  
ATOM 7850  H HE2  . LYS A 1 16 ? -7.078  -9.210  -18.167 1.00 0.00 ? 16 LYS A HE2  7  
ATOM 7851  H HE3  . LYS A 1 16 ? -8.535  -10.141 -17.826 1.00 0.00 ? 16 LYS A HE3  7  
ATOM 7852  H HZ1  . LYS A 1 16 ? -7.974  -7.325  -17.335 1.00 0.00 ? 16 LYS A HZ1  7  
ATOM 7853  H HZ2  . LYS A 1 16 ? -8.895  -8.125  -16.164 1.00 0.00 ? 16 LYS A HZ2  7  
ATOM 7854  H HZ3  . LYS A 1 16 ? -9.424  -8.080  -17.770 1.00 0.00 ? 16 LYS A HZ3  7  
ATOM 7855  N N    . GLY A 1 17 ? -6.262  -5.836  -13.104 1.00 0.00 ? 17 GLY A N    7  
ATOM 7856  C CA   . GLY A 1 17 ? -6.683  -4.581  -12.509 1.00 0.00 ? 17 GLY A CA   7  
ATOM 7857  C C    . GLY A 1 17 ? -7.854  -4.752  -11.561 1.00 0.00 ? 17 GLY A C    7  
ATOM 7858  O O    . GLY A 1 17 ? -9.000  -4.493  -11.928 1.00 0.00 ? 17 GLY A O    7  
ATOM 7859  H H    . GLY A 1 17 ? -6.680  -6.676  -12.819 1.00 0.00 ? 17 GLY A H    7  
ATOM 7860  H HA2  . GLY A 1 17 ? -5.852  -4.156  -11.965 1.00 0.00 ? 17 GLY A HA2  7  
ATOM 7861  H HA3  . GLY A 1 17 ? -6.970  -3.900  -13.297 1.00 0.00 ? 17 GLY A HA3  7  
ATOM 7862  N N    . ARG A 1 18 ? -7.566  -5.191  -10.340 1.00 0.00 ? 18 ARG A N    7  
ATOM 7863  C CA   . ARG A 1 18 ? -8.604  -5.399  -9.339  1.00 0.00 ? 18 ARG A CA   7  
ATOM 7864  C C    . ARG A 1 18 ? -8.962  -4.088  -8.645  1.00 0.00 ? 18 ARG A C    7  
ATOM 7865  O O    . ARG A 1 18 ? -8.220  -3.109  -8.726  1.00 0.00 ? 18 ARG A O    7  
ATOM 7866  C CB   . ARG A 1 18 ? -8.145  -6.427  -8.303  1.00 0.00 ? 18 ARG A CB   7  
ATOM 7867  C CG   . ARG A 1 18 ? -8.496  -7.860  -8.670  1.00 0.00 ? 18 ARG A CG   7  
ATOM 7868  C CD   . ARG A 1 18 ? -9.958  -8.166  -8.385  1.00 0.00 ? 18 ARG A CD   7  
ATOM 7869  N NE   . ARG A 1 18 ? -10.822 -7.798  -9.503  1.00 0.00 ? 18 ARG A NE   7  
ATOM 7870  C CZ   . ARG A 1 18 ? -12.149 -7.806  -9.440  1.00 0.00 ? 18 ARG A CZ   7  
ATOM 7871  N NH1  . ARG A 1 18 ? -12.760 -8.162  -8.318  1.00 0.00 ? 18 ARG A NH1  7  
ATOM 7872  N NH2  . ARG A 1 18 ? -12.867 -7.458  -10.500 1.00 0.00 ? 18 ARG A NH2  7  
ATOM 7873  H H    . ARG A 1 18 ? -6.633  -5.380  -10.108 1.00 0.00 ? 18 ARG A H    7  
ATOM 7874  H HA   . ARG A 1 18 ? -9.481  -5.777  -9.843  1.00 0.00 ? 18 ARG A HA   7  
ATOM 7875  H HB2  . ARG A 1 18 ? -7.072  -6.359  -8.196  1.00 0.00 ? 18 ARG A HB2  7  
ATOM 7876  H HB3  . ARG A 1 18 ? -8.609  -6.198  -7.356  1.00 0.00 ? 18 ARG A HB3  7  
ATOM 7877  H HG2  . ARG A 1 18 ? -8.307  -8.009  -9.723  1.00 0.00 ? 18 ARG A HG2  7  
ATOM 7878  H HG3  . ARG A 1 18 ? -7.877  -8.531  -8.093  1.00 0.00 ? 18 ARG A HG3  7  
ATOM 7879  H HD2  . ARG A 1 18 ? -10.060 -9.224  -8.197  1.00 0.00 ? 18 ARG A HD2  7  
ATOM 7880  H HD3  . ARG A 1 18 ? -10.263 -7.614  -7.509  1.00 0.00 ? 18 ARG A HD3  7  
ATOM 7881  H HE   . ARG A 1 18 ? -10.391 -7.532  -10.342 1.00 0.00 ? 18 ARG A HE   7  
ATOM 7882  H HH11 . ARG A 1 18 ? -12.222 -8.424  -7.518  1.00 0.00 ? 18 ARG A HH11 7  
ATOM 7883  H HH12 . ARG A 1 18 ? -13.759 -8.166  -8.273  1.00 0.00 ? 18 ARG A HH12 7  
ATOM 7884  H HH21 . ARG A 1 18 ? -12.410 -7.189  -11.347 1.00 0.00 ? 18 ARG A HH21 7  
ATOM 7885  H HH22 . ARG A 1 18 ? -13.865 -7.464  -10.451 1.00 0.00 ? 18 ARG A HH22 7  
ATOM 7886  N N    . ARG A 1 19 ? -10.103 -4.076  -7.964  1.00 0.00 ? 19 ARG A N    7  
ATOM 7887  C CA   . ARG A 1 19 ? -10.560 -2.885  -7.258  1.00 0.00 ? 19 ARG A CA   7  
ATOM 7888  C C    . ARG A 1 19 ? -10.996 -3.229  -5.837  1.00 0.00 ? 19 ARG A C    7  
ATOM 7889  O O    . ARG A 1 19 ? -11.170 -4.399  -5.497  1.00 0.00 ? 19 ARG A O    7  
ATOM 7890  C CB   . ARG A 1 19 ? -11.718 -2.231  -8.014  1.00 0.00 ? 19 ARG A CB   7  
ATOM 7891  C CG   . ARG A 1 19 ? -11.292 -1.533  -9.295  1.00 0.00 ? 19 ARG A CG   7  
ATOM 7892  C CD   . ARG A 1 19 ? -10.784 -0.126  -9.019  1.00 0.00 ? 19 ARG A CD   7  
ATOM 7893  N NE   . ARG A 1 19 ? -10.813 0.711   -10.216 1.00 0.00 ? 19 ARG A NE   7  
ATOM 7894  C CZ   . ARG A 1 19 ? -10.351 1.955   -10.254 1.00 0.00 ? 19 ARG A CZ   7  
ATOM 7895  N NH1  . ARG A 1 19 ? -9.826  2.504   -9.167  1.00 0.00 ? 19 ARG A NH1  7  
ATOM 7896  N NH2  . ARG A 1 19 ? -10.412 2.653   -11.381 1.00 0.00 ? 19 ARG A NH2  7  
ATOM 7897  H H    . ARG A 1 19 ? -10.652 -4.888  -7.936  1.00 0.00 ? 19 ARG A H    7  
ATOM 7898  H HA   . ARG A 1 19 ? -9.735  -2.191  -7.211  1.00 0.00 ? 19 ARG A HA   7  
ATOM 7899  H HB2  . ARG A 1 19 ? -12.442 -2.992  -8.269  1.00 0.00 ? 19 ARG A HB2  7  
ATOM 7900  H HB3  . ARG A 1 19 ? -12.186 -1.502  -7.370  1.00 0.00 ? 19 ARG A HB3  7  
ATOM 7901  H HG2  . ARG A 1 19 ? -10.503 -2.104  -9.760  1.00 0.00 ? 19 ARG A HG2  7  
ATOM 7902  H HG3  . ARG A 1 19 ? -12.140 -1.476  -9.962  1.00 0.00 ? 19 ARG A HG3  7  
ATOM 7903  H HD2  . ARG A 1 19 ? -11.406 0.325   -8.261  1.00 0.00 ? 19 ARG A HD2  7  
ATOM 7904  H HD3  . ARG A 1 19 ? -9.768  -0.189  -8.660  1.00 0.00 ? 19 ARG A HD3  7  
ATOM 7905  H HE   . ARG A 1 19 ? -11.197 0.324   -11.031 1.00 0.00 ? 19 ARG A HE   7  
ATOM 7906  H HH11 . ARG A 1 19 ? -9.777  1.981   -8.317  1.00 0.00 ? 19 ARG A HH11 7  
ATOM 7907  H HH12 . ARG A 1 19 ? -9.477  3.442   -9.199  1.00 0.00 ? 19 ARG A HH12 7  
ATOM 7908  H HH21 . ARG A 1 19 ? -10.807 2.242   -12.202 1.00 0.00 ? 19 ARG A HH21 7  
ATOM 7909  H HH22 . ARG A 1 19 ? -10.064 3.590   -11.409 1.00 0.00 ? 19 ARG A HH22 7  
ATOM 7910  N N    . SER A 1 20 ? -11.168 -2.202  -5.012  1.00 0.00 ? 20 SER A N    7  
ATOM 7911  C CA   . SER A 1 20 ? -11.579 -2.395  -3.626  1.00 0.00 ? 20 SER A CA   7  
ATOM 7912  C C    . SER A 1 20 ? -13.099 -2.353  -3.499  1.00 0.00 ? 20 SER A C    7  
ATOM 7913  O O    . SER A 1 20 ? -13.723 -1.316  -3.726  1.00 0.00 ? 20 SER A O    7  
ATOM 7914  C CB   . SER A 1 20 ? -10.951 -1.325  -2.731  1.00 0.00 ? 20 SER A CB   7  
ATOM 7915  O OG   . SER A 1 20 ? -9.539  -1.436  -2.718  1.00 0.00 ? 20 SER A OG   7  
ATOM 7916  H H    . SER A 1 20 ? -11.013 -1.292  -5.342  1.00 0.00 ? 20 SER A H    7  
ATOM 7917  H HA   . SER A 1 20 ? -11.230 -3.367  -3.309  1.00 0.00 ? 20 SER A HA   7  
ATOM 7918  H HB2  . SER A 1 20 ? -11.220 -0.347  -3.102  1.00 0.00 ? 20 SER A HB2  7  
ATOM 7919  H HB3  . SER A 1 20 ? -11.320 -1.441  -1.722  1.00 0.00 ? 20 SER A HB3  7  
ATOM 7920  H HG   . SER A 1 20 ? -9.219  -1.339  -1.818  1.00 0.00 ? 20 SER A HG   7  
ATOM 7921  N N    . ARG A 1 21 ? -13.688 -3.488  -3.135  1.00 0.00 ? 21 ARG A N    7  
ATOM 7922  C CA   . ARG A 1 21 ? -15.134 -3.582  -2.979  1.00 0.00 ? 21 ARG A CA   7  
ATOM 7923  C C    . ARG A 1 21 ? -15.539 -3.369  -1.523  1.00 0.00 ? 21 ARG A C    7  
ATOM 7924  O O    . ARG A 1 21 ? -16.319 -2.470  -1.208  1.00 0.00 ? 21 ARG A O    7  
ATOM 7925  C CB   . ARG A 1 21 ? -15.633 -4.944  -3.464  1.00 0.00 ? 21 ARG A CB   7  
ATOM 7926  C CG   . ARG A 1 21 ? -17.130 -4.987  -3.724  1.00 0.00 ? 21 ARG A CG   7  
ATOM 7927  C CD   . ARG A 1 21 ? -17.462 -4.552  -5.143  1.00 0.00 ? 21 ARG A CD   7  
ATOM 7928  N NE   . ARG A 1 21 ? -18.902 -4.530  -5.386  1.00 0.00 ? 21 ARG A NE   7  
ATOM 7929  C CZ   . ARG A 1 21 ? -19.726 -3.639  -4.844  1.00 0.00 ? 21 ARG A CZ   7  
ATOM 7930  N NH1  . ARG A 1 21 ? -19.254 -2.702  -4.034  1.00 0.00 ? 21 ARG A NH1  7  
ATOM 7931  N NH2  . ARG A 1 21 ? -21.024 -3.684  -5.114  1.00 0.00 ? 21 ARG A NH2  7  
ATOM 7932  H H    . ARG A 1 21 ? -13.136 -4.280  -2.968  1.00 0.00 ? 21 ARG A H    7  
ATOM 7933  H HA   . ARG A 1 21 ? -15.584 -2.807  -3.581  1.00 0.00 ? 21 ARG A HA   7  
ATOM 7934  H HB2  . ARG A 1 21 ? -15.124 -5.194  -4.383  1.00 0.00 ? 21 ARG A HB2  7  
ATOM 7935  H HB3  . ARG A 1 21 ? -15.398 -5.687  -2.717  1.00 0.00 ? 21 ARG A HB3  7  
ATOM 7936  H HG2  . ARG A 1 21 ? -17.483 -5.997  -3.577  1.00 0.00 ? 21 ARG A HG2  7  
ATOM 7937  H HG3  . ARG A 1 21 ? -17.626 -4.325  -3.028  1.00 0.00 ? 21 ARG A HG3  7  
ATOM 7938  H HD2  . ARG A 1 21 ? -17.065 -3.560  -5.304  1.00 0.00 ? 21 ARG A HD2  7  
ATOM 7939  H HD3  . ARG A 1 21 ? -17.000 -5.241  -5.833  1.00 0.00 ? 21 ARG A HD3  7  
ATOM 7940  H HE   . ARG A 1 21 ? -19.272 -5.214  -5.982  1.00 0.00 ? 21 ARG A HE   7  
ATOM 7941  H HH11 . ARG A 1 21 ? -18.276 -2.665  -3.830  1.00 0.00 ? 21 ARG A HH11 7  
ATOM 7942  H HH12 . ARG A 1 21 ? -19.876 -2.032  -3.629  1.00 0.00 ? 21 ARG A HH12 7  
ATOM 7943  H HH21 . ARG A 1 21 ? -21.384 -4.389  -5.724  1.00 0.00 ? 21 ARG A HH21 7  
ATOM 7944  H HH22 . ARG A 1 21 ? -21.643 -3.014  -4.706  1.00 0.00 ? 21 ARG A HH22 7  
ATOM 7945  N N    . THR A 1 22 ? -15.003 -4.204  -0.637  1.00 0.00 ? 22 THR A N    7  
ATOM 7946  C CA   . THR A 1 22 ? -15.309 -4.109  0.785   1.00 0.00 ? 22 THR A CA   7  
ATOM 7947  C C    . THR A 1 22 ? -14.458 -3.040  1.460   1.00 0.00 ? 22 THR A C    7  
ATOM 7948  O O    . THR A 1 22 ? -13.275 -2.890  1.156   1.00 0.00 ? 22 THR A O    7  
ATOM 7949  C CB   . THR A 1 22 ? -15.084 -5.456  1.499   1.00 0.00 ? 22 THR A CB   7  
ATOM 7950  O OG1  . THR A 1 22 ? -15.419 -5.337  2.886   1.00 0.00 ? 22 THR A OG1  7  
ATOM 7951  C CG2  . THR A 1 22 ? -13.638 -5.907  1.358   1.00 0.00 ? 22 THR A CG2  7  
ATOM 7952  H H    . THR A 1 22 ? -14.388 -4.900  -0.949  1.00 0.00 ? 22 THR A H    7  
ATOM 7953  H HA   . THR A 1 22 ? -16.351 -3.843  0.884   1.00 0.00 ? 22 THR A HA   7  
ATOM 7954  H HB   . THR A 1 22 ? -15.723 -6.198  1.044   1.00 0.00 ? 22 THR A HB   7  
ATOM 7955  H HG1  . THR A 1 22 ? -16.175 -5.896  3.081   1.00 0.00 ? 22 THR A HG1  7  
ATOM 7956  H HG21 . THR A 1 22 ? -12.980 -5.073  1.553   1.00 0.00 ? 22 THR A HG21 7  
ATOM 7957  H HG22 . THR A 1 22 ? -13.471 -6.272  0.356   1.00 0.00 ? 22 THR A HG22 7  
ATOM 7958  H HG23 . THR A 1 22 ? -13.438 -6.697  2.067   1.00 0.00 ? 22 THR A HG23 7  
ATOM 7959  N N    . VAL A 1 23 ? -15.068 -2.299  2.380   1.00 0.00 ? 23 VAL A N    7  
ATOM 7960  C CA   . VAL A 1 23 ? -14.365 -1.244  3.100   1.00 0.00 ? 23 VAL A CA   7  
ATOM 7961  C C    . VAL A 1 23 ? -13.614 -1.805  4.302   1.00 0.00 ? 23 VAL A C    7  
ATOM 7962  O O    . VAL A 1 23 ? -13.873 -2.926  4.741   1.00 0.00 ? 23 VAL A O    7  
ATOM 7963  C CB   . VAL A 1 23 ? -15.336 -0.149  3.581   1.00 0.00 ? 23 VAL A CB   7  
ATOM 7964  C CG1  . VAL A 1 23 ? -16.016 0.519   2.396   1.00 0.00 ? 23 VAL A CG1  7  
ATOM 7965  C CG2  . VAL A 1 23 ? -16.365 -0.733  4.537   1.00 0.00 ? 23 VAL A CG2  7  
ATOM 7966  H H    . VAL A 1 23 ? -16.013 -2.465  2.578   1.00 0.00 ? 23 VAL A H    7  
ATOM 7967  H HA   . VAL A 1 23 ? -13.655 -0.793  2.423   1.00 0.00 ? 23 VAL A HA   7  
ATOM 7968  H HB   . VAL A 1 23 ? -14.768 0.600   4.112   1.00 0.00 ? 23 VAL A HB   7  
ATOM 7969  H HG11 . VAL A 1 23 ? -15.575 1.491   2.229   1.00 0.00 ? 23 VAL A HG11 7  
ATOM 7970  H HG12 . VAL A 1 23 ? -15.888 -0.092  1.515   1.00 0.00 ? 23 VAL A HG12 7  
ATOM 7971  H HG13 . VAL A 1 23 ? -17.070 0.635   2.605   1.00 0.00 ? 23 VAL A HG13 7  
ATOM 7972  H HG21 . VAL A 1 23 ? -16.495 -1.785  4.327   1.00 0.00 ? 23 VAL A HG21 7  
ATOM 7973  H HG22 . VAL A 1 23 ? -16.024 -0.609  5.554   1.00 0.00 ? 23 VAL A HG22 7  
ATOM 7974  H HG23 . VAL A 1 23 ? -17.307 -0.221  4.409   1.00 0.00 ? 23 VAL A HG23 7  
ATOM 7975  N N    . PHE A 1 24 ? -12.682 -1.019  4.831   1.00 0.00 ? 24 PHE A N    7  
ATOM 7976  C CA   . PHE A 1 24 ? -11.892 -1.438  5.983   1.00 0.00 ? 24 PHE A CA   7  
ATOM 7977  C C    . PHE A 1 24 ? -12.550 -0.990  7.285   1.00 0.00 ? 24 PHE A C    7  
ATOM 7978  O O    . PHE A 1 24 ? -12.997 0.151   7.408   1.00 0.00 ? 24 PHE A O    7  
ATOM 7979  C CB   . PHE A 1 24 ? -10.476 -0.868  5.891   1.00 0.00 ? 24 PHE A CB   7  
ATOM 7980  C CG   . PHE A 1 24 ? -9.664  -1.457  4.773   1.00 0.00 ? 24 PHE A CG   7  
ATOM 7981  C CD1  . PHE A 1 24 ? -8.964  -2.640  4.956   1.00 0.00 ? 24 PHE A CD1  7  
ATOM 7982  C CD2  . PHE A 1 24 ? -9.600  -0.830  3.540   1.00 0.00 ? 24 PHE A CD2  7  
ATOM 7983  C CE1  . PHE A 1 24 ? -8.216  -3.184  3.929   1.00 0.00 ? 24 PHE A CE1  7  
ATOM 7984  C CE2  . PHE A 1 24 ? -8.854  -1.369  2.509   1.00 0.00 ? 24 PHE A CE2  7  
ATOM 7985  C CZ   . PHE A 1 24 ? -8.161  -2.548  2.704   1.00 0.00 ? 24 PHE A CZ   7  
ATOM 7986  H H    . PHE A 1 24 ? -12.522 -0.136  4.436   1.00 0.00 ? 24 PHE A H    7  
ATOM 7987  H HA   . PHE A 1 24 ? -11.839 -2.516  5.973   1.00 0.00 ? 24 PHE A HA   7  
ATOM 7988  H HB2  . PHE A 1 24 ? -10.534 0.198   5.731   1.00 0.00 ? 24 PHE A HB2  7  
ATOM 7989  H HB3  . PHE A 1 24 ? -9.957  -1.061  6.818   1.00 0.00 ? 24 PHE A HB3  7  
ATOM 7990  H HD1  . PHE A 1 24 ? -9.007  -3.138  5.913   1.00 0.00 ? 24 PHE A HD1  7  
ATOM 7991  H HD2  . PHE A 1 24 ? -10.142 0.093   3.386   1.00 0.00 ? 24 PHE A HD2  7  
ATOM 7992  H HE1  . PHE A 1 24 ? -7.676  -4.106  4.084   1.00 0.00 ? 24 PHE A HE1  7  
ATOM 7993  H HE2  . PHE A 1 24 ? -8.813  -0.870  1.552   1.00 0.00 ? 24 PHE A HE2  7  
ATOM 7994  H HZ   . PHE A 1 24 ? -7.577  -2.971  1.901   1.00 0.00 ? 24 PHE A HZ   7  
ATOM 7995  N N    . THR A 1 25 ? -12.606 -1.896  8.256   1.00 0.00 ? 25 THR A N    7  
ATOM 7996  C CA   . THR A 1 25 ? -13.209 -1.596  9.548   1.00 0.00 ? 25 THR A CA   7  
ATOM 7997  C C    . THR A 1 25 ? -12.270 -0.765  10.414  1.00 0.00 ? 25 THR A C    7  
ATOM 7998  O O    . THR A 1 25 ? -11.051 -0.919  10.347  1.00 0.00 ? 25 THR A O    7  
ATOM 7999  C CB   . THR A 1 25 ? -13.583 -2.884  10.306  1.00 0.00 ? 25 THR A CB   7  
ATOM 8000  O OG1  . THR A 1 25 ? -12.398 -3.605  10.660  1.00 0.00 ? 25 THR A OG1  7  
ATOM 8001  C CG2  . THR A 1 25 ? -14.486 -3.768  9.459   1.00 0.00 ? 25 THR A CG2  7  
ATOM 8002  H H    . THR A 1 25 ? -12.232 -2.788  8.097   1.00 0.00 ? 25 THR A H    7  
ATOM 8003  H HA   . THR A 1 25 ? -14.114 -1.033  9.371   1.00 0.00 ? 25 THR A HA   7  
ATOM 8004  H HB   . THR A 1 25 ? -14.113 -2.612  11.207  1.00 0.00 ? 25 THR A HB   7  
ATOM 8005  H HG1  . THR A 1 25 ? -12.215 -3.482  11.595  1.00 0.00 ? 25 THR A HG1  7  
ATOM 8006  H HG21 . THR A 1 25 ? -15.518 -3.504  9.636   1.00 0.00 ? 25 THR A HG21 7  
ATOM 8007  H HG22 . THR A 1 25 ? -14.328 -4.803  9.724   1.00 0.00 ? 25 THR A HG22 7  
ATOM 8008  H HG23 . THR A 1 25 ? -14.252 -3.625  8.415   1.00 0.00 ? 25 THR A HG23 7  
ATOM 8009  N N    . GLU A 1 26 ? -12.845 0.116   11.226  1.00 0.00 ? 26 GLU A N    7  
ATOM 8010  C CA   . GLU A 1 26 ? -12.057 0.971   12.106  1.00 0.00 ? 26 GLU A CA   7  
ATOM 8011  C C    . GLU A 1 26 ? -10.861 0.213   12.673  1.00 0.00 ? 26 GLU A C    7  
ATOM 8012  O O    . GLU A 1 26 ? -9.746  0.735   12.720  1.00 0.00 ? 26 GLU A O    7  
ATOM 8013  C CB   . GLU A 1 26 ? -12.925 1.505   13.247  1.00 0.00 ? 26 GLU A CB   7  
ATOM 8014  C CG   . GLU A 1 26 ? -13.880 2.608   12.822  1.00 0.00 ? 26 GLU A CG   7  
ATOM 8015  C CD   . GLU A 1 26 ? -15.066 2.746   13.756  1.00 0.00 ? 26 GLU A CD   7  
ATOM 8016  O OE1  . GLU A 1 26 ? -15.963 1.879   13.709  1.00 0.00 ? 26 GLU A OE1  7  
ATOM 8017  O OE2  . GLU A 1 26 ? -15.095 3.721   14.536  1.00 0.00 ? 26 GLU A OE2  7  
ATOM 8018  H H    . GLU A 1 26 ? -13.822 0.192   11.234  1.00 0.00 ? 26 GLU A H    7  
ATOM 8019  H HA   . GLU A 1 26 ? -11.696 1.804   11.521  1.00 0.00 ? 26 GLU A HA   7  
ATOM 8020  H HB2  . GLU A 1 26 ? -13.507 0.690   13.652  1.00 0.00 ? 26 GLU A HB2  7  
ATOM 8021  H HB3  . GLU A 1 26 ? -12.281 1.895   14.021  1.00 0.00 ? 26 GLU A HB3  7  
ATOM 8022  H HG2  . GLU A 1 26 ? -13.343 3.544   12.805  1.00 0.00 ? 26 GLU A HG2  7  
ATOM 8023  H HG3  . GLU A 1 26 ? -14.246 2.387   11.830  1.00 0.00 ? 26 GLU A HG3  7  
ATOM 8024  N N    . LEU A 1 27 ? -11.100 -1.020  13.104  1.00 0.00 ? 27 LEU A N    7  
ATOM 8025  C CA   . LEU A 1 27 ? -10.043 -1.852  13.669  1.00 0.00 ? 27 LEU A CA   7  
ATOM 8026  C C    . LEU A 1 27 ? -8.970  -2.153  12.628  1.00 0.00 ? 27 LEU A C    7  
ATOM 8027  O O    . LEU A 1 27 ? -7.785  -1.916  12.858  1.00 0.00 ? 27 LEU A O    7  
ATOM 8028  C CB   . LEU A 1 27 ? -10.628 -3.159  14.208  1.00 0.00 ? 27 LEU A CB   7  
ATOM 8029  C CG   . LEU A 1 27 ? -9.705  -3.991  15.098  1.00 0.00 ? 27 LEU A CG   7  
ATOM 8030  C CD1  . LEU A 1 27 ? -10.516 -4.830  16.073  1.00 0.00 ? 27 LEU A CD1  7  
ATOM 8031  C CD2  . LEU A 1 27 ? -8.804  -4.878  14.251  1.00 0.00 ? 27 LEU A CD2  7  
ATOM 8032  H H    . LEU A 1 27 ? -12.008 -1.382  13.040  1.00 0.00 ? 27 LEU A H    7  
ATOM 8033  H HA   . LEU A 1 27 ? -9.593  -1.306  14.485  1.00 0.00 ? 27 LEU A HA   7  
ATOM 8034  H HB2  . LEU A 1 27 ? -11.509 -2.915  14.782  1.00 0.00 ? 27 LEU A HB2  7  
ATOM 8035  H HB3  . LEU A 1 27 ? -10.910 -3.768  13.361  1.00 0.00 ? 27 LEU A HB3  7  
ATOM 8036  H HG   . LEU A 1 27 ? -9.075  -3.327  15.674  1.00 0.00 ? 27 LEU A HG   7  
ATOM 8037  H HD11 . LEU A 1 27 ? -11.530 -4.920  15.713  1.00 0.00 ? 27 LEU A HD11 7  
ATOM 8038  H HD12 . LEU A 1 27 ? -10.519 -4.353  17.042  1.00 0.00 ? 27 LEU A HD12 7  
ATOM 8039  H HD13 . LEU A 1 27 ? -10.075 -5.812  16.157  1.00 0.00 ? 27 LEU A HD13 7  
ATOM 8040  H HD21 . LEU A 1 27 ? -8.898  -4.597  13.212  1.00 0.00 ? 27 LEU A HD21 7  
ATOM 8041  H HD22 . LEU A 1 27 ? -9.098  -5.910  14.373  1.00 0.00 ? 27 LEU A HD22 7  
ATOM 8042  H HD23 . LEU A 1 27 ? -7.778  -4.755  14.566  1.00 0.00 ? 27 LEU A HD23 7  
ATOM 8043  N N    . GLN A 1 28 ? -9.396  -2.673  11.481  1.00 0.00 ? 28 GLN A N    7  
ATOM 8044  C CA   . GLN A 1 28 ? -8.471  -3.005  10.403  1.00 0.00 ? 28 GLN A CA   7  
ATOM 8045  C C    . GLN A 1 28 ? -7.641  -1.789  10.006  1.00 0.00 ? 28 GLN A C    7  
ATOM 8046  O O    . GLN A 1 28 ? -6.426  -1.885  9.828   1.00 0.00 ? 28 GLN A O    7  
ATOM 8047  C CB   . GLN A 1 28 ? -9.238  -3.533  9.190   1.00 0.00 ? 28 GLN A CB   7  
ATOM 8048  C CG   . GLN A 1 28 ? -10.034 -4.796  9.475   1.00 0.00 ? 28 GLN A CG   7  
ATOM 8049  C CD   . GLN A 1 28 ? -9.195  -6.053  9.357   1.00 0.00 ? 28 GLN A CD   7  
ATOM 8050  O OE1  . GLN A 1 28 ? -7.968  -5.989  9.269   1.00 0.00 ? 28 GLN A OE1  7  
ATOM 8051  N NE2  . GLN A 1 28 ? -9.853  -7.207  9.354   1.00 0.00 ? 28 GLN A NE2  7  
ATOM 8052  H H    . GLN A 1 28 ? -10.353 -2.839  11.357  1.00 0.00 ? 28 GLN A H    7  
ATOM 8053  H HA   . GLN A 1 28 ? -7.808  -3.777  10.762  1.00 0.00 ? 28 GLN A HA   7  
ATOM 8054  H HB2  . GLN A 1 28 ? -9.923  -2.770  8.852   1.00 0.00 ? 28 GLN A HB2  7  
ATOM 8055  H HB3  . GLN A 1 28 ? -8.534  -3.748  8.400   1.00 0.00 ? 28 GLN A HB3  7  
ATOM 8056  H HG2  . GLN A 1 28 ? -10.428 -4.739  10.479  1.00 0.00 ? 28 GLN A HG2  7  
ATOM 8057  H HG3  . GLN A 1 28 ? -10.850 -4.858  8.771   1.00 0.00 ? 28 GLN A HG3  7  
ATOM 8058  H HE21 . GLN A 1 28 ? -10.831 -7.181  9.426   1.00 0.00 ? 28 GLN A HE21 7  
ATOM 8059  H HE22 . GLN A 1 28 ? -9.336  -8.035  9.278   1.00 0.00 ? 28 GLN A HE22 7  
ATOM 8060  N N    . LEU A 1 29 ? -8.303  -0.646  9.867   1.00 0.00 ? 29 LEU A N    7  
ATOM 8061  C CA   . LEU A 1 29 ? -7.626  0.590   9.490   1.00 0.00 ? 29 LEU A CA   7  
ATOM 8062  C C    . LEU A 1 29 ? -6.616  1.005   10.555  1.00 0.00 ? 29 LEU A C    7  
ATOM 8063  O O    . LEU A 1 29 ? -5.518  1.461   10.239  1.00 0.00 ? 29 LEU A O    7  
ATOM 8064  C CB   . LEU A 1 29 ? -8.647  1.709   9.275   1.00 0.00 ? 29 LEU A CB   7  
ATOM 8065  C CG   . LEU A 1 29 ? -9.407  1.678   7.949   1.00 0.00 ? 29 LEU A CG   7  
ATOM 8066  C CD1  . LEU A 1 29 ? -10.574 2.653   7.980   1.00 0.00 ? 29 LEU A CD1  7  
ATOM 8067  C CD2  . LEU A 1 29 ? -8.473  1.998   6.791   1.00 0.00 ? 29 LEU A CD2  7  
ATOM 8068  H H    . LEU A 1 29 ? -9.270  -0.632  10.022  1.00 0.00 ? 29 LEU A H    7  
ATOM 8069  H HA   . LEU A 1 29 ? -7.101  0.410   8.563   1.00 0.00 ? 29 LEU A HA   7  
ATOM 8070  H HB2  . LEU A 1 29 ? -9.372  1.653   10.073  1.00 0.00 ? 29 LEU A HB2  7  
ATOM 8071  H HB3  . LEU A 1 29 ? -8.121  2.651   9.334   1.00 0.00 ? 29 LEU A HB3  7  
ATOM 8072  H HG   . LEU A 1 29 ? -9.807  0.685   7.793   1.00 0.00 ? 29 LEU A HG   7  
ATOM 8073  H HD11 . LEU A 1 29 ? -10.411 3.385   8.756   1.00 0.00 ? 29 LEU A HD11 7  
ATOM 8074  H HD12 . LEU A 1 29 ? -11.488 2.114   8.179   1.00 0.00 ? 29 LEU A HD12 7  
ATOM 8075  H HD13 . LEU A 1 29 ? -10.652 3.152   7.024   1.00 0.00 ? 29 LEU A HD13 7  
ATOM 8076  H HD21 . LEU A 1 29 ? -8.522  3.054   6.570   1.00 0.00 ? 29 LEU A HD21 7  
ATOM 8077  H HD22 . LEU A 1 29 ? -8.774  1.434   5.920   1.00 0.00 ? 29 LEU A HD22 7  
ATOM 8078  H HD23 . LEU A 1 29 ? -7.462  1.733   7.061   1.00 0.00 ? 29 LEU A HD23 7  
ATOM 8079  N N    . MET A 1 30 ? -6.996  0.840   11.818  1.00 0.00 ? 30 MET A N    7  
ATOM 8080  C CA   . MET A 1 30 ? -6.121  1.195   12.930  1.00 0.00 ? 30 MET A CA   7  
ATOM 8081  C C    . MET A 1 30 ? -4.799  0.440   12.844  1.00 0.00 ? 30 MET A C    7  
ATOM 8082  O O    . MET A 1 30 ? -3.740  0.985   13.154  1.00 0.00 ? 30 MET A O    7  
ATOM 8083  C CB   . MET A 1 30 ? -6.808  0.892   14.263  1.00 0.00 ? 30 MET A CB   7  
ATOM 8084  C CG   . MET A 1 30 ? -5.913  1.114   15.472  1.00 0.00 ? 30 MET A CG   7  
ATOM 8085  S SD   . MET A 1 30 ? -6.839  1.591   16.944  1.00 0.00 ? 30 MET A SD   7  
ATOM 8086  C CE   . MET A 1 30 ? -7.191  -0.014  17.658  1.00 0.00 ? 30 MET A CE   7  
ATOM 8087  H H    . MET A 1 30 ? -7.883  0.471   12.008  1.00 0.00 ? 30 MET A H    7  
ATOM 8088  H HA   . MET A 1 30 ? -5.922  2.254   12.870  1.00 0.00 ? 30 MET A HA   7  
ATOM 8089  H HB2  . MET A 1 30 ? -7.674  1.531   14.362  1.00 0.00 ? 30 MET A HB2  7  
ATOM 8090  H HB3  . MET A 1 30 ? -7.129  -0.139  14.264  1.00 0.00 ? 30 MET A HB3  7  
ATOM 8091  H HG2  . MET A 1 30 ? -5.380  0.198   15.681  1.00 0.00 ? 30 MET A HG2  7  
ATOM 8092  H HG3  . MET A 1 30 ? -5.205  1.895   15.240  1.00 0.00 ? 30 MET A HG3  7  
ATOM 8093  H HE1  . MET A 1 30 ? -6.529  -0.189  18.493  1.00 0.00 ? 30 MET A HE1  7  
ATOM 8094  H HE2  . MET A 1 30 ? -8.215  -0.040  17.998  1.00 0.00 ? 30 MET A HE2  7  
ATOM 8095  H HE3  . MET A 1 30 ? -7.039  -0.781  16.911  1.00 0.00 ? 30 MET A HE3  7  
ATOM 8096  N N    . GLY A 1 31 ? -4.867  -0.819  12.420  1.00 0.00 ? 31 GLY A N    7  
ATOM 8097  C CA   . GLY A 1 31 ? -3.668  -1.628  12.302  1.00 0.00 ? 31 GLY A CA   7  
ATOM 8098  C C    . GLY A 1 31 ? -2.909  -1.354  11.018  1.00 0.00 ? 31 GLY A C    7  
ATOM 8099  O O    . GLY A 1 31 ? -1.700  -1.118  11.041  1.00 0.00 ? 31 GLY A O    7  
ATOM 8100  H H    . GLY A 1 31 ? -5.739  -1.201  12.187  1.00 0.00 ? 31 GLY A H    7  
ATOM 8101  H HA2  . GLY A 1 31 ? -3.022  -1.419  13.141  1.00 0.00 ? 31 GLY A HA2  7  
ATOM 8102  H HA3  . GLY A 1 31 ? -3.947  -2.671  12.325  1.00 0.00 ? 31 GLY A HA3  7  
ATOM 8103  N N    . LEU A 1 32 ? -3.618  -1.387  9.895   1.00 0.00 ? 32 LEU A N    7  
ATOM 8104  C CA   . LEU A 1 32 ? -3.003  -1.143  8.595   1.00 0.00 ? 32 LEU A CA   7  
ATOM 8105  C C    . LEU A 1 32 ? -2.254  0.186   8.588   1.00 0.00 ? 32 LEU A C    7  
ATOM 8106  O O    . LEU A 1 32 ? -1.184  0.303   7.993   1.00 0.00 ? 32 LEU A O    7  
ATOM 8107  C CB   . LEU A 1 32 ? -4.068  -1.147  7.497   1.00 0.00 ? 32 LEU A CB   7  
ATOM 8108  C CG   . LEU A 1 32 ? -4.497  -2.522  6.983   1.00 0.00 ? 32 LEU A CG   7  
ATOM 8109  C CD1  . LEU A 1 32 ? -5.737  -2.403  6.111   1.00 0.00 ? 32 LEU A CD1  7  
ATOM 8110  C CD2  . LEU A 1 32 ? -3.362  -3.182  6.213   1.00 0.00 ? 32 LEU A CD2  7  
ATOM 8111  H H    . LEU A 1 32 ? -4.577  -1.581  9.940   1.00 0.00 ? 32 LEU A H    7  
ATOM 8112  H HA   . LEU A 1 32 ? -2.299  -1.940  8.406   1.00 0.00 ? 32 LEU A HA   7  
ATOM 8113  H HB2  . LEU A 1 32 ? -4.944  -0.651  7.884   1.00 0.00 ? 32 LEU A HB2  7  
ATOM 8114  H HB3  . LEU A 1 32 ? -3.679  -0.586  6.659   1.00 0.00 ? 32 LEU A HB3  7  
ATOM 8115  H HG   . LEU A 1 32 ? -4.741  -3.154  7.826   1.00 0.00 ? 32 LEU A HG   7  
ATOM 8116  H HD11 . LEU A 1 32 ? -5.646  -1.539  5.471   1.00 0.00 ? 32 LEU A HD11 7  
ATOM 8117  H HD12 . LEU A 1 32 ? -6.609  -2.296  6.739   1.00 0.00 ? 32 LEU A HD12 7  
ATOM 8118  H HD13 . LEU A 1 32 ? -5.837  -3.292  5.505   1.00 0.00 ? 32 LEU A HD13 7  
ATOM 8119  H HD21 . LEU A 1 32 ? -3.745  -3.589  5.289   1.00 0.00 ? 32 LEU A HD21 7  
ATOM 8120  H HD22 . LEU A 1 32 ? -2.937  -3.977  6.808   1.00 0.00 ? 32 LEU A HD22 7  
ATOM 8121  H HD23 . LEU A 1 32 ? -2.601  -2.448  5.995   1.00 0.00 ? 32 LEU A HD23 7  
ATOM 8122  N N    . GLU A 1 33 ? -2.825  1.185   9.255   1.00 0.00 ? 33 GLU A N    7  
ATOM 8123  C CA   . GLU A 1 33 ? -2.210  2.505   9.326   1.00 0.00 ? 33 GLU A CA   7  
ATOM 8124  C C    . GLU A 1 33 ? -0.999  2.492   10.255  1.00 0.00 ? 33 GLU A C    7  
ATOM 8125  O O    . GLU A 1 33 ? -0.005  3.174   10.008  1.00 0.00 ? 33 GLU A O    7  
ATOM 8126  C CB   . GLU A 1 33 ? -3.227  3.540   9.811   1.00 0.00 ? 33 GLU A CB   7  
ATOM 8127  C CG   . GLU A 1 33 ? -4.310  3.853   8.793   1.00 0.00 ? 33 GLU A CG   7  
ATOM 8128  C CD   . GLU A 1 33 ? -5.210  4.993   9.229   1.00 0.00 ? 33 GLU A CD   7  
ATOM 8129  O OE1  . GLU A 1 33 ? -5.406  5.158   10.451  1.00 0.00 ? 33 GLU A OE1  7  
ATOM 8130  O OE2  . GLU A 1 33 ? -5.717  5.719   8.349   1.00 0.00 ? 33 GLU A OE2  7  
ATOM 8131  H H    . GLU A 1 33 ? -3.679  1.030   9.710   1.00 0.00 ? 33 GLU A H    7  
ATOM 8132  H HA   . GLU A 1 33 ? -1.883  2.772   8.333   1.00 0.00 ? 33 GLU A HA   7  
ATOM 8133  H HB2  . GLU A 1 33 ? -3.701  3.169   10.708  1.00 0.00 ? 33 GLU A HB2  7  
ATOM 8134  H HB3  . GLU A 1 33 ? -2.705  4.457   10.044  1.00 0.00 ? 33 GLU A HB3  7  
ATOM 8135  H HG2  . GLU A 1 33 ? -3.841  4.123   7.858   1.00 0.00 ? 33 GLU A HG2  7  
ATOM 8136  H HG3  . GLU A 1 33 ? -4.916  2.970   8.648   1.00 0.00 ? 33 GLU A HG3  7  
ATOM 8137  N N    . LYS A 1 34 ? -1.090  1.710   11.326  1.00 0.00 ? 34 LYS A N    7  
ATOM 8138  C CA   . LYS A 1 34 ? -0.004  1.605   12.292  1.00 0.00 ? 34 LYS A CA   7  
ATOM 8139  C C    . LYS A 1 34 ? 1.217   0.937   11.668  1.00 0.00 ? 34 LYS A C    7  
ATOM 8140  O O    . LYS A 1 34 ? 2.356   1.274   11.995  1.00 0.00 ? 34 LYS A O    7  
ATOM 8141  C CB   . LYS A 1 34 ? -0.460  0.814   13.520  1.00 0.00 ? 34 LYS A CB   7  
ATOM 8142  C CG   . LYS A 1 34 ? 0.263   1.203   14.798  1.00 0.00 ? 34 LYS A CG   7  
ATOM 8143  C CD   . LYS A 1 34 ? -0.333  2.457   15.416  1.00 0.00 ? 34 LYS A CD   7  
ATOM 8144  C CE   . LYS A 1 34 ? -1.571  2.138   16.240  1.00 0.00 ? 34 LYS A CE   7  
ATOM 8145  N NZ   . LYS A 1 34 ? -1.240  1.341   17.453  1.00 0.00 ? 34 LYS A NZ   7  
ATOM 8146  H H    . LYS A 1 34 ? -1.909  1.189   11.468  1.00 0.00 ? 34 LYS A H    7  
ATOM 8147  H HA   . LYS A 1 34 ? 0.265   2.605   12.598  1.00 0.00 ? 34 LYS A HA   7  
ATOM 8148  H HB2  . LYS A 1 34 ? -1.518  0.977   13.665  1.00 0.00 ? 34 LYS A HB2  7  
ATOM 8149  H HB3  . LYS A 1 34 ? -0.288  -0.237  13.340  1.00 0.00 ? 34 LYS A HB3  7  
ATOM 8150  H HG2  . LYS A 1 34 ? 0.183   0.393   15.507  1.00 0.00 ? 34 LYS A HG2  7  
ATOM 8151  H HG3  . LYS A 1 34 ? 1.304   1.385   14.571  1.00 0.00 ? 34 LYS A HG3  7  
ATOM 8152  H HD2  . LYS A 1 34 ? 0.403   2.917   16.057  1.00 0.00 ? 34 LYS A HD2  7  
ATOM 8153  H HD3  . LYS A 1 34 ? -0.605  3.143   14.626  1.00 0.00 ? 34 LYS A HD3  7  
ATOM 8154  H HE2  . LYS A 1 34 ? -2.034  3.064   16.544  1.00 0.00 ? 34 LYS A HE2  7  
ATOM 8155  H HE3  . LYS A 1 34 ? -2.260  1.575   15.627  1.00 0.00 ? 34 LYS A HE3  7  
ATOM 8156  H HZ1  . LYS A 1 34 ? -1.154  0.334   17.206  1.00 0.00 ? 34 LYS A HZ1  7  
ATOM 8157  H HZ2  . LYS A 1 34 ? -1.988  1.448   18.167  1.00 0.00 ? 34 LYS A HZ2  7  
ATOM 8158  H HZ3  . LYS A 1 34 ? -0.339  1.665   17.859  1.00 0.00 ? 34 LYS A HZ3  7  
ATOM 8159  N N    . ARG A 1 35 ? 0.972   -0.011  10.769  1.00 0.00 ? 35 ARG A N    7  
ATOM 8160  C CA   . ARG A 1 35 ? 2.052   -0.726  10.100  1.00 0.00 ? 35 ARG A CA   7  
ATOM 8161  C C    . ARG A 1 35 ? 2.637   0.111   8.966   1.00 0.00 ? 35 ARG A C    7  
ATOM 8162  O O    . ARG A 1 35 ? 3.855   0.198   8.809   1.00 0.00 ? 35 ARG A O    7  
ATOM 8163  C CB   . ARG A 1 35 ? 1.546   -2.062  9.554   1.00 0.00 ? 35 ARG A CB   7  
ATOM 8164  C CG   . ARG A 1 35 ? 1.503   -3.169  10.595  1.00 0.00 ? 35 ARG A CG   7  
ATOM 8165  C CD   . ARG A 1 35 ? 2.889   -3.474  11.141  1.00 0.00 ? 35 ARG A CD   7  
ATOM 8166  N NE   . ARG A 1 35 ? 3.014   -4.864  11.571  1.00 0.00 ? 35 ARG A NE   7  
ATOM 8167  C CZ   . ARG A 1 35 ? 4.153   -5.403  11.992  1.00 0.00 ? 35 ARG A CZ   7  
ATOM 8168  N NH1  . ARG A 1 35 ? 5.259   -4.673  12.039  1.00 0.00 ? 35 ARG A NH1  7  
ATOM 8169  N NH2  . ARG A 1 35 ? 4.187   -6.675  12.367  1.00 0.00 ? 35 ARG A NH2  7  
ATOM 8170  H H    . ARG A 1 35 ? 0.044   -0.235  10.551  1.00 0.00 ? 35 ARG A H    7  
ATOM 8171  H HA   . ARG A 1 35 ? 2.827   -0.915  10.828  1.00 0.00 ? 35 ARG A HA   7  
ATOM 8172  H HB2  . ARG A 1 35 ? 0.547   -1.924  9.166   1.00 0.00 ? 35 ARG A HB2  7  
ATOM 8173  H HB3  . ARG A 1 35 ? 2.195   -2.378  8.751   1.00 0.00 ? 35 ARG A HB3  7  
ATOM 8174  H HG2  . ARG A 1 35 ? 0.867   -2.858  11.411  1.00 0.00 ? 35 ARG A HG2  7  
ATOM 8175  H HG3  . ARG A 1 35 ? 1.100   -4.062  10.141  1.00 0.00 ? 35 ARG A HG3  7  
ATOM 8176  H HD2  . ARG A 1 35 ? 3.617   -3.279  10.368  1.00 0.00 ? 35 ARG A HD2  7  
ATOM 8177  H HD3  . ARG A 1 35 ? 3.079   -2.827  11.985  1.00 0.00 ? 35 ARG A HD3  7  
ATOM 8178  H HE   . ARG A 1 35 ? 2.209   -5.421  11.545  1.00 0.00 ? 35 ARG A HE   7  
ATOM 8179  H HH11 . ARG A 1 35 ? 5.236   -3.714  11.758  1.00 0.00 ? 35 ARG A HH11 7  
ATOM 8180  H HH12 . ARG A 1 35 ? 6.115   -5.081  12.357  1.00 0.00 ? 35 ARG A HH12 7  
ATOM 8181  H HH21 . ARG A 1 35 ? 3.356   -7.229  12.333  1.00 0.00 ? 35 ARG A HH21 7  
ATOM 8182  H HH22 . ARG A 1 35 ? 5.044   -7.080  12.683  1.00 0.00 ? 35 ARG A HH22 7  
ATOM 8183  N N    . PHE A 1 36 ? 1.761   0.723   8.176   1.00 0.00 ? 36 PHE A N    7  
ATOM 8184  C CA   . PHE A 1 36 ? 2.190   1.551   7.055   1.00 0.00 ? 36 PHE A CA   7  
ATOM 8185  C C    . PHE A 1 36 ? 2.957   2.776   7.546   1.00 0.00 ? 36 PHE A C    7  
ATOM 8186  O O    . PHE A 1 36 ? 4.058   3.060   7.076   1.00 0.00 ? 36 PHE A O    7  
ATOM 8187  C CB   . PHE A 1 36 ? 0.981   1.991   6.227   1.00 0.00 ? 36 PHE A CB   7  
ATOM 8188  C CG   . PHE A 1 36 ? 1.351   2.724   4.969   1.00 0.00 ? 36 PHE A CG   7  
ATOM 8189  C CD1  . PHE A 1 36 ? 1.995   3.950   5.030   1.00 0.00 ? 36 PHE A CD1  7  
ATOM 8190  C CD2  . PHE A 1 36 ? 1.056   2.188   3.726   1.00 0.00 ? 36 PHE A CD2  7  
ATOM 8191  C CE1  . PHE A 1 36 ? 2.336   4.627   3.874   1.00 0.00 ? 36 PHE A CE1  7  
ATOM 8192  C CE2  . PHE A 1 36 ? 1.395   2.860   2.567   1.00 0.00 ? 36 PHE A CE2  7  
ATOM 8193  C CZ   . PHE A 1 36 ? 2.037   4.081   2.641   1.00 0.00 ? 36 PHE A CZ   7  
ATOM 8194  H H    . PHE A 1 36 ? 0.802   0.615   8.352   1.00 0.00 ? 36 PHE A H    7  
ATOM 8195  H HA   . PHE A 1 36 ? 2.843   0.956   6.436   1.00 0.00 ? 36 PHE A HA   7  
ATOM 8196  H HB2  . PHE A 1 36 ? 0.410   1.119   5.946   1.00 0.00 ? 36 PHE A HB2  7  
ATOM 8197  H HB3  . PHE A 1 36 ? 0.363   2.644   6.824   1.00 0.00 ? 36 PHE A HB3  7  
ATOM 8198  H HD1  . PHE A 1 36 ? 2.231   4.378   5.993   1.00 0.00 ? 36 PHE A HD1  7  
ATOM 8199  H HD2  . PHE A 1 36 ? 0.554   1.232   3.667   1.00 0.00 ? 36 PHE A HD2  7  
ATOM 8200  H HE1  . PHE A 1 36 ? 2.838   5.581   3.935   1.00 0.00 ? 36 PHE A HE1  7  
ATOM 8201  H HE2  . PHE A 1 36 ? 1.159   2.430   1.605   1.00 0.00 ? 36 PHE A HE2  7  
ATOM 8202  H HZ   . PHE A 1 36 ? 2.302   4.608   1.737   1.00 0.00 ? 36 PHE A HZ   7  
ATOM 8203  N N    . GLU A 1 37 ? 2.366   3.496   8.494   1.00 0.00 ? 37 GLU A N    7  
ATOM 8204  C CA   . GLU A 1 37 ? 2.993   4.691   9.047   1.00 0.00 ? 37 GLU A CA   7  
ATOM 8205  C C    . GLU A 1 37 ? 4.400   4.383   9.551   1.00 0.00 ? 37 GLU A C    7  
ATOM 8206  O O    . GLU A 1 37 ? 5.349   5.113   9.263   1.00 0.00 ? 37 GLU A O    7  
ATOM 8207  C CB   . GLU A 1 37 ? 2.144   5.259   10.186  1.00 0.00 ? 37 GLU A CB   7  
ATOM 8208  C CG   . GLU A 1 37 ? 2.388   4.580   11.524  1.00 0.00 ? 37 GLU A CG   7  
ATOM 8209  C CD   . GLU A 1 37 ? 1.506   5.132   12.627  1.00 0.00 ? 37 GLU A CD   7  
ATOM 8210  O OE1  . GLU A 1 37 ? 0.502   5.801   12.307  1.00 0.00 ? 37 GLU A OE1  7  
ATOM 8211  O OE2  . GLU A 1 37 ? 1.821   4.893   13.812  1.00 0.00 ? 37 GLU A OE2  7  
ATOM 8212  H H    . GLU A 1 37 ? 1.487   3.219   8.828   1.00 0.00 ? 37 GLU A H    7  
ATOM 8213  H HA   . GLU A 1 37 ? 3.059   5.426   8.259   1.00 0.00 ? 37 GLU A HA   7  
ATOM 8214  H HB2  . GLU A 1 37 ? 2.364   6.311   10.294  1.00 0.00 ? 37 GLU A HB2  7  
ATOM 8215  H HB3  . GLU A 1 37 ? 1.100   5.143   9.933   1.00 0.00 ? 37 GLU A HB3  7  
ATOM 8216  H HG2  . GLU A 1 37 ? 2.188   3.524   11.419  1.00 0.00 ? 37 GLU A HG2  7  
ATOM 8217  H HG3  . GLU A 1 37 ? 3.421   4.723   11.802  1.00 0.00 ? 37 GLU A HG3  7  
ATOM 8218  N N    . LYS A 1 38 ? 4.527   3.297   10.306  1.00 0.00 ? 38 LYS A N    7  
ATOM 8219  C CA   . LYS A 1 38 ? 5.816   2.890   10.851  1.00 0.00 ? 38 LYS A CA   7  
ATOM 8220  C C    . LYS A 1 38 ? 6.788   2.524   9.734   1.00 0.00 ? 38 LYS A C    7  
ATOM 8221  O O    . LYS A 1 38 ? 7.875   3.092   9.635   1.00 0.00 ? 38 LYS A O    7  
ATOM 8222  C CB   . LYS A 1 38 ? 5.640   1.701   11.798  1.00 0.00 ? 38 LYS A CB   7  
ATOM 8223  C CG   . LYS A 1 38 ? 5.134   2.090   13.176  1.00 0.00 ? 38 LYS A CG   7  
ATOM 8224  C CD   . LYS A 1 38 ? 5.473   1.033   14.214  1.00 0.00 ? 38 LYS A CD   7  
ATOM 8225  C CE   . LYS A 1 38 ? 6.863   1.246   14.793  1.00 0.00 ? 38 LYS A CE   7  
ATOM 8226  N NZ   . LYS A 1 38 ? 6.916   2.436   15.687  1.00 0.00 ? 38 LYS A NZ   7  
ATOM 8227  H H    . LYS A 1 38 ? 3.733   2.755   10.501  1.00 0.00 ? 38 LYS A H    7  
ATOM 8228  H HA   . LYS A 1 38 ? 6.221   3.724   11.405  1.00 0.00 ? 38 LYS A HA   7  
ATOM 8229  H HB2  . LYS A 1 38 ? 4.936   1.009   11.361  1.00 0.00 ? 38 LYS A HB2  7  
ATOM 8230  H HB3  . LYS A 1 38 ? 6.593   1.205   11.915  1.00 0.00 ? 38 LYS A HB3  7  
ATOM 8231  H HG2  . LYS A 1 38 ? 5.592   3.024   13.467  1.00 0.00 ? 38 LYS A HG2  7  
ATOM 8232  H HG3  . LYS A 1 38 ? 4.061   2.211   13.135  1.00 0.00 ? 38 LYS A HG3  7  
ATOM 8233  H HD2  . LYS A 1 38 ? 4.750   1.083   15.015  1.00 0.00 ? 38 LYS A HD2  7  
ATOM 8234  H HD3  . LYS A 1 38 ? 5.431   0.059   13.749  1.00 0.00 ? 38 LYS A HD3  7  
ATOM 8235  H HE2  . LYS A 1 38 ? 7.141   0.369   15.359  1.00 0.00 ? 38 LYS A HE2  7  
ATOM 8236  H HE3  . LYS A 1 38 ? 7.560   1.385   13.980  1.00 0.00 ? 38 LYS A HE3  7  
ATOM 8237  H HZ1  . LYS A 1 38 ? 6.687   2.159   16.663  1.00 0.00 ? 38 LYS A HZ1  7  
ATOM 8238  H HZ2  . LYS A 1 38 ? 6.229   3.150   15.371  1.00 0.00 ? 38 LYS A HZ2  7  
ATOM 8239  H HZ3  . LYS A 1 38 ? 7.868   2.853   15.670  1.00 0.00 ? 38 LYS A HZ3  7  
ATOM 8240  N N    . GLN A 1 39 ? 6.388   1.574   8.895   1.00 0.00 ? 39 GLN A N    7  
ATOM 8241  C CA   . GLN A 1 39 ? 7.224   1.134   7.785   1.00 0.00 ? 39 GLN A CA   7  
ATOM 8242  C C    . GLN A 1 39 ? 6.502   1.316   6.454   1.00 0.00 ? 39 GLN A C    7  
ATOM 8243  O O    . GLN A 1 39 ? 5.531   0.619   6.161   1.00 0.00 ? 39 GLN A O    7  
ATOM 8244  C CB   . GLN A 1 39 ? 7.620   -0.333  7.967   1.00 0.00 ? 39 GLN A CB   7  
ATOM 8245  C CG   . GLN A 1 39 ? 8.969   -0.679  7.356   1.00 0.00 ? 39 GLN A CG   7  
ATOM 8246  C CD   . GLN A 1 39 ? 9.466   -2.047  7.778   1.00 0.00 ? 39 GLN A CD   7  
ATOM 8247  O OE1  . GLN A 1 39 ? 10.576  -2.186  8.291   1.00 0.00 ? 39 GLN A OE1  7  
ATOM 8248  N NE2  . GLN A 1 39 ? 8.644   -3.068  7.563   1.00 0.00 ? 39 GLN A NE2  7  
ATOM 8249  H H    . GLN A 1 39 ? 5.510   1.159   9.026   1.00 0.00 ? 39 GLN A H    7  
ATOM 8250  H HA   . GLN A 1 39 ? 8.117   1.740   7.782   1.00 0.00 ? 39 GLN A HA   7  
ATOM 8251  H HB2  . GLN A 1 39 ? 7.659   -0.554  9.023   1.00 0.00 ? 39 GLN A HB2  7  
ATOM 8252  H HB3  . GLN A 1 39 ? 6.869   -0.956  7.504   1.00 0.00 ? 39 GLN A HB3  7  
ATOM 8253  H HG2  . GLN A 1 39 ? 8.877   -0.662  6.280   1.00 0.00 ? 39 GLN A HG2  7  
ATOM 8254  H HG3  . GLN A 1 39 ? 9.690   0.062   7.667   1.00 0.00 ? 39 GLN A HG3  7  
ATOM 8255  H HE21 . GLN A 1 39 ? 7.775   -2.883  7.148   1.00 0.00 ? 39 GLN A HE21 7  
ATOM 8256  H HE22 . GLN A 1 39 ? 8.941   -3.964  7.825   1.00 0.00 ? 39 GLN A HE22 7  
ATOM 8257  N N    . LYS A 1 40 ? 6.982   2.260   5.651   1.00 0.00 ? 40 LYS A N    7  
ATOM 8258  C CA   . LYS A 1 40 ? 6.384   2.535   4.350   1.00 0.00 ? 40 LYS A CA   7  
ATOM 8259  C C    . LYS A 1 40 ? 6.025   1.238   3.631   1.00 0.00 ? 40 LYS A C    7  
ATOM 8260  O O    . LYS A 1 40 ? 4.954   1.125   3.034   1.00 0.00 ? 40 LYS A O    7  
ATOM 8261  C CB   . LYS A 1 40 ? 7.344   3.359   3.488   1.00 0.00 ? 40 LYS A CB   7  
ATOM 8262  C CG   . LYS A 1 40 ? 7.581   4.764   4.015   1.00 0.00 ? 40 LYS A CG   7  
ATOM 8263  C CD   . LYS A 1 40 ? 6.322   5.610   3.930   1.00 0.00 ? 40 LYS A CD   7  
ATOM 8264  C CE   . LYS A 1 40 ? 6.579   7.038   4.385   1.00 0.00 ? 40 LYS A CE   7  
ATOM 8265  N NZ   . LYS A 1 40 ? 6.957   7.103   5.824   1.00 0.00 ? 40 LYS A NZ   7  
ATOM 8266  H H    . LYS A 1 40 ? 7.759   2.784   5.940   1.00 0.00 ? 40 LYS A H    7  
ATOM 8267  H HA   . LYS A 1 40 ? 5.482   3.104   4.513   1.00 0.00 ? 40 LYS A HA   7  
ATOM 8268  H HB2  . LYS A 1 40 ? 8.295   2.849   3.442   1.00 0.00 ? 40 LYS A HB2  7  
ATOM 8269  H HB3  . LYS A 1 40 ? 6.937   3.435   2.490   1.00 0.00 ? 40 LYS A HB3  7  
ATOM 8270  H HG2  . LYS A 1 40 ? 7.893   4.704   5.047   1.00 0.00 ? 40 LYS A HG2  7  
ATOM 8271  H HG3  . LYS A 1 40 ? 8.358   5.232   3.428   1.00 0.00 ? 40 LYS A HG3  7  
ATOM 8272  H HD2  . LYS A 1 40 ? 5.977   5.627   2.907   1.00 0.00 ? 40 LYS A HD2  7  
ATOM 8273  H HD3  . LYS A 1 40 ? 5.561   5.172   4.561   1.00 0.00 ? 40 LYS A HD3  7  
ATOM 8274  H HE2  . LYS A 1 40 ? 7.380   7.453   3.793   1.00 0.00 ? 40 LYS A HE2  7  
ATOM 8275  H HE3  . LYS A 1 40 ? 5.681   7.618   4.231   1.00 0.00 ? 40 LYS A HE3  7  
ATOM 8276  H HZ1  . LYS A 1 40 ? 6.767   6.189   6.284   1.00 0.00 ? 40 LYS A HZ1  7  
ATOM 8277  H HZ2  . LYS A 1 40 ? 6.406   7.841   6.306   1.00 0.00 ? 40 LYS A HZ2  7  
ATOM 8278  H HZ3  . LYS A 1 40 ? 7.969   7.323   5.919   1.00 0.00 ? 40 LYS A HZ3  7  
ATOM 8279  N N    . TYR A 1 41 ? 6.925   0.263   3.694   1.00 0.00 ? 41 TYR A N    7  
ATOM 8280  C CA   . TYR A 1 41 ? 6.702   -1.025  3.049   1.00 0.00 ? 41 TYR A CA   7  
ATOM 8281  C C    . TYR A 1 41 ? 6.891   -2.170  4.039   1.00 0.00 ? 41 TYR A C    7  
ATOM 8282  O O    . TYR A 1 41 ? 7.565   -2.020  5.059   1.00 0.00 ? 41 TYR A O    7  
ATOM 8283  C CB   . TYR A 1 41 ? 7.655   -1.197  1.865   1.00 0.00 ? 41 TYR A CB   7  
ATOM 8284  C CG   . TYR A 1 41 ? 7.729   0.016   0.965   1.00 0.00 ? 41 TYR A CG   7  
ATOM 8285  C CD1  . TYR A 1 41 ? 8.552   1.091   1.281   1.00 0.00 ? 41 TYR A CD1  7  
ATOM 8286  C CD2  . TYR A 1 41 ? 6.977   0.088   -0.201  1.00 0.00 ? 41 TYR A CD2  7  
ATOM 8287  C CE1  . TYR A 1 41 ? 8.622   2.201   0.463   1.00 0.00 ? 41 TYR A CE1  7  
ATOM 8288  C CE2  . TYR A 1 41 ? 7.042   1.194   -1.026  1.00 0.00 ? 41 TYR A CE2  7  
ATOM 8289  C CZ   . TYR A 1 41 ? 7.865   2.248   -0.689  1.00 0.00 ? 41 TYR A CZ   7  
ATOM 8290  O OH   . TYR A 1 41 ? 7.934   3.352   -1.508  1.00 0.00 ? 41 TYR A OH   7  
ATOM 8291  H H    . TYR A 1 41 ? 7.759   0.414   4.185   1.00 0.00 ? 41 TYR A H    7  
ATOM 8292  H HA   . TYR A 1 41 ? 5.685   -1.043  2.685   1.00 0.00 ? 41 TYR A HA   7  
ATOM 8293  H HB2  . TYR A 1 41 ? 8.649   -1.394  2.237   1.00 0.00 ? 41 TYR A HB2  7  
ATOM 8294  H HB3  . TYR A 1 41 ? 7.327   -2.034  1.266   1.00 0.00 ? 41 TYR A HB3  7  
ATOM 8295  H HD1  . TYR A 1 41 ? 9.143   1.050   2.185   1.00 0.00 ? 41 TYR A HD1  7  
ATOM 8296  H HD2  . TYR A 1 41 ? 6.333   -0.739  -0.462  1.00 0.00 ? 41 TYR A HD2  7  
ATOM 8297  H HE1  . TYR A 1 41 ? 9.267   3.027   0.726   1.00 0.00 ? 41 TYR A HE1  7  
ATOM 8298  H HE2  . TYR A 1 41 ? 6.450   1.232   -1.928  1.00 0.00 ? 41 TYR A HE2  7  
ATOM 8299  H HH   . TYR A 1 41 ? 8.596   3.206   -2.187  1.00 0.00 ? 41 TYR A HH   7  
ATOM 8300  N N    . LEU A 1 42 ? 6.291   -3.315  3.730   1.00 0.00 ? 42 LEU A N    7  
ATOM 8301  C CA   . LEU A 1 42 ? 6.393   -4.488  4.591   1.00 0.00 ? 42 LEU A CA   7  
ATOM 8302  C C    . LEU A 1 42 ? 7.144   -5.615  3.889   1.00 0.00 ? 42 LEU A C    7  
ATOM 8303  O O    . LEU A 1 42 ? 7.057   -5.769  2.671   1.00 0.00 ? 42 LEU A O    7  
ATOM 8304  C CB   . LEU A 1 42 ? 4.999   -4.967  5.000   1.00 0.00 ? 42 LEU A CB   7  
ATOM 8305  C CG   . LEU A 1 42 ? 4.182   -4.000  5.858   1.00 0.00 ? 42 LEU A CG   7  
ATOM 8306  C CD1  . LEU A 1 42 ? 2.721   -4.420  5.894   1.00 0.00 ? 42 LEU A CD1  7  
ATOM 8307  C CD2  . LEU A 1 42 ? 4.752   -3.925  7.267   1.00 0.00 ? 42 LEU A CD2  7  
ATOM 8308  H H    . LEU A 1 42 ? 5.768   -3.374  2.904   1.00 0.00 ? 42 LEU A H    7  
ATOM 8309  H HA   . LEU A 1 42 ? 6.941   -4.203  5.476   1.00 0.00 ? 42 LEU A HA   7  
ATOM 8310  H HB2  . LEU A 1 42 ? 4.439   -5.163  4.099   1.00 0.00 ? 42 LEU A HB2  7  
ATOM 8311  H HB3  . LEU A 1 42 ? 5.116   -5.886  5.557   1.00 0.00 ? 42 LEU A HB3  7  
ATOM 8312  H HG   . LEU A 1 42 ? 4.234   -3.011  5.423   1.00 0.00 ? 42 LEU A HG   7  
ATOM 8313  H HD11 . LEU A 1 42 ? 2.140   -3.754  5.275   1.00 0.00 ? 42 LEU A HD11 7  
ATOM 8314  H HD12 . LEU A 1 42 ? 2.359   -4.377  6.910   1.00 0.00 ? 42 LEU A HD12 7  
ATOM 8315  H HD13 . LEU A 1 42 ? 2.629   -5.430  5.522   1.00 0.00 ? 42 LEU A HD13 7  
ATOM 8316  H HD21 . LEU A 1 42 ? 5.431   -3.088  7.337   1.00 0.00 ? 42 LEU A HD21 7  
ATOM 8317  H HD22 . LEU A 1 42 ? 5.284   -4.839  7.489   1.00 0.00 ? 42 LEU A HD22 7  
ATOM 8318  H HD23 . LEU A 1 42 ? 3.947   -3.797  7.975   1.00 0.00 ? 42 LEU A HD23 7  
ATOM 8319  N N    . SER A 1 43 ? 7.881   -6.402  4.667   1.00 0.00 ? 43 SER A N    7  
ATOM 8320  C CA   . SER A 1 43 ? 8.649   -7.515  4.120   1.00 0.00 ? 43 SER A CA   7  
ATOM 8321  C C    . SER A 1 43 ? 7.728   -8.658  3.705   1.00 0.00 ? 43 SER A C    7  
ATOM 8322  O O    . SER A 1 43 ? 6.603   -8.775  4.193   1.00 0.00 ? 43 SER A O    7  
ATOM 8323  C CB   . SER A 1 43 ? 9.668   -8.012  5.147   1.00 0.00 ? 43 SER A CB   7  
ATOM 8324  O OG   . SER A 1 43 ? 10.797  -8.584  4.510   1.00 0.00 ? 43 SER A OG   7  
ATOM 8325  H H    . SER A 1 43 ? 7.910   -6.229  5.631   1.00 0.00 ? 43 SER A H    7  
ATOM 8326  H HA   . SER A 1 43 ? 9.175   -7.157  3.248   1.00 0.00 ? 43 SER A HA   7  
ATOM 8327  H HB2  . SER A 1 43 ? 9.995   -7.184  5.757   1.00 0.00 ? 43 SER A HB2  7  
ATOM 8328  H HB3  . SER A 1 43 ? 9.206   -8.761  5.775   1.00 0.00 ? 43 SER A HB3  7  
ATOM 8329  H HG   . SER A 1 43 ? 10.547  -8.899  3.638   1.00 0.00 ? 43 SER A HG   7  
ATOM 8330  N N    . THR A 1 44 ? 8.214   -9.502  2.799   1.00 0.00 ? 44 THR A N    7  
ATOM 8331  C CA   . THR A 1 44 ? 7.436   -10.636 2.316   1.00 0.00 ? 44 THR A CA   7  
ATOM 8332  C C    . THR A 1 44 ? 6.697   -11.322 3.459   1.00 0.00 ? 44 THR A C    7  
ATOM 8333  O O    . THR A 1 44 ? 5.470   -11.425 3.463   1.00 0.00 ? 44 THR A O    7  
ATOM 8334  C CB   . THR A 1 44 ? 8.331   -11.668 1.605   1.00 0.00 ? 44 THR A CB   7  
ATOM 8335  O OG1  . THR A 1 44 ? 8.389   -11.383 0.203   1.00 0.00 ? 44 THR A OG1  7  
ATOM 8336  C CG2  . THR A 1 44 ? 7.804   -13.079 1.820   1.00 0.00 ? 44 THR A CG2  7  
ATOM 8337  H H    . THR A 1 44 ? 9.117   -9.356  2.448   1.00 0.00 ? 44 THR A H    7  
ATOM 8338  H HA   . THR A 1 44 ? 6.713   -10.265 1.604   1.00 0.00 ? 44 THR A HA   7  
ATOM 8339  H HB   . THR A 1 44 ? 9.327   -11.605 2.020   1.00 0.00 ? 44 THR A HB   7  
ATOM 8340  H HG1  . THR A 1 44 ? 9.064   -10.720 0.039   1.00 0.00 ? 44 THR A HG1  7  
ATOM 8341  H HG21 . THR A 1 44 ? 6.764   -13.123 1.530   1.00 0.00 ? 44 THR A HG21 7  
ATOM 8342  H HG22 . THR A 1 44 ? 7.899   -13.345 2.862   1.00 0.00 ? 44 THR A HG22 7  
ATOM 8343  H HG23 . THR A 1 44 ? 8.374   -13.771 1.218   1.00 0.00 ? 44 THR A HG23 7  
ATOM 8344  N N    . PRO A 1 45 ? 7.458   -11.802 4.454   1.00 0.00 ? 45 PRO A N    7  
ATOM 8345  C CA   . PRO A 1 45 ? 6.895   -12.486 5.622   1.00 0.00 ? 45 PRO A CA   7  
ATOM 8346  C C    . PRO A 1 45 ? 6.128   -11.536 6.536   1.00 0.00 ? 45 PRO A C    7  
ATOM 8347  O O    . PRO A 1 45 ? 5.071   -11.885 7.062   1.00 0.00 ? 45 PRO A O    7  
ATOM 8348  C CB   . PRO A 1 45 ? 8.130   -13.038 6.339   1.00 0.00 ? 45 PRO A CB   7  
ATOM 8349  C CG   . PRO A 1 45 ? 9.243   -12.140 5.922   1.00 0.00 ? 45 PRO A CG   7  
ATOM 8350  C CD   . PRO A 1 45 ? 8.926   -11.714 4.515   1.00 0.00 ? 45 PRO A CD   7  
ATOM 8351  H HA   . PRO A 1 45 ? 6.250   -13.303 5.331   1.00 0.00 ? 45 PRO A HA   7  
ATOM 8352  H HB2  . PRO A 1 45 ? 7.973   -13.004 7.408   1.00 0.00 ? 45 PRO A HB2  7  
ATOM 8353  H HB3  . PRO A 1 45 ? 8.306   -14.056 6.027   1.00 0.00 ? 45 PRO A HB3  7  
ATOM 8354  H HG2  . PRO A 1 45 ? 9.285   -11.280 6.573   1.00 0.00 ? 45 PRO A HG2  7  
ATOM 8355  H HG3  . PRO A 1 45 ? 10.178  -12.679 5.948   1.00 0.00 ? 45 PRO A HG3  7  
ATOM 8356  H HD2  . PRO A 1 45 ? 9.260   -10.701 4.343   1.00 0.00 ? 45 PRO A HD2  7  
ATOM 8357  H HD3  . PRO A 1 45 ? 9.382   -12.389 3.805   1.00 0.00 ? 45 PRO A HD3  7  
ATOM 8358  N N    . ASP A 1 46 ? 6.667   -10.336 6.719   1.00 0.00 ? 46 ASP A N    7  
ATOM 8359  C CA   . ASP A 1 46 ? 6.032   -9.335  7.569   1.00 0.00 ? 46 ASP A CA   7  
ATOM 8360  C C    . ASP A 1 46 ? 4.576   -9.123  7.164   1.00 0.00 ? 46 ASP A C    7  
ATOM 8361  O O    . ASP A 1 46 ? 3.659   -9.435  7.923   1.00 0.00 ? 46 ASP A O    7  
ATOM 8362  C CB   . ASP A 1 46 ? 6.794   -8.011  7.491   1.00 0.00 ? 46 ASP A CB   7  
ATOM 8363  C CG   . ASP A 1 46 ? 7.893   -7.914  8.531   1.00 0.00 ? 46 ASP A CG   7  
ATOM 8364  O OD1  . ASP A 1 46 ? 7.619   -8.210  9.713   1.00 0.00 ? 46 ASP A OD1  7  
ATOM 8365  O OD2  . ASP A 1 46 ? 9.026   -7.543  8.163   1.00 0.00 ? 46 ASP A OD2  7  
ATOM 8366  H H    . ASP A 1 46 ? 7.511   -10.117 6.272   1.00 0.00 ? 46 ASP A H    7  
ATOM 8367  H HA   . ASP A 1 46 ? 6.060   -9.697  8.586   1.00 0.00 ? 46 ASP A HA   7  
ATOM 8368  H HB2  . ASP A 1 46 ? 7.242   -7.918  6.512   1.00 0.00 ? 46 ASP A HB2  7  
ATOM 8369  H HB3  . ASP A 1 46 ? 6.103   -7.196  7.645   1.00 0.00 ? 46 ASP A HB3  7  
ATOM 8370  N N    . ARG A 1 47 ? 4.373   -8.589  5.964   1.00 0.00 ? 47 ARG A N    7  
ATOM 8371  C CA   . ARG A 1 47 ? 3.030   -8.333  5.459   1.00 0.00 ? 47 ARG A CA   7  
ATOM 8372  C C    . ARG A 1 47 ? 2.074   -9.450  5.866   1.00 0.00 ? 47 ARG A C    7  
ATOM 8373  O O    . ARG A 1 47 ? 0.903   -9.204  6.157   1.00 0.00 ? 47 ARG A O    7  
ATOM 8374  C CB   . ARG A 1 47 ? 3.052   -8.195  3.936   1.00 0.00 ? 47 ARG A CB   7  
ATOM 8375  C CG   . ARG A 1 47 ? 1.669   -8.083  3.314   1.00 0.00 ? 47 ARG A CG   7  
ATOM 8376  C CD   . ARG A 1 47 ? 1.740   -8.081  1.795   1.00 0.00 ? 47 ARG A CD   7  
ATOM 8377  N NE   . ARG A 1 47 ? 2.365   -9.294  1.274   1.00 0.00 ? 47 ARG A NE   7  
ATOM 8378  C CZ   . ARG A 1 47 ? 3.678   -9.449  1.149   1.00 0.00 ? 47 ARG A CZ   7  
ATOM 8379  N NH1  . ARG A 1 47 ? 4.501   -8.472  1.505   1.00 0.00 ? 47 ARG A NH1  7  
ATOM 8380  N NH2  . ARG A 1 47 ? 4.171   -10.582 0.667   1.00 0.00 ? 47 ARG A NH2  7  
ATOM 8381  H H    . ARG A 1 47 ? 5.145   -8.361  5.405   1.00 0.00 ? 47 ARG A H    7  
ATOM 8382  H HA   . ARG A 1 47 ? 2.684   -7.405  5.891   1.00 0.00 ? 47 ARG A HA   7  
ATOM 8383  H HB2  . ARG A 1 47 ? 3.612   -7.310  3.674   1.00 0.00 ? 47 ARG A HB2  7  
ATOM 8384  H HB3  . ARG A 1 47 ? 3.543   -9.060  3.515   1.00 0.00 ? 47 ARG A HB3  7  
ATOM 8385  H HG2  . ARG A 1 47 ? 1.072   -8.924  3.634   1.00 0.00 ? 47 ARG A HG2  7  
ATOM 8386  H HG3  . ARG A 1 47 ? 1.209   -7.164  3.646   1.00 0.00 ? 47 ARG A HG3  7  
ATOM 8387  H HD2  . ARG A 1 47 ? 0.737   -8.007  1.401   1.00 0.00 ? 47 ARG A HD2  7  
ATOM 8388  H HD3  . ARG A 1 47 ? 2.316   -7.225  1.476   1.00 0.00 ? 47 ARG A HD3  7  
ATOM 8389  H HE   . ARG A 1 47 ? 1.775   -10.028 1.005   1.00 0.00 ? 47 ARG A HE   7  
ATOM 8390  H HH11 . ARG A 1 47 ? 4.132   -7.617  1.870   1.00 0.00 ? 47 ARG A HH11 7  
ATOM 8391  H HH12 . ARG A 1 47 ? 5.489   -8.591  1.411   1.00 0.00 ? 47 ARG A HH12 7  
ATOM 8392  H HH21 . ARG A 1 47 ? 3.553   -11.321 0.398   1.00 0.00 ? 47 ARG A HH21 7  
ATOM 8393  H HH22 . ARG A 1 47 ? 5.159   -10.698 0.573   1.00 0.00 ? 47 ARG A HH22 7  
ATOM 8394  N N    . ILE A 1 48 ? 2.581   -10.678 5.882   1.00 0.00 ? 48 ILE A N    7  
ATOM 8395  C CA   . ILE A 1 48 ? 1.772   -11.833 6.253   1.00 0.00 ? 48 ILE A CA   7  
ATOM 8396  C C    . ILE A 1 48 ? 1.439   -11.815 7.741   1.00 0.00 ? 48 ILE A C    7  
ATOM 8397  O O    . ILE A 1 48 ? 0.271   -11.885 8.127   1.00 0.00 ? 48 ILE A O    7  
ATOM 8398  C CB   . ILE A 1 48 ? 2.488   -13.154 5.915   1.00 0.00 ? 48 ILE A CB   7  
ATOM 8399  C CG1  . ILE A 1 48 ? 2.878   -13.184 4.436   1.00 0.00 ? 48 ILE A CG1  7  
ATOM 8400  C CG2  . ILE A 1 48 ? 1.601   -14.341 6.259   1.00 0.00 ? 48 ILE A CG2  7  
ATOM 8401  C CD1  . ILE A 1 48 ? 3.699   -14.395 4.052   1.00 0.00 ? 48 ILE A CD1  7  
ATOM 8402  H H    . ILE A 1 48 ? 3.521   -10.811 5.640   1.00 0.00 ? 48 ILE A H    7  
ATOM 8403  H HA   . ILE A 1 48 ? 0.852   -11.791 5.688   1.00 0.00 ? 48 ILE A HA   7  
ATOM 8404  H HB   . ILE A 1 48 ? 3.382   -13.217 6.517   1.00 0.00 ? 48 ILE A HB   7  
ATOM 8405  H HG12 . ILE A 1 48 ? 1.984   -13.186 3.834   1.00 0.00 ? 48 ILE A HG12 7  
ATOM 8406  H HG13 . ILE A 1 48 ? 3.459   -12.302 4.207   1.00 0.00 ? 48 ILE A HG13 7  
ATOM 8407  H HG21 . ILE A 1 48 ? 1.064   -14.656 5.376   1.00 0.00 ? 48 ILE A HG21 7  
ATOM 8408  H HG22 . ILE A 1 48 ? 2.212   -15.155 6.617   1.00 0.00 ? 48 ILE A HG22 7  
ATOM 8409  H HG23 . ILE A 1 48 ? 0.896   -14.054 7.025   1.00 0.00 ? 48 ILE A HG23 7  
ATOM 8410  H HD11 . ILE A 1 48 ? 3.719   -14.490 2.976   1.00 0.00 ? 48 ILE A HD11 7  
ATOM 8411  H HD12 . ILE A 1 48 ? 4.707   -14.280 4.423   1.00 0.00 ? 48 ILE A HD12 7  
ATOM 8412  H HD13 . ILE A 1 48 ? 3.256   -15.281 4.483   1.00 0.00 ? 48 ILE A HD13 7  
ATOM 8413  N N    . ASP A 1 49 ? 2.471   -11.719 8.572   1.00 0.00 ? 49 ASP A N    7  
ATOM 8414  C CA   . ASP A 1 49 ? 2.287   -11.689 10.019  1.00 0.00 ? 49 ASP A CA   7  
ATOM 8415  C C    . ASP A 1 49 ? 1.147   -10.752 10.402  1.00 0.00 ? 49 ASP A C    7  
ATOM 8416  O O    . ASP A 1 49 ? 0.288   -11.101 11.214  1.00 0.00 ? 49 ASP A O    7  
ATOM 8417  C CB   . ASP A 1 49 ? 3.579   -11.249 10.709  1.00 0.00 ? 49 ASP A CB   7  
ATOM 8418  C CG   . ASP A 1 49 ? 3.607   -11.622 12.178  1.00 0.00 ? 49 ASP A CG   7  
ATOM 8419  O OD1  . ASP A 1 49 ? 3.294   -12.787 12.499  1.00 0.00 ? 49 ASP A OD1  7  
ATOM 8420  O OD2  . ASP A 1 49 ? 3.942   -10.749 13.006  1.00 0.00 ? 49 ASP A OD2  7  
ATOM 8421  H H    . ASP A 1 49 ? 3.378   -11.667 8.204   1.00 0.00 ? 49 ASP A H    7  
ATOM 8422  H HA   . ASP A 1 49 ? 2.040   -12.689 10.343  1.00 0.00 ? 49 ASP A HA   7  
ATOM 8423  H HB2  . ASP A 1 49 ? 4.420   -11.721 10.220  1.00 0.00 ? 49 ASP A HB2  7  
ATOM 8424  H HB3  . ASP A 1 49 ? 3.677   -10.176 10.626  1.00 0.00 ? 49 ASP A HB3  7  
ATOM 8425  N N    . LEU A 1 50 ? 1.144   -9.560  9.815   1.00 0.00 ? 50 LEU A N    7  
ATOM 8426  C CA   . LEU A 1 50 ? 0.108   -8.572  10.096  1.00 0.00 ? 50 LEU A CA   7  
ATOM 8427  C C    . LEU A 1 50 ? -1.256  -9.061  9.619   1.00 0.00 ? 50 LEU A C    7  
ATOM 8428  O O    . LEU A 1 50 ? -2.198  -9.163  10.404  1.00 0.00 ? 50 LEU A O    7  
ATOM 8429  C CB   . LEU A 1 50 ? 0.450   -7.242  9.422   1.00 0.00 ? 50 LEU A CB   7  
ATOM 8430  C CG   . LEU A 1 50 ? -0.715  -6.271  9.222   1.00 0.00 ? 50 LEU A CG   7  
ATOM 8431  C CD1  . LEU A 1 50 ? -1.077  -5.595  10.535  1.00 0.00 ? 50 LEU A CD1  7  
ATOM 8432  C CD2  . LEU A 1 50 ? -0.370  -5.234  8.163   1.00 0.00 ? 50 LEU A CD2  7  
ATOM 8433  H H    . LEU A 1 50 ? 1.853   -9.340  9.177   1.00 0.00 ? 50 LEU A H    7  
ATOM 8434  H HA   . LEU A 1 50 ? 0.072   -8.425  11.165  1.00 0.00 ? 50 LEU A HA   7  
ATOM 8435  H HB2  . LEU A 1 50 ? 1.193   -6.745  10.027  1.00 0.00 ? 50 LEU A HB2  7  
ATOM 8436  H HB3  . LEU A 1 50 ? 0.868   -7.462  8.450   1.00 0.00 ? 50 LEU A HB3  7  
ATOM 8437  H HG   . LEU A 1 50 ? -1.580  -6.823  8.882   1.00 0.00 ? 50 LEU A HG   7  
ATOM 8438  H HD11 . LEU A 1 50 ? -0.175  -5.305  11.051  1.00 0.00 ? 50 LEU A HD11 7  
ATOM 8439  H HD12 . LEU A 1 50 ? -1.639  -6.282  11.151  1.00 0.00 ? 50 LEU A HD12 7  
ATOM 8440  H HD13 . LEU A 1 50 ? -1.676  -4.719  10.335  1.00 0.00 ? 50 LEU A HD13 7  
ATOM 8441  H HD21 . LEU A 1 50 ? -1.188  -5.149  7.463   1.00 0.00 ? 50 LEU A HD21 7  
ATOM 8442  H HD22 . LEU A 1 50 ? 0.523   -5.540  7.637   1.00 0.00 ? 50 LEU A HD22 7  
ATOM 8443  H HD23 . LEU A 1 50 ? -0.201  -4.279  8.637   1.00 0.00 ? 50 LEU A HD23 7  
ATOM 8444  N N    . ALA A 1 51 ? -1.352  -9.363  8.329   1.00 0.00 ? 51 ALA A N    7  
ATOM 8445  C CA   . ALA A 1 51 ? -2.600  -9.846  7.749   1.00 0.00 ? 51 ALA A CA   7  
ATOM 8446  C C    . ALA A 1 51 ? -3.221  -10.937 8.614   1.00 0.00 ? 51 ALA A C    7  
ATOM 8447  O O    . ALA A 1 51 ? -4.434  -11.143 8.591   1.00 0.00 ? 51 ALA A O    7  
ATOM 8448  C CB   . ALA A 1 51 ? -2.360  -10.361 6.337   1.00 0.00 ? 51 ALA A CB   7  
ATOM 8449  H H    . ALA A 1 51 ? -0.566  -9.261  7.753   1.00 0.00 ? 51 ALA A H    7  
ATOM 8450  H HA   . ALA A 1 51 ? -3.285  -9.012  7.690   1.00 0.00 ? 51 ALA A HA   7  
ATOM 8451  H HB1  . ALA A 1 51 ? -2.995  -9.824  5.647   1.00 0.00 ? 51 ALA A HB1  7  
ATOM 8452  H HB2  . ALA A 1 51 ? -1.326  -10.209 6.069   1.00 0.00 ? 51 ALA A HB2  7  
ATOM 8453  H HB3  . ALA A 1 51 ? -2.593  -11.414 6.295   1.00 0.00 ? 51 ALA A HB3  7  
ATOM 8454  N N    . GLU A 1 52 ? -2.382  -11.632 9.375   1.00 0.00 ? 52 GLU A N    7  
ATOM 8455  C CA   . GLU A 1 52 ? -2.851  -12.704 10.246  1.00 0.00 ? 52 GLU A CA   7  
ATOM 8456  C C    . GLU A 1 52 ? -3.346  -12.145 11.577  1.00 0.00 ? 52 GLU A C    7  
ATOM 8457  O O    . GLU A 1 52 ? -4.238  -12.713 12.208  1.00 0.00 ? 52 GLU A O    7  
ATOM 8458  C CB   . GLU A 1 52 ? -1.733  -13.719 10.490  1.00 0.00 ? 52 GLU A CB   7  
ATOM 8459  C CG   . GLU A 1 52 ? -1.699  -14.845 9.471   1.00 0.00 ? 52 GLU A CG   7  
ATOM 8460  C CD   . GLU A 1 52 ? -2.755  -15.901 9.733   1.00 0.00 ? 52 GLU A CD   7  
ATOM 8461  O OE1  . GLU A 1 52 ? -3.948  -15.620 9.493   1.00 0.00 ? 52 GLU A OE1  7  
ATOM 8462  O OE2  . GLU A 1 52 ? -2.388  -17.009 10.177  1.00 0.00 ? 52 GLU A OE2  7  
ATOM 8463  H H    . GLU A 1 52 ? -1.426  -11.421 9.349   1.00 0.00 ? 52 GLU A H    7  
ATOM 8464  H HA   . GLU A 1 52 ? -3.672  -13.199 9.750   1.00 0.00 ? 52 GLU A HA   7  
ATOM 8465  H HB2  . GLU A 1 52 ? -0.783  -13.205 10.461  1.00 0.00 ? 52 GLU A HB2  7  
ATOM 8466  H HB3  . GLU A 1 52 ? -1.866  -14.153 11.470  1.00 0.00 ? 52 GLU A HB3  7  
ATOM 8467  H HG2  . GLU A 1 52 ? -1.864  -14.429 8.488   1.00 0.00 ? 52 GLU A HG2  7  
ATOM 8468  H HG3  . GLU A 1 52 ? -0.726  -15.314 9.503   1.00 0.00 ? 52 GLU A HG3  7  
ATOM 8469  N N    . SER A 1 53 ? -2.760  -11.029 11.998  1.00 0.00 ? 53 SER A N    7  
ATOM 8470  C CA   . SER A 1 53 ? -3.138  -10.395 13.256  1.00 0.00 ? 53 SER A CA   7  
ATOM 8471  C C    . SER A 1 53 ? -4.545  -9.811  13.169  1.00 0.00 ? 53 SER A C    7  
ATOM 8472  O O    . SER A 1 53 ? -5.356  -9.977  14.082  1.00 0.00 ? 53 SER A O    7  
ATOM 8473  C CB   . SER A 1 53 ? -2.138  -9.294  13.617  1.00 0.00 ? 53 SER A CB   7  
ATOM 8474  O OG   . SER A 1 53 ? -2.383  -8.790  14.919  1.00 0.00 ? 53 SER A OG   7  
ATOM 8475  H H    . SER A 1 53 ? -2.055  -10.623 11.450  1.00 0.00 ? 53 SER A H    7  
ATOM 8476  H HA   . SER A 1 53 ? -3.121  -11.151 14.026  1.00 0.00 ? 53 SER A HA   7  
ATOM 8477  H HB2  . SER A 1 53 ? -1.137  -9.696  13.582  1.00 0.00 ? 53 SER A HB2  7  
ATOM 8478  H HB3  . SER A 1 53 ? -2.227  -8.485  12.907  1.00 0.00 ? 53 SER A HB3  7  
ATOM 8479  H HG   . SER A 1 53 ? -2.651  -9.509  15.495  1.00 0.00 ? 53 SER A HG   7  
ATOM 8480  N N    . LEU A 1 54 ? -4.828  -9.128  12.066  1.00 0.00 ? 54 LEU A N    7  
ATOM 8481  C CA   . LEU A 1 54 ? -6.137  -8.518  11.858  1.00 0.00 ? 54 LEU A CA   7  
ATOM 8482  C C    . LEU A 1 54 ? -7.054  -9.452  11.075  1.00 0.00 ? 54 LEU A C    7  
ATOM 8483  O O    . LEU A 1 54 ? -8.274  -9.409  11.224  1.00 0.00 ? 54 LEU A O    7  
ATOM 8484  C CB   . LEU A 1 54 ? -5.990  -7.188  11.117  1.00 0.00 ? 54 LEU A CB   7  
ATOM 8485  C CG   . LEU A 1 54 ? -4.905  -6.246  11.637  1.00 0.00 ? 54 LEU A CG   7  
ATOM 8486  C CD1  . LEU A 1 54 ? -4.628  -5.142  10.628  1.00 0.00 ? 54 LEU A CD1  7  
ATOM 8487  C CD2  . LEU A 1 54 ? -5.310  -5.654  12.979  1.00 0.00 ? 54 LEU A CD2  7  
ATOM 8488  H H    . LEU A 1 54 ? -4.141  -9.030  11.374  1.00 0.00 ? 54 LEU A H    7  
ATOM 8489  H HA   . LEU A 1 54 ? -6.574  -8.334  12.828  1.00 0.00 ? 54 LEU A HA   7  
ATOM 8490  H HB2  . LEU A 1 54 ? -5.769  -7.409  10.084  1.00 0.00 ? 54 LEU A HB2  7  
ATOM 8491  H HB3  . LEU A 1 54 ? -6.937  -6.670  11.178  1.00 0.00 ? 54 LEU A HB3  7  
ATOM 8492  H HG   . LEU A 1 54 ? -3.990  -6.804  11.779  1.00 0.00 ? 54 LEU A HG   7  
ATOM 8493  H HD11 . LEU A 1 54 ? -5.505  -4.981  10.020  1.00 0.00 ? 54 LEU A HD11 7  
ATOM 8494  H HD12 . LEU A 1 54 ? -3.800  -5.430  9.997   1.00 0.00 ? 54 LEU A HD12 7  
ATOM 8495  H HD13 . LEU A 1 54 ? -4.380  -4.230  11.152  1.00 0.00 ? 54 LEU A HD13 7  
ATOM 8496  H HD21 . LEU A 1 54 ? -6.380  -5.743  13.103  1.00 0.00 ? 54 LEU A HD21 7  
ATOM 8497  H HD22 . LEU A 1 54 ? -5.029  -4.612  13.013  1.00 0.00 ? 54 LEU A HD22 7  
ATOM 8498  H HD23 . LEU A 1 54 ? -4.810  -6.188  13.774  1.00 0.00 ? 54 LEU A HD23 7  
ATOM 8499  N N    . GLY A 1 55 ? -6.457  -10.298 10.241  1.00 0.00 ? 55 GLY A N    7  
ATOM 8500  C CA   . GLY A 1 55 ? -7.235  -11.232 9.448   1.00 0.00 ? 55 GLY A CA   7  
ATOM 8501  C C    . GLY A 1 55 ? -7.482  -10.731 8.039   1.00 0.00 ? 55 GLY A C    7  
ATOM 8502  O O    . GLY A 1 55 ? -8.503  -11.049 7.429   1.00 0.00 ? 55 GLY A O    7  
ATOM 8503  H H    . GLY A 1 55 ? -5.480  -10.287 10.163  1.00 0.00 ? 55 GLY A H    7  
ATOM 8504  H HA2  . GLY A 1 55 ? -6.706  -12.172 9.398   1.00 0.00 ? 55 GLY A HA2  7  
ATOM 8505  H HA3  . GLY A 1 55 ? -8.187  -11.391 9.933   1.00 0.00 ? 55 GLY A HA3  7  
ATOM 8506  N N    . LEU A 1 56 ? -6.546  -9.943  7.520   1.00 0.00 ? 56 LEU A N    7  
ATOM 8507  C CA   . LEU A 1 56 ? -6.667  -9.395  6.174   1.00 0.00 ? 56 LEU A CA   7  
ATOM 8508  C C    . LEU A 1 56 ? -5.903  -10.250 5.167   1.00 0.00 ? 56 LEU A C    7  
ATOM 8509  O O    . LEU A 1 56 ? -5.153  -11.150 5.545   1.00 0.00 ? 56 LEU A O    7  
ATOM 8510  C CB   . LEU A 1 56 ? -6.147  -7.957  6.138   1.00 0.00 ? 56 LEU A CB   7  
ATOM 8511  C CG   . LEU A 1 56 ? -6.764  -6.995  7.153   1.00 0.00 ? 56 LEU A CG   7  
ATOM 8512  C CD1  . LEU A 1 56 ? -5.858  -5.792  7.368   1.00 0.00 ? 56 LEU A CD1  7  
ATOM 8513  C CD2  . LEU A 1 56 ? -8.145  -6.550  6.695   1.00 0.00 ? 56 LEU A CD2  7  
ATOM 8514  H H    . LEU A 1 56 ? -5.754  -9.725  8.054   1.00 0.00 ? 56 LEU A H    7  
ATOM 8515  H HA   . LEU A 1 56 ? -7.714  -9.397  5.908   1.00 0.00 ? 56 LEU A HA   7  
ATOM 8516  H HB2  . LEU A 1 56 ? -5.083  -7.987  6.315   1.00 0.00 ? 56 LEU A HB2  7  
ATOM 8517  H HB3  . LEU A 1 56 ? -6.335  -7.563  5.150   1.00 0.00 ? 56 LEU A HB3  7  
ATOM 8518  H HG   . LEU A 1 56 ? -6.873  -7.503  8.102   1.00 0.00 ? 56 LEU A HG   7  
ATOM 8519  H HD11 . LEU A 1 56 ? -6.461  -4.905  7.490   1.00 0.00 ? 56 LEU A HD11 7  
ATOM 8520  H HD12 . LEU A 1 56 ? -5.211  -5.672  6.512   1.00 0.00 ? 56 LEU A HD12 7  
ATOM 8521  H HD13 . LEU A 1 56 ? -5.259  -5.946  8.253   1.00 0.00 ? 56 LEU A HD13 7  
ATOM 8522  H HD21 . LEU A 1 56 ? -8.196  -6.590  5.617   1.00 0.00 ? 56 LEU A HD21 7  
ATOM 8523  H HD22 . LEU A 1 56 ? -8.325  -5.537  7.026   1.00 0.00 ? 56 LEU A HD22 7  
ATOM 8524  H HD23 . LEU A 1 56 ? -8.893  -7.205  7.116   1.00 0.00 ? 56 LEU A HD23 7  
ATOM 8525  N N    . SER A 1 57 ? -6.099  -9.961  3.885   1.00 0.00 ? 57 SER A N    7  
ATOM 8526  C CA   . SER A 1 57 ? -5.429  -10.703 2.823   1.00 0.00 ? 57 SER A CA   7  
ATOM 8527  C C    . SER A 1 57 ? -4.188  -9.960  2.339   1.00 0.00 ? 57 SER A C    7  
ATOM 8528  O O    . SER A 1 57 ? -4.239  -8.761  2.064   1.00 0.00 ? 57 SER A O    7  
ATOM 8529  C CB   . SER A 1 57 ? -6.387  -10.937 1.653   1.00 0.00 ? 57 SER A CB   7  
ATOM 8530  O OG   . SER A 1 57 ? -7.633  -11.437 2.106   1.00 0.00 ? 57 SER A OG   7  
ATOM 8531  H H    . SER A 1 57 ? -6.709  -9.232  3.647   1.00 0.00 ? 57 SER A H    7  
ATOM 8532  H HA   . SER A 1 57 ? -5.128  -11.659 3.226   1.00 0.00 ? 57 SER A HA   7  
ATOM 8533  H HB2  . SER A 1 57 ? -6.554  -10.004 1.136   1.00 0.00 ? 57 SER A HB2  7  
ATOM 8534  H HB3  . SER A 1 57 ? -5.951  -11.653 0.972   1.00 0.00 ? 57 SER A HB3  7  
ATOM 8535  H HG   . SER A 1 57 ? -7.795  -11.130 3.001   1.00 0.00 ? 57 SER A HG   7  
ATOM 8536  N N    . GLN A 1 58 ? -3.076  -10.680 2.237   1.00 0.00 ? 58 GLN A N    7  
ATOM 8537  C CA   . GLN A 1 58 ? -1.822  -10.089 1.787   1.00 0.00 ? 58 GLN A CA   7  
ATOM 8538  C C    . GLN A 1 58 ? -2.074  -9.006  0.743   1.00 0.00 ? 58 GLN A C    7  
ATOM 8539  O O    . GLN A 1 58 ? -1.345  -8.015  0.672   1.00 0.00 ? 58 GLN A O    7  
ATOM 8540  C CB   . GLN A 1 58 ? -0.904  -11.167 1.209   1.00 0.00 ? 58 GLN A CB   7  
ATOM 8541  C CG   . GLN A 1 58 ? -0.422  -12.174 2.241   1.00 0.00 ? 58 GLN A CG   7  
ATOM 8542  C CD   . GLN A 1 58 ? 0.222   -13.393 1.611   1.00 0.00 ? 58 GLN A CD   7  
ATOM 8543  O OE1  . GLN A 1 58 ? -0.455  -14.368 1.283   1.00 0.00 ? 58 GLN A OE1  7  
ATOM 8544  N NE2  . GLN A 1 58 ? 1.538   -13.344 1.437   1.00 0.00 ? 58 GLN A NE2  7  
ATOM 8545  H H    . GLN A 1 58 ? -3.100  -11.631 2.471   1.00 0.00 ? 58 GLN A H    7  
ATOM 8546  H HA   . GLN A 1 58 ? -1.341  -9.641  2.643   1.00 0.00 ? 58 GLN A HA   7  
ATOM 8547  H HB2  . GLN A 1 58 ? -1.438  -11.702 0.437   1.00 0.00 ? 58 GLN A HB2  7  
ATOM 8548  H HB3  . GLN A 1 58 ? -0.039  -10.690 0.772   1.00 0.00 ? 58 GLN A HB3  7  
ATOM 8549  H HG2  . GLN A 1 58 ? 0.303   -11.694 2.882   1.00 0.00 ? 58 GLN A HG2  7  
ATOM 8550  H HG3  . GLN A 1 58 ? -1.267  -12.496 2.832   1.00 0.00 ? 58 GLN A HG3  7  
ATOM 8551  H HE21 . GLN A 1 58 ? 2.012   -12.535 1.723   1.00 0.00 ? 58 GLN A HE21 7  
ATOM 8552  H HE22 . GLN A 1 58 ? 1.980   -14.118 1.033   1.00 0.00 ? 58 GLN A HE22 7  
ATOM 8553  N N    . LEU A 1 59 ? -3.110  -9.201  -0.065  1.00 0.00 ? 59 LEU A N    7  
ATOM 8554  C CA   . LEU A 1 59 ? -3.459  -8.240  -1.106  1.00 0.00 ? 59 LEU A CA   7  
ATOM 8555  C C    . LEU A 1 59 ? -3.803  -6.883  -0.502  1.00 0.00 ? 59 LEU A C    7  
ATOM 8556  O O    . LEU A 1 59 ? -3.257  -5.857  -0.906  1.00 0.00 ? 59 LEU A O    7  
ATOM 8557  C CB   . LEU A 1 59 ? -4.639  -8.758  -1.931  1.00 0.00 ? 59 LEU A CB   7  
ATOM 8558  C CG   . LEU A 1 59 ? -5.126  -7.842  -3.054  1.00 0.00 ? 59 LEU A CG   7  
ATOM 8559  C CD1  . LEU A 1 59 ? -4.121  -7.815  -4.195  1.00 0.00 ? 59 LEU A CD1  7  
ATOM 8560  C CD2  . LEU A 1 59 ? -6.491  -8.292  -3.555  1.00 0.00 ? 59 LEU A CD2  7  
ATOM 8561  H H    . LEU A 1 59 ? -3.654  -10.009 0.039   1.00 0.00 ? 59 LEU A H    7  
ATOM 8562  H HA   . LEU A 1 59 ? -2.601  -8.126  -1.752  1.00 0.00 ? 59 LEU A HA   7  
ATOM 8563  H HB2  . LEU A 1 59 ? -4.345  -9.697  -2.374  1.00 0.00 ? 59 LEU A HB2  7  
ATOM 8564  H HB3  . LEU A 1 59 ? -5.466  -8.924  -1.255  1.00 0.00 ? 59 LEU A HB3  7  
ATOM 8565  H HG   . LEU A 1 59 ? -5.224  -6.835  -2.672  1.00 0.00 ? 59 LEU A HG   7  
ATOM 8566  H HD11 . LEU A 1 59 ? -4.644  -7.876  -5.137  1.00 0.00 ? 59 LEU A HD11 7  
ATOM 8567  H HD12 . LEU A 1 59 ? -3.447  -8.654  -4.101  1.00 0.00 ? 59 LEU A HD12 7  
ATOM 8568  H HD13 . LEU A 1 59 ? -3.556  -6.895  -4.155  1.00 0.00 ? 59 LEU A HD13 7  
ATOM 8569  H HD21 . LEU A 1 59 ? -6.377  -8.803  -4.499  1.00 0.00 ? 59 LEU A HD21 7  
ATOM 8570  H HD22 . LEU A 1 59 ? -7.128  -7.429  -3.687  1.00 0.00 ? 59 LEU A HD22 7  
ATOM 8571  H HD23 . LEU A 1 59 ? -6.936  -8.961  -2.834  1.00 0.00 ? 59 LEU A HD23 7  
ATOM 8572  N N    . GLN A 1 60 ? -4.711  -6.886  0.469   1.00 0.00 ? 60 GLN A N    7  
ATOM 8573  C CA   . GLN A 1 60 ? -5.126  -5.655  1.130   1.00 0.00 ? 60 GLN A CA   7  
ATOM 8574  C C    . GLN A 1 60 ? -3.929  -4.748  1.394   1.00 0.00 ? 60 GLN A C    7  
ATOM 8575  O O    . GLN A 1 60 ? -3.879  -3.614  0.917   1.00 0.00 ? 60 GLN A O    7  
ATOM 8576  C CB   . GLN A 1 60 ? -5.839  -5.973  2.446   1.00 0.00 ? 60 GLN A CB   7  
ATOM 8577  C CG   . GLN A 1 60 ? -7.183  -6.657  2.259   1.00 0.00 ? 60 GLN A CG   7  
ATOM 8578  C CD   . GLN A 1 60 ? -8.243  -5.722  1.711   1.00 0.00 ? 60 GLN A CD   7  
ATOM 8579  O OE1  . GLN A 1 60 ? -7.962  -4.875  0.863   1.00 0.00 ? 60 GLN A OE1  7  
ATOM 8580  N NE2  . GLN A 1 60 ? -9.472  -5.872  2.193   1.00 0.00 ? 60 GLN A NE2  7  
ATOM 8581  H H    . GLN A 1 60 ? -5.110  -7.736  0.747   1.00 0.00 ? 60 GLN A H    7  
ATOM 8582  H HA   . GLN A 1 60 ? -5.813  -5.142  0.474   1.00 0.00 ? 60 GLN A HA   7  
ATOM 8583  H HB2  . GLN A 1 60 ? -5.208  -6.620  3.036   1.00 0.00 ? 60 GLN A HB2  7  
ATOM 8584  H HB3  . GLN A 1 60 ? -6.001  -5.051  2.985   1.00 0.00 ? 60 GLN A HB3  7  
ATOM 8585  H HG2  . GLN A 1 60 ? -7.061  -7.481  1.571   1.00 0.00 ? 60 GLN A HG2  7  
ATOM 8586  H HG3  . GLN A 1 60 ? -7.516  -7.035  3.215   1.00 0.00 ? 60 GLN A HG3  7  
ATOM 8587  H HE21 . GLN A 1 60 ? -9.622  -6.567  2.868   1.00 0.00 ? 60 GLN A HE21 7  
ATOM 8588  H HE22 . GLN A 1 60 ? -10.176 -5.280  1.858   1.00 0.00 ? 60 GLN A HE22 7  
ATOM 8589  N N    . VAL A 1 61 ? -2.965  -5.254  2.156   1.00 0.00 ? 61 VAL A N    7  
ATOM 8590  C CA   . VAL A 1 61 ? -1.767  -4.490  2.483   1.00 0.00 ? 61 VAL A CA   7  
ATOM 8591  C C    . VAL A 1 61 ? -1.040  -4.042  1.220   1.00 0.00 ? 61 VAL A C    7  
ATOM 8592  O O    . VAL A 1 61 ? -0.801  -2.851  1.017   1.00 0.00 ? 61 VAL A O    7  
ATOM 8593  C CB   . VAL A 1 61 ? -0.798  -5.310  3.355   1.00 0.00 ? 61 VAL A CB   7  
ATOM 8594  C CG1  . VAL A 1 61 ? 0.367   -4.447  3.816   1.00 0.00 ? 61 VAL A CG1  7  
ATOM 8595  C CG2  . VAL A 1 61 ? -1.532  -5.909  4.546   1.00 0.00 ? 61 VAL A CG2  7  
ATOM 8596  H H    . VAL A 1 61 ? -3.062  -6.164  2.507   1.00 0.00 ? 61 VAL A H    7  
ATOM 8597  H HA   . VAL A 1 61 ? -2.070  -3.616  3.041   1.00 0.00 ? 61 VAL A HA   7  
ATOM 8598  H HB   . VAL A 1 61 ? -0.404  -6.119  2.758   1.00 0.00 ? 61 VAL A HB   7  
ATOM 8599  H HG11 . VAL A 1 61 ? 0.450   -3.583  3.173   1.00 0.00 ? 61 VAL A HG11 7  
ATOM 8600  H HG12 . VAL A 1 61 ? 0.197   -4.126  4.833   1.00 0.00 ? 61 VAL A HG12 7  
ATOM 8601  H HG13 . VAL A 1 61 ? 1.280   -5.021  3.766   1.00 0.00 ? 61 VAL A HG13 7  
ATOM 8602  H HG21 . VAL A 1 61 ? -2.194  -6.690  4.203   1.00 0.00 ? 61 VAL A HG21 7  
ATOM 8603  H HG22 . VAL A 1 61 ? -0.815  -6.324  5.240   1.00 0.00 ? 61 VAL A HG22 7  
ATOM 8604  H HG23 . VAL A 1 61 ? -2.107  -5.140  5.040   1.00 0.00 ? 61 VAL A HG23 7  
ATOM 8605  N N    . LYS A 1 62 ? -0.691  -5.003  0.372   1.00 0.00 ? 62 LYS A N    7  
ATOM 8606  C CA   . LYS A 1 62 ? 0.007   -4.709  -0.874  1.00 0.00 ? 62 LYS A CA   7  
ATOM 8607  C C    . LYS A 1 62 ? -0.653  -3.546  -1.606  1.00 0.00 ? 62 LYS A C    7  
ATOM 8608  O O    . LYS A 1 62 ? -0.038  -2.499  -1.815  1.00 0.00 ? 62 LYS A O    7  
ATOM 8609  C CB   . LYS A 1 62 ? 0.030   -5.946  -1.774  1.00 0.00 ? 62 LYS A CB   7  
ATOM 8610  C CG   . LYS A 1 62 ? 1.003   -5.836  -2.935  1.00 0.00 ? 62 LYS A CG   7  
ATOM 8611  C CD   . LYS A 1 62 ? 0.836   -6.986  -3.914  1.00 0.00 ? 62 LYS A CD   7  
ATOM 8612  C CE   . LYS A 1 62 ? -0.417  -6.820  -4.761  1.00 0.00 ? 62 LYS A CE   7  
ATOM 8613  N NZ   . LYS A 1 62 ? -0.811  -8.093  -5.425  1.00 0.00 ? 62 LYS A NZ   7  
ATOM 8614  H H    . LYS A 1 62 ? -0.910  -5.934  0.589   1.00 0.00 ? 62 LYS A H    7  
ATOM 8615  H HA   . LYS A 1 62 ? 1.022   -4.435  -0.628  1.00 0.00 ? 62 LYS A HA   7  
ATOM 8616  H HB2  . LYS A 1 62 ? 0.306   -6.804  -1.180  1.00 0.00 ? 62 LYS A HB2  7  
ATOM 8617  H HB3  . LYS A 1 62 ? -0.961  -6.102  -2.177  1.00 0.00 ? 62 LYS A HB3  7  
ATOM 8618  H HG2  . LYS A 1 62 ? 0.825   -4.906  -3.455  1.00 0.00 ? 62 LYS A HG2  7  
ATOM 8619  H HG3  . LYS A 1 62 ? 2.012   -5.848  -2.549  1.00 0.00 ? 62 LYS A HG3  7  
ATOM 8620  H HD2  . LYS A 1 62 ? 1.696   -7.020  -4.566  1.00 0.00 ? 62 LYS A HD2  7  
ATOM 8621  H HD3  . LYS A 1 62 ? 0.765   -7.912  -3.360  1.00 0.00 ? 62 LYS A HD3  7  
ATOM 8622  H HE2  . LYS A 1 62 ? -1.224  -6.490  -4.126  1.00 0.00 ? 62 LYS A HE2  7  
ATOM 8623  H HE3  . LYS A 1 62 ? -0.226  -6.073  -5.518  1.00 0.00 ? 62 LYS A HE3  7  
ATOM 8624  H HZ1  . LYS A 1 62 ? -1.580  -7.919  -6.103  1.00 0.00 ? 62 LYS A HZ1  7  
ATOM 8625  H HZ2  . LYS A 1 62 ? -1.138  -8.779  -4.715  1.00 0.00 ? 62 LYS A HZ2  7  
ATOM 8626  H HZ3  . LYS A 1 62 ? 0.001   -8.497  -5.934  1.00 0.00 ? 62 LYS A HZ3  7  
ATOM 8627  N N    . THR A 1 63 ? -1.911  -3.734  -1.995  1.00 0.00 ? 63 THR A N    7  
ATOM 8628  C CA   . THR A 1 63 ? -2.655  -2.701  -2.704  1.00 0.00 ? 63 THR A CA   7  
ATOM 8629  C C    . THR A 1 63 ? -2.870  -1.475  -1.822  1.00 0.00 ? 63 THR A C    7  
ATOM 8630  O O    . THR A 1 63 ? -2.387  -0.386  -2.130  1.00 0.00 ? 63 THR A O    7  
ATOM 8631  C CB   . THR A 1 63 ? -4.023  -3.221  -3.182  1.00 0.00 ? 63 THR A CB   7  
ATOM 8632  O OG1  . THR A 1 63 ? -3.843  -4.336  -4.062  1.00 0.00 ? 63 THR A OG1  7  
ATOM 8633  C CG2  . THR A 1 63 ? -4.800  -2.126  -3.896  1.00 0.00 ? 63 THR A CG2  7  
ATOM 8634  H H    . THR A 1 63 ? -2.347  -4.590  -1.800  1.00 0.00 ? 63 THR A H    7  
ATOM 8635  H HA   . THR A 1 63 ? -2.080  -2.411  -3.571  1.00 0.00 ? 63 THR A HA   7  
ATOM 8636  H HB   . THR A 1 63 ? -4.591  -3.541  -2.319  1.00 0.00 ? 63 THR A HB   7  
ATOM 8637  H HG1  . THR A 1 63 ? -3.257  -4.977  -3.651  1.00 0.00 ? 63 THR A HG1  7  
ATOM 8638  H HG21 . THR A 1 63 ? -5.859  -2.325  -3.818  1.00 0.00 ? 63 THR A HG21 7  
ATOM 8639  H HG22 . THR A 1 63 ? -4.514  -2.102  -4.937  1.00 0.00 ? 63 THR A HG22 7  
ATOM 8640  H HG23 . THR A 1 63 ? -4.579  -1.173  -3.439  1.00 0.00 ? 63 THR A HG23 7  
ATOM 8641  N N    . TRP A 1 64 ? -3.595  -1.662  -0.726  1.00 0.00 ? 64 TRP A N    7  
ATOM 8642  C CA   . TRP A 1 64 ? -3.873  -0.570  0.201   1.00 0.00 ? 64 TRP A CA   7  
ATOM 8643  C C    . TRP A 1 64 ? -2.663  0.346   0.342   1.00 0.00 ? 64 TRP A C    7  
ATOM 8644  O O    . TRP A 1 64 ? -2.785  1.568   0.258   1.00 0.00 ? 64 TRP A O    7  
ATOM 8645  C CB   . TRP A 1 64 ? -4.270  -1.125  1.570   1.00 0.00 ? 64 TRP A CB   7  
ATOM 8646  C CG   . TRP A 1 64 ? -4.745  -0.070  2.524   1.00 0.00 ? 64 TRP A CG   7  
ATOM 8647  C CD1  . TRP A 1 64 ? -6.036  0.317   2.741   1.00 0.00 ? 64 TRP A CD1  7  
ATOM 8648  C CD2  . TRP A 1 64 ? -3.932  0.733   3.386   1.00 0.00 ? 64 TRP A CD2  7  
ATOM 8649  N NE1  . TRP A 1 64 ? -6.075  1.312   3.687   1.00 0.00 ? 64 TRP A NE1  7  
ATOM 8650  C CE2  . TRP A 1 64 ? -4.798  1.585   4.099   1.00 0.00 ? 64 TRP A CE2  7  
ATOM 8651  C CE3  . TRP A 1 64 ? -2.558  0.814   3.627   1.00 0.00 ? 64 TRP A CE3  7  
ATOM 8652  C CZ2  . TRP A 1 64 ? -4.332  2.506   5.034   1.00 0.00 ? 64 TRP A CZ2  7  
ATOM 8653  C CZ3  . TRP A 1 64 ? -2.097  1.729   4.555   1.00 0.00 ? 64 TRP A CZ3  7  
ATOM 8654  C CH2  . TRP A 1 64 ? -2.982  2.564   5.250   1.00 0.00 ? 64 TRP A CH2  7  
ATOM 8655  H H    . TRP A 1 64 ? -3.953  -2.554  -0.534  1.00 0.00 ? 64 TRP A H    7  
ATOM 8656  H HA   . TRP A 1 64 ? -4.698  0.001   -0.199  1.00 0.00 ? 64 TRP A HA   7  
ATOM 8657  H HB2  . TRP A 1 64 ? -5.067  -1.843  1.444   1.00 0.00 ? 64 TRP A HB2  7  
ATOM 8658  H HB3  . TRP A 1 64 ? -3.416  -1.616  2.013   1.00 0.00 ? 64 TRP A HB3  7  
ATOM 8659  H HD1  . TRP A 1 64 ? -6.891  -0.106  2.235   1.00 0.00 ? 64 TRP A HD1  7  
ATOM 8660  H HE1  . TRP A 1 64 ? -6.887  1.754   4.015   1.00 0.00 ? 64 TRP A HE1  7  
ATOM 8661  H HE3  . TRP A 1 64 ? -1.860  0.179   3.102   1.00 0.00 ? 64 TRP A HE3  7  
ATOM 8662  H HZ2  . TRP A 1 64 ? -5.001  3.156   5.578   1.00 0.00 ? 64 TRP A HZ2  7  
ATOM 8663  H HZ3  . TRP A 1 64 ? -1.039  1.806   4.754   1.00 0.00 ? 64 TRP A HZ3  7  
ATOM 8664  H HH2  . TRP A 1 64 ? -2.578  3.263   5.965   1.00 0.00 ? 64 TRP A HH2  7  
ATOM 8665  N N    . TYR A 1 65 ? -1.496  -0.251  0.555   1.00 0.00 ? 65 TYR A N    7  
ATOM 8666  C CA   . TYR A 1 65 ? -0.263  0.512   0.710   1.00 0.00 ? 65 TYR A CA   7  
ATOM 8667  C C    . TYR A 1 65 ? 0.002   1.373   -0.522  1.00 0.00 ? 65 TYR A C    7  
ATOM 8668  O O    . TYR A 1 65 ? 0.042   2.600   -0.437  1.00 0.00 ? 65 TYR A O    7  
ATOM 8669  C CB   . TYR A 1 65 ? 0.918   -0.429  0.952   1.00 0.00 ? 65 TYR A CB   7  
ATOM 8670  C CG   . TYR A 1 65 ? 1.178   -0.710  2.415   1.00 0.00 ? 65 TYR A CG   7  
ATOM 8671  C CD1  . TYR A 1 65 ? 0.187   -1.250  3.226   1.00 0.00 ? 65 TYR A CD1  7  
ATOM 8672  C CD2  . TYR A 1 65 ? 2.415   -0.436  2.986   1.00 0.00 ? 65 TYR A CD2  7  
ATOM 8673  C CE1  . TYR A 1 65 ? 0.421   -1.507  4.563   1.00 0.00 ? 65 TYR A CE1  7  
ATOM 8674  C CE2  . TYR A 1 65 ? 2.657   -0.691  4.322   1.00 0.00 ? 65 TYR A CE2  7  
ATOM 8675  C CZ   . TYR A 1 65 ? 1.657   -1.226  5.106   1.00 0.00 ? 65 TYR A CZ   7  
ATOM 8676  O OH   . TYR A 1 65 ? 1.894   -1.482  6.437   1.00 0.00 ? 65 TYR A OH   7  
ATOM 8677  H H    . TYR A 1 65 ? -1.462  -1.229  0.613   1.00 0.00 ? 65 TYR A H    7  
ATOM 8678  H HA   . TYR A 1 65 ? -0.379  1.158   1.568   1.00 0.00 ? 65 TYR A HA   7  
ATOM 8679  H HB2  . TYR A 1 65 ? 0.724   -1.372  0.464   1.00 0.00 ? 65 TYR A HB2  7  
ATOM 8680  H HB3  . TYR A 1 65 ? 1.811   0.011   0.535   1.00 0.00 ? 65 TYR A HB3  7  
ATOM 8681  H HD1  . TYR A 1 65 ? -0.780  -1.469  2.797   1.00 0.00 ? 65 TYR A HD1  7  
ATOM 8682  H HD2  . TYR A 1 65 ? 3.196   -0.016  2.369   1.00 0.00 ? 65 TYR A HD2  7  
ATOM 8683  H HE1  . TYR A 1 65 ? -0.362  -1.926  5.178   1.00 0.00 ? 65 TYR A HE1  7  
ATOM 8684  H HE2  . TYR A 1 65 ? 3.625   -0.471  4.748   1.00 0.00 ? 65 TYR A HE2  7  
ATOM 8685  H HH   . TYR A 1 65 ? 1.636   -2.385  6.640   1.00 0.00 ? 65 TYR A HH   7  
ATOM 8686  N N    . GLN A 1 66 ? 0.183   0.719   -1.665  1.00 0.00 ? 66 GLN A N    7  
ATOM 8687  C CA   . GLN A 1 66 ? 0.445   1.423   -2.914  1.00 0.00 ? 66 GLN A CA   7  
ATOM 8688  C C    . GLN A 1 66 ? -0.497  2.611   -3.077  1.00 0.00 ? 66 GLN A C    7  
ATOM 8689  O O    . GLN A 1 66 ? -0.055  3.747   -3.248  1.00 0.00 ? 66 GLN A O    7  
ATOM 8690  C CB   . GLN A 1 66 ? 0.294   0.471   -4.102  1.00 0.00 ? 66 GLN A CB   7  
ATOM 8691  C CG   . GLN A 1 66 ? 1.340   -0.632  -4.134  1.00 0.00 ? 66 GLN A CG   7  
ATOM 8692  C CD   . GLN A 1 66 ? 1.659   -1.093  -5.543  1.00 0.00 ? 66 GLN A CD   7  
ATOM 8693  O OE1  . GLN A 1 66 ? 2.434   -0.456  -6.256  1.00 0.00 ? 66 GLN A OE1  7  
ATOM 8694  N NE2  . GLN A 1 66 ? 1.061   -2.206  -5.951  1.00 0.00 ? 66 GLN A NE2  7  
ATOM 8695  H H    . GLN A 1 66 ? 0.140   -0.260  -1.667  1.00 0.00 ? 66 GLN A H    7  
ATOM 8696  H HA   . GLN A 1 66 ? 1.461   1.787   -2.883  1.00 0.00 ? 66 GLN A HA   7  
ATOM 8697  H HB2  . GLN A 1 66 ? -0.682  0.012   -4.058  1.00 0.00 ? 66 GLN A HB2  7  
ATOM 8698  H HB3  . GLN A 1 66 ? 0.375   1.040   -5.016  1.00 0.00 ? 66 GLN A HB3  7  
ATOM 8699  H HG2  . GLN A 1 66 ? 2.247   -0.264  -3.679  1.00 0.00 ? 66 GLN A HG2  7  
ATOM 8700  H HG3  . GLN A 1 66 ? 0.972   -1.475  -3.569  1.00 0.00 ? 66 GLN A HG3  7  
ATOM 8701  H HE21 . GLN A 1 66 ? 0.455   -2.660  -5.328  1.00 0.00 ? 66 GLN A HE21 7  
ATOM 8702  H HE22 . GLN A 1 66 ? 1.248   -2.526  -6.857  1.00 0.00 ? 66 GLN A HE22 7  
ATOM 8703  N N    . ASN A 1 67 ? -1.797  2.341   -3.022  1.00 0.00 ? 67 ASN A N    7  
ATOM 8704  C CA   . ASN A 1 67 ? -2.802  3.389   -3.165  1.00 0.00 ? 67 ASN A CA   7  
ATOM 8705  C C    . ASN A 1 67 ? -2.528  4.540   -2.202  1.00 0.00 ? 67 ASN A C    7  
ATOM 8706  O O    . ASN A 1 67 ? -2.604  5.709   -2.579  1.00 0.00 ? 67 ASN A O    7  
ATOM 8707  C CB   . ASN A 1 67 ? -4.200  2.821   -2.914  1.00 0.00 ? 67 ASN A CB   7  
ATOM 8708  C CG   . ASN A 1 67 ? -4.510  1.632   -3.804  1.00 0.00 ? 67 ASN A CG   7  
ATOM 8709  O OD1  . ASN A 1 67 ? -3.718  1.271   -4.674  1.00 0.00 ? 67 ASN A OD1  7  
ATOM 8710  N ND2  . ASN A 1 67 ? -5.668  1.018   -3.588  1.00 0.00 ? 67 ASN A ND2  7  
ATOM 8711  H H    . ASN A 1 67 ? -2.088  1.416   -2.884  1.00 0.00 ? 67 ASN A H    7  
ATOM 8712  H HA   . ASN A 1 67 ? -2.751  3.761   -4.177  1.00 0.00 ? 67 ASN A HA   7  
ATOM 8713  H HB2  . ASN A 1 67 ? -4.273  2.503   -1.884  1.00 0.00 ? 67 ASN A HB2  7  
ATOM 8714  H HB3  . ASN A 1 67 ? -4.934  3.589   -3.101  1.00 0.00 ? 67 ASN A HB3  7  
ATOM 8715  H HD21 . ASN A 1 67 ? -6.249  1.361   -2.878  1.00 0.00 ? 67 ASN A HD21 7  
ATOM 8716  H HD22 . ASN A 1 67 ? -5.893  0.247   -4.149  1.00 0.00 ? 67 ASN A HD22 7  
ATOM 8717  N N    . ARG A 1 68 ? -2.208  4.200   -0.958  1.00 0.00 ? 68 ARG A N    7  
ATOM 8718  C CA   . ARG A 1 68 ? -1.924  5.205   0.060   1.00 0.00 ? 68 ARG A CA   7  
ATOM 8719  C C    . ARG A 1 68 ? -0.754  6.090   -0.363  1.00 0.00 ? 68 ARG A C    7  
ATOM 8720  O O    . ARG A 1 68 ? -0.822  7.315   -0.260  1.00 0.00 ? 68 ARG A O    7  
ATOM 8721  C CB   . ARG A 1 68 ? -1.611  4.532   1.398   1.00 0.00 ? 68 ARG A CB   7  
ATOM 8722  C CG   . ARG A 1 68 ? -2.846  4.042   2.136   1.00 0.00 ? 68 ARG A CG   7  
ATOM 8723  C CD   . ARG A 1 68 ? -3.654  5.200   2.700   1.00 0.00 ? 68 ARG A CD   7  
ATOM 8724  N NE   . ARG A 1 68 ? -2.892  5.978   3.672   1.00 0.00 ? 68 ARG A NE   7  
ATOM 8725  C CZ   . ARG A 1 68 ? -3.421  6.937   4.424   1.00 0.00 ? 68 ARG A CZ   7  
ATOM 8726  N NH1  . ARG A 1 68 ? -4.709  7.233   4.316   1.00 0.00 ? 68 ARG A NH1  7  
ATOM 8727  N NH2  . ARG A 1 68 ? -2.662  7.601   5.286   1.00 0.00 ? 68 ARG A NH2  7  
ATOM 8728  H H    . ARG A 1 68 ? -2.164  3.251   -0.717  1.00 0.00 ? 68 ARG A H    7  
ATOM 8729  H HA   . ARG A 1 68 ? -2.803  5.821   0.173   1.00 0.00 ? 68 ARG A HA   7  
ATOM 8730  H HB2  . ARG A 1 68 ? -0.965  3.685   1.219   1.00 0.00 ? 68 ARG A HB2  7  
ATOM 8731  H HB3  . ARG A 1 68 ? -1.097  5.240   2.031   1.00 0.00 ? 68 ARG A HB3  7  
ATOM 8732  H HG2  . ARG A 1 68 ? -3.466  3.484   1.450   1.00 0.00 ? 68 ARG A HG2  7  
ATOM 8733  H HG3  . ARG A 1 68 ? -2.537  3.400   2.948   1.00 0.00 ? 68 ARG A HG3  7  
ATOM 8734  H HD2  . ARG A 1 68 ? -3.948  5.846   1.886   1.00 0.00 ? 68 ARG A HD2  7  
ATOM 8735  H HD3  . ARG A 1 68 ? -4.536  4.804   3.181   1.00 0.00 ? 68 ARG A HD3  7  
ATOM 8736  H HE   . ARG A 1 68 ? -1.938  5.776   3.767   1.00 0.00 ? 68 ARG A HE   7  
ATOM 8737  H HH11 . ARG A 1 68 ? -5.283  6.733   3.668   1.00 0.00 ? 68 ARG A HH11 7  
ATOM 8738  H HH12 . ARG A 1 68 ? -5.105  7.954   4.884   1.00 0.00 ? 68 ARG A HH12 7  
ATOM 8739  H HH21 . ARG A 1 68 ? -1.690  7.380   5.370   1.00 0.00 ? 68 ARG A HH21 7  
ATOM 8740  H HH22 . ARG A 1 68 ? -3.061  8.322   5.851   1.00 0.00 ? 68 ARG A HH22 7  
ATOM 8741  N N    . ARG A 1 69 ? 0.316   5.461   -0.837  1.00 0.00 ? 69 ARG A N    7  
ATOM 8742  C CA   . ARG A 1 69 ? 1.500   6.190   -1.273  1.00 0.00 ? 69 ARG A CA   7  
ATOM 8743  C C    . ARG A 1 69 ? 1.118   7.353   -2.183  1.00 0.00 ? 69 ARG A C    7  
ATOM 8744  O O    . ARG A 1 69 ? 1.717   8.427   -2.120  1.00 0.00 ? 69 ARG A O    7  
ATOM 8745  C CB   . ARG A 1 69 ? 2.464   5.253   -2.003  1.00 0.00 ? 69 ARG A CB   7  
ATOM 8746  C CG   . ARG A 1 69 ? 3.233   4.327   -1.075  1.00 0.00 ? 69 ARG A CG   7  
ATOM 8747  C CD   . ARG A 1 69 ? 4.267   3.511   -1.834  1.00 0.00 ? 69 ARG A CD   7  
ATOM 8748  N NE   . ARG A 1 69 ? 5.210   4.359   -2.558  1.00 0.00 ? 69 ARG A NE   7  
ATOM 8749  C CZ   . ARG A 1 69 ? 4.980   4.842   -3.774  1.00 0.00 ? 69 ARG A CZ   7  
ATOM 8750  N NH1  . ARG A 1 69 ? 3.845   4.560   -4.399  1.00 0.00 ? 69 ARG A NH1  7  
ATOM 8751  N NH2  . ARG A 1 69 ? 5.887   5.607   -4.368  1.00 0.00 ? 69 ARG A NH2  7  
ATOM 8752  H H    . ARG A 1 69 ? 0.310   4.482   -0.894  1.00 0.00 ? 69 ARG A H    7  
ATOM 8753  H HA   . ARG A 1 69 ? 1.991   6.583   -0.394  1.00 0.00 ? 69 ARG A HA   7  
ATOM 8754  H HB2  . ARG A 1 69 ? 1.900   4.645   -2.696  1.00 0.00 ? 69 ARG A HB2  7  
ATOM 8755  H HB3  . ARG A 1 69 ? 3.176   5.847   -2.555  1.00 0.00 ? 69 ARG A HB3  7  
ATOM 8756  H HG2  . ARG A 1 69 ? 3.737   4.920   -0.326  1.00 0.00 ? 69 ARG A HG2  7  
ATOM 8757  H HG3  . ARG A 1 69 ? 2.537   3.654   -0.595  1.00 0.00 ? 69 ARG A HG3  7  
ATOM 8758  H HD2  . ARG A 1 69 ? 4.814   2.902   -1.129  1.00 0.00 ? 69 ARG A HD2  7  
ATOM 8759  H HD3  . ARG A 1 69 ? 3.756   2.873   -2.539  1.00 0.00 ? 69 ARG A HD3  7  
ATOM 8760  H HE   . ARG A 1 69 ? 6.055   4.580   -2.115  1.00 0.00 ? 69 ARG A HE   7  
ATOM 8761  H HH11 . ARG A 1 69 ? 3.160   3.984   -3.954  1.00 0.00 ? 69 ARG A HH11 7  
ATOM 8762  H HH12 . ARG A 1 69 ? 3.674   4.926   -5.315  1.00 0.00 ? 69 ARG A HH12 7  
ATOM 8763  H HH21 . ARG A 1 69 ? 6.744   5.822   -3.900  1.00 0.00 ? 69 ARG A HH21 7  
ATOM 8764  H HH22 . ARG A 1 69 ? 5.713   5.969   -5.283  1.00 0.00 ? 69 ARG A HH22 7  
ATOM 8765  N N    . MET A 1 70 ? 0.117   7.132   -3.029  1.00 0.00 ? 70 MET A N    7  
ATOM 8766  C CA   . MET A 1 70 ? -0.345  8.161   -3.952  1.00 0.00 ? 70 MET A CA   7  
ATOM 8767  C C    . MET A 1 70 ? -0.703  9.442   -3.204  1.00 0.00 ? 70 MET A C    7  
ATOM 8768  O O    . MET A 1 70 ? -0.136  10.503  -3.462  1.00 0.00 ? 70 MET A O    7  
ATOM 8769  C CB   . MET A 1 70 ? -1.558  7.663   -4.741  1.00 0.00 ? 70 MET A CB   7  
ATOM 8770  C CG   . MET A 1 70 ? -1.297  6.376   -5.506  1.00 0.00 ? 70 MET A CG   7  
ATOM 8771  S SD   . MET A 1 70 ? -2.797  5.680   -6.226  1.00 0.00 ? 70 MET A SD   7  
ATOM 8772  C CE   . MET A 1 70 ? -2.132  4.252   -7.079  1.00 0.00 ? 70 MET A CE   7  
ATOM 8773  H H    . MET A 1 70 ? -0.321  6.255   -3.033  1.00 0.00 ? 70 MET A H    7  
ATOM 8774  H HA   . MET A 1 70 ? 0.458   8.374   -4.641  1.00 0.00 ? 70 MET A HA   7  
ATOM 8775  H HB2  . MET A 1 70 ? -2.372  7.489   -4.054  1.00 0.00 ? 70 MET A HB2  7  
ATOM 8776  H HB3  . MET A 1 70 ? -1.850  8.424   -5.449  1.00 0.00 ? 70 MET A HB3  7  
ATOM 8777  H HG2  . MET A 1 70 ? -0.596  6.581   -6.301  1.00 0.00 ? 70 MET A HG2  7  
ATOM 8778  H HG3  . MET A 1 70 ? -0.869  5.651   -4.829  1.00 0.00 ? 70 MET A HG3  7  
ATOM 8779  H HE1  . MET A 1 70 ? -1.532  4.579   -7.915  1.00 0.00 ? 70 MET A HE1  7  
ATOM 8780  H HE2  . MET A 1 70 ? -1.519  3.680   -6.398  1.00 0.00 ? 70 MET A HE2  7  
ATOM 8781  H HE3  . MET A 1 70 ? -2.945  3.636   -7.437  1.00 0.00 ? 70 MET A HE3  7  
ATOM 8782  N N    . LYS A 1 71 ? -1.646  9.335   -2.274  1.00 0.00 ? 71 LYS A N    7  
ATOM 8783  C CA   . LYS A 1 71 ? -2.079  10.483  -1.487  1.00 0.00 ? 71 LYS A CA   7  
ATOM 8784  C C    . LYS A 1 71 ? -0.958  10.972  -0.576  1.00 0.00 ? 71 LYS A C    7  
ATOM 8785  O O    . LYS A 1 71 ? -0.745  12.175  -0.429  1.00 0.00 ? 71 LYS A O    7  
ATOM 8786  C CB   . LYS A 1 71 ? -3.308  10.120  -0.651  1.00 0.00 ? 71 LYS A CB   7  
ATOM 8787  C CG   . LYS A 1 71 ? -3.985  11.320  -0.012  1.00 0.00 ? 71 LYS A CG   7  
ATOM 8788  C CD   . LYS A 1 71 ? -3.408  11.620  1.361   1.00 0.00 ? 71 LYS A CD   7  
ATOM 8789  C CE   . LYS A 1 71 ? -4.006  12.888  1.952   1.00 0.00 ? 71 LYS A CE   7  
ATOM 8790  N NZ   . LYS A 1 71 ? -3.351  14.113  1.414   1.00 0.00 ? 71 LYS A NZ   7  
ATOM 8791  H H    . LYS A 1 71 ? -2.062  8.461   -2.114  1.00 0.00 ? 71 LYS A H    7  
ATOM 8792  H HA   . LYS A 1 71 ? -2.342  11.275  -2.172  1.00 0.00 ? 71 LYS A HA   7  
ATOM 8793  H HB2  . LYS A 1 71 ? -4.027  9.623   -1.286  1.00 0.00 ? 71 LYS A HB2  7  
ATOM 8794  H HB3  . LYS A 1 71 ? -3.006  9.442   0.135   1.00 0.00 ? 71 LYS A HB3  7  
ATOM 8795  H HG2  . LYS A 1 71 ? -3.844  12.182  -0.646  1.00 0.00 ? 71 LYS A HG2  7  
ATOM 8796  H HG3  . LYS A 1 71 ? -5.042  11.114  0.089   1.00 0.00 ? 71 LYS A HG3  7  
ATOM 8797  H HD2  . LYS A 1 71 ? -3.622  10.794  2.022   1.00 0.00 ? 71 LYS A HD2  7  
ATOM 8798  H HD3  . LYS A 1 71 ? -2.338  11.745  1.272   1.00 0.00 ? 71 LYS A HD3  7  
ATOM 8799  H HE2  . LYS A 1 71 ? -5.058  12.919  1.714   1.00 0.00 ? 71 LYS A HE2  7  
ATOM 8800  H HE3  . LYS A 1 71 ? -3.879  12.864  3.024   1.00 0.00 ? 71 LYS A HE3  7  
ATOM 8801  H HZ1  . LYS A 1 71 ? -2.370  13.902  1.140   1.00 0.00 ? 71 LYS A HZ1  7  
ATOM 8802  H HZ2  . LYS A 1 71 ? -3.344  14.861  2.136   1.00 0.00 ? 71 LYS A HZ2  7  
ATOM 8803  H HZ3  . LYS A 1 71 ? -3.867  14.457  0.579   1.00 0.00 ? 71 LYS A HZ3  7  
ATOM 8804  N N    . TRP A 1 72 ? -0.243  10.032  0.032   1.00 0.00 ? 72 TRP A N    7  
ATOM 8805  C CA   . TRP A 1 72 ? 0.857   10.368  0.927   1.00 0.00 ? 72 TRP A CA   7  
ATOM 8806  C C    . TRP A 1 72 ? 1.850   11.302  0.244   1.00 0.00 ? 72 TRP A C    7  
ATOM 8807  O O    . TRP A 1 72 ? 2.335   12.259  0.848   1.00 0.00 ? 72 TRP A O    7  
ATOM 8808  C CB   . TRP A 1 72 ? 1.571   9.097   1.391   1.00 0.00 ? 72 TRP A CB   7  
ATOM 8809  C CG   . TRP A 1 72 ? 2.926   9.357   1.978   1.00 0.00 ? 72 TRP A CG   7  
ATOM 8810  C CD1  . TRP A 1 72 ? 3.199   9.878   3.210   1.00 0.00 ? 72 TRP A CD1  7  
ATOM 8811  C CD2  . TRP A 1 72 ? 4.191   9.108   1.355   1.00 0.00 ? 72 TRP A CD2  7  
ATOM 8812  N NE1  . TRP A 1 72 ? 4.558   9.969   3.391   1.00 0.00 ? 72 TRP A NE1  7  
ATOM 8813  C CE2  . TRP A 1 72 ? 5.189   9.502   2.268   1.00 0.00 ? 72 TRP A CE2  7  
ATOM 8814  C CE3  . TRP A 1 72 ? 4.578   8.589   0.117   1.00 0.00 ? 72 TRP A CE3  7  
ATOM 8815  C CZ2  . TRP A 1 72 ? 6.546   9.394   1.979   1.00 0.00 ? 72 TRP A CZ2  7  
ATOM 8816  C CZ3  . TRP A 1 72 ? 5.926   8.483   -0.169  1.00 0.00 ? 72 TRP A CZ3  7  
ATOM 8817  C CH2  . TRP A 1 72 ? 6.897   8.883   0.759   1.00 0.00 ? 72 TRP A CH2  7  
ATOM 8818  H H    . TRP A 1 72 ? -0.461  9.089   -0.125  1.00 0.00 ? 72 TRP A H    7  
ATOM 8819  H HA   . TRP A 1 72 ? 0.442   10.871  1.788   1.00 0.00 ? 72 TRP A HA   7  
ATOM 8820  H HB2  . TRP A 1 72 ? 0.970   8.608   2.143   1.00 0.00 ? 72 TRP A HB2  7  
ATOM 8821  H HB3  . TRP A 1 72 ? 1.694   8.434   0.547   1.00 0.00 ? 72 TRP A HB3  7  
ATOM 8822  H HD1  . TRP A 1 72 ? 2.447   10.173  3.925   1.00 0.00 ? 72 TRP A HD1  7  
ATOM 8823  H HE1  . TRP A 1 72 ? 5.003   10.311  4.195   1.00 0.00 ? 72 TRP A HE1  7  
ATOM 8824  H HE3  . TRP A 1 72 ? 3.845   8.276   -0.611  1.00 0.00 ? 72 TRP A HE3  7  
ATOM 8825  H HZ2  . TRP A 1 72 ? 7.307   9.698   2.684   1.00 0.00 ? 72 TRP A HZ2  7  
ATOM 8826  H HZ3  . TRP A 1 72 ? 6.245   8.085   -1.121  1.00 0.00 ? 72 TRP A HZ3  7  
ATOM 8827  H HH2  . TRP A 1 72 ? 7.938   8.782   0.494   1.00 0.00 ? 72 TRP A HH2  7  
ATOM 8828  N N    . LYS A 1 73 ? 2.147   11.020  -1.020  1.00 0.00 ? 73 LYS A N    7  
ATOM 8829  C CA   . LYS A 1 73 ? 3.081   11.835  -1.787  1.00 0.00 ? 73 LYS A CA   7  
ATOM 8830  C C    . LYS A 1 73 ? 2.837   13.321  -1.539  1.00 0.00 ? 73 LYS A C    7  
ATOM 8831  O O    . LYS A 1 73 ? 1.743   13.830  -1.780  1.00 0.00 ? 73 LYS A O    7  
ATOM 8832  C CB   . LYS A 1 73 ? 2.949   11.529  -3.281  1.00 0.00 ? 73 LYS A CB   7  
ATOM 8833  C CG   . LYS A 1 73 ? 3.701   10.283  -3.715  1.00 0.00 ? 73 LYS A CG   7  
ATOM 8834  C CD   . LYS A 1 73 ? 5.174   10.573  -3.949  1.00 0.00 ? 73 LYS A CD   7  
ATOM 8835  C CE   . LYS A 1 73 ? 5.842   9.463   -4.745  1.00 0.00 ? 73 LYS A CE   7  
ATOM 8836  N NZ   . LYS A 1 73 ? 7.324   9.494   -4.606  1.00 0.00 ? 73 LYS A NZ   7  
ATOM 8837  H H    . LYS A 1 73 ? 1.728   10.243  -1.448  1.00 0.00 ? 73 LYS A H    7  
ATOM 8838  H HA   . LYS A 1 73 ? 4.081   11.588  -1.465  1.00 0.00 ? 73 LYS A HA   7  
ATOM 8839  H HB2  . LYS A 1 73 ? 1.904   11.395  -3.518  1.00 0.00 ? 73 LYS A HB2  7  
ATOM 8840  H HB3  . LYS A 1 73 ? 3.331   12.369  -3.843  1.00 0.00 ? 73 LYS A HB3  7  
ATOM 8841  H HG2  . LYS A 1 73 ? 3.611   9.532   -2.944  1.00 0.00 ? 73 LYS A HG2  7  
ATOM 8842  H HG3  . LYS A 1 73 ? 3.266   9.913   -4.633  1.00 0.00 ? 73 LYS A HG3  7  
ATOM 8843  H HD2  . LYS A 1 73 ? 5.267   11.499  -4.497  1.00 0.00 ? 73 LYS A HD2  7  
ATOM 8844  H HD3  . LYS A 1 73 ? 5.669   10.667  -2.993  1.00 0.00 ? 73 LYS A HD3  7  
ATOM 8845  H HE2  . LYS A 1 73 ? 5.476   8.512   -4.388  1.00 0.00 ? 73 LYS A HE2  7  
ATOM 8846  H HE3  . LYS A 1 73 ? 5.584   9.580   -5.787  1.00 0.00 ? 73 LYS A HE3  7  
ATOM 8847  H HZ1  . LYS A 1 73 ? 7.705   10.359  -5.040  1.00 0.00 ? 73 LYS A HZ1  7  
ATOM 8848  H HZ2  . LYS A 1 73 ? 7.745   8.669   -5.077  1.00 0.00 ? 73 LYS A HZ2  7  
ATOM 8849  H HZ3  . LYS A 1 73 ? 7.589   9.479   -3.600  1.00 0.00 ? 73 LYS A HZ3  7  
ATOM 8850  N N    . LYS A 1 74 ? 3.864   14.011  -1.056  1.00 0.00 ? 74 LYS A N    7  
ATOM 8851  C CA   . LYS A 1 74 ? 3.764   15.439  -0.776  1.00 0.00 ? 74 LYS A CA   7  
ATOM 8852  C C    . LYS A 1 74 ? 4.298   16.260  -1.945  1.00 0.00 ? 74 LYS A C    7  
ATOM 8853  O O    . LYS A 1 74 ? 5.509   16.358  -2.145  1.00 0.00 ? 74 LYS A O    7  
ATOM 8854  C CB   . LYS A 1 74 ? 4.534   15.785  0.500   1.00 0.00 ? 74 LYS A CB   7  
ATOM 8855  C CG   . LYS A 1 74 ? 3.958   16.970  1.255   1.00 0.00 ? 74 LYS A CG   7  
ATOM 8856  C CD   . LYS A 1 74 ? 4.506   18.286  0.731   1.00 0.00 ? 74 LYS A CD   7  
ATOM 8857  C CE   . LYS A 1 74 ? 5.855   18.616  1.353   1.00 0.00 ? 74 LYS A CE   7  
ATOM 8858  N NZ   . LYS A 1 74 ? 5.707   19.254  2.691   1.00 0.00 ? 74 LYS A NZ   7  
ATOM 8859  H H    . LYS A 1 74 ? 4.712   13.549  -0.883  1.00 0.00 ? 74 LYS A H    7  
ATOM 8860  H HA   . LYS A 1 74 ? 2.721   15.676  -0.633  1.00 0.00 ? 74 LYS A HA   7  
ATOM 8861  H HB2  . LYS A 1 74 ? 4.525   14.927  1.156   1.00 0.00 ? 74 LYS A HB2  7  
ATOM 8862  H HB3  . LYS A 1 74 ? 5.557   16.016  0.237   1.00 0.00 ? 74 LYS A HB3  7  
ATOM 8863  H HG2  . LYS A 1 74 ? 2.884   16.969  1.142   1.00 0.00 ? 74 LYS A HG2  7  
ATOM 8864  H HG3  . LYS A 1 74 ? 4.211   16.876  2.302   1.00 0.00 ? 74 LYS A HG3  7  
ATOM 8865  H HD2  . LYS A 1 74 ? 4.624   18.216  -0.340  1.00 0.00 ? 74 LYS A HD2  7  
ATOM 8866  H HD3  . LYS A 1 74 ? 3.808   19.077  0.967   1.00 0.00 ? 74 LYS A HD3  7  
ATOM 8867  H HE2  . LYS A 1 74 ? 6.420   17.702  1.460   1.00 0.00 ? 74 LYS A HE2  7  
ATOM 8868  H HE3  . LYS A 1 74 ? 6.384   19.291  0.697   1.00 0.00 ? 74 LYS A HE3  7  
ATOM 8869  H HZ1  . LYS A 1 74 ? 4.913   18.823  3.206   1.00 0.00 ? 74 LYS A HZ1  7  
ATOM 8870  H HZ2  . LYS A 1 74 ? 5.524   20.272  2.582   1.00 0.00 ? 74 LYS A HZ2  7  
ATOM 8871  H HZ3  . LYS A 1 74 ? 6.578   19.126  3.246   1.00 0.00 ? 74 LYS A HZ3  7  
ATOM 8872  N N    . SER A 1 75 ? 3.388   16.851  -2.713  1.00 0.00 ? 75 SER A N    7  
ATOM 8873  C CA   . SER A 1 75 ? 3.769   17.663  -3.862  1.00 0.00 ? 75 SER A CA   7  
ATOM 8874  C C    . SER A 1 75 ? 3.441   19.134  -3.622  1.00 0.00 ? 75 SER A C    7  
ATOM 8875  O O    . SER A 1 75 ? 2.384   19.619  -4.022  1.00 0.00 ? 75 SER A O    7  
ATOM 8876  C CB   . SER A 1 75 ? 3.053   17.169  -5.121  1.00 0.00 ? 75 SER A CB   7  
ATOM 8877  O OG   . SER A 1 75 ? 3.833   17.412  -6.280  1.00 0.00 ? 75 SER A OG   7  
ATOM 8878  H H    . SER A 1 75 ? 2.438   16.736  -2.502  1.00 0.00 ? 75 SER A H    7  
ATOM 8879  H HA   . SER A 1 75 ? 4.835   17.562  -4.001  1.00 0.00 ? 75 SER A HA   7  
ATOM 8880  H HB2  . SER A 1 75 ? 2.876   16.108  -5.038  1.00 0.00 ? 75 SER A HB2  7  
ATOM 8881  H HB3  . SER A 1 75 ? 2.110   17.686  -5.222  1.00 0.00 ? 75 SER A HB3  7  
ATOM 8882  H HG   . SER A 1 75 ? 3.377   17.069  -7.051  1.00 0.00 ? 75 SER A HG   7  
ATOM 8883  N N    . GLY A 1 76 ? 4.357   19.838  -2.963  1.00 0.00 ? 76 GLY A N    7  
ATOM 8884  C CA   . GLY A 1 76 ? 4.148   21.245  -2.680  1.00 0.00 ? 76 GLY A CA   7  
ATOM 8885  C C    . GLY A 1 76 ? 4.952   22.147  -3.595  1.00 0.00 ? 76 GLY A C    7  
ATOM 8886  O O    . GLY A 1 76 ? 4.452   22.650  -4.602  1.00 0.00 ? 76 GLY A O    7  
ATOM 8887  H H    . GLY A 1 76 ? 5.182   19.397  -2.668  1.00 0.00 ? 76 GLY A H    7  
ATOM 8888  H HA2  . GLY A 1 76 ? 3.099   21.473  -2.797  1.00 0.00 ? 76 GLY A HA2  7  
ATOM 8889  H HA3  . GLY A 1 76 ? 4.437   21.441  -1.657  1.00 0.00 ? 76 GLY A HA3  7  
ATOM 8890  N N    . PRO A 1 77 ? 6.229   22.364  -3.247  1.00 0.00 ? 77 PRO A N    7  
ATOM 8891  C CA   . PRO A 1 77 ? 7.130   23.213  -4.032  1.00 0.00 ? 77 PRO A CA   7  
ATOM 8892  C C    . PRO A 1 77 ? 7.500   22.584  -5.370  1.00 0.00 ? 77 PRO A C    7  
ATOM 8893  O O    . PRO A 1 77 ? 8.240   23.171  -6.159  1.00 0.00 ? 77 PRO A O    7  
ATOM 8894  C CB   . PRO A 1 77 ? 8.367   23.337  -3.139  1.00 0.00 ? 77 PRO A CB   7  
ATOM 8895  C CG   . PRO A 1 77 ? 8.343   22.116  -2.287  1.00 0.00 ? 77 PRO A CG   7  
ATOM 8896  C CD   . PRO A 1 77 ? 6.891   21.797  -2.060  1.00 0.00 ? 77 PRO A CD   7  
ATOM 8897  H HA   . PRO A 1 77 ? 6.706   24.193  -4.200  1.00 0.00 ? 77 PRO A HA   7  
ATOM 8898  H HB2  . PRO A 1 77 ? 9.256   23.374  -3.754  1.00 0.00 ? 77 PRO A HB2  7  
ATOM 8899  H HB3  . PRO A 1 77 ? 8.298   24.235  -2.544  1.00 0.00 ? 77 PRO A HB3  7  
ATOM 8900  H HG2  . PRO A 1 77 ? 8.831   21.300  -2.799  1.00 0.00 ? 77 PRO A HG2  7  
ATOM 8901  H HG3  . PRO A 1 77 ? 8.834   22.316  -1.345  1.00 0.00 ? 77 PRO A HG3  7  
ATOM 8902  H HD2  . PRO A 1 77 ? 6.743   20.729  -2.010  1.00 0.00 ? 77 PRO A HD2  7  
ATOM 8903  H HD3  . PRO A 1 77 ? 6.537   22.272  -1.158  1.00 0.00 ? 77 PRO A HD3  7  
ATOM 8904  N N    . SER A 1 78 ? 6.979   21.387  -5.621  1.00 0.00 ? 78 SER A N    7  
ATOM 8905  C CA   . SER A 1 78 ? 7.258   20.677  -6.864  1.00 0.00 ? 78 SER A CA   7  
ATOM 8906  C C    . SER A 1 78 ? 8.752   20.685  -7.170  1.00 0.00 ? 78 SER A C    7  
ATOM 8907  O O    . SER A 1 78 ? 9.163   20.916  -8.308  1.00 0.00 ? 78 SER A O    7  
ATOM 8908  C CB   . SER A 1 78 ? 6.485   21.310  -8.022  1.00 0.00 ? 78 SER A CB   7  
ATOM 8909  O OG   . SER A 1 78 ? 6.806   22.684  -8.159  1.00 0.00 ? 78 SER A OG   7  
ATOM 8910  H H    . SER A 1 78 ? 6.396   20.971  -4.952  1.00 0.00 ? 78 SER A H    7  
ATOM 8911  H HA   . SER A 1 78 ? 6.933   19.655  -6.741  1.00 0.00 ? 78 SER A HA   7  
ATOM 8912  H HB2  . SER A 1 78 ? 6.735   20.801  -8.940  1.00 0.00 ? 78 SER A HB2  7  
ATOM 8913  H HB3  . SER A 1 78 ? 5.424   21.218  -7.836  1.00 0.00 ? 78 SER A HB3  7  
ATOM 8914  H HG   . SER A 1 78 ? 6.203   23.209  -7.628  1.00 0.00 ? 78 SER A HG   7  
ATOM 8915  N N    . SER A 1 79 ? 9.562   20.431  -6.147  1.00 0.00 ? 79 SER A N    7  
ATOM 8916  C CA   . SER A 1 79 ? 11.011  20.413  -6.305  1.00 0.00 ? 79 SER A CA   7  
ATOM 8917  C C    . SER A 1 79 ? 11.521  18.985  -6.473  1.00 0.00 ? 79 SER A C    7  
ATOM 8918  O O    . SER A 1 79 ? 11.303  18.131  -5.615  1.00 0.00 ? 79 SER A O    7  
ATOM 8919  C CB   . SER A 1 79 ? 11.685  21.068  -5.098  1.00 0.00 ? 79 SER A CB   7  
ATOM 8920  O OG   . SER A 1 79 ? 13.083  21.187  -5.297  1.00 0.00 ? 79 SER A OG   7  
ATOM 8921  H H    . SER A 1 79 ? 9.174   20.255  -5.264  1.00 0.00 ? 79 SER A H    7  
ATOM 8922  H HA   . SER A 1 79 ? 11.255  20.976  -7.193  1.00 0.00 ? 79 SER A HA   7  
ATOM 8923  H HB2  . SER A 1 79 ? 11.270  22.053  -4.949  1.00 0.00 ? 79 SER A HB2  7  
ATOM 8924  H HB3  . SER A 1 79 ? 11.509  20.466  -4.219  1.00 0.00 ? 79 SER A HB3  7  
ATOM 8925  H HG   . SER A 1 79 ? 13.492  21.532  -4.500  1.00 0.00 ? 79 SER A HG   7  
ATOM 8926  N N    . GLY A 1 80 ? 12.202  18.733  -7.587  1.00 0.00 ? 80 GLY A N    7  
ATOM 8927  C CA   . GLY A 1 80 ? 12.733  17.408  -7.848  1.00 0.00 ? 80 GLY A CA   7  
ATOM 8928  C C    . GLY A 1 80 ? 11.915  16.648  -8.873  1.00 0.00 ? 80 GLY A C    7  
ATOM 8929  O O    . GLY A 1 80 ? 12.467  15.954  -9.727  1.00 0.00 ? 80 GLY A O    7  
ATOM 8930  H H    . GLY A 1 80 ? 12.346  19.453  -8.236  1.00 0.00 ? 80 GLY A H    7  
ATOM 8931  H HA2  . GLY A 1 80 ? 13.746  17.503  -8.210  1.00 0.00 ? 80 GLY A HA2  7  
ATOM 8932  H HA3  . GLY A 1 80 ? 12.742  16.848  -6.925  1.00 0.00 ? 80 GLY A HA3  7  
ATOM 8933  N N    . GLY A 1 1  ? 6.012   50.949  7.448   1.00 0.00 ? 1  GLY A N    8  
ATOM 8934  C CA   . GLY A 1 1  ? 5.668   49.565  7.181   1.00 0.00 ? 1  GLY A CA   8  
ATOM 8935  C C    . GLY A 1 1  ? 4.698   49.421  6.025   1.00 0.00 ? 1  GLY A C    8  
ATOM 8936  O O    . GLY A 1 1  ? 3.695   50.131  5.955   1.00 0.00 ? 1  GLY A O    8  
ATOM 8937  H H1   . GLY A 1 1  ? 5.304   51.622  7.527   1.00 0.00 ? 1  GLY A H1   8  
ATOM 8938  H HA2  . GLY A 1 1  ? 6.570   49.018  6.951   1.00 0.00 ? 1  GLY A HA2  8  
ATOM 8939  H HA3  . GLY A 1 1  ? 5.218   49.140  8.067   1.00 0.00 ? 1  GLY A HA3  8  
ATOM 8940  N N    . SER A 1 2  ? 4.998   48.500  5.115   1.00 0.00 ? 2  SER A N    8  
ATOM 8941  C CA   . SER A 1 2  ? 4.148   48.269  3.952   1.00 0.00 ? 2  SER A CA   8  
ATOM 8942  C C    . SER A 1 2  ? 2.855   47.566  4.356   1.00 0.00 ? 2  SER A C    8  
ATOM 8943  O O    . SER A 1 2  ? 1.760   48.089  4.150   1.00 0.00 ? 2  SER A O    8  
ATOM 8944  C CB   . SER A 1 2  ? 4.891   47.434  2.908   1.00 0.00 ? 2  SER A CB   8  
ATOM 8945  O OG   . SER A 1 2  ? 5.651   48.260  2.042   1.00 0.00 ? 2  SER A OG   8  
ATOM 8946  H H    . SER A 1 2  ? 5.811   47.965  5.226   1.00 0.00 ? 2  SER A H    8  
ATOM 8947  H HA   . SER A 1 2  ? 3.902   49.230  3.525   1.00 0.00 ? 2  SER A HA   8  
ATOM 8948  H HB2  . SER A 1 2  ? 5.558   46.748  3.408   1.00 0.00 ? 2  SER A HB2  8  
ATOM 8949  H HB3  . SER A 1 2  ? 4.175   46.878  2.320   1.00 0.00 ? 2  SER A HB3  8  
ATOM 8950  H HG   . SER A 1 2  ? 5.695   47.856  1.172   1.00 0.00 ? 2  SER A HG   8  
ATOM 8951  N N    . SER A 1 3  ? 2.991   46.376  4.932   1.00 0.00 ? 3  SER A N    8  
ATOM 8952  C CA   . SER A 1 3  ? 1.835   45.597  5.361   1.00 0.00 ? 3  SER A CA   8  
ATOM 8953  C C    . SER A 1 3  ? 0.855   45.400  4.209   1.00 0.00 ? 3  SER A C    8  
ATOM 8954  O O    . SER A 1 3  ? -0.356  45.540  4.378   1.00 0.00 ? 3  SER A O    8  
ATOM 8955  C CB   . SER A 1 3  ? 1.133   46.290  6.530   1.00 0.00 ? 3  SER A CB   8  
ATOM 8956  O OG   . SER A 1 3  ? 0.314   45.381  7.245   1.00 0.00 ? 3  SER A OG   8  
ATOM 8957  H H    . SER A 1 3  ? 3.891   46.011  5.068   1.00 0.00 ? 3  SER A H    8  
ATOM 8958  H HA   . SER A 1 3  ? 2.189   44.630  5.686   1.00 0.00 ? 3  SER A HA   8  
ATOM 8959  H HB2  . SER A 1 3  ? 1.874   46.694  7.204   1.00 0.00 ? 3  SER A HB2  8  
ATOM 8960  H HB3  . SER A 1 3  ? 0.516   47.092  6.152   1.00 0.00 ? 3  SER A HB3  8  
ATOM 8961  H HG   . SER A 1 3  ? -0.605  45.527  7.011   1.00 0.00 ? 3  SER A HG   8  
ATOM 8962  N N    . GLY A 1 4  ? 1.388   45.075  3.035   1.00 0.00 ? 4  GLY A N    8  
ATOM 8963  C CA   . GLY A 1 4  ? 0.547   44.864  1.871   1.00 0.00 ? 4  GLY A CA   8  
ATOM 8964  C C    . GLY A 1 4  ? 0.439   43.400  1.491   1.00 0.00 ? 4  GLY A C    8  
ATOM 8965  O O    . GLY A 1 4  ? -0.646  42.913  1.174   1.00 0.00 ? 4  GLY A O    8  
ATOM 8966  H H    . GLY A 1 4  ? 2.360   44.977  2.959   1.00 0.00 ? 4  GLY A H    8  
ATOM 8967  H HA2  . GLY A 1 4  ? -0.442  45.244  2.081   1.00 0.00 ? 4  GLY A HA2  8  
ATOM 8968  H HA3  . GLY A 1 4  ? 0.963   45.410  1.037   1.00 0.00 ? 4  GLY A HA3  8  
ATOM 8969  N N    . SER A 1 5  ? 1.567   42.698  1.521   1.00 0.00 ? 5  SER A N    8  
ATOM 8970  C CA   . SER A 1 5  ? 1.596   41.283  1.172   1.00 0.00 ? 5  SER A CA   8  
ATOM 8971  C C    . SER A 1 5  ? 0.514   40.515  1.925   1.00 0.00 ? 5  SER A C    8  
ATOM 8972  O O    . SER A 1 5  ? 0.197   40.831  3.072   1.00 0.00 ? 5  SER A O    8  
ATOM 8973  C CB   . SER A 1 5  ? 2.970   40.687  1.483   1.00 0.00 ? 5  SER A CB   8  
ATOM 8974  O OG   . SER A 1 5  ? 3.107   39.396  0.914   1.00 0.00 ? 5  SER A OG   8  
ATOM 8975  H H    . SER A 1 5  ? 2.400   43.144  1.782   1.00 0.00 ? 5  SER A H    8  
ATOM 8976  H HA   . SER A 1 5  ? 1.409   41.199  0.112   1.00 0.00 ? 5  SER A HA   8  
ATOM 8977  H HB2  . SER A 1 5  ? 3.738   41.328  1.079   1.00 0.00 ? 5  SER A HB2  8  
ATOM 8978  H HB3  . SER A 1 5  ? 3.092   40.610  2.554   1.00 0.00 ? 5  SER A HB3  8  
ATOM 8979  H HG   . SER A 1 5  ? 2.757   39.401  0.020   1.00 0.00 ? 5  SER A HG   8  
ATOM 8980  N N    . SER A 1 6  ? -0.050  39.504  1.271   1.00 0.00 ? 6  SER A N    8  
ATOM 8981  C CA   . SER A 1 6  ? -1.099  38.693  1.876   1.00 0.00 ? 6  SER A CA   8  
ATOM 8982  C C    . SER A 1 6  ? -1.385  37.455  1.031   1.00 0.00 ? 6  SER A C    8  
ATOM 8983  O O    . SER A 1 6  ? -0.922  37.344  -0.103  1.00 0.00 ? 6  SER A O    8  
ATOM 8984  C CB   . SER A 1 6  ? -2.378  39.516  2.043   1.00 0.00 ? 6  SER A CB   8  
ATOM 8985  O OG   . SER A 1 6  ? -2.774  40.098  0.813   1.00 0.00 ? 6  SER A OG   8  
ATOM 8986  H H    . SER A 1 6  ? 0.246   39.301  0.359   1.00 0.00 ? 6  SER A H    8  
ATOM 8987  H HA   . SER A 1 6  ? -0.755  38.378  2.850   1.00 0.00 ? 6  SER A HA   8  
ATOM 8988  H HB2  . SER A 1 6  ? -3.172  38.877  2.397   1.00 0.00 ? 6  SER A HB2  8  
ATOM 8989  H HB3  . SER A 1 6  ? -2.203  40.305  2.761   1.00 0.00 ? 6  SER A HB3  8  
ATOM 8990  H HG   . SER A 1 6  ? -2.513  39.524  0.089   1.00 0.00 ? 6  SER A HG   8  
ATOM 8991  N N    . GLY A 1 7  ? -2.152  36.526  1.593   1.00 0.00 ? 7  GLY A N    8  
ATOM 8992  C CA   . GLY A 1 7  ? -2.486  35.308  0.878   1.00 0.00 ? 7  GLY A CA   8  
ATOM 8993  C C    . GLY A 1 7  ? -3.524  34.475  1.605   1.00 0.00 ? 7  GLY A C    8  
ATOM 8994  O O    . GLY A 1 7  ? -3.924  34.805  2.721   1.00 0.00 ? 7  GLY A O    8  
ATOM 8995  H H    . GLY A 1 7  ? -2.493  36.669  2.501   1.00 0.00 ? 7  GLY A H    8  
ATOM 8996  H HA2  . GLY A 1 7  ? -2.869  35.570  -0.097  1.00 0.00 ? 7  GLY A HA2  8  
ATOM 8997  H HA3  . GLY A 1 7  ? -1.590  34.718  0.756   1.00 0.00 ? 7  GLY A HA3  8  
ATOM 8998  N N    . GLY A 1 8  ? -3.962  33.392  0.971   1.00 0.00 ? 8  GLY A N    8  
ATOM 8999  C CA   . GLY A 1 8  ? -4.956  32.528  1.578   1.00 0.00 ? 8  GLY A CA   8  
ATOM 9000  C C    . GLY A 1 8  ? -6.260  32.511  0.805   1.00 0.00 ? 8  GLY A C    8  
ATOM 9001  O O    . GLY A 1 8  ? -7.305  32.892  1.331   1.00 0.00 ? 8  GLY A O    8  
ATOM 9002  H H    . GLY A 1 8  ? -3.607  33.179  0.082   1.00 0.00 ? 8  GLY A H    8  
ATOM 9003  H HA2  . GLY A 1 8  ? -4.564  31.523  1.624   1.00 0.00 ? 8  GLY A HA2  8  
ATOM 9004  H HA3  . GLY A 1 8  ? -5.152  32.874  2.583   1.00 0.00 ? 8  GLY A HA3  8  
ATOM 9005  N N    . GLU A 1 9  ? -6.198  32.070  -0.447  1.00 0.00 ? 9  GLU A N    8  
ATOM 9006  C CA   . GLU A 1 9  ? -7.384  32.009  -1.294  1.00 0.00 ? 9  GLU A CA   8  
ATOM 9007  C C    . GLU A 1 9  ? -8.401  31.019  -0.734  1.00 0.00 ? 9  GLU A C    8  
ATOM 9008  O O    . GLU A 1 9  ? -8.052  29.973  -0.187  1.00 0.00 ? 9  GLU A O    8  
ATOM 9009  C CB   . GLU A 1 9  ? -6.999  31.609  -2.720  1.00 0.00 ? 9  GLU A CB   8  
ATOM 9010  C CG   . GLU A 1 9  ? -6.201  32.673  -3.456  1.00 0.00 ? 9  GLU A CG   8  
ATOM 9011  C CD   . GLU A 1 9  ? -7.048  33.868  -3.850  1.00 0.00 ? 9  GLU A CD   8  
ATOM 9012  O OE1  . GLU A 1 9  ? -7.765  33.776  -4.869  1.00 0.00 ? 9  GLU A OE1  8  
ATOM 9013  O OE2  . GLU A 1 9  ? -6.994  34.894  -3.140  1.00 0.00 ? 9  GLU A OE2  8  
ATOM 9014  H H    . GLU A 1 9  ? -5.335  31.780  -0.810  1.00 0.00 ? 9  GLU A H    8  
ATOM 9015  H HA   . GLU A 1 9  ? -7.829  32.992  -1.314  1.00 0.00 ? 9  GLU A HA   8  
ATOM 9016  H HB2  . GLU A 1 9  ? -6.406  30.707  -2.681  1.00 0.00 ? 9  GLU A HB2  8  
ATOM 9017  H HB3  . GLU A 1 9  ? -7.900  31.412  -3.281  1.00 0.00 ? 9  GLU A HB3  8  
ATOM 9018  H HG2  . GLU A 1 9  ? -5.402  33.013  -2.815  1.00 0.00 ? 9  GLU A HG2  8  
ATOM 9019  H HG3  . GLU A 1 9  ? -5.783  32.236  -4.351  1.00 0.00 ? 9  GLU A HG3  8  
ATOM 9020  N N    . PRO A 1 10 ? -9.692  31.356  -0.874  1.00 0.00 ? 10 PRO A N    8  
ATOM 9021  C CA   . PRO A 1 10 ? -10.788 30.511  -0.388  1.00 0.00 ? 10 PRO A CA   8  
ATOM 9022  C C    . PRO A 1 10 ? -10.934 29.228  -1.200  1.00 0.00 ? 10 PRO A C    8  
ATOM 9023  O O    . PRO A 1 10 ? -10.231 29.025  -2.189  1.00 0.00 ? 10 PRO A O    8  
ATOM 9024  C CB   . PRO A 1 10 ? -12.023 31.398  -0.563  1.00 0.00 ? 10 PRO A CB   8  
ATOM 9025  C CG   . PRO A 1 10 ? -11.659 32.344  -1.654  1.00 0.00 ? 10 PRO A CG   8  
ATOM 9026  C CD   . PRO A 1 10 ? -10.182 32.587  -1.516  1.00 0.00 ? 10 PRO A CD   8  
ATOM 9027  H HA   . PRO A 1 10 ? -10.665 30.263  0.656   1.00 0.00 ? 10 PRO A HA   8  
ATOM 9028  H HB2  . PRO A 1 10 ? -12.872 30.787  -0.836  1.00 0.00 ? 10 PRO A HB2  8  
ATOM 9029  H HB3  . PRO A 1 10 ? -12.230 31.919  0.360   1.00 0.00 ? 10 PRO A HB3  8  
ATOM 9030  H HG2  . PRO A 1 10 ? -11.878 31.901  -2.613  1.00 0.00 ? 10 PRO A HG2  8  
ATOM 9031  H HG3  . PRO A 1 10 ? -12.203 33.269  -1.534  1.00 0.00 ? 10 PRO A HG3  8  
ATOM 9032  H HD2  . PRO A 1 10 ? -9.729  32.722  -2.487  1.00 0.00 ? 10 PRO A HD2  8  
ATOM 9033  H HD3  . PRO A 1 10 ? -9.998  33.447  -0.889  1.00 0.00 ? 10 PRO A HD3  8  
ATOM 9034  N N    . GLY A 1 11 ? -11.852 28.366  -0.775  1.00 0.00 ? 11 GLY A N    8  
ATOM 9035  C CA   . GLY A 1 11 ? -12.074 27.114  -1.475  1.00 0.00 ? 11 GLY A CA   8  
ATOM 9036  C C    . GLY A 1 11 ? -12.768 27.309  -2.808  1.00 0.00 ? 11 GLY A C    8  
ATOM 9037  O O    . GLY A 1 11 ? -13.710 28.095  -2.917  1.00 0.00 ? 11 GLY A O    8  
ATOM 9038  H H    . GLY A 1 11 ? -12.383 28.582  0.020   1.00 0.00 ? 11 GLY A H    8  
ATOM 9039  H HA2  . GLY A 1 11 ? -11.121 26.635  -1.644  1.00 0.00 ? 11 GLY A HA2  8  
ATOM 9040  H HA3  . GLY A 1 11 ? -12.683 26.472  -0.855  1.00 0.00 ? 11 GLY A HA3  8  
ATOM 9041  N N    . THR A 1 12 ? -12.302 26.594  -3.827  1.00 0.00 ? 12 THR A N    8  
ATOM 9042  C CA   . THR A 1 12 ? -12.882 26.694  -5.160  1.00 0.00 ? 12 THR A CA   8  
ATOM 9043  C C    . THR A 1 12 ? -13.471 25.360  -5.605  1.00 0.00 ? 12 THR A C    8  
ATOM 9044  O O    . THR A 1 12 ? -14.606 25.298  -6.078  1.00 0.00 ? 12 THR A O    8  
ATOM 9045  C CB   . THR A 1 12 ? -11.837 27.152  -6.194  1.00 0.00 ? 12 THR A CB   8  
ATOM 9046  O OG1  . THR A 1 12 ? -11.128 28.295  -5.702  1.00 0.00 ? 12 THR A OG1  8  
ATOM 9047  C CG2  . THR A 1 12 ? -12.501 27.493  -7.520  1.00 0.00 ? 12 THR A CG2  8  
ATOM 9048  H H    . THR A 1 12 ? -11.549 25.985  -3.677  1.00 0.00 ? 12 THR A H    8  
ATOM 9049  H HA   . THR A 1 12 ? -13.671 27.432  -5.125  1.00 0.00 ? 12 THR A HA   8  
ATOM 9050  H HB   . THR A 1 12 ? -11.136 26.346  -6.357  1.00 0.00 ? 12 THR A HB   8  
ATOM 9051  H HG1  . THR A 1 12 ? -10.446 28.544  -6.331  1.00 0.00 ? 12 THR A HG1  8  
ATOM 9052  H HG21 . THR A 1 12 ? -12.830 28.522  -7.504  1.00 0.00 ? 12 THR A HG21 8  
ATOM 9053  H HG22 . THR A 1 12 ? -13.351 26.846  -7.674  1.00 0.00 ? 12 THR A HG22 8  
ATOM 9054  H HG23 . THR A 1 12 ? -11.793 27.355  -8.323  1.00 0.00 ? 12 THR A HG23 8  
ATOM 9055  N N    . LYS A 1 13 ? -12.692 24.295  -5.451  1.00 0.00 ? 13 LYS A N    8  
ATOM 9056  C CA   . LYS A 1 13 ? -13.137 22.960  -5.835  1.00 0.00 ? 13 LYS A CA   8  
ATOM 9057  C C    . LYS A 1 13 ? -13.344 22.081  -4.606  1.00 0.00 ? 13 LYS A C    8  
ATOM 9058  O O    . LYS A 1 13 ? -14.460 21.644  -4.325  1.00 0.00 ? 13 LYS A O    8  
ATOM 9059  C CB   . LYS A 1 13 ? -12.117 22.311  -6.773  1.00 0.00 ? 13 LYS A CB   8  
ATOM 9060  C CG   . LYS A 1 13 ? -11.997 23.008  -8.118  1.00 0.00 ? 13 LYS A CG   8  
ATOM 9061  C CD   . LYS A 1 13 ? -11.208 22.172  -9.111  1.00 0.00 ? 13 LYS A CD   8  
ATOM 9062  C CE   . LYS A 1 13 ? -12.073 21.090  -9.739  1.00 0.00 ? 13 LYS A CE   8  
ATOM 9063  N NZ   . LYS A 1 13 ? -11.305 20.256  -10.705 1.00 0.00 ? 13 LYS A NZ   8  
ATOM 9064  H H    . LYS A 1 13 ? -11.797 24.408  -5.068  1.00 0.00 ? 13 LYS A H    8  
ATOM 9065  H HA   . LYS A 1 13 ? -14.078 23.060  -6.354  1.00 0.00 ? 13 LYS A HA   8  
ATOM 9066  H HB2  . LYS A 1 13 ? -11.148 22.324  -6.297  1.00 0.00 ? 13 LYS A HB2  8  
ATOM 9067  H HB3  . LYS A 1 13 ? -12.408 21.285  -6.948  1.00 0.00 ? 13 LYS A HB3  8  
ATOM 9068  H HG2  . LYS A 1 13 ? -12.987 23.179  -8.514  1.00 0.00 ? 13 LYS A HG2  8  
ATOM 9069  H HG3  . LYS A 1 13 ? -11.494 23.955  -7.978  1.00 0.00 ? 13 LYS A HG3  8  
ATOM 9070  H HD2  . LYS A 1 13 ? -10.833 22.815  -9.893  1.00 0.00 ? 13 LYS A HD2  8  
ATOM 9071  H HD3  . LYS A 1 13 ? -10.380 21.705  -8.598  1.00 0.00 ? 13 LYS A HD3  8  
ATOM 9072  H HE2  . LYS A 1 13 ? -12.459 20.455  -8.956  1.00 0.00 ? 13 LYS A HE2  8  
ATOM 9073  H HE3  . LYS A 1 13 ? -12.895 21.561  -10.258 1.00 0.00 ? 13 LYS A HE3  8  
ATOM 9074  H HZ1  . LYS A 1 13 ? -10.725 19.560  -10.193 1.00 0.00 ? 13 LYS A HZ1  8  
ATOM 9075  H HZ2  . LYS A 1 13 ? -10.679 20.858  -11.277 1.00 0.00 ? 13 LYS A HZ2  8  
ATOM 9076  H HZ3  . LYS A 1 13 ? -11.956 19.750  -11.338 1.00 0.00 ? 13 LYS A HZ3  8  
ATOM 9077  N N    . ALA A 1 14 ? -12.263 21.827  -3.877  1.00 0.00 ? 14 ALA A N    8  
ATOM 9078  C CA   . ALA A 1 14 ? -12.328 21.003  -2.676  1.00 0.00 ? 14 ALA A CA   8  
ATOM 9079  C C    . ALA A 1 14 ? -13.023 21.744  -1.539  1.00 0.00 ? 14 ALA A C    8  
ATOM 9080  O O    . ALA A 1 14 ? -12.386 22.469  -0.775  1.00 0.00 ? 14 ALA A O    8  
ATOM 9081  C CB   . ALA A 1 14 ? -10.930 20.575  -2.253  1.00 0.00 ? 14 ALA A CB   8  
ATOM 9082  H H    . ALA A 1 14 ? -11.401 22.204  -4.152  1.00 0.00 ? 14 ALA A H    8  
ATOM 9083  H HA   . ALA A 1 14 ? -12.894 20.113  -2.912  1.00 0.00 ? 14 ALA A HA   8  
ATOM 9084  H HB1  . ALA A 1 14 ? -10.564 21.248  -1.491  1.00 0.00 ? 14 ALA A HB1  8  
ATOM 9085  H HB2  . ALA A 1 14 ? -10.965 19.570  -1.860  1.00 0.00 ? 14 ALA A HB2  8  
ATOM 9086  H HB3  . ALA A 1 14 ? -10.271 20.606  -3.107  1.00 0.00 ? 14 ALA A HB3  8  
ATOM 9087  N N    . LYS A 1 15 ? -14.334 21.557  -1.432  1.00 0.00 ? 15 LYS A N    8  
ATOM 9088  C CA   . LYS A 1 15 ? -15.118 22.206  -0.388  1.00 0.00 ? 15 LYS A CA   8  
ATOM 9089  C C    . LYS A 1 15 ? -15.913 21.181  0.414   1.00 0.00 ? 15 LYS A C    8  
ATOM 9090  O O    . LYS A 1 15 ? -15.948 21.230  1.644   1.00 0.00 ? 15 LYS A O    8  
ATOM 9091  C CB   . LYS A 1 15 ? -16.068 23.237  -1.001  1.00 0.00 ? 15 LYS A CB   8  
ATOM 9092  C CG   . LYS A 1 15 ? -17.119 22.629  -1.913  1.00 0.00 ? 15 LYS A CG   8  
ATOM 9093  C CD   . LYS A 1 15 ? -18.068 23.686  -2.453  1.00 0.00 ? 15 LYS A CD   8  
ATOM 9094  C CE   . LYS A 1 15 ? -17.409 24.526  -3.535  1.00 0.00 ? 15 LYS A CE   8  
ATOM 9095  N NZ   . LYS A 1 15 ? -17.216 23.756  -4.795  1.00 0.00 ? 15 LYS A NZ   8  
ATOM 9096  H H    . LYS A 1 15 ? -14.786 20.966  -2.071  1.00 0.00 ? 15 LYS A H    8  
ATOM 9097  H HA   . LYS A 1 15 ? -14.432 22.711  0.276   1.00 0.00 ? 15 LYS A HA   8  
ATOM 9098  H HB2  . LYS A 1 15 ? -16.573 23.763  -0.204  1.00 0.00 ? 15 LYS A HB2  8  
ATOM 9099  H HB3  . LYS A 1 15 ? -15.488 23.945  -1.577  1.00 0.00 ? 15 LYS A HB3  8  
ATOM 9100  H HG2  . LYS A 1 15 ? -16.627 22.145  -2.743  1.00 0.00 ? 15 LYS A HG2  8  
ATOM 9101  H HG3  . LYS A 1 15 ? -17.688 21.899  -1.354  1.00 0.00 ? 15 LYS A HG3  8  
ATOM 9102  H HD2  . LYS A 1 15 ? -18.936 23.198  -2.871  1.00 0.00 ? 15 LYS A HD2  8  
ATOM 9103  H HD3  . LYS A 1 15 ? -18.372 24.333  -1.641  1.00 0.00 ? 15 LYS A HD3  8  
ATOM 9104  H HE2  . LYS A 1 15 ? -18.033 25.382  -3.738  1.00 0.00 ? 15 LYS A HE2  8  
ATOM 9105  H HE3  . LYS A 1 15 ? -16.446 24.860  -3.176  1.00 0.00 ? 15 LYS A HE3  8  
ATOM 9106  H HZ1  . LYS A 1 15 ? -18.002 23.943  -5.451  1.00 0.00 ? 15 LYS A HZ1  8  
ATOM 9107  H HZ2  . LYS A 1 15 ? -17.185 22.737  -4.590  1.00 0.00 ? 15 LYS A HZ2  8  
ATOM 9108  H HZ3  . LYS A 1 15 ? -16.324 24.034  -5.251  1.00 0.00 ? 15 LYS A HZ3  8  
ATOM 9109  N N    . LYS A 1 16 ? -16.549 20.251  -0.290  1.00 0.00 ? 16 LYS A N    8  
ATOM 9110  C CA   . LYS A 1 16 ? -17.341 19.211  0.355   1.00 0.00 ? 16 LYS A CA   8  
ATOM 9111  C C    . LYS A 1 16 ? -17.727 18.123  -0.642  1.00 0.00 ? 16 LYS A C    8  
ATOM 9112  O O    . LYS A 1 16 ? -18.380 18.393  -1.649  1.00 0.00 ? 16 LYS A O    8  
ATOM 9113  C CB   . LYS A 1 16 ? -18.602 19.814  0.979   1.00 0.00 ? 16 LYS A CB   8  
ATOM 9114  C CG   . LYS A 1 16 ? -19.317 18.875  1.934   1.00 0.00 ? 16 LYS A CG   8  
ATOM 9115  C CD   . LYS A 1 16 ? -18.520 18.662  3.210   1.00 0.00 ? 16 LYS A CD   8  
ATOM 9116  C CE   . LYS A 1 16 ? -19.423 18.298  4.378   1.00 0.00 ? 16 LYS A CE   8  
ATOM 9117  N NZ   . LYS A 1 16 ? -18.658 18.157  5.648   1.00 0.00 ? 16 LYS A NZ   8  
ATOM 9118  H H    . LYS A 1 16 ? -16.483 20.263  -1.268  1.00 0.00 ? 16 LYS A H    8  
ATOM 9119  H HA   . LYS A 1 16 ? -16.739 18.770  1.135   1.00 0.00 ? 16 LYS A HA   8  
ATOM 9120  H HB2  . LYS A 1 16 ? -18.327 20.706  1.523   1.00 0.00 ? 16 LYS A HB2  8  
ATOM 9121  H HB3  . LYS A 1 16 ? -19.288 20.082  0.189   1.00 0.00 ? 16 LYS A HB3  8  
ATOM 9122  H HG2  . LYS A 1 16 ? -20.278 19.298  2.189   1.00 0.00 ? 16 LYS A HG2  8  
ATOM 9123  H HG3  . LYS A 1 16 ? -19.461 17.921  1.446   1.00 0.00 ? 16 LYS A HG3  8  
ATOM 9124  H HD2  . LYS A 1 16 ? -17.813 17.861  3.053   1.00 0.00 ? 16 LYS A HD2  8  
ATOM 9125  H HD3  . LYS A 1 16 ? -17.988 19.572  3.447   1.00 0.00 ? 16 LYS A HD3  8  
ATOM 9126  H HE2  . LYS A 1 16 ? -20.164 19.073  4.498   1.00 0.00 ? 16 LYS A HE2  8  
ATOM 9127  H HE3  . LYS A 1 16 ? -19.915 17.362  4.158   1.00 0.00 ? 16 LYS A HE3  8  
ATOM 9128  H HZ1  . LYS A 1 16 ? -19.202 18.558  6.438   1.00 0.00 ? 16 LYS A HZ1  8  
ATOM 9129  H HZ2  . LYS A 1 16 ? -17.751 18.659  5.576   1.00 0.00 ? 16 LYS A HZ2  8  
ATOM 9130  H HZ3  . LYS A 1 16 ? -18.472 17.153  5.843   1.00 0.00 ? 16 LYS A HZ3  8  
ATOM 9131  N N    . GLY A 1 17 ? -17.319 16.890  -0.354  1.00 0.00 ? 17 GLY A N    8  
ATOM 9132  C CA   . GLY A 1 17 ? -17.632 15.780  -1.235  1.00 0.00 ? 17 GLY A CA   8  
ATOM 9133  C C    . GLY A 1 17 ? -16.636 14.644  -1.112  1.00 0.00 ? 17 GLY A C    8  
ATOM 9134  O O    . GLY A 1 17 ? -15.637 14.605  -1.831  1.00 0.00 ? 17 GLY A O    8  
ATOM 9135  H H    . GLY A 1 17 ? -16.801 16.734  0.463   1.00 0.00 ? 17 GLY A H    8  
ATOM 9136  H HA2  . GLY A 1 17 ? -18.617 15.410  -0.993  1.00 0.00 ? 17 GLY A HA2  8  
ATOM 9137  H HA3  . GLY A 1 17 ? -17.632 16.134  -2.255  1.00 0.00 ? 17 GLY A HA3  8  
ATOM 9138  N N    . ARG A 1 18 ? -16.907 13.718  -0.198  1.00 0.00 ? 18 ARG A N    8  
ATOM 9139  C CA   . ARG A 1 18 ? -16.025 12.577  0.018   1.00 0.00 ? 18 ARG A CA   8  
ATOM 9140  C C    . ARG A 1 18 ? -16.710 11.276  -0.389  1.00 0.00 ? 18 ARG A C    8  
ATOM 9141  O O    . ARG A 1 18 ? -17.734 10.897  0.180   1.00 0.00 ? 18 ARG A O    8  
ATOM 9142  C CB   . ARG A 1 18 ? -15.601 12.505  1.486   1.00 0.00 ? 18 ARG A CB   8  
ATOM 9143  C CG   . ARG A 1 18 ? -14.694 11.326  1.800   1.00 0.00 ? 18 ARG A CG   8  
ATOM 9144  C CD   . ARG A 1 18 ? -13.241 11.639  1.478   1.00 0.00 ? 18 ARG A CD   8  
ATOM 9145  N NE   . ARG A 1 18 ? -12.707 12.697  2.331   1.00 0.00 ? 18 ARG A NE   8  
ATOM 9146  C CZ   . ARG A 1 18 ? -12.365 12.513  3.602   1.00 0.00 ? 18 ARG A CZ   8  
ATOM 9147  N NH1  . ARG A 1 18 ? -12.500 11.320  4.163   1.00 0.00 ? 18 ARG A NH1  8  
ATOM 9148  N NH2  . ARG A 1 18 ? -11.885 13.525  4.314   1.00 0.00 ? 18 ARG A NH2  8  
ATOM 9149  H H    . ARG A 1 18 ? -17.719 13.804  0.344   1.00 0.00 ? 18 ARG A H    8  
ATOM 9150  H HA   . ARG A 1 18 ? -15.147 12.715  -0.595  1.00 0.00 ? 18 ARG A HA   8  
ATOM 9151  H HB2  . ARG A 1 18 ? -15.075 13.413  1.742   1.00 0.00 ? 18 ARG A HB2  8  
ATOM 9152  H HB3  . ARG A 1 18 ? -16.485 12.424  2.100   1.00 0.00 ? 18 ARG A HB3  8  
ATOM 9153  H HG2  . ARG A 1 18 ? -14.775 11.092  2.852   1.00 0.00 ? 18 ARG A HG2  8  
ATOM 9154  H HG3  . ARG A 1 18 ? -15.009 10.475  1.214   1.00 0.00 ? 18 ARG A HG3  8  
ATOM 9155  H HD2  . ARG A 1 18 ? -12.654 10.744  1.619   1.00 0.00 ? 18 ARG A HD2  8  
ATOM 9156  H HD3  . ARG A 1 18 ? -13.176 11.953  0.447   1.00 0.00 ? 18 ARG A HD3  8  
ATOM 9157  H HE   . ARG A 1 18 ? -12.598 13.587  1.937   1.00 0.00 ? 18 ARG A HE   8  
ATOM 9158  H HH11 . ARG A 1 18 ? -12.861 10.555  3.628   1.00 0.00 ? 18 ARG A HH11 8  
ATOM 9159  H HH12 . ARG A 1 18 ? -12.241 11.184  5.119   1.00 0.00 ? 18 ARG A HH12 8  
ATOM 9160  H HH21 . ARG A 1 18 ? -11.781 14.426  3.894   1.00 0.00 ? 18 ARG A HH21 8  
ATOM 9161  H HH22 . ARG A 1 18 ? -11.628 13.386  5.270   1.00 0.00 ? 18 ARG A HH22 8  
ATOM 9162  N N    . ARG A 1 19 ? -16.138 10.597  -1.378  1.00 0.00 ? 19 ARG A N    8  
ATOM 9163  C CA   . ARG A 1 19 ? -16.694 9.339   -1.863  1.00 0.00 ? 19 ARG A CA   8  
ATOM 9164  C C    . ARG A 1 19 ? -15.620 8.258   -1.925  1.00 0.00 ? 19 ARG A C    8  
ATOM 9165  O O    . ARG A 1 19 ? -14.967 8.075   -2.952  1.00 0.00 ? 19 ARG A O    8  
ATOM 9166  C CB   . ARG A 1 19 ? -17.319 9.533   -3.246  1.00 0.00 ? 19 ARG A CB   8  
ATOM 9167  C CG   . ARG A 1 19 ? -16.314 9.920   -4.319  1.00 0.00 ? 19 ARG A CG   8  
ATOM 9168  C CD   . ARG A 1 19 ? -16.955 10.777  -5.399  1.00 0.00 ? 19 ARG A CD   8  
ATOM 9169  N NE   . ARG A 1 19 ? -17.638 11.941  -4.841  1.00 0.00 ? 19 ARG A NE   8  
ATOM 9170  C CZ   . ARG A 1 19 ? -18.254 12.857  -5.580  1.00 0.00 ? 19 ARG A CZ   8  
ATOM 9171  N NH1  . ARG A 1 19 ? -18.274 12.743  -6.901  1.00 0.00 ? 19 ARG A NH1  8  
ATOM 9172  N NH2  . ARG A 1 19 ? -18.853 13.888  -4.999  1.00 0.00 ? 19 ARG A NH2  8  
ATOM 9173  H H    . ARG A 1 19 ? -15.323 10.950  -1.793  1.00 0.00 ? 19 ARG A H    8  
ATOM 9174  H HA   . ARG A 1 19 ? -17.463 9.028   -1.172  1.00 0.00 ? 19 ARG A HA   8  
ATOM 9175  H HB2  . ARG A 1 19 ? -17.794 8.610   -3.546  1.00 0.00 ? 19 ARG A HB2  8  
ATOM 9176  H HB3  . ARG A 1 19 ? -18.065 10.310  -3.185  1.00 0.00 ? 19 ARG A HB3  8  
ATOM 9177  H HG2  . ARG A 1 19 ? -15.511 10.479  -3.862  1.00 0.00 ? 19 ARG A HG2  8  
ATOM 9178  H HG3  . ARG A 1 19 ? -15.919 9.022   -4.771  1.00 0.00 ? 19 ARG A HG3  8  
ATOM 9179  H HD2  . ARG A 1 19 ? -16.186 11.114  -6.077  1.00 0.00 ? 19 ARG A HD2  8  
ATOM 9180  H HD3  . ARG A 1 19 ? -17.672 10.176  -5.939  1.00 0.00 ? 19 ARG A HD3  8  
ATOM 9181  H HE   . ARG A 1 19 ? -17.636 12.045  -3.867  1.00 0.00 ? 19 ARG A HE   8  
ATOM 9182  H HH11 . ARG A 1 19 ? -17.824 11.967  -7.342  1.00 0.00 ? 19 ARG A HH11 8  
ATOM 9183  H HH12 . ARG A 1 19 ? -18.740 13.433  -7.456  1.00 0.00 ? 19 ARG A HH12 8  
ATOM 9184  H HH21 . ARG A 1 19 ? -18.841 13.977  -4.003  1.00 0.00 ? 19 ARG A HH21 8  
ATOM 9185  H HH22 . ARG A 1 19 ? -19.317 14.576  -5.556  1.00 0.00 ? 19 ARG A HH22 8  
ATOM 9186  N N    . SER A 1 20 ? -15.441 7.544   -0.818  1.00 0.00 ? 20 SER A N    8  
ATOM 9187  C CA   . SER A 1 20 ? -14.443 6.483   -0.744  1.00 0.00 ? 20 SER A CA   8  
ATOM 9188  C C    . SER A 1 20 ? -15.058 5.195   -0.205  1.00 0.00 ? 20 SER A C    8  
ATOM 9189  O O    . SER A 1 20 ? -15.087 4.968   1.005   1.00 0.00 ? 20 SER A O    8  
ATOM 9190  C CB   . SER A 1 20 ? -13.274 6.915   0.143   1.00 0.00 ? 20 SER A CB   8  
ATOM 9191  O OG   . SER A 1 20 ? -13.716 7.228   1.452   1.00 0.00 ? 20 SER A OG   8  
ATOM 9192  H H    . SER A 1 20 ? -15.993 7.737   -0.031  1.00 0.00 ? 20 SER A H    8  
ATOM 9193  H HA   . SER A 1 20 ? -14.077 6.303   -1.744  1.00 0.00 ? 20 SER A HA   8  
ATOM 9194  H HB2  . SER A 1 20 ? -12.555 6.113   0.202   1.00 0.00 ? 20 SER A HB2  8  
ATOM 9195  H HB3  . SER A 1 20 ? -12.805 7.789   -0.285  1.00 0.00 ? 20 SER A HB3  8  
ATOM 9196  H HG   . SER A 1 20 ? -14.075 8.119   1.465   1.00 0.00 ? 20 SER A HG   8  
ATOM 9197  N N    . ARG A 1 21 ? -15.548 4.356   -1.111  1.00 0.00 ? 21 ARG A N    8  
ATOM 9198  C CA   . ARG A 1 21 ? -16.163 3.091   -0.728  1.00 0.00 ? 21 ARG A CA   8  
ATOM 9199  C C    . ARG A 1 21 ? -15.119 2.123   -0.181  1.00 0.00 ? 21 ARG A C    8  
ATOM 9200  O O    . ARG A 1 21 ? -14.590 1.284   -0.912  1.00 0.00 ? 21 ARG A O    8  
ATOM 9201  C CB   . ARG A 1 21 ? -16.879 2.464   -1.925  1.00 0.00 ? 21 ARG A CB   8  
ATOM 9202  C CG   . ARG A 1 21 ? -18.221 3.105   -2.237  1.00 0.00 ? 21 ARG A CG   8  
ATOM 9203  C CD   . ARG A 1 21 ? -18.050 4.442   -2.942  1.00 0.00 ? 21 ARG A CD   8  
ATOM 9204  N NE   . ARG A 1 21 ? -19.172 4.742   -3.827  1.00 0.00 ? 21 ARG A NE   8  
ATOM 9205  C CZ   . ARG A 1 21 ? -19.372 4.136   -4.992  1.00 0.00 ? 21 ARG A CZ   8  
ATOM 9206  N NH1  . ARG A 1 21 ? -18.529 3.202   -5.410  1.00 0.00 ? 21 ARG A NH1  8  
ATOM 9207  N NH2  . ARG A 1 21 ? -20.416 4.464   -5.741  1.00 0.00 ? 21 ARG A NH2  8  
ATOM 9208  H H    . ARG A 1 21 ? -15.495 4.593   -2.061  1.00 0.00 ? 21 ARG A H    8  
ATOM 9209  H HA   . ARG A 1 21 ? -16.887 3.296   0.046   1.00 0.00 ? 21 ARG A HA   8  
ATOM 9210  H HB2  . ARG A 1 21 ? -16.248 2.559   -2.797  1.00 0.00 ? 21 ARG A HB2  8  
ATOM 9211  H HB3  . ARG A 1 21 ? -17.043 1.416   -1.723  1.00 0.00 ? 21 ARG A HB3  8  
ATOM 9212  H HG2  . ARG A 1 21 ? -18.786 2.444   -2.878  1.00 0.00 ? 21 ARG A HG2  8  
ATOM 9213  H HG3  . ARG A 1 21 ? -18.758 3.261   -1.314  1.00 0.00 ? 21 ARG A HG3  8  
ATOM 9214  H HD2  . ARG A 1 21 ? -17.974 5.220   -2.196  1.00 0.00 ? 21 ARG A HD2  8  
ATOM 9215  H HD3  . ARG A 1 21 ? -17.141 4.413   -3.524  1.00 0.00 ? 21 ARG A HD3  8  
ATOM 9216  H HE   . ARG A 1 21 ? -19.807 5.430   -3.537  1.00 0.00 ? 21 ARG A HE   8  
ATOM 9217  H HH11 . ARG A 1 21 ? -17.742 2.952   -4.846  1.00 0.00 ? 21 ARG A HH11 8  
ATOM 9218  H HH12 . ARG A 1 21 ? -18.683 2.746   -6.287  1.00 0.00 ? 21 ARG A HH12 8  
ATOM 9219  H HH21 . ARG A 1 21 ? -21.054 5.168   -5.429  1.00 0.00 ? 21 ARG A HH21 8  
ATOM 9220  H HH22 . ARG A 1 21 ? -20.566 4.008   -6.617  1.00 0.00 ? 21 ARG A HH22 8  
ATOM 9221  N N    . THR A 1 22 ? -14.825 2.244   1.110   1.00 0.00 ? 22 THR A N    8  
ATOM 9222  C CA   . THR A 1 22 ? -13.843 1.381   1.754   1.00 0.00 ? 22 THR A CA   8  
ATOM 9223  C C    . THR A 1 22 ? -14.511 0.169   2.393   1.00 0.00 ? 22 THR A C    8  
ATOM 9224  O O    . THR A 1 22 ? -15.638 0.254   2.882   1.00 0.00 ? 22 THR A O    8  
ATOM 9225  C CB   . THR A 1 22 ? -13.048 2.142   2.832   1.00 0.00 ? 22 THR A CB   8  
ATOM 9226  O OG1  . THR A 1 22 ? -12.055 1.284   3.406   1.00 0.00 ? 22 THR A OG1  8  
ATOM 9227  C CG2  . THR A 1 22 ? -13.973 2.657   3.925   1.00 0.00 ? 22 THR A CG2  8  
ATOM 9228  H H    . THR A 1 22 ? -15.279 2.931   1.640   1.00 0.00 ? 22 THR A H    8  
ATOM 9229  H HA   . THR A 1 22 ? -13.150 1.041   0.998   1.00 0.00 ? 22 THR A HA   8  
ATOM 9230  H HB   . THR A 1 22 ? -12.558 2.986   2.368   1.00 0.00 ? 22 THR A HB   8  
ATOM 9231  H HG1  . THR A 1 22 ? -11.348 1.817   3.778   1.00 0.00 ? 22 THR A HG1  8  
ATOM 9232  H HG21 . THR A 1 22 ? -14.960 2.815   3.516   1.00 0.00 ? 22 THR A HG21 8  
ATOM 9233  H HG22 . THR A 1 22 ? -13.589 3.589   4.312   1.00 0.00 ? 22 THR A HG22 8  
ATOM 9234  H HG23 . THR A 1 22 ? -14.027 1.931   4.722   1.00 0.00 ? 22 THR A HG23 8  
ATOM 9235  N N    . VAL A 1 23 ? -13.809 -0.960  2.387   1.00 0.00 ? 23 VAL A N    8  
ATOM 9236  C CA   . VAL A 1 23 ? -14.335 -2.190  2.967   1.00 0.00 ? 23 VAL A CA   8  
ATOM 9237  C C    . VAL A 1 23 ? -13.496 -2.637  4.159   1.00 0.00 ? 23 VAL A C    8  
ATOM 9238  O O    . VAL A 1 23 ? -13.317 -3.832  4.393   1.00 0.00 ? 23 VAL A O    8  
ATOM 9239  C CB   . VAL A 1 23 ? -14.378 -3.327  1.929   1.00 0.00 ? 23 VAL A CB   8  
ATOM 9240  C CG1  . VAL A 1 23 ? -15.211 -4.490  2.446   1.00 0.00 ? 23 VAL A CG1  8  
ATOM 9241  C CG2  . VAL A 1 23 ? -14.924 -2.817  0.604   1.00 0.00 ? 23 VAL A CG2  8  
ATOM 9242  H H    . VAL A 1 23 ? -12.917 -0.965  1.982   1.00 0.00 ? 23 VAL A H    8  
ATOM 9243  H HA   . VAL A 1 23 ? -15.344 -1.997  3.302   1.00 0.00 ? 23 VAL A HA   8  
ATOM 9244  H HB   . VAL A 1 23 ? -13.370 -3.678  1.767   1.00 0.00 ? 23 VAL A HB   8  
ATOM 9245  H HG11 . VAL A 1 23 ? -15.359 -4.382  3.510   1.00 0.00 ? 23 VAL A HG11 8  
ATOM 9246  H HG12 . VAL A 1 23 ? -16.169 -4.498  1.946   1.00 0.00 ? 23 VAL A HG12 8  
ATOM 9247  H HG13 . VAL A 1 23 ? -14.694 -5.418  2.248   1.00 0.00 ? 23 VAL A HG13 8  
ATOM 9248  H HG21 . VAL A 1 23 ? -15.687 -3.492  0.246   1.00 0.00 ? 23 VAL A HG21 8  
ATOM 9249  H HG22 . VAL A 1 23 ? -15.350 -1.834  0.744   1.00 0.00 ? 23 VAL A HG22 8  
ATOM 9250  H HG23 . VAL A 1 23 ? -14.124 -2.762  -0.119  1.00 0.00 ? 23 VAL A HG23 8  
ATOM 9251  N N    . PHE A 1 24 ? -12.983 -1.669  4.911   1.00 0.00 ? 24 PHE A N    8  
ATOM 9252  C CA   . PHE A 1 24 ? -12.161 -1.962  6.080   1.00 0.00 ? 24 PHE A CA   8  
ATOM 9253  C C    . PHE A 1 24 ? -12.833 -1.462  7.355   1.00 0.00 ? 24 PHE A C    8  
ATOM 9254  O O    . PHE A 1 24 ? -13.434 -0.387  7.375   1.00 0.00 ? 24 PHE A O    8  
ATOM 9255  C CB   . PHE A 1 24 ? -10.780 -1.321  5.932   1.00 0.00 ? 24 PHE A CB   8  
ATOM 9256  C CG   . PHE A 1 24 ? -9.983  -1.872  4.784   1.00 0.00 ? 24 PHE A CG   8  
ATOM 9257  C CD1  . PHE A 1 24 ? -9.386  -3.119  4.872   1.00 0.00 ? 24 PHE A CD1  8  
ATOM 9258  C CD2  . PHE A 1 24 ? -9.832  -1.142  3.616   1.00 0.00 ? 24 PHE A CD2  8  
ATOM 9259  C CE1  . PHE A 1 24 ? -8.653  -3.627  3.817   1.00 0.00 ? 24 PHE A CE1  8  
ATOM 9260  C CE2  . PHE A 1 24 ? -9.100  -1.646  2.557   1.00 0.00 ? 24 PHE A CE2  8  
ATOM 9261  C CZ   . PHE A 1 24 ? -8.510  -2.890  2.658   1.00 0.00 ? 24 PHE A CZ   8  
ATOM 9262  H H    . PHE A 1 24 ? -13.160 -0.734  4.674   1.00 0.00 ? 24 PHE A H    8  
ATOM 9263  H HA   . PHE A 1 24 ? -12.047 -3.033  6.143   1.00 0.00 ? 24 PHE A HA   8  
ATOM 9264  H HB2  . PHE A 1 24 ? -10.898 -0.260  5.775   1.00 0.00 ? 24 PHE A HB2  8  
ATOM 9265  H HB3  . PHE A 1 24 ? -10.216 -1.487  6.838   1.00 0.00 ? 24 PHE A HB3  8  
ATOM 9266  H HD1  . PHE A 1 24 ? -9.498  -3.697  5.777   1.00 0.00 ? 24 PHE A HD1  8  
ATOM 9267  H HD2  . PHE A 1 24 ? -10.293 -0.168  3.536   1.00 0.00 ? 24 PHE A HD2  8  
ATOM 9268  H HE1  . PHE A 1 24 ? -8.193  -4.601  3.898   1.00 0.00 ? 24 PHE A HE1  8  
ATOM 9269  H HE2  . PHE A 1 24 ? -8.990  -1.066  1.652   1.00 0.00 ? 24 PHE A HE2  8  
ATOM 9270  H HZ   . PHE A 1 24 ? -7.937  -3.285  1.832   1.00 0.00 ? 24 PHE A HZ   8  
ATOM 9271  N N    . THR A 1 25 ? -12.726 -2.250  8.421   1.00 0.00 ? 25 THR A N    8  
ATOM 9272  C CA   . THR A 1 25 ? -13.324 -1.890  9.701   1.00 0.00 ? 25 THR A CA   8  
ATOM 9273  C C    . THR A 1 25 ? -12.393 -0.993  10.509  1.00 0.00 ? 25 THR A C    8  
ATOM 9274  O O    . THR A 1 25 ? -11.188 -0.952  10.262  1.00 0.00 ? 25 THR A O    8  
ATOM 9275  C CB   . THR A 1 25 ? -13.665 -3.140  10.533  1.00 0.00 ? 25 THR A CB   8  
ATOM 9276  O OG1  . THR A 1 25 ? -12.469 -3.865  10.840  1.00 0.00 ? 25 THR A OG1  8  
ATOM 9277  C CG2  . THR A 1 25 ? -14.633 -4.042  9.783   1.00 0.00 ? 25 THR A CG2  8  
ATOM 9278  H H    . THR A 1 25 ? -12.235 -3.094  8.343   1.00 0.00 ? 25 THR A H    8  
ATOM 9279  H HA   . THR A 1 25 ? -14.241 -1.354  9.502   1.00 0.00 ? 25 THR A HA   8  
ATOM 9280  H HB   . THR A 1 25 ? -14.131 -2.823  11.455  1.00 0.00 ? 25 THR A HB   8  
ATOM 9281  H HG1  . THR A 1 25 ? -12.314 -3.842  11.787  1.00 0.00 ? 25 THR A HG1  8  
ATOM 9282  H HG21 . THR A 1 25 ? -14.096 -4.885  9.374   1.00 0.00 ? 25 THR A HG21 8  
ATOM 9283  H HG22 . THR A 1 25 ? -15.096 -3.486  8.981   1.00 0.00 ? 25 THR A HG22 8  
ATOM 9284  H HG23 . THR A 1 25 ? -15.394 -4.395  10.462  1.00 0.00 ? 25 THR A HG23 8  
ATOM 9285  N N    . GLU A 1 26 ? -12.959 -0.278  11.475  1.00 0.00 ? 26 GLU A N    8  
ATOM 9286  C CA   . GLU A 1 26 ? -12.178 0.619   12.320  1.00 0.00 ? 26 GLU A CA   8  
ATOM 9287  C C    . GLU A 1 26 ? -10.930 -0.083  12.849  1.00 0.00 ? 26 GLU A C    8  
ATOM 9288  O O    . GLU A 1 26 ? -9.847  0.501   12.892  1.00 0.00 ? 26 GLU A O    8  
ATOM 9289  C CB   . GLU A 1 26 ? -13.027 1.124   13.488  1.00 0.00 ? 26 GLU A CB   8  
ATOM 9290  C CG   . GLU A 1 26 ? -13.816 2.382   13.168  1.00 0.00 ? 26 GLU A CG   8  
ATOM 9291  C CD   . GLU A 1 26 ? -14.041 3.255   14.387  1.00 0.00 ? 26 GLU A CD   8  
ATOM 9292  O OE1  . GLU A 1 26 ? -14.429 2.713   15.443  1.00 0.00 ? 26 GLU A OE1  8  
ATOM 9293  O OE2  . GLU A 1 26 ? -13.830 4.482   14.285  1.00 0.00 ? 26 GLU A OE2  8  
ATOM 9294  H H    . GLU A 1 26 ? -13.925 -0.354  11.624  1.00 0.00 ? 26 GLU A H    8  
ATOM 9295  H HA   . GLU A 1 26 ? -11.874 1.461   11.717  1.00 0.00 ? 26 GLU A HA   8  
ATOM 9296  H HB2  . GLU A 1 26 ? -13.724 0.349   13.773  1.00 0.00 ? 26 GLU A HB2  8  
ATOM 9297  H HB3  . GLU A 1 26 ? -12.377 1.335   14.324  1.00 0.00 ? 26 GLU A HB3  8  
ATOM 9298  H HG2  . GLU A 1 26 ? -13.273 2.954   12.430  1.00 0.00 ? 26 GLU A HG2  8  
ATOM 9299  H HG3  . GLU A 1 26 ? -14.776 2.097   12.765  1.00 0.00 ? 26 GLU A HG3  8  
ATOM 9300  N N    . LEU A 1 27 ? -11.091 -1.338  13.252  1.00 0.00 ? 27 LEU A N    8  
ATOM 9301  C CA   . LEU A 1 27 ? -9.978  -2.121  13.780  1.00 0.00 ? 27 LEU A CA   8  
ATOM 9302  C C    . LEU A 1 27 ? -8.943  -2.396  12.694  1.00 0.00 ? 27 LEU A C    8  
ATOM 9303  O O    . LEU A 1 27 ? -7.770  -2.056  12.842  1.00 0.00 ? 27 LEU A O    8  
ATOM 9304  C CB   . LEU A 1 27 ? -10.488 -3.441  14.361  1.00 0.00 ? 27 LEU A CB   8  
ATOM 9305  C CG   . LEU A 1 27 ? -9.590  -4.106  15.405  1.00 0.00 ? 27 LEU A CG   8  
ATOM 9306  C CD1  . LEU A 1 27 ? -9.844  -3.515  16.783  1.00 0.00 ? 27 LEU A CD1  8  
ATOM 9307  C CD2  . LEU A 1 27 ? -9.812  -5.611  15.418  1.00 0.00 ? 27 LEU A CD2  8  
ATOM 9308  H H    . LEU A 1 27 ? -11.978 -1.750  13.194  1.00 0.00 ? 27 LEU A H    8  
ATOM 9309  H HA   . LEU A 1 27 ? -9.513  -1.546  14.566  1.00 0.00 ? 27 LEU A HA   8  
ATOM 9310  H HB2  . LEU A 1 27 ? -11.445 -3.251  14.822  1.00 0.00 ? 27 LEU A HB2  8  
ATOM 9311  H HB3  . LEU A 1 27 ? -10.615 -4.135  13.542  1.00 0.00 ? 27 LEU A HB3  8  
ATOM 9312  H HG   . LEU A 1 27 ? -8.555  -3.922  15.149  1.00 0.00 ? 27 LEU A HG   8  
ATOM 9313  H HD11 . LEU A 1 27 ? -10.847 -3.117  16.824  1.00 0.00 ? 27 LEU A HD11 8  
ATOM 9314  H HD12 . LEU A 1 27 ? -9.134  -2.723  16.971  1.00 0.00 ? 27 LEU A HD12 8  
ATOM 9315  H HD13 . LEU A 1 27 ? -9.731  -4.286  17.531  1.00 0.00 ? 27 LEU A HD13 8  
ATOM 9316  H HD21 . LEU A 1 27 ? -9.746  -5.993  14.410  1.00 0.00 ? 27 LEU A HD21 8  
ATOM 9317  H HD22 . LEU A 1 27 ? -10.791 -5.827  15.821  1.00 0.00 ? 27 LEU A HD22 8  
ATOM 9318  H HD23 . LEU A 1 27 ? -9.058  -6.081  16.032  1.00 0.00 ? 27 LEU A HD23 8  
ATOM 9319  N N    . GLN A 1 28 ? -9.387  -3.012  11.603  1.00 0.00 ? 28 GLN A N    8  
ATOM 9320  C CA   . GLN A 1 28 ? -8.499  -3.332  10.492  1.00 0.00 ? 28 GLN A CA   8  
ATOM 9321  C C    . GLN A 1 28 ? -7.727  -2.097  10.039  1.00 0.00 ? 28 GLN A C    8  
ATOM 9322  O O    . GLN A 1 28 ? -6.504  -2.135  9.893   1.00 0.00 ? 28 GLN A O    8  
ATOM 9323  C CB   . GLN A 1 28 ? -9.298  -3.905  9.320   1.00 0.00 ? 28 GLN A CB   8  
ATOM 9324  C CG   . GLN A 1 28 ? -9.924  -5.259  9.615   1.00 0.00 ? 28 GLN A CG   8  
ATOM 9325  C CD   . GLN A 1 28 ? -10.800 -5.756  8.482   1.00 0.00 ? 28 GLN A CD   8  
ATOM 9326  O OE1  . GLN A 1 28 ? -11.207 -4.986  7.612   1.00 0.00 ? 28 GLN A OE1  8  
ATOM 9327  N NE2  . GLN A 1 28 ? -11.095 -7.051  8.487   1.00 0.00 ? 28 GLN A NE2  8  
ATOM 9328  H H    . GLN A 1 28 ? -10.333 -3.258  11.544  1.00 0.00 ? 28 GLN A H    8  
ATOM 9329  H HA   . GLN A 1 28 ? -7.795  -4.076  10.833  1.00 0.00 ? 28 GLN A HA   8  
ATOM 9330  H HB2  . GLN A 1 28 ? -10.089 -3.214  9.067   1.00 0.00 ? 28 GLN A HB2  8  
ATOM 9331  H HB3  . GLN A 1 28 ? -8.641  -4.014  8.470   1.00 0.00 ? 28 GLN A HB3  8  
ATOM 9332  H HG2  . GLN A 1 28 ? -9.135  -5.977  9.781   1.00 0.00 ? 28 GLN A HG2  8  
ATOM 9333  H HG3  . GLN A 1 28 ? -10.527 -5.176  10.507  1.00 0.00 ? 28 GLN A HG3  8  
ATOM 9334  H HE21 . GLN A 1 28 ? -10.737 -7.605  9.213   1.00 0.00 ? 28 GLN A HE21 8  
ATOM 9335  H HE22 . GLN A 1 28 ? -11.660 -7.399  7.767   1.00 0.00 ? 28 GLN A HE22 8  
ATOM 9336  N N    . LEU A 1 29 ? -8.447  -1.003  9.819   1.00 0.00 ? 29 LEU A N    8  
ATOM 9337  C CA   . LEU A 1 29 ? -7.830  0.245   9.383   1.00 0.00 ? 29 LEU A CA   8  
ATOM 9338  C C    . LEU A 1 29 ? -6.770  0.705   10.378  1.00 0.00 ? 29 LEU A C    8  
ATOM 9339  O O    . LEU A 1 29 ? -5.645  1.027   9.996   1.00 0.00 ? 29 LEU A O    8  
ATOM 9340  C CB   . LEU A 1 29 ? -8.894  1.332   9.215   1.00 0.00 ? 29 LEU A CB   8  
ATOM 9341  C CG   . LEU A 1 29 ? -9.690  1.295   7.910   1.00 0.00 ? 29 LEU A CG   8  
ATOM 9342  C CD1  . LEU A 1 29 ? -10.878 2.242   7.983   1.00 0.00 ? 29 LEU A CD1  8  
ATOM 9343  C CD2  . LEU A 1 29 ? -8.796  1.648   6.730   1.00 0.00 ? 29 LEU A CD2  8  
ATOM 9344  H H    . LEU A 1 29 ? -9.417  -1.034  9.952   1.00 0.00 ? 29 LEU A H    8  
ATOM 9345  H HA   . LEU A 1 29 ? -7.357  0.065   8.429   1.00 0.00 ? 29 LEU A HA   8  
ATOM 9346  H HB2  . LEU A 1 29 ? -9.593  1.239   10.031  1.00 0.00 ? 29 LEU A HB2  8  
ATOM 9347  H HB3  . LEU A 1 29 ? -8.398  2.290   9.275   1.00 0.00 ? 29 LEU A HB3  8  
ATOM 9348  H HG   . LEU A 1 29 ? -10.070 0.295   7.755   1.00 0.00 ? 29 LEU A HG   8  
ATOM 9349  H HD11 . LEU A 1 29 ? -10.871 2.755   8.932   1.00 0.00 ? 29 LEU A HD11 8  
ATOM 9350  H HD12 . LEU A 1 29 ? -11.794 1.679   7.884   1.00 0.00 ? 29 LEU A HD12 8  
ATOM 9351  H HD13 . LEU A 1 29 ? -10.812 2.965   7.182   1.00 0.00 ? 29 LEU A HD13 8  
ATOM 9352  H HD21 . LEU A 1 29 ? -8.557  2.701   6.762   1.00 0.00 ? 29 LEU A HD21 8  
ATOM 9353  H HD22 . LEU A 1 29 ? -9.313  1.425   5.807   1.00 0.00 ? 29 LEU A HD22 8  
ATOM 9354  H HD23 . LEU A 1 29 ? -7.886  1.070   6.782   1.00 0.00 ? 29 LEU A HD23 8  
ATOM 9355  N N    . MET A 1 30 ? -7.136  0.731   11.655  1.00 0.00 ? 30 MET A N    8  
ATOM 9356  C CA   . MET A 1 30 ? -6.214  1.148   12.706  1.00 0.00 ? 30 MET A CA   8  
ATOM 9357  C C    . MET A 1 30 ? -4.884  0.411   12.586  1.00 0.00 ? 30 MET A C    8  
ATOM 9358  O O    . MET A 1 30 ? -3.817  1.019   12.665  1.00 0.00 ? 30 MET A O    8  
ATOM 9359  C CB   . MET A 1 30 ? -6.829  0.894   14.083  1.00 0.00 ? 30 MET A CB   8  
ATOM 9360  C CG   . MET A 1 30 ? -5.865  1.135   15.233  1.00 0.00 ? 30 MET A CG   8  
ATOM 9361  S SD   . MET A 1 30 ? -6.689  1.167   16.836  1.00 0.00 ? 30 MET A SD   8  
ATOM 9362  C CE   . MET A 1 30 ? -7.293  -0.516  16.940  1.00 0.00 ? 30 MET A CE   8  
ATOM 9363  H H    . MET A 1 30 ? -8.047  0.462   11.898  1.00 0.00 ? 30 MET A H    8  
ATOM 9364  H HA   . MET A 1 30 ? -6.038  2.207   12.590  1.00 0.00 ? 30 MET A HA   8  
ATOM 9365  H HB2  . MET A 1 30 ? -7.679  1.548   14.211  1.00 0.00 ? 30 MET A HB2  8  
ATOM 9366  H HB3  . MET A 1 30 ? -7.164  -0.131  14.132  1.00 0.00 ? 30 MET A HB3  8  
ATOM 9367  H HG2  . MET A 1 30 ? -5.128  0.346   15.239  1.00 0.00 ? 30 MET A HG2  8  
ATOM 9368  H HG3  . MET A 1 30 ? -5.372  2.084   15.078  1.00 0.00 ? 30 MET A HG3  8  
ATOM 9369  H HE1  . MET A 1 30 ? -6.472  -1.203  16.799  1.00 0.00 ? 30 MET A HE1  8  
ATOM 9370  H HE2  . MET A 1 30 ? -7.737  -0.680  17.910  1.00 0.00 ? 30 MET A HE2  8  
ATOM 9371  H HE3  . MET A 1 30 ? -8.035  -0.679  16.171  1.00 0.00 ? 30 MET A HE3  8  
ATOM 9372  N N    . GLY A 1 31 ? -4.955  -0.903  12.396  1.00 0.00 ? 31 GLY A N    8  
ATOM 9373  C CA   . GLY A 1 31 ? -3.750  -1.701  12.269  1.00 0.00 ? 31 GLY A CA   8  
ATOM 9374  C C    . GLY A 1 31 ? -2.974  -1.383  11.006  1.00 0.00 ? 31 GLY A C    8  
ATOM 9375  O O    . GLY A 1 31 ? -1.760  -1.182  11.048  1.00 0.00 ? 31 GLY A O    8  
ATOM 9376  H H    . GLY A 1 31 ? -5.834  -1.334  12.341  1.00 0.00 ? 31 GLY A H    8  
ATOM 9377  H HA2  . GLY A 1 31 ? -3.117  -1.515  13.124  1.00 0.00 ? 31 GLY A HA2  8  
ATOM 9378  H HA3  . GLY A 1 31 ? -4.023  -2.746  12.256  1.00 0.00 ? 31 GLY A HA3  8  
ATOM 9379  N N    . LEU A 1 32 ? -3.676  -1.338  9.879   1.00 0.00 ? 32 LEU A N    8  
ATOM 9380  C CA   . LEU A 1 32 ? -3.045  -1.044  8.596   1.00 0.00 ? 32 LEU A CA   8  
ATOM 9381  C C    . LEU A 1 32 ? -2.338  0.307   8.635   1.00 0.00 ? 32 LEU A C    8  
ATOM 9382  O O    . LEU A 1 32 ? -1.232  0.453   8.116   1.00 0.00 ? 32 LEU A O    8  
ATOM 9383  C CB   . LEU A 1 32 ? -4.089  -1.055  7.478   1.00 0.00 ? 32 LEU A CB   8  
ATOM 9384  C CG   . LEU A 1 32 ? -4.559  -2.433  7.012   1.00 0.00 ? 32 LEU A CG   8  
ATOM 9385  C CD1  . LEU A 1 32 ? -5.766  -2.304  6.096   1.00 0.00 ? 32 LEU A CD1  8  
ATOM 9386  C CD2  . LEU A 1 32 ? -3.430  -3.172  6.309   1.00 0.00 ? 32 LEU A CD2  8  
ATOM 9387  H H    . LEU A 1 32 ? -4.640  -1.507  9.908   1.00 0.00 ? 32 LEU A H    8  
ATOM 9388  H HA   . LEU A 1 32 ? -2.314  -1.814  8.403   1.00 0.00 ? 32 LEU A HA   8  
ATOM 9389  H HB2  . LEU A 1 32 ? -4.953  -0.511  7.828   1.00 0.00 ? 32 LEU A HB2  8  
ATOM 9390  H HB3  . LEU A 1 32 ? -3.664  -0.543  6.626   1.00 0.00 ? 32 LEU A HB3  8  
ATOM 9391  H HG   . LEU A 1 32 ? -4.856  -3.016  7.873   1.00 0.00 ? 32 LEU A HG   8  
ATOM 9392  H HD11 . LEU A 1 32 ? -6.633  -2.031  6.679   1.00 0.00 ? 32 LEU A HD11 8  
ATOM 9393  H HD12 . LEU A 1 32 ? -5.946  -3.247  5.602   1.00 0.00 ? 32 LEU A HD12 8  
ATOM 9394  H HD13 . LEU A 1 32 ? -5.575  -1.541  5.355   1.00 0.00 ? 32 LEU A HD13 8  
ATOM 9395  H HD21 . LEU A 1 32 ? -2.570  -2.523  6.230   1.00 0.00 ? 32 LEU A HD21 8  
ATOM 9396  H HD22 . LEU A 1 32 ? -3.752  -3.464  5.320   1.00 0.00 ? 32 LEU A HD22 8  
ATOM 9397  H HD23 . LEU A 1 32 ? -3.167  -4.052  6.877   1.00 0.00 ? 32 LEU A HD23 8  
ATOM 9398  N N    . GLU A 1 33 ? -2.984  1.290   9.254   1.00 0.00 ? 33 GLU A N    8  
ATOM 9399  C CA   . GLU A 1 33 ? -2.415  2.628   9.361   1.00 0.00 ? 33 GLU A CA   8  
ATOM 9400  C C    . GLU A 1 33 ? -1.199  2.631   10.283  1.00 0.00 ? 33 GLU A C    8  
ATOM 9401  O O    . GLU A 1 33 ? -0.160  3.205   9.958   1.00 0.00 ? 33 GLU A O    8  
ATOM 9402  C CB   . GLU A 1 33 ? -3.465  3.613   9.880   1.00 0.00 ? 33 GLU A CB   8  
ATOM 9403  C CG   . GLU A 1 33 ? -4.668  3.759   8.964   1.00 0.00 ? 33 GLU A CG   8  
ATOM 9404  C CD   . GLU A 1 33 ? -5.841  4.437   9.645   1.00 0.00 ? 33 GLU A CD   8  
ATOM 9405  O OE1  . GLU A 1 33 ? -6.421  3.832   10.571  1.00 0.00 ? 33 GLU A OE1  8  
ATOM 9406  O OE2  . GLU A 1 33 ? -6.179  5.574   9.252   1.00 0.00 ? 33 GLU A OE2  8  
ATOM 9407  H H    . GLU A 1 33 ? -3.863  1.111   9.648   1.00 0.00 ? 33 GLU A H    8  
ATOM 9408  H HA   . GLU A 1 33 ? -2.104  2.936   8.374   1.00 0.00 ? 33 GLU A HA   8  
ATOM 9409  H HB2  . GLU A 1 33 ? -3.812  3.275   10.846  1.00 0.00 ? 33 GLU A HB2  8  
ATOM 9410  H HB3  . GLU A 1 33 ? -3.005  4.584   9.993   1.00 0.00 ? 33 GLU A HB3  8  
ATOM 9411  H HG2  . GLU A 1 33 ? -4.382  4.346   8.105   1.00 0.00 ? 33 GLU A HG2  8  
ATOM 9412  H HG3  . GLU A 1 33 ? -4.979  2.776   8.640   1.00 0.00 ? 33 GLU A HG3  8  
ATOM 9413  N N    . LYS A 1 34 ? -1.338  1.985   11.436  1.00 0.00 ? 34 LYS A N    8  
ATOM 9414  C CA   . LYS A 1 34 ? -0.252  1.911   12.407  1.00 0.00 ? 34 LYS A CA   8  
ATOM 9415  C C    . LYS A 1 34 ? 0.996   1.297   11.782  1.00 0.00 ? 34 LYS A C    8  
ATOM 9416  O O    . LYS A 1 34 ? 2.109   1.781   11.990  1.00 0.00 ? 34 LYS A O    8  
ATOM 9417  C CB   . LYS A 1 34 ? -0.684  1.089   13.623  1.00 0.00 ? 34 LYS A CB   8  
ATOM 9418  C CG   . LYS A 1 34 ? -0.008  1.514   14.916  1.00 0.00 ? 34 LYS A CG   8  
ATOM 9419  C CD   . LYS A 1 34 ? 1.410   0.977   15.006  1.00 0.00 ? 34 LYS A CD   8  
ATOM 9420  C CE   . LYS A 1 34 ? 2.078   1.382   16.312  1.00 0.00 ? 34 LYS A CE   8  
ATOM 9421  N NZ   . LYS A 1 34 ? 2.345   2.846   16.367  1.00 0.00 ? 34 LYS A NZ   8  
ATOM 9422  H H    . LYS A 1 34 ? -2.191  1.547   11.639  1.00 0.00 ? 34 LYS A H    8  
ATOM 9423  H HA   . LYS A 1 34 ? -0.023  2.917   12.726  1.00 0.00 ? 34 LYS A HA   8  
ATOM 9424  H HB2  . LYS A 1 34 ? -1.752  1.189   13.750  1.00 0.00 ? 34 LYS A HB2  8  
ATOM 9425  H HB3  . LYS A 1 34 ? -0.447  0.050   13.443  1.00 0.00 ? 34 LYS A HB3  8  
ATOM 9426  H HG2  . LYS A 1 34 ? 0.024   2.593   14.957  1.00 0.00 ? 34 LYS A HG2  8  
ATOM 9427  H HG3  . LYS A 1 34 ? -0.580  1.137   15.751  1.00 0.00 ? 34 LYS A HG3  8  
ATOM 9428  H HD2  . LYS A 1 34 ? 1.383   -0.101  14.949  1.00 0.00 ? 34 LYS A HD2  8  
ATOM 9429  H HD3  . LYS A 1 34 ? 1.988   1.369   14.180  1.00 0.00 ? 34 LYS A HD3  8  
ATOM 9430  H HE2  . LYS A 1 34 ? 1.429   1.112   17.131  1.00 0.00 ? 34 LYS A HE2  8  
ATOM 9431  H HE3  . LYS A 1 34 ? 3.013   0.850   16.402  1.00 0.00 ? 34 LYS A HE3  8  
ATOM 9432  H HZ1  . LYS A 1 34 ? 2.926   3.071   17.200  1.00 0.00 ? 34 LYS A HZ1  8  
ATOM 9433  H HZ2  . LYS A 1 34 ? 1.449   3.370   16.432  1.00 0.00 ? 34 LYS A HZ2  8  
ATOM 9434  H HZ3  . LYS A 1 34 ? 2.851   3.150   15.511  1.00 0.00 ? 34 LYS A HZ3  8  
ATOM 9435  N N    . ARG A 1 35 ? 0.804   0.229   11.014  1.00 0.00 ? 35 ARG A N    8  
ATOM 9436  C CA   . ARG A 1 35 ? 1.914   -0.451  10.359  1.00 0.00 ? 35 ARG A CA   8  
ATOM 9437  C C    . ARG A 1 35 ? 2.440   0.373   9.187   1.00 0.00 ? 35 ARG A C    8  
ATOM 9438  O O    . ARG A 1 35 ? 3.648   0.559   9.038   1.00 0.00 ? 35 ARG A O    8  
ATOM 9439  C CB   . ARG A 1 35 ? 1.477   -1.833  9.869   1.00 0.00 ? 35 ARG A CB   8  
ATOM 9440  C CG   . ARG A 1 35 ? 1.395   -2.873  10.974  1.00 0.00 ? 35 ARG A CG   8  
ATOM 9441  C CD   . ARG A 1 35 ? 2.706   -2.981  11.736  1.00 0.00 ? 35 ARG A CD   8  
ATOM 9442  N NE   . ARG A 1 35 ? 2.925   -4.325  12.262  1.00 0.00 ? 35 ARG A NE   8  
ATOM 9443  C CZ   . ARG A 1 35 ? 2.432   -4.751  13.420  1.00 0.00 ? 35 ARG A CZ   8  
ATOM 9444  N NH1  . ARG A 1 35 ? 1.696   -3.941  14.169  1.00 0.00 ? 35 ARG A NH1  8  
ATOM 9445  N NH2  . ARG A 1 35 ? 2.674   -5.989  13.831  1.00 0.00 ? 35 ARG A NH2  8  
ATOM 9446  H H    . ARG A 1 35 ? -0.107  -0.111  10.887  1.00 0.00 ? 35 ARG A H    8  
ATOM 9447  H HA   . ARG A 1 35 ? 2.705   -0.570  11.084  1.00 0.00 ? 35 ARG A HA   8  
ATOM 9448  H HB2  . ARG A 1 35 ? 0.502   -1.748  9.412   1.00 0.00 ? 35 ARG A HB2  8  
ATOM 9449  H HB3  . ARG A 1 35 ? 2.183   -2.179  9.130   1.00 0.00 ? 35 ARG A HB3  8  
ATOM 9450  H HG2  . ARG A 1 35 ? 0.613   -2.591  11.664  1.00 0.00 ? 35 ARG A HG2  8  
ATOM 9451  H HG3  . ARG A 1 35 ? 1.163   -3.832  10.536  1.00 0.00 ? 35 ARG A HG3  8  
ATOM 9452  H HD2  . ARG A 1 35 ? 3.517   -2.730  11.069  1.00 0.00 ? 35 ARG A HD2  8  
ATOM 9453  H HD3  . ARG A 1 35 ? 2.687   -2.281  12.558  1.00 0.00 ? 35 ARG A HD3  8  
ATOM 9454  H HE   . ARG A 1 35 ? 3.466   -4.940  11.725  1.00 0.00 ? 35 ARG A HE   8  
ATOM 9455  H HH11 . ARG A 1 35 ? 1.510   -3.008  13.861  1.00 0.00 ? 35 ARG A HH11 8  
ATOM 9456  H HH12 . ARG A 1 35 ? 1.325   -4.264  15.040  1.00 0.00 ? 35 ARG A HH12 8  
ATOM 9457  H HH21 . ARG A 1 35 ? 3.229   -6.602  13.270  1.00 0.00 ? 35 ARG A HH21 8  
ATOM 9458  H HH22 . ARG A 1 35 ? 2.303   -6.308  14.703  1.00 0.00 ? 35 ARG A HH22 8  
ATOM 9459  N N    . PHE A 1 36 ? 1.526   0.863   8.357   1.00 0.00 ? 36 PHE A N    8  
ATOM 9460  C CA   . PHE A 1 36 ? 1.897   1.666   7.198   1.00 0.00 ? 36 PHE A CA   8  
ATOM 9461  C C    . PHE A 1 36 ? 2.644   2.926   7.625   1.00 0.00 ? 36 PHE A C    8  
ATOM 9462  O O    . PHE A 1 36 ? 3.452   3.466   6.871   1.00 0.00 ? 36 PHE A O    8  
ATOM 9463  C CB   . PHE A 1 36 ? 0.652   2.045   6.393   1.00 0.00 ? 36 PHE A CB   8  
ATOM 9464  C CG   . PHE A 1 36 ? 0.955   2.859   5.168   1.00 0.00 ? 36 PHE A CG   8  
ATOM 9465  C CD1  . PHE A 1 36 ? 1.464   4.142   5.282   1.00 0.00 ? 36 PHE A CD1  8  
ATOM 9466  C CD2  . PHE A 1 36 ? 0.731   2.341   3.903   1.00 0.00 ? 36 PHE A CD2  8  
ATOM 9467  C CE1  . PHE A 1 36 ? 1.743   4.894   4.156   1.00 0.00 ? 36 PHE A CE1  8  
ATOM 9468  C CE2  . PHE A 1 36 ? 1.009   3.088   2.773   1.00 0.00 ? 36 PHE A CE2  8  
ATOM 9469  C CZ   . PHE A 1 36 ? 1.516   4.366   2.900   1.00 0.00 ? 36 PHE A CZ   8  
ATOM 9470  H H    . PHE A 1 36 ? 0.578   0.680   8.528   1.00 0.00 ? 36 PHE A H    8  
ATOM 9471  H HA   . PHE A 1 36 ? 2.548   1.069   6.577   1.00 0.00 ? 36 PHE A HA   8  
ATOM 9472  H HB2  . PHE A 1 36 ? 0.149   1.144   6.076   1.00 0.00 ? 36 PHE A HB2  8  
ATOM 9473  H HB3  . PHE A 1 36 ? -0.011  2.621   7.020   1.00 0.00 ? 36 PHE A HB3  8  
ATOM 9474  H HD1  . PHE A 1 36 ? 1.644   4.557   6.263   1.00 0.00 ? 36 PHE A HD1  8  
ATOM 9475  H HD2  . PHE A 1 36 ? 0.334   1.340   3.802   1.00 0.00 ? 36 PHE A HD2  8  
ATOM 9476  H HE1  . PHE A 1 36 ? 2.141   5.893   4.258   1.00 0.00 ? 36 PHE A HE1  8  
ATOM 9477  H HE2  . PHE A 1 36 ? 0.830   2.671   1.793   1.00 0.00 ? 36 PHE A HE2  8  
ATOM 9478  H HZ   . PHE A 1 36 ? 1.733   4.951   2.019   1.00 0.00 ? 36 PHE A HZ   8  
ATOM 9479  N N    . GLU A 1 37 ? 2.365   3.388   8.840   1.00 0.00 ? 37 GLU A N    8  
ATOM 9480  C CA   . GLU A 1 37 ? 3.009   4.586   9.367   1.00 0.00 ? 37 GLU A CA   8  
ATOM 9481  C C    . GLU A 1 37 ? 4.462   4.304   9.737   1.00 0.00 ? 37 GLU A C    8  
ATOM 9482  O O    . GLU A 1 37 ? 5.375   4.998   9.290   1.00 0.00 ? 37 GLU A O    8  
ATOM 9483  C CB   . GLU A 1 37 ? 2.250   5.103   10.591  1.00 0.00 ? 37 GLU A CB   8  
ATOM 9484  C CG   . GLU A 1 37 ? 1.138   6.081   10.249  1.00 0.00 ? 37 GLU A CG   8  
ATOM 9485  C CD   . GLU A 1 37 ? 1.612   7.214   9.360   1.00 0.00 ? 37 GLU A CD   8  
ATOM 9486  O OE1  . GLU A 1 37 ? 2.254   8.150   9.883   1.00 0.00 ? 37 GLU A OE1  8  
ATOM 9487  O OE2  . GLU A 1 37 ? 1.340   7.167   8.142   1.00 0.00 ? 37 GLU A OE2  8  
ATOM 9488  H H    . GLU A 1 37 ? 1.711   2.914   9.394   1.00 0.00 ? 37 GLU A H    8  
ATOM 9489  H HA   . GLU A 1 37 ? 2.986   5.341   8.596   1.00 0.00 ? 37 GLU A HA   8  
ATOM 9490  H HB2  . GLU A 1 37 ? 1.815   4.262   11.112  1.00 0.00 ? 37 GLU A HB2  8  
ATOM 9491  H HB3  . GLU A 1 37 ? 2.948   5.599   11.248  1.00 0.00 ? 37 GLU A HB3  8  
ATOM 9492  H HG2  . GLU A 1 37 ? 0.351   5.548   9.738   1.00 0.00 ? 37 GLU A HG2  8  
ATOM 9493  H HG3  . GLU A 1 37 ? 0.751   6.500   11.167  1.00 0.00 ? 37 GLU A HG3  8  
ATOM 9494  N N    . LYS A 1 38 ? 4.669   3.280   10.558  1.00 0.00 ? 38 LYS A N    8  
ATOM 9495  C CA   . LYS A 1 38 ? 6.010   2.904   10.990  1.00 0.00 ? 38 LYS A CA   8  
ATOM 9496  C C    . LYS A 1 38 ? 6.840   2.405   9.812   1.00 0.00 ? 38 LYS A C    8  
ATOM 9497  O O    . LYS A 1 38 ? 7.972   2.844   9.610   1.00 0.00 ? 38 LYS A O    8  
ATOM 9498  C CB   . LYS A 1 38 ? 5.936   1.822   12.070  1.00 0.00 ? 38 LYS A CB   8  
ATOM 9499  C CG   . LYS A 1 38 ? 5.240   0.552   11.612  1.00 0.00 ? 38 LYS A CG   8  
ATOM 9500  C CD   . LYS A 1 38 ? 5.175   -0.480  12.725  1.00 0.00 ? 38 LYS A CD   8  
ATOM 9501  C CE   . LYS A 1 38 ? 6.401   -1.380  12.723  1.00 0.00 ? 38 LYS A CE   8  
ATOM 9502  N NZ   . LYS A 1 38 ? 7.601   -0.684  13.264  1.00 0.00 ? 38 LYS A NZ   8  
ATOM 9503  H H    . LYS A 1 38 ? 3.900   2.764   10.882  1.00 0.00 ? 38 LYS A H    8  
ATOM 9504  H HA   . LYS A 1 38 ? 6.484   3.781   11.403  1.00 0.00 ? 38 LYS A HA   8  
ATOM 9505  H HB2  . LYS A 1 38 ? 6.939   1.568   12.377  1.00 0.00 ? 38 LYS A HB2  8  
ATOM 9506  H HB3  . LYS A 1 38 ? 5.397   2.216   12.920  1.00 0.00 ? 38 LYS A HB3  8  
ATOM 9507  H HG2  . LYS A 1 38 ? 4.235   0.794   11.301  1.00 0.00 ? 38 LYS A HG2  8  
ATOM 9508  H HG3  . LYS A 1 38 ? 5.786   0.135   10.778  1.00 0.00 ? 38 LYS A HG3  8  
ATOM 9509  H HD2  . LYS A 1 38 ? 5.118   0.030   13.675  1.00 0.00 ? 38 LYS A HD2  8  
ATOM 9510  H HD3  . LYS A 1 38 ? 4.292   -1.089  12.588  1.00 0.00 ? 38 LYS A HD3  8  
ATOM 9511  H HE2  . LYS A 1 38 ? 6.195   -2.248  13.331  1.00 0.00 ? 38 LYS A HE2  8  
ATOM 9512  H HE3  . LYS A 1 38 ? 6.602   -1.691  11.708  1.00 0.00 ? 38 LYS A HE3  8  
ATOM 9513  H HZ1  . LYS A 1 38 ? 7.314   0.029   13.965  1.00 0.00 ? 38 LYS A HZ1  8  
ATOM 9514  H HZ2  . LYS A 1 38 ? 8.116   -0.210  12.494  1.00 0.00 ? 38 LYS A HZ2  8  
ATOM 9515  H HZ3  . LYS A 1 38 ? 8.236   -1.368  13.721  1.00 0.00 ? 38 LYS A HZ3  8  
ATOM 9516  N N    . GLN A 1 39 ? 6.270   1.487   9.038   1.00 0.00 ? 39 GLN A N    8  
ATOM 9517  C CA   . GLN A 1 39 ? 6.959   0.930   7.880   1.00 0.00 ? 39 GLN A CA   8  
ATOM 9518  C C    . GLN A 1 39 ? 6.207   1.250   6.593   1.00 0.00 ? 39 GLN A C    8  
ATOM 9519  O O    . GLN A 1 39 ? 5.182   0.639   6.291   1.00 0.00 ? 39 GLN A O    8  
ATOM 9520  C CB   . GLN A 1 39 ? 7.112   -0.585  8.032   1.00 0.00 ? 39 GLN A CB   8  
ATOM 9521  C CG   . GLN A 1 39 ? 8.169   -1.184  7.117   1.00 0.00 ? 39 GLN A CG   8  
ATOM 9522  C CD   . GLN A 1 39 ? 8.818   -2.421  7.707   1.00 0.00 ? 39 GLN A CD   8  
ATOM 9523  O OE1  . GLN A 1 39 ? 10.003  -2.415  8.039   1.00 0.00 ? 39 GLN A OE1  8  
ATOM 9524  N NE2  . GLN A 1 39 ? 8.042   -3.490  7.840   1.00 0.00 ? 39 GLN A NE2  8  
ATOM 9525  H H    . GLN A 1 39 ? 5.366   1.177   9.251   1.00 0.00 ? 39 GLN A H    8  
ATOM 9526  H HA   . GLN A 1 39 ? 7.940   1.378   7.831   1.00 0.00 ? 39 GLN A HA   8  
ATOM 9527  H HB2  . GLN A 1 39 ? 7.383   -0.807  9.053   1.00 0.00 ? 39 GLN A HB2  8  
ATOM 9528  H HB3  . GLN A 1 39 ? 6.166   -1.055  7.808   1.00 0.00 ? 39 GLN A HB3  8  
ATOM 9529  H HG2  . GLN A 1 39 ? 7.705   -1.452  6.180   1.00 0.00 ? 39 GLN A HG2  8  
ATOM 9530  H HG3  . GLN A 1 39 ? 8.935   -0.443  6.940   1.00 0.00 ? 39 GLN A HG3  8  
ATOM 9531  H HE21 . GLN A 1 39 ? 7.107   -3.421  7.553   1.00 0.00 ? 39 GLN A HE21 8  
ATOM 9532  H HE22 . GLN A 1 39 ? 8.435   -4.303  8.218   1.00 0.00 ? 39 GLN A HE22 8  
ATOM 9533  N N    . LYS A 1 40 ? 6.722   2.214   5.837   1.00 0.00 ? 40 LYS A N    8  
ATOM 9534  C CA   . LYS A 1 40 ? 6.100   2.616   4.581   1.00 0.00 ? 40 LYS A CA   8  
ATOM 9535  C C    . LYS A 1 40 ? 5.763   1.399   3.726   1.00 0.00 ? 40 LYS A C    8  
ATOM 9536  O O    . LYS A 1 40 ? 4.693   1.329   3.122   1.00 0.00 ? 40 LYS A O    8  
ATOM 9537  C CB   . LYS A 1 40 ? 7.028   3.556   3.807   1.00 0.00 ? 40 LYS A CB   8  
ATOM 9538  C CG   . LYS A 1 40 ? 7.337   4.848   4.543   1.00 0.00 ? 40 LYS A CG   8  
ATOM 9539  C CD   . LYS A 1 40 ? 6.206   5.853   4.404   1.00 0.00 ? 40 LYS A CD   8  
ATOM 9540  C CE   . LYS A 1 40 ? 6.359   7.004   5.387   1.00 0.00 ? 40 LYS A CE   8  
ATOM 9541  N NZ   . LYS A 1 40 ? 7.673   7.688   5.239   1.00 0.00 ? 40 LYS A NZ   8  
ATOM 9542  H H    . LYS A 1 40 ? 7.541   2.665   6.131   1.00 0.00 ? 40 LYS A H    8  
ATOM 9543  H HA   . LYS A 1 40 ? 5.186   3.140   4.816   1.00 0.00 ? 40 LYS A HA   8  
ATOM 9544  H HB2  . LYS A 1 40 ? 7.959   3.044   3.614   1.00 0.00 ? 40 LYS A HB2  8  
ATOM 9545  H HB3  . LYS A 1 40 ? 6.562   3.806   2.864   1.00 0.00 ? 40 LYS A HB3  8  
ATOM 9546  H HG2  . LYS A 1 40 ? 7.483   4.629   5.591   1.00 0.00 ? 40 LYS A HG2  8  
ATOM 9547  H HG3  . LYS A 1 40 ? 8.240   5.278   4.134   1.00 0.00 ? 40 LYS A HG3  8  
ATOM 9548  H HD2  . LYS A 1 40 ? 6.209   6.250   3.400   1.00 0.00 ? 40 LYS A HD2  8  
ATOM 9549  H HD3  . LYS A 1 40 ? 5.266   5.353   4.593   1.00 0.00 ? 40 LYS A HD3  8  
ATOM 9550  H HE2  . LYS A 1 40 ? 5.569   7.718   5.211   1.00 0.00 ? 40 LYS A HE2  8  
ATOM 9551  H HE3  . LYS A 1 40 ? 6.276   6.616   6.391   1.00 0.00 ? 40 LYS A HE3  8  
ATOM 9552  H HZ1  . LYS A 1 40 ? 8.164   7.721   6.155   1.00 0.00 ? 40 LYS A HZ1  8  
ATOM 9553  H HZ2  . LYS A 1 40 ? 7.533   8.661   4.899   1.00 0.00 ? 40 LYS A HZ2  8  
ATOM 9554  H HZ3  . LYS A 1 40 ? 8.268   7.176   4.557   1.00 0.00 ? 40 LYS A HZ3  8  
ATOM 9555  N N    . TYR A 1 41 ? 6.683   0.442   3.680   1.00 0.00 ? 41 TYR A N    8  
ATOM 9556  C CA   . TYR A 1 41 ? 6.484   -0.773  2.898   1.00 0.00 ? 41 TYR A CA   8  
ATOM 9557  C C    . TYR A 1 41 ? 6.909   -2.006  3.688   1.00 0.00 ? 41 TYR A C    8  
ATOM 9558  O O    . TYR A 1 41 ? 8.075   -2.150  4.058   1.00 0.00 ? 41 TYR A O    8  
ATOM 9559  C CB   . TYR A 1 41 ? 7.271   -0.696  1.588   1.00 0.00 ? 41 TYR A CB   8  
ATOM 9560  C CG   . TYR A 1 41 ? 7.443   0.713   1.067   1.00 0.00 ? 41 TYR A CG   8  
ATOM 9561  C CD1  . TYR A 1 41 ? 6.341   1.519   0.810   1.00 0.00 ? 41 TYR A CD1  8  
ATOM 9562  C CD2  . TYR A 1 41 ? 8.707   1.237   0.829   1.00 0.00 ? 41 TYR A CD2  8  
ATOM 9563  C CE1  . TYR A 1 41 ? 6.493   2.806   0.333   1.00 0.00 ? 41 TYR A CE1  8  
ATOM 9564  C CE2  . TYR A 1 41 ? 8.869   2.524   0.353   1.00 0.00 ? 41 TYR A CE2  8  
ATOM 9565  C CZ   . TYR A 1 41 ? 7.759   3.304   0.107   1.00 0.00 ? 41 TYR A CZ   8  
ATOM 9566  O OH   . TYR A 1 41 ? 7.916   4.586   -0.369  1.00 0.00 ? 41 TYR A OH   8  
ATOM 9567  H H    . TYR A 1 41 ? 7.517   0.555   4.182   1.00 0.00 ? 41 TYR A H    8  
ATOM 9568  H HA   . TYR A 1 41 ? 5.431   -0.851  2.669   1.00 0.00 ? 41 TYR A HA   8  
ATOM 9569  H HB2  . TYR A 1 41 ? 8.254   -1.114  1.742   1.00 0.00 ? 41 TYR A HB2  8  
ATOM 9570  H HB3  . TYR A 1 41 ? 6.755   -1.269  0.832   1.00 0.00 ? 41 TYR A HB3  8  
ATOM 9571  H HD1  . TYR A 1 41 ? 5.350   1.126   0.989   1.00 0.00 ? 41 TYR A HD1  8  
ATOM 9572  H HD2  . TYR A 1 41 ? 9.575   0.623   1.023   1.00 0.00 ? 41 TYR A HD2  8  
ATOM 9573  H HE1  . TYR A 1 41 ? 5.624   3.418   0.140   1.00 0.00 ? 41 TYR A HE1  8  
ATOM 9574  H HE2  . TYR A 1 41 ? 9.860   2.914   0.175   1.00 0.00 ? 41 TYR A HE2  8  
ATOM 9575  H HH   . TYR A 1 41 ? 8.609   4.598   -1.033  1.00 0.00 ? 41 TYR A HH   8  
ATOM 9576  N N    . LEU A 1 42 ? 5.955   -2.894  3.945   1.00 0.00 ? 42 LEU A N    8  
ATOM 9577  C CA   . LEU A 1 42 ? 6.229   -4.117  4.691   1.00 0.00 ? 42 LEU A CA   8  
ATOM 9578  C C    . LEU A 1 42 ? 6.937   -5.144  3.813   1.00 0.00 ? 42 LEU A C    8  
ATOM 9579  O O    . LEU A 1 42 ? 6.662   -5.249  2.618   1.00 0.00 ? 42 LEU A O    8  
ATOM 9580  C CB   . LEU A 1 42 ? 4.927   -4.707  5.237   1.00 0.00 ? 42 LEU A CB   8  
ATOM 9581  C CG   . LEU A 1 42 ? 4.101   -3.790  6.140   1.00 0.00 ? 42 LEU A CG   8  
ATOM 9582  C CD1  . LEU A 1 42 ? 2.649   -4.239  6.172   1.00 0.00 ? 42 LEU A CD1  8  
ATOM 9583  C CD2  . LEU A 1 42 ? 4.683   -3.761  7.546   1.00 0.00 ? 42 LEU A CD2  8  
ATOM 9584  H H    . LEU A 1 42 ? 5.045   -2.724  3.625   1.00 0.00 ? 42 LEU A H    8  
ATOM 9585  H HA   . LEU A 1 42 ? 6.874   -3.863  5.519   1.00 0.00 ? 42 LEU A HA   8  
ATOM 9586  H HB2  . LEU A 1 42 ? 4.311   -4.984  4.395   1.00 0.00 ? 42 LEU A HB2  8  
ATOM 9587  H HB3  . LEU A 1 42 ? 5.178   -5.592  5.804   1.00 0.00 ? 42 LEU A HB3  8  
ATOM 9588  H HG   . LEU A 1 42 ? 4.130   -2.784  5.744   1.00 0.00 ? 42 LEU A HG   8  
ATOM 9589  H HD11 . LEU A 1 42 ? 2.015   -3.435  5.830   1.00 0.00 ? 42 LEU A HD11 8  
ATOM 9590  H HD12 . LEU A 1 42 ? 2.377   -4.507  7.182   1.00 0.00 ? 42 LEU A HD12 8  
ATOM 9591  H HD13 . LEU A 1 42 ? 2.523   -5.096  5.526   1.00 0.00 ? 42 LEU A HD13 8  
ATOM 9592  H HD21 . LEU A 1 42 ? 5.276   -2.866  7.671   1.00 0.00 ? 42 LEU A HD21 8  
ATOM 9593  H HD22 . LEU A 1 42 ? 5.308   -4.630  7.695   1.00 0.00 ? 42 LEU A HD22 8  
ATOM 9594  H HD23 . LEU A 1 42 ? 3.880   -3.765  8.268   1.00 0.00 ? 42 LEU A HD23 8  
ATOM 9595  N N    . SER A 1 43 ? 7.848   -5.901  4.415   1.00 0.00 ? 43 SER A N    8  
ATOM 9596  C CA   . SER A 1 43 ? 8.597   -6.919  3.688   1.00 0.00 ? 43 SER A CA   8  
ATOM 9597  C C    . SER A 1 43 ? 7.678   -8.048  3.233   1.00 0.00 ? 43 SER A C    8  
ATOM 9598  O O    . SER A 1 43 ? 6.465   -8.000  3.440   1.00 0.00 ? 43 SER A O    8  
ATOM 9599  C CB   . SER A 1 43 ? 9.719   -7.481  4.564   1.00 0.00 ? 43 SER A CB   8  
ATOM 9600  O OG   . SER A 1 43 ? 10.463  -6.439  5.170   1.00 0.00 ? 43 SER A OG   8  
ATOM 9601  H H    . SER A 1 43 ? 8.023   -5.770  5.371   1.00 0.00 ? 43 SER A H    8  
ATOM 9602  H HA   . SER A 1 43 ? 9.033   -6.452  2.817   1.00 0.00 ? 43 SER A HA   8  
ATOM 9603  H HB2  . SER A 1 43 ? 9.291   -8.099  5.339   1.00 0.00 ? 43 SER A HB2  8  
ATOM 9604  H HB3  . SER A 1 43 ? 10.384  -8.076  3.955   1.00 0.00 ? 43 SER A HB3  8  
ATOM 9605  H HG   . SER A 1 43 ? 11.026  -6.023  4.513   1.00 0.00 ? 43 SER A HG   8  
ATOM 9606  N N    . THR A 1 44 ? 8.265   -9.066  2.609   1.00 0.00 ? 44 THR A N    8  
ATOM 9607  C CA   . THR A 1 44 ? 7.500   -10.207 2.123   1.00 0.00 ? 44 THR A CA   8  
ATOM 9608  C C    . THR A 1 44 ? 6.761   -10.900 3.262   1.00 0.00 ? 44 THR A C    8  
ATOM 9609  O O    . THR A 1 44 ? 5.535   -11.014 3.260   1.00 0.00 ? 44 THR A O    8  
ATOM 9610  C CB   . THR A 1 44 ? 8.408   -11.232 1.417   1.00 0.00 ? 44 THR A CB   8  
ATOM 9611  O OG1  . THR A 1 44 ? 8.472   -10.947 0.015   1.00 0.00 ? 44 THR A OG1  8  
ATOM 9612  C CG2  . THR A 1 44 ? 7.894   -12.648 1.630   1.00 0.00 ? 44 THR A CG2  8  
ATOM 9613  H H    . THR A 1 44 ? 9.235   -9.046  2.474   1.00 0.00 ? 44 THR A H    8  
ATOM 9614  H HA   . THR A 1 44 ? 6.778   -9.844  1.406   1.00 0.00 ? 44 THR A HA   8  
ATOM 9615  H HB   . THR A 1 44 ? 9.402   -11.159 1.837   1.00 0.00 ? 44 THR A HB   8  
ATOM 9616  H HG1  . THR A 1 44 ? 8.367   -10.003 -0.124  1.00 0.00 ? 44 THR A HG1  8  
ATOM 9617  H HG21 . THR A 1 44 ? 7.975   -12.907 2.675   1.00 0.00 ? 44 THR A HG21 8  
ATOM 9618  H HG22 . THR A 1 44 ? 8.481   -13.336 1.041   1.00 0.00 ? 44 THR A HG22 8  
ATOM 9619  H HG23 . THR A 1 44 ? 6.860   -12.704 1.325   1.00 0.00 ? 44 THR A HG23 8  
ATOM 9620  N N    . PRO A 1 45 ? 7.521   -11.373 4.260   1.00 0.00 ? 45 PRO A N    8  
ATOM 9621  C CA   . PRO A 1 45 ? 6.958   -12.062 5.426   1.00 0.00 ? 45 PRO A CA   8  
ATOM 9622  C C    . PRO A 1 45 ? 6.179   -11.119 6.336   1.00 0.00 ? 45 PRO A C    8  
ATOM 9623  O O    . PRO A 1 45 ? 5.084   -11.447 6.793   1.00 0.00 ? 45 PRO A O    8  
ATOM 9624  C CB   . PRO A 1 45 ? 8.194   -12.602 6.149   1.00 0.00 ? 45 PRO A CB   8  
ATOM 9625  C CG   . PRO A 1 45 ? 9.302   -11.695 5.738   1.00 0.00 ? 45 PRO A CG   8  
ATOM 9626  C CD   . PRO A 1 45 ? 8.989   -11.272 4.329   1.00 0.00 ? 45 PRO A CD   8  
ATOM 9627  H HA   . PRO A 1 45 ? 6.323   -12.884 5.132   1.00 0.00 ? 45 PRO A HA   8  
ATOM 9628  H HB2  . PRO A 1 45 ? 8.032   -12.570 7.218   1.00 0.00 ? 45 PRO A HB2  8  
ATOM 9629  H HB3  . PRO A 1 45 ? 8.382   -13.619 5.839   1.00 0.00 ? 45 PRO A HB3  8  
ATOM 9630  H HG2  . PRO A 1 45 ? 9.333   -10.835 6.389   1.00 0.00 ? 45 PRO A HG2  8  
ATOM 9631  H HG3  . PRO A 1 45 ? 10.242  -12.225 5.769   1.00 0.00 ? 45 PRO A HG3  8  
ATOM 9632  H HD2  . PRO A 1 45 ? 9.314   -10.257 4.159   1.00 0.00 ? 45 PRO A HD2  8  
ATOM 9633  H HD3  . PRO A 1 45 ? 9.454   -11.943 3.622   1.00 0.00 ? 45 PRO A HD3  8  
ATOM 9634  N N    . ASP A 1 46 ? 6.749   -9.947  6.594   1.00 0.00 ? 46 ASP A N    8  
ATOM 9635  C CA   . ASP A 1 46 ? 6.106   -8.956  7.448   1.00 0.00 ? 46 ASP A CA   8  
ATOM 9636  C C    . ASP A 1 46 ? 4.631   -8.802  7.088   1.00 0.00 ? 46 ASP A C    8  
ATOM 9637  O O    . ASP A 1 46 ? 3.751   -9.087  7.900   1.00 0.00 ? 46 ASP A O    8  
ATOM 9638  C CB   . ASP A 1 46 ? 6.817   -7.607  7.325   1.00 0.00 ? 46 ASP A CB   8  
ATOM 9639  C CG   . ASP A 1 46 ? 8.087   -7.545  8.149   1.00 0.00 ? 46 ASP A CG   8  
ATOM 9640  O OD1  . ASP A 1 46 ? 8.225   -8.355  9.089   1.00 0.00 ? 46 ASP A OD1  8  
ATOM 9641  O OD2  . ASP A 1 46 ? 8.945   -6.685  7.855   1.00 0.00 ? 46 ASP A OD2  8  
ATOM 9642  H H    . ASP A 1 46 ? 7.623   -9.744  6.199   1.00 0.00 ? 46 ASP A H    8  
ATOM 9643  H HA   . ASP A 1 46 ? 6.180   -9.299  8.469   1.00 0.00 ? 46 ASP A HA   8  
ATOM 9644  H HB2  . ASP A 1 46 ? 7.073   -7.436  6.289   1.00 0.00 ? 46 ASP A HB2  8  
ATOM 9645  H HB3  . ASP A 1 46 ? 6.152   -6.825  7.661   1.00 0.00 ? 46 ASP A HB3  8  
ATOM 9646  N N    . ARG A 1 47 ? 4.370   -8.349  5.866   1.00 0.00 ? 47 ARG A N    8  
ATOM 9647  C CA   . ARG A 1 47 ? 3.002   -8.156  5.399   1.00 0.00 ? 47 ARG A CA   8  
ATOM 9648  C C    . ARG A 1 47 ? 2.113   -9.321  5.823   1.00 0.00 ? 47 ARG A C    8  
ATOM 9649  O O    . ARG A 1 47 ? 0.980   -9.123  6.263   1.00 0.00 ? 47 ARG A O    8  
ATOM 9650  C CB   . ARG A 1 47 ? 2.976   -8.008  3.877   1.00 0.00 ? 47 ARG A CB   8  
ATOM 9651  C CG   . ARG A 1 47 ? 1.581   -7.805  3.309   1.00 0.00 ? 47 ARG A CG   8  
ATOM 9652  C CD   . ARG A 1 47 ? 1.626   -7.504  1.819   1.00 0.00 ? 47 ARG A CD   8  
ATOM 9653  N NE   . ARG A 1 47 ? 2.070   -8.656  1.040   1.00 0.00 ? 47 ARG A NE   8  
ATOM 9654  C CZ   . ARG A 1 47 ? 2.414   -8.589  -0.242  1.00 0.00 ? 47 ARG A CZ   8  
ATOM 9655  N NH1  . ARG A 1 47 ? 2.365   -7.431  -0.885  1.00 0.00 ? 47 ARG A NH1  8  
ATOM 9656  N NH2  . ARG A 1 47 ? 2.809   -9.682  -0.882  1.00 0.00 ? 47 ARG A NH2  8  
ATOM 9657  H H    . ARG A 1 47 ? 5.114   -8.139  5.264   1.00 0.00 ? 47 ARG A H    8  
ATOM 9658  H HA   . ARG A 1 47 ? 2.624   -7.249  5.847   1.00 0.00 ? 47 ARG A HA   8  
ATOM 9659  H HB2  . ARG A 1 47 ? 3.581   -7.157  3.599   1.00 0.00 ? 47 ARG A HB2  8  
ATOM 9660  H HB3  . ARG A 1 47 ? 3.397   -8.898  3.434   1.00 0.00 ? 47 ARG A HB3  8  
ATOM 9661  H HG2  . ARG A 1 47 ? 1.005   -8.705  3.465   1.00 0.00 ? 47 ARG A HG2  8  
ATOM 9662  H HG3  . ARG A 1 47 ? 1.111   -6.980  3.821   1.00 0.00 ? 47 ARG A HG3  8  
ATOM 9663  H HD2  . ARG A 1 47 ? 0.636   -7.222  1.493   1.00 0.00 ? 47 ARG A HD2  8  
ATOM 9664  H HD3  . ARG A 1 47 ? 2.307   -6.683  1.651   1.00 0.00 ? 47 ARG A HD3  8  
ATOM 9665  H HE   . ARG A 1 47 ? 2.114   -9.522  1.496   1.00 0.00 ? 47 ARG A HE   8  
ATOM 9666  H HH11 . ARG A 1 47 ? 2.069   -6.605  -0.404  1.00 0.00 ? 47 ARG A HH11 8  
ATOM 9667  H HH12 . ARG A 1 47 ? 2.625   -7.382  -1.849  1.00 0.00 ? 47 ARG A HH12 8  
ATOM 9668  H HH21 . ARG A 1 47 ? 2.847   -10.557 -0.401  1.00 0.00 ? 47 ARG A HH21 8  
ATOM 9669  H HH22 . ARG A 1 47 ? 3.067   -9.630  -1.846  1.00 0.00 ? 47 ARG A HH22 8  
ATOM 9670  N N    . ILE A 1 48 ? 2.634   -10.536 5.687   1.00 0.00 ? 48 ILE A N    8  
ATOM 9671  C CA   . ILE A 1 48 ? 1.888   -11.732 6.056   1.00 0.00 ? 48 ILE A CA   8  
ATOM 9672  C C    . ILE A 1 48 ? 1.540   -11.727 7.541   1.00 0.00 ? 48 ILE A C    8  
ATOM 9673  O O    . ILE A 1 48 ? 0.367   -11.704 7.914   1.00 0.00 ? 48 ILE A O    8  
ATOM 9674  C CB   . ILE A 1 48 ? 2.680   -13.013 5.730   1.00 0.00 ? 48 ILE A CB   8  
ATOM 9675  C CG1  . ILE A 1 48 ? 3.075   -13.032 4.253   1.00 0.00 ? 48 ILE A CG1  8  
ATOM 9676  C CG2  . ILE A 1 48 ? 1.861   -14.246 6.081   1.00 0.00 ? 48 ILE A CG2  8  
ATOM 9677  C CD1  . ILE A 1 48 ? 4.067   -14.121 3.906   1.00 0.00 ? 48 ILE A CD1  8  
ATOM 9678  H H    . ILE A 1 48 ? 3.542   -10.630 5.331   1.00 0.00 ? 48 ILE A H    8  
ATOM 9679  H HA   . ILE A 1 48 ? 0.972   -11.744 5.483   1.00 0.00 ? 48 ILE A HA   8  
ATOM 9680  H HB   . ILE A 1 48 ? 3.574   -13.020 6.335   1.00 0.00 ? 48 ILE A HB   8  
ATOM 9681  H HG12 . ILE A 1 48 ? 2.193   -13.184 3.652   1.00 0.00 ? 48 ILE A HG12 8  
ATOM 9682  H HG13 . ILE A 1 48 ? 3.521   -12.082 3.995   1.00 0.00 ? 48 ILE A HG13 8  
ATOM 9683  H HG21 . ILE A 1 48 ? 2.266   -14.706 6.971   1.00 0.00 ? 48 ILE A HG21 8  
ATOM 9684  H HG22 . ILE A 1 48 ? 0.836   -13.957 6.261   1.00 0.00 ? 48 ILE A HG22 8  
ATOM 9685  H HG23 . ILE A 1 48 ? 1.900   -14.949 5.263   1.00 0.00 ? 48 ILE A HG23 8  
ATOM 9686  H HD11 . ILE A 1 48 ? 4.664   -13.809 3.062   1.00 0.00 ? 48 ILE A HD11 8  
ATOM 9687  H HD12 . ILE A 1 48 ? 4.709   -14.307 4.754   1.00 0.00 ? 48 ILE A HD12 8  
ATOM 9688  H HD13 . ILE A 1 48 ? 3.533   -15.026 3.654   1.00 0.00 ? 48 ILE A HD13 8  
ATOM 9689  N N    . ASP A 1 49 ? 2.567   -11.747 8.383   1.00 0.00 ? 49 ASP A N    8  
ATOM 9690  C CA   . ASP A 1 49 ? 2.370   -11.742 9.828   1.00 0.00 ? 49 ASP A CA   8  
ATOM 9691  C C    . ASP A 1 49 ? 1.243   -10.791 10.220  1.00 0.00 ? 49 ASP A C    8  
ATOM 9692  O O    . ASP A 1 49 ? 0.405   -11.118 11.062  1.00 0.00 ? 49 ASP A O    8  
ATOM 9693  C CB   . ASP A 1 49 ? 3.664   -11.340 10.539  1.00 0.00 ? 49 ASP A CB   8  
ATOM 9694  C CG   . ASP A 1 49 ? 3.792   -11.973 11.910  1.00 0.00 ? 49 ASP A CG   8  
ATOM 9695  O OD1  . ASP A 1 49 ? 3.879   -13.216 11.984  1.00 0.00 ? 49 ASP A OD1  8  
ATOM 9696  O OD2  . ASP A 1 49 ? 3.804   -11.225 12.911  1.00 0.00 ? 49 ASP A OD2  8  
ATOM 9697  H H    . ASP A 1 49 ? 3.479   -11.766 8.025   1.00 0.00 ? 49 ASP A H    8  
ATOM 9698  H HA   . ASP A 1 49 ? 2.101   -12.743 10.130  1.00 0.00 ? 49 ASP A HA   8  
ATOM 9699  H HB2  . ASP A 1 49 ? 4.507   -11.650 9.940   1.00 0.00 ? 49 ASP A HB2  8  
ATOM 9700  H HB3  . ASP A 1 49 ? 3.684   -10.266 10.654  1.00 0.00 ? 49 ASP A HB3  8  
ATOM 9701  N N    . LEU A 1 50 ? 1.229   -9.614  9.605   1.00 0.00 ? 50 LEU A N    8  
ATOM 9702  C CA   . LEU A 1 50 ? 0.206   -8.614  9.890   1.00 0.00 ? 50 LEU A CA   8  
ATOM 9703  C C    . LEU A 1 50 ? -1.162  -9.082  9.405   1.00 0.00 ? 50 LEU A C    8  
ATOM 9704  O O    . LEU A 1 50 ? -2.071  -9.311  10.203  1.00 0.00 ? 50 LEU A O    8  
ATOM 9705  C CB   . LEU A 1 50 ? 0.566   -7.283  9.228   1.00 0.00 ? 50 LEU A CB   8  
ATOM 9706  C CG   . LEU A 1 50 ? -0.575  -6.276  9.080   1.00 0.00 ? 50 LEU A CG   8  
ATOM 9707  C CD1  . LEU A 1 50 ? -0.891  -5.628  10.419  1.00 0.00 ? 50 LEU A CD1  8  
ATOM 9708  C CD2  . LEU A 1 50 ? -0.222  -5.219  8.043   1.00 0.00 ? 50 LEU A CD2  8  
ATOM 9709  H H    . LEU A 1 50 ? 1.923   -9.411  8.944   1.00 0.00 ? 50 LEU A H    8  
ATOM 9710  H HA   . LEU A 1 50 ? 0.167   -8.476  10.960  1.00 0.00 ? 50 LEU A HA   8  
ATOM 9711  H HB2  . LEU A 1 50 ? 1.342   -6.820  9.818   1.00 0.00 ? 50 LEU A HB2  8  
ATOM 9712  H HB3  . LEU A 1 50 ? 0.948   -7.499  8.240   1.00 0.00 ? 50 LEU A HB3  8  
ATOM 9713  H HG   . LEU A 1 50 ? -1.462  -6.794  8.742   1.00 0.00 ? 50 LEU A HG   8  
ATOM 9714  H HD11 . LEU A 1 50 ? -1.421  -4.702  10.254  1.00 0.00 ? 50 LEU A HD11 8  
ATOM 9715  H HD12 . LEU A 1 50 ? 0.029   -5.427  10.948  1.00 0.00 ? 50 LEU A HD12 8  
ATOM 9716  H HD13 . LEU A 1 50 ? -1.505  -6.295  11.006  1.00 0.00 ? 50 LEU A HD13 8  
ATOM 9717  H HD21 . LEU A 1 50 ? -1.113  -4.934  7.504   1.00 0.00 ? 50 LEU A HD21 8  
ATOM 9718  H HD22 . LEU A 1 50 ? 0.504   -5.622  7.352   1.00 0.00 ? 50 LEU A HD22 8  
ATOM 9719  H HD23 . LEU A 1 50 ? 0.192   -4.354  8.538   1.00 0.00 ? 50 LEU A HD23 8  
ATOM 9720  N N    . ALA A 1 51 ? -1.302  -9.226  8.091   1.00 0.00 ? 51 ALA A N    8  
ATOM 9721  C CA   . ALA A 1 51 ? -2.557  -9.671  7.500   1.00 0.00 ? 51 ALA A CA   8  
ATOM 9722  C C    . ALA A 1 51 ? -3.218  -10.744 8.358   1.00 0.00 ? 51 ALA A C    8  
ATOM 9723  O O    . ALA A 1 51 ? -4.441  -10.877 8.367   1.00 0.00 ? 51 ALA A O    8  
ATOM 9724  C CB   . ALA A 1 51 ? -2.321  -10.192 6.090   1.00 0.00 ? 51 ALA A CB   8  
ATOM 9725  H H    . ALA A 1 51 ? -0.541  -9.028  7.506   1.00 0.00 ? 51 ALA A H    8  
ATOM 9726  H HA   . ALA A 1 51 ? -3.217  -8.818  7.436   1.00 0.00 ? 51 ALA A HA   8  
ATOM 9727  H HB1  . ALA A 1 51 ? -3.243  -10.140 5.529   1.00 0.00 ? 51 ALA A HB1  8  
ATOM 9728  H HB2  . ALA A 1 51 ? -1.569  -9.588  5.604   1.00 0.00 ? 51 ALA A HB2  8  
ATOM 9729  H HB3  . ALA A 1 51 ? -1.986  -11.217 6.137   1.00 0.00 ? 51 ALA A HB3  8  
ATOM 9730  N N    . GLU A 1 52 ? -2.401  -11.506 9.078   1.00 0.00 ? 52 GLU A N    8  
ATOM 9731  C CA   . GLU A 1 52 ? -2.908  -12.569 9.939   1.00 0.00 ? 52 GLU A CA   8  
ATOM 9732  C C    . GLU A 1 52 ? -3.394  -12.004 11.271  1.00 0.00 ? 52 GLU A C    8  
ATOM 9733  O O    . GLU A 1 52 ? -4.441  -12.402 11.780  1.00 0.00 ? 52 GLU A O    8  
ATOM 9734  C CB   . GLU A 1 52 ? -1.823  -13.619 10.182  1.00 0.00 ? 52 GLU A CB   8  
ATOM 9735  C CG   . GLU A 1 52 ? -1.796  -14.721 9.136   1.00 0.00 ? 52 GLU A CG   8  
ATOM 9736  C CD   . GLU A 1 52 ? -3.004  -15.634 9.219   1.00 0.00 ? 52 GLU A CD   8  
ATOM 9737  O OE1  . GLU A 1 52 ? -3.191  -16.275 10.275  1.00 0.00 ? 52 GLU A OE1  8  
ATOM 9738  O OE2  . GLU A 1 52 ? -3.762  -15.707 8.230   1.00 0.00 ? 52 GLU A OE2  8  
ATOM 9739  H H    . GLU A 1 52 ? -1.435  -11.351 9.028   1.00 0.00 ? 52 GLU A H    8  
ATOM 9740  H HA   . GLU A 1 52 ? -3.741  -13.035 9.434   1.00 0.00 ? 52 GLU A HA   8  
ATOM 9741  H HB2  . GLU A 1 52 ? -0.860  -13.131 10.186  1.00 0.00 ? 52 GLU A HB2  8  
ATOM 9742  H HB3  . GLU A 1 52 ? -1.990  -14.073 11.148  1.00 0.00 ? 52 GLU A HB3  8  
ATOM 9743  H HG2  . GLU A 1 52 ? -1.773  -14.269 8.156   1.00 0.00 ? 52 GLU A HG2  8  
ATOM 9744  H HG3  . GLU A 1 52 ? -0.905  -15.314 9.279   1.00 0.00 ? 52 GLU A HG3  8  
ATOM 9745  N N    . SER A 1 53 ? -2.624  -11.076 11.829  1.00 0.00 ? 53 SER A N    8  
ATOM 9746  C CA   . SER A 1 53 ? -2.973  -10.459 13.104  1.00 0.00 ? 53 SER A CA   8  
ATOM 9747  C C    . SER A 1 53 ? -4.364  -9.835  13.043  1.00 0.00 ? 53 SER A C    8  
ATOM 9748  O O    . SER A 1 53 ? -5.205  -10.078 13.910  1.00 0.00 ? 53 SER A O    8  
ATOM 9749  C CB   . SER A 1 53 ? -1.940  -9.395  13.479  1.00 0.00 ? 53 SER A CB   8  
ATOM 9750  O OG   . SER A 1 53 ? -0.668  -9.977  13.707  1.00 0.00 ? 53 SER A OG   8  
ATOM 9751  H H    . SER A 1 53 ? -1.801  -10.800 11.374  1.00 0.00 ? 53 SER A H    8  
ATOM 9752  H HA   . SER A 1 53 ? -2.971  -11.233 13.857  1.00 0.00 ? 53 SER A HA   8  
ATOM 9753  H HB2  . SER A 1 53 ? -1.856  -8.679  12.676  1.00 0.00 ? 53 SER A HB2  8  
ATOM 9754  H HB3  . SER A 1 53 ? -2.258  -8.891  14.380  1.00 0.00 ? 53 SER A HB3  8  
ATOM 9755  H HG   . SER A 1 53 ? -0.188  -10.033 12.877  1.00 0.00 ? 53 SER A HG   8  
ATOM 9756  N N    . LEU A 1 54 ? -4.599  -9.029  12.014  1.00 0.00 ? 54 LEU A N    8  
ATOM 9757  C CA   . LEU A 1 54 ? -5.887  -8.368  11.838  1.00 0.00 ? 54 LEU A CA   8  
ATOM 9758  C C    . LEU A 1 54 ? -6.885  -9.295  11.149  1.00 0.00 ? 54 LEU A C    8  
ATOM 9759  O O    . LEU A 1 54 ? -8.096  -9.137  11.294  1.00 0.00 ? 54 LEU A O    8  
ATOM 9760  C CB   . LEU A 1 54 ? -5.718  -7.086  11.022  1.00 0.00 ? 54 LEU A CB   8  
ATOM 9761  C CG   . LEU A 1 54 ? -4.864  -5.991  11.662  1.00 0.00 ? 54 LEU A CG   8  
ATOM 9762  C CD1  . LEU A 1 54 ? -4.671  -4.831  10.696  1.00 0.00 ? 54 LEU A CD1  8  
ATOM 9763  C CD2  . LEU A 1 54 ? -5.498  -5.509  12.958  1.00 0.00 ? 54 LEU A CD2  8  
ATOM 9764  H H    . LEU A 1 54 ? -3.890  -8.874  11.356  1.00 0.00 ? 54 LEU A H    8  
ATOM 9765  H HA   . LEU A 1 54 ? -6.266  -8.115  12.817  1.00 0.00 ? 54 LEU A HA   8  
ATOM 9766  H HB2  . LEU A 1 54 ? -5.264  -7.351  10.079  1.00 0.00 ? 54 LEU A HB2  8  
ATOM 9767  H HB3  . LEU A 1 54 ? -6.702  -6.676  10.843  1.00 0.00 ? 54 LEU A HB3  8  
ATOM 9768  H HG   . LEU A 1 54 ? -3.888  -6.395  11.896  1.00 0.00 ? 54 LEU A HG   8  
ATOM 9769  H HD11 . LEU A 1 54 ? -5.358  -4.037  10.946  1.00 0.00 ? 54 LEU A HD11 8  
ATOM 9770  H HD12 . LEU A 1 54 ? -4.861  -5.168  9.688   1.00 0.00 ? 54 LEU A HD12 8  
ATOM 9771  H HD13 . LEU A 1 54 ? -3.657  -4.468  10.769  1.00 0.00 ? 54 LEU A HD13 8  
ATOM 9772  H HD21 . LEU A 1 54 ? -5.637  -6.347  13.624  1.00 0.00 ? 54 LEU A HD21 8  
ATOM 9773  H HD22 . LEU A 1 54 ? -6.456  -5.057  12.744  1.00 0.00 ? 54 LEU A HD22 8  
ATOM 9774  H HD23 . LEU A 1 54 ? -4.852  -4.780  13.425  1.00 0.00 ? 54 LEU A HD23 8  
ATOM 9775  N N    . GLY A 1 55 ? -6.366  -10.264 10.401  1.00 0.00 ? 55 GLY A N    8  
ATOM 9776  C CA   . GLY A 1 55 ? -7.225  -11.203 9.703   1.00 0.00 ? 55 GLY A CA   8  
ATOM 9777  C C    . GLY A 1 55 ? -7.335  -10.897 8.223   1.00 0.00 ? 55 GLY A C    8  
ATOM 9778  O O    . GLY A 1 55 ? -7.972  -11.639 7.474   1.00 0.00 ? 55 GLY A O    8  
ATOM 9779  H H    . GLY A 1 55 ? -5.392  -10.342 10.323  1.00 0.00 ? 55 GLY A H    8  
ATOM 9780  H HA2  . GLY A 1 55 ? -6.826  -12.199 9.826   1.00 0.00 ? 55 GLY A HA2  8  
ATOM 9781  H HA3  . GLY A 1 55 ? -8.211  -11.165 10.141  1.00 0.00 ? 55 GLY A HA3  8  
ATOM 9782  N N    . LEU A 1 56 ? -6.716  -9.801  7.799   1.00 0.00 ? 56 LEU A N    8  
ATOM 9783  C CA   . LEU A 1 56 ? -6.749  -9.398  6.397   1.00 0.00 ? 56 LEU A CA   8  
ATOM 9784  C C    . LEU A 1 56 ? -5.832  -10.279 5.555   1.00 0.00 ? 56 LEU A C    8  
ATOM 9785  O O    . LEU A 1 56 ? -5.125  -11.139 6.082   1.00 0.00 ? 56 LEU A O    8  
ATOM 9786  C CB   . LEU A 1 56 ? -6.334  -7.932  6.258   1.00 0.00 ? 56 LEU A CB   8  
ATOM 9787  C CG   . LEU A 1 56 ? -7.222  -6.913  6.975   1.00 0.00 ? 56 LEU A CG   8  
ATOM 9788  C CD1  . LEU A 1 56 ? -6.543  -5.553  7.020   1.00 0.00 ? 56 LEU A CD1  8  
ATOM 9789  C CD2  . LEU A 1 56 ? -8.577  -6.812  6.291   1.00 0.00 ? 56 LEU A CD2  8  
ATOM 9790  H H    . LEU A 1 56 ? -6.224  -9.250  8.442   1.00 0.00 ? 56 LEU A H    8  
ATOM 9791  H HA   . LEU A 1 56 ? -7.762  -9.512  6.043   1.00 0.00 ? 56 LEU A HA   8  
ATOM 9792  H HB2  . LEU A 1 56 ? -5.334  -7.832  6.651   1.00 0.00 ? 56 LEU A HB2  8  
ATOM 9793  H HB3  . LEU A 1 56 ? -6.332  -7.688  5.205   1.00 0.00 ? 56 LEU A HB3  8  
ATOM 9794  H HG   . LEU A 1 56 ? -7.383  -7.239  7.993   1.00 0.00 ? 56 LEU A HG   8  
ATOM 9795  H HD11 . LEU A 1 56 ? -6.593  -5.159  8.024   1.00 0.00 ? 56 LEU A HD11 8  
ATOM 9796  H HD12 . LEU A 1 56 ? -7.045  -4.877  6.343   1.00 0.00 ? 56 LEU A HD12 8  
ATOM 9797  H HD13 . LEU A 1 56 ? -5.509  -5.656  6.725   1.00 0.00 ? 56 LEU A HD13 8  
ATOM 9798  H HD21 . LEU A 1 56 ? -8.440  -6.506  5.264   1.00 0.00 ? 56 LEU A HD21 8  
ATOM 9799  H HD22 . LEU A 1 56 ? -9.187  -6.083  6.805   1.00 0.00 ? 56 LEU A HD22 8  
ATOM 9800  H HD23 . LEU A 1 56 ? -9.067  -7.774  6.318   1.00 0.00 ? 56 LEU A HD23 8  
ATOM 9801  N N    . SER A 1 57 ? -5.846  -10.057 4.245   1.00 0.00 ? 57 SER A N    8  
ATOM 9802  C CA   . SER A 1 57 ? -5.017  -10.832 3.329   1.00 0.00 ? 57 SER A CA   8  
ATOM 9803  C C    . SER A 1 57 ? -3.828  -10.009 2.844   1.00 0.00 ? 57 SER A C    8  
ATOM 9804  O O    . SER A 1 57 ? -3.799  -8.789  3.002   1.00 0.00 ? 57 SER A O    8  
ATOM 9805  C CB   . SER A 1 57 ? -5.846  -11.306 2.134   1.00 0.00 ? 57 SER A CB   8  
ATOM 9806  O OG   . SER A 1 57 ? -6.812  -12.264 2.530   1.00 0.00 ? 57 SER A OG   8  
ATOM 9807  H H    . SER A 1 57 ? -6.431  -9.358  3.885   1.00 0.00 ? 57 SER A H    8  
ATOM 9808  H HA   . SER A 1 57 ? -4.648  -11.694 3.865   1.00 0.00 ? 57 SER A HA   8  
ATOM 9809  H HB2  . SER A 1 57 ? -6.353  -10.461 1.693   1.00 0.00 ? 57 SER A HB2  8  
ATOM 9810  H HB3  . SER A 1 57 ? -5.191  -11.755 1.401   1.00 0.00 ? 57 SER A HB3  8  
ATOM 9811  H HG   . SER A 1 57 ? -7.662  -11.832 2.645   1.00 0.00 ? 57 SER A HG   8  
ATOM 9812  N N    . GLN A 1 58 ? -2.850  -10.686 2.251   1.00 0.00 ? 58 GLN A N    8  
ATOM 9813  C CA   . GLN A 1 58 ? -1.658  -10.017 1.743   1.00 0.00 ? 58 GLN A CA   8  
ATOM 9814  C C    . GLN A 1 58 ? -2.031  -8.895  0.781   1.00 0.00 ? 58 GLN A C    8  
ATOM 9815  O O    . GLN A 1 58 ? -1.385  -7.847  0.752   1.00 0.00 ? 58 GLN A O    8  
ATOM 9816  C CB   . GLN A 1 58 ? -0.743  -11.023 1.042   1.00 0.00 ? 58 GLN A CB   8  
ATOM 9817  C CG   . GLN A 1 58 ? -0.337  -12.193 1.923   1.00 0.00 ? 58 GLN A CG   8  
ATOM 9818  C CD   . GLN A 1 58 ? 0.274   -13.334 1.134   1.00 0.00 ? 58 GLN A CD   8  
ATOM 9819  O OE1  . GLN A 1 58 ? -0.436  -14.123 0.510   1.00 0.00 ? 58 GLN A OE1  8  
ATOM 9820  N NE2  . GLN A 1 58 ? 1.599   -13.427 1.156   1.00 0.00 ? 58 GLN A NE2  8  
ATOM 9821  H H    . GLN A 1 58 ? -2.931  -11.657 2.155   1.00 0.00 ? 58 GLN A H    8  
ATOM 9822  H HA   . GLN A 1 58 ? -1.132  -9.592  2.585   1.00 0.00 ? 58 GLN A HA   8  
ATOM 9823  H HB2  . GLN A 1 58 ? -1.254  -11.414 0.175   1.00 0.00 ? 58 GLN A HB2  8  
ATOM 9824  H HB3  . GLN A 1 58 ? 0.154   -10.514 0.722   1.00 0.00 ? 58 GLN A HB3  8  
ATOM 9825  H HG2  . GLN A 1 58 ? 0.388   -11.849 2.646   1.00 0.00 ? 58 GLN A HG2  8  
ATOM 9826  H HG3  . GLN A 1 58 ? -1.212  -12.560 2.439   1.00 0.00 ? 58 GLN A HG3  8  
ATOM 9827  H HE21 . GLN A 1 58 ? 2.100   -12.764 1.676   1.00 0.00 ? 58 GLN A HE21 8  
ATOM 9828  H HE22 . GLN A 1 58 ? 2.020   -14.156 0.655   1.00 0.00 ? 58 GLN A HE22 8  
ATOM 9829  N N    . LEU A 1 59 ? -3.077  -9.121  -0.006  1.00 0.00 ? 59 LEU A N    8  
ATOM 9830  C CA   . LEU A 1 59 ? -3.538  -8.129  -0.971  1.00 0.00 ? 59 LEU A CA   8  
ATOM 9831  C C    . LEU A 1 59 ? -3.866  -6.809  -0.281  1.00 0.00 ? 59 LEU A C    8  
ATOM 9832  O O    . LEU A 1 59 ? -3.266  -5.777  -0.579  1.00 0.00 ? 59 LEU A O    8  
ATOM 9833  C CB   . LEU A 1 59 ? -4.769  -8.647  -1.717  1.00 0.00 ? 59 LEU A CB   8  
ATOM 9834  C CG   . LEU A 1 59 ? -5.234  -7.808  -2.908  1.00 0.00 ? 59 LEU A CG   8  
ATOM 9835  C CD1  . LEU A 1 59 ? -4.112  -7.651  -3.922  1.00 0.00 ? 59 LEU A CD1  8  
ATOM 9836  C CD2  . LEU A 1 59 ? -6.458  -8.437  -3.558  1.00 0.00 ? 59 LEU A CD2  8  
ATOM 9837  H H    . LEU A 1 59 ? -3.552  -9.976  0.063   1.00 0.00 ? 59 LEU A H    8  
ATOM 9838  H HA   . LEU A 1 59 ? -2.741  -7.962  -1.681  1.00 0.00 ? 59 LEU A HA   8  
ATOM 9839  H HB2  . LEU A 1 59 ? -4.543  -9.638  -2.080  1.00 0.00 ? 59 LEU A HB2  8  
ATOM 9840  H HB3  . LEU A 1 59 ? -5.584  -8.701  -1.010  1.00 0.00 ? 59 LEU A HB3  8  
ATOM 9841  H HG   . LEU A 1 59 ? -5.509  -6.822  -2.560  1.00 0.00 ? 59 LEU A HG   8  
ATOM 9842  H HD11 . LEU A 1 59 ? -3.335  -8.371  -3.713  1.00 0.00 ? 59 LEU A HD11 8  
ATOM 9843  H HD12 . LEU A 1 59 ? -3.705  -6.653  -3.856  1.00 0.00 ? 59 LEU A HD12 8  
ATOM 9844  H HD13 . LEU A 1 59 ? -4.500  -7.817  -4.916  1.00 0.00 ? 59 LEU A HD13 8  
ATOM 9845  H HD21 . LEU A 1 59 ? -6.175  -9.363  -4.036  1.00 0.00 ? 59 LEU A HD21 8  
ATOM 9846  H HD22 . LEU A 1 59 ? -6.862  -7.760  -4.296  1.00 0.00 ? 59 LEU A HD22 8  
ATOM 9847  H HD23 . LEU A 1 59 ? -7.205  -8.635  -2.803  1.00 0.00 ? 59 LEU A HD23 8  
ATOM 9848  N N    . GLN A 1 60 ? -4.820  -6.852  0.644   1.00 0.00 ? 60 GLN A N    8  
ATOM 9849  C CA   . GLN A 1 60 ? -5.225  -5.659  1.378   1.00 0.00 ? 60 GLN A CA   8  
ATOM 9850  C C    . GLN A 1 60 ? -4.035  -4.737  1.620   1.00 0.00 ? 60 GLN A C    8  
ATOM 9851  O O    . GLN A 1 60 ? -3.989  -3.617  1.111   1.00 0.00 ? 60 GLN A O    8  
ATOM 9852  C CB   . GLN A 1 60 ? -5.864  -6.048  2.712   1.00 0.00 ? 60 GLN A CB   8  
ATOM 9853  C CG   . GLN A 1 60 ? -7.131  -6.876  2.562   1.00 0.00 ? 60 GLN A CG   8  
ATOM 9854  C CD   . GLN A 1 60 ? -8.291  -6.072  2.008   1.00 0.00 ? 60 GLN A CD   8  
ATOM 9855  O OE1  . GLN A 1 60 ? -8.139  -5.327  1.040   1.00 0.00 ? 60 GLN A OE1  8  
ATOM 9856  N NE2  . GLN A 1 60 ? -9.459  -6.219  2.621   1.00 0.00 ? 60 GLN A NE2  8  
ATOM 9857  H H    . GLN A 1 60 ? -5.261  -7.705  0.836   1.00 0.00 ? 60 GLN A H    8  
ATOM 9858  H HA   . GLN A 1 60 ? -5.955  -5.134  0.779   1.00 0.00 ? 60 GLN A HA   8  
ATOM 9859  H HB2  . GLN A 1 60 ? -5.151  -6.621  3.285   1.00 0.00 ? 60 GLN A HB2  8  
ATOM 9860  H HB3  . GLN A 1 60 ? -6.111  -5.148  3.255   1.00 0.00 ? 60 GLN A HB3  8  
ATOM 9861  H HG2  . GLN A 1 60 ? -6.930  -7.698  1.891   1.00 0.00 ? 60 GLN A HG2  8  
ATOM 9862  H HG3  . GLN A 1 60 ? -7.409  -7.262  3.531   1.00 0.00 ? 60 GLN A HG3  8  
ATOM 9863  H HE21 . GLN A 1 60 ? -9.506  -6.829  3.388   1.00 0.00 ? 60 GLN A HE21 8  
ATOM 9864  H HE22 . GLN A 1 60 ? -10.226 -5.711  2.285   1.00 0.00 ? 60 GLN A HE22 8  
ATOM 9865  N N    . VAL A 1 61 ? -3.071  -5.216  2.401   1.00 0.00 ? 61 VAL A N    8  
ATOM 9866  C CA   . VAL A 1 61 ? -1.879  -4.436  2.711   1.00 0.00 ? 61 VAL A CA   8  
ATOM 9867  C C    . VAL A 1 61 ? -1.198  -3.945  1.438   1.00 0.00 ? 61 VAL A C    8  
ATOM 9868  O O    . VAL A 1 61 ? -0.993  -2.745  1.253   1.00 0.00 ? 61 VAL A O    8  
ATOM 9869  C CB   . VAL A 1 61 ? -0.871  -5.256  3.537   1.00 0.00 ? 61 VAL A CB   8  
ATOM 9870  C CG1  . VAL A 1 61 ? 0.374   -4.432  3.830   1.00 0.00 ? 61 VAL A CG1  8  
ATOM 9871  C CG2  . VAL A 1 61 ? -1.512  -5.745  4.826   1.00 0.00 ? 61 VAL A CG2  8  
ATOM 9872  H H    . VAL A 1 61 ? -3.165  -6.116  2.778   1.00 0.00 ? 61 VAL A H    8  
ATOM 9873  H HA   . VAL A 1 61 ? -2.183  -3.581  3.298   1.00 0.00 ? 61 VAL A HA   8  
ATOM 9874  H HB   . VAL A 1 61 ? -0.576  -6.117  2.956   1.00 0.00 ? 61 VAL A HB   8  
ATOM 9875  H HG11 . VAL A 1 61 ? 1.241   -4.934  3.425   1.00 0.00 ? 61 VAL A HG11 8  
ATOM 9876  H HG12 . VAL A 1 61 ? 0.276   -3.457  3.376   1.00 0.00 ? 61 VAL A HG12 8  
ATOM 9877  H HG13 . VAL A 1 61 ? 0.489   -4.322  4.898   1.00 0.00 ? 61 VAL A HG13 8  
ATOM 9878  H HG21 . VAL A 1 61 ? -2.347  -5.108  5.077   1.00 0.00 ? 61 VAL A HG21 8  
ATOM 9879  H HG22 . VAL A 1 61 ? -1.861  -6.759  4.693   1.00 0.00 ? 61 VAL A HG22 8  
ATOM 9880  H HG23 . VAL A 1 61 ? -0.784  -5.718  5.624   1.00 0.00 ? 61 VAL A HG23 8  
ATOM 9881  N N    . LYS A 1 62 ? -0.849  -4.881  0.562   1.00 0.00 ? 62 LYS A N    8  
ATOM 9882  C CA   . LYS A 1 62 ? -0.192  -4.546  -0.695  1.00 0.00 ? 62 LYS A CA   8  
ATOM 9883  C C    . LYS A 1 62 ? -0.906  -3.391  -1.391  1.00 0.00 ? 62 LYS A C    8  
ATOM 9884  O O    . LYS A 1 62 ? -0.342  -2.309  -1.558  1.00 0.00 ? 62 LYS A O    8  
ATOM 9885  C CB   . LYS A 1 62 ? -0.155  -5.767  -1.617  1.00 0.00 ? 62 LYS A CB   8  
ATOM 9886  C CG   . LYS A 1 62 ? 0.721   -5.577  -2.843  1.00 0.00 ? 62 LYS A CG   8  
ATOM 9887  C CD   . LYS A 1 62 ? 0.414   -6.611  -3.913  1.00 0.00 ? 62 LYS A CD   8  
ATOM 9888  C CE   . LYS A 1 62 ? 0.727   -6.083  -5.305  1.00 0.00 ? 62 LYS A CE   8  
ATOM 9889  N NZ   . LYS A 1 62 ? 0.225   -6.995  -6.370  1.00 0.00 ? 62 LYS A NZ   8  
ATOM 9890  H H    . LYS A 1 62 ? -1.039  -5.821  0.766   1.00 0.00 ? 62 LYS A H    8  
ATOM 9891  H HA   . LYS A 1 62 ? 0.820   -4.244  -0.471  1.00 0.00 ? 62 LYS A HA   8  
ATOM 9892  H HB2  . LYS A 1 62 ? 0.220   -6.612  -1.060  1.00 0.00 ? 62 LYS A HB2  8  
ATOM 9893  H HB3  . LYS A 1 62 ? -1.160  -5.982  -1.949  1.00 0.00 ? 62 LYS A HB3  8  
ATOM 9894  H HG2  . LYS A 1 62 ? 0.548   -4.592  -3.250  1.00 0.00 ? 62 LYS A HG2  8  
ATOM 9895  H HG3  . LYS A 1 62 ? 1.758   -5.671  -2.552  1.00 0.00 ? 62 LYS A HG3  8  
ATOM 9896  H HD2  . LYS A 1 62 ? 1.012   -7.492  -3.733  1.00 0.00 ? 62 LYS A HD2  8  
ATOM 9897  H HD3  . LYS A 1 62 ? -0.634  -6.869  -3.862  1.00 0.00 ? 62 LYS A HD3  8  
ATOM 9898  H HE2  . LYS A 1 62 ? 0.261   -5.117  -5.422  1.00 0.00 ? 62 LYS A HE2  8  
ATOM 9899  H HE3  . LYS A 1 62 ? 1.797   -5.981  -5.405  1.00 0.00 ? 62 LYS A HE3  8  
ATOM 9900  H HZ1  . LYS A 1 62 ? 1.023   -7.385  -6.911  1.00 0.00 ? 62 LYS A HZ1  8  
ATOM 9901  H HZ2  . LYS A 1 62 ? -0.399  -6.477  -7.020  1.00 0.00 ? 62 LYS A HZ2  8  
ATOM 9902  H HZ3  . LYS A 1 62 ? -0.309  -7.780  -5.946  1.00 0.00 ? 62 LYS A HZ3  8  
ATOM 9903  N N    . THR A 1 63 ? -2.150  -3.628  -1.795  1.00 0.00 ? 63 THR A N    8  
ATOM 9904  C CA   . THR A 1 63 ? -2.941  -2.609  -2.473  1.00 0.00 ? 63 THR A CA   8  
ATOM 9905  C C    . THR A 1 63 ? -3.142  -1.388  -1.583  1.00 0.00 ? 63 THR A C    8  
ATOM 9906  O O    . THR A 1 63 ? -2.678  -0.293  -1.901  1.00 0.00 ? 63 THR A O    8  
ATOM 9907  C CB   . THR A 1 63 ? -4.318  -3.155  -2.895  1.00 0.00 ? 63 THR A CB   8  
ATOM 9908  O OG1  . THR A 1 63 ? -4.155  -4.346  -3.672  1.00 0.00 ? 63 THR A OG1  8  
ATOM 9909  C CG2  . THR A 1 63 ? -5.087  -2.118  -3.701  1.00 0.00 ? 63 THR A CG2  8  
ATOM 9910  H H    . THR A 1 63 ? -2.544  -4.511  -1.633  1.00 0.00 ? 63 THR A H    8  
ATOM 9911  H HA   . THR A 1 63 ? -2.407  -2.309  -3.363  1.00 0.00 ? 63 THR A HA   8  
ATOM 9912  H HB   . THR A 1 63 ? -4.884  -3.389  -2.004  1.00 0.00 ? 63 THR A HB   8  
ATOM 9913  H HG1  . THR A 1 63 ? -5.015  -4.653  -3.971  1.00 0.00 ? 63 THR A HG1  8  
ATOM 9914  H HG21 . THR A 1 63 ? -5.796  -2.617  -4.344  1.00 0.00 ? 63 THR A HG21 8  
ATOM 9915  H HG22 . THR A 1 63 ? -4.397  -1.545  -4.301  1.00 0.00 ? 63 THR A HG22 8  
ATOM 9916  H HG23 . THR A 1 63 ? -5.614  -1.459  -3.028  1.00 0.00 ? 63 THR A HG23 8  
ATOM 9917  N N    . TRP A 1 64 ? -3.835  -1.583  -0.467  1.00 0.00 ? 64 TRP A N    8  
ATOM 9918  C CA   . TRP A 1 64 ? -4.097  -0.496  0.470   1.00 0.00 ? 64 TRP A CA   8  
ATOM 9919  C C    . TRP A 1 64 ? -2.891  0.430   0.581   1.00 0.00 ? 64 TRP A C    8  
ATOM 9920  O O    . TRP A 1 64 ? -3.023  1.651   0.494   1.00 0.00 ? 64 TRP A O    8  
ATOM 9921  C CB   . TRP A 1 64 ? -4.452  -1.057  1.848   1.00 0.00 ? 64 TRP A CB   8  
ATOM 9922  C CG   . TRP A 1 64 ? -5.058  -0.039  2.766   1.00 0.00 ? 64 TRP A CG   8  
ATOM 9923  C CD1  . TRP A 1 64 ? -6.338  0.437   2.731   1.00 0.00 ? 64 TRP A CD1  8  
ATOM 9924  C CD2  . TRP A 1 64 ? -4.409  0.629   3.853   1.00 0.00 ? 64 TRP A CD2  8  
ATOM 9925  N NE1  . TRP A 1 64 ? -6.523  1.362   3.731   1.00 0.00 ? 64 TRP A NE1  8  
ATOM 9926  C CE2  . TRP A 1 64 ? -5.355  1.496   4.434   1.00 0.00 ? 64 TRP A CE2  8  
ATOM 9927  C CE3  . TRP A 1 64 ? -3.121  0.578   4.393   1.00 0.00 ? 64 TRP A CE3  8  
ATOM 9928  C CZ2  . TRP A 1 64 ? -5.051  2.304   5.526   1.00 0.00 ? 64 TRP A CZ2  8  
ATOM 9929  C CZ3  . TRP A 1 64 ? -2.821  1.381   5.477   1.00 0.00 ? 64 TRP A CZ3  8  
ATOM 9930  C CH2  . TRP A 1 64 ? -3.782  2.234   6.035   1.00 0.00 ? 64 TRP A CH2  8  
ATOM 9931  H H    . TRP A 1 64 ? -4.179  -2.479  -0.268  1.00 0.00 ? 64 TRP A H    8  
ATOM 9932  H HA   . TRP A 1 64 ? -4.937  0.070   0.094   1.00 0.00 ? 64 TRP A HA   8  
ATOM 9933  H HB2  . TRP A 1 64 ? -5.161  -1.863  1.730   1.00 0.00 ? 64 TRP A HB2  8  
ATOM 9934  H HB3  . TRP A 1 64 ? -3.556  -1.437  2.316   1.00 0.00 ? 64 TRP A HB3  8  
ATOM 9935  H HD1  . TRP A 1 64 ? -7.083  0.126   2.016   1.00 0.00 ? 64 TRP A HD1  8  
ATOM 9936  H HE1  . TRP A 1 64 ? -7.357  1.844   3.912   1.00 0.00 ? 64 TRP A HE1  8  
ATOM 9937  H HE3  . TRP A 1 64 ? -2.366  -0.073  3.977   1.00 0.00 ? 64 TRP A HE3  8  
ATOM 9938  H HZ2  . TRP A 1 64 ? -5.781  2.967   5.968   1.00 0.00 ? 64 TRP A HZ2  8  
ATOM 9939  H HZ3  . TRP A 1 64 ? -1.831  1.355   5.908   1.00 0.00 ? 64 TRP A HZ3  8  
ATOM 9940  H HH2  . TRP A 1 64 ? -3.504  2.843   6.881   1.00 0.00 ? 64 TRP A HH2  8  
ATOM 9941  N N    . TYR A 1 65 ? -1.715  -0.158  0.771   1.00 0.00 ? 65 TYR A N    8  
ATOM 9942  C CA   . TYR A 1 65 ? -0.485  0.616   0.895   1.00 0.00 ? 65 TYR A CA   8  
ATOM 9943  C C    . TYR A 1 65 ? -0.257  1.479   -0.342  1.00 0.00 ? 65 TYR A C    8  
ATOM 9944  O O    . TYR A 1 65 ? -0.131  2.699   -0.246  1.00 0.00 ? 65 TYR A O    8  
ATOM 9945  C CB   . TYR A 1 65 ? 0.709   -0.316  1.108   1.00 0.00 ? 65 TYR A CB   8  
ATOM 9946  C CG   . TYR A 1 65 ? 1.016   -0.584  2.564   1.00 0.00 ? 65 TYR A CG   8  
ATOM 9947  C CD1  . TYR A 1 65 ? 0.030   -1.038  3.431   1.00 0.00 ? 65 TYR A CD1  8  
ATOM 9948  C CD2  . TYR A 1 65 ? 2.294   -0.384  3.073   1.00 0.00 ? 65 TYR A CD2  8  
ATOM 9949  C CE1  . TYR A 1 65 ? 0.306   -1.283  4.762   1.00 0.00 ? 65 TYR A CE1  8  
ATOM 9950  C CE2  . TYR A 1 65 ? 2.579   -0.628  4.402   1.00 0.00 ? 65 TYR A CE2  8  
ATOM 9951  C CZ   . TYR A 1 65 ? 1.582   -1.077  5.243   1.00 0.00 ? 65 TYR A CZ   8  
ATOM 9952  O OH   . TYR A 1 65 ? 1.862   -1.321  6.568   1.00 0.00 ? 65 TYR A OH   8  
ATOM 9953  H H    . TYR A 1 65 ? -1.673  -1.135  0.832   1.00 0.00 ? 65 TYR A H    8  
ATOM 9954  H HA   . TYR A 1 65 ? -0.584  1.260   1.757   1.00 0.00 ? 65 TYR A HA   8  
ATOM 9955  H HB2  . TYR A 1 65 ? 0.507   -1.264  0.633   1.00 0.00 ? 65 TYR A HB2  8  
ATOM 9956  H HB3  . TYR A 1 65 ? 1.587   0.126   0.660   1.00 0.00 ? 65 TYR A HB3  8  
ATOM 9957  H HD1  . TYR A 1 65 ? -0.969  -1.198  3.051   1.00 0.00 ? 65 TYR A HD1  8  
ATOM 9958  H HD2  . TYR A 1 65 ? 3.073   -0.033  2.412   1.00 0.00 ? 65 TYR A HD2  8  
ATOM 9959  H HE1  . TYR A 1 65 ? -0.475  -1.635  5.420   1.00 0.00 ? 65 TYR A HE1  8  
ATOM 9960  H HE2  . TYR A 1 65 ? 3.579   -0.467  4.780   1.00 0.00 ? 65 TYR A HE2  8  
ATOM 9961  H HH   . TYR A 1 65 ? 2.813   -1.356  6.693   1.00 0.00 ? 65 TYR A HH   8  
ATOM 9962  N N    . GLN A 1 66 ? -0.205  0.834   -1.503  1.00 0.00 ? 66 GLN A N    8  
ATOM 9963  C CA   . GLN A 1 66 ? 0.009   1.542   -2.760  1.00 0.00 ? 66 GLN A CA   8  
ATOM 9964  C C    . GLN A 1 66 ? -0.901  2.763   -2.858  1.00 0.00 ? 66 GLN A C    8  
ATOM 9965  O O    . GLN A 1 66 ? -0.431  3.886   -3.031  1.00 0.00 ? 66 GLN A O    8  
ATOM 9966  C CB   . GLN A 1 66 ? -0.242  0.608   -3.945  1.00 0.00 ? 66 GLN A CB   8  
ATOM 9967  C CG   . GLN A 1 66 ? 0.031   1.250   -5.295  1.00 0.00 ? 66 GLN A CG   8  
ATOM 9968  C CD   . GLN A 1 66 ? 1.453   1.761   -5.421  1.00 0.00 ? 66 GLN A CD   8  
ATOM 9969  O OE1  . GLN A 1 66 ? 1.770   2.865   -4.978  1.00 0.00 ? 66 GLN A OE1  8  
ATOM 9970  N NE2  . GLN A 1 66 ? 2.319   0.958   -6.029  1.00 0.00 ? 66 GLN A NE2  8  
ATOM 9971  H H    . GLN A 1 66 ? -0.311  -0.139  -1.515  1.00 0.00 ? 66 GLN A H    8  
ATOM 9972  H HA   . GLN A 1 66 ? 1.036   1.871   -2.785  1.00 0.00 ? 66 GLN A HA   8  
ATOM 9973  H HB2  . GLN A 1 66 ? 0.395   -0.258  -3.847  1.00 0.00 ? 66 GLN A HB2  8  
ATOM 9974  H HB3  . GLN A 1 66 ? -1.274  0.289   -3.925  1.00 0.00 ? 66 GLN A HB3  8  
ATOM 9975  H HG2  . GLN A 1 66 ? -0.142  0.518   -6.070  1.00 0.00 ? 66 GLN A HG2  8  
ATOM 9976  H HG3  . GLN A 1 66 ? -0.647  2.080   -5.428  1.00 0.00 ? 66 GLN A HG3  8  
ATOM 9977  H HE21 . GLN A 1 66 ? 1.995   0.093   -6.358  1.00 0.00 ? 66 GLN A HE21 8  
ATOM 9978  H HE22 . GLN A 1 66 ? 3.244   1.263   -6.125  1.00 0.00 ? 66 GLN A HE22 8  
ATOM 9979  N N    . ASN A 1 67 ? -2.205  2.533   -2.748  1.00 0.00 ? 67 ASN A N    8  
ATOM 9980  C CA   . ASN A 1 67 ? -3.181  3.614   -2.826  1.00 0.00 ? 67 ASN A CA   8  
ATOM 9981  C C    . ASN A 1 67 ? -2.867  4.704   -1.806  1.00 0.00 ? 67 ASN A C    8  
ATOM 9982  O O    . ASN A 1 67 ? -3.326  5.839   -1.934  1.00 0.00 ? 67 ASN A O    8  
ATOM 9983  C CB   . ASN A 1 67 ? -4.593  3.073   -2.593  1.00 0.00 ? 67 ASN A CB   8  
ATOM 9984  C CG   . ASN A 1 67 ? -5.145  2.354   -3.809  1.00 0.00 ? 67 ASN A CG   8  
ATOM 9985  O OD1  . ASN A 1 67 ? -5.432  2.975   -4.833  1.00 0.00 ? 67 ASN A OD1  8  
ATOM 9986  N ND2  . ASN A 1 67 ? -5.295  1.039   -3.701  1.00 0.00 ? 67 ASN A ND2  8  
ATOM 9987  H H    . ASN A 1 67 ? -2.519  1.615   -2.612  1.00 0.00 ? 67 ASN A H    8  
ATOM 9988  H HA   . ASN A 1 67 ? -3.127  4.038   -3.817  1.00 0.00 ? 67 ASN A HA   8  
ATOM 9989  H HB2  . ASN A 1 67 ? -4.573  2.377   -1.766  1.00 0.00 ? 67 ASN A HB2  8  
ATOM 9990  H HB3  . ASN A 1 67 ? -5.252  3.893   -2.352  1.00 0.00 ? 67 ASN A HB3  8  
ATOM 9991  H HD21 . ASN A 1 67 ? -5.045  0.612   -2.855  1.00 0.00 ? 67 ASN A HD21 8  
ATOM 9992  H HD22 . ASN A 1 67 ? -5.649  0.550   -4.473  1.00 0.00 ? 67 ASN A HD22 8  
ATOM 9993  N N    . ARG A 1 68 ? -2.082  4.351   -0.793  1.00 0.00 ? 68 ARG A N    8  
ATOM 9994  C CA   . ARG A 1 68 ? -1.707  5.298   0.250   1.00 0.00 ? 68 ARG A CA   8  
ATOM 9995  C C    . ARG A 1 68 ? -0.368  5.956   -0.069  1.00 0.00 ? 68 ARG A C    8  
ATOM 9996  O O    . ARG A 1 68 ? -0.103  7.083   0.350   1.00 0.00 ? 68 ARG A O    8  
ATOM 9997  C CB   . ARG A 1 68 ? -1.632  4.594   1.606   1.00 0.00 ? 68 ARG A CB   8  
ATOM 9998  C CG   . ARG A 1 68 ? -2.993  4.256   2.193   1.00 0.00 ? 68 ARG A CG   8  
ATOM 9999  C CD   . ARG A 1 68 ? -3.668  5.487   2.777   1.00 0.00 ? 68 ARG A CD   8  
ATOM 10000 N NE   . ARG A 1 68 ? -2.840  6.138   3.788   1.00 0.00 ? 68 ARG A NE   8  
ATOM 10001 C CZ   . ARG A 1 68 ? -2.969  7.414   4.134   1.00 0.00 ? 68 ARG A CZ   8  
ATOM 10002 N NH1  . ARG A 1 68 ? -3.888  8.172   3.552   1.00 0.00 ? 68 ARG A NH1  8  
ATOM 10003 N NH2  . ARG A 1 68 ? -2.177  7.935   5.063   1.00 0.00 ? 68 ARG A NH2  8  
ATOM 10004 H H    . ARG A 1 68 ? -1.748  3.431   -0.745  1.00 0.00 ? 68 ARG A H    8  
ATOM 10005 H HA   . ARG A 1 68 ? -2.469  6.063   0.293   1.00 0.00 ? 68 ARG A HA   8  
ATOM 10006 H HB2  . ARG A 1 68 ? -1.076  3.675   1.491   1.00 0.00 ? 68 ARG A HB2  8  
ATOM 10007 H HB3  . ARG A 1 68 ? -1.112  5.235   2.302   1.00 0.00 ? 68 ARG A HB3  8  
ATOM 10008 H HG2  . ARG A 1 68 ? -3.621  3.851   1.413   1.00 0.00 ? 68 ARG A HG2  8  
ATOM 10009 H HG3  . ARG A 1 68 ? -2.865  3.522   2.974   1.00 0.00 ? 68 ARG A HG3  8  
ATOM 10010 H HD2  . ARG A 1 68 ? -3.862  6.188   1.979   1.00 0.00 ? 68 ARG A HD2  8  
ATOM 10011 H HD3  . ARG A 1 68 ? -4.603  5.188   3.228   1.00 0.00 ? 68 ARG A HD3  8  
ATOM 10012 H HE   . ARG A 1 68 ? -2.154  5.597   4.231   1.00 0.00 ? 68 ARG A HE   8  
ATOM 10013 H HH11 . ARG A 1 68 ? -4.486  7.783   2.853   1.00 0.00 ? 68 ARG A HH11 8  
ATOM 10014 H HH12 . ARG A 1 68 ? -3.984  9.133   3.815   1.00 0.00 ? 68 ARG A HH12 8  
ATOM 10015 H HH21 . ARG A 1 68 ? -1.483  7.366   5.504   1.00 0.00 ? 68 ARG A HH21 8  
ATOM 10016 H HH22 . ARG A 1 68 ? -2.274  8.895   5.322   1.00 0.00 ? 68 ARG A HH22 8  
ATOM 10017 N N    . ARG A 1 69 ? 0.473   5.244   -0.812  1.00 0.00 ? 69 ARG A N    8  
ATOM 10018 C CA   . ARG A 1 69 ? 1.786   5.757   -1.185  1.00 0.00 ? 69 ARG A CA   8  
ATOM 10019 C C    . ARG A 1 69 ? 1.674   6.745   -2.343  1.00 0.00 ? 69 ARG A C    8  
ATOM 10020 O O    . ARG A 1 69 ? 2.548   7.589   -2.537  1.00 0.00 ? 69 ARG A O    8  
ATOM 10021 C CB   . ARG A 1 69 ? 2.716   4.606   -1.571  1.00 0.00 ? 69 ARG A CB   8  
ATOM 10022 C CG   . ARG A 1 69 ? 2.901   3.576   -0.469  1.00 0.00 ? 69 ARG A CG   8  
ATOM 10023 C CD   . ARG A 1 69 ? 3.341   2.233   -1.029  1.00 0.00 ? 69 ARG A CD   8  
ATOM 10024 N NE   . ARG A 1 69 ? 4.145   2.381   -2.239  1.00 0.00 ? 69 ARG A NE   8  
ATOM 10025 C CZ   . ARG A 1 69 ? 4.423   1.378   -3.064  1.00 0.00 ? 69 ARG A CZ   8  
ATOM 10026 N NH1  . ARG A 1 69 ? 3.965   0.160   -2.811  1.00 0.00 ? 69 ARG A NH1  8  
ATOM 10027 N NH2  . ARG A 1 69 ? 5.161   1.593   -4.146  1.00 0.00 ? 69 ARG A NH2  8  
ATOM 10028 H H    . ARG A 1 69 ? 0.205   4.351   -1.116  1.00 0.00 ? 69 ARG A H    8  
ATOM 10029 H HA   . ARG A 1 69 ? 2.198   6.269   -0.329  1.00 0.00 ? 69 ARG A HA   8  
ATOM 10030 H HB2  . ARG A 1 69 ? 2.309   4.104   -2.437  1.00 0.00 ? 69 ARG A HB2  8  
ATOM 10031 H HB3  . ARG A 1 69 ? 3.685   5.011   -1.822  1.00 0.00 ? 69 ARG A HB3  8  
ATOM 10032 H HG2  . ARG A 1 69 ? 3.654   3.930   0.220   1.00 0.00 ? 69 ARG A HG2  8  
ATOM 10033 H HG3  . ARG A 1 69 ? 1.964   3.449   0.053   1.00 0.00 ? 69 ARG A HG3  8  
ATOM 10034 H HD2  . ARG A 1 69 ? 3.927   1.720   -0.281  1.00 0.00 ? 69 ARG A HD2  8  
ATOM 10035 H HD3  . ARG A 1 69 ? 2.463   1.649   -1.261  1.00 0.00 ? 69 ARG A HD3  8  
ATOM 10036 H HE   . ARG A 1 69 ? 4.494   3.273   -2.446  1.00 0.00 ? 69 ARG A HE   8  
ATOM 10037 H HH11 . ARG A 1 69 ? 3.407   -0.004  -1.997  1.00 0.00 ? 69 ARG A HH11 8  
ATOM 10038 H HH12 . ARG A 1 69 ? 4.175   -0.593  -3.435  1.00 0.00 ? 69 ARG A HH12 8  
ATOM 10039 H HH21 . ARG A 1 69 ? 5.509   2.510   -4.340  1.00 0.00 ? 69 ARG A HH21 8  
ATOM 10040 H HH22 . ARG A 1 69 ? 5.370   0.837   -4.766  1.00 0.00 ? 69 ARG A HH22 8  
ATOM 10041 N N    . MET A 1 70 ? 0.593   6.632   -3.108  1.00 0.00 ? 70 MET A N    8  
ATOM 10042 C CA   . MET A 1 70 ? 0.368   7.516   -4.246  1.00 0.00 ? 70 MET A CA   8  
ATOM 10043 C C    . MET A 1 70 ? 0.015   8.924   -3.779  1.00 0.00 ? 70 MET A C    8  
ATOM 10044 O O    . MET A 1 70 ? 0.548   9.910   -4.287  1.00 0.00 ? 70 MET A O    8  
ATOM 10045 C CB   . MET A 1 70 ? -0.751  6.965   -5.133  1.00 0.00 ? 70 MET A CB   8  
ATOM 10046 C CG   . MET A 1 70 ? -2.062  6.751   -4.395  1.00 0.00 ? 70 MET A CG   8  
ATOM 10047 S SD   . MET A 1 70 ? -3.368  6.122   -5.467  1.00 0.00 ? 70 MET A SD   8  
ATOM 10048 C CE   . MET A 1 70 ? -4.798  6.958   -4.787  1.00 0.00 ? 70 MET A CE   8  
ATOM 10049 H H    . MET A 1 70 ? -0.068  5.939   -2.903  1.00 0.00 ? 70 MET A H    8  
ATOM 10050 H HA   . MET A 1 70 ? 1.282   7.558   -4.819  1.00 0.00 ? 70 MET A HA   8  
ATOM 10051 H HB2  . MET A 1 70 ? -0.926  7.657   -5.942  1.00 0.00 ? 70 MET A HB2  8  
ATOM 10052 H HB3  . MET A 1 70 ? -0.435  6.017   -5.543  1.00 0.00 ? 70 MET A HB3  8  
ATOM 10053 H HG2  . MET A 1 70 ? -1.900  6.043   -3.596  1.00 0.00 ? 70 MET A HG2  8  
ATOM 10054 H HG3  . MET A 1 70 ? -2.381  7.695   -3.978  1.00 0.00 ? 70 MET A HG3  8  
ATOM 10055 H HE1  . MET A 1 70 ? -5.437  6.239   -4.298  1.00 0.00 ? 70 MET A HE1  8  
ATOM 10056 H HE2  . MET A 1 70 ? -4.474  7.699   -4.071  1.00 0.00 ? 70 MET A HE2  8  
ATOM 10057 H HE3  . MET A 1 70 ? -5.344  7.442   -5.584  1.00 0.00 ? 70 MET A HE3  8  
ATOM 10058 N N    . LYS A 1 71 ? -0.888  9.012   -2.807  1.00 0.00 ? 71 LYS A N    8  
ATOM 10059 C CA   . LYS A 1 71 ? -1.312  10.299  -2.270  1.00 0.00 ? 71 LYS A CA   8  
ATOM 10060 C C    . LYS A 1 71 ? -0.291  10.836  -1.273  1.00 0.00 ? 71 LYS A C    8  
ATOM 10061 O O    . LYS A 1 71 ? -0.223  12.040  -1.027  1.00 0.00 ? 71 LYS A O    8  
ATOM 10062 C CB   . LYS A 1 71 ? -2.679  10.167  -1.595  1.00 0.00 ? 71 LYS A CB   8  
ATOM 10063 C CG   . LYS A 1 71 ? -3.235  11.486  -1.086  1.00 0.00 ? 71 LYS A CG   8  
ATOM 10064 C CD   . LYS A 1 71 ? -4.246  11.271  0.028   1.00 0.00 ? 71 LYS A CD   8  
ATOM 10065 C CE   . LYS A 1 71 ? -4.814  12.591  0.527   1.00 0.00 ? 71 LYS A CE   8  
ATOM 10066 N NZ   . LYS A 1 71 ? -5.506  12.438  1.837   1.00 0.00 ? 71 LYS A NZ   8  
ATOM 10067 H H    . LYS A 1 71 ? -1.278  8.189   -2.442  1.00 0.00 ? 71 LYS A H    8  
ATOM 10068 H HA   . LYS A 1 71 ? -1.392  10.992  -3.094  1.00 0.00 ? 71 LYS A HA   8  
ATOM 10069 H HB2  . LYS A 1 71 ? -3.380  9.756   -2.306  1.00 0.00 ? 71 LYS A HB2  8  
ATOM 10070 H HB3  . LYS A 1 71 ? -2.590  9.491   -0.757  1.00 0.00 ? 71 LYS A HB3  8  
ATOM 10071 H HG2  . LYS A 1 71 ? -2.422  12.087  -0.708  1.00 0.00 ? 71 LYS A HG2  8  
ATOM 10072 H HG3  . LYS A 1 71 ? -3.718  12.002  -1.903  1.00 0.00 ? 71 LYS A HG3  8  
ATOM 10073 H HD2  . LYS A 1 71 ? -5.056  10.662  -0.344  1.00 0.00 ? 71 LYS A HD2  8  
ATOM 10074 H HD3  . LYS A 1 71 ? -3.761  10.764  0.850   1.00 0.00 ? 71 LYS A HD3  8  
ATOM 10075 H HE2  . LYS A 1 71 ? -4.006  13.297  0.637   1.00 0.00 ? 71 LYS A HE2  8  
ATOM 10076 H HE3  . LYS A 1 71 ? -5.520  12.963  -0.201  1.00 0.00 ? 71 LYS A HE3  8  
ATOM 10077 H HZ1  . LYS A 1 71 ? -5.945  13.338  2.117   1.00 0.00 ? 71 LYS A HZ1  8  
ATOM 10078 H HZ2  . LYS A 1 71 ? -4.824  12.156  2.570   1.00 0.00 ? 71 LYS A HZ2  8  
ATOM 10079 H HZ3  . LYS A 1 71 ? -6.245  11.710  1.768   1.00 0.00 ? 71 LYS A HZ3  8  
ATOM 10080 N N    . TRP A 1 72 ? 0.503   9.936   -0.704  1.00 0.00 ? 72 TRP A N    8  
ATOM 10081 C CA   . TRP A 1 72 ? 1.522   10.320  0.266   1.00 0.00 ? 72 TRP A CA   8  
ATOM 10082 C C    . TRP A 1 72 ? 2.716   10.968  -0.427  1.00 0.00 ? 72 TRP A C    8  
ATOM 10083 O O    . TRP A 1 72 ? 3.266   11.957  0.058   1.00 0.00 ? 72 TRP A O    8  
ATOM 10084 C CB   . TRP A 1 72 ? 1.982   9.099   1.064   1.00 0.00 ? 72 TRP A CB   8  
ATOM 10085 C CG   . TRP A 1 72 ? 3.322   9.282   1.711   1.00 0.00 ? 72 TRP A CG   8  
ATOM 10086 C CD1  . TRP A 1 72 ? 3.609   10.064  2.794   1.00 0.00 ? 72 TRP A CD1  8  
ATOM 10087 C CD2  . TRP A 1 72 ? 4.555   8.674   1.315   1.00 0.00 ? 72 TRP A CD2  8  
ATOM 10088 N NE1  . TRP A 1 72 ? 4.947   9.978   3.094   1.00 0.00 ? 72 TRP A NE1  8  
ATOM 10089 C CE2  . TRP A 1 72 ? 5.549   9.130   2.202   1.00 0.00 ? 72 TRP A CE2  8  
ATOM 10090 C CE3  . TRP A 1 72 ? 4.917   7.786   0.298   1.00 0.00 ? 72 TRP A CE3  8  
ATOM 10091 C CZ2  . TRP A 1 72 ? 6.879   8.729   2.101   1.00 0.00 ? 72 TRP A CZ2  8  
ATOM 10092 C CZ3  . TRP A 1 72 ? 6.237   7.389   0.199   1.00 0.00 ? 72 TRP A CZ3  8  
ATOM 10093 C CH2  . TRP A 1 72 ? 7.204   7.859   1.096   1.00 0.00 ? 72 TRP A CH2  8  
ATOM 10094 H H    . TRP A 1 72 ? 0.401   8.990   -0.941  1.00 0.00 ? 72 TRP A H    8  
ATOM 10095 H HA   . TRP A 1 72 ? 1.081   11.036  0.943   1.00 0.00 ? 72 TRP A HA   8  
ATOM 10096 H HB2  . TRP A 1 72 ? 1.262   8.893   1.842   1.00 0.00 ? 72 TRP A HB2  8  
ATOM 10097 H HB3  . TRP A 1 72 ? 2.045   8.248   0.402   1.00 0.00 ? 72 TRP A HB3  8  
ATOM 10098 H HD1  . TRP A 1 72 ? 2.881   10.659  3.325   1.00 0.00 ? 72 TRP A HD1  8  
ATOM 10099 H HE1  . TRP A 1 72 ? 5.396   10.446  3.829   1.00 0.00 ? 72 TRP A HE1  8  
ATOM 10100 H HE3  . TRP A 1 72 ? 4.185   7.412   -0.403  1.00 0.00 ? 72 TRP A HE3  8  
ATOM 10101 H HZ2  . TRP A 1 72 ? 7.636   9.082   2.785   1.00 0.00 ? 72 TRP A HZ2  8  
ATOM 10102 H HZ3  . TRP A 1 72 ? 6.535   6.703   -0.581  1.00 0.00 ? 72 TRP A HZ3  8  
ATOM 10103 H HH2  . TRP A 1 72 ? 8.223   7.523   0.980   1.00 0.00 ? 72 TRP A HH2  8  
ATOM 10104 N N    . LYS A 1 73 ? 3.111   10.407  -1.564  1.00 0.00 ? 73 LYS A N    8  
ATOM 10105 C CA   . LYS A 1 73 ? 4.238   10.931  -2.326  1.00 0.00 ? 73 LYS A CA   8  
ATOM 10106 C C    . LYS A 1 73 ? 4.004   12.389  -2.711  1.00 0.00 ? 73 LYS A C    8  
ATOM 10107 O O    . LYS A 1 73 ? 2.986   12.980  -2.353  1.00 0.00 ? 73 LYS A O    8  
ATOM 10108 C CB   . LYS A 1 73 ? 4.466   10.090  -3.584  1.00 0.00 ? 73 LYS A CB   8  
ATOM 10109 C CG   . LYS A 1 73 ? 5.319   8.857   -3.345  1.00 0.00 ? 73 LYS A CG   8  
ATOM 10110 C CD   . LYS A 1 73 ? 6.029   8.416   -4.614  1.00 0.00 ? 73 LYS A CD   8  
ATOM 10111 C CE   . LYS A 1 73 ? 5.126   7.561   -5.490  1.00 0.00 ? 73 LYS A CE   8  
ATOM 10112 N NZ   . LYS A 1 73 ? 5.229   6.115   -5.149  1.00 0.00 ? 73 LYS A NZ   8  
ATOM 10113 H H    . LYS A 1 73 ? 2.631   9.620   -1.901  1.00 0.00 ? 73 LYS A H    8  
ATOM 10114 H HA   . LYS A 1 73 ? 5.117   10.873  -1.701  1.00 0.00 ? 73 LYS A HA   8  
ATOM 10115 H HB2  . LYS A 1 73 ? 3.507   9.772   -3.967  1.00 0.00 ? 73 LYS A HB2  8  
ATOM 10116 H HB3  . LYS A 1 73 ? 4.955   10.703  -4.328  1.00 0.00 ? 73 LYS A HB3  8  
ATOM 10117 H HG2  . LYS A 1 73 ? 6.058   9.082   -2.592  1.00 0.00 ? 73 LYS A HG2  8  
ATOM 10118 H HG3  . LYS A 1 73 ? 4.684   8.053   -3.001  1.00 0.00 ? 73 LYS A HG3  8  
ATOM 10119 H HD2  . LYS A 1 73 ? 6.329   9.291   -5.172  1.00 0.00 ? 73 LYS A HD2  8  
ATOM 10120 H HD3  . LYS A 1 73 ? 6.904   7.841   -4.345  1.00 0.00 ? 73 LYS A HD3  8  
ATOM 10121 H HE2  . LYS A 1 73 ? 4.105   7.883   -5.354  1.00 0.00 ? 73 LYS A HE2  8  
ATOM 10122 H HE3  . LYS A 1 73 ? 5.412   7.700   -6.523  1.00 0.00 ? 73 LYS A HE3  8  
ATOM 10123 H HZ1  . LYS A 1 73 ? 6.187   5.896   -4.809  1.00 0.00 ? 73 LYS A HZ1  8  
ATOM 10124 H HZ2  . LYS A 1 73 ? 5.030   5.535   -5.989  1.00 0.00 ? 73 LYS A HZ2  8  
ATOM 10125 H HZ3  . LYS A 1 73 ? 4.545   5.874   -4.404  1.00 0.00 ? 73 LYS A HZ3  8  
ATOM 10126 N N    . LYS A 1 74 ? 4.953   12.962  -3.443  1.00 0.00 ? 74 LYS A N    8  
ATOM 10127 C CA   . LYS A 1 74 ? 4.850   14.349  -3.880  1.00 0.00 ? 74 LYS A CA   8  
ATOM 10128 C C    . LYS A 1 74 ? 4.536   14.429  -5.370  1.00 0.00 ? 74 LYS A C    8  
ATOM 10129 O O    . LYS A 1 74 ? 5.246   13.854  -6.195  1.00 0.00 ? 74 LYS A O    8  
ATOM 10130 C CB   . LYS A 1 74 ? 6.151   15.098  -3.581  1.00 0.00 ? 74 LYS A CB   8  
ATOM 10131 C CG   . LYS A 1 74 ? 6.316   15.472  -2.119  1.00 0.00 ? 74 LYS A CG   8  
ATOM 10132 C CD   . LYS A 1 74 ? 7.758   15.817  -1.790  1.00 0.00 ? 74 LYS A CD   8  
ATOM 10133 C CE   . LYS A 1 74 ? 8.635   14.574  -1.755  1.00 0.00 ? 74 LYS A CE   8  
ATOM 10134 N NZ   . LYS A 1 74 ? 9.934   14.831  -1.074  1.00 0.00 ? 74 LYS A NZ   8  
ATOM 10135 H H    . LYS A 1 74 ? 5.742   12.438  -3.698  1.00 0.00 ? 74 LYS A H    8  
ATOM 10136 H HA   . LYS A 1 74 ? 4.044   14.811  -3.329  1.00 0.00 ? 74 LYS A HA   8  
ATOM 10137 H HB2  . LYS A 1 74 ? 6.985   14.474  -3.868  1.00 0.00 ? 74 LYS A HB2  8  
ATOM 10138 H HB3  . LYS A 1 74 ? 6.173   16.005  -4.168  1.00 0.00 ? 74 LYS A HB3  8  
ATOM 10139 H HG2  . LYS A 1 74 ? 5.694   16.328  -1.903  1.00 0.00 ? 74 LYS A HG2  8  
ATOM 10140 H HG3  . LYS A 1 74 ? 6.006   14.637  -1.506  1.00 0.00 ? 74 LYS A HG3  8  
ATOM 10141 H HD2  . LYS A 1 74 ? 8.139   16.491  -2.544  1.00 0.00 ? 74 LYS A HD2  8  
ATOM 10142 H HD3  . LYS A 1 74 ? 7.793   16.299  -0.824  1.00 0.00 ? 74 LYS A HD3  8  
ATOM 10143 H HE2  . LYS A 1 74 ? 8.109   13.794  -1.226  1.00 0.00 ? 74 LYS A HE2  8  
ATOM 10144 H HE3  . LYS A 1 74 ? 8.826   14.256  -2.769  1.00 0.00 ? 74 LYS A HE3  8  
ATOM 10145 H HZ1  . LYS A 1 74 ? 10.560  15.382  -1.696  1.00 0.00 ? 74 LYS A HZ1  8  
ATOM 10146 H HZ2  . LYS A 1 74 ? 10.400  13.931  -0.842  1.00 0.00 ? 74 LYS A HZ2  8  
ATOM 10147 H HZ3  . LYS A 1 74 ? 9.778   15.366  -0.196  1.00 0.00 ? 74 LYS A HZ3  8  
ATOM 10148 N N    . SER A 1 75 ? 3.468   15.145  -5.708  1.00 0.00 ? 75 SER A N    8  
ATOM 10149 C CA   . SER A 1 75 ? 3.059   15.297  -7.100  1.00 0.00 ? 75 SER A CA   8  
ATOM 10150 C C    . SER A 1 75 ? 2.302   16.606  -7.303  1.00 0.00 ? 75 SER A C    8  
ATOM 10151 O O    . SER A 1 75 ? 1.227   16.808  -6.740  1.00 0.00 ? 75 SER A O    8  
ATOM 10152 C CB   . SER A 1 75 ? 2.185   14.117  -7.529  1.00 0.00 ? 75 SER A CB   8  
ATOM 10153 O OG   . SER A 1 75 ? 1.594   14.354  -8.795  1.00 0.00 ? 75 SER A OG   8  
ATOM 10154 H H    . SER A 1 75 ? 2.942   15.579  -5.004  1.00 0.00 ? 75 SER A H    8  
ATOM 10155 H HA   . SER A 1 75 ? 3.951   15.313  -7.708  1.00 0.00 ? 75 SER A HA   8  
ATOM 10156 H HB2  . SER A 1 75 ? 2.792   13.227  -7.589  1.00 0.00 ? 75 SER A HB2  8  
ATOM 10157 H HB3  . SER A 1 75 ? 1.401   13.970  -6.800  1.00 0.00 ? 75 SER A HB3  8  
ATOM 10158 H HG   . SER A 1 75 ? 0.897   13.712  -8.948  1.00 0.00 ? 75 SER A HG   8  
ATOM 10159 N N    . GLY A 1 76 ? 2.872   17.493  -8.113  1.00 0.00 ? 76 GLY A N    8  
ATOM 10160 C CA   . GLY A 1 76 ? 2.238   18.772  -8.376  1.00 0.00 ? 76 GLY A CA   8  
ATOM 10161 C C    . GLY A 1 76 ? 3.242   19.861  -8.700  1.00 0.00 ? 76 GLY A C    8  
ATOM 10162 O O    . GLY A 1 76 ? 4.358   19.880  -8.181  1.00 0.00 ? 76 GLY A O    8  
ATOM 10163 H H    . GLY A 1 76 ? 3.731   17.278  -8.534  1.00 0.00 ? 76 GLY A H    8  
ATOM 10164 H HA2  . GLY A 1 76 ? 1.562   18.660  -9.211  1.00 0.00 ? 76 GLY A HA2  8  
ATOM 10165 H HA3  . GLY A 1 76 ? 1.673   19.067  -7.505  1.00 0.00 ? 76 GLY A HA3  8  
ATOM 10166 N N    . PRO A 1 77 ? 2.846   20.793  -9.579  1.00 0.00 ? 77 PRO A N    8  
ATOM 10167 C CA   . PRO A 1 77 ? 3.705   21.907  -9.992  1.00 0.00 ? 77 PRO A CA   8  
ATOM 10168 C C    . PRO A 1 77 ? 3.924   22.917  -8.870  1.00 0.00 ? 77 PRO A C    8  
ATOM 10169 O O    . PRO A 1 77 ? 4.697   23.864  -9.017  1.00 0.00 ? 77 PRO A O    8  
ATOM 10170 C CB   . PRO A 1 77 ? 2.926   22.548  -11.143 1.00 0.00 ? 77 PRO A CB   8  
ATOM 10171 C CG   . PRO A 1 77 ? 1.504   22.190  -10.884 1.00 0.00 ? 77 PRO A CG   8  
ATOM 10172 C CD   . PRO A 1 77 ? 1.529   20.833  -10.237 1.00 0.00 ? 77 PRO A CD   8  
ATOM 10173 H HA   . PRO A 1 77 ? 4.662   21.558  -10.352 1.00 0.00 ? 77 PRO A HA   8  
ATOM 10174 H HB2  . PRO A 1 77 ? 3.074   23.619  -11.129 1.00 0.00 ? 77 PRO A HB2  8  
ATOM 10175 H HB3  . PRO A 1 77 ? 3.270   22.144  -12.084 1.00 0.00 ? 77 PRO A HB3  8  
ATOM 10176 H HG2  . PRO A 1 77 ? 1.058   22.914  -10.218 1.00 0.00 ? 77 PRO A HG2  8  
ATOM 10177 H HG3  . PRO A 1 77 ? 0.960   22.150  -11.816 1.00 0.00 ? 77 PRO A HG3  8  
ATOM 10178 H HD2  . PRO A 1 77 ? 0.734   20.745  -9.512  1.00 0.00 ? 77 PRO A HD2  8  
ATOM 10179 H HD3  . PRO A 1 77 ? 1.449   20.057  -10.984 1.00 0.00 ? 77 PRO A HD3  8  
ATOM 10180 N N    . SER A 1 78 ? 3.240   22.708  -7.750  1.00 0.00 ? 78 SER A N    8  
ATOM 10181 C CA   . SER A 1 78 ? 3.358   23.602  -6.604  1.00 0.00 ? 78 SER A CA   8  
ATOM 10182 C C    . SER A 1 78 ? 4.786   23.613  -6.068  1.00 0.00 ? 78 SER A C    8  
ATOM 10183 O O    . SER A 1 78 ? 5.303   22.587  -5.627  1.00 0.00 ? 78 SER A O    8  
ATOM 10184 C CB   . SER A 1 78 ? 2.389   23.179  -5.498  1.00 0.00 ? 78 SER A CB   8  
ATOM 10185 O OG   . SER A 1 78 ? 2.385   24.117  -4.437  1.00 0.00 ? 78 SER A OG   8  
ATOM 10186 H H    . SER A 1 78 ? 2.640   21.935  -7.694  1.00 0.00 ? 78 SER A H    8  
ATOM 10187 H HA   . SER A 1 78 ? 3.101   24.598  -6.933  1.00 0.00 ? 78 SER A HA   8  
ATOM 10188 H HB2  . SER A 1 78 ? 1.392   23.108  -5.904  1.00 0.00 ? 78 SER A HB2  8  
ATOM 10189 H HB3  . SER A 1 78 ? 2.689   22.216  -5.111  1.00 0.00 ? 78 SER A HB3  8  
ATOM 10190 H HG   . SER A 1 78 ? 3.242   24.547  -4.386  1.00 0.00 ? 78 SER A HG   8  
ATOM 10191 N N    . SER A 1 79 ? 5.418   24.782  -6.111  1.00 0.00 ? 79 SER A N    8  
ATOM 10192 C CA   . SER A 1 79 ? 6.788   24.928  -5.633  1.00 0.00 ? 79 SER A CA   8  
ATOM 10193 C C    . SER A 1 79 ? 7.161   26.400  -5.492  1.00 0.00 ? 79 SER A C    8  
ATOM 10194 O O    . SER A 1 79 ? 6.880   27.211  -6.374  1.00 0.00 ? 79 SER A O    8  
ATOM 10195 C CB   . SER A 1 79 ? 7.760   24.233  -6.589  1.00 0.00 ? 79 SER A CB   8  
ATOM 10196 O OG   . SER A 1 79 ? 7.584   24.693  -7.918  1.00 0.00 ? 79 SER A OG   8  
ATOM 10197 H H    . SER A 1 79 ? 4.952   25.564  -6.474  1.00 0.00 ? 79 SER A H    8  
ATOM 10198 H HA   . SER A 1 79 ? 6.853   24.457  -4.664  1.00 0.00 ? 79 SER A HA   8  
ATOM 10199 H HB2  . SER A 1 79 ? 8.774   24.440  -6.281  1.00 0.00 ? 79 SER A HB2  8  
ATOM 10200 H HB3  . SER A 1 79 ? 7.587   23.167  -6.563  1.00 0.00 ? 79 SER A HB3  8  
ATOM 10201 H HG   . SER A 1 79 ? 8.287   24.346  -8.473  1.00 0.00 ? 79 SER A HG   8  
ATOM 10202 N N    . GLY A 1 80 ? 7.796   26.739  -4.375  1.00 0.00 ? 80 GLY A N    8  
ATOM 10203 C CA   . GLY A 1 80 ? 8.197   28.114  -4.137  1.00 0.00 ? 80 GLY A CA   8  
ATOM 10204 C C    . GLY A 1 80 ? 8.639   28.816  -5.405  1.00 0.00 ? 80 GLY A C    8  
ATOM 10205 O O    . GLY A 1 80 ? 9.720   28.546  -5.928  1.00 0.00 ? 80 GLY A O    8  
ATOM 10206 H H    . GLY A 1 80 ? 7.994   26.050  -3.706  1.00 0.00 ? 80 GLY A H    8  
ATOM 10207 H HA2  . GLY A 1 80 ? 7.364   28.652  -3.711  1.00 0.00 ? 80 GLY A HA2  8  
ATOM 10208 H HA3  . GLY A 1 80 ? 9.016   28.121  -3.432  1.00 0.00 ? 80 GLY A HA3  8  
ATOM 10209 N N    . GLY A 1 1  ? -49.178 22.907  -2.346  1.00 0.00 ? 1  GLY A N    9  
ATOM 10210 C CA   . GLY A 1 1  ? -48.625 24.247  -2.417  1.00 0.00 ? 1  GLY A CA   9  
ATOM 10211 C C    . GLY A 1 1  ? -48.201 24.772  -1.060  1.00 0.00 ? 1  GLY A C    9  
ATOM 10212 O O    . GLY A 1 1  ? -48.960 24.702  -0.094  1.00 0.00 ? 1  GLY A O    9  
ATOM 10213 H H1   . GLY A 1 1  ? -49.680 22.628  -1.552  1.00 0.00 ? 1  GLY A H1   9  
ATOM 10214 H HA2  . GLY A 1 1  ? -47.767 24.237  -3.072  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 10215 H HA3  . GLY A 1 1  ? -49.372 24.910  -2.829  1.00 0.00 ? 1  GLY A HA3  9  
ATOM 10216 N N    . SER A 1 2  ? -46.983 25.299  -0.986  1.00 0.00 ? 2  SER A N    9  
ATOM 10217 C CA   . SER A 1 2  ? -46.456 25.834  0.264   1.00 0.00 ? 2  SER A CA   9  
ATOM 10218 C C    . SER A 1 2  ? -45.104 26.505  0.041   1.00 0.00 ? 2  SER A C    9  
ATOM 10219 O O    . SER A 1 2  ? -44.576 26.509  -1.071  1.00 0.00 ? 2  SER A O    9  
ATOM 10220 C CB   . SER A 1 2  ? -46.319 24.718  1.303   1.00 0.00 ? 2  SER A CB   9  
ATOM 10221 O OG   . SER A 1 2  ? -45.141 23.961  1.085   1.00 0.00 ? 2  SER A OG   9  
ATOM 10222 H H    . SER A 1 2  ? -46.424 25.327  -1.791  1.00 0.00 ? 2  SER A H    9  
ATOM 10223 H HA   . SER A 1 2  ? -47.154 26.571  0.630   1.00 0.00 ? 2  SER A HA   9  
ATOM 10224 H HB2  . SER A 1 2  ? -46.276 25.152  2.290   1.00 0.00 ? 2  SER A HB2  9  
ATOM 10225 H HB3  . SER A 1 2  ? -47.174 24.061  1.235   1.00 0.00 ? 2  SER A HB3  9  
ATOM 10226 H HG   . SER A 1 2  ? -44.614 23.951  1.887   1.00 0.00 ? 2  SER A HG   9  
ATOM 10227 N N    . SER A 1 3  ? -44.549 27.072  1.108   1.00 0.00 ? 3  SER A N    9  
ATOM 10228 C CA   . SER A 1 3  ? -43.260 27.750  1.029   1.00 0.00 ? 3  SER A CA   9  
ATOM 10229 C C    . SER A 1 3  ? -42.392 27.409  2.237   1.00 0.00 ? 3  SER A C    9  
ATOM 10230 O O    . SER A 1 3  ? -42.850 26.772  3.184   1.00 0.00 ? 3  SER A O    9  
ATOM 10231 C CB   . SER A 1 3  ? -43.462 29.264  0.943   1.00 0.00 ? 3  SER A CB   9  
ATOM 10232 O OG   . SER A 1 3  ? -44.271 29.609  -0.169  1.00 0.00 ? 3  SER A OG   9  
ATOM 10233 H H    . SER A 1 3  ? -45.019 27.035  1.967   1.00 0.00 ? 3  SER A H    9  
ATOM 10234 H HA   . SER A 1 3  ? -42.761 27.410  0.134   1.00 0.00 ? 3  SER A HA   9  
ATOM 10235 H HB2  . SER A 1 3  ? -43.942 29.613  1.844   1.00 0.00 ? 3  SER A HB2  9  
ATOM 10236 H HB3  . SER A 1 3  ? -42.501 29.747  0.836   1.00 0.00 ? 3  SER A HB3  9  
ATOM 10237 H HG   . SER A 1 3  ? -45.174 29.324  -0.008  1.00 0.00 ? 3  SER A HG   9  
ATOM 10238 N N    . GLY A 1 4  ? -41.135 27.840  2.194   1.00 0.00 ? 4  GLY A N    9  
ATOM 10239 C CA   . GLY A 1 4  ? -40.222 27.571  3.290   1.00 0.00 ? 4  GLY A CA   9  
ATOM 10240 C C    . GLY A 1 4  ? -38.854 28.185  3.068   1.00 0.00 ? 4  GLY A C    9  
ATOM 10241 O O    . GLY A 1 4  ? -38.579 28.737  2.003   1.00 0.00 ? 4  GLY A O    9  
ATOM 10242 H H    . GLY A 1 4  ? -40.825 28.344  1.413   1.00 0.00 ? 4  GLY A H    9  
ATOM 10243 H HA2  . GLY A 1 4  ? -40.642 27.972  4.201   1.00 0.00 ? 4  GLY A HA2  9  
ATOM 10244 H HA3  . GLY A 1 4  ? -40.111 26.502  3.396   1.00 0.00 ? 4  GLY A HA3  9  
ATOM 10245 N N    . SER A 1 5  ? -37.994 28.092  4.078   1.00 0.00 ? 5  SER A N    9  
ATOM 10246 C CA   . SER A 1 5  ? -36.649 28.648  3.990   1.00 0.00 ? 5  SER A CA   9  
ATOM 10247 C C    . SER A 1 5  ? -35.619 27.667  4.541   1.00 0.00 ? 5  SER A C    9  
ATOM 10248 O O    . SER A 1 5  ? -35.966 26.582  5.008   1.00 0.00 ? 5  SER A O    9  
ATOM 10249 C CB   . SER A 1 5  ? -36.570 29.970  4.755   1.00 0.00 ? 5  SER A CB   9  
ATOM 10250 O OG   . SER A 1 5  ? -37.328 30.979  4.110   1.00 0.00 ? 5  SER A OG   9  
ATOM 10251 H H    . SER A 1 5  ? -38.273 27.640  4.902   1.00 0.00 ? 5  SER A H    9  
ATOM 10252 H HA   . SER A 1 5  ? -36.433 28.831  2.948   1.00 0.00 ? 5  SER A HA   9  
ATOM 10253 H HB2  . SER A 1 5  ? -36.957 29.830  5.753   1.00 0.00 ? 5  SER A HB2  9  
ATOM 10254 H HB3  . SER A 1 5  ? -35.540 30.290  4.810   1.00 0.00 ? 5  SER A HB3  9  
ATOM 10255 H HG   . SER A 1 5  ? -37.489 30.724  3.198   1.00 0.00 ? 5  SER A HG   9  
ATOM 10256 N N    . SER A 1 6  ? -34.349 28.056  4.482   1.00 0.00 ? 6  SER A N    9  
ATOM 10257 C CA   . SER A 1 6  ? -33.267 27.210  4.971   1.00 0.00 ? 6  SER A CA   9  
ATOM 10258 C C    . SER A 1 6  ? -31.953 27.984  5.022   1.00 0.00 ? 6  SER A C    9  
ATOM 10259 O O    . SER A 1 6  ? -31.869 29.118  4.551   1.00 0.00 ? 6  SER A O    9  
ATOM 10260 C CB   . SER A 1 6  ? -33.111 25.978  4.078   1.00 0.00 ? 6  SER A CB   9  
ATOM 10261 O OG   . SER A 1 6  ? -33.940 24.918  4.522   1.00 0.00 ? 6  SER A OG   9  
ATOM 10262 H H    . SER A 1 6  ? -34.136 28.932  4.098   1.00 0.00 ? 6  SER A H    9  
ATOM 10263 H HA   . SER A 1 6  ? -33.522 26.890  5.970   1.00 0.00 ? 6  SER A HA   9  
ATOM 10264 H HB2  . SER A 1 6  ? -33.386 26.233  3.066   1.00 0.00 ? 6  SER A HB2  9  
ATOM 10265 H HB3  . SER A 1 6  ? -32.082 25.648  4.100   1.00 0.00 ? 6  SER A HB3  9  
ATOM 10266 H HG   . SER A 1 6  ? -34.352 24.495  3.766   1.00 0.00 ? 6  SER A HG   9  
ATOM 10267 N N    . GLY A 1 7  ? -30.929 27.363  5.598   1.00 0.00 ? 7  GLY A N    9  
ATOM 10268 C CA   . GLY A 1 7  ? -29.633 28.007  5.701   1.00 0.00 ? 7  GLY A CA   9  
ATOM 10269 C C    . GLY A 1 7  ? -28.516 27.159  5.124   1.00 0.00 ? 7  GLY A C    9  
ATOM 10270 O O    . GLY A 1 7  ? -28.696 26.493  4.105   1.00 0.00 ? 7  GLY A O    9  
ATOM 10271 H H    . GLY A 1 7  ? -31.054 26.459  5.956   1.00 0.00 ? 7  GLY A H    9  
ATOM 10272 H HA2  . GLY A 1 7  ? -29.667 28.947  5.172   1.00 0.00 ? 7  GLY A HA2  9  
ATOM 10273 H HA3  . GLY A 1 7  ? -29.421 28.199  6.743   1.00 0.00 ? 7  GLY A HA3  9  
ATOM 10274 N N    . GLY A 1 8  ? -27.358 27.186  5.775   1.00 0.00 ? 8  GLY A N    9  
ATOM 10275 C CA   . GLY A 1 8  ? -26.224 26.411  5.305   1.00 0.00 ? 8  GLY A CA   9  
ATOM 10276 C C    . GLY A 1 8  ? -25.254 26.068  6.417   1.00 0.00 ? 8  GLY A C    9  
ATOM 10277 O O    . GLY A 1 8  ? -25.485 26.408  7.577   1.00 0.00 ? 8  GLY A O    9  
ATOM 10278 H H    . GLY A 1 8  ? -27.272 27.735  6.582   1.00 0.00 ? 8  GLY A H    9  
ATOM 10279 H HA2  . GLY A 1 8  ? -26.587 25.496  4.862   1.00 0.00 ? 8  GLY A HA2  9  
ATOM 10280 H HA3  . GLY A 1 8  ? -25.701 26.982  4.551   1.00 0.00 ? 8  GLY A HA3  9  
ATOM 10281 N N    . GLU A 1 9  ? -24.165 25.392  6.064   1.00 0.00 ? 9  GLU A N    9  
ATOM 10282 C CA   . GLU A 1 9  ? -23.159 25.000  7.044   1.00 0.00 ? 9  GLU A CA   9  
ATOM 10283 C C    . GLU A 1 9  ? -21.883 24.526  6.353   1.00 0.00 ? 9  GLU A C    9  
ATOM 10284 O O    . GLU A 1 9  ? -21.918 23.893  5.297   1.00 0.00 ? 9  GLU A O    9  
ATOM 10285 C CB   . GLU A 1 9  ? -23.701 23.896  7.952   1.00 0.00 ? 9  GLU A CB   9  
ATOM 10286 C CG   . GLU A 1 9  ? -24.151 22.655  7.200   1.00 0.00 ? 9  GLU A CG   9  
ATOM 10287 C CD   . GLU A 1 9  ? -25.150 21.826  7.985   1.00 0.00 ? 9  GLU A CD   9  
ATOM 10288 O OE1  . GLU A 1 9  ? -24.758 21.252  9.022   1.00 0.00 ? 9  GLU A OE1  9  
ATOM 10289 O OE2  . GLU A 1 9  ? -26.322 21.753  7.562   1.00 0.00 ? 9  GLU A OE2  9  
ATOM 10290 H H    . GLU A 1 9  ? -24.037 25.150  5.123   1.00 0.00 ? 9  GLU A H    9  
ATOM 10291 H HA   . GLU A 1 9  ? -22.927 25.867  7.645   1.00 0.00 ? 9  GLU A HA   9  
ATOM 10292 H HB2  . GLU A 1 9  ? -22.929 23.608  8.650   1.00 0.00 ? 9  GLU A HB2  9  
ATOM 10293 H HB3  . GLU A 1 9  ? -24.546 24.282  8.504   1.00 0.00 ? 9  GLU A HB3  9  
ATOM 10294 H HG2  . GLU A 1 9  ? -24.610 22.959  6.271   1.00 0.00 ? 9  GLU A HG2  9  
ATOM 10295 H HG3  . GLU A 1 9  ? -23.286 22.044  6.989   1.00 0.00 ? 9  GLU A HG3  9  
ATOM 10296 N N    . PRO A 1 10 ? -20.730 24.838  6.962   1.00 0.00 ? 10 PRO A N    9  
ATOM 10297 C CA   . PRO A 1 10 ? -19.421 24.453  6.424   1.00 0.00 ? 10 PRO A CA   9  
ATOM 10298 C C    . PRO A 1 10 ? -19.176 22.951  6.515   1.00 0.00 ? 10 PRO A C    9  
ATOM 10299 O O    . PRO A 1 10 ? -19.953 22.221  7.129   1.00 0.00 ? 10 PRO A O    9  
ATOM 10300 C CB   . PRO A 1 10 ? -18.435 25.211  7.316   1.00 0.00 ? 10 PRO A CB   9  
ATOM 10301 C CG   . PRO A 1 10 ? -19.167 25.423  8.596   1.00 0.00 ? 10 PRO A CG   9  
ATOM 10302 C CD   . PRO A 1 10 ? -20.614 25.589  8.223   1.00 0.00 ? 10 PRO A CD   9  
ATOM 10303 H HA   . PRO A 1 10 ? -19.303 24.775  5.400   1.00 0.00 ? 10 PRO A HA   9  
ATOM 10304 H HB2  . PRO A 1 10 ? -17.546 24.613  7.463   1.00 0.00 ? 10 PRO A HB2  9  
ATOM 10305 H HB3  . PRO A 1 10 ? -18.172 26.149  6.852   1.00 0.00 ? 10 PRO A HB3  9  
ATOM 10306 H HG2  . PRO A 1 10 ? -19.042 24.563  9.237   1.00 0.00 ? 10 PRO A HG2  9  
ATOM 10307 H HG3  . PRO A 1 10 ? -18.801 26.314  9.085   1.00 0.00 ? 10 PRO A HG3  9  
ATOM 10308 H HD2  . PRO A 1 10 ? -21.251 25.166  8.985   1.00 0.00 ? 10 PRO A HD2  9  
ATOM 10309 H HD3  . PRO A 1 10 ? -20.846 26.633  8.071   1.00 0.00 ? 10 PRO A HD3  9  
ATOM 10310 N N    . GLY A 1 11 ? -18.090 22.495  5.898   1.00 0.00 ? 11 GLY A N    9  
ATOM 10311 C CA   . GLY A 1 11 ? -17.762 21.082  5.922   1.00 0.00 ? 11 GLY A CA   9  
ATOM 10312 C C    . GLY A 1 11 ? -16.466 20.775  5.197   1.00 0.00 ? 11 GLY A C    9  
ATOM 10313 O O    . GLY A 1 11 ? -15.551 21.598  5.169   1.00 0.00 ? 11 GLY A O    9  
ATOM 10314 H H    . GLY A 1 11 ? -17.506 23.124  5.424   1.00 0.00 ? 11 GLY A H    9  
ATOM 10315 H HA2  . GLY A 1 11 ? -17.672 20.761  6.949   1.00 0.00 ? 11 GLY A HA2  9  
ATOM 10316 H HA3  . GLY A 1 11 ? -18.563 20.530  5.452   1.00 0.00 ? 11 GLY A HA3  9  
ATOM 10317 N N    . THR A 1 12 ? -16.387 19.585  4.609   1.00 0.00 ? 12 THR A N    9  
ATOM 10318 C CA   . THR A 1 12 ? -15.193 19.170  3.882   1.00 0.00 ? 12 THR A CA   9  
ATOM 10319 C C    . THR A 1 12 ? -15.553 18.586  2.521   1.00 0.00 ? 12 THR A C    9  
ATOM 10320 O O    . THR A 1 12 ? -16.231 17.562  2.432   1.00 0.00 ? 12 THR A O    9  
ATOM 10321 C CB   . THR A 1 12 ? -14.386 18.127  4.678   1.00 0.00 ? 12 THR A CB   9  
ATOM 10322 O OG1  . THR A 1 12 ? -14.004 18.668  5.948   1.00 0.00 ? 12 THR A OG1  9  
ATOM 10323 C CG2  . THR A 1 12 ? -13.145 17.702  3.908   1.00 0.00 ? 12 THR A CG2  9  
ATOM 10324 H H    . THR A 1 12 ? -17.149 18.973  4.666   1.00 0.00 ? 12 THR A H    9  
ATOM 10325 H HA   . THR A 1 12 ? -14.571 20.041  3.737   1.00 0.00 ? 12 THR A HA   9  
ATOM 10326 H HB   . THR A 1 12 ? -15.008 17.258  4.838   1.00 0.00 ? 12 THR A HB   9  
ATOM 10327 H HG1  . THR A 1 12 ? -13.365 18.085  6.365   1.00 0.00 ? 12 THR A HG1  9  
ATOM 10328 H HG21 . THR A 1 12 ? -13.319 17.822  2.849   1.00 0.00 ? 12 THR A HG21 9  
ATOM 10329 H HG22 . THR A 1 12 ? -12.926 16.666  4.122   1.00 0.00 ? 12 THR A HG22 9  
ATOM 10330 H HG23 . THR A 1 12 ? -12.308 18.315  4.207   1.00 0.00 ? 12 THR A HG23 9  
ATOM 10331 N N    . LYS A 1 13 ? -15.095 19.244  1.461   1.00 0.00 ? 13 LYS A N    9  
ATOM 10332 C CA   . LYS A 1 13 ? -15.367 18.790  0.102   1.00 0.00 ? 13 LYS A CA   9  
ATOM 10333 C C    . LYS A 1 13 ? -14.588 17.516  -0.212  1.00 0.00 ? 13 LYS A C    9  
ATOM 10334 O O    . LYS A 1 13 ? -13.500 17.568  -0.783  1.00 0.00 ? 13 LYS A O    9  
ATOM 10335 C CB   . LYS A 1 13 ? -15.004 19.883  -0.905  1.00 0.00 ? 13 LYS A CB   9  
ATOM 10336 C CG   . LYS A 1 13 ? -15.704 19.732  -2.245  1.00 0.00 ? 13 LYS A CG   9  
ATOM 10337 C CD   . LYS A 1 13 ? -17.054 20.429  -2.251  1.00 0.00 ? 13 LYS A CD   9  
ATOM 10338 C CE   . LYS A 1 13 ? -18.159 19.508  -1.759  1.00 0.00 ? 13 LYS A CE   9  
ATOM 10339 N NZ   . LYS A 1 13 ? -19.492 19.906  -2.292  1.00 0.00 ? 13 LYS A NZ   9  
ATOM 10340 H H    . LYS A 1 13 ? -14.560 20.054  1.596   1.00 0.00 ? 13 LYS A H    9  
ATOM 10341 H HA   . LYS A 1 13 ? -16.423 18.579  0.028   1.00 0.00 ? 13 LYS A HA   9  
ATOM 10342 H HB2  . LYS A 1 13 ? -15.273 20.843  -0.489  1.00 0.00 ? 13 LYS A HB2  9  
ATOM 10343 H HB3  . LYS A 1 13 ? -13.938 19.860  -1.075  1.00 0.00 ? 13 LYS A HB3  9  
ATOM 10344 H HG2  . LYS A 1 13 ? -15.084 20.165  -3.016  1.00 0.00 ? 13 LYS A HG2  9  
ATOM 10345 H HG3  . LYS A 1 13 ? -15.851 18.680  -2.447  1.00 0.00 ? 13 LYS A HG3  9  
ATOM 10346 H HD2  . LYS A 1 13 ? -17.006 21.293  -1.605  1.00 0.00 ? 13 LYS A HD2  9  
ATOM 10347 H HD3  . LYS A 1 13 ? -17.282 20.744  -3.260  1.00 0.00 ? 13 LYS A HD3  9  
ATOM 10348 H HE2  . LYS A 1 13 ? -17.940 18.501  -2.078  1.00 0.00 ? 13 LYS A HE2  9  
ATOM 10349 H HE3  . LYS A 1 13 ? -18.187 19.545  -0.680  1.00 0.00 ? 13 LYS A HE3  9  
ATOM 10350 H HZ1  . LYS A 1 13 ? -19.502 20.924  -2.504  1.00 0.00 ? 13 LYS A HZ1  9  
ATOM 10351 H HZ2  . LYS A 1 13 ? -20.232 19.702  -1.591  1.00 0.00 ? 13 LYS A HZ2  9  
ATOM 10352 H HZ3  . LYS A 1 13 ? -19.700 19.379  -3.164  1.00 0.00 ? 13 LYS A HZ3  9  
ATOM 10353 N N    . ALA A 1 14 ? -15.154 16.374  0.165   1.00 0.00 ? 14 ALA A N    9  
ATOM 10354 C CA   . ALA A 1 14 ? -14.514 15.087  -0.080  1.00 0.00 ? 14 ALA A CA   9  
ATOM 10355 C C    . ALA A 1 14 ? -14.729 14.632  -1.519  1.00 0.00 ? 14 ALA A C    9  
ATOM 10356 O O    . ALA A 1 14 ? -13.778 14.298  -2.225  1.00 0.00 ? 14 ALA A O    9  
ATOM 10357 C CB   . ALA A 1 14 ? -15.043 14.042  0.891   1.00 0.00 ? 14 ALA A CB   9  
ATOM 10358 H H    . ALA A 1 14 ? -16.023 16.397  0.617   1.00 0.00 ? 14 ALA A H    9  
ATOM 10359 H HA   . ALA A 1 14 ? -13.454 15.203  0.096   1.00 0.00 ? 14 ALA A HA   9  
ATOM 10360 H HB1  . ALA A 1 14 ? -15.941 13.598  0.486   1.00 0.00 ? 14 ALA A HB1  9  
ATOM 10361 H HB2  . ALA A 1 14 ? -14.296 13.276  1.037   1.00 0.00 ? 14 ALA A HB2  9  
ATOM 10362 H HB3  . ALA A 1 14 ? -15.268 14.511  1.837   1.00 0.00 ? 14 ALA A HB3  9  
ATOM 10363 N N    . LYS A 1 15 ? -15.987 14.621  -1.950  1.00 0.00 ? 15 LYS A N    9  
ATOM 10364 C CA   . LYS A 1 15 ? -16.328 14.207  -3.305  1.00 0.00 ? 15 LYS A CA   9  
ATOM 10365 C C    . LYS A 1 15 ? -15.497 13.001  -3.732  1.00 0.00 ? 15 LYS A C    9  
ATOM 10366 O O    . LYS A 1 15 ? -15.043 12.919  -4.873  1.00 0.00 ? 15 LYS A O    9  
ATOM 10367 C CB   . LYS A 1 15 ? -16.108 15.363  -4.284  1.00 0.00 ? 15 LYS A CB   9  
ATOM 10368 C CG   . LYS A 1 15 ? -16.923 15.243  -5.560  1.00 0.00 ? 15 LYS A CG   9  
ATOM 10369 C CD   . LYS A 1 15 ? -16.245 15.948  -6.723  1.00 0.00 ? 15 LYS A CD   9  
ATOM 10370 C CE   . LYS A 1 15 ? -16.877 15.564  -8.052  1.00 0.00 ? 15 LYS A CE   9  
ATOM 10371 N NZ   . LYS A 1 15 ? -18.231 16.162  -8.215  1.00 0.00 ? 15 LYS A NZ   9  
ATOM 10372 H H    . LYS A 1 15 ? -16.703 14.898  -1.340  1.00 0.00 ? 15 LYS A H    9  
ATOM 10373 H HA   . LYS A 1 15 ? -17.372 13.932  -3.315  1.00 0.00 ? 15 LYS A HA   9  
ATOM 10374 H HB2  . LYS A 1 15 ? -16.377 16.288  -3.796  1.00 0.00 ? 15 LYS A HB2  9  
ATOM 10375 H HB3  . LYS A 1 15 ? -15.062 15.398  -4.552  1.00 0.00 ? 15 LYS A HB3  9  
ATOM 10376 H HG2  . LYS A 1 15 ? -17.040 14.198  -5.805  1.00 0.00 ? 15 LYS A HG2  9  
ATOM 10377 H HG3  . LYS A 1 15 ? -17.895 15.687  -5.399  1.00 0.00 ? 15 LYS A HG3  9  
ATOM 10378 H HD2  . LYS A 1 15 ? -16.336 17.015  -6.589  1.00 0.00 ? 15 LYS A HD2  9  
ATOM 10379 H HD3  . LYS A 1 15 ? -15.200 15.673  -6.739  1.00 0.00 ? 15 LYS A HD3  9  
ATOM 10380 H HE2  . LYS A 1 15 ? -16.241 15.911  -8.852  1.00 0.00 ? 15 LYS A HE2  9  
ATOM 10381 H HE3  . LYS A 1 15 ? -16.960 14.488  -8.099  1.00 0.00 ? 15 LYS A HE3  9  
ATOM 10382 H HZ1  . LYS A 1 15 ? -18.173 17.199  -8.159  1.00 0.00 ? 15 LYS A HZ1  9  
ATOM 10383 H HZ2  . LYS A 1 15 ? -18.865 15.821  -7.465  1.00 0.00 ? 15 LYS A HZ2  9  
ATOM 10384 H HZ3  . LYS A 1 15 ? -18.630 15.898  -9.139  1.00 0.00 ? 15 LYS A HZ3  9  
ATOM 10385 N N    . LYS A 1 16 ? -15.303 12.066  -2.808  1.00 0.00 ? 16 LYS A N    9  
ATOM 10386 C CA   . LYS A 1 16 ? -14.529 10.862  -3.089  1.00 0.00 ? 16 LYS A CA   9  
ATOM 10387 C C    . LYS A 1 16 ? -15.310 9.611   -2.700  1.00 0.00 ? 16 LYS A C    9  
ATOM 10388 O O    . LYS A 1 16 ? -15.040 8.994   -1.670  1.00 0.00 ? 16 LYS A O    9  
ATOM 10389 C CB   . LYS A 1 16 ? -13.197 10.900  -2.335  1.00 0.00 ? 16 LYS A CB   9  
ATOM 10390 C CG   . LYS A 1 16 ? -12.081 11.582  -3.107  1.00 0.00 ? 16 LYS A CG   9  
ATOM 10391 C CD   . LYS A 1 16 ? -10.744 11.437  -2.400  1.00 0.00 ? 16 LYS A CD   9  
ATOM 10392 C CE   . LYS A 1 16 ? -9.614  12.051  -3.212  1.00 0.00 ? 16 LYS A CE   9  
ATOM 10393 N NZ   . LYS A 1 16 ? -9.706  13.536  -3.255  1.00 0.00 ? 16 LYS A NZ   9  
ATOM 10394 H H    . LYS A 1 16 ? -15.690 12.188  -1.916  1.00 0.00 ? 16 LYS A H    9  
ATOM 10395 H HA   . LYS A 1 16 ? -14.332 10.834  -4.149  1.00 0.00 ? 16 LYS A HA   9  
ATOM 10396 H HB2  . LYS A 1 16 ? -13.339 11.430  -1.405  1.00 0.00 ? 16 LYS A HB2  9  
ATOM 10397 H HB3  . LYS A 1 16 ? -12.891 9.887   -2.120  1.00 0.00 ? 16 LYS A HB3  9  
ATOM 10398 H HG2  . LYS A 1 16 ? -12.008 11.134  -4.087  1.00 0.00 ? 16 LYS A HG2  9  
ATOM 10399 H HG3  . LYS A 1 16 ? -12.314 12.633  -3.206  1.00 0.00 ? 16 LYS A HG3  9  
ATOM 10400 H HD2  . LYS A 1 16 ? -10.797 11.935  -1.443  1.00 0.00 ? 16 LYS A HD2  9  
ATOM 10401 H HD3  . LYS A 1 16 ? -10.539 10.386  -2.250  1.00 0.00 ? 16 LYS A HD3  9  
ATOM 10402 H HE2  . LYS A 1 16 ? -8.673  11.769  -2.765  1.00 0.00 ? 16 LYS A HE2  9  
ATOM 10403 H HE3  . LYS A 1 16 ? -9.663  11.666  -4.220  1.00 0.00 ? 16 LYS A HE3  9  
ATOM 10404 H HZ1  . LYS A 1 16 ? -10.400 13.831  -3.971  1.00 0.00 ? 16 LYS A HZ1  9  
ATOM 10405 H HZ2  . LYS A 1 16 ? -8.780  13.944  -3.497  1.00 0.00 ? 16 LYS A HZ2  9  
ATOM 10406 H HZ3  . LYS A 1 16 ? -10.002 13.903  -2.328  1.00 0.00 ? 16 LYS A HZ3  9  
ATOM 10407 N N    . GLY A 1 17 ? -16.279 9.241   -3.532  1.00 0.00 ? 17 GLY A N    9  
ATOM 10408 C CA   . GLY A 1 17 ? -17.082 8.064   -3.258  1.00 0.00 ? 17 GLY A CA   9  
ATOM 10409 C C    . GLY A 1 17 ? -18.566 8.372   -3.211  1.00 0.00 ? 17 GLY A C    9  
ATOM 10410 O O    . GLY A 1 17 ? -18.976 9.400   -2.672  1.00 0.00 ? 17 GLY A O    9  
ATOM 10411 H H    . GLY A 1 17 ? -16.449 9.771   -4.338  1.00 0.00 ? 17 GLY A H    9  
ATOM 10412 H HA2  . GLY A 1 17 ? -16.902 7.330   -4.029  1.00 0.00 ? 17 GLY A HA2  9  
ATOM 10413 H HA3  . GLY A 1 17 ? -16.782 7.651   -2.305  1.00 0.00 ? 17 GLY A HA3  9  
ATOM 10414 N N    . ARG A 1 18 ? -19.372 7.482   -3.779  1.00 0.00 ? 18 ARG A N    9  
ATOM 10415 C CA   . ARG A 1 18 ? -20.818 7.666   -3.803  1.00 0.00 ? 18 ARG A CA   9  
ATOM 10416 C C    . ARG A 1 18 ? -21.501 6.733   -2.807  1.00 0.00 ? 18 ARG A C    9  
ATOM 10417 O O    . ARG A 1 18 ? -22.377 7.151   -2.049  1.00 0.00 ? 18 ARG A O    9  
ATOM 10418 C CB   . ARG A 1 18 ? -21.363 7.414   -5.210  1.00 0.00 ? 18 ARG A CB   9  
ATOM 10419 C CG   . ARG A 1 18 ? -22.629 8.195   -5.521  1.00 0.00 ? 18 ARG A CG   9  
ATOM 10420 C CD   . ARG A 1 18 ? -23.872 7.438   -5.080  1.00 0.00 ? 18 ARG A CD   9  
ATOM 10421 N NE   . ARG A 1 18 ? -24.359 6.532   -6.117  1.00 0.00 ? 18 ARG A NE   9  
ATOM 10422 C CZ   . ARG A 1 18 ? -25.591 6.036   -6.140  1.00 0.00 ? 18 ARG A CZ   9  
ATOM 10423 N NH1  . ARG A 1 18 ? -26.456 6.355   -5.188  1.00 0.00 ? 18 ARG A NH1  9  
ATOM 10424 N NH2  . ARG A 1 18 ? -25.959 5.217   -7.117  1.00 0.00 ? 18 ARG A NH2  9  
ATOM 10425 H H    . ARG A 1 18 ? -18.985 6.682   -4.193  1.00 0.00 ? 18 ARG A H    9  
ATOM 10426 H HA   . ARG A 1 18 ? -21.027 8.687   -3.522  1.00 0.00 ? 18 ARG A HA   9  
ATOM 10427 H HB2  . ARG A 1 18 ? -20.608 7.694   -5.931  1.00 0.00 ? 18 ARG A HB2  9  
ATOM 10428 H HB3  . ARG A 1 18 ? -21.579 6.362   -5.317  1.00 0.00 ? 18 ARG A HB3  9  
ATOM 10429 H HG2  . ARG A 1 18 ? -22.595 9.141   -5.002  1.00 0.00 ? 18 ARG A HG2  9  
ATOM 10430 H HG3  . ARG A 1 18 ? -22.682 8.367   -6.586  1.00 0.00 ? 18 ARG A HG3  9  
ATOM 10431 H HD2  . ARG A 1 18 ? -23.634 6.864   -4.197  1.00 0.00 ? 18 ARG A HD2  9  
ATOM 10432 H HD3  . ARG A 1 18 ? -24.648 8.152   -4.845  1.00 0.00 ? 18 ARG A HD3  9  
ATOM 10433 H HE   . ARG A 1 18 ? -23.736 6.283   -6.830  1.00 0.00 ? 18 ARG A HE   9  
ATOM 10434 H HH11 . ARG A 1 18 ? -26.181 6.972   -4.450  1.00 0.00 ? 18 ARG A HH11 9  
ATOM 10435 H HH12 . ARG A 1 18 ? -27.383 5.981   -5.208  1.00 0.00 ? 18 ARG A HH12 9  
ATOM 10436 H HH21 . ARG A 1 18 ? -25.309 4.974   -7.837  1.00 0.00 ? 18 ARG A HH21 9  
ATOM 10437 H HH22 . ARG A 1 18 ? -26.886 4.844   -7.134  1.00 0.00 ? 18 ARG A HH22 9  
ATOM 10438 N N    . ARG A 1 19 ? -21.095 5.467   -2.816  1.00 0.00 ? 19 ARG A N    9  
ATOM 10439 C CA   . ARG A 1 19 ? -21.669 4.475   -1.915  1.00 0.00 ? 19 ARG A CA   9  
ATOM 10440 C C    . ARG A 1 19 ? -20.620 3.959   -0.935  1.00 0.00 ? 19 ARG A C    9  
ATOM 10441 O O    . ARG A 1 19 ? -20.766 4.103   0.279   1.00 0.00 ? 19 ARG A O    9  
ATOM 10442 C CB   . ARG A 1 19 ? -22.254 3.308   -2.714  1.00 0.00 ? 19 ARG A CB   9  
ATOM 10443 C CG   . ARG A 1 19 ? -23.223 3.740   -3.802  1.00 0.00 ? 19 ARG A CG   9  
ATOM 10444 C CD   . ARG A 1 19 ? -22.506 3.993   -5.118  1.00 0.00 ? 19 ARG A CD   9  
ATOM 10445 N NE   . ARG A 1 19 ? -22.351 2.771   -5.902  1.00 0.00 ? 19 ARG A NE   9  
ATOM 10446 C CZ   . ARG A 1 19 ? -22.156 2.759   -7.216  1.00 0.00 ? 19 ARG A CZ   9  
ATOM 10447 N NH1  . ARG A 1 19 ? -22.092 3.899   -7.890  1.00 0.00 ? 19 ARG A NH1  9  
ATOM 10448 N NH2  . ARG A 1 19 ? -22.024 1.606   -7.858  1.00 0.00 ? 19 ARG A NH2  9  
ATOM 10449 H H    . ARG A 1 19 ? -20.394 5.194   -3.443  1.00 0.00 ? 19 ARG A H    9  
ATOM 10450 H HA   . ARG A 1 19 ? -22.462 4.951   -1.358  1.00 0.00 ? 19 ARG A HA   9  
ATOM 10451 H HB2  . ARG A 1 19 ? -21.445 2.764   -3.179  1.00 0.00 ? 19 ARG A HB2  9  
ATOM 10452 H HB3  . ARG A 1 19 ? -22.777 2.650   -2.036  1.00 0.00 ? 19 ARG A HB3  9  
ATOM 10453 H HG2  . ARG A 1 19 ? -23.956 2.960   -3.948  1.00 0.00 ? 19 ARG A HG2  9  
ATOM 10454 H HG3  . ARG A 1 19 ? -23.718 4.647   -3.490  1.00 0.00 ? 19 ARG A HG3  9  
ATOM 10455 H HD2  . ARG A 1 19 ? -23.078 4.707   -5.693  1.00 0.00 ? 19 ARG A HD2  9  
ATOM 10456 H HD3  . ARG A 1 19 ? -21.529 4.401   -4.907  1.00 0.00 ? 19 ARG A HD3  9  
ATOM 10457 H HE   . ARG A 1 19 ? -22.395 1.917   -5.424  1.00 0.00 ? 19 ARG A HE   9  
ATOM 10458 H HH11 . ARG A 1 19 ? -22.191 4.770   -7.408  1.00 0.00 ? 19 ARG A HH11 9  
ATOM 10459 H HH12 . ARG A 1 19 ? -21.944 3.888   -8.879  1.00 0.00 ? 19 ARG A HH12 9  
ATOM 10460 H HH21 . ARG A 1 19 ? -22.071 0.744   -7.353  1.00 0.00 ? 19 ARG A HH21 9  
ATOM 10461 H HH22 . ARG A 1 19 ? -21.878 1.598   -8.847  1.00 0.00 ? 19 ARG A HH22 9  
ATOM 10462 N N    . SER A 1 20 ? -19.563 3.356   -1.470  1.00 0.00 ? 20 SER A N    9  
ATOM 10463 C CA   . SER A 1 20 ? -18.491 2.815   -0.642  1.00 0.00 ? 20 SER A CA   9  
ATOM 10464 C C    . SER A 1 20 ? -17.347 2.296   -1.507  1.00 0.00 ? 20 SER A C    9  
ATOM 10465 O O    . SER A 1 20 ? -17.550 1.462   -2.390  1.00 0.00 ? 20 SER A O    9  
ATOM 10466 C CB   . SER A 1 20 ? -19.024 1.691   0.248   1.00 0.00 ? 20 SER A CB   9  
ATOM 10467 O OG   . SER A 1 20 ? -19.447 0.583   -0.528  1.00 0.00 ? 20 SER A OG   9  
ATOM 10468 H H    . SER A 1 20 ? -19.504 3.272   -2.445  1.00 0.00 ? 20 SER A H    9  
ATOM 10469 H HA   . SER A 1 20 ? -18.121 3.613   -0.016  1.00 0.00 ? 20 SER A HA   9  
ATOM 10470 H HB2  . SER A 1 20 ? -18.244 1.367   0.920   1.00 0.00 ? 20 SER A HB2  9  
ATOM 10471 H HB3  . SER A 1 20 ? -19.864 2.056   0.820   1.00 0.00 ? 20 SER A HB3  9  
ATOM 10472 H HG   . SER A 1 20 ? -20.284 0.257   -0.191  1.00 0.00 ? 20 SER A HG   9  
ATOM 10473 N N    . ARG A 1 21 ? -16.143 2.795   -1.246  1.00 0.00 ? 21 ARG A N    9  
ATOM 10474 C CA   . ARG A 1 21 ? -14.965 2.383   -2.000  1.00 0.00 ? 21 ARG A CA   9  
ATOM 10475 C C    . ARG A 1 21 ? -14.112 1.412   -1.189  1.00 0.00 ? 21 ARG A C    9  
ATOM 10476 O O    . ARG A 1 21 ? -13.633 0.404   -1.709  1.00 0.00 ? 21 ARG A O    9  
ATOM 10477 C CB   . ARG A 1 21 ? -14.132 3.604   -2.394  1.00 0.00 ? 21 ARG A CB   9  
ATOM 10478 C CG   . ARG A 1 21 ? -14.534 4.211   -3.729  1.00 0.00 ? 21 ARG A CG   9  
ATOM 10479 C CD   . ARG A 1 21 ? -15.843 4.976   -3.622  1.00 0.00 ? 21 ARG A CD   9  
ATOM 10480 N NE   . ARG A 1 21 ? -16.509 5.104   -4.915  1.00 0.00 ? 21 ARG A NE   9  
ATOM 10481 C CZ   . ARG A 1 21 ? -17.099 4.092   -5.541  1.00 0.00 ? 21 ARG A CZ   9  
ATOM 10482 N NH1  . ARG A 1 21 ? -17.106 2.883   -4.995  1.00 0.00 ? 21 ARG A NH1  9  
ATOM 10483 N NH2  . ARG A 1 21 ? -17.685 4.287   -6.716  1.00 0.00 ? 21 ARG A NH2  9  
ATOM 10484 H H    . ARG A 1 21 ? -16.044 3.456   -0.530  1.00 0.00 ? 21 ARG A H    9  
ATOM 10485 H HA   . ARG A 1 21 ? -15.303 1.884   -2.897  1.00 0.00 ? 21 ARG A HA   9  
ATOM 10486 H HB2  . ARG A 1 21 ? -14.243 4.362   -1.632  1.00 0.00 ? 21 ARG A HB2  9  
ATOM 10487 H HB3  . ARG A 1 21 ? -13.094 3.314   -2.453  1.00 0.00 ? 21 ARG A HB3  9  
ATOM 10488 H HG2  . ARG A 1 21 ? -13.758 4.889   -4.053  1.00 0.00 ? 21 ARG A HG2  9  
ATOM 10489 H HG3  . ARG A 1 21 ? -14.648 3.418   -4.453  1.00 0.00 ? 21 ARG A HG3  9  
ATOM 10490 H HD2  . ARG A 1 21 ? -16.497 4.451   -2.942  1.00 0.00 ? 21 ARG A HD2  9  
ATOM 10491 H HD3  . ARG A 1 21 ? -15.637 5.962   -3.234  1.00 0.00 ? 21 ARG A HD3  9  
ATOM 10492 H HE   . ARG A 1 21 ? -16.517 5.988   -5.337  1.00 0.00 ? 21 ARG A HE   9  
ATOM 10493 H HH11 . ARG A 1 21 ? -16.666 2.733   -4.110  1.00 0.00 ? 21 ARG A HH11 9  
ATOM 10494 H HH12 . ARG A 1 21 ? -17.552 2.123   -5.468  1.00 0.00 ? 21 ARG A HH12 9  
ATOM 10495 H HH21 . ARG A 1 21 ? -17.682 5.196   -7.131  1.00 0.00 ? 21 ARG A HH21 9  
ATOM 10496 H HH22 . ARG A 1 21 ? -18.128 3.525   -7.186  1.00 0.00 ? 21 ARG A HH22 9  
ATOM 10497 N N    . THR A 1 22 ? -13.924 1.724   0.090   1.00 0.00 ? 22 THR A N    9  
ATOM 10498 C CA   . THR A 1 22 ? -13.128 0.881   0.973   1.00 0.00 ? 22 THR A CA   9  
ATOM 10499 C C    . THR A 1 22 ? -14.017 -0.009  1.833   1.00 0.00 ? 22 THR A C    9  
ATOM 10500 O O    . THR A 1 22 ? -15.126 0.376   2.203   1.00 0.00 ? 22 THR A O    9  
ATOM 10501 C CB   . THR A 1 22 ? -12.224 1.726   1.891   1.00 0.00 ? 22 THR A CB   9  
ATOM 10502 O OG1  . THR A 1 22 ? -11.754 0.928   2.984   1.00 0.00 ? 22 THR A OG1  9  
ATOM 10503 C CG2  . THR A 1 22 ? -12.976 2.935   2.426   1.00 0.00 ? 22 THR A CG2  9  
ATOM 10504 H H    . THR A 1 22 ? -14.331 2.541   0.446   1.00 0.00 ? 22 THR A H    9  
ATOM 10505 H HA   . THR A 1 22 ? -12.496 0.256   0.357   1.00 0.00 ? 22 THR A HA   9  
ATOM 10506 H HB   . THR A 1 22 ? -11.377 2.072   1.317   1.00 0.00 ? 22 THR A HB   9  
ATOM 10507 H HG1  . THR A 1 22 ? -12.355 1.017   3.727   1.00 0.00 ? 22 THR A HG1  9  
ATOM 10508 H HG21 . THR A 1 22 ? -13.113 3.654   1.632   1.00 0.00 ? 22 THR A HG21 9  
ATOM 10509 H HG22 . THR A 1 22 ? -12.409 3.386   3.227   1.00 0.00 ? 22 THR A HG22 9  
ATOM 10510 H HG23 . THR A 1 22 ? -13.940 2.623   2.798   1.00 0.00 ? 22 THR A HG23 9  
ATOM 10511 N N    . VAL A 1 23 ? -13.524 -1.203  2.148   1.00 0.00 ? 23 VAL A N    9  
ATOM 10512 C CA   . VAL A 1 23 ? -14.273 -2.148  2.967   1.00 0.00 ? 23 VAL A CA   9  
ATOM 10513 C C    . VAL A 1 23 ? -13.468 -2.577  4.188   1.00 0.00 ? 23 VAL A C    9  
ATOM 10514 O O    . VAL A 1 23 ? -13.518 -3.735  4.603   1.00 0.00 ? 23 VAL A O    9  
ATOM 10515 C CB   . VAL A 1 23 ? -14.668 -3.399  2.160   1.00 0.00 ? 23 VAL A CB   9  
ATOM 10516 C CG1  . VAL A 1 23 ? -15.685 -4.231  2.928   1.00 0.00 ? 23 VAL A CG1  9  
ATOM 10517 C CG2  . VAL A 1 23 ? -15.213 -3.003  0.796   1.00 0.00 ? 23 VAL A CG2  9  
ATOM 10518 H H    . VAL A 1 23 ? -12.634 -1.453  1.823   1.00 0.00 ? 23 VAL A H    9  
ATOM 10519 H HA   . VAL A 1 23 ? -15.178 -1.658  3.298   1.00 0.00 ? 23 VAL A HA   9  
ATOM 10520 H HB   . VAL A 1 23 ? -13.784 -4.000  2.011   1.00 0.00 ? 23 VAL A HB   9  
ATOM 10521 H HG11 . VAL A 1 23 ? -16.669 -4.066  2.516   1.00 0.00 ? 23 VAL A HG11 9  
ATOM 10522 H HG12 . VAL A 1 23 ? -15.429 -5.277  2.846   1.00 0.00 ? 23 VAL A HG12 9  
ATOM 10523 H HG13 . VAL A 1 23 ? -15.677 -3.938  3.968   1.00 0.00 ? 23 VAL A HG13 9  
ATOM 10524 H HG21 . VAL A 1 23 ? -14.604 -3.448  0.024   1.00 0.00 ? 23 VAL A HG21 9  
ATOM 10525 H HG22 . VAL A 1 23 ? -16.231 -3.353  0.699   1.00 0.00 ? 23 VAL A HG22 9  
ATOM 10526 H HG23 . VAL A 1 23 ? -15.191 -1.928  0.698   1.00 0.00 ? 23 VAL A HG23 9  
ATOM 10527 N N    . PHE A 1 24 ? -12.724 -1.636  4.760   1.00 0.00 ? 24 PHE A N    9  
ATOM 10528 C CA   . PHE A 1 24 ? -11.906 -1.916  5.934   1.00 0.00 ? 24 PHE A CA   9  
ATOM 10529 C C    . PHE A 1 24 ? -12.540 -1.327  7.192   1.00 0.00 ? 24 PHE A C    9  
ATOM 10530 O O    . PHE A 1 24 ? -12.968 -0.173  7.203   1.00 0.00 ? 24 PHE A O    9  
ATOM 10531 C CB   . PHE A 1 24 ? -10.497 -1.351  5.747   1.00 0.00 ? 24 PHE A CB   9  
ATOM 10532 C CG   . PHE A 1 24 ? -9.718  -2.033  4.659   1.00 0.00 ? 24 PHE A CG   9  
ATOM 10533 C CD1  . PHE A 1 24 ? -9.391  -3.376  4.759   1.00 0.00 ? 24 PHE A CD1  9  
ATOM 10534 C CD2  . PHE A 1 24 ? -9.312  -1.331  3.536   1.00 0.00 ? 24 PHE A CD2  9  
ATOM 10535 C CE1  . PHE A 1 24 ? -8.673  -4.005  3.760   1.00 0.00 ? 24 PHE A CE1  9  
ATOM 10536 C CE2  . PHE A 1 24 ? -8.594  -1.955  2.532   1.00 0.00 ? 24 PHE A CE2  9  
ATOM 10537 C CZ   . PHE A 1 24 ? -8.276  -3.294  2.644   1.00 0.00 ? 24 PHE A CZ   9  
ATOM 10538 H H    . PHE A 1 24 ? -12.725 -0.731  4.383   1.00 0.00 ? 24 PHE A H    9  
ATOM 10539 H HA   . PHE A 1 24 ? -11.844 -2.988  6.045   1.00 0.00 ? 24 PHE A HA   9  
ATOM 10540 H HB2  . PHE A 1 24 ? -10.567 -0.303  5.498   1.00 0.00 ? 24 PHE A HB2  9  
ATOM 10541 H HB3  . PHE A 1 24 ? -9.947  -1.462  6.670   1.00 0.00 ? 24 PHE A HB3  9  
ATOM 10542 H HD1  . PHE A 1 24 ? -9.702  -3.933  5.631   1.00 0.00 ? 24 PHE A HD1  9  
ATOM 10543 H HD2  . PHE A 1 24 ? -9.561  -0.283  3.447   1.00 0.00 ? 24 PHE A HD2  9  
ATOM 10544 H HE1  . PHE A 1 24 ? -8.426  -5.052  3.850   1.00 0.00 ? 24 PHE A HE1  9  
ATOM 10545 H HE2  . PHE A 1 24 ? -8.285  -1.396  1.662   1.00 0.00 ? 24 PHE A HE2  9  
ATOM 10546 H HZ   . PHE A 1 24 ? -7.714  -3.783  1.862   1.00 0.00 ? 24 PHE A HZ   9  
ATOM 10547 N N    . THR A 1 25 ? -12.596 -2.130  8.250   1.00 0.00 ? 25 THR A N    9  
ATOM 10548 C CA   . THR A 1 25 ? -13.178 -1.690  9.512   1.00 0.00 ? 25 THR A CA   9  
ATOM 10549 C C    . THR A 1 25 ? -12.170 -0.897  10.336  1.00 0.00 ? 25 THR A C    9  
ATOM 10550 O O    . THR A 1 25 ? -10.969 -0.939  10.071  1.00 0.00 ? 25 THR A O    9  
ATOM 10551 C CB   . THR A 1 25 ? -13.678 -2.885  10.346  1.00 0.00 ? 25 THR A CB   9  
ATOM 10552 O OG1  . THR A 1 25 ? -12.584 -3.484  11.049  1.00 0.00 ? 25 THR A OG1  9  
ATOM 10553 C CG2  . THR A 1 25 ? -14.346 -3.924  9.457   1.00 0.00 ? 25 THR A CG2  9  
ATOM 10554 H H    . THR A 1 25 ? -12.238 -3.039  8.179   1.00 0.00 ? 25 THR A H    9  
ATOM 10555 H HA   . THR A 1 25 ? -14.023 -1.056  9.287   1.00 0.00 ? 25 THR A HA   9  
ATOM 10556 H HB   . THR A 1 25 ? -14.404 -2.526  11.062  1.00 0.00 ? 25 THR A HB   9  
ATOM 10557 H HG1  . THR A 1 25 ? -12.575 -3.168  11.956  1.00 0.00 ? 25 THR A HG1  9  
ATOM 10558 H HG21 . THR A 1 25 ? -13.734 -4.812  9.420   1.00 0.00 ? 25 THR A HG21 9  
ATOM 10559 H HG22 . THR A 1 25 ? -14.462 -3.524  8.461   1.00 0.00 ? 25 THR A HG22 9  
ATOM 10560 H HG23 . THR A 1 25 ? -15.316 -4.172  9.861   1.00 0.00 ? 25 THR A HG23 9  
ATOM 10561 N N    . GLU A 1 26 ? -12.667 -0.174  11.335  1.00 0.00 ? 26 GLU A N    9  
ATOM 10562 C CA   . GLU A 1 26 ? -11.808 0.629   12.197  1.00 0.00 ? 26 GLU A CA   9  
ATOM 10563 C C    . GLU A 1 26 ? -10.632 -0.194  12.712  1.00 0.00 ? 26 GLU A C    9  
ATOM 10564 O O    . GLU A 1 26 ? -9.499  0.287   12.767  1.00 0.00 ? 26 GLU A O    9  
ATOM 10565 C CB   . GLU A 1 26 ? -12.609 1.188   13.375  1.00 0.00 ? 26 GLU A CB   9  
ATOM 10566 C CG   . GLU A 1 26 ? -13.400 2.440   13.034  1.00 0.00 ? 26 GLU A CG   9  
ATOM 10567 C CD   . GLU A 1 26 ? -14.123 3.017   14.235  1.00 0.00 ? 26 GLU A CD   9  
ATOM 10568 O OE1  . GLU A 1 26 ? -13.523 3.048   15.330  1.00 0.00 ? 26 GLU A OE1  9  
ATOM 10569 O OE2  . GLU A 1 26 ? -15.288 3.438   14.081  1.00 0.00 ? 26 GLU A OE2  9  
ATOM 10570 H H    . GLU A 1 26 ? -13.634 -0.181  11.495  1.00 0.00 ? 26 GLU A H    9  
ATOM 10571 H HA   . GLU A 1 26 ? -11.427 1.452   11.611  1.00 0.00 ? 26 GLU A HA   9  
ATOM 10572 H HB2  . GLU A 1 26 ? -13.301 0.431   13.715  1.00 0.00 ? 26 GLU A HB2  9  
ATOM 10573 H HB3  . GLU A 1 26 ? -11.927 1.425   14.177  1.00 0.00 ? 26 GLU A HB3  9  
ATOM 10574 H HG2  . GLU A 1 26 ? -12.720 3.186   12.650  1.00 0.00 ? 26 GLU A HG2  9  
ATOM 10575 H HG3  . GLU A 1 26 ? -14.129 2.195   12.277  1.00 0.00 ? 26 GLU A HG3  9  
ATOM 10576 N N    . LEU A 1 27 ? -10.908 -1.438  13.089  1.00 0.00 ? 27 LEU A N    9  
ATOM 10577 C CA   . LEU A 1 27 ? -9.873  -2.330  13.601  1.00 0.00 ? 27 LEU A CA   9  
ATOM 10578 C C    . LEU A 1 27 ? -8.796  -2.575  12.549  1.00 0.00 ? 27 LEU A C    9  
ATOM 10579 O O    . LEU A 1 27 ? -7.614  -2.335  12.791  1.00 0.00 ? 27 LEU A O    9  
ATOM 10580 C CB   . LEU A 1 27 ? -10.489 -3.661  14.036  1.00 0.00 ? 27 LEU A CB   9  
ATOM 10581 C CG   . LEU A 1 27 ? -9.715  -4.444  15.097  1.00 0.00 ? 27 LEU A CG   9  
ATOM 10582 C CD1  . LEU A 1 27 ? -10.157 -4.034  16.493  1.00 0.00 ? 27 LEU A CD1  9  
ATOM 10583 C CD2  . LEU A 1 27 ? -9.899  -5.941  14.895  1.00 0.00 ? 27 LEU A CD2  9  
ATOM 10584 H H    . LEU A 1 27 ? -11.829 -1.765  13.022  1.00 0.00 ? 27 LEU A H    9  
ATOM 10585 H HA   . LEU A 1 27 ? -9.421  -1.855  14.458  1.00 0.00 ? 27 LEU A HA   9  
ATOM 10586 H HB2  . LEU A 1 27 ? -11.473 -3.457  14.429  1.00 0.00 ? 27 LEU A HB2  9  
ATOM 10587 H HB3  . LEU A 1 27 ? -10.576 -4.286  13.159  1.00 0.00 ? 27 LEU A HB3  9  
ATOM 10588 H HG   . LEU A 1 27 ? -8.661  -4.220  15.002  1.00 0.00 ? 27 LEU A HG   9  
ATOM 10589 H HD11 . LEU A 1 27 ? -10.434 -2.990  16.490  1.00 0.00 ? 27 LEU A HD11 9  
ATOM 10590 H HD12 . LEU A 1 27 ? -9.346  -4.190  17.188  1.00 0.00 ? 27 LEU A HD12 9  
ATOM 10591 H HD13 . LEU A 1 27 ? -11.006 -4.631  16.791  1.00 0.00 ? 27 LEU A HD13 9  
ATOM 10592 H HD21 . LEU A 1 27 ? -10.546 -6.331  15.668  1.00 0.00 ? 27 LEU A HD21 9  
ATOM 10593 H HD22 . LEU A 1 27 ? -8.939  -6.433  14.948  1.00 0.00 ? 27 LEU A HD22 9  
ATOM 10594 H HD23 . LEU A 1 27 ? -10.344 -6.122  13.928  1.00 0.00 ? 27 LEU A HD23 9  
ATOM 10595 N N    . GLN A 1 28 ? -9.215  -3.052  11.381  1.00 0.00 ? 28 GLN A N    9  
ATOM 10596 C CA   . GLN A 1 28 ? -8.285  -3.327  10.292  1.00 0.00 ? 28 GLN A CA   9  
ATOM 10597 C C    . GLN A 1 28 ? -7.461  -2.090  9.953   1.00 0.00 ? 28 GLN A C    9  
ATOM 10598 O O    . GLN A 1 28 ? -6.230  -2.137  9.933   1.00 0.00 ? 28 GLN A O    9  
ATOM 10599 C CB   . GLN A 1 28 ? -9.045  -3.803  9.053   1.00 0.00 ? 28 GLN A CB   9  
ATOM 10600 C CG   . GLN A 1 28 ? -10.065 -4.892  9.345   1.00 0.00 ? 28 GLN A CG   9  
ATOM 10601 C CD   . GLN A 1 28 ? -9.447  -6.108  10.007  1.00 0.00 ? 28 GLN A CD   9  
ATOM 10602 O OE1  . GLN A 1 28 ? -9.365  -7.181  9.408   1.00 0.00 ? 28 GLN A OE1  9  
ATOM 10603 N NE2  . GLN A 1 28 ? -9.007  -5.946  11.250  1.00 0.00 ? 28 GLN A NE2  9  
ATOM 10604 H H    . GLN A 1 28 ? -10.170 -3.223  11.249  1.00 0.00 ? 28 GLN A H    9  
ATOM 10605 H HA   . GLN A 1 28 ? -7.618  -4.111  10.616  1.00 0.00 ? 28 GLN A HA   9  
ATOM 10606 H HB2  . GLN A 1 28 ? -9.563  -2.962  8.617   1.00 0.00 ? 28 GLN A HB2  9  
ATOM 10607 H HB3  . GLN A 1 28 ? -8.335  -4.189  8.336   1.00 0.00 ? 28 GLN A HB3  9  
ATOM 10608 H HG2  . GLN A 1 28 ? -10.823 -4.491  10.002  1.00 0.00 ? 28 GLN A HG2  9  
ATOM 10609 H HG3  . GLN A 1 28 ? -10.521 -5.199  8.416   1.00 0.00 ? 28 GLN A HG3  9  
ATOM 10610 H HE21 . GLN A 1 28 ? -9.107  -5.063  11.664  1.00 0.00 ? 28 GLN A HE21 9  
ATOM 10611 H HE22 . GLN A 1 28 ? -8.604  -6.716  11.702  1.00 0.00 ? 28 GLN A HE22 9  
ATOM 10612 N N    . LEU A 1 29 ? -8.147  -0.983  9.687   1.00 0.00 ? 29 LEU A N    9  
ATOM 10613 C CA   . LEU A 1 29 ? -7.478  0.268   9.349   1.00 0.00 ? 29 LEU A CA   9  
ATOM 10614 C C    . LEU A 1 29 ? -6.558  0.717   10.479  1.00 0.00 ? 29 LEU A C    9  
ATOM 10615 O O    . LEU A 1 29 ? -5.455  1.208   10.238  1.00 0.00 ? 29 LEU A O    9  
ATOM 10616 C CB   . LEU A 1 29 ? -8.511  1.357   9.053   1.00 0.00 ? 29 LEU A CB   9  
ATOM 10617 C CG   . LEU A 1 29 ? -9.232  1.252   7.709   1.00 0.00 ? 29 LEU A CG   9  
ATOM 10618 C CD1  . LEU A 1 29 ? -10.307 2.321   7.595   1.00 0.00 ? 29 LEU A CD1  9  
ATOM 10619 C CD2  . LEU A 1 29 ? -8.239  1.366   6.561   1.00 0.00 ? 29 LEU A CD2  9  
ATOM 10620 H H    . LEU A 1 29 ? -9.125  -1.007  9.719   1.00 0.00 ? 29 LEU A H    9  
ATOM 10621 H HA   . LEU A 1 29 ? -6.884  0.097   8.464   1.00 0.00 ? 29 LEU A HA   9  
ATOM 10622 H HB2  . LEU A 1 29 ? -9.257  1.325   9.832   1.00 0.00 ? 29 LEU A HB2  9  
ATOM 10623 H HB3  . LEU A 1 29 ? -8.002  2.311   9.083   1.00 0.00 ? 29 LEU A HB3  9  
ATOM 10624 H HG   . LEU A 1 29 ? -9.713  0.286   7.641   1.00 0.00 ? 29 LEU A HG   9  
ATOM 10625 H HD11 . LEU A 1 29 ? -9.922  3.161   7.037   1.00 0.00 ? 29 LEU A HD11 9  
ATOM 10626 H HD12 . LEU A 1 29 ? -10.598 2.646   8.583   1.00 0.00 ? 29 LEU A HD12 9  
ATOM 10627 H HD13 . LEU A 1 29 ? -11.167 1.913   7.084   1.00 0.00 ? 29 LEU A HD13 9  
ATOM 10628 H HD21 . LEU A 1 29 ? -7.242  1.487   6.958   1.00 0.00 ? 29 LEU A HD21 9  
ATOM 10629 H HD22 . LEU A 1 29 ? -8.490  2.223   5.952   1.00 0.00 ? 29 LEU A HD22 9  
ATOM 10630 H HD23 . LEU A 1 29 ? -8.281  0.471   5.958   1.00 0.00 ? 29 LEU A HD23 9  
ATOM 10631 N N    . MET A 1 30 ? -7.018  0.544   11.714  1.00 0.00 ? 30 MET A N    9  
ATOM 10632 C CA   . MET A 1 30 ? -6.235  0.929   12.882  1.00 0.00 ? 30 MET A CA   9  
ATOM 10633 C C    . MET A 1 30 ? -4.811  0.389   12.784  1.00 0.00 ? 30 MET A C    9  
ATOM 10634 O O    . MET A 1 30 ? -3.851  1.080   13.122  1.00 0.00 ? 30 MET A O    9  
ATOM 10635 C CB   . MET A 1 30 ? -6.900  0.415   14.161  1.00 0.00 ? 30 MET A CB   9  
ATOM 10636 C CG   . MET A 1 30 ? -6.104  0.711   15.421  1.00 0.00 ? 30 MET A CG   9  
ATOM 10637 S SD   . MET A 1 30 ? -7.152  0.900   16.876  1.00 0.00 ? 30 MET A SD   9  
ATOM 10638 C CE   . MET A 1 30 ? -7.547  -0.810  17.233  1.00 0.00 ? 30 MET A CE   9  
ATOM 10639 H H    . MET A 1 30 ? -7.905  0.148   11.843  1.00 0.00 ? 30 MET A H    9  
ATOM 10640 H HA   . MET A 1 30 ? -6.197  2.007   12.916  1.00 0.00 ? 30 MET A HA   9  
ATOM 10641 H HB2  . MET A 1 30 ? -7.871  0.876   14.258  1.00 0.00 ? 30 MET A HB2  9  
ATOM 10642 H HB3  . MET A 1 30 ? -7.024  -0.655  14.083  1.00 0.00 ? 30 MET A HB3  9  
ATOM 10643 H HG2  . MET A 1 30 ? -5.414  -0.102  15.595  1.00 0.00 ? 30 MET A HG2  9  
ATOM 10644 H HG3  . MET A 1 30 ? -5.548  1.625   15.273  1.00 0.00 ? 30 MET A HG3  9  
ATOM 10645 H HE1  . MET A 1 30 ? -6.657  -1.414  17.133  1.00 0.00 ? 30 MET A HE1  9  
ATOM 10646 H HE2  . MET A 1 30 ? -7.924  -0.889  18.242  1.00 0.00 ? 30 MET A HE2  9  
ATOM 10647 H HE3  . MET A 1 30 ? -8.298  -1.158  16.539  1.00 0.00 ? 30 MET A HE3  9  
ATOM 10648 N N    . GLY A 1 31 ? -4.683  -0.850  12.318  1.00 0.00 ? 31 GLY A N    9  
ATOM 10649 C CA   . GLY A 1 31 ? -3.373  -1.460  12.184  1.00 0.00 ? 31 GLY A CA   9  
ATOM 10650 C C    . GLY A 1 31 ? -2.681  -1.069  10.894  1.00 0.00 ? 31 GLY A C    9  
ATOM 10651 O O    . GLY A 1 31 ? -1.514  -0.673  10.902  1.00 0.00 ? 31 GLY A O    9  
ATOM 10652 H H    . GLY A 1 31 ? -5.485  -1.353  12.064  1.00 0.00 ? 31 GLY A H    9  
ATOM 10653 H HA2  . GLY A 1 31 ? -2.759  -1.154  13.018  1.00 0.00 ? 31 GLY A HA2  9  
ATOM 10654 H HA3  . GLY A 1 31 ? -3.485  -2.534  12.207  1.00 0.00 ? 31 GLY A HA3  9  
ATOM 10655 N N    . LEU A 1 32 ? -3.398  -1.180  9.782   1.00 0.00 ? 32 LEU A N    9  
ATOM 10656 C CA   . LEU A 1 32 ? -2.845  -0.837  8.476   1.00 0.00 ? 32 LEU A CA   9  
ATOM 10657 C C    . LEU A 1 32 ? -2.157  0.524   8.518   1.00 0.00 ? 32 LEU A C    9  
ATOM 10658 O O    . LEU A 1 32 ? -1.062  0.692   7.983   1.00 0.00 ? 32 LEU A O    9  
ATOM 10659 C CB   . LEU A 1 32 ? -3.950  -0.830  7.418   1.00 0.00 ? 32 LEU A CB   9  
ATOM 10660 C CG   . LEU A 1 32 ? -4.453  -2.202  6.965   1.00 0.00 ? 32 LEU A CG   9  
ATOM 10661 C CD1  . LEU A 1 32 ? -5.787  -2.070  6.247   1.00 0.00 ? 32 LEU A CD1  9  
ATOM 10662 C CD2  . LEU A 1 32 ? -3.427  -2.877  6.068   1.00 0.00 ? 32 LEU A CD2  9  
ATOM 10663 H H    . LEU A 1 32 ? -4.322  -1.501  9.838   1.00 0.00 ? 32 LEU A H    9  
ATOM 10664 H HA   . LEU A 1 32 ? -2.114  -1.588  8.218   1.00 0.00 ? 32 LEU A HA   9  
ATOM 10665 H HB2  . LEU A 1 32 ? -4.790  -0.286  7.820   1.00 0.00 ? 32 LEU A HB2  9  
ATOM 10666 H HB3  . LEU A 1 32 ? -3.570  -0.313  6.548   1.00 0.00 ? 32 LEU A HB3  9  
ATOM 10667 H HG   . LEU A 1 32 ? -4.603  -2.828  7.834   1.00 0.00 ? 32 LEU A HG   9  
ATOM 10668 H HD11 . LEU A 1 32 ? -5.896  -2.876  5.538   1.00 0.00 ? 32 LEU A HD11 9  
ATOM 10669 H HD12 . LEU A 1 32 ? -5.823  -1.125  5.726   1.00 0.00 ? 32 LEU A HD12 9  
ATOM 10670 H HD13 . LEU A 1 32 ? -6.590  -2.113  6.969   1.00 0.00 ? 32 LEU A HD13 9  
ATOM 10671 H HD21 . LEU A 1 32 ? -2.760  -2.132  5.660   1.00 0.00 ? 32 LEU A HD21 9  
ATOM 10672 H HD22 . LEU A 1 32 ? -3.934  -3.387  5.261   1.00 0.00 ? 32 LEU A HD22 9  
ATOM 10673 H HD23 . LEU A 1 32 ? -2.859  -3.592  6.645   1.00 0.00 ? 32 LEU A HD23 9  
ATOM 10674 N N    . GLU A 1 33 ? -2.807  1.491   9.157   1.00 0.00 ? 33 GLU A N    9  
ATOM 10675 C CA   . GLU A 1 33 ? -2.257  2.837   9.269   1.00 0.00 ? 33 GLU A CA   9  
ATOM 10676 C C    . GLU A 1 33 ? -1.014  2.844   10.154  1.00 0.00 ? 33 GLU A C    9  
ATOM 10677 O O    . GLU A 1 33 ? -0.021  3.504   9.846   1.00 0.00 ? 33 GLU A O    9  
ATOM 10678 C CB   . GLU A 1 33 ? -3.306  3.796   9.836   1.00 0.00 ? 33 GLU A CB   9  
ATOM 10679 C CG   . GLU A 1 33 ? -4.485  4.027   8.906   1.00 0.00 ? 33 GLU A CG   9  
ATOM 10680 C CD   . GLU A 1 33 ? -5.640  4.728   9.593   1.00 0.00 ? 33 GLU A CD   9  
ATOM 10681 O OE1  . GLU A 1 33 ? -6.385  4.055   10.336  1.00 0.00 ? 33 GLU A OE1  9  
ATOM 10682 O OE2  . GLU A 1 33 ? -5.801  5.949   9.388   1.00 0.00 ? 33 GLU A OE2  9  
ATOM 10683 H H    . GLU A 1 33 ? -3.678  1.295   9.563   1.00 0.00 ? 33 GLU A H    9  
ATOM 10684 H HA   . GLU A 1 33 ? -1.980  3.165   8.279   1.00 0.00 ? 33 GLU A HA   9  
ATOM 10685 H HB2  . GLU A 1 33 ? -3.680  3.392   10.766  1.00 0.00 ? 33 GLU A HB2  9  
ATOM 10686 H HB3  . GLU A 1 33 ? -2.836  4.748   10.032  1.00 0.00 ? 33 GLU A HB3  9  
ATOM 10687 H HG2  . GLU A 1 33 ? -4.158  4.635   8.076   1.00 0.00 ? 33 GLU A HG2  9  
ATOM 10688 H HG3  . GLU A 1 33 ? -4.830  3.072   8.538   1.00 0.00 ? 33 GLU A HG3  9  
ATOM 10689 N N    . LYS A 1 34 ? -1.076  2.106   11.257  1.00 0.00 ? 34 LYS A N    9  
ATOM 10690 C CA   . LYS A 1 34 ? 0.043   2.025   12.188  1.00 0.00 ? 34 LYS A CA   9  
ATOM 10691 C C    . LYS A 1 34 ? 1.278   1.445   11.506  1.00 0.00 ? 34 LYS A C    9  
ATOM 10692 O O    . LYS A 1 34 ? 2.332   2.080   11.466  1.00 0.00 ? 34 LYS A O    9  
ATOM 10693 C CB   . LYS A 1 34 ? -0.334  1.166   13.398  1.00 0.00 ? 34 LYS A CB   9  
ATOM 10694 C CG   . LYS A 1 34 ? 0.460   1.497   14.650  1.00 0.00 ? 34 LYS A CG   9  
ATOM 10695 C CD   . LYS A 1 34 ? -0.199  2.607   15.452  1.00 0.00 ? 34 LYS A CD   9  
ATOM 10696 C CE   . LYS A 1 34 ? 0.567   2.900   16.732  1.00 0.00 ? 34 LYS A CE   9  
ATOM 10697 N NZ   . LYS A 1 34 ? 0.592   1.724   17.645  1.00 0.00 ? 34 LYS A NZ   9  
ATOM 10698 H H    . LYS A 1 34 ? -1.895  1.602   11.449  1.00 0.00 ? 34 LYS A H    9  
ATOM 10699 H HA   . LYS A 1 34 ? 0.268   3.025   12.524  1.00 0.00 ? 34 LYS A HA   9  
ATOM 10700 H HB2  . LYS A 1 34 ? -1.383  1.310   13.613  1.00 0.00 ? 34 LYS A HB2  9  
ATOM 10701 H HB3  . LYS A 1 34 ? -0.165  0.127   13.154  1.00 0.00 ? 34 LYS A HB3  9  
ATOM 10702 H HG2  . LYS A 1 34 ? 0.527   0.613   15.267  1.00 0.00 ? 34 LYS A HG2  9  
ATOM 10703 H HG3  . LYS A 1 34 ? 1.452   1.814   14.362  1.00 0.00 ? 34 LYS A HG3  9  
ATOM 10704 H HD2  . LYS A 1 34 ? -0.230  3.503   14.851  1.00 0.00 ? 34 LYS A HD2  9  
ATOM 10705 H HD3  . LYS A 1 34 ? -1.206  2.306   15.705  1.00 0.00 ? 34 LYS A HD3  9  
ATOM 10706 H HE2  . LYS A 1 34 ? 1.580   3.168   16.477  1.00 0.00 ? 34 LYS A HE2  9  
ATOM 10707 H HE3  . LYS A 1 34 ? 0.092   3.728   17.238  1.00 0.00 ? 34 LYS A HE3  9  
ATOM 10708 H HZ1  . LYS A 1 34 ? 1.163   1.938   18.488  1.00 0.00 ? 34 LYS A HZ1  9  
ATOM 10709 H HZ2  . LYS A 1 34 ? 1.006   0.903   17.159  1.00 0.00 ? 34 LYS A HZ2  9  
ATOM 10710 H HZ3  . LYS A 1 34 ? -0.374  1.484   17.946  1.00 0.00 ? 34 LYS A HZ3  9  
ATOM 10711 N N    . ARG A 1 35 ? 1.140   0.237   10.969  1.00 0.00 ? 35 ARG A N    9  
ATOM 10712 C CA   . ARG A 1 35 ? 2.245   -0.427  10.288  1.00 0.00 ? 35 ARG A CA   9  
ATOM 10713 C C    . ARG A 1 35 ? 2.737   0.407   9.109   1.00 0.00 ? 35 ARG A C    9  
ATOM 10714 O O    . ARG A 1 35 ? 3.870   0.889   9.105   1.00 0.00 ? 35 ARG A O    9  
ATOM 10715 C CB   . ARG A 1 35 ? 1.814   -1.812  9.802   1.00 0.00 ? 35 ARG A CB   9  
ATOM 10716 C CG   . ARG A 1 35 ? 1.942   -2.896  10.860  1.00 0.00 ? 35 ARG A CG   9  
ATOM 10717 C CD   . ARG A 1 35 ? 3.399   -3.175  11.197  1.00 0.00 ? 35 ARG A CD   9  
ATOM 10718 N NE   . ARG A 1 35 ? 3.537   -4.250  12.176  1.00 0.00 ? 35 ARG A NE   9  
ATOM 10719 C CZ   . ARG A 1 35 ? 3.207   -4.126  13.456  1.00 0.00 ? 35 ARG A CZ   9  
ATOM 10720 N NH1  . ARG A 1 35 ? 2.720   -2.979  13.910  1.00 0.00 ? 35 ARG A NH1  9  
ATOM 10721 N NH2  . ARG A 1 35 ? 3.362   -5.150  14.286  1.00 0.00 ? 35 ARG A NH2  9  
ATOM 10722 H H    . ARG A 1 35 ? 0.275   -0.219  11.033  1.00 0.00 ? 35 ARG A H    9  
ATOM 10723 H HA   . ARG A 1 35 ? 3.052   -0.539  10.996  1.00 0.00 ? 35 ARG A HA   9  
ATOM 10724 H HB2  . ARG A 1 35 ? 0.781   -1.766  9.490   1.00 0.00 ? 35 ARG A HB2  9  
ATOM 10725 H HB3  . ARG A 1 35 ? 2.425   -2.090  8.957   1.00 0.00 ? 35 ARG A HB3  9  
ATOM 10726 H HG2  . ARG A 1 35 ? 1.433   -2.574  11.756  1.00 0.00 ? 35 ARG A HG2  9  
ATOM 10727 H HG3  . ARG A 1 35 ? 1.487   -3.802  10.490  1.00 0.00 ? 35 ARG A HG3  9  
ATOM 10728 H HD2  . ARG A 1 35 ? 3.916   -3.457  10.292  1.00 0.00 ? 35 ARG A HD2  9  
ATOM 10729 H HD3  . ARG A 1 35 ? 3.840   -2.276  11.599  1.00 0.00 ? 35 ARG A HD3  9  
ATOM 10730 H HE   . ARG A 1 35 ? 3.894   -5.107  11.862  1.00 0.00 ? 35 ARG A HE   9  
ATOM 10731 H HH11 . ARG A 1 35 ? 2.602   -2.206  13.287  1.00 0.00 ? 35 ARG A HH11 9  
ATOM 10732 H HH12 . ARG A 1 35 ? 2.471   -2.888  14.875  1.00 0.00 ? 35 ARG A HH12 9  
ATOM 10733 H HH21 . ARG A 1 35 ? 3.728   -6.016  13.947  1.00 0.00 ? 35 ARG A HH21 9  
ATOM 10734 H HH22 . ARG A 1 35 ? 3.113   -5.055  15.249  1.00 0.00 ? 35 ARG A HH22 9  
ATOM 10735 N N    . PHE A 1 36 ? 1.877   0.574   8.109   1.00 0.00 ? 36 PHE A N    9  
ATOM 10736 C CA   . PHE A 1 36 ? 2.225   1.348   6.923   1.00 0.00 ? 36 PHE A CA   9  
ATOM 10737 C C    . PHE A 1 36 ? 3.086   2.552   7.293   1.00 0.00 ? 36 PHE A C    9  
ATOM 10738 O O    . PHE A 1 36 ? 4.189   2.721   6.775   1.00 0.00 ? 36 PHE A O    9  
ATOM 10739 C CB   . PHE A 1 36 ? 0.958   1.815   6.204   1.00 0.00 ? 36 PHE A CB   9  
ATOM 10740 C CG   . PHE A 1 36 ? 1.232   2.680   5.007   1.00 0.00 ? 36 PHE A CG   9  
ATOM 10741 C CD1  . PHE A 1 36 ? 1.783   3.942   5.161   1.00 0.00 ? 36 PHE A CD1  9  
ATOM 10742 C CD2  . PHE A 1 36 ? 0.939   2.232   3.730   1.00 0.00 ? 36 PHE A CD2  9  
ATOM 10743 C CE1  . PHE A 1 36 ? 2.035   4.741   4.062   1.00 0.00 ? 36 PHE A CE1  9  
ATOM 10744 C CE2  . PHE A 1 36 ? 1.190   3.026   2.626   1.00 0.00 ? 36 PHE A CE2  9  
ATOM 10745 C CZ   . PHE A 1 36 ? 1.740   4.282   2.793   1.00 0.00 ? 36 PHE A CZ   9  
ATOM 10746 H H    . PHE A 1 36 ? 0.988   0.165   8.170   1.00 0.00 ? 36 PHE A H    9  
ATOM 10747 H HA   . PHE A 1 36 ? 2.788   0.707   6.263   1.00 0.00 ? 36 PHE A HA   9  
ATOM 10748 H HB2  . PHE A 1 36 ? 0.404   0.951   5.868   1.00 0.00 ? 36 PHE A HB2  9  
ATOM 10749 H HB3  . PHE A 1 36 ? 0.349   2.381   6.893   1.00 0.00 ? 36 PHE A HB3  9  
ATOM 10750 H HD1  . PHE A 1 36 ? 2.016   4.302   6.152   1.00 0.00 ? 36 PHE A HD1  9  
ATOM 10751 H HD2  . PHE A 1 36 ? 0.509   1.249   3.598   1.00 0.00 ? 36 PHE A HD2  9  
ATOM 10752 H HE1  . PHE A 1 36 ? 2.466   5.723   4.194   1.00 0.00 ? 36 PHE A HE1  9  
ATOM 10753 H HE2  . PHE A 1 36 ? 0.957   2.664   1.636   1.00 0.00 ? 36 PHE A HE2  9  
ATOM 10754 H HZ   . PHE A 1 36 ? 1.936   4.905   1.933   1.00 0.00 ? 36 PHE A HZ   9  
ATOM 10755 N N    . GLU A 1 37 ? 2.572   3.386   8.192   1.00 0.00 ? 37 GLU A N    9  
ATOM 10756 C CA   . GLU A 1 37 ? 3.294   4.575   8.630   1.00 0.00 ? 37 GLU A CA   9  
ATOM 10757 C C    . GLU A 1 37 ? 4.701   4.216   9.099   1.00 0.00 ? 37 GLU A C    9  
ATOM 10758 O O    . GLU A 1 37 ? 5.689   4.771   8.617   1.00 0.00 ? 37 GLU A O    9  
ATOM 10759 C CB   . GLU A 1 37 ? 2.532   5.275   9.757   1.00 0.00 ? 37 GLU A CB   9  
ATOM 10760 C CG   . GLU A 1 37 ? 1.377   6.134   9.270   1.00 0.00 ? 37 GLU A CG   9  
ATOM 10761 C CD   . GLU A 1 37 ? 1.839   7.317   8.442   1.00 0.00 ? 37 GLU A CD   9  
ATOM 10762 O OE1  . GLU A 1 37 ? 1.977   7.163   7.211   1.00 0.00 ? 37 GLU A OE1  9  
ATOM 10763 O OE2  . GLU A 1 37 ? 2.063   8.398   9.027   1.00 0.00 ? 37 GLU A OE2  9  
ATOM 10764 H H    . GLU A 1 37 ? 1.688   3.197   8.569   1.00 0.00 ? 37 GLU A H    9  
ATOM 10765 H HA   . GLU A 1 37 ? 3.368   5.247   7.788   1.00 0.00 ? 37 GLU A HA   9  
ATOM 10766 H HB2  . GLU A 1 37 ? 2.138   4.525   10.429  1.00 0.00 ? 37 GLU A HB2  9  
ATOM 10767 H HB3  . GLU A 1 37 ? 3.218   5.907   10.301  1.00 0.00 ? 37 GLU A HB3  9  
ATOM 10768 H HG2  . GLU A 1 37 ? 0.722   5.525   8.665   1.00 0.00 ? 37 GLU A HG2  9  
ATOM 10769 H HG3  . GLU A 1 37 ? 0.833   6.503   10.127  1.00 0.00 ? 37 GLU A HG3  9  
ATOM 10770 N N    . LYS A 1 38 ? 4.784   3.284   10.042  1.00 0.00 ? 38 LYS A N    9  
ATOM 10771 C CA   . LYS A 1 38 ? 6.068   2.849   10.577  1.00 0.00 ? 38 LYS A CA   9  
ATOM 10772 C C    . LYS A 1 38 ? 6.975   2.334   9.464   1.00 0.00 ? 38 LYS A C    9  
ATOM 10773 O O    . LYS A 1 38 ? 8.193   2.504   9.515   1.00 0.00 ? 38 LYS A O    9  
ATOM 10774 C CB   . LYS A 1 38 ? 5.862   1.756   11.628  1.00 0.00 ? 38 LYS A CB   9  
ATOM 10775 C CG   . LYS A 1 38 ? 5.181   2.248   12.893  1.00 0.00 ? 38 LYS A CG   9  
ATOM 10776 C CD   . LYS A 1 38 ? 5.293   1.234   14.018  1.00 0.00 ? 38 LYS A CD   9  
ATOM 10777 C CE   . LYS A 1 38 ? 6.579   1.419   14.809  1.00 0.00 ? 38 LYS A CE   9  
ATOM 10778 N NZ   . LYS A 1 38 ? 7.764   0.902   14.070  1.00 0.00 ? 38 LYS A NZ   9  
ATOM 10779 H H    . LYS A 1 38 ? 3.960   2.878   10.387  1.00 0.00 ? 38 LYS A H    9  
ATOM 10780 H HA   . LYS A 1 38 ? 6.539   3.701   11.044  1.00 0.00 ? 38 LYS A HA   9  
ATOM 10781 H HB2  . LYS A 1 38 ? 5.256   0.971   11.200  1.00 0.00 ? 38 LYS A HB2  9  
ATOM 10782 H HB3  . LYS A 1 38 ? 6.826   1.348   11.899  1.00 0.00 ? 38 LYS A HB3  9  
ATOM 10783 H HG2  . LYS A 1 38 ? 5.647   3.171   13.206  1.00 0.00 ? 38 LYS A HG2  9  
ATOM 10784 H HG3  . LYS A 1 38 ? 4.135   2.425   12.682  1.00 0.00 ? 38 LYS A HG3  9  
ATOM 10785 H HD2  . LYS A 1 38 ? 4.453   1.355   14.686  1.00 0.00 ? 38 LYS A HD2  9  
ATOM 10786 H HD3  . LYS A 1 38 ? 5.279   0.239   13.597  1.00 0.00 ? 38 LYS A HD3  9  
ATOM 10787 H HE2  . LYS A 1 38 ? 6.718   2.471   15.004  1.00 0.00 ? 38 LYS A HE2  9  
ATOM 10788 H HE3  . LYS A 1 38 ? 6.489   0.888   15.745  1.00 0.00 ? 38 LYS A HE3  9  
ATOM 10789 H HZ1  . LYS A 1 38 ? 8.395   0.392   14.720  1.00 0.00 ? 38 LYS A HZ1  9  
ATOM 10790 H HZ2  . LYS A 1 38 ? 8.289   1.691   13.642  1.00 0.00 ? 38 LYS A HZ2  9  
ATOM 10791 H HZ3  . LYS A 1 38 ? 7.460   0.252   13.317  1.00 0.00 ? 38 LYS A HZ3  9  
ATOM 10792 N N    . GLN A 1 39 ? 6.373   1.706   8.459   1.00 0.00 ? 39 GLN A N    9  
ATOM 10793 C CA   . GLN A 1 39 ? 7.128   1.168   7.333   1.00 0.00 ? 39 GLN A CA   9  
ATOM 10794 C C    . GLN A 1 39 ? 6.352   1.330   6.031   1.00 0.00 ? 39 GLN A C    9  
ATOM 10795 O O    . GLN A 1 39 ? 5.274   0.759   5.862   1.00 0.00 ? 39 GLN A O    9  
ATOM 10796 C CB   . GLN A 1 39 ? 7.451   -0.309  7.568   1.00 0.00 ? 39 GLN A CB   9  
ATOM 10797 C CG   . GLN A 1 39 ? 6.302   -1.093  8.181   1.00 0.00 ? 39 GLN A CG   9  
ATOM 10798 C CD   . GLN A 1 39 ? 6.776   -2.269  9.013   1.00 0.00 ? 39 GLN A CD   9  
ATOM 10799 O OE1  . GLN A 1 39 ? 6.226   -2.552  10.078  1.00 0.00 ? 39 GLN A OE1  9  
ATOM 10800 N NE2  . GLN A 1 39 ? 7.801   -2.961  8.530   1.00 0.00 ? 39 GLN A NE2  9  
ATOM 10801 H H    . GLN A 1 39 ? 5.399   1.602   8.476   1.00 0.00 ? 39 GLN A H    9  
ATOM 10802 H HA   . GLN A 1 39 ? 8.051   1.721   7.259   1.00 0.00 ? 39 GLN A HA   9  
ATOM 10803 H HB2  . GLN A 1 39 ? 7.705   -0.764  6.623   1.00 0.00 ? 39 GLN A HB2  9  
ATOM 10804 H HB3  . GLN A 1 39 ? 8.300   -0.378  8.232   1.00 0.00 ? 39 GLN A HB3  9  
ATOM 10805 H HG2  . GLN A 1 39 ? 5.729   -0.432  8.815   1.00 0.00 ? 39 GLN A HG2  9  
ATOM 10806 H HG3  . GLN A 1 39 ? 5.671   -1.463  7.387   1.00 0.00 ? 39 GLN A HG3  9  
ATOM 10807 H HE21 . GLN A 1 39 ? 8.189   -2.676  7.676   1.00 0.00 ? 39 GLN A HE21 9  
ATOM 10808 H HE22 . GLN A 1 39 ? 8.128   -3.725  9.047   1.00 0.00 ? 39 GLN A HE22 9  
ATOM 10809 N N    . LYS A 1 40 ? 6.906   2.113   5.111   1.00 0.00 ? 40 LYS A N    9  
ATOM 10810 C CA   . LYS A 1 40 ? 6.267   2.350   3.822   1.00 0.00 ? 40 LYS A CA   9  
ATOM 10811 C C    . LYS A 1 40 ? 5.948   1.033   3.122   1.00 0.00 ? 40 LYS A C    9  
ATOM 10812 O O    . LYS A 1 40 ? 5.172   0.999   2.167   1.00 0.00 ? 40 LYS A O    9  
ATOM 10813 C CB   . LYS A 1 40 ? 7.171   3.207   2.932   1.00 0.00 ? 40 LYS A CB   9  
ATOM 10814 C CG   . LYS A 1 40 ? 7.154   4.683   3.290   1.00 0.00 ? 40 LYS A CG   9  
ATOM 10815 C CD   . LYS A 1 40 ? 5.892   5.365   2.787   1.00 0.00 ? 40 LYS A CD   9  
ATOM 10816 C CE   . LYS A 1 40 ? 5.554   6.594   3.617   1.00 0.00 ? 40 LYS A CE   9  
ATOM 10817 N NZ   . LYS A 1 40 ? 5.229   6.240   5.026   1.00 0.00 ? 40 LYS A NZ   9  
ATOM 10818 H H    . LYS A 1 40 ? 7.767   2.541   5.304   1.00 0.00 ? 40 LYS A H    9  
ATOM 10819 H HA   . LYS A 1 40 ? 5.345   2.881   4.002   1.00 0.00 ? 40 LYS A HA   9  
ATOM 10820 H HB2  . LYS A 1 40 ? 8.186   2.849   3.019   1.00 0.00 ? 40 LYS A HB2  9  
ATOM 10821 H HB3  . LYS A 1 40 ? 6.848   3.104   1.906   1.00 0.00 ? 40 LYS A HB3  9  
ATOM 10822 H HG2  . LYS A 1 40 ? 7.201   4.784   4.365   1.00 0.00 ? 40 LYS A HG2  9  
ATOM 10823 H HG3  . LYS A 1 40 ? 8.014   5.162   2.844   1.00 0.00 ? 40 LYS A HG3  9  
ATOM 10824 H HD2  . LYS A 1 40 ? 6.042   5.667   1.761   1.00 0.00 ? 40 LYS A HD2  9  
ATOM 10825 H HD3  . LYS A 1 40 ? 5.070   4.666   2.843   1.00 0.00 ? 40 LYS A HD3  9  
ATOM 10826 H HE2  . LYS A 1 40 ? 6.402   7.262   3.609   1.00 0.00 ? 40 LYS A HE2  9  
ATOM 10827 H HE3  . LYS A 1 40 ? 4.703   7.088   3.173   1.00 0.00 ? 40 LYS A HE3  9  
ATOM 10828 H HZ1  . LYS A 1 40 ? 4.400   6.779   5.348   1.00 0.00 ? 40 LYS A HZ1  9  
ATOM 10829 H HZ2  . LYS A 1 40 ? 6.034   6.462   5.645   1.00 0.00 ? 40 LYS A HZ2  9  
ATOM 10830 H HZ3  . LYS A 1 40 ? 5.019   5.224   5.100   1.00 0.00 ? 40 LYS A HZ3  9  
ATOM 10831 N N    . TYR A 1 41 ? 6.550   -0.048  3.604   1.00 0.00 ? 41 TYR A N    9  
ATOM 10832 C CA   . TYR A 1 41 ? 6.330   -1.368  3.024   1.00 0.00 ? 41 TYR A CA   9  
ATOM 10833 C C    . TYR A 1 41 ? 6.497   -2.460  4.075   1.00 0.00 ? 41 TYR A C    9  
ATOM 10834 O O    . TYR A 1 41 ? 6.713   -2.176  5.254   1.00 0.00 ? 41 TYR A O    9  
ATOM 10835 C CB   . TYR A 1 41 ? 7.300   -1.606  1.865   1.00 0.00 ? 41 TYR A CB   9  
ATOM 10836 C CG   . TYR A 1 41 ? 7.563   -0.373  1.032   1.00 0.00 ? 41 TYR A CG   9  
ATOM 10837 C CD1  . TYR A 1 41 ? 6.684   0.010   0.025   1.00 0.00 ? 41 TYR A CD1  9  
ATOM 10838 C CD2  . TYR A 1 41 ? 8.690   0.410   1.249   1.00 0.00 ? 41 TYR A CD2  9  
ATOM 10839 C CE1  . TYR A 1 41 ? 6.921   1.136   -0.739  1.00 0.00 ? 41 TYR A CE1  9  
ATOM 10840 C CE2  . TYR A 1 41 ? 8.934   1.538   0.491   1.00 0.00 ? 41 TYR A CE2  9  
ATOM 10841 C CZ   . TYR A 1 41 ? 8.046   1.897   -0.503  1.00 0.00 ? 41 TYR A CZ   9  
ATOM 10842 O OH   . TYR A 1 41 ? 8.286   3.020   -1.261  1.00 0.00 ? 41 TYR A OH   9  
ATOM 10843 H H    . TYR A 1 41 ? 7.158   0.042   4.367   1.00 0.00 ? 41 TYR A H    9  
ATOM 10844 H HA   . TYR A 1 41 ? 5.319   -1.400  2.646   1.00 0.00 ? 41 TYR A HA   9  
ATOM 10845 H HB2  . TYR A 1 41 ? 8.245   -1.947  2.260   1.00 0.00 ? 41 TYR A HB2  9  
ATOM 10846 H HB3  . TYR A 1 41 ? 6.893   -2.366  1.214   1.00 0.00 ? 41 TYR A HB3  9  
ATOM 10847 H HD1  . TYR A 1 41 ? 5.803   -0.588  -0.158  1.00 0.00 ? 41 TYR A HD1  9  
ATOM 10848 H HD2  . TYR A 1 41 ? 9.383   0.126   2.028   1.00 0.00 ? 41 TYR A HD2  9  
ATOM 10849 H HE1  . TYR A 1 41 ? 6.226   1.417   -1.517  1.00 0.00 ? 41 TYR A HE1  9  
ATOM 10850 H HE2  . TYR A 1 41 ? 9.815   2.134   0.676   1.00 0.00 ? 41 TYR A HE2  9  
ATOM 10851 H HH   . TYR A 1 41 ? 9.076   3.460   -0.940  1.00 0.00 ? 41 TYR A HH   9  
ATOM 10852 N N    . LEU A 1 42 ? 6.398   -3.711  3.640   1.00 0.00 ? 42 LEU A N    9  
ATOM 10853 C CA   . LEU A 1 42 ? 6.539   -4.849  4.542   1.00 0.00 ? 42 LEU A CA   9  
ATOM 10854 C C    . LEU A 1 42 ? 7.126   -6.053  3.812   1.00 0.00 ? 42 LEU A C    9  
ATOM 10855 O O    . LEU A 1 42 ? 6.746   -6.351  2.680   1.00 0.00 ? 42 LEU A O    9  
ATOM 10856 C CB   . LEU A 1 42 ? 5.183   -5.217  5.147   1.00 0.00 ? 42 LEU A CB   9  
ATOM 10857 C CG   . LEU A 1 42 ? 4.399   -4.069  5.784   1.00 0.00 ? 42 LEU A CG   9  
ATOM 10858 C CD1  . LEU A 1 42 ? 2.908   -4.371  5.776   1.00 0.00 ? 42 LEU A CD1  9  
ATOM 10859 C CD2  . LEU A 1 42 ? 4.885   -3.813  7.203   1.00 0.00 ? 42 LEU A CD2  9  
ATOM 10860 H H    . LEU A 1 42 ? 6.225   -3.875  2.689   1.00 0.00 ? 42 LEU A H    9  
ATOM 10861 H HA   . LEU A 1 42 ? 7.212   -4.561  5.336   1.00 0.00 ? 42 LEU A HA   9  
ATOM 10862 H HB2  . LEU A 1 42 ? 4.573   -5.637  4.362   1.00 0.00 ? 42 LEU A HB2  9  
ATOM 10863 H HB3  . LEU A 1 42 ? 5.353   -5.965  5.908   1.00 0.00 ? 42 LEU A HB3  9  
ATOM 10864 H HG   . LEU A 1 42 ? 4.559   -3.168  5.207   1.00 0.00 ? 42 LEU A HG   9  
ATOM 10865 H HD11 . LEU A 1 42 ? 2.516   -4.276  6.777   1.00 0.00 ? 42 LEU A HD11 9  
ATOM 10866 H HD12 . LEU A 1 42 ? 2.747   -5.378  5.420   1.00 0.00 ? 42 LEU A HD12 9  
ATOM 10867 H HD13 . LEU A 1 42 ? 2.403   -3.674  5.123   1.00 0.00 ? 42 LEU A HD13 9  
ATOM 10868 H HD21 . LEU A 1 42 ? 4.246   -3.082  7.676   1.00 0.00 ? 42 LEU A HD21 9  
ATOM 10869 H HD22 . LEU A 1 42 ? 5.899   -3.440  7.174   1.00 0.00 ? 42 LEU A HD22 9  
ATOM 10870 H HD23 . LEU A 1 42 ? 4.856   -4.735  7.765   1.00 0.00 ? 42 LEU A HD23 9  
ATOM 10871 N N    . SER A 1 43 ? 8.052   -6.743  4.470   1.00 0.00 ? 43 SER A N    9  
ATOM 10872 C CA   . SER A 1 43 ? 8.693   -7.914  3.884   1.00 0.00 ? 43 SER A CA   9  
ATOM 10873 C C    . SER A 1 43 ? 7.659   -8.974  3.518   1.00 0.00 ? 43 SER A C    9  
ATOM 10874 O O    . SER A 1 43 ? 6.471   -8.828  3.811   1.00 0.00 ? 43 SER A O    9  
ATOM 10875 C CB   . SER A 1 43 ? 9.719   -8.501  4.856   1.00 0.00 ? 43 SER A CB   9  
ATOM 10876 O OG   . SER A 1 43 ? 10.782  -9.127  4.159   1.00 0.00 ? 43 SER A OG   9  
ATOM 10877 H H    . SER A 1 43 ? 8.313   -6.455  5.370   1.00 0.00 ? 43 SER A H    9  
ATOM 10878 H HA   . SER A 1 43 ? 9.202   -7.599  2.985   1.00 0.00 ? 43 SER A HA   9  
ATOM 10879 H HB2  . SER A 1 43 ? 10.123  -7.710  5.469   1.00 0.00 ? 43 SER A HB2  9  
ATOM 10880 H HB3  . SER A 1 43 ? 9.235   -9.234  5.485   1.00 0.00 ? 43 SER A HB3  9  
ATOM 10881 H HG   . SER A 1 43 ? 10.517  -10.013 3.900   1.00 0.00 ? 43 SER A HG   9  
ATOM 10882 N N    . THR A 1 44 ? 8.117   -10.042 2.874   1.00 0.00 ? 44 THR A N    9  
ATOM 10883 C CA   . THR A 1 44 ? 7.233   -11.127 2.466   1.00 0.00 ? 44 THR A CA   9  
ATOM 10884 C C    . THR A 1 44 ? 6.413   -11.640 3.644   1.00 0.00 ? 44 THR A C    9  
ATOM 10885 O O    . THR A 1 44 ? 5.182   -11.619 3.631   1.00 0.00 ? 44 THR A O    9  
ATOM 10886 C CB   . THR A 1 44 ? 8.025   -12.299 1.857   1.00 0.00 ? 44 THR A CB   9  
ATOM 10887 O OG1  . THR A 1 44 ? 8.130   -12.135 0.438   1.00 0.00 ? 44 THR A OG1  9  
ATOM 10888 C CG2  . THR A 1 44 ? 7.354   -13.627 2.170   1.00 0.00 ? 44 THR A CG2  9  
ATOM 10889 H H    . THR A 1 44 ? 9.073   -10.101 2.668   1.00 0.00 ? 44 THR A H    9  
ATOM 10890 H HA   . THR A 1 44 ? 6.561   -10.744 1.712   1.00 0.00 ? 44 THR A HA   9  
ATOM 10891 H HB   . THR A 1 44 ? 9.018   -12.304 2.285   1.00 0.00 ? 44 THR A HB   9  
ATOM 10892 H HG1  . THR A 1 44 ? 7.349   -12.499 0.015   1.00 0.00 ? 44 THR A HG1  9  
ATOM 10893 H HG21 . THR A 1 44 ? 6.323   -13.594 1.850   1.00 0.00 ? 44 THR A HG21 9  
ATOM 10894 H HG22 . THR A 1 44 ? 7.395   -13.809 3.234   1.00 0.00 ? 44 THR A HG22 9  
ATOM 10895 H HG23 . THR A 1 44 ? 7.866   -14.421 1.649   1.00 0.00 ? 44 THR A HG23 9  
ATOM 10896 N N    . PRO A 1 45 ? 7.109   -12.113 4.688   1.00 0.00 ? 45 PRO A N    9  
ATOM 10897 C CA   . PRO A 1 45 ? 6.464   -12.641 5.895   1.00 0.00 ? 45 PRO A CA   9  
ATOM 10898 C C    . PRO A 1 45 ? 5.788   -11.548 6.715   1.00 0.00 ? 45 PRO A C    9  
ATOM 10899 O O    . PRO A 1 45 ? 4.695   -11.744 7.247   1.00 0.00 ? 45 PRO A O    9  
ATOM 10900 C CB   . PRO A 1 45 ? 7.627   -13.255 6.679   1.00 0.00 ? 45 PRO A CB   9  
ATOM 10901 C CG   . PRO A 1 45 ? 8.832   -12.510 6.215   1.00 0.00 ? 45 PRO A CG   9  
ATOM 10902 C CD   . PRO A 1 45 ? 8.578   -12.170 4.772   1.00 0.00 ? 45 PRO A CD   9  
ATOM 10903 H HA   . PRO A 1 45 ? 5.743   -13.409 5.657   1.00 0.00 ? 45 PRO A HA   9  
ATOM 10904 H HB2  . PRO A 1 45 ? 7.462   -13.119 7.738   1.00 0.00 ? 45 PRO A HB2  9  
ATOM 10905 H HB3  . PRO A 1 45 ? 7.703   -14.307 6.452   1.00 0.00 ? 45 PRO A HB3  9  
ATOM 10906 H HG2  . PRO A 1 45 ? 8.953   -11.610 6.797   1.00 0.00 ? 45 PRO A HG2  9  
ATOM 10907 H HG3  . PRO A 1 45 ? 9.707   -13.137 6.303   1.00 0.00 ? 45 PRO A HG3  9  
ATOM 10908 H HD2  . PRO A 1 45 ? 9.015   -11.213 4.528   1.00 0.00 ? 45 PRO A HD2  9  
ATOM 10909 H HD3  . PRO A 1 45 ? 8.971   -12.942 4.128   1.00 0.00 ? 45 PRO A HD3  9  
ATOM 10910 N N    . ASP A 1 46 ? 6.443   -10.396 6.813   1.00 0.00 ? 46 ASP A N    9  
ATOM 10911 C CA   . ASP A 1 46 ? 5.904   -9.271  7.568   1.00 0.00 ? 46 ASP A CA   9  
ATOM 10912 C C    . ASP A 1 46 ? 4.451   -9.007  7.186   1.00 0.00 ? 46 ASP A C    9  
ATOM 10913 O O    . ASP A 1 46 ? 3.557   -9.056  8.031   1.00 0.00 ? 46 ASP A O    9  
ATOM 10914 C CB   . ASP A 1 46 ? 6.744   -8.017  7.325   1.00 0.00 ? 46 ASP A CB   9  
ATOM 10915 C CG   . ASP A 1 46 ? 7.901   -7.897  8.297   1.00 0.00 ? 46 ASP A CG   9  
ATOM 10916 O OD1  . ASP A 1 46 ? 8.837   -8.719  8.209   1.00 0.00 ? 46 ASP A OD1  9  
ATOM 10917 O OD2  . ASP A 1 46 ? 7.870   -6.983  9.147   1.00 0.00 ? 46 ASP A OD2  9  
ATOM 10918 H H    . ASP A 1 46 ? 7.311   -10.301 6.367   1.00 0.00 ? 46 ASP A H    9  
ATOM 10919 H HA   . ASP A 1 46 ? 5.946   -9.524  8.617   1.00 0.00 ? 46 ASP A HA   9  
ATOM 10920 H HB2  . ASP A 1 46 ? 7.144   -8.048  6.321   1.00 0.00 ? 46 ASP A HB2  9  
ATOM 10921 H HB3  . ASP A 1 46 ? 6.116   -7.144  7.431   1.00 0.00 ? 46 ASP A HB3  9  
ATOM 10922 N N    . ARG A 1 47 ? 4.222   -8.726  5.907   1.00 0.00 ? 47 ARG A N    9  
ATOM 10923 C CA   . ARG A 1 47 ? 2.878   -8.452  5.413   1.00 0.00 ? 47 ARG A CA   9  
ATOM 10924 C C    . ARG A 1 47 ? 1.915   -9.566  5.811   1.00 0.00 ? 47 ARG A C    9  
ATOM 10925 O O    . ARG A 1 47 ? 0.726   -9.326  6.023   1.00 0.00 ? 47 ARG A O    9  
ATOM 10926 C CB   . ARG A 1 47 ? 2.893   -8.295  3.891   1.00 0.00 ? 47 ARG A CB   9  
ATOM 10927 C CG   . ARG A 1 47 ? 1.525   -8.007  3.295   1.00 0.00 ? 47 ARG A CG   9  
ATOM 10928 C CD   . ARG A 1 47 ? 1.614   -7.732  1.803   1.00 0.00 ? 47 ARG A CD   9  
ATOM 10929 N NE   . ARG A 1 47 ? 2.586   -6.685  1.496   1.00 0.00 ? 47 ARG A NE   9  
ATOM 10930 C CZ   . ARG A 1 47 ? 3.884   -6.914  1.327   1.00 0.00 ? 47 ARG A CZ   9  
ATOM 10931 N NH1  . ARG A 1 47 ? 4.362   -8.146  1.434   1.00 0.00 ? 47 ARG A NH1  9  
ATOM 10932 N NH2  . ARG A 1 47 ? 4.705   -5.909  1.050   1.00 0.00 ? 47 ARG A NH2  9  
ATOM 10933 H H    . ARG A 1 47 ? 4.976   -8.702  5.281   1.00 0.00 ? 47 ARG A H    9  
ATOM 10934 H HA   . ARG A 1 47 ? 2.544   -7.527  5.858   1.00 0.00 ? 47 ARG A HA   9  
ATOM 10935 H HB2  . ARG A 1 47 ? 3.554   -7.481  3.631   1.00 0.00 ? 47 ARG A HB2  9  
ATOM 10936 H HB3  . ARG A 1 47 ? 3.268   -9.207  3.452   1.00 0.00 ? 47 ARG A HB3  9  
ATOM 10937 H HG2  . ARG A 1 47 ? 0.886   -8.863  3.454   1.00 0.00 ? 47 ARG A HG2  9  
ATOM 10938 H HG3  . ARG A 1 47 ? 1.103   -7.144  3.788   1.00 0.00 ? 47 ARG A HG3  9  
ATOM 10939 H HD2  . ARG A 1 47 ? 1.908   -8.641  1.299   1.00 0.00 ? 47 ARG A HD2  9  
ATOM 10940 H HD3  . ARG A 1 47 ? 0.642   -7.422  1.449   1.00 0.00 ? 47 ARG A HD3  9  
ATOM 10941 H HE   . ARG A 1 47 ? 2.254   -5.768  1.413   1.00 0.00 ? 47 ARG A HE   9  
ATOM 10942 H HH11 . ARG A 1 47 ? 3.746   -8.905  1.641   1.00 0.00 ? 47 ARG A HH11 9  
ATOM 10943 H HH12 . ARG A 1 47 ? 5.340   -8.316  1.304   1.00 0.00 ? 47 ARG A HH12 9  
ATOM 10944 H HH21 . ARG A 1 47 ? 4.348   -4.979  0.969   1.00 0.00 ? 47 ARG A HH21 9  
ATOM 10945 H HH22 . ARG A 1 47 ? 5.681   -6.082  0.924   1.00 0.00 ? 47 ARG A HH22 9  
ATOM 10946 N N    . ILE A 1 48 ? 2.436   -10.784 5.911   1.00 0.00 ? 48 ILE A N    9  
ATOM 10947 C CA   . ILE A 1 48 ? 1.623   -11.935 6.284   1.00 0.00 ? 48 ILE A CA   9  
ATOM 10948 C C    . ILE A 1 48 ? 1.251   -11.888 7.762   1.00 0.00 ? 48 ILE A C    9  
ATOM 10949 O O    . ILE A 1 48 ? 0.090   -12.078 8.127   1.00 0.00 ? 48 ILE A O    9  
ATOM 10950 C CB   . ILE A 1 48 ? 2.352   -13.259 5.991   1.00 0.00 ? 48 ILE A CB   9  
ATOM 10951 C CG1  . ILE A 1 48 ? 2.711   -13.351 4.506   1.00 0.00 ? 48 ILE A CG1  9  
ATOM 10952 C CG2  . ILE A 1 48 ? 1.490   -14.442 6.408   1.00 0.00 ? 48 ILE A CG2  9  
ATOM 10953 C CD1  . ILE A 1 48 ? 3.601   -14.527 4.172   1.00 0.00 ? 48 ILE A CD1  9  
ATOM 10954 H H    . ILE A 1 48 ? 3.391   -10.912 5.730   1.00 0.00 ? 48 ILE A H    9  
ATOM 10955 H HA   . ILE A 1 48 ? 0.717   -11.907 5.695   1.00 0.00 ? 48 ILE A HA   9  
ATOM 10956 H HB   . ILE A 1 48 ? 3.259   -13.282 6.575   1.00 0.00 ? 48 ILE A HB   9  
ATOM 10957 H HG12 . ILE A 1 48 ? 1.805   -13.446 3.929   1.00 0.00 ? 48 ILE A HG12 9  
ATOM 10958 H HG13 . ILE A 1 48 ? 3.227   -12.449 4.212   1.00 0.00 ? 48 ILE A HG13 9  
ATOM 10959 H HG21 . ILE A 1 48 ? 2.083   -15.130 6.993   1.00 0.00 ? 48 ILE A HG21 9  
ATOM 10960 H HG22 . ILE A 1 48 ? 0.659   -14.090 7.000   1.00 0.00 ? 48 ILE A HG22 9  
ATOM 10961 H HG23 . ILE A 1 48 ? 1.119   -14.944 5.527   1.00 0.00 ? 48 ILE A HG23 9  
ATOM 10962 H HD11 . ILE A 1 48 ? 4.591   -14.172 3.927   1.00 0.00 ? 48 ILE A HD11 9  
ATOM 10963 H HD12 . ILE A 1 48 ? 3.655   -15.191 5.021   1.00 0.00 ? 48 ILE A HD12 9  
ATOM 10964 H HD13 . ILE A 1 48 ? 3.191   -15.059 3.325   1.00 0.00 ? 48 ILE A HD13 9  
ATOM 10965 N N    . ASP A 1 49 ? 2.242   -11.634 8.608   1.00 0.00 ? 49 ASP A N    9  
ATOM 10966 C CA   . ASP A 1 49 ? 2.019   -11.560 10.048  1.00 0.00 ? 49 ASP A CA   9  
ATOM 10967 C C    . ASP A 1 49 ? 0.940   -10.533 10.378  1.00 0.00 ? 49 ASP A C    9  
ATOM 10968 O O    . ASP A 1 49 ? 0.050   -10.792 11.189  1.00 0.00 ? 49 ASP A O    9  
ATOM 10969 C CB   . ASP A 1 49 ? 3.320   -11.201 10.769  1.00 0.00 ? 49 ASP A CB   9  
ATOM 10970 C CG   . ASP A 1 49 ? 3.241   -11.452 12.262  1.00 0.00 ? 49 ASP A CG   9  
ATOM 10971 O OD1  . ASP A 1 49 ? 3.356   -12.625 12.673  1.00 0.00 ? 49 ASP A OD1  9  
ATOM 10972 O OD2  . ASP A 1 49 ? 3.064   -10.475 13.020  1.00 0.00 ? 49 ASP A OD2  9  
ATOM 10973 H H    . ASP A 1 49 ? 3.146   -11.492 8.257   1.00 0.00 ? 49 ASP A H    9  
ATOM 10974 H HA   . ASP A 1 49 ? 1.689   -12.531 10.383  1.00 0.00 ? 49 ASP A HA   9  
ATOM 10975 H HB2  . ASP A 1 49 ? 4.124   -11.798 10.365  1.00 0.00 ? 49 ASP A HB2  9  
ATOM 10976 H HB3  . ASP A 1 49 ? 3.536   -10.156 10.608  1.00 0.00 ? 49 ASP A HB3  9  
ATOM 10977 N N    . LEU A 1 50 ? 1.027   -9.368  9.746   1.00 0.00 ? 50 LEU A N    9  
ATOM 10978 C CA   . LEU A 1 50 ? 0.058   -8.301  9.974   1.00 0.00 ? 50 LEU A CA   9  
ATOM 10979 C C    . LEU A 1 50 ? -1.336  -8.725  9.522   1.00 0.00 ? 50 LEU A C    9  
ATOM 10980 O O    . LEU A 1 50 ? -2.284  -8.713  10.306  1.00 0.00 ? 50 LEU A O    9  
ATOM 10981 C CB   . LEU A 1 50 ? 0.483   -7.032  9.232   1.00 0.00 ? 50 LEU A CB   9  
ATOM 10982 C CG   . LEU A 1 50 ? -0.613  -5.992  8.999   1.00 0.00 ? 50 LEU A CG   9  
ATOM 10983 C CD1  . LEU A 1 50 ? -1.010  -5.333  10.310  1.00 0.00 ? 50 LEU A CD1  9  
ATOM 10984 C CD2  . LEU A 1 50 ? -0.151  -4.947  7.993   1.00 0.00 ? 50 LEU A CD2  9  
ATOM 10985 H H    . LEU A 1 50 ? 1.758   -9.220  9.112   1.00 0.00 ? 50 LEU A H    9  
ATOM 10986 H HA   . LEU A 1 50 ? 0.033   -8.096  11.034  1.00 0.00 ? 50 LEU A HA   9  
ATOM 10987 H HB2  . LEU A 1 50 ? 1.269   -6.563  9.803   1.00 0.00 ? 50 LEU A HB2  9  
ATOM 10988 H HB3  . LEU A 1 50 ? 0.870   -7.329  8.267   1.00 0.00 ? 50 LEU A HB3  9  
ATOM 10989 H HG   . LEU A 1 50 ? -1.487  -6.483  8.594   1.00 0.00 ? 50 LEU A HG   9  
ATOM 10990 H HD11 . LEU A 1 50 ? -1.703  -4.529  10.113  1.00 0.00 ? 50 LEU A HD11 9  
ATOM 10991 H HD12 . LEU A 1 50 ? -0.130  -4.939  10.797  1.00 0.00 ? 50 LEU A HD12 9  
ATOM 10992 H HD13 . LEU A 1 50 ? -1.479  -6.064  10.952  1.00 0.00 ? 50 LEU A HD13 9  
ATOM 10993 H HD21 . LEU A 1 50 ? 0.522   -5.405  7.282   1.00 0.00 ? 50 LEU A HD21 9  
ATOM 10994 H HD22 . LEU A 1 50 ? 0.362   -4.150  8.512   1.00 0.00 ? 50 LEU A HD22 9  
ATOM 10995 H HD23 . LEU A 1 50 ? -1.007  -4.546  7.472   1.00 0.00 ? 50 LEU A HD23 9  
ATOM 10996 N N    . ALA A 1 51 ? -1.451  -9.102  8.252   1.00 0.00 ? 51 ALA A N    9  
ATOM 10997 C CA   . ALA A 1 51 ? -2.728  -9.534  7.697   1.00 0.00 ? 51 ALA A CA   9  
ATOM 10998 C C    . ALA A 1 51 ? -3.406  -10.552 8.608   1.00 0.00 ? 51 ALA A C    9  
ATOM 10999 O O    . ALA A 1 51 ? -4.629  -10.686 8.601   1.00 0.00 ? 51 ALA A O    9  
ATOM 11000 C CB   . ALA A 1 51 ? -2.528  -10.117 6.306   1.00 0.00 ? 51 ALA A CB   9  
ATOM 11001 H H    . ALA A 1 51 ? -0.659  -9.090  7.676   1.00 0.00 ? 51 ALA A H    9  
ATOM 11002 H HA   . ALA A 1 51 ? -3.365  -8.665  7.609   1.00 0.00 ? 51 ALA A HA   9  
ATOM 11003 H HB1  . ALA A 1 51 ? -1.567  -9.807  5.922   1.00 0.00 ? 51 ALA A HB1  9  
ATOM 11004 H HB2  . ALA A 1 51 ? -2.564  -11.195 6.359   1.00 0.00 ? 51 ALA A HB2  9  
ATOM 11005 H HB3  . ALA A 1 51 ? -3.310  -9.761  5.652   1.00 0.00 ? 51 ALA A HB3  9  
ATOM 11006 N N    . GLU A 1 52 ? -2.602  -11.268 9.388   1.00 0.00 ? 52 GLU A N    9  
ATOM 11007 C CA   . GLU A 1 52 ? -3.126  -12.276 10.303  1.00 0.00 ? 52 GLU A CA   9  
ATOM 11008 C C    . GLU A 1 52 ? -3.636  -11.632 11.589  1.00 0.00 ? 52 GLU A C    9  
ATOM 11009 O O    . GLU A 1 52 ? -4.614  -12.089 12.179  1.00 0.00 ? 52 GLU A O    9  
ATOM 11010 C CB   . GLU A 1 52 ? -2.047  -13.310 10.630  1.00 0.00 ? 52 GLU A CB   9  
ATOM 11011 C CG   . GLU A 1 52 ? -2.006  -14.477 9.657   1.00 0.00 ? 52 GLU A CG   9  
ATOM 11012 C CD   . GLU A 1 52 ? -3.095  -15.498 9.925   1.00 0.00 ? 52 GLU A CD   9  
ATOM 11013 O OE1  . GLU A 1 52 ? -3.566  -15.573 11.079  1.00 0.00 ? 52 GLU A OE1  9  
ATOM 11014 O OE2  . GLU A 1 52 ? -3.475  -16.223 8.982   1.00 0.00 ? 52 GLU A OE2  9  
ATOM 11015 H H    . GLU A 1 52 ? -1.635  -11.116 9.348   1.00 0.00 ? 52 GLU A H    9  
ATOM 11016 H HA   . GLU A 1 52 ? -3.950  -12.773 9.812   1.00 0.00 ? 52 GLU A HA   9  
ATOM 11017 H HB2  . GLU A 1 52 ? -1.083  -12.823 10.617  1.00 0.00 ? 52 GLU A HB2  9  
ATOM 11018 H HB3  . GLU A 1 52 ? -2.229  -13.701 11.620  1.00 0.00 ? 52 GLU A HB3  9  
ATOM 11019 H HG2  . GLU A 1 52 ? -2.130  -14.097 8.654   1.00 0.00 ? 52 GLU A HG2  9  
ATOM 11020 H HG3  . GLU A 1 52 ? -1.047  -14.965 9.740   1.00 0.00 ? 52 GLU A HG3  9  
ATOM 11021 N N    . SER A 1 53 ? -2.964  -10.567 12.016  1.00 0.00 ? 53 SER A N    9  
ATOM 11022 C CA   . SER A 1 53 ? -3.345  -9.862  13.235  1.00 0.00 ? 53 SER A CA   9  
ATOM 11023 C C    . SER A 1 53 ? -4.711  -9.202  13.076  1.00 0.00 ? 53 SER A C    9  
ATOM 11024 O O    . SER A 1 53 ? -5.593  -9.362  13.921  1.00 0.00 ? 53 SER A O    9  
ATOM 11025 C CB   . SER A 1 53 ? -2.295  -8.807  13.588  1.00 0.00 ? 53 SER A CB   9  
ATOM 11026 O OG   . SER A 1 53 ? -1.039  -9.407  13.853  1.00 0.00 ? 53 SER A OG   9  
ATOM 11027 H H    . SER A 1 53 ? -2.192  -10.251 11.502  1.00 0.00 ? 53 SER A H    9  
ATOM 11028 H HA   . SER A 1 53 ? -3.398  -10.586 14.034  1.00 0.00 ? 53 SER A HA   9  
ATOM 11029 H HB2  . SER A 1 53 ? -2.185  -8.121  12.762  1.00 0.00 ? 53 SER A HB2  9  
ATOM 11030 H HB3  . SER A 1 53 ? -2.614  -8.265  14.466  1.00 0.00 ? 53 SER A HB3  9  
ATOM 11031 H HG   . SER A 1 53 ? -0.798  -9.983  13.124  1.00 0.00 ? 53 SER A HG   9  
ATOM 11032 N N    . LEU A 1 54 ? -4.880  -8.461  11.987  1.00 0.00 ? 54 LEU A N    9  
ATOM 11033 C CA   . LEU A 1 54 ? -6.139  -7.775  11.715  1.00 0.00 ? 54 LEU A CA   9  
ATOM 11034 C C    . LEU A 1 54 ? -7.136  -8.714  11.043  1.00 0.00 ? 54 LEU A C    9  
ATOM 11035 O O    . LEU A 1 54 ? -8.347  -8.564  11.198  1.00 0.00 ? 54 LEU A O    9  
ATOM 11036 C CB   . LEU A 1 54 ? -5.896  -6.553  10.828  1.00 0.00 ? 54 LEU A CB   9  
ATOM 11037 C CG   . LEU A 1 54 ? -4.867  -5.545  11.342  1.00 0.00 ? 54 LEU A CG   9  
ATOM 11038 C CD1  . LEU A 1 54 ? -4.496  -4.556  10.248  1.00 0.00 ? 54 LEU A CD1  9  
ATOM 11039 C CD2  . LEU A 1 54 ? -5.401  -4.814  12.565  1.00 0.00 ? 54 LEU A CD2  9  
ATOM 11040 H H    . LEU A 1 54 ? -4.141  -8.371  11.350  1.00 0.00 ? 54 LEU A H    9  
ATOM 11041 H HA   . LEU A 1 54 ? -6.549  -7.450  12.659  1.00 0.00 ? 54 LEU A HA   9  
ATOM 11042 H HB2  . LEU A 1 54 ? -5.561  -6.904  9.865   1.00 0.00 ? 54 LEU A HB2  9  
ATOM 11043 H HB3  . LEU A 1 54 ? -6.838  -6.036  10.714  1.00 0.00 ? 54 LEU A HB3  9  
ATOM 11044 H HG   . LEU A 1 54 ? -3.969  -6.073  11.632  1.00 0.00 ? 54 LEU A HG   9  
ATOM 11045 H HD11 . LEU A 1 54 ? -3.926  -3.744  10.675  1.00 0.00 ? 54 LEU A HD11 9  
ATOM 11046 H HD12 . LEU A 1 54 ? -5.395  -4.166  9.795   1.00 0.00 ? 54 LEU A HD12 9  
ATOM 11047 H HD13 . LEU A 1 54 ? -3.903  -5.057  9.496   1.00 0.00 ? 54 LEU A HD13 9  
ATOM 11048 H HD21 . LEU A 1 54 ? -5.361  -5.471  13.422  1.00 0.00 ? 54 LEU A HD21 9  
ATOM 11049 H HD22 . LEU A 1 54 ? -6.424  -4.516  12.388  1.00 0.00 ? 54 LEU A HD22 9  
ATOM 11050 H HD23 . LEU A 1 54 ? -4.797  -3.939  12.754  1.00 0.00 ? 54 LEU A HD23 9  
ATOM 11051 N N    . GLY A 1 55 ? -6.617  -9.685  10.298  1.00 0.00 ? 55 GLY A N    9  
ATOM 11052 C CA   . GLY A 1 55 ? -7.475  -10.636 9.616   1.00 0.00 ? 55 GLY A CA   9  
ATOM 11053 C C    . GLY A 1 55 ? -7.652  -10.308 8.146   1.00 0.00 ? 55 GLY A C    9  
ATOM 11054 O O    . GLY A 1 55 ? -8.510  -10.880 7.473   1.00 0.00 ? 55 GLY A O    9  
ATOM 11055 H H    . GLY A 1 55 ? -5.643  -9.757  10.210  1.00 0.00 ? 55 GLY A H    9  
ATOM 11056 H HA2  . GLY A 1 55 ? -7.044  -11.622 9.704   1.00 0.00 ? 55 GLY A HA2  9  
ATOM 11057 H HA3  . GLY A 1 55 ? -8.445  -10.634 10.092  1.00 0.00 ? 55 GLY A HA3  9  
ATOM 11058 N N    . LEU A 1 56 ? -6.839  -9.383  7.647   1.00 0.00 ? 56 LEU A N    9  
ATOM 11059 C CA   . LEU A 1 56 ? -6.910  -8.978  6.247   1.00 0.00 ? 56 LEU A CA   9  
ATOM 11060 C C    . LEU A 1 56 ? -6.170  -9.970  5.355   1.00 0.00 ? 56 LEU A C    9  
ATOM 11061 O O    . LEU A 1 56 ? -5.643  -10.975 5.831   1.00 0.00 ? 56 LEU A O    9  
ATOM 11062 C CB   . LEU A 1 56 ? -6.320  -7.578  6.071   1.00 0.00 ? 56 LEU A CB   9  
ATOM 11063 C CG   . LEU A 1 56 ? -6.810  -6.514  7.055   1.00 0.00 ? 56 LEU A CG   9  
ATOM 11064 C CD1  . LEU A 1 56 ? -5.886  -5.306  7.039   1.00 0.00 ? 56 LEU A CD1  9  
ATOM 11065 C CD2  . LEU A 1 56 ? -8.237  -6.102  6.727   1.00 0.00 ? 56 LEU A CD2  9  
ATOM 11066 H H    . LEU A 1 56 ? -6.175  -8.963  8.232   1.00 0.00 ? 56 LEU A H    9  
ATOM 11067 H HA   . LEU A 1 56 ? -7.950  -8.960  5.960   1.00 0.00 ? 56 LEU A HA   9  
ATOM 11068 H HB2  . LEU A 1 56 ? -5.248  -7.655  6.174   1.00 0.00 ? 56 LEU A HB2  9  
ATOM 11069 H HB3  . LEU A 1 56 ? -6.560  -7.242  5.072   1.00 0.00 ? 56 LEU A HB3  9  
ATOM 11070 H HG   . LEU A 1 56 ? -6.801  -6.927  8.055   1.00 0.00 ? 56 LEU A HG   9  
ATOM 11071 H HD11 . LEU A 1 56 ? -6.445  -4.430  6.747   1.00 0.00 ? 56 LEU A HD11 9  
ATOM 11072 H HD12 . LEU A 1 56 ? -5.086  -5.474  6.333   1.00 0.00 ? 56 LEU A HD12 9  
ATOM 11073 H HD13 . LEU A 1 56 ? -5.471  -5.157  8.025   1.00 0.00 ? 56 LEU A HD13 9  
ATOM 11074 H HD21 . LEU A 1 56 ? -8.227  -5.154  6.208   1.00 0.00 ? 56 LEU A HD21 9  
ATOM 11075 H HD22 . LEU A 1 56 ? -8.803  -6.004  7.643   1.00 0.00 ? 56 LEU A HD22 9  
ATOM 11076 H HD23 . LEU A 1 56 ? -8.694  -6.852  6.099   1.00 0.00 ? 56 LEU A HD23 9  
ATOM 11077 N N    . SER A 1 57 ? -6.132  -9.678  4.059   1.00 0.00 ? 57 SER A N    9  
ATOM 11078 C CA   . SER A 1 57 ? -5.458  -10.544 3.099   1.00 0.00 ? 57 SER A CA   9  
ATOM 11079 C C    . SER A 1 57 ? -4.183  -9.889  2.578   1.00 0.00 ? 57 SER A C    9  
ATOM 11080 O O    . SER A 1 57 ? -4.168  -8.699  2.264   1.00 0.00 ? 57 SER A O    9  
ATOM 11081 C CB   . SER A 1 57 ? -6.391  -10.871 1.932   1.00 0.00 ? 57 SER A CB   9  
ATOM 11082 O OG   . SER A 1 57 ? -5.946  -12.019 1.229   1.00 0.00 ? 57 SER A OG   9  
ATOM 11083 H H    . SER A 1 57 ? -6.571  -8.861  3.740   1.00 0.00 ? 57 SER A H    9  
ATOM 11084 H HA   . SER A 1 57 ? -5.196  -11.461 3.607   1.00 0.00 ? 57 SER A HA   9  
ATOM 11085 H HB2  . SER A 1 57 ? -7.385  -11.058 2.310   1.00 0.00 ? 57 SER A HB2  9  
ATOM 11086 H HB3  . SER A 1 57 ? -6.417  -10.033 1.250   1.00 0.00 ? 57 SER A HB3  9  
ATOM 11087 H HG   . SER A 1 57 ? -5.513  -12.620 1.839   1.00 0.00 ? 57 SER A HG   9  
ATOM 11088 N N    . GLN A 1 58 ? -3.115  -10.675 2.489   1.00 0.00 ? 58 GLN A N    9  
ATOM 11089 C CA   . GLN A 1 58 ? -1.834  -10.172 2.007   1.00 0.00 ? 58 GLN A CA   9  
ATOM 11090 C C    . GLN A 1 58 ? -2.037  -9.113  0.928   1.00 0.00 ? 58 GLN A C    9  
ATOM 11091 O O    . GLN A 1 58 ? -1.404  -8.057  0.953   1.00 0.00 ? 58 GLN A O    9  
ATOM 11092 C CB   . GLN A 1 58 ? -0.985  -11.320 1.459   1.00 0.00 ? 58 GLN A CB   9  
ATOM 11093 C CG   . GLN A 1 58 ? -0.662  -12.386 2.493   1.00 0.00 ? 58 GLN A CG   9  
ATOM 11094 C CD   . GLN A 1 58 ? 0.197   -13.502 1.932   1.00 0.00 ? 58 GLN A CD   9  
ATOM 11095 O OE1  . GLN A 1 58 ? -0.267  -14.630 1.758   1.00 0.00 ? 58 GLN A OE1  9  
ATOM 11096 N NE2  . GLN A 1 58 ? 1.456   -13.194 1.647   1.00 0.00 ? 58 GLN A NE2  9  
ATOM 11097 H H    . GLN A 1 58 ? -3.190  -11.615 2.755   1.00 0.00 ? 58 GLN A H    9  
ATOM 11098 H HA   . GLN A 1 58 ? -1.319  -9.722  2.842   1.00 0.00 ? 58 GLN A HA   9  
ATOM 11099 H HB2  . GLN A 1 58 ? -1.516  -11.788 0.644   1.00 0.00 ? 58 GLN A HB2  9  
ATOM 11100 H HB3  . GLN A 1 58 ? -0.054  -10.917 1.087   1.00 0.00 ? 58 GLN A HB3  9  
ATOM 11101 H HG2  . GLN A 1 58 ? -0.134  -11.925 3.314   1.00 0.00 ? 58 GLN A HG2  9  
ATOM 11102 H HG3  . GLN A 1 58 ? -1.588  -12.810 2.854   1.00 0.00 ? 58 GLN A HG3  9  
ATOM 11103 H HE21 . GLN A 1 58 ? 1.757   -12.276 1.813   1.00 0.00 ? 58 GLN A HE21 9  
ATOM 11104 H HE22 . GLN A 1 58 ? 2.034   -13.896 1.284   1.00 0.00 ? 58 GLN A HE22 9  
ATOM 11105 N N    . LEU A 1 59 ? -2.922  -9.403  -0.019  1.00 0.00 ? 59 LEU A N    9  
ATOM 11106 C CA   . LEU A 1 59 ? -3.208  -8.476  -1.109  1.00 0.00 ? 59 LEU A CA   9  
ATOM 11107 C C    . LEU A 1 59 ? -3.606  -7.106  -0.568  1.00 0.00 ? 59 LEU A C    9  
ATOM 11108 O O    . LEU A 1 59 ? -3.120  -6.078  -1.039  1.00 0.00 ? 59 LEU A O    9  
ATOM 11109 C CB   . LEU A 1 59 ? -4.325  -9.030  -1.996  1.00 0.00 ? 59 LEU A CB   9  
ATOM 11110 C CG   . LEU A 1 59 ? -4.818  -8.106  -3.110  1.00 0.00 ? 59 LEU A CG   9  
ATOM 11111 C CD1  . LEU A 1 59 ? -3.727  -7.892  -4.148  1.00 0.00 ? 59 LEU A CD1  9  
ATOM 11112 C CD2  . LEU A 1 59 ? -6.071  -8.675  -3.759  1.00 0.00 ? 59 LEU A CD2  9  
ATOM 11113 H H    . LEU A 1 59 ? -3.395  -10.261 0.014   1.00 0.00 ? 59 LEU A H    9  
ATOM 11114 H HA   . LEU A 1 59 ? -2.310  -8.370  -1.698  1.00 0.00 ? 59 LEU A HA   9  
ATOM 11115 H HB2  . LEU A 1 59 ? -3.963  -9.937  -2.455  1.00 0.00 ? 59 LEU A HB2  9  
ATOM 11116 H HB3  . LEU A 1 59 ? -5.167  -9.262  -1.360  1.00 0.00 ? 59 LEU A HB3  9  
ATOM 11117 H HG   . LEU A 1 59 ? -5.067  -7.143  -2.686  1.00 0.00 ? 59 LEU A HG   9  
ATOM 11118 H HD11 . LEU A 1 59 ? -2.761  -8.057  -3.695  1.00 0.00 ? 59 LEU A HD11 9  
ATOM 11119 H HD12 . LEU A 1 59 ? -3.780  -6.881  -4.523  1.00 0.00 ? 59 LEU A HD12 9  
ATOM 11120 H HD13 . LEU A 1 59 ? -3.866  -8.586  -4.964  1.00 0.00 ? 59 LEU A HD13 9  
ATOM 11121 H HD21 . LEU A 1 59 ? -6.475  -7.953  -4.454  1.00 0.00 ? 59 LEU A HD21 9  
ATOM 11122 H HD22 . LEU A 1 59 ? -6.805  -8.891  -2.997  1.00 0.00 ? 59 LEU A HD22 9  
ATOM 11123 H HD23 . LEU A 1 59 ? -5.821  -9.583  -4.288  1.00 0.00 ? 59 LEU A HD23 9  
ATOM 11124 N N    . GLN A 1 60 ? -4.489  -7.102  0.426   1.00 0.00 ? 60 GLN A N    9  
ATOM 11125 C CA   . GLN A 1 60 ? -4.950  -5.858  1.031   1.00 0.00 ? 60 GLN A CA   9  
ATOM 11126 C C    . GLN A 1 60 ? -3.780  -4.914  1.293   1.00 0.00 ? 60 GLN A C    9  
ATOM 11127 O O    . GLN A 1 60 ? -3.673  -3.856  0.673   1.00 0.00 ? 60 GLN A O    9  
ATOM 11128 C CB   . GLN A 1 60 ? -5.690  -6.146  2.339   1.00 0.00 ? 60 GLN A CB   9  
ATOM 11129 C CG   . GLN A 1 60 ? -6.966  -6.951  2.150   1.00 0.00 ? 60 GLN A CG   9  
ATOM 11130 C CD   . GLN A 1 60 ? -8.045  -6.173  1.423   1.00 0.00 ? 60 GLN A CD   9  
ATOM 11131 O OE1  . GLN A 1 60 ? -7.815  -5.634  0.340   1.00 0.00 ? 60 GLN A OE1  9  
ATOM 11132 N NE2  . GLN A 1 60 ? -9.231  -6.110  2.017   1.00 0.00 ? 60 GLN A NE2  9  
ATOM 11133 H H    . GLN A 1 60 ? -4.839  -7.954  0.758   1.00 0.00 ? 60 GLN A H    9  
ATOM 11134 H HA   . GLN A 1 60 ? -5.630  -5.385  0.340   1.00 0.00 ? 60 GLN A HA   9  
ATOM 11135 H HB2  . GLN A 1 60 ? -5.035  -6.698  2.995   1.00 0.00 ? 60 GLN A HB2  9  
ATOM 11136 H HB3  . GLN A 1 60 ? -5.948  -5.208  2.807   1.00 0.00 ? 60 GLN A HB3  9  
ATOM 11137 H HG2  . GLN A 1 60 ? -6.736  -7.838  1.578   1.00 0.00 ? 60 GLN A HG2  9  
ATOM 11138 H HG3  . GLN A 1 60 ? -7.341  -7.238  3.121   1.00 0.00 ? 60 GLN A HG3  9  
ATOM 11139 H HE21 . GLN A 1 60 ? -9.341  -6.563  2.879   1.00 0.00 ? 60 GLN A HE21 9  
ATOM 11140 H HE22 . GLN A 1 60 ? -9.947  -5.613  1.569   1.00 0.00 ? 60 GLN A HE22 9  
ATOM 11141 N N    . VAL A 1 61 ? -2.906  -5.304  2.216   1.00 0.00 ? 61 VAL A N    9  
ATOM 11142 C CA   . VAL A 1 61 ? -1.744  -4.493  2.559   1.00 0.00 ? 61 VAL A CA   9  
ATOM 11143 C C    . VAL A 1 61 ? -0.999  -4.043  1.308   1.00 0.00 ? 61 VAL A C    9  
ATOM 11144 O O    . VAL A 1 61 ? -0.700  -2.860  1.141   1.00 0.00 ? 61 VAL A O    9  
ATOM 11145 C CB   . VAL A 1 61 ? -0.772  -5.264  3.472   1.00 0.00 ? 61 VAL A CB   9  
ATOM 11146 C CG1  . VAL A 1 61 ? 0.430   -4.400  3.822   1.00 0.00 ? 61 VAL A CG1  9  
ATOM 11147 C CG2  . VAL A 1 61 ? -1.485  -5.735  4.731   1.00 0.00 ? 61 VAL A CG2  9  
ATOM 11148 H H    . VAL A 1 61 ? -3.046  -6.158  2.676   1.00 0.00 ? 61 VAL A H    9  
ATOM 11149 H HA   . VAL A 1 61 ? -2.092  -3.621  3.093   1.00 0.00 ? 61 VAL A HA   9  
ATOM 11150 H HB   . VAL A 1 61 ? -0.420  -6.133  2.937   1.00 0.00 ? 61 VAL A HB   9  
ATOM 11151 H HG11 . VAL A 1 61 ? 0.386   -4.128  4.866   1.00 0.00 ? 61 VAL A HG11 9  
ATOM 11152 H HG12 . VAL A 1 61 ? 1.338   -4.953  3.630   1.00 0.00 ? 61 VAL A HG12 9  
ATOM 11153 H HG13 . VAL A 1 61 ? 0.419   -3.506  3.217   1.00 0.00 ? 61 VAL A HG13 9  
ATOM 11154 H HG21 . VAL A 1 61 ? -1.177  -6.743  4.962   1.00 0.00 ? 61 VAL A HG21 9  
ATOM 11155 H HG22 . VAL A 1 61 ? -1.230  -5.083  5.555   1.00 0.00 ? 61 VAL A HG22 9  
ATOM 11156 H HG23 . VAL A 1 61 ? -2.552  -5.711  4.571   1.00 0.00 ? 61 VAL A HG23 9  
ATOM 11157 N N    . LYS A 1 62 ? -0.702  -4.993  0.428   1.00 0.00 ? 62 LYS A N    9  
ATOM 11158 C CA   . LYS A 1 62 ? 0.007   -4.696  -0.811  1.00 0.00 ? 62 LYS A CA   9  
ATOM 11159 C C    . LYS A 1 62 ? -0.657  -3.540  -1.553  1.00 0.00 ? 62 LYS A C    9  
ATOM 11160 O O    . LYS A 1 62 ? -0.053  -2.484  -1.746  1.00 0.00 ? 62 LYS A O    9  
ATOM 11161 C CB   . LYS A 1 62 ? 0.049   -5.935  -1.708  1.00 0.00 ? 62 LYS A CB   9  
ATOM 11162 C CG   . LYS A 1 62 ? 0.917   -5.762  -2.943  1.00 0.00 ? 62 LYS A CG   9  
ATOM 11163 C CD   . LYS A 1 62 ? 1.235   -7.098  -3.593  1.00 0.00 ? 62 LYS A CD   9  
ATOM 11164 C CE   . LYS A 1 62 ? 1.561   -6.936  -5.069  1.00 0.00 ? 62 LYS A CE   9  
ATOM 11165 N NZ   . LYS A 1 62 ? 2.949   -6.438  -5.279  1.00 0.00 ? 62 LYS A NZ   9  
ATOM 11166 H H    . LYS A 1 62 ? -0.967  -5.918  0.617   1.00 0.00 ? 62 LYS A H    9  
ATOM 11167 H HA   . LYS A 1 62 ? 1.016   -4.412  -0.555  1.00 0.00 ? 62 LYS A HA   9  
ATOM 11168 H HB2  . LYS A 1 62 ? 0.434   -6.766  -1.136  1.00 0.00 ? 62 LYS A HB2  9  
ATOM 11169 H HB3  . LYS A 1 62 ? -0.956  -6.166  -2.030  1.00 0.00 ? 62 LYS A HB3  9  
ATOM 11170 H HG2  . LYS A 1 62 ? 0.395   -5.142  -3.656  1.00 0.00 ? 62 LYS A HG2  9  
ATOM 11171 H HG3  . LYS A 1 62 ? 1.843   -5.282  -2.656  1.00 0.00 ? 62 LYS A HG3  9  
ATOM 11172 H HD2  . LYS A 1 62 ? 2.085   -7.539  -3.094  1.00 0.00 ? 62 LYS A HD2  9  
ATOM 11173 H HD3  . LYS A 1 62 ? 0.378   -7.750  -3.492  1.00 0.00 ? 62 LYS A HD3  9  
ATOM 11174 H HE2  . LYS A 1 62 ? 1.455   -7.894  -5.555  1.00 0.00 ? 62 LYS A HE2  9  
ATOM 11175 H HE3  . LYS A 1 62 ? 0.866   -6.233  -5.503  1.00 0.00 ? 62 LYS A HE3  9  
ATOM 11176 H HZ1  . LYS A 1 62 ? 3.636   -7.150  -4.960  1.00 0.00 ? 62 LYS A HZ1  9  
ATOM 11177 H HZ2  . LYS A 1 62 ? 3.099   -5.562  -4.739  1.00 0.00 ? 62 LYS A HZ2  9  
ATOM 11178 H HZ3  . LYS A 1 62 ? 3.110   -6.243  -6.288  1.00 0.00 ? 62 LYS A HZ3  9  
ATOM 11179 N N    . THR A 1 63 ? -1.904  -3.746  -1.966  1.00 0.00 ? 63 THR A N    9  
ATOM 11180 C CA   . THR A 1 63 ? -2.649  -2.721  -2.687  1.00 0.00 ? 63 THR A CA   9  
ATOM 11181 C C    . THR A 1 63 ? -2.866  -1.487  -1.819  1.00 0.00 ? 63 THR A C    9  
ATOM 11182 O O    . THR A 1 63 ? -2.380  -0.401  -2.136  1.00 0.00 ? 63 THR A O    9  
ATOM 11183 C CB   . THR A 1 63 ? -4.017  -3.249  -3.159  1.00 0.00 ? 63 THR A CB   9  
ATOM 11184 O OG1  . THR A 1 63 ? -3.836  -4.397  -3.996  1.00 0.00 ? 63 THR A OG1  9  
ATOM 11185 C CG2  . THR A 1 63 ? -4.778  -2.175  -3.921  1.00 0.00 ? 63 THR A CG2  9  
ATOM 11186 H H    . THR A 1 63 ? -2.331  -4.608  -1.782  1.00 0.00 ? 63 THR A H    9  
ATOM 11187 H HA   . THR A 1 63 ? -2.074  -2.441  -3.558  1.00 0.00 ? 63 THR A HA   9  
ATOM 11188 H HB   . THR A 1 63 ? -4.595  -3.533  -2.292  1.00 0.00 ? 63 THR A HB   9  
ATOM 11189 H HG1  . THR A 1 63 ? -3.733  -5.179  -3.449  1.00 0.00 ? 63 THR A HG1  9  
ATOM 11190 H HG21 . THR A 1 63 ? -5.777  -2.524  -4.134  1.00 0.00 ? 63 THR A HG21 9  
ATOM 11191 H HG22 . THR A 1 63 ? -4.267  -1.960  -4.848  1.00 0.00 ? 63 THR A HG22 9  
ATOM 11192 H HG23 . THR A 1 63 ? -4.830  -1.278  -3.322  1.00 0.00 ? 63 THR A HG23 9  
ATOM 11193 N N    . TRP A 1 64 ? -3.597  -1.660  -0.724  1.00 0.00 ? 64 TRP A N    9  
ATOM 11194 C CA   . TRP A 1 64 ? -3.877  -0.559  0.190   1.00 0.00 ? 64 TRP A CA   9  
ATOM 11195 C C    . TRP A 1 64 ? -2.666  0.357   0.326   1.00 0.00 ? 64 TRP A C    9  
ATOM 11196 O O    . TRP A 1 64 ? -2.795  1.581   0.298   1.00 0.00 ? 64 TRP A O    9  
ATOM 11197 C CB   . TRP A 1 64 ? -4.281  -1.099  1.563   1.00 0.00 ? 64 TRP A CB   9  
ATOM 11198 C CG   . TRP A 1 64 ? -4.838  -0.047  2.474   1.00 0.00 ? 64 TRP A CG   9  
ATOM 11199 C CD1  . TRP A 1 64 ? -6.125  0.406   2.514   1.00 0.00 ? 64 TRP A CD1  9  
ATOM 11200 C CD2  . TRP A 1 64 ? -4.122  0.684   3.476   1.00 0.00 ? 64 TRP A CD2  9  
ATOM 11201 N NE1  . TRP A 1 64 ? -6.254  1.375   3.480   1.00 0.00 ? 64 TRP A NE1  9  
ATOM 11202 C CE2  . TRP A 1 64 ? -5.040  1.563   4.085   1.00 0.00 ? 64 TRP A CE2  9  
ATOM 11203 C CE3  . TRP A 1 64 ? -2.797  0.681   3.919   1.00 0.00 ? 64 TRP A CE3  9  
ATOM 11204 C CZ2  . TRP A 1 64 ? -4.671  2.429   5.111   1.00 0.00 ? 64 TRP A CZ2  9  
ATOM 11205 C CZ3  . TRP A 1 64 ? -2.433  1.541   4.938   1.00 0.00 ? 64 TRP A CZ3  9  
ATOM 11206 C CH2  . TRP A 1 64 ? -3.368  2.404   5.526   1.00 0.00 ? 64 TRP A CH2  9  
ATOM 11207 H H    . TRP A 1 64 ? -3.957  -2.550  -0.526  1.00 0.00 ? 64 TRP A H    9  
ATOM 11208 H HA   . TRP A 1 64 ? -4.699  0.010   -0.220  1.00 0.00 ? 64 TRP A HA   9  
ATOM 11209 H HB2  . TRP A 1 64 ? -5.035  -1.861  1.435   1.00 0.00 ? 64 TRP A HB2  9  
ATOM 11210 H HB3  . TRP A 1 64 ? -3.414  -1.531  2.041   1.00 0.00 ? 64 TRP A HB3  9  
ATOM 11211 H HD1  . TRP A 1 64 ? -6.916  0.047   1.872   1.00 0.00 ? 64 TRP A HD1  9  
ATOM 11212 H HE1  . TRP A 1 64 ? -7.082  1.852   3.700   1.00 0.00 ? 64 TRP A HE1  9  
ATOM 11213 H HE3  . TRP A 1 64 ? -2.063  0.023   3.479   1.00 0.00 ? 64 TRP A HE3  9  
ATOM 11214 H HZ2  . TRP A 1 64 ? -5.380  3.100   5.575   1.00 0.00 ? 64 TRP A HZ2  9  
ATOM 11215 H HZ3  . TRP A 1 64 ? -1.413  1.552   5.293   1.00 0.00 ? 64 TRP A HZ3  9  
ATOM 11216 H HH2  . TRP A 1 64 ? -3.039  3.059   6.318   1.00 0.00 ? 64 TRP A HH2  9  
ATOM 11217 N N    . TYR A 1 65 ? -1.490  -0.243  0.475   1.00 0.00 ? 65 TYR A N    9  
ATOM 11218 C CA   . TYR A 1 65 ? -0.256  0.519   0.618   1.00 0.00 ? 65 TYR A CA   9  
ATOM 11219 C C    . TYR A 1 65 ? 0.016   1.356   -0.628  1.00 0.00 ? 65 TYR A C    9  
ATOM 11220 O O    . TYR A 1 65 ? -0.001  2.585   -0.579  1.00 0.00 ? 65 TYR A O    9  
ATOM 11221 C CB   . TYR A 1 65 ? 0.922   -0.421  0.882   1.00 0.00 ? 65 TYR A CB   9  
ATOM 11222 C CG   . TYR A 1 65 ? 1.168   -0.687  2.350   1.00 0.00 ? 65 TYR A CG   9  
ATOM 11223 C CD1  . TYR A 1 65 ? 0.154   -1.171  3.167   1.00 0.00 ? 65 TYR A CD1  9  
ATOM 11224 C CD2  . TYR A 1 65 ? 2.414   -0.456  2.918   1.00 0.00 ? 65 TYR A CD2  9  
ATOM 11225 C CE1  . TYR A 1 65 ? 0.374   -1.415  4.509   1.00 0.00 ? 65 TYR A CE1  9  
ATOM 11226 C CE2  . TYR A 1 65 ? 2.643   -0.699  4.259   1.00 0.00 ? 65 TYR A CE2  9  
ATOM 11227 C CZ   . TYR A 1 65 ? 1.620   -1.178  5.050   1.00 0.00 ? 65 TYR A CZ   9  
ATOM 11228 O OH   . TYR A 1 65 ? 1.844   -1.421  6.386   1.00 0.00 ? 65 TYR A OH   9  
ATOM 11229 H H    . TYR A 1 65 ? -1.451  -1.222  0.490   1.00 0.00 ? 65 TYR A H    9  
ATOM 11230 H HA   . TYR A 1 65 ? -0.371  1.181   1.464   1.00 0.00 ? 65 TYR A HA   9  
ATOM 11231 H HB2  . TYR A 1 65 ? 0.732   -1.368  0.401   1.00 0.00 ? 65 TYR A HB2  9  
ATOM 11232 H HB3  . TYR A 1 65 ? 1.820   0.014   0.468   1.00 0.00 ? 65 TYR A HB3  9  
ATOM 11233 H HD1  . TYR A 1 65 ? -0.821  -1.357  2.740   1.00 0.00 ? 65 TYR A HD1  9  
ATOM 11234 H HD2  . TYR A 1 65 ? 3.214   -0.081  2.296   1.00 0.00 ? 65 TYR A HD2  9  
ATOM 11235 H HE1  . TYR A 1 65 ? -0.427  -1.791  5.129   1.00 0.00 ? 65 TYR A HE1  9  
ATOM 11236 H HE2  . TYR A 1 65 ? 3.619   -0.513  4.683   1.00 0.00 ? 65 TYR A HE2  9  
ATOM 11237 H HH   . TYR A 1 65 ? 1.810   -2.367  6.549   1.00 0.00 ? 65 TYR A HH   9  
ATOM 11238 N N    . GLN A 1 66 ? 0.266   0.679   -1.745  1.00 0.00 ? 66 GLN A N    9  
ATOM 11239 C CA   . GLN A 1 66 ? 0.541   1.359   -3.005  1.00 0.00 ? 66 GLN A CA   9  
ATOM 11240 C C    . GLN A 1 66 ? -0.337  2.596   -3.158  1.00 0.00 ? 66 GLN A C    9  
ATOM 11241 O O    . GLN A 1 66 ? 0.161   3.697   -3.389  1.00 0.00 ? 66 GLN A O    9  
ATOM 11242 C CB   . GLN A 1 66 ? 0.313   0.408   -4.182  1.00 0.00 ? 66 GLN A CB   9  
ATOM 11243 C CG   . GLN A 1 66 ? 1.523   -0.451  -4.512  1.00 0.00 ? 66 GLN A CG   9  
ATOM 11244 C CD   . GLN A 1 66 ? 1.185   -1.604  -5.436  1.00 0.00 ? 66 GLN A CD   9  
ATOM 11245 O OE1  . GLN A 1 66 ? 0.057   -1.718  -5.918  1.00 0.00 ? 66 GLN A OE1  9  
ATOM 11246 N NE2  . GLN A 1 66 ? 2.162   -2.467  -5.688  1.00 0.00 ? 66 GLN A NE2  9  
ATOM 11247 H H    . GLN A 1 66 ? 0.265   -0.300  -1.720  1.00 0.00 ? 66 GLN A H    9  
ATOM 11248 H HA   . GLN A 1 66 ? 1.576   1.665   -2.996  1.00 0.00 ? 66 GLN A HA   9  
ATOM 11249 H HB2  . GLN A 1 66 ? -0.513  -0.246  -3.946  1.00 0.00 ? 66 GLN A HB2  9  
ATOM 11250 H HB3  . GLN A 1 66 ? 0.064   0.991   -5.056  1.00 0.00 ? 66 GLN A HB3  9  
ATOM 11251 H HG2  . GLN A 1 66 ? 2.268   0.167   -4.991  1.00 0.00 ? 66 GLN A HG2  9  
ATOM 11252 H HG3  . GLN A 1 66 ? 1.925   -0.852  -3.593  1.00 0.00 ? 66 GLN A HG3  9  
ATOM 11253 H HE21 . GLN A 1 66 ? 3.034   -2.314  -5.268  1.00 0.00 ? 66 GLN A HE21 9  
ATOM 11254 H HE22 . GLN A 1 66 ? 1.971   -3.222  -6.282  1.00 0.00 ? 66 GLN A HE22 9  
ATOM 11255 N N    . ASN A 1 67 ? -1.646  2.407   -3.029  1.00 0.00 ? 67 ASN A N    9  
ATOM 11256 C CA   . ASN A 1 67 ? -2.593  3.509   -3.154  1.00 0.00 ? 67 ASN A CA   9  
ATOM 11257 C C    . ASN A 1 67 ? -2.333  4.574   -2.094  1.00 0.00 ? 67 ASN A C    9  
ATOM 11258 O O    . ASN A 1 67 ? -2.280  5.766   -2.397  1.00 0.00 ? 67 ASN A O    9  
ATOM 11259 C CB   . ASN A 1 67 ? -4.028  2.991   -3.031  1.00 0.00 ? 67 ASN A CB   9  
ATOM 11260 C CG   . ASN A 1 67 ? -4.463  2.198   -4.248  1.00 0.00 ? 67 ASN A CG   9  
ATOM 11261 O OD1  . ASN A 1 67 ? -4.182  2.579   -5.385  1.00 0.00 ? 67 ASN A OD1  9  
ATOM 11262 N ND2  . ASN A 1 67 ? -5.153  1.088   -4.015  1.00 0.00 ? 67 ASN A ND2  9  
ATOM 11263 H H    . ASN A 1 67 ? -1.983  1.506   -2.845  1.00 0.00 ? 67 ASN A H    9  
ATOM 11264 H HA   . ASN A 1 67 ? -2.462  3.949   -4.131  1.00 0.00 ? 67 ASN A HA   9  
ATOM 11265 H HB2  . ASN A 1 67 ? -4.100  2.351   -2.164  1.00 0.00 ? 67 ASN A HB2  9  
ATOM 11266 H HB3  . ASN A 1 67 ? -4.698  3.829   -2.912  1.00 0.00 ? 67 ASN A HB3  9  
ATOM 11267 H HD21 . ASN A 1 67 ? -5.341  0.846   -3.084  1.00 0.00 ? 67 ASN A HD21 9  
ATOM 11268 H HD22 . ASN A 1 67 ? -5.447  0.556   -4.784  1.00 0.00 ? 67 ASN A HD22 9  
ATOM 11269 N N    . ARG A 1 68 ? -2.169  4.136   -0.850  1.00 0.00 ? 68 ARG A N    9  
ATOM 11270 C CA   . ARG A 1 68 ? -1.914  5.052   0.255   1.00 0.00 ? 68 ARG A CA   9  
ATOM 11271 C C    . ARG A 1 68 ? -0.800  6.033   -0.098  1.00 0.00 ? 68 ARG A C    9  
ATOM 11272 O O    . ARG A 1 68 ? -0.931  7.239   0.113   1.00 0.00 ? 68 ARG A O    9  
ATOM 11273 C CB   . ARG A 1 68 ? -1.540  4.271   1.516   1.00 0.00 ? 68 ARG A CB   9  
ATOM 11274 C CG   . ARG A 1 68 ? -2.741  3.742   2.283   1.00 0.00 ? 68 ARG A CG   9  
ATOM 11275 C CD   . ARG A 1 68 ? -3.489  4.862   2.989   1.00 0.00 ? 68 ARG A CD   9  
ATOM 11276 N NE   . ARG A 1 68 ? -4.501  5.470   2.131   1.00 0.00 ? 68 ARG A NE   9  
ATOM 11277 C CZ   . ARG A 1 68 ? -5.333  6.423   2.536   1.00 0.00 ? 68 ARG A CZ   9  
ATOM 11278 N NH1  . ARG A 1 68 ? -5.272  6.875   3.781   1.00 0.00 ? 68 ARG A NH1  9  
ATOM 11279 N NH2  . ARG A 1 68 ? -6.227  6.927   1.696   1.00 0.00 ? 68 ARG A NH2  9  
ATOM 11280 H H    . ARG A 1 68 ? -2.222  3.174   -0.671  1.00 0.00 ? 68 ARG A H    9  
ATOM 11281 H HA   . ARG A 1 68 ? -2.821  5.607   0.442   1.00 0.00 ? 68 ARG A HA   9  
ATOM 11282 H HB2  . ARG A 1 68 ? -0.922  3.431   1.236   1.00 0.00 ? 68 ARG A HB2  9  
ATOM 11283 H HB3  . ARG A 1 68 ? -0.978  4.918   2.172   1.00 0.00 ? 68 ARG A HB3  9  
ATOM 11284 H HG2  . ARG A 1 68 ? -3.413  3.256   1.591   1.00 0.00 ? 68 ARG A HG2  9  
ATOM 11285 H HG3  . ARG A 1 68 ? -2.400  3.028   3.019   1.00 0.00 ? 68 ARG A HG3  9  
ATOM 11286 H HD2  . ARG A 1 68 ? -3.971  4.458   3.867   1.00 0.00 ? 68 ARG A HD2  9  
ATOM 11287 H HD3  . ARG A 1 68 ? -2.779  5.619   3.286   1.00 0.00 ? 68 ARG A HD3  9  
ATOM 11288 H HE   . ARG A 1 68 ? -4.564  5.151   1.206   1.00 0.00 ? 68 ARG A HE   9  
ATOM 11289 H HH11 . ARG A 1 68 ? -4.598  6.498   4.417   1.00 0.00 ? 68 ARG A HH11 9  
ATOM 11290 H HH12 . ARG A 1 68 ? -5.898  7.594   4.084   1.00 0.00 ? 68 ARG A HH12 9  
ATOM 11291 H HH21 . ARG A 1 68 ? -6.276  6.590   0.756   1.00 0.00 ? 68 ARG A HH21 9  
ATOM 11292 H HH22 . ARG A 1 68 ? -6.852  7.644   2.002   1.00 0.00 ? 68 ARG A HH22 9  
ATOM 11293 N N    . ARG A 1 69 ? 0.297   5.507   -0.634  1.00 0.00 ? 69 ARG A N    9  
ATOM 11294 C CA   . ARG A 1 69 ? 1.434   6.336   -1.015  1.00 0.00 ? 69 ARG A CA   9  
ATOM 11295 C C    . ARG A 1 69 ? 0.986   7.509   -1.881  1.00 0.00 ? 69 ARG A C    9  
ATOM 11296 O O    . ARG A 1 69 ? 1.391   8.650   -1.655  1.00 0.00 ? 69 ARG A O    9  
ATOM 11297 C CB   . ARG A 1 69 ? 2.472   5.500   -1.766  1.00 0.00 ? 69 ARG A CB   9  
ATOM 11298 C CG   . ARG A 1 69 ? 3.360   4.668   -0.855  1.00 0.00 ? 69 ARG A CG   9  
ATOM 11299 C CD   . ARG A 1 69 ? 4.703   4.374   -1.503  1.00 0.00 ? 69 ARG A CD   9  
ATOM 11300 N NE   . ARG A 1 69 ? 4.592   3.378   -2.566  1.00 0.00 ? 69 ARG A NE   9  
ATOM 11301 C CZ   . ARG A 1 69 ? 5.548   3.145   -3.458  1.00 0.00 ? 69 ARG A CZ   9  
ATOM 11302 N NH1  . ARG A 1 69 ? 6.681   3.833   -3.416  1.00 0.00 ? 69 ARG A NH1  9  
ATOM 11303 N NH2  . ARG A 1 69 ? 5.373   2.222   -4.395  1.00 0.00 ? 69 ARG A NH2  9  
ATOM 11304 H H    . ARG A 1 69 ? 0.342   4.538   -0.778  1.00 0.00 ? 69 ARG A H    9  
ATOM 11305 H HA   . ARG A 1 69 ? 1.881   6.721   -0.110  1.00 0.00 ? 69 ARG A HA   9  
ATOM 11306 H HB2  . ARG A 1 69 ? 1.959   4.831   -2.441  1.00 0.00 ? 69 ARG A HB2  9  
ATOM 11307 H HB3  . ARG A 1 69 ? 3.103   6.163   -2.339  1.00 0.00 ? 69 ARG A HB3  9  
ATOM 11308 H HG2  . ARG A 1 69 ? 3.527   5.211   0.063   1.00 0.00 ? 69 ARG A HG2  9  
ATOM 11309 H HG3  . ARG A 1 69 ? 2.862   3.735   -0.638  1.00 0.00 ? 69 ARG A HG3  9  
ATOM 11310 H HD2  . ARG A 1 69 ? 5.095   5.289   -1.921  1.00 0.00 ? 69 ARG A HD2  9  
ATOM 11311 H HD3  . ARG A 1 69 ? 5.380   4.006   -0.747  1.00 0.00 ? 69 ARG A HD3  9  
ATOM 11312 H HE   . ARG A 1 69 ? 3.764   2.858   -2.615  1.00 0.00 ? 69 ARG A HE   9  
ATOM 11313 H HH11 . ARG A 1 69 ? 6.816   4.529   -2.710  1.00 0.00 ? 69 ARG A HH11 9  
ATOM 11314 H HH12 . ARG A 1 69 ? 7.400   3.655   -4.088  1.00 0.00 ? 69 ARG A HH12 9  
ATOM 11315 H HH21 . ARG A 1 69 ? 4.520   1.701   -4.430  1.00 0.00 ? 69 ARG A HH21 9  
ATOM 11316 H HH22 . ARG A 1 69 ? 6.093   2.048   -5.066  1.00 0.00 ? 69 ARG A HH22 9  
ATOM 11317 N N    . MET A 1 70 ? 0.149   7.221   -2.872  1.00 0.00 ? 70 MET A N    9  
ATOM 11318 C CA   . MET A 1 70 ? -0.354  8.253   -3.771  1.00 0.00 ? 70 MET A CA   9  
ATOM 11319 C C    . MET A 1 70 ? -0.885  9.448   -2.985  1.00 0.00 ? 70 MET A C    9  
ATOM 11320 O O    . MET A 1 70 ? -0.515  10.592  -3.249  1.00 0.00 ? 70 MET A O    9  
ATOM 11321 C CB   . MET A 1 70 ? -1.457  7.686   -4.667  1.00 0.00 ? 70 MET A CB   9  
ATOM 11322 C CG   . MET A 1 70 ? -1.026  6.464   -5.461  1.00 0.00 ? 70 MET A CG   9  
ATOM 11323 S SD   . MET A 1 70 ? -0.131  6.894   -6.966  1.00 0.00 ? 70 MET A SD   9  
ATOM 11324 C CE   . MET A 1 70 ? -0.929  5.818   -8.155  1.00 0.00 ? 70 MET A CE   9  
ATOM 11325 H H    . MET A 1 70 ? -0.138  6.293   -3.002  1.00 0.00 ? 70 MET A H    9  
ATOM 11326 H HA   . MET A 1 70 ? 0.467   8.581   -4.391  1.00 0.00 ? 70 MET A HA   9  
ATOM 11327 H HB2  . MET A 1 70 ? -2.298  7.409   -4.049  1.00 0.00 ? 70 MET A HB2  9  
ATOM 11328 H HB3  . MET A 1 70 ? -1.768  8.450   -5.363  1.00 0.00 ? 70 MET A HB3  9  
ATOM 11329 H HG2  . MET A 1 70 ? -0.386  5.855   -4.841  1.00 0.00 ? 70 MET A HG2  9  
ATOM 11330 H HG3  . MET A 1 70 ? -1.906  5.899   -5.731  1.00 0.00 ? 70 MET A HG3  9  
ATOM 11331 H HE1  . MET A 1 70 ? -1.936  6.165   -8.335  1.00 0.00 ? 70 MET A HE1  9  
ATOM 11332 H HE2  . MET A 1 70 ? -0.374  5.830   -9.081  1.00 0.00 ? 70 MET A HE2  9  
ATOM 11333 H HE3  . MET A 1 70 ? -0.960  4.811   -7.765  1.00 0.00 ? 70 MET A HE3  9  
ATOM 11334 N N    . LYS A 1 71 ? -1.754  9.175   -2.018  1.00 0.00 ? 71 LYS A N    9  
ATOM 11335 C CA   . LYS A 1 71 ? -2.336  10.226  -1.192  1.00 0.00 ? 71 LYS A CA   9  
ATOM 11336 C C    . LYS A 1 71 ? -1.297  10.808  -0.240  1.00 0.00 ? 71 LYS A C    9  
ATOM 11337 O O    . LYS A 1 71 ? -1.272  12.014  0.005   1.00 0.00 ? 71 LYS A O    9  
ATOM 11338 C CB   . LYS A 1 71 ? -3.523  9.679   -0.396  1.00 0.00 ? 71 LYS A CB   9  
ATOM 11339 C CG   . LYS A 1 71 ? -4.459  10.759  0.120   1.00 0.00 ? 71 LYS A CG   9  
ATOM 11340 C CD   . LYS A 1 71 ? -4.028  11.264  1.487   1.00 0.00 ? 71 LYS A CD   9  
ATOM 11341 C CE   . LYS A 1 71 ? -5.095  12.146  2.117   1.00 0.00 ? 71 LYS A CE   9  
ATOM 11342 N NZ   . LYS A 1 71 ? -5.155  13.488  1.475   1.00 0.00 ? 71 LYS A NZ   9  
ATOM 11343 H H    . LYS A 1 71 ? -2.011  8.242   -1.855  1.00 0.00 ? 71 LYS A H    9  
ATOM 11344 H HA   . LYS A 1 71 ? -2.684  11.009  -1.849  1.00 0.00 ? 71 LYS A HA   9  
ATOM 11345 H HB2  . LYS A 1 71 ? -4.090  9.014   -1.030  1.00 0.00 ? 71 LYS A HB2  9  
ATOM 11346 H HB3  . LYS A 1 71 ? -3.148  9.123   0.451   1.00 0.00 ? 71 LYS A HB3  9  
ATOM 11347 H HG2  . LYS A 1 71 ? -4.457  11.587  -0.574  1.00 0.00 ? 71 LYS A HG2  9  
ATOM 11348 H HG3  . LYS A 1 71 ? -5.457  10.352  0.194   1.00 0.00 ? 71 LYS A HG3  9  
ATOM 11349 H HD2  . LYS A 1 71 ? -3.849  10.418  2.133   1.00 0.00 ? 71 LYS A HD2  9  
ATOM 11350 H HD3  . LYS A 1 71 ? -3.118  11.836  1.379   1.00 0.00 ? 71 LYS A HD3  9  
ATOM 11351 H HE2  . LYS A 1 71 ? -6.054  11.661  2.009   1.00 0.00 ? 71 LYS A HE2  9  
ATOM 11352 H HE3  . LYS A 1 71 ? -4.869  12.267  3.166   1.00 0.00 ? 71 LYS A HE3  9  
ATOM 11353 H HZ1  . LYS A 1 71 ? -4.987  14.230  2.184   1.00 0.00 ? 71 LYS A HZ1  9  
ATOM 11354 H HZ2  . LYS A 1 71 ? -6.092  13.638  1.049   1.00 0.00 ? 71 LYS A HZ2  9  
ATOM 11355 H HZ3  . LYS A 1 71 ? -4.432  13.562  0.732   1.00 0.00 ? 71 LYS A HZ3  9  
ATOM 11356 N N    . TRP A 1 72 ? -0.440  9.944   0.293   1.00 0.00 ? 72 TRP A N    9  
ATOM 11357 C CA   . TRP A 1 72 ? 0.603   10.373  1.218   1.00 0.00 ? 72 TRP A CA   9  
ATOM 11358 C C    . TRP A 1 72 ? 1.528   11.391  0.560   1.00 0.00 ? 72 TRP A C    9  
ATOM 11359 O O    . TRP A 1 72 ? 2.132   12.224  1.236   1.00 0.00 ? 72 TRP A O    9  
ATOM 11360 C CB   . TRP A 1 72 ? 1.411   9.168   1.702   1.00 0.00 ? 72 TRP A CB   9  
ATOM 11361 C CG   . TRP A 1 72 ? 2.753   9.538   2.258   1.00 0.00 ? 72 TRP A CG   9  
ATOM 11362 C CD1  . TRP A 1 72 ? 3.004   10.172  3.441   1.00 0.00 ? 72 TRP A CD1  9  
ATOM 11363 C CD2  . TRP A 1 72 ? 4.027   9.298   1.651   1.00 0.00 ? 72 TRP A CD2  9  
ATOM 11364 N NE1  . TRP A 1 72 ? 4.357   10.340  3.607   1.00 0.00 ? 72 TRP A NE1  9  
ATOM 11365 C CE2  . TRP A 1 72 ? 5.007   9.812   2.523   1.00 0.00 ? 72 TRP A CE2  9  
ATOM 11366 C CE3  . TRP A 1 72 ? 4.436   8.697   0.458   1.00 0.00 ? 72 TRP A CE3  9  
ATOM 11367 C CZ2  . TRP A 1 72 ? 6.368   9.743   2.236   1.00 0.00 ? 72 TRP A CZ2  9  
ATOM 11368 C CZ3  . TRP A 1 72 ? 5.787   8.630   0.174   1.00 0.00 ? 72 TRP A CZ3  9  
ATOM 11369 C CH2  . TRP A 1 72 ? 6.740   9.150   1.061   1.00 0.00 ? 72 TRP A CH2  9  
ATOM 11370 H H    . TRP A 1 72 ? -0.511  8.994   0.059   1.00 0.00 ? 72 TRP A H    9  
ATOM 11371 H HA   . TRP A 1 72 ? 0.122   10.837  2.066   1.00 0.00 ? 72 TRP A HA   9  
ATOM 11372 H HB2  . TRP A 1 72 ? 0.858   8.660   2.478   1.00 0.00 ? 72 TRP A HB2  9  
ATOM 11373 H HB3  . TRP A 1 72 ? 1.567   8.492   0.874   1.00 0.00 ? 72 TRP A HB3  9  
ATOM 11374 H HD1  . TRP A 1 72 ? 2.240   10.490  4.134   1.00 0.00 ? 72 TRP A HD1  9  
ATOM 11375 H HE1  . TRP A 1 72 ? 4.787   10.768  4.377   1.00 0.00 ? 72 TRP A HE1  9  
ATOM 11376 H HE3  . TRP A 1 72 ? 3.717   8.291   -0.238  1.00 0.00 ? 72 TRP A HE3  9  
ATOM 11377 H HZ2  . TRP A 1 72 ? 7.115   10.139  2.909   1.00 0.00 ? 72 TRP A HZ2  9  
ATOM 11378 H HZ3  . TRP A 1 72 ? 6.122   8.170   -0.744  1.00 0.00 ? 72 TRP A HZ3  9  
ATOM 11379 H HH2  . TRP A 1 72 ? 7.784   9.076   0.798   1.00 0.00 ? 72 TRP A HH2  9  
ATOM 11380 N N    . LYS A 1 73 ? 1.637   11.317  -0.762  1.00 0.00 ? 73 LYS A N    9  
ATOM 11381 C CA   . LYS A 1 73 ? 2.488   12.233  -1.513  1.00 0.00 ? 73 LYS A CA   9  
ATOM 11382 C C    . LYS A 1 73 ? 1.758   13.541  -1.802  1.00 0.00 ? 73 LYS A C    9  
ATOM 11383 O O    . LYS A 1 73 ? 0.597   13.711  -1.431  1.00 0.00 ? 73 LYS A O    9  
ATOM 11384 C CB   . LYS A 1 73 ? 2.936   11.586  -2.825  1.00 0.00 ? 73 LYS A CB   9  
ATOM 11385 C CG   . LYS A 1 73 ? 4.020   10.537  -2.647  1.00 0.00 ? 73 LYS A CG   9  
ATOM 11386 C CD   . LYS A 1 73 ? 4.007   9.523   -3.780  1.00 0.00 ? 73 LYS A CD   9  
ATOM 11387 C CE   . LYS A 1 73 ? 4.748   10.043  -5.001  1.00 0.00 ? 73 LYS A CE   9  
ATOM 11388 N NZ   . LYS A 1 73 ? 4.843   9.013   -6.073  1.00 0.00 ? 73 LYS A NZ   9  
ATOM 11389 H H    . LYS A 1 73 ? 1.130   10.630  -1.246  1.00 0.00 ? 73 LYS A H    9  
ATOM 11390 H HA   . LYS A 1 73 ? 3.358   12.445  -0.911  1.00 0.00 ? 73 LYS A HA   9  
ATOM 11391 H HB2  . LYS A 1 73 ? 2.082   11.116  -3.291  1.00 0.00 ? 73 LYS A HB2  9  
ATOM 11392 H HB3  . LYS A 1 73 ? 3.314   12.356  -3.482  1.00 0.00 ? 73 LYS A HB3  9  
ATOM 11393 H HG2  . LYS A 1 73 ? 4.982   11.026  -2.628  1.00 0.00 ? 73 LYS A HG2  9  
ATOM 11394 H HG3  . LYS A 1 73 ? 3.858   10.020  -1.712  1.00 0.00 ? 73 LYS A HG3  9  
ATOM 11395 H HD2  . LYS A 1 73 ? 4.483   8.614   -3.443  1.00 0.00 ? 73 LYS A HD2  9  
ATOM 11396 H HD3  . LYS A 1 73 ? 2.982   9.315   -4.053  1.00 0.00 ? 73 LYS A HD3  9  
ATOM 11397 H HE2  . LYS A 1 73 ? 4.222   10.903  -5.387  1.00 0.00 ? 73 LYS A HE2  9  
ATOM 11398 H HE3  . LYS A 1 73 ? 5.745   10.334  -4.704  1.00 0.00 ? 73 LYS A HE3  9  
ATOM 11399 H HZ1  . LYS A 1 73 ? 4.380   9.356   -6.939  1.00 0.00 ? 73 LYS A HZ1  9  
ATOM 11400 H HZ2  . LYS A 1 73 ? 4.375   8.136   -5.767  1.00 0.00 ? 73 LYS A HZ2  9  
ATOM 11401 H HZ3  . LYS A 1 73 ? 5.840   8.807   -6.283  1.00 0.00 ? 73 LYS A HZ3  9  
ATOM 11402 N N    . LYS A 1 74 ? 2.446   14.462  -2.468  1.00 0.00 ? 74 LYS A N    9  
ATOM 11403 C CA   . LYS A 1 74 ? 1.863   15.754  -2.810  1.00 0.00 ? 74 LYS A CA   9  
ATOM 11404 C C    . LYS A 1 74 ? 1.920   15.995  -4.315  1.00 0.00 ? 74 LYS A C    9  
ATOM 11405 O O    . LYS A 1 74 ? 2.843   15.542  -4.992  1.00 0.00 ? 74 LYS A O    9  
ATOM 11406 C CB   . LYS A 1 74 ? 2.597   16.878  -2.075  1.00 0.00 ? 74 LYS A CB   9  
ATOM 11407 C CG   . LYS A 1 74 ? 2.145   18.269  -2.485  1.00 0.00 ? 74 LYS A CG   9  
ATOM 11408 C CD   . LYS A 1 74 ? 3.223   19.307  -2.218  1.00 0.00 ? 74 LYS A CD   9  
ATOM 11409 C CE   . LYS A 1 74 ? 3.233   19.737  -0.759  1.00 0.00 ? 74 LYS A CE   9  
ATOM 11410 N NZ   . LYS A 1 74 ? 4.001   18.788  0.094   1.00 0.00 ? 74 LYS A NZ   9  
ATOM 11411 H H    . LYS A 1 74 ? 3.369   14.268  -2.737  1.00 0.00 ? 74 LYS A H    9  
ATOM 11412 H HA   . LYS A 1 74 ? 0.830   15.745  -2.497  1.00 0.00 ? 74 LYS A HA   9  
ATOM 11413 H HB2  . LYS A 1 74 ? 2.431   16.766  -1.014  1.00 0.00 ? 74 LYS A HB2  9  
ATOM 11414 H HB3  . LYS A 1 74 ? 3.655   16.793  -2.276  1.00 0.00 ? 74 LYS A HB3  9  
ATOM 11415 H HG2  . LYS A 1 74 ? 1.916   18.267  -3.540  1.00 0.00 ? 74 LYS A HG2  9  
ATOM 11416 H HG3  . LYS A 1 74 ? 1.260   18.530  -1.923  1.00 0.00 ? 74 LYS A HG3  9  
ATOM 11417 H HD2  . LYS A 1 74 ? 4.186   18.884  -2.464  1.00 0.00 ? 74 LYS A HD2  9  
ATOM 11418 H HD3  . LYS A 1 74 ? 3.038   20.172  -2.838  1.00 0.00 ? 74 LYS A HD3  9  
ATOM 11419 H HE2  . LYS A 1 74 ? 3.683   20.715  -0.689  1.00 0.00 ? 74 LYS A HE2  9  
ATOM 11420 H HE3  . LYS A 1 74 ? 2.214   19.784  -0.404  1.00 0.00 ? 74 LYS A HE3  9  
ATOM 11421 H HZ1  . LYS A 1 74 ? 4.286   17.957  -0.464  1.00 0.00 ? 74 LYS A HZ1  9  
ATOM 11422 H HZ2  . LYS A 1 74 ? 3.415   18.471  0.892   1.00 0.00 ? 74 LYS A HZ2  9  
ATOM 11423 H HZ3  . LYS A 1 74 ? 4.854   19.251  0.466   1.00 0.00 ? 74 LYS A HZ3  9  
ATOM 11424 N N    . SER A 1 75 ? 0.927   16.712  -4.833  1.00 0.00 ? 75 SER A N    9  
ATOM 11425 C CA   . SER A 1 75 ? 0.863   17.011  -6.258  1.00 0.00 ? 75 SER A CA   9  
ATOM 11426 C C    . SER A 1 75 ? 1.403   18.409  -6.545  1.00 0.00 ? 75 SER A C    9  
ATOM 11427 O O    . SER A 1 75 ? 2.354   18.575  -7.307  1.00 0.00 ? 75 SER A O    9  
ATOM 11428 C CB   . SER A 1 75 ? -0.577  16.896  -6.761  1.00 0.00 ? 75 SER A CB   9  
ATOM 11429 O OG   . SER A 1 75 ? -1.066  15.574  -6.609  1.00 0.00 ? 75 SER A OG   9  
ATOM 11430 H H    . SER A 1 75 ? 0.220   17.045  -4.241  1.00 0.00 ? 75 SER A H    9  
ATOM 11431 H HA   . SER A 1 75 ? 1.475   16.288  -6.777  1.00 0.00 ? 75 SER A HA   9  
ATOM 11432 H HB2  . SER A 1 75 ? -1.207  17.567  -6.197  1.00 0.00 ? 75 SER A HB2  9  
ATOM 11433 H HB3  . SER A 1 75 ? -0.613  17.162  -7.807  1.00 0.00 ? 75 SER A HB3  9  
ATOM 11434 H HG   . SER A 1 75 ? -0.452  14.957  -7.013  1.00 0.00 ? 75 SER A HG   9  
ATOM 11435 N N    . GLY A 1 76 ? 0.788   19.413  -5.927  1.00 0.00 ? 76 GLY A N    9  
ATOM 11436 C CA   . GLY A 1 76 ? 1.219   20.784  -6.128  1.00 0.00 ? 76 GLY A CA   9  
ATOM 11437 C C    . GLY A 1 76 ? 0.191   21.791  -5.654  1.00 0.00 ? 76 GLY A C    9  
ATOM 11438 O O    . GLY A 1 76 ? 0.137   22.149  -4.477  1.00 0.00 ? 76 GLY A O    9  
ATOM 11439 H H    . GLY A 1 76 ? 0.034   19.221  -5.330  1.00 0.00 ? 76 GLY A H    9  
ATOM 11440 H HA2  . GLY A 1 76 ? 2.140   20.943  -5.586  1.00 0.00 ? 76 GLY A HA2  9  
ATOM 11441 H HA3  . GLY A 1 76 ? 1.401   20.941  -7.181  1.00 0.00 ? 76 GLY A HA3  9  
ATOM 11442 N N    . PRO A 1 77 ? -0.650  22.266  -6.584  1.00 0.00 ? 77 PRO A N    9  
ATOM 11443 C CA   . PRO A 1 77 ? -1.697  23.246  -6.279  1.00 0.00 ? 77 PRO A CA   9  
ATOM 11444 C C    . PRO A 1 77 ? -2.816  22.653  -5.430  1.00 0.00 ? 77 PRO A C    9  
ATOM 11445 O O    . PRO A 1 77 ? -3.310  23.293  -4.502  1.00 0.00 ? 77 PRO A O    9  
ATOM 11446 C CB   . PRO A 1 77 ? -2.226  23.642  -7.660  1.00 0.00 ? 77 PRO A CB   9  
ATOM 11447 C CG   . PRO A 1 77 ? -1.925  22.472  -8.531  1.00 0.00 ? 77 PRO A CG   9  
ATOM 11448 C CD   . PRO A 1 77 ? -0.644  21.884  -8.006  1.00 0.00 ? 77 PRO A CD   9  
ATOM 11449 H HA   . PRO A 1 77 ? -1.293  24.116  -5.783  1.00 0.00 ? 77 PRO A HA   9  
ATOM 11450 H HB2  . PRO A 1 77 ? -3.289  23.829  -7.601  1.00 0.00 ? 77 PRO A HB2  9  
ATOM 11451 H HB3  . PRO A 1 77 ? -1.717  24.531  -8.003  1.00 0.00 ? 77 PRO A HB3  9  
ATOM 11452 H HG2  . PRO A 1 77 ? -2.724  21.749  -8.464  1.00 0.00 ? 77 PRO A HG2  9  
ATOM 11453 H HG3  . PRO A 1 77 ? -1.796  22.798  -9.552  1.00 0.00 ? 77 PRO A HG3  9  
ATOM 11454 H HD2  . PRO A 1 77 ? -0.649  20.809  -8.117  1.00 0.00 ? 77 PRO A HD2  9  
ATOM 11455 H HD3  . PRO A 1 77 ? 0.205   22.313  -8.517  1.00 0.00 ? 77 PRO A HD3  9  
ATOM 11456 N N    . SER A 1 78 ? -3.212  21.426  -5.754  1.00 0.00 ? 78 SER A N    9  
ATOM 11457 C CA   . SER A 1 78 ? -4.276  20.748  -5.023  1.00 0.00 ? 78 SER A CA   9  
ATOM 11458 C C    . SER A 1 78 ? -4.181  21.043  -3.529  1.00 0.00 ? 78 SER A C    9  
ATOM 11459 O O    . SER A 1 78 ? -3.117  21.396  -3.021  1.00 0.00 ? 78 SER A O    9  
ATOM 11460 C CB   . SER A 1 78 ? -4.205  19.238  -5.261  1.00 0.00 ? 78 SER A CB   9  
ATOM 11461 O OG   . SER A 1 78 ? -5.225  18.561  -4.548  1.00 0.00 ? 78 SER A OG   9  
ATOM 11462 H H    . SER A 1 78 ? -2.779  20.967  -6.505  1.00 0.00 ? 78 SER A H    9  
ATOM 11463 H HA   . SER A 1 78 ? -5.220  21.118  -5.392  1.00 0.00 ? 78 SER A HA   9  
ATOM 11464 H HB2  . SER A 1 78 ? -4.325  19.037  -6.315  1.00 0.00 ? 78 SER A HB2  9  
ATOM 11465 H HB3  . SER A 1 78 ? -3.245  18.869  -4.932  1.00 0.00 ? 78 SER A HB3  9  
ATOM 11466 H HG   . SER A 1 78 ? -4.857  17.781  -4.125  1.00 0.00 ? 78 SER A HG   9  
ATOM 11467 N N    . SER A 1 79 ? -5.303  20.895  -2.831  1.00 0.00 ? 79 SER A N    9  
ATOM 11468 C CA   . SER A 1 79 ? -5.349  21.149  -1.396  1.00 0.00 ? 79 SER A CA   9  
ATOM 11469 C C    . SER A 1 79 ? -5.605  19.858  -0.624  1.00 0.00 ? 79 SER A C    9  
ATOM 11470 O O    . SER A 1 79 ? -4.804  19.456  0.219   1.00 0.00 ? 79 SER A O    9  
ATOM 11471 C CB   . SER A 1 79 ? -6.438  22.174  -1.073  1.00 0.00 ? 79 SER A CB   9  
ATOM 11472 O OG   . SER A 1 79 ? -5.924  23.493  -1.112  1.00 0.00 ? 79 SER A OG   9  
ATOM 11473 H H    . SER A 1 79 ? -6.119  20.610  -3.293  1.00 0.00 ? 79 SER A H    9  
ATOM 11474 H HA   . SER A 1 79 ? -4.391  21.548  -1.099  1.00 0.00 ? 79 SER A HA   9  
ATOM 11475 H HB2  . SER A 1 79 ? -7.235  22.089  -1.796  1.00 0.00 ? 79 SER A HB2  9  
ATOM 11476 H HB3  . SER A 1 79 ? -6.828  21.981  -0.084  1.00 0.00 ? 79 SER A HB3  9  
ATOM 11477 H HG   . SER A 1 79 ? -5.085  23.524  -0.646  1.00 0.00 ? 79 SER A HG   9  
ATOM 11478 N N    . GLY A 1 80 ? -6.729  19.212  -0.919  1.00 0.00 ? 80 GLY A N    9  
ATOM 11479 C CA   . GLY A 1 80 ? -7.072  17.973  -0.244  1.00 0.00 ? 80 GLY A CA   9  
ATOM 11480 C C    . GLY A 1 80 ? -7.165  16.800  -1.199  1.00 0.00 ? 80 GLY A C    9  
ATOM 11481 O O    . GLY A 1 80 ? -7.659  16.939  -2.318  1.00 0.00 ? 80 GLY A O    9  
ATOM 11482 H H    . GLY A 1 80 ? -7.331  19.579  -1.600  1.00 0.00 ? 80 GLY A H    9  
ATOM 11483 H HA2  . GLY A 1 80 ? -6.318  17.760  0.499   1.00 0.00 ? 80 GLY A HA2  9  
ATOM 11484 H HA3  . GLY A 1 80 ? -8.024  18.097  0.249   1.00 0.00 ? 80 GLY A HA3  9  
ATOM 11485 N N    . GLY A 1 1  ? -18.921 48.537  -20.847 1.00 0.00 ? 1  GLY A N    10 
ATOM 11486 C CA   . GLY A 1 1  ? -17.923 47.783  -20.111 1.00 0.00 ? 1  GLY A CA   10 
ATOM 11487 C C    . GLY A 1 1  ? -18.329 46.338  -19.898 1.00 0.00 ? 1  GLY A C    10 
ATOM 11488 O O    . GLY A 1 1  ? -19.330 46.058  -19.239 1.00 0.00 ? 1  GLY A O    10 
ATOM 11489 H H1   . GLY A 1 1  ? -19.841 48.204  -20.903 1.00 0.00 ? 1  GLY A H1   10 
ATOM 11490 H HA2  . GLY A 1 1  ? -16.992 47.808  -20.658 1.00 0.00 ? 1  GLY A HA2  10 
ATOM 11491 H HA3  . GLY A 1 1  ? -17.775 48.249  -19.147 1.00 0.00 ? 1  GLY A HA3  10 
ATOM 11492 N N    . SER A 1 2  ? -17.550 45.418  -20.459 1.00 0.00 ? 2  SER A N    10 
ATOM 11493 C CA   . SER A 1 2  ? -17.837 43.994  -20.332 1.00 0.00 ? 2  SER A CA   10 
ATOM 11494 C C    . SER A 1 2  ? -16.597 43.161  -20.640 1.00 0.00 ? 2  SER A C    10 
ATOM 11495 O O    . SER A 1 2  ? -15.549 43.696  -21.000 1.00 0.00 ? 2  SER A O    10 
ATOM 11496 C CB   . SER A 1 2  ? -18.979 43.597  -21.270 1.00 0.00 ? 2  SER A CB   10 
ATOM 11497 O OG   . SER A 1 2  ? -20.239 43.882  -20.689 1.00 0.00 ? 2  SER A OG   10 
ATOM 11498 H H    . SER A 1 2  ? -16.766 45.704  -20.972 1.00 0.00 ? 2  SER A H    10 
ATOM 11499 H HA   . SER A 1 2  ? -18.139 43.806  -19.312 1.00 0.00 ? 2  SER A HA   10 
ATOM 11500 H HB2  . SER A 1 2  ? -18.889 44.146  -22.194 1.00 0.00 ? 2  SER A HB2  10 
ATOM 11501 H HB3  . SER A 1 2  ? -18.921 42.537  -21.473 1.00 0.00 ? 2  SER A HB3  10 
ATOM 11502 H HG   . SER A 1 2  ? -20.307 43.442  -19.838 1.00 0.00 ? 2  SER A HG   10 
ATOM 11503 N N    . SER A 1 3  ? -16.725 41.846  -20.495 1.00 0.00 ? 3  SER A N    10 
ATOM 11504 C CA   . SER A 1 3  ? -15.614 40.937  -20.753 1.00 0.00 ? 3  SER A CA   10 
ATOM 11505 C C    . SER A 1 3  ? -14.524 41.096  -19.698 1.00 0.00 ? 3  SER A C    10 
ATOM 11506 O O    . SER A 1 3  ? -13.335 41.103  -20.013 1.00 0.00 ? 3  SER A O    10 
ATOM 11507 C CB   . SER A 1 3  ? -15.033 41.191  -22.145 1.00 0.00 ? 3  SER A CB   10 
ATOM 11508 O OG   . SER A 1 3  ? -14.233 40.101  -22.571 1.00 0.00 ? 3  SER A OG   10 
ATOM 11509 H H    . SER A 1 3  ? -17.586 41.478  -20.204 1.00 0.00 ? 3  SER A H    10 
ATOM 11510 H HA   . SER A 1 3  ? -15.995 39.927  -20.710 1.00 0.00 ? 3  SER A HA   10 
ATOM 11511 H HB2  . SER A 1 3  ? -15.839 41.327  -22.850 1.00 0.00 ? 3  SER A HB2  10 
ATOM 11512 H HB3  . SER A 1 3  ? -14.422 42.082  -22.120 1.00 0.00 ? 3  SER A HB3  10 
ATOM 11513 H HG   . SER A 1 3  ? -14.520 39.300  -22.127 1.00 0.00 ? 3  SER A HG   10 
ATOM 11514 N N    . GLY A 1 4  ? -14.940 41.225  -18.441 1.00 0.00 ? 4  GLY A N    10 
ATOM 11515 C CA   . GLY A 1 4  ? -13.988 41.384  -17.357 1.00 0.00 ? 4  GLY A CA   10 
ATOM 11516 C C    . GLY A 1 4  ? -14.294 40.478  -16.181 1.00 0.00 ? 4  GLY A C    10 
ATOM 11517 O O    . GLY A 1 4  ? -15.447 40.349  -15.770 1.00 0.00 ? 4  GLY A O    10 
ATOM 11518 H H    . GLY A 1 4  ? -15.901 41.213  -18.249 1.00 0.00 ? 4  GLY A H    10 
ATOM 11519 H HA2  . GLY A 1 4  ? -12.999 41.157  -17.725 1.00 0.00 ? 4  GLY A HA2  10 
ATOM 11520 H HA3  . GLY A 1 4  ? -14.010 42.410  -17.021 1.00 0.00 ? 4  GLY A HA3  10 
ATOM 11521 N N    . SER A 1 5  ? -13.258 39.847  -15.637 1.00 0.00 ? 5  SER A N    10 
ATOM 11522 C CA   . SER A 1 5  ? -13.422 38.944  -14.504 1.00 0.00 ? 5  SER A CA   10 
ATOM 11523 C C    . SER A 1 5  ? -12.067 38.473  -13.984 1.00 0.00 ? 5  SER A C    10 
ATOM 11524 O O    . SER A 1 5  ? -11.035 38.696  -14.617 1.00 0.00 ? 5  SER A O    10 
ATOM 11525 C CB   . SER A 1 5  ? -14.273 37.737  -14.905 1.00 0.00 ? 5  SER A CB   10 
ATOM 11526 O OG   . SER A 1 5  ? -14.784 37.072  -13.763 1.00 0.00 ? 5  SER A OG   10 
ATOM 11527 H H    . SER A 1 5  ? -12.362 39.990  -16.009 1.00 0.00 ? 5  SER A H    10 
ATOM 11528 H HA   . SER A 1 5  ? -13.927 39.485  -13.719 1.00 0.00 ? 5  SER A HA   10 
ATOM 11529 H HB2  . SER A 1 5  ? -15.101 38.070  -15.513 1.00 0.00 ? 5  SER A HB2  10 
ATOM 11530 H HB3  . SER A 1 5  ? -13.667 37.044  -15.471 1.00 0.00 ? 5  SER A HB3  10 
ATOM 11531 H HG   . SER A 1 5  ? -14.861 37.694  -13.037 1.00 0.00 ? 5  SER A HG   10 
ATOM 11532 N N    . SER A 1 6  ? -12.078 37.821  -12.826 1.00 0.00 ? 6  SER A N    10 
ATOM 11533 C CA   . SER A 1 6  ? -10.851 37.322  -12.217 1.00 0.00 ? 6  SER A CA   10 
ATOM 11534 C C    . SER A 1 6  ? -11.162 36.423  -11.025 1.00 0.00 ? 6  SER A C    10 
ATOM 11535 O O    . SER A 1 6  ? -12.310 36.317  -10.596 1.00 0.00 ? 6  SER A O    10 
ATOM 11536 C CB   . SER A 1 6  ? -9.966  38.489  -11.773 1.00 0.00 ? 6  SER A CB   10 
ATOM 11537 O OG   . SER A 1 6  ? -10.643 39.318  -10.845 1.00 0.00 ? 6  SER A OG   10 
ATOM 11538 H H    . SER A 1 6  ? -12.933 37.675  -12.369 1.00 0.00 ? 6  SER A H    10 
ATOM 11539 H HA   . SER A 1 6  ? -10.323 36.744  -12.961 1.00 0.00 ? 6  SER A HA   10 
ATOM 11540 H HB2  . SER A 1 6  ? -9.072  38.102  -11.307 1.00 0.00 ? 6  SER A HB2  10 
ATOM 11541 H HB3  . SER A 1 6  ? -9.695  39.080  -12.636 1.00 0.00 ? 6  SER A HB3  10 
ATOM 11542 H HG   . SER A 1 6  ? -11.282 38.795  -10.355 1.00 0.00 ? 6  SER A HG   10 
ATOM 11543 N N    . GLY A 1 7  ? -10.129 35.777  -10.493 1.00 0.00 ? 7  GLY A N    10 
ATOM 11544 C CA   . GLY A 1 7  ? -10.312 34.894  -9.355  1.00 0.00 ? 7  GLY A CA   10 
ATOM 11545 C C    . GLY A 1 7  ? -9.250  33.815  -9.282  1.00 0.00 ? 7  GLY A C    10 
ATOM 11546 O O    . GLY A 1 7  ? -8.272  33.846  -10.027 1.00 0.00 ? 7  GLY A O    10 
ATOM 11547 H H    . GLY A 1 7  ? -9.235  35.900  -10.876 1.00 0.00 ? 7  GLY A H    10 
ATOM 11548 H HA2  . GLY A 1 7  ? -10.277 35.481  -8.449  1.00 0.00 ? 7  GLY A HA2  10 
ATOM 11549 H HA3  . GLY A 1 7  ? -11.282 34.425  -9.431  1.00 0.00 ? 7  GLY A HA3  10 
ATOM 11550 N N    . GLY A 1 8  ? -9.443  32.857  -8.381  1.00 0.00 ? 8  GLY A N    10 
ATOM 11551 C CA   . GLY A 1 8  ? -8.485  31.777  -8.229  1.00 0.00 ? 8  GLY A CA   10 
ATOM 11552 C C    . GLY A 1 8  ? -8.045  31.591  -6.790  1.00 0.00 ? 8  GLY A C    10 
ATOM 11553 O O    . GLY A 1 8  ? -6.992  32.085  -6.388  1.00 0.00 ? 8  GLY A O    10 
ATOM 11554 H H    . GLY A 1 8  ? -10.243 32.884  -7.814  1.00 0.00 ? 8  GLY A H    10 
ATOM 11555 H HA2  . GLY A 1 8  ? -8.935  30.860  -8.578  1.00 0.00 ? 8  GLY A HA2  10 
ATOM 11556 H HA3  . GLY A 1 8  ? -7.617  31.994  -8.833  1.00 0.00 ? 8  GLY A HA3  10 
ATOM 11557 N N    . GLU A 1 9  ? -8.854  30.878  -6.013  1.00 0.00 ? 9  GLU A N    10 
ATOM 11558 C CA   . GLU A 1 9  ? -8.543  30.631  -4.610  1.00 0.00 ? 9  GLU A CA   10 
ATOM 11559 C C    . GLU A 1 9  ? -8.245  29.154  -4.371  1.00 0.00 ? 9  GLU A C    10 
ATOM 11560 O O    . GLU A 1 9  ? -8.800  28.269  -5.023  1.00 0.00 ? 9  GLU A O    10 
ATOM 11561 C CB   . GLU A 1 9  ? -9.704  31.079  -3.720  1.00 0.00 ? 9  GLU A CB   10 
ATOM 11562 C CG   . GLU A 1 9  ? -9.637  32.544  -3.323  1.00 0.00 ? 9  GLU A CG   10 
ATOM 11563 C CD   . GLU A 1 9  ? -10.822 32.976  -2.482  1.00 0.00 ? 9  GLU A CD   10 
ATOM 11564 O OE1  . GLU A 1 9  ? -11.957 32.955  -3.002  1.00 0.00 ? 9  GLU A OE1  10 
ATOM 11565 O OE2  . GLU A 1 9  ? -10.615 33.335  -1.304  1.00 0.00 ? 9  GLU A OE2  10 
ATOM 11566 H H    . GLU A 1 9  ? -9.680  30.511  -6.391  1.00 0.00 ? 9  GLU A H    10 
ATOM 11567 H HA   . GLU A 1 9  ? -7.666  31.208  -4.358  1.00 0.00 ? 9  GLU A HA   10 
ATOM 11568 H HB2  . GLU A 1 9  ? -10.631 30.912  -4.247  1.00 0.00 ? 9  GLU A HB2  10 
ATOM 11569 H HB3  . GLU A 1 9  ? -9.701  30.484  -2.819  1.00 0.00 ? 9  GLU A HB3  10 
ATOM 11570 H HG2  . GLU A 1 9  ? -8.733  32.709  -2.755  1.00 0.00 ? 9  GLU A HG2  10 
ATOM 11571 H HG3  . GLU A 1 9  ? -9.612  33.146  -4.220  1.00 0.00 ? 9  GLU A HG3  10 
ATOM 11572 N N    . PRO A 1 10 ? -7.347  28.879  -3.413  1.00 0.00 ? 10 PRO A N    10 
ATOM 11573 C CA   . PRO A 1 10 ? -6.955  27.510  -3.065  1.00 0.00 ? 10 PRO A CA   10 
ATOM 11574 C C    . PRO A 1 10 ? -8.076  26.744  -2.371  1.00 0.00 ? 10 PRO A C    10 
ATOM 11575 O O    . PRO A 1 10 ? -9.126  27.306  -2.061  1.00 0.00 ? 10 PRO A O    10 
ATOM 11576 C CB   . PRO A 1 10 ? -5.774  27.711  -2.111  1.00 0.00 ? 10 PRO A CB   10 
ATOM 11577 C CG   . PRO A 1 10 ? -5.990  29.061  -1.520  1.00 0.00 ? 10 PRO A CG   10 
ATOM 11578 C CD   . PRO A 1 10 ? -6.647  29.883  -2.595  1.00 0.00 ? 10 PRO A CD   10 
ATOM 11579 H HA   . PRO A 1 10 ? -6.628  26.958  -3.934  1.00 0.00 ? 10 PRO A HA   10 
ATOM 11580 H HB2  . PRO A 1 10 ? -5.786  26.941  -1.353  1.00 0.00 ? 10 PRO A HB2  10 
ATOM 11581 H HB3  . PRO A 1 10 ? -4.848  27.666  -2.664  1.00 0.00 ? 10 PRO A HB3  10 
ATOM 11582 H HG2  . PRO A 1 10 ? -6.636  28.986  -0.659  1.00 0.00 ? 10 PRO A HG2  10 
ATOM 11583 H HG3  . PRO A 1 10 ? -5.041  29.497  -1.244  1.00 0.00 ? 10 PRO A HG3  10 
ATOM 11584 H HD2  . PRO A 1 10 ? -7.346  30.583  -2.161  1.00 0.00 ? 10 PRO A HD2  10 
ATOM 11585 H HD3  . PRO A 1 10 ? -5.903  30.404  -3.179  1.00 0.00 ? 10 PRO A HD3  10 
ATOM 11586 N N    . GLY A 1 11 ? -7.846  25.457  -2.128  1.00 0.00 ? 11 GLY A N    10 
ATOM 11587 C CA   . GLY A 1 11 ? -8.846  24.636  -1.472  1.00 0.00 ? 11 GLY A CA   10 
ATOM 11588 C C    . GLY A 1 11 ? -9.737  23.908  -2.459  1.00 0.00 ? 11 GLY A C    10 
ATOM 11589 O O    . GLY A 1 11 ? -10.836 24.367  -2.771  1.00 0.00 ? 11 GLY A O    10 
ATOM 11590 H H    . GLY A 1 11 ? -6.990  25.062  -2.398  1.00 0.00 ? 11 GLY A H    10 
ATOM 11591 H HA2  . GLY A 1 11 ? -8.346  23.908  -0.849  1.00 0.00 ? 11 GLY A HA2  10 
ATOM 11592 H HA3  . GLY A 1 11 ? -9.461  25.267  -0.848  1.00 0.00 ? 11 GLY A HA3  10 
ATOM 11593 N N    . THR A 1 12 ? -9.263  22.768  -2.953  1.00 0.00 ? 12 THR A N    10 
ATOM 11594 C CA   . THR A 1 12 ? -10.023 21.977  -3.913  1.00 0.00 ? 12 THR A CA   10 
ATOM 11595 C C    . THR A 1 12 ? -10.480 20.659  -3.298  1.00 0.00 ? 12 THR A C    10 
ATOM 11596 O O    . THR A 1 12 ? -9.707  19.706  -3.201  1.00 0.00 ? 12 THR A O    10 
ATOM 11597 C CB   . THR A 1 12 ? -9.195  21.681  -5.177  1.00 0.00 ? 12 THR A CB   10 
ATOM 11598 O OG1  . THR A 1 12 ? -7.936  21.102  -4.814  1.00 0.00 ? 12 THR A OG1  10 
ATOM 11599 C CG2  . THR A 1 12 ? -8.961  22.951  -5.981  1.00 0.00 ? 12 THR A CG2  10 
ATOM 11600 H H    . THR A 1 12 ? -8.380  22.454  -2.666  1.00 0.00 ? 12 THR A H    10 
ATOM 11601 H HA   . THR A 1 12 ? -10.892 22.549  -4.203  1.00 0.00 ? 12 THR A HA   10 
ATOM 11602 H HB   . THR A 1 12 ? -9.742  20.979  -5.791  1.00 0.00 ? 12 THR A HB   10 
ATOM 11603 H HG1  . THR A 1 12 ? -7.366  21.781  -4.447  1.00 0.00 ? 12 THR A HG1  10 
ATOM 11604 H HG21 . THR A 1 12 ? -8.054  22.850  -6.559  1.00 0.00 ? 12 THR A HG21 10 
ATOM 11605 H HG22 . THR A 1 12 ? -8.868  23.790  -5.309  1.00 0.00 ? 12 THR A HG22 10 
ATOM 11606 H HG23 . THR A 1 12 ? -9.795  23.113  -6.647  1.00 0.00 ? 12 THR A HG23 10 
ATOM 11607 N N    . LYS A 1 13 ? -11.742 20.611  -2.885  1.00 0.00 ? 13 LYS A N    10 
ATOM 11608 C CA   . LYS A 1 13 ? -12.305 19.408  -2.282  1.00 0.00 ? 13 LYS A CA   10 
ATOM 11609 C C    . LYS A 1 13 ? -13.828 19.479  -2.246  1.00 0.00 ? 13 LYS A C    10 
ATOM 11610 O O    . LYS A 1 13 ? -14.407 20.564  -2.197  1.00 0.00 ? 13 LYS A O    10 
ATOM 11611 C CB   . LYS A 1 13 ? -11.759 19.221  -0.864  1.00 0.00 ? 13 LYS A CB   10 
ATOM 11612 C CG   . LYS A 1 13 ? -11.897 17.802  -0.342  1.00 0.00 ? 13 LYS A CG   10 
ATOM 11613 C CD   . LYS A 1 13 ? -12.033 17.776  1.171   1.00 0.00 ? 13 LYS A CD   10 
ATOM 11614 C CE   . LYS A 1 13 ? -12.723 16.506  1.647   1.00 0.00 ? 13 LYS A CE   10 
ATOM 11615 N NZ   . LYS A 1 13 ? -11.907 15.293  1.366   1.00 0.00 ? 13 LYS A NZ   10 
ATOM 11616 H H    . LYS A 1 13 ? -12.310 21.403  -2.990  1.00 0.00 ? 13 LYS A H    10 
ATOM 11617 H HA   . LYS A 1 13 ? -12.009 18.564  -2.886  1.00 0.00 ? 13 LYS A HA   10 
ATOM 11618 H HB2  . LYS A 1 13 ? -10.712 19.486  -0.857  1.00 0.00 ? 13 LYS A HB2  10 
ATOM 11619 H HB3  . LYS A 1 13 ? -12.293 19.882  -0.196  1.00 0.00 ? 13 LYS A HB3  10 
ATOM 11620 H HG2  . LYS A 1 13 ? -12.775 17.351  -0.779  1.00 0.00 ? 13 LYS A HG2  10 
ATOM 11621 H HG3  . LYS A 1 13 ? -11.021 17.237  -0.625  1.00 0.00 ? 13 LYS A HG3  10 
ATOM 11622 H HD2  . LYS A 1 13 ? -11.049 17.824  1.614   1.00 0.00 ? 13 LYS A HD2  10 
ATOM 11623 H HD3  . LYS A 1 13 ? -12.614 18.631  1.487   1.00 0.00 ? 13 LYS A HD3  10 
ATOM 11624 H HE2  . LYS A 1 13 ? -12.888 16.579  2.711   1.00 0.00 ? 13 LYS A HE2  10 
ATOM 11625 H HE3  . LYS A 1 13 ? -13.672 16.417  1.140   1.00 0.00 ? 13 LYS A HE3  10 
ATOM 11626 H HZ1  . LYS A 1 13 ? -11.114 15.534  0.736   1.00 0.00 ? 13 LYS A HZ1  10 
ATOM 11627 H HZ2  . LYS A 1 13 ? -12.492 14.568  0.904   1.00 0.00 ? 13 LYS A HZ2  10 
ATOM 11628 H HZ3  . LYS A 1 13 ? -11.526 14.904  2.252   1.00 0.00 ? 13 LYS A HZ3  10 
ATOM 11629 N N    . ALA A 1 14 ? -14.471 18.316  -2.270  1.00 0.00 ? 14 ALA A N    10 
ATOM 11630 C CA   . ALA A 1 14 ? -15.926 18.247  -2.237  1.00 0.00 ? 14 ALA A CA   10 
ATOM 11631 C C    . ALA A 1 14 ? -16.400 16.898  -1.706  1.00 0.00 ? 14 ALA A C    10 
ATOM 11632 O O    . ALA A 1 14 ? -15.614 15.958  -1.580  1.00 0.00 ? 14 ALA A O    10 
ATOM 11633 C CB   . ALA A 1 14 ? -16.498 18.500  -3.624  1.00 0.00 ? 14 ALA A CB   10 
ATOM 11634 H H    . ALA A 1 14 ? -13.953 17.485  -2.310  1.00 0.00 ? 14 ALA A H    10 
ATOM 11635 H HA   . ALA A 1 14 ? -16.283 19.027  -1.580  1.00 0.00 ? 14 ALA A HA   10 
ATOM 11636 H HB1  . ALA A 1 14 ? -15.745 18.965  -4.244  1.00 0.00 ? 14 ALA A HB1  10 
ATOM 11637 H HB2  . ALA A 1 14 ? -16.798 17.561  -4.066  1.00 0.00 ? 14 ALA A HB2  10 
ATOM 11638 H HB3  . ALA A 1 14 ? -17.355 19.152  -3.547  1.00 0.00 ? 14 ALA A HB3  10 
ATOM 11639 N N    . LYS A 1 15 ? -17.688 16.810  -1.394  1.00 0.00 ? 15 LYS A N    10 
ATOM 11640 C CA   . LYS A 1 15 ? -18.267 15.576  -0.876  1.00 0.00 ? 15 LYS A CA   10 
ATOM 11641 C C    . LYS A 1 15 ? -19.787 15.679  -0.798  1.00 0.00 ? 15 LYS A C    10 
ATOM 11642 O O    . LYS A 1 15 ? -20.340 16.772  -0.674  1.00 0.00 ? 15 LYS A O    10 
ATOM 11643 C CB   . LYS A 1 15 ? -17.695 15.262  0.509   1.00 0.00 ? 15 LYS A CB   10 
ATOM 11644 C CG   . LYS A 1 15 ? -17.752 13.787  0.870   1.00 0.00 ? 15 LYS A CG   10 
ATOM 11645 C CD   . LYS A 1 15 ? -17.696 13.579  2.374   1.00 0.00 ? 15 LYS A CD   10 
ATOM 11646 C CE   . LYS A 1 15 ? -19.038 13.868  3.027   1.00 0.00 ? 15 LYS A CE   10 
ATOM 11647 N NZ   . LYS A 1 15 ? -18.912 14.044  4.500   1.00 0.00 ? 15 LYS A NZ   10 
ATOM 11648 H H    . LYS A 1 15 ? -18.264 17.594  -1.516  1.00 0.00 ? 15 LYS A H    10 
ATOM 11649 H HA   . LYS A 1 15 ? -18.007 14.777  -1.553  1.00 0.00 ? 15 LYS A HA   10 
ATOM 11650 H HB2  . LYS A 1 15 ? -16.664 15.579  0.539   1.00 0.00 ? 15 LYS A HB2  10 
ATOM 11651 H HB3  . LYS A 1 15 ? -18.255 15.814  1.250   1.00 0.00 ? 15 LYS A HB3  10 
ATOM 11652 H HG2  . LYS A 1 15 ? -18.674 13.369  0.494   1.00 0.00 ? 15 LYS A HG2  10 
ATOM 11653 H HG3  . LYS A 1 15 ? -16.912 13.282  0.414   1.00 0.00 ? 15 LYS A HG3  10 
ATOM 11654 H HD2  . LYS A 1 15 ? -17.423 12.554  2.577   1.00 0.00 ? 15 LYS A HD2  10 
ATOM 11655 H HD3  . LYS A 1 15 ? -16.951 14.241  2.793   1.00 0.00 ? 15 LYS A HD3  10 
ATOM 11656 H HE2  . LYS A 1 15 ? -19.445 14.771  2.599   1.00 0.00 ? 15 LYS A HE2  10 
ATOM 11657 H HE3  . LYS A 1 15 ? -19.706 13.043  2.828   1.00 0.00 ? 15 LYS A HE3  10 
ATOM 11658 H HZ1  . LYS A 1 15 ? -19.188 13.169  4.990   1.00 0.00 ? 15 LYS A HZ1  10 
ATOM 11659 H HZ2  . LYS A 1 15 ? -19.528 14.817  4.822   1.00 0.00 ? 15 LYS A HZ2  10 
ATOM 11660 H HZ3  . LYS A 1 15 ? -17.928 14.273  4.750   1.00 0.00 ? 15 LYS A HZ3  10 
ATOM 11661 N N    . LYS A 1 16 ? -20.458 14.534  -0.869  1.00 0.00 ? 16 LYS A N    10 
ATOM 11662 C CA   . LYS A 1 16 ? -21.914 14.495  -0.804  1.00 0.00 ? 16 LYS A CA   10 
ATOM 11663 C C    . LYS A 1 16 ? -22.383 13.754  0.444   1.00 0.00 ? 16 LYS A C    10 
ATOM 11664 O O    . LYS A 1 16 ? -23.130 14.298  1.256   1.00 0.00 ? 16 LYS A O    10 
ATOM 11665 C CB   . LYS A 1 16 ? -22.483 13.820  -2.055  1.00 0.00 ? 16 LYS A CB   10 
ATOM 11666 C CG   . LYS A 1 16 ? -22.752 14.784  -3.197  1.00 0.00 ? 16 LYS A CG   10 
ATOM 11667 C CD   . LYS A 1 16 ? -22.804 14.064  -4.534  1.00 0.00 ? 16 LYS A CD   10 
ATOM 11668 C CE   . LYS A 1 16 ? -22.729 15.041  -5.697  1.00 0.00 ? 16 LYS A CE   10 
ATOM 11669 N NZ   . LYS A 1 16 ? -21.342 15.534  -5.918  1.00 0.00 ? 16 LYS A NZ   10 
ATOM 11670 H H    . LYS A 1 16 ? -19.961 13.695  -0.968  1.00 0.00 ? 16 LYS A H    10 
ATOM 11671 H HA   . LYS A 1 16 ? -22.272 15.512  -0.760  1.00 0.00 ? 16 LYS A HA   10 
ATOM 11672 H HB2  . LYS A 1 16 ? -21.780 13.075  -2.398  1.00 0.00 ? 16 LYS A HB2  10 
ATOM 11673 H HB3  . LYS A 1 16 ? -23.412 13.334  -1.795  1.00 0.00 ? 16 LYS A HB3  10 
ATOM 11674 H HG2  . LYS A 1 16 ? -23.699 15.274  -3.027  1.00 0.00 ? 16 LYS A HG2  10 
ATOM 11675 H HG3  . LYS A 1 16 ? -21.963 15.522  -3.227  1.00 0.00 ? 16 LYS A HG3  10 
ATOM 11676 H HD2  . LYS A 1 16 ? -21.971 13.381  -4.598  1.00 0.00 ? 16 LYS A HD2  10 
ATOM 11677 H HD3  . LYS A 1 16 ? -23.731 13.511  -4.599  1.00 0.00 ? 16 LYS A HD3  10 
ATOM 11678 H HE2  . LYS A 1 16 ? -23.072 14.544  -6.591  1.00 0.00 ? 16 LYS A HE2  10 
ATOM 11679 H HE3  . LYS A 1 16 ? -23.372 15.883  -5.485  1.00 0.00 ? 16 LYS A HE3  10 
ATOM 11680 H HZ1  . LYS A 1 16 ? -21.278 16.543  -5.673  1.00 0.00 ? 16 LYS A HZ1  10 
ATOM 11681 H HZ2  . LYS A 1 16 ? -21.074 15.414  -6.915  1.00 0.00 ? 16 LYS A HZ2  10 
ATOM 11682 H HZ3  . LYS A 1 16 ? -20.674 15.002  -5.324  1.00 0.00 ? 16 LYS A HZ3  10 
ATOM 11683 N N    . GLY A 1 17 ? -21.938 12.510  0.591   1.00 0.00 ? 17 GLY A N    10 
ATOM 11684 C CA   . GLY A 1 17 ? -22.321 11.716  1.743   1.00 0.00 ? 17 GLY A CA   10 
ATOM 11685 C C    . GLY A 1 17 ? -21.265 10.698  2.124   1.00 0.00 ? 17 GLY A C    10 
ATOM 11686 O O    . GLY A 1 17 ? -20.073 10.924  1.917   1.00 0.00 ? 17 GLY A O    10 
ATOM 11687 H H    . GLY A 1 17 ? -21.344 12.128  -0.089  1.00 0.00 ? 17 GLY A H    10 
ATOM 11688 H HA2  . GLY A 1 17 ? -22.489 12.376  2.581   1.00 0.00 ? 17 GLY A HA2  10 
ATOM 11689 H HA3  . GLY A 1 17 ? -23.241 11.196  1.518   1.00 0.00 ? 17 GLY A HA3  10 
ATOM 11690 N N    . ARG A 1 18 ? -21.702 9.574   2.682   1.00 0.00 ? 18 ARG A N    10 
ATOM 11691 C CA   . ARG A 1 18 ? -20.785 8.518   3.095   1.00 0.00 ? 18 ARG A CA   10 
ATOM 11692 C C    . ARG A 1 18 ? -20.484 7.575   1.934   1.00 0.00 ? 18 ARG A C    10 
ATOM 11693 O O    . ARG A 1 18 ? -21.393 7.120   1.239   1.00 0.00 ? 18 ARG A O    10 
ATOM 11694 C CB   . ARG A 1 18 ? -21.374 7.731   4.266   1.00 0.00 ? 18 ARG A CB   10 
ATOM 11695 C CG   . ARG A 1 18 ? -21.149 8.389   5.617   1.00 0.00 ? 18 ARG A CG   10 
ATOM 11696 C CD   . ARG A 1 18 ? -19.709 8.233   6.080   1.00 0.00 ? 18 ARG A CD   10 
ATOM 11697 N NE   . ARG A 1 18 ? -19.469 8.898   7.358   1.00 0.00 ? 18 ARG A NE   10 
ATOM 11698 C CZ   . ARG A 1 18 ? -19.922 8.441   8.521   1.00 0.00 ? 18 ARG A CZ   10 
ATOM 11699 N NH1  . ARG A 1 18 ? -20.634 7.324   8.566   1.00 0.00 ? 18 ARG A NH1  10 
ATOM 11700 N NH2  . ARG A 1 18 ? -19.663 9.103   9.641   1.00 0.00 ? 18 ARG A NH2  10 
ATOM 11701 H H    . ARG A 1 18 ? -22.665 9.451   2.820   1.00 0.00 ? 18 ARG A H    10 
ATOM 11702 H HA   . ARG A 1 18 ? -19.864 8.984   3.412   1.00 0.00 ? 18 ARG A HA   10 
ATOM 11703 H HB2  . ARG A 1 18 ? -22.438 7.625   4.115   1.00 0.00 ? 18 ARG A HB2  10 
ATOM 11704 H HB3  . ARG A 1 18 ? -20.923 6.750   4.288   1.00 0.00 ? 18 ARG A HB3  10 
ATOM 11705 H HG2  . ARG A 1 18 ? -21.377 9.442   5.537   1.00 0.00 ? 18 ARG A HG2  10 
ATOM 11706 H HG3  . ARG A 1 18 ? -21.804 7.932   6.344   1.00 0.00 ? 18 ARG A HG3  10 
ATOM 11707 H HD2  . ARG A 1 18 ? -19.492 7.180   6.187   1.00 0.00 ? 18 ARG A HD2  10 
ATOM 11708 H HD3  . ARG A 1 18 ? -19.057 8.661   5.334   1.00 0.00 ? 18 ARG A HD3  10 
ATOM 11709 H HE   . ARG A 1 18 ? -18.945 9.725   7.348   1.00 0.00 ? 18 ARG A HE   10 
ATOM 11710 H HH11 . ARG A 1 18 ? -20.831 6.823   7.723   1.00 0.00 ? 18 ARG A HH11 10 
ATOM 11711 H HH12 . ARG A 1 18 ? -20.973 6.982   9.443   1.00 0.00 ? 18 ARG A HH12 10 
ATOM 11712 H HH21 . ARG A 1 18 ? -19.126 9.946   9.611   1.00 0.00 ? 18 ARG A HH21 10 
ATOM 11713 H HH22 . ARG A 1 18 ? -20.004 8.759   10.515  1.00 0.00 ? 18 ARG A HH22 10 
ATOM 11714 N N    . ARG A 1 19 ? -19.203 7.286   1.730   1.00 0.00 ? 19 ARG A N    10 
ATOM 11715 C CA   . ARG A 1 19 ? -18.782 6.399   0.652   1.00 0.00 ? 19 ARG A CA   10 
ATOM 11716 C C    . ARG A 1 19 ? -17.506 5.652   1.030   1.00 0.00 ? 19 ARG A C    10 
ATOM 11717 O O    . ARG A 1 19 ? -16.479 6.265   1.320   1.00 0.00 ? 19 ARG A O    10 
ATOM 11718 C CB   . ARG A 1 19 ? -18.558 7.195   -0.635  1.00 0.00 ? 19 ARG A CB   10 
ATOM 11719 C CG   . ARG A 1 19 ? -18.436 6.325   -1.875  1.00 0.00 ? 19 ARG A CG   10 
ATOM 11720 C CD   . ARG A 1 19 ? -18.785 7.101   -3.136  1.00 0.00 ? 19 ARG A CD   10 
ATOM 11721 N NE   . ARG A 1 19 ? -18.121 6.554   -4.316  1.00 0.00 ? 19 ARG A NE   10 
ATOM 11722 C CZ   . ARG A 1 19 ? -16.885 6.878   -4.680  1.00 0.00 ? 19 ARG A CZ   10 
ATOM 11723 N NH1  . ARG A 1 19 ? -16.182 7.740   -3.958  1.00 0.00 ? 19 ARG A NH1  10 
ATOM 11724 N NH2  . ARG A 1 19 ? -16.350 6.338   -5.767  1.00 0.00 ? 19 ARG A NH2  10 
ATOM 11725 H H    . ARG A 1 19 ? -18.524 7.680   2.317   1.00 0.00 ? 19 ARG A H    10 
ATOM 11726 H HA   . ARG A 1 19 ? -19.570 5.680   0.488   1.00 0.00 ? 19 ARG A HA   10 
ATOM 11727 H HB2  . ARG A 1 19 ? -19.389 7.870   -0.776  1.00 0.00 ? 19 ARG A HB2  10 
ATOM 11728 H HB3  . ARG A 1 19 ? -17.650 7.770   -0.534  1.00 0.00 ? 19 ARG A HB3  10 
ATOM 11729 H HG2  . ARG A 1 19 ? -17.419 5.969   -1.955  1.00 0.00 ? 19 ARG A HG2  10 
ATOM 11730 H HG3  . ARG A 1 19 ? -19.107 5.485   -1.782  1.00 0.00 ? 19 ARG A HG3  10 
ATOM 11731 H HD2  . ARG A 1 19 ? -19.854 7.058   -3.284  1.00 0.00 ? 19 ARG A HD2  10 
ATOM 11732 H HD3  . ARG A 1 19 ? -18.481 8.128   -3.006  1.00 0.00 ? 19 ARG A HD3  10 
ATOM 11733 H HE   . ARG A 1 19 ? -18.622 5.916   -4.864  1.00 0.00 ? 19 ARG A HE   10 
ATOM 11734 H HH11 . ARG A 1 19 ? -16.583 8.147   -3.137  1.00 0.00 ? 19 ARG A HH11 10 
ATOM 11735 H HH12 . ARG A 1 19 ? -15.251 7.981   -4.233  1.00 0.00 ? 19 ARG A HH12 10 
ATOM 11736 H HH21 . ARG A 1 19 ? -16.876 5.688   -6.314  1.00 0.00 ? 19 ARG A HH21 10 
ATOM 11737 H HH22 . ARG A 1 19 ? -15.420 6.582   -6.040  1.00 0.00 ? 19 ARG A HH22 10 
ATOM 11738 N N    . SER A 1 20 ? -17.579 4.325   1.024   1.00 0.00 ? 20 SER A N    10 
ATOM 11739 C CA   . SER A 1 20 ? -16.432 3.495   1.371   1.00 0.00 ? 20 SER A CA   10 
ATOM 11740 C C    . SER A 1 20 ? -16.173 2.447   0.291   1.00 0.00 ? 20 SER A C    10 
ATOM 11741 O O    . SER A 1 20 ? -16.589 1.296   0.417   1.00 0.00 ? 20 SER A O    10 
ATOM 11742 C CB   . SER A 1 20 ? -16.660 2.808   2.719   1.00 0.00 ? 20 SER A CB   10 
ATOM 11743 O OG   . SER A 1 20 ? -15.429 2.493   3.346   1.00 0.00 ? 20 SER A OG   10 
ATOM 11744 H H    . SER A 1 20 ? -18.426 3.894   0.784   1.00 0.00 ? 20 SER A H    10 
ATOM 11745 H HA   . SER A 1 20 ? -15.568 4.138   1.446   1.00 0.00 ? 20 SER A HA   10 
ATOM 11746 H HB2  . SER A 1 20 ? -17.220 3.467   3.365   1.00 0.00 ? 20 SER A HB2  10 
ATOM 11747 H HB3  . SER A 1 20 ? -17.217 1.895   2.565   1.00 0.00 ? 20 SER A HB3  10 
ATOM 11748 H HG   . SER A 1 20 ? -15.372 2.950   4.188   1.00 0.00 ? 20 SER A HG   10 
ATOM 11749 N N    . ARG A 1 21 ? -15.484 2.857   -0.768  1.00 0.00 ? 21 ARG A N    10 
ATOM 11750 C CA   . ARG A 1 21 ? -15.171 1.956   -1.871  1.00 0.00 ? 21 ARG A CA   10 
ATOM 11751 C C    . ARG A 1 21 ? -14.600 0.639   -1.351  1.00 0.00 ? 21 ARG A C    10 
ATOM 11752 O O    . ARG A 1 21 ? -14.602 -0.372  -2.055  1.00 0.00 ? 21 ARG A O    10 
ATOM 11753 C CB   . ARG A 1 21 ? -14.175 2.613   -2.828  1.00 0.00 ? 21 ARG A CB   10 
ATOM 11754 C CG   . ARG A 1 21 ? -12.758 2.680   -2.282  1.00 0.00 ? 21 ARG A CG   10 
ATOM 11755 C CD   . ARG A 1 21 ? -12.520 3.965   -1.506  1.00 0.00 ? 21 ARG A CD   10 
ATOM 11756 N NE   . ARG A 1 21 ? -13.002 3.872   -0.130  1.00 0.00 ? 21 ARG A NE   10 
ATOM 11757 C CZ   . ARG A 1 21 ? -12.551 4.634   0.860   1.00 0.00 ? 21 ARG A CZ   10 
ATOM 11758 N NH1  . ARG A 1 21 ? -11.612 5.541   0.628   1.00 0.00 ? 21 ARG A NH1  10 
ATOM 11759 N NH2  . ARG A 1 21 ? -13.040 4.490   2.085   1.00 0.00 ? 21 ARG A NH2  10 
ATOM 11760 H H    . ARG A 1 21 ? -15.179 3.788   -0.811  1.00 0.00 ? 21 ARG A H    10 
ATOM 11761 H HA   . ARG A 1 21 ? -16.087 1.752   -2.403  1.00 0.00 ? 21 ARG A HA   10 
ATOM 11762 H HB2  . ARG A 1 21 ? -14.155 2.052   -3.751  1.00 0.00 ? 21 ARG A HB2  10 
ATOM 11763 H HB3  . ARG A 1 21 ? -14.505 3.620   -3.035  1.00 0.00 ? 21 ARG A HB3  10 
ATOM 11764 H HG2  . ARG A 1 21 ? -12.596 1.839   -1.623  1.00 0.00 ? 21 ARG A HG2  10 
ATOM 11765 H HG3  . ARG A 1 21 ? -12.062 2.632   -3.106  1.00 0.00 ? 21 ARG A HG3  10 
ATOM 11766 H HD2  . ARG A 1 21 ? -11.460 4.171   -1.492  1.00 0.00 ? 21 ARG A HD2  10 
ATOM 11767 H HD3  . ARG A 1 21 ? -13.035 4.772   -2.005  1.00 0.00 ? 21 ARG A HD3  10 
ATOM 11768 H HE   . ARG A 1 21 ? -13.696 3.208   0.063   1.00 0.00 ? 21 ARG A HE   10 
ATOM 11769 H HH11 . ARG A 1 21 ? -11.243 5.652   -0.294  1.00 0.00 ? 21 ARG A HH11 10 
ATOM 11770 H HH12 . ARG A 1 21 ? -11.275 6.114   1.376   1.00 0.00 ? 21 ARG A HH12 10 
ATOM 11771 H HH21 . ARG A 1 21 ? -13.748 3.807   2.263   1.00 0.00 ? 21 ARG A HH21 10 
ATOM 11772 H HH22 . ARG A 1 21 ? -12.700 5.063   2.830   1.00 0.00 ? 21 ARG A HH22 10 
ATOM 11773 N N    . THR A 1 22 ? -14.111 0.659   -0.115  1.00 0.00 ? 22 THR A N    10 
ATOM 11774 C CA   . THR A 1 22 ? -13.535 -0.531  0.498   1.00 0.00 ? 22 THR A CA   10 
ATOM 11775 C C    . THR A 1 22 ? -14.407 -1.037  1.642   1.00 0.00 ? 22 THR A C    10 
ATOM 11776 O O    . THR A 1 22 ? -15.331 -0.352  2.081   1.00 0.00 ? 22 THR A O    10 
ATOM 11777 C CB   . THR A 1 22 ? -12.116 -0.259  1.031   1.00 0.00 ? 22 THR A CB   10 
ATOM 11778 O OG1  . THR A 1 22 ? -12.120 0.909   1.860   1.00 0.00 ? 22 THR A OG1  10 
ATOM 11779 C CG2  . THR A 1 22 ? -11.135 -0.068  -0.116  1.00 0.00 ? 22 THR A CG2  10 
ATOM 11780 H H    . THR A 1 22 ? -14.137 1.495   0.395   1.00 0.00 ? 22 THR A H    10 
ATOM 11781 H HA   . THR A 1 22 ? -13.471 -1.299  -0.260  1.00 0.00 ? 22 THR A HA   10 
ATOM 11782 H HB   . THR A 1 22 ? -11.799 -1.108  1.619   1.00 0.00 ? 22 THR A HB   10 
ATOM 11783 H HG1  . THR A 1 22 ? -12.405 0.671   2.746   1.00 0.00 ? 22 THR A HG1  10 
ATOM 11784 H HG21 . THR A 1 22 ? -10.512 0.792   0.082   1.00 0.00 ? 22 THR A HG21 10 
ATOM 11785 H HG22 . THR A 1 22 ? -11.681 0.086   -1.035  1.00 0.00 ? 22 THR A HG22 10 
ATOM 11786 H HG23 . THR A 1 22 ? -10.515 -0.947  -0.209  1.00 0.00 ? 22 THR A HG23 10 
ATOM 11787 N N    . VAL A 1 23 ? -14.106 -2.239  2.122   1.00 0.00 ? 23 VAL A N    10 
ATOM 11788 C CA   . VAL A 1 23 ? -14.862 -2.836  3.217   1.00 0.00 ? 23 VAL A CA   10 
ATOM 11789 C C    . VAL A 1 23 ? -13.991 -3.006  4.457   1.00 0.00 ? 23 VAL A C    10 
ATOM 11790 O O    . VAL A 1 23 ? -14.117 -3.989  5.187   1.00 0.00 ? 23 VAL A O    10 
ATOM 11791 C CB   . VAL A 1 23 ? -15.441 -4.206  2.818   1.00 0.00 ? 23 VAL A CB   10 
ATOM 11792 C CG1  . VAL A 1 23 ? -16.373 -4.728  3.902   1.00 0.00 ? 23 VAL A CG1  10 
ATOM 11793 C CG2  . VAL A 1 23 ? -16.164 -4.110  1.483   1.00 0.00 ? 23 VAL A CG2  10 
ATOM 11794 H H    . VAL A 1 23 ? -13.358 -2.737  1.731   1.00 0.00 ? 23 VAL A H    10 
ATOM 11795 H HA   . VAL A 1 23 ? -15.684 -2.176  3.454   1.00 0.00 ? 23 VAL A HA   10 
ATOM 11796 H HB   . VAL A 1 23 ? -14.623 -4.903  2.712   1.00 0.00 ? 23 VAL A HB   10 
ATOM 11797 H HG11 . VAL A 1 23 ? -16.575 -3.940  4.613   1.00 0.00 ? 23 VAL A HG11 10 
ATOM 11798 H HG12 . VAL A 1 23 ? -17.299 -5.056  3.453   1.00 0.00 ? 23 VAL A HG12 10 
ATOM 11799 H HG13 . VAL A 1 23 ? -15.904 -5.558  4.409   1.00 0.00 ? 23 VAL A HG13 10 
ATOM 11800 H HG21 . VAL A 1 23 ? -15.828 -3.230  0.955   1.00 0.00 ? 23 VAL A HG21 10 
ATOM 11801 H HG22 . VAL A 1 23 ? -15.948 -4.988  0.892   1.00 0.00 ? 23 VAL A HG22 10 
ATOM 11802 H HG23 . VAL A 1 23 ? -17.228 -4.044  1.653   1.00 0.00 ? 23 VAL A HG23 10 
ATOM 11803 N N    . PHE A 1 24 ? -13.107 -2.042  4.689   1.00 0.00 ? 24 PHE A N    10 
ATOM 11804 C CA   . PHE A 1 24 ? -12.213 -2.084  5.841   1.00 0.00 ? 24 PHE A CA   10 
AT