data_2DMZ
# 
_entry.id   2DMZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2DMZ         pdb_00002dmz 10.2210/pdb2dmz/pdb 
RCSB  RCSB025605   ?            ?                   
WWPDB D_1000025605 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso003006830.6 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DMZ 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-24 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inoue, K.'                                              1 
'Nagashima, T.'                                          2 
'Hayashi, F.'                                            3 
'Yokoyama, S.'                                           4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the third PDZ domain of human InaD-like protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Inoue, K.'     1 ? 
primary 'Nagashima, T.' 2 ? 
primary 'Hayashi, F.'   3 ? 
primary 'Yokoyama, S.'  4 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'InaD-like protein' 
_entity.formula_weight             13306.592 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              I53V 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Inadl protein, hINADL, Pals1-associated tight junction protein, Protein associated to tight junctions' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGGSDSSLFETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSVIPGSAAYHNGHIQVNDKIVAVDGVNIQ
GFANHDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPPSDRGTVSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGGSDSSLFETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSVIPGSAAYHNGHIQVNDKIVAVDGVNIQ
GFANHDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPPSDRGTVSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso003006830.6 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   GLY n 
1 9   SER n 
1 10  ASP n 
1 11  SER n 
1 12  SER n 
1 13  LEU n 
1 14  PHE n 
1 15  GLU n 
1 16  THR n 
1 17  TYR n 
1 18  ASN n 
1 19  VAL n 
1 20  GLU n 
1 21  LEU n 
1 22  VAL n 
1 23  ARG n 
1 24  LYS n 
1 25  ASP n 
1 26  GLY n 
1 27  GLN n 
1 28  SER n 
1 29  LEU n 
1 30  GLY n 
1 31  ILE n 
1 32  ARG n 
1 33  ILE n 
1 34  VAL n 
1 35  GLY n 
1 36  TYR n 
1 37  VAL n 
1 38  GLY n 
1 39  THR n 
1 40  SER n 
1 41  HIS n 
1 42  THR n 
1 43  GLY n 
1 44  GLU n 
1 45  ALA n 
1 46  SER n 
1 47  GLY n 
1 48  ILE n 
1 49  TYR n 
1 50  VAL n 
1 51  LYS n 
1 52  SER n 
1 53  VAL n 
1 54  ILE n 
1 55  PRO n 
1 56  GLY n 
1 57  SER n 
1 58  ALA n 
1 59  ALA n 
1 60  TYR n 
1 61  HIS n 
1 62  ASN n 
1 63  GLY n 
1 64  HIS n 
1 65  ILE n 
1 66  GLN n 
1 67  VAL n 
1 68  ASN n 
1 69  ASP n 
1 70  LYS n 
1 71  ILE n 
1 72  VAL n 
1 73  ALA n 
1 74  VAL n 
1 75  ASP n 
1 76  GLY n 
1 77  VAL n 
1 78  ASN n 
1 79  ILE n 
1 80  GLN n 
1 81  GLY n 
1 82  PHE n 
1 83  ALA n 
1 84  ASN n 
1 85  HIS n 
1 86  ASP n 
1 87  VAL n 
1 88  VAL n 
1 89  GLU n 
1 90  VAL n 
1 91  LEU n 
1 92  ARG n 
1 93  ASN n 
1 94  ALA n 
1 95  GLY n 
1 96  GLN n 
1 97  VAL n 
1 98  VAL n 
1 99  HIS n 
1 100 LEU n 
1 101 THR n 
1 102 LEU n 
1 103 VAL n 
1 104 ARG n 
1 105 ARG n 
1 106 LYS n 
1 107 THR n 
1 108 SER n 
1 109 SER n 
1 110 SER n 
1 111 THR n 
1 112 SER n 
1 113 PRO n 
1 114 LEU n 
1 115 GLU n 
1 116 PRO n 
1 117 PRO n 
1 118 SER n 
1 119 ASP n 
1 120 ARG n 
1 121 GLY n 
1 122 THR n 
1 123 VAL n 
1 124 SER n 
1 125 GLY n 
1 126 PRO n 
1 127 SER n 
1 128 SER n 
1 129 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'INADL, PATJ' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell free synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050627-17 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    INADL_HUMAN 
_struct_ref.pdbx_db_accession          Q8NI35 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           355 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DMZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 123 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8NI35 
_struct_ref_seq.db_align_beg                  355 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  470 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       123 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DMZ GLY A 1   ? UNP Q8NI35 ?   ?   'cloning artifact'    1   1  
1 2DMZ SER A 2   ? UNP Q8NI35 ?   ?   'cloning artifact'    2   2  
1 2DMZ SER A 3   ? UNP Q8NI35 ?   ?   'cloning artifact'    3   3  
1 2DMZ GLY A 4   ? UNP Q8NI35 ?   ?   'cloning artifact'    4   4  
1 2DMZ SER A 5   ? UNP Q8NI35 ?   ?   'cloning artifact'    5   5  
1 2DMZ SER A 6   ? UNP Q8NI35 ?   ?   'cloning artifact'    6   6  
1 2DMZ GLY A 7   ? UNP Q8NI35 ?   ?   'cloning artifact'    7   7  
1 2DMZ VAL A 53  ? UNP Q8NI35 ILE 400 'engineered mutation' 53  8  
1 2DMZ SER A 124 ? UNP Q8NI35 ?   ?   'cloning artifact'    124 9  
1 2DMZ GLY A 125 ? UNP Q8NI35 ?   ?   'cloning artifact'    125 10 
1 2DMZ PRO A 126 ? UNP Q8NI35 ?   ?   'cloning artifact'    126 11 
1 2DMZ SER A 127 ? UNP Q8NI35 ?   ?   'cloning artifact'    127 12 
1 2DMZ SER A 128 ? UNP Q8NI35 ?   ?   'cloning artifact'    128 13 
1 2DMZ GLY A 129 ? UNP Q8NI35 ?   ?   'cloning artifact'    129 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.26mM U-15N,13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 800 ? 
2 INOVA Varian 900 ? 
# 
_pdbx_nmr_refine.entry_id           2DMZ 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2DMZ 
_pdbx_nmr_details.text       'spectrometer_id 1 for 3D_15N_separated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY' 
# 
_pdbx_nmr_ensemble.entry_id                                      2DMZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function,structures with the lowest energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DMZ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      KUJIRA  0.93191  'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2DMZ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DMZ 
_struct.title                     'Solution structure of the third PDZ domain of human InaD-like protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DMZ 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;PDZ domain, InaD-like protein, Inadl protein, hINADL, Pals1-associated tight junction protein, Protein associated to tight junctions, INADL, PATJ, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 57 ? GLY A 63 ? SER A 57 GLY A 63 1 ? 7  
HELX_P HELX_P2 2 ALA A 83 ? ALA A 94 ? ALA A 83 ALA A 94 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 14 ? LEU A 21  ? PHE A 14 LEU A 21  
A 2 VAL A 98 ? ARG A 105 ? VAL A 98 ARG A 105 
A 3 ILE A 71 ? VAL A 74  ? ILE A 71 VAL A 74  
B 1 ILE A 31 ? TYR A 36  ? ILE A 31 TYR A 36  
B 2 GLY A 47 ? VAL A 53  ? GLY A 47 VAL A 53  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 19  ? N VAL A 19  O LEU A 100 ? O LEU A 100 
A 2 3 O THR A 101 ? O THR A 101 N ALA A 73  ? N ALA A 73  
B 1 2 N ARG A 32  ? N ARG A 32  O SER A 52  ? O SER A 52  
# 
_database_PDB_matrix.entry_id          2DMZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DMZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -22.684 20.011  -25.745 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -21.925 18.785  -25.912 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -22.416 17.671  -25.009 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -23.406 17.833  -24.295 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -23.599 20.069  -26.092 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -22.004 18.463  -26.940 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -20.888 18.985  -25.687 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -21.724 16.537  -25.041 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -22.099 15.389  -24.223 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -20.886 14.827  -23.488 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -19.761 15.290  -23.679 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -22.732 14.302  -25.093 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -21.846 13.889  -26.119 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -20.944 16.470  -25.632 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -22.823 15.724  -23.496 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -22.973 13.448  -24.478 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -23.634 14.686  -25.546 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -21.430 14.660  -26.512 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -21.123 13.826  -22.647 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -20.052 13.202  -21.879 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -19.733 11.812  -22.423 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -20.602 11.130  -22.964 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -20.442 13.108  -20.403 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -20.379 14.377  -19.777 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -22.042 13.501  -22.538 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -19.173 13.822  -21.972 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -21.450 12.730  -20.323 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -19.764 12.435  -19.897 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -19.916 14.994  -20.349 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -18.478 11.400  -22.274 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -18.064 10.094  -22.754 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -17.089 9.413   -21.815 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -17.276 9.427   -20.598 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -17.827 11.986  -21.834 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -18.938 9.470   -22.864 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -17.594 10.211  -23.720 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -16.046 8.814   -22.380 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -15.040 8.119   -21.585 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -15.674 7.456   -20.366 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -15.169 7.573   -19.249 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -13.948 9.094   -21.140 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -14.450 10.025  -20.196 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -15.952 8.837   -23.356 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -14.596 7.355   -22.206 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -13.139 8.542   -20.687 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -13.580 9.634   -22.000 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -15.400 10.113  -20.307 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -16.784 6.760   -20.589 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -17.490 6.081   -19.509 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -17.718 4.611   -19.848 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -18.440 4.284   -20.789 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -18.831 6.767   -19.238 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -19.795 6.406   -20.212 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -17.138 6.704   -21.502 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -16.878 6.143   -18.622 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -19.192 6.472   -18.264 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -18.695 7.838   -19.262 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -19.802 7.061   -20.913 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -17.094 3.728   -19.074 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -17.240 2.303   -19.308 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -16.186 1.759   -20.251 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -15.549 2.515   -20.984 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -16.531 4.047   -18.339 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -17.166 1.785   -18.364 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -18.216 2.118   -19.732 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . GLY A 1 8   ? -16.000 0.443   -20.233 1.00 0.00 ? 8   GLY A N    1  
ATOM 67    C CA   . GLY A 1 8   ? -15.013 -0.179  -21.096 1.00 0.00 ? 8   GLY A CA   1  
ATOM 68    C C    . GLY A 1 8   ? -14.526 -1.509  -20.557 1.00 0.00 ? 8   GLY A C    1  
ATOM 69    O O    . GLY A 1 8   ? -14.596 -1.762  -19.354 1.00 0.00 ? 8   GLY A O    1  
ATOM 70    H H    . GLY A 1 8   ? -16.537 -0.111  -19.628 1.00 0.00 ? 8   GLY A H    1  
ATOM 71    H HA2  . GLY A 1 8   ? -15.450 -0.336  -22.071 1.00 0.00 ? 8   GLY A HA2  1  
ATOM 72    H HA3  . GLY A 1 8   ? -14.167 0.487   -21.195 1.00 0.00 ? 8   GLY A HA3  1  
ATOM 73    N N    . SER A 1 9   ? -14.033 -2.363  -21.448 1.00 0.00 ? 9   SER A N    1  
ATOM 74    C CA   . SER A 1 9   ? -13.538 -3.677  -21.055 1.00 0.00 ? 9   SER A CA   1  
ATOM 75    C C    . SER A 1 9   ? -12.872 -3.619  -19.684 1.00 0.00 ? 9   SER A C    1  
ATOM 76    O O    . SER A 1 9   ? -12.076 -2.722  -19.406 1.00 0.00 ? 9   SER A O    1  
ATOM 77    C CB   . SER A 1 9   ? -12.547 -4.204  -22.095 1.00 0.00 ? 9   SER A CB   1  
ATOM 78    O OG   . SER A 1 9   ? -13.204 -4.527  -23.308 1.00 0.00 ? 9   SER A OG   1  
ATOM 79    H H    . SER A 1 9   ? -14.004 -2.103  -22.393 1.00 0.00 ? 9   SER A H    1  
ATOM 80    H HA   . SER A 1 9   ? -14.383 -4.348  -21.004 1.00 0.00 ? 9   SER A HA   1  
ATOM 81    H HB2  . SER A 1 9   ? -11.802 -3.448  -22.293 1.00 0.00 ? 9   SER A HB2  1  
ATOM 82    H HB3  . SER A 1 9   ? -12.066 -5.092  -21.712 1.00 0.00 ? 9   SER A HB3  1  
ATOM 83    H HG   . SER A 1 9   ? -13.787 -3.807  -23.559 1.00 0.00 ? 9   SER A HG   1  
ATOM 84    N N    . ASP A 1 10  ? -13.203 -4.583  -18.832 1.00 0.00 ? 10  ASP A N    1  
ATOM 85    C CA   . ASP A 1 10  ? -12.637 -4.644  -17.489 1.00 0.00 ? 10  ASP A CA   1  
ATOM 86    C C    . ASP A 1 10  ? -11.272 -5.325  -17.505 1.00 0.00 ? 10  ASP A C    1  
ATOM 87    O O    . ASP A 1 10  ? -10.972 -6.158  -16.650 1.00 0.00 ? 10  ASP A O    1  
ATOM 88    C CB   . ASP A 1 10  ? -13.582 -5.391  -16.547 1.00 0.00 ? 10  ASP A CB   1  
ATOM 89    C CG   . ASP A 1 10  ? -13.869 -6.804  -17.016 1.00 0.00 ? 10  ASP A CG   1  
ATOM 90    O OD1  . ASP A 1 10  ? -13.852 -7.037  -18.243 1.00 0.00 ? 10  ASP A OD1  1  
ATOM 91    O OD2  . ASP A 1 10  ? -14.110 -7.677  -16.156 1.00 0.00 ? 10  ASP A OD2  1  
ATOM 92    H H    . ASP A 1 10  ? -13.843 -5.270  -19.112 1.00 0.00 ? 10  ASP A H    1  
ATOM 93    H HA   . ASP A 1 10  ? -12.516 -3.632  -17.134 1.00 0.00 ? 10  ASP A HA   1  
ATOM 94    H HB2  . ASP A 1 10  ? -13.135 -5.442  -15.565 1.00 0.00 ? 10  ASP A HB2  1  
ATOM 95    H HB3  . ASP A 1 10  ? -14.517 -4.854  -16.486 1.00 0.00 ? 10  ASP A HB3  1  
ATOM 96    N N    . SER A 1 11  ? -10.448 -4.965  -18.485 1.00 0.00 ? 11  SER A N    1  
ATOM 97    C CA   . SER A 1 11  ? -9.117  -5.545  -18.616 1.00 0.00 ? 11  SER A CA   1  
ATOM 98    C C    . SER A 1 11  ? -8.131  -4.858  -17.675 1.00 0.00 ? 11  SER A C    1  
ATOM 99    O O    . SER A 1 11  ? -7.559  -5.491  -16.788 1.00 0.00 ? 11  SER A O    1  
ATOM 100   C CB   . SER A 1 11  ? -8.627  -5.429  -20.060 1.00 0.00 ? 11  SER A CB   1  
ATOM 101   O OG   . SER A 1 11  ? -7.736  -6.483  -20.383 1.00 0.00 ? 11  SER A OG   1  
ATOM 102   H H    . SER A 1 11  ? -10.745 -4.295  -19.136 1.00 0.00 ? 11  SER A H    1  
ATOM 103   H HA   . SER A 1 11  ? -9.182  -6.589  -18.350 1.00 0.00 ? 11  SER A HA   1  
ATOM 104   H HB2  . SER A 1 11  ? -9.472  -5.471  -20.729 1.00 0.00 ? 11  SER A HB2  1  
ATOM 105   H HB3  . SER A 1 11  ? -8.113  -4.487  -20.188 1.00 0.00 ? 11  SER A HB3  1  
ATOM 106   H HG   . SER A 1 11  ? -7.819  -7.183  -19.731 1.00 0.00 ? 11  SER A HG   1  
ATOM 107   N N    . SER A 1 12  ? -7.936  -3.559  -17.878 1.00 0.00 ? 12  SER A N    1  
ATOM 108   C CA   . SER A 1 12  ? -7.017  -2.786  -17.051 1.00 0.00 ? 12  SER A CA   1  
ATOM 109   C C    . SER A 1 12  ? -7.780  -1.911  -16.061 1.00 0.00 ? 12  SER A C    1  
ATOM 110   O O    . SER A 1 12  ? -7.893  -0.699  -16.243 1.00 0.00 ? 12  SER A O    1  
ATOM 111   C CB   . SER A 1 12  ? -6.118  -1.914  -17.930 1.00 0.00 ? 12  SER A CB   1  
ATOM 112   O OG   . SER A 1 12  ? -5.501  -2.683  -18.948 1.00 0.00 ? 12  SER A OG   1  
ATOM 113   H H    . SER A 1 12  ? -8.422  -3.110  -18.602 1.00 0.00 ? 12  SER A H    1  
ATOM 114   H HA   . SER A 1 12  ? -6.402  -3.481  -16.500 1.00 0.00 ? 12  SER A HA   1  
ATOM 115   H HB2  . SER A 1 12  ? -6.711  -1.139  -18.391 1.00 0.00 ? 12  SER A HB2  1  
ATOM 116   H HB3  . SER A 1 12  ? -5.349  -1.464  -17.319 1.00 0.00 ? 12  SER A HB3  1  
ATOM 117   H HG   . SER A 1 12  ? -4.574  -2.812  -18.734 1.00 0.00 ? 12  SER A HG   1  
ATOM 118   N N    . LEU A 1 13  ? -8.304  -2.536  -15.012 1.00 0.00 ? 13  LEU A N    1  
ATOM 119   C CA   . LEU A 1 13  ? -9.057  -1.817  -13.990 1.00 0.00 ? 13  LEU A CA   1  
ATOM 120   C C    . LEU A 1 13  ? -8.202  -0.729  -13.348 1.00 0.00 ? 13  LEU A C    1  
ATOM 121   O O    . LEU A 1 13  ? -8.692  0.358   -13.038 1.00 0.00 ? 13  LEU A O    1  
ATOM 122   C CB   . LEU A 1 13  ? -9.557  -2.787  -12.919 1.00 0.00 ? 13  LEU A CB   1  
ATOM 123   C CG   . LEU A 1 13  ? -10.746 -3.665  -13.311 1.00 0.00 ? 13  LEU A CG   1  
ATOM 124   C CD1  . LEU A 1 13  ? -11.943 -2.805  -13.686 1.00 0.00 ? 13  LEU A CD1  1  
ATOM 125   C CD2  . LEU A 1 13  ? -10.371 -4.591  -14.459 1.00 0.00 ? 13  LEU A CD2  1  
ATOM 126   H H    . LEU A 1 13  ? -8.181  -3.504  -14.920 1.00 0.00 ? 13  LEU A H    1  
ATOM 127   H HA   . LEU A 1 13  ? -9.907  -1.354  -14.470 1.00 0.00 ? 13  LEU A HA   1  
ATOM 128   H HB2  . LEU A 1 13  ? -8.738  -3.439  -12.655 1.00 0.00 ? 13  LEU A HB2  1  
ATOM 129   H HB3  . LEU A 1 13  ? -9.845  -2.205  -12.055 1.00 0.00 ? 13  LEU A HB3  1  
ATOM 130   H HG   . LEU A 1 13  ? -11.028 -4.277  -12.465 1.00 0.00 ? 13  LEU A HG   1  
ATOM 131   H HD11 . LEU A 1 13  ? -12.806 -3.123  -13.121 1.00 0.00 ? 13  LEU A HD11 1  
ATOM 132   H HD12 . LEU A 1 13  ? -12.145 -2.912  -14.742 1.00 0.00 ? 13  LEU A HD12 1  
ATOM 133   H HD13 . LEU A 1 13  ? -11.727 -1.771  -13.464 1.00 0.00 ? 13  LEU A HD13 1  
ATOM 134   H HD21 . LEU A 1 13  ? -11.179 -5.282  -14.642 1.00 0.00 ? 13  LEU A HD21 1  
ATOM 135   H HD22 . LEU A 1 13  ? -9.478  -5.141  -14.199 1.00 0.00 ? 13  LEU A HD22 1  
ATOM 136   H HD23 . LEU A 1 13  ? -10.188 -4.006  -15.348 1.00 0.00 ? 13  LEU A HD23 1  
ATOM 137   N N    . PHE A 1 14  ? -6.922  -1.027  -13.153 1.00 0.00 ? 14  PHE A N    1  
ATOM 138   C CA   . PHE A 1 14  ? -5.999  -0.074  -12.549 1.00 0.00 ? 14  PHE A CA   1  
ATOM 139   C C    . PHE A 1 14  ? -5.147  0.609   -13.615 1.00 0.00 ? 14  PHE A C    1  
ATOM 140   O O    . PHE A 1 14  ? -5.177  0.228   -14.785 1.00 0.00 ? 14  PHE A O    1  
ATOM 141   C CB   . PHE A 1 14  ? -5.096  -0.779  -11.534 1.00 0.00 ? 14  PHE A CB   1  
ATOM 142   C CG   . PHE A 1 14  ? -5.811  -1.813  -10.712 1.00 0.00 ? 14  PHE A CG   1  
ATOM 143   C CD1  . PHE A 1 14  ? -6.061  -3.075  -11.227 1.00 0.00 ? 14  PHE A CD1  1  
ATOM 144   C CD2  . PHE A 1 14  ? -6.233  -1.523  -9.425  1.00 0.00 ? 14  PHE A CD2  1  
ATOM 145   C CE1  . PHE A 1 14  ? -6.720  -4.028  -10.473 1.00 0.00 ? 14  PHE A CE1  1  
ATOM 146   C CE2  . PHE A 1 14  ? -6.892  -2.472  -8.666  1.00 0.00 ? 14  PHE A CE2  1  
ATOM 147   C CZ   . PHE A 1 14  ? -7.135  -3.726  -9.191  1.00 0.00 ? 14  PHE A CZ   1  
ATOM 148   H H    . PHE A 1 14  ? -6.591  -1.910  -13.421 1.00 0.00 ? 14  PHE A H    1  
ATOM 149   H HA   . PHE A 1 14  ? -6.584  0.675   -12.038 1.00 0.00 ? 14  PHE A HA   1  
ATOM 150   H HB2  . PHE A 1 14  ? -4.292  -1.272  -12.060 1.00 0.00 ? 14  PHE A HB2  1  
ATOM 151   H HB3  . PHE A 1 14  ? -4.683  -0.045  -10.860 1.00 0.00 ? 14  PHE A HB3  1  
ATOM 152   H HD1  . PHE A 1 14  ? -5.737  -3.313  -12.229 1.00 0.00 ? 14  PHE A HD1  1  
ATOM 153   H HD2  . PHE A 1 14  ? -6.044  -0.542  -9.013  1.00 0.00 ? 14  PHE A HD2  1  
ATOM 154   H HE1  . PHE A 1 14  ? -6.908  -5.008  -10.886 1.00 0.00 ? 14  PHE A HE1  1  
ATOM 155   H HE2  . PHE A 1 14  ? -7.215  -2.233  -7.664  1.00 0.00 ? 14  PHE A HE2  1  
ATOM 156   H HZ   . PHE A 1 14  ? -7.650  -4.469  -8.600  1.00 0.00 ? 14  PHE A HZ   1  
ATOM 157   N N    . GLU A 1 15  ? -4.390  1.620   -13.201 1.00 0.00 ? 15  GLU A N    1  
ATOM 158   C CA   . GLU A 1 15  ? -3.532  2.358   -14.121 1.00 0.00 ? 15  GLU A CA   1  
ATOM 159   C C    . GLU A 1 15  ? -2.115  2.473   -13.568 1.00 0.00 ? 15  GLU A C    1  
ATOM 160   O O    . GLU A 1 15  ? -1.914  2.869   -12.420 1.00 0.00 ? 15  GLU A O    1  
ATOM 161   C CB   . GLU A 1 15  ? -4.105  3.752   -14.382 1.00 0.00 ? 15  GLU A CB   1  
ATOM 162   C CG   . GLU A 1 15  ? -4.342  4.559   -13.117 1.00 0.00 ? 15  GLU A CG   1  
ATOM 163   C CD   . GLU A 1 15  ? -4.220  6.053   -13.347 1.00 0.00 ? 15  GLU A CD   1  
ATOM 164   O OE1  . GLU A 1 15  ? -5.177  6.650   -13.885 1.00 0.00 ? 15  GLU A OE1  1  
ATOM 165   O OE2  . GLU A 1 15  ? -3.170  6.626   -12.989 1.00 0.00 ? 15  GLU A OE2  1  
ATOM 166   H H    . GLU A 1 15  ? -4.410  1.877   -12.256 1.00 0.00 ? 15  GLU A H    1  
ATOM 167   H HA   . GLU A 1 15  ? -3.499  1.812   -15.053 1.00 0.00 ? 15  GLU A HA   1  
ATOM 168   H HB2  . GLU A 1 15  ? -3.418  4.299   -15.011 1.00 0.00 ? 15  GLU A HB2  1  
ATOM 169   H HB3  . GLU A 1 15  ? -5.048  3.649   -14.899 1.00 0.00 ? 15  GLU A HB3  1  
ATOM 170   H HG2  . GLU A 1 15  ? -5.334  4.347   -12.750 1.00 0.00 ? 15  GLU A HG2  1  
ATOM 171   H HG3  . GLU A 1 15  ? -3.614  4.264   -12.375 1.00 0.00 ? 15  GLU A HG3  1  
ATOM 172   N N    . THR A 1 16  ? -1.133  2.125   -14.395 1.00 0.00 ? 16  THR A N    1  
ATOM 173   C CA   . THR A 1 16  ? 0.265   2.187   -13.989 1.00 0.00 ? 16  THR A CA   1  
ATOM 174   C C    . THR A 1 16  ? 0.901   3.509   -14.408 1.00 0.00 ? 16  THR A C    1  
ATOM 175   O O    . THR A 1 16  ? 0.579   4.056   -15.463 1.00 0.00 ? 16  THR A O    1  
ATOM 176   C CB   . THR A 1 16  ? 1.078   1.026   -14.593 1.00 0.00 ? 16  THR A CB   1  
ATOM 177   O OG1  . THR A 1 16  ? 0.545   -0.227  -14.150 1.00 0.00 ? 16  THR A OG1  1  
ATOM 178   C CG2  . THR A 1 16  ? 2.543   1.128   -14.197 1.00 0.00 ? 16  THR A CG2  1  
ATOM 179   H H    . THR A 1 16  ? -1.357  1.818   -15.298 1.00 0.00 ? 16  THR A H    1  
ATOM 180   H HA   . THR A 1 16  ? 0.305   2.105   -12.913 1.00 0.00 ? 16  THR A HA   1  
ATOM 181   H HB   . THR A 1 16  ? 1.007   1.079   -15.670 1.00 0.00 ? 16  THR A HB   1  
ATOM 182   H HG1  . THR A 1 16  ? 0.904   -0.936  -14.689 1.00 0.00 ? 16  THR A HG1  1  
ATOM 183   H HG21 . THR A 1 16  ? 2.617   1.410   -13.157 1.00 0.00 ? 16  THR A HG21 1  
ATOM 184   H HG22 . THR A 1 16  ? 3.030   1.873   -14.808 1.00 0.00 ? 16  THR A HG22 1  
ATOM 185   H HG23 . THR A 1 16  ? 3.022   0.172   -14.345 1.00 0.00 ? 16  THR A HG23 1  
ATOM 186   N N    . TYR A 1 17  ? 1.804   4.015   -13.576 1.00 0.00 ? 17  TYR A N    1  
ATOM 187   C CA   . TYR A 1 17  ? 2.483   5.274   -13.860 1.00 0.00 ? 17  TYR A CA   1  
ATOM 188   C C    . TYR A 1 17  ? 3.897   5.270   -13.288 1.00 0.00 ? 17  TYR A C    1  
ATOM 189   O O    . TYR A 1 17  ? 4.158   4.662   -12.250 1.00 0.00 ? 17  TYR A O    1  
ATOM 190   C CB   . TYR A 1 17  ? 1.690   6.447   -13.282 1.00 0.00 ? 17  TYR A CB   1  
ATOM 191   C CG   . TYR A 1 17  ? 1.452   6.342   -11.792 1.00 0.00 ? 17  TYR A CG   1  
ATOM 192   C CD1  . TYR A 1 17  ? 0.395   5.594   -11.289 1.00 0.00 ? 17  TYR A CD1  1  
ATOM 193   C CD2  . TYR A 1 17  ? 2.284   6.991   -10.888 1.00 0.00 ? 17  TYR A CD2  1  
ATOM 194   C CE1  . TYR A 1 17  ? 0.173   5.496   -9.929  1.00 0.00 ? 17  TYR A CE1  1  
ATOM 195   C CE2  . TYR A 1 17  ? 2.071   6.897   -9.527  1.00 0.00 ? 17  TYR A CE2  1  
ATOM 196   C CZ   . TYR A 1 17  ? 1.014   6.148   -9.052  1.00 0.00 ? 17  TYR A CZ   1  
ATOM 197   O OH   . TYR A 1 17  ? 0.797   6.053   -7.696  1.00 0.00 ? 17  TYR A OH   1  
ATOM 198   H H    . TYR A 1 17  ? 2.018   3.532   -12.751 1.00 0.00 ? 17  TYR A H    1  
ATOM 199   H HA   . TYR A 1 17  ? 2.541   5.385   -14.933 1.00 0.00 ? 17  TYR A HA   1  
ATOM 200   H HB2  . TYR A 1 17  ? 2.229   7.363   -13.467 1.00 0.00 ? 17  TYR A HB2  1  
ATOM 201   H HB3  . TYR A 1 17  ? 0.727   6.497   -13.769 1.00 0.00 ? 17  TYR A HB3  1  
ATOM 202   H HD1  . TYR A 1 17  ? -0.262  5.084   -11.978 1.00 0.00 ? 17  TYR A HD1  1  
ATOM 203   H HD2  . TYR A 1 17  ? 3.111   7.577   -11.264 1.00 0.00 ? 17  TYR A HD2  1  
ATOM 204   H HE1  . TYR A 1 17  ? -0.654  4.909   -9.557  1.00 0.00 ? 17  TYR A HE1  1  
ATOM 205   H HE2  . TYR A 1 17  ? 2.729   7.408   -8.840  1.00 0.00 ? 17  TYR A HE2  1  
ATOM 206   H HH   . TYR A 1 17  ? 0.133   5.381   -7.525  1.00 0.00 ? 17  TYR A HH   1  
ATOM 207   N N    . ASN A 1 18  ? 4.807   5.955   -13.973 1.00 0.00 ? 18  ASN A N    1  
ATOM 208   C CA   . ASN A 1 18  ? 6.196   6.032   -13.534 1.00 0.00 ? 18  ASN A CA   1  
ATOM 209   C C    . ASN A 1 18  ? 6.458   7.335   -12.784 1.00 0.00 ? 18  ASN A C    1  
ATOM 210   O O    . ASN A 1 18  ? 5.982   8.399   -13.180 1.00 0.00 ? 18  ASN A O    1  
ATOM 211   C CB   . ASN A 1 18  ? 7.139   5.923   -14.734 1.00 0.00 ? 18  ASN A CB   1  
ATOM 212   C CG   . ASN A 1 18  ? 7.475   4.484   -15.076 1.00 0.00 ? 18  ASN A CG   1  
ATOM 213   O OD1  . ASN A 1 18  ? 8.610   4.042   -14.899 1.00 0.00 ? 18  ASN A OD1  1  
ATOM 214   N ND2  . ASN A 1 18  ? 6.487   3.747   -15.569 1.00 0.00 ? 18  ASN A ND2  1  
ATOM 215   H H    . ASN A 1 18  ? 4.539   6.420   -14.793 1.00 0.00 ? 18  ASN A H    1  
ATOM 216   H HA   . ASN A 1 18  ? 6.379   5.203   -12.867 1.00 0.00 ? 18  ASN A HA   1  
ATOM 217   H HB2  . ASN A 1 18  ? 6.670   6.377   -15.595 1.00 0.00 ? 18  ASN A HB2  1  
ATOM 218   H HB3  . ASN A 1 18  ? 8.057   6.446   -14.512 1.00 0.00 ? 18  ASN A HB3  1  
ATOM 219   H HD21 . ASN A 1 18  ? 5.609   4.166   -15.684 1.00 0.00 ? 18  ASN A HD21 1  
ATOM 220   H HD22 . ASN A 1 18  ? 6.677   2.813   -15.798 1.00 0.00 ? 18  ASN A HD22 1  
ATOM 221   N N    . VAL A 1 19  ? 7.220   7.243   -11.698 1.00 0.00 ? 19  VAL A N    1  
ATOM 222   C CA   . VAL A 1 19  ? 7.547   8.414   -10.894 1.00 0.00 ? 19  VAL A CA   1  
ATOM 223   C C    . VAL A 1 19  ? 9.056   8.584   -10.760 1.00 0.00 ? 19  VAL A C    1  
ATOM 224   O O    . VAL A 1 19  ? 9.732   7.756   -10.150 1.00 0.00 ? 19  VAL A O    1  
ATOM 225   C CB   . VAL A 1 19  ? 6.925   8.321   -9.487  1.00 0.00 ? 19  VAL A CB   1  
ATOM 226   C CG1  . VAL A 1 19  ? 6.832   9.699   -8.852  1.00 0.00 ? 19  VAL A CG1  1  
ATOM 227   C CG2  . VAL A 1 19  ? 5.556   7.661   -9.554  1.00 0.00 ? 19  VAL A CG2  1  
ATOM 228   H H    . VAL A 1 19  ? 7.570   6.368   -11.433 1.00 0.00 ? 19  VAL A H    1  
ATOM 229   H HA   . VAL A 1 19  ? 7.139   9.284   -11.388 1.00 0.00 ? 19  VAL A HA   1  
ATOM 230   H HB   . VAL A 1 19  ? 7.568   7.708   -8.872  1.00 0.00 ? 19  VAL A HB   1  
ATOM 231   H HG11 . VAL A 1 19  ? 7.629   10.323  -9.228  1.00 0.00 ? 19  VAL A HG11 1  
ATOM 232   H HG12 . VAL A 1 19  ? 5.878   10.145  -9.097  1.00 0.00 ? 19  VAL A HG12 1  
ATOM 233   H HG13 . VAL A 1 19  ? 6.922   9.608   -7.780  1.00 0.00 ? 19  VAL A HG13 1  
ATOM 234   H HG21 . VAL A 1 19  ? 4.841   8.262   -9.013  1.00 0.00 ? 19  VAL A HG21 1  
ATOM 235   H HG22 . VAL A 1 19  ? 5.247   7.575   -10.586 1.00 0.00 ? 19  VAL A HG22 1  
ATOM 236   H HG23 . VAL A 1 19  ? 5.608   6.677   -9.111  1.00 0.00 ? 19  VAL A HG23 1  
ATOM 237   N N    . GLU A 1 20  ? 9.578   9.664   -11.333 1.00 0.00 ? 20  GLU A N    1  
ATOM 238   C CA   . GLU A 1 20  ? 11.008  9.943   -11.277 1.00 0.00 ? 20  GLU A CA   1  
ATOM 239   C C    . GLU A 1 20  ? 11.356  10.757  -10.034 1.00 0.00 ? 20  GLU A C    1  
ATOM 240   O O    . GLU A 1 20  ? 11.214  11.981  -10.020 1.00 0.00 ? 20  GLU A O    1  
ATOM 241   C CB   . GLU A 1 20  ? 11.454  10.694  -12.534 1.00 0.00 ? 20  GLU A CB   1  
ATOM 242   C CG   . GLU A 1 20  ? 12.937  11.021  -12.554 1.00 0.00 ? 20  GLU A CG   1  
ATOM 243   C CD   . GLU A 1 20  ? 13.245  12.291  -13.323 1.00 0.00 ? 20  GLU A CD   1  
ATOM 244   O OE1  . GLU A 1 20  ? 12.480  12.621  -14.254 1.00 0.00 ? 20  GLU A OE1  1  
ATOM 245   O OE2  . GLU A 1 20  ? 14.250  12.955  -12.993 1.00 0.00 ? 20  GLU A OE2  1  
ATOM 246   H H    . GLU A 1 20  ? 8.987   10.288  -11.804 1.00 0.00 ? 20  GLU A H    1  
ATOM 247   H HA   . GLU A 1 20  ? 11.528  8.998   -11.231 1.00 0.00 ? 20  GLU A HA   1  
ATOM 248   H HB2  . GLU A 1 20  ? 11.227  10.089  -13.399 1.00 0.00 ? 20  GLU A HB2  1  
ATOM 249   H HB3  . GLU A 1 20  ? 10.902  11.620  -12.599 1.00 0.00 ? 20  GLU A HB3  1  
ATOM 250   H HG2  . GLU A 1 20  ? 13.280  11.142  -11.537 1.00 0.00 ? 20  GLU A HG2  1  
ATOM 251   H HG3  . GLU A 1 20  ? 13.467  10.201  -13.015 1.00 0.00 ? 20  GLU A HG3  1  
ATOM 252   N N    . LEU A 1 21  ? 11.812  10.070  -8.993  1.00 0.00 ? 21  LEU A N    1  
ATOM 253   C CA   . LEU A 1 21  ? 12.180  10.728  -7.744  1.00 0.00 ? 21  LEU A CA   1  
ATOM 254   C C    . LEU A 1 21  ? 13.619  11.232  -7.797  1.00 0.00 ? 21  LEU A C    1  
ATOM 255   O O    . LEU A 1 21  ? 14.475  10.629  -8.446  1.00 0.00 ? 21  LEU A O    1  
ATOM 256   C CB   . LEU A 1 21  ? 12.008  9.766   -6.567  1.00 0.00 ? 21  LEU A CB   1  
ATOM 257   C CG   . LEU A 1 21  ? 10.619  9.148   -6.404  1.00 0.00 ? 21  LEU A CG   1  
ATOM 258   C CD1  . LEU A 1 21  ? 10.631  8.090   -5.311  1.00 0.00 ? 21  LEU A CD1  1  
ATOM 259   C CD2  . LEU A 1 21  ? 9.588   10.224  -6.097  1.00 0.00 ? 21  LEU A CD2  1  
ATOM 260   H H    . LEU A 1 21  ? 11.903  9.097   -9.064  1.00 0.00 ? 21  LEU A H    1  
ATOM 261   H HA   . LEU A 1 21  ? 11.521  11.573  -7.608  1.00 0.00 ? 21  LEU A HA   1  
ATOM 262   H HB2  . LEU A 1 21  ? 12.715  8.961   -6.692  1.00 0.00 ? 21  LEU A HB2  1  
ATOM 263   H HB3  . LEU A 1 21  ? 12.238  10.309  -5.661  1.00 0.00 ? 21  LEU A HB3  1  
ATOM 264   H HG   . LEU A 1 21  ? 10.335  8.666   -7.330  1.00 0.00 ? 21  LEU A HG   1  
ATOM 265   H HD11 . LEU A 1 21  ? 10.194  8.498   -4.412  1.00 0.00 ? 21  LEU A HD11 1  
ATOM 266   H HD12 . LEU A 1 21  ? 11.648  7.789   -5.113  1.00 0.00 ? 21  LEU A HD12 1  
ATOM 267   H HD13 . LEU A 1 21  ? 10.058  7.233   -5.633  1.00 0.00 ? 21  LEU A HD13 1  
ATOM 268   H HD21 . LEU A 1 21  ? 8.717   10.075  -6.717  1.00 0.00 ? 21  LEU A HD21 1  
ATOM 269   H HD22 . LEU A 1 21  ? 10.012  11.197  -6.300  1.00 0.00 ? 21  LEU A HD22 1  
ATOM 270   H HD23 . LEU A 1 21  ? 9.305   10.164  -5.056  1.00 0.00 ? 21  LEU A HD23 1  
ATOM 271   N N    . VAL A 1 22  ? 13.879  12.339  -7.110  1.00 0.00 ? 22  VAL A N    1  
ATOM 272   C CA   . VAL A 1 22  ? 15.215  12.922  -7.076  1.00 0.00 ? 22  VAL A CA   1  
ATOM 273   C C    . VAL A 1 22  ? 15.836  12.792  -5.690  1.00 0.00 ? 22  VAL A C    1  
ATOM 274   O O    . VAL A 1 22  ? 15.186  13.058  -4.679  1.00 0.00 ? 22  VAL A O    1  
ATOM 275   C CB   . VAL A 1 22  ? 15.189  14.409  -7.477  1.00 0.00 ? 22  VAL A CB   1  
ATOM 276   C CG1  . VAL A 1 22  ? 14.455  15.232  -6.430  1.00 0.00 ? 22  VAL A CG1  1  
ATOM 277   C CG2  . VAL A 1 22  ? 16.604  14.930  -7.681  1.00 0.00 ? 22  VAL A CG2  1  
ATOM 278   H H    . VAL A 1 22  ? 13.155  12.774  -6.613  1.00 0.00 ? 22  VAL A H    1  
ATOM 279   H HA   . VAL A 1 22  ? 15.830  12.389  -7.787  1.00 0.00 ? 22  VAL A HA   1  
ATOM 280   H HB   . VAL A 1 22  ? 14.656  14.499  -8.413  1.00 0.00 ? 22  VAL A HB   1  
ATOM 281   H HG11 . VAL A 1 22  ? 15.073  15.327  -5.549  1.00 0.00 ? 22  VAL A HG11 1  
ATOM 282   H HG12 . VAL A 1 22  ? 14.239  16.213  -6.828  1.00 0.00 ? 22  VAL A HG12 1  
ATOM 283   H HG13 . VAL A 1 22  ? 13.530  14.738  -6.168  1.00 0.00 ? 22  VAL A HG13 1  
ATOM 284   H HG21 . VAL A 1 22  ? 17.026  15.206  -6.727  1.00 0.00 ? 22  VAL A HG21 1  
ATOM 285   H HG22 . VAL A 1 22  ? 17.210  14.158  -8.133  1.00 0.00 ? 22  VAL A HG22 1  
ATOM 286   H HG23 . VAL A 1 22  ? 16.580  15.794  -8.329  1.00 0.00 ? 22  VAL A HG23 1  
ATOM 287   N N    . ARG A 1 23  ? 17.100  12.381  -5.650  1.00 0.00 ? 23  ARG A N    1  
ATOM 288   C CA   . ARG A 1 23  ? 17.810  12.214  -4.388  1.00 0.00 ? 23  ARG A CA   1  
ATOM 289   C C    . ARG A 1 23  ? 18.807  13.348  -4.171  1.00 0.00 ? 23  ARG A C    1  
ATOM 290   O O    . ARG A 1 23  ? 19.867  13.386  -4.798  1.00 0.00 ? 23  ARG A O    1  
ATOM 291   C CB   . ARG A 1 23  ? 18.537  10.869  -4.360  1.00 0.00 ? 23  ARG A CB   1  
ATOM 292   C CG   . ARG A 1 23  ? 17.609  9.672   -4.493  1.00 0.00 ? 23  ARG A CG   1  
ATOM 293   C CD   . ARG A 1 23  ? 18.161  8.456   -3.766  1.00 0.00 ? 23  ARG A CD   1  
ATOM 294   N NE   . ARG A 1 23  ? 19.432  8.012   -4.330  1.00 0.00 ? 23  ARG A NE   1  
ATOM 295   C CZ   . ARG A 1 23  ? 20.335  7.315   -3.649  1.00 0.00 ? 23  ARG A CZ   1  
ATOM 296   N NH1  . ARG A 1 23  ? 20.107  6.985   -2.386  1.00 0.00 ? 23  ARG A NH1  1  
ATOM 297   N NH2  . ARG A 1 23  ? 21.469  6.947   -4.232  1.00 0.00 ? 23  ARG A NH2  1  
ATOM 298   H H    . ARG A 1 23  ? 17.565  12.184  -6.490  1.00 0.00 ? 23  ARG A H    1  
ATOM 299   H HA   . ARG A 1 23  ? 17.080  12.236  -3.592  1.00 0.00 ? 23  ARG A HA   1  
ATOM 300   H HB2  . ARG A 1 23  ? 19.245  10.839  -5.175  1.00 0.00 ? 23  ARG A HB2  1  
ATOM 301   H HB3  . ARG A 1 23  ? 19.071  10.781  -3.426  1.00 0.00 ? 23  ARG A HB3  1  
ATOM 302   H HG2  . ARG A 1 23  ? 16.648  9.925   -4.070  1.00 0.00 ? 23  ARG A HG2  1  
ATOM 303   H HG3  . ARG A 1 23  ? 17.492  9.434   -5.539  1.00 0.00 ? 23  ARG A HG3  1  
ATOM 304   H HD2  . ARG A 1 23  ? 18.308  8.710   -2.727  1.00 0.00 ? 23  ARG A HD2  1  
ATOM 305   H HD3  . ARG A 1 23  ? 17.443  7.652   -3.841  1.00 0.00 ? 23  ARG A HD3  1  
ATOM 306   H HE   . ARG A 1 23  ? 19.621  8.245   -5.263  1.00 0.00 ? 23  ARG A HE   1  
ATOM 307   H HH11 . ARG A 1 23  ? 19.253  7.260   -1.944  1.00 0.00 ? 23  ARG A HH11 1  
ATOM 308   H HH12 . ARG A 1 23  ? 20.788  6.459   -1.875  1.00 0.00 ? 23  ARG A HH12 1  
ATOM 309   H HH21 . ARG A 1 23  ? 21.644  7.194   -5.185  1.00 0.00 ? 23  ARG A HH21 1  
ATOM 310   H HH22 . ARG A 1 23  ? 22.148  6.423   -3.719  1.00 0.00 ? 23  ARG A HH22 1  
ATOM 311   N N    . LYS A 1 24  ? 18.462  14.272  -3.281  1.00 0.00 ? 24  LYS A N    1  
ATOM 312   C CA   . LYS A 1 24  ? 19.326  15.407  -2.981  1.00 0.00 ? 24  LYS A CA   1  
ATOM 313   C C    . LYS A 1 24  ? 20.746  14.943  -2.670  1.00 0.00 ? 24  LYS A C    1  
ATOM 314   O O    . LYS A 1 24  ? 21.019  13.744  -2.615  1.00 0.00 ? 24  LYS A O    1  
ATOM 315   C CB   . LYS A 1 24  ? 18.768  16.201  -1.797  1.00 0.00 ? 24  LYS A CB   1  
ATOM 316   C CG   . LYS A 1 24  ? 17.802  17.300  -2.204  1.00 0.00 ? 24  LYS A CG   1  
ATOM 317   C CD   . LYS A 1 24  ? 18.536  18.574  -2.586  1.00 0.00 ? 24  LYS A CD   1  
ATOM 318   C CE   . LYS A 1 24  ? 18.708  19.499  -1.391  1.00 0.00 ? 24  LYS A CE   1  
ATOM 319   N NZ   . LYS A 1 24  ? 20.004  19.271  -0.694  1.00 0.00 ? 24  LYS A NZ   1  
ATOM 320   H H    . LYS A 1 24  ? 17.604  14.187  -2.813  1.00 0.00 ? 24  LYS A H    1  
ATOM 321   H HA   . LYS A 1 24  ? 19.351  16.045  -3.851  1.00 0.00 ? 24  LYS A HA   1  
ATOM 322   H HB2  . LYS A 1 24  ? 18.250  15.521  -1.136  1.00 0.00 ? 24  LYS A HB2  1  
ATOM 323   H HB3  . LYS A 1 24  ? 19.590  16.653  -1.262  1.00 0.00 ? 24  LYS A HB3  1  
ATOM 324   H HG2  . LYS A 1 24  ? 17.223  16.963  -3.051  1.00 0.00 ? 24  LYS A HG2  1  
ATOM 325   H HG3  . LYS A 1 24  ? 17.141  17.511  -1.375  1.00 0.00 ? 24  LYS A HG3  1  
ATOM 326   H HD2  . LYS A 1 24  ? 19.512  18.316  -2.970  1.00 0.00 ? 24  LYS A HD2  1  
ATOM 327   H HD3  . LYS A 1 24  ? 17.972  19.089  -3.351  1.00 0.00 ? 24  LYS A HD3  1  
ATOM 328   H HE2  . LYS A 1 24  ? 18.669  20.521  -1.734  1.00 0.00 ? 24  LYS A HE2  1  
ATOM 329   H HE3  . LYS A 1 24  ? 17.900  19.321  -0.696  1.00 0.00 ? 24  LYS A HE3  1  
ATOM 330   H HZ1  . LYS A 1 24  ? 19.870  19.321  0.336   1.00 0.00 ? 24  LYS A HZ1  1  
ATOM 331   H HZ2  . LYS A 1 24  ? 20.694  19.995  -0.978  1.00 0.00 ? 24  LYS A HZ2  1  
ATOM 332   H HZ3  . LYS A 1 24  ? 20.381  18.333  -0.939  1.00 0.00 ? 24  LYS A HZ3  1  
ATOM 333   N N    . ASP A 1 25  ? 21.645  15.900  -2.467  1.00 0.00 ? 25  ASP A N    1  
ATOM 334   C CA   . ASP A 1 25  ? 23.036  15.589  -2.159  1.00 0.00 ? 25  ASP A CA   1  
ATOM 335   C C    . ASP A 1 25  ? 23.155  14.926  -0.791  1.00 0.00 ? 25  ASP A C    1  
ATOM 336   O O    . ASP A 1 25  ? 23.438  15.587  0.208   1.00 0.00 ? 25  ASP A O    1  
ATOM 337   C CB   . ASP A 1 25  ? 23.886  16.860  -2.200  1.00 0.00 ? 25  ASP A CB   1  
ATOM 338   C CG   . ASP A 1 25  ? 23.938  17.477  -3.584  1.00 0.00 ? 25  ASP A CG   1  
ATOM 339   O OD1  . ASP A 1 25  ? 24.196  16.736  -4.555  1.00 0.00 ? 25  ASP A OD1  1  
ATOM 340   O OD2  . ASP A 1 25  ? 23.720  18.702  -3.695  1.00 0.00 ? 25  ASP A OD2  1  
ATOM 341   H H    . ASP A 1 25  ? 21.366  16.838  -2.524  1.00 0.00 ? 25  ASP A H    1  
ATOM 342   H HA   . ASP A 1 25  ? 23.396  14.902  -2.910  1.00 0.00 ? 25  ASP A HA   1  
ATOM 343   H HB2  . ASP A 1 25  ? 23.469  17.586  -1.517  1.00 0.00 ? 25  ASP A HB2  1  
ATOM 344   H HB3  . ASP A 1 25  ? 24.894  16.621  -1.893  1.00 0.00 ? 25  ASP A HB3  1  
ATOM 345   N N    . GLY A 1 26  ? 22.935  13.615  -0.752  1.00 0.00 ? 26  GLY A N    1  
ATOM 346   C CA   . GLY A 1 26  ? 23.021  12.885  0.499   1.00 0.00 ? 26  GLY A CA   1  
ATOM 347   C C    . GLY A 1 26  ? 21.658  12.575  1.084   1.00 0.00 ? 26  GLY A C    1  
ATOM 348   O O    . GLY A 1 26  ? 21.459  12.673  2.295   1.00 0.00 ? 26  GLY A O    1  
ATOM 349   H H    . GLY A 1 26  ? 22.713  13.140  -1.580  1.00 0.00 ? 26  GLY A H    1  
ATOM 350   H HA2  . GLY A 1 26  ? 23.547  11.957  0.327   1.00 0.00 ? 26  GLY A HA2  1  
ATOM 351   H HA3  . GLY A 1 26  ? 23.579  13.476  1.210   1.00 0.00 ? 26  GLY A HA3  1  
ATOM 352   N N    . GLN A 1 27  ? 20.717  12.202  0.223   1.00 0.00 ? 27  GLN A N    1  
ATOM 353   C CA   . GLN A 1 27  ? 19.364  11.880  0.662   1.00 0.00 ? 27  GLN A CA   1  
ATOM 354   C C    . GLN A 1 27  ? 18.999  10.445  0.294   1.00 0.00 ? 27  GLN A C    1  
ATOM 355   O O    . GLN A 1 27  ? 19.616  9.844   -0.586  1.00 0.00 ? 27  GLN A O    1  
ATOM 356   C CB   . GLN A 1 27  ? 18.358  12.850  0.041   1.00 0.00 ? 27  GLN A CB   1  
ATOM 357   C CG   . GLN A 1 27  ? 16.927  12.619  0.498   1.00 0.00 ? 27  GLN A CG   1  
ATOM 358   C CD   . GLN A 1 27  ? 16.024  13.803  0.212   1.00 0.00 ? 27  GLN A CD   1  
ATOM 359   O OE1  . GLN A 1 27  ? 15.534  14.460  1.130   1.00 0.00 ? 27  GLN A OE1  1  
ATOM 360   N NE2  . GLN A 1 27  ? 15.800  14.081  -1.067  1.00 0.00 ? 27  GLN A NE2  1  
ATOM 361   H H    . GLN A 1 27  ? 20.937  12.143  -0.729  1.00 0.00 ? 27  GLN A H    1  
ATOM 362   H HA   . GLN A 1 27  ? 19.332  11.981  1.736   1.00 0.00 ? 27  GLN A HA   1  
ATOM 363   H HB2  . GLN A 1 27  ? 18.639  13.859  0.304   1.00 0.00 ? 27  GLN A HB2  1  
ATOM 364   H HB3  . GLN A 1 27  ? 18.391  12.745  -1.034  1.00 0.00 ? 27  GLN A HB3  1  
ATOM 365   H HG2  . GLN A 1 27  ? 16.534  11.754  -0.016  1.00 0.00 ? 27  GLN A HG2  1  
ATOM 366   H HG3  . GLN A 1 27  ? 16.929  12.434  1.562   1.00 0.00 ? 27  GLN A HG3  1  
ATOM 367   H HE21 . GLN A 1 27  ? 16.224  13.513  -1.745  1.00 0.00 ? 27  GLN A HE21 1  
ATOM 368   H HE22 . GLN A 1 27  ? 15.220  14.840  -1.280  1.00 0.00 ? 27  GLN A HE22 1  
ATOM 369   N N    . SER A 1 28  ? 17.994  9.903   0.972   1.00 0.00 ? 28  SER A N    1  
ATOM 370   C CA   . SER A 1 28  ? 17.549  8.537   0.719   1.00 0.00 ? 28  SER A CA   1  
ATOM 371   C C    . SER A 1 28  ? 16.163  8.526   0.081   1.00 0.00 ? 28  SER A C    1  
ATOM 372   O O    . SER A 1 28  ? 15.557  9.577   -0.133  1.00 0.00 ? 28  SER A O    1  
ATOM 373   C CB   . SER A 1 28  ? 17.530  7.735   2.021   1.00 0.00 ? 28  SER A CB   1  
ATOM 374   O OG   . SER A 1 28  ? 16.468  8.153   2.862   1.00 0.00 ? 28  SER A OG   1  
ATOM 375   H H    . SER A 1 28  ? 17.541  10.433  1.662   1.00 0.00 ? 28  SER A H    1  
ATOM 376   H HA   . SER A 1 28  ? 18.251  8.082   0.036   1.00 0.00 ? 28  SER A HA   1  
ATOM 377   H HB2  . SER A 1 28  ? 17.401  6.687   1.794   1.00 0.00 ? 28  SER A HB2  1  
ATOM 378   H HB3  . SER A 1 28  ? 18.465  7.878   2.543   1.00 0.00 ? 28  SER A HB3  1  
ATOM 379   H HG   . SER A 1 28  ? 15.669  7.673   2.631   1.00 0.00 ? 28  SER A HG   1  
ATOM 380   N N    . LEU A 1 29  ? 15.668  7.332   -0.222  1.00 0.00 ? 29  LEU A N    1  
ATOM 381   C CA   . LEU A 1 29  ? 14.353  7.182   -0.836  1.00 0.00 ? 29  LEU A CA   1  
ATOM 382   C C    . LEU A 1 29  ? 13.248  7.567   0.142   1.00 0.00 ? 29  LEU A C    1  
ATOM 383   O O    . LEU A 1 29  ? 12.388  8.390   -0.170  1.00 0.00 ? 29  LEU A O    1  
ATOM 384   C CB   . LEU A 1 29  ? 14.151  5.741   -1.310  1.00 0.00 ? 29  LEU A CB   1  
ATOM 385   C CG   . LEU A 1 29  ? 13.245  5.556   -2.528  1.00 0.00 ? 29  LEU A CG   1  
ATOM 386   C CD1  . LEU A 1 29  ? 13.818  6.283   -3.735  1.00 0.00 ? 29  LEU A CD1  1  
ATOM 387   C CD2  . LEU A 1 29  ? 13.058  4.077   -2.834  1.00 0.00 ? 29  LEU A CD2  1  
ATOM 388   H H    . LEU A 1 29  ? 16.198  6.531   -0.028  1.00 0.00 ? 29  LEU A H    1  
ATOM 389   H HA   . LEU A 1 29  ? 14.309  7.842   -1.689  1.00 0.00 ? 29  LEU A HA   1  
ATOM 390   H HB2  . LEU A 1 29  ? 15.120  5.335   -1.554  1.00 0.00 ? 29  LEU A HB2  1  
ATOM 391   H HB3  . LEU A 1 29  ? 13.724  5.181   -0.490  1.00 0.00 ? 29  LEU A HB3  1  
ATOM 392   H HG   . LEU A 1 29  ? 12.274  5.980   -2.314  1.00 0.00 ? 29  LEU A HG   1  
ATOM 393   H HD11 . LEU A 1 29  ? 13.904  5.595   -4.562  1.00 0.00 ? 29  LEU A HD11 1  
ATOM 394   H HD12 . LEU A 1 29  ? 14.794  6.675   -3.489  1.00 0.00 ? 29  LEU A HD12 1  
ATOM 395   H HD13 . LEU A 1 29  ? 13.163  7.097   -4.009  1.00 0.00 ? 29  LEU A HD13 1  
ATOM 396   H HD21 . LEU A 1 29  ? 13.353  3.493   -1.975  1.00 0.00 ? 29  LEU A HD21 1  
ATOM 397   H HD22 . LEU A 1 29  ? 13.669  3.805   -3.682  1.00 0.00 ? 29  LEU A HD22 1  
ATOM 398   H HD23 . LEU A 1 29  ? 12.020  3.886   -3.061  1.00 0.00 ? 29  LEU A HD23 1  
ATOM 399   N N    . GLY A 1 30  ? 13.279  6.968   1.329   1.00 0.00 ? 30  GLY A N    1  
ATOM 400   C CA   . GLY A 1 30  ? 12.277  7.263   2.335   1.00 0.00 ? 30  GLY A CA   1  
ATOM 401   C C    . GLY A 1 30  ? 10.936  6.630   2.021   1.00 0.00 ? 30  GLY A C    1  
ATOM 402   O O    . GLY A 1 30  ? 9.893   7.270   2.158   1.00 0.00 ? 30  GLY A O    1  
ATOM 403   H H    . GLY A 1 30  ? 13.989  6.320   1.522   1.00 0.00 ? 30  GLY A H    1  
ATOM 404   H HA2  . GLY A 1 30  ? 12.622  6.895   3.290   1.00 0.00 ? 30  GLY A HA2  1  
ATOM 405   H HA3  . GLY A 1 30  ? 12.150  8.334   2.398   1.00 0.00 ? 30  GLY A HA3  1  
ATOM 406   N N    . ILE A 1 31  ? 10.963  5.371   1.597   1.00 0.00 ? 31  ILE A N    1  
ATOM 407   C CA   . ILE A 1 31  ? 9.740   4.652   1.262   1.00 0.00 ? 31  ILE A CA   1  
ATOM 408   C C    . ILE A 1 31  ? 9.712   3.277   1.921   1.00 0.00 ? 31  ILE A C    1  
ATOM 409   O O    . ILE A 1 31  ? 10.578  2.439   1.668   1.00 0.00 ? 31  ILE A O    1  
ATOM 410   C CB   . ILE A 1 31  ? 9.586   4.482   -0.261  1.00 0.00 ? 31  ILE A CB   1  
ATOM 411   C CG1  . ILE A 1 31  ? 9.511   5.850   -0.943  1.00 0.00 ? 31  ILE A CG1  1  
ATOM 412   C CG2  . ILE A 1 31  ? 8.348   3.657   -0.580  1.00 0.00 ? 31  ILE A CG2  1  
ATOM 413   C CD1  . ILE A 1 31  ? 9.613   5.779   -2.451  1.00 0.00 ? 31  ILE A CD1  1  
ATOM 414   H H    . ILE A 1 31  ? 11.825  4.915   1.509   1.00 0.00 ? 31  ILE A H    1  
ATOM 415   H HA   . ILE A 1 31  ? 8.903   5.231   1.626   1.00 0.00 ? 31  ILE A HA   1  
ATOM 416   H HB   . ILE A 1 31  ? 10.449  3.950   -0.631  1.00 0.00 ? 31  ILE A HB   1  
ATOM 417   H HG12 . ILE A 1 31  ? 8.571   6.318   -0.697  1.00 0.00 ? 31  ILE A HG12 1  
ATOM 418   H HG13 . ILE A 1 31  ? 10.321  6.468   -0.584  1.00 0.00 ? 31  ILE A HG13 1  
ATOM 419   H HG21 . ILE A 1 31  ? 7.988   3.185   0.323   1.00 0.00 ? 31  ILE A HG21 1  
ATOM 420   H HG22 . ILE A 1 31  ? 7.580   4.301   -0.979  1.00 0.00 ? 31  ILE A HG22 1  
ATOM 421   H HG23 . ILE A 1 31  ? 8.598   2.899   -1.307  1.00 0.00 ? 31  ILE A HG23 1  
ATOM 422   H HD11 . ILE A 1 31  ? 9.795   6.768   -2.847  1.00 0.00 ? 31  ILE A HD11 1  
ATOM 423   H HD12 . ILE A 1 31  ? 10.425  5.125   -2.727  1.00 0.00 ? 31  ILE A HD12 1  
ATOM 424   H HD13 . ILE A 1 31  ? 8.688   5.395   -2.856  1.00 0.00 ? 31  ILE A HD13 1  
ATOM 425   N N    . ARG A 1 32  ? 8.711   3.051   2.765   1.00 0.00 ? 32  ARG A N    1  
ATOM 426   C CA   . ARG A 1 32  ? 8.570   1.777   3.460   1.00 0.00 ? 32  ARG A CA   1  
ATOM 427   C C    . ARG A 1 32  ? 7.724   0.804   2.644   1.00 0.00 ? 32  ARG A C    1  
ATOM 428   O O    . ARG A 1 32  ? 6.683   1.176   2.101   1.00 0.00 ? 32  ARG A O    1  
ATOM 429   C CB   . ARG A 1 32  ? 7.938   1.990   4.836   1.00 0.00 ? 32  ARG A CB   1  
ATOM 430   C CG   . ARG A 1 32  ? 8.759   2.884   5.752   1.00 0.00 ? 32  ARG A CG   1  
ATOM 431   C CD   . ARG A 1 32  ? 10.027  2.188   6.220   1.00 0.00 ? 32  ARG A CD   1  
ATOM 432   N NE   . ARG A 1 32  ? 10.615  2.847   7.384   1.00 0.00 ? 32  ARG A NE   1  
ATOM 433   C CZ   . ARG A 1 32  ? 11.783  2.501   7.912   1.00 0.00 ? 32  ARG A CZ   1  
ATOM 434   N NH1  . ARG A 1 32  ? 12.486  1.508   7.383   1.00 0.00 ? 32  ARG A NH1  1  
ATOM 435   N NH2  . ARG A 1 32  ? 12.252  3.148   8.971   1.00 0.00 ? 32  ARG A NH2  1  
ATOM 436   H H    . ARG A 1 32  ? 8.052   3.758   2.926   1.00 0.00 ? 32  ARG A H    1  
ATOM 437   H HA   . ARG A 1 32  ? 9.557   1.358   3.587   1.00 0.00 ? 32  ARG A HA   1  
ATOM 438   H HB2  . ARG A 1 32  ? 6.965   2.440   4.707   1.00 0.00 ? 32  ARG A HB2  1  
ATOM 439   H HB3  . ARG A 1 32  ? 7.821   1.031   5.317   1.00 0.00 ? 32  ARG A HB3  1  
ATOM 440   H HG2  . ARG A 1 32  ? 9.031   3.781   5.214   1.00 0.00 ? 32  ARG A HG2  1  
ATOM 441   H HG3  . ARG A 1 32  ? 8.162   3.146   6.613   1.00 0.00 ? 32  ARG A HG3  1  
ATOM 442   H HD2  . ARG A 1 32  ? 9.787   1.168   6.479   1.00 0.00 ? 32  ARG A HD2  1  
ATOM 443   H HD3  . ARG A 1 32  ? 10.744  2.196   5.413   1.00 0.00 ? 32  ARG A HD3  1  
ATOM 444   H HE   . ARG A 1 32  ? 10.113  3.583   7.790   1.00 0.00 ? 32  ARG A HE   1  
ATOM 445   H HH11 . ARG A 1 32  ? 12.135  1.020   6.584   1.00 0.00 ? 32  ARG A HH11 1  
ATOM 446   H HH12 . ARG A 1 32  ? 13.366  1.250   7.782   1.00 0.00 ? 32  ARG A HH12 1  
ATOM 447   H HH21 . ARG A 1 32  ? 11.726  3.897   9.372   1.00 0.00 ? 32  ARG A HH21 1  
ATOM 448   H HH22 . ARG A 1 32  ? 13.131  2.887   9.368   1.00 0.00 ? 32  ARG A HH22 1  
ATOM 449   N N    . ILE A 1 33  ? 8.178   -0.442  2.563   1.00 0.00 ? 33  ILE A N    1  
ATOM 450   C CA   . ILE A 1 33  ? 7.462   -1.468  1.815   1.00 0.00 ? 33  ILE A CA   1  
ATOM 451   C C    . ILE A 1 33  ? 6.936   -2.558  2.742   1.00 0.00 ? 33  ILE A C    1  
ATOM 452   O O    . ILE A 1 33  ? 7.415   -2.718  3.865   1.00 0.00 ? 33  ILE A O    1  
ATOM 453   C CB   . ILE A 1 33  ? 8.359   -2.111  0.741   1.00 0.00 ? 33  ILE A CB   1  
ATOM 454   C CG1  . ILE A 1 33  ? 9.598   -2.734  1.388   1.00 0.00 ? 33  ILE A CG1  1  
ATOM 455   C CG2  . ILE A 1 33  ? 8.761   -1.079  -0.301  1.00 0.00 ? 33  ILE A CG2  1  
ATOM 456   C CD1  . ILE A 1 33  ? 10.143  -3.923  0.628   1.00 0.00 ? 33  ILE A CD1  1  
ATOM 457   H H    . ILE A 1 33  ? 9.013   -0.677  3.018   1.00 0.00 ? 33  ILE A H    1  
ATOM 458   H HA   . ILE A 1 33  ? 6.625   -0.996  1.321   1.00 0.00 ? 33  ILE A HA   1  
ATOM 459   H HB   . ILE A 1 33  ? 7.793   -2.885  0.247   1.00 0.00 ? 33  ILE A HB   1  
ATOM 460   H HG12 . ILE A 1 33  ? 10.379  -1.992  1.445   1.00 0.00 ? 33  ILE A HG12 1  
ATOM 461   H HG13 . ILE A 1 33  ? 9.347   -3.063  2.386   1.00 0.00 ? 33  ILE A HG13 1  
ATOM 462   H HG21 . ILE A 1 33  ? 9.198   -1.579  -1.153  1.00 0.00 ? 33  ILE A HG21 1  
ATOM 463   H HG22 . ILE A 1 33  ? 7.888   -0.528  -0.617  1.00 0.00 ? 33  ILE A HG22 1  
ATOM 464   H HG23 . ILE A 1 33  ? 9.482   -0.398  0.125   1.00 0.00 ? 33  ILE A HG23 1  
ATOM 465   H HD11 . ILE A 1 33  ? 9.338   -4.416  0.104   1.00 0.00 ? 33  ILE A HD11 1  
ATOM 466   H HD12 . ILE A 1 33  ? 10.885  -3.589  -0.081  1.00 0.00 ? 33  ILE A HD12 1  
ATOM 467   H HD13 . ILE A 1 33  ? 10.596  -4.616  1.322   1.00 0.00 ? 33  ILE A HD13 1  
ATOM 468   N N    . VAL A 1 34  ? 5.948   -3.309  2.264   1.00 0.00 ? 34  VAL A N    1  
ATOM 469   C CA   . VAL A 1 34  ? 5.359   -4.387  3.049   1.00 0.00 ? 34  VAL A CA   1  
ATOM 470   C C    . VAL A 1 34  ? 5.210   -5.655  2.215   1.00 0.00 ? 34  VAL A C    1  
ATOM 471   O O    . VAL A 1 34  ? 4.878   -5.597  1.032   1.00 0.00 ? 34  VAL A O    1  
ATOM 472   C CB   . VAL A 1 34  ? 3.979   -3.987  3.605   1.00 0.00 ? 34  VAL A CB   1  
ATOM 473   C CG1  . VAL A 1 34  ? 2.920   -4.069  2.517   1.00 0.00 ? 34  VAL A CG1  1  
ATOM 474   C CG2  . VAL A 1 34  ? 3.608   -4.865  4.790   1.00 0.00 ? 34  VAL A CG2  1  
ATOM 475   H H    . VAL A 1 34  ? 5.608   -3.133  1.362   1.00 0.00 ? 34  VAL A H    1  
ATOM 476   H HA   . VAL A 1 34  ? 6.015   -4.591  3.882   1.00 0.00 ? 34  VAL A HA   1  
ATOM 477   H HB   . VAL A 1 34  ? 4.034   -2.963  3.946   1.00 0.00 ? 34  VAL A HB   1  
ATOM 478   H HG11 . VAL A 1 34  ? 3.127   -3.332  1.756   1.00 0.00 ? 34  VAL A HG11 1  
ATOM 479   H HG12 . VAL A 1 34  ? 2.931   -5.056  2.077   1.00 0.00 ? 34  VAL A HG12 1  
ATOM 480   H HG13 . VAL A 1 34  ? 1.947   -3.878  2.947   1.00 0.00 ? 34  VAL A HG13 1  
ATOM 481   H HG21 . VAL A 1 34  ? 4.227   -5.750  4.789   1.00 0.00 ? 34  VAL A HG21 1  
ATOM 482   H HG22 . VAL A 1 34  ? 3.766   -4.318  5.709   1.00 0.00 ? 34  VAL A HG22 1  
ATOM 483   H HG23 . VAL A 1 34  ? 2.570   -5.151  4.716   1.00 0.00 ? 34  VAL A HG23 1  
ATOM 484   N N    . GLY A 1 35  ? 5.457   -6.801  2.842   1.00 0.00 ? 35  GLY A N    1  
ATOM 485   C CA   . GLY A 1 35  ? 5.345   -8.068  2.143   1.00 0.00 ? 35  GLY A CA   1  
ATOM 486   C C    . GLY A 1 35  ? 4.081   -8.821  2.508   1.00 0.00 ? 35  GLY A C    1  
ATOM 487   O O    . GLY A 1 35  ? 3.950   -9.324  3.624   1.00 0.00 ? 35  GLY A O    1  
ATOM 488   H H    . GLY A 1 35  ? 5.718   -6.786  3.787   1.00 0.00 ? 35  GLY A H    1  
ATOM 489   H HA2  . GLY A 1 35  ? 5.346   -7.881  1.080   1.00 0.00 ? 35  GLY A HA2  1  
ATOM 490   H HA3  . GLY A 1 35  ? 6.199   -8.680  2.392   1.00 0.00 ? 35  GLY A HA3  1  
ATOM 491   N N    . TYR A 1 36  ? 3.148   -8.898  1.566   1.00 0.00 ? 36  TYR A N    1  
ATOM 492   C CA   . TYR A 1 36  ? 1.886   -9.592  1.795   1.00 0.00 ? 36  TYR A CA   1  
ATOM 493   C C    . TYR A 1 36  ? 1.913   -10.989 1.182   1.00 0.00 ? 36  TYR A C    1  
ATOM 494   O O    . TYR A 1 36  ? 2.550   -11.216 0.154   1.00 0.00 ? 36  TYR A O    1  
ATOM 495   C CB   . TYR A 1 36  ? 0.724   -8.788  1.208   1.00 0.00 ? 36  TYR A CB   1  
ATOM 496   C CG   . TYR A 1 36  ? 0.045   -7.885  2.212   1.00 0.00 ? 36  TYR A CG   1  
ATOM 497   C CD1  . TYR A 1 36  ? 0.482   -6.580  2.409   1.00 0.00 ? 36  TYR A CD1  1  
ATOM 498   C CD2  . TYR A 1 36  ? -1.032  -8.335  2.965   1.00 0.00 ? 36  TYR A CD2  1  
ATOM 499   C CE1  . TYR A 1 36  ? -0.135  -5.751  3.326   1.00 0.00 ? 36  TYR A CE1  1  
ATOM 500   C CE2  . TYR A 1 36  ? -1.656  -7.512  3.883   1.00 0.00 ? 36  TYR A CE2  1  
ATOM 501   C CZ   . TYR A 1 36  ? -1.204  -6.221  4.060   1.00 0.00 ? 36  TYR A CZ   1  
ATOM 502   O OH   . TYR A 1 36  ? -1.822  -5.399  4.974   1.00 0.00 ? 36  TYR A OH   1  
ATOM 503   H H    . TYR A 1 36  ? 3.310   -8.477  0.696   1.00 0.00 ? 36  TYR A H    1  
ATOM 504   H HA   . TYR A 1 36  ? 1.746   -9.682  2.862   1.00 0.00 ? 36  TYR A HA   1  
ATOM 505   H HB2  . TYR A 1 36  ? 1.092   -8.171  0.403   1.00 0.00 ? 36  TYR A HB2  1  
ATOM 506   H HB3  . TYR A 1 36  ? -0.018  -9.471  0.821   1.00 0.00 ? 36  TYR A HB3  1  
ATOM 507   H HD1  . TYR A 1 36  ? 1.319   -6.214  1.832   1.00 0.00 ? 36  TYR A HD1  1  
ATOM 508   H HD2  . TYR A 1 36  ? -1.384  -9.347  2.824   1.00 0.00 ? 36  TYR A HD2  1  
ATOM 509   H HE1  . TYR A 1 36  ? 0.219   -4.740  3.464   1.00 0.00 ? 36  TYR A HE1  1  
ATOM 510   H HE2  . TYR A 1 36  ? -2.493  -7.881  4.458   1.00 0.00 ? 36  TYR A HE2  1  
ATOM 511   H HH   . TYR A 1 36  ? -2.040  -5.904  5.761   1.00 0.00 ? 36  TYR A HH   1  
ATOM 512   N N    . VAL A 1 37  ? 1.216   -11.922 1.822   1.00 0.00 ? 37  VAL A N    1  
ATOM 513   C CA   . VAL A 1 37  ? 1.158   -13.297 1.341   1.00 0.00 ? 37  VAL A CA   1  
ATOM 514   C C    . VAL A 1 37  ? -0.276  -13.708 1.022   1.00 0.00 ? 37  VAL A C    1  
ATOM 515   O O    . VAL A 1 37  ? -0.512  -14.573 0.180   1.00 0.00 ? 37  VAL A O    1  
ATOM 516   C CB   . VAL A 1 37  ? 1.743   -14.279 2.373   1.00 0.00 ? 37  VAL A CB   1  
ATOM 517   C CG1  . VAL A 1 37  ? 1.611   -15.712 1.883   1.00 0.00 ? 37  VAL A CG1  1  
ATOM 518   C CG2  . VAL A 1 37  ? 3.197   -13.939 2.666   1.00 0.00 ? 37  VAL A CG2  1  
ATOM 519   H H    . VAL A 1 37  ? 0.729   -11.680 2.637   1.00 0.00 ? 37  VAL A H    1  
ATOM 520   H HA   . VAL A 1 37  ? 1.749   -13.361 0.439   1.00 0.00 ? 37  VAL A HA   1  
ATOM 521   H HB   . VAL A 1 37  ? 1.181   -14.182 3.291   1.00 0.00 ? 37  VAL A HB   1  
ATOM 522   H HG11 . VAL A 1 37  ? 2.051   -16.382 2.607   1.00 0.00 ? 37  VAL A HG11 1  
ATOM 523   H HG12 . VAL A 1 37  ? 0.566   -15.955 1.755   1.00 0.00 ? 37  VAL A HG12 1  
ATOM 524   H HG13 . VAL A 1 37  ? 2.124   -15.818 0.938   1.00 0.00 ? 37  VAL A HG13 1  
ATOM 525   H HG21 . VAL A 1 37  ? 3.631   -13.448 1.808   1.00 0.00 ? 37  VAL A HG21 1  
ATOM 526   H HG22 . VAL A 1 37  ? 3.248   -13.280 3.521   1.00 0.00 ? 37  VAL A HG22 1  
ATOM 527   H HG23 . VAL A 1 37  ? 3.743   -14.846 2.878   1.00 0.00 ? 37  VAL A HG23 1  
ATOM 528   N N    . GLY A 1 38  ? -1.230  -13.079 1.701   1.00 0.00 ? 38  GLY A N    1  
ATOM 529   C CA   . GLY A 1 38  ? -2.629  -13.392 1.476   1.00 0.00 ? 38  GLY A CA   1  
ATOM 530   C C    . GLY A 1 38  ? -2.961  -14.835 1.803   1.00 0.00 ? 38  GLY A C    1  
ATOM 531   O O    . GLY A 1 38  ? -3.138  -15.659 0.904   1.00 0.00 ? 38  GLY A O    1  
ATOM 532   H H    . GLY A 1 38  ? -0.983  -12.398 2.361   1.00 0.00 ? 38  GLY A H    1  
ATOM 533   H HA2  . GLY A 1 38  ? -3.235  -12.746 2.093   1.00 0.00 ? 38  GLY A HA2  1  
ATOM 534   H HA3  . GLY A 1 38  ? -2.865  -13.207 0.438   1.00 0.00 ? 38  GLY A HA3  1  
ATOM 535   N N    . THR A 1 39  ? -3.044  -15.144 3.093   1.00 0.00 ? 39  THR A N    1  
ATOM 536   C CA   . THR A 1 39  ? -3.353  -16.497 3.536   1.00 0.00 ? 39  THR A CA   1  
ATOM 537   C C    . THR A 1 39  ? -4.710  -16.952 3.011   1.00 0.00 ? 39  THR A C    1  
ATOM 538   O O    . THR A 1 39  ? -5.418  -16.190 2.353   1.00 0.00 ? 39  THR A O    1  
ATOM 539   C CB   . THR A 1 39  ? -3.350  -16.600 5.073   1.00 0.00 ? 39  THR A CB   1  
ATOM 540   O OG1  . THR A 1 39  ? -3.347  -17.975 5.473   1.00 0.00 ? 39  THR A OG1  1  
ATOM 541   C CG2  . THR A 1 39  ? -4.562  -15.897 5.665   1.00 0.00 ? 39  THR A CG2  1  
ATOM 542   H H    . THR A 1 39  ? -2.892  -14.444 3.762   1.00 0.00 ? 39  THR A H    1  
ATOM 543   H HA   . THR A 1 39  ? -2.589  -17.157 3.151   1.00 0.00 ? 39  THR A HA   1  
ATOM 544   H HB   . THR A 1 39  ? -2.456  -16.122 5.449   1.00 0.00 ? 39  THR A HB   1  
ATOM 545   H HG1  . THR A 1 39  ? -4.247  -18.258 5.653   1.00 0.00 ? 39  THR A HG1  1  
ATOM 546   H HG21 . THR A 1 39  ? -4.677  -14.927 5.204   1.00 0.00 ? 39  THR A HG21 1  
ATOM 547   H HG22 . THR A 1 39  ? -4.425  -15.776 6.729   1.00 0.00 ? 39  THR A HG22 1  
ATOM 548   H HG23 . THR A 1 39  ? -5.446  -16.489 5.480   1.00 0.00 ? 39  THR A HG23 1  
ATOM 549   N N    . SER A 1 40  ? -5.067  -18.198 3.306   1.00 0.00 ? 40  SER A N    1  
ATOM 550   C CA   . SER A 1 40  ? -6.338  -18.754 2.860   1.00 0.00 ? 40  SER A CA   1  
ATOM 551   C C    . SER A 1 40  ? -7.451  -18.429 3.852   1.00 0.00 ? 40  SER A C    1  
ATOM 552   O O    . SER A 1 40  ? -7.194  -18.164 5.027   1.00 0.00 ? 40  SER A O    1  
ATOM 553   C CB   . SER A 1 40  ? -6.223  -20.270 2.685   1.00 0.00 ? 40  SER A CB   1  
ATOM 554   O OG   . SER A 1 40  ? -7.150  -20.745 1.725   1.00 0.00 ? 40  SER A OG   1  
ATOM 555   H H    . SER A 1 40  ? -4.458  -18.756 3.834   1.00 0.00 ? 40  SER A H    1  
ATOM 556   H HA   . SER A 1 40  ? -6.580  -18.308 1.907   1.00 0.00 ? 40  SER A HA   1  
ATOM 557   H HB2  . SER A 1 40  ? -5.225  -20.517 2.357   1.00 0.00 ? 40  SER A HB2  1  
ATOM 558   H HB3  . SER A 1 40  ? -6.421  -20.755 3.630   1.00 0.00 ? 40  SER A HB3  1  
ATOM 559   H HG   . SER A 1 40  ? -7.384  -20.032 1.126   1.00 0.00 ? 40  SER A HG   1  
ATOM 560   N N    . HIS A 1 41  ? -8.690  -18.451 3.370   1.00 0.00 ? 41  HIS A N    1  
ATOM 561   C CA   . HIS A 1 41  ? -9.844  -18.159 4.213   1.00 0.00 ? 41  HIS A CA   1  
ATOM 562   C C    . HIS A 1 41  ? -9.777  -16.733 4.750   1.00 0.00 ? 41  HIS A C    1  
ATOM 563   O O    . HIS A 1 41  ? -10.189 -16.463 5.879   1.00 0.00 ? 41  HIS A O    1  
ATOM 564   C CB   . HIS A 1 41  ? -9.918  -19.151 5.374   1.00 0.00 ? 41  HIS A CB   1  
ATOM 565   C CG   . HIS A 1 41  ? -11.308 -19.376 5.882   1.00 0.00 ? 41  HIS A CG   1  
ATOM 566   N ND1  . HIS A 1 41  ? -12.080 -20.456 5.511   1.00 0.00 ? 41  HIS A ND1  1  
ATOM 567   C CD2  . HIS A 1 41  ? -12.065 -18.652 6.740   1.00 0.00 ? 41  HIS A CD2  1  
ATOM 568   C CE1  . HIS A 1 41  ? -13.252 -20.386 6.117   1.00 0.00 ? 41  HIS A CE1  1  
ATOM 569   N NE2  . HIS A 1 41  ? -13.268 -19.301 6.869   1.00 0.00 ? 41  HIS A NE2  1  
ATOM 570   H H    . HIS A 1 41  ? -8.831  -18.669 2.425   1.00 0.00 ? 41  HIS A H    1  
ATOM 571   H HA   . HIS A 1 41  ? -10.731 -18.261 3.607   1.00 0.00 ? 41  HIS A HA   1  
ATOM 572   H HB2  . HIS A 1 41  ? -9.526  -20.104 5.050   1.00 0.00 ? 41  HIS A HB2  1  
ATOM 573   H HB3  . HIS A 1 41  ? -9.319  -18.781 6.194   1.00 0.00 ? 41  HIS A HB3  1  
ATOM 574   H HD1  . HIS A 1 41  ? -11.810 -21.167 4.894   1.00 0.00 ? 41  HIS A HD1  1  
ATOM 575   H HD2  . HIS A 1 41  ? -11.777 -17.733 7.232   1.00 0.00 ? 41  HIS A HD2  1  
ATOM 576   H HE1  . HIS A 1 41  ? -14.060 -21.096 6.015   1.00 0.00 ? 41  HIS A HE1  1  
ATOM 577   H HE2  . HIS A 1 41  ? -14.048 -18.965 7.358   1.00 0.00 ? 41  HIS A HE2  1  
ATOM 578   N N    . THR A 1 42  ? -9.253  -15.822 3.935   1.00 0.00 ? 42  THR A N    1  
ATOM 579   C CA   . THR A 1 42  ? -9.130  -14.424 4.329   1.00 0.00 ? 42  THR A CA   1  
ATOM 580   C C    . THR A 1 42  ? -9.223  -13.502 3.119   1.00 0.00 ? 42  THR A C    1  
ATOM 581   O O    . THR A 1 42  ? -8.933  -13.907 1.994   1.00 0.00 ? 42  THR A O    1  
ATOM 582   C CB   . THR A 1 42  ? -7.800  -14.162 5.061   1.00 0.00 ? 42  THR A CB   1  
ATOM 583   O OG1  . THR A 1 42  ? -6.706  -14.654 4.279   1.00 0.00 ? 42  THR A OG1  1  
ATOM 584   C CG2  . THR A 1 42  ? -7.794  -14.828 6.428   1.00 0.00 ? 42  THR A CG2  1  
ATOM 585   H H    . THR A 1 42  ? -8.942  -16.099 3.048   1.00 0.00 ? 42  THR A H    1  
ATOM 586   H HA   . THR A 1 42  ? -9.941  -14.196 5.006   1.00 0.00 ? 42  THR A HA   1  
ATOM 587   H HB   . THR A 1 42  ? -7.686  -13.096 5.196   1.00 0.00 ? 42  THR A HB   1  
ATOM 588   H HG1  . THR A 1 42  ? -7.045  -15.103 3.501   1.00 0.00 ? 42  THR A HG1  1  
ATOM 589   H HG21 . THR A 1 42  ? -7.085  -14.326 7.070   1.00 0.00 ? 42  THR A HG21 1  
ATOM 590   H HG22 . THR A 1 42  ? -7.512  -15.865 6.321   1.00 0.00 ? 42  THR A HG22 1  
ATOM 591   H HG23 . THR A 1 42  ? -8.780  -14.767 6.863   1.00 0.00 ? 42  THR A HG23 1  
ATOM 592   N N    . GLY A 1 43  ? -9.628  -12.258 3.358   1.00 0.00 ? 43  GLY A N    1  
ATOM 593   C CA   . GLY A 1 43  ? -9.750  -11.297 2.278   1.00 0.00 ? 43  GLY A CA   1  
ATOM 594   C C    . GLY A 1 43  ? -8.549  -10.378 2.181   1.00 0.00 ? 43  GLY A C    1  
ATOM 595   O O    . GLY A 1 43  ? -8.689  -9.193  1.878   1.00 0.00 ? 43  GLY A O    1  
ATOM 596   H H    . GLY A 1 43  ? -9.845  -11.991 4.276   1.00 0.00 ? 43  GLY A H    1  
ATOM 597   H HA2  . GLY A 1 43  ? -9.857  -11.832 1.346   1.00 0.00 ? 43  GLY A HA2  1  
ATOM 598   H HA3  . GLY A 1 43  ? -10.634 -10.699 2.442   1.00 0.00 ? 43  GLY A HA3  1  
ATOM 599   N N    . GLU A 1 44  ? -7.365  -10.924 2.440   1.00 0.00 ? 44  GLU A N    1  
ATOM 600   C CA   . GLU A 1 44  ? -6.135  -10.142 2.383   1.00 0.00 ? 44  GLU A CA   1  
ATOM 601   C C    . GLU A 1 44  ? -5.616  -10.049 0.951   1.00 0.00 ? 44  GLU A C    1  
ATOM 602   O O    . GLU A 1 44  ? -6.205  -10.612 0.028   1.00 0.00 ? 44  GLU A O    1  
ATOM 603   C CB   . GLU A 1 44  ? -5.067  -10.765 3.284   1.00 0.00 ? 44  GLU A CB   1  
ATOM 604   C CG   . GLU A 1 44  ? -5.470  -10.834 4.747   1.00 0.00 ? 44  GLU A CG   1  
ATOM 605   C CD   . GLU A 1 44  ? -5.490  -9.472  5.413   1.00 0.00 ? 44  GLU A CD   1  
ATOM 606   O OE1  . GLU A 1 44  ? -4.459  -8.769  5.358   1.00 0.00 ? 44  GLU A OE1  1  
ATOM 607   O OE2  . GLU A 1 44  ? -6.537  -9.108  5.988   1.00 0.00 ? 44  GLU A OE2  1  
ATOM 608   H H    . GLU A 1 44  ? -7.318  -11.874 2.676   1.00 0.00 ? 44  GLU A H    1  
ATOM 609   H HA   . GLU A 1 44  ? -6.357  -9.147  2.738   1.00 0.00 ? 44  GLU A HA   1  
ATOM 610   H HB2  . GLU A 1 44  ? -4.862  -11.768 2.940   1.00 0.00 ? 44  GLU A HB2  1  
ATOM 611   H HB3  . GLU A 1 44  ? -4.164  -10.177 3.209   1.00 0.00 ? 44  GLU A HB3  1  
ATOM 612   H HG2  . GLU A 1 44  ? -6.458  -11.264 4.815   1.00 0.00 ? 44  GLU A HG2  1  
ATOM 613   H HG3  . GLU A 1 44  ? -4.768  -11.465 5.272   1.00 0.00 ? 44  GLU A HG3  1  
ATOM 614   N N    . ALA A 1 45  ? -4.511  -9.333  0.774   1.00 0.00 ? 45  ALA A N    1  
ATOM 615   C CA   . ALA A 1 45  ? -3.911  -9.167  -0.545  1.00 0.00 ? 45  ALA A CA   1  
ATOM 616   C C    . ALA A 1 45  ? -2.549  -9.849  -0.619  1.00 0.00 ? 45  ALA A C    1  
ATOM 617   O O    . ALA A 1 45  ? -2.126  -10.514 0.326   1.00 0.00 ? 45  ALA A O    1  
ATOM 618   C CB   . ALA A 1 45  ? -3.782  -7.689  -0.883  1.00 0.00 ? 45  ALA A CB   1  
ATOM 619   H H    . ALA A 1 45  ? -4.087  -8.908  1.548   1.00 0.00 ? 45  ALA A H    1  
ATOM 620   H HA   . ALA A 1 45  ? -4.570  -9.621  -1.271  1.00 0.00 ? 45  ALA A HA   1  
ATOM 621   H HB1  . ALA A 1 45  ? -3.476  -7.144  -0.002  1.00 0.00 ? 45  ALA A HB1  1  
ATOM 622   H HB2  . ALA A 1 45  ? -3.044  -7.561  -1.661  1.00 0.00 ? 45  ALA A HB2  1  
ATOM 623   H HB3  . ALA A 1 45  ? -4.735  -7.314  -1.225  1.00 0.00 ? 45  ALA A HB3  1  
ATOM 624   N N    . SER A 1 46  ? -1.869  -9.680  -1.748  1.00 0.00 ? 46  SER A N    1  
ATOM 625   C CA   . SER A 1 46  ? -0.556  -10.284 -1.946  1.00 0.00 ? 46  SER A CA   1  
ATOM 626   C C    . SER A 1 46  ? 0.309   -9.415  -2.854  1.00 0.00 ? 46  SER A C    1  
ATOM 627   O O    . SER A 1 46  ? -0.063  -9.118  -3.988  1.00 0.00 ? 46  SER A O    1  
ATOM 628   C CB   . SER A 1 46  ? -0.701  -11.683 -2.548  1.00 0.00 ? 46  SER A CB   1  
ATOM 629   O OG   . SER A 1 46  ? -1.106  -11.616 -3.904  1.00 0.00 ? 46  SER A OG   1  
ATOM 630   H H    . SER A 1 46  ? -2.260  -9.138  -2.465  1.00 0.00 ? 46  SER A H    1  
ATOM 631   H HA   . SER A 1 46  ? -0.078  -10.363 -0.981  1.00 0.00 ? 46  SER A HA   1  
ATOM 632   H HB2  . SER A 1 46  ? 0.248   -12.195 -2.493  1.00 0.00 ? 46  SER A HB2  1  
ATOM 633   H HB3  . SER A 1 46  ? -1.442  -12.237 -1.989  1.00 0.00 ? 46  SER A HB3  1  
ATOM 634   H HG   . SER A 1 46  ? -1.635  -12.388 -4.118  1.00 0.00 ? 46  SER A HG   1  
ATOM 635   N N    . GLY A 1 47  ? 1.469   -9.010  -2.345  1.00 0.00 ? 47  GLY A N    1  
ATOM 636   C CA   . GLY A 1 47  ? 2.371   -8.179  -3.121  1.00 0.00 ? 47  GLY A CA   1  
ATOM 637   C C    . GLY A 1 47  ? 3.041   -7.109  -2.282  1.00 0.00 ? 47  GLY A C    1  
ATOM 638   O O    . GLY A 1 47  ? 2.820   -7.030  -1.073  1.00 0.00 ? 47  GLY A O    1  
ATOM 639   H H    . GLY A 1 47  ? 1.714   -9.277  -1.434  1.00 0.00 ? 47  GLY A H    1  
ATOM 640   H HA2  . GLY A 1 47  ? 3.132   -8.806  -3.561  1.00 0.00 ? 47  GLY A HA2  1  
ATOM 641   H HA3  . GLY A 1 47  ? 1.810   -7.702  -3.912  1.00 0.00 ? 47  GLY A HA3  1  
ATOM 642   N N    . ILE A 1 48  ? 3.862   -6.285  -2.923  1.00 0.00 ? 48  ILE A N    1  
ATOM 643   C CA   . ILE A 1 48  ? 4.567   -5.215  -2.228  1.00 0.00 ? 48  ILE A CA   1  
ATOM 644   C C    . ILE A 1 48  ? 3.745   -3.930  -2.220  1.00 0.00 ? 48  ILE A C    1  
ATOM 645   O O    . ILE A 1 48  ? 3.366   -3.417  -3.273  1.00 0.00 ? 48  ILE A O    1  
ATOM 646   C CB   . ILE A 1 48  ? 5.937   -4.931  -2.872  1.00 0.00 ? 48  ILE A CB   1  
ATOM 647   C CG1  . ILE A 1 48  ? 6.813   -6.185  -2.832  1.00 0.00 ? 48  ILE A CG1  1  
ATOM 648   C CG2  . ILE A 1 48  ? 6.625   -3.775  -2.163  1.00 0.00 ? 48  ILE A CG2  1  
ATOM 649   C CD1  . ILE A 1 48  ? 6.949   -6.784  -1.450  1.00 0.00 ? 48  ILE A CD1  1  
ATOM 650   H H    . ILE A 1 48  ? 3.997   -6.398  -3.887  1.00 0.00 ? 48  ILE A H    1  
ATOM 651   H HA   . ILE A 1 48  ? 4.729   -5.532  -1.208  1.00 0.00 ? 48  ILE A HA   1  
ATOM 652   H HB   . ILE A 1 48  ? 5.774   -4.647  -3.900  1.00 0.00 ? 48  ILE A HB   1  
ATOM 653   H HG12 . ILE A 1 48  ? 6.385   -6.936  -3.477  1.00 0.00 ? 48  ILE A HG12 1  
ATOM 654   H HG13 . ILE A 1 48  ? 7.803   -5.934  -3.185  1.00 0.00 ? 48  ILE A HG13 1  
ATOM 655   H HG21 . ILE A 1 48  ? 7.092   -3.131  -2.895  1.00 0.00 ? 48  ILE A HG21 1  
ATOM 656   H HG22 . ILE A 1 48  ? 5.896   -3.211  -1.602  1.00 0.00 ? 48  ILE A HG22 1  
ATOM 657   H HG23 . ILE A 1 48  ? 7.377   -4.160  -1.491  1.00 0.00 ? 48  ILE A HG23 1  
ATOM 658   H HD11 . ILE A 1 48  ? 6.034   -7.293  -1.186  1.00 0.00 ? 48  ILE A HD11 1  
ATOM 659   H HD12 . ILE A 1 48  ? 7.769   -7.486  -1.440  1.00 0.00 ? 48  ILE A HD12 1  
ATOM 660   H HD13 . ILE A 1 48  ? 7.141   -5.997  -0.734  1.00 0.00 ? 48  ILE A HD13 1  
ATOM 661   N N    . TYR A 1 49  ? 3.476   -3.414  -1.026  1.00 0.00 ? 49  TYR A N    1  
ATOM 662   C CA   . TYR A 1 49  ? 2.699   -2.189  -0.880  1.00 0.00 ? 49  TYR A CA   1  
ATOM 663   C C    . TYR A 1 49  ? 3.441   -1.173  -0.017  1.00 0.00 ? 49  TYR A C    1  
ATOM 664   O O    . TYR A 1 49  ? 4.220   -1.539  0.862   1.00 0.00 ? 49  TYR A O    1  
ATOM 665   C CB   . TYR A 1 49  ? 1.333   -2.497  -0.264  1.00 0.00 ? 49  TYR A CB   1  
ATOM 666   C CG   . TYR A 1 49  ? 0.469   -3.392  -1.124  1.00 0.00 ? 49  TYR A CG   1  
ATOM 667   C CD1  . TYR A 1 49  ? 0.648   -4.770  -1.124  1.00 0.00 ? 49  TYR A CD1  1  
ATOM 668   C CD2  . TYR A 1 49  ? -0.525  -2.861  -1.936  1.00 0.00 ? 49  TYR A CD2  1  
ATOM 669   C CE1  . TYR A 1 49  ? -0.138  -5.592  -1.908  1.00 0.00 ? 49  TYR A CE1  1  
ATOM 670   C CE2  . TYR A 1 49  ? -1.317  -3.675  -2.722  1.00 0.00 ? 49  TYR A CE2  1  
ATOM 671   C CZ   . TYR A 1 49  ? -1.120  -5.040  -2.704  1.00 0.00 ? 49  TYR A CZ   1  
ATOM 672   O OH   . TYR A 1 49  ? -1.905  -5.855  -3.487  1.00 0.00 ? 49  TYR A OH   1  
ATOM 673   H H    . TYR A 1 49  ? 3.806   -3.869  -0.223  1.00 0.00 ? 49  TYR A H    1  
ATOM 674   H HA   . TYR A 1 49  ? 2.553   -1.770  -1.865  1.00 0.00 ? 49  TYR A HA   1  
ATOM 675   H HB2  . TYR A 1 49  ? 1.476   -2.988  0.686   1.00 0.00 ? 49  TYR A HB2  1  
ATOM 676   H HB3  . TYR A 1 49  ? 0.799   -1.571  -0.108  1.00 0.00 ? 49  TYR A HB3  1  
ATOM 677   H HD1  . TYR A 1 49  ? 1.418   -5.200  -0.499  1.00 0.00 ? 49  TYR A HD1  1  
ATOM 678   H HD2  . TYR A 1 49  ? -0.676  -1.791  -1.947  1.00 0.00 ? 49  TYR A HD2  1  
ATOM 679   H HE1  . TYR A 1 49  ? 0.016   -6.661  -1.895  1.00 0.00 ? 49  TYR A HE1  1  
ATOM 680   H HE2  . TYR A 1 49  ? -2.085  -3.243  -3.346  1.00 0.00 ? 49  TYR A HE2  1  
ATOM 681   H HH   . TYR A 1 49  ? -1.766  -6.771  -3.236  1.00 0.00 ? 49  TYR A HH   1  
ATOM 682   N N    . VAL A 1 50  ? 3.192   0.107   -0.276  1.00 0.00 ? 50  VAL A N    1  
ATOM 683   C CA   . VAL A 1 50  ? 3.834   1.178   0.477   1.00 0.00 ? 50  VAL A CA   1  
ATOM 684   C C    . VAL A 1 50  ? 3.271   1.270   1.891   1.00 0.00 ? 50  VAL A C    1  
ATOM 685   O O    . VAL A 1 50  ? 2.239   1.899   2.120   1.00 0.00 ? 50  VAL A O    1  
ATOM 686   C CB   . VAL A 1 50  ? 3.659   2.539   -0.223  1.00 0.00 ? 50  VAL A CB   1  
ATOM 687   C CG1  . VAL A 1 50  ? 4.252   3.655   0.623   1.00 0.00 ? 50  VAL A CG1  1  
ATOM 688   C CG2  . VAL A 1 50  ? 4.293   2.512   -1.606  1.00 0.00 ? 50  VAL A CG2  1  
ATOM 689   H H    . VAL A 1 50  ? 2.561   0.336   -0.990  1.00 0.00 ? 50  VAL A H    1  
ATOM 690   H HA   . VAL A 1 50  ? 4.891   0.959   0.533   1.00 0.00 ? 50  VAL A HA   1  
ATOM 691   H HB   . VAL A 1 50  ? 2.602   2.728   -0.338  1.00 0.00 ? 50  VAL A HB   1  
ATOM 692   H HG11 . VAL A 1 50  ? 5.177   3.991   0.178   1.00 0.00 ? 50  VAL A HG11 1  
ATOM 693   H HG12 . VAL A 1 50  ? 3.555   4.479   0.673   1.00 0.00 ? 50  VAL A HG12 1  
ATOM 694   H HG13 . VAL A 1 50  ? 4.446   3.286   1.620   1.00 0.00 ? 50  VAL A HG13 1  
ATOM 695   H HG21 . VAL A 1 50  ? 3.868   1.703   -2.180  1.00 0.00 ? 50  VAL A HG21 1  
ATOM 696   H HG22 . VAL A 1 50  ? 4.101   3.449   -2.108  1.00 0.00 ? 50  VAL A HG22 1  
ATOM 697   H HG23 . VAL A 1 50  ? 5.358   2.367   -1.511  1.00 0.00 ? 50  VAL A HG23 1  
ATOM 698   N N    . LYS A 1 51  ? 3.958   0.637   2.836   1.00 0.00 ? 51  LYS A N    1  
ATOM 699   C CA   . LYS A 1 51  ? 3.529   0.648   4.230   1.00 0.00 ? 51  LYS A CA   1  
ATOM 700   C C    . LYS A 1 51  ? 3.441   2.075   4.761   1.00 0.00 ? 51  LYS A C    1  
ATOM 701   O O    . LYS A 1 51  ? 2.466   2.444   5.417   1.00 0.00 ? 51  LYS A O    1  
ATOM 702   C CB   . LYS A 1 51  ? 4.497   -0.169  5.089   1.00 0.00 ? 51  LYS A CB   1  
ATOM 703   C CG   . LYS A 1 51  ? 4.109   -0.225  6.556   1.00 0.00 ? 51  LYS A CG   1  
ATOM 704   C CD   . LYS A 1 51  ? 2.918   -1.142  6.783   1.00 0.00 ? 51  LYS A CD   1  
ATOM 705   C CE   . LYS A 1 51  ? 2.843   -1.611  8.228   1.00 0.00 ? 51  LYS A CE   1  
ATOM 706   N NZ   . LYS A 1 51  ? 1.440   -1.867  8.657   1.00 0.00 ? 51  LYS A NZ   1  
ATOM 707   H H    . LYS A 1 51  ? 4.774   0.152   2.591   1.00 0.00 ? 51  LYS A H    1  
ATOM 708   H HA   . LYS A 1 51  ? 2.549   0.197   4.279   1.00 0.00 ? 51  LYS A HA   1  
ATOM 709   H HB2  . LYS A 1 51  ? 4.533   -1.179  4.709   1.00 0.00 ? 51  LYS A HB2  1  
ATOM 710   H HB3  . LYS A 1 51  ? 5.482   0.270   5.016   1.00 0.00 ? 51  LYS A HB3  1  
ATOM 711   H HG2  . LYS A 1 51  ? 4.947   -0.594  7.128   1.00 0.00 ? 51  LYS A HG2  1  
ATOM 712   H HG3  . LYS A 1 51  ? 3.853   0.771   6.890   1.00 0.00 ? 51  LYS A HG3  1  
ATOM 713   H HD2  . LYS A 1 51  ? 2.011   -0.607  6.544   1.00 0.00 ? 51  LYS A HD2  1  
ATOM 714   H HD3  . LYS A 1 51  ? 3.011   -2.004  6.138   1.00 0.00 ? 51  LYS A HD3  1  
ATOM 715   H HE2  . LYS A 1 51  ? 3.413   -2.523  8.327   1.00 0.00 ? 51  LYS A HE2  1  
ATOM 716   H HE3  . LYS A 1 51  ? 3.271   -0.849  8.863   1.00 0.00 ? 51  LYS A HE3  1  
ATOM 717   H HZ1  . LYS A 1 51  ? 1.002   -2.578  8.036   1.00 0.00 ? 51  LYS A HZ1  1  
ATOM 718   H HZ2  . LYS A 1 51  ? 0.885   -0.989  8.605   1.00 0.00 ? 51  LYS A HZ2  1  
ATOM 719   H HZ3  . LYS A 1 51  ? 1.424   -2.219  9.635   1.00 0.00 ? 51  LYS A HZ3  1  
ATOM 720   N N    . SER A 1 52  ? 4.463   2.873   4.473   1.00 0.00 ? 52  SER A N    1  
ATOM 721   C CA   . SER A 1 52  ? 4.502   4.259   4.924   1.00 0.00 ? 52  SER A CA   1  
ATOM 722   C C    . SER A 1 52  ? 5.468   5.080   4.075   1.00 0.00 ? 52  SER A C    1  
ATOM 723   O O    . SER A 1 52  ? 6.104   4.559   3.159   1.00 0.00 ? 52  SER A O    1  
ATOM 724   C CB   . SER A 1 52  ? 4.914   4.328   6.396   1.00 0.00 ? 52  SER A CB   1  
ATOM 725   O OG   . SER A 1 52  ? 3.809   4.082   7.247   1.00 0.00 ? 52  SER A OG   1  
ATOM 726   H H    . SER A 1 52  ? 5.211   2.520   3.946   1.00 0.00 ? 52  SER A H    1  
ATOM 727   H HA   . SER A 1 52  ? 3.509   4.670   4.818   1.00 0.00 ? 52  SER A HA   1  
ATOM 728   H HB2  . SER A 1 52  ? 5.674   3.586   6.589   1.00 0.00 ? 52  SER A HB2  1  
ATOM 729   H HB3  . SER A 1 52  ? 5.308   5.310   6.611   1.00 0.00 ? 52  SER A HB3  1  
ATOM 730   H HG   . SER A 1 52  ? 3.725   3.138   7.400   1.00 0.00 ? 52  SER A HG   1  
ATOM 731   N N    . VAL A 1 53  ? 5.571   6.369   4.386   1.00 0.00 ? 53  VAL A N    1  
ATOM 732   C CA   . VAL A 1 53  ? 6.459   7.263   3.653   1.00 0.00 ? 53  VAL A CA   1  
ATOM 733   C C    . VAL A 1 53  ? 7.216   8.185   4.602   1.00 0.00 ? 53  VAL A C    1  
ATOM 734   O O    . VAL A 1 53  ? 6.631   9.081   5.212   1.00 0.00 ? 53  VAL A O    1  
ATOM 735   C CB   . VAL A 1 53  ? 5.680   8.119   2.637   1.00 0.00 ? 53  VAL A CB   1  
ATOM 736   C CG1  . VAL A 1 53  ? 6.626   9.026   1.866   1.00 0.00 ? 53  VAL A CG1  1  
ATOM 737   C CG2  . VAL A 1 53  ? 4.889   7.231   1.688   1.00 0.00 ? 53  VAL A CG2  1  
ATOM 738   H H    . VAL A 1 53  ? 5.038   6.726   5.126   1.00 0.00 ? 53  VAL A H    1  
ATOM 739   H HA   . VAL A 1 53  ? 7.170   6.657   3.111   1.00 0.00 ? 53  VAL A HA   1  
ATOM 740   H HB   . VAL A 1 53  ? 4.983   8.741   3.179   1.00 0.00 ? 53  VAL A HB   1  
ATOM 741   H HG11 . VAL A 1 53  ? 6.088   9.510   1.064   1.00 0.00 ? 53  VAL A HG11 1  
ATOM 742   H HG12 . VAL A 1 53  ? 7.031   9.774   2.532   1.00 0.00 ? 53  VAL A HG12 1  
ATOM 743   H HG13 . VAL A 1 53  ? 7.432   8.437   1.452   1.00 0.00 ? 53  VAL A HG13 1  
ATOM 744   H HG21 . VAL A 1 53  ? 4.840   6.230   2.090   1.00 0.00 ? 53  VAL A HG21 1  
ATOM 745   H HG22 . VAL A 1 53  ? 3.888   7.623   1.577   1.00 0.00 ? 53  VAL A HG22 1  
ATOM 746   H HG23 . VAL A 1 53  ? 5.375   7.209   0.725   1.00 0.00 ? 53  VAL A HG23 1  
ATOM 747   N N    . ILE A 1 54  ? 8.520   7.959   4.723   1.00 0.00 ? 54  ILE A N    1  
ATOM 748   C CA   . ILE A 1 54  ? 9.358   8.770   5.597   1.00 0.00 ? 54  ILE A CA   1  
ATOM 749   C C    . ILE A 1 54  ? 9.331   10.236  5.178   1.00 0.00 ? 54  ILE A C    1  
ATOM 750   O O    . ILE A 1 54  ? 9.562   10.581  4.019   1.00 0.00 ? 54  ILE A O    1  
ATOM 751   C CB   . ILE A 1 54  ? 10.816  8.275   5.598   1.00 0.00 ? 54  ILE A CB   1  
ATOM 752   C CG1  . ILE A 1 54  ? 10.930  6.957   6.367   1.00 0.00 ? 54  ILE A CG1  1  
ATOM 753   C CG2  . ILE A 1 54  ? 11.733  9.328   6.202   1.00 0.00 ? 54  ILE A CG2  1  
ATOM 754   C CD1  . ILE A 1 54  ? 10.568  5.743   5.542   1.00 0.00 ? 54  ILE A CD1  1  
ATOM 755   H H    . ILE A 1 54  ? 8.928   7.230   4.211   1.00 0.00 ? 54  ILE A H    1  
ATOM 756   H HA   . ILE A 1 54  ? 8.970   8.687   6.602   1.00 0.00 ? 54  ILE A HA   1  
ATOM 757   H HB   . ILE A 1 54  ? 11.119  8.113   4.574   1.00 0.00 ? 54  ILE A HB   1  
ATOM 758   H HG12 . ILE A 1 54  ? 11.945  6.834   6.710   1.00 0.00 ? 54  ILE A HG12 1  
ATOM 759   H HG13 . ILE A 1 54  ? 10.268  6.989   7.220   1.00 0.00 ? 54  ILE A HG13 1  
ATOM 760   H HG21 . ILE A 1 54  ? 11.666  10.238  5.623   1.00 0.00 ? 54  ILE A HG21 1  
ATOM 761   H HG22 . ILE A 1 54  ? 11.431  9.527   7.219   1.00 0.00 ? 54  ILE A HG22 1  
ATOM 762   H HG23 . ILE A 1 54  ? 12.751  8.969   6.191   1.00 0.00 ? 54  ILE A HG23 1  
ATOM 763   H HD11 . ILE A 1 54  ? 11.160  5.731   4.639   1.00 0.00 ? 54  ILE A HD11 1  
ATOM 764   H HD12 . ILE A 1 54  ? 10.762  4.848   6.113   1.00 0.00 ? 54  ILE A HD12 1  
ATOM 765   H HD13 . ILE A 1 54  ? 9.519   5.783   5.283   1.00 0.00 ? 54  ILE A HD13 1  
ATOM 766   N N    . PRO A 1 55  ? 9.044   11.122  6.144   1.00 0.00 ? 55  PRO A N    1  
ATOM 767   C CA   . PRO A 1 55  ? 8.983   12.566  5.900   1.00 0.00 ? 55  PRO A CA   1  
ATOM 768   C C    . PRO A 1 55  ? 10.357  13.166  5.622   1.00 0.00 ? 55  PRO A C    1  
ATOM 769   O O    . PRO A 1 55  ? 11.368  12.691  6.137   1.00 0.00 ? 55  PRO A O    1  
ATOM 770   C CB   . PRO A 1 55  ? 8.411   13.122  7.207   1.00 0.00 ? 55  PRO A CB   1  
ATOM 771   C CG   . PRO A 1 55  ? 8.782   12.116  8.241   1.00 0.00 ? 55  PRO A CG   1  
ATOM 772   C CD   . PRO A 1 55  ? 8.759   10.782  7.548   1.00 0.00 ? 55  PRO A CD   1  
ATOM 773   H HA   . PRO A 1 55  ? 8.316   12.803  5.084   1.00 0.00 ? 55  PRO A HA   1  
ATOM 774   H HB2  . PRO A 1 55  ? 8.854   14.086  7.415   1.00 0.00 ? 55  PRO A HB2  1  
ATOM 775   H HB3  . PRO A 1 55  ? 7.340   13.223  7.121   1.00 0.00 ? 55  PRO A HB3  1  
ATOM 776   H HG2  . PRO A 1 55  ? 9.771   12.325  8.619   1.00 0.00 ? 55  PRO A HG2  1  
ATOM 777   H HG3  . PRO A 1 55  ? 8.060   12.133  9.044   1.00 0.00 ? 55  PRO A HG3  1  
ATOM 778   H HD2  . PRO A 1 55  ? 9.523   10.134  7.951   1.00 0.00 ? 55  PRO A HD2  1  
ATOM 779   H HD3  . PRO A 1 55  ? 7.785   10.324  7.642   1.00 0.00 ? 55  PRO A HD3  1  
ATOM 780   N N    . GLY A 1 56  ? 10.385  14.215  4.805   1.00 0.00 ? 56  GLY A N    1  
ATOM 781   C CA   . GLY A 1 56  ? 11.641  14.863  4.474   1.00 0.00 ? 56  GLY A CA   1  
ATOM 782   C C    . GLY A 1 56  ? 12.511  14.013  3.570   1.00 0.00 ? 56  GLY A C    1  
ATOM 783   O O    . GLY A 1 56  ? 13.738  14.107  3.609   1.00 0.00 ? 56  GLY A O    1  
ATOM 784   H H    . GLY A 1 56  ? 9.547   14.551  4.425   1.00 0.00 ? 56  GLY A H    1  
ATOM 785   H HA2  . GLY A 1 56  ? 11.431  15.799  3.978   1.00 0.00 ? 56  GLY A HA2  1  
ATOM 786   H HA3  . GLY A 1 56  ? 12.181  15.065  5.387   1.00 0.00 ? 56  GLY A HA3  1  
ATOM 787   N N    . SER A 1 57  ? 11.876  13.178  2.753   1.00 0.00 ? 57  SER A N    1  
ATOM 788   C CA   . SER A 1 57  ? 12.600  12.303  1.839   1.00 0.00 ? 57  SER A CA   1  
ATOM 789   C C    . SER A 1 57  ? 12.176  12.554  0.396   1.00 0.00 ? 57  SER A C    1  
ATOM 790   O O    . SER A 1 57  ? 11.257  13.330  0.133   1.00 0.00 ? 57  SER A O    1  
ATOM 791   C CB   . SER A 1 57  ? 12.361  10.837  2.205   1.00 0.00 ? 57  SER A CB   1  
ATOM 792   O OG   . SER A 1 57  ? 11.182  10.344  1.592   1.00 0.00 ? 57  SER A OG   1  
ATOM 793   H H    . SER A 1 57  ? 10.896  13.148  2.769   1.00 0.00 ? 57  SER A H    1  
ATOM 794   H HA   . SER A 1 57  ? 13.653  12.522  1.936   1.00 0.00 ? 57  SER A HA   1  
ATOM 795   H HB2  . SER A 1 57  ? 13.200  10.244  1.874   1.00 0.00 ? 57  SER A HB2  1  
ATOM 796   H HB3  . SER A 1 57  ? 12.258  10.749  3.277   1.00 0.00 ? 57  SER A HB3  1  
ATOM 797   H HG   . SER A 1 57  ? 10.521  10.166  2.264   1.00 0.00 ? 57  SER A HG   1  
ATOM 798   N N    . ALA A 1 58  ? 12.852  11.892  -0.537  1.00 0.00 ? 58  ALA A N    1  
ATOM 799   C CA   . ALA A 1 58  ? 12.545  12.041  -1.954  1.00 0.00 ? 58  ALA A CA   1  
ATOM 800   C C    . ALA A 1 58  ? 11.063  11.803  -2.223  1.00 0.00 ? 58  ALA A C    1  
ATOM 801   O O    . ALA A 1 58  ? 10.380  12.657  -2.788  1.00 0.00 ? 58  ALA A O    1  
ATOM 802   C CB   . ALA A 1 58  ? 13.393  11.087  -2.782  1.00 0.00 ? 58  ALA A CB   1  
ATOM 803   H H    . ALA A 1 58  ? 13.574  11.288  -0.266  1.00 0.00 ? 58  ALA A H    1  
ATOM 804   H HA   . ALA A 1 58  ? 12.795  13.051  -2.246  1.00 0.00 ? 58  ALA A HA   1  
ATOM 805   H HB1  . ALA A 1 58  ? 13.079  10.071  -2.591  1.00 0.00 ? 58  ALA A HB1  1  
ATOM 806   H HB2  . ALA A 1 58  ? 13.268  11.312  -3.830  1.00 0.00 ? 58  ALA A HB2  1  
ATOM 807   H HB3  . ALA A 1 58  ? 14.431  11.200  -2.509  1.00 0.00 ? 58  ALA A HB3  1  
ATOM 808   N N    . ALA A 1 59  ? 10.572  10.638  -1.814  1.00 0.00 ? 59  ALA A N    1  
ATOM 809   C CA   . ALA A 1 59  ? 9.170   10.289  -2.009  1.00 0.00 ? 59  ALA A CA   1  
ATOM 810   C C    . ALA A 1 59  ? 8.252   11.382  -1.474  1.00 0.00 ? 59  ALA A C    1  
ATOM 811   O O    . ALA A 1 59  ? 7.411   11.912  -2.201  1.00 0.00 ? 59  ALA A O    1  
ATOM 812   C CB   . ALA A 1 59  ? 8.859   8.960   -1.337  1.00 0.00 ? 59  ALA A CB   1  
ATOM 813   H H    . ALA A 1 59  ? 11.166  9.998   -1.369  1.00 0.00 ? 59  ALA A H    1  
ATOM 814   H HA   . ALA A 1 59  ? 8.999   10.176  -3.070  1.00 0.00 ? 59  ALA A HA   1  
ATOM 815   H HB1  . ALA A 1 59  ? 8.278   8.345   -2.009  1.00 0.00 ? 59  ALA A HB1  1  
ATOM 816   H HB2  . ALA A 1 59  ? 9.782   8.455   -1.094  1.00 0.00 ? 59  ALA A HB2  1  
ATOM 817   H HB3  . ALA A 1 59  ? 8.296   9.137   -0.433  1.00 0.00 ? 59  ALA A HB3  1  
ATOM 818   N N    . TYR A 1 60  ? 8.418   11.715  -0.199  1.00 0.00 ? 60  TYR A N    1  
ATOM 819   C CA   . TYR A 1 60  ? 7.602   12.744  0.435   1.00 0.00 ? 60  TYR A CA   1  
ATOM 820   C C    . TYR A 1 60  ? 7.657   14.048  -0.356  1.00 0.00 ? 60  TYR A C    1  
ATOM 821   O O    . TYR A 1 60  ? 6.624   14.629  -0.690  1.00 0.00 ? 60  TYR A O    1  
ATOM 822   C CB   . TYR A 1 60  ? 8.072   12.985  1.870   1.00 0.00 ? 60  TYR A CB   1  
ATOM 823   C CG   . TYR A 1 60  ? 7.242   14.007  2.615   1.00 0.00 ? 60  TYR A CG   1  
ATOM 824   C CD1  . TYR A 1 60  ? 6.049   13.647  3.229   1.00 0.00 ? 60  TYR A CD1  1  
ATOM 825   C CD2  . TYR A 1 60  ? 7.653   15.331  2.707   1.00 0.00 ? 60  TYR A CD2  1  
ATOM 826   C CE1  . TYR A 1 60  ? 5.287   14.577  3.910   1.00 0.00 ? 60  TYR A CE1  1  
ATOM 827   C CE2  . TYR A 1 60  ? 6.899   16.267  3.387   1.00 0.00 ? 60  TYR A CE2  1  
ATOM 828   C CZ   . TYR A 1 60  ? 5.717   15.886  3.987   1.00 0.00 ? 60  TYR A CZ   1  
ATOM 829   O OH   . TYR A 1 60  ? 4.962   16.815  4.665   1.00 0.00 ? 60  TYR A OH   1  
ATOM 830   H H    . TYR A 1 60  ? 9.105   11.258  0.330   1.00 0.00 ? 60  TYR A H    1  
ATOM 831   H HA   . TYR A 1 60  ? 6.581   12.392  0.455   1.00 0.00 ? 60  TYR A HA   1  
ATOM 832   H HB2  . TYR A 1 60  ? 8.024   12.057  2.418   1.00 0.00 ? 60  TYR A HB2  1  
ATOM 833   H HB3  . TYR A 1 60  ? 9.093   13.336  1.853   1.00 0.00 ? 60  TYR A HB3  1  
ATOM 834   H HD1  . TYR A 1 60  ? 5.716   12.621  3.168   1.00 0.00 ? 60  TYR A HD1  1  
ATOM 835   H HD2  . TYR A 1 60  ? 8.579   15.627  2.236   1.00 0.00 ? 60  TYR A HD2  1  
ATOM 836   H HE1  . TYR A 1 60  ? 4.362   14.279  4.380   1.00 0.00 ? 60  TYR A HE1  1  
ATOM 837   H HE2  . TYR A 1 60  ? 7.234   17.292  3.447   1.00 0.00 ? 60  TYR A HE2  1  
ATOM 838   H HH   . TYR A 1 60  ? 4.544   17.408  4.037   1.00 0.00 ? 60  TYR A HH   1  
ATOM 839   N N    . HIS A 1 61  ? 8.871   14.501  -0.653  1.00 0.00 ? 61  HIS A N    1  
ATOM 840   C CA   . HIS A 1 61  ? 9.063   15.735  -1.406  1.00 0.00 ? 61  HIS A CA   1  
ATOM 841   C C    . HIS A 1 61  ? 8.314   15.683  -2.735  1.00 0.00 ? 61  HIS A C    1  
ATOM 842   O O    . HIS A 1 61  ? 7.509   16.562  -3.039  1.00 0.00 ? 61  HIS A O    1  
ATOM 843   C CB   . HIS A 1 61  ? 10.552  15.978  -1.656  1.00 0.00 ? 61  HIS A CB   1  
ATOM 844   C CG   . HIS A 1 61  ? 11.340  16.204  -0.403  1.00 0.00 ? 61  HIS A CG   1  
ATOM 845   N ND1  . HIS A 1 61  ? 10.964  17.105  0.571   1.00 0.00 ? 61  HIS A ND1  1  
ATOM 846   C CD2  . HIS A 1 61  ? 12.489  15.638  0.034   1.00 0.00 ? 61  HIS A CD2  1  
ATOM 847   C CE1  . HIS A 1 61  ? 11.849  17.085  1.552   1.00 0.00 ? 61  HIS A CE1  1  
ATOM 848   N NE2  . HIS A 1 61  ? 12.785  16.202  1.251   1.00 0.00 ? 61  HIS A NE2  1  
ATOM 849   H H    . HIS A 1 61  ? 9.656   13.993  -0.359  1.00 0.00 ? 61  HIS A H    1  
ATOM 850   H HA   . HIS A 1 61  ? 8.668   16.548  -0.817  1.00 0.00 ? 61  HIS A HA   1  
ATOM 851   H HB2  . HIS A 1 61  ? 10.971  15.120  -2.161  1.00 0.00 ? 61  HIS A HB2  1  
ATOM 852   H HB3  . HIS A 1 61  ? 10.667  16.851  -2.283  1.00 0.00 ? 61  HIS A HB3  1  
ATOM 853   H HD1  . HIS A 1 61  ? 10.169  17.676  0.546   1.00 0.00 ? 61  HIS A HD1  1  
ATOM 854   H HD2  . HIS A 1 61  ? 13.068  14.882  -0.478  1.00 0.00 ? 61  HIS A HD2  1  
ATOM 855   H HE1  . HIS A 1 61  ? 11.814  17.687  2.447   1.00 0.00 ? 61  HIS A HE1  1  
ATOM 856   H HE2  . HIS A 1 61  ? 13.604  16.051  1.766   1.00 0.00 ? 61  HIS A HE2  1  
ATOM 857   N N    . ASN A 1 62  ? 8.587   14.647  -3.522  1.00 0.00 ? 62  ASN A N    1  
ATOM 858   C CA   . ASN A 1 62  ? 7.939   14.481  -4.818  1.00 0.00 ? 62  ASN A CA   1  
ATOM 859   C C    . ASN A 1 62  ? 6.425   14.619  -4.692  1.00 0.00 ? 62  ASN A C    1  
ATOM 860   O O    . ASN A 1 62  ? 5.803   15.417  -5.392  1.00 0.00 ? 62  ASN A O    1  
ATOM 861   C CB   . ASN A 1 62  ? 8.291   13.118  -5.416  1.00 0.00 ? 62  ASN A CB   1  
ATOM 862   C CG   . ASN A 1 62  ? 8.311   13.139  -6.933  1.00 0.00 ? 62  ASN A CG   1  
ATOM 863   O OD1  . ASN A 1 62  ? 8.818   14.079  -7.545  1.00 0.00 ? 62  ASN A OD1  1  
ATOM 864   N ND2  . ASN A 1 62  ? 7.756   12.100  -7.546  1.00 0.00 ? 62  ASN A ND2  1  
ATOM 865   H H    . ASN A 1 62  ? 9.238   13.978  -3.224  1.00 0.00 ? 62  ASN A H    1  
ATOM 866   H HA   . ASN A 1 62  ? 8.306   15.257  -5.473  1.00 0.00 ? 62  ASN A HA   1  
ATOM 867   H HB2  . ASN A 1 62  ? 9.269   12.819  -5.067  1.00 0.00 ? 62  ASN A HB2  1  
ATOM 868   H HB3  . ASN A 1 62  ? 7.561   12.391  -5.094  1.00 0.00 ? 62  ASN A HB3  1  
ATOM 869   H HD21 . ASN A 1 62  ? 7.370   11.388  -6.994  1.00 0.00 ? 62  ASN A HD21 1  
ATOM 870   H HD22 . ASN A 1 62  ? 7.755   12.088  -8.526  1.00 0.00 ? 62  ASN A HD22 1  
ATOM 871   N N    . GLY A 1 63  ? 5.838   13.835  -3.793  1.00 0.00 ? 63  GLY A N    1  
ATOM 872   C CA   . GLY A 1 63  ? 4.402   13.885  -3.590  1.00 0.00 ? 63  GLY A CA   1  
ATOM 873   C C    . GLY A 1 63  ? 3.644   13.052  -4.604  1.00 0.00 ? 63  GLY A C    1  
ATOM 874   O O    . GLY A 1 63  ? 2.505   13.367  -4.952  1.00 0.00 ? 63  GLY A O    1  
ATOM 875   H H    . GLY A 1 63  ? 6.385   13.218  -3.262  1.00 0.00 ? 63  GLY A H    1  
ATOM 876   H HA2  . GLY A 1 63  ? 4.176   13.521  -2.599  1.00 0.00 ? 63  GLY A HA2  1  
ATOM 877   H HA3  . GLY A 1 63  ? 4.074   14.912  -3.668  1.00 0.00 ? 63  GLY A HA3  1  
ATOM 878   N N    . HIS A 1 64  ? 4.277   11.986  -5.083  1.00 0.00 ? 64  HIS A N    1  
ATOM 879   C CA   . HIS A 1 64  ? 3.655   11.105  -6.065  1.00 0.00 ? 64  HIS A CA   1  
ATOM 880   C C    . HIS A 1 64  ? 3.443   9.709   -5.486  1.00 0.00 ? 64  HIS A C    1  
ATOM 881   O O    . HIS A 1 64  ? 2.410   9.081   -5.719  1.00 0.00 ? 64  HIS A O    1  
ATOM 882   C CB   . HIS A 1 64  ? 4.518   11.021  -7.325  1.00 0.00 ? 64  HIS A CB   1  
ATOM 883   C CG   . HIS A 1 64  ? 4.466   12.257  -8.169  1.00 0.00 ? 64  HIS A CG   1  
ATOM 884   N ND1  . HIS A 1 64  ? 4.603   12.238  -9.541  1.00 0.00 ? 64  HIS A ND1  1  
ATOM 885   C CD2  . HIS A 1 64  ? 4.290   13.555  -7.828  1.00 0.00 ? 64  HIS A CD2  1  
ATOM 886   C CE1  . HIS A 1 64  ? 4.515   13.471  -10.007 1.00 0.00 ? 64  HIS A CE1  1  
ATOM 887   N NE2  . HIS A 1 64  ? 4.325   14.290  -8.988  1.00 0.00 ? 64  HIS A NE2  1  
ATOM 888   H H    . HIS A 1 64  ? 5.183   11.786  -4.768  1.00 0.00 ? 64  HIS A H    1  
ATOM 889   H HA   . HIS A 1 64  ? 2.694   11.523  -6.325  1.00 0.00 ? 64  HIS A HA   1  
ATOM 890   H HB2  . HIS A 1 64  ? 5.546   10.858  -7.039  1.00 0.00 ? 64  HIS A HB2  1  
ATOM 891   H HB3  . HIS A 1 64  ? 4.181   10.191  -7.930  1.00 0.00 ? 64  HIS A HB3  1  
ATOM 892   H HD1  . HIS A 1 64  ? 4.746   11.440  -10.091 1.00 0.00 ? 64  HIS A HD1  1  
ATOM 893   H HD2  . HIS A 1 64  ? 4.149   13.943  -6.829  1.00 0.00 ? 64  HIS A HD2  1  
ATOM 894   H HE1  . HIS A 1 64  ? 4.586   13.762  -11.045 1.00 0.00 ? 64  HIS A HE1  1  
ATOM 895   H HE2  . HIS A 1 64  ? 4.311   15.267  -9.045  1.00 0.00 ? 64  HIS A HE2  1  
ATOM 896   N N    . ILE A 1 65  ? 4.428   9.230   -4.733  1.00 0.00 ? 65  ILE A N    1  
ATOM 897   C CA   . ILE A 1 65  ? 4.348   7.910   -4.121  1.00 0.00 ? 65  ILE A CA   1  
ATOM 898   C C    . ILE A 1 65  ? 3.891   8.003   -2.670  1.00 0.00 ? 65  ILE A C    1  
ATOM 899   O O    . ILE A 1 65  ? 4.520   8.676   -1.853  1.00 0.00 ? 65  ILE A O    1  
ATOM 900   C CB   . ILE A 1 65  ? 5.704   7.182   -4.175  1.00 0.00 ? 65  ILE A CB   1  
ATOM 901   C CG1  . ILE A 1 65  ? 6.165   7.023   -5.625  1.00 0.00 ? 65  ILE A CG1  1  
ATOM 902   C CG2  . ILE A 1 65  ? 5.604   5.826   -3.493  1.00 0.00 ? 65  ILE A CG2  1  
ATOM 903   C CD1  . ILE A 1 65  ? 7.669   7.010   -5.783  1.00 0.00 ? 65  ILE A CD1  1  
ATOM 904   H H    . ILE A 1 65  ? 5.226   9.779   -4.585  1.00 0.00 ? 65  ILE A H    1  
ATOM 905   H HA   . ILE A 1 65  ? 3.627   7.328   -4.678  1.00 0.00 ? 65  ILE A HA   1  
ATOM 906   H HB   . ILE A 1 65  ? 6.428   7.776   -3.638  1.00 0.00 ? 65  ILE A HB   1  
ATOM 907   H HG12 . ILE A 1 65  ? 5.783   6.093   -6.018  1.00 0.00 ? 65  ILE A HG12 1  
ATOM 908   H HG13 . ILE A 1 65  ? 5.776   7.843   -6.211  1.00 0.00 ? 65  ILE A HG13 1  
ATOM 909   H HG21 . ILE A 1 65  ? 4.774   5.830   -2.802  1.00 0.00 ? 65  ILE A HG21 1  
ATOM 910   H HG22 . ILE A 1 65  ? 5.448   5.060   -4.238  1.00 0.00 ? 65  ILE A HG22 1  
ATOM 911   H HG23 . ILE A 1 65  ? 6.519   5.624   -2.956  1.00 0.00 ? 65  ILE A HG23 1  
ATOM 912   H HD11 . ILE A 1 65  ? 8.101   6.326   -5.067  1.00 0.00 ? 65  ILE A HD11 1  
ATOM 913   H HD12 . ILE A 1 65  ? 7.924   6.694   -6.783  1.00 0.00 ? 65  ILE A HD12 1  
ATOM 914   H HD13 . ILE A 1 65  ? 8.058   8.003   -5.610  1.00 0.00 ? 65  ILE A HD13 1  
ATOM 915   N N    . GLN A 1 66  ? 2.793   7.323   -2.356  1.00 0.00 ? 66  GLN A N    1  
ATOM 916   C CA   . GLN A 1 66  ? 2.253   7.328   -1.002  1.00 0.00 ? 66  GLN A CA   1  
ATOM 917   C C    . GLN A 1 66  ? 1.665   5.967   -0.644  1.00 0.00 ? 66  GLN A C    1  
ATOM 918   O O    . GLN A 1 66  ? 1.501   5.104   -1.507  1.00 0.00 ? 66  GLN A O    1  
ATOM 919   C CB   . GLN A 1 66  ? 1.182   8.412   -0.861  1.00 0.00 ? 66  GLN A CB   1  
ATOM 920   C CG   . GLN A 1 66  ? 1.614   9.766   -1.400  1.00 0.00 ? 66  GLN A CG   1  
ATOM 921   C CD   . GLN A 1 66  ? 1.270   9.948   -2.865  1.00 0.00 ? 66  GLN A CD   1  
ATOM 922   O OE1  . GLN A 1 66  ? 0.748   9.038   -3.510  1.00 0.00 ? 66  GLN A OE1  1  
ATOM 923   N NE2  . GLN A 1 66  ? 1.561   11.129  -3.400  1.00 0.00 ? 66  GLN A NE2  1  
ATOM 924   H H    . GLN A 1 66  ? 2.336   6.805   -3.051  1.00 0.00 ? 66  GLN A H    1  
ATOM 925   H HA   . GLN A 1 66  ? 3.063   7.546   -0.322  1.00 0.00 ? 66  GLN A HA   1  
ATOM 926   H HB2  . GLN A 1 66  ? 0.299   8.100   -1.398  1.00 0.00 ? 66  GLN A HB2  1  
ATOM 927   H HB3  . GLN A 1 66  ? 0.938   8.526   0.184   1.00 0.00 ? 66  GLN A HB3  1  
ATOM 928   H HG2  . GLN A 1 66  ? 1.119   10.540  -0.832  1.00 0.00 ? 66  GLN A HG2  1  
ATOM 929   H HG3  . GLN A 1 66  ? 2.683   9.862   -1.281  1.00 0.00 ? 66  GLN A HG3  1  
ATOM 930   H HE21 . GLN A 1 66  ? 1.977   11.806  -2.826  1.00 0.00 ? 66  GLN A HE21 1  
ATOM 931   H HE22 . GLN A 1 66  ? 1.350   11.273  -4.345  1.00 0.00 ? 66  GLN A HE22 1  
ATOM 932   N N    . VAL A 1 67  ? 1.350   5.780   0.634   1.00 0.00 ? 67  VAL A N    1  
ATOM 933   C CA   . VAL A 1 67  ? 0.780   4.524   1.105   1.00 0.00 ? 67  VAL A CA   1  
ATOM 934   C C    . VAL A 1 67  ? -0.404  4.100   0.243   1.00 0.00 ? 67  VAL A C    1  
ATOM 935   O O    . VAL A 1 67  ? -0.875  4.862   -0.600  1.00 0.00 ? 67  VAL A O    1  
ATOM 936   C CB   . VAL A 1 67  ? 0.320   4.632   2.571   1.00 0.00 ? 67  VAL A CB   1  
ATOM 937   C CG1  . VAL A 1 67  ? 1.509   4.884   3.486   1.00 0.00 ? 67  VAL A CG1  1  
ATOM 938   C CG2  . VAL A 1 67  ? -0.722  5.729   2.723   1.00 0.00 ? 67  VAL A CG2  1  
ATOM 939   H H    . VAL A 1 67  ? 1.504   6.506   1.274   1.00 0.00 ? 67  VAL A H    1  
ATOM 940   H HA   . VAL A 1 67  ? 1.547   3.766   1.045   1.00 0.00 ? 67  VAL A HA   1  
ATOM 941   H HB   . VAL A 1 67  ? -0.132  3.693   2.855   1.00 0.00 ? 67  VAL A HB   1  
ATOM 942   H HG11 . VAL A 1 67  ? 1.158   5.046   4.495   1.00 0.00 ? 67  VAL A HG11 1  
ATOM 943   H HG12 . VAL A 1 67  ? 2.167   4.027   3.466   1.00 0.00 ? 67  VAL A HG12 1  
ATOM 944   H HG13 . VAL A 1 67  ? 2.045   5.758   3.147   1.00 0.00 ? 67  VAL A HG13 1  
ATOM 945   H HG21 . VAL A 1 67  ? -1.629  5.437   2.214   1.00 0.00 ? 67  VAL A HG21 1  
ATOM 946   H HG22 . VAL A 1 67  ? -0.932  5.884   3.772   1.00 0.00 ? 67  VAL A HG22 1  
ATOM 947   H HG23 . VAL A 1 67  ? -0.346  6.645   2.293   1.00 0.00 ? 67  VAL A HG23 1  
ATOM 948   N N    . ASN A 1 68  ? -0.880  2.879   0.461   1.00 0.00 ? 68  ASN A N    1  
ATOM 949   C CA   . ASN A 1 68  ? -2.010  2.352   -0.297  1.00 0.00 ? 68  ASN A CA   1  
ATOM 950   C C    . ASN A 1 68  ? -1.674  2.262   -1.782  1.00 0.00 ? 68  ASN A C    1  
ATOM 951   O O    . ASN A 1 68  ? -2.497  2.589   -2.637  1.00 0.00 ? 68  ASN A O    1  
ATOM 952   C CB   . ASN A 1 68  ? -3.242  3.236   -0.095  1.00 0.00 ? 68  ASN A CB   1  
ATOM 953   C CG   . ASN A 1 68  ? -3.416  3.664   1.350   1.00 0.00 ? 68  ASN A CG   1  
ATOM 954   O OD1  . ASN A 1 68  ? -3.008  2.957   2.272   1.00 0.00 ? 68  ASN A OD1  1  
ATOM 955   N ND2  . ASN A 1 68  ? -4.023  4.828   1.553   1.00 0.00 ? 68  ASN A ND2  1  
ATOM 956   H H    . ASN A 1 68  ? -0.462  2.318   1.147   1.00 0.00 ? 68  ASN A H    1  
ATOM 957   H HA   . ASN A 1 68  ? -2.224  1.361   0.073   1.00 0.00 ? 68  ASN A HA   1  
ATOM 958   H HB2  . ASN A 1 68  ? -3.146  4.123   -0.704  1.00 0.00 ? 68  ASN A HB2  1  
ATOM 959   H HB3  . ASN A 1 68  ? -4.123  2.690   -0.398  1.00 0.00 ? 68  ASN A HB3  1  
ATOM 960   H HD21 . ASN A 1 68  ? -4.322  5.337   0.770   1.00 0.00 ? 68  ASN A HD21 1  
ATOM 961   H HD22 . ASN A 1 68  ? -4.148  5.129   2.477   1.00 0.00 ? 68  ASN A HD22 1  
ATOM 962   N N    . ASP A 1 69  ? -0.459  1.815   -2.082  1.00 0.00 ? 69  ASP A N    1  
ATOM 963   C CA   . ASP A 1 69  ? -0.014  1.679   -3.464  1.00 0.00 ? 69  ASP A CA   1  
ATOM 964   C C    . ASP A 1 69  ? 0.676   0.336   -3.684  1.00 0.00 ? 69  ASP A C    1  
ATOM 965   O O    . ASP A 1 69  ? 1.314   -0.201  -2.778  1.00 0.00 ? 69  ASP A O    1  
ATOM 966   C CB   . ASP A 1 69  ? 0.936   2.820   -3.831  1.00 0.00 ? 69  ASP A CB   1  
ATOM 967   C CG   . ASP A 1 69  ? 0.201   4.046   -4.335  1.00 0.00 ? 69  ASP A CG   1  
ATOM 968   O OD1  . ASP A 1 69  ? -0.403  3.969   -5.425  1.00 0.00 ? 69  ASP A OD1  1  
ATOM 969   O OD2  . ASP A 1 69  ? 0.229   5.084   -3.640  1.00 0.00 ? 69  ASP A OD2  1  
ATOM 970   H H    . ASP A 1 69  ? 0.153   1.569   -1.357  1.00 0.00 ? 69  ASP A H    1  
ATOM 971   H HA   . ASP A 1 69  ? -0.885  1.730   -4.100  1.00 0.00 ? 69  ASP A HA   1  
ATOM 972   H HB2  . ASP A 1 69  ? 1.507   3.100   -2.957  1.00 0.00 ? 69  ASP A HB2  1  
ATOM 973   H HB3  . ASP A 1 69  ? 1.611   2.484   -4.604  1.00 0.00 ? 69  ASP A HB3  1  
ATOM 974   N N    . LYS A 1 70  ? 0.543   -0.201  -4.891  1.00 0.00 ? 70  LYS A N    1  
ATOM 975   C CA   . LYS A 1 70  ? 1.153   -1.481  -5.231  1.00 0.00 ? 70  LYS A CA   1  
ATOM 976   C C    . LYS A 1 70  ? 2.311   -1.290  -6.204  1.00 0.00 ? 70  LYS A C    1  
ATOM 977   O O    . LYS A 1 70  ? 2.107   -0.929  -7.364  1.00 0.00 ? 70  LYS A O    1  
ATOM 978   C CB   . LYS A 1 70  ? 0.110   -2.421  -5.841  1.00 0.00 ? 70  LYS A CB   1  
ATOM 979   C CG   . LYS A 1 70  ? 0.413   -3.892  -5.620  1.00 0.00 ? 70  LYS A CG   1  
ATOM 980   C CD   . LYS A 1 70  ? -0.224  -4.761  -6.692  1.00 0.00 ? 70  LYS A CD   1  
ATOM 981   C CE   . LYS A 1 70  ? 0.603   -4.768  -7.968  1.00 0.00 ? 70  LYS A CE   1  
ATOM 982   N NZ   . LYS A 1 70  ? -0.232  -5.046  -9.169  1.00 0.00 ? 70  LYS A NZ   1  
ATOM 983   H H    . LYS A 1 70  ? 0.021   0.275   -5.572  1.00 0.00 ? 70  LYS A H    1  
ATOM 984   H HA   . LYS A 1 70  ? 1.531   -1.921  -4.321  1.00 0.00 ? 70  LYS A HA   1  
ATOM 985   H HB2  . LYS A 1 70  ? -0.853  -2.203  -5.403  1.00 0.00 ? 70  LYS A HB2  1  
ATOM 986   H HB3  . LYS A 1 70  ? 0.060   -2.241  -6.906  1.00 0.00 ? 70  LYS A HB3  1  
ATOM 987   H HG2  . LYS A 1 70  ? 1.483   -4.038  -5.643  1.00 0.00 ? 70  LYS A HG2  1  
ATOM 988   H HG3  . LYS A 1 70  ? 0.029   -4.188  -4.654  1.00 0.00 ? 70  LYS A HG3  1  
ATOM 989   H HD2  . LYS A 1 70  ? -0.305  -5.772  -6.323  1.00 0.00 ? 70  LYS A HD2  1  
ATOM 990   H HD3  . LYS A 1 70  ? -1.210  -4.377  -6.914  1.00 0.00 ? 70  LYS A HD3  1  
ATOM 991   H HE2  . LYS A 1 70  ? 1.073   -3.803  -8.082  1.00 0.00 ? 70  LYS A HE2  1  
ATOM 992   H HE3  . LYS A 1 70  ? 1.363   -5.531  -7.884  1.00 0.00 ? 70  LYS A HE3  1  
ATOM 993   H HZ1  . LYS A 1 70  ? 0.193   -5.810  -9.731  1.00 0.00 ? 70  LYS A HZ1  1  
ATOM 994   H HZ2  . LYS A 1 70  ? -0.302  -4.194  -9.761  1.00 0.00 ? 70  LYS A HZ2  1  
ATOM 995   H HZ3  . LYS A 1 70  ? -1.189  -5.333  -8.880  1.00 0.00 ? 70  LYS A HZ3  1  
ATOM 996   N N    . ILE A 1 71  ? 3.526   -1.536  -5.726  1.00 0.00 ? 71  ILE A N    1  
ATOM 997   C CA   . ILE A 1 71  ? 4.717   -1.394  -6.555  1.00 0.00 ? 71  ILE A CA   1  
ATOM 998   C C    . ILE A 1 71  ? 4.945   -2.637  -7.408  1.00 0.00 ? 71  ILE A C    1  
ATOM 999   O O    . ILE A 1 71  ? 5.097   -3.742  -6.887  1.00 0.00 ? 71  ILE A O    1  
ATOM 1000  C CB   . ILE A 1 71  ? 5.971   -1.135  -5.700  1.00 0.00 ? 71  ILE A CB   1  
ATOM 1001  C CG1  . ILE A 1 71  ? 5.775   0.111   -4.833  1.00 0.00 ? 71  ILE A CG1  1  
ATOM 1002  C CG2  . ILE A 1 71  ? 7.196   -0.981  -6.589  1.00 0.00 ? 71  ILE A CG2  1  
ATOM 1003  C CD1  . ILE A 1 71  ? 5.171   -0.185  -3.479  1.00 0.00 ? 71  ILE A CD1  1  
ATOM 1004  H H    . ILE A 1 71  ? 3.625   -1.821  -4.794  1.00 0.00 ? 71  ILE A H    1  
ATOM 1005  H HA   . ILE A 1 71  ? 4.568   -0.545  -7.208  1.00 0.00 ? 71  ILE A HA   1  
ATOM 1006  H HB   . ILE A 1 71  ? 6.126   -1.990  -5.060  1.00 0.00 ? 71  ILE A HB   1  
ATOM 1007  H HG12 . ILE A 1 71  ? 6.731   0.584   -4.673  1.00 0.00 ? 71  ILE A HG12 1  
ATOM 1008  H HG13 . ILE A 1 71  ? 5.120   0.799   -5.347  1.00 0.00 ? 71  ILE A HG13 1  
ATOM 1009  H HG21 . ILE A 1 71  ? 7.276   -1.837  -7.243  1.00 0.00 ? 71  ILE A HG21 1  
ATOM 1010  H HG22 . ILE A 1 71  ? 7.099   -0.084  -7.183  1.00 0.00 ? 71  ILE A HG22 1  
ATOM 1011  H HG23 . ILE A 1 71  ? 8.081   -0.913  -5.975  1.00 0.00 ? 71  ILE A HG23 1  
ATOM 1012  H HD11 . ILE A 1 71  ? 4.096   -0.246  -3.569  1.00 0.00 ? 71  ILE A HD11 1  
ATOM 1013  H HD12 . ILE A 1 71  ? 5.556   -1.123  -3.109  1.00 0.00 ? 71  ILE A HD12 1  
ATOM 1014  H HD13 . ILE A 1 71  ? 5.428   0.607   -2.789  1.00 0.00 ? 71  ILE A HD13 1  
ATOM 1015  N N    . VAL A 1 72  ? 4.968   -2.449  -8.724  1.00 0.00 ? 72  VAL A N    1  
ATOM 1016  C CA   . VAL A 1 72  ? 5.181   -3.555  -9.650  1.00 0.00 ? 72  VAL A CA   1  
ATOM 1017  C C    . VAL A 1 72  ? 6.609   -3.560  -10.182 1.00 0.00 ? 72  VAL A C    1  
ATOM 1018  O O    . VAL A 1 72  ? 7.116   -4.592  -10.620 1.00 0.00 ? 72  VAL A O    1  
ATOM 1019  C CB   . VAL A 1 72  ? 4.203   -3.488  -10.838 1.00 0.00 ? 72  VAL A CB   1  
ATOM 1020  C CG1  . VAL A 1 72  ? 2.804   -3.896  -10.403 1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1021  C CG2  . VAL A 1 72  ? 4.196   -2.092  -11.444 1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1022  H H    . VAL A 1 72  ? 4.840   -1.545  -9.080  1.00 0.00 ? 72  VAL A H    1  
ATOM 1023  H HA   . VAL A 1 72  ? 5.002   -4.477  -9.116  1.00 0.00 ? 72  VAL A HA   1  
ATOM 1024  H HB   . VAL A 1 72  ? 4.538   -4.183  -11.594 1.00 0.00 ? 72  VAL A HB   1  
ATOM 1025  H HG11 . VAL A 1 72  ? 2.683   -3.697  -9.348  1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1026  H HG12 . VAL A 1 72  ? 2.073   -3.331  -10.963 1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1027  H HG13 . VAL A 1 72  ? 2.663   -4.951  -10.587 1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1028  H HG21 . VAL A 1 72  ? 3.493   -1.472  -10.907 1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1029  H HG22 . VAL A 1 72  ? 5.184   -1.662  -11.371 1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1030  H HG23 . VAL A 1 72  ? 3.905   -2.151  -12.482 1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1031  N N    . ALA A 1 73  ? 7.254   -2.399  -10.140 1.00 0.00 ? 73  ALA A N    1  
ATOM 1032  C CA   . ALA A 1 73  ? 8.626   -2.269  -10.615 1.00 0.00 ? 73  ALA A CA   1  
ATOM 1033  C C    . ALA A 1 73  ? 9.291   -1.023  -10.039 1.00 0.00 ? 73  ALA A C    1  
ATOM 1034  O O    . ALA A 1 73  ? 8.647   0.011   -9.861  1.00 0.00 ? 73  ALA A O    1  
ATOM 1035  C CB   . ALA A 1 73  ? 8.657   -2.232  -12.135 1.00 0.00 ? 73  ALA A CB   1  
ATOM 1036  H H    . ALA A 1 73  ? 6.797   -1.611  -9.779  1.00 0.00 ? 73  ALA A H    1  
ATOM 1037  H HA   . ALA A 1 73  ? 9.176   -3.141  -10.289 1.00 0.00 ? 73  ALA A HA   1  
ATOM 1038  H HB1  . ALA A 1 73  ? 8.022   -1.432  -12.488 1.00 0.00 ? 73  ALA A HB1  1  
ATOM 1039  H HB2  . ALA A 1 73  ? 9.669   -2.062  -12.471 1.00 0.00 ? 73  ALA A HB2  1  
ATOM 1040  H HB3  . ALA A 1 73  ? 8.301   -3.173  -12.526 1.00 0.00 ? 73  ALA A HB3  1  
ATOM 1041  N N    . VAL A 1 74  ? 10.584  -1.128  -9.749  1.00 0.00 ? 74  VAL A N    1  
ATOM 1042  C CA   . VAL A 1 74  ? 11.337  -0.010  -9.194  1.00 0.00 ? 74  VAL A CA   1  
ATOM 1043  C C    . VAL A 1 74  ? 12.422  0.455   -10.159 1.00 0.00 ? 74  VAL A C    1  
ATOM 1044  O O    . VAL A 1 74  ? 13.357  -0.287  -10.461 1.00 0.00 ? 74  VAL A O    1  
ATOM 1045  C CB   . VAL A 1 74  ? 11.986  -0.383  -7.849  1.00 0.00 ? 74  VAL A CB   1  
ATOM 1046  C CG1  . VAL A 1 74  ? 12.817  0.775   -7.317  1.00 0.00 ? 74  VAL A CG1  1  
ATOM 1047  C CG2  . VAL A 1 74  ? 10.924  -0.794  -6.841  1.00 0.00 ? 74  VAL A CG2  1  
ATOM 1048  H H    . VAL A 1 74  ? 11.043  -1.978  -9.914  1.00 0.00 ? 74  VAL A H    1  
ATOM 1049  H HA   . VAL A 1 74  ? 10.648  0.805   -9.024  1.00 0.00 ? 74  VAL A HA   1  
ATOM 1050  H HB   . VAL A 1 74  ? 12.644  -1.224  -8.010  1.00 0.00 ? 74  VAL A HB   1  
ATOM 1051  H HG11 . VAL A 1 74  ? 13.729  0.393   -6.882  1.00 0.00 ? 74  VAL A HG11 1  
ATOM 1052  H HG12 . VAL A 1 74  ? 13.057  1.448   -8.127  1.00 0.00 ? 74  VAL A HG12 1  
ATOM 1053  H HG13 . VAL A 1 74  ? 12.254  1.305   -6.563  1.00 0.00 ? 74  VAL A HG13 1  
ATOM 1054  H HG21 . VAL A 1 74  ? 10.751  0.017   -6.149  1.00 0.00 ? 74  VAL A HG21 1  
ATOM 1055  H HG22 . VAL A 1 74  ? 10.005  -1.026  -7.360  1.00 0.00 ? 74  VAL A HG22 1  
ATOM 1056  H HG23 . VAL A 1 74  ? 11.260  -1.665  -6.298  1.00 0.00 ? 74  VAL A HG23 1  
ATOM 1057  N N    . ASP A 1 75  ? 12.293  1.687   -10.638 1.00 0.00 ? 75  ASP A N    1  
ATOM 1058  C CA   . ASP A 1 75  ? 13.264  2.252   -11.567 1.00 0.00 ? 75  ASP A CA   1  
ATOM 1059  C C    . ASP A 1 75  ? 13.507  1.308   -12.740 1.00 0.00 ? 75  ASP A C    1  
ATOM 1060  O O    . ASP A 1 75  ? 14.615  1.231   -13.269 1.00 0.00 ? 75  ASP A O    1  
ATOM 1061  C CB   . ASP A 1 75  ? 14.582  2.542   -10.847 1.00 0.00 ? 75  ASP A CB   1  
ATOM 1062  C CG   . ASP A 1 75  ? 15.330  1.276   -10.477 1.00 0.00 ? 75  ASP A CG   1  
ATOM 1063  O OD1  . ASP A 1 75  ? 15.958  0.675   -11.373 1.00 0.00 ? 75  ASP A OD1  1  
ATOM 1064  O OD2  . ASP A 1 75  ? 15.286  0.886   -9.291  1.00 0.00 ? 75  ASP A OD2  1  
ATOM 1065  H H    . ASP A 1 75  ? 11.525  2.230   -10.359 1.00 0.00 ? 75  ASP A H    1  
ATOM 1066  H HA   . ASP A 1 75  ? 12.860  3.179   -11.946 1.00 0.00 ? 75  ASP A HA   1  
ATOM 1067  H HB2  . ASP A 1 75  ? 15.214  3.135   -11.492 1.00 0.00 ? 75  ASP A HB2  1  
ATOM 1068  H HB3  . ASP A 1 75  ? 14.376  3.095   -9.943  1.00 0.00 ? 75  ASP A HB3  1  
ATOM 1069  N N    . GLY A 1 76  ? 12.463  0.589   -13.141 1.00 0.00 ? 76  GLY A N    1  
ATOM 1070  C CA   . GLY A 1 76  ? 12.584  -0.342  -14.248 1.00 0.00 ? 76  GLY A CA   1  
ATOM 1071  C C    . GLY A 1 76  ? 12.721  -1.779  -13.784 1.00 0.00 ? 76  GLY A C    1  
ATOM 1072  O O    . GLY A 1 76  ? 12.424  -2.711  -14.531 1.00 0.00 ? 76  GLY A O    1  
ATOM 1073  H H    . GLY A 1 76  ? 11.603  0.692   -12.682 1.00 0.00 ? 76  GLY A H    1  
ATOM 1074  H HA2  . GLY A 1 76  ? 11.708  -0.258  -14.872 1.00 0.00 ? 76  GLY A HA2  1  
ATOM 1075  H HA3  . GLY A 1 76  ? 13.456  -0.080  -14.830 1.00 0.00 ? 76  GLY A HA3  1  
ATOM 1076  N N    . VAL A 1 77  ? 13.174  -1.960  -12.547 1.00 0.00 ? 77  VAL A N    1  
ATOM 1077  C CA   . VAL A 1 77  ? 13.350  -3.293  -11.985 1.00 0.00 ? 77  VAL A CA   1  
ATOM 1078  C C    . VAL A 1 77  ? 12.005  -3.965  -11.731 1.00 0.00 ? 77  VAL A C    1  
ATOM 1079  O O    . VAL A 1 77  ? 11.263  -3.570  -10.833 1.00 0.00 ? 77  VAL A O    1  
ATOM 1080  C CB   . VAL A 1 77  ? 14.145  -3.246  -10.667 1.00 0.00 ? 77  VAL A CB   1  
ATOM 1081  C CG1  . VAL A 1 77  ? 14.249  -4.635  -10.056 1.00 0.00 ? 77  VAL A CG1  1  
ATOM 1082  C CG2  . VAL A 1 77  ? 15.526  -2.651  -10.899 1.00 0.00 ? 77  VAL A CG2  1  
ATOM 1083  H H    . VAL A 1 77  ? 13.394  -1.177  -12.000 1.00 0.00 ? 77  VAL A H    1  
ATOM 1084  H HA   . VAL A 1 77  ? 13.908  -3.885  -12.696 1.00 0.00 ? 77  VAL A HA   1  
ATOM 1085  H HB   . VAL A 1 77  ? 13.614  -2.611  -9.973  1.00 0.00 ? 77  VAL A HB   1  
ATOM 1086  H HG11 . VAL A 1 77  ? 15.242  -5.027  -10.222 1.00 0.00 ? 77  VAL A HG11 1  
ATOM 1087  H HG12 . VAL A 1 77  ? 14.056  -4.577  -8.994  1.00 0.00 ? 77  VAL A HG12 1  
ATOM 1088  H HG13 . VAL A 1 77  ? 13.523  -5.287  -10.519 1.00 0.00 ? 77  VAL A HG13 1  
ATOM 1089  H HG21 . VAL A 1 77  ? 15.499  -1.591  -10.696 1.00 0.00 ? 77  VAL A HG21 1  
ATOM 1090  H HG22 . VAL A 1 77  ? 16.238  -3.126  -10.239 1.00 0.00 ? 77  VAL A HG22 1  
ATOM 1091  H HG23 . VAL A 1 77  ? 15.821  -2.815  -11.924 1.00 0.00 ? 77  VAL A HG23 1  
ATOM 1092  N N    . ASN A 1 78  ? 11.698  -4.982  -12.529 1.00 0.00 ? 78  ASN A N    1  
ATOM 1093  C CA   . ASN A 1 78  ? 10.441  -5.710  -12.391 1.00 0.00 ? 78  ASN A CA   1  
ATOM 1094  C C    . ASN A 1 78  ? 10.422  -6.521  -11.099 1.00 0.00 ? 78  ASN A C    1  
ATOM 1095  O O    . ASN A 1 78  ? 10.778  -7.700  -11.090 1.00 0.00 ? 78  ASN A O    1  
ATOM 1096  C CB   . ASN A 1 78  ? 10.229  -6.635  -13.591 1.00 0.00 ? 78  ASN A CB   1  
ATOM 1097  C CG   . ASN A 1 78  ? 8.793   -7.111  -13.707 1.00 0.00 ? 78  ASN A CG   1  
ATOM 1098  O OD1  . ASN A 1 78  ? 8.507   -8.298  -13.556 1.00 0.00 ? 78  ASN A OD1  1  
ATOM 1099  N ND2  . ASN A 1 78  ? 7.883   -6.183  -13.977 1.00 0.00 ? 78  ASN A ND2  1  
ATOM 1100  H H    . ASN A 1 78  ? 12.331  -5.250  -13.228 1.00 0.00 ? 78  ASN A H    1  
ATOM 1101  H HA   . ASN A 1 78  ? 9.641   -4.986  -12.360 1.00 0.00 ? 78  ASN A HA   1  
ATOM 1102  H HB2  . ASN A 1 78  ? 10.486  -6.104  -14.496 1.00 0.00 ? 78  ASN A HB2  1  
ATOM 1103  H HB3  . ASN A 1 78  ? 10.868  -7.498  -13.490 1.00 0.00 ? 78  ASN A HB3  1  
ATOM 1104  H HD21 . ASN A 1 78  ? 8.183   -5.256  -14.085 1.00 0.00 ? 78  ASN A HD21 1  
ATOM 1105  H HD22 . ASN A 1 78  ? 6.947   -6.463  -14.057 1.00 0.00 ? 78  ASN A HD22 1  
ATOM 1106  N N    . ILE A 1 79  ? 10.003  -5.883  -10.012 1.00 0.00 ? 79  ILE A N    1  
ATOM 1107  C CA   . ILE A 1 79  ? 9.936   -6.546  -8.715  1.00 0.00 ? 79  ILE A CA   1  
ATOM 1108  C C    . ILE A 1 79  ? 8.604   -7.267  -8.536  1.00 0.00 ? 79  ILE A C    1  
ATOM 1109  O O    . ILE A 1 79  ? 8.244   -7.656  -7.425  1.00 0.00 ? 79  ILE A O    1  
ATOM 1110  C CB   . ILE A 1 79  ? 10.125  -5.545  -7.560  1.00 0.00 ? 79  ILE A CB   1  
ATOM 1111  C CG1  . ILE A 1 79  ? 8.969   -4.542  -7.532  1.00 0.00 ? 79  ILE A CG1  1  
ATOM 1112  C CG2  . ILE A 1 79  ? 11.457  -4.823  -7.698  1.00 0.00 ? 79  ILE A CG2  1  
ATOM 1113  C CD1  . ILE A 1 79  ? 8.651   -4.026  -6.146  1.00 0.00 ? 79  ILE A CD1  1  
ATOM 1114  H H    . ILE A 1 79  ? 9.733   -4.944  -10.083 1.00 0.00 ? 79  ILE A H    1  
ATOM 1115  H HA   . ILE A 1 79  ? 10.735  -7.272  -8.671  1.00 0.00 ? 79  ILE A HA   1  
ATOM 1116  H HB   . ILE A 1 79  ? 10.136  -6.097  -6.633  1.00 0.00 ? 79  ILE A HB   1  
ATOM 1117  H HG12 . ILE A 1 79  ? 9.221   -3.695  -8.151  1.00 0.00 ? 79  ILE A HG12 1  
ATOM 1118  H HG13 . ILE A 1 79  ? 8.081   -5.016  -7.922  1.00 0.00 ? 79  ILE A HG13 1  
ATOM 1119  H HG21 . ILE A 1 79  ? 11.717  -4.365  -6.755  1.00 0.00 ? 79  ILE A HG21 1  
ATOM 1120  H HG22 . ILE A 1 79  ? 12.222  -5.531  -7.977  1.00 0.00 ? 79  ILE A HG22 1  
ATOM 1121  H HG23 . ILE A 1 79  ? 11.377  -4.060  -8.458  1.00 0.00 ? 79  ILE A HG23 1  
ATOM 1122  H HD11 . ILE A 1 79  ? 9.411   -4.358  -5.454  1.00 0.00 ? 79  ILE A HD11 1  
ATOM 1123  H HD12 . ILE A 1 79  ? 8.623   -2.947  -6.160  1.00 0.00 ? 79  ILE A HD12 1  
ATOM 1124  H HD13 . ILE A 1 79  ? 7.690   -4.407  -5.832  1.00 0.00 ? 79  ILE A HD13 1  
ATOM 1125  N N    . GLN A 1 80  ? 7.879   -7.442  -9.636  1.00 0.00 ? 80  GLN A N    1  
ATOM 1126  C CA   . GLN A 1 80  ? 6.587   -8.118  -9.599  1.00 0.00 ? 80  GLN A CA   1  
ATOM 1127  C C    . GLN A 1 80  ? 6.608   -9.279  -8.610  1.00 0.00 ? 80  GLN A C    1  
ATOM 1128  O O    . GLN A 1 80  ? 5.864   -9.287  -7.631  1.00 0.00 ? 80  GLN A O    1  
ATOM 1129  C CB   . GLN A 1 80  ? 6.214   -8.626  -10.993 1.00 0.00 ? 80  GLN A CB   1  
ATOM 1130  C CG   . GLN A 1 80  ? 5.638   -7.549  -11.898 1.00 0.00 ? 80  GLN A CG   1  
ATOM 1131  C CD   . GLN A 1 80  ? 5.088   -8.110  -13.195 1.00 0.00 ? 80  GLN A CD   1  
ATOM 1132  O OE1  . GLN A 1 80  ? 5.527   -9.159  -13.667 1.00 0.00 ? 80  GLN A OE1  1  
ATOM 1133  N NE2  . GLN A 1 80  ? 4.120   -7.413  -13.778 1.00 0.00 ? 80  GLN A NE2  1  
ATOM 1134  H H    . GLN A 1 80  ? 8.220   -7.109  -10.491 1.00 0.00 ? 80  GLN A H    1  
ATOM 1135  H HA   . GLN A 1 80  ? 5.847   -7.401  -9.277  1.00 0.00 ? 80  GLN A HA   1  
ATOM 1136  H HB2  . GLN A 1 80  ? 7.098   -9.028  -11.465 1.00 0.00 ? 80  GLN A HB2  1  
ATOM 1137  H HB3  . GLN A 1 80  ? 5.480   -9.411  -10.892 1.00 0.00 ? 80  GLN A HB3  1  
ATOM 1138  H HG2  . GLN A 1 80  ? 4.839   -7.046  -11.374 1.00 0.00 ? 80  GLN A HG2  1  
ATOM 1139  H HG3  . GLN A 1 80  ? 6.417   -6.839  -12.132 1.00 0.00 ? 80  GLN A HG3  1  
ATOM 1140  H HE21 . GLN A 1 80  ? 3.820   -6.586  -13.345 1.00 0.00 ? 80  GLN A HE21 1  
ATOM 1141  H HE22 . GLN A 1 80  ? 3.746   -7.752  -14.617 1.00 0.00 ? 80  GLN A HE22 1  
ATOM 1142  N N    . GLY A 1 81  ? 7.467   -10.260 -8.875  1.00 0.00 ? 81  GLY A N    1  
ATOM 1143  C CA   . GLY A 1 81  ? 7.568   -11.413 -8.000  1.00 0.00 ? 81  GLY A CA   1  
ATOM 1144  C C    . GLY A 1 81  ? 8.839   -11.404 -7.174  1.00 0.00 ? 81  GLY A C    1  
ATOM 1145  O O    . GLY A 1 81  ? 9.547   -12.408 -7.100  1.00 0.00 ? 81  GLY A O    1  
ATOM 1146  H H    . GLY A 1 81  ? 8.036   -10.200 -9.671  1.00 0.00 ? 81  GLY A H    1  
ATOM 1147  H HA2  . GLY A 1 81  ? 6.718   -11.421 -7.334  1.00 0.00 ? 81  GLY A HA2  1  
ATOM 1148  H HA3  . GLY A 1 81  ? 7.550   -12.310 -8.602  1.00 0.00 ? 81  GLY A HA3  1  
ATOM 1149  N N    . PHE A 1 82  ? 9.131   -10.266 -6.552  1.00 0.00 ? 82  PHE A N    1  
ATOM 1150  C CA   . PHE A 1 82  ? 10.327  -10.130 -5.729  1.00 0.00 ? 82  PHE A CA   1  
ATOM 1151  C C    . PHE A 1 82  ? 9.982   -10.231 -4.247  1.00 0.00 ? 82  PHE A C    1  
ATOM 1152  O O    . PHE A 1 82  ? 8.813   -10.191 -3.866  1.00 0.00 ? 82  PHE A O    1  
ATOM 1153  C CB   . PHE A 1 82  ? 11.018  -8.794  -6.014  1.00 0.00 ? 82  PHE A CB   1  
ATOM 1154  C CG   . PHE A 1 82  ? 11.942  -8.837  -7.197  1.00 0.00 ? 82  PHE A CG   1  
ATOM 1155  C CD1  . PHE A 1 82  ? 11.587  -9.524  -8.346  1.00 0.00 ? 82  PHE A CD1  1  
ATOM 1156  C CD2  . PHE A 1 82  ? 13.167  -8.191  -7.159  1.00 0.00 ? 82  PHE A CD2  1  
ATOM 1157  C CE1  . PHE A 1 82  ? 12.435  -9.566  -9.437  1.00 0.00 ? 82  PHE A CE1  1  
ATOM 1158  C CE2  . PHE A 1 82  ? 14.019  -8.228  -8.247  1.00 0.00 ? 82  PHE A CE2  1  
ATOM 1159  C CZ   . PHE A 1 82  ? 13.653  -8.917  -9.386  1.00 0.00 ? 82  PHE A CZ   1  
ATOM 1160  H H    . PHE A 1 82  ? 8.527   -9.500  -6.649  1.00 0.00 ? 82  PHE A H    1  
ATOM 1161  H HA   . PHE A 1 82  ? 10.999  -10.934 -5.986  1.00 0.00 ? 82  PHE A HA   1  
ATOM 1162  H HB2  . PHE A 1 82  ? 10.267  -8.043  -6.207  1.00 0.00 ? 82  PHE A HB2  1  
ATOM 1163  H HB3  . PHE A 1 82  ? 11.596  -8.505  -5.149  1.00 0.00 ? 82  PHE A HB3  1  
ATOM 1164  H HD1  . PHE A 1 82  ? 10.633  -10.032 -8.386  1.00 0.00 ? 82  PHE A HD1  1  
ATOM 1165  H HD2  . PHE A 1 82  ? 13.456  -7.652  -6.268  1.00 0.00 ? 82  PHE A HD2  1  
ATOM 1166  H HE1  . PHE A 1 82  ? 12.145  -10.106 -10.326 1.00 0.00 ? 82  PHE A HE1  1  
ATOM 1167  H HE2  . PHE A 1 82  ? 14.972  -7.721  -8.205  1.00 0.00 ? 82  PHE A HE2  1  
ATOM 1168  H HZ   . PHE A 1 82  ? 14.317  -8.948  -10.237 1.00 0.00 ? 82  PHE A HZ   1  
ATOM 1169  N N    . ALA A 1 83  ? 11.010  -10.364 -3.414  1.00 0.00 ? 83  ALA A N    1  
ATOM 1170  C CA   . ALA A 1 83  ? 10.816  -10.470 -1.973  1.00 0.00 ? 83  ALA A CA   1  
ATOM 1171  C C    . ALA A 1 83  ? 11.211  -9.176  -1.270  1.00 0.00 ? 83  ALA A C    1  
ATOM 1172  O O    . ALA A 1 83  ? 12.051  -8.423  -1.761  1.00 0.00 ? 83  ALA A O    1  
ATOM 1173  C CB   . ALA A 1 83  ? 11.615  -11.640 -1.418  1.00 0.00 ? 83  ALA A CB   1  
ATOM 1174  H H    . ALA A 1 83  ? 11.919  -10.390 -3.777  1.00 0.00 ? 83  ALA A H    1  
ATOM 1175  H HA   . ALA A 1 83  ? 9.769   -10.662 -1.790  1.00 0.00 ? 83  ALA A HA   1  
ATOM 1176  H HB1  . ALA A 1 83  ? 11.730  -12.393 -2.185  1.00 0.00 ? 83  ALA A HB1  1  
ATOM 1177  H HB2  . ALA A 1 83  ? 12.589  -11.294 -1.104  1.00 0.00 ? 83  ALA A HB2  1  
ATOM 1178  H HB3  . ALA A 1 83  ? 11.093  -12.064 -0.573  1.00 0.00 ? 83  ALA A HB3  1  
ATOM 1179  N N    . ASN A 1 84  ? 10.600  -8.925  -0.117  1.00 0.00 ? 84  ASN A N    1  
ATOM 1180  C CA   . ASN A 1 84  ? 10.888  -7.720  0.654   1.00 0.00 ? 84  ASN A CA   1  
ATOM 1181  C C    . ASN A 1 84  ? 12.374  -7.380  0.597   1.00 0.00 ? 84  ASN A C    1  
ATOM 1182  O O    . ASN A 1 84  ? 12.753  -6.265  0.236   1.00 0.00 ? 84  ASN A O    1  
ATOM 1183  C CB   . ASN A 1 84  ? 10.450  -7.904  2.109   1.00 0.00 ? 84  ASN A CB   1  
ATOM 1184  C CG   . ASN A 1 84  ? 8.943   -7.994  2.253   1.00 0.00 ? 84  ASN A CG   1  
ATOM 1185  O OD1  . ASN A 1 84  ? 8.381   -9.086  2.337   1.00 0.00 ? 84  ASN A OD1  1  
ATOM 1186  N ND2  . ASN A 1 84  ? 8.282   -6.843  2.281   1.00 0.00 ? 84  ASN A ND2  1  
ATOM 1187  H H    . ASN A 1 84  ? 9.940   -9.564  0.224   1.00 0.00 ? 84  ASN A H    1  
ATOM 1188  H HA   . ASN A 1 84  ? 10.327  -6.907  0.219   1.00 0.00 ? 84  ASN A HA   1  
ATOM 1189  H HB2  . ASN A 1 84  ? 10.885  -8.814  2.497   1.00 0.00 ? 84  ASN A HB2  1  
ATOM 1190  H HB3  . ASN A 1 84  ? 10.800  -7.066  2.692   1.00 0.00 ? 84  ASN A HB3  1  
ATOM 1191  H HD21 . ASN A 1 84  ? 8.796   -6.012  2.208   1.00 0.00 ? 84  ASN A HD21 1  
ATOM 1192  H HD22 . ASN A 1 84  ? 7.307   -6.873  2.373   1.00 0.00 ? 84  ASN A HD22 1  
ATOM 1193  N N    . HIS A 1 85  ? 13.211  -8.348  0.956   1.00 0.00 ? 85  HIS A N    1  
ATOM 1194  C CA   . HIS A 1 85  ? 14.656  -8.151  0.945   1.00 0.00 ? 85  HIS A CA   1  
ATOM 1195  C C    . HIS A 1 85  ? 15.157  -7.883  -0.471  1.00 0.00 ? 85  HIS A C    1  
ATOM 1196  O O    . HIS A 1 85  ? 15.990  -7.003  -0.689  1.00 0.00 ? 85  HIS A O    1  
ATOM 1197  C CB   . HIS A 1 85  ? 15.363  -9.377  1.524   1.00 0.00 ? 85  HIS A CB   1  
ATOM 1198  C CG   . HIS A 1 85  ? 14.814  -10.678 1.024   1.00 0.00 ? 85  HIS A CG   1  
ATOM 1199  N ND1  . HIS A 1 85  ? 13.916  -11.440 1.740   1.00 0.00 ? 85  HIS A ND1  1  
ATOM 1200  C CD2  . HIS A 1 85  ? 15.039  -11.349 -0.130  1.00 0.00 ? 85  HIS A CD2  1  
ATOM 1201  C CE1  . HIS A 1 85  ? 13.614  -12.525 1.050   1.00 0.00 ? 85  HIS A CE1  1  
ATOM 1202  N NE2  . HIS A 1 85  ? 14.281  -12.493 -0.089  1.00 0.00 ? 85  HIS A NE2  1  
ATOM 1203  H H    . HIS A 1 85  ? 12.849  -9.214  1.235   1.00 0.00 ? 85  HIS A H    1  
ATOM 1204  H HA   . HIS A 1 85  ? 14.879  -7.294  1.561   1.00 0.00 ? 85  HIS A HA   1  
ATOM 1205  H HB2  . HIS A 1 85  ? 16.411  -9.338  1.262   1.00 0.00 ? 85  HIS A HB2  1  
ATOM 1206  H HB3  . HIS A 1 85  ? 15.265  -9.366  2.600   1.00 0.00 ? 85  HIS A HB3  1  
ATOM 1207  H HD1  . HIS A 1 85  ? 13.555  -11.220 2.624   1.00 0.00 ? 85  HIS A HD1  1  
ATOM 1208  H HD2  . HIS A 1 85  ? 15.693  -11.041 -0.934  1.00 0.00 ? 85  HIS A HD2  1  
ATOM 1209  H HE1  . HIS A 1 85  ? 12.936  -13.305 1.362   1.00 0.00 ? 85  HIS A HE1  1  
ATOM 1210  H HE2  . HIS A 1 85  ? 14.306  -13.217 -0.749  1.00 0.00 ? 85  HIS A HE2  1  
ATOM 1211  N N    . ASP A 1 86  ? 14.644  -8.646  -1.430  1.00 0.00 ? 86  ASP A N    1  
ATOM 1212  C CA   . ASP A 1 86  ? 15.039  -8.490  -2.825  1.00 0.00 ? 86  ASP A CA   1  
ATOM 1213  C C    . ASP A 1 86  ? 14.705  -7.090  -3.331  1.00 0.00 ? 86  ASP A C    1  
ATOM 1214  O O    . ASP A 1 86  ? 15.396  -6.550  -4.194  1.00 0.00 ? 86  ASP A O    1  
ATOM 1215  C CB   . ASP A 1 86  ? 14.344  -9.540  -3.694  1.00 0.00 ? 86  ASP A CB   1  
ATOM 1216  C CG   . ASP A 1 86  ? 15.125  -9.855  -4.955  1.00 0.00 ? 86  ASP A CG   1  
ATOM 1217  O OD1  . ASP A 1 86  ? 15.897  -8.985  -5.407  1.00 0.00 ? 86  ASP A OD1  1  
ATOM 1218  O OD2  . ASP A 1 86  ? 14.962  -10.973 -5.490  1.00 0.00 ? 86  ASP A OD2  1  
ATOM 1219  H H    . ASP A 1 86  ? 13.983  -9.331  -1.193  1.00 0.00 ? 86  ASP A H    1  
ATOM 1220  H HA   . ASP A 1 86  ? 16.107  -8.636  -2.886  1.00 0.00 ? 86  ASP A HA   1  
ATOM 1221  H HB2  . ASP A 1 86  ? 14.231  -10.451 -3.125  1.00 0.00 ? 86  ASP A HB2  1  
ATOM 1222  H HB3  . ASP A 1 86  ? 13.369  -9.174  -3.978  1.00 0.00 ? 86  ASP A HB3  1  
ATOM 1223  N N    . VAL A 1 87  ? 13.639  -6.509  -2.788  1.00 0.00 ? 87  VAL A N    1  
ATOM 1224  C CA   . VAL A 1 87  ? 13.213  -5.172  -3.185  1.00 0.00 ? 87  VAL A CA   1  
ATOM 1225  C C    . VAL A 1 87  ? 14.068  -4.102  -2.516  1.00 0.00 ? 87  VAL A C    1  
ATOM 1226  O O    . VAL A 1 87  ? 14.359  -3.063  -3.110  1.00 0.00 ? 87  VAL A O    1  
ATOM 1227  C CB   . VAL A 1 87  ? 11.734  -4.927  -2.831  1.00 0.00 ? 87  VAL A CB   1  
ATOM 1228  C CG1  . VAL A 1 87  ? 11.313  -3.524  -3.240  1.00 0.00 ? 87  VAL A CG1  1  
ATOM 1229  C CG2  . VAL A 1 87  ? 10.848  -5.972  -3.493  1.00 0.00 ? 87  VAL A CG2  1  
ATOM 1230  H H    . VAL A 1 87  ? 13.129  -6.991  -2.105  1.00 0.00 ? 87  VAL A H    1  
ATOM 1231  H HA   . VAL A 1 87  ? 13.324  -5.090  -4.256  1.00 0.00 ? 87  VAL A HA   1  
ATOM 1232  H HB   . VAL A 1 87  ? 11.621  -5.016  -1.761  1.00 0.00 ? 87  VAL A HB   1  
ATOM 1233  H HG11 . VAL A 1 87  ? 10.690  -3.577  -4.121  1.00 0.00 ? 87  VAL A HG11 1  
ATOM 1234  H HG12 . VAL A 1 87  ? 10.759  -3.065  -2.434  1.00 0.00 ? 87  VAL A HG12 1  
ATOM 1235  H HG13 . VAL A 1 87  ? 12.191  -2.933  -3.456  1.00 0.00 ? 87  VAL A HG13 1  
ATOM 1236  H HG21 . VAL A 1 87  ? 11.371  -6.917  -3.526  1.00 0.00 ? 87  VAL A HG21 1  
ATOM 1237  H HG22 . VAL A 1 87  ? 9.937   -6.085  -2.924  1.00 0.00 ? 87  VAL A HG22 1  
ATOM 1238  H HG23 . VAL A 1 87  ? 10.608  -5.657  -4.497  1.00 0.00 ? 87  VAL A HG23 1  
ATOM 1239  N N    . VAL A 1 88  ? 14.469  -4.362  -1.276  1.00 0.00 ? 88  VAL A N    1  
ATOM 1240  C CA   . VAL A 1 88  ? 15.293  -3.422  -0.525  1.00 0.00 ? 88  VAL A CA   1  
ATOM 1241  C C    . VAL A 1 88  ? 16.599  -3.132  -1.256  1.00 0.00 ? 88  VAL A C    1  
ATOM 1242  O O    . VAL A 1 88  ? 16.945  -1.975  -1.493  1.00 0.00 ? 88  VAL A O    1  
ATOM 1243  C CB   . VAL A 1 88  ? 15.613  -3.956  0.884   1.00 0.00 ? 88  VAL A CB   1  
ATOM 1244  C CG1  . VAL A 1 88  ? 16.533  -2.996  1.623   1.00 0.00 ? 88  VAL A CG1  1  
ATOM 1245  C CG2  . VAL A 1 88  ? 14.331  -4.189  1.668   1.00 0.00 ? 88  VAL A CG2  1  
ATOM 1246  H H    . VAL A 1 88  ? 14.206  -5.207  -0.855  1.00 0.00 ? 88  VAL A H    1  
ATOM 1247  H HA   . VAL A 1 88  ? 14.738  -2.501  -0.421  1.00 0.00 ? 88  VAL A HA   1  
ATOM 1248  H HB   . VAL A 1 88  ? 16.124  -4.902  0.781   1.00 0.00 ? 88  VAL A HB   1  
ATOM 1249  H HG11 . VAL A 1 88  ? 16.484  -3.195  2.683   1.00 0.00 ? 88  VAL A HG11 1  
ATOM 1250  H HG12 . VAL A 1 88  ? 17.547  -3.131  1.276   1.00 0.00 ? 88  VAL A HG12 1  
ATOM 1251  H HG13 . VAL A 1 88  ? 16.219  -1.980  1.433   1.00 0.00 ? 88  VAL A HG13 1  
ATOM 1252  H HG21 . VAL A 1 88  ? 13.480  -4.001  1.030   1.00 0.00 ? 88  VAL A HG21 1  
ATOM 1253  H HG22 . VAL A 1 88  ? 14.301  -5.212  2.015   1.00 0.00 ? 88  VAL A HG22 1  
ATOM 1254  H HG23 . VAL A 1 88  ? 14.300  -3.521  2.516   1.00 0.00 ? 88  VAL A HG23 1  
ATOM 1255  N N    . GLU A 1 89  ? 17.321  -4.191  -1.610  1.00 0.00 ? 89  GLU A N    1  
ATOM 1256  C CA   . GLU A 1 89  ? 18.590  -4.048  -2.314  1.00 0.00 ? 89  GLU A CA   1  
ATOM 1257  C C    . GLU A 1 89  ? 18.413  -3.245  -3.599  1.00 0.00 ? 89  GLU A C    1  
ATOM 1258  O O    . GLU A 1 89  ? 19.267  -2.436  -3.961  1.00 0.00 ? 89  GLU A O    1  
ATOM 1259  C CB   . GLU A 1 89  ? 19.177  -5.424  -2.636  1.00 0.00 ? 89  GLU A CB   1  
ATOM 1260  C CG   . GLU A 1 89  ? 18.330  -6.235  -3.603  1.00 0.00 ? 89  GLU A CG   1  
ATOM 1261  C CD   . GLU A 1 89  ? 18.940  -7.587  -3.920  1.00 0.00 ? 89  GLU A CD   1  
ATOM 1262  O OE1  . GLU A 1 89  ? 18.666  -8.551  -3.174  1.00 0.00 ? 89  GLU A OE1  1  
ATOM 1263  O OE2  . GLU A 1 89  ? 19.691  -7.681  -4.913  1.00 0.00 ? 89  GLU A OE2  1  
ATOM 1264  H H    . GLU A 1 89  ? 16.992  -5.088  -1.393  1.00 0.00 ? 89  GLU A H    1  
ATOM 1265  H HA   . GLU A 1 89  ? 19.272  -3.520  -1.664  1.00 0.00 ? 89  GLU A HA   1  
ATOM 1266  H HB2  . GLU A 1 89  ? 20.156  -5.292  -3.072  1.00 0.00 ? 89  GLU A HB2  1  
ATOM 1267  H HB3  . GLU A 1 89  ? 19.273  -5.985  -1.718  1.00 0.00 ? 89  GLU A HB3  1  
ATOM 1268  H HG2  . GLU A 1 89  ? 17.356  -6.391  -3.165  1.00 0.00 ? 89  GLU A HG2  1  
ATOM 1269  H HG3  . GLU A 1 89  ? 18.224  -5.679  -4.523  1.00 0.00 ? 89  GLU A HG3  1  
ATOM 1270  N N    . VAL A 1 90  ? 17.297  -3.474  -4.284  1.00 0.00 ? 90  VAL A N    1  
ATOM 1271  C CA   . VAL A 1 90  ? 17.007  -2.772  -5.529  1.00 0.00 ? 90  VAL A CA   1  
ATOM 1272  C C    . VAL A 1 90  ? 16.976  -1.263  -5.314  1.00 0.00 ? 90  VAL A C    1  
ATOM 1273  O O    . VAL A 1 90  ? 17.562  -0.503  -6.087  1.00 0.00 ? 90  VAL A O    1  
ATOM 1274  C CB   . VAL A 1 90  ? 15.660  -3.222  -6.125  1.00 0.00 ? 90  VAL A CB   1  
ATOM 1275  C CG1  . VAL A 1 90  ? 15.304  -2.377  -7.339  1.00 0.00 ? 90  VAL A CG1  1  
ATOM 1276  C CG2  . VAL A 1 90  ? 15.705  -4.699  -6.489  1.00 0.00 ? 90  VAL A CG2  1  
ATOM 1277  H H    . VAL A 1 90  ? 16.654  -4.131  -3.945  1.00 0.00 ? 90  VAL A H    1  
ATOM 1278  H HA   . VAL A 1 90  ? 17.787  -3.010  -6.236  1.00 0.00 ? 90  VAL A HA   1  
ATOM 1279  H HB   . VAL A 1 90  ? 14.893  -3.081  -5.378  1.00 0.00 ? 90  VAL A HB   1  
ATOM 1280  H HG11 . VAL A 1 90  ? 15.253  -3.007  -8.214  1.00 0.00 ? 90  VAL A HG11 1  
ATOM 1281  H HG12 . VAL A 1 90  ? 14.347  -1.902  -7.179  1.00 0.00 ? 90  VAL A HG12 1  
ATOM 1282  H HG13 . VAL A 1 90  ? 16.062  -1.621  -7.485  1.00 0.00 ? 90  VAL A HG13 1  
ATOM 1283  H HG21 . VAL A 1 90  ? 14.725  -5.131  -6.359  1.00 0.00 ? 90  VAL A HG21 1  
ATOM 1284  H HG22 . VAL A 1 90  ? 16.012  -4.807  -7.519  1.00 0.00 ? 90  VAL A HG22 1  
ATOM 1285  H HG23 . VAL A 1 90  ? 16.411  -5.206  -5.848  1.00 0.00 ? 90  VAL A HG23 1  
ATOM 1286  N N    . LEU A 1 91  ? 16.291  -0.835  -4.260  1.00 0.00 ? 91  LEU A N    1  
ATOM 1287  C CA   . LEU A 1 91  ? 16.184  0.585   -3.942  1.00 0.00 ? 91  LEU A CA   1  
ATOM 1288  C C    . LEU A 1 91  ? 17.562  1.198   -3.718  1.00 0.00 ? 91  LEU A C    1  
ATOM 1289  O O    . LEU A 1 91  ? 17.876  2.258   -4.259  1.00 0.00 ? 91  LEU A O    1  
ATOM 1290  C CB   . LEU A 1 91  ? 15.315  0.785   -2.698  1.00 0.00 ? 91  LEU A CB   1  
ATOM 1291  C CG   . LEU A 1 91  ? 13.915  0.174   -2.752  1.00 0.00 ? 91  LEU A CG   1  
ATOM 1292  C CD1  . LEU A 1 91  ? 13.296  0.136   -1.364  1.00 0.00 ? 91  LEU A CD1  1  
ATOM 1293  C CD2  . LEU A 1 91  ? 13.029  0.954   -3.712  1.00 0.00 ? 91  LEU A CD2  1  
ATOM 1294  H H    . LEU A 1 91  ? 15.845  -1.488  -3.681  1.00 0.00 ? 91  LEU A H    1  
ATOM 1295  H HA   . LEU A 1 91  ? 15.716  1.078   -4.781  1.00 0.00 ? 91  LEU A HA   1  
ATOM 1296  H HB2  . LEU A 1 91  ? 15.835  0.348   -1.859  1.00 0.00 ? 91  LEU A HB2  1  
ATOM 1297  H HB3  . LEU A 1 91  ? 15.208  1.849   -2.539  1.00 0.00 ? 91  LEU A HB3  1  
ATOM 1298  H HG   . LEU A 1 91  ? 13.986  -0.843  -3.113  1.00 0.00 ? 91  LEU A HG   1  
ATOM 1299  H HD11 . LEU A 1 91  ? 12.220  0.151   -1.449  1.00 0.00 ? 91  LEU A HD11 1  
ATOM 1300  H HD12 . LEU A 1 91  ? 13.623  0.997   -0.800  1.00 0.00 ? 91  LEU A HD12 1  
ATOM 1301  H HD13 . LEU A 1 91  ? 13.605  -0.765  -0.856  1.00 0.00 ? 91  LEU A HD13 1  
ATOM 1302  H HD21 . LEU A 1 91  ? 12.126  1.256   -3.203  1.00 0.00 ? 91  LEU A HD21 1  
ATOM 1303  H HD22 . LEU A 1 91  ? 12.775  0.329   -4.556  1.00 0.00 ? 91  LEU A HD22 1  
ATOM 1304  H HD23 . LEU A 1 91  ? 13.557  1.830   -4.059  1.00 0.00 ? 91  LEU A HD23 1  
ATOM 1305  N N    . ARG A 1 92  ? 18.381  0.523   -2.918  1.00 0.00 ? 92  ARG A N    1  
ATOM 1306  C CA   . ARG A 1 92  ? 19.727  1.001   -2.624  1.00 0.00 ? 92  ARG A CA   1  
ATOM 1307  C C    . ARG A 1 92  ? 20.566  1.082   -3.896  1.00 0.00 ? 92  ARG A C    1  
ATOM 1308  O O    . ARG A 1 92  ? 21.323  2.031   -4.092  1.00 0.00 ? 92  ARG A O    1  
ATOM 1309  C CB   . ARG A 1 92  ? 20.407  0.080   -1.609  1.00 0.00 ? 92  ARG A CB   1  
ATOM 1310  C CG   . ARG A 1 92  ? 19.643  -0.056  -0.302  1.00 0.00 ? 92  ARG A CG   1  
ATOM 1311  C CD   . ARG A 1 92  ? 20.382  -0.946  0.685   1.00 0.00 ? 92  ARG A CD   1  
ATOM 1312  N NE   . ARG A 1 92  ? 20.106  -0.574  2.070   1.00 0.00 ? 92  ARG A NE   1  
ATOM 1313  C CZ   . ARG A 1 92  ? 20.765  0.379   2.721   1.00 0.00 ? 92  ARG A CZ   1  
ATOM 1314  N NH1  . ARG A 1 92  ? 21.733  1.053   2.114   1.00 0.00 ? 92  ARG A NH1  1  
ATOM 1315  N NH2  . ARG A 1 92  ? 20.456  0.660   3.980   1.00 0.00 ? 92  ARG A NH2  1  
ATOM 1316  H H    . ARG A 1 92  ? 18.074  -0.316  -2.516  1.00 0.00 ? 92  ARG A H    1  
ATOM 1317  H HA   . ARG A 1 92  ? 19.642  1.990   -2.199  1.00 0.00 ? 92  ARG A HA   1  
ATOM 1318  H HB2  . ARG A 1 92  ? 20.510  -0.903  -2.044  1.00 0.00 ? 92  ARG A HB2  1  
ATOM 1319  H HB3  . ARG A 1 92  ? 21.389  0.471   -1.388  1.00 0.00 ? 92  ARG A HB3  1  
ATOM 1320  H HG2  . ARG A 1 92  ? 19.520  0.924   0.136   1.00 0.00 ? 92  ARG A HG2  1  
ATOM 1321  H HG3  . ARG A 1 92  ? 18.674  -0.486  -0.506  1.00 0.00 ? 92  ARG A HG3  1  
ATOM 1322  H HD2  . ARG A 1 92  ? 20.073  -1.968  0.529   1.00 0.00 ? 92  ARG A HD2  1  
ATOM 1323  H HD3  . ARG A 1 92  ? 21.443  -0.859  0.503   1.00 0.00 ? 92  ARG A HD3  1  
ATOM 1324  H HE   . ARG A 1 92  ? 19.395  -1.059  2.537   1.00 0.00 ? 92  ARG A HE   1  
ATOM 1325  H HH11 . ARG A 1 92  ? 21.967  0.844   1.165   1.00 0.00 ? 92  ARG A HH11 1  
ATOM 1326  H HH12 . ARG A 1 92  ? 22.226  1.771   2.606   1.00 0.00 ? 92  ARG A HH12 1  
ATOM 1327  H HH21 . ARG A 1 92  ? 19.727  0.154   4.440   1.00 0.00 ? 92  ARG A HH21 1  
ATOM 1328  H HH22 . ARG A 1 92  ? 20.952  1.376   4.469   1.00 0.00 ? 92  ARG A HH22 1  
ATOM 1329  N N    . ASN A 1 93  ? 20.425  0.079   -4.756  1.00 0.00 ? 93  ASN A N    1  
ATOM 1330  C CA   . ASN A 1 93  ? 21.170  0.036   -6.009  1.00 0.00 ? 93  ASN A CA   1  
ATOM 1331  C C    . ASN A 1 93  ? 20.775  1.196   -6.917  1.00 0.00 ? 93  ASN A C    1  
ATOM 1332  O O    . ASN A 1 93  ? 21.618  1.779   -7.598  1.00 0.00 ? 93  ASN A O    1  
ATOM 1333  C CB   . ASN A 1 93  ? 20.927  -1.294  -6.726  1.00 0.00 ? 93  ASN A CB   1  
ATOM 1334  C CG   . ASN A 1 93  ? 21.864  -2.387  -6.250  1.00 0.00 ? 93  ASN A CG   1  
ATOM 1335  O OD1  . ASN A 1 93  ? 23.075  -2.317  -6.459  1.00 0.00 ? 93  ASN A OD1  1  
ATOM 1336  N ND2  . ASN A 1 93  ? 21.306  -3.406  -5.607  1.00 0.00 ? 93  ASN A ND2  1  
ATOM 1337  H H    . ASN A 1 93  ? 19.805  -0.650  -4.544  1.00 0.00 ? 93  ASN A H    1  
ATOM 1338  H HA   . ASN A 1 93  ? 22.220  0.120   -5.772  1.00 0.00 ? 93  ASN A HA   1  
ATOM 1339  H HB2  . ASN A 1 93  ? 19.911  -1.613  -6.544  1.00 0.00 ? 93  ASN A HB2  1  
ATOM 1340  H HB3  . ASN A 1 93  ? 21.073  -1.156  -7.787  1.00 0.00 ? 93  ASN A HB3  1  
ATOM 1341  H HD21 . ASN A 1 93  ? 20.334  -3.395  -5.477  1.00 0.00 ? 93  ASN A HD21 1  
ATOM 1342  H HD22 . ASN A 1 93  ? 21.888  -4.127  -5.288  1.00 0.00 ? 93  ASN A HD22 1  
ATOM 1343  N N    . ALA A 1 94  ? 19.488  1.526   -6.921  1.00 0.00 ? 94  ALA A N    1  
ATOM 1344  C CA   . ALA A 1 94  ? 18.981  2.617   -7.743  1.00 0.00 ? 94  ALA A CA   1  
ATOM 1345  C C    . ALA A 1 94  ? 19.752  3.906   -7.479  1.00 0.00 ? 94  ALA A C    1  
ATOM 1346  O O    . ALA A 1 94  ? 20.173  4.170   -6.353  1.00 0.00 ? 94  ALA A O    1  
ATOM 1347  C CB   . ALA A 1 94  ? 17.496  2.826   -7.486  1.00 0.00 ? 94  ALA A CB   1  
ATOM 1348  H H    . ALA A 1 94  ? 18.864  1.023   -6.356  1.00 0.00 ? 94  ALA A H    1  
ATOM 1349  H HA   . ALA A 1 94  ? 19.106  2.341   -8.780  1.00 0.00 ? 94  ALA A HA   1  
ATOM 1350  H HB1  . ALA A 1 94  ? 17.181  3.758   -7.933  1.00 0.00 ? 94  ALA A HB1  1  
ATOM 1351  H HB2  . ALA A 1 94  ? 16.937  2.011   -7.921  1.00 0.00 ? 94  ALA A HB2  1  
ATOM 1352  H HB3  . ALA A 1 94  ? 17.316  2.859   -6.422  1.00 0.00 ? 94  ALA A HB3  1  
ATOM 1353  N N    . GLY A 1 95  ? 19.934  4.707   -8.525  1.00 0.00 ? 95  GLY A N    1  
ATOM 1354  C CA   . GLY A 1 95  ? 20.655  5.958   -8.385  1.00 0.00 ? 95  GLY A CA   1  
ATOM 1355  C C    . GLY A 1 95  ? 19.730  7.138   -8.161  1.00 0.00 ? 95  GLY A C    1  
ATOM 1356  O O    . GLY A 1 95  ? 18.597  6.969   -7.709  1.00 0.00 ? 95  GLY A O    1  
ATOM 1357  H H    . GLY A 1 95  ? 19.576  4.445   -9.399  1.00 0.00 ? 95  GLY A H    1  
ATOM 1358  H HA2  . GLY A 1 95  ? 21.331  5.880   -7.547  1.00 0.00 ? 95  GLY A HA2  1  
ATOM 1359  H HA3  . GLY A 1 95  ? 21.229  6.132   -9.283  1.00 0.00 ? 95  GLY A HA3  1  
ATOM 1360  N N    . GLN A 1 96  ? 20.213  8.335   -8.476  1.00 0.00 ? 96  GLN A N    1  
ATOM 1361  C CA   . GLN A 1 96  ? 19.422  9.548   -8.304  1.00 0.00 ? 96  GLN A CA   1  
ATOM 1362  C C    . GLN A 1 96  ? 18.054  9.403   -8.962  1.00 0.00 ? 96  GLN A C    1  
ATOM 1363  O O    . GLN A 1 96  ? 17.022  9.461   -8.293  1.00 0.00 ? 96  GLN A O    1  
ATOM 1364  C CB   . GLN A 1 96  ? 20.160  10.752  -8.892  1.00 0.00 ? 96  GLN A CB   1  
ATOM 1365  C CG   . GLN A 1 96  ? 19.694  12.085  -8.330  1.00 0.00 ? 96  GLN A CG   1  
ATOM 1366  C CD   . GLN A 1 96  ? 20.759  13.160  -8.421  1.00 0.00 ? 96  GLN A CD   1  
ATOM 1367  O OE1  . GLN A 1 96  ? 21.311  13.414  -9.492  1.00 0.00 ? 96  GLN A OE1  1  
ATOM 1368  N NE2  . GLN A 1 96  ? 21.052  13.800  -7.295  1.00 0.00 ? 96  GLN A NE2  1  
ATOM 1369  H H    . GLN A 1 96  ? 21.123  8.405   -8.832  1.00 0.00 ? 96  GLN A H    1  
ATOM 1370  H HA   . GLN A 1 96  ? 19.283  9.705   -7.245  1.00 0.00 ? 96  GLN A HA   1  
ATOM 1371  H HB2  . GLN A 1 96  ? 21.215  10.648  -8.688  1.00 0.00 ? 96  GLN A HB2  1  
ATOM 1372  H HB3  . GLN A 1 96  ? 20.008  10.764  -9.962  1.00 0.00 ? 96  GLN A HB3  1  
ATOM 1373  H HG2  . GLN A 1 96  ? 18.827  12.412  -8.885  1.00 0.00 ? 96  GLN A HG2  1  
ATOM 1374  H HG3  . GLN A 1 96  ? 19.427  11.950  -7.293  1.00 0.00 ? 96  GLN A HG3  1  
ATOM 1375  H HE21 . GLN A 1 96  ? 20.572  13.543  -6.479  1.00 0.00 ? 96  GLN A HE21 1  
ATOM 1376  H HE22 . GLN A 1 96  ? 21.737  14.499  -7.324  1.00 0.00 ? 96  GLN A HE22 1  
ATOM 1377  N N    . VAL A 1 97  ? 18.053  9.215   -10.278 1.00 0.00 ? 97  VAL A N    1  
ATOM 1378  C CA   . VAL A 1 97  ? 16.811  9.061   -11.027 1.00 0.00 ? 97  VAL A CA   1  
ATOM 1379  C C    . VAL A 1 97  ? 16.152  7.719   -10.728 1.00 0.00 ? 97  VAL A C    1  
ATOM 1380  O O    . VAL A 1 97  ? 16.549  6.686   -11.266 1.00 0.00 ? 97  VAL A O    1  
ATOM 1381  C CB   . VAL A 1 97  ? 17.053  9.175   -12.544 1.00 0.00 ? 97  VAL A CB   1  
ATOM 1382  C CG1  . VAL A 1 97  ? 15.768  8.906   -13.311 1.00 0.00 ? 97  VAL A CG1  1  
ATOM 1383  C CG2  . VAL A 1 97  ? 17.615  10.545  -12.892 1.00 0.00 ? 97  VAL A CG2  1  
ATOM 1384  H H    . VAL A 1 97  ? 18.907  9.178   -10.756 1.00 0.00 ? 97  VAL A H    1  
ATOM 1385  H HA   . VAL A 1 97  ? 16.141  9.855   -10.730 1.00 0.00 ? 97  VAL A HA   1  
ATOM 1386  H HB   . VAL A 1 97  ? 17.780  8.429   -12.829 1.00 0.00 ? 97  VAL A HB   1  
ATOM 1387  H HG11 . VAL A 1 97  ? 14.936  8.882   -12.623 1.00 0.00 ? 97  VAL A HG11 1  
ATOM 1388  H HG12 . VAL A 1 97  ? 15.613  9.688   -14.040 1.00 0.00 ? 97  VAL A HG12 1  
ATOM 1389  H HG13 . VAL A 1 97  ? 15.844  7.954   -13.816 1.00 0.00 ? 97  VAL A HG13 1  
ATOM 1390  H HG21 . VAL A 1 97  ? 17.252  11.273  -12.181 1.00 0.00 ? 97  VAL A HG21 1  
ATOM 1391  H HG22 . VAL A 1 97  ? 18.694  10.513  -12.854 1.00 0.00 ? 97  VAL A HG22 1  
ATOM 1392  H HG23 . VAL A 1 97  ? 17.298  10.823  -13.886 1.00 0.00 ? 97  VAL A HG23 1  
ATOM 1393  N N    . VAL A 1 98  ? 15.140  7.743   -9.866  1.00 0.00 ? 98  VAL A N    1  
ATOM 1394  C CA   . VAL A 1 98  ? 14.423  6.528   -9.496  1.00 0.00 ? 98  VAL A CA   1  
ATOM 1395  C C    . VAL A 1 98  ? 13.007  6.533   -10.060 1.00 0.00 ? 98  VAL A C    1  
ATOM 1396  O O    . VAL A 1 98  ? 12.131  7.241   -9.563  1.00 0.00 ? 98  VAL A O    1  
ATOM 1397  C CB   . VAL A 1 98  ? 14.354  6.361   -7.966  1.00 0.00 ? 98  VAL A CB   1  
ATOM 1398  C CG1  . VAL A 1 98  ? 13.591  5.097   -7.601  1.00 0.00 ? 98  VAL A CG1  1  
ATOM 1399  C CG2  . VAL A 1 98  ? 15.753  6.341   -7.369  1.00 0.00 ? 98  VAL A CG2  1  
ATOM 1400  H H    . VAL A 1 98  ? 14.869  8.597   -9.470  1.00 0.00 ? 98  VAL A H    1  
ATOM 1401  H HA   . VAL A 1 98  ? 14.961  5.685   -9.905  1.00 0.00 ? 98  VAL A HA   1  
ATOM 1402  H HB   . VAL A 1 98  ? 13.822  7.207   -7.556  1.00 0.00 ? 98  VAL A HB   1  
ATOM 1403  H HG11 . VAL A 1 98  ? 12.562  5.195   -7.913  1.00 0.00 ? 98  VAL A HG11 1  
ATOM 1404  H HG12 . VAL A 1 98  ? 14.041  4.249   -8.097  1.00 0.00 ? 98  VAL A HG12 1  
ATOM 1405  H HG13 . VAL A 1 98  ? 13.629  4.950   -6.531  1.00 0.00 ? 98  VAL A HG13 1  
ATOM 1406  H HG21 . VAL A 1 98  ? 16.416  6.926   -7.989  1.00 0.00 ? 98  VAL A HG21 1  
ATOM 1407  H HG22 . VAL A 1 98  ? 15.727  6.762   -6.374  1.00 0.00 ? 98  VAL A HG22 1  
ATOM 1408  H HG23 . VAL A 1 98  ? 16.109  5.323   -7.319  1.00 0.00 ? 98  VAL A HG23 1  
ATOM 1409  N N    . HIS A 1 99  ? 12.788  5.736   -11.102 1.00 0.00 ? 99  HIS A N    1  
ATOM 1410  C CA   . HIS A 1 99  ? 11.477  5.647   -11.734 1.00 0.00 ? 99  HIS A CA   1  
ATOM 1411  C C    . HIS A 1 99  ? 10.639  4.545   -11.093 1.00 0.00 ? 99  HIS A C    1  
ATOM 1412  O O    . HIS A 1 99  ? 10.720  3.381   -11.487 1.00 0.00 ? 99  HIS A O    1  
ATOM 1413  C CB   . HIS A 1 99  ? 11.627  5.384   -13.233 1.00 0.00 ? 99  HIS A CB   1  
ATOM 1414  C CG   . HIS A 1 99  ? 11.866  6.625   -14.038 1.00 0.00 ? 99  HIS A CG   1  
ATOM 1415  N ND1  . HIS A 1 99  ? 12.986  6.808   -14.822 1.00 0.00 ? 99  HIS A ND1  1  
ATOM 1416  C CD2  . HIS A 1 99  ? 11.122  7.746   -14.178 1.00 0.00 ? 99  HIS A CD2  1  
ATOM 1417  C CE1  . HIS A 1 99  ? 12.920  7.990   -15.408 1.00 0.00 ? 99  HIS A CE1  1  
ATOM 1418  N NE2  . HIS A 1 99  ? 11.799  8.579   -15.035 1.00 0.00 ? 99  HIS A NE2  1  
ATOM 1419  H H    . HIS A 1 99  ? 13.526  5.196   -11.453 1.00 0.00 ? 99  HIS A H    1  
ATOM 1420  H HA   . HIS A 1 99  ? 10.975  6.593   -11.592 1.00 0.00 ? 99  HIS A HA   1  
ATOM 1421  H HB2  . HIS A 1 99  ? 12.462  4.719   -13.393 1.00 0.00 ? 99  HIS A HB2  1  
ATOM 1422  H HB3  . HIS A 1 99  ? 10.725  4.918   -13.602 1.00 0.00 ? 99  HIS A HB3  1  
ATOM 1423  H HD1  . HIS A 1 99  ? 13.719  6.168   -14.930 1.00 0.00 ? 99  HIS A HD1  1  
ATOM 1424  H HD2  . HIS A 1 99  ? 10.172  7.950   -13.704 1.00 0.00 ? 99  HIS A HD2  1  
ATOM 1425  H HE1  . HIS A 1 99  ? 13.658  8.404   -16.080 1.00 0.00 ? 99  HIS A HE1  1  
ATOM 1426  H HE2  . HIS A 1 99  ? 11.544  9.499   -15.256 1.00 0.00 ? 99  HIS A HE2  1  
ATOM 1427  N N    . LEU A 1 100 ? 9.834   4.920   -10.105 1.00 0.00 ? 100 LEU A N    1  
ATOM 1428  C CA   . LEU A 1 100 ? 8.981   3.963   -9.408  1.00 0.00 ? 100 LEU A CA   1  
ATOM 1429  C C    . LEU A 1 100 ? 7.746   3.630   -10.239 1.00 0.00 ? 100 LEU A C    1  
ATOM 1430  O O    . LEU A 1 100 ? 7.106   4.518   -10.804 1.00 0.00 ? 100 LEU A O    1  
ATOM 1431  C CB   . LEU A 1 100 ? 8.560   4.521   -8.048  1.00 0.00 ? 100 LEU A CB   1  
ATOM 1432  C CG   . LEU A 1 100 ? 8.332   3.491   -6.941  1.00 0.00 ? 100 LEU A CG   1  
ATOM 1433  C CD1  . LEU A 1 100 ? 7.515   2.319   -7.463  1.00 0.00 ? 100 LEU A CD1  1  
ATOM 1434  C CD2  . LEU A 1 100 ? 9.662   3.008   -6.380  1.00 0.00 ? 100 LEU A CD2  1  
ATOM 1435  H H    . LEU A 1 100 ? 9.813   5.861   -9.836  1.00 0.00 ? 100 LEU A H    1  
ATOM 1436  H HA   . LEU A 1 100 ? 9.552   3.059   -9.257  1.00 0.00 ? 100 LEU A HA   1  
ATOM 1437  H HB2  . LEU A 1 100 ? 9.332   5.198   -7.715  1.00 0.00 ? 100 LEU A HB2  1  
ATOM 1438  H HB3  . LEU A 1 100 ? 7.638   5.068   -8.187  1.00 0.00 ? 100 LEU A HB3  1  
ATOM 1439  H HG   . LEU A 1 100 ? 7.777   3.953   -6.137  1.00 0.00 ? 100 LEU A HG   1  
ATOM 1440  H HD11 . LEU A 1 100 ? 8.170   1.609   -7.945  1.00 0.00 ? 100 LEU A HD11 1  
ATOM 1441  H HD12 . LEU A 1 100 ? 6.785   2.677   -8.174  1.00 0.00 ? 100 LEU A HD12 1  
ATOM 1442  H HD13 . LEU A 1 100 ? 7.007   1.839   -6.638  1.00 0.00 ? 100 LEU A HD13 1  
ATOM 1443  H HD21 . LEU A 1 100 ? 10.405  3.782   -6.501  1.00 0.00 ? 100 LEU A HD21 1  
ATOM 1444  H HD22 . LEU A 1 100 ? 9.976   2.121   -6.912  1.00 0.00 ? 100 LEU A HD22 1  
ATOM 1445  H HD23 . LEU A 1 100 ? 9.548   2.778   -5.331  1.00 0.00 ? 100 LEU A HD23 1  
ATOM 1446  N N    . THR A 1 101 ? 7.414   2.344   -10.308 1.00 0.00 ? 101 THR A N    1  
ATOM 1447  C CA   . THR A 1 101 ? 6.255   1.894   -11.068 1.00 0.00 ? 101 THR A CA   1  
ATOM 1448  C C    . THR A 1 101 ? 5.132   1.442   -10.141 1.00 0.00 ? 101 THR A C    1  
ATOM 1449  O O    . THR A 1 101 ? 5.206   0.374   -9.533  1.00 0.00 ? 101 THR A O    1  
ATOM 1450  C CB   . THR A 1 101 ? 6.620   0.736   -12.015 1.00 0.00 ? 101 THR A CB   1  
ATOM 1451  O OG1  . THR A 1 101 ? 7.815   1.053   -12.738 1.00 0.00 ? 101 THR A OG1  1  
ATOM 1452  C CG2  . THR A 1 101 ? 5.488   0.459   -12.993 1.00 0.00 ? 101 THR A CG2  1  
ATOM 1453  H H    . THR A 1 101 ? 7.963   1.684   -9.836  1.00 0.00 ? 101 THR A H    1  
ATOM 1454  H HA   . THR A 1 101 ? 5.904   2.723   -11.665 1.00 0.00 ? 101 THR A HA   1  
ATOM 1455  H HB   . THR A 1 101 ? 6.791   -0.153  -11.424 1.00 0.00 ? 101 THR A HB   1  
ATOM 1456  H HG1  . THR A 1 101 ? 7.696   1.884   -13.204 1.00 0.00 ? 101 THR A HG1  1  
ATOM 1457  H HG21 . THR A 1 101 ? 5.183   1.383   -13.462 1.00 0.00 ? 101 THR A HG21 1  
ATOM 1458  H HG22 . THR A 1 101 ? 4.650   0.031   -12.462 1.00 0.00 ? 101 THR A HG22 1  
ATOM 1459  H HG23 . THR A 1 101 ? 5.827   -0.233  -13.749 1.00 0.00 ? 101 THR A HG23 1  
ATOM 1460  N N    . LEU A 1 102 ? 4.091   2.262   -10.038 1.00 0.00 ? 102 LEU A N    1  
ATOM 1461  C CA   . LEU A 1 102 ? 2.950   1.946   -9.185  1.00 0.00 ? 102 LEU A CA   1  
ATOM 1462  C C    . LEU A 1 102 ? 1.679   1.789   -10.013 1.00 0.00 ? 102 LEU A C    1  
ATOM 1463  O O    . LEU A 1 102 ? 1.589   2.289   -11.134 1.00 0.00 ? 102 LEU A O    1  
ATOM 1464  C CB   . LEU A 1 102 ? 2.756   3.040   -8.133  1.00 0.00 ? 102 LEU A CB   1  
ATOM 1465  C CG   . LEU A 1 102 ? 4.026   3.541   -7.444  1.00 0.00 ? 102 LEU A CG   1  
ATOM 1466  C CD1  . LEU A 1 102 ? 4.695   4.622   -8.278  1.00 0.00 ? 102 LEU A CD1  1  
ATOM 1467  C CD2  . LEU A 1 102 ? 3.706   4.061   -6.050  1.00 0.00 ? 102 LEU A CD2  1  
ATOM 1468  H H    . LEU A 1 102 ? 4.089   3.099   -10.546 1.00 0.00 ? 102 LEU A H    1  
ATOM 1469  H HA   . LEU A 1 102 ? 3.158   1.011   -8.686  1.00 0.00 ? 102 LEU A HA   1  
ATOM 1470  H HB2  . LEU A 1 102 ? 2.288   3.883   -8.616  1.00 0.00 ? 102 LEU A HB2  1  
ATOM 1471  H HB3  . LEU A 1 102 ? 2.096   2.651   -7.371  1.00 0.00 ? 102 LEU A HB3  1  
ATOM 1472  H HG   . LEU A 1 102 ? 4.721   2.719   -7.343  1.00 0.00 ? 102 LEU A HG   1  
ATOM 1473  H HD11 . LEU A 1 102 ? 4.097   4.823   -9.154  1.00 0.00 ? 102 LEU A HD11 1  
ATOM 1474  H HD12 . LEU A 1 102 ? 5.676   4.287   -8.582  1.00 0.00 ? 102 LEU A HD12 1  
ATOM 1475  H HD13 . LEU A 1 102 ? 4.789   5.523   -7.691  1.00 0.00 ? 102 LEU A HD13 1  
ATOM 1476  H HD21 . LEU A 1 102 ? 2.742   3.687   -5.739  1.00 0.00 ? 102 LEU A HD21 1  
ATOM 1477  H HD22 . LEU A 1 102 ? 3.684   5.142   -6.066  1.00 0.00 ? 102 LEU A HD22 1  
ATOM 1478  H HD23 . LEU A 1 102 ? 4.463   3.726   -5.358  1.00 0.00 ? 102 LEU A HD23 1  
ATOM 1479  N N    . VAL A 1 103 ? 0.695   1.092   -9.451  1.00 0.00 ? 103 VAL A N    1  
ATOM 1480  C CA   . VAL A 1 103 ? -0.573  0.872   -10.136 1.00 0.00 ? 103 VAL A CA   1  
ATOM 1481  C C    . VAL A 1 103 ? -1.745  0.968   -9.165  1.00 0.00 ? 103 VAL A C    1  
ATOM 1482  O O    . VAL A 1 103 ? -1.907  0.121   -8.286  1.00 0.00 ? 103 VAL A O    1  
ATOM 1483  C CB   . VAL A 1 103 ? -0.605  -0.503  -10.829 1.00 0.00 ? 103 VAL A CB   1  
ATOM 1484  C CG1  . VAL A 1 103 ? -0.223  -1.603  -9.851  1.00 0.00 ? 103 VAL A CG1  1  
ATOM 1485  C CG2  . VAL A 1 103 ? -1.979  -0.765  -11.429 1.00 0.00 ? 103 VAL A CG2  1  
ATOM 1486  H H    . VAL A 1 103 ? 0.826   0.718   -8.555  1.00 0.00 ? 103 VAL A H    1  
ATOM 1487  H HA   . VAL A 1 103 ? -0.681  1.636   -10.892 1.00 0.00 ? 103 VAL A HA   1  
ATOM 1488  H HB   . VAL A 1 103 ? 0.119   -0.497  -11.631 1.00 0.00 ? 103 VAL A HB   1  
ATOM 1489  H HG11 . VAL A 1 103 ? 0.691   -2.075  -10.180 1.00 0.00 ? 103 VAL A HG11 1  
ATOM 1490  H HG12 . VAL A 1 103 ? -0.078  -1.178  -8.869  1.00 0.00 ? 103 VAL A HG12 1  
ATOM 1491  H HG13 . VAL A 1 103 ? -1.012  -2.340  -9.811  1.00 0.00 ? 103 VAL A HG13 1  
ATOM 1492  H HG21 . VAL A 1 103 ? -2.071  -1.813  -11.671 1.00 0.00 ? 103 VAL A HG21 1  
ATOM 1493  H HG22 . VAL A 1 103 ? -2.742  -0.492  -10.714 1.00 0.00 ? 103 VAL A HG22 1  
ATOM 1494  H HG23 . VAL A 1 103 ? -2.099  -0.175  -12.325 1.00 0.00 ? 103 VAL A HG23 1  
ATOM 1495  N N    . ARG A 1 104 ? -2.560  2.004   -9.331  1.00 0.00 ? 104 ARG A N    1  
ATOM 1496  C CA   . ARG A 1 104 ? -3.718  2.211   -8.469  1.00 0.00 ? 104 ARG A CA   1  
ATOM 1497  C C    . ARG A 1 104 ? -5.016  2.045   -9.253  1.00 0.00 ? 104 ARG A C    1  
ATOM 1498  O O    . ARG A 1 104 ? -5.048  2.241   -10.469 1.00 0.00 ? 104 ARG A O    1  
ATOM 1499  C CB   . ARG A 1 104 ? -3.666  3.602   -7.835  1.00 0.00 ? 104 ARG A CB   1  
ATOM 1500  C CG   . ARG A 1 104 ? -3.692  4.734   -8.849  1.00 0.00 ? 104 ARG A CG   1  
ATOM 1501  C CD   . ARG A 1 104 ? -2.941  5.955   -8.340  1.00 0.00 ? 104 ARG A CD   1  
ATOM 1502  N NE   . ARG A 1 104 ? -3.656  6.626   -7.257  1.00 0.00 ? 104 ARG A NE   1  
ATOM 1503  C CZ   . ARG A 1 104 ? -3.067  7.419   -6.369  1.00 0.00 ? 104 ARG A CZ   1  
ATOM 1504  N NH1  . ARG A 1 104 ? -1.762  7.641   -6.436  1.00 0.00 ? 104 ARG A NH1  1  
ATOM 1505  N NH2  . ARG A 1 104 ? -3.785  7.994   -5.413  1.00 0.00 ? 104 ARG A NH2  1  
ATOM 1506  H H    . ARG A 1 104 ? -2.379  2.645   -10.050 1.00 0.00 ? 104 ARG A H    1  
ATOM 1507  H HA   . ARG A 1 104 ? -3.686  1.467   -7.687  1.00 0.00 ? 104 ARG A HA   1  
ATOM 1508  H HB2  . ARG A 1 104 ? -4.515  3.717   -7.178  1.00 0.00 ? 104 ARG A HB2  1  
ATOM 1509  H HB3  . ARG A 1 104 ? -2.759  3.687   -7.256  1.00 0.00 ? 104 ARG A HB3  1  
ATOM 1510  H HG2  . ARG A 1 104 ? -3.230  4.397   -9.764  1.00 0.00 ? 104 ARG A HG2  1  
ATOM 1511  H HG3  . ARG A 1 104 ? -4.719  5.009   -9.041  1.00 0.00 ? 104 ARG A HG3  1  
ATOM 1512  H HD2  . ARG A 1 104 ? -1.973  5.640   -7.979  1.00 0.00 ? 104 ARG A HD2  1  
ATOM 1513  H HD3  . ARG A 1 104 ? -2.812  6.648   -9.158  1.00 0.00 ? 104 ARG A HD3  1  
ATOM 1514  H HE   . ARG A 1 104 ? -4.621  6.476   -7.190  1.00 0.00 ? 104 ARG A HE   1  
ATOM 1515  H HH11 . ARG A 1 104 ? -1.218  7.210   -7.156  1.00 0.00 ? 104 ARG A HH11 1  
ATOM 1516  H HH12 . ARG A 1 104 ? -1.321  8.240   -5.767  1.00 0.00 ? 104 ARG A HH12 1  
ATOM 1517  H HH21 . ARG A 1 104 ? -4.770  7.830   -5.360  1.00 0.00 ? 104 ARG A HH21 1  
ATOM 1518  H HH22 . ARG A 1 104 ? -3.342  8.591   -4.745  1.00 0.00 ? 104 ARG A HH22 1  
ATOM 1519  N N    . ARG A 1 105 ? -6.084  1.683   -8.550  1.00 0.00 ? 105 ARG A N    1  
ATOM 1520  C CA   . ARG A 1 105 ? -7.384  1.490   -9.181  1.00 0.00 ? 105 ARG A CA   1  
ATOM 1521  C C    . ARG A 1 105 ? -7.876  2.784   -9.822  1.00 0.00 ? 105 ARG A C    1  
ATOM 1522  O O    . ARG A 1 105 ? -7.940  3.827   -9.171  1.00 0.00 ? 105 ARG A O    1  
ATOM 1523  C CB   . ARG A 1 105 ? -8.405  0.998   -8.153  1.00 0.00 ? 105 ARG A CB   1  
ATOM 1524  C CG   . ARG A 1 105 ? -9.640  0.366   -8.775  1.00 0.00 ? 105 ARG A CG   1  
ATOM 1525  C CD   . ARG A 1 105 ? -10.340 -0.566  -7.799  1.00 0.00 ? 105 ARG A CD   1  
ATOM 1526  N NE   . ARG A 1 105 ? -11.188 0.162   -6.859  1.00 0.00 ? 105 ARG A NE   1  
ATOM 1527  C CZ   . ARG A 1 105 ? -12.228 -0.380  -6.236  1.00 0.00 ? 105 ARG A CZ   1  
ATOM 1528  N NH1  . ARG A 1 105 ? -12.547 -1.649  -6.451  1.00 0.00 ? 105 ARG A NH1  1  
ATOM 1529  N NH2  . ARG A 1 105 ? -12.952 0.347   -5.394  1.00 0.00 ? 105 ARG A NH2  1  
ATOM 1530  H H    . ARG A 1 105 ? -5.996  1.542   -7.584  1.00 0.00 ? 105 ARG A H    1  
ATOM 1531  H HA   . ARG A 1 105 ? -7.272  0.741   -9.950  1.00 0.00 ? 105 ARG A HA   1  
ATOM 1532  H HB2  . ARG A 1 105 ? -7.933  0.263   -7.517  1.00 0.00 ? 105 ARG A HB2  1  
ATOM 1533  H HB3  . ARG A 1 105 ? -8.721  1.835   -7.549  1.00 0.00 ? 105 ARG A HB3  1  
ATOM 1534  H HG2  . ARG A 1 105 ? -10.326 1.148   -9.064  1.00 0.00 ? 105 ARG A HG2  1  
ATOM 1535  H HG3  . ARG A 1 105 ? -9.344  -0.196  -9.648  1.00 0.00 ? 105 ARG A HG3  1  
ATOM 1536  H HD2  . ARG A 1 105 ? -10.952 -1.258  -8.359  1.00 0.00 ? 105 ARG A HD2  1  
ATOM 1537  H HD3  . ARG A 1 105 ? -9.592  -1.114  -7.245  1.00 0.00 ? 105 ARG A HD3  1  
ATOM 1538  H HE   . ARG A 1 105 ? -10.971 1.101   -6.685  1.00 0.00 ? 105 ARG A HE   1  
ATOM 1539  H HH11 . ARG A 1 105 ? -12.003 -2.200  -7.084  1.00 0.00 ? 105 ARG A HH11 1  
ATOM 1540  H HH12 . ARG A 1 105 ? -13.330 -2.055  -5.980  1.00 0.00 ? 105 ARG A HH12 1  
ATOM 1541  H HH21 . ARG A 1 105 ? -12.715 1.304   -5.229  1.00 0.00 ? 105 ARG A HH21 1  
ATOM 1542  H HH22 . ARG A 1 105 ? -13.735 -0.062  -4.926  1.00 0.00 ? 105 ARG A HH22 1  
ATOM 1543  N N    . LYS A 1 106 ? -8.221  2.710   -11.103 1.00 0.00 ? 106 LYS A N    1  
ATOM 1544  C CA   . LYS A 1 106 ? -8.707  3.874   -11.834 1.00 0.00 ? 106 LYS A CA   1  
ATOM 1545  C C    . LYS A 1 106 ? -10.015 4.384   -11.236 1.00 0.00 ? 106 LYS A C    1  
ATOM 1546  O O    . LYS A 1 106 ? -10.620 3.729   -10.387 1.00 0.00 ? 106 LYS A O    1  
ATOM 1547  C CB   . LYS A 1 106 ? -8.910  3.527   -13.310 1.00 0.00 ? 106 LYS A CB   1  
ATOM 1548  C CG   . LYS A 1 106 ? -7.624  3.157   -14.030 1.00 0.00 ? 106 LYS A CG   1  
ATOM 1549  C CD   . LYS A 1 106 ? -7.898  2.301   -15.255 1.00 0.00 ? 106 LYS A CD   1  
ATOM 1550  C CE   . LYS A 1 106 ? -6.803  2.457   -16.299 1.00 0.00 ? 106 LYS A CE   1  
ATOM 1551  N NZ   . LYS A 1 106 ? -7.114  1.703   -17.546 1.00 0.00 ? 106 LYS A NZ   1  
ATOM 1552  H H    . LYS A 1 106 ? -8.148  1.850   -11.568 1.00 0.00 ? 106 LYS A H    1  
ATOM 1553  H HA   . LYS A 1 106 ? -7.962  4.651   -11.754 1.00 0.00 ? 106 LYS A HA   1  
ATOM 1554  H HB2  . LYS A 1 106 ? -9.591  2.693   -13.381 1.00 0.00 ? 106 LYS A HB2  1  
ATOM 1555  H HB3  . LYS A 1 106 ? -9.345  4.380   -13.811 1.00 0.00 ? 106 LYS A HB3  1  
ATOM 1556  H HG2  . LYS A 1 106 ? -7.122  4.061   -14.340 1.00 0.00 ? 106 LYS A HG2  1  
ATOM 1557  H HG3  . LYS A 1 106 ? -6.989  2.605   -13.351 1.00 0.00 ? 106 LYS A HG3  1  
ATOM 1558  H HD2  . LYS A 1 106 ? -7.950  1.265   -14.957 1.00 0.00 ? 106 LYS A HD2  1  
ATOM 1559  H HD3  . LYS A 1 106 ? -8.842  2.601   -15.689 1.00 0.00 ? 106 LYS A HD3  1  
ATOM 1560  H HE2  . LYS A 1 106 ? -6.698  3.504   -16.539 1.00 0.00 ? 106 LYS A HE2  1  
ATOM 1561  H HE3  . LYS A 1 106 ? -5.876  2.088   -15.887 1.00 0.00 ? 106 LYS A HE3  1  
ATOM 1562  H HZ1  . LYS A 1 106 ? -8.121  1.808   -17.784 1.00 0.00 ? 106 LYS A HZ1  1  
ATOM 1563  H HZ2  . LYS A 1 106 ? -6.903  0.693   -17.414 1.00 0.00 ? 106 LYS A HZ2  1  
ATOM 1564  H HZ3  . LYS A 1 106 ? -6.542  2.066   -18.335 1.00 0.00 ? 106 LYS A HZ3  1  
ATOM 1565  N N    . THR A 1 107 ? -10.449 5.557   -11.687 1.00 0.00 ? 107 THR A N    1  
ATOM 1566  C CA   . THR A 1 107 ? -11.685 6.155   -11.198 1.00 0.00 ? 107 THR A CA   1  
ATOM 1567  C C    . THR A 1 107 ? -11.572 6.522   -9.722  1.00 0.00 ? 107 THR A C    1  
ATOM 1568  O O    . THR A 1 107 ? -12.473 6.241   -8.932  1.00 0.00 ? 107 THR A O    1  
ATOM 1569  C CB   . THR A 1 107 ? -12.882 5.204   -11.388 1.00 0.00 ? 107 THR A CB   1  
ATOM 1570  O OG1  . THR A 1 107 ? -12.744 4.483   -12.618 1.00 0.00 ? 107 THR A OG1  1  
ATOM 1571  C CG2  . THR A 1 107 ? -14.192 5.978   -11.393 1.00 0.00 ? 107 THR A CG2  1  
ATOM 1572  H H    . THR A 1 107 ? -9.923  6.032   -12.364 1.00 0.00 ? 107 THR A H    1  
ATOM 1573  H HA   . THR A 1 107 ? -11.870 7.053   -11.769 1.00 0.00 ? 107 THR A HA   1  
ATOM 1574  H HB   . THR A 1 107 ? -12.899 4.502   -10.567 1.00 0.00 ? 107 THR A HB   1  
ATOM 1575  H HG1  . THR A 1 107 ? -13.188 3.635   -12.542 1.00 0.00 ? 107 THR A HG1  1  
ATOM 1576  H HG21 . THR A 1 107 ? -14.148 6.756   -12.141 1.00 0.00 ? 107 THR A HG21 1  
ATOM 1577  H HG22 . THR A 1 107 ? -14.351 6.422   -10.421 1.00 0.00 ? 107 THR A HG22 1  
ATOM 1578  H HG23 . THR A 1 107 ? -15.005 5.306   -11.620 1.00 0.00 ? 107 THR A HG23 1  
ATOM 1579  N N    . SER A 1 108 ? -10.459 7.151   -9.358  1.00 0.00 ? 108 SER A N    1  
ATOM 1580  C CA   . SER A 1 108 ? -10.227 7.554   -7.976  1.00 0.00 ? 108 SER A CA   1  
ATOM 1581  C C    . SER A 1 108 ? -9.864  9.034   -7.895  1.00 0.00 ? 108 SER A C    1  
ATOM 1582  O O    . SER A 1 108 ? -9.735  9.709   -8.915  1.00 0.00 ? 108 SER A O    1  
ATOM 1583  C CB   . SER A 1 108 ? -9.112  6.709   -7.356  1.00 0.00 ? 108 SER A CB   1  
ATOM 1584  O OG   . SER A 1 108 ? -9.231  6.664   -5.945  1.00 0.00 ? 108 SER A OG   1  
ATOM 1585  H H    . SER A 1 108 ? -9.777  7.347   -10.034 1.00 0.00 ? 108 SER A H    1  
ATOM 1586  H HA   . SER A 1 108 ? -11.141 7.389   -7.424  1.00 0.00 ? 108 SER A HA   1  
ATOM 1587  H HB2  . SER A 1 108 ? -9.170  5.703   -7.743  1.00 0.00 ? 108 SER A HB2  1  
ATOM 1588  H HB3  . SER A 1 108 ? -8.154  7.139   -7.611  1.00 0.00 ? 108 SER A HB3  1  
ATOM 1589  H HG   . SER A 1 108 ? -8.377  6.842   -5.545  1.00 0.00 ? 108 SER A HG   1  
ATOM 1590  N N    . SER A 1 109 ? -9.700  9.531   -6.673  1.00 0.00 ? 109 SER A N    1  
ATOM 1591  C CA   . SER A 1 109 ? -9.356  10.931  -6.457  1.00 0.00 ? 109 SER A CA   1  
ATOM 1592  C C    . SER A 1 109 ? -8.422  11.436  -7.552  1.00 0.00 ? 109 SER A C    1  
ATOM 1593  O O    . SER A 1 109 ? -8.583  12.547  -8.057  1.00 0.00 ? 109 SER A O    1  
ATOM 1594  C CB   . SER A 1 109 ? -8.698  11.111  -5.087  1.00 0.00 ? 109 SER A CB   1  
ATOM 1595  O OG   . SER A 1 109 ? -7.483  10.385  -5.006  1.00 0.00 ? 109 SER A OG   1  
ATOM 1596  H H    . SER A 1 109 ? -9.816  8.941   -5.898  1.00 0.00 ? 109 SER A H    1  
ATOM 1597  H HA   . SER A 1 109 ? -10.270 11.505  -6.486  1.00 0.00 ? 109 SER A HA   1  
ATOM 1598  H HB2  . SER A 1 109 ? -8.489  12.157  -4.925  1.00 0.00 ? 109 SER A HB2  1  
ATOM 1599  H HB3  . SER A 1 109 ? -9.369  10.754  -4.319  1.00 0.00 ? 109 SER A HB3  1  
ATOM 1600  H HG   . SER A 1 109 ? -6.840  10.768  -5.607  1.00 0.00 ? 109 SER A HG   1  
ATOM 1601  N N    . SER A 1 110 ? -7.445  10.611  -7.915  1.00 0.00 ? 110 SER A N    1  
ATOM 1602  C CA   . SER A 1 110 ? -6.482  10.974  -8.949  1.00 0.00 ? 110 SER A CA   1  
ATOM 1603  C C    . SER A 1 110 ? -7.184  11.605  -10.148 1.00 0.00 ? 110 SER A C    1  
ATOM 1604  O O    . SER A 1 110 ? -8.408  11.549  -10.266 1.00 0.00 ? 110 SER A O    1  
ATOM 1605  C CB   . SER A 1 110 ? -5.693  9.742   -9.395  1.00 0.00 ? 110 SER A CB   1  
ATOM 1606  O OG   . SER A 1 110 ? -4.613  9.482   -8.515  1.00 0.00 ? 110 SER A OG   1  
ATOM 1607  H H    . SER A 1 110 ? -7.369  9.738   -7.476  1.00 0.00 ? 110 SER A H    1  
ATOM 1608  H HA   . SER A 1 110 ? -5.799  11.695  -8.526  1.00 0.00 ? 110 SER A HA   1  
ATOM 1609  H HB2  . SER A 1 110 ? -6.347  8.883   -9.407  1.00 0.00 ? 110 SER A HB2  1  
ATOM 1610  H HB3  . SER A 1 110 ? -5.301  9.910   -10.388 1.00 0.00 ? 110 SER A HB3  1  
ATOM 1611  H HG   . SER A 1 110 ? -4.521  10.210  -7.896  1.00 0.00 ? 110 SER A HG   1  
ATOM 1612  N N    . THR A 1 111 ? -6.398  12.206  -11.036 1.00 0.00 ? 111 THR A N    1  
ATOM 1613  C CA   . THR A 1 111 ? -6.942  12.849  -12.225 1.00 0.00 ? 111 THR A CA   1  
ATOM 1614  C C    . THR A 1 111 ? -6.745  11.977  -13.460 1.00 0.00 ? 111 THR A C    1  
ATOM 1615  O O    . THR A 1 111 ? -5.784  11.214  -13.546 1.00 0.00 ? 111 THR A O    1  
ATOM 1616  C CB   . THR A 1 111 ? -6.288  14.222  -12.471 1.00 0.00 ? 111 THR A CB   1  
ATOM 1617  O OG1  . THR A 1 111 ? -6.877  14.847  -13.616 1.00 0.00 ? 111 THR A OG1  1  
ATOM 1618  C CG2  . THR A 1 111 ? -4.789  14.077  -12.680 1.00 0.00 ? 111 THR A CG2  1  
ATOM 1619  H H    . THR A 1 111 ? -5.430  12.217  -10.886 1.00 0.00 ? 111 THR A H    1  
ATOM 1620  H HA   . THR A 1 111 ? -8.000  13.000  -12.068 1.00 0.00 ? 111 THR A HA   1  
ATOM 1621  H HB   . THR A 1 111 ? -6.457  14.844  -11.604 1.00 0.00 ? 111 THR A HB   1  
ATOM 1622  H HG1  . THR A 1 111 ? -7.629  15.377  -13.341 1.00 0.00 ? 111 THR A HG1  1  
ATOM 1623  H HG21 . THR A 1 111 ? -4.515  13.035  -12.614 1.00 0.00 ? 111 THR A HG21 1  
ATOM 1624  H HG22 . THR A 1 111 ? -4.263  14.637  -11.921 1.00 0.00 ? 111 THR A HG22 1  
ATOM 1625  H HG23 . THR A 1 111 ? -4.524  14.457  -13.655 1.00 0.00 ? 111 THR A HG23 1  
ATOM 1626  N N    . SER A 1 112 ? -7.662  12.096  -14.415 1.00 0.00 ? 112 SER A N    1  
ATOM 1627  C CA   . SER A 1 112 ? -7.591  11.316  -15.645 1.00 0.00 ? 112 SER A CA   1  
ATOM 1628  C C    . SER A 1 112 ? -6.154  11.228  -16.150 1.00 0.00 ? 112 SER A C    1  
ATOM 1629  O O    . SER A 1 112 ? -5.332  12.115  -15.918 1.00 0.00 ? 112 SER A O    1  
ATOM 1630  C CB   . SER A 1 112 ? -8.484  11.937  -16.721 1.00 0.00 ? 112 SER A CB   1  
ATOM 1631  O OG   . SER A 1 112 ? -9.826  12.034  -16.276 1.00 0.00 ? 112 SER A OG   1  
ATOM 1632  H H    . SER A 1 112 ? -8.406  12.722  -14.288 1.00 0.00 ? 112 SER A H    1  
ATOM 1633  H HA   . SER A 1 112 ? -7.945  10.319  -15.427 1.00 0.00 ? 112 SER A HA   1  
ATOM 1634  H HB2  . SER A 1 112 ? -8.123  12.926  -16.957 1.00 0.00 ? 112 SER A HB2  1  
ATOM 1635  H HB3  . SER A 1 112 ? -8.455  11.321  -17.608 1.00 0.00 ? 112 SER A HB3  1  
ATOM 1636  H HG   . SER A 1 112 ? -9.846  12.030  -15.316 1.00 0.00 ? 112 SER A HG   1  
ATOM 1637  N N    . PRO A 1 113 ? -5.842  10.132  -16.857 1.00 0.00 ? 113 PRO A N    1  
ATOM 1638  C CA   . PRO A 1 113 ? -4.504  9.901   -17.411 1.00 0.00 ? 113 PRO A CA   1  
ATOM 1639  C C    . PRO A 1 113 ? -4.178  10.853  -18.557 1.00 0.00 ? 113 PRO A C    1  
ATOM 1640  O O    . PRO A 1 113 ? -4.882  11.839  -18.777 1.00 0.00 ? 113 PRO A O    1  
ATOM 1641  C CB   . PRO A 1 113 ? -4.574  8.458   -17.917 1.00 0.00 ? 113 PRO A CB   1  
ATOM 1642  C CG   . PRO A 1 113 ? -6.020  8.222   -18.191 1.00 0.00 ? 113 PRO A CG   1  
ATOM 1643  C CD   . PRO A 1 113 ? -6.771  9.034   -17.172 1.00 0.00 ? 113 PRO A CD   1  
ATOM 1644  H HA   . PRO A 1 113 ? -3.741  9.980   -16.650 1.00 0.00 ? 113 PRO A HA   1  
ATOM 1645  H HB2  . PRO A 1 113 ? -3.980  8.360   -18.815 1.00 0.00 ? 113 PRO A HB2  1  
ATOM 1646  H HB3  . PRO A 1 113 ? -4.202  7.787   -17.158 1.00 0.00 ? 113 PRO A HB3  1  
ATOM 1647  H HG2  . PRO A 1 113 ? -6.263  8.554   -19.188 1.00 0.00 ? 113 PRO A HG2  1  
ATOM 1648  H HG3  . PRO A 1 113 ? -6.248  7.173   -18.076 1.00 0.00 ? 113 PRO A HG3  1  
ATOM 1649  H HD2  . PRO A 1 113 ? -7.689  9.415   -17.596 1.00 0.00 ? 113 PRO A HD2  1  
ATOM 1650  H HD3  . PRO A 1 113 ? -6.977  8.440   -16.294 1.00 0.00 ? 113 PRO A HD3  1  
ATOM 1651  N N    . LEU A 1 114 ? -3.108  10.551  -19.284 1.00 0.00 ? 114 LEU A N    1  
ATOM 1652  C CA   . LEU A 1 114 ? -2.689  11.380  -20.408 1.00 0.00 ? 114 LEU A CA   1  
ATOM 1653  C C    . LEU A 1 114 ? -3.220  10.821  -21.725 1.00 0.00 ? 114 LEU A C    1  
ATOM 1654  O O    . LEU A 1 114 ? -3.926  11.508  -22.462 1.00 0.00 ? 114 LEU A O    1  
ATOM 1655  C CB   . LEU A 1 114 ? -1.163  11.473  -20.459 1.00 0.00 ? 114 LEU A CB   1  
ATOM 1656  C CG   . LEU A 1 114 ? -0.476  11.939  -19.175 1.00 0.00 ? 114 LEU A CG   1  
ATOM 1657  C CD1  . LEU A 1 114 ? 1.029   11.745  -19.273 1.00 0.00 ? 114 LEU A CD1  1  
ATOM 1658  C CD2  . LEU A 1 114 ? -0.811  13.396  -18.890 1.00 0.00 ? 114 LEU A CD2  1  
ATOM 1659  H H    . LEU A 1 114 ? -2.587  9.753   -19.060 1.00 0.00 ? 114 LEU A H    1  
ATOM 1660  H HA   . LEU A 1 114 ? -3.097  12.369  -20.261 1.00 0.00 ? 114 LEU A HA   1  
ATOM 1661  H HB2  . LEU A 1 114 ? -0.780  10.493  -20.701 1.00 0.00 ? 114 LEU A HB2  1  
ATOM 1662  H HB3  . LEU A 1 114 ? -0.900  12.165  -21.246 1.00 0.00 ? 114 LEU A HB3  1  
ATOM 1663  H HG   . LEU A 1 114 ? -0.835  11.344  -18.346 1.00 0.00 ? 114 LEU A HG   1  
ATOM 1664  H HD11 . LEU A 1 114 ? 1.457   12.546  -19.858 1.00 0.00 ? 114 LEU A HD11 1  
ATOM 1665  H HD12 . LEU A 1 114 ? 1.239   10.799  -19.750 1.00 0.00 ? 114 LEU A HD12 1  
ATOM 1666  H HD13 . LEU A 1 114 ? 1.458   11.753  -18.282 1.00 0.00 ? 114 LEU A HD13 1  
ATOM 1667  H HD21 . LEU A 1 114 ? 0.003   13.852  -18.345 1.00 0.00 ? 114 LEU A HD21 1  
ATOM 1668  H HD22 . LEU A 1 114 ? -1.714  13.449  -18.298 1.00 0.00 ? 114 LEU A HD22 1  
ATOM 1669  H HD23 . LEU A 1 114 ? -0.959  13.920  -19.822 1.00 0.00 ? 114 LEU A HD23 1  
ATOM 1670  N N    . GLU A 1 115 ? -2.875  9.569   -22.011 1.00 0.00 ? 115 GLU A N    1  
ATOM 1671  C CA   . GLU A 1 115 ? -3.319  8.918   -23.238 1.00 0.00 ? 115 GLU A CA   1  
ATOM 1672  C C    . GLU A 1 115 ? -3.870  7.525   -22.946 1.00 0.00 ? 115 GLU A C    1  
ATOM 1673  O O    . GLU A 1 115 ? -3.244  6.507   -23.243 1.00 0.00 ? 115 GLU A O    1  
ATOM 1674  C CB   . GLU A 1 115 ? -2.164  8.822   -24.237 1.00 0.00 ? 115 GLU A CB   1  
ATOM 1675  C CG   . GLU A 1 115 ? -2.547  8.160   -25.550 1.00 0.00 ? 115 GLU A CG   1  
ATOM 1676  C CD   . GLU A 1 115 ? -3.079  9.149   -26.569 1.00 0.00 ? 115 GLU A CD   1  
ATOM 1677  O OE1  . GLU A 1 115 ? -2.260  9.838   -27.212 1.00 0.00 ? 115 GLU A OE1  1  
ATOM 1678  O OE2  . GLU A 1 115 ? -4.316  9.234   -26.723 1.00 0.00 ? 115 GLU A OE2  1  
ATOM 1679  H H    . GLU A 1 115 ? -2.310  9.073   -21.384 1.00 0.00 ? 115 GLU A H    1  
ATOM 1680  H HA   . GLU A 1 115 ? -4.105  9.520   -23.668 1.00 0.00 ? 115 GLU A HA   1  
ATOM 1681  H HB2  . GLU A 1 115 ? -1.805  9.818   -24.451 1.00 0.00 ? 115 GLU A HB2  1  
ATOM 1682  H HB3  . GLU A 1 115 ? -1.364  8.250   -23.790 1.00 0.00 ? 115 GLU A HB3  1  
ATOM 1683  H HG2  . GLU A 1 115 ? -1.675  7.675   -25.963 1.00 0.00 ? 115 GLU A HG2  1  
ATOM 1684  H HG3  . GLU A 1 115 ? -3.310  7.420   -25.356 1.00 0.00 ? 115 GLU A HG3  1  
ATOM 1685  N N    . PRO A 1 116 ? -5.071  7.478   -22.350 1.00 0.00 ? 116 PRO A N    1  
ATOM 1686  C CA   . PRO A 1 116 ? -5.733  6.216   -22.005 1.00 0.00 ? 116 PRO A CA   1  
ATOM 1687  C C    . PRO A 1 116 ? -6.206  5.453   -23.237 1.00 0.00 ? 116 PRO A C    1  
ATOM 1688  O O    . PRO A 1 116 ? -6.573  6.038   -24.257 1.00 0.00 ? 116 PRO A O    1  
ATOM 1689  C CB   . PRO A 1 116 ? -6.930  6.664   -21.162 1.00 0.00 ? 116 PRO A CB   1  
ATOM 1690  C CG   . PRO A 1 116 ? -7.208  8.058   -21.608 1.00 0.00 ? 116 PRO A CG   1  
ATOM 1691  C CD   . PRO A 1 116 ? -5.874  8.651   -21.969 1.00 0.00 ? 116 PRO A CD   1  
ATOM 1692  H HA   . PRO A 1 116 ? -5.092  5.580   -21.413 1.00 0.00 ? 116 PRO A HA   1  
ATOM 1693  H HB2  . PRO A 1 116 ? -7.771  6.012   -21.351 1.00 0.00 ? 116 PRO A HB2  1  
ATOM 1694  H HB3  . PRO A 1 116 ? -6.670  6.630   -20.114 1.00 0.00 ? 116 PRO A HB3  1  
ATOM 1695  H HG2  . PRO A 1 116 ? -7.857  8.045   -22.470 1.00 0.00 ? 116 PRO A HG2  1  
ATOM 1696  H HG3  . PRO A 1 116 ? -7.661  8.617   -20.804 1.00 0.00 ? 116 PRO A HG3  1  
ATOM 1697  H HD2  . PRO A 1 116 ? -5.977  9.335   -22.798 1.00 0.00 ? 116 PRO A HD2  1  
ATOM 1698  H HD3  . PRO A 1 116 ? -5.441  9.152   -21.115 1.00 0.00 ? 116 PRO A HD3  1  
ATOM 1699  N N    . PRO A 1 117 ? -6.198  4.115   -23.145 1.00 0.00 ? 117 PRO A N    1  
ATOM 1700  C CA   . PRO A 1 117 ? -6.624  3.243   -24.243 1.00 0.00 ? 117 PRO A CA   1  
ATOM 1701  C C    . PRO A 1 117 ? -8.127  3.315   -24.491 1.00 0.00 ? 117 PRO A C    1  
ATOM 1702  O O    . PRO A 1 117 ? -8.878  3.829   -23.663 1.00 0.00 ? 117 PRO A O    1  
ATOM 1703  C CB   . PRO A 1 117 ? -6.228  1.845   -23.761 1.00 0.00 ? 117 PRO A CB   1  
ATOM 1704  C CG   . PRO A 1 117 ? -6.214  1.948   -22.275 1.00 0.00 ? 117 PRO A CG   1  
ATOM 1705  C CD   . PRO A 1 117 ? -5.773  3.350   -21.960 1.00 0.00 ? 117 PRO A CD   1  
ATOM 1706  H HA   . PRO A 1 117 ? -6.098  3.472   -25.159 1.00 0.00 ? 117 PRO A HA   1  
ATOM 1707  H HB2  . PRO A 1 117 ? -6.957  1.124   -24.101 1.00 0.00 ? 117 PRO A HB2  1  
ATOM 1708  H HB3  . PRO A 1 117 ? -5.253  1.590   -24.148 1.00 0.00 ? 117 PRO A HB3  1  
ATOM 1709  H HG2  . PRO A 1 117 ? -7.204  1.769   -21.885 1.00 0.00 ? 117 PRO A HG2  1  
ATOM 1710  H HG3  . PRO A 1 117 ? -5.514  1.235   -21.865 1.00 0.00 ? 117 PRO A HG3  1  
ATOM 1711  H HD2  . PRO A 1 117 ? -6.268  3.711   -21.070 1.00 0.00 ? 117 PRO A HD2  1  
ATOM 1712  H HD3  . PRO A 1 117 ? -4.700  3.391   -21.840 1.00 0.00 ? 117 PRO A HD3  1  
ATOM 1713  N N    . SER A 1 118 ? -8.559  2.796   -25.636 1.00 0.00 ? 118 SER A N    1  
ATOM 1714  C CA   . SER A 1 118 ? -9.972  2.804   -25.994 1.00 0.00 ? 118 SER A CA   1  
ATOM 1715  C C    . SER A 1 118 ? -10.437 1.411   -26.407 1.00 0.00 ? 118 SER A C    1  
ATOM 1716  O O    . SER A 1 118 ? -9.712  0.677   -27.080 1.00 0.00 ? 118 SER A O    1  
ATOM 1717  C CB   . SER A 1 118 ? -10.227 3.797   -27.130 1.00 0.00 ? 118 SER A CB   1  
ATOM 1718  O OG   . SER A 1 118 ? -10.455 5.101   -26.626 1.00 0.00 ? 118 SER A OG   1  
ATOM 1719  H H    . SER A 1 118 ? -7.911  2.400   -26.255 1.00 0.00 ? 118 SER A H    1  
ATOM 1720  H HA   . SER A 1 118 ? -10.533 3.115   -25.124 1.00 0.00 ? 118 SER A HA   1  
ATOM 1721  H HB2  . SER A 1 118 ? -9.367  3.821   -27.782 1.00 0.00 ? 118 SER A HB2  1  
ATOM 1722  H HB3  . SER A 1 118 ? -11.095 3.482   -27.691 1.00 0.00 ? 118 SER A HB3  1  
ATOM 1723  H HG   . SER A 1 118 ? -10.654 5.052   -25.689 1.00 0.00 ? 118 SER A HG   1  
ATOM 1724  N N    . ASP A 1 119 ? -11.649 1.053   -25.999 1.00 0.00 ? 119 ASP A N    1  
ATOM 1725  C CA   . ASP A 1 119 ? -12.212 -0.252  -26.326 1.00 0.00 ? 119 ASP A CA   1  
ATOM 1726  C C    . ASP A 1 119 ? -12.909 -0.218  -27.683 1.00 0.00 ? 119 ASP A C    1  
ATOM 1727  O O    . ASP A 1 119 ? -14.132 -0.100  -27.761 1.00 0.00 ? 119 ASP A O    1  
ATOM 1728  C CB   . ASP A 1 119 ? -13.198 -0.692  -25.243 1.00 0.00 ? 119 ASP A CB   1  
ATOM 1729  C CG   . ASP A 1 119 ? -12.537 -0.855  -23.889 1.00 0.00 ? 119 ASP A CG   1  
ATOM 1730  O OD1  . ASP A 1 119 ? -11.614 -1.689  -23.776 1.00 0.00 ? 119 ASP A OD1  1  
ATOM 1731  O OD2  . ASP A 1 119 ? -12.941 -0.147  -22.943 1.00 0.00 ? 119 ASP A OD2  1  
ATOM 1732  H H    . ASP A 1 119 ? -12.178 1.682   -25.464 1.00 0.00 ? 119 ASP A H    1  
ATOM 1733  H HA   . ASP A 1 119 ? -11.400 -0.962  -26.370 1.00 0.00 ? 119 ASP A HA   1  
ATOM 1734  H HB2  . ASP A 1 119 ? -13.980 0.049   -25.154 1.00 0.00 ? 119 ASP A HB2  1  
ATOM 1735  H HB3  . ASP A 1 119 ? -13.636 -1.638  -25.527 1.00 0.00 ? 119 ASP A HB3  1  
ATOM 1736  N N    . ARG A 1 120 ? -12.122 -0.321  -28.749 1.00 0.00 ? 120 ARG A N    1  
ATOM 1737  C CA   . ARG A 1 120 ? -12.663 -0.300  -30.103 1.00 0.00 ? 120 ARG A CA   1  
ATOM 1738  C C    . ARG A 1 120 ? -13.336 -1.628  -30.440 1.00 0.00 ? 120 ARG A C    1  
ATOM 1739  O O    . ARG A 1 120 ? -12.885 -2.690  -30.013 1.00 0.00 ? 120 ARG A O    1  
ATOM 1740  C CB   . ARG A 1 120 ? -11.554 -0.006  -31.114 1.00 0.00 ? 120 ARG A CB   1  
ATOM 1741  C CG   . ARG A 1 120 ? -10.625 -1.185  -31.358 1.00 0.00 ? 120 ARG A CG   1  
ATOM 1742  C CD   . ARG A 1 120 ? -9.540  -1.268  -30.296 1.00 0.00 ? 120 ARG A CD   1  
ATOM 1743  N NE   . ARG A 1 120 ? -8.360  -1.983  -30.774 1.00 0.00 ? 120 ARG A NE   1  
ATOM 1744  C CZ   . ARG A 1 120 ? -7.146  -1.829  -30.257 1.00 0.00 ? 120 ARG A CZ   1  
ATOM 1745  N NH1  . ARG A 1 120 ? -6.954  -0.988  -29.249 1.00 0.00 ? 120 ARG A NH1  1  
ATOM 1746  N NH2  . ARG A 1 120 ? -6.122  -2.515  -30.746 1.00 0.00 ? 120 ARG A NH2  1  
ATOM 1747  H H    . ARG A 1 120 ? -11.155 -0.413  -28.623 1.00 0.00 ? 120 ARG A H    1  
ATOM 1748  H HA   . ARG A 1 120 ? -13.401 0.486   -30.153 1.00 0.00 ? 120 ARG A HA   1  
ATOM 1749  H HB2  . ARG A 1 120 ? -12.004 0.269   -32.056 1.00 0.00 ? 120 ARG A HB2  1  
ATOM 1750  H HB3  . ARG A 1 120 ? -10.962 0.821   -30.751 1.00 0.00 ? 120 ARG A HB3  1  
ATOM 1751  H HG2  . ARG A 1 120 ? -11.203 -2.097  -31.339 1.00 0.00 ? 120 ARG A HG2  1  
ATOM 1752  H HG3  . ARG A 1 120 ? -10.161 -1.070  -32.327 1.00 0.00 ? 120 ARG A HG3  1  
ATOM 1753  H HD2  . ARG A 1 120 ? -9.252  -0.266  -30.015 1.00 0.00 ? 120 ARG A HD2  1  
ATOM 1754  H HD3  . ARG A 1 120 ? -9.937  -1.783  -29.435 1.00 0.00 ? 120 ARG A HD3  1  
ATOM 1755  H HE   . ARG A 1 120 ? -8.479  -2.609  -31.518 1.00 0.00 ? 120 ARG A HE   1  
ATOM 1756  H HH11 . ARG A 1 120 ? -7.724  -0.470  -28.877 1.00 0.00 ? 120 ARG A HH11 1  
ATOM 1757  H HH12 . ARG A 1 120 ? -6.040  -0.875  -28.860 1.00 0.00 ? 120 ARG A HH12 1  
ATOM 1758  H HH21 . ARG A 1 120 ? -6.263  -3.150  -31.506 1.00 0.00 ? 120 ARG A HH21 1  
ATOM 1759  H HH22 . ARG A 1 120 ? -5.209  -2.398  -30.356 1.00 0.00 ? 120 ARG A HH22 1  
ATOM 1760  N N    . GLY A 1 121 ? -14.417 -1.559  -31.211 1.00 0.00 ? 121 GLY A N    1  
ATOM 1761  C CA   . GLY A 1 121 ? -15.134 -2.761  -31.592 1.00 0.00 ? 121 GLY A CA   1  
ATOM 1762  C C    . GLY A 1 121 ? -14.661 -3.323  -32.918 1.00 0.00 ? 121 GLY A C    1  
ATOM 1763  O O    . GLY A 1 121 ? -15.469 -3.647  -33.788 1.00 0.00 ? 121 GLY A O    1  
ATOM 1764  H H    . GLY A 1 121 ? -14.731 -0.684  -31.523 1.00 0.00 ? 121 GLY A H    1  
ATOM 1765  H HA2  . GLY A 1 121 ? -14.994 -3.509  -30.826 1.00 0.00 ? 121 GLY A HA2  1  
ATOM 1766  H HA3  . GLY A 1 121 ? -16.187 -2.530  -31.668 1.00 0.00 ? 121 GLY A HA3  1  
ATOM 1767  N N    . THR A 1 122 ? -13.345 -3.437  -33.075 1.00 0.00 ? 122 THR A N    1  
ATOM 1768  C CA   . THR A 1 122 ? -12.765 -3.960  -34.305 1.00 0.00 ? 122 THR A CA   1  
ATOM 1769  C C    . THR A 1 122 ? -13.598 -3.562  -35.518 1.00 0.00 ? 122 THR A C    1  
ATOM 1770  O O    . THR A 1 122 ? -13.787 -4.355  -36.441 1.00 0.00 ? 122 THR A O    1  
ATOM 1771  C CB   . THR A 1 122 ? -12.644 -5.495  -34.261 1.00 0.00 ? 122 THR A CB   1  
ATOM 1772  O OG1  . THR A 1 122 ? -11.972 -5.968  -35.434 1.00 0.00 ? 122 THR A OG1  1  
ATOM 1773  C CG2  . THR A 1 122 ? -14.017 -6.144  -34.160 1.00 0.00 ? 122 THR A CG2  1  
ATOM 1774  H H    . THR A 1 122 ? -12.753 -3.162  -32.345 1.00 0.00 ? 122 THR A H    1  
ATOM 1775  H HA   . THR A 1 122 ? -11.773 -3.545  -34.409 1.00 0.00 ? 122 THR A HA   1  
ATOM 1776  H HB   . THR A 1 122 ? -12.067 -5.771  -33.389 1.00 0.00 ? 122 THR A HB   1  
ATOM 1777  H HG1  . THR A 1 122 ? -11.749 -6.895  -35.323 1.00 0.00 ? 122 THR A HG1  1  
ATOM 1778  H HG21 . THR A 1 122 ? -13.972 -7.145  -34.562 1.00 0.00 ? 122 THR A HG21 1  
ATOM 1779  H HG22 . THR A 1 122 ? -14.732 -5.562  -34.723 1.00 0.00 ? 122 THR A HG22 1  
ATOM 1780  H HG23 . THR A 1 122 ? -14.320 -6.184  -33.125 1.00 0.00 ? 122 THR A HG23 1  
ATOM 1781  N N    . VAL A 1 123 ? -14.093 -2.329  -35.512 1.00 0.00 ? 123 VAL A N    1  
ATOM 1782  C CA   . VAL A 1 123 ? -14.904 -1.825  -36.613 1.00 0.00 ? 123 VAL A CA   1  
ATOM 1783  C C    . VAL A 1 123 ? -14.033 -1.196  -37.695 1.00 0.00 ? 123 VAL A C    1  
ATOM 1784  O O    . VAL A 1 123 ? -13.019 -0.563  -37.399 1.00 0.00 ? 123 VAL A O    1  
ATOM 1785  C CB   . VAL A 1 123 ? -15.929 -0.784  -36.125 1.00 0.00 ? 123 VAL A CB   1  
ATOM 1786  C CG1  . VAL A 1 123 ? -15.235 0.329   -35.354 1.00 0.00 ? 123 VAL A CG1  1  
ATOM 1787  C CG2  . VAL A 1 123 ? -16.716 -0.220  -37.299 1.00 0.00 ? 123 VAL A CG2  1  
ATOM 1788  H H    . VAL A 1 123 ? -13.908 -1.743  -34.748 1.00 0.00 ? 123 VAL A H    1  
ATOM 1789  H HA   . VAL A 1 123 ? -15.444 -2.658  -37.039 1.00 0.00 ? 123 VAL A HA   1  
ATOM 1790  H HB   . VAL A 1 123 ? -16.622 -1.276  -35.458 1.00 0.00 ? 123 VAL A HB   1  
ATOM 1791  H HG11 . VAL A 1 123 ? -15.917 1.156   -35.225 1.00 0.00 ? 123 VAL A HG11 1  
ATOM 1792  H HG12 . VAL A 1 123 ? -14.927 -0.041  -34.387 1.00 0.00 ? 123 VAL A HG12 1  
ATOM 1793  H HG13 . VAL A 1 123 ? -14.367 0.661   -35.905 1.00 0.00 ? 123 VAL A HG13 1  
ATOM 1794  H HG21 . VAL A 1 123 ? -17.436 0.498   -36.936 1.00 0.00 ? 123 VAL A HG21 1  
ATOM 1795  H HG22 . VAL A 1 123 ? -16.038 0.266   -37.986 1.00 0.00 ? 123 VAL A HG22 1  
ATOM 1796  H HG23 . VAL A 1 123 ? -17.230 -1.022  -37.807 1.00 0.00 ? 123 VAL A HG23 1  
ATOM 1797  N N    . SER A 1 124 ? -14.436 -1.373  -38.949 1.00 0.00 ? 124 SER A N    1  
ATOM 1798  C CA   . SER A 1 124 ? -13.690 -0.825  -40.076 1.00 0.00 ? 124 SER A CA   1  
ATOM 1799  C C    . SER A 1 124 ? -14.237 0.541   -40.476 1.00 0.00 ? 124 SER A C    1  
ATOM 1800  O O    . SER A 1 124 ? -14.398 0.836   -41.660 1.00 0.00 ? 124 SER A O    1  
ATOM 1801  C CB   . SER A 1 124 ? -13.751 -1.782  -41.268 1.00 0.00 ? 124 SER A CB   1  
ATOM 1802  O OG   . SER A 1 124 ? -15.073 -1.891  -41.766 1.00 0.00 ? 124 SER A OG   1  
ATOM 1803  H H    . SER A 1 124 ? -15.253 -1.887  -39.120 1.00 0.00 ? 124 SER A H    1  
ATOM 1804  H HA   . SER A 1 124 ? -12.661 -0.712  -39.769 1.00 0.00 ? 124 SER A HA   1  
ATOM 1805  H HB2  . SER A 1 124 ? -13.112 -1.412  -42.056 1.00 0.00 ? 124 SER A HB2  1  
ATOM 1806  H HB3  . SER A 1 124 ? -13.413 -2.760  -40.959 1.00 0.00 ? 124 SER A HB3  1  
ATOM 1807  H HG   . SER A 1 124 ? -15.697 -1.655  -41.075 1.00 0.00 ? 124 SER A HG   1  
ATOM 1808  N N    . GLY A 1 125 ? -14.521 1.374   -39.479 1.00 0.00 ? 125 GLY A N    1  
ATOM 1809  C CA   . GLY A 1 125 ? -15.047 2.700   -39.747 1.00 0.00 ? 125 GLY A CA   1  
ATOM 1810  C C    . GLY A 1 125 ? -16.562 2.724   -39.790 1.00 0.00 ? 125 GLY A C    1  
ATOM 1811  O O    . GLY A 1 125 ? -17.232 1.782   -39.367 1.00 0.00 ? 125 GLY A O    1  
ATOM 1812  H H    . GLY A 1 125 ? -14.372 1.085   -38.554 1.00 0.00 ? 125 GLY A H    1  
ATOM 1813  H HA2  . GLY A 1 125 ? -14.708 3.372   -38.973 1.00 0.00 ? 125 GLY A HA2  1  
ATOM 1814  H HA3  . GLY A 1 125 ? -14.666 3.040   -40.698 1.00 0.00 ? 125 GLY A HA3  1  
ATOM 1815  N N    . PRO A 1 126 ? -17.125 3.825   -40.311 1.00 0.00 ? 126 PRO A N    1  
ATOM 1816  C CA   . PRO A 1 126 ? -18.577 3.996   -40.419 1.00 0.00 ? 126 PRO A CA   1  
ATOM 1817  C C    . PRO A 1 126 ? -19.194 3.068   -41.460 1.00 0.00 ? 126 PRO A C    1  
ATOM 1818  O O    . PRO A 1 126 ? -20.402 3.099   -41.694 1.00 0.00 ? 126 PRO A O    1  
ATOM 1819  C CB   . PRO A 1 126 ? -18.732 5.457   -40.846 1.00 0.00 ? 126 PRO A CB   1  
ATOM 1820  C CG   . PRO A 1 126 ? -17.451 5.789   -41.532 1.00 0.00 ? 126 PRO A CG   1  
ATOM 1821  C CD   . PRO A 1 126 ? -16.388 4.987   -40.835 1.00 0.00 ? 126 PRO A CD   1  
ATOM 1822  H HA   . PRO A 1 126 ? -19.066 3.843   -39.468 1.00 0.00 ? 126 PRO A HA   1  
ATOM 1823  H HB2  . PRO A 1 126 ? -19.576 5.552   -41.515 1.00 0.00 ? 126 PRO A HB2  1  
ATOM 1824  H HB3  . PRO A 1 126 ? -18.884 6.077   -39.975 1.00 0.00 ? 126 PRO A HB3  1  
ATOM 1825  H HG2  . PRO A 1 126 ? -17.510 5.509   -42.573 1.00 0.00 ? 126 PRO A HG2  1  
ATOM 1826  H HG3  . PRO A 1 126 ? -17.247 6.845   -41.437 1.00 0.00 ? 126 PRO A HG3  1  
ATOM 1827  H HD2  . PRO A 1 126 ? -15.628 4.677   -41.536 1.00 0.00 ? 126 PRO A HD2  1  
ATOM 1828  H HD3  . PRO A 1 126 ? -15.951 5.560   -40.030 1.00 0.00 ? 126 PRO A HD3  1  
ATOM 1829  N N    . SER A 1 127 ? -18.357 2.244   -42.082 1.00 0.00 ? 127 SER A N    1  
ATOM 1830  C CA   . SER A 1 127 ? -18.820 1.310   -43.101 1.00 0.00 ? 127 SER A CA   1  
ATOM 1831  C C    . SER A 1 127 ? -20.001 0.490   -42.590 1.00 0.00 ? 127 SER A C    1  
ATOM 1832  O O    . SER A 1 127 ? -20.781 -0.051  -43.374 1.00 0.00 ? 127 SER A O    1  
ATOM 1833  C CB   . SER A 1 127 ? -17.682 0.378   -43.524 1.00 0.00 ? 127 SER A CB   1  
ATOM 1834  O OG   . SER A 1 127 ? -17.033 -0.179  -42.394 1.00 0.00 ? 127 SER A OG   1  
ATOM 1835  H H    . SER A 1 127 ? -17.404 2.267   -41.851 1.00 0.00 ? 127 SER A H    1  
ATOM 1836  H HA   . SER A 1 127 ? -19.140 1.885   -43.957 1.00 0.00 ? 127 SER A HA   1  
ATOM 1837  H HB2  . SER A 1 127 ? -18.082 -0.424  -44.126 1.00 0.00 ? 127 SER A HB2  1  
ATOM 1838  H HB3  . SER A 1 127 ? -16.960 0.936   -44.102 1.00 0.00 ? 127 SER A HB3  1  
ATOM 1839  H HG   . SER A 1 127 ? -17.231 0.350   -41.618 1.00 0.00 ? 127 SER A HG   1  
ATOM 1840  N N    . SER A 1 128 ? -20.125 0.402   -41.270 1.00 0.00 ? 128 SER A N    1  
ATOM 1841  C CA   . SER A 1 128 ? -21.208 -0.355  -40.652 1.00 0.00 ? 128 SER A CA   1  
ATOM 1842  C C    . SER A 1 128 ? -21.713 0.347   -39.396 1.00 0.00 ? 128 SER A C    1  
ATOM 1843  O O    . SER A 1 128 ? -21.046 1.226   -38.851 1.00 0.00 ? 128 SER A O    1  
ATOM 1844  C CB   . SER A 1 128 ? -20.737 -1.769  -40.307 1.00 0.00 ? 128 SER A CB   1  
ATOM 1845  O OG   . SER A 1 128 ? -21.815 -2.568  -39.851 1.00 0.00 ? 128 SER A OG   1  
ATOM 1846  H H    . SER A 1 128 ? -19.471 0.856   -40.697 1.00 0.00 ? 128 SER A H    1  
ATOM 1847  H HA   . SER A 1 128 ? -22.016 -0.418  -41.365 1.00 0.00 ? 128 SER A HA   1  
ATOM 1848  H HB2  . SER A 1 128 ? -20.311 -2.228  -41.185 1.00 0.00 ? 128 SER A HB2  1  
ATOM 1849  H HB3  . SER A 1 128 ? -19.989 -1.716  -39.528 1.00 0.00 ? 128 SER A HB3  1  
ATOM 1850  H HG   . SER A 1 128 ? -21.574 -3.495  -39.909 1.00 0.00 ? 128 SER A HG   1  
ATOM 1851  N N    . GLY A 1 129 ? -22.898 -0.048  -38.940 1.00 0.00 ? 129 GLY A N    1  
ATOM 1852  C CA   . GLY A 1 129 ? -23.474 0.552   -37.751 1.00 0.00 ? 129 GLY A CA   1  
ATOM 1853  C C    . GLY A 1 129 ? -23.135 2.024   -37.622 1.00 0.00 ? 129 GLY A C    1  
ATOM 1854  O O    . GLY A 1 129 ? -22.650 2.467   -36.581 1.00 0.00 ? 129 GLY A O    1  
ATOM 1855  H H    . GLY A 1 129 ? -23.385 -0.754  -39.416 1.00 0.00 ? 129 GLY A H    1  
ATOM 1856  H HA2  . GLY A 1 129 ? -24.548 0.443   -37.790 1.00 0.00 ? 129 GLY A HA2  1  
ATOM 1857  H HA3  . GLY A 1 129 ? -23.101 0.031   -36.882 1.00 0.00 ? 129 GLY A HA3  1  
ATOM 1858  N N    . GLY A 1 1   ? -11.115 15.315  -28.553 1.00 0.00 ? 1   GLY A N    2  
ATOM 1859  C CA   . GLY A 1 1   ? -12.192 14.494  -28.028 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1860  C C    . GLY A 1 1   ? -11.797 13.037  -27.893 1.00 0.00 ? 1   GLY A C    2  
ATOM 1861  O O    . GLY A 1 1   ? -10.846 12.583  -28.530 1.00 0.00 ? 1   GLY A O    2  
ATOM 1862  H H1   . GLY A 1 1   ? -10.279 14.895  -28.844 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1863  H HA2  . GLY A 1 1   ? -12.476 14.871  -27.057 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1864  H HA3  . GLY A 1 1   ? -13.040 14.565  -28.693 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1865  N N    . SER A 1 2   ? -12.527 12.302  -27.060 1.00 0.00 ? 2   SER A N    2  
ATOM 1866  C CA   . SER A 1 2   ? -12.245 10.889  -26.839 1.00 0.00 ? 2   SER A CA   2  
ATOM 1867  C C    . SER A 1 2   ? -12.195 10.132  -28.163 1.00 0.00 ? 2   SER A C    2  
ATOM 1868  O O    . SER A 1 2   ? -11.201 9.477   -28.479 1.00 0.00 ? 2   SER A O    2  
ATOM 1869  C CB   . SER A 1 2   ? -13.305 10.272  -25.925 1.00 0.00 ? 2   SER A CB   2  
ATOM 1870  O OG   . SER A 1 2   ? -13.307 10.895  -24.653 1.00 0.00 ? 2   SER A OG   2  
ATOM 1871  H H    . SER A 1 2   ? -13.272 12.722  -26.581 1.00 0.00 ? 2   SER A H    2  
ATOM 1872  H HA   . SER A 1 2   ? -11.281 10.815  -26.359 1.00 0.00 ? 2   SER A HA   2  
ATOM 1873  H HB2  . SER A 1 2   ? -14.279 10.395  -26.374 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1874  H HB3  . SER A 1 2   ? -13.098 9.219   -25.798 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1875  H HG   . SER A 1 2   ? -13.420 11.842  -24.760 1.00 0.00 ? 2   SER A HG   2  
ATOM 1876  N N    . SER A 1 3   ? -13.274 10.226  -28.933 1.00 0.00 ? 3   SER A N    2  
ATOM 1877  C CA   . SER A 1 3   ? -13.356 9.547   -30.220 1.00 0.00 ? 3   SER A CA   2  
ATOM 1878  C C    . SER A 1 3   ? -13.109 8.050   -30.062 1.00 0.00 ? 3   SER A C    2  
ATOM 1879  O O    . SER A 1 3   ? -12.407 7.437   -30.866 1.00 0.00 ? 3   SER A O    2  
ATOM 1880  C CB   . SER A 1 3   ? -12.343 10.142  -31.200 1.00 0.00 ? 3   SER A CB   2  
ATOM 1881  O OG   . SER A 1 3   ? -12.803 10.037  -32.536 1.00 0.00 ? 3   SER A OG   2  
ATOM 1882  H H    . SER A 1 3   ? -14.034 10.763  -28.625 1.00 0.00 ? 3   SER A H    2  
ATOM 1883  H HA   . SER A 1 3   ? -14.352 9.696   -30.611 1.00 0.00 ? 3   SER A HA   2  
ATOM 1884  H HB2  . SER A 1 3   ? -12.189 11.184  -30.966 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1885  H HB3  . SER A 1 3   ? -11.406 9.611   -31.111 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1886  H HG   . SER A 1 3   ? -13.164 9.160   -32.682 1.00 0.00 ? 3   SER A HG   2  
ATOM 1887  N N    . GLY A 1 4   ? -13.691 7.467   -29.018 1.00 0.00 ? 4   GLY A N    2  
ATOM 1888  C CA   . GLY A 1 4   ? -13.522 6.047   -28.772 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1889  C C    . GLY A 1 4   ? -14.544 5.502   -27.794 1.00 0.00 ? 4   GLY A C    2  
ATOM 1890  O O    . GLY A 1 4   ? -14.666 5.997   -26.674 1.00 0.00 ? 4   GLY A O    2  
ATOM 1891  H H    . GLY A 1 4   ? -14.239 8.006   -28.411 1.00 0.00 ? 4   GLY A H    2  
ATOM 1892  H HA2  . GLY A 1 4   ? -13.617 5.517   -29.708 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1893  H HA3  . GLY A 1 4   ? -12.533 5.877   -28.372 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1894  N N    . SER A 1 5   ? -15.282 4.482   -28.219 1.00 0.00 ? 5   SER A N    2  
ATOM 1895  C CA   . SER A 1 5   ? -16.304 3.873   -27.374 1.00 0.00 ? 5   SER A CA   2  
ATOM 1896  C C    . SER A 1 5   ? -15.666 3.051   -26.258 1.00 0.00 ? 5   SER A C    2  
ATOM 1897  O O    . SER A 1 5   ? -14.686 2.340   -26.478 1.00 0.00 ? 5   SER A O    2  
ATOM 1898  C CB   . SER A 1 5   ? -17.227 2.987   -28.212 1.00 0.00 ? 5   SER A CB   2  
ATOM 1899  O OG   . SER A 1 5   ? -16.533 1.860   -28.717 1.00 0.00 ? 5   SER A OG   2  
ATOM 1900  H H    . SER A 1 5   ? -15.138 4.131   -29.123 1.00 0.00 ? 5   SER A H    2  
ATOM 1901  H HA   . SER A 1 5   ? -16.885 4.669   -26.932 1.00 0.00 ? 5   SER A HA   2  
ATOM 1902  H HB2  . SER A 1 5   ? -18.047 2.645   -27.599 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1903  H HB3  . SER A 1 5   ? -17.614 3.560   -29.043 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1904  H HG   . SER A 1 5   ? -17.164 1.215   -29.044 1.00 0.00 ? 5   SER A HG   2  
ATOM 1905  N N    . SER A 1 6   ? -16.231 3.153   -25.059 1.00 0.00 ? 6   SER A N    2  
ATOM 1906  C CA   . SER A 1 6   ? -15.717 2.423   -23.907 1.00 0.00 ? 6   SER A CA   2  
ATOM 1907  C C    . SER A 1 6   ? -15.841 0.917   -24.119 1.00 0.00 ? 6   SER A C    2  
ATOM 1908  O O    . SER A 1 6   ? -14.898 0.165   -23.876 1.00 0.00 ? 6   SER A O    2  
ATOM 1909  C CB   . SER A 1 6   ? -16.468 2.834   -22.639 1.00 0.00 ? 6   SER A CB   2  
ATOM 1910  O OG   . SER A 1 6   ? -17.864 2.641   -22.788 1.00 0.00 ? 6   SER A OG   2  
ATOM 1911  H H    . SER A 1 6   ? -17.011 3.737   -24.947 1.00 0.00 ? 6   SER A H    2  
ATOM 1912  H HA   . SER A 1 6   ? -14.673 2.674   -23.794 1.00 0.00 ? 6   SER A HA   2  
ATOM 1913  H HB2  . SER A 1 6   ? -16.121 2.238   -21.809 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1914  H HB3  . SER A 1 6   ? -16.281 3.879   -22.436 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1915  H HG   . SER A 1 6   ? -18.101 1.764   -22.478 1.00 0.00 ? 6   SER A HG   2  
ATOM 1916  N N    . GLY A 1 7   ? -17.012 0.484   -24.575 1.00 0.00 ? 7   GLY A N    2  
ATOM 1917  C CA   . GLY A 1 7   ? -17.239 -0.930  -24.812 1.00 0.00 ? 7   GLY A CA   2  
ATOM 1918  C C    . GLY A 1 7   ? -17.499 -1.698  -23.532 1.00 0.00 ? 7   GLY A C    2  
ATOM 1919  O O    . GLY A 1 7   ? -17.310 -1.174  -22.436 1.00 0.00 ? 7   GLY A O    2  
ATOM 1920  H H    . GLY A 1 7   ? -17.728 1.130   -24.751 1.00 0.00 ? 7   GLY A H    2  
ATOM 1921  H HA2  . GLY A 1 7   ? -18.091 -1.041  -25.467 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1922  H HA3  . GLY A 1 7   ? -16.368 -1.346  -25.298 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1923  N N    . GLY A 1 8   ? -17.936 -2.946  -23.671 1.00 0.00 ? 8   GLY A N    2  
ATOM 1924  C CA   . GLY A 1 8   ? -18.218 -3.767  -22.508 1.00 0.00 ? 8   GLY A CA   2  
ATOM 1925  C C    . GLY A 1 8   ? -17.115 -4.768  -22.225 1.00 0.00 ? 8   GLY A C    2  
ATOM 1926  O O    . GLY A 1 8   ? -17.169 -5.909  -22.686 1.00 0.00 ? 8   GLY A O    2  
ATOM 1927  H H    . GLY A 1 8   ? -18.069 -3.312  -24.571 1.00 0.00 ? 8   GLY A H    2  
ATOM 1928  H HA2  . GLY A 1 8   ? -18.337 -3.126  -21.648 1.00 0.00 ? 8   GLY A HA2  2  
ATOM 1929  H HA3  . GLY A 1 8   ? -19.140 -4.304  -22.675 1.00 0.00 ? 8   GLY A HA3  2  
ATOM 1930  N N    . SER A 1 9   ? -16.111 -4.342  -21.466 1.00 0.00 ? 9   SER A N    2  
ATOM 1931  C CA   . SER A 1 9   ? -14.988 -5.208  -21.126 1.00 0.00 ? 9   SER A CA   2  
ATOM 1932  C C    . SER A 1 9   ? -14.367 -4.795  -19.796 1.00 0.00 ? 9   SER A C    2  
ATOM 1933  O O    . SER A 1 9   ? -14.659 -3.722  -19.268 1.00 0.00 ? 9   SER A O    2  
ATOM 1934  C CB   . SER A 1 9   ? -13.931 -5.163  -22.231 1.00 0.00 ? 9   SER A CB   2  
ATOM 1935  O OG   . SER A 1 9   ? -13.459 -3.842  -22.434 1.00 0.00 ? 9   SER A OG   2  
ATOM 1936  H H    . SER A 1 9   ? -16.125 -3.422  -21.128 1.00 0.00 ? 9   SER A H    2  
ATOM 1937  H HA   . SER A 1 9   ? -15.362 -6.217  -21.038 1.00 0.00 ? 9   SER A HA   2  
ATOM 1938  H HB2  . SER A 1 9   ? -13.097 -5.791  -21.954 1.00 0.00 ? 9   SER A HB2  2  
ATOM 1939  H HB3  . SER A 1 9   ? -14.363 -5.524  -23.154 1.00 0.00 ? 9   SER A HB3  2  
ATOM 1940  H HG   . SER A 1 9   ? -12.948 -3.564  -21.670 1.00 0.00 ? 9   SER A HG   2  
ATOM 1941  N N    . ASP A 1 10  ? -13.508 -5.655  -19.259 1.00 0.00 ? 10  ASP A N    2  
ATOM 1942  C CA   . ASP A 1 10  ? -12.844 -5.381  -17.990 1.00 0.00 ? 10  ASP A CA   2  
ATOM 1943  C C    . ASP A 1 10  ? -11.342 -5.200  -18.191 1.00 0.00 ? 10  ASP A C    2  
ATOM 1944  O O    . ASP A 1 10  ? -10.534 -5.830  -17.509 1.00 0.00 ? 10  ASP A O    2  
ATOM 1945  C CB   . ASP A 1 10  ? -13.105 -6.515  -16.998 1.00 0.00 ? 10  ASP A CB   2  
ATOM 1946  C CG   . ASP A 1 10  ? -14.441 -7.192  -17.231 1.00 0.00 ? 10  ASP A CG   2  
ATOM 1947  O OD1  . ASP A 1 10  ? -15.480 -6.593  -16.879 1.00 0.00 ? 10  ASP A OD1  2  
ATOM 1948  O OD2  . ASP A 1 10  ? -14.448 -8.320  -17.767 1.00 0.00 ? 10  ASP A OD2  2  
ATOM 1949  H H    . ASP A 1 10  ? -13.316 -6.494  -19.728 1.00 0.00 ? 10  ASP A H    2  
ATOM 1950  H HA   . ASP A 1 10  ? -13.253 -4.465  -17.592 1.00 0.00 ? 10  ASP A HA   2  
ATOM 1951  H HB2  . ASP A 1 10  ? -12.325 -7.256  -17.094 1.00 0.00 ? 10  ASP A HB2  2  
ATOM 1952  H HB3  . ASP A 1 10  ? -13.094 -6.115  -15.994 1.00 0.00 ? 10  ASP A HB3  2  
ATOM 1953  N N    . SER A 1 11  ? -10.976 -4.336  -19.132 1.00 0.00 ? 11  SER A N    2  
ATOM 1954  C CA   . SER A 1 11  ? -9.572  -4.076  -19.426 1.00 0.00 ? 11  SER A CA   2  
ATOM 1955  C C    . SER A 1 11  ? -8.818  -3.670  -18.163 1.00 0.00 ? 11  SER A C    2  
ATOM 1956  O O    . SER A 1 11  ? -9.392  -3.613  -17.076 1.00 0.00 ? 11  SER A O    2  
ATOM 1957  C CB   . SER A 1 11  ? -9.445  -2.978  -20.484 1.00 0.00 ? 11  SER A CB   2  
ATOM 1958  O OG   . SER A 1 11  ? -10.076 -3.360  -21.694 1.00 0.00 ? 11  SER A OG   2  
ATOM 1959  H H    . SER A 1 11  ? -11.667 -3.864  -19.642 1.00 0.00 ? 11  SER A H    2  
ATOM 1960  H HA   . SER A 1 11  ? -9.139  -4.987  -19.812 1.00 0.00 ? 11  SER A HA   2  
ATOM 1961  H HB2  . SER A 1 11  ? -9.910  -2.075  -20.120 1.00 0.00 ? 11  SER A HB2  2  
ATOM 1962  H HB3  . SER A 1 11  ? -8.399  -2.790  -20.681 1.00 0.00 ? 11  SER A HB3  2  
ATOM 1963  H HG   . SER A 1 11  ? -10.831 -2.789  -21.856 1.00 0.00 ? 11  SER A HG   2  
ATOM 1964  N N    . SER A 1 12  ? -7.528  -3.388  -18.316 1.00 0.00 ? 12  SER A N    2  
ATOM 1965  C CA   . SER A 1 12  ? -6.694  -2.991  -17.188 1.00 0.00 ? 12  SER A CA   2  
ATOM 1966  C C    . SER A 1 12  ? -7.484  -2.135  -16.203 1.00 0.00 ? 12  SER A C    2  
ATOM 1967  O O    . SER A 1 12  ? -7.565  -0.915  -16.349 1.00 0.00 ? 12  SER A O    2  
ATOM 1968  C CB   . SER A 1 12  ? -5.467  -2.220  -17.681 1.00 0.00 ? 12  SER A CB   2  
ATOM 1969  O OG   . SER A 1 12  ? -4.513  -3.096  -18.257 1.00 0.00 ? 12  SER A OG   2  
ATOM 1970  H H    . SER A 1 12  ? -7.128  -3.451  -19.209 1.00 0.00 ? 12  SER A H    2  
ATOM 1971  H HA   . SER A 1 12  ? -6.366  -3.889  -16.685 1.00 0.00 ? 12  SER A HA   2  
ATOM 1972  H HB2  . SER A 1 12  ? -5.772  -1.500  -18.424 1.00 0.00 ? 12  SER A HB2  2  
ATOM 1973  H HB3  . SER A 1 12  ? -5.010  -1.706  -16.847 1.00 0.00 ? 12  SER A HB3  2  
ATOM 1974  H HG   . SER A 1 12  ? -4.472  -3.907  -17.745 1.00 0.00 ? 12  SER A HG   2  
ATOM 1975  N N    . LEU A 1 13  ? -8.064  -2.783  -15.199 1.00 0.00 ? 13  LEU A N    2  
ATOM 1976  C CA   . LEU A 1 13  ? -8.848  -2.083  -14.188 1.00 0.00 ? 13  LEU A CA   2  
ATOM 1977  C C    . LEU A 1 13  ? -8.016  -1.002  -13.505 1.00 0.00 ? 13  LEU A C    2  
ATOM 1978  O O    . LEU A 1 13  ? -8.540  0.035   -13.098 1.00 0.00 ? 13  LEU A O    2  
ATOM 1979  C CB   . LEU A 1 13  ? -9.373  -3.073  -13.146 1.00 0.00 ? 13  LEU A CB   2  
ATOM 1980  C CG   . LEU A 1 13  ? -10.611 -3.876  -13.547 1.00 0.00 ? 13  LEU A CG   2  
ATOM 1981  C CD1  . LEU A 1 13  ? -11.610 -2.989  -14.274 1.00 0.00 ? 13  LEU A CD1  2  
ATOM 1982  C CD2  . LEU A 1 13  ? -10.219 -5.063  -14.415 1.00 0.00 ? 13  LEU A CD2  2  
ATOM 1983  H H    . LEU A 1 13  ? -7.963  -3.756  -15.136 1.00 0.00 ? 13  LEU A H    2  
ATOM 1984  H HA   . LEU A 1 13  ? -9.686  -1.616  -14.683 1.00 0.00 ? 13  LEU A HA   2  
ATOM 1985  H HB2  . LEU A 1 13  ? -8.582  -3.773  -12.927 1.00 0.00 ? 13  LEU A HB2  2  
ATOM 1986  H HB3  . LEU A 1 13  ? -9.615  -2.514  -12.253 1.00 0.00 ? 13  LEU A HB3  2  
ATOM 1987  H HG   . LEU A 1 13  ? -11.090 -4.256  -12.655 1.00 0.00 ? 13  LEU A HG   2  
ATOM 1988  H HD11 . LEU A 1 13  ? -12.612 -3.343  -14.082 1.00 0.00 ? 13  LEU A HD11 2  
ATOM 1989  H HD12 . LEU A 1 13  ? -11.414 -3.021  -15.335 1.00 0.00 ? 13  LEU A HD12 2  
ATOM 1990  H HD13 . LEU A 1 13  ? -11.513 -1.973  -13.921 1.00 0.00 ? 13  LEU A HD13 2  
ATOM 1991  H HD21 . LEU A 1 13  ? -10.878 -5.893  -14.207 1.00 0.00 ? 13  LEU A HD21 2  
ATOM 1992  H HD22 . LEU A 1 13  ? -9.200  -5.349  -14.194 1.00 0.00 ? 13  LEU A HD22 2  
ATOM 1993  H HD23 . LEU A 1 13  ? -10.300 -4.790  -15.456 1.00 0.00 ? 13  LEU A HD23 2  
ATOM 1994  N N    . PHE A 1 14  ? -6.716  -1.251  -13.385 1.00 0.00 ? 14  PHE A N    2  
ATOM 1995  C CA   . PHE A 1 14  ? -5.811  -0.299  -12.753 1.00 0.00 ? 14  PHE A CA   2  
ATOM 1996  C C    . PHE A 1 14  ? -4.972  0.430   -13.799 1.00 0.00 ? 14  PHE A C    2  
ATOM 1997  O O    . PHE A 1 14  ? -4.984  0.075   -14.976 1.00 0.00 ? 14  PHE A O    2  
ATOM 1998  C CB   . PHE A 1 14  ? -4.896  -1.016  -11.758 1.00 0.00 ? 14  PHE A CB   2  
ATOM 1999  C CG   . PHE A 1 14  ? -5.598  -2.067  -10.948 1.00 0.00 ? 14  PHE A CG   2  
ATOM 2000  C CD1  . PHE A 1 14  ? -5.876  -3.310  -11.494 1.00 0.00 ? 14  PHE A CD1  2  
ATOM 2001  C CD2  . PHE A 1 14  ? -5.980  -1.813  -9.641  1.00 0.00 ? 14  PHE A CD2  2  
ATOM 2002  C CE1  . PHE A 1 14  ? -6.523  -4.279  -10.751 1.00 0.00 ? 14  PHE A CE1  2  
ATOM 2003  C CE2  . PHE A 1 14  ? -6.627  -2.779  -8.892  1.00 0.00 ? 14  PHE A CE2  2  
ATOM 2004  C CZ   . PHE A 1 14  ? -6.898  -4.014  -9.448  1.00 0.00 ? 14  PHE A CZ   2  
ATOM 2005  H H    . PHE A 1 14  ? -6.357  -2.096  -13.730 1.00 0.00 ? 14  PHE A H    2  
ATOM 2006  H HA   . PHE A 1 14  ? -6.410  0.424   -12.222 1.00 0.00 ? 14  PHE A HA   2  
ATOM 2007  H HB2  . PHE A 1 14  ? -4.094  -1.495  -12.299 1.00 0.00 ? 14  PHE A HB2  2  
ATOM 2008  H HB3  . PHE A 1 14  ? -4.481  -0.290  -11.075 1.00 0.00 ? 14  PHE A HB3  2  
ATOM 2009  H HD1  . PHE A 1 14  ? -5.582  -3.520  -12.512 1.00 0.00 ? 14  PHE A HD1  2  
ATOM 2010  H HD2  . PHE A 1 14  ? -5.768  -0.847  -9.205  1.00 0.00 ? 14  PHE A HD2  2  
ATOM 2011  H HE1  . PHE A 1 14  ? -6.733  -5.244  -11.187 1.00 0.00 ? 14  PHE A HE1  2  
ATOM 2012  H HE2  . PHE A 1 14  ? -6.919  -2.568  -7.874  1.00 0.00 ? 14  PHE A HE2  2  
ATOM 2013  H HZ   . PHE A 1 14  ? -7.404  -4.769  -8.866  1.00 0.00 ? 14  PHE A HZ   2  
ATOM 2014  N N    . GLU A 1 15  ? -4.246  1.453   -13.358 1.00 0.00 ? 15  GLU A N    2  
ATOM 2015  C CA   . GLU A 1 15  ? -3.402  2.233   -14.256 1.00 0.00 ? 15  GLU A CA   2  
ATOM 2016  C C    . GLU A 1 15  ? -1.971  2.305   -13.732 1.00 0.00 ? 15  GLU A C    2  
ATOM 2017  O O    . GLU A 1 15  ? -1.740  2.616   -12.563 1.00 0.00 ? 15  GLU A O    2  
ATOM 2018  C CB   . GLU A 1 15  ? -3.967  3.645   -14.424 1.00 0.00 ? 15  GLU A CB   2  
ATOM 2019  C CG   . GLU A 1 15  ? -4.378  4.297   -13.114 1.00 0.00 ? 15  GLU A CG   2  
ATOM 2020  C CD   . GLU A 1 15  ? -4.355  5.811   -13.184 1.00 0.00 ? 15  GLU A CD   2  
ATOM 2021  O OE1  . GLU A 1 15  ? -3.399  6.365   -13.767 1.00 0.00 ? 15  GLU A OE1  2  
ATOM 2022  O OE2  . GLU A 1 15  ? -5.293  6.443   -12.654 1.00 0.00 ? 15  GLU A OE2  2  
ATOM 2023  H H    . GLU A 1 15  ? -4.278  1.688   -12.407 1.00 0.00 ? 15  GLU A H    2  
ATOM 2024  H HA   . GLU A 1 15  ? -3.397  1.741   -15.217 1.00 0.00 ? 15  GLU A HA   2  
ATOM 2025  H HB2  . GLU A 1 15  ? -3.218  4.266   -14.893 1.00 0.00 ? 15  GLU A HB2  2  
ATOM 2026  H HB3  . GLU A 1 15  ? -4.835  3.598   -15.065 1.00 0.00 ? 15  GLU A HB3  2  
ATOM 2027  H HG2  . GLU A 1 15  ? -5.379  3.978   -12.867 1.00 0.00 ? 15  GLU A HG2  2  
ATOM 2028  H HG3  . GLU A 1 15  ? -3.697  3.976   -12.339 1.00 0.00 ? 15  GLU A HG3  2  
ATOM 2029  N N    . THR A 1 16  ? -1.012  2.016   -14.606 1.00 0.00 ? 16  THR A N    2  
ATOM 2030  C CA   . THR A 1 16  ? 0.397   2.046   -14.233 1.00 0.00 ? 16  THR A CA   2  
ATOM 2031  C C    . THR A 1 16  ? 1.040   3.372   -14.621 1.00 0.00 ? 16  THR A C    2  
ATOM 2032  O O    . THR A 1 16  ? 0.832   3.875   -15.725 1.00 0.00 ? 16  THR A O    2  
ATOM 2033  C CB   . THR A 1 16  ? 1.178   0.896   -14.895 1.00 0.00 ? 16  THR A CB   2  
ATOM 2034  O OG1  . THR A 1 16  ? 0.446   -0.328  -14.773 1.00 0.00 ? 16  THR A OG1  2  
ATOM 2035  C CG2  . THR A 1 16  ? 2.551   0.738   -14.259 1.00 0.00 ? 16  THR A CG2  2  
ATOM 2036  H H    . THR A 1 16  ? -1.259  1.776   -15.523 1.00 0.00 ? 16  THR A H    2  
ATOM 2037  H HA   . THR A 1 16  ? 0.460   1.926   -13.161 1.00 0.00 ? 16  THR A HA   2  
ATOM 2038  H HB   . THR A 1 16  ? 1.308   1.126   -15.943 1.00 0.00 ? 16  THR A HB   2  
ATOM 2039  H HG1  . THR A 1 16  ? -0.011  -0.345  -13.928 1.00 0.00 ? 16  THR A HG1  2  
ATOM 2040  H HG21 . THR A 1 16  ? 2.595   -0.201  -13.727 1.00 0.00 ? 16  THR A HG21 2  
ATOM 2041  H HG22 . THR A 1 16  ? 2.725   1.551   -13.571 1.00 0.00 ? 16  THR A HG22 2  
ATOM 2042  H HG23 . THR A 1 16  ? 3.308   0.750   -15.029 1.00 0.00 ? 16  THR A HG23 2  
ATOM 2043  N N    . TYR A 1 17  ? 1.823   3.935   -13.707 1.00 0.00 ? 17  TYR A N    2  
ATOM 2044  C CA   . TYR A 1 17  ? 2.496   5.204   -13.953 1.00 0.00 ? 17  TYR A CA   2  
ATOM 2045  C C    . TYR A 1 17  ? 3.898   5.204   -13.351 1.00 0.00 ? 17  TYR A C    2  
ATOM 2046  O O    . TYR A 1 17  ? 4.158   4.526   -12.358 1.00 0.00 ? 17  TYR A O    2  
ATOM 2047  C CB   . TYR A 1 17  ? 1.679   6.360   -13.372 1.00 0.00 ? 17  TYR A CB   2  
ATOM 2048  C CG   . TYR A 1 17  ? 1.432   6.239   -11.886 1.00 0.00 ? 17  TYR A CG   2  
ATOM 2049  C CD1  . TYR A 1 17  ? 0.435   5.406   -11.393 1.00 0.00 ? 17  TYR A CD1  2  
ATOM 2050  C CD2  . TYR A 1 17  ? 2.194   6.959   -10.974 1.00 0.00 ? 17  TYR A CD2  2  
ATOM 2051  C CE1  . TYR A 1 17  ? 0.204   5.293   -10.036 1.00 0.00 ? 17  TYR A CE1  2  
ATOM 2052  C CE2  . TYR A 1 17  ? 1.971   6.851   -9.615  1.00 0.00 ? 17  TYR A CE2  2  
ATOM 2053  C CZ   . TYR A 1 17  ? 0.976   6.017   -9.151  1.00 0.00 ? 17  TYR A CZ   2  
ATOM 2054  O OH   . TYR A 1 17  ? 0.750   5.907   -7.798  1.00 0.00 ? 17  TYR A OH   2  
ATOM 2055  H H    . TYR A 1 17  ? 1.950   3.486   -12.845 1.00 0.00 ? 17  TYR A H    2  
ATOM 2056  H HA   . TYR A 1 17  ? 2.576   5.335   -15.023 1.00 0.00 ? 17  TYR A HA   2  
ATOM 2057  H HB2  . TYR A 1 17  ? 2.204   7.286   -13.546 1.00 0.00 ? 17  TYR A HB2  2  
ATOM 2058  H HB3  . TYR A 1 17  ? 0.720   6.397   -13.867 1.00 0.00 ? 17  TYR A HB3  2  
ATOM 2059  H HD1  . TYR A 1 17  ? -0.168  4.840   -12.089 1.00 0.00 ? 17  TYR A HD1  2  
ATOM 2060  H HD2  . TYR A 1 17  ? 2.973   7.611   -11.341 1.00 0.00 ? 17  TYR A HD2  2  
ATOM 2061  H HE1  . TYR A 1 17  ? -0.575  4.639   -9.672  1.00 0.00 ? 17  TYR A HE1  2  
ATOM 2062  H HE2  . TYR A 1 17  ? 2.575   7.418   -8.921  1.00 0.00 ? 17  TYR A HE2  2  
ATOM 2063  H HH   . TYR A 1 17  ? 1.146   5.095   -7.472  1.00 0.00 ? 17  TYR A HH   2  
ATOM 2064  N N    . ASN A 1 18  ? 4.796   5.972   -13.959 1.00 0.00 ? 18  ASN A N    2  
ATOM 2065  C CA   . ASN A 1 18  ? 6.172   6.061   -13.483 1.00 0.00 ? 18  ASN A CA   2  
ATOM 2066  C C    . ASN A 1 18  ? 6.411   7.381   -12.755 1.00 0.00 ? 18  ASN A C    2  
ATOM 2067  O O    . ASN A 1 18  ? 6.014   8.445   -13.230 1.00 0.00 ? 18  ASN A O    2  
ATOM 2068  C CB   . ASN A 1 18  ? 7.148   5.928   -14.654 1.00 0.00 ? 18  ASN A CB   2  
ATOM 2069  C CG   . ASN A 1 18  ? 7.162   4.528   -15.238 1.00 0.00 ? 18  ASN A CG   2  
ATOM 2070  O OD1  . ASN A 1 18  ? 8.216   3.903   -15.355 1.00 0.00 ? 18  ASN A OD1  2  
ATOM 2071  N ND2  . ASN A 1 18  ? 5.988   4.030   -15.609 1.00 0.00 ? 18  ASN A ND2  2  
ATOM 2072  H H    . ASN A 1 18  ? 4.528   6.490   -14.746 1.00 0.00 ? 18  ASN A H    2  
ATOM 2073  H HA   . ASN A 1 18  ? 6.338   5.248   -12.793 1.00 0.00 ? 18  ASN A HA   2  
ATOM 2074  H HB2  . ASN A 1 18  ? 6.862   6.619   -15.433 1.00 0.00 ? 18  ASN A HB2  2  
ATOM 2075  H HB3  . ASN A 1 18  ? 8.144   6.166   -14.314 1.00 0.00 ? 18  ASN A HB3  2  
ATOM 2076  H HD21 . ASN A 1 18  ? 5.190   4.585   -15.486 1.00 0.00 ? 18  ASN A HD21 2  
ATOM 2077  H HD22 . ASN A 1 18  ? 5.968   3.127   -15.989 1.00 0.00 ? 18  ASN A HD22 2  
ATOM 2078  N N    . VAL A 1 19  ? 7.064   7.303   -11.600 1.00 0.00 ? 19  VAL A N    2  
ATOM 2079  C CA   . VAL A 1 19  ? 7.359   8.491   -10.807 1.00 0.00 ? 19  VAL A CA   2  
ATOM 2080  C C    . VAL A 1 19  ? 8.862   8.679   -10.637 1.00 0.00 ? 19  VAL A C    2  
ATOM 2081  O O    . VAL A 1 19  ? 9.528   7.874   -9.987  1.00 0.00 ? 19  VAL A O    2  
ATOM 2082  C CB   . VAL A 1 19  ? 6.701   8.414   -9.416  1.00 0.00 ? 19  VAL A CB   2  
ATOM 2083  C CG1  . VAL A 1 19  ? 6.555   9.804   -8.817  1.00 0.00 ? 19  VAL A CG1  2  
ATOM 2084  C CG2  . VAL A 1 19  ? 5.351   7.718   -9.503  1.00 0.00 ? 19  VAL A CG2  2  
ATOM 2085  H H    . VAL A 1 19  ? 7.356   6.426   -11.274 1.00 0.00 ? 19  VAL A H    2  
ATOM 2086  H HA   . VAL A 1 19  ? 6.954   9.348   -11.326 1.00 0.00 ? 19  VAL A HA   2  
ATOM 2087  H HB   . VAL A 1 19  ? 7.341   7.832   -8.769  1.00 0.00 ? 19  VAL A HB   2  
ATOM 2088  H HG11 . VAL A 1 19  ? 6.420   9.722   -7.748  1.00 0.00 ? 19  VAL A HG11 2  
ATOM 2089  H HG12 . VAL A 1 19  ? 7.444   10.381  -9.026  1.00 0.00 ? 19  VAL A HG12 2  
ATOM 2090  H HG13 . VAL A 1 19  ? 5.696   10.295  -9.250  1.00 0.00 ? 19  VAL A HG13 2  
ATOM 2091  H HG21 . VAL A 1 19  ? 5.415   6.749   -9.030  1.00 0.00 ? 19  VAL A HG21 2  
ATOM 2092  H HG22 . VAL A 1 19  ? 4.604   8.315   -9.000  1.00 0.00 ? 19  VAL A HG22 2  
ATOM 2093  H HG23 . VAL A 1 19  ? 5.075   7.595   -10.540 1.00 0.00 ? 19  VAL A HG23 2  
ATOM 2094  N N    . GLU A 1 20  ? 9.389   9.748   -11.224 1.00 0.00 ? 20  GLU A N    2  
ATOM 2095  C CA   . GLU A 1 20  ? 10.815  10.042  -11.137 1.00 0.00 ? 20  GLU A CA   2  
ATOM 2096  C C    . GLU A 1 20  ? 11.133  10.818  -9.863  1.00 0.00 ? 20  GLU A C    2  
ATOM 2097  O O    . GLU A 1 20  ? 10.883  12.021  -9.775  1.00 0.00 ? 20  GLU A O    2  
ATOM 2098  C CB   . GLU A 1 20  ? 11.269  10.841  -12.361 1.00 0.00 ? 20  GLU A CB   2  
ATOM 2099  C CG   . GLU A 1 20  ? 12.763  11.115  -12.388 1.00 0.00 ? 20  GLU A CG   2  
ATOM 2100  C CD   . GLU A 1 20  ? 13.107  12.407  -13.104 1.00 0.00 ? 20  GLU A CD   2  
ATOM 2101  O OE1  . GLU A 1 20  ? 12.857  13.487  -12.528 1.00 0.00 ? 20  GLU A OE1  2  
ATOM 2102  O OE2  . GLU A 1 20  ? 13.624  12.339  -14.238 1.00 0.00 ? 20  GLU A OE2  2  
ATOM 2103  H H    . GLU A 1 20  ? 8.806   10.353  -11.729 1.00 0.00 ? 20  GLU A H    2  
ATOM 2104  H HA   . GLU A 1 20  ? 11.346  9.103   -11.115 1.00 0.00 ? 20  GLU A HA   2  
ATOM 2105  H HB2  . GLU A 1 20  ? 11.008  10.291  -13.253 1.00 0.00 ? 20  GLU A HB2  2  
ATOM 2106  H HB3  . GLU A 1 20  ? 10.751  11.789  -12.369 1.00 0.00 ? 20  GLU A HB3  2  
ATOM 2107  H HG2  . GLU A 1 20  ? 13.124  11.177  -11.372 1.00 0.00 ? 20  GLU A HG2  2  
ATOM 2108  H HG3  . GLU A 1 20  ? 13.257  10.298  -12.894 1.00 0.00 ? 20  GLU A HG3  2  
ATOM 2109  N N    . LEU A 1 21  ? 11.687  10.121  -8.876  1.00 0.00 ? 21  LEU A N    2  
ATOM 2110  C CA   . LEU A 1 21  ? 12.041  10.743  -7.605  1.00 0.00 ? 21  LEU A CA   2  
ATOM 2111  C C    . LEU A 1 21  ? 13.498  11.193  -7.605  1.00 0.00 ? 21  LEU A C    2  
ATOM 2112  O O    . LEU A 1 21  ? 14.367  10.518  -8.157  1.00 0.00 ? 21  LEU A O    2  
ATOM 2113  C CB   . LEU A 1 21  ? 11.797  9.767   -6.452  1.00 0.00 ? 21  LEU A CB   2  
ATOM 2114  C CG   . LEU A 1 21  ? 10.405  9.137   -6.389  1.00 0.00 ? 21  LEU A CG   2  
ATOM 2115  C CD1  . LEU A 1 21  ? 10.344  8.087   -5.291  1.00 0.00 ? 21  LEU A CD1  2  
ATOM 2116  C CD2  . LEU A 1 21  ? 9.345   10.206  -6.168  1.00 0.00 ? 21  LEU A CD2  2  
ATOM 2117  H H    . LEU A 1 21  ? 11.863  9.166   -9.005  1.00 0.00 ? 21  LEU A H    2  
ATOM 2118  H HA   . LEU A 1 21  ? 11.409  11.609  -7.473  1.00 0.00 ? 21  LEU A HA   2  
ATOM 2119  H HB2  . LEU A 1 21  ? 12.518  8.969   -6.537  1.00 0.00 ? 21  LEU A HB2  2  
ATOM 2120  H HB3  . LEU A 1 21  ? 11.961  10.302  -5.527  1.00 0.00 ? 21  LEU A HB3  2  
ATOM 2121  H HG   . LEU A 1 21  ? 10.196  8.647   -7.330  1.00 0.00 ? 21  LEU A HG   2  
ATOM 2122  H HD11 . LEU A 1 21  ? 9.953   7.166   -5.695  1.00 0.00 ? 21  LEU A HD11 2  
ATOM 2123  H HD12 . LEU A 1 21  ? 9.699   8.434   -4.497  1.00 0.00 ? 21  LEU A HD12 2  
ATOM 2124  H HD13 . LEU A 1 21  ? 11.336  7.918   -4.899  1.00 0.00 ? 21  LEU A HD13 2  
ATOM 2125  H HD21 . LEU A 1 21  ? 9.732   11.166  -6.478  1.00 0.00 ? 21  LEU A HD21 2  
ATOM 2126  H HD22 . LEU A 1 21  ? 9.085   10.244  -5.120  1.00 0.00 ? 21  LEU A HD22 2  
ATOM 2127  H HD23 . LEU A 1 21  ? 8.467   9.967   -6.749  1.00 0.00 ? 21  LEU A HD23 2  
ATOM 2128  N N    . VAL A 1 22  ? 13.759  12.338  -6.981  1.00 0.00 ? 22  VAL A N    2  
ATOM 2129  C CA   . VAL A 1 22  ? 15.111  12.877  -6.907  1.00 0.00 ? 22  VAL A CA   2  
ATOM 2130  C C    . VAL A 1 22  ? 15.696  12.703  -5.509  1.00 0.00 ? 22  VAL A C    2  
ATOM 2131  O O    . VAL A 1 22  ? 15.019  12.940  -4.508  1.00 0.00 ? 22  VAL A O    2  
ATOM 2132  C CB   . VAL A 1 22  ? 15.141  14.371  -7.281  1.00 0.00 ? 22  VAL A CB   2  
ATOM 2133  C CG1  . VAL A 1 22  ? 14.345  15.189  -6.277  1.00 0.00 ? 22  VAL A CG1  2  
ATOM 2134  C CG2  . VAL A 1 22  ? 16.576  14.869  -7.369  1.00 0.00 ? 22  VAL A CG2  2  
ATOM 2135  H H    . VAL A 1 22  ? 13.024  12.831  -6.560  1.00 0.00 ? 22  VAL A H    2  
ATOM 2136  H HA   . VAL A 1 22  ? 15.725  12.338  -7.613  1.00 0.00 ? 22  VAL A HA   2  
ATOM 2137  H HB   . VAL A 1 22  ? 14.682  14.487  -8.252  1.00 0.00 ? 22  VAL A HB   2  
ATOM 2138  H HG11 . VAL A 1 22  ? 13.322  14.842  -6.260  1.00 0.00 ? 22  VAL A HG11 2  
ATOM 2139  H HG12 . VAL A 1 22  ? 14.780  15.077  -5.294  1.00 0.00 ? 22  VAL A HG12 2  
ATOM 2140  H HG13 . VAL A 1 22  ? 14.366  16.231  -6.564  1.00 0.00 ? 22  VAL A HG13 2  
ATOM 2141  H HG21 . VAL A 1 22  ? 17.222  14.201  -6.819  1.00 0.00 ? 22  VAL A HG21 2  
ATOM 2142  H HG22 . VAL A 1 22  ? 16.885  14.897  -8.404  1.00 0.00 ? 22  VAL A HG22 2  
ATOM 2143  H HG23 . VAL A 1 22  ? 16.640  15.861  -6.947  1.00 0.00 ? 22  VAL A HG23 2  
ATOM 2144  N N    . ARG A 1 23  ? 16.957  12.288  -5.449  1.00 0.00 ? 23  ARG A N    2  
ATOM 2145  C CA   . ARG A 1 23  ? 17.633  12.081  -4.175  1.00 0.00 ? 23  ARG A CA   2  
ATOM 2146  C C    . ARG A 1 23  ? 18.800  13.050  -4.015  1.00 0.00 ? 23  ARG A C    2  
ATOM 2147  O O    . ARG A 1 23  ? 19.817  12.933  -4.698  1.00 0.00 ? 23  ARG A O    2  
ATOM 2148  C CB   . ARG A 1 23  ? 18.135  10.640  -4.067  1.00 0.00 ? 23  ARG A CB   2  
ATOM 2149  C CG   . ARG A 1 23  ? 17.040  9.599   -4.235  1.00 0.00 ? 23  ARG A CG   2  
ATOM 2150  C CD   . ARG A 1 23  ? 17.618  8.199   -4.370  1.00 0.00 ? 23  ARG A CD   2  
ATOM 2151  N NE   . ARG A 1 23  ? 18.655  7.937   -3.376  1.00 0.00 ? 23  ARG A NE   2  
ATOM 2152  C CZ   . ARG A 1 23  ? 18.960  6.722   -2.934  1.00 0.00 ? 23  ARG A CZ   2  
ATOM 2153  N NH1  . ARG A 1 23  ? 18.311  5.662   -3.397  1.00 0.00 ? 23  ARG A NH1  2  
ATOM 2154  N NH2  . ARG A 1 23  ? 19.917  6.564   -2.029  1.00 0.00 ? 23  ARG A NH2  2  
ATOM 2155  H H    . ARG A 1 23  ? 17.444  12.115  -6.282  1.00 0.00 ? 23  ARG A H    2  
ATOM 2156  H HA   . ARG A 1 23  ? 16.918  12.263  -3.386  1.00 0.00 ? 23  ARG A HA   2  
ATOM 2157  H HB2  . ARG A 1 23  ? 18.880  10.472  -4.831  1.00 0.00 ? 23  ARG A HB2  2  
ATOM 2158  H HB3  . ARG A 1 23  ? 18.589  10.500  -3.097  1.00 0.00 ? 23  ARG A HB3  2  
ATOM 2159  H HG2  . ARG A 1 23  ? 16.394  9.628   -3.370  1.00 0.00 ? 23  ARG A HG2  2  
ATOM 2160  H HG3  . ARG A 1 23  ? 16.470  9.831   -5.122  1.00 0.00 ? 23  ARG A HG3  2  
ATOM 2161  H HD2  . ARG A 1 23  ? 16.821  7.481   -4.242  1.00 0.00 ? 23  ARG A HD2  2  
ATOM 2162  H HD3  . ARG A 1 23  ? 18.043  8.093   -5.357  1.00 0.00 ? 23  ARG A HD3  2  
ATOM 2163  H HE   . ARG A 1 23  ? 19.148  8.705   -3.020  1.00 0.00 ? 23  ARG A HE   2  
ATOM 2164  H HH11 . ARG A 1 23  ? 17.590  5.778   -4.080  1.00 0.00 ? 23  ARG A HH11 2  
ATOM 2165  H HH12 . ARG A 1 23  ? 18.543  4.748   -3.064  1.00 0.00 ? 23  ARG A HH12 2  
ATOM 2166  H HH21 . ARG A 1 23  ? 20.409  7.360   -1.678  1.00 0.00 ? 23  ARG A HH21 2  
ATOM 2167  H HH22 . ARG A 1 23  ? 20.146  5.649   -1.697  1.00 0.00 ? 23  ARG A HH22 2  
ATOM 2168  N N    . LYS A 1 24  ? 18.646  14.009  -3.107  1.00 0.00 ? 24  LYS A N    2  
ATOM 2169  C CA   . LYS A 1 24  ? 19.686  14.999  -2.856  1.00 0.00 ? 24  LYS A CA   2  
ATOM 2170  C C    . LYS A 1 24  ? 21.039  14.327  -2.646  1.00 0.00 ? 24  LYS A C    2  
ATOM 2171  O O    . LYS A 1 24  ? 21.149  13.102  -2.703  1.00 0.00 ? 24  LYS A O    2  
ATOM 2172  C CB   . LYS A 1 24  ? 19.329  15.844  -1.631  1.00 0.00 ? 24  LYS A CB   2  
ATOM 2173  C CG   . LYS A 1 24  ? 18.351  16.967  -1.930  1.00 0.00 ? 24  LYS A CG   2  
ATOM 2174  C CD   . LYS A 1 24  ? 19.070  18.231  -2.370  1.00 0.00 ? 24  LYS A CD   2  
ATOM 2175  C CE   . LYS A 1 24  ? 18.128  19.190  -3.082  1.00 0.00 ? 24  LYS A CE   2  
ATOM 2176  N NZ   . LYS A 1 24  ? 17.663  18.644  -4.387  1.00 0.00 ? 24  LYS A NZ   2  
ATOM 2177  H H    . LYS A 1 24  ? 17.812  14.050  -2.593  1.00 0.00 ? 24  LYS A H    2  
ATOM 2178  H HA   . LYS A 1 24  ? 19.748  15.642  -3.720  1.00 0.00 ? 24  LYS A HA   2  
ATOM 2179  H HB2  . LYS A 1 24  ? 18.890  15.202  -0.881  1.00 0.00 ? 24  LYS A HB2  2  
ATOM 2180  H HB3  . LYS A 1 24  ? 20.234  16.280  -1.233  1.00 0.00 ? 24  LYS A HB3  2  
ATOM 2181  H HG2  . LYS A 1 24  ? 17.685  16.651  -2.720  1.00 0.00 ? 24  LYS A HG2  2  
ATOM 2182  H HG3  . LYS A 1 24  ? 17.779  17.181  -1.038  1.00 0.00 ? 24  LYS A HG3  2  
ATOM 2183  H HD2  . LYS A 1 24  ? 19.478  18.724  -1.501  1.00 0.00 ? 24  LYS A HD2  2  
ATOM 2184  H HD3  . LYS A 1 24  ? 19.873  17.962  -3.043  1.00 0.00 ? 24  LYS A HD3  2  
ATOM 2185  H HE2  . LYS A 1 24  ? 17.271  19.367  -2.450  1.00 0.00 ? 24  LYS A HE2  2  
ATOM 2186  H HE3  . LYS A 1 24  ? 18.647  20.121  -3.255  1.00 0.00 ? 24  LYS A HE3  2  
ATOM 2187  H HZ1  . LYS A 1 24  ? 17.128  17.765  -4.236  1.00 0.00 ? 24  LYS A HZ1  2  
ATOM 2188  H HZ2  . LYS A 1 24  ? 18.478  18.439  -5.000  1.00 0.00 ? 24  LYS A HZ2  2  
ATOM 2189  H HZ3  . LYS A 1 24  ? 17.049  19.333  -4.864  1.00 0.00 ? 24  LYS A HZ3  2  
ATOM 2190  N N    . ASP A 1 25  ? 22.065  15.134  -2.400  1.00 0.00 ? 25  ASP A N    2  
ATOM 2191  C CA   . ASP A 1 25  ? 23.410  14.617  -2.179  1.00 0.00 ? 25  ASP A CA   2  
ATOM 2192  C C    . ASP A 1 25  ? 23.512  13.934  -0.818  1.00 0.00 ? 25  ASP A C    2  
ATOM 2193  O O    . ASP A 1 25  ? 23.956  14.536  0.158   1.00 0.00 ? 25  ASP A O    2  
ATOM 2194  C CB   . ASP A 1 25  ? 24.436  15.746  -2.275  1.00 0.00 ? 25  ASP A CB   2  
ATOM 2195  C CG   . ASP A 1 25  ? 24.369  16.478  -3.601  1.00 0.00 ? 25  ASP A CG   2  
ATOM 2196  O OD1  . ASP A 1 25  ? 24.718  15.869  -4.634  1.00 0.00 ? 25  ASP A OD1  2  
ATOM 2197  O OD2  . ASP A 1 25  ? 23.968  17.661  -3.606  1.00 0.00 ? 25  ASP A OD2  2  
ATOM 2198  H H    . ASP A 1 25  ? 21.913  16.102  -2.367  1.00 0.00 ? 25  ASP A H    2  
ATOM 2199  H HA   . ASP A 1 25  ? 23.616  13.889  -2.949  1.00 0.00 ? 25  ASP A HA   2  
ATOM 2200  H HB2  . ASP A 1 25  ? 24.254  16.458  -1.483  1.00 0.00 ? 25  ASP A HB2  2  
ATOM 2201  H HB3  . ASP A 1 25  ? 25.428  15.334  -2.161  1.00 0.00 ? 25  ASP A HB3  2  
ATOM 2202  N N    . GLY A 1 26  ? 23.097  12.672  -0.762  1.00 0.00 ? 26  GLY A N    2  
ATOM 2203  C CA   . GLY A 1 26  ? 23.149  11.929  0.483   1.00 0.00 ? 26  GLY A CA   2  
ATOM 2204  C C    . GLY A 1 26  ? 21.779  11.748  1.108   1.00 0.00 ? 26  GLY A C    2  
ATOM 2205  O O    . GLY A 1 26  ? 21.642  11.768  2.331   1.00 0.00 ? 26  GLY A O    2  
ATOM 2206  H H    . GLY A 1 26  ? 22.752  12.243  -1.573  1.00 0.00 ? 26  GLY A H    2  
ATOM 2207  H HA2  . GLY A 1 26  ? 23.576  10.956  0.291   1.00 0.00 ? 26  GLY A HA2  2  
ATOM 2208  H HA3  . GLY A 1 26  ? 23.782  12.459  1.179   1.00 0.00 ? 26  GLY A HA3  2  
ATOM 2209  N N    . GLN A 1 27  ? 20.765  11.573  0.267   1.00 0.00 ? 27  GLN A N    2  
ATOM 2210  C CA   . GLN A 1 27  ? 19.400  11.391  0.745   1.00 0.00 ? 27  GLN A CA   2  
ATOM 2211  C C    . GLN A 1 27  ? 18.838  10.048  0.290   1.00 0.00 ? 27  GLN A C    2  
ATOM 2212  O O    . GLN A 1 27  ? 19.016  9.647   -0.860  1.00 0.00 ? 27  GLN A O    2  
ATOM 2213  C CB   . GLN A 1 27  ? 18.506  12.527  0.245   1.00 0.00 ? 27  GLN A CB   2  
ATOM 2214  C CG   . GLN A 1 27  ? 17.034  12.332  0.572   1.00 0.00 ? 27  GLN A CG   2  
ATOM 2215  C CD   . GLN A 1 27  ? 16.268  13.639  0.613   1.00 0.00 ? 27  GLN A CD   2  
ATOM 2216  O OE1  . GLN A 1 27  ? 16.298  14.359  1.612   1.00 0.00 ? 27  GLN A OE1  2  
ATOM 2217  N NE2  . GLN A 1 27  ? 15.575  13.954  -0.475  1.00 0.00 ? 27  GLN A NE2  2  
ATOM 2218  H H    . GLN A 1 27  ? 20.939  11.567  -0.697  1.00 0.00 ? 27  GLN A H    2  
ATOM 2219  H HA   . GLN A 1 27  ? 19.421  11.411  1.824   1.00 0.00 ? 27  GLN A HA   2  
ATOM 2220  H HB2  . GLN A 1 27  ? 18.834  13.452  0.694   1.00 0.00 ? 27  GLN A HB2  2  
ATOM 2221  H HB3  . GLN A 1 27  ? 18.606  12.602  -0.828  1.00 0.00 ? 27  GLN A HB3  2  
ATOM 2222  H HG2  . GLN A 1 27  ? 16.592  11.697  -0.181  1.00 0.00 ? 27  GLN A HG2  2  
ATOM 2223  H HG3  . GLN A 1 27  ? 16.954  11.854  1.537   1.00 0.00 ? 27  GLN A HG3  2  
ATOM 2224  H HE21 . GLN A 1 27  ? 15.596  13.332  -1.233  1.00 0.00 ? 27  GLN A HE21 2  
ATOM 2225  H HE22 . GLN A 1 27  ? 15.069  14.793  -0.475  1.00 0.00 ? 27  GLN A HE22 2  
ATOM 2226  N N    . SER A 1 28  ? 18.160  9.357   1.201   1.00 0.00 ? 28  SER A N    2  
ATOM 2227  C CA   . SER A 1 28  ? 17.576  8.056   0.894   1.00 0.00 ? 28  SER A CA   2  
ATOM 2228  C C    . SER A 1 28  ? 16.213  8.217   0.226   1.00 0.00 ? 28  SER A C    2  
ATOM 2229  O O    . SER A 1 28  ? 15.551  9.244   0.379   1.00 0.00 ? 28  SER A O    2  
ATOM 2230  C CB   . SER A 1 28  ? 17.436  7.223   2.170   1.00 0.00 ? 28  SER A CB   2  
ATOM 2231  O OG   . SER A 1 28  ? 16.453  7.771   3.031   1.00 0.00 ? 28  SER A OG   2  
ATOM 2232  H H    . SER A 1 28  ? 18.052  9.730   2.101   1.00 0.00 ? 28  SER A H    2  
ATOM 2233  H HA   . SER A 1 28  ? 18.240  7.547   0.213   1.00 0.00 ? 28  SER A HA   2  
ATOM 2234  H HB2  . SER A 1 28  ? 17.147  6.216   1.909   1.00 0.00 ? 28  SER A HB2  2  
ATOM 2235  H HB3  . SER A 1 28  ? 18.383  7.204   2.689   1.00 0.00 ? 28  SER A HB3  2  
ATOM 2236  H HG   . SER A 1 28  ? 16.469  7.306   3.872   1.00 0.00 ? 28  SER A HG   2  
ATOM 2237  N N    . LEU A 1 29  ? 15.802  7.194   -0.516  1.00 0.00 ? 29  LEU A N    2  
ATOM 2238  C CA   . LEU A 1 29  ? 14.518  7.220   -1.209  1.00 0.00 ? 29  LEU A CA   2  
ATOM 2239  C C    . LEU A 1 29  ? 13.401  7.662   -0.269  1.00 0.00 ? 29  LEU A C    2  
ATOM 2240  O O    . LEU A 1 29  ? 12.651  8.589   -0.572  1.00 0.00 ? 29  LEU A O    2  
ATOM 2241  C CB   . LEU A 1 29  ? 14.200  5.839   -1.784  1.00 0.00 ? 29  LEU A CB   2  
ATOM 2242  C CG   . LEU A 1 29  ? 13.134  5.798   -2.880  1.00 0.00 ? 29  LEU A CG   2  
ATOM 2243  C CD1  . LEU A 1 29  ? 13.636  6.489   -4.139  1.00 0.00 ? 29  LEU A CD1  2  
ATOM 2244  C CD2  . LEU A 1 29  ? 12.734  4.361   -3.182  1.00 0.00 ? 29  LEU A CD2  2  
ATOM 2245  H H    . LEU A 1 29  ? 16.373  6.403   -0.600  1.00 0.00 ? 29  LEU A H    2  
ATOM 2246  H HA   . LEU A 1 29  ? 14.593  7.930   -2.018  1.00 0.00 ? 29  LEU A HA   2  
ATOM 2247  H HB2  . LEU A 1 29  ? 15.112  5.434   -2.195  1.00 0.00 ? 29  LEU A HB2  2  
ATOM 2248  H HB3  . LEU A 1 29  ? 13.863  5.212   -0.971  1.00 0.00 ? 29  LEU A HB3  2  
ATOM 2249  H HG   . LEU A 1 29  ? 12.255  6.327   -2.538  1.00 0.00 ? 29  LEU A HG   2  
ATOM 2250  H HD11 . LEU A 1 29  ? 14.714  6.536   -4.118  1.00 0.00 ? 29  LEU A HD11 2  
ATOM 2251  H HD12 . LEU A 1 29  ? 13.232  7.490   -4.185  1.00 0.00 ? 29  LEU A HD12 2  
ATOM 2252  H HD13 . LEU A 1 29  ? 13.315  5.932   -5.007  1.00 0.00 ? 29  LEU A HD13 2  
ATOM 2253  H HD21 . LEU A 1 29  ? 13.611  3.793   -3.453  1.00 0.00 ? 29  LEU A HD21 2  
ATOM 2254  H HD22 . LEU A 1 29  ? 12.029  4.348   -4.001  1.00 0.00 ? 29  LEU A HD22 2  
ATOM 2255  H HD23 . LEU A 1 29  ? 12.278  3.924   -2.306  1.00 0.00 ? 29  LEU A HD23 2  
ATOM 2256  N N    . GLY A 1 30  ? 13.297  6.992   0.875   1.00 0.00 ? 30  GLY A N    2  
ATOM 2257  C CA   . GLY A 1 30  ? 12.270  7.331   1.843   1.00 0.00 ? 30  GLY A CA   2  
ATOM 2258  C C    . GLY A 1 30  ? 10.934  6.692   1.519   1.00 0.00 ? 30  GLY A C    2  
ATOM 2259  O O    . GLY A 1 30  ? 9.909   7.373   1.466   1.00 0.00 ? 30  GLY A O    2  
ATOM 2260  H H    . GLY A 1 30  ? 13.923  6.261   1.063   1.00 0.00 ? 30  GLY A H    2  
ATOM 2261  H HA2  . GLY A 1 30  ? 12.588  7.000   2.820   1.00 0.00 ? 30  GLY A HA2  2  
ATOM 2262  H HA3  . GLY A 1 30  ? 12.147  8.404   1.859   1.00 0.00 ? 30  GLY A HA3  2  
ATOM 2263  N N    . ILE A 1 31  ? 10.945  5.382   1.299   1.00 0.00 ? 31  ILE A N    2  
ATOM 2264  C CA   . ILE A 1 31  ? 9.725   4.651   0.978   1.00 0.00 ? 31  ILE A CA   2  
ATOM 2265  C C    . ILE A 1 31  ? 9.717   3.277   1.639   1.00 0.00 ? 31  ILE A C    2  
ATOM 2266  O O    . ILE A 1 31  ? 10.529  2.413   1.308   1.00 0.00 ? 31  ILE A O    2  
ATOM 2267  C CB   . ILE A 1 31  ? 9.556   4.478   -0.543  1.00 0.00 ? 31  ILE A CB   2  
ATOM 2268  C CG1  . ILE A 1 31  ? 9.420   5.843   -1.222  1.00 0.00 ? 31  ILE A CG1  2  
ATOM 2269  C CG2  . ILE A 1 31  ? 8.347   3.607   -0.846  1.00 0.00 ? 31  ILE A CG2  2  
ATOM 2270  C CD1  . ILE A 1 31  ? 9.354   5.763   -2.731  1.00 0.00 ? 31  ILE A CD1  2  
ATOM 2271  H H    . ILE A 1 31  ? 11.793  4.894   1.355   1.00 0.00 ? 31  ILE A H    2  
ATOM 2272  H HA   . ILE A 1 31  ? 8.887   5.223   1.350   1.00 0.00 ? 31  ILE A HA   2  
ATOM 2273  H HB   . ILE A 1 31  ? 10.434  3.980   -0.926  1.00 0.00 ? 31  ILE A HB   2  
ATOM 2274  H HG12 . ILE A 1 31  ? 8.518   6.321   -0.876  1.00 0.00 ? 31  ILE A HG12 2  
ATOM 2275  H HG13 . ILE A 1 31  ? 10.271  6.454   -0.958  1.00 0.00 ? 31  ILE A HG13 2  
ATOM 2276  H HG21 . ILE A 1 31  ? 7.643   4.164   -1.447  1.00 0.00 ? 31  ILE A HG21 2  
ATOM 2277  H HG22 . ILE A 1 31  ? 8.664   2.728   -1.387  1.00 0.00 ? 31  ILE A HG22 2  
ATOM 2278  H HG23 . ILE A 1 31  ? 7.875   3.310   0.078   1.00 0.00 ? 31  ILE A HG23 2  
ATOM 2279  H HD11 . ILE A 1 31  ? 10.293  6.095   -3.151  1.00 0.00 ? 31  ILE A HD11 2  
ATOM 2280  H HD12 . ILE A 1 31  ? 9.165   4.744   -3.030  1.00 0.00 ? 31  ILE A HD12 2  
ATOM 2281  H HD13 . ILE A 1 31  ? 8.556   6.398   -3.090  1.00 0.00 ? 31  ILE A HD13 2  
ATOM 2282  N N    . ARG A 1 32  ? 8.792   3.081   2.573   1.00 0.00 ? 32  ARG A N    2  
ATOM 2283  C CA   . ARG A 1 32  ? 8.677   1.812   3.280   1.00 0.00 ? 32  ARG A CA   2  
ATOM 2284  C C    . ARG A 1 32  ? 7.836   0.820   2.483   1.00 0.00 ? 32  ARG A C    2  
ATOM 2285  O O    . ARG A 1 32  ? 6.876   1.202   1.814   1.00 0.00 ? 32  ARG A O    2  
ATOM 2286  C CB   . ARG A 1 32  ? 8.058   2.027   4.662   1.00 0.00 ? 32  ARG A CB   2  
ATOM 2287  C CG   . ARG A 1 32  ? 8.889   2.920   5.570   1.00 0.00 ? 32  ARG A CG   2  
ATOM 2288  C CD   . ARG A 1 32  ? 8.706   2.550   7.033   1.00 0.00 ? 32  ARG A CD   2  
ATOM 2289  N NE   . ARG A 1 32  ? 8.994   3.674   7.921   1.00 0.00 ? 32  ARG A NE   2  
ATOM 2290  C CZ   . ARG A 1 32  ? 9.028   3.573   9.245   1.00 0.00 ? 32  ARG A CZ   2  
ATOM 2291  N NH1  . ARG A 1 32  ? 8.793   2.408   9.832   1.00 0.00 ? 32  ARG A NH1  2  
ATOM 2292  N NH2  . ARG A 1 32  ? 9.298   4.641   9.986   1.00 0.00 ? 32  ARG A NH2  2  
ATOM 2293  H H    . ARG A 1 32  ? 8.173   3.808   2.793   1.00 0.00 ? 32  ARG A H    2  
ATOM 2294  H HA   . ARG A 1 32  ? 9.671   1.408   3.400   1.00 0.00 ? 32  ARG A HA   2  
ATOM 2295  H HB2  . ARG A 1 32  ? 7.085   2.481   4.541   1.00 0.00 ? 32  ARG A HB2  2  
ATOM 2296  H HB3  . ARG A 1 32  ? 7.941   1.069   5.145   1.00 0.00 ? 32  ARG A HB3  2  
ATOM 2297  H HG2  . ARG A 1 32  ? 9.931   2.810   5.310   1.00 0.00 ? 32  ARG A HG2  2  
ATOM 2298  H HG3  . ARG A 1 32  ? 8.585   3.946   5.425   1.00 0.00 ? 32  ARG A HG3  2  
ATOM 2299  H HD2  . ARG A 1 32  ? 7.684   2.236   7.187   1.00 0.00 ? 32  ARG A HD2  2  
ATOM 2300  H HD3  . ARG A 1 32  ? 9.372   1.735   7.271   1.00 0.00 ? 32  ARG A HD3  2  
ATOM 2301  H HE   . ARG A 1 32  ? 9.171   4.544   7.509   1.00 0.00 ? 32  ARG A HE   2  
ATOM 2302  H HH11 . ARG A 1 32  ? 8.590   1.602   9.276   1.00 0.00 ? 32  ARG A HH11 2  
ATOM 2303  H HH12 . ARG A 1 32  ? 8.820   2.335   10.829  1.00 0.00 ? 32  ARG A HH12 2  
ATOM 2304  H HH21 . ARG A 1 32  ? 9.476   5.521   9.547   1.00 0.00 ? 32  ARG A HH21 2  
ATOM 2305  H HH22 . ARG A 1 32  ? 9.323   4.565   10.982  1.00 0.00 ? 32  ARG A HH22 2  
ATOM 2306  N N    . ILE A 1 33  ? 8.203   -0.455  2.559   1.00 0.00 ? 33  ILE A N    2  
ATOM 2307  C CA   . ILE A 1 33  ? 7.481   -1.501  1.845   1.00 0.00 ? 33  ILE A CA   2  
ATOM 2308  C C    . ILE A 1 33  ? 6.942   -2.553  2.809   1.00 0.00 ? 33  ILE A C    2  
ATOM 2309  O O    . ILE A 1 33  ? 7.272   -2.551  3.995   1.00 0.00 ? 33  ILE A O    2  
ATOM 2310  C CB   . ILE A 1 33  ? 8.378   -2.191  0.800   1.00 0.00 ? 33  ILE A CB   2  
ATOM 2311  C CG1  . ILE A 1 33  ? 9.593   -2.827  1.479   1.00 0.00 ? 33  ILE A CG1  2  
ATOM 2312  C CG2  . ILE A 1 33  ? 8.819   -1.193  -0.260  1.00 0.00 ? 33  ILE A CG2  2  
ATOM 2313  C CD1  . ILE A 1 33  ? 10.160  -4.007  0.721   1.00 0.00 ? 33  ILE A CD1  2  
ATOM 2314  H H    . ILE A 1 33  ? 8.977   -0.698  3.109   1.00 0.00 ? 33  ILE A H    2  
ATOM 2315  H HA   . ILE A 1 33  ? 6.651   -1.041  1.330   1.00 0.00 ? 33  ILE A HA   2  
ATOM 2316  H HB   . ILE A 1 33  ? 7.800   -2.963  0.316   1.00 0.00 ? 33  ILE A HB   2  
ATOM 2317  H HG12 . ILE A 1 33  ? 10.373  -2.088  1.573   1.00 0.00 ? 33  ILE A HG12 2  
ATOM 2318  H HG13 . ILE A 1 33  ? 9.308   -3.170  2.463   1.00 0.00 ? 33  ILE A HG13 2  
ATOM 2319  H HG21 . ILE A 1 33  ? 9.862   -0.952  -0.116  1.00 0.00 ? 33  ILE A HG21 2  
ATOM 2320  H HG22 . ILE A 1 33  ? 8.684   -1.627  -1.240  1.00 0.00 ? 33  ILE A HG22 2  
ATOM 2321  H HG23 . ILE A 1 33  ? 8.227   -0.295  -0.178  1.00 0.00 ? 33  ILE A HG23 2  
ATOM 2322  H HD11 . ILE A 1 33  ? 9.380   -4.464  0.130   1.00 0.00 ? 33  ILE A HD11 2  
ATOM 2323  H HD12 . ILE A 1 33  ? 10.955  -3.671  0.073   1.00 0.00 ? 33  ILE A HD12 2  
ATOM 2324  H HD13 . ILE A 1 33  ? 10.550  -4.731  1.422   1.00 0.00 ? 33  ILE A HD13 2  
ATOM 2325  N N    . VAL A 1 34  ? 6.111   -3.452  2.291   1.00 0.00 ? 34  VAL A N    2  
ATOM 2326  C CA   . VAL A 1 34  ? 5.527   -4.512  3.104   1.00 0.00 ? 34  VAL A CA   2  
ATOM 2327  C C    . VAL A 1 34  ? 5.139   -5.712  2.248   1.00 0.00 ? 34  VAL A C    2  
ATOM 2328  O O    . VAL A 1 34  ? 4.662   -5.557  1.124   1.00 0.00 ? 34  VAL A O    2  
ATOM 2329  C CB   . VAL A 1 34  ? 4.284   -4.015  3.866   1.00 0.00 ? 34  VAL A CB   2  
ATOM 2330  C CG1  . VAL A 1 34  ? 3.099   -3.880  2.922   1.00 0.00 ? 34  VAL A CG1  2  
ATOM 2331  C CG2  . VAL A 1 34  ? 3.955   -4.953  5.017   1.00 0.00 ? 34  VAL A CG2  2  
ATOM 2332  H H    . VAL A 1 34  ? 5.885   -3.401  1.339   1.00 0.00 ? 34  VAL A H    2  
ATOM 2333  H HA   . VAL A 1 34  ? 6.267   -4.822  3.828   1.00 0.00 ? 34  VAL A HA   2  
ATOM 2334  H HB   . VAL A 1 34  ? 4.503   -3.040  4.275   1.00 0.00 ? 34  VAL A HB   2  
ATOM 2335  H HG11 . VAL A 1 34  ? 2.222   -3.593  3.485   1.00 0.00 ? 34  VAL A HG11 2  
ATOM 2336  H HG12 . VAL A 1 34  ? 3.314   -3.126  2.179   1.00 0.00 ? 34  VAL A HG12 2  
ATOM 2337  H HG13 . VAL A 1 34  ? 2.918   -4.826  2.434   1.00 0.00 ? 34  VAL A HG13 2  
ATOM 2338  H HG21 . VAL A 1 34  ? 2.926   -5.270  4.940   1.00 0.00 ? 34  VAL A HG21 2  
ATOM 2339  H HG22 . VAL A 1 34  ? 4.602   -5.817  4.974   1.00 0.00 ? 34  VAL A HG22 2  
ATOM 2340  H HG23 . VAL A 1 34  ? 4.104   -4.439  5.955   1.00 0.00 ? 34  VAL A HG23 2  
ATOM 2341  N N    . GLY A 1 35  ? 5.348   -6.909  2.787   1.00 0.00 ? 35  GLY A N    2  
ATOM 2342  C CA   . GLY A 1 35  ? 5.014   -8.119  2.058   1.00 0.00 ? 35  GLY A CA   2  
ATOM 2343  C C    . GLY A 1 35  ? 3.665   -8.683  2.459   1.00 0.00 ? 35  GLY A C    2  
ATOM 2344  O O    . GLY A 1 35  ? 3.374   -8.830  3.646   1.00 0.00 ? 35  GLY A O    2  
ATOM 2345  H H    . GLY A 1 35  ? 5.731   -6.971  3.687   1.00 0.00 ? 35  GLY A H    2  
ATOM 2346  H HA2  . GLY A 1 35  ? 5.000   -7.897  1.002   1.00 0.00 ? 35  GLY A HA2  2  
ATOM 2347  H HA3  . GLY A 1 35  ? 5.773   -8.862  2.251   1.00 0.00 ? 35  GLY A HA3  2  
ATOM 2348  N N    . TYR A 1 36  ? 2.840   -8.999  1.467   1.00 0.00 ? 36  TYR A N    2  
ATOM 2349  C CA   . TYR A 1 36  ? 1.513   -9.547  1.722   1.00 0.00 ? 36  TYR A CA   2  
ATOM 2350  C C    . TYR A 1 36  ? 1.313   -10.862 0.975   1.00 0.00 ? 36  TYR A C    2  
ATOM 2351  O O    . TYR A 1 36  ? 1.883   -11.075 -0.095  1.00 0.00 ? 36  TYR A O    2  
ATOM 2352  C CB   . TYR A 1 36  ? 0.436   -8.543  1.307   1.00 0.00 ? 36  TYR A CB   2  
ATOM 2353  C CG   . TYR A 1 36  ? -0.044  -7.666  2.441   1.00 0.00 ? 36  TYR A CG   2  
ATOM 2354  C CD1  . TYR A 1 36  ? 0.617   -6.486  2.759   1.00 0.00 ? 36  TYR A CD1  2  
ATOM 2355  C CD2  . TYR A 1 36  ? -1.157  -8.017  3.195   1.00 0.00 ? 36  TYR A CD2  2  
ATOM 2356  C CE1  . TYR A 1 36  ? 0.182   -5.681  3.795   1.00 0.00 ? 36  TYR A CE1  2  
ATOM 2357  C CE2  . TYR A 1 36  ? -1.599  -7.218  4.231   1.00 0.00 ? 36  TYR A CE2  2  
ATOM 2358  C CZ   . TYR A 1 36  ? -0.926  -6.051  4.528   1.00 0.00 ? 36  TYR A CZ   2  
ATOM 2359  O OH   . TYR A 1 36  ? -1.362  -5.253  5.560   1.00 0.00 ? 36  TYR A OH   2  
ATOM 2360  H H    . TYR A 1 36  ? 3.129   -8.860  0.541   1.00 0.00 ? 36  TYR A H    2  
ATOM 2361  H HA   . TYR A 1 36  ? 1.429   -9.732  2.783   1.00 0.00 ? 36  TYR A HA   2  
ATOM 2362  H HB2  . TYR A 1 36  ? 0.830   -7.901  0.535   1.00 0.00 ? 36  TYR A HB2  2  
ATOM 2363  H HB3  . TYR A 1 36  ? -0.417  -9.081  0.919   1.00 0.00 ? 36  TYR A HB3  2  
ATOM 2364  H HD1  . TYR A 1 36  ? 1.484   -6.198  2.183   1.00 0.00 ? 36  TYR A HD1  2  
ATOM 2365  H HD2  . TYR A 1 36  ? -1.681  -8.932  2.960   1.00 0.00 ? 36  TYR A HD2  2  
ATOM 2366  H HE1  . TYR A 1 36  ? 0.709   -4.767  4.027   1.00 0.00 ? 36  TYR A HE1  2  
ATOM 2367  H HE2  . TYR A 1 36  ? -2.466  -7.508  4.805   1.00 0.00 ? 36  TYR A HE2  2  
ATOM 2368  H HH   . TYR A 1 36  ? -2.020  -5.727  6.075   1.00 0.00 ? 36  TYR A HH   2  
ATOM 2369  N N    . VAL A 1 37  ? 0.499   -11.743 1.548   1.00 0.00 ? 37  VAL A N    2  
ATOM 2370  C CA   . VAL A 1 37  ? 0.222   -13.037 0.938   1.00 0.00 ? 37  VAL A CA   2  
ATOM 2371  C C    . VAL A 1 37  ? -1.278  -13.258 0.775   1.00 0.00 ? 37  VAL A C    2  
ATOM 2372  O O    . VAL A 1 37  ? -1.714  -14.029 -0.079  1.00 0.00 ? 37  VAL A O    2  
ATOM 2373  C CB   . VAL A 1 37  ? 0.811   -14.190 1.772   1.00 0.00 ? 37  VAL A CB   2  
ATOM 2374  C CG1  . VAL A 1 37  ? 2.330   -14.113 1.791   1.00 0.00 ? 37  VAL A CG1  2  
ATOM 2375  C CG2  . VAL A 1 37  ? 0.250   -14.164 3.186   1.00 0.00 ? 37  VAL A CG2  2  
ATOM 2376  H H    . VAL A 1 37  ? 0.074   -11.516 2.402   1.00 0.00 ? 37  VAL A H    2  
ATOM 2377  H HA   . VAL A 1 37  ? 0.686   -13.053 -0.038  1.00 0.00 ? 37  VAL A HA   2  
ATOM 2378  H HB   . VAL A 1 37  ? 0.526   -15.124 1.311   1.00 0.00 ? 37  VAL A HB   2  
ATOM 2379  H HG11 . VAL A 1 37  ? 2.678   -13.654 0.878   1.00 0.00 ? 37  VAL A HG11 2  
ATOM 2380  H HG12 . VAL A 1 37  ? 2.650   -13.522 2.637   1.00 0.00 ? 37  VAL A HG12 2  
ATOM 2381  H HG13 . VAL A 1 37  ? 2.740   -15.109 1.872   1.00 0.00 ? 37  VAL A HG13 2  
ATOM 2382  H HG21 . VAL A 1 37  ? -0.660  -13.583 3.201   1.00 0.00 ? 37  VAL A HG21 2  
ATOM 2383  H HG22 . VAL A 1 37  ? 0.038   -15.174 3.508   1.00 0.00 ? 37  VAL A HG22 2  
ATOM 2384  H HG23 . VAL A 1 37  ? 0.973   -13.719 3.853   1.00 0.00 ? 37  VAL A HG23 2  
ATOM 2385  N N    . GLY A 1 38  ? -2.065  -12.574 1.600   1.00 0.00 ? 38  GLY A N    2  
ATOM 2386  C CA   . GLY A 1 38  ? -3.508  -12.709 1.531   1.00 0.00 ? 38  GLY A CA   2  
ATOM 2387  C C    . GLY A 1 38  ? -3.972  -14.126 1.802   1.00 0.00 ? 38  GLY A C    2  
ATOM 2388  O O    . GLY A 1 38  ? -4.604  -14.754 0.952   1.00 0.00 ? 38  GLY A O    2  
ATOM 2389  H H    . GLY A 1 38  ? -1.661  -11.973 2.261   1.00 0.00 ? 38  GLY A H    2  
ATOM 2390  H HA2  . GLY A 1 38  ? -3.955  -12.049 2.260   1.00 0.00 ? 38  GLY A HA2  2  
ATOM 2391  H HA3  . GLY A 1 38  ? -3.839  -12.416 0.545   1.00 0.00 ? 38  GLY A HA3  2  
ATOM 2392  N N    . THR A 1 39  ? -3.656  -14.634 2.990   1.00 0.00 ? 39  THR A N    2  
ATOM 2393  C CA   . THR A 1 39  ? -4.041  -15.987 3.369   1.00 0.00 ? 39  THR A CA   2  
ATOM 2394  C C    . THR A 1 39  ? -5.189  -15.971 4.373   1.00 0.00 ? 39  THR A C    2  
ATOM 2395  O O    . THR A 1 39  ? -6.078  -16.821 4.327   1.00 0.00 ? 39  THR A O    2  
ATOM 2396  C CB   . THR A 1 39  ? -2.855  -16.760 3.975   1.00 0.00 ? 39  THR A CB   2  
ATOM 2397  O OG1  . THR A 1 39  ? -3.246  -18.107 4.268   1.00 0.00 ? 39  THR A OG1  2  
ATOM 2398  C CG2  . THR A 1 39  ? -2.360  -16.083 5.245   1.00 0.00 ? 39  THR A CG2  2  
ATOM 2399  H H    . THR A 1 39  ? -3.151  -14.084 3.624   1.00 0.00 ? 39  THR A H    2  
ATOM 2400  H HA   . THR A 1 39  ? -4.363  -16.505 2.477   1.00 0.00 ? 39  THR A HA   2  
ATOM 2401  H HB   . THR A 1 39  ? -2.049  -16.776 3.255   1.00 0.00 ? 39  THR A HB   2  
ATOM 2402  H HG1  . THR A 1 39  ? -4.170  -18.229 4.037   1.00 0.00 ? 39  THR A HG1  2  
ATOM 2403  H HG21 . THR A 1 39  ? -2.478  -15.014 5.152   1.00 0.00 ? 39  THR A HG21 2  
ATOM 2404  H HG22 . THR A 1 39  ? -1.317  -16.319 5.395   1.00 0.00 ? 39  THR A HG22 2  
ATOM 2405  H HG23 . THR A 1 39  ? -2.934  -16.437 6.088   1.00 0.00 ? 39  THR A HG23 2  
ATOM 2406  N N    . SER A 1 40  ? -5.163  -14.998 5.278   1.00 0.00 ? 40  SER A N    2  
ATOM 2407  C CA   . SER A 1 40  ? -6.200  -14.873 6.296   1.00 0.00 ? 40  SER A CA   2  
ATOM 2408  C C    . SER A 1 40  ? -6.931  -13.541 6.166   1.00 0.00 ? 40  SER A C    2  
ATOM 2409  O O    . SER A 1 40  ? -6.875  -12.698 7.062   1.00 0.00 ? 40  SER A O    2  
ATOM 2410  C CB   . SER A 1 40  ? -5.591  -14.999 7.694   1.00 0.00 ? 40  SER A CB   2  
ATOM 2411  O OG   . SER A 1 40  ? -5.143  -16.322 7.937   1.00 0.00 ? 40  SER A OG   2  
ATOM 2412  H H    . SER A 1 40  ? -4.427  -14.351 5.263   1.00 0.00 ? 40  SER A H    2  
ATOM 2413  H HA   . SER A 1 40  ? -6.908  -15.675 6.148   1.00 0.00 ? 40  SER A HA   2  
ATOM 2414  H HB2  . SER A 1 40  ? -4.751  -14.326 7.780   1.00 0.00 ? 40  SER A HB2  2  
ATOM 2415  H HB3  . SER A 1 40  ? -6.336  -14.742 8.433   1.00 0.00 ? 40  SER A HB3  2  
ATOM 2416  H HG   . SER A 1 40  ? -5.432  -16.602 8.809   1.00 0.00 ? 40  SER A HG   2  
ATOM 2417  N N    . HIS A 1 41  ? -7.617  -13.357 5.042   1.00 0.00 ? 41  HIS A N    2  
ATOM 2418  C CA   . HIS A 1 41  ? -8.360  -12.127 4.793   1.00 0.00 ? 41  HIS A CA   2  
ATOM 2419  C C    . HIS A 1 41  ? -9.179  -12.237 3.510   1.00 0.00 ? 41  HIS A C    2  
ATOM 2420  O O    . HIS A 1 41  ? -9.006  -13.173 2.729   1.00 0.00 ? 41  HIS A O    2  
ATOM 2421  C CB   . HIS A 1 41  ? -7.404  -10.937 4.702   1.00 0.00 ? 41  HIS A CB   2  
ATOM 2422  C CG   . HIS A 1 41  ? -8.022  -9.638  5.118   1.00 0.00 ? 41  HIS A CG   2  
ATOM 2423  N ND1  . HIS A 1 41  ? -8.330  -9.337  6.428   1.00 0.00 ? 41  HIS A ND1  2  
ATOM 2424  C CD2  . HIS A 1 41  ? -8.388  -8.558  4.389   1.00 0.00 ? 41  HIS A CD2  2  
ATOM 2425  C CE1  . HIS A 1 41  ? -8.861  -8.129  6.486   1.00 0.00 ? 41  HIS A CE1  2  
ATOM 2426  N NE2  . HIS A 1 41  ? -8.907  -7.634  5.263   1.00 0.00 ? 41  HIS A NE2  2  
ATOM 2427  H H    . HIS A 1 41  ? -7.623  -14.065 4.365   1.00 0.00 ? 41  HIS A H    2  
ATOM 2428  H HA   . HIS A 1 41  ? -9.034  -11.973 5.622   1.00 0.00 ? 41  HIS A HA   2  
ATOM 2429  H HB2  . HIS A 1 41  ? -6.552  -11.119 5.340   1.00 0.00 ? 41  HIS A HB2  2  
ATOM 2430  H HB3  . HIS A 1 41  ? -7.066  -10.833 3.680   1.00 0.00 ? 41  HIS A HB3  2  
ATOM 2431  H HD1  . HIS A 1 41  ? -8.184  -9.923  7.199   1.00 0.00 ? 41  HIS A HD1  2  
ATOM 2432  H HD2  . HIS A 1 41  ? -8.292  -8.443  3.318   1.00 0.00 ? 41  HIS A HD2  2  
ATOM 2433  H HE1  . HIS A 1 41  ? -9.199  -7.629  7.382   1.00 0.00 ? 41  HIS A HE1  2  
ATOM 2434  H HE2  . HIS A 1 41  ? -9.332  -6.788  5.012   1.00 0.00 ? 41  HIS A HE2  2  
ATOM 2435  N N    . THR A 1 42  ? -10.071 -11.274 3.298   1.00 0.00 ? 42  THR A N    2  
ATOM 2436  C CA   . THR A 1 42  ? -10.917 -11.264 2.111   1.00 0.00 ? 42  THR A CA   2  
ATOM 2437  C C    . THR A 1 42  ? -10.152 -10.754 0.895   1.00 0.00 ? 42  THR A C    2  
ATOM 2438  O O    . THR A 1 42  ? -9.083  -10.159 1.027   1.00 0.00 ? 42  THR A O    2  
ATOM 2439  C CB   . THR A 1 42  ? -12.167 -10.389 2.321   1.00 0.00 ? 42  THR A CB   2  
ATOM 2440  O OG1  . THR A 1 42  ? -13.063 -10.542 1.214   1.00 0.00 ? 42  THR A OG1  2  
ATOM 2441  C CG2  . THR A 1 42  ? -11.785 -8.925  2.471   1.00 0.00 ? 42  THR A CG2  2  
ATOM 2442  H H    . THR A 1 42  ? -10.161 -10.554 3.957   1.00 0.00 ? 42  THR A H    2  
ATOM 2443  H HA   . THR A 1 42  ? -11.239 -12.277 1.923   1.00 0.00 ? 42  THR A HA   2  
ATOM 2444  H HB   . THR A 1 42  ? -12.666 -10.711 3.224   1.00 0.00 ? 42  THR A HB   2  
ATOM 2445  H HG1  . THR A 1 42  ? -12.884 -9.861  0.561   1.00 0.00 ? 42  THR A HG1  2  
ATOM 2446  H HG21 . THR A 1 42  ? -11.072 -8.820  3.276   1.00 0.00 ? 42  THR A HG21 2  
ATOM 2447  H HG22 . THR A 1 42  ? -12.667 -8.343  2.694   1.00 0.00 ? 42  THR A HG22 2  
ATOM 2448  H HG23 . THR A 1 42  ? -11.343 -8.572  1.552   1.00 0.00 ? 42  THR A HG23 2  
ATOM 2449  N N    . GLY A 1 43  ? -10.707 -10.989 -0.289  1.00 0.00 ? 43  GLY A N    2  
ATOM 2450  C CA   . GLY A 1 43  ? -10.064 -10.546 -1.512  1.00 0.00 ? 43  GLY A CA   2  
ATOM 2451  C C    . GLY A 1 43  ? -8.557  -10.710 -1.466  1.00 0.00 ? 43  GLY A C    2  
ATOM 2452  O O    . GLY A 1 43  ? -7.836  -9.776  -1.115  1.00 0.00 ? 43  GLY A O    2  
ATOM 2453  H H    . GLY A 1 43  ? -11.562 -11.468 -0.334  1.00 0.00 ? 43  GLY A H    2  
ATOM 2454  H HA2  . GLY A 1 43  ? -10.452 -11.121 -2.340  1.00 0.00 ? 43  GLY A HA2  2  
ATOM 2455  H HA3  . GLY A 1 43  ? -10.296 -9.503  -1.670  1.00 0.00 ? 43  GLY A HA3  2  
ATOM 2456  N N    . GLU A 1 44  ? -8.081  -11.899 -1.821  1.00 0.00 ? 44  GLU A N    2  
ATOM 2457  C CA   . GLU A 1 44  ? -6.650  -12.181 -1.816  1.00 0.00 ? 44  GLU A CA   2  
ATOM 2458  C C    . GLU A 1 44  ? -5.852  -10.950 -2.235  1.00 0.00 ? 44  GLU A C    2  
ATOM 2459  O O    . GLU A 1 44  ? -5.972  -10.475 -3.364  1.00 0.00 ? 44  GLU A O    2  
ATOM 2460  C CB   . GLU A 1 44  ? -6.335  -13.350 -2.751  1.00 0.00 ? 44  GLU A CB   2  
ATOM 2461  C CG   . GLU A 1 44  ? -6.849  -14.689 -2.247  1.00 0.00 ? 44  GLU A CG   2  
ATOM 2462  C CD   . GLU A 1 44  ? -6.588  -15.819 -3.223  1.00 0.00 ? 44  GLU A CD   2  
ATOM 2463  O OE1  . GLU A 1 44  ? -7.188  -15.808 -4.318  1.00 0.00 ? 44  GLU A OE1  2  
ATOM 2464  O OE2  . GLU A 1 44  ? -5.783  -16.714 -2.891  1.00 0.00 ? 44  GLU A OE2  2  
ATOM 2465  H H    . GLU A 1 44  ? -8.706  -12.603 -2.092  1.00 0.00 ? 44  GLU A H    2  
ATOM 2466  H HA   . GLU A 1 44  ? -6.370  -12.452 -0.809  1.00 0.00 ? 44  GLU A HA   2  
ATOM 2467  H HB2  . GLU A 1 44  ? -6.782  -13.156 -3.714  1.00 0.00 ? 44  GLU A HB2  2  
ATOM 2468  H HB3  . GLU A 1 44  ? -5.264  -13.422 -2.869  1.00 0.00 ? 44  GLU A HB3  2  
ATOM 2469  H HG2  . GLU A 1 44  ? -6.359  -14.920 -1.313  1.00 0.00 ? 44  GLU A HG2  2  
ATOM 2470  H HG3  . GLU A 1 44  ? -7.914  -14.612 -2.083  1.00 0.00 ? 44  GLU A HG3  2  
ATOM 2471  N N    . ALA A 1 45  ? -5.037  -10.440 -1.317  1.00 0.00 ? 45  ALA A N    2  
ATOM 2472  C CA   . ALA A 1 45  ? -4.218  -9.266  -1.592  1.00 0.00 ? 45  ALA A CA   2  
ATOM 2473  C C    . ALA A 1 45  ? -2.742  -9.555  -1.338  1.00 0.00 ? 45  ALA A C    2  
ATOM 2474  O O    . ALA A 1 45  ? -2.261  -9.434  -0.212  1.00 0.00 ? 45  ALA A O    2  
ATOM 2475  C CB   . ALA A 1 45  ? -4.680  -8.090  -0.745  1.00 0.00 ? 45  ALA A CB   2  
ATOM 2476  H H    . ALA A 1 45  ? -4.985  -10.864 -0.436  1.00 0.00 ? 45  ALA A H    2  
ATOM 2477  H HA   . ALA A 1 45  ? -4.349  -9.003  -2.632  1.00 0.00 ? 45  ALA A HA   2  
ATOM 2478  H HB1  . ALA A 1 45  ? -4.397  -8.255  0.285   1.00 0.00 ? 45  ALA A HB1  2  
ATOM 2479  H HB2  . ALA A 1 45  ? -4.217  -7.183  -1.105  1.00 0.00 ? 45  ALA A HB2  2  
ATOM 2480  H HB3  . ALA A 1 45  ? -5.754  -7.998  -0.813  1.00 0.00 ? 45  ALA A HB3  2  
ATOM 2481  N N    . SER A 1 46  ? -2.029  -9.939  -2.392  1.00 0.00 ? 46  SER A N    2  
ATOM 2482  C CA   . SER A 1 46  ? -0.609  -10.250 -2.282  1.00 0.00 ? 46  SER A CA   2  
ATOM 2483  C C    . SER A 1 46  ? 0.221   -9.314  -3.155  1.00 0.00 ? 46  SER A C    2  
ATOM 2484  O O    . SER A 1 46  ? -0.155  -9.003  -4.284  1.00 0.00 ? 46  SER A O    2  
ATOM 2485  C CB   . SER A 1 46  ? -0.351  -11.703 -2.685  1.00 0.00 ? 46  SER A CB   2  
ATOM 2486  O OG   . SER A 1 46  ? -0.396  -11.858 -4.092  1.00 0.00 ? 46  SER A OG   2  
ATOM 2487  H H    . SER A 1 46  ? -2.470  -10.017 -3.264  1.00 0.00 ? 46  SER A H    2  
ATOM 2488  H HA   . SER A 1 46  ? -0.319  -10.114 -1.251  1.00 0.00 ? 46  SER A HA   2  
ATOM 2489  H HB2  . SER A 1 46  ? 0.624   -12.004 -2.332  1.00 0.00 ? 46  SER A HB2  2  
ATOM 2490  H HB3  . SER A 1 46  ? -1.105  -12.336 -2.240  1.00 0.00 ? 46  SER A HB3  2  
ATOM 2491  H HG   . SER A 1 46  ? 0.295   -11.326 -4.495  1.00 0.00 ? 46  SER A HG   2  
ATOM 2492  N N    . GLY A 1 47  ? 1.354   -8.867  -2.621  1.00 0.00 ? 47  GLY A N    2  
ATOM 2493  C CA   . GLY A 1 47  ? 2.221   -7.970  -3.364  1.00 0.00 ? 47  GLY A CA   2  
ATOM 2494  C C    . GLY A 1 47  ? 2.891   -6.942  -2.474  1.00 0.00 ? 47  GLY A C    2  
ATOM 2495  O O    . GLY A 1 47  ? 2.601   -6.862  -1.280  1.00 0.00 ? 47  GLY A O    2  
ATOM 2496  H H    . GLY A 1 47  ? 1.603   -9.148  -1.716  1.00 0.00 ? 47  GLY A H    2  
ATOM 2497  H HA2  . GLY A 1 47  ? 2.983   -8.552  -3.860  1.00 0.00 ? 47  GLY A HA2  2  
ATOM 2498  H HA3  . GLY A 1 47  ? 1.633   -7.455  -4.109  1.00 0.00 ? 47  GLY A HA3  2  
ATOM 2499  N N    . ILE A 1 48  ? 3.790   -6.155  -3.055  1.00 0.00 ? 48  ILE A N    2  
ATOM 2500  C CA   . ILE A 1 48  ? 4.503   -5.128  -2.306  1.00 0.00 ? 48  ILE A CA   2  
ATOM 2501  C C    . ILE A 1 48  ? 3.696   -3.835  -2.240  1.00 0.00 ? 48  ILE A C    2  
ATOM 2502  O O    . ILE A 1 48  ? 3.241   -3.322  -3.262  1.00 0.00 ? 48  ILE A O    2  
ATOM 2503  C CB   . ILE A 1 48  ? 5.879   -4.829  -2.929  1.00 0.00 ? 48  ILE A CB   2  
ATOM 2504  C CG1  . ILE A 1 48  ? 6.701   -6.114  -3.045  1.00 0.00 ? 48  ILE A CG1  2  
ATOM 2505  C CG2  . ILE A 1 48  ? 6.622   -3.791  -2.101  1.00 0.00 ? 48  ILE A CG2  2  
ATOM 2506  C CD1  . ILE A 1 48  ? 7.047   -6.732  -1.708  1.00 0.00 ? 48  ILE A CD1  2  
ATOM 2507  H H    . ILE A 1 48  ? 3.977   -6.267  -4.010  1.00 0.00 ? 48  ILE A H    2  
ATOM 2508  H HA   . ILE A 1 48  ? 4.657   -5.495  -1.301  1.00 0.00 ? 48  ILE A HA   2  
ATOM 2509  H HB   . ILE A 1 48  ? 5.721   -4.421  -3.916  1.00 0.00 ? 48  ILE A HB   2  
ATOM 2510  H HG12 . ILE A 1 48  ? 6.141   -6.842  -3.611  1.00 0.00 ? 48  ILE A HG12 2  
ATOM 2511  H HG13 . ILE A 1 48  ? 7.625   -5.896  -3.560  1.00 0.00 ? 48  ILE A HG13 2  
ATOM 2512  H HG21 . ILE A 1 48  ? 5.998   -2.919  -1.973  1.00 0.00 ? 48  ILE A HG21 2  
ATOM 2513  H HG22 . ILE A 1 48  ? 6.860   -4.207  -1.134  1.00 0.00 ? 48  ILE A HG22 2  
ATOM 2514  H HG23 . ILE A 1 48  ? 7.533   -3.511  -2.608  1.00 0.00 ? 48  ILE A HG23 2  
ATOM 2515  H HD11 . ILE A 1 48  ? 6.146   -6.865  -1.128  1.00 0.00 ? 48  ILE A HD11 2  
ATOM 2516  H HD12 . ILE A 1 48  ? 7.521   -7.689  -1.865  1.00 0.00 ? 48  ILE A HD12 2  
ATOM 2517  H HD13 . ILE A 1 48  ? 7.724   -6.079  -1.175  1.00 0.00 ? 48  ILE A HD13 2  
ATOM 2518  N N    . TYR A 1 49  ? 3.523   -3.313  -1.031  1.00 0.00 ? 49  TYR A N    2  
ATOM 2519  C CA   . TYR A 1 49  ? 2.771   -2.081  -0.831  1.00 0.00 ? 49  TYR A CA   2  
ATOM 2520  C C    . TYR A 1 49  ? 3.565   -1.088  0.012   1.00 0.00 ? 49  TYR A C    2  
ATOM 2521  O O    . TYR A 1 49  ? 4.492   -1.465  0.728   1.00 0.00 ? 49  TYR A O    2  
ATOM 2522  C CB   . TYR A 1 49  ? 1.431   -2.380  -0.156  1.00 0.00 ? 49  TYR A CB   2  
ATOM 2523  C CG   . TYR A 1 49  ? 0.517   -3.253  -0.987  1.00 0.00 ? 49  TYR A CG   2  
ATOM 2524  C CD1  . TYR A 1 49  ? 0.635   -4.638  -0.961  1.00 0.00 ? 49  TYR A CD1  2  
ATOM 2525  C CD2  . TYR A 1 49  ? -0.463  -2.694  -1.797  1.00 0.00 ? 49  TYR A CD2  2  
ATOM 2526  C CE1  . TYR A 1 49  ? -0.197  -5.439  -1.719  1.00 0.00 ? 49  TYR A CE1  2  
ATOM 2527  C CE2  . TYR A 1 49  ? -1.300  -3.488  -2.557  1.00 0.00 ? 49  TYR A CE2  2  
ATOM 2528  C CZ   . TYR A 1 49  ? -1.164  -4.860  -2.515  1.00 0.00 ? 49  TYR A CZ   2  
ATOM 2529  O OH   . TYR A 1 49  ? -1.995  -5.654  -3.271  1.00 0.00 ? 49  TYR A OH   2  
ATOM 2530  H H    . TYR A 1 49  ? 3.910   -3.768  -0.253  1.00 0.00 ? 49  TYR A H    2  
ATOM 2531  H HA   . TYR A 1 49  ? 2.584   -1.644  -1.801  1.00 0.00 ? 49  TYR A HA   2  
ATOM 2532  H HB2  . TYR A 1 49  ? 1.611   -2.886  0.779   1.00 0.00 ? 49  TYR A HB2  2  
ATOM 2533  H HB3  . TYR A 1 49  ? 0.916   -1.450  0.036   1.00 0.00 ? 49  TYR A HB3  2  
ATOM 2534  H HD1  . TYR A 1 49  ? 1.392   -5.089  -0.337  1.00 0.00 ? 49  TYR A HD1  2  
ATOM 2535  H HD2  . TYR A 1 49  ? -0.567  -1.619  -1.829  1.00 0.00 ? 49  TYR A HD2  2  
ATOM 2536  H HE1  . TYR A 1 49  ? -0.091  -6.514  -1.686  1.00 0.00 ? 49  TYR A HE1  2  
ATOM 2537  H HE2  . TYR A 1 49  ? -2.057  -3.034  -3.181  1.00 0.00 ? 49  TYR A HE2  2  
ATOM 2538  H HH   . TYR A 1 49  ? -1.476  -6.127  -3.926  1.00 0.00 ? 49  TYR A HH   2  
ATOM 2539  N N    . VAL A 1 50  ? 3.195   0.186   -0.080  1.00 0.00 ? 50  VAL A N    2  
ATOM 2540  C CA   . VAL A 1 50  ? 3.870   1.235   0.674   1.00 0.00 ? 50  VAL A CA   2  
ATOM 2541  C C    . VAL A 1 50  ? 3.342   1.313   2.102   1.00 0.00 ? 50  VAL A C    2  
ATOM 2542  O O    . VAL A 1 50  ? 2.269   1.864   2.350   1.00 0.00 ? 50  VAL A O    2  
ATOM 2543  C CB   . VAL A 1 50  ? 3.701   2.609   0.000   1.00 0.00 ? 50  VAL A CB   2  
ATOM 2544  C CG1  . VAL A 1 50  ? 4.196   3.718   0.915   1.00 0.00 ? 50  VAL A CG1  2  
ATOM 2545  C CG2  . VAL A 1 50  ? 4.431   2.641   -1.334  1.00 0.00 ? 50  VAL A CG2  2  
ATOM 2546  H H    . VAL A 1 50  ? 2.448   0.425   -0.668  1.00 0.00 ? 50  VAL A H    2  
ATOM 2547  H HA   . VAL A 1 50  ? 4.924   0.999   0.703   1.00 0.00 ? 50  VAL A HA   2  
ATOM 2548  H HB   . VAL A 1 50  ? 2.649   2.769   -0.186  1.00 0.00 ? 50  VAL A HB   2  
ATOM 2549  H HG11 . VAL A 1 50  ? 4.967   4.283   0.412   1.00 0.00 ? 50  VAL A HG11 2  
ATOM 2550  H HG12 . VAL A 1 50  ? 3.374   4.372   1.166   1.00 0.00 ? 50  VAL A HG12 2  
ATOM 2551  H HG13 . VAL A 1 50  ? 4.600   3.285   1.819   1.00 0.00 ? 50  VAL A HG13 2  
ATOM 2552  H HG21 . VAL A 1 50  ? 4.727   3.656   -1.557  1.00 0.00 ? 50  VAL A HG21 2  
ATOM 2553  H HG22 . VAL A 1 50  ? 5.310   2.014   -1.279  1.00 0.00 ? 50  VAL A HG22 2  
ATOM 2554  H HG23 . VAL A 1 50  ? 3.778   2.276   -2.112  1.00 0.00 ? 50  VAL A HG23 2  
ATOM 2555  N N    . LYS A 1 51  ? 4.102   0.758   3.040   1.00 0.00 ? 51  LYS A N    2  
ATOM 2556  C CA   . LYS A 1 51  ? 3.712   0.765   4.445   1.00 0.00 ? 51  LYS A CA   2  
ATOM 2557  C C    . LYS A 1 51  ? 3.729   2.183   5.007   1.00 0.00 ? 51  LYS A C    2  
ATOM 2558  O O    . LYS A 1 51  ? 2.898   2.540   5.841   1.00 0.00 ? 51  LYS A O    2  
ATOM 2559  C CB   . LYS A 1 51  ? 4.649   -0.129  5.260   1.00 0.00 ? 51  LYS A CB   2  
ATOM 2560  C CG   . LYS A 1 51  ? 4.332   -0.149  6.745   1.00 0.00 ? 51  LYS A CG   2  
ATOM 2561  C CD   . LYS A 1 51  ? 3.252   -1.168  7.071   1.00 0.00 ? 51  LYS A CD   2  
ATOM 2562  C CE   . LYS A 1 51  ? 3.417   -1.724  8.477   1.00 0.00 ? 51  LYS A CE   2  
ATOM 2563  N NZ   . LYS A 1 51  ? 4.648   -2.553  8.605   1.00 0.00 ? 51  LYS A NZ   2  
ATOM 2564  H H    . LYS A 1 51  ? 4.947   0.333   2.780   1.00 0.00 ? 51  LYS A H    2  
ATOM 2565  H HA   . LYS A 1 51  ? 2.708   0.376   4.513   1.00 0.00 ? 51  LYS A HA   2  
ATOM 2566  H HB2  . LYS A 1 51  ? 4.580   -1.139  4.885   1.00 0.00 ? 51  LYS A HB2  2  
ATOM 2567  H HB3  . LYS A 1 51  ? 5.663   0.224   5.135   1.00 0.00 ? 51  LYS A HB3  2  
ATOM 2568  H HG2  . LYS A 1 51  ? 5.228   -0.403  7.292   1.00 0.00 ? 51  LYS A HG2  2  
ATOM 2569  H HG3  . LYS A 1 51  ? 3.990   0.832   7.044   1.00 0.00 ? 51  LYS A HG3  2  
ATOM 2570  H HD2  . LYS A 1 51  ? 2.286   -0.692  6.995   1.00 0.00 ? 51  LYS A HD2  2  
ATOM 2571  H HD3  . LYS A 1 51  ? 3.312   -1.981  6.362   1.00 0.00 ? 51  LYS A HD3  2  
ATOM 2572  H HE2  . LYS A 1 51  ? 3.474   -0.901  9.172   1.00 0.00 ? 51  LYS A HE2  2  
ATOM 2573  H HE3  . LYS A 1 51  ? 2.557   -2.334  8.711   1.00 0.00 ? 51  LYS A HE3  2  
ATOM 2574  H HZ1  . LYS A 1 51  ? 4.404   -3.563  8.567   1.00 0.00 ? 51  LYS A HZ1  2  
ATOM 2575  H HZ2  . LYS A 1 51  ? 5.119   -2.355  9.511   1.00 0.00 ? 51  LYS A HZ2  2  
ATOM 2576  H HZ3  . LYS A 1 51  ? 5.307   -2.336  7.830   1.00 0.00 ? 51  LYS A HZ3  2  
ATOM 2577  N N    . SER A 1 52  ? 4.680   2.987   4.543   1.00 0.00 ? 52  SER A N    2  
ATOM 2578  C CA   . SER A 1 52  ? 4.807   4.366   5.001   1.00 0.00 ? 52  SER A CA   2  
ATOM 2579  C C    . SER A 1 52  ? 5.704   5.170   4.065   1.00 0.00 ? 52  SER A C    2  
ATOM 2580  O O    . SER A 1 52  ? 6.293   4.625   3.131   1.00 0.00 ? 52  SER A O    2  
ATOM 2581  C CB   . SER A 1 52  ? 5.370   4.403   6.423   1.00 0.00 ? 52  SER A CB   2  
ATOM 2582  O OG   . SER A 1 52  ? 4.330   4.366   7.385   1.00 0.00 ? 52  SER A OG   2  
ATOM 2583  H H    . SER A 1 52  ? 5.314   2.644   3.878   1.00 0.00 ? 52  SER A H    2  
ATOM 2584  H HA   . SER A 1 52  ? 3.821   4.806   5.002   1.00 0.00 ? 52  SER A HA   2  
ATOM 2585  H HB2  . SER A 1 52  ? 6.015   3.551   6.575   1.00 0.00 ? 52  SER A HB2  2  
ATOM 2586  H HB3  . SER A 1 52  ? 5.938   5.313   6.559   1.00 0.00 ? 52  SER A HB3  2  
ATOM 2587  H HG   . SER A 1 52  ? 3.511   4.664   6.983   1.00 0.00 ? 52  SER A HG   2  
ATOM 2588  N N    . VAL A 1 53  ? 5.804   6.470   4.323   1.00 0.00 ? 53  VAL A N    2  
ATOM 2589  C CA   . VAL A 1 53  ? 6.629   7.350   3.505   1.00 0.00 ? 53  VAL A CA   2  
ATOM 2590  C C    . VAL A 1 53  ? 7.480   8.270   4.374   1.00 0.00 ? 53  VAL A C    2  
ATOM 2591  O O    . VAL A 1 53  ? 7.022   9.326   4.811   1.00 0.00 ? 53  VAL A O    2  
ATOM 2592  C CB   . VAL A 1 53  ? 5.769   8.208   2.558   1.00 0.00 ? 53  VAL A CB   2  
ATOM 2593  C CG1  . VAL A 1 53  ? 6.639   9.187   1.785   1.00 0.00 ? 53  VAL A CG1  2  
ATOM 2594  C CG2  . VAL A 1 53  ? 4.977   7.321   1.609   1.00 0.00 ? 53  VAL A CG2  2  
ATOM 2595  H H    . VAL A 1 53  ? 5.310   6.846   5.081   1.00 0.00 ? 53  VAL A H    2  
ATOM 2596  H HA   . VAL A 1 53  ? 7.282   6.733   2.904   1.00 0.00 ? 53  VAL A HA   2  
ATOM 2597  H HB   . VAL A 1 53  ? 5.070   8.775   3.155   1.00 0.00 ? 53  VAL A HB   2  
ATOM 2598  H HG11 . VAL A 1 53  ? 6.475   9.055   0.726   1.00 0.00 ? 53  VAL A HG11 2  
ATOM 2599  H HG12 . VAL A 1 53  ? 6.382   10.198  2.068   1.00 0.00 ? 53  VAL A HG12 2  
ATOM 2600  H HG13 . VAL A 1 53  ? 7.678   9.003   2.014   1.00 0.00 ? 53  VAL A HG13 2  
ATOM 2601  H HG21 . VAL A 1 53  ? 5.659   6.774   0.975   1.00 0.00 ? 53  VAL A HG21 2  
ATOM 2602  H HG22 . VAL A 1 53  ? 4.379   6.626   2.180   1.00 0.00 ? 53  VAL A HG22 2  
ATOM 2603  H HG23 . VAL A 1 53  ? 4.330   7.934   0.998   1.00 0.00 ? 53  VAL A HG23 2  
ATOM 2604  N N    . ILE A 1 54  ? 8.720   7.862   4.620   1.00 0.00 ? 54  ILE A N    2  
ATOM 2605  C CA   . ILE A 1 54  ? 9.636   8.650   5.436   1.00 0.00 ? 54  ILE A CA   2  
ATOM 2606  C C    . ILE A 1 54  ? 9.512   10.136  5.120   1.00 0.00 ? 54  ILE A C    2  
ATOM 2607  O O    . ILE A 1 54  ? 9.509   10.552  3.961   1.00 0.00 ? 54  ILE A O    2  
ATOM 2608  C CB   . ILE A 1 54  ? 11.097  8.211   5.225   1.00 0.00 ? 54  ILE A CB   2  
ATOM 2609  C CG1  . ILE A 1 54  ? 11.325  6.820   5.819   1.00 0.00 ? 54  ILE A CG1  2  
ATOM 2610  C CG2  . ILE A 1 54  ? 12.048  9.222   5.849   1.00 0.00 ? 54  ILE A CG2  2  
ATOM 2611  C CD1  . ILE A 1 54  ? 11.023  5.694   4.854   1.00 0.00 ? 54  ILE A CD1  2  
ATOM 2612  H H    . ILE A 1 54  ? 9.027   7.011   4.244   1.00 0.00 ? 54  ILE A H    2  
ATOM 2613  H HA   . ILE A 1 54  ? 9.379   8.490   6.473   1.00 0.00 ? 54  ILE A HA   2  
ATOM 2614  H HB   . ILE A 1 54  ? 11.290  8.178   4.164   1.00 0.00 ? 54  ILE A HB   2  
ATOM 2615  H HG12 . ILE A 1 54  ? 12.357  6.729   6.121   1.00 0.00 ? 54  ILE A HG12 2  
ATOM 2616  H HG13 . ILE A 1 54  ? 10.689  6.697   6.684   1.00 0.00 ? 54  ILE A HG13 2  
ATOM 2617  H HG21 . ILE A 1 54  ? 13.067  8.949   5.615   1.00 0.00 ? 54  ILE A HG21 2  
ATOM 2618  H HG22 . ILE A 1 54  ? 11.840  10.204  5.452   1.00 0.00 ? 54  ILE A HG22 2  
ATOM 2619  H HG23 . ILE A 1 54  ? 11.914  9.230   6.920   1.00 0.00 ? 54  ILE A HG23 2  
ATOM 2620  H HD11 . ILE A 1 54  ? 10.194  5.112   5.228   1.00 0.00 ? 54  ILE A HD11 2  
ATOM 2621  H HD12 . ILE A 1 54  ? 10.770  6.105   3.889   1.00 0.00 ? 54  ILE A HD12 2  
ATOM 2622  H HD13 . ILE A 1 54  ? 11.893  5.060   4.758   1.00 0.00 ? 54  ILE A HD13 2  
ATOM 2623  N N    . PRO A 1 55  ? 9.410   10.959  6.174   1.00 0.00 ? 55  PRO A N    2  
ATOM 2624  C CA   . PRO A 1 55  ? 9.287   12.413  6.035   1.00 0.00 ? 55  PRO A CA   2  
ATOM 2625  C C    . PRO A 1 55  ? 10.574  13.058  5.532   1.00 0.00 ? 55  PRO A C    2  
ATOM 2626  O O    . PRO A 1 55  ? 11.651  12.468  5.618   1.00 0.00 ? 55  PRO A O    2  
ATOM 2627  C CB   . PRO A 1 55  ? 8.976   12.880  7.459   1.00 0.00 ? 55  PRO A CB   2  
ATOM 2628  C CG   . PRO A 1 55  ? 9.552   11.825  8.339   1.00 0.00 ? 55  PRO A CG   2  
ATOM 2629  C CD   . PRO A 1 55  ? 9.408   10.533  7.584   1.00 0.00 ? 55  PRO A CD   2  
ATOM 2630  H HA   . PRO A 1 55  ? 8.472   12.681  5.380   1.00 0.00 ? 55  PRO A HA   2  
ATOM 2631  H HB2  . PRO A 1 55  ? 9.441   13.840  7.636   1.00 0.00 ? 55  PRO A HB2  2  
ATOM 2632  H HB3  . PRO A 1 55  ? 7.907   12.963  7.589   1.00 0.00 ? 55  PRO A HB3  2  
ATOM 2633  H HG2  . PRO A 1 55  ? 10.593  12.034  8.530   1.00 0.00 ? 55  PRO A HG2  2  
ATOM 2634  H HG3  . PRO A 1 55  ? 9.001   11.780  9.267   1.00 0.00 ? 55  PRO A HG3  2  
ATOM 2635  H HD2  . PRO A 1 55  ? 10.243  9.880   7.791   1.00 0.00 ? 55  PRO A HD2  2  
ATOM 2636  H HD3  . PRO A 1 55  ? 8.476   10.049  7.838   1.00 0.00 ? 55  PRO A HD3  2  
ATOM 2637  N N    . GLY A 1 56  ? 10.456  14.274  5.007   1.00 0.00 ? 56  GLY A N    2  
ATOM 2638  C CA   . GLY A 1 56  ? 11.618  14.979  4.499   1.00 0.00 ? 56  GLY A CA   2  
ATOM 2639  C C    . GLY A 1 56  ? 12.469  14.114  3.591   1.00 0.00 ? 56  GLY A C    2  
ATOM 2640  O O    . GLY A 1 56  ? 13.695  14.223  3.589   1.00 0.00 ? 56  GLY A O    2  
ATOM 2641  H H    . GLY A 1 56  ? 9.572   14.695  4.965   1.00 0.00 ? 56  GLY A H    2  
ATOM 2642  H HA2  . GLY A 1 56  ? 11.286  15.845  3.946   1.00 0.00 ? 56  GLY A HA2  2  
ATOM 2643  H HA3  . GLY A 1 56  ? 12.220  15.305  5.334   1.00 0.00 ? 56  GLY A HA3  2  
ATOM 2644  N N    . SER A 1 57  ? 11.818  13.250  2.818   1.00 0.00 ? 57  SER A N    2  
ATOM 2645  C CA   . SER A 1 57  ? 12.524  12.359  1.905   1.00 0.00 ? 57  SER A CA   2  
ATOM 2646  C C    . SER A 1 57  ? 12.127  12.637  0.458   1.00 0.00 ? 57  SER A C    2  
ATOM 2647  O O    . SER A 1 57  ? 11.251  13.459  0.191   1.00 0.00 ? 57  SER A O    2  
ATOM 2648  C CB   . SER A 1 57  ? 12.230  10.899  2.254   1.00 0.00 ? 57  SER A CB   2  
ATOM 2649  O OG   . SER A 1 57  ? 10.909  10.542  1.883   1.00 0.00 ? 57  SER A OG   2  
ATOM 2650  H H    . SER A 1 57  ? 10.840  13.211  2.864   1.00 0.00 ? 57  SER A H    2  
ATOM 2651  H HA   . SER A 1 57  ? 13.583  12.540  2.017   1.00 0.00 ? 57  SER A HA   2  
ATOM 2652  H HB2  . SER A 1 57  ? 12.923  10.259  1.731   1.00 0.00 ? 57  SER A HB2  2  
ATOM 2653  H HB3  . SER A 1 57  ? 12.342  10.757  3.320   1.00 0.00 ? 57  SER A HB3  2  
ATOM 2654  H HG   . SER A 1 57  ? 10.285  11.133  2.310   1.00 0.00 ? 57  SER A HG   2  
ATOM 2655  N N    . ALA A 1 58  ? 12.779  11.946  -0.471  1.00 0.00 ? 58  ALA A N    2  
ATOM 2656  C CA   . ALA A 1 58  ? 12.494  12.117  -1.890  1.00 0.00 ? 58  ALA A CA   2  
ATOM 2657  C C    . ALA A 1 58  ? 11.019  11.869  -2.188  1.00 0.00 ? 58  ALA A C    2  
ATOM 2658  O O    . ALA A 1 58  ? 10.333  12.731  -2.735  1.00 0.00 ? 58  ALA A O    2  
ATOM 2659  C CB   . ALA A 1 58  ? 13.366  11.185  -2.719  1.00 0.00 ? 58  ALA A CB   2  
ATOM 2660  H H    . ALA A 1 58  ? 13.468  11.306  -0.195  1.00 0.00 ? 58  ALA A H    2  
ATOM 2661  H HA   . ALA A 1 58  ? 12.739  13.134  -2.160  1.00 0.00 ? 58  ALA A HA   2  
ATOM 2662  H HB1  . ALA A 1 58  ? 14.391  11.525  -2.682  1.00 0.00 ? 58  ALA A HB1  2  
ATOM 2663  H HB2  . ALA A 1 58  ? 13.303  10.184  -2.320  1.00 0.00 ? 58  ALA A HB2  2  
ATOM 2664  H HB3  . ALA A 1 58  ? 13.023  11.187  -3.743  1.00 0.00 ? 58  ALA A HB3  2  
ATOM 2665  N N    . ALA A 1 59  ? 10.539  10.684  -1.824  1.00 0.00 ? 59  ALA A N    2  
ATOM 2666  C CA   . ALA A 1 59  ? 9.145   10.323  -2.051  1.00 0.00 ? 59  ALA A CA   2  
ATOM 2667  C C    . ALA A 1 59  ? 8.205   11.396  -1.510  1.00 0.00 ? 59  ALA A C    2  
ATOM 2668  O O    . ALA A 1 59  ? 7.231   11.769  -2.165  1.00 0.00 ? 59  ALA A O    2  
ATOM 2669  C CB   . ALA A 1 59  ? 8.837   8.978   -1.411  1.00 0.00 ? 59  ALA A CB   2  
ATOM 2670  H H    . ALA A 1 59  ? 11.135  10.038  -1.392  1.00 0.00 ? 59  ALA A H    2  
ATOM 2671  H HA   . ALA A 1 59  ? 8.993   10.231  -3.117  1.00 0.00 ? 59  ALA A HA   2  
ATOM 2672  H HB1  . ALA A 1 59  ? 9.609   8.736   -0.695  1.00 0.00 ? 59  ALA A HB1  2  
ATOM 2673  H HB2  . ALA A 1 59  ? 7.882   9.028   -0.909  1.00 0.00 ? 59  ALA A HB2  2  
ATOM 2674  H HB3  . ALA A 1 59  ? 8.803   8.215   -2.175  1.00 0.00 ? 59  ALA A HB3  2  
ATOM 2675  N N    . TYR A 1 60  ? 8.502   11.887  -0.312  1.00 0.00 ? 60  TYR A N    2  
ATOM 2676  C CA   . TYR A 1 60  ? 7.682   12.914  0.318   1.00 0.00 ? 60  TYR A CA   2  
ATOM 2677  C C    . TYR A 1 60  ? 7.751   14.222  -0.464  1.00 0.00 ? 60  TYR A C    2  
ATOM 2678  O O    . TYR A 1 60  ? 6.727   14.845  -0.748  1.00 0.00 ? 60  TYR A O    2  
ATOM 2679  C CB   . TYR A 1 60  ? 8.136   13.145  1.760   1.00 0.00 ? 60  TYR A CB   2  
ATOM 2680  C CG   . TYR A 1 60  ? 7.420   14.288  2.444   1.00 0.00 ? 60  TYR A CG   2  
ATOM 2681  C CD1  . TYR A 1 60  ? 7.855   15.598  2.287   1.00 0.00 ? 60  TYR A CD1  2  
ATOM 2682  C CD2  . TYR A 1 60  ? 6.311   14.058  3.248   1.00 0.00 ? 60  TYR A CD2  2  
ATOM 2683  C CE1  . TYR A 1 60  ? 7.205   16.646  2.911   1.00 0.00 ? 60  TYR A CE1  2  
ATOM 2684  C CE2  . TYR A 1 60  ? 5.654   15.099  3.874   1.00 0.00 ? 60  TYR A CE2  2  
ATOM 2685  C CZ   . TYR A 1 60  ? 6.105   16.392  3.703   1.00 0.00 ? 60  TYR A CZ   2  
ATOM 2686  O OH   . TYR A 1 60  ? 5.454   17.432  4.326   1.00 0.00 ? 60  TYR A OH   2  
ATOM 2687  H H    . TYR A 1 60  ? 9.292   11.549  0.160   1.00 0.00 ? 60  TYR A H    2  
ATOM 2688  H HA   . TYR A 1 60  ? 6.660   12.565  0.324   1.00 0.00 ? 60  TYR A HA   2  
ATOM 2689  H HB2  . TYR A 1 60  ? 7.954   12.250  2.335   1.00 0.00 ? 60  TYR A HB2  2  
ATOM 2690  H HB3  . TYR A 1 60  ? 9.193   13.363  1.767   1.00 0.00 ? 60  TYR A HB3  2  
ATOM 2691  H HD1  . TYR A 1 60  ? 8.717   15.795  1.666   1.00 0.00 ? 60  TYR A HD1  2  
ATOM 2692  H HD2  . TYR A 1 60  ? 5.960   13.044  3.381   1.00 0.00 ? 60  TYR A HD2  2  
ATOM 2693  H HE1  . TYR A 1 60  ? 7.558   17.658  2.777   1.00 0.00 ? 60  TYR A HE1  2  
ATOM 2694  H HE2  . TYR A 1 60  ? 4.793   14.900  4.495   1.00 0.00 ? 60  TYR A HE2  2  
ATOM 2695  H HH   . TYR A 1 60  ? 6.096   18.089  4.604   1.00 0.00 ? 60  TYR A HH   2  
ATOM 2696  N N    . HIS A 1 61  ? 8.967   14.633  -0.811  1.00 0.00 ? 61  HIS A N    2  
ATOM 2697  C CA   . HIS A 1 61  ? 9.172   15.866  -1.562  1.00 0.00 ? 61  HIS A CA   2  
ATOM 2698  C C    . HIS A 1 61  ? 8.384   15.844  -2.869  1.00 0.00 ? 61  HIS A C    2  
ATOM 2699  O O    . HIS A 1 61  ? 7.681   16.799  -3.196  1.00 0.00 ? 61  HIS A O    2  
ATOM 2700  C CB   . HIS A 1 61  ? 10.659  16.070  -1.854  1.00 0.00 ? 61  HIS A CB   2  
ATOM 2701  C CG   . HIS A 1 61  ? 11.405  16.724  -0.732  1.00 0.00 ? 61  HIS A CG   2  
ATOM 2702  N ND1  . HIS A 1 61  ? 10.911  17.802  -0.027  1.00 0.00 ? 61  HIS A ND1  2  
ATOM 2703  C CD2  . HIS A 1 61  ? 12.614  16.446  -0.192  1.00 0.00 ? 61  HIS A CD2  2  
ATOM 2704  C CE1  . HIS A 1 61  ? 11.786  18.160  0.896   1.00 0.00 ? 61  HIS A CE1  2  
ATOM 2705  N NE2  . HIS A 1 61  ? 12.828  17.352  0.818   1.00 0.00 ? 61  HIS A NE2  2  
ATOM 2706  H H    . HIS A 1 61  ? 9.744   14.094  -0.557  1.00 0.00 ? 61  HIS A H    2  
ATOM 2707  H HA   . HIS A 1 61  ? 8.817   16.686  -0.956  1.00 0.00 ? 61  HIS A HA   2  
ATOM 2708  H HB2  . HIS A 1 61  ? 11.117  15.110  -2.040  1.00 0.00 ? 61  HIS A HB2  2  
ATOM 2709  H HB3  . HIS A 1 61  ? 10.765  16.692  -2.731  1.00 0.00 ? 61  HIS A HB3  2  
ATOM 2710  H HD1  . HIS A 1 61  ? 10.049  18.241  -0.183  1.00 0.00 ? 61  HIS A HD1  2  
ATOM 2711  H HD2  . HIS A 1 61  ? 13.288  15.657  -0.498  1.00 0.00 ? 61  HIS A HD2  2  
ATOM 2712  H HE1  . HIS A 1 61  ? 11.669  18.973  1.596   1.00 0.00 ? 61  HIS A HE1  2  
ATOM 2713  H HE2  . HIS A 1 61  ? 13.657  17.450  1.330   1.00 0.00 ? 61  HIS A HE2  2  
ATOM 2714  N N    . ASN A 1 62  ? 8.508   14.748  -3.610  1.00 0.00 ? 62  ASN A N    2  
ATOM 2715  C CA   . ASN A 1 62  ? 7.808   14.603  -4.882  1.00 0.00 ? 62  ASN A CA   2  
ATOM 2716  C C    . ASN A 1 62  ? 6.298   14.712  -4.687  1.00 0.00 ? 62  ASN A C    2  
ATOM 2717  O O    . ASN A 1 62  ? 5.617   15.424  -5.423  1.00 0.00 ? 62  ASN A O    2  
ATOM 2718  C CB   . ASN A 1 62  ? 8.155   13.260  -5.528  1.00 0.00 ? 62  ASN A CB   2  
ATOM 2719  C CG   . ASN A 1 62  ? 8.122   13.322  -7.043  1.00 0.00 ? 62  ASN A CG   2  
ATOM 2720  O OD1  . ASN A 1 62  ? 8.600   14.283  -7.646  1.00 0.00 ? 62  ASN A OD1  2  
ATOM 2721  N ND2  . ASN A 1 62  ? 7.557   12.294  -7.665  1.00 0.00 ? 62  ASN A ND2  2  
ATOM 2722  H H    . ASN A 1 62  ? 9.083   14.020  -3.296  1.00 0.00 ? 62  ASN A H    2  
ATOM 2723  H HA   . ASN A 1 62  ? 8.134   15.400  -5.532  1.00 0.00 ? 62  ASN A HA   2  
ATOM 2724  H HB2  . ASN A 1 62  ? 9.148   12.966  -5.220  1.00 0.00 ? 62  ASN A HB2  2  
ATOM 2725  H HB3  . ASN A 1 62  ? 7.445   12.515  -5.200  1.00 0.00 ? 62  ASN A HB3  2  
ATOM 2726  H HD21 . ASN A 1 62  ? 7.197   11.563  -7.119  1.00 0.00 ? 62  ASN A HD21 2  
ATOM 2727  H HD22 . ASN A 1 62  ? 7.523   12.308  -8.644  1.00 0.00 ? 62  ASN A HD22 2  
ATOM 2728  N N    . GLY A 1 63  ? 5.783   13.999  -3.690  1.00 0.00 ? 63  GLY A N    2  
ATOM 2729  C CA   . GLY A 1 63  ? 4.358   14.029  -3.416  1.00 0.00 ? 63  GLY A CA   2  
ATOM 2730  C C    . GLY A 1 63  ? 3.555   13.241  -4.433  1.00 0.00 ? 63  GLY A C    2  
ATOM 2731  O O    . GLY A 1 63  ? 2.432   13.615  -4.772  1.00 0.00 ? 63  GLY A O    2  
ATOM 2732  H H    . GLY A 1 63  ? 6.375   13.448  -3.136  1.00 0.00 ? 63  GLY A H    2  
ATOM 2733  H HA2  . GLY A 1 63  ? 4.182   13.615  -2.435  1.00 0.00 ? 63  GLY A HA2  2  
ATOM 2734  H HA3  . GLY A 1 63  ? 4.022   15.056  -3.428  1.00 0.00 ? 63  GLY A HA3  2  
ATOM 2735  N N    . HIS A 1 64  ? 4.133   12.149  -4.922  1.00 0.00 ? 64  HIS A N    2  
ATOM 2736  C CA   . HIS A 1 64  ? 3.464   11.306  -5.907  1.00 0.00 ? 64  HIS A CA   2  
ATOM 2737  C C    . HIS A 1 64  ? 3.218   9.908   -5.349  1.00 0.00 ? 64  HIS A C    2  
ATOM 2738  O O    . HIS A 1 64  ? 2.168   9.311   -5.586  1.00 0.00 ? 64  HIS A O    2  
ATOM 2739  C CB   . HIS A 1 64  ? 4.298   11.219  -7.185  1.00 0.00 ? 64  HIS A CB   2  
ATOM 2740  C CG   . HIS A 1 64  ? 4.081   12.366  -8.123  1.00 0.00 ? 64  HIS A CG   2  
ATOM 2741  N ND1  . HIS A 1 64  ? 3.798   12.201  -9.462  1.00 0.00 ? 64  HIS A ND1  2  
ATOM 2742  C CD2  . HIS A 1 64  ? 4.105   13.702  -7.907  1.00 0.00 ? 64  HIS A CD2  2  
ATOM 2743  C CE1  . HIS A 1 64  ? 3.658   13.386  -10.030 1.00 0.00 ? 64  HIS A CE1  2  
ATOM 2744  N NE2  . HIS A 1 64  ? 3.839   14.314  -9.107  1.00 0.00 ? 64  HIS A NE2  2  
ATOM 2745  H H    . HIS A 1 64  ? 5.029   11.903  -4.613  1.00 0.00 ? 64  HIS A H    2  
ATOM 2746  H HA   . HIS A 1 64  ? 2.512   11.760  -6.139  1.00 0.00 ? 64  HIS A HA   2  
ATOM 2747  H HB2  . HIS A 1 64  ? 5.346   11.200  -6.922  1.00 0.00 ? 64  HIS A HB2  2  
ATOM 2748  H HB3  . HIS A 1 64  ? 4.047   10.308  -7.710  1.00 0.00 ? 64  HIS A HB3  2  
ATOM 2749  H HD1  . HIS A 1 64  ? 3.713   11.343  -9.927  1.00 0.00 ? 64  HIS A HD1  2  
ATOM 2750  H HD2  . HIS A 1 64  ? 4.297   14.197  -6.965  1.00 0.00 ? 64  HIS A HD2  2  
ATOM 2751  H HE1  . HIS A 1 64  ? 3.434   13.565  -11.070 1.00 0.00 ? 64  HIS A HE1  2  
ATOM 2752  H HE2  . HIS A 1 64  ? 3.876   15.278  -9.277  1.00 0.00 ? 64  HIS A HE2  2  
ATOM 2753  N N    . ILE A 1 65  ? 4.193   9.392   -4.608  1.00 0.00 ? 65  ILE A N    2  
ATOM 2754  C CA   . ILE A 1 65  ? 4.082   8.065   -4.017  1.00 0.00 ? 65  ILE A CA   2  
ATOM 2755  C C    . ILE A 1 65  ? 3.593   8.145   -2.575  1.00 0.00 ? 65  ILE A C    2  
ATOM 2756  O O    . ILE A 1 65  ? 4.145   8.886   -1.762  1.00 0.00 ? 65  ILE A O    2  
ATOM 2757  C CB   . ILE A 1 65  ? 5.429   7.319   -4.049  1.00 0.00 ? 65  ILE A CB   2  
ATOM 2758  C CG1  . ILE A 1 65  ? 5.885   7.107   -5.494  1.00 0.00 ? 65  ILE A CG1  2  
ATOM 2759  C CG2  . ILE A 1 65  ? 5.315   5.987   -3.323  1.00 0.00 ? 65  ILE A CG2  2  
ATOM 2760  C CD1  . ILE A 1 65  ? 7.389   7.067   -5.654  1.00 0.00 ? 65  ILE A CD1  2  
ATOM 2761  H H    . ILE A 1 65  ? 5.006   9.917   -4.455  1.00 0.00 ? 65  ILE A H    2  
ATOM 2762  H HA   . ILE A 1 65  ? 3.367   7.500   -4.598  1.00 0.00 ? 65  ILE A HA   2  
ATOM 2763  H HB   . ILE A 1 65  ? 6.161   7.921   -3.533  1.00 0.00 ? 65  ILE A HB   2  
ATOM 2764  H HG12 . ILE A 1 65  ? 5.488   6.172   -5.857  1.00 0.00 ? 65  ILE A HG12 2  
ATOM 2765  H HG13 . ILE A 1 65  ? 5.507   7.914   -6.105  1.00 0.00 ? 65  ILE A HG13 2  
ATOM 2766  H HG21 . ILE A 1 65  ? 5.655   6.102   -2.305  1.00 0.00 ? 65  ILE A HG21 2  
ATOM 2767  H HG22 . ILE A 1 65  ? 4.285   5.665   -3.323  1.00 0.00 ? 65  ILE A HG22 2  
ATOM 2768  H HG23 . ILE A 1 65  ? 5.924   5.250   -3.825  1.00 0.00 ? 65  ILE A HG23 2  
ATOM 2769  H HD11 . ILE A 1 65  ? 7.806   8.023   -5.377  1.00 0.00 ? 65  ILE A HD11 2  
ATOM 2770  H HD12 . ILE A 1 65  ? 7.798   6.295   -5.020  1.00 0.00 ? 65  ILE A HD12 2  
ATOM 2771  H HD13 . ILE A 1 65  ? 7.635   6.853   -6.685  1.00 0.00 ? 65  ILE A HD13 2  
ATOM 2772  N N    . GLN A 1 66  ? 2.555   7.375   -2.264  1.00 0.00 ? 66  GLN A N    2  
ATOM 2773  C CA   . GLN A 1 66  ? 1.992   7.358   -0.919  1.00 0.00 ? 66  GLN A CA   2  
ATOM 2774  C C    . GLN A 1 66  ? 1.522   5.957   -0.543  1.00 0.00 ? 66  GLN A C    2  
ATOM 2775  O O    . GLN A 1 66  ? 1.512   5.050   -1.376  1.00 0.00 ? 66  GLN A O    2  
ATOM 2776  C CB   . GLN A 1 66  ? 0.827   8.344   -0.819  1.00 0.00 ? 66  GLN A CB   2  
ATOM 2777  C CG   . GLN A 1 66  ? 1.126   9.703   -1.430  1.00 0.00 ? 66  GLN A CG   2  
ATOM 2778  C CD   . GLN A 1 66  ? 0.750   9.780   -2.896  1.00 0.00 ? 66  GLN A CD   2  
ATOM 2779  O OE1  . GLN A 1 66  ? 0.079   8.892   -3.424  1.00 0.00 ? 66  GLN A OE1  2  
ATOM 2780  N NE2  . GLN A 1 66  ? 1.180   10.844  -3.563  1.00 0.00 ? 66  GLN A NE2  2  
ATOM 2781  H H    . GLN A 1 66  ? 2.158   6.806   -2.955  1.00 0.00 ? 66  GLN A H    2  
ATOM 2782  H HA   . GLN A 1 66  ? 2.767   7.660   -0.232  1.00 0.00 ? 66  GLN A HA   2  
ATOM 2783  H HB2  . GLN A 1 66  ? -0.029  7.925   -1.327  1.00 0.00 ? 66  GLN A HB2  2  
ATOM 2784  H HB3  . GLN A 1 66  ? 0.582   8.488   0.223   1.00 0.00 ? 66  GLN A HB3  2  
ATOM 2785  H HG2  . GLN A 1 66  ? 0.568   10.456  -0.892  1.00 0.00 ? 66  GLN A HG2  2  
ATOM 2786  H HG3  . GLN A 1 66  ? 2.183   9.902   -1.333  1.00 0.00 ? 66  GLN A HG3  2  
ATOM 2787  H HE21 . GLN A 1 66  ? 1.711   11.510  -3.078  1.00 0.00 ? 66  GLN A HE21 2  
ATOM 2788  H HE22 . GLN A 1 66  ? 0.953   10.918  -4.513  1.00 0.00 ? 66  GLN A HE22 2  
ATOM 2789  N N    . VAL A 1 67  ? 1.132   5.787   0.716   1.00 0.00 ? 67  VAL A N    2  
ATOM 2790  C CA   . VAL A 1 67  ? 0.660   4.496   1.203   1.00 0.00 ? 67  VAL A CA   2  
ATOM 2791  C C    . VAL A 1 67  ? -0.556  4.023   0.415   1.00 0.00 ? 67  VAL A C    2  
ATOM 2792  O O    . VAL A 1 67  ? -1.096  4.757   -0.412  1.00 0.00 ? 67  VAL A O    2  
ATOM 2793  C CB   . VAL A 1 67  ? 0.297   4.558   2.698   1.00 0.00 ? 67  VAL A CB   2  
ATOM 2794  C CG1  . VAL A 1 67  ? 1.533   4.845   3.537   1.00 0.00 ? 67  VAL A CG1  2  
ATOM 2795  C CG2  . VAL A 1 67  ? -0.778  5.607   2.942   1.00 0.00 ? 67  VAL A CG2  2  
ATOM 2796  H H    . VAL A 1 67  ? 1.163   6.548   1.333   1.00 0.00 ? 67  VAL A H    2  
ATOM 2797  H HA   . VAL A 1 67  ? 1.459   3.779   1.077   1.00 0.00 ? 67  VAL A HA   2  
ATOM 2798  H HB   . VAL A 1 67  ? -0.096  3.596   2.993   1.00 0.00 ? 67  VAL A HB   2  
ATOM 2799  H HG11 . VAL A 1 67  ? 1.280   5.539   4.325   1.00 0.00 ? 67  VAL A HG11 2  
ATOM 2800  H HG12 . VAL A 1 67  ? 1.897   3.924   3.969   1.00 0.00 ? 67  VAL A HG12 2  
ATOM 2801  H HG13 . VAL A 1 67  ? 2.300   5.277   2.911   1.00 0.00 ? 67  VAL A HG13 2  
ATOM 2802  H HG21 . VAL A 1 67  ? -0.459  6.551   2.526   1.00 0.00 ? 67  VAL A HG21 2  
ATOM 2803  H HG22 . VAL A 1 67  ? -1.698  5.298   2.467   1.00 0.00 ? 67  VAL A HG22 2  
ATOM 2804  H HG23 . VAL A 1 67  ? -0.940  5.718   4.003   1.00 0.00 ? 67  VAL A HG23 2  
ATOM 2805  N N    . ASN A 1 68  ? -0.983  2.792   0.677   1.00 0.00 ? 68  ASN A N    2  
ATOM 2806  C CA   . ASN A 1 68  ? -2.137  2.221   -0.008  1.00 0.00 ? 68  ASN A CA   2  
ATOM 2807  C C    . ASN A 1 68  ? -1.876  2.103   -1.506  1.00 0.00 ? 68  ASN A C    2  
ATOM 2808  O O    . ASN A 1 68  ? -2.784  2.278   -2.320  1.00 0.00 ? 68  ASN A O    2  
ATOM 2809  C CB   . ASN A 1 68  ? -3.379  3.078   0.240   1.00 0.00 ? 68  ASN A CB   2  
ATOM 2810  C CG   . ASN A 1 68  ? -3.416  3.652   1.643   1.00 0.00 ? 68  ASN A CG   2  
ATOM 2811  O OD1  . ASN A 1 68  ? -3.081  2.972   2.613   1.00 0.00 ? 68  ASN A OD1  2  
ATOM 2812  N ND2  . ASN A 1 68  ? -3.823  4.911   1.757   1.00 0.00 ? 68  ASN A ND2  2  
ATOM 2813  H H    . ASN A 1 68  ? -0.511  2.255   1.347   1.00 0.00 ? 68  ASN A H    2  
ATOM 2814  H HA   . ASN A 1 68  ? -2.306  1.233   0.395   1.00 0.00 ? 68  ASN A HA   2  
ATOM 2815  H HB2  . ASN A 1 68  ? -3.390  3.898   -0.464  1.00 0.00 ? 68  ASN A HB2  2  
ATOM 2816  H HB3  . ASN A 1 68  ? -4.262  2.473   0.095   1.00 0.00 ? 68  ASN A HB3  2  
ATOM 2817  H HD21 . ASN A 1 68  ? -4.074  5.392   0.941   1.00 0.00 ? 68  ASN A HD21 2  
ATOM 2818  H HD22 . ASN A 1 68  ? -3.855  5.308   2.652   1.00 0.00 ? 68  ASN A HD22 2  
ATOM 2819  N N    . ASP A 1 69  ? -0.632  1.806   -1.863  1.00 0.00 ? 69  ASP A N    2  
ATOM 2820  C CA   . ASP A 1 69  ? -0.252  1.664   -3.264  1.00 0.00 ? 69  ASP A CA   2  
ATOM 2821  C C    . ASP A 1 69  ? 0.541   0.379   -3.484  1.00 0.00 ? 69  ASP A C    2  
ATOM 2822  O O    . ASP A 1 69  ? 1.210   -0.114  -2.575  1.00 0.00 ? 69  ASP A O    2  
ATOM 2823  C CB   . ASP A 1 69  ? 0.572   2.870   -3.716  1.00 0.00 ? 69  ASP A CB   2  
ATOM 2824  C CG   . ASP A 1 69  ? -0.295  4.013   -4.207  1.00 0.00 ? 69  ASP A CG   2  
ATOM 2825  O OD1  . ASP A 1 69  ? -1.302  4.324   -3.536  1.00 0.00 ? 69  ASP A OD1  2  
ATOM 2826  O OD2  . ASP A 1 69  ? 0.034   4.596   -5.260  1.00 0.00 ? 69  ASP A OD2  2  
ATOM 2827  H H    . ASP A 1 69  ? 0.047   1.679   -1.168  1.00 0.00 ? 69  ASP A H    2  
ATOM 2828  H HA   . ASP A 1 69  ? -1.157  1.618   -3.850  1.00 0.00 ? 69  ASP A HA   2  
ATOM 2829  H HB2  . ASP A 1 69  ? 1.166   3.224   -2.886  1.00 0.00 ? 69  ASP A HB2  2  
ATOM 2830  H HB3  . ASP A 1 69  ? 1.228   2.569   -4.520  1.00 0.00 ? 69  ASP A HB3  2  
ATOM 2831  N N    . LYS A 1 70  ? 0.461   -0.159  -4.696  1.00 0.00 ? 70  LYS A N    2  
ATOM 2832  C CA   . LYS A 1 70  ? 1.171   -1.387  -5.037  1.00 0.00 ? 70  LYS A CA   2  
ATOM 2833  C C    . LYS A 1 70  ? 2.260   -1.116  -6.070  1.00 0.00 ? 70  LYS A C    2  
ATOM 2834  O O    . LYS A 1 70  ? 2.002   -0.516  -7.114  1.00 0.00 ? 70  LYS A O    2  
ATOM 2835  C CB   . LYS A 1 70  ? 0.192   -2.434  -5.573  1.00 0.00 ? 70  LYS A CB   2  
ATOM 2836  C CG   . LYS A 1 70  ? 0.609   -3.864  -5.278  1.00 0.00 ? 70  LYS A CG   2  
ATOM 2837  C CD   . LYS A 1 70  ? -0.021  -4.842  -6.255  1.00 0.00 ? 70  LYS A CD   2  
ATOM 2838  C CE   . LYS A 1 70  ? 0.863   -5.060  -7.473  1.00 0.00 ? 70  LYS A CE   2  
ATOM 2839  N NZ   . LYS A 1 70  ? 2.004   -5.969  -7.175  1.00 0.00 ? 70  LYS A NZ   2  
ATOM 2840  H H    . LYS A 1 70  ? -0.088  0.280   -5.379  1.00 0.00 ? 70  LYS A H    2  
ATOM 2841  H HA   . LYS A 1 70  ? 1.632   -1.765  -4.137  1.00 0.00 ? 70  LYS A HA   2  
ATOM 2842  H HB2  . LYS A 1 70  ? -0.777  -2.264  -5.128  1.00 0.00 ? 70  LYS A HB2  2  
ATOM 2843  H HB3  . LYS A 1 70  ? 0.112   -2.319  -6.645  1.00 0.00 ? 70  LYS A HB3  2  
ATOM 2844  H HG2  . LYS A 1 70  ? 1.684   -3.939  -5.353  1.00 0.00 ? 70  LYS A HG2  2  
ATOM 2845  H HG3  . LYS A 1 70  ? 0.298   -4.120  -4.275  1.00 0.00 ? 70  LYS A HG3  2  
ATOM 2846  H HD2  . LYS A 1 70  ? -0.169  -5.789  -5.758  1.00 0.00 ? 70  LYS A HD2  2  
ATOM 2847  H HD3  . LYS A 1 70  ? -0.975  -4.450  -6.578  1.00 0.00 ? 70  LYS A HD3  2  
ATOM 2848  H HE2  . LYS A 1 70  ? 0.266   -5.493  -8.262  1.00 0.00 ? 70  LYS A HE2  2  
ATOM 2849  H HE3  . LYS A 1 70  ? 1.249   -4.105  -7.797  1.00 0.00 ? 70  LYS A HE3  2  
ATOM 2850  H HZ1  . LYS A 1 70  ? 1.651   -6.894  -6.859  1.00 0.00 ? 70  LYS A HZ1  2  
ATOM 2851  H HZ2  . LYS A 1 70  ? 2.598   -5.562  -6.424  1.00 0.00 ? 70  LYS A HZ2  2  
ATOM 2852  H HZ3  . LYS A 1 70  ? 2.586   -6.104  -8.027  1.00 0.00 ? 70  LYS A HZ3  2  
ATOM 2853  N N    . ILE A 1 71  ? 3.475   -1.565  -5.774  1.00 0.00 ? 71  ILE A N    2  
ATOM 2854  C CA   . ILE A 1 71  ? 4.601   -1.373  -6.679  1.00 0.00 ? 71  ILE A CA   2  
ATOM 2855  C C    . ILE A 1 71  ? 4.827   -2.608  -7.545  1.00 0.00 ? 71  ILE A C    2  
ATOM 2856  O O    . ILE A 1 71  ? 4.920   -3.727  -7.039  1.00 0.00 ? 71  ILE A O    2  
ATOM 2857  C CB   . ILE A 1 71  ? 5.896   -1.058  -5.907  1.00 0.00 ? 71  ILE A CB   2  
ATOM 2858  C CG1  . ILE A 1 71  ? 5.809   0.330   -5.268  1.00 0.00 ? 71  ILE A CG1  2  
ATOM 2859  C CG2  . ILE A 1 71  ? 7.100   -1.146  -6.834  1.00 0.00 ? 71  ILE A CG2  2  
ATOM 2860  C CD1  . ILE A 1 71  ? 5.207   0.319   -3.881  1.00 0.00 ? 71  ILE A CD1  2  
ATOM 2861  H H    . ILE A 1 71  ? 3.617   -2.037  -4.927  1.00 0.00 ? 71  ILE A H    2  
ATOM 2862  H HA   . ILE A 1 71  ? 4.374   -0.534  -7.320  1.00 0.00 ? 71  ILE A HA   2  
ATOM 2863  H HB   . ILE A 1 71  ? 6.015   -1.798  -5.131  1.00 0.00 ? 71  ILE A HB   2  
ATOM 2864  H HG12 . ILE A 1 71  ? 6.801   0.748   -5.196  1.00 0.00 ? 71  ILE A HG12 2  
ATOM 2865  H HG13 . ILE A 1 71  ? 5.199   0.967   -5.891  1.00 0.00 ? 71  ILE A HG13 2  
ATOM 2866  H HG21 . ILE A 1 71  ? 7.127   -2.122  -7.296  1.00 0.00 ? 71  ILE A HG21 2  
ATOM 2867  H HG22 . ILE A 1 71  ? 7.020   -0.388  -7.599  1.00 0.00 ? 71  ILE A HG22 2  
ATOM 2868  H HG23 . ILE A 1 71  ? 8.004   -0.991  -6.266  1.00 0.00 ? 71  ILE A HG23 2  
ATOM 2869  H HD11 . ILE A 1 71  ? 4.686   -0.613  -3.721  1.00 0.00 ? 71  ILE A HD11 2  
ATOM 2870  H HD12 . ILE A 1 71  ? 5.991   0.424   -3.146  1.00 0.00 ? 71  ILE A HD12 2  
ATOM 2871  H HD13 . ILE A 1 71  ? 4.511   1.140   -3.784  1.00 0.00 ? 71  ILE A HD13 2  
ATOM 2872  N N    . VAL A 1 72  ? 4.916   -2.398  -8.854  1.00 0.00 ? 72  VAL A N    2  
ATOM 2873  C CA   . VAL A 1 72  ? 5.134   -3.493  -9.792  1.00 0.00 ? 72  VAL A CA   2  
ATOM 2874  C C    . VAL A 1 72  ? 6.548   -3.456  -10.361 1.00 0.00 ? 72  VAL A C    2  
ATOM 2875  O O    . VAL A 1 72  ? 7.066   -4.470  -10.829 1.00 0.00 ? 72  VAL A O    2  
ATOM 2876  C CB   . VAL A 1 72  ? 4.124   -3.447  -10.953 1.00 0.00 ? 72  VAL A CB   2  
ATOM 2877  C CG1  . VAL A 1 72  ? 2.756   -3.926  -10.491 1.00 0.00 ? 72  VAL A CG1  2  
ATOM 2878  C CG2  . VAL A 1 72  ? 4.039   -2.042  -11.530 1.00 0.00 ? 72  VAL A CG2  2  
ATOM 2879  H H    . VAL A 1 72  ? 4.834   -1.484  -9.198  1.00 0.00 ? 72  VAL A H    2  
ATOM 2880  H HA   . VAL A 1 72  ? 4.995   -4.422  -9.258  1.00 0.00 ? 72  VAL A HA   2  
ATOM 2881  H HB   . VAL A 1 72  ? 4.469   -4.113  -11.731 1.00 0.00 ? 72  VAL A HB   2  
ATOM 2882  H HG11 . VAL A 1 72  ? 2.435   -3.336  -9.645  1.00 0.00 ? 72  VAL A HG11 2  
ATOM 2883  H HG12 . VAL A 1 72  ? 2.045   -3.819  -11.297 1.00 0.00 ? 72  VAL A HG12 2  
ATOM 2884  H HG13 . VAL A 1 72  ? 2.818   -4.965  -10.201 1.00 0.00 ? 72  VAL A HG13 2  
ATOM 2885  H HG21 . VAL A 1 72  ? 5.035   -1.652  -11.674 1.00 0.00 ? 72  VAL A HG21 2  
ATOM 2886  H HG22 . VAL A 1 72  ? 3.523   -2.073  -12.479 1.00 0.00 ? 72  VAL A HG22 2  
ATOM 2887  H HG23 . VAL A 1 72  ? 3.497   -1.404  -10.847 1.00 0.00 ? 72  VAL A HG23 2  
ATOM 2888  N N    . ALA A 1 73  ? 7.167   -2.282  -10.316 1.00 0.00 ? 73  ALA A N    2  
ATOM 2889  C CA   . ALA A 1 73  ? 8.523   -2.113  -10.825 1.00 0.00 ? 73  ALA A CA   2  
ATOM 2890  C C    . ALA A 1 73  ? 9.199   -0.901  -10.193 1.00 0.00 ? 73  ALA A C    2  
ATOM 2891  O O    . ALA A 1 73  ? 8.550   0.105   -9.905  1.00 0.00 ? 73  ALA A O    2  
ATOM 2892  C CB   . ALA A 1 73  ? 8.505   -1.980  -12.340 1.00 0.00 ? 73  ALA A CB   2  
ATOM 2893  H H    . ALA A 1 73  ? 6.702   -1.510  -9.930  1.00 0.00 ? 73  ALA A H    2  
ATOM 2894  H HA   . ALA A 1 73  ? 9.087   -2.999  -10.572 1.00 0.00 ? 73  ALA A HA   2  
ATOM 2895  H HB1  . ALA A 1 73  ? 7.891   -1.136  -12.619 1.00 0.00 ? 73  ALA A HB1  2  
ATOM 2896  H HB2  . ALA A 1 73  ? 9.512   -1.828  -12.700 1.00 0.00 ? 73  ALA A HB2  2  
ATOM 2897  H HB3  . ALA A 1 73  ? 8.099   -2.881  -12.775 1.00 0.00 ? 73  ALA A HB3  2  
ATOM 2898  N N    . VAL A 1 74  ? 10.508  -1.003  -9.980  1.00 0.00 ? 74  VAL A N    2  
ATOM 2899  C CA   . VAL A 1 74  ? 11.272  0.085   -9.383  1.00 0.00 ? 74  VAL A CA   2  
ATOM 2900  C C    . VAL A 1 74  ? 12.391  0.544   -10.311 1.00 0.00 ? 74  VAL A C    2  
ATOM 2901  O O    . VAL A 1 74  ? 13.388  -0.155  -10.491 1.00 0.00 ? 74  VAL A O    2  
ATOM 2902  C CB   . VAL A 1 74  ? 11.880  -0.332  -8.031  1.00 0.00 ? 74  VAL A CB   2  
ATOM 2903  C CG1  . VAL A 1 74  ? 12.801  0.757   -7.501  1.00 0.00 ? 74  VAL A CG1  2  
ATOM 2904  C CG2  . VAL A 1 74  ? 10.781  -0.646  -7.027  1.00 0.00 ? 74  VAL A CG2  2  
ATOM 2905  H H    . VAL A 1 74  ? 10.969  -1.830  -10.232 1.00 0.00 ? 74  VAL A H    2  
ATOM 2906  H HA   . VAL A 1 74  ? 10.598  0.912   -9.212  1.00 0.00 ? 74  VAL A HA   2  
ATOM 2907  H HB   . VAL A 1 74  ? 12.466  -1.226  -8.183  1.00 0.00 ? 74  VAL A HB   2  
ATOM 2908  H HG11 . VAL A 1 74  ? 12.560  0.960   -6.468  1.00 0.00 ? 74  VAL A HG11 2  
ATOM 2909  H HG12 . VAL A 1 74  ? 13.827  0.427   -7.575  1.00 0.00 ? 74  VAL A HG12 2  
ATOM 2910  H HG13 . VAL A 1 74  ? 12.669  1.656   -8.084  1.00 0.00 ? 74  VAL A HG13 2  
ATOM 2911  H HG21 . VAL A 1 74  ? 10.427  -1.654  -7.186  1.00 0.00 ? 74  VAL A HG21 2  
ATOM 2912  H HG22 . VAL A 1 74  ? 11.172  -0.556  -6.024  1.00 0.00 ? 74  VAL A HG22 2  
ATOM 2913  H HG23 . VAL A 1 74  ? 9.964   0.048   -7.159  1.00 0.00 ? 74  VAL A HG23 2  
ATOM 2914  N N    . ASP A 1 75  ? 12.220  1.724   -10.897 1.00 0.00 ? 75  ASP A N    2  
ATOM 2915  C CA   . ASP A 1 75  ? 13.217  2.278   -11.806 1.00 0.00 ? 75  ASP A CA   2  
ATOM 2916  C C    . ASP A 1 75  ? 13.368  1.402   -13.046 1.00 0.00 ? 75  ASP A C    2  
ATOM 2917  O O    . ASP A 1 75  ? 14.448  1.318   -13.630 1.00 0.00 ? 75  ASP A O    2  
ATOM 2918  C CB   . ASP A 1 75  ? 14.564  2.417   -11.096 1.00 0.00 ? 75  ASP A CB   2  
ATOM 2919  C CG   . ASP A 1 75  ? 15.618  3.061   -11.975 1.00 0.00 ? 75  ASP A CG   2  
ATOM 2920  O OD1  . ASP A 1 75  ? 15.384  4.193   -12.448 1.00 0.00 ? 75  ASP A OD1  2  
ATOM 2921  O OD2  . ASP A 1 75  ? 16.676  2.434   -12.191 1.00 0.00 ? 75  ASP A OD2  2  
ATOM 2922  H H    . ASP A 1 75  ? 11.404  2.235   -10.713 1.00 0.00 ? 75  ASP A H    2  
ATOM 2923  H HA   . ASP A 1 75  ? 12.879  3.257   -12.112 1.00 0.00 ? 75  ASP A HA   2  
ATOM 2924  H HB2  . ASP A 1 75  ? 14.438  3.026   -10.213 1.00 0.00 ? 75  ASP A HB2  2  
ATOM 2925  H HB3  . ASP A 1 75  ? 14.913  1.437   -10.806 1.00 0.00 ? 75  ASP A HB3  2  
ATOM 2926  N N    . GLY A 1 76  ? 12.279  0.751   -13.441 1.00 0.00 ? 76  GLY A N    2  
ATOM 2927  C CA   . GLY A 1 76  ? 12.312  -0.111  -14.608 1.00 0.00 ? 76  GLY A CA   2  
ATOM 2928  C C    . GLY A 1 76  ? 12.515  -1.569  -14.246 1.00 0.00 ? 76  GLY A C    2  
ATOM 2929  O O    . GLY A 1 76  ? 12.289  -2.458  -15.067 1.00 0.00 ? 76  GLY A O    2  
ATOM 2930  H H    . GLY A 1 76  ? 11.446  0.856   -12.936 1.00 0.00 ? 76  GLY A H    2  
ATOM 2931  H HA2  . GLY A 1 76  ? 11.380  -0.011  -15.143 1.00 0.00 ? 76  GLY A HA2  2  
ATOM 2932  H HA3  . GLY A 1 76  ? 13.121  0.204   -15.250 1.00 0.00 ? 76  GLY A HA3  2  
ATOM 2933  N N    . VAL A 1 77  ? 12.946  -1.817  -13.013 1.00 0.00 ? 77  VAL A N    2  
ATOM 2934  C CA   . VAL A 1 77  ? 13.180  -3.178  -12.544 1.00 0.00 ? 77  VAL A CA   2  
ATOM 2935  C C    . VAL A 1 77  ? 11.883  -3.831  -12.081 1.00 0.00 ? 77  VAL A C    2  
ATOM 2936  O O    . VAL A 1 77  ? 11.277  -3.404  -11.099 1.00 0.00 ? 77  VAL A O    2  
ATOM 2937  C CB   . VAL A 1 77  ? 14.197  -3.205  -11.387 1.00 0.00 ? 77  VAL A CB   2  
ATOM 2938  C CG1  . VAL A 1 77  ? 14.322  -4.611  -10.819 1.00 0.00 ? 77  VAL A CG1  2  
ATOM 2939  C CG2  . VAL A 1 77  ? 15.549  -2.687  -11.854 1.00 0.00 ? 77  VAL A CG2  2  
ATOM 2940  H H    . VAL A 1 77  ? 13.109  -1.067  -12.404 1.00 0.00 ? 77  VAL A H    2  
ATOM 2941  H HA   . VAL A 1 77  ? 13.586  -3.749  -13.366 1.00 0.00 ? 77  VAL A HA   2  
ATOM 2942  H HB   . VAL A 1 77  ? 13.837  -2.555  -10.603 1.00 0.00 ? 77  VAL A HB   2  
ATOM 2943  H HG11 . VAL A 1 77  ? 14.161  -4.583  -9.752  1.00 0.00 ? 77  VAL A HG11 2  
ATOM 2944  H HG12 . VAL A 1 77  ? 13.585  -5.252  -11.280 1.00 0.00 ? 77  VAL A HG12 2  
ATOM 2945  H HG13 . VAL A 1 77  ? 15.311  -4.994  -11.024 1.00 0.00 ? 77  VAL A HG13 2  
ATOM 2946  H HG21 . VAL A 1 77  ? 15.623  -1.632  -11.640 1.00 0.00 ? 77  VAL A HG21 2  
ATOM 2947  H HG22 . VAL A 1 77  ? 16.336  -3.216  -11.335 1.00 0.00 ? 77  VAL A HG22 2  
ATOM 2948  H HG23 . VAL A 1 77  ? 15.648  -2.847  -12.917 1.00 0.00 ? 77  VAL A HG23 2  
ATOM 2949  N N    . ASN A 1 78  ? 11.461  -4.869  -12.796 1.00 0.00 ? 78  ASN A N    2  
ATOM 2950  C CA   . ASN A 1 78  ? 10.234  -5.582  -12.459 1.00 0.00 ? 78  ASN A CA   2  
ATOM 2951  C C    . ASN A 1 78  ? 10.394  -6.351  -11.152 1.00 0.00 ? 78  ASN A C    2  
ATOM 2952  O O    . ASN A 1 78  ? 10.825  -7.505  -11.147 1.00 0.00 ? 78  ASN A O    2  
ATOM 2953  C CB   . ASN A 1 78  ? 9.852   -6.543  -13.586 1.00 0.00 ? 78  ASN A CB   2  
ATOM 2954  C CG   . ASN A 1 78  ? 8.500   -7.192  -13.360 1.00 0.00 ? 78  ASN A CG   2  
ATOM 2955  O OD1  . ASN A 1 78  ? 8.414   -8.379  -13.049 1.00 0.00 ? 78  ASN A OD1  2  
ATOM 2956  N ND2  . ASN A 1 78  ? 7.437   -6.412  -13.516 1.00 0.00 ? 78  ASN A ND2  2  
ATOM 2957  H H    . ASN A 1 78  ? 11.987  -5.162  -13.569 1.00 0.00 ? 78  ASN A H    2  
ATOM 2958  H HA   . ASN A 1 78  ? 9.449   -4.851  -12.340 1.00 0.00 ? 78  ASN A HA   2  
ATOM 2959  H HB2  . ASN A 1 78  ? 9.817   -5.999  -14.519 1.00 0.00 ? 78  ASN A HB2  2  
ATOM 2960  H HB3  . ASN A 1 78  ? 10.598  -7.321  -13.656 1.00 0.00 ? 78  ASN A HB3  2  
ATOM 2961  H HD21 . ASN A 1 78  ? 7.582   -5.475  -13.765 1.00 0.00 ? 78  ASN A HD21 2  
ATOM 2962  H HD22 . ASN A 1 78  ? 6.550   -6.805  -13.375 1.00 0.00 ? 78  ASN A HD22 2  
ATOM 2963  N N    . ILE A 1 79  ? 10.044  -5.705  -10.045 1.00 0.00 ? 79  ILE A N    2  
ATOM 2964  C CA   . ILE A 1 79  ? 10.147  -6.329  -8.731  1.00 0.00 ? 79  ILE A CA   2  
ATOM 2965  C C    . ILE A 1 79  ? 8.906   -7.158  -8.418  1.00 0.00 ? 79  ILE A C    2  
ATOM 2966  O O    . ILE A 1 79  ? 8.656   -7.505  -7.264  1.00 0.00 ? 79  ILE A O    2  
ATOM 2967  C CB   . ILE A 1 79  ? 10.343  -5.278  -7.623  1.00 0.00 ? 79  ILE A CB   2  
ATOM 2968  C CG1  . ILE A 1 79  ? 9.083   -4.422  -7.473  1.00 0.00 ? 79  ILE A CG1  2  
ATOM 2969  C CG2  . ILE A 1 79  ? 11.550  -4.404  -7.928  1.00 0.00 ? 79  ILE A CG2  2  
ATOM 2970  C CD1  . ILE A 1 79  ? 8.870   -3.901  -6.069  1.00 0.00 ? 79  ILE A CD1  2  
ATOM 2971  H H    . ILE A 1 79  ? 9.708   -4.787  -10.113 1.00 0.00 ? 79  ILE A H    2  
ATOM 2972  H HA   . ILE A 1 79  ? 11.009  -6.980  -8.739  1.00 0.00 ? 79  ILE A HA   2  
ATOM 2973  H HB   . ILE A 1 79  ? 10.529  -5.797  -6.695  1.00 0.00 ? 79  ILE A HB   2  
ATOM 2974  H HG12 . ILE A 1 79  ? 9.152   -3.573  -8.135  1.00 0.00 ? 79  ILE A HG12 2  
ATOM 2975  H HG13 . ILE A 1 79  ? 8.221   -5.014  -7.742  1.00 0.00 ? 79  ILE A HG13 2  
ATOM 2976  H HG21 . ILE A 1 79  ? 11.906  -4.618  -8.925  1.00 0.00 ? 79  ILE A HG21 2  
ATOM 2977  H HG22 . ILE A 1 79  ? 11.267  -3.364  -7.863  1.00 0.00 ? 79  ILE A HG22 2  
ATOM 2978  H HG23 . ILE A 1 79  ? 12.333  -4.610  -7.214  1.00 0.00 ? 79  ILE A HG23 2  
ATOM 2979  H HD11 . ILE A 1 79  ? 8.905   -2.821  -6.076  1.00 0.00 ? 79  ILE A HD11 2  
ATOM 2980  H HD12 . ILE A 1 79  ? 7.908   -4.229  -5.705  1.00 0.00 ? 79  ILE A HD12 2  
ATOM 2981  H HD13 . ILE A 1 79  ? 9.648   -4.281  -5.422  1.00 0.00 ? 79  ILE A HD13 2  
ATOM 2982  N N    . GLN A 1 80  ? 8.134   -7.471  -9.453  1.00 0.00 ? 80  GLN A N    2  
ATOM 2983  C CA   . GLN A 1 80  ? 6.919   -8.261  -9.287  1.00 0.00 ? 80  GLN A CA   2  
ATOM 2984  C C    . GLN A 1 80  ? 7.231   -9.616  -8.661  1.00 0.00 ? 80  GLN A C    2  
ATOM 2985  O O    . GLN A 1 80  ? 7.614   -10.558 -9.354  1.00 0.00 ? 80  GLN A O    2  
ATOM 2986  C CB   . GLN A 1 80  ? 6.225   -8.457  -10.636 1.00 0.00 ? 80  GLN A CB   2  
ATOM 2987  C CG   . GLN A 1 80  ? 5.468   -7.228  -11.115 1.00 0.00 ? 80  GLN A CG   2  
ATOM 2988  C CD   . GLN A 1 80  ? 4.487   -7.544  -12.227 1.00 0.00 ? 80  GLN A CD   2  
ATOM 2989  O OE1  . GLN A 1 80  ? 4.875   -7.710  -13.384 1.00 0.00 ? 80  GLN A OE1  2  
ATOM 2990  N NE2  . GLN A 1 80  ? 3.208   -7.629  -11.882 1.00 0.00 ? 80  GLN A NE2  2  
ATOM 2991  H H    . GLN A 1 80  ? 8.386   -7.165  -10.348 1.00 0.00 ? 80  GLN A H    2  
ATOM 2992  H HA   . GLN A 1 80  ? 6.258   -7.718  -8.628  1.00 0.00 ? 80  GLN A HA   2  
ATOM 2993  H HB2  . GLN A 1 80  ? 6.969   -8.706  -11.377 1.00 0.00 ? 80  GLN A HB2  2  
ATOM 2994  H HB3  . GLN A 1 80  ? 5.524   -9.274  -10.551 1.00 0.00 ? 80  GLN A HB3  2  
ATOM 2995  H HG2  . GLN A 1 80  ? 4.921   -6.811  -10.282 1.00 0.00 ? 80  GLN A HG2  2  
ATOM 2996  H HG3  . GLN A 1 80  ? 6.179   -6.502  -11.477 1.00 0.00 ? 80  GLN A HG3  2  
ATOM 2997  H HE21 . GLN A 1 80  ? 2.972   -7.484  -10.941 1.00 0.00 ? 80  GLN A HE21 2  
ATOM 2998  H HE22 . GLN A 1 80  ? 2.552   -7.831  -12.581 1.00 0.00 ? 80  GLN A HE22 2  
ATOM 2999  N N    . GLY A 1 81  ? 7.066   -9.707  -7.345  1.00 0.00 ? 81  GLY A N    2  
ATOM 3000  C CA   . GLY A 1 81  ? 7.336   -10.951 -6.648  1.00 0.00 ? 81  GLY A CA   2  
ATOM 3001  C C    . GLY A 1 81  ? 8.583   -10.876 -5.790  1.00 0.00 ? 81  GLY A C    2  
ATOM 3002  O O    . GLY A 1 81  ? 8.798   -11.718 -4.918  1.00 0.00 ? 81  GLY A O    2  
ATOM 3003  H H    . GLY A 1 81  ? 6.759   -8.923  -6.843  1.00 0.00 ? 81  GLY A H    2  
ATOM 3004  H HA2  . GLY A 1 81  ? 6.492   -11.187 -6.017  1.00 0.00 ? 81  GLY A HA2  2  
ATOM 3005  H HA3  . GLY A 1 81  ? 7.460   -11.738 -7.376  1.00 0.00 ? 81  GLY A HA3  2  
ATOM 3006  N N    . PHE A 1 82  ? 9.411   -9.866  -6.038  1.00 0.00 ? 82  PHE A N    2  
ATOM 3007  C CA   . PHE A 1 82  ? 10.646  -9.686  -5.284  1.00 0.00 ? 82  PHE A CA   2  
ATOM 3008  C C    . PHE A 1 82  ? 10.374  -9.709  -3.783  1.00 0.00 ? 82  PHE A C    2  
ATOM 3009  O O    . PHE A 1 82  ? 9.489   -9.011  -3.290  1.00 0.00 ? 82  PHE A O    2  
ATOM 3010  C CB   . PHE A 1 82  ? 11.317  -8.367  -5.672  1.00 0.00 ? 82  PHE A CB   2  
ATOM 3011  C CG   . PHE A 1 82  ? 12.275  -8.497  -6.821  1.00 0.00 ? 82  PHE A CG   2  
ATOM 3012  C CD1  . PHE A 1 82  ? 11.918  -9.199  -7.962  1.00 0.00 ? 82  PHE A CD1  2  
ATOM 3013  C CD2  . PHE A 1 82  ? 13.533  -7.919  -6.761  1.00 0.00 ? 82  PHE A CD2  2  
ATOM 3014  C CE1  . PHE A 1 82  ? 12.797  -9.320  -9.021  1.00 0.00 ? 82  PHE A CE1  2  
ATOM 3015  C CE2  . PHE A 1 82  ? 14.416  -8.036  -7.818  1.00 0.00 ? 82  PHE A CE2  2  
ATOM 3016  C CZ   . PHE A 1 82  ? 14.048  -8.739  -8.949  1.00 0.00 ? 82  PHE A CZ   2  
ATOM 3017  H H    . PHE A 1 82  ? 9.185   -9.226  -6.747  1.00 0.00 ? 82  PHE A H    2  
ATOM 3018  H HA   . PHE A 1 82  ? 11.306  -10.503 -5.531  1.00 0.00 ? 82  PHE A HA   2  
ATOM 3019  H HB2  . PHE A 1 82  ? 10.558  -7.653  -5.953  1.00 0.00 ? 82  PHE A HB2  2  
ATOM 3020  H HB3  . PHE A 1 82  ? 11.865  -7.987  -4.823  1.00 0.00 ? 82  PHE A HB3  2  
ATOM 3021  H HD1  . PHE A 1 82  ? 10.940  -9.654  -8.019  1.00 0.00 ? 82  PHE A HD1  2  
ATOM 3022  H HD2  . PHE A 1 82  ? 13.822  -7.370  -5.877  1.00 0.00 ? 82  PHE A HD2  2  
ATOM 3023  H HE1  . PHE A 1 82  ? 12.506  -9.870  -9.904  1.00 0.00 ? 82  PHE A HE1  2  
ATOM 3024  H HE2  . PHE A 1 82  ? 15.393  -7.581  -7.759  1.00 0.00 ? 82  PHE A HE2  2  
ATOM 3025  H HZ   . PHE A 1 82  ? 14.736  -8.832  -9.776  1.00 0.00 ? 82  PHE A HZ   2  
ATOM 3026  N N    . ALA A 1 83  ? 11.143  -10.519 -3.061  1.00 0.00 ? 83  ALA A N    2  
ATOM 3027  C CA   . ALA A 1 83  ? 10.987  -10.633 -1.617  1.00 0.00 ? 83  ALA A CA   2  
ATOM 3028  C C    . ALA A 1 83  ? 11.281  -9.306  -0.926  1.00 0.00 ? 83  ALA A C    2  
ATOM 3029  O O    . ALA A 1 83  ? 11.970  -8.449  -1.477  1.00 0.00 ? 83  ALA A O    2  
ATOM 3030  C CB   . ALA A 1 83  ? 11.895  -11.726 -1.073  1.00 0.00 ? 83  ALA A CB   2  
ATOM 3031  H H    . ALA A 1 83  ? 11.831  -11.051 -3.511  1.00 0.00 ? 83  ALA A H    2  
ATOM 3032  H HA   . ALA A 1 83  ? 9.964   -10.915 -1.412  1.00 0.00 ? 83  ALA A HA   2  
ATOM 3033  H HB1  . ALA A 1 83  ? 12.863  -11.307 -0.842  1.00 0.00 ? 83  ALA A HB1  2  
ATOM 3034  H HB2  . ALA A 1 83  ? 11.460  -12.143 -0.177  1.00 0.00 ? 83  ALA A HB2  2  
ATOM 3035  H HB3  . ALA A 1 83  ? 12.007  -12.503 -1.814  1.00 0.00 ? 83  ALA A HB3  2  
ATOM 3036  N N    . ASN A 1 84  ? 10.754  -9.144  0.283   1.00 0.00 ? 84  ASN A N    2  
ATOM 3037  C CA   . ASN A 1 84  ? 10.960  -7.919  1.049   1.00 0.00 ? 84  ASN A CA   2  
ATOM 3038  C C    . ASN A 1 84  ? 12.389  -7.410  0.887   1.00 0.00 ? 84  ASN A C    2  
ATOM 3039  O O    . ASN A 1 84  ? 12.610  -6.249  0.541   1.00 0.00 ? 84  ASN A O    2  
ATOM 3040  C CB   . ASN A 1 84  ? 10.658  -8.162  2.529   1.00 0.00 ? 84  ASN A CB   2  
ATOM 3041  C CG   . ASN A 1 84  ? 10.967  -6.951  3.388   1.00 0.00 ? 84  ASN A CG   2  
ATOM 3042  O OD1  . ASN A 1 84  ? 12.000  -6.897  4.055   1.00 0.00 ? 84  ASN A OD1  2  
ATOM 3043  N ND2  . ASN A 1 84  ? 10.070  -5.972  3.375   1.00 0.00 ? 84  ASN A ND2  2  
ATOM 3044  H H    . ASN A 1 84  ? 10.214  -9.864  0.670   1.00 0.00 ? 84  ASN A H    2  
ATOM 3045  H HA   . ASN A 1 84  ? 10.279  -7.173  0.669   1.00 0.00 ? 84  ASN A HA   2  
ATOM 3046  H HB2  . ASN A 1 84  ? 9.610   -8.400  2.642   1.00 0.00 ? 84  ASN A HB2  2  
ATOM 3047  H HB3  . ASN A 1 84  ? 11.251  -8.992  2.881   1.00 0.00 ? 84  ASN A HB3  2  
ATOM 3048  H HD21 . ASN A 1 84  ? 9.270   -6.083  2.820   1.00 0.00 ? 84  ASN A HD21 2  
ATOM 3049  H HD22 . ASN A 1 84  ? 10.246  -5.177  3.921   1.00 0.00 ? 84  ASN A HD22 2  
ATOM 3050  N N    . HIS A 1 85  ? 13.356  -8.287  1.138   1.00 0.00 ? 85  HIS A N    2  
ATOM 3051  C CA   . HIS A 1 85  ? 14.764  -7.927  1.019   1.00 0.00 ? 85  HIS A CA   2  
ATOM 3052  C C    . HIS A 1 85  ? 15.143  -7.690  -0.440  1.00 0.00 ? 85  HIS A C    2  
ATOM 3053  O O    . HIS A 1 85  ? 15.763  -6.680  -0.773  1.00 0.00 ? 85  HIS A O    2  
ATOM 3054  C CB   . HIS A 1 85  ? 15.645  -9.026  1.614   1.00 0.00 ? 85  HIS A CB   2  
ATOM 3055  C CG   . HIS A 1 85  ? 15.404  -10.377 1.015   1.00 0.00 ? 85  HIS A CG   2  
ATOM 3056  N ND1  . HIS A 1 85  ? 14.431  -11.241 1.473   1.00 0.00 ? 85  HIS A ND1  2  
ATOM 3057  C CD2  . HIS A 1 85  ? 16.015  -11.012 -0.012  1.00 0.00 ? 85  HIS A CD2  2  
ATOM 3058  C CE1  . HIS A 1 85  ? 14.456  -12.349 0.754   1.00 0.00 ? 85  HIS A CE1  2  
ATOM 3059  N NE2  . HIS A 1 85  ? 15.408  -12.235 -0.155  1.00 0.00 ? 85  HIS A NE2  2  
ATOM 3060  H H    . HIS A 1 85  ? 13.116  -9.198  1.410   1.00 0.00 ? 85  HIS A H    2  
ATOM 3061  H HA   . HIS A 1 85  ? 14.921  -7.013  1.572   1.00 0.00 ? 85  HIS A HA   2  
ATOM 3062  H HB2  . HIS A 1 85  ? 16.683  -8.773  1.454   1.00 0.00 ? 85  HIS A HB2  2  
ATOM 3063  H HB3  . HIS A 1 85  ? 15.457  -9.094  2.676   1.00 0.00 ? 85  HIS A HB3  2  
ATOM 3064  H HD1  . HIS A 1 85  ? 13.816  -11.068 2.215   1.00 0.00 ? 85  HIS A HD1  2  
ATOM 3065  H HD2  . HIS A 1 85  ? 16.831  -10.628 -0.610  1.00 0.00 ? 85  HIS A HD2  2  
ATOM 3066  H HE1  . HIS A 1 85  ? 13.807  -13.202 0.885   1.00 0.00 ? 85  HIS A HE1  2  
ATOM 3067  H HE2  . HIS A 1 85  ? 15.696  -12.948 -0.762  1.00 0.00 ? 85  HIS A HE2  2  
ATOM 3068  N N    . ASP A 1 86  ? 14.767  -8.626  -1.303  1.00 0.00 ? 86  ASP A N    2  
ATOM 3069  C CA   . ASP A 1 86  ? 15.067  -8.518  -2.726  1.00 0.00 ? 86  ASP A CA   2  
ATOM 3070  C C    . ASP A 1 86  ? 14.747  -7.120  -3.245  1.00 0.00 ? 86  ASP A C    2  
ATOM 3071  O O    . ASP A 1 86  ? 15.458  -6.584  -4.095  1.00 0.00 ? 86  ASP A O    2  
ATOM 3072  C CB   . ASP A 1 86  ? 14.275  -9.562  -3.516  1.00 0.00 ? 86  ASP A CB   2  
ATOM 3073  C CG   . ASP A 1 86  ? 14.822  -10.964 -3.333  1.00 0.00 ? 86  ASP A CG   2  
ATOM 3074  O OD1  . ASP A 1 86  ? 15.932  -11.238 -3.836  1.00 0.00 ? 86  ASP A OD1  2  
ATOM 3075  O OD2  . ASP A 1 86  ? 14.140  -11.788 -2.689  1.00 0.00 ? 86  ASP A OD2  2  
ATOM 3076  H H    . ASP A 1 86  ? 14.275  -9.408  -0.976  1.00 0.00 ? 86  ASP A H    2  
ATOM 3077  H HA   . ASP A 1 86  ? 16.122  -8.705  -2.858  1.00 0.00 ? 86  ASP A HA   2  
ATOM 3078  H HB2  . ASP A 1 86  ? 13.247  -9.551  -3.185  1.00 0.00 ? 86  ASP A HB2  2  
ATOM 3079  H HB3  . ASP A 1 86  ? 14.314  -9.314  -4.567  1.00 0.00 ? 86  ASP A HB3  2  
ATOM 3080  N N    . VAL A 1 87  ? 13.671  -6.534  -2.728  1.00 0.00 ? 87  VAL A N    2  
ATOM 3081  C CA   . VAL A 1 87  ? 13.257  -5.198  -3.138  1.00 0.00 ? 87  VAL A CA   2  
ATOM 3082  C C    . VAL A 1 87  ? 14.144  -4.130  -2.509  1.00 0.00 ? 87  VAL A C    2  
ATOM 3083  O O    . VAL A 1 87  ? 14.464  -3.122  -3.139  1.00 0.00 ? 87  VAL A O    2  
ATOM 3084  C CB   . VAL A 1 87  ? 11.791  -4.922  -2.755  1.00 0.00 ? 87  VAL A CB   2  
ATOM 3085  C CG1  . VAL A 1 87  ? 11.392  -3.508  -3.149  1.00 0.00 ? 87  VAL A CG1  2  
ATOM 3086  C CG2  . VAL A 1 87  ? 10.870  -5.945  -3.404  1.00 0.00 ? 87  VAL A CG2  2  
ATOM 3087  H H    . VAL A 1 87  ? 13.145  -7.012  -2.054  1.00 0.00 ? 87  VAL A H    2  
ATOM 3088  H HA   . VAL A 1 87  ? 13.344  -5.137  -4.213  1.00 0.00 ? 87  VAL A HA   2  
ATOM 3089  H HB   . VAL A 1 87  ? 11.697  -5.013  -1.683  1.00 0.00 ? 87  VAL A HB   2  
ATOM 3090  H HG11 . VAL A 1 87  ? 11.014  -3.510  -4.161  1.00 0.00 ? 87  VAL A HG11 2  
ATOM 3091  H HG12 . VAL A 1 87  ? 10.626  -3.149  -2.478  1.00 0.00 ? 87  VAL A HG12 2  
ATOM 3092  H HG13 . VAL A 1 87  ? 12.255  -2.862  -3.090  1.00 0.00 ? 87  VAL A HG13 2  
ATOM 3093  H HG21 . VAL A 1 87  ? 11.087  -6.926  -3.008  1.00 0.00 ? 87  VAL A HG21 2  
ATOM 3094  H HG22 . VAL A 1 87  ? 9.842   -5.690  -3.191  1.00 0.00 ? 87  VAL A HG22 2  
ATOM 3095  H HG23 . VAL A 1 87  ? 11.027  -5.944  -4.472  1.00 0.00 ? 87  VAL A HG23 2  
ATOM 3096  N N    . VAL A 1 88  ? 14.541  -4.357  -1.261  1.00 0.00 ? 88  VAL A N    2  
ATOM 3097  C CA   . VAL A 1 88  ? 15.393  -3.415  -0.545  1.00 0.00 ? 88  VAL A CA   2  
ATOM 3098  C C    . VAL A 1 88  ? 16.671  -3.128  -1.326  1.00 0.00 ? 88  VAL A C    2  
ATOM 3099  O O    . VAL A 1 88  ? 16.973  -1.977  -1.638  1.00 0.00 ? 88  VAL A O    2  
ATOM 3100  C CB   . VAL A 1 88  ? 15.767  -3.946  0.852   1.00 0.00 ? 88  VAL A CB   2  
ATOM 3101  C CG1  . VAL A 1 88  ? 16.735  -2.997  1.542   1.00 0.00 ? 88  VAL A CG1  2  
ATOM 3102  C CG2  . VAL A 1 88  ? 14.517  -4.151  1.695   1.00 0.00 ? 88  VAL A CG2  2  
ATOM 3103  H H    . VAL A 1 88  ? 14.253  -5.179  -0.810  1.00 0.00 ? 88  VAL A H    2  
ATOM 3104  H HA   . VAL A 1 88  ? 14.843  -2.494  -0.422  1.00 0.00 ? 88  VAL A HA   2  
ATOM 3105  H HB   . VAL A 1 88  ? 16.256  -4.901  0.733   1.00 0.00 ? 88  VAL A HB   2  
ATOM 3106  H HG11 . VAL A 1 88  ? 17.219  -3.510  2.360   1.00 0.00 ? 88  VAL A HG11 2  
ATOM 3107  H HG12 . VAL A 1 88  ? 17.479  -2.664  0.833   1.00 0.00 ? 88  VAL A HG12 2  
ATOM 3108  H HG13 . VAL A 1 88  ? 16.193  -2.144  1.923   1.00 0.00 ? 88  VAL A HG13 2  
ATOM 3109  H HG21 . VAL A 1 88  ? 14.610  -5.069  2.257   1.00 0.00 ? 88  VAL A HG21 2  
ATOM 3110  H HG22 . VAL A 1 88  ? 14.402  -3.321  2.377   1.00 0.00 ? 88  VAL A HG22 2  
ATOM 3111  H HG23 . VAL A 1 88  ? 13.653  -4.209  1.050   1.00 0.00 ? 88  VAL A HG23 2  
ATOM 3112  N N    . GLU A 1 89  ? 17.417  -4.183  -1.638  1.00 0.00 ? 89  GLU A N    2  
ATOM 3113  C CA   . GLU A 1 89  ? 18.663  -4.043  -2.383  1.00 0.00 ? 89  GLU A CA   2  
ATOM 3114  C C    . GLU A 1 89  ? 18.440  -3.259  -3.673  1.00 0.00 ? 89  GLU A C    2  
ATOM 3115  O O    . GLU A 1 89  ? 19.289  -2.469  -4.087  1.00 0.00 ? 89  GLU A O    2  
ATOM 3116  C CB   . GLU A 1 89  ? 19.248  -5.420  -2.704  1.00 0.00 ? 89  GLU A CB   2  
ATOM 3117  C CG   . GLU A 1 89  ? 18.491  -6.165  -3.791  1.00 0.00 ? 89  GLU A CG   2  
ATOM 3118  C CD   . GLU A 1 89  ? 19.259  -7.360  -4.323  1.00 0.00 ? 89  GLU A CD   2  
ATOM 3119  O OE1  . GLU A 1 89  ? 20.373  -7.163  -4.850  1.00 0.00 ? 89  GLU A OE1  2  
ATOM 3120  O OE2  . GLU A 1 89  ? 18.745  -8.492  -4.210  1.00 0.00 ? 89  GLU A OE2  2  
ATOM 3121  H H    . GLU A 1 89  ? 17.123  -5.076  -1.361  1.00 0.00 ? 89  GLU A H    2  
ATOM 3122  H HA   . GLU A 1 89  ? 19.361  -3.502  -1.763  1.00 0.00 ? 89  GLU A HA   2  
ATOM 3123  H HB2  . GLU A 1 89  ? 20.272  -5.297  -3.026  1.00 0.00 ? 89  GLU A HB2  2  
ATOM 3124  H HB3  . GLU A 1 89  ? 19.233  -6.022  -1.808  1.00 0.00 ? 89  GLU A HB3  2  
ATOM 3125  H HG2  . GLU A 1 89  ? 17.552  -6.511  -3.386  1.00 0.00 ? 89  GLU A HG2  2  
ATOM 3126  H HG3  . GLU A 1 89  ? 18.301  -5.485  -4.609  1.00 0.00 ? 89  GLU A HG3  2  
ATOM 3127  N N    . VAL A 1 90  ? 17.293  -3.484  -4.305  1.00 0.00 ? 90  VAL A N    2  
ATOM 3128  C CA   . VAL A 1 90  ? 16.957  -2.799  -5.548  1.00 0.00 ? 90  VAL A CA   2  
ATOM 3129  C C    . VAL A 1 90  ? 16.977  -1.286  -5.364  1.00 0.00 ? 90  VAL A C    2  
ATOM 3130  O O    . VAL A 1 90  ? 17.552  -0.559  -6.175  1.00 0.00 ? 90  VAL A O    2  
ATOM 3131  C CB   . VAL A 1 90  ? 15.571  -3.225  -6.066  1.00 0.00 ? 90  VAL A CB   2  
ATOM 3132  C CG1  . VAL A 1 90  ? 15.219  -2.465  -7.337  1.00 0.00 ? 90  VAL A CG1  2  
ATOM 3133  C CG2  . VAL A 1 90  ? 15.529  -4.726  -6.304  1.00 0.00 ? 90  VAL A CG2  2  
ATOM 3134  H H    . VAL A 1 90  ? 16.656  -4.125  -3.926  1.00 0.00 ? 90  VAL A H    2  
ATOM 3135  H HA   . VAL A 1 90  ? 17.695  -3.072  -6.289  1.00 0.00 ? 90  VAL A HA   2  
ATOM 3136  H HB   . VAL A 1 90  ? 14.836  -2.980  -5.313  1.00 0.00 ? 90  VAL A HB   2  
ATOM 3137  H HG11 . VAL A 1 90  ? 14.147  -2.457  -7.466  1.00 0.00 ? 90  VAL A HG11 2  
ATOM 3138  H HG12 . VAL A 1 90  ? 15.583  -1.451  -7.262  1.00 0.00 ? 90  VAL A HG12 2  
ATOM 3139  H HG13 . VAL A 1 90  ? 15.679  -2.951  -8.185  1.00 0.00 ? 90  VAL A HG13 2  
ATOM 3140  H HG21 . VAL A 1 90  ? 15.452  -4.920  -7.364  1.00 0.00 ? 90  VAL A HG21 2  
ATOM 3141  H HG22 . VAL A 1 90  ? 16.432  -5.178  -5.921  1.00 0.00 ? 90  VAL A HG22 2  
ATOM 3142  H HG23 . VAL A 1 90  ? 14.673  -5.148  -5.797  1.00 0.00 ? 90  VAL A HG23 2  
ATOM 3143  N N    . LEU A 1 91  ? 16.346  -0.818  -4.293  1.00 0.00 ? 91  LEU A N    2  
ATOM 3144  C CA   . LEU A 1 91  ? 16.291  0.611   -4.002  1.00 0.00 ? 91  LEU A CA   2  
ATOM 3145  C C    . LEU A 1 91  ? 17.693  1.183   -3.816  1.00 0.00 ? 91  LEU A C    2  
ATOM 3146  O O    . LEU A 1 91  ? 18.022  2.235   -4.365  1.00 0.00 ? 91  LEU A O    2  
ATOM 3147  C CB   . LEU A 1 91  ? 15.454  0.863   -2.746  1.00 0.00 ? 91  LEU A CB   2  
ATOM 3148  C CG   . LEU A 1 91  ? 14.050  0.258   -2.742  1.00 0.00 ? 91  LEU A CG   2  
ATOM 3149  C CD1  . LEU A 1 91  ? 13.498  0.200   -1.327  1.00 0.00 ? 91  LEU A CD1  2  
ATOM 3150  C CD2  . LEU A 1 91  ? 13.123  1.056   -3.646  1.00 0.00 ? 91  LEU A CD2  2  
ATOM 3151  H H    . LEU A 1 91  ? 15.906  -1.446  -3.684  1.00 0.00 ? 91  LEU A H    2  
ATOM 3152  H HA   . LEU A 1 91  ? 15.823  1.103   -4.841  1.00 0.00 ? 91  LEU A HA   2  
ATOM 3153  H HB2  . LEU A 1 91  ? 15.992  0.456   -1.903  1.00 0.00 ? 91  LEU A HB2  2  
ATOM 3154  H HB3  . LEU A 1 91  ? 15.355  1.932   -2.625  1.00 0.00 ? 91  LEU A HB3  2  
ATOM 3155  H HG   . LEU A 1 91  ? 14.100  -0.754  -3.122  1.00 0.00 ? 91  LEU A HG   2  
ATOM 3156  H HD11 . LEU A 1 91  ? 14.314  0.126   -0.624  1.00 0.00 ? 91  LEU A HD11 2  
ATOM 3157  H HD12 . LEU A 1 91  ? 12.856  -0.663  -1.226  1.00 0.00 ? 91  LEU A HD12 2  
ATOM 3158  H HD13 . LEU A 1 91  ? 12.929  1.096   -1.125  1.00 0.00 ? 91  LEU A HD13 2  
ATOM 3159  H HD21 . LEU A 1 91  ? 12.345  0.410   -4.024  1.00 0.00 ? 91  LEU A HD21 2  
ATOM 3160  H HD22 . LEU A 1 91  ? 13.688  1.462   -4.474  1.00 0.00 ? 91  LEU A HD22 2  
ATOM 3161  H HD23 . LEU A 1 91  ? 12.679  1.864   -3.083  1.00 0.00 ? 91  LEU A HD23 2  
ATOM 3162  N N    . ARG A 1 92  ? 18.514  0.482   -3.041  1.00 0.00 ? 92  ARG A N    2  
ATOM 3163  C CA   . ARG A 1 92  ? 19.881  0.920   -2.784  1.00 0.00 ? 92  ARG A CA   2  
ATOM 3164  C C    . ARG A 1 92  ? 20.672  1.024   -4.085  1.00 0.00 ? 92  ARG A C    2  
ATOM 3165  O O    . ARG A 1 92  ? 21.453  1.956   -4.275  1.00 0.00 ? 92  ARG A O    2  
ATOM 3166  C CB   . ARG A 1 92  ? 20.578  -0.049  -1.827  1.00 0.00 ? 92  ARG A CB   2  
ATOM 3167  C CG   . ARG A 1 92  ? 19.915  -0.138  -0.462  1.00 0.00 ? 92  ARG A CG   2  
ATOM 3168  C CD   . ARG A 1 92  ? 20.309  -1.414  0.266   1.00 0.00 ? 92  ARG A CD   2  
ATOM 3169  N NE   . ARG A 1 92  ? 21.745  -1.475  0.526   1.00 0.00 ? 92  ARG A NE   2  
ATOM 3170  C CZ   . ARG A 1 92  ? 22.401  -2.605  0.769   1.00 0.00 ? 92  ARG A CZ   2  
ATOM 3171  N NH1  . ARG A 1 92  ? 21.752  -3.761  0.784   1.00 0.00 ? 92  ARG A NH1  2  
ATOM 3172  N NH2  . ARG A 1 92  ? 23.708  -2.579  0.996   1.00 0.00 ? 92  ARG A NH2  2  
ATOM 3173  H H    . ARG A 1 92  ? 18.194  -0.348  -2.631  1.00 0.00 ? 92  ARG A H    2  
ATOM 3174  H HA   . ARG A 1 92  ? 19.836  1.896   -2.325  1.00 0.00 ? 92  ARG A HA   2  
ATOM 3175  H HB2  . ARG A 1 92  ? 20.578  -1.035  -2.268  1.00 0.00 ? 92  ARG A HB2  2  
ATOM 3176  H HB3  . ARG A 1 92  ? 21.598  0.275   -1.687  1.00 0.00 ? 92  ARG A HB3  2  
ATOM 3177  H HG2  . ARG A 1 92  ? 20.220  0.710   0.133   1.00 0.00 ? 92  ARG A HG2  2  
ATOM 3178  H HG3  . ARG A 1 92  ? 18.843  -0.124  -0.591  1.00 0.00 ? 92  ARG A HG3  2  
ATOM 3179  H HD2  . ARG A 1 92  ? 19.781  -1.454  1.206   1.00 0.00 ? 92  ARG A HD2  2  
ATOM 3180  H HD3  . ARG A 1 92  ? 20.026  -2.261  -0.342  1.00 0.00 ? 92  ARG A HD3  2  
ATOM 3181  H HE   . ARG A 1 92  ? 22.244  -0.632  0.519   1.00 0.00 ? 92  ARG A HE   2  
ATOM 3182  H HH11 . ARG A 1 92  ? 20.768  -3.784  0.612   1.00 0.00 ? 92  ARG A HH11 2  
ATOM 3183  H HH12 . ARG A 1 92  ? 22.249  -4.610  0.966   1.00 0.00 ? 92  ARG A HH12 2  
ATOM 3184  H HH21 . ARG A 1 92  ? 24.200  -1.709  0.985   1.00 0.00 ? 92  ARG A HH21 2  
ATOM 3185  H HH22 . ARG A 1 92  ? 24.200  -3.429  1.179   1.00 0.00 ? 92  ARG A HH22 2  
ATOM 3186  N N    . ASN A 1 93  ? 20.464  0.061   -4.977  1.00 0.00 ? 93  ASN A N    2  
ATOM 3187  C CA   . ASN A 1 93  ? 21.158  0.044   -6.259  1.00 0.00 ? 93  ASN A CA   2  
ATOM 3188  C C    . ASN A 1 93  ? 20.777  1.259   -7.100  1.00 0.00 ? 93  ASN A C    2  
ATOM 3189  O O    . ASN A 1 93  ? 21.619  1.841   -7.784  1.00 0.00 ? 93  ASN A O    2  
ATOM 3190  C CB   . ASN A 1 93  ? 20.832  -1.241  -7.022  1.00 0.00 ? 93  ASN A CB   2  
ATOM 3191  C CG   . ASN A 1 93  ? 21.703  -2.406  -6.592  1.00 0.00 ? 93  ASN A CG   2  
ATOM 3192  O OD1  . ASN A 1 93  ? 22.922  -2.380  -6.764  1.00 0.00 ? 93  ASN A OD1  2  
ATOM 3193  N ND2  . ASN A 1 93  ? 21.080  -3.435  -6.030  1.00 0.00 ? 93  ASN A ND2  2  
ATOM 3194  H H    . ASN A 1 93  ? 19.828  -0.655  -4.768  1.00 0.00 ? 93  ASN A H    2  
ATOM 3195  H HA   . ASN A 1 93  ? 22.219  0.076   -6.062  1.00 0.00 ? 93  ASN A HA   2  
ATOM 3196  H HB2  . ASN A 1 93  ? 19.799  -1.505  -6.845  1.00 0.00 ? 93  ASN A HB2  2  
ATOM 3197  H HB3  . ASN A 1 93  ? 20.981  -1.074  -8.078  1.00 0.00 ? 93  ASN A HB3  2  
ATOM 3198  H HD21 . ASN A 1 93  ? 20.107  -3.386  -5.925  1.00 0.00 ? 93  ASN A HD21 2  
ATOM 3199  H HD22 . ASN A 1 93  ? 21.620  -4.201  -5.742  1.00 0.00 ? 93  ASN A HD22 2  
ATOM 3200  N N    . ALA A 1 94  ? 19.504  1.635   -7.044  1.00 0.00 ? 94  ALA A N    2  
ATOM 3201  C CA   . ALA A 1 94  ? 19.012  2.781   -7.798  1.00 0.00 ? 94  ALA A CA   2  
ATOM 3202  C C    . ALA A 1 94  ? 19.806  4.039   -7.465  1.00 0.00 ? 94  ALA A C    2  
ATOM 3203  O O    . ALA A 1 94  ? 20.483  4.104   -6.440  1.00 0.00 ? 94  ALA A O    2  
ATOM 3204  C CB   . ALA A 1 94  ? 17.532  2.999   -7.521  1.00 0.00 ? 94  ALA A CB   2  
ATOM 3205  H H    . ALA A 1 94  ? 18.881  1.130   -6.481  1.00 0.00 ? 94  ALA A H    2  
ATOM 3206  H HA   . ALA A 1 94  ? 19.127  2.563   -8.850  1.00 0.00 ? 94  ALA A HA   2  
ATOM 3207  H HB1  . ALA A 1 94  ? 17.385  3.990   -7.115  1.00 0.00 ? 94  ALA A HB1  2  
ATOM 3208  H HB2  . ALA A 1 94  ? 16.975  2.900   -8.440  1.00 0.00 ? 94  ALA A HB2  2  
ATOM 3209  H HB3  . ALA A 1 94  ? 17.187  2.264   -6.809  1.00 0.00 ? 94  ALA A HB3  2  
ATOM 3210  N N    . GLY A 1 95  ? 19.719  5.038   -8.339  1.00 0.00 ? 95  GLY A N    2  
ATOM 3211  C CA   . GLY A 1 95  ? 20.435  6.280   -8.119  1.00 0.00 ? 95  GLY A CA   2  
ATOM 3212  C C    . GLY A 1 95  ? 19.504  7.456   -7.903  1.00 0.00 ? 95  GLY A C    2  
ATOM 3213  O O    . GLY A 1 95  ? 18.404  7.296   -7.374  1.00 0.00 ? 95  GLY A O    2  
ATOM 3214  H H    . GLY A 1 95  ? 19.164  4.929   -9.139  1.00 0.00 ? 95  GLY A H    2  
ATOM 3215  H HA2  . GLY A 1 95  ? 21.067  6.171   -7.250  1.00 0.00 ? 95  GLY A HA2  2  
ATOM 3216  H HA3  . GLY A 1 95  ? 21.057  6.481   -8.979  1.00 0.00 ? 95  GLY A HA3  2  
ATOM 3217  N N    . GLN A 1 96  ? 19.945  8.642   -8.313  1.00 0.00 ? 96  GLN A N    2  
ATOM 3218  C CA   . GLN A 1 96  ? 19.143  9.849   -8.159  1.00 0.00 ? 96  GLN A CA   2  
ATOM 3219  C C    . GLN A 1 96  ? 17.799  9.704   -8.866  1.00 0.00 ? 96  GLN A C    2  
ATOM 3220  O O    . GLN A 1 96  ? 16.743  9.822   -8.245  1.00 0.00 ? 96  GLN A O    2  
ATOM 3221  C CB   . GLN A 1 96  ? 19.895  11.061  -8.712  1.00 0.00 ? 96  GLN A CB   2  
ATOM 3222  C CG   . GLN A 1 96  ? 19.468  12.379  -8.088  1.00 0.00 ? 96  GLN A CG   2  
ATOM 3223  C CD   . GLN A 1 96  ? 20.575  13.415  -8.096  1.00 0.00 ? 96  GLN A CD   2  
ATOM 3224  O OE1  . GLN A 1 96  ? 21.246  13.615  -9.110  1.00 0.00 ? 96  GLN A OE1  2  
ATOM 3225  N NE2  . GLN A 1 96  ? 20.772  14.081  -6.965  1.00 0.00 ? 96  GLN A NE2  2  
ATOM 3226  H H    . GLN A 1 96  ? 20.830  8.705   -8.727  1.00 0.00 ? 96  GLN A H    2  
ATOM 3227  H HA   . GLN A 1 96  ? 18.966  9.998   -7.104  1.00 0.00 ? 96  GLN A HA   2  
ATOM 3228  H HB2  . GLN A 1 96  ? 20.951  10.927  -8.531  1.00 0.00 ? 96  GLN A HB2  2  
ATOM 3229  H HB3  . GLN A 1 96  ? 19.725  11.120  -9.777  1.00 0.00 ? 96  GLN A HB3  2  
ATOM 3230  H HG2  . GLN A 1 96  ? 18.627  12.770  -8.641  1.00 0.00 ? 96  GLN A HG2  2  
ATOM 3231  H HG3  . GLN A 1 96  ? 19.172  12.199  -7.065  1.00 0.00 ? 96  GLN A HG3  2  
ATOM 3232  H HE21 . GLN A 1 96  ? 20.200  13.868  -6.197  1.00 0.00 ? 96  GLN A HE21 2  
ATOM 3233  H HE22 . GLN A 1 96  ? 21.481  14.755  -6.942  1.00 0.00 ? 96  GLN A HE22 2  
ATOM 3234  N N    . VAL A 1 97  ? 17.847  9.448   -10.170 1.00 0.00 ? 97  VAL A N    2  
ATOM 3235  C CA   . VAL A 1 97  ? 16.633  9.287   -10.962 1.00 0.00 ? 97  VAL A CA   2  
ATOM 3236  C C    . VAL A 1 97  ? 15.984  7.931   -10.703 1.00 0.00 ? 97  VAL A C    2  
ATOM 3237  O O    . VAL A 1 97  ? 16.368  6.924   -11.297 1.00 0.00 ? 97  VAL A O    2  
ATOM 3238  C CB   . VAL A 1 97  ? 16.924  9.425   -12.468 1.00 0.00 ? 97  VAL A CB   2  
ATOM 3239  C CG1  . VAL A 1 97  ? 15.656  9.203   -13.279 1.00 0.00 ? 97  VAL A CG1  2  
ATOM 3240  C CG2  . VAL A 1 97  ? 17.529  10.787  -12.771 1.00 0.00 ? 97  VAL A CG2  2  
ATOM 3241  H H    . VAL A 1 97  ? 18.719  9.366   -10.609 1.00 0.00 ? 97  VAL A H    2  
ATOM 3242  H HA   . VAL A 1 97  ? 15.942  10.066  -10.677 1.00 0.00 ? 97  VAL A HA   2  
ATOM 3243  H HB   . VAL A 1 97  ? 17.640  8.666   -12.747 1.00 0.00 ? 97  VAL A HB   2  
ATOM 3244  H HG11 . VAL A 1 97  ? 15.217  10.158  -13.528 1.00 0.00 ? 97  VAL A HG11 2  
ATOM 3245  H HG12 . VAL A 1 97  ? 15.897  8.669   -14.186 1.00 0.00 ? 97  VAL A HG12 2  
ATOM 3246  H HG13 . VAL A 1 97  ? 14.953  8.626   -12.697 1.00 0.00 ? 97  VAL A HG13 2  
ATOM 3247  H HG21 . VAL A 1 97  ? 17.227  11.103  -13.758 1.00 0.00 ? 97  VAL A HG21 2  
ATOM 3248  H HG22 . VAL A 1 97  ? 17.182  11.506  -12.042 1.00 0.00 ? 97  VAL A HG22 2  
ATOM 3249  H HG23 . VAL A 1 97  ? 18.605  10.722  -12.726 1.00 0.00 ? 97  VAL A HG23 2  
ATOM 3250  N N    . VAL A 1 98  ? 14.999  7.914   -9.811  1.00 0.00 ? 98  VAL A N    2  
ATOM 3251  C CA   . VAL A 1 98  ? 14.294  6.683   -9.474  1.00 0.00 ? 98  VAL A CA   2  
ATOM 3252  C C    . VAL A 1 98  ? 12.862  6.709   -9.995  1.00 0.00 ? 98  VAL A C    2  
ATOM 3253  O O    . VAL A 1 98  ? 12.004  7.402   -9.449  1.00 0.00 ? 98  VAL A O    2  
ATOM 3254  C CB   . VAL A 1 98  ? 14.271  6.449   -7.951  1.00 0.00 ? 98  VAL A CB   2  
ATOM 3255  C CG1  . VAL A 1 98  ? 13.555  5.148   -7.622  1.00 0.00 ? 98  VAL A CG1  2  
ATOM 3256  C CG2  . VAL A 1 98  ? 15.686  6.444   -7.392  1.00 0.00 ? 98  VAL A CG2  2  
ATOM 3257  H H    . VAL A 1 98  ? 14.738  8.750   -9.370  1.00 0.00 ? 98  VAL A H    2  
ATOM 3258  H HA   . VAL A 1 98  ? 14.821  5.860   -9.935  1.00 0.00 ? 98  VAL A HA   2  
ATOM 3259  H HB   . VAL A 1 98  ? 13.727  7.260   -7.491  1.00 0.00 ? 98  VAL A HB   2  
ATOM 3260  H HG11 . VAL A 1 98  ? 14.021  4.688   -6.763  1.00 0.00 ? 98  VAL A HG11 2  
ATOM 3261  H HG12 . VAL A 1 98  ? 12.517  5.354   -7.403  1.00 0.00 ? 98  VAL A HG12 2  
ATOM 3262  H HG13 . VAL A 1 98  ? 13.619  4.478   -8.467  1.00 0.00 ? 98  VAL A HG13 2  
ATOM 3263  H HG21 . VAL A 1 98  ? 15.652  6.628   -6.328  1.00 0.00 ? 98  VAL A HG21 2  
ATOM 3264  H HG22 . VAL A 1 98  ? 16.144  5.484   -7.577  1.00 0.00 ? 98  VAL A HG22 2  
ATOM 3265  H HG23 . VAL A 1 98  ? 16.266  7.218   -7.873  1.00 0.00 ? 98  VAL A HG23 2  
ATOM 3266  N N    . HIS A 1 99  ? 12.610  5.947   -11.055 1.00 0.00 ? 99  HIS A N    2  
ATOM 3267  C CA   . HIS A 1 99  ? 11.280  5.882   -11.650 1.00 0.00 ? 99  HIS A CA   2  
ATOM 3268  C C    . HIS A 1 99  ? 10.453  4.771   -11.010 1.00 0.00 ? 99  HIS A C    2  
ATOM 3269  O O    . HIS A 1 99  ? 10.499  3.619   -11.444 1.00 0.00 ? 99  HIS A O    2  
ATOM 3270  C CB   . HIS A 1 99  ? 11.384  5.652   -13.158 1.00 0.00 ? 99  HIS A CB   2  
ATOM 3271  C CG   . HIS A 1 99  ? 11.690  6.896   -13.934 1.00 0.00 ? 99  HIS A CG   2  
ATOM 3272  N ND1  . HIS A 1 99  ? 12.848  7.062   -14.663 1.00 0.00 ? 99  HIS A ND1  2  
ATOM 3273  C CD2  . HIS A 1 99  ? 10.980  8.037   -14.094 1.00 0.00 ? 99  HIS A CD2  2  
ATOM 3274  C CE1  . HIS A 1 99  ? 12.838  8.252   -15.236 1.00 0.00 ? 99  HIS A CE1  2  
ATOM 3275  N NE2  . HIS A 1 99  ? 11.715  8.864   -14.907 1.00 0.00 ? 99  HIS A NE2  2  
ATOM 3276  H H    . HIS A 1 99  ? 13.335  5.417   -11.446 1.00 0.00 ? 99  HIS A H    2  
ATOM 3277  H HA   . HIS A 1 99  ? 10.790  6.827   -11.472 1.00 0.00 ? 99  HIS A HA   2  
ATOM 3278  H HB2  . HIS A 1 99  ? 12.170  4.938   -13.353 1.00 0.00 ? 99  HIS A HB2  2  
ATOM 3279  H HB3  . HIS A 1 99  ? 10.446  5.256   -13.521 1.00 0.00 ? 99  HIS A HB3  2  
ATOM 3280  H HD1  . HIS A 1 99  ? 13.571  6.406   -14.747 1.00 0.00 ? 99  HIS A HD1  2  
ATOM 3281  H HD2  . HIS A 1 99  ? 10.013  8.257   -13.661 1.00 0.00 ? 99  HIS A HD2  2  
ATOM 3282  H HE1  . HIS A 1 99  ? 13.615  8.657   -15.867 1.00 0.00 ? 99  HIS A HE1  2  
ATOM 3283  H HE2  . HIS A 1 99  ? 11.492  9.792   -15.127 1.00 0.00 ? 99  HIS A HE2  2  
ATOM 3284  N N    . LEU A 1 100 ? 9.697   5.124   -9.976  1.00 0.00 ? 100 LEU A N    2  
ATOM 3285  C CA   . LEU A 1 100 ? 8.859   4.157   -9.275  1.00 0.00 ? 100 LEU A CA   2  
ATOM 3286  C C    . LEU A 1 100 ? 7.612   3.826   -10.089 1.00 0.00 ? 100 LEU A C    2  
ATOM 3287  O O    . LEU A 1 100 ? 6.878   4.720   -10.512 1.00 0.00 ? 100 LEU A O    2  
ATOM 3288  C CB   . LEU A 1 100 ? 8.457   4.701   -7.903  1.00 0.00 ? 100 LEU A CB   2  
ATOM 3289  C CG   . LEU A 1 100 ? 8.338   3.669   -6.781  1.00 0.00 ? 100 LEU A CG   2  
ATOM 3290  C CD1  . LEU A 1 100 ? 7.287   2.624   -7.126  1.00 0.00 ? 100 LEU A CD1  2  
ATOM 3291  C CD2  . LEU A 1 100 ? 9.683   3.008   -6.518  1.00 0.00 ? 100 LEU A CD2  2  
ATOM 3292  H H    . LEU A 1 100 ? 9.702   6.057   -9.676  1.00 0.00 ? 100 LEU A H    2  
ATOM 3293  H HA   . LEU A 1 100 ? 9.437   3.255   -9.141  1.00 0.00 ? 100 LEU A HA   2  
ATOM 3294  H HB2  . LEU A 1 100 ? 9.198   5.427   -7.606  1.00 0.00 ? 100 LEU A HB2  2  
ATOM 3295  H HB3  . LEU A 1 100 ? 7.499   5.188   -8.009  1.00 0.00 ? 100 LEU A HB3  2  
ATOM 3296  H HG   . LEU A 1 100 ? 8.026   4.167   -5.874  1.00 0.00 ? 100 LEU A HG   2  
ATOM 3297  H HD11 . LEU A 1 100 ? 6.904   2.813   -8.118  1.00 0.00 ? 100 LEU A HD11 2  
ATOM 3298  H HD12 . LEU A 1 100 ? 6.479   2.677   -6.412  1.00 0.00 ? 100 LEU A HD12 2  
ATOM 3299  H HD13 . LEU A 1 100 ? 7.733   1.641   -7.093  1.00 0.00 ? 100 LEU A HD13 2  
ATOM 3300  H HD21 . LEU A 1 100 ? 10.467  3.594   -6.975  1.00 0.00 ? 100 LEU A HD21 2  
ATOM 3301  H HD22 . LEU A 1 100 ? 9.684   2.014   -6.942  1.00 0.00 ? 100 LEU A HD22 2  
ATOM 3302  H HD23 . LEU A 1 100 ? 9.852   2.947   -5.454  1.00 0.00 ? 100 LEU A HD23 2  
ATOM 3303  N N    . THR A 1 101 ? 7.377   2.535   -10.304 1.00 0.00 ? 101 THR A N    2  
ATOM 3304  C CA   . THR A 1 101 ? 6.219   2.086   -11.065 1.00 0.00 ? 101 THR A CA   2  
ATOM 3305  C C    . THR A 1 101 ? 5.105   1.607   -10.141 1.00 0.00 ? 101 THR A C    2  
ATOM 3306  O O    . THR A 1 101 ? 5.239   0.582   -9.471  1.00 0.00 ? 101 THR A O    2  
ATOM 3307  C CB   . THR A 1 101 ? 6.591   0.948   -12.035 1.00 0.00 ? 101 THR A CB   2  
ATOM 3308  O OG1  . THR A 1 101 ? 7.796   1.276   -12.736 1.00 0.00 ? 101 THR A OG1  2  
ATOM 3309  C CG2  . THR A 1 101 ? 5.470   0.699   -13.033 1.00 0.00 ? 101 THR A CG2  2  
ATOM 3310  H H    . THR A 1 101 ? 7.999   1.871   -9.941  1.00 0.00 ? 101 THR A H    2  
ATOM 3311  H HA   . THR A 1 101 ? 5.857   2.922   -11.646 1.00 0.00 ? 101 THR A HA   2  
ATOM 3312  H HB   . THR A 1 101 ? 6.751   0.046   -11.462 1.00 0.00 ? 101 THR A HB   2  
ATOM 3313  H HG1  . THR A 1 101 ? 7.872   0.724   -13.518 1.00 0.00 ? 101 THR A HG1  2  
ATOM 3314  H HG21 . THR A 1 101 ? 4.674   0.150   -12.551 1.00 0.00 ? 101 THR A HG21 2  
ATOM 3315  H HG22 . THR A 1 101 ? 5.850   0.126   -13.865 1.00 0.00 ? 101 THR A HG22 2  
ATOM 3316  H HG23 . THR A 1 101 ? 5.089   1.644   -13.389 1.00 0.00 ? 101 THR A HG23 2  
ATOM 3317  N N    . LEU A 1 102 ? 4.007   2.353   -10.110 1.00 0.00 ? 102 LEU A N    2  
ATOM 3318  C CA   . LEU A 1 102 ? 2.868   2.003   -9.267  1.00 0.00 ? 102 LEU A CA   2  
ATOM 3319  C C    . LEU A 1 102 ? 1.619   1.770   -10.110 1.00 0.00 ? 102 LEU A C    2  
ATOM 3320  O O    . LEU A 1 102 ? 1.497   2.292   -11.218 1.00 0.00 ? 102 LEU A O    2  
ATOM 3321  C CB   . LEU A 1 102 ? 2.607   3.110   -8.244  1.00 0.00 ? 102 LEU A CB   2  
ATOM 3322  C CG   . LEU A 1 102 ? 3.823   3.591   -7.451  1.00 0.00 ? 102 LEU A CG   2  
ATOM 3323  C CD1  . LEU A 1 102 ? 4.621   4.602   -8.259  1.00 0.00 ? 102 LEU A CD1  2  
ATOM 3324  C CD2  . LEU A 1 102 ? 3.389   4.191   -6.121  1.00 0.00 ? 102 LEU A CD2  2  
ATOM 3325  H H    . LEU A 1 102 ? 3.959   3.158   -10.665 1.00 0.00 ? 102 LEU A H    2  
ATOM 3326  H HA   . LEU A 1 102 ? 3.111   1.090   -8.744  1.00 0.00 ? 102 LEU A HA   2  
ATOM 3327  H HB2  . LEU A 1 102 ? 2.200   3.959   -8.771  1.00 0.00 ? 102 LEU A HB2  2  
ATOM 3328  H HB3  . LEU A 1 102 ? 1.876   2.741   -7.539  1.00 0.00 ? 102 LEU A HB3  2  
ATOM 3329  H HG   . LEU A 1 102 ? 4.467   2.747   -7.243  1.00 0.00 ? 102 LEU A HG   2  
ATOM 3330  H HD11 . LEU A 1 102 ? 4.018   4.966   -9.077  1.00 0.00 ? 102 LEU A HD11 2  
ATOM 3331  H HD12 . LEU A 1 102 ? 5.510   4.129   -8.649  1.00 0.00 ? 102 LEU A HD12 2  
ATOM 3332  H HD13 . LEU A 1 102 ? 4.903   5.429   -7.623  1.00 0.00 ? 102 LEU A HD13 2  
ATOM 3333  H HD21 . LEU A 1 102 ? 2.471   3.723   -5.798  1.00 0.00 ? 102 LEU A HD21 2  
ATOM 3334  H HD22 . LEU A 1 102 ? 3.228   5.253   -6.241  1.00 0.00 ? 102 LEU A HD22 2  
ATOM 3335  H HD23 . LEU A 1 102 ? 4.159   4.023   -5.382  1.00 0.00 ? 102 LEU A HD23 2  
ATOM 3336  N N    . VAL A 1 103 ? 0.690   0.982   -9.576  1.00 0.00 ? 103 VAL A N    2  
ATOM 3337  C CA   . VAL A 1 103 ? -0.552  0.681   -10.278 1.00 0.00 ? 103 VAL A CA   2  
ATOM 3338  C C    . VAL A 1 103 ? -1.755  0.827   -9.352  1.00 0.00 ? 103 VAL A C    2  
ATOM 3339  O O    . VAL A 1 103 ? -1.976  -0.003  -8.470  1.00 0.00 ? 103 VAL A O    2  
ATOM 3340  C CB   . VAL A 1 103 ? -0.537  -0.744  -10.861 1.00 0.00 ? 103 VAL A CB   2  
ATOM 3341  C CG1  . VAL A 1 103 ? -0.039  -1.740  -9.825  1.00 0.00 ? 103 VAL A CG1  2  
ATOM 3342  C CG2  . VAL A 1 103 ? -1.921  -1.129  -11.362 1.00 0.00 ? 103 VAL A CG2  2  
ATOM 3343  H H    . VAL A 1 103 ? 0.844   0.594   -8.690  1.00 0.00 ? 103 VAL A H    2  
ATOM 3344  H HA   . VAL A 1 103 ? -0.652  1.381   -11.095 1.00 0.00 ? 103 VAL A HA   2  
ATOM 3345  H HB   . VAL A 1 103 ? 0.144   -0.760  -11.700 1.00 0.00 ? 103 VAL A HB   2  
ATOM 3346  H HG11 . VAL A 1 103 ? 0.921   -2.129  -10.132 1.00 0.00 ? 103 VAL A HG11 2  
ATOM 3347  H HG12 . VAL A 1 103 ? 0.060   -1.247  -8.869  1.00 0.00 ? 103 VAL A HG12 2  
ATOM 3348  H HG13 . VAL A 1 103 ? -0.745  -2.553  -9.740  1.00 0.00 ? 103 VAL A HG13 2  
ATOM 3349  H HG21 . VAL A 1 103 ? -2.200  -0.483  -12.180 1.00 0.00 ? 103 VAL A HG21 2  
ATOM 3350  H HG22 . VAL A 1 103 ? -1.908  -2.155  -11.702 1.00 0.00 ? 103 VAL A HG22 2  
ATOM 3351  H HG23 . VAL A 1 103 ? -2.636  -1.025  -10.560 1.00 0.00 ? 103 VAL A HG23 2  
ATOM 3352  N N    . ARG A 1 104 ? -2.529  1.887   -9.559  1.00 0.00 ? 104 ARG A N    2  
ATOM 3353  C CA   . ARG A 1 104 ? -3.710  2.142   -8.743  1.00 0.00 ? 104 ARG A CA   2  
ATOM 3354  C C    . ARG A 1 104 ? -4.987  1.872   -9.534  1.00 0.00 ? 104 ARG A C    2  
ATOM 3355  O O    . ARG A 1 104 ? -4.995  1.946   -10.763 1.00 0.00 ? 104 ARG A O    2  
ATOM 3356  C CB   . ARG A 1 104 ? -3.705  3.586   -8.238  1.00 0.00 ? 104 ARG A CB   2  
ATOM 3357  C CG   . ARG A 1 104 ? -2.630  3.865   -7.201  1.00 0.00 ? 104 ARG A CG   2  
ATOM 3358  C CD   . ARG A 1 104 ? -2.289  5.345   -7.136  1.00 0.00 ? 104 ARG A CD   2  
ATOM 3359  N NE   . ARG A 1 104 ? -3.120  6.057   -6.170  1.00 0.00 ? 104 ARG A NE   2  
ATOM 3360  C CZ   . ARG A 1 104 ? -2.790  7.229   -5.639  1.00 0.00 ? 104 ARG A CZ   2  
ATOM 3361  N NH1  . ARG A 1 104 ? -1.652  7.818   -5.979  1.00 0.00 ? 104 ARG A NH1  2  
ATOM 3362  N NH2  . ARG A 1 104 ? -3.600  7.815   -4.766  1.00 0.00 ? 104 ARG A NH2  2  
ATOM 3363  H H    . ARG A 1 104 ? -2.301  2.513   -10.278 1.00 0.00 ? 104 ARG A H    2  
ATOM 3364  H HA   . ARG A 1 104 ? -3.678  1.473   -7.895  1.00 0.00 ? 104 ARG A HA   2  
ATOM 3365  H HB2  . ARG A 1 104 ? -3.546  4.247   -9.076  1.00 0.00 ? 104 ARG A HB2  2  
ATOM 3366  H HB3  . ARG A 1 104 ? -4.666  3.803   -7.796  1.00 0.00 ? 104 ARG A HB3  2  
ATOM 3367  H HG2  . ARG A 1 104 ? -2.986  3.547   -6.232  1.00 0.00 ? 104 ARG A HG2  2  
ATOM 3368  H HG3  . ARG A 1 104 ? -1.740  3.310   -7.460  1.00 0.00 ? 104 ARG A HG3  2  
ATOM 3369  H HD2  . ARG A 1 104 ? -1.252  5.450   -6.851  1.00 0.00 ? 104 ARG A HD2  2  
ATOM 3370  H HD3  . ARG A 1 104 ? -2.438  5.778   -8.114  1.00 0.00 ? 104 ARG A HD3  2  
ATOM 3371  H HE   . ARG A 1 104 ? -3.966  5.640   -5.904  1.00 0.00 ? 104 ARG A HE   2  
ATOM 3372  H HH11 . ARG A 1 104 ? -1.041  7.380   -6.637  1.00 0.00 ? 104 ARG A HH11 2  
ATOM 3373  H HH12 . ARG A 1 104 ? -1.407  8.701   -5.578  1.00 0.00 ? 104 ARG A HH12 2  
ATOM 3374  H HH21 . ARG A 1 104 ? -4.459  7.374   -4.507  1.00 0.00 ? 104 ARG A HH21 2  
ATOM 3375  H HH22 . ARG A 1 104 ? -3.350  8.697   -4.366  1.00 0.00 ? 104 ARG A HH22 2  
ATOM 3376  N N    . ARG A 1 105 ? -6.064  1.559   -8.821  1.00 0.00 ? 105 ARG A N    2  
ATOM 3377  C CA   . ARG A 1 105 ? -7.345  1.277   -9.456  1.00 0.00 ? 105 ARG A CA   2  
ATOM 3378  C C    . ARG A 1 105 ? -7.918  2.533   -10.106 1.00 0.00 ? 105 ARG A C    2  
ATOM 3379  O O    . ARG A 1 105 ? -7.953  3.601   -9.495  1.00 0.00 ? 105 ARG A O    2  
ATOM 3380  C CB   . ARG A 1 105 ? -8.336  0.724   -8.430  1.00 0.00 ? 105 ARG A CB   2  
ATOM 3381  C CG   . ARG A 1 105 ? -9.505  -0.022  -9.053  1.00 0.00 ? 105 ARG A CG   2  
ATOM 3382  C CD   . ARG A 1 105 ? -10.047 -1.090  -8.117  1.00 0.00 ? 105 ARG A CD   2  
ATOM 3383  N NE   . ARG A 1 105 ? -10.635 -0.513  -6.910  1.00 0.00 ? 105 ARG A NE   2  
ATOM 3384  C CZ   . ARG A 1 105 ? -10.891 -1.213  -5.811  1.00 0.00 ? 105 ARG A CZ   2  
ATOM 3385  N NH1  . ARG A 1 105 ? -10.612 -2.509  -5.766  1.00 0.00 ? 105 ARG A NH1  2  
ATOM 3386  N NH2  . ARG A 1 105 ? -11.426 -0.618  -4.753  1.00 0.00 ? 105 ARG A NH2  2  
ATOM 3387  H H    . ARG A 1 105 ? -5.995  1.516   -7.844  1.00 0.00 ? 105 ARG A H    2  
ATOM 3388  H HA   . ARG A 1 105 ? -7.180  0.533   -10.221 1.00 0.00 ? 105 ARG A HA   2  
ATOM 3389  H HB2  . ARG A 1 105 ? -7.814  0.044   -7.772  1.00 0.00 ? 105 ARG A HB2  2  
ATOM 3390  H HB3  . ARG A 1 105 ? -8.729  1.544   -7.849  1.00 0.00 ? 105 ARG A HB3  2  
ATOM 3391  H HG2  . ARG A 1 105 ? -10.294 0.683   -9.272  1.00 0.00 ? 105 ARG A HG2  2  
ATOM 3392  H HG3  . ARG A 1 105 ? -9.174  -0.491  -9.968  1.00 0.00 ? 105 ARG A HG3  2  
ATOM 3393  H HD2  . ARG A 1 105 ? -10.804 -1.657  -8.638  1.00 0.00 ? 105 ARG A HD2  2  
ATOM 3394  H HD3  . ARG A 1 105 ? -9.238  -1.746  -7.834  1.00 0.00 ? 105 ARG A HD3  2  
ATOM 3395  H HE   . ARG A 1 105 ? -10.848 0.443   -6.922  1.00 0.00 ? 105 ARG A HE   2  
ATOM 3396  H HH11 . ARG A 1 105 ? -10.208 -2.960  -6.561  1.00 0.00 ? 105 ARG A HH11 2  
ATOM 3397  H HH12 . ARG A 1 105 ? -10.805 -3.034  -4.936  1.00 0.00 ? 105 ARG A HH12 2  
ATOM 3398  H HH21 . ARG A 1 105 ? -11.637 0.359   -4.783  1.00 0.00 ? 105 ARG A HH21 2  
ATOM 3399  H HH22 . ARG A 1 105 ? -11.619 -1.145  -3.926  1.00 0.00 ? 105 ARG A HH22 2  
ATOM 3400  N N    . LYS A 1 106 ? -8.365  2.398   -11.350 1.00 0.00 ? 106 LYS A N    2  
ATOM 3401  C CA   . LYS A 1 106 ? -8.937  3.520   -12.084 1.00 0.00 ? 106 LYS A CA   2  
ATOM 3402  C C    . LYS A 1 106 ? -10.317 3.878   -11.543 1.00 0.00 ? 106 LYS A C    2  
ATOM 3403  O O    . LYS A 1 106 ? -10.615 5.047   -11.297 1.00 0.00 ? 106 LYS A O    2  
ATOM 3404  C CB   . LYS A 1 106 ? -9.033  3.185   -13.575 1.00 0.00 ? 106 LYS A CB   2  
ATOM 3405  C CG   . LYS A 1 106 ? -7.709  2.769   -14.191 1.00 0.00 ? 106 LYS A CG   2  
ATOM 3406  C CD   . LYS A 1 106 ? -7.913  1.848   -15.383 1.00 0.00 ? 106 LYS A CD   2  
ATOM 3407  C CE   . LYS A 1 106 ? -6.828  2.043   -16.430 1.00 0.00 ? 106 LYS A CE   2  
ATOM 3408  N NZ   . LYS A 1 106 ? -7.062  3.263   -17.251 1.00 0.00 ? 106 LYS A NZ   2  
ATOM 3409  H H    . LYS A 1 106 ? -8.310  1.520   -11.785 1.00 0.00 ? 106 LYS A H    2  
ATOM 3410  H HA   . LYS A 1 106 ? -8.282  4.368   -11.957 1.00 0.00 ? 106 LYS A HA   2  
ATOM 3411  H HB2  . LYS A 1 106 ? -9.737  2.376   -13.705 1.00 0.00 ? 106 LYS A HB2  2  
ATOM 3412  H HB3  . LYS A 1 106 ? -9.395  4.054   -14.104 1.00 0.00 ? 106 LYS A HB3  2  
ATOM 3413  H HG2  . LYS A 1 106 ? -7.181  3.652   -14.520 1.00 0.00 ? 106 LYS A HG2  2  
ATOM 3414  H HG3  . LYS A 1 106 ? -7.121  2.253   -13.445 1.00 0.00 ? 106 LYS A HG3  2  
ATOM 3415  H HD2  . LYS A 1 106 ? -7.890  0.823   -15.043 1.00 0.00 ? 106 LYS A HD2  2  
ATOM 3416  H HD3  . LYS A 1 106 ? -8.875  2.059   -15.829 1.00 0.00 ? 106 LYS A HD3  2  
ATOM 3417  H HE2  . LYS A 1 106 ? -5.876  2.133   -15.931 1.00 0.00 ? 106 LYS A HE2  2  
ATOM 3418  H HE3  . LYS A 1 106 ? -6.814  1.179   -17.079 1.00 0.00 ? 106 LYS A HE3  2  
ATOM 3419  H HZ1  . LYS A 1 106 ? -7.839  3.097   -17.924 1.00 0.00 ? 106 LYS A HZ1  2  
ATOM 3420  H HZ2  . LYS A 1 106 ? -6.203  3.505   -17.785 1.00 0.00 ? 106 LYS A HZ2  2  
ATOM 3421  H HZ3  . LYS A 1 106 ? -7.315  4.063   -16.638 1.00 0.00 ? 106 LYS A HZ3  2  
ATOM 3422  N N    . THR A 1 107 ? -11.156 2.864   -11.357 1.00 0.00 ? 107 THR A N    2  
ATOM 3423  C CA   . THR A 1 107 ? -12.504 3.072   -10.844 1.00 0.00 ? 107 THR A CA   2  
ATOM 3424  C C    . THR A 1 107 ? -12.542 4.225   -9.848  1.00 0.00 ? 107 THR A C    2  
ATOM 3425  O O    . THR A 1 107 ? -11.628 4.390   -9.041  1.00 0.00 ? 107 THR A O    2  
ATOM 3426  C CB   . THR A 1 107 ? -13.048 1.802   -10.163 1.00 0.00 ? 107 THR A CB   2  
ATOM 3427  O OG1  . THR A 1 107 ? -13.002 0.699   -11.074 1.00 0.00 ? 107 THR A OG1  2  
ATOM 3428  C CG2  . THR A 1 107 ? -14.477 2.013   -9.686  1.00 0.00 ? 107 THR A CG2  2  
ATOM 3429  H H    . THR A 1 107 ? -10.860 1.954   -11.571 1.00 0.00 ? 107 THR A H    2  
ATOM 3430  H HA   . THR A 1 107 ? -13.146 3.309   -11.680 1.00 0.00 ? 107 THR A HA   2  
ATOM 3431  H HB   . THR A 1 107 ? -12.428 1.578   -9.306  1.00 0.00 ? 107 THR A HB   2  
ATOM 3432  H HG1  . THR A 1 107 ? -13.892 0.369   -11.224 1.00 0.00 ? 107 THR A HG1  2  
ATOM 3433  H HG21 . THR A 1 107 ? -14.985 2.689   -10.358 1.00 0.00 ? 107 THR A HG21 2  
ATOM 3434  H HG22 . THR A 1 107 ? -14.466 2.434   -8.691  1.00 0.00 ? 107 THR A HG22 2  
ATOM 3435  H HG23 . THR A 1 107 ? -14.995 1.066   -9.670  1.00 0.00 ? 107 THR A HG23 2  
ATOM 3436  N N    . SER A 1 108 ? -13.605 5.020   -9.910  1.00 0.00 ? 108 SER A N    2  
ATOM 3437  C CA   . SER A 1 108 ? -13.760 6.161   -9.015  1.00 0.00 ? 108 SER A CA   2  
ATOM 3438  C C    . SER A 1 108 ? -13.279 5.817   -7.609  1.00 0.00 ? 108 SER A C    2  
ATOM 3439  O O    . SER A 1 108 ? -13.840 4.946   -6.944  1.00 0.00 ? 108 SER A O    2  
ATOM 3440  C CB   . SER A 1 108 ? -15.224 6.606   -8.971  1.00 0.00 ? 108 SER A CB   2  
ATOM 3441  O OG   . SER A 1 108 ? -15.551 7.395   -10.101 1.00 0.00 ? 108 SER A OG   2  
ATOM 3442  H H    . SER A 1 108 ? -14.301 4.836   -10.576 1.00 0.00 ? 108 SER A H    2  
ATOM 3443  H HA   . SER A 1 108 ? -13.158 6.970   -9.402  1.00 0.00 ? 108 SER A HA   2  
ATOM 3444  H HB2  . SER A 1 108 ? -15.862 5.736   -8.957  1.00 0.00 ? 108 SER A HB2  2  
ATOM 3445  H HB3  . SER A 1 108 ? -15.392 7.190   -8.078  1.00 0.00 ? 108 SER A HB3  2  
ATOM 3446  H HG   . SER A 1 108 ? -15.409 8.322   -9.897  1.00 0.00 ? 108 SER A HG   2  
ATOM 3447  N N    . SER A 1 109 ? -12.235 6.508   -7.163  1.00 0.00 ? 109 SER A N    2  
ATOM 3448  C CA   . SER A 1 109 ? -11.674 6.274   -5.837  1.00 0.00 ? 109 SER A CA   2  
ATOM 3449  C C    . SER A 1 109 ? -10.717 7.397   -5.447  1.00 0.00 ? 109 SER A C    2  
ATOM 3450  O O    . SER A 1 109 ? -10.460 8.309   -6.232  1.00 0.00 ? 109 SER A O    2  
ATOM 3451  C CB   . SER A 1 109 ? -10.944 4.930   -5.799  1.00 0.00 ? 109 SER A CB   2  
ATOM 3452  O OG   . SER A 1 109 ? -9.965  4.852   -6.821  1.00 0.00 ? 109 SER A OG   2  
ATOM 3453  H H    . SER A 1 109 ? -11.831 7.189   -7.740  1.00 0.00 ? 109 SER A H    2  
ATOM 3454  H HA   . SER A 1 109 ? -12.490 6.251   -5.131  1.00 0.00 ? 109 SER A HA   2  
ATOM 3455  H HB2  . SER A 1 109 ? -10.457 4.815   -4.842  1.00 0.00 ? 109 SER A HB2  2  
ATOM 3456  H HB3  . SER A 1 109 ? -11.658 4.132   -5.938  1.00 0.00 ? 109 SER A HB3  2  
ATOM 3457  H HG   . SER A 1 109 ? -9.090  4.856   -6.428  1.00 0.00 ? 109 SER A HG   2  
ATOM 3458  N N    . SER A 1 110 ? -10.193 7.322   -4.227  1.00 0.00 ? 110 SER A N    2  
ATOM 3459  C CA   . SER A 1 110 ? -9.268  8.333   -3.729  1.00 0.00 ? 110 SER A CA   2  
ATOM 3460  C C    . SER A 1 110 ? -7.882  8.150   -4.342  1.00 0.00 ? 110 SER A C    2  
ATOM 3461  O O    . SER A 1 110 ? -6.880  8.074   -3.630  1.00 0.00 ? 110 SER A O    2  
ATOM 3462  C CB   . SER A 1 110 ? -9.176  8.264   -2.204  1.00 0.00 ? 110 SER A CB   2  
ATOM 3463  O OG   . SER A 1 110 ? -10.457 8.387   -1.610  1.00 0.00 ? 110 SER A OG   2  
ATOM 3464  H H    . SER A 1 110 ? -10.437 6.570   -3.648  1.00 0.00 ? 110 SER A H    2  
ATOM 3465  H HA   . SER A 1 110 ? -9.650  9.301   -4.015  1.00 0.00 ? 110 SER A HA   2  
ATOM 3466  H HB2  . SER A 1 110 ? -8.748  7.316   -1.914  1.00 0.00 ? 110 SER A HB2  2  
ATOM 3467  H HB3  . SER A 1 110 ? -8.548  9.067   -1.847  1.00 0.00 ? 110 SER A HB3  2  
ATOM 3468  H HG   . SER A 1 110 ? -10.450 7.973   -0.744  1.00 0.00 ? 110 SER A HG   2  
ATOM 3469  N N    . THR A 1 111 ? -7.833  8.079   -5.669  1.00 0.00 ? 111 THR A N    2  
ATOM 3470  C CA   . THR A 1 111 ? -6.573  7.904   -6.379  1.00 0.00 ? 111 THR A CA   2  
ATOM 3471  C C    . THR A 1 111 ? -6.541  8.735   -7.657  1.00 0.00 ? 111 THR A C    2  
ATOM 3472  O O    . THR A 1 111 ? -7.583  9.147   -8.166  1.00 0.00 ? 111 THR A O    2  
ATOM 3473  C CB   . THR A 1 111 ? -6.329  6.425   -6.735  1.00 0.00 ? 111 THR A CB   2  
ATOM 3474  O OG1  . THR A 1 111 ? -7.210  6.024   -7.790  1.00 0.00 ? 111 THR A OG1  2  
ATOM 3475  C CG2  . THR A 1 111 ? -6.544  5.534   -5.521  1.00 0.00 ? 111 THR A CG2  2  
ATOM 3476  H H    . THR A 1 111 ? -8.666  8.146   -6.181  1.00 0.00 ? 111 THR A H    2  
ATOM 3477  H HA   . THR A 1 111 ? -5.775  8.232   -5.728  1.00 0.00 ? 111 THR A HA   2  
ATOM 3478  H HB   . THR A 1 111 ? -5.307  6.315   -7.068  1.00 0.00 ? 111 THR A HB   2  
ATOM 3479  H HG1  . THR A 1 111 ? -7.232  5.066   -7.842  1.00 0.00 ? 111 THR A HG1  2  
ATOM 3480  H HG21 . THR A 1 111 ? -6.237  4.526   -5.756  1.00 0.00 ? 111 THR A HG21 2  
ATOM 3481  H HG22 . THR A 1 111 ? -7.590  5.538   -5.253  1.00 0.00 ? 111 THR A HG22 2  
ATOM 3482  H HG23 . THR A 1 111 ? -5.959  5.905   -4.694  1.00 0.00 ? 111 THR A HG23 2  
ATOM 3483  N N    . SER A 1 112 ? -5.340  8.977   -8.170  1.00 0.00 ? 112 SER A N    2  
ATOM 3484  C CA   . SER A 1 112 ? -5.173  9.761   -9.388  1.00 0.00 ? 112 SER A CA   2  
ATOM 3485  C C    . SER A 1 112 ? -6.303  9.482   -10.373 1.00 0.00 ? 112 SER A C    2  
ATOM 3486  O O    . SER A 1 112 ? -6.899  8.405   -10.385 1.00 0.00 ? 112 SER A O    2  
ATOM 3487  C CB   . SER A 1 112 ? -3.824  9.450   -10.040 1.00 0.00 ? 112 SER A CB   2  
ATOM 3488  O OG   . SER A 1 112 ? -3.854  8.195   -10.698 1.00 0.00 ? 112 SER A OG   2  
ATOM 3489  H H    . SER A 1 112 ? -4.546  8.621   -7.718  1.00 0.00 ? 112 SER A H    2  
ATOM 3490  H HA   . SER A 1 112 ? -5.198  10.806  -9.115  1.00 0.00 ? 112 SER A HA   2  
ATOM 3491  H HB2  . SER A 1 112 ? -3.591  10.216  -10.763 1.00 0.00 ? 112 SER A HB2  2  
ATOM 3492  H HB3  . SER A 1 112 ? -3.057  9.426   -9.280  1.00 0.00 ? 112 SER A HB3  2  
ATOM 3493  H HG   . SER A 1 112 ? -3.213  7.606   -10.294 1.00 0.00 ? 112 SER A HG   2  
ATOM 3494  N N    . PRO A 1 113 ? -6.607  10.476  -11.221 1.00 0.00 ? 113 PRO A N    2  
ATOM 3495  C CA   . PRO A 1 113 ? -7.668  10.363  -12.227 1.00 0.00 ? 113 PRO A CA   2  
ATOM 3496  C C    . PRO A 1 113 ? -7.306  9.390   -13.343 1.00 0.00 ? 113 PRO A C    2  
ATOM 3497  O O    . PRO A 1 113 ? -6.353  8.618   -13.224 1.00 0.00 ? 113 PRO A O    2  
ATOM 3498  C CB   . PRO A 1 113 ? -7.790  11.786  -12.776 1.00 0.00 ? 113 PRO A CB   2  
ATOM 3499  C CG   . PRO A 1 113 ? -6.454  12.400  -12.536 1.00 0.00 ? 113 PRO A CG   2  
ATOM 3500  C CD   . PRO A 1 113 ? -5.939  11.788  -11.263 1.00 0.00 ? 113 PRO A CD   2  
ATOM 3501  H HA   . PRO A 1 113 ? -8.606  10.065  -11.782 1.00 0.00 ? 113 PRO A HA   2  
ATOM 3502  H HB2  . PRO A 1 113 ? -8.025  11.749  -13.831 1.00 0.00 ? 113 PRO A HB2  2  
ATOM 3503  H HB3  . PRO A 1 113 ? -8.568  12.315  -12.247 1.00 0.00 ? 113 PRO A HB3  2  
ATOM 3504  H HG2  . PRO A 1 113 ? -5.792  12.172  -13.357 1.00 0.00 ? 113 PRO A HG2  2  
ATOM 3505  H HG3  . PRO A 1 113 ? -6.557  13.469  -12.422 1.00 0.00 ? 113 PRO A HG3  2  
ATOM 3506  H HD2  . PRO A 1 113 ? -4.866  11.672  -11.307 1.00 0.00 ? 113 PRO A HD2  2  
ATOM 3507  H HD3  . PRO A 1 113 ? -6.221  12.391  -10.413 1.00 0.00 ? 113 PRO A HD3  2  
ATOM 3508  N N    . LEU A 1 114 ? -8.071  9.431   -14.429 1.00 0.00 ? 114 LEU A N    2  
ATOM 3509  C CA   . LEU A 1 114 ? -7.830  8.553   -15.568 1.00 0.00 ? 114 LEU A CA   2  
ATOM 3510  C C    . LEU A 1 114 ? -6.642  9.041   -16.391 1.00 0.00 ? 114 LEU A C    2  
ATOM 3511  O O    . LEU A 1 114 ? -5.882  8.242   -16.935 1.00 0.00 ? 114 LEU A O    2  
ATOM 3512  C CB   . LEU A 1 114 ? -9.078  8.475   -16.450 1.00 0.00 ? 114 LEU A CB   2  
ATOM 3513  C CG   . LEU A 1 114 ? -9.496  9.774   -17.138 1.00 0.00 ? 114 LEU A CG   2  
ATOM 3514  C CD1  . LEU A 1 114 ? -10.186 9.480   -18.461 1.00 0.00 ? 114 LEU A CD1  2  
ATOM 3515  C CD2  . LEU A 1 114 ? -10.404 10.591  -16.231 1.00 0.00 ? 114 LEU A CD2  2  
ATOM 3516  H H    . LEU A 1 114 ? -8.815  10.067  -14.466 1.00 0.00 ? 114 LEU A H    2  
ATOM 3517  H HA   . LEU A 1 114 ? -7.607  7.568   -15.186 1.00 0.00 ? 114 LEU A HA   2  
ATOM 3518  H HB2  . LEU A 1 114 ? -8.895  7.738   -17.217 1.00 0.00 ? 114 LEU A HB2  2  
ATOM 3519  H HB3  . LEU A 1 114 ? -9.900  8.149   -15.829 1.00 0.00 ? 114 LEU A HB3  2  
ATOM 3520  H HG   . LEU A 1 114 ? -8.613  10.364  -17.347 1.00 0.00 ? 114 LEU A HG   2  
ATOM 3521  H HD11 . LEU A 1 114 ? -11.219 9.227   -18.279 1.00 0.00 ? 114 LEU A HD11 2  
ATOM 3522  H HD12 . LEU A 1 114 ? -9.693  8.651   -18.948 1.00 0.00 ? 114 LEU A HD12 2  
ATOM 3523  H HD13 . LEU A 1 114 ? -10.134 10.352  -19.096 1.00 0.00 ? 114 LEU A HD13 2  
ATOM 3524  H HD21 . LEU A 1 114 ? -10.973 9.925   -15.599 1.00 0.00 ? 114 LEU A HD21 2  
ATOM 3525  H HD22 . LEU A 1 114 ? -11.081 11.179  -16.834 1.00 0.00 ? 114 LEU A HD22 2  
ATOM 3526  H HD23 . LEU A 1 114 ? -9.805  11.246  -15.617 1.00 0.00 ? 114 LEU A HD23 2  
ATOM 3527  N N    . GLU A 1 115 ? -6.489  10.359  -16.475 1.00 0.00 ? 115 GLU A N    2  
ATOM 3528  C CA   . GLU A 1 115 ? -5.392  10.954  -17.230 1.00 0.00 ? 115 GLU A CA   2  
ATOM 3529  C C    . GLU A 1 115 ? -4.717  12.062  -16.428 1.00 0.00 ? 115 GLU A C    2  
ATOM 3530  O O    . GLU A 1 115 ? -4.886  13.251  -16.700 1.00 0.00 ? 115 GLU A O    2  
ATOM 3531  C CB   . GLU A 1 115 ? -5.903  11.510  -18.561 1.00 0.00 ? 115 GLU A CB   2  
ATOM 3532  C CG   . GLU A 1 115 ? -4.804  12.067  -19.450 1.00 0.00 ? 115 GLU A CG   2  
ATOM 3533  C CD   . GLU A 1 115 ? -5.346  12.755  -20.687 1.00 0.00 ? 115 GLU A CD   2  
ATOM 3534  O OE1  . GLU A 1 115 ? -6.501  13.227  -20.645 1.00 0.00 ? 115 GLU A OE1  2  
ATOM 3535  O OE2  . GLU A 1 115 ? -4.615  12.822  -21.697 1.00 0.00 ? 115 GLU A OE2  2  
ATOM 3536  H H    . GLU A 1 115 ? -7.129  10.945  -16.018 1.00 0.00 ? 115 GLU A H    2  
ATOM 3537  H HA   . GLU A 1 115 ? -4.668  10.178  -17.429 1.00 0.00 ? 115 GLU A HA   2  
ATOM 3538  H HB2  . GLU A 1 115 ? -6.408  10.721  -19.098 1.00 0.00 ? 115 GLU A HB2  2  
ATOM 3539  H HB3  . GLU A 1 115 ? -6.608  12.303  -18.358 1.00 0.00 ? 115 GLU A HB3  2  
ATOM 3540  H HG2  . GLU A 1 115 ? -4.227  12.782  -18.883 1.00 0.00 ? 115 GLU A HG2  2  
ATOM 3541  H HG3  . GLU A 1 115 ? -4.163  11.254  -19.759 1.00 0.00 ? 115 GLU A HG3  2  
ATOM 3542  N N    . PRO A 1 116 ? -3.935  11.666  -15.413 1.00 0.00 ? 116 PRO A N    2  
ATOM 3543  C CA   . PRO A 1 116 ? -3.218  12.609  -14.550 1.00 0.00 ? 116 PRO A CA   2  
ATOM 3544  C C    . PRO A 1 116 ? -2.081  13.315  -15.281 1.00 0.00 ? 116 PRO A C    2  
ATOM 3545  O O    . PRO A 1 116 ? -1.576  12.840  -16.299 1.00 0.00 ? 116 PRO A O    2  
ATOM 3546  C CB   . PRO A 1 116 ? -2.666  11.720  -13.434 1.00 0.00 ? 116 PRO A CB   2  
ATOM 3547  C CG   . PRO A 1 116 ? -2.556  10.367  -14.047 1.00 0.00 ? 116 PRO A CG   2  
ATOM 3548  C CD   . PRO A 1 116 ? -3.688  10.265  -15.032 1.00 0.00 ? 116 PRO A CD   2  
ATOM 3549  H HA   . PRO A 1 116 ? -3.886  13.347  -14.129 1.00 0.00 ? 116 PRO A HA   2  
ATOM 3550  H HB2  . PRO A 1 116 ? -1.701  12.091  -13.119 1.00 0.00 ? 116 PRO A HB2  2  
ATOM 3551  H HB3  . PRO A 1 116 ? -3.348  11.720  -12.597 1.00 0.00 ? 116 PRO A HB3  2  
ATOM 3552  H HG2  . PRO A 1 116 ? -1.608  10.269  -14.554 1.00 0.00 ? 116 PRO A HG2  2  
ATOM 3553  H HG3  . PRO A 1 116 ? -2.655  9.609   -13.283 1.00 0.00 ? 116 PRO A HG3  2  
ATOM 3554  H HD2  . PRO A 1 116 ? -3.391  9.678   -15.888 1.00 0.00 ? 116 PRO A HD2  2  
ATOM 3555  H HD3  . PRO A 1 116 ? -4.560  9.835   -14.561 1.00 0.00 ? 116 PRO A HD3  2  
ATOM 3556  N N    . PRO A 1 117 ? -1.666  14.476  -14.752 1.00 0.00 ? 117 PRO A N    2  
ATOM 3557  C CA   . PRO A 1 117 ? -0.583  15.271  -15.338 1.00 0.00 ? 117 PRO A CA   2  
ATOM 3558  C C    . PRO A 1 117 ? 0.778   14.600  -15.182 1.00 0.00 ? 117 PRO A C    2  
ATOM 3559  O O    . PRO A 1 117 ? 1.524   14.899  -14.250 1.00 0.00 ? 117 PRO A O    2  
ATOM 3560  C CB   . PRO A 1 117 ? -0.630  16.577  -14.541 1.00 0.00 ? 117 PRO A CB   2  
ATOM 3561  C CG   . PRO A 1 117 ? -1.245  16.202  -13.237 1.00 0.00 ? 117 PRO A CG   2  
ATOM 3562  C CD   . PRO A 1 117 ? -2.223  15.101  -13.540 1.00 0.00 ? 117 PRO A CD   2  
ATOM 3563  H HA   . PRO A 1 117 ? -0.763  15.478  -16.383 1.00 0.00 ? 117 PRO A HA   2  
ATOM 3564  H HB2  . PRO A 1 117 ? 0.372   16.959  -14.411 1.00 0.00 ? 117 PRO A HB2  2  
ATOM 3565  H HB3  . PRO A 1 117 ? -1.233  17.302  -15.067 1.00 0.00 ? 117 PRO A HB3  2  
ATOM 3566  H HG2  . PRO A 1 117 ? -0.483  15.851  -12.559 1.00 0.00 ? 117 PRO A HG2  2  
ATOM 3567  H HG3  . PRO A 1 117 ? -1.760  17.054  -12.816 1.00 0.00 ? 117 PRO A HG3  2  
ATOM 3568  H HD2  . PRO A 1 117 ? -2.261  14.394  -12.724 1.00 0.00 ? 117 PRO A HD2  2  
ATOM 3569  H HD3  . PRO A 1 117 ? -3.204  15.510  -13.734 1.00 0.00 ? 117 PRO A HD3  2  
ATOM 3570  N N    . SER A 1 118 ? 1.094   13.693  -16.100 1.00 0.00 ? 118 SER A N    2  
ATOM 3571  C CA   . SER A 1 118 ? 2.365   12.978  -16.062 1.00 0.00 ? 118 SER A CA   2  
ATOM 3572  C C    . SER A 1 118 ? 2.605   12.228  -17.369 1.00 0.00 ? 118 SER A C    2  
ATOM 3573  O O    . SER A 1 118 ? 1.786   12.279  -18.286 1.00 0.00 ? 118 SER A O    2  
ATOM 3574  C CB   . SER A 1 118 ? 2.388   11.999  -14.887 1.00 0.00 ? 118 SER A CB   2  
ATOM 3575  O OG   . SER A 1 118 ? 1.385   11.009  -15.028 1.00 0.00 ? 118 SER A OG   2  
ATOM 3576  H H    . SER A 1 118 ? 0.457   13.499  -16.819 1.00 0.00 ? 118 SER A H    2  
ATOM 3577  H HA   . SER A 1 118 ? 3.151   13.706  -15.929 1.00 0.00 ? 118 SER A HA   2  
ATOM 3578  H HB2  . SER A 1 118 ? 3.352   11.515  -14.844 1.00 0.00 ? 118 SER A HB2  2  
ATOM 3579  H HB3  . SER A 1 118 ? 2.216   12.540  -13.968 1.00 0.00 ? 118 SER A HB3  2  
ATOM 3580  H HG   . SER A 1 118 ? 0.565   11.421  -15.311 1.00 0.00 ? 118 SER A HG   2  
ATOM 3581  N N    . ASP A 1 119 ? 3.734   11.532  -17.445 1.00 0.00 ? 119 ASP A N    2  
ATOM 3582  C CA   . ASP A 1 119 ? 4.084   10.770  -18.638 1.00 0.00 ? 119 ASP A CA   2  
ATOM 3583  C C    . ASP A 1 119 ? 3.159   9.569   -18.805 1.00 0.00 ? 119 ASP A C    2  
ATOM 3584  O O    . ASP A 1 119 ? 2.242   9.362   -18.009 1.00 0.00 ? 119 ASP A O    2  
ATOM 3585  C CB   . ASP A 1 119 ? 5.538   10.303  -18.563 1.00 0.00 ? 119 ASP A CB   2  
ATOM 3586  C CG   . ASP A 1 119 ? 6.475   11.401  -18.100 1.00 0.00 ? 119 ASP A CG   2  
ATOM 3587  O OD1  . ASP A 1 119 ? 6.565   11.627  -16.875 1.00 0.00 ? 119 ASP A OD1  2  
ATOM 3588  O OD2  . ASP A 1 119 ? 7.119   12.035  -18.962 1.00 0.00 ? 119 ASP A OD2  2  
ATOM 3589  H H    . ASP A 1 119 ? 4.347   11.531  -16.680 1.00 0.00 ? 119 ASP A H    2  
ATOM 3590  H HA   . ASP A 1 119 ? 3.967   11.419  -19.492 1.00 0.00 ? 119 ASP A HA   2  
ATOM 3591  H HB2  . ASP A 1 119 ? 5.609   9.478   -17.869 1.00 0.00 ? 119 ASP A HB2  2  
ATOM 3592  H HB3  . ASP A 1 119 ? 5.854   9.973   -19.541 1.00 0.00 ? 119 ASP A HB3  2  
ATOM 3593  N N    . ARG A 1 120 ? 3.404   8.779   -19.846 1.00 0.00 ? 120 ARG A N    2  
ATOM 3594  C CA   . ARG A 1 120 ? 2.592   7.600   -20.119 1.00 0.00 ? 120 ARG A CA   2  
ATOM 3595  C C    . ARG A 1 120 ? 3.270   6.339   -19.591 1.00 0.00 ? 120 ARG A C    2  
ATOM 3596  O O    . ARG A 1 120 ? 4.417   6.377   -19.149 1.00 0.00 ? 120 ARG A O    2  
ATOM 3597  C CB   . ARG A 1 120 ? 2.339   7.465   -21.622 1.00 0.00 ? 120 ARG A CB   2  
ATOM 3598  C CG   . ARG A 1 120 ? 1.584   8.641   -22.220 1.00 0.00 ? 120 ARG A CG   2  
ATOM 3599  C CD   . ARG A 1 120 ? 2.518   9.795   -22.547 1.00 0.00 ? 120 ARG A CD   2  
ATOM 3600  N NE   . ARG A 1 120 ? 3.503   9.432   -23.562 1.00 0.00 ? 120 ARG A NE   2  
ATOM 3601  C CZ   . ARG A 1 120 ? 4.664   10.059  -23.717 1.00 0.00 ? 120 ARG A CZ   2  
ATOM 3602  N NH1  . ARG A 1 120 ? 4.983   11.076  -22.927 1.00 0.00 ? 120 ARG A NH1  2  
ATOM 3603  N NH2  . ARG A 1 120 ? 5.508   9.670   -24.664 1.00 0.00 ? 120 ARG A NH2  2  
ATOM 3604  H H    . ARG A 1 120 ? 4.149   8.996   -20.445 1.00 0.00 ? 120 ARG A H    2  
ATOM 3605  H HA   . ARG A 1 120 ? 1.646   7.724   -19.614 1.00 0.00 ? 120 ARG A HA   2  
ATOM 3606  H HB2  . ARG A 1 120 ? 3.289   7.381   -22.129 1.00 0.00 ? 120 ARG A HB2  2  
ATOM 3607  H HB3  . ARG A 1 120 ? 1.765   6.568   -21.799 1.00 0.00 ? 120 ARG A HB3  2  
ATOM 3608  H HG2  . ARG A 1 120 ? 1.097   8.319   -23.129 1.00 0.00 ? 120 ARG A HG2  2  
ATOM 3609  H HG3  . ARG A 1 120 ? 0.842   8.978   -21.511 1.00 0.00 ? 120 ARG A HG3  2  
ATOM 3610  H HD2  . ARG A 1 120 ? 1.930   10.625  -22.910 1.00 0.00 ? 120 ARG A HD2  2  
ATOM 3611  H HD3  . ARG A 1 120 ? 3.035   10.088  -21.645 1.00 0.00 ? 120 ARG A HD3  2  
ATOM 3612  H HE   . ARG A 1 120 ? 3.288   8.684   -24.156 1.00 0.00 ? 120 ARG A HE   2  
ATOM 3613  H HH11 . ARG A 1 120 ? 4.349   11.370  -22.213 1.00 0.00 ? 120 ARG A HH11 2  
ATOM 3614  H HH12 . ARG A 1 120 ? 5.858   11.545  -23.046 1.00 0.00 ? 120 ARG A HH12 2  
ATOM 3615  H HH21 . ARG A 1 120 ? 5.271   8.905   -25.261 1.00 0.00 ? 120 ARG A HH21 2  
ATOM 3616  H HH22 . ARG A 1 120 ? 6.381   10.143  -24.780 1.00 0.00 ? 120 ARG A HH22 2  
ATOM 3617  N N    . GLY A 1 121 ? 2.551   5.221   -19.641 1.00 0.00 ? 121 GLY A N    2  
ATOM 3618  C CA   . GLY A 1 121 ? 3.100   3.965   -19.165 1.00 0.00 ? 121 GLY A CA   2  
ATOM 3619  C C    . GLY A 1 121 ? 2.935   2.842   -20.170 1.00 0.00 ? 121 GLY A C    2  
ATOM 3620  O O    . GLY A 1 121 ? 2.060   2.896   -21.035 1.00 0.00 ? 121 GLY A O    2  
ATOM 3621  H H    . GLY A 1 121 ? 1.642   5.250   -20.005 1.00 0.00 ? 121 GLY A H    2  
ATOM 3622  H HA2  . GLY A 1 121 ? 4.151   4.098   -18.959 1.00 0.00 ? 121 GLY A HA2  2  
ATOM 3623  H HA3  . GLY A 1 121 ? 2.596   3.689   -18.250 1.00 0.00 ? 121 GLY A HA3  2  
ATOM 3624  N N    . THR A 1 122 ? 3.780   1.822   -20.059 1.00 0.00 ? 122 THR A N    2  
ATOM 3625  C CA   . THR A 1 122 ? 3.726   0.683   -20.967 1.00 0.00 ? 122 THR A CA   2  
ATOM 3626  C C    . THR A 1 122 ? 2.715   -0.353  -20.490 1.00 0.00 ? 122 THR A C    2  
ATOM 3627  O O    . THR A 1 122 ? 2.878   -0.952  -19.427 1.00 0.00 ? 122 THR A O    2  
ATOM 3628  C CB   . THR A 1 122 ? 5.105   0.011   -21.106 1.00 0.00 ? 122 THR A CB   2  
ATOM 3629  O OG1  . THR A 1 122 ? 5.035   -1.058  -22.057 1.00 0.00 ? 122 THR A OG1  2  
ATOM 3630  C CG2  . THR A 1 122 ? 5.584   -0.527  -19.766 1.00 0.00 ? 122 THR A CG2  2  
ATOM 3631  H H    . THR A 1 122 ? 4.455   1.837   -19.349 1.00 0.00 ? 122 THR A H    2  
ATOM 3632  H HA   . THR A 1 122 ? 3.426   1.045   -21.939 1.00 0.00 ? 122 THR A HA   2  
ATOM 3633  H HB   . THR A 1 122 ? 5.814   0.747   -21.456 1.00 0.00 ? 122 THR A HB   2  
ATOM 3634  H HG1  . THR A 1 122 ? 4.251   -1.587  -21.887 1.00 0.00 ? 122 THR A HG1  2  
ATOM 3635  H HG21 . THR A 1 122 ? 5.095   -1.468  -19.560 1.00 0.00 ? 122 THR A HG21 2  
ATOM 3636  H HG22 . THR A 1 122 ? 5.343   0.182   -18.988 1.00 0.00 ? 122 THR A HG22 2  
ATOM 3637  H HG23 . THR A 1 122 ? 6.652   -0.676  -19.799 1.00 0.00 ? 122 THR A HG23 2  
ATOM 3638  N N    . VAL A 1 123 ? 1.669   -0.561  -21.284 1.00 0.00 ? 123 VAL A N    2  
ATOM 3639  C CA   . VAL A 1 123 ? 0.631   -1.527  -20.944 1.00 0.00 ? 123 VAL A CA   2  
ATOM 3640  C C    . VAL A 1 123 ? 0.702   -2.752  -21.849 1.00 0.00 ? 123 VAL A C    2  
ATOM 3641  O O    . VAL A 1 123 ? 1.067   -2.651  -23.020 1.00 0.00 ? 123 VAL A O    2  
ATOM 3642  C CB   . VAL A 1 123 ? -0.773  -0.903  -21.052 1.00 0.00 ? 123 VAL A CB   2  
ATOM 3643  C CG1  . VAL A 1 123 ? -1.846  -1.961  -20.841 1.00 0.00 ? 123 VAL A CG1  2  
ATOM 3644  C CG2  . VAL A 1 123 ? -0.930  0.233   -20.053 1.00 0.00 ? 123 VAL A CG2  2  
ATOM 3645  H H    . VAL A 1 123 ? 1.594   -0.053  -22.119 1.00 0.00 ? 123 VAL A H    2  
ATOM 3646  H HA   . VAL A 1 123 ? 0.786   -1.837  -19.921 1.00 0.00 ? 123 VAL A HA   2  
ATOM 3647  H HB   . VAL A 1 123 ? -0.890  -0.498  -22.046 1.00 0.00 ? 123 VAL A HB   2  
ATOM 3648  H HG11 . VAL A 1 123 ? -1.858  -2.258  -19.802 1.00 0.00 ? 123 VAL A HG11 2  
ATOM 3649  H HG12 . VAL A 1 123 ? -2.810  -1.556  -21.113 1.00 0.00 ? 123 VAL A HG12 2  
ATOM 3650  H HG13 . VAL A 1 123 ? -1.629  -2.821  -21.457 1.00 0.00 ? 123 VAL A HG13 2  
ATOM 3651  H HG21 . VAL A 1 123 ? -1.248  1.126   -20.570 1.00 0.00 ? 123 VAL A HG21 2  
ATOM 3652  H HG22 . VAL A 1 123 ? -1.670  -0.036  -19.313 1.00 0.00 ? 123 VAL A HG22 2  
ATOM 3653  H HG23 . VAL A 1 123 ? 0.016   0.417   -19.565 1.00 0.00 ? 123 VAL A HG23 2  
ATOM 3654  N N    . SER A 1 124 ? 0.350   -3.909  -21.298 1.00 0.00 ? 124 SER A N    2  
ATOM 3655  C CA   . SER A 1 124 ? 0.376   -5.155  -22.054 1.00 0.00 ? 124 SER A CA   2  
ATOM 3656  C C    . SER A 1 124 ? -1.039  -5.638  -22.355 1.00 0.00 ? 124 SER A C    2  
ATOM 3657  O O    . SER A 1 124 ? -1.344  -6.040  -23.477 1.00 0.00 ? 124 SER A O    2  
ATOM 3658  C CB   . SER A 1 124 ? 1.141   -6.230  -21.279 1.00 0.00 ? 124 SER A CB   2  
ATOM 3659  O OG   . SER A 1 124 ? 0.499   -6.526  -20.051 1.00 0.00 ? 124 SER A OG   2  
ATOM 3660  H H    . SER A 1 124 ? 0.067   -3.925  -20.359 1.00 0.00 ? 124 SER A H    2  
ATOM 3661  H HA   . SER A 1 124 ? 0.886   -4.966  -22.987 1.00 0.00 ? 124 SER A HA   2  
ATOM 3662  H HB2  . SER A 1 124 ? 1.190   -7.131  -21.872 1.00 0.00 ? 124 SER A HB2  2  
ATOM 3663  H HB3  . SER A 1 124 ? 2.142   -5.879  -21.074 1.00 0.00 ? 124 SER A HB3  2  
ATOM 3664  H HG   . SER A 1 124 ? 0.140   -5.719  -19.675 1.00 0.00 ? 124 SER A HG   2  
ATOM 3665  N N    . GLY A 1 125 ? -1.900  -5.596  -21.343 1.00 0.00 ? 125 GLY A N    2  
ATOM 3666  C CA   . GLY A 1 125 ? -3.273  -6.032  -21.518 1.00 0.00 ? 125 GLY A CA   2  
ATOM 3667  C C    . GLY A 1 125 ? -3.581  -7.301  -20.749 1.00 0.00 ? 125 GLY A C    2  
ATOM 3668  O O    . GLY A 1 125 ? -3.896  -7.270  -19.559 1.00 0.00 ? 125 GLY A O    2  
ATOM 3669  H H    . GLY A 1 125 ? -1.601  -5.265  -20.470 1.00 0.00 ? 125 GLY A H    2  
ATOM 3670  H HA2  . GLY A 1 125 ? -3.934  -5.248  -21.180 1.00 0.00 ? 125 GLY A HA2  2  
ATOM 3671  H HA3  . GLY A 1 125 ? -3.451  -6.210  -22.569 1.00 0.00 ? 125 GLY A HA3  2  
ATOM 3672  N N    . PRO A 1 126 ? -3.493  -8.450  -21.435 1.00 0.00 ? 126 PRO A N    2  
ATOM 3673  C CA   . PRO A 1 126 ? -3.762  -9.757  -20.828 1.00 0.00 ? 126 PRO A CA   2  
ATOM 3674  C C    . PRO A 1 126 ? -2.689  -10.161 -19.822 1.00 0.00 ? 126 PRO A C    2  
ATOM 3675  O O    . PRO A 1 126 ? -1.652  -9.508  -19.710 1.00 0.00 ? 126 PRO A O    2  
ATOM 3676  C CB   . PRO A 1 126 ? -3.759  -10.711 -22.025 1.00 0.00 ? 126 PRO A CB   2  
ATOM 3677  C CG   . PRO A 1 126 ? -2.906  -10.038 -23.044 1.00 0.00 ? 126 PRO A CG   2  
ATOM 3678  C CD   . PRO A 1 126 ? -3.123  -8.562  -22.856 1.00 0.00 ? 126 PRO A CD   2  
ATOM 3679  H HA   . PRO A 1 126 ? -4.730  -9.780  -20.349 1.00 0.00 ? 126 PRO A HA   2  
ATOM 3680  H HB2  . PRO A 1 126 ? -3.344  -11.664 -21.728 1.00 0.00 ? 126 PRO A HB2  2  
ATOM 3681  H HB3  . PRO A 1 126 ? -4.768  -10.848 -22.383 1.00 0.00 ? 126 PRO A HB3  2  
ATOM 3682  H HG2  . PRO A 1 126 ? -1.869  -10.289 -22.879 1.00 0.00 ? 126 PRO A HG2  2  
ATOM 3683  H HG3  . PRO A 1 126 ? -3.213  -10.338 -24.035 1.00 0.00 ? 126 PRO A HG3  2  
ATOM 3684  H HD2  . PRO A 1 126 ? -2.213  -8.018  -23.061 1.00 0.00 ? 126 PRO A HD2  2  
ATOM 3685  H HD3  . PRO A 1 126 ? -3.924  -8.214  -23.491 1.00 0.00 ? 126 PRO A HD3  2  
ATOM 3686  N N    . SER A 1 127 ? -2.946  -11.242 -19.093 1.00 0.00 ? 127 SER A N    2  
ATOM 3687  C CA   . SER A 1 127 ? -2.003  -11.731 -18.093 1.00 0.00 ? 127 SER A CA   2  
ATOM 3688  C C    . SER A 1 127 ? -1.522  -13.137 -18.442 1.00 0.00 ? 127 SER A C    2  
ATOM 3689  O O    . SER A 1 127 ? -2.225  -14.120 -18.212 1.00 0.00 ? 127 SER A O    2  
ATOM 3690  C CB   . SER A 1 127 ? -2.651  -11.731 -16.707 1.00 0.00 ? 127 SER A CB   2  
ATOM 3691  O OG   . SER A 1 127 ? -1.886  -12.491 -15.787 1.00 0.00 ? 127 SER A OG   2  
ATOM 3692  H H    . SER A 1 127 ? -3.790  -11.721 -19.228 1.00 0.00 ? 127 SER A H    2  
ATOM 3693  H HA   . SER A 1 127 ? -1.154  -11.065 -18.085 1.00 0.00 ? 127 SER A HA   2  
ATOM 3694  H HB2  . SER A 1 127 ? -2.721  -10.716 -16.346 1.00 0.00 ? 127 SER A HB2  2  
ATOM 3695  H HB3  . SER A 1 127 ? -3.640  -12.159 -16.775 1.00 0.00 ? 127 SER A HB3  2  
ATOM 3696  H HG   . SER A 1 127 ? -1.325  -11.904 -15.275 1.00 0.00 ? 127 SER A HG   2  
ATOM 3697  N N    . SER A 1 128 ? -0.319  -13.222 -19.000 1.00 0.00 ? 128 SER A N    2  
ATOM 3698  C CA   . SER A 1 128 ? 0.256   -14.506 -19.385 1.00 0.00 ? 128 SER A CA   2  
ATOM 3699  C C    . SER A 1 128 ? 1.605   -14.723 -18.705 1.00 0.00 ? 128 SER A C    2  
ATOM 3700  O O    . SER A 1 128 ? 1.862   -15.783 -18.136 1.00 0.00 ? 128 SER A O    2  
ATOM 3701  C CB   . SER A 1 128 ? 0.420   -14.580 -20.904 1.00 0.00 ? 128 SER A CB   2  
ATOM 3702  O OG   . SER A 1 128 ? 1.148   -13.467 -21.393 1.00 0.00 ? 128 SER A OG   2  
ATOM 3703  H H    . SER A 1 128 ? 0.194   -12.402 -19.158 1.00 0.00 ? 128 SER A H    2  
ATOM 3704  H HA   . SER A 1 128 ? -0.423  -15.282 -19.066 1.00 0.00 ? 128 SER A HA   2  
ATOM 3705  H HB2  . SER A 1 128 ? 0.951   -15.484 -21.162 1.00 0.00 ? 128 SER A HB2  2  
ATOM 3706  H HB3  . SER A 1 128 ? -0.555  -14.590 -21.368 1.00 0.00 ? 128 SER A HB3  2  
ATOM 3707  H HG   . SER A 1 128 ? 1.918   -13.775 -21.876 1.00 0.00 ? 128 SER A HG   2  
ATOM 3708  N N    . GLY A 1 129 ? 2.463   -13.709 -18.769 1.00 0.00 ? 129 GLY A N    2  
ATOM 3709  C CA   . GLY A 1 129 ? 3.775   -13.808 -18.157 1.00 0.00 ? 129 GLY A CA   2  
ATOM 3710  C C    . GLY A 1 129 ? 3.780   -13.332 -16.717 1.00 0.00 ? 129 GLY A C    2  
ATOM 3711  O O    . GLY A 1 129 ? 4.525   -12.419 -16.361 1.00 0.00 ? 129 GLY A O    2  
ATOM 3712  H H    . GLY A 1 129 ? 2.203   -12.888 -19.236 1.00 0.00 ? 129 GLY A H    2  
ATOM 3713  H HA2  . GLY A 1 129 ? 4.097   -14.838 -18.186 1.00 0.00 ? 129 GLY A HA2  2  
ATOM 3714  H HA3  . GLY A 1 129 ? 4.470   -13.207 -18.724 1.00 0.00 ? 129 GLY A HA3  2  
ATOM 3715  N N    . GLY A 1 1   ? -14.362 11.233  -34.240 1.00 0.00 ? 1   GLY A N    3  
ATOM 3716  C CA   . GLY A 1 1   ? -14.860 12.126  -33.210 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3717  C C    . GLY A 1 1   ? -16.262 11.768  -32.760 1.00 0.00 ? 1   GLY A C    3  
ATOM 3718  O O    . GLY A 1 1   ? -17.242 12.319  -33.262 1.00 0.00 ? 1   GLY A O    3  
ATOM 3719  H H1   . GLY A 1 1   ? -14.988 10.816  -34.868 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3720  H HA2  . GLY A 1 1   ? -14.197 12.080  -32.358 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3721  H HA3  . GLY A 1 1   ? -14.865 13.134  -33.596 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3722  N N    . SER A 1 2   ? -16.360 10.840  -31.813 1.00 0.00 ? 2   SER A N    3  
ATOM 3723  C CA   . SER A 1 2   ? -17.654 10.405  -31.300 1.00 0.00 ? 2   SER A CA   3  
ATOM 3724  C C    . SER A 1 2   ? -18.263 11.468  -30.391 1.00 0.00 ? 2   SER A C    3  
ATOM 3725  O O    . SER A 1 2   ? -19.385 11.923  -30.614 1.00 0.00 ? 2   SER A O    3  
ATOM 3726  C CB   . SER A 1 2   ? -17.506 9.088   -30.536 1.00 0.00 ? 2   SER A CB   3  
ATOM 3727  O OG   . SER A 1 2   ? -18.759 8.443   -30.384 1.00 0.00 ? 2   SER A OG   3  
ATOM 3728  H H    . SER A 1 2   ? -15.542 10.438  -31.453 1.00 0.00 ? 2   SER A H    3  
ATOM 3729  H HA   . SER A 1 2   ? -18.310 10.251  -32.143 1.00 0.00 ? 2   SER A HA   3  
ATOM 3730  H HB2  . SER A 1 2   ? -16.841 8.433   -31.078 1.00 0.00 ? 2   SER A HB2  3  
ATOM 3731  H HB3  . SER A 1 2   ? -17.096 9.287   -29.556 1.00 0.00 ? 2   SER A HB3  3  
ATOM 3732  H HG   . SER A 1 2   ? -19.465 9.076   -30.535 1.00 0.00 ? 2   SER A HG   3  
ATOM 3733  N N    . SER A 1 3   ? -17.514 11.860  -29.364 1.00 0.00 ? 3   SER A N    3  
ATOM 3734  C CA   . SER A 1 3   ? -17.981 12.866  -28.418 1.00 0.00 ? 3   SER A CA   3  
ATOM 3735  C C    . SER A 1 3   ? -19.243 12.395  -27.702 1.00 0.00 ? 3   SER A C    3  
ATOM 3736  O O    . SER A 1 3   ? -20.184 13.163  -27.509 1.00 0.00 ? 3   SER A O    3  
ATOM 3737  C CB   . SER A 1 3   ? -18.253 14.187  -29.139 1.00 0.00 ? 3   SER A CB   3  
ATOM 3738  O OG   . SER A 1 3   ? -17.046 14.879  -29.410 1.00 0.00 ? 3   SER A OG   3  
ATOM 3739  H H    . SER A 1 3   ? -16.628 11.460  -29.239 1.00 0.00 ? 3   SER A H    3  
ATOM 3740  H HA   . SER A 1 3   ? -17.202 13.019  -27.686 1.00 0.00 ? 3   SER A HA   3  
ATOM 3741  H HB2  . SER A 1 3   ? -18.757 13.988  -30.073 1.00 0.00 ? 3   SER A HB2  3  
ATOM 3742  H HB3  . SER A 1 3   ? -18.880 14.811  -28.518 1.00 0.00 ? 3   SER A HB3  3  
ATOM 3743  H HG   . SER A 1 3   ? -16.308 14.391  -29.039 1.00 0.00 ? 3   SER A HG   3  
ATOM 3744  N N    . GLY A 1 4   ? -19.254 11.124  -27.310 1.00 0.00 ? 4   GLY A N    3  
ATOM 3745  C CA   . GLY A 1 4   ? -20.405 10.571  -26.620 1.00 0.00 ? 4   GLY A CA   3  
ATOM 3746  C C    . GLY A 1 4   ? -20.012 9.601   -25.524 1.00 0.00 ? 4   GLY A C    3  
ATOM 3747  O O    . GLY A 1 4   ? -19.377 9.986   -24.543 1.00 0.00 ? 4   GLY A O    3  
ATOM 3748  H H    . GLY A 1 4   ? -18.475 10.558  -27.491 1.00 0.00 ? 4   GLY A H    3  
ATOM 3749  H HA2  . GLY A 1 4   ? -20.973 11.380  -26.184 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3750  H HA3  . GLY A 1 4   ? -21.026 10.054  -27.337 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3751  N N    . SER A 1 5   ? -20.392 8.338   -25.690 1.00 0.00 ? 5   SER A N    3  
ATOM 3752  C CA   . SER A 1 5   ? -20.080 7.310   -24.704 1.00 0.00 ? 5   SER A CA   3  
ATOM 3753  C C    . SER A 1 5   ? -20.035 5.930   -25.353 1.00 0.00 ? 5   SER A C    3  
ATOM 3754  O O    . SER A 1 5   ? -20.393 5.769   -26.520 1.00 0.00 ? 5   SER A O    3  
ATOM 3755  C CB   . SER A 1 5   ? -21.116 7.322   -23.578 1.00 0.00 ? 5   SER A CB   3  
ATOM 3756  O OG   . SER A 1 5   ? -21.054 8.531   -22.841 1.00 0.00 ? 5   SER A OG   3  
ATOM 3757  H H    . SER A 1 5   ? -20.896 8.092   -26.494 1.00 0.00 ? 5   SER A H    3  
ATOM 3758  H HA   . SER A 1 5   ? -19.108 7.532   -24.289 1.00 0.00 ? 5   SER A HA   3  
ATOM 3759  H HB2  . SER A 1 5   ? -22.104 7.223   -24.000 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3760  H HB3  . SER A 1 5   ? -20.926 6.496   -22.909 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3761  H HG   . SER A 1 5   ? -21.922 8.735   -22.486 1.00 0.00 ? 5   SER A HG   3  
ATOM 3762  N N    . SER A 1 6   ? -19.591 4.937   -24.588 1.00 0.00 ? 6   SER A N    3  
ATOM 3763  C CA   . SER A 1 6   ? -19.495 3.571   -25.089 1.00 0.00 ? 6   SER A CA   3  
ATOM 3764  C C    . SER A 1 6   ? -19.246 2.590   -23.947 1.00 0.00 ? 6   SER A C    3  
ATOM 3765  O O    . SER A 1 6   ? -18.980 2.992   -22.815 1.00 0.00 ? 6   SER A O    3  
ATOM 3766  C CB   . SER A 1 6   ? -18.372 3.463   -26.123 1.00 0.00 ? 6   SER A CB   3  
ATOM 3767  O OG   . SER A 1 6   ? -18.397 2.203   -26.772 1.00 0.00 ? 6   SER A OG   3  
ATOM 3768  H H    . SER A 1 6   ? -19.320 5.129   -23.666 1.00 0.00 ? 6   SER A H    3  
ATOM 3769  H HA   . SER A 1 6   ? -20.433 3.324   -25.562 1.00 0.00 ? 6   SER A HA   3  
ATOM 3770  H HB2  . SER A 1 6   ? -18.492 4.238   -26.863 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3771  H HB3  . SER A 1 6   ? -17.419 3.581   -25.628 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3772  H HG   . SER A 1 6   ? -18.046 2.294   -27.661 1.00 0.00 ? 6   SER A HG   3  
ATOM 3773  N N    . GLY A 1 7   ? -19.337 1.300   -24.253 1.00 0.00 ? 7   GLY A N    3  
ATOM 3774  C CA   . GLY A 1 7   ? -19.120 0.280   -23.244 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3775  C C    . GLY A 1 7   ? -17.901 0.563   -22.387 1.00 0.00 ? 7   GLY A C    3  
ATOM 3776  O O    . GLY A 1 7   ? -17.045 1.365   -22.758 1.00 0.00 ? 7   GLY A O    3  
ATOM 3777  H H    . GLY A 1 7   ? -19.552 1.037   -25.173 1.00 0.00 ? 7   GLY A H    3  
ATOM 3778  H HA2  . GLY A 1 7   ? -19.990 0.229   -22.607 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3779  H HA3  . GLY A 1 7   ? -18.987 -0.673  -23.733 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3780  N N    . GLY A 1 8   ? -17.822 -0.098  -21.236 1.00 0.00 ? 8   GLY A N    3  
ATOM 3781  C CA   . GLY A 1 8   ? -16.697 0.102   -20.342 1.00 0.00 ? 8   GLY A CA   3  
ATOM 3782  C C    . GLY A 1 8   ? -16.048 -1.204  -19.927 1.00 0.00 ? 8   GLY A C    3  
ATOM 3783  O O    . GLY A 1 8   ? -16.421 -1.796  -18.915 1.00 0.00 ? 8   GLY A O    3  
ATOM 3784  H H    . GLY A 1 8   ? -18.535 -0.725  -20.992 1.00 0.00 ? 8   GLY A H    3  
ATOM 3785  H HA2  . GLY A 1 8   ? -15.961 0.716   -20.838 1.00 0.00 ? 8   GLY A HA2  3  
ATOM 3786  H HA3  . GLY A 1 8   ? -17.042 0.616   -19.456 1.00 0.00 ? 8   GLY A HA3  3  
ATOM 3787  N N    . SER A 1 9   ? -15.074 -1.654  -20.711 1.00 0.00 ? 9   SER A N    3  
ATOM 3788  C CA   . SER A 1 9   ? -14.375 -2.901  -20.423 1.00 0.00 ? 9   SER A CA   3  
ATOM 3789  C C    . SER A 1 9   ? -13.817 -2.895  -19.003 1.00 0.00 ? 9   SER A C    3  
ATOM 3790  O O    . SER A 1 9   ? -13.620 -1.836  -18.406 1.00 0.00 ? 9   SER A O    3  
ATOM 3791  C CB   . SER A 1 9   ? -13.241 -3.119  -21.427 1.00 0.00 ? 9   SER A CB   3  
ATOM 3792  O OG   . SER A 1 9   ? -12.171 -2.221  -21.191 1.00 0.00 ? 9   SER A OG   3  
ATOM 3793  H H    . SER A 1 9   ? -14.821 -1.136  -21.504 1.00 0.00 ? 9   SER A H    3  
ATOM 3794  H HA   . SER A 1 9   ? -15.086 -3.708  -20.515 1.00 0.00 ? 9   SER A HA   3  
ATOM 3795  H HB2  . SER A 1 9   ? -12.874 -4.129  -21.338 1.00 0.00 ? 9   SER A HB2  3  
ATOM 3796  H HB3  . SER A 1 9   ? -13.616 -2.959  -22.428 1.00 0.00 ? 9   SER A HB3  3  
ATOM 3797  H HG   . SER A 1 9   ? -12.461 -1.323  -21.366 1.00 0.00 ? 9   SER A HG   3  
ATOM 3798  N N    . ASP A 1 10  ? -13.564 -4.085  -18.469 1.00 0.00 ? 10  ASP A N    3  
ATOM 3799  C CA   . ASP A 1 10  ? -13.028 -4.218  -17.119 1.00 0.00 ? 10  ASP A CA   3  
ATOM 3800  C C    . ASP A 1 10  ? -11.708 -4.983  -17.132 1.00 0.00 ? 10  ASP A C    3  
ATOM 3801  O O    . ASP A 1 10  ? -11.462 -5.830  -16.274 1.00 0.00 ? 10  ASP A O    3  
ATOM 3802  C CB   . ASP A 1 10  ? -14.036 -4.931  -16.215 1.00 0.00 ? 10  ASP A CB   3  
ATOM 3803  C CG   . ASP A 1 10  ? -14.709 -6.100  -16.907 1.00 0.00 ? 10  ASP A CG   3  
ATOM 3804  O OD1  . ASP A 1 10  ? -14.063 -6.730  -17.770 1.00 0.00 ? 10  ASP A OD1  3  
ATOM 3805  O OD2  . ASP A 1 10  ? -15.882 -6.384  -16.587 1.00 0.00 ? 10  ASP A OD2  3  
ATOM 3806  H H    . ASP A 1 10  ? -13.742 -4.892  -18.995 1.00 0.00 ? 10  ASP A H    3  
ATOM 3807  H HA   . ASP A 1 10  ? -12.851 -3.226  -16.733 1.00 0.00 ? 10  ASP A HA   3  
ATOM 3808  H HB2  . ASP A 1 10  ? -13.524 -5.302  -15.339 1.00 0.00 ? 10  ASP A HB2  3  
ATOM 3809  H HB3  . ASP A 1 10  ? -14.797 -4.228  -15.912 1.00 0.00 ? 10  ASP A HB3  3  
ATOM 3810  N N    . SER A 1 11  ? -10.864 -4.679  -18.113 1.00 0.00 ? 11  SER A N    3  
ATOM 3811  C CA   . SER A 1 11  ? -9.571  -5.341  -18.241 1.00 0.00 ? 11  SER A CA   3  
ATOM 3812  C C    . SER A 1 11  ? -8.519  -4.651  -17.376 1.00 0.00 ? 11  SER A C    3  
ATOM 3813  O O    . SER A 1 11  ? -7.897  -5.278  -16.518 1.00 0.00 ? 11  SER A O    3  
ATOM 3814  C CB   . SER A 1 11  ? -9.120  -5.348  -19.703 1.00 0.00 ? 11  SER A CB   3  
ATOM 3815  O OG   . SER A 1 11  ? -8.245  -6.433  -19.961 1.00 0.00 ? 11  SER A OG   3  
ATOM 3816  H H    . SER A 1 11  ? -11.118 -3.995  -18.767 1.00 0.00 ? 11  SER A H    3  
ATOM 3817  H HA   . SER A 1 11  ? -9.685  -6.360  -17.903 1.00 0.00 ? 11  SER A HA   3  
ATOM 3818  H HB2  . SER A 1 11  ? -9.985  -5.439  -20.342 1.00 0.00 ? 11  SER A HB2  3  
ATOM 3819  H HB3  . SER A 1 11  ? -8.605  -4.425  -19.922 1.00 0.00 ? 11  SER A HB3  3  
ATOM 3820  H HG   . SER A 1 11  ? -8.380  -6.746  -20.858 1.00 0.00 ? 11  SER A HG   3  
ATOM 3821  N N    . SER A 1 12  ? -8.327  -3.357  -17.610 1.00 0.00 ? 12  SER A N    3  
ATOM 3822  C CA   . SER A 1 12  ? -7.349  -2.582  -16.856 1.00 0.00 ? 12  SER A CA   3  
ATOM 3823  C C    . SER A 1 12  ? -8.036  -1.715  -15.805 1.00 0.00 ? 12  SER A C    3  
ATOM 3824  O O    . SER A 1 12  ? -8.225  -0.513  -16.001 1.00 0.00 ? 12  SER A O    3  
ATOM 3825  C CB   . SER A 1 12  ? -6.526  -1.703  -17.800 1.00 0.00 ? 12  SER A CB   3  
ATOM 3826  O OG   . SER A 1 12  ? -5.980  -2.467  -18.861 1.00 0.00 ? 12  SER A OG   3  
ATOM 3827  H H    . SER A 1 12  ? -8.854  -2.914  -18.307 1.00 0.00 ? 12  SER A H    3  
ATOM 3828  H HA   . SER A 1 12  ? -6.689  -3.276  -16.357 1.00 0.00 ? 12  SER A HA   3  
ATOM 3829  H HB2  . SER A 1 12  ? -7.159  -0.934  -18.215 1.00 0.00 ? 12  SER A HB2  3  
ATOM 3830  H HB3  . SER A 1 12  ? -5.718  -1.245  -17.248 1.00 0.00 ? 12  SER A HB3  3  
ATOM 3831  H HG   . SER A 1 12  ? -5.754  -1.886  -19.592 1.00 0.00 ? 12  SER A HG   3  
ATOM 3832  N N    . LEU A 1 13  ? -8.407  -2.332  -14.689 1.00 0.00 ? 13  LEU A N    3  
ATOM 3833  C CA   . LEU A 1 13  ? -9.073  -1.618  -13.605 1.00 0.00 ? 13  LEU A CA   3  
ATOM 3834  C C    . LEU A 1 13  ? -8.140  -0.589  -12.977 1.00 0.00 ? 13  LEU A C    3  
ATOM 3835  O O    . LEU A 1 13  ? -8.568  0.501   -12.593 1.00 0.00 ? 13  LEU A O    3  
ATOM 3836  C CB   . LEU A 1 13  ? -9.556  -2.604  -12.540 1.00 0.00 ? 13  LEU A CB   3  
ATOM 3837  C CG   . LEU A 1 13  ? -10.804 -3.415  -12.892 1.00 0.00 ? 13  LEU A CG   3  
ATOM 3838  C CD1  . LEU A 1 13  ? -11.991 -2.493  -13.127 1.00 0.00 ? 13  LEU A CD1  3  
ATOM 3839  C CD2  . LEU A 1 13  ? -10.548 -4.282  -14.116 1.00 0.00 ? 13  LEU A CD2  3  
ATOM 3840  H H    . LEU A 1 13  ? -8.230  -3.290  -14.590 1.00 0.00 ? 13  LEU A H    3  
ATOM 3841  H HA   . LEU A 1 13  ? -9.927  -1.105  -14.023 1.00 0.00 ? 13  LEU A HA   3  
ATOM 3842  H HB2  . LEU A 1 13  ? -8.754  -3.299  -12.345 1.00 0.00 ? 13  LEU A HB2  3  
ATOM 3843  H HB3  . LEU A 1 13  ? -9.768  -2.041  -11.642 1.00 0.00 ? 13  LEU A HB3  3  
ATOM 3844  H HG   . LEU A 1 13  ? -11.047 -4.067  -12.064 1.00 0.00 ? 13  LEU A HG   3  
ATOM 3845  H HD11 . LEU A 1 13  ? -12.287 -2.546  -14.164 1.00 0.00 ? 13  LEU A HD11 3  
ATOM 3846  H HD12 . LEU A 1 13  ? -11.713 -1.479  -12.883 1.00 0.00 ? 13  LEU A HD12 3  
ATOM 3847  H HD13 . LEU A 1 13  ? -12.815 -2.801  -12.501 1.00 0.00 ? 13  LEU A HD13 3  
ATOM 3848  H HD21 . LEU A 1 13  ? -11.370 -4.971  -14.246 1.00 0.00 ? 13  LEU A HD21 3  
ATOM 3849  H HD22 . LEU A 1 13  ? -9.632  -4.838  -13.978 1.00 0.00 ? 13  LEU A HD22 3  
ATOM 3850  H HD23 . LEU A 1 13  ? -10.462 -3.654  -14.990 1.00 0.00 ? 13  LEU A HD23 3  
ATOM 3851  N N    . PHE A 1 14  ? -6.862  -0.940  -12.875 1.00 0.00 ? 14  PHE A N    3  
ATOM 3852  C CA   . PHE A 1 14  ? -5.867  -0.046  -12.294 1.00 0.00 ? 14  PHE A CA   3  
ATOM 3853  C C    . PHE A 1 14  ? -5.056  0.647   -13.385 1.00 0.00 ? 14  PHE A C    3  
ATOM 3854  O O    . PHE A 1 14  ? -5.196  0.338   -14.567 1.00 0.00 ? 14  PHE A O    3  
ATOM 3855  C CB   . PHE A 1 14  ? -4.934  -0.823  -11.364 1.00 0.00 ? 14  PHE A CB   3  
ATOM 3856  C CG   . PHE A 1 14  ? -5.640  -1.854  -10.531 1.00 0.00 ? 14  PHE A CG   3  
ATOM 3857  C CD1  . PHE A 1 14  ? -6.000  -3.077  -11.075 1.00 0.00 ? 14  PHE A CD1  3  
ATOM 3858  C CD2  . PHE A 1 14  ? -5.944  -1.602  -9.203  1.00 0.00 ? 14  PHE A CD2  3  
ATOM 3859  C CE1  . PHE A 1 14  ? -6.651  -4.027  -10.311 1.00 0.00 ? 14  PHE A CE1  3  
ATOM 3860  C CE2  . PHE A 1 14  ? -6.594  -2.548  -8.433  1.00 0.00 ? 14  PHE A CE2  3  
ATOM 3861  C CZ   . PHE A 1 14  ? -6.947  -3.762  -8.988  1.00 0.00 ? 14  PHE A CZ   3  
ATOM 3862  H H    . PHE A 1 14  ? -6.582  -1.822  -13.199 1.00 0.00 ? 14  PHE A H    3  
ATOM 3863  H HA   . PHE A 1 14  ? -6.391  0.703   -11.721 1.00 0.00 ? 14  PHE A HA   3  
ATOM 3864  H HB2  . PHE A 1 14  ? -4.188  -1.331  -11.956 1.00 0.00 ? 14  PHE A HB2  3  
ATOM 3865  H HB3  . PHE A 1 14  ? -4.446  -0.131  -10.694 1.00 0.00 ? 14  PHE A HB3  3  
ATOM 3866  H HD1  . PHE A 1 14  ? -5.768  -3.285  -12.109 1.00 0.00 ? 14  PHE A HD1  3  
ATOM 3867  H HD2  . PHE A 1 14  ? -5.668  -0.651  -8.767  1.00 0.00 ? 14  PHE A HD2  3  
ATOM 3868  H HE1  . PHE A 1 14  ? -6.925  -4.975  -10.747 1.00 0.00 ? 14  PHE A HE1  3  
ATOM 3869  H HE2  . PHE A 1 14  ? -6.824  -2.338  -7.399  1.00 0.00 ? 14  PHE A HE2  3  
ATOM 3870  H HZ   . PHE A 1 14  ? -7.456  -4.503  -8.389  1.00 0.00 ? 14  PHE A HZ   3  
ATOM 3871  N N    . GLU A 1 15  ? -4.208  1.586   -12.977 1.00 0.00 ? 15  GLU A N    3  
ATOM 3872  C CA   . GLU A 1 15  ? -3.375  2.323   -13.919 1.00 0.00 ? 15  GLU A CA   3  
ATOM 3873  C C    . GLU A 1 15  ? -1.944  2.443   -13.402 1.00 0.00 ? 15  GLU A C    3  
ATOM 3874  O O    . GLU A 1 15  ? -1.715  2.843   -12.260 1.00 0.00 ? 15  GLU A O    3  
ATOM 3875  C CB   . GLU A 1 15  ? -3.957  3.716   -14.167 1.00 0.00 ? 15  GLU A CB   3  
ATOM 3876  C CG   . GLU A 1 15  ? -4.166  4.524   -12.898 1.00 0.00 ? 15  GLU A CG   3  
ATOM 3877  C CD   . GLU A 1 15  ? -4.045  6.017   -13.130 1.00 0.00 ? 15  GLU A CD   3  
ATOM 3878  O OE1  . GLU A 1 15  ? -3.181  6.425   -13.933 1.00 0.00 ? 15  GLU A OE1  3  
ATOM 3879  O OE2  . GLU A 1 15  ? -4.816  6.778   -12.507 1.00 0.00 ? 15  GLU A OE2  3  
ATOM 3880  H H    . GLU A 1 15  ? -4.141  1.787   -12.020 1.00 0.00 ? 15  GLU A H    3  
ATOM 3881  H HA   . GLU A 1 15  ? -3.363  1.777   -14.850 1.00 0.00 ? 15  GLU A HA   3  
ATOM 3882  H HB2  . GLU A 1 15  ? -3.287  4.264   -14.813 1.00 0.00 ? 15  GLU A HB2  3  
ATOM 3883  H HB3  . GLU A 1 15  ? -4.912  3.610   -14.662 1.00 0.00 ? 15  GLU A HB3  3  
ATOM 3884  H HG2  . GLU A 1 15  ? -5.152  4.314   -12.511 1.00 0.00 ? 15  GLU A HG2  3  
ATOM 3885  H HG3  . GLU A 1 15  ? -3.425  4.226   -12.171 1.00 0.00 ? 15  GLU A HG3  3  
ATOM 3886  N N    . THR A 1 16  ? -0.983  2.093   -14.252 1.00 0.00 ? 16  THR A N    3  
ATOM 3887  C CA   . THR A 1 16  ? 0.426   2.160   -13.882 1.00 0.00 ? 16  THR A CA   3  
ATOM 3888  C C    . THR A 1 16  ? 1.047   3.482   -14.318 1.00 0.00 ? 16  THR A C    3  
ATOM 3889  O O    . THR A 1 16  ? 0.765   3.982   -15.406 1.00 0.00 ? 16  THR A O    3  
ATOM 3890  C CB   . THR A 1 16  ? 1.225   1.000   -14.504 1.00 0.00 ? 16  THR A CB   3  
ATOM 3891  O OG1  . THR A 1 16  ? 0.670   -0.254  -14.093 1.00 0.00 ? 16  THR A OG1  3  
ATOM 3892  C CG2  . THR A 1 16  ? 2.689   1.071   -14.096 1.00 0.00 ? 16  THR A CG2  3  
ATOM 3893  H H    . THR A 1 16  ? -1.228  1.783   -15.148 1.00 0.00 ? 16  THR A H    3  
ATOM 3894  H HA   . THR A 1 16  ? 0.492   2.079   -12.806 1.00 0.00 ? 16  THR A HA   3  
ATOM 3895  H HB   . THR A 1 16  ? 1.163   1.077   -15.581 1.00 0.00 ? 16  THR A HB   3  
ATOM 3896  H HG1  . THR A 1 16  ? 1.373   -0.902  -14.005 1.00 0.00 ? 16  THR A HG1  3  
ATOM 3897  H HG21 . THR A 1 16  ? 2.818   0.595   -13.135 1.00 0.00 ? 16  THR A HG21 3  
ATOM 3898  H HG22 . THR A 1 16  ? 2.994   2.104   -14.030 1.00 0.00 ? 16  THR A HG22 3  
ATOM 3899  H HG23 . THR A 1 16  ? 3.293   0.563   -14.832 1.00 0.00 ? 16  THR A HG23 3  
ATOM 3900  N N    . TYR A 1 17  ? 1.894   4.043   -13.462 1.00 0.00 ? 17  TYR A N    3  
ATOM 3901  C CA   . TYR A 1 17  ? 2.554   5.308   -13.758 1.00 0.00 ? 17  TYR A CA   3  
ATOM 3902  C C    . TYR A 1 17  ? 3.975   5.325   -13.202 1.00 0.00 ? 17  TYR A C    3  
ATOM 3903  O O    . TYR A 1 17  ? 4.245   4.761   -12.143 1.00 0.00 ? 17  TYR A O    3  
ATOM 3904  C CB   . TYR A 1 17  ? 1.753   6.474   -13.177 1.00 0.00 ? 17  TYR A CB   3  
ATOM 3905  C CG   . TYR A 1 17  ? 1.539   6.376   -11.683 1.00 0.00 ? 17  TYR A CG   3  
ATOM 3906  C CD1  . TYR A 1 17  ? 0.493   5.625   -11.159 1.00 0.00 ? 17  TYR A CD1  3  
ATOM 3907  C CD2  . TYR A 1 17  ? 2.381   7.035   -10.796 1.00 0.00 ? 17  TYR A CD2  3  
ATOM 3908  C CE1  . TYR A 1 17  ? 0.293   5.533   -9.795  1.00 0.00 ? 17  TYR A CE1  3  
ATOM 3909  C CE2  . TYR A 1 17  ? 2.189   6.947   -9.430  1.00 0.00 ? 17  TYR A CE2  3  
ATOM 3910  C CZ   . TYR A 1 17  ? 1.144   6.196   -8.935  1.00 0.00 ? 17  TYR A CZ   3  
ATOM 3911  O OH   . TYR A 1 17  ? 0.949   6.107   -7.576  1.00 0.00 ? 17  TYR A OH   3  
ATOM 3912  H H    . TYR A 1 17  ? 2.079   3.596   -12.609 1.00 0.00 ? 17  TYR A H    3  
ATOM 3913  H HA   . TYR A 1 17  ? 2.599   5.415   -14.832 1.00 0.00 ? 17  TYR A HA   3  
ATOM 3914  H HB2  . TYR A 1 17  ? 2.276   7.397   -13.376 1.00 0.00 ? 17  TYR A HB2  3  
ATOM 3915  H HB3  . TYR A 1 17  ? 0.782   6.507   -13.650 1.00 0.00 ? 17  TYR A HB3  3  
ATOM 3916  H HD1  . TYR A 1 17  ? -0.171  5.107   -11.836 1.00 0.00 ? 17  TYR A HD1  3  
ATOM 3917  H HD2  . TYR A 1 17  ? 3.198   7.623   -11.187 1.00 0.00 ? 17  TYR A HD2  3  
ATOM 3918  H HE1  . TYR A 1 17  ? -0.525  4.944   -9.407  1.00 0.00 ? 17  TYR A HE1  3  
ATOM 3919  H HE2  . TYR A 1 17  ? 2.855   7.466   -8.757  1.00 0.00 ? 17  TYR A HE2  3  
ATOM 3920  H HH   . TYR A 1 17  ? 0.160   6.597   -7.334  1.00 0.00 ? 17  TYR A HH   3  
ATOM 3921  N N    . ASN A 1 18  ? 4.879   5.977   -13.926 1.00 0.00 ? 18  ASN A N    3  
ATOM 3922  C CA   . ASN A 1 18  ? 6.272   6.069   -13.506 1.00 0.00 ? 18  ASN A CA   3  
ATOM 3923  C C    . ASN A 1 18  ? 6.527   7.365   -12.743 1.00 0.00 ? 18  ASN A C    3  
ATOM 3924  O O    . ASN A 1 18  ? 6.067   8.435   -13.144 1.00 0.00 ? 18  ASN A O    3  
ATOM 3925  C CB   . ASN A 1 18  ? 7.199   5.989   -14.721 1.00 0.00 ? 18  ASN A CB   3  
ATOM 3926  C CG   . ASN A 1 18  ? 6.779   4.907   -15.698 1.00 0.00 ? 18  ASN A CG   3  
ATOM 3927  O OD1  . ASN A 1 18  ? 6.490   5.185   -16.862 1.00 0.00 ? 18  ASN A OD1  3  
ATOM 3928  N ND2  . ASN A 1 18  ? 6.744   3.666   -15.227 1.00 0.00 ? 18  ASN A ND2  3  
ATOM 3929  H H    . ASN A 1 18  ? 4.603   6.407   -14.762 1.00 0.00 ? 18  ASN A H    3  
ATOM 3930  H HA   . ASN A 1 18  ? 6.477   5.234   -12.852 1.00 0.00 ? 18  ASN A HA   3  
ATOM 3931  H HB2  . ASN A 1 18  ? 7.188   6.937   -15.237 1.00 0.00 ? 18  ASN A HB2  3  
ATOM 3932  H HB3  . ASN A 1 18  ? 8.204   5.777   -14.387 1.00 0.00 ? 18  ASN A HB3  3  
ATOM 3933  H HD21 . ASN A 1 18  ? 6.987   3.519   -14.289 1.00 0.00 ? 18  ASN A HD21 3  
ATOM 3934  H HD22 . ASN A 1 18  ? 6.477   2.948   -15.837 1.00 0.00 ? 18  ASN A HD22 3  
ATOM 3935  N N    . VAL A 1 19  ? 7.263   7.263   -11.641 1.00 0.00 ? 19  VAL A N    3  
ATOM 3936  C CA   . VAL A 1 19  ? 7.580   8.427   -10.822 1.00 0.00 ? 19  VAL A CA   3  
ATOM 3937  C C    . VAL A 1 19  ? 9.088   8.612   -10.692 1.00 0.00 ? 19  VAL A C    3  
ATOM 3938  O O    . VAL A 1 19  ? 9.778   7.773   -10.116 1.00 0.00 ? 19  VAL A O    3  
ATOM 3939  C CB   . VAL A 1 19  ? 6.965   8.308   -9.415  1.00 0.00 ? 19  VAL A CB   3  
ATOM 3940  C CG1  . VAL A 1 19  ? 6.907   9.670   -8.741  1.00 0.00 ? 19  VAL A CG1  3  
ATOM 3941  C CG2  . VAL A 1 19  ? 5.581   7.681   -9.490  1.00 0.00 ? 19  VAL A CG2  3  
ATOM 3942  H H    . VAL A 1 19  ? 7.601   6.383   -11.372 1.00 0.00 ? 19  VAL A H    3  
ATOM 3943  H HA   . VAL A 1 19  ? 7.160   9.298   -11.304 1.00 0.00 ? 19  VAL A HA   3  
ATOM 3944  H HB   . VAL A 1 19  ? 7.597   7.664   -8.822  1.00 0.00 ? 19  VAL A HB   3  
ATOM 3945  H HG11 . VAL A 1 19  ? 7.722   10.283  -9.098  1.00 0.00 ? 19  VAL A HG11 3  
ATOM 3946  H HG12 . VAL A 1 19  ? 5.967   10.148  -8.974  1.00 0.00 ? 19  VAL A HG12 3  
ATOM 3947  H HG13 . VAL A 1 19  ? 6.993   9.546   -7.671  1.00 0.00 ? 19  VAL A HG13 3  
ATOM 3948  H HG21 . VAL A 1 19  ? 5.324   7.501   -10.523 1.00 0.00 ? 19  VAL A HG21 3  
ATOM 3949  H HG22 . VAL A 1 19  ? 5.579   6.746   -8.950  1.00 0.00 ? 19  VAL A HG22 3  
ATOM 3950  H HG23 . VAL A 1 19  ? 4.858   8.352   -9.051  1.00 0.00 ? 19  VAL A HG23 3  
ATOM 3951  N N    . GLU A 1 20  ? 9.591   9.718   -11.231 1.00 0.00 ? 20  GLU A N    3  
ATOM 3952  C CA   . GLU A 1 20  ? 11.018  10.014  -11.175 1.00 0.00 ? 20  GLU A CA   3  
ATOM 3953  C C    . GLU A 1 20  ? 11.358  10.820  -9.925  1.00 0.00 ? 20  GLU A C    3  
ATOM 3954  O O    . GLU A 1 20  ? 11.124  12.028  -9.869  1.00 0.00 ? 20  GLU A O    3  
ATOM 3955  C CB   . GLU A 1 20  ? 11.452  10.783  -12.425 1.00 0.00 ? 20  GLU A CB   3  
ATOM 3956  C CG   . GLU A 1 20  ? 12.903  11.231  -12.390 1.00 0.00 ? 20  GLU A CG   3  
ATOM 3957  C CD   . GLU A 1 20  ? 13.145  12.347  -11.393 1.00 0.00 ? 20  GLU A CD   3  
ATOM 3958  O OE1  . GLU A 1 20  ? 12.445  13.378  -11.473 1.00 0.00 ? 20  GLU A OE1  3  
ATOM 3959  O OE2  . GLU A 1 20  ? 14.035  12.189  -10.531 1.00 0.00 ? 20  GLU A OE2  3  
ATOM 3960  H H    . GLU A 1 20  ? 8.989   10.350  -11.678 1.00 0.00 ? 20  GLU A H    3  
ATOM 3961  H HA   . GLU A 1 20  ? 11.550  9.075   -11.139 1.00 0.00 ? 20  GLU A HA   3  
ATOM 3962  H HB2  . GLU A 1 20  ? 11.312  10.150  -13.289 1.00 0.00 ? 20  GLU A HB2  3  
ATOM 3963  H HB3  . GLU A 1 20  ? 10.828  11.659  -12.527 1.00 0.00 ? 20  GLU A HB3  3  
ATOM 3964  H HG2  . GLU A 1 20  ? 13.521  10.388  -12.120 1.00 0.00 ? 20  GLU A HG2  3  
ATOM 3965  H HG3  . GLU A 1 20  ? 13.182  11.580  -13.374 1.00 0.00 ? 20  GLU A HG3  3  
ATOM 3966  N N    . LEU A 1 21  ? 11.910  10.143  -8.924  1.00 0.00 ? 21  LEU A N    3  
ATOM 3967  C CA   . LEU A 1 21  ? 12.282  10.795  -7.673  1.00 0.00 ? 21  LEU A CA   3  
ATOM 3968  C C    . LEU A 1 21  ? 13.734  11.260  -7.713  1.00 0.00 ? 21  LEU A C    3  
ATOM 3969  O O    . LEU A 1 21  ? 14.615  10.542  -8.187  1.00 0.00 ? 21  LEU A O    3  
ATOM 3970  C CB   . LEU A 1 21  ? 12.072  9.841   -6.496  1.00 0.00 ? 21  LEU A CB   3  
ATOM 3971  C CG   . LEU A 1 21  ? 10.676  9.231   -6.368  1.00 0.00 ? 21  LEU A CG   3  
ATOM 3972  C CD1  . LEU A 1 21  ? 10.663  8.148   -5.299  1.00 0.00 ? 21  LEU A CD1  3  
ATOM 3973  C CD2  . LEU A 1 21  ? 9.650   10.308  -6.050  1.00 0.00 ? 21  LEU A CD2  3  
ATOM 3974  H H    . LEU A 1 21  ? 12.072  9.183   -9.028  1.00 0.00 ? 21  LEU A H    3  
ATOM 3975  H HA   . LEU A 1 21  ? 11.644  11.657  -7.546  1.00 0.00 ? 21  LEU A HA   3  
ATOM 3976  H HB2  . LEU A 1 21  ? 12.779  9.032   -6.596  1.00 0.00 ? 21  LEU A HB2  3  
ATOM 3977  H HB3  . LEU A 1 21  ? 12.280  10.388  -5.587  1.00 0.00 ? 21  LEU A HB3  3  
ATOM 3978  H HG   . LEU A 1 21  ? 10.402  8.773   -7.309  1.00 0.00 ? 21  LEU A HG   3  
ATOM 3979  H HD11 . LEU A 1 21  ? 10.117  7.291   -5.662  1.00 0.00 ? 21  LEU A HD11 3  
ATOM 3980  H HD12 . LEU A 1 21  ? 10.187  8.529   -4.408  1.00 0.00 ? 21  LEU A HD12 3  
ATOM 3981  H HD13 . LEU A 1 21  ? 11.678  7.858   -5.069  1.00 0.00 ? 21  LEU A HD13 3  
ATOM 3982  H HD21 . LEU A 1 21  ? 9.784   11.142  -6.724  1.00 0.00 ? 21  LEU A HD21 3  
ATOM 3983  H HD22 . LEU A 1 21  ? 9.784   10.644  -5.032  1.00 0.00 ? 21  LEU A HD22 3  
ATOM 3984  H HD23 . LEU A 1 21  ? 8.656   9.905   -6.169  1.00 0.00 ? 21  LEU A HD23 3  
ATOM 3985  N N    . VAL A 1 22  ? 13.978  12.466  -7.210  1.00 0.00 ? 22  VAL A N    3  
ATOM 3986  C CA   . VAL A 1 22  ? 15.324  13.026  -7.184  1.00 0.00 ? 22  VAL A CA   3  
ATOM 3987  C C    . VAL A 1 22  ? 16.016  12.735  -5.858  1.00 0.00 ? 22  VAL A C    3  
ATOM 3988  O O    . VAL A 1 22  ? 15.444  12.945  -4.788  1.00 0.00 ? 22  VAL A O    3  
ATOM 3989  C CB   . VAL A 1 22  ? 15.303  14.549  -7.416  1.00 0.00 ? 22  VAL A CB   3  
ATOM 3990  C CG1  . VAL A 1 22  ? 14.680  15.262  -6.225  1.00 0.00 ? 22  VAL A CG1  3  
ATOM 3991  C CG2  . VAL A 1 22  ? 16.708  15.067  -7.682  1.00 0.00 ? 22  VAL A CG2  3  
ATOM 3992  H H    . VAL A 1 22  ? 13.235  12.992  -6.846  1.00 0.00 ? 22  VAL A H    3  
ATOM 3993  H HA   . VAL A 1 22  ? 15.891  12.570  -7.983  1.00 0.00 ? 22  VAL A HA   3  
ATOM 3994  H HB   . VAL A 1 22  ? 14.696  14.752  -8.286  1.00 0.00 ? 22  VAL A HB   3  
ATOM 3995  H HG11 . VAL A 1 22  ? 15.353  15.206  -5.381  1.00 0.00 ? 22  VAL A HG11 3  
ATOM 3996  H HG12 . VAL A 1 22  ? 14.502  16.297  -6.477  1.00 0.00 ? 22  VAL A HG12 3  
ATOM 3997  H HG13 . VAL A 1 22  ? 13.744  14.786  -5.970  1.00 0.00 ? 22  VAL A HG13 3  
ATOM 3998  H HG21 . VAL A 1 22  ? 17.274  15.058  -6.763  1.00 0.00 ? 22  VAL A HG21 3  
ATOM 3999  H HG22 . VAL A 1 22  ? 17.194  14.433  -8.410  1.00 0.00 ? 22  VAL A HG22 3  
ATOM 4000  H HG23 . VAL A 1 22  ? 16.654  16.075  -8.064  1.00 0.00 ? 22  VAL A HG23 3  
ATOM 4001  N N    . ARG A 1 23  ? 17.251  12.249  -5.935  1.00 0.00 ? 23  ARG A N    3  
ATOM 4002  C CA   . ARG A 1 23  ? 18.021  11.928  -4.739  1.00 0.00 ? 23  ARG A CA   3  
ATOM 4003  C C    . ARG A 1 23  ? 18.997  13.051  -4.403  1.00 0.00 ? 23  ARG A C    3  
ATOM 4004  O O    . ARG A 1 23  ? 20.008  13.235  -5.082  1.00 0.00 ? 23  ARG A O    3  
ATOM 4005  C CB   . ARG A 1 23  ? 18.785  10.617  -4.936  1.00 0.00 ? 23  ARG A CB   3  
ATOM 4006  C CG   . ARG A 1 23  ? 17.914  9.473   -5.430  1.00 0.00 ? 23  ARG A CG   3  
ATOM 4007  C CD   . ARG A 1 23  ? 17.351  8.662   -4.273  1.00 0.00 ? 23  ARG A CD   3  
ATOM 4008  N NE   . ARG A 1 23  ? 18.406  8.072   -3.454  1.00 0.00 ? 23  ARG A NE   3  
ATOM 4009  C CZ   . ARG A 1 23  ? 18.236  6.987   -2.706  1.00 0.00 ? 23  ARG A CZ   3  
ATOM 4010  N NH1  . ARG A 1 23  ? 17.059  6.378   -2.674  1.00 0.00 ? 23  ARG A NH1  3  
ATOM 4011  N NH2  . ARG A 1 23  ? 19.245  6.510   -1.988  1.00 0.00 ? 23  ARG A NH2  3  
ATOM 4012  H H    . ARG A 1 23  ? 17.653  12.103  -6.816  1.00 0.00 ? 23  ARG A H    3  
ATOM 4013  H HA   . ARG A 1 23  ? 17.328  11.811  -3.920  1.00 0.00 ? 23  ARG A HA   3  
ATOM 4014  H HB2  . ARG A 1 23  ? 19.572  10.777  -5.658  1.00 0.00 ? 23  ARG A HB2  3  
ATOM 4015  H HB3  . ARG A 1 23  ? 19.224  10.325  -3.994  1.00 0.00 ? 23  ARG A HB3  3  
ATOM 4016  H HG2  . ARG A 1 23  ? 17.093  9.879   -6.003  1.00 0.00 ? 23  ARG A HG2  3  
ATOM 4017  H HG3  . ARG A 1 23  ? 18.508  8.826   -6.057  1.00 0.00 ? 23  ARG A HG3  3  
ATOM 4018  H HD2  . ARG A 1 23  ? 16.749  9.311   -3.655  1.00 0.00 ? 23  ARG A HD2  3  
ATOM 4019  H HD3  . ARG A 1 23  ? 16.733  7.872   -4.673  1.00 0.00 ? 23  ARG A HD3  3  
ATOM 4020  H HE   . ARG A 1 23  ? 19.284  8.506   -3.463  1.00 0.00 ? 23  ARG A HE   3  
ATOM 4021  H HH11 . ARG A 1 23  ? 16.297  6.735   -3.215  1.00 0.00 ? 23  ARG A HH11 3  
ATOM 4022  H HH12 . ARG A 1 23  ? 16.934  5.561   -2.111  1.00 0.00 ? 23  ARG A HH12 3  
ATOM 4023  H HH21 . ARG A 1 23  ? 20.134  6.967   -2.010  1.00 0.00 ? 23  ARG A HH21 3  
ATOM 4024  H HH22 . ARG A 1 23  ? 19.116  5.694   -1.425  1.00 0.00 ? 23  ARG A HH22 3  
ATOM 4025  N N    . LYS A 1 24  ? 18.687  13.801  -3.351  1.00 0.00 ? 24  LYS A N    3  
ATOM 4026  C CA   . LYS A 1 24  ? 19.536  14.907  -2.922  1.00 0.00 ? 24  LYS A CA   3  
ATOM 4027  C C    . LYS A 1 24  ? 20.948  14.421  -2.613  1.00 0.00 ? 24  LYS A C    3  
ATOM 4028  O O    . LYS A 1 24  ? 21.200  13.217  -2.545  1.00 0.00 ? 24  LYS A O    3  
ATOM 4029  C CB   . LYS A 1 24  ? 18.938  15.588  -1.689  1.00 0.00 ? 24  LYS A CB   3  
ATOM 4030  C CG   . LYS A 1 24  ? 17.860  16.606  -2.019  1.00 0.00 ? 24  LYS A CG   3  
ATOM 4031  C CD   . LYS A 1 24  ? 17.557  17.502  -0.829  1.00 0.00 ? 24  LYS A CD   3  
ATOM 4032  C CE   . LYS A 1 24  ? 16.702  18.693  -1.233  1.00 0.00 ? 24  LYS A CE   3  
ATOM 4033  N NZ   . LYS A 1 24  ? 16.262  19.485  -0.051  1.00 0.00 ? 24  LYS A NZ   3  
ATOM 4034  H H    . LYS A 1 24  ? 17.868  13.606  -2.849  1.00 0.00 ? 24  LYS A H    3  
ATOM 4035  H HA   . LYS A 1 24  ? 19.583  15.621  -3.730  1.00 0.00 ? 24  LYS A HA   3  
ATOM 4036  H HB2  . LYS A 1 24  ? 18.507  14.832  -1.049  1.00 0.00 ? 24  LYS A HB2  3  
ATOM 4037  H HB3  . LYS A 1 24  ? 19.729  16.093  -1.153  1.00 0.00 ? 24  LYS A HB3  3  
ATOM 4038  H HG2  . LYS A 1 24  ? 18.197  17.219  -2.841  1.00 0.00 ? 24  LYS A HG2  3  
ATOM 4039  H HG3  . LYS A 1 24  ? 16.959  16.082  -2.303  1.00 0.00 ? 24  LYS A HG3  3  
ATOM 4040  H HD2  . LYS A 1 24  ? 17.026  16.928  -0.084  1.00 0.00 ? 24  LYS A HD2  3  
ATOM 4041  H HD3  . LYS A 1 24  ? 18.488  17.862  -0.414  1.00 0.00 ? 24  LYS A HD3  3  
ATOM 4042  H HE2  . LYS A 1 24  ? 17.279  19.329  -1.887  1.00 0.00 ? 24  LYS A HE2  3  
ATOM 4043  H HE3  . LYS A 1 24  ? 15.830  18.332  -1.759  1.00 0.00 ? 24  LYS A HE3  3  
ATOM 4044  H HZ1  . LYS A 1 24  ? 16.982  19.439  0.698   1.00 0.00 ? 24  LYS A HZ1  3  
ATOM 4045  H HZ2  . LYS A 1 24  ? 15.367  19.107  0.319   1.00 0.00 ? 24  LYS A HZ2  3  
ATOM 4046  H HZ3  . LYS A 1 24  ? 16.120  20.480  -0.320  1.00 0.00 ? 24  LYS A HZ3  3  
ATOM 4047  N N    . ASP A 1 25  ? 21.866  15.363  -2.425  1.00 0.00 ? 25  ASP A N    3  
ATOM 4048  C CA   . ASP A 1 25  ? 23.252  15.030  -2.120  1.00 0.00 ? 25  ASP A CA   3  
ATOM 4049  C C    . ASP A 1 25  ? 23.346  14.221  -0.830  1.00 0.00 ? 25  ASP A C    3  
ATOM 4050  O O    . ASP A 1 25  ? 23.552  14.776  0.249   1.00 0.00 ? 25  ASP A O    3  
ATOM 4051  C CB   . ASP A 1 25  ? 24.090  16.304  -2.000  1.00 0.00 ? 25  ASP A CB   3  
ATOM 4052  C CG   . ASP A 1 25  ? 23.743  17.328  -3.063  1.00 0.00 ? 25  ASP A CG   3  
ATOM 4053  O OD1  . ASP A 1 25  ? 23.495  16.923  -4.219  1.00 0.00 ? 25  ASP A OD1  3  
ATOM 4054  O OD2  . ASP A 1 25  ? 23.718  18.533  -2.740  1.00 0.00 ? 25  ASP A OD2  3  
ATOM 4055  H H    . ASP A 1 25  ? 21.604  16.305  -2.492  1.00 0.00 ? 25  ASP A H    3  
ATOM 4056  H HA   . ASP A 1 25  ? 23.637  14.433  -2.933  1.00 0.00 ? 25  ASP A HA   3  
ATOM 4057  H HB2  . ASP A 1 25  ? 23.921  16.748  -1.030  1.00 0.00 ? 25  ASP A HB2  3  
ATOM 4058  H HB3  . ASP A 1 25  ? 25.136  16.050  -2.098  1.00 0.00 ? 25  ASP A HB3  3  
ATOM 4059  N N    . GLY A 1 26  ? 23.193  12.906  -0.949  1.00 0.00 ? 26  GLY A N    3  
ATOM 4060  C CA   . GLY A 1 26  ? 23.262  12.043  0.215   1.00 0.00 ? 26  GLY A CA   3  
ATOM 4061  C C    . GLY A 1 26  ? 21.914  11.863  0.885   1.00 0.00 ? 26  GLY A C    3  
ATOM 4062  O O    . GLY A 1 26  ? 21.810  11.924  2.109   1.00 0.00 ? 26  GLY A O    3  
ATOM 4063  H H    . GLY A 1 26  ? 23.031  12.519  -1.835  1.00 0.00 ? 26  GLY A H    3  
ATOM 4064  H HA2  . GLY A 1 26  ? 23.633  11.075  -0.089  1.00 0.00 ? 26  GLY A HA2  3  
ATOM 4065  H HA3  . GLY A 1 26  ? 23.950  12.473  0.928   1.00 0.00 ? 26  GLY A HA3  3  
ATOM 4066  N N    . GLN A 1 27  ? 20.880  11.642  0.079   1.00 0.00 ? 27  GLN A N    3  
ATOM 4067  C CA   . GLN A 1 27  ? 19.531  11.455  0.602   1.00 0.00 ? 27  GLN A CA   3  
ATOM 4068  C C    . GLN A 1 27  ? 18.999  10.070  0.252   1.00 0.00 ? 27  GLN A C    3  
ATOM 4069  O O    . GLN A 1 27  ? 19.397  9.476   -0.750  1.00 0.00 ? 27  GLN A O    3  
ATOM 4070  C CB   . GLN A 1 27  ? 18.594  12.530  0.049   1.00 0.00 ? 27  GLN A CB   3  
ATOM 4071  C CG   . GLN A 1 27  ? 17.149  12.363  0.491   1.00 0.00 ? 27  GLN A CG   3  
ATOM 4072  C CD   . GLN A 1 27  ? 16.187  13.193  -0.336  1.00 0.00 ? 27  GLN A CD   3  
ATOM 4073  O OE1  . GLN A 1 27  ? 16.243  13.189  -1.566  1.00 0.00 ? 27  GLN A OE1  3  
ATOM 4074  N NE2  . GLN A 1 27  ? 15.295  13.911  0.338   1.00 0.00 ? 27  GLN A NE2  3  
ATOM 4075  H H    . GLN A 1 27  ? 21.027  11.604  -0.888  1.00 0.00 ? 27  GLN A H    3  
ATOM 4076  H HA   . GLN A 1 27  ? 19.577  11.549  1.677   1.00 0.00 ? 27  GLN A HA   3  
ATOM 4077  H HB2  . GLN A 1 27  ? 18.940  13.498  0.381   1.00 0.00 ? 27  GLN A HB2  3  
ATOM 4078  H HB3  . GLN A 1 27  ? 18.624  12.496  -1.030  1.00 0.00 ? 27  GLN A HB3  3  
ATOM 4079  H HG2  . GLN A 1 27  ? 16.875  11.323  0.396   1.00 0.00 ? 27  GLN A HG2  3  
ATOM 4080  H HG3  . GLN A 1 27  ? 17.065  12.663  1.525   1.00 0.00 ? 27  GLN A HG3  3  
ATOM 4081  H HE21 . GLN A 1 27  ? 15.310  13.867  1.317   1.00 0.00 ? 27  GLN A HE21 3  
ATOM 4082  H HE22 . GLN A 1 27  ? 14.662  14.458  -0.171  1.00 0.00 ? 27  GLN A HE22 3  
ATOM 4083  N N    . SER A 1 28  ? 18.096  9.561   1.084   1.00 0.00 ? 28  SER A N    3  
ATOM 4084  C CA   . SER A 1 28  ? 17.511  8.243   0.864   1.00 0.00 ? 28  SER A CA   3  
ATOM 4085  C C    . SER A 1 28  ? 16.107  8.362   0.280   1.00 0.00 ? 28  SER A C    3  
ATOM 4086  O O    . SER A 1 28  ? 15.408  9.351   0.509   1.00 0.00 ? 28  SER A O    3  
ATOM 4087  C CB   . SER A 1 28  ? 17.465  7.457   2.176   1.00 0.00 ? 28  SER A CB   3  
ATOM 4088  O OG   . SER A 1 28  ? 18.770  7.132   2.622   1.00 0.00 ? 28  SER A OG   3  
ATOM 4089  H H    . SER A 1 28  ? 17.818  10.083  1.866   1.00 0.00 ? 28  SER A H    3  
ATOM 4090  H HA   . SER A 1 28  ? 18.137  7.716   0.161   1.00 0.00 ? 28  SER A HA   3  
ATOM 4091  H HB2  . SER A 1 28  ? 16.977  8.053   2.932   1.00 0.00 ? 28  SER A HB2  3  
ATOM 4092  H HB3  . SER A 1 28  ? 16.910  6.542   2.025   1.00 0.00 ? 28  SER A HB3  3  
ATOM 4093  H HG   . SER A 1 28  ? 19.393  7.249   1.902   1.00 0.00 ? 28  SER A HG   3  
ATOM 4094  N N    . LEU A 1 29  ? 15.700  7.349   -0.476  1.00 0.00 ? 29  LEU A N    3  
ATOM 4095  C CA   . LEU A 1 29  ? 14.379  7.338   -1.095  1.00 0.00 ? 29  LEU A CA   3  
ATOM 4096  C C    . LEU A 1 29  ? 13.304  7.743   -0.091  1.00 0.00 ? 29  LEU A C    3  
ATOM 4097  O O    . LEU A 1 29  ? 12.611  8.742   -0.277  1.00 0.00 ? 29  LEU A O    3  
ATOM 4098  C CB   . LEU A 1 29  ? 14.069  5.950   -1.659  1.00 0.00 ? 29  LEU A CB   3  
ATOM 4099  C CG   . LEU A 1 29  ? 13.026  5.897   -2.776  1.00 0.00 ? 29  LEU A CG   3  
ATOM 4100  C CD1  . LEU A 1 29  ? 13.566  6.543   -4.042  1.00 0.00 ? 29  LEU A CD1  3  
ATOM 4101  C CD2  . LEU A 1 29  ? 12.607  4.459   -3.046  1.00 0.00 ? 29  LEU A CD2  3  
ATOM 4102  H H    . LEU A 1 29  ? 16.301  6.589   -0.623  1.00 0.00 ? 29  LEU A H    3  
ATOM 4103  H HA   . LEU A 1 29  ? 14.386  8.053   -1.904  1.00 0.00 ? 29  LEU A HA   3  
ATOM 4104  H HB2  . LEU A 1 29  ? 14.988  5.538   -2.046  1.00 0.00 ? 29  LEU A HB2  3  
ATOM 4105  H HB3  . LEU A 1 29  ? 13.715  5.335   -0.844  1.00 0.00 ? 29  LEU A HB3  3  
ATOM 4106  H HG   . LEU A 1 29  ? 12.149  6.450   -2.467  1.00 0.00 ? 29  LEU A HG   3  
ATOM 4107  H HD11 . LEU A 1 29  ? 14.618  6.322   -4.139  1.00 0.00 ? 29  LEU A HD11 3  
ATOM 4108  H HD12 . LEU A 1 29  ? 13.426  7.613   -3.988  1.00 0.00 ? 29  LEU A HD12 3  
ATOM 4109  H HD13 . LEU A 1 29  ? 13.035  6.155   -4.899  1.00 0.00 ? 29  LEU A HD13 3  
ATOM 4110  H HD21 . LEU A 1 29  ? 12.075  4.073   -2.189  1.00 0.00 ? 29  LEU A HD21 3  
ATOM 4111  H HD22 . LEU A 1 29  ? 13.485  3.856   -3.226  1.00 0.00 ? 29  LEU A HD22 3  
ATOM 4112  H HD23 . LEU A 1 29  ? 11.963  4.429   -3.912  1.00 0.00 ? 29  LEU A HD23 3  
ATOM 4113  N N    . GLY A 1 30  ? 13.173  6.960   0.976   1.00 0.00 ? 30  GLY A N    3  
ATOM 4114  C CA   . GLY A 1 30  ? 12.182  7.254   1.994   1.00 0.00 ? 30  GLY A CA   3  
ATOM 4115  C C    . GLY A 1 30  ? 10.845  6.599   1.710   1.00 0.00 ? 30  GLY A C    3  
ATOM 4116  O O    . GLY A 1 30  ? 9.800   7.245   1.791   1.00 0.00 ? 30  GLY A O    3  
ATOM 4117  H H    . GLY A 1 30  ? 13.753  6.176   1.071   1.00 0.00 ? 30  GLY A H    3  
ATOM 4118  H HA2  . GLY A 1 30  ? 12.547  6.904   2.948   1.00 0.00 ? 30  GLY A HA2  3  
ATOM 4119  H HA3  . GLY A 1 30  ? 12.042  8.324   2.045   1.00 0.00 ? 30  GLY A HA3  3  
ATOM 4120  N N    . ILE A 1 31  ? 10.877  5.314   1.373   1.00 0.00 ? 31  ILE A N    3  
ATOM 4121  C CA   . ILE A 1 31  ? 9.659   4.572   1.075   1.00 0.00 ? 31  ILE A CA   3  
ATOM 4122  C C    . ILE A 1 31  ? 9.677   3.197   1.733   1.00 0.00 ? 31  ILE A C    3  
ATOM 4123  O O    . ILE A 1 31  ? 10.567  2.386   1.476   1.00 0.00 ? 31  ILE A O    3  
ATOM 4124  C CB   . ILE A 1 31  ? 9.462   4.400   -0.443  1.00 0.00 ? 31  ILE A CB   3  
ATOM 4125  C CG1  . ILE A 1 31  ? 9.387   5.766   -1.128  1.00 0.00 ? 31  ILE A CG1  3  
ATOM 4126  C CG2  . ILE A 1 31  ? 8.206   3.590   -0.726  1.00 0.00 ? 31  ILE A CG2  3  
ATOM 4127  C CD1  . ILE A 1 31  ? 9.439   5.689   -2.638  1.00 0.00 ? 31  ILE A CD1  3  
ATOM 4128  H H    . ILE A 1 31  ? 11.741  4.854   1.325   1.00 0.00 ? 31  ILE A H    3  
ATOM 4129  H HA   . ILE A 1 31  ? 8.823   5.135   1.464   1.00 0.00 ? 31  ILE A HA   3  
ATOM 4130  H HB   . ILE A 1 31  ? 10.308  3.855   -0.834  1.00 0.00 ? 31  ILE A HB   3  
ATOM 4131  H HG12 . ILE A 1 31  ? 8.462   6.249   -0.853  1.00 0.00 ? 31  ILE A HG12 3  
ATOM 4132  H HG13 . ILE A 1 31  ? 10.217  6.372   -0.797  1.00 0.00 ? 31  ILE A HG13 3  
ATOM 4133  H HG21 . ILE A 1 31  ? 7.514   4.187   -1.301  1.00 0.00 ? 31  ILE A HG21 3  
ATOM 4134  H HG22 . ILE A 1 31  ? 8.467   2.705   -1.286  1.00 0.00 ? 31  ILE A HG22 3  
ATOM 4135  H HG23 . ILE A 1 31  ? 7.745   3.302   0.207   1.00 0.00 ? 31  ILE A HG23 3  
ATOM 4136  H HD11 . ILE A 1 31  ? 8.434   5.679   -3.034  1.00 0.00 ? 31  ILE A HD11 3  
ATOM 4137  H HD12 . ILE A 1 31  ? 9.972   6.544   -3.024  1.00 0.00 ? 31  ILE A HD12 3  
ATOM 4138  H HD13 . ILE A 1 31  ? 9.950   4.783   -2.934  1.00 0.00 ? 31  ILE A HD13 3  
ATOM 4139  N N    . ARG A 1 32  ? 8.687   2.940   2.582   1.00 0.00 ? 32  ARG A N    3  
ATOM 4140  C CA   . ARG A 1 32  ? 8.589   1.662   3.277   1.00 0.00 ? 32  ARG A CA   3  
ATOM 4141  C C    . ARG A 1 32  ? 7.670   0.704   2.526   1.00 0.00 ? 32  ARG A C    3  
ATOM 4142  O O    . ARG A 1 32  ? 6.540   1.053   2.182   1.00 0.00 ? 32  ARG A O    3  
ATOM 4143  C CB   . ARG A 1 32  ? 8.072   1.871   4.701   1.00 0.00 ? 32  ARG A CB   3  
ATOM 4144  C CG   . ARG A 1 32  ? 9.031   2.643   5.591   1.00 0.00 ? 32  ARG A CG   3  
ATOM 4145  C CD   . ARG A 1 32  ? 10.064  1.725   6.226   1.00 0.00 ? 32  ARG A CD   3  
ATOM 4146  N NE   . ARG A 1 32  ? 11.256  2.454   6.653   1.00 0.00 ? 32  ARG A NE   3  
ATOM 4147  C CZ   . ARG A 1 32  ? 12.423  1.872   6.903   1.00 0.00 ? 32  ARG A CZ   3  
ATOM 4148  N NH1  . ARG A 1 32  ? 12.555  0.559   6.770   1.00 0.00 ? 32  ARG A NH1  3  
ATOM 4149  N NH2  . ARG A 1 32  ? 13.462  2.603   7.287   1.00 0.00 ? 32  ARG A NH2  3  
ATOM 4150  H H    . ARG A 1 32  ? 8.007   3.626   2.746   1.00 0.00 ? 32  ARG A H    3  
ATOM 4151  H HA   . ARG A 1 32  ? 9.579   1.232   3.323   1.00 0.00 ? 32  ARG A HA   3  
ATOM 4152  H HB2  . ARG A 1 32  ? 7.139   2.415   4.657   1.00 0.00 ? 32  ARG A HB2  3  
ATOM 4153  H HB3  . ARG A 1 32  ? 7.895   0.906   5.152   1.00 0.00 ? 32  ARG A HB3  3  
ATOM 4154  H HG2  . ARG A 1 32  ? 9.543   3.385   4.995   1.00 0.00 ? 32  ARG A HG2  3  
ATOM 4155  H HG3  . ARG A 1 32  ? 8.468   3.133   6.372   1.00 0.00 ? 32  ARG A HG3  3  
ATOM 4156  H HD2  . ARG A 1 32  ? 9.620   1.246   7.086   1.00 0.00 ? 32  ARG A HD2  3  
ATOM 4157  H HD3  . ARG A 1 32  ? 10.351  0.975   5.505   1.00 0.00 ? 32  ARG A HD3  3  
ATOM 4158  H HE   . ARG A 1 32  ? 11.181  3.425   6.757   1.00 0.00 ? 32  ARG A HE   3  
ATOM 4159  H HH11 . ARG A 1 32  ? 11.774  0.006   6.480   1.00 0.00 ? 32  ARG A HH11 3  
ATOM 4160  H HH12 . ARG A 1 32  ? 13.435  0.123   6.958   1.00 0.00 ? 32  ARG A HH12 3  
ATOM 4161  H HH21 . ARG A 1 32  ? 13.366  3.593   7.388   1.00 0.00 ? 32  ARG A HH21 3  
ATOM 4162  H HH22 . ARG A 1 32  ? 14.340  2.164   7.475   1.00 0.00 ? 32  ARG A HH22 3  
ATOM 4163  N N    . ILE A 1 33  ? 8.163   -0.504  2.273   1.00 0.00 ? 33  ILE A N    3  
ATOM 4164  C CA   . ILE A 1 33  ? 7.386   -1.512  1.563   1.00 0.00 ? 33  ILE A CA   3  
ATOM 4165  C C    . ILE A 1 33  ? 6.899   -2.601  2.513   1.00 0.00 ? 33  ILE A C    3  
ATOM 4166  O O    . ILE A 1 33  ? 7.266   -2.625  3.688   1.00 0.00 ? 33  ILE A O    3  
ATOM 4167  C CB   . ILE A 1 33  ? 8.206   -2.162  0.433   1.00 0.00 ? 33  ILE A CB   3  
ATOM 4168  C CG1  . ILE A 1 33  ? 9.438   -2.866  1.006   1.00 0.00 ? 33  ILE A CG1  3  
ATOM 4169  C CG2  . ILE A 1 33  ? 8.616   -1.116  -0.593  1.00 0.00 ? 33  ILE A CG2  3  
ATOM 4170  C CD1  . ILE A 1 33  ? 9.895   -4.050  0.183   1.00 0.00 ? 33  ILE A CD1  3  
ATOM 4171  H H    . ILE A 1 33  ? 9.070   -0.723  2.572   1.00 0.00 ? 33  ILE A H    3  
ATOM 4172  H HA   . ILE A 1 33  ? 6.529   -1.023  1.123   1.00 0.00 ? 33  ILE A HA   3  
ATOM 4173  H HB   . ILE A 1 33  ? 7.582   -2.891  -0.062  1.00 0.00 ? 33  ILE A HB   3  
ATOM 4174  H HG12 . ILE A 1 33  ? 10.254  -2.163  1.058   1.00 0.00 ? 33  ILE A HG12 3  
ATOM 4175  H HG13 . ILE A 1 33  ? 9.210   -3.220  2.001   1.00 0.00 ? 33  ILE A HG13 3  
ATOM 4176  H HG21 . ILE A 1 33  ? 9.683   -1.170  -0.755  1.00 0.00 ? 33  ILE A HG21 3  
ATOM 4177  H HG22 . ILE A 1 33  ? 8.102   -1.304  -1.523  1.00 0.00 ? 33  ILE A HG22 3  
ATOM 4178  H HG23 . ILE A 1 33  ? 8.357   -0.133  -0.229  1.00 0.00 ? 33  ILE A HG23 3  
ATOM 4179  H HD11 . ILE A 1 33  ? 9.335   -4.927  0.471   1.00 0.00 ? 33  ILE A HD11 3  
ATOM 4180  H HD12 . ILE A 1 33  ? 9.733   -3.845  -0.864  1.00 0.00 ? 33  ILE A HD12 3  
ATOM 4181  H HD13 . ILE A 1 33  ? 10.948  -4.223  0.357   1.00 0.00 ? 33  ILE A HD13 3  
ATOM 4182  N N    . VAL A 1 34  ? 6.072   -3.504  1.996   1.00 0.00 ? 34  VAL A N    3  
ATOM 4183  C CA   . VAL A 1 34  ? 5.536   -4.598  2.797   1.00 0.00 ? 34  VAL A CA   3  
ATOM 4184  C C    . VAL A 1 34  ? 5.219   -5.811  1.930   1.00 0.00 ? 34  VAL A C    3  
ATOM 4185  O O    . VAL A 1 34  ? 4.841   -5.673  0.767   1.00 0.00 ? 34  VAL A O    3  
ATOM 4186  C CB   . VAL A 1 34  ? 4.262   -4.172  3.550   1.00 0.00 ? 34  VAL A CB   3  
ATOM 4187  C CG1  . VAL A 1 34  ? 3.070   -4.137  2.605   1.00 0.00 ? 34  VAL A CG1  3  
ATOM 4188  C CG2  . VAL A 1 34  ? 3.997   -5.105  4.721   1.00 0.00 ? 34  VAL A CG2  3  
ATOM 4189  H H    . VAL A 1 34  ? 5.816   -3.432  1.053   1.00 0.00 ? 34  VAL A H    3  
ATOM 4190  H HA   . VAL A 1 34  ? 6.284   -4.875  3.527   1.00 0.00 ? 34  VAL A HA   3  
ATOM 4191  H HB   . VAL A 1 34  ? 4.414   -3.175  3.938   1.00 0.00 ? 34  VAL A HB   3  
ATOM 4192  H HG11 . VAL A 1 34  ? 2.983   -5.089  2.101   1.00 0.00 ? 34  VAL A HG11 3  
ATOM 4193  H HG12 . VAL A 1 34  ? 2.169   -3.943  3.168   1.00 0.00 ? 34  VAL A HG12 3  
ATOM 4194  H HG13 . VAL A 1 34  ? 3.213   -3.355  1.873   1.00 0.00 ? 34  VAL A HG13 3  
ATOM 4195  H HG21 . VAL A 1 34  ? 3.817   -4.522  5.612   1.00 0.00 ? 34  VAL A HG21 3  
ATOM 4196  H HG22 . VAL A 1 34  ? 3.130   -5.714  4.508   1.00 0.00 ? 34  VAL A HG22 3  
ATOM 4197  H HG23 . VAL A 1 34  ? 4.855   -5.743  4.875   1.00 0.00 ? 34  VAL A HG23 3  
ATOM 4198  N N    . GLY A 1 35  ? 5.376   -7.000  2.504   1.00 0.00 ? 35  GLY A N    3  
ATOM 4199  C CA   . GLY A 1 35  ? 5.102   -8.220  1.768   1.00 0.00 ? 35  GLY A CA   3  
ATOM 4200  C C    . GLY A 1 35  ? 3.703   -8.746  2.018   1.00 0.00 ? 35  GLY A C    3  
ATOM 4201  O O    . GLY A 1 35  ? 3.412   -9.272  3.093   1.00 0.00 ? 35  GLY A O    3  
ATOM 4202  H H    . GLY A 1 35  ? 5.681   -7.048  3.434   1.00 0.00 ? 35  GLY A H    3  
ATOM 4203  H HA2  . GLY A 1 35  ? 5.219   -8.026  0.712   1.00 0.00 ? 35  GLY A HA2  3  
ATOM 4204  H HA3  . GLY A 1 35  ? 5.816   -8.975  2.066   1.00 0.00 ? 35  GLY A HA3  3  
ATOM 4205  N N    . TYR A 1 36  ? 2.832   -8.602  1.025   1.00 0.00 ? 36  TYR A N    3  
ATOM 4206  C CA   . TYR A 1 36  ? 1.454   -9.063  1.144   1.00 0.00 ? 36  TYR A CA   3  
ATOM 4207  C C    . TYR A 1 36  ? 1.331   -10.526 0.727   1.00 0.00 ? 36  TYR A C    3  
ATOM 4208  O O    . TYR A 1 36  ? 2.017   -10.983 -0.187  1.00 0.00 ? 36  TYR A O    3  
ATOM 4209  C CB   . TYR A 1 36  ? 0.529   -8.197  0.287   1.00 0.00 ? 36  TYR A CB   3  
ATOM 4210  C CG   . TYR A 1 36  ? -0.112  -7.059  1.047   1.00 0.00 ? 36  TYR A CG   3  
ATOM 4211  C CD1  . TYR A 1 36  ? 0.557   -5.854  1.226   1.00 0.00 ? 36  TYR A CD1  3  
ATOM 4212  C CD2  . TYR A 1 36  ? -1.385  -7.188  1.588   1.00 0.00 ? 36  TYR A CD2  3  
ATOM 4213  C CE1  . TYR A 1 36  ? -0.024  -4.811  1.921   1.00 0.00 ? 36  TYR A CE1  3  
ATOM 4214  C CE2  . TYR A 1 36  ? -1.974  -6.150  2.284   1.00 0.00 ? 36  TYR A CE2  3  
ATOM 4215  C CZ   . TYR A 1 36  ? -1.290  -4.963  2.448   1.00 0.00 ? 36  TYR A CZ   3  
ATOM 4216  O OH   . TYR A 1 36  ? -1.873  -3.927  3.141   1.00 0.00 ? 36  TYR A OH   3  
ATOM 4217  H H    . TYR A 1 36  ? 3.123   -8.175  0.192   1.00 0.00 ? 36  TYR A H    3  
ATOM 4218  H HA   . TYR A 1 36  ? 1.161   -8.969  2.179   1.00 0.00 ? 36  TYR A HA   3  
ATOM 4219  H HB2  . TYR A 1 36  ? 1.096   -7.773  -0.528  1.00 0.00 ? 36  TYR A HB2  3  
ATOM 4220  H HB3  . TYR A 1 36  ? -0.261  -8.815  -0.115  1.00 0.00 ? 36  TYR A HB3  3  
ATOM 4221  H HD1  . TYR A 1 36  ? 1.548   -5.737  0.813   1.00 0.00 ? 36  TYR A HD1  3  
ATOM 4222  H HD2  . TYR A 1 36  ? -1.918  -8.119  1.458   1.00 0.00 ? 36  TYR A HD2  3  
ATOM 4223  H HE1  . TYR A 1 36  ? 0.511   -3.881  2.050   1.00 0.00 ? 36  TYR A HE1  3  
ATOM 4224  H HE2  . TYR A 1 36  ? -2.965  -6.269  2.696   1.00 0.00 ? 36  TYR A HE2  3  
ATOM 4225  H HH   . TYR A 1 36  ? -1.708  -3.101  2.680   1.00 0.00 ? 36  TYR A HH   3  
ATOM 4226  N N    . VAL A 1 37  ? 0.450   -11.255 1.405   1.00 0.00 ? 37  VAL A N    3  
ATOM 4227  C CA   . VAL A 1 37  ? 0.233   -12.665 1.106   1.00 0.00 ? 37  VAL A CA   3  
ATOM 4228  C C    . VAL A 1 37  ? -1.189  -12.911 0.616   1.00 0.00 ? 37  VAL A C    3  
ATOM 4229  O O    . VAL A 1 37  ? -1.452  -13.876 -0.101  1.00 0.00 ? 37  VAL A O    3  
ATOM 4230  C CB   . VAL A 1 37  ? 0.500   -13.548 2.340   1.00 0.00 ? 37  VAL A CB   3  
ATOM 4231  C CG1  . VAL A 1 37  ? 0.308   -15.017 1.996   1.00 0.00 ? 37  VAL A CG1  3  
ATOM 4232  C CG2  . VAL A 1 37  ? 1.899   -13.296 2.882   1.00 0.00 ? 37  VAL A CG2  3  
ATOM 4233  H H    . VAL A 1 37  ? -0.068  -10.834 2.123   1.00 0.00 ? 37  VAL A H    3  
ATOM 4234  H HA   . VAL A 1 37  ? 0.926   -12.952 0.328   1.00 0.00 ? 37  VAL A HA   3  
ATOM 4235  H HB   . VAL A 1 37  ? -0.214  -13.285 3.106   1.00 0.00 ? 37  VAL A HB   3  
ATOM 4236  H HG11 . VAL A 1 37  ? -0.473  -15.433 2.616   1.00 0.00 ? 37  VAL A HG11 3  
ATOM 4237  H HG12 . VAL A 1 37  ? 0.033   -15.112 0.956   1.00 0.00 ? 37  VAL A HG12 3  
ATOM 4238  H HG13 . VAL A 1 37  ? 1.230   -15.551 2.175   1.00 0.00 ? 37  VAL A HG13 3  
ATOM 4239  H HG21 . VAL A 1 37  ? 2.287   -14.209 3.310   1.00 0.00 ? 37  VAL A HG21 3  
ATOM 4240  H HG22 . VAL A 1 37  ? 2.544   -12.972 2.079   1.00 0.00 ? 37  VAL A HG22 3  
ATOM 4241  H HG23 . VAL A 1 37  ? 1.858   -12.530 3.642   1.00 0.00 ? 37  VAL A HG23 3  
ATOM 4242  N N    . GLY A 1 38  ? -2.105  -12.030 1.008   1.00 0.00 ? 38  GLY A N    3  
ATOM 4243  C CA   . GLY A 1 38  ? -3.491  -12.169 0.600   1.00 0.00 ? 38  GLY A CA   3  
ATOM 4244  C C    . GLY A 1 38  ? -4.165  -13.370 1.233   1.00 0.00 ? 38  GLY A C    3  
ATOM 4245  O O    . GLY A 1 38  ? -4.177  -14.460 0.660   1.00 0.00 ? 38  GLY A O    3  
ATOM 4246  H H    . GLY A 1 38  ? -1.838  -11.281 1.580   1.00 0.00 ? 38  GLY A H    3  
ATOM 4247  H HA2  . GLY A 1 38  ? -4.029  -11.277 0.882   1.00 0.00 ? 38  GLY A HA2  3  
ATOM 4248  H HA3  . GLY A 1 38  ? -3.528  -12.276 -0.475  1.00 0.00 ? 38  GLY A HA3  3  
ATOM 4249  N N    . THR A 1 39  ? -4.726  -13.172 2.422   1.00 0.00 ? 39  THR A N    3  
ATOM 4250  C CA   . THR A 1 39  ? -5.402  -14.248 3.136   1.00 0.00 ? 39  THR A CA   3  
ATOM 4251  C C    . THR A 1 39  ? -6.887  -13.946 3.307   1.00 0.00 ? 39  THR A C    3  
ATOM 4252  O O    . THR A 1 39  ? -7.466  -14.208 4.362   1.00 0.00 ? 39  THR A O    3  
ATOM 4253  C CB   . THR A 1 39  ? -4.775  -14.484 4.523   1.00 0.00 ? 39  THR A CB   3  
ATOM 4254  O OG1  . THR A 1 39  ? -5.368  -15.631 5.141   1.00 0.00 ? 39  THR A OG1  3  
ATOM 4255  C CG2  . THR A 1 39  ? -4.963  -13.266 5.416   1.00 0.00 ? 39  THR A CG2  3  
ATOM 4256  H H    . THR A 1 39  ? -4.683  -12.282 2.828   1.00 0.00 ? 39  THR A H    3  
ATOM 4257  H HA   . THR A 1 39  ? -5.294  -15.153 2.556   1.00 0.00 ? 39  THR A HA   3  
ATOM 4258  H HB   . THR A 1 39  ? -3.716  -14.659 4.397   1.00 0.00 ? 39  THR A HB   3  
ATOM 4259  H HG1  . THR A 1 39  ? -4.685  -16.277 5.338   1.00 0.00 ? 39  THR A HG1  3  
ATOM 4260  H HG21 . THR A 1 39  ? -5.712  -13.481 6.164   1.00 0.00 ? 39  THR A HG21 3  
ATOM 4261  H HG22 . THR A 1 39  ? -5.282  -12.427 4.817   1.00 0.00 ? 39  THR A HG22 3  
ATOM 4262  H HG23 . THR A 1 39  ? -4.029  -13.029 5.901   1.00 0.00 ? 39  THR A HG23 3  
ATOM 4263  N N    . SER A 1 40  ? -7.498  -13.395 2.264   1.00 0.00 ? 40  SER A N    3  
ATOM 4264  C CA   . SER A 1 40  ? -8.915  -13.054 2.300   1.00 0.00 ? 40  SER A CA   3  
ATOM 4265  C C    . SER A 1 40  ? -9.567  -13.293 0.941   1.00 0.00 ? 40  SER A C    3  
ATOM 4266  O O    . SER A 1 40  ? -8.914  -13.739 -0.003  1.00 0.00 ? 40  SER A O    3  
ATOM 4267  C CB   . SER A 1 40  ? -9.100  -11.594 2.717   1.00 0.00 ? 40  SER A CB   3  
ATOM 4268  O OG   . SER A 1 40  ? -8.844  -11.422 4.101   1.00 0.00 ? 40  SER A OG   3  
ATOM 4269  H H    . SER A 1 40  ? -6.982  -13.210 1.451   1.00 0.00 ? 40  SER A H    3  
ATOM 4270  H HA   . SER A 1 40  ? -9.391  -13.691 3.031   1.00 0.00 ? 40  SER A HA   3  
ATOM 4271  H HB2  . SER A 1 40  ? -8.418  -10.973 2.158   1.00 0.00 ? 40  SER A HB2  3  
ATOM 4272  H HB3  . SER A 1 40  ? -10.116 -11.289 2.511   1.00 0.00 ? 40  SER A HB3  3  
ATOM 4273  H HG   . SER A 1 40  ? -9.665  -11.220 4.555   1.00 0.00 ? 40  SER A HG   3  
ATOM 4274  N N    . HIS A 1 41  ? -10.859 -12.994 0.851   1.00 0.00 ? 41  HIS A N    3  
ATOM 4275  C CA   . HIS A 1 41  ? -11.600 -13.175 -0.392  1.00 0.00 ? 41  HIS A CA   3  
ATOM 4276  C C    . HIS A 1 41  ? -10.823 -12.606 -1.576  1.00 0.00 ? 41  HIS A C    3  
ATOM 4277  O O    . HIS A 1 41  ? -11.069 -12.970 -2.727  1.00 0.00 ? 41  HIS A O    3  
ATOM 4278  C CB   . HIS A 1 41  ? -12.970 -12.504 -0.297  1.00 0.00 ? 41  HIS A CB   3  
ATOM 4279  C CG   . HIS A 1 41  ? -12.992 -11.315 0.614   1.00 0.00 ? 41  HIS A CG   3  
ATOM 4280  N ND1  . HIS A 1 41  ? -14.093 -10.962 1.365   1.00 0.00 ? 41  HIS A ND1  3  
ATOM 4281  C CD2  . HIS A 1 41  ? -12.038 -10.396 0.893   1.00 0.00 ? 41  HIS A CD2  3  
ATOM 4282  C CE1  . HIS A 1 41  ? -13.816 -9.876  2.065   1.00 0.00 ? 41  HIS A CE1  3  
ATOM 4283  N NE2  . HIS A 1 41  ? -12.575 -9.513  1.798   1.00 0.00 ? 41  HIS A NE2  3  
ATOM 4284  H H    . HIS A 1 41  ? -11.324 -12.643 1.638   1.00 0.00 ? 41  HIS A H    3  
ATOM 4285  H HA   . HIS A 1 41  ? -11.738 -14.235 -0.545  1.00 0.00 ? 41  HIS A HA   3  
ATOM 4286  H HB2  . HIS A 1 41  ? -13.271 -12.174 -1.280  1.00 0.00 ? 41  HIS A HB2  3  
ATOM 4287  H HB3  . HIS A 1 41  ? -13.690 -13.220 0.074   1.00 0.00 ? 41  HIS A HB3  3  
ATOM 4288  H HD1  . HIS A 1 41  ? -14.951 -11.435 1.380   1.00 0.00 ? 41  HIS A HD1  3  
ATOM 4289  H HD2  . HIS A 1 41  ? -11.039 -10.363 0.481   1.00 0.00 ? 41  HIS A HD2  3  
ATOM 4290  H HE1  . HIS A 1 41  ? -14.489 -9.372  2.742   1.00 0.00 ? 41  HIS A HE1  3  
ATOM 4291  H HE2  . HIS A 1 41  ? -12.146 -8.692  2.117   1.00 0.00 ? 41  HIS A HE2  3  
ATOM 4292  N N    . THR A 1 42  ? -9.884  -11.711 -1.286  1.00 0.00 ? 42  THR A N    3  
ATOM 4293  C CA   . THR A 1 42  ? -9.073  -11.090 -2.326  1.00 0.00 ? 42  THR A CA   3  
ATOM 4294  C C    . THR A 1 42  ? -7.905  -11.987 -2.720  1.00 0.00 ? 42  THR A C    3  
ATOM 4295  O O    . THR A 1 42  ? -6.909  -12.076 -2.004  1.00 0.00 ? 42  THR A O    3  
ATOM 4296  C CB   . THR A 1 42  ? -8.526  -9.724  -1.871  1.00 0.00 ? 42  THR A CB   3  
ATOM 4297  O OG1  . THR A 1 42  ? -7.910  -9.847  -0.585  1.00 0.00 ? 42  THR A OG1  3  
ATOM 4298  C CG2  . THR A 1 42  ? -9.639  -8.689  -1.809  1.00 0.00 ? 42  THR A CG2  3  
ATOM 4299  H H    . THR A 1 42  ? -9.735  -11.462 -0.350  1.00 0.00 ? 42  THR A H    3  
ATOM 4300  H HA   . THR A 1 42  ? -9.702  -10.933 -3.190  1.00 0.00 ? 42  THR A HA   3  
ATOM 4301  H HB   . THR A 1 42  ? -7.787  -9.393  -2.586  1.00 0.00 ? 42  THR A HB   3  
ATOM 4302  H HG1  . THR A 1 42  ? -7.190  -9.215  -0.513  1.00 0.00 ? 42  THR A HG1  3  
ATOM 4303  H HG21 . THR A 1 42  ? -9.212  -7.698  -1.853  1.00 0.00 ? 42  THR A HG21 3  
ATOM 4304  H HG22 . THR A 1 42  ? -10.187 -8.804  -0.885  1.00 0.00 ? 42  THR A HG22 3  
ATOM 4305  H HG23 . THR A 1 42  ? -10.308 -8.830  -2.644  1.00 0.00 ? 42  THR A HG23 3  
ATOM 4306  N N    . GLY A 1 43  ? -8.034  -12.649 -3.866  1.00 0.00 ? 43  GLY A N    3  
ATOM 4307  C CA   . GLY A 1 43  ? -6.980  -13.530 -4.336  1.00 0.00 ? 43  GLY A CA   3  
ATOM 4308  C C    . GLY A 1 43  ? -5.752  -12.771 -4.796  1.00 0.00 ? 43  GLY A C    3  
ATOM 4309  O O    . GLY A 1 43  ? -4.633  -13.084 -4.390  1.00 0.00 ? 43  GLY A O    3  
ATOM 4310  H H    . GLY A 1 43  ? -8.851  -12.539 -4.397  1.00 0.00 ? 43  GLY A H    3  
ATOM 4311  H HA2  . GLY A 1 43  ? -6.700  -14.197 -3.535  1.00 0.00 ? 43  GLY A HA2  3  
ATOM 4312  H HA3  . GLY A 1 43  ? -7.358  -14.115 -5.162  1.00 0.00 ? 43  GLY A HA3  3  
ATOM 4313  N N    . GLU A 1 44  ? -5.960  -11.771 -5.647  1.00 0.00 ? 44  GLU A N    3  
ATOM 4314  C CA   . GLU A 1 44  ? -4.859  -10.967 -6.164  1.00 0.00 ? 44  GLU A CA   3  
ATOM 4315  C C    . GLU A 1 44  ? -4.397  -9.946  -5.128  1.00 0.00 ? 44  GLU A C    3  
ATOM 4316  O O    . GLU A 1 44  ? -4.212  -8.770  -5.439  1.00 0.00 ? 44  GLU A O    3  
ATOM 4317  C CB   . GLU A 1 44  ? -5.280  -10.250 -7.449  1.00 0.00 ? 44  GLU A CB   3  
ATOM 4318  C CG   . GLU A 1 44  ? -5.328  -11.159 -8.665  1.00 0.00 ? 44  GLU A CG   3  
ATOM 4319  C CD   . GLU A 1 44  ? -5.571  -10.398 -9.954  1.00 0.00 ? 44  GLU A CD   3  
ATOM 4320  O OE1  . GLU A 1 44  ? -4.609  -9.795  -10.476 1.00 0.00 ? 44  GLU A OE1  3  
ATOM 4321  O OE2  . GLU A 1 44  ? -6.721  -10.404 -10.440 1.00 0.00 ? 44  GLU A OE2  3  
ATOM 4322  H H    . GLU A 1 44  ? -6.875  -11.569 -5.934  1.00 0.00 ? 44  GLU A H    3  
ATOM 4323  H HA   . GLU A 1 44  ? -4.038  -11.632 -6.387  1.00 0.00 ? 44  GLU A HA   3  
ATOM 4324  H HB2  . GLU A 1 44  ? -6.262  -9.825  -7.304  1.00 0.00 ? 44  GLU A HB2  3  
ATOM 4325  H HB3  . GLU A 1 44  ? -4.579  -9.453  -7.648  1.00 0.00 ? 44  GLU A HB3  3  
ATOM 4326  H HG2  . GLU A 1 44  ? -4.386  -11.681 -8.746  1.00 0.00 ? 44  GLU A HG2  3  
ATOM 4327  H HG3  . GLU A 1 44  ? -6.125  -11.876 -8.532  1.00 0.00 ? 44  GLU A HG3  3  
ATOM 4328  N N    . ALA A 1 45  ? -4.212  -10.406 -3.895  1.00 0.00 ? 45  ALA A N    3  
ATOM 4329  C CA   . ALA A 1 45  ? -3.770  -9.535  -2.812  1.00 0.00 ? 45  ALA A CA   3  
ATOM 4330  C C    . ALA A 1 45  ? -2.354  -9.885  -2.369  1.00 0.00 ? 45  ALA A C    3  
ATOM 4331  O O    . ALA A 1 45  ? -1.976  -9.650  -1.222  1.00 0.00 ? 45  ALA A O    3  
ATOM 4332  C CB   . ALA A 1 45  ? -4.731  -9.626  -1.636  1.00 0.00 ? 45  ALA A CB   3  
ATOM 4333  H H    . ALA A 1 45  ? -4.375  -11.354 -3.709  1.00 0.00 ? 45  ALA A H    3  
ATOM 4334  H HA   . ALA A 1 45  ? -3.782  -8.518  -3.177  1.00 0.00 ? 45  ALA A HA   3  
ATOM 4335  H HB1  . ALA A 1 45  ? -5.748  -9.616  -2.001  1.00 0.00 ? 45  ALA A HB1  3  
ATOM 4336  H HB2  . ALA A 1 45  ? -4.551  -10.543 -1.095  1.00 0.00 ? 45  ALA A HB2  3  
ATOM 4337  H HB3  . ALA A 1 45  ? -4.576  -8.783  -0.979  1.00 0.00 ? 45  ALA A HB3  3  
ATOM 4338  N N    . SER A 1 46  ? -1.574  -10.449 -3.286  1.00 0.00 ? 46  SER A N    3  
ATOM 4339  C CA   . SER A 1 46  ? -0.200  -10.836 -2.988  1.00 0.00 ? 46  SER A CA   3  
ATOM 4340  C C    . SER A 1 46  ? 0.788   -9.970  -3.763  1.00 0.00 ? 46  SER A C    3  
ATOM 4341  O O    . SER A 1 46  ? 0.757   -9.920  -4.992  1.00 0.00 ? 46  SER A O    3  
ATOM 4342  C CB   . SER A 1 46  ? 0.022   -12.311 -3.328  1.00 0.00 ? 46  SER A CB   3  
ATOM 4343  O OG   . SER A 1 46  ? 1.404   -12.617 -3.391  1.00 0.00 ? 46  SER A OG   3  
ATOM 4344  H H    . SER A 1 46  ? -1.933  -10.611 -4.184  1.00 0.00 ? 46  SER A H    3  
ATOM 4345  H HA   . SER A 1 46  ? -0.037  -10.690 -1.931  1.00 0.00 ? 46  SER A HA   3  
ATOM 4346  H HB2  . SER A 1 46  ? -0.436  -12.926 -2.568  1.00 0.00 ? 46  SER A HB2  3  
ATOM 4347  H HB3  . SER A 1 46  ? -0.427  -12.528 -4.286  1.00 0.00 ? 46  SER A HB3  3  
ATOM 4348  H HG   . SER A 1 46  ? 1.654   -12.781 -4.303  1.00 0.00 ? 46  SER A HG   3  
ATOM 4349  N N    . GLY A 1 47  ? 1.666   -9.287  -3.034  1.00 0.00 ? 47  GLY A N    3  
ATOM 4350  C CA   . GLY A 1 47  ? 2.651   -8.431  -3.668  1.00 0.00 ? 47  GLY A CA   3  
ATOM 4351  C C    . GLY A 1 47  ? 3.232   -7.408  -2.712  1.00 0.00 ? 47  GLY A C    3  
ATOM 4352  O O    . GLY A 1 47  ? 3.094   -7.538  -1.495  1.00 0.00 ? 47  GLY A O    3  
ATOM 4353  H H    . GLY A 1 47  ? 1.643   -9.365  -2.057  1.00 0.00 ? 47  GLY A H    3  
ATOM 4354  H HA2  . GLY A 1 47  ? 3.452   -9.046  -4.051  1.00 0.00 ? 47  GLY A HA2  3  
ATOM 4355  H HA3  . GLY A 1 47  ? 2.183   -7.912  -4.492  1.00 0.00 ? 47  GLY A HA3  3  
ATOM 4356  N N    . ILE A 1 48  ? 3.883   -6.389  -3.263  1.00 0.00 ? 48  ILE A N    3  
ATOM 4357  C CA   . ILE A 1 48  ? 4.487   -5.341  -2.450  1.00 0.00 ? 48  ILE A CA   3  
ATOM 4358  C C    . ILE A 1 48  ? 3.613   -4.092  -2.426  1.00 0.00 ? 48  ILE A C    3  
ATOM 4359  O O    . ILE A 1 48  ? 3.074   -3.679  -3.453  1.00 0.00 ? 48  ILE A O    3  
ATOM 4360  C CB   . ILE A 1 48  ? 5.888   -4.963  -2.968  1.00 0.00 ? 48  ILE A CB   3  
ATOM 4361  C CG1  . ILE A 1 48  ? 6.738   -6.220  -3.168  1.00 0.00 ? 48  ILE A CG1  3  
ATOM 4362  C CG2  . ILE A 1 48  ? 6.569   -4.004  -2.003  1.00 0.00 ? 48  ILE A CG2  3  
ATOM 4363  C CD1  . ILE A 1 48  ? 7.130   -6.895  -1.872  1.00 0.00 ? 48  ILE A CD1  3  
ATOM 4364  H H    . ILE A 1 48  ? 3.959   -6.342  -4.238  1.00 0.00 ? 48  ILE A H    3  
ATOM 4365  H HA   . ILE A 1 48  ? 4.588   -5.717  -1.442  1.00 0.00 ? 48  ILE A HA   3  
ATOM 4366  H HB   . ILE A 1 48  ? 5.773   -4.461  -3.916  1.00 0.00 ? 48  ILE A HB   3  
ATOM 4367  H HG12 . ILE A 1 48  ? 6.183   -6.932  -3.758  1.00 0.00 ? 48  ILE A HG12 3  
ATOM 4368  H HG13 . ILE A 1 48  ? 7.644   -5.953  -3.691  1.00 0.00 ? 48  ILE A HG13 3  
ATOM 4369  H HG21 . ILE A 1 48  ? 5.861   -3.688  -1.251  1.00 0.00 ? 48  ILE A HG21 3  
ATOM 4370  H HG22 . ILE A 1 48  ? 7.400   -4.503  -1.528  1.00 0.00 ? 48  ILE A HG22 3  
ATOM 4371  H HG23 . ILE A 1 48  ? 6.927   -3.142  -2.545  1.00 0.00 ? 48  ILE A HG23 3  
ATOM 4372  H HD11 . ILE A 1 48  ? 7.323   -7.942  -2.056  1.00 0.00 ? 48  ILE A HD11 3  
ATOM 4373  H HD12 . ILE A 1 48  ? 8.019   -6.428  -1.477  1.00 0.00 ? 48  ILE A HD12 3  
ATOM 4374  H HD13 . ILE A 1 48  ? 6.325   -6.799  -1.158  1.00 0.00 ? 48  ILE A HD13 3  
ATOM 4375  N N    . TYR A 1 49  ? 3.478   -3.494  -1.247  1.00 0.00 ? 49  TYR A N    3  
ATOM 4376  C CA   . TYR A 1 49  ? 2.668   -2.292  -1.088  1.00 0.00 ? 49  TYR A CA   3  
ATOM 4377  C C    . TYR A 1 49  ? 3.372   -1.275  -0.196  1.00 0.00 ? 49  TYR A C    3  
ATOM 4378  O O    . TYR A 1 49  ? 4.094   -1.640  0.733   1.00 0.00 ? 49  TYR A O    3  
ATOM 4379  C CB   . TYR A 1 49  ? 1.302   -2.646  -0.498  1.00 0.00 ? 49  TYR A CB   3  
ATOM 4380  C CG   . TYR A 1 49  ? 0.451   -3.501  -1.410  1.00 0.00 ? 49  TYR A CG   3  
ATOM 4381  C CD1  . TYR A 1 49  ? 0.810   -4.811  -1.701  1.00 0.00 ? 49  TYR A CD1  3  
ATOM 4382  C CD2  . TYR A 1 49  ? -0.711  -2.997  -1.981  1.00 0.00 ? 49  TYR A CD2  3  
ATOM 4383  C CE1  . TYR A 1 49  ? 0.036   -5.595  -2.535  1.00 0.00 ? 49  TYR A CE1  3  
ATOM 4384  C CE2  . TYR A 1 49  ? -1.492  -3.775  -2.815  1.00 0.00 ? 49  TYR A CE2  3  
ATOM 4385  C CZ   . TYR A 1 49  ? -1.114  -5.073  -3.088  1.00 0.00 ? 49  TYR A CZ   3  
ATOM 4386  O OH   . TYR A 1 49  ? -1.888  -5.850  -3.919  1.00 0.00 ? 49  TYR A OH   3  
ATOM 4387  H H    . TYR A 1 49  ? 3.932   -3.871  -0.465  1.00 0.00 ? 49  TYR A H    3  
ATOM 4388  H HA   . TYR A 1 49  ? 2.524   -1.857  -2.067  1.00 0.00 ? 49  TYR A HA   3  
ATOM 4389  H HB2  . TYR A 1 49  ? 1.446   -3.188  0.424   1.00 0.00 ? 49  TYR A HB2  3  
ATOM 4390  H HB3  . TYR A 1 49  ? 0.759   -1.735  -0.294  1.00 0.00 ? 49  TYR A HB3  3  
ATOM 4391  H HD1  . TYR A 1 49  ? 1.712   -5.217  -1.266  1.00 0.00 ? 49  TYR A HD1  3  
ATOM 4392  H HD2  . TYR A 1 49  ? -1.004  -1.980  -1.765  1.00 0.00 ? 49  TYR A HD2  3  
ATOM 4393  H HE1  . TYR A 1 49  ? 0.332   -6.612  -2.750  1.00 0.00 ? 49  TYR A HE1  3  
ATOM 4394  H HE2  . TYR A 1 49  ? -2.392  -3.366  -3.249  1.00 0.00 ? 49  TYR A HE2  3  
ATOM 4395  H HH   . TYR A 1 49  ? -2.078  -6.687  -3.489  1.00 0.00 ? 49  TYR A HH   3  
ATOM 4396  N N    . VAL A 1 50  ? 3.157   0.005   -0.483  1.00 0.00 ? 50  VAL A N    3  
ATOM 4397  C CA   . VAL A 1 50  ? 3.769   1.077   0.293   1.00 0.00 ? 50  VAL A CA   3  
ATOM 4398  C C    . VAL A 1 50  ? 3.177   1.145   1.696   1.00 0.00 ? 50  VAL A C    3  
ATOM 4399  O O    . VAL A 1 50  ? 2.077   1.663   1.894   1.00 0.00 ? 50  VAL A O    3  
ATOM 4400  C CB   . VAL A 1 50  ? 3.588   2.442   -0.396  1.00 0.00 ? 50  VAL A CB   3  
ATOM 4401  C CG1  . VAL A 1 50  ? 4.126   3.560   0.484   1.00 0.00 ? 50  VAL A CG1  3  
ATOM 4402  C CG2  . VAL A 1 50  ? 4.271   2.447   -1.755  1.00 0.00 ? 50  VAL A CG2  3  
ATOM 4403  H H    . VAL A 1 50  ? 2.572   0.233   -1.236  1.00 0.00 ? 50  VAL A H    3  
ATOM 4404  H HA   . VAL A 1 50  ? 4.827   0.872   0.369   1.00 0.00 ? 50  VAL A HA   3  
ATOM 4405  H HB   . VAL A 1 50  ? 2.532   2.610   -0.546  1.00 0.00 ? 50  VAL A HB   3  
ATOM 4406  H HG11 . VAL A 1 50  ? 3.306   4.039   0.998   1.00 0.00 ? 50  VAL A HG11 3  
ATOM 4407  H HG12 . VAL A 1 50  ? 4.815   3.149   1.208   1.00 0.00 ? 50  VAL A HG12 3  
ATOM 4408  H HG13 . VAL A 1 50  ? 4.639   4.286   -0.129  1.00 0.00 ? 50  VAL A HG13 3  
ATOM 4409  H HG21 . VAL A 1 50  ? 5.231   1.960   -1.677  1.00 0.00 ? 50  VAL A HG21 3  
ATOM 4410  H HG22 . VAL A 1 50  ? 3.656   1.918   -2.469  1.00 0.00 ? 50  VAL A HG22 3  
ATOM 4411  H HG23 . VAL A 1 50  ? 4.409   3.466   -2.085  1.00 0.00 ? 50  VAL A HG23 3  
ATOM 4412  N N    . LYS A 1 51  ? 3.913   0.620   2.669   1.00 0.00 ? 51  LYS A N    3  
ATOM 4413  C CA   . LYS A 1 51  ? 3.464   0.622   4.056   1.00 0.00 ? 51  LYS A CA   3  
ATOM 4414  C C    . LYS A 1 51  ? 3.435   2.040   4.617   1.00 0.00 ? 51  LYS A C    3  
ATOM 4415  O O    . LYS A 1 51  ? 2.491   2.427   5.306   1.00 0.00 ? 51  LYS A O    3  
ATOM 4416  C CB   . LYS A 1 51  ? 4.378   -0.258  4.912   1.00 0.00 ? 51  LYS A CB   3  
ATOM 4417  C CG   . LYS A 1 51  ? 3.958   -0.335  6.369   1.00 0.00 ? 51  LYS A CG   3  
ATOM 4418  C CD   . LYS A 1 51  ? 2.742   -1.227  6.553   1.00 0.00 ? 51  LYS A CD   3  
ATOM 4419  C CE   . LYS A 1 51  ? 2.456   -1.484  8.024   1.00 0.00 ? 51  LYS A CE   3  
ATOM 4420  N NZ   . LYS A 1 51  ? 1.696   -0.364  8.645   1.00 0.00 ? 51  LYS A NZ   3  
ATOM 4421  H H    . LYS A 1 51  ? 4.782   0.221   2.449   1.00 0.00 ? 51  LYS A H    3  
ATOM 4422  H HA   . LYS A 1 51  ? 2.463   0.218   4.081   1.00 0.00 ? 51  LYS A HA   3  
ATOM 4423  H HB2  . LYS A 1 51  ? 4.379   -1.258  4.505   1.00 0.00 ? 51  LYS A HB2  3  
ATOM 4424  H HB3  . LYS A 1 51  ? 5.382   0.140   4.869   1.00 0.00 ? 51  LYS A HB3  3  
ATOM 4425  H HG2  . LYS A 1 51  ? 4.776   -0.736  6.950   1.00 0.00 ? 51  LYS A HG2  3  
ATOM 4426  H HG3  . LYS A 1 51  ? 3.719   0.660   6.719   1.00 0.00 ? 51  LYS A HG3  3  
ATOM 4427  H HD2  . LYS A 1 51  ? 1.883   -0.747  6.109   1.00 0.00 ? 51  LYS A HD2  3  
ATOM 4428  H HD3  . LYS A 1 51  ? 2.923   -2.172  6.060   1.00 0.00 ? 51  LYS A HD3  3  
ATOM 4429  H HE2  . LYS A 1 51  ? 1.878   -2.391  8.112   1.00 0.00 ? 51  LYS A HE2  3  
ATOM 4430  H HE3  . LYS A 1 51  ? 3.395   -1.603  8.545   1.00 0.00 ? 51  LYS A HE3  3  
ATOM 4431  H HZ1  . LYS A 1 51  ? 1.328   0.270   7.907   1.00 0.00 ? 51  LYS A HZ1  3  
ATOM 4432  H HZ2  . LYS A 1 51  ? 2.316   0.181   9.277   1.00 0.00 ? 51  LYS A HZ2  3  
ATOM 4433  H HZ3  . LYS A 1 51  ? 0.897   -0.736  9.197   1.00 0.00 ? 51  LYS A HZ3  3  
ATOM 4434  N N    . SER A 1 52  ? 4.475   2.812   4.315   1.00 0.00 ? 52  SER A N    3  
ATOM 4435  C CA   . SER A 1 52  ? 4.569   4.187   4.791   1.00 0.00 ? 52  SER A CA   3  
ATOM 4436  C C    . SER A 1 52  ? 5.557   4.987   3.947   1.00 0.00 ? 52  SER A C    3  
ATOM 4437  O O    . SER A 1 52  ? 6.280   4.429   3.122   1.00 0.00 ? 52  SER A O    3  
ATOM 4438  C CB   . SER A 1 52  ? 4.997   4.213   6.259   1.00 0.00 ? 52  SER A CB   3  
ATOM 4439  O OG   . SER A 1 52  ? 3.894   3.977   7.116   1.00 0.00 ? 52  SER A OG   3  
ATOM 4440  H H    . SER A 1 52  ? 5.196   2.447   3.761   1.00 0.00 ? 52  SER A H    3  
ATOM 4441  H HA   . SER A 1 52  ? 3.592   4.637   4.702   1.00 0.00 ? 52  SER A HA   3  
ATOM 4442  H HB2  . SER A 1 52  ? 5.739   3.448   6.429   1.00 0.00 ? 52  SER A HB2  3  
ATOM 4443  H HB3  . SER A 1 52  ? 5.418   5.180   6.492   1.00 0.00 ? 52  SER A HB3  3  
ATOM 4444  H HG   . SER A 1 52  ? 3.296   4.728   7.084   1.00 0.00 ? 52  SER A HG   3  
ATOM 4445  N N    . VAL A 1 53  ? 5.582   6.299   4.161   1.00 0.00 ? 53  VAL A N    3  
ATOM 4446  C CA   . VAL A 1 53  ? 6.482   7.177   3.422   1.00 0.00 ? 53  VAL A CA   3  
ATOM 4447  C C    . VAL A 1 53  ? 7.210   8.132   4.360   1.00 0.00 ? 53  VAL A C    3  
ATOM 4448  O O    . VAL A 1 53  ? 6.626   9.095   4.859   1.00 0.00 ? 53  VAL A O    3  
ATOM 4449  C CB   . VAL A 1 53  ? 5.721   7.996   2.362   1.00 0.00 ? 53  VAL A CB   3  
ATOM 4450  C CG1  . VAL A 1 53  ? 6.668   8.936   1.633   1.00 0.00 ? 53  VAL A CG1  3  
ATOM 4451  C CG2  . VAL A 1 53  ? 5.014   7.072   1.382   1.00 0.00 ? 53  VAL A CG2  3  
ATOM 4452  H H    . VAL A 1 53  ? 4.982   6.685   4.832   1.00 0.00 ? 53  VAL A H    3  
ATOM 4453  H HA   . VAL A 1 53  ? 7.209   6.560   2.916   1.00 0.00 ? 53  VAL A HA   3  
ATOM 4454  H HB   . VAL A 1 53  ? 4.974   8.592   2.865   1.00 0.00 ? 53  VAL A HB   3  
ATOM 4455  H HG11 . VAL A 1 53  ? 6.621   8.742   0.572   1.00 0.00 ? 53  VAL A HG11 3  
ATOM 4456  H HG12 . VAL A 1 53  ? 6.380   9.959   1.827   1.00 0.00 ? 53  VAL A HG12 3  
ATOM 4457  H HG13 . VAL A 1 53  ? 7.677   8.774   1.983   1.00 0.00 ? 53  VAL A HG13 3  
ATOM 4458  H HG21 . VAL A 1 53  ? 4.383   7.656   0.729   1.00 0.00 ? 53  VAL A HG21 3  
ATOM 4459  H HG22 . VAL A 1 53  ? 5.748   6.542   0.793   1.00 0.00 ? 53  VAL A HG22 3  
ATOM 4460  H HG23 . VAL A 1 53  ? 4.410   6.362   1.927   1.00 0.00 ? 53  VAL A HG23 3  
ATOM 4461  N N    . ILE A 1 54  ? 8.489   7.861   4.596   1.00 0.00 ? 54  ILE A N    3  
ATOM 4462  C CA   . ILE A 1 54  ? 9.298   8.697   5.474   1.00 0.00 ? 54  ILE A CA   3  
ATOM 4463  C C    . ILE A 1 54  ? 9.200   10.166  5.077   1.00 0.00 ? 54  ILE A C    3  
ATOM 4464  O O    . ILE A 1 54  ? 9.362   10.533  3.913   1.00 0.00 ? 54  ILE A O    3  
ATOM 4465  C CB   . ILE A 1 54  ? 10.778  8.270   5.452   1.00 0.00 ? 54  ILE A CB   3  
ATOM 4466  C CG1  . ILE A 1 54  ? 10.929  6.851   6.006   1.00 0.00 ? 54  ILE A CG1  3  
ATOM 4467  C CG2  . ILE A 1 54  ? 11.624  9.250   6.251   1.00 0.00 ? 54  ILE A CG2  3  
ATOM 4468  C CD1  . ILE A 1 54  ? 10.595  5.771   5.001   1.00 0.00 ? 54  ILE A CD1  3  
ATOM 4469  H H    . ILE A 1 54  ? 8.899   7.079   4.170   1.00 0.00 ? 54  ILE A H    3  
ATOM 4470  H HA   . ILE A 1 54  ? 8.925   8.582   6.481   1.00 0.00 ? 54  ILE A HA   3  
ATOM 4471  H HB   . ILE A 1 54  ? 11.120  8.287   4.429   1.00 0.00 ? 54  ILE A HB   3  
ATOM 4472  H HG12 . ILE A 1 54  ? 11.949  6.703   6.324   1.00 0.00 ? 54  ILE A HG12 3  
ATOM 4473  H HG13 . ILE A 1 54  ? 10.271  6.732   6.855   1.00 0.00 ? 54  ILE A HG13 3  
ATOM 4474  H HG21 . ILE A 1 54  ? 12.665  8.976   6.170   1.00 0.00 ? 54  ILE A HG21 3  
ATOM 4475  H HG22 . ILE A 1 54  ? 11.483  10.247  5.862   1.00 0.00 ? 54  ILE A HG22 3  
ATOM 4476  H HG23 . ILE A 1 54  ? 11.325  9.222   7.288   1.00 0.00 ? 54  ILE A HG23 3  
ATOM 4477  H HD11 . ILE A 1 54  ? 11.328  4.981   5.064   1.00 0.00 ? 54  ILE A HD11 3  
ATOM 4478  H HD12 . ILE A 1 54  ? 9.615   5.372   5.214   1.00 0.00 ? 54  ILE A HD12 3  
ATOM 4479  H HD13 . ILE A 1 54  ? 10.604  6.191   4.006   1.00 0.00 ? 54  ILE A HD13 3  
ATOM 4480  N N    . PRO A 1 55  ? 8.929   11.030  6.067   1.00 0.00 ? 55  PRO A N    3  
ATOM 4481  C CA   . PRO A 1 55  ? 8.805   12.474  5.846   1.00 0.00 ? 55  PRO A CA   3  
ATOM 4482  C C    . PRO A 1 55  ? 10.142  13.126  5.511   1.00 0.00 ? 55  PRO A C    3  
ATOM 4483  O O    . PRO A 1 55  ? 11.202  12.607  5.860   1.00 0.00 ? 55  PRO A O    3  
ATOM 4484  C CB   . PRO A 1 55  ? 8.278   12.993  7.186   1.00 0.00 ? 55  PRO A CB   3  
ATOM 4485  C CG   . PRO A 1 55  ? 8.733   11.989  8.187   1.00 0.00 ? 55  PRO A CG   3  
ATOM 4486  C CD   . PRO A 1 55  ? 8.724   10.663  7.478   1.00 0.00 ? 55  PRO A CD   3  
ATOM 4487  H HA   . PRO A 1 55  ? 8.092   12.696  5.066   1.00 0.00 ? 55  PRO A HA   3  
ATOM 4488  H HB2  . PRO A 1 55  ? 8.696   13.970  7.386   1.00 0.00 ? 55  PRO A HB2  3  
ATOM 4489  H HB3  . PRO A 1 55  ? 7.201   13.057  7.153   1.00 0.00 ? 55  PRO A HB3  3  
ATOM 4490  H HG2  . PRO A 1 55  ? 9.731   12.229  8.521   1.00 0.00 ? 55  PRO A HG2  3  
ATOM 4491  H HG3  . PRO A 1 55  ? 8.051   11.970  9.024   1.00 0.00 ? 55  PRO A HG3  3  
ATOM 4492  H HD2  . PRO A 1 55  ? 9.529   10.038  7.835   1.00 0.00 ? 55  PRO A HD2  3  
ATOM 4493  H HD3  . PRO A 1 55  ? 7.772   10.170  7.613   1.00 0.00 ? 55  PRO A HD3  3  
ATOM 4494  N N    . GLY A 1 56  ? 10.085  14.267  4.831   1.00 0.00 ? 56  GLY A N    3  
ATOM 4495  C CA   . GLY A 1 56  ? 11.299  14.971  4.460   1.00 0.00 ? 56  GLY A CA   3  
ATOM 4496  C C    . GLY A 1 56  ? 12.222  14.125  3.606   1.00 0.00 ? 56  GLY A C    3  
ATOM 4497  O O    . GLY A 1 56  ? 13.440  14.304  3.631   1.00 0.00 ? 56  GLY A O    3  
ATOM 4498  H H    . GLY A 1 56  ? 9.212   14.634  4.579   1.00 0.00 ? 56  GLY A H    3  
ATOM 4499  H HA2  . GLY A 1 56  ? 11.032  15.862  3.911   1.00 0.00 ? 56  GLY A HA2  3  
ATOM 4500  H HA3  . GLY A 1 56  ? 11.823  15.259  5.360   1.00 0.00 ? 56  GLY A HA3  3  
ATOM 4501  N N    . SER A 1 57  ? 11.642  13.200  2.849   1.00 0.00 ? 57  SER A N    3  
ATOM 4502  C CA   . SER A 1 57  ? 12.422  12.319  1.987   1.00 0.00 ? 57  SER A CA   3  
ATOM 4503  C C    . SER A 1 57  ? 12.103  12.575  0.517   1.00 0.00 ? 57  SER A C    3  
ATOM 4504  O O    . SER A 1 57  ? 11.169  13.307  0.192   1.00 0.00 ? 57  SER A O    3  
ATOM 4505  C CB   . SER A 1 57  ? 12.144  10.855  2.333   1.00 0.00 ? 57  SER A CB   3  
ATOM 4506  O OG   . SER A 1 57  ? 10.983  10.386  1.670   1.00 0.00 ? 57  SER A OG   3  
ATOM 4507  H H    . SER A 1 57  ? 10.667  13.106  2.872   1.00 0.00 ? 57  SER A H    3  
ATOM 4508  H HA   . SER A 1 57  ? 13.467  12.528  2.158   1.00 0.00 ? 57  SER A HA   3  
ATOM 4509  H HB2  . SER A 1 57  ? 12.985  10.250  2.031   1.00 0.00 ? 57  SER A HB2  3  
ATOM 4510  H HB3  . SER A 1 57  ? 11.998  10.762  3.400   1.00 0.00 ? 57  SER A HB3  3  
ATOM 4511  H HG   . SER A 1 57  ? 10.293  10.214  2.316   1.00 0.00 ? 57  SER A HG   3  
ATOM 4512  N N    . ALA A 1 58  ? 12.887  11.966  -0.367  1.00 0.00 ? 58  ALA A N    3  
ATOM 4513  C CA   . ALA A 1 58  ? 12.688  12.126  -1.802  1.00 0.00 ? 58  ALA A CA   3  
ATOM 4514  C C    . ALA A 1 58  ? 11.234  11.873  -2.186  1.00 0.00 ? 58  ALA A C    3  
ATOM 4515  O O    . ALA A 1 58  ? 10.608  12.693  -2.857  1.00 0.00 ? 58  ALA A O    3  
ATOM 4516  C CB   . ALA A 1 58  ? 13.609  11.190  -2.570  1.00 0.00 ? 58  ALA A CB   3  
ATOM 4517  H H    . ALA A 1 58  ? 13.615  11.395  -0.046  1.00 0.00 ? 58  ALA A H    3  
ATOM 4518  H HA   . ALA A 1 58  ? 12.947  13.142  -2.064  1.00 0.00 ? 58  ALA A HA   3  
ATOM 4519  H HB1  . ALA A 1 58  ? 13.341  11.201  -3.616  1.00 0.00 ? 58  ALA A HB1  3  
ATOM 4520  H HB2  . ALA A 1 58  ? 14.631  11.518  -2.456  1.00 0.00 ? 58  ALA A HB2  3  
ATOM 4521  H HB3  . ALA A 1 58  ? 13.507  10.187  -2.182  1.00 0.00 ? 58  ALA A HB3  3  
ATOM 4522  N N    . ALA A 1 59  ? 10.703  10.733  -1.756  1.00 0.00 ? 59  ALA A N    3  
ATOM 4523  C CA   . ALA A 1 59  ? 9.322   10.374  -2.054  1.00 0.00 ? 59  ALA A CA   3  
ATOM 4524  C C    . ALA A 1 59  ? 8.354   11.430  -1.531  1.00 0.00 ? 59  ALA A C    3  
ATOM 4525  O O    . ALA A 1 59  ? 7.523   11.949  -2.277  1.00 0.00 ? 59  ALA A O    3  
ATOM 4526  C CB   . ALA A 1 59  ? 8.991   9.012   -1.460  1.00 0.00 ? 59  ALA A CB   3  
ATOM 4527  H H    . ALA A 1 59  ? 11.252  10.121  -1.224  1.00 0.00 ? 59  ALA A H    3  
ATOM 4528  H HA   . ALA A 1 59  ? 9.219   10.306  -3.127  1.00 0.00 ? 59  ALA A HA   3  
ATOM 4529  H HB1  . ALA A 1 59  ? 9.504   8.243   -2.019  1.00 0.00 ? 59  ALA A HB1  3  
ATOM 4530  H HB2  . ALA A 1 59  ? 9.310   8.982   -0.429  1.00 0.00 ? 59  ALA A HB2  3  
ATOM 4531  H HB3  . ALA A 1 59  ? 7.926   8.846   -1.513  1.00 0.00 ? 59  ALA A HB3  3  
ATOM 4532  N N    . TYR A 1 60  ? 8.467   11.743  -0.245  1.00 0.00 ? 60  TYR A N    3  
ATOM 4533  C CA   . TYR A 1 60  ? 7.599   12.736  0.379   1.00 0.00 ? 60  TYR A CA   3  
ATOM 4534  C C    . TYR A 1 60  ? 7.624   14.047  -0.400  1.00 0.00 ? 60  TYR A C    3  
ATOM 4535  O O    . TYR A 1 60  ? 6.578   14.588  -0.763  1.00 0.00 ? 60  TYR A O    3  
ATOM 4536  C CB   . TYR A 1 60  ? 8.029   12.982  1.826   1.00 0.00 ? 60  TYR A CB   3  
ATOM 4537  C CG   . TYR A 1 60  ? 7.121   13.932  2.574   1.00 0.00 ? 60  TYR A CG   3  
ATOM 4538  C CD1  . TYR A 1 60  ? 5.934   13.489  3.142   1.00 0.00 ? 60  TYR A CD1  3  
ATOM 4539  C CD2  . TYR A 1 60  ? 7.452   15.275  2.713   1.00 0.00 ? 60  TYR A CD2  3  
ATOM 4540  C CE1  . TYR A 1 60  ? 5.102   14.354  3.825   1.00 0.00 ? 60  TYR A CE1  3  
ATOM 4541  C CE2  . TYR A 1 60  ? 6.627   16.147  3.395   1.00 0.00 ? 60  TYR A CE2  3  
ATOM 4542  C CZ   . TYR A 1 60  ? 5.452   15.682  3.949   1.00 0.00 ? 60  TYR A CZ   3  
ATOM 4543  O OH   . TYR A 1 60  ? 4.627   16.547  4.630   1.00 0.00 ? 60  TYR A OH   3  
ATOM 4544  H H    . TYR A 1 60  ? 9.148   11.296  0.299   1.00 0.00 ? 60  TYR A H    3  
ATOM 4545  H HA   . TYR A 1 60  ? 6.592   12.346  0.374   1.00 0.00 ? 60  TYR A HA   3  
ATOM 4546  H HB2  . TYR A 1 60  ? 8.034   12.043  2.357   1.00 0.00 ? 60  TYR A HB2  3  
ATOM 4547  H HB3  . TYR A 1 60  ? 9.025   13.399  1.833   1.00 0.00 ? 60  TYR A HB3  3  
ATOM 4548  H HD1  . TYR A 1 60  ? 5.662   12.447  3.043   1.00 0.00 ? 60  TYR A HD1  3  
ATOM 4549  H HD2  . TYR A 1 60  ? 8.373   15.636  2.277   1.00 0.00 ? 60  TYR A HD2  3  
ATOM 4550  H HE1  . TYR A 1 60  ? 4.182   13.990  4.260   1.00 0.00 ? 60  TYR A HE1  3  
ATOM 4551  H HE2  . TYR A 1 60  ? 6.901   17.187  3.493   1.00 0.00 ? 60  TYR A HE2  3  
ATOM 4552  H HH   . TYR A 1 60  ? 3.882   16.061  4.991   1.00 0.00 ? 60  TYR A HH   3  
ATOM 4553  N N    . HIS A 1 61  ? 8.826   14.554  -0.656  1.00 0.00 ? 61  HIS A N    3  
ATOM 4554  C CA   . HIS A 1 61  ? 8.989   15.802  -1.394  1.00 0.00 ? 61  HIS A CA   3  
ATOM 4555  C C    . HIS A 1 61  ? 8.253   15.743  -2.729  1.00 0.00 ? 61  HIS A C    3  
ATOM 4556  O O    . HIS A 1 61  ? 7.448   16.619  -3.044  1.00 0.00 ? 61  HIS A O    3  
ATOM 4557  C CB   . HIS A 1 61  ? 10.472  16.091  -1.627  1.00 0.00 ? 61  HIS A CB   3  
ATOM 4558  C CG   . HIS A 1 61  ? 11.197  16.535  -0.394  1.00 0.00 ? 61  HIS A CG   3  
ATOM 4559  N ND1  . HIS A 1 61  ? 10.646  17.392  0.535   1.00 0.00 ? 61  HIS A ND1  3  
ATOM 4560  C CD2  . HIS A 1 61  ? 12.436  16.234  0.060   1.00 0.00 ? 61  HIS A CD2  3  
ATOM 4561  C CE1  . HIS A 1 61  ? 11.516  17.600  1.508   1.00 0.00 ? 61  HIS A CE1  3  
ATOM 4562  N NE2  . HIS A 1 61  ? 12.610  16.909  1.244   1.00 0.00 ? 61  HIS A NE2  3  
ATOM 4563  H H    . HIS A 1 61  ? 9.622   14.077  -0.341  1.00 0.00 ? 61  HIS A H    3  
ATOM 4564  H HA   . HIS A 1 61  ? 8.565   16.596  -0.798  1.00 0.00 ? 61  HIS A HA   3  
ATOM 4565  H HB2  . HIS A 1 61  ? 10.953  15.195  -1.990  1.00 0.00 ? 61  HIS A HB2  3  
ATOM 4566  H HB3  . HIS A 1 61  ? 10.567  16.871  -2.369  1.00 0.00 ? 61  HIS A HB3  3  
ATOM 4567  H HD1  . HIS A 1 61  ? 9.752   17.789  0.488   1.00 0.00 ? 61  HIS A HD1  3  
ATOM 4568  H HD2  . HIS A 1 61  ? 13.155  15.585  -0.418  1.00 0.00 ? 61  HIS A HD2  3  
ATOM 4569  H HE1  . HIS A 1 61  ? 11.359  18.228  2.372   1.00 0.00 ? 61  HIS A HE1  3  
ATOM 4570  H HE2  . HIS A 1 61  ? 13.442  16.952  1.758   1.00 0.00 ? 61  HIS A HE2  3  
ATOM 4571  N N    . ASN A 1 62  ? 8.536   14.706  -3.510  1.00 0.00 ? 62  ASN A N    3  
ATOM 4572  C CA   . ASN A 1 62  ? 7.902   14.534  -4.812  1.00 0.00 ? 62  ASN A CA   3  
ATOM 4573  C C    . ASN A 1 62  ? 6.387   14.677  -4.703  1.00 0.00 ? 62  ASN A C    3  
ATOM 4574  O O    . ASN A 1 62  ? 5.777   15.485  -5.402  1.00 0.00 ? 62  ASN A O    3  
ATOM 4575  C CB   . ASN A 1 62  ? 8.256   13.166  -5.398  1.00 0.00 ? 62  ASN A CB   3  
ATOM 4576  C CG   . ASN A 1 62  ? 8.326   13.186  -6.913  1.00 0.00 ? 62  ASN A CG   3  
ATOM 4577  O OD1  . ASN A 1 62  ? 8.900   14.100  -7.507  1.00 0.00 ? 62  ASN A OD1  3  
ATOM 4578  N ND2  . ASN A 1 62  ? 7.741   12.176  -7.546  1.00 0.00 ? 62  ASN A ND2  3  
ATOM 4579  H H    . ASN A 1 62  ? 9.187   14.040  -3.204  1.00 0.00 ? 62  ASN A H    3  
ATOM 4580  H HA   . ASN A 1 62  ? 8.278   15.305  -5.468  1.00 0.00 ? 62  ASN A HA   3  
ATOM 4581  H HB2  . ASN A 1 62  ? 9.217   12.855  -5.017  1.00 0.00 ? 62  ASN A HB2  3  
ATOM 4582  H HB3  . ASN A 1 62  ? 7.506   12.448  -5.101  1.00 0.00 ? 62  ASN A HB3  3  
ATOM 4583  H HD21 . ASN A 1 62  ? 7.302   11.484  -7.008  1.00 0.00 ? 62  ASN A HD21 3  
ATOM 4584  H HD22 . ASN A 1 62  ? 7.772   12.164  -8.526  1.00 0.00 ? 62  ASN A HD22 3  
ATOM 4585  N N    . GLY A 1 63  ? 5.786   13.886  -3.820  1.00 0.00 ? 63  GLY A N    3  
ATOM 4586  C CA   . GLY A 1 63  ? 4.347   13.940  -3.634  1.00 0.00 ? 63  GLY A CA   3  
ATOM 4587  C C    . GLY A 1 63  ? 3.599   13.117  -4.664  1.00 0.00 ? 63  GLY A C    3  
ATOM 4588  O O    . GLY A 1 63  ? 2.494   13.476  -5.072  1.00 0.00 ? 63  GLY A O    3  
ATOM 4589  H H    . GLY A 1 63  ? 6.323   13.260  -3.290  1.00 0.00 ? 63  GLY A H    3  
ATOM 4590  H HA2  . GLY A 1 63  ? 4.108   13.569  -2.649  1.00 0.00 ? 63  GLY A HA2  3  
ATOM 4591  H HA3  . GLY A 1 63  ? 4.025   14.968  -3.708  1.00 0.00 ? 63  GLY A HA3  3  
ATOM 4592  N N    . HIS A 1 64  ? 4.201   12.010  -5.086  1.00 0.00 ? 64  HIS A N    3  
ATOM 4593  C CA   . HIS A 1 64  ? 3.585   11.134  -6.076  1.00 0.00 ? 64  HIS A CA   3  
ATOM 4594  C C    . HIS A 1 64  ? 3.347   9.742   -5.497  1.00 0.00 ? 64  HIS A C    3  
ATOM 4595  O O    . HIS A 1 64  ? 2.316   9.120   -5.756  1.00 0.00 ? 64  HIS A O    3  
ATOM 4596  C CB   . HIS A 1 64  ? 4.466   11.037  -7.321  1.00 0.00 ? 64  HIS A CB   3  
ATOM 4597  C CG   . HIS A 1 64  ? 4.389   12.244  -8.205  1.00 0.00 ? 64  HIS A CG   3  
ATOM 4598  N ND1  . HIS A 1 64  ? 4.088   12.175  -9.548  1.00 0.00 ? 64  HIS A ND1  3  
ATOM 4599  C CD2  . HIS A 1 64  ? 4.576   13.556  -7.929  1.00 0.00 ? 64  HIS A CD2  3  
ATOM 4600  C CE1  . HIS A 1 64  ? 4.094   13.393  -10.061 1.00 0.00 ? 64  HIS A CE1  3  
ATOM 4601  N NE2  . HIS A 1 64  ? 4.387   14.249  -9.099  1.00 0.00 ? 64  HIS A NE2  3  
ATOM 4602  H H    . HIS A 1 64  ? 5.081   11.777  -4.723  1.00 0.00 ? 64  HIS A H    3  
ATOM 4603  H HA   . HIS A 1 64  ? 2.633   11.563  -6.351  1.00 0.00 ? 64  HIS A HA   3  
ATOM 4604  H HB2  . HIS A 1 64  ? 5.495   10.913  -7.018  1.00 0.00 ? 64  HIS A HB2  3  
ATOM 4605  H HB3  . HIS A 1 64  ? 4.162   10.179  -7.904  1.00 0.00 ? 64  HIS A HB3  3  
ATOM 4606  H HD1  . HIS A 1 64  ? 3.900   11.356  -10.052 1.00 0.00 ? 64  HIS A HD1  3  
ATOM 4607  H HD2  . HIS A 1 64  ? 4.827   13.980  -6.967  1.00 0.00 ? 64  HIS A HD2  3  
ATOM 4608  H HE1  . HIS A 1 64  ? 3.893   13.646  -11.092 1.00 0.00 ? 64  HIS A HE1  3  
ATOM 4609  H HE2  . HIS A 1 64  ? 4.541   15.208  -9.225  1.00 0.00 ? 64  HIS A HE2  3  
ATOM 4610  N N    . ILE A 1 65  ? 4.306   9.261   -4.713  1.00 0.00 ? 65  ILE A N    3  
ATOM 4611  C CA   . ILE A 1 65  ? 4.200   7.944   -4.098  1.00 0.00 ? 65  ILE A CA   3  
ATOM 4612  C C    . ILE A 1 65  ? 3.603   8.038   -2.698  1.00 0.00 ? 65  ILE A C    3  
ATOM 4613  O O    . ILE A 1 65  ? 4.098   8.782   -1.851  1.00 0.00 ? 65  ILE A O    3  
ATOM 4614  C CB   . ILE A 1 65  ? 5.572   7.250   -4.014  1.00 0.00 ? 65  ILE A CB   3  
ATOM 4615  C CG1  . ILE A 1 65  ? 6.183   7.109   -5.409  1.00 0.00 ? 65  ILE A CG1  3  
ATOM 4616  C CG2  . ILE A 1 65  ? 5.437   5.888   -3.349  1.00 0.00 ? 65  ILE A CG2  3  
ATOM 4617  C CD1  . ILE A 1 65  ? 7.696   7.135   -5.412  1.00 0.00 ? 65  ILE A CD1  3  
ATOM 4618  H H    . ILE A 1 65  ? 5.103   9.805   -4.544  1.00 0.00 ? 65  ILE A H    3  
ATOM 4619  H HA   . ILE A 1 65  ? 3.550   7.340   -4.715  1.00 0.00 ? 65  ILE A HA   3  
ATOM 4620  H HB   . ILE A 1 65  ? 6.222   7.858   -3.404  1.00 0.00 ? 65  ILE A HB   3  
ATOM 4621  H HG12 . ILE A 1 65  ? 5.867   6.173   -5.841  1.00 0.00 ? 65  ILE A HG12 3  
ATOM 4622  H HG13 . ILE A 1 65  ? 5.835   7.923   -6.030  1.00 0.00 ? 65  ILE A HG13 3  
ATOM 4623  H HG21 . ILE A 1 65  ? 5.867   5.926   -2.359  1.00 0.00 ? 65  ILE A HG21 3  
ATOM 4624  H HG22 . ILE A 1 65  ? 4.392   5.626   -3.276  1.00 0.00 ? 65  ILE A HG22 3  
ATOM 4625  H HG23 . ILE A 1 65  ? 5.955   5.146   -3.938  1.00 0.00 ? 65  ILE A HG23 3  
ATOM 4626  H HD11 . ILE A 1 65  ? 8.050   7.608   -4.508  1.00 0.00 ? 65  ILE A HD11 3  
ATOM 4627  H HD12 . ILE A 1 65  ? 8.073   6.125   -5.463  1.00 0.00 ? 65  ILE A HD12 3  
ATOM 4628  H HD13 . ILE A 1 65  ? 8.044   7.693   -6.269  1.00 0.00 ? 65  ILE A HD13 3  
ATOM 4629  N N    . GLN A 1 66  ? 2.539   7.277   -2.461  1.00 0.00 ? 66  GLN A N    3  
ATOM 4630  C CA   . GLN A 1 66  ? 1.876   7.274   -1.163  1.00 0.00 ? 66  GLN A CA   3  
ATOM 4631  C C    . GLN A 1 66  ? 1.387   5.875   -0.805  1.00 0.00 ? 66  GLN A C    3  
ATOM 4632  O O    . GLN A 1 66  ? 1.354   4.982   -1.652  1.00 0.00 ? 66  GLN A O    3  
ATOM 4633  C CB   . GLN A 1 66  ? 0.701   8.253   -1.164  1.00 0.00 ? 66  GLN A CB   3  
ATOM 4634  C CG   . GLN A 1 66  ? 1.084   9.662   -1.586  1.00 0.00 ? 66  GLN A CG   3  
ATOM 4635  C CD   . GLN A 1 66  ? 0.959   9.878   -3.082  1.00 0.00 ? 66  GLN A CD   3  
ATOM 4636  O OE1  . GLN A 1 66  ? 0.358   9.069   -3.789  1.00 0.00 ? 66  GLN A OE1  3  
ATOM 4637  N NE2  . GLN A 1 66  ? 1.528   10.973  -3.572  1.00 0.00 ? 66  GLN A NE2  3  
ATOM 4638  H H    . GLN A 1 66  ? 2.192   6.705   -3.177  1.00 0.00 ? 66  GLN A H    3  
ATOM 4639  H HA   . GLN A 1 66  ? 2.596   7.590   -0.423  1.00 0.00 ? 66  GLN A HA   3  
ATOM 4640  H HB2  . GLN A 1 66  ? -0.054  7.890   -1.844  1.00 0.00 ? 66  GLN A HB2  3  
ATOM 4641  H HB3  . GLN A 1 66  ? 0.286   8.300   -0.168  1.00 0.00 ? 66  GLN A HB3  3  
ATOM 4642  H HG2  . GLN A 1 66  ? 0.437   10.364  -1.082  1.00 0.00 ? 66  GLN A HG2  3  
ATOM 4643  H HG3  . GLN A 1 66  ? 2.108   9.846   -1.295  1.00 0.00 ? 66  GLN A HG3  3  
ATOM 4644  H HE21 . GLN A 1 66  ? 1.992   11.572  -2.949  1.00 0.00 ? 66  GLN A HE21 3  
ATOM 4645  H HE22 . GLN A 1 66  ? 1.464   11.137  -4.535  1.00 0.00 ? 66  GLN A HE22 3  
ATOM 4646  N N    . VAL A 1 67  ? 1.007   5.690   0.456   1.00 0.00 ? 67  VAL A N    3  
ATOM 4647  C CA   . VAL A 1 67  ? 0.519   4.399   0.926   1.00 0.00 ? 67  VAL A CA   3  
ATOM 4648  C C    . VAL A 1 67  ? -0.675  3.931   0.102   1.00 0.00 ? 67  VAL A C    3  
ATOM 4649  O O    . VAL A 1 67  ? -1.206  4.676   -0.720  1.00 0.00 ? 67  VAL A O    3  
ATOM 4650  C CB   . VAL A 1 67  ? 0.112   4.460   2.410   1.00 0.00 ? 67  VAL A CB   3  
ATOM 4651  C CG1  . VAL A 1 67  ? 1.317   4.783   3.281   1.00 0.00 ? 67  VAL A CG1  3  
ATOM 4652  C CG2  . VAL A 1 67  ? -0.995  5.482   2.618   1.00 0.00 ? 67  VAL A CG2  3  
ATOM 4653  H H    . VAL A 1 67  ? 1.056   6.440   1.084   1.00 0.00 ? 67  VAL A H    3  
ATOM 4654  H HA   . VAL A 1 67  ? 1.319   3.681   0.822   1.00 0.00 ? 67  VAL A HA   3  
ATOM 4655  H HB   . VAL A 1 67  ? -0.263  3.489   2.700   1.00 0.00 ? 67  VAL A HB   3  
ATOM 4656  H HG11 . VAL A 1 67  ? 0.987   5.279   4.182   1.00 0.00 ? 67  VAL A HG11 3  
ATOM 4657  H HG12 . VAL A 1 67  ? 1.830   3.868   3.540   1.00 0.00 ? 67  VAL A HG12 3  
ATOM 4658  H HG13 . VAL A 1 67  ? 1.989   5.432   2.739   1.00 0.00 ? 67  VAL A HG13 3  
ATOM 4659  H HG21 . VAL A 1 67  ? -1.833  5.238   1.981   1.00 0.00 ? 67  VAL A HG21 3  
ATOM 4660  H HG22 . VAL A 1 67  ? -1.312  5.466   3.651   1.00 0.00 ? 67  VAL A HG22 3  
ATOM 4661  H HG23 . VAL A 1 67  ? -0.628  6.466   2.370   1.00 0.00 ? 67  VAL A HG23 3  
ATOM 4662  N N    . ASN A 1 68  ? -1.094  2.690   0.330   1.00 0.00 ? 68  ASN A N    3  
ATOM 4663  C CA   . ASN A 1 68  ? -2.226  2.121   -0.392  1.00 0.00 ? 68  ASN A CA   3  
ATOM 4664  C C    . ASN A 1 68  ? -1.915  1.993   -1.880  1.00 0.00 ? 68  ASN A C    3  
ATOM 4665  O O    . ASN A 1 68  ? -2.768  2.256   -2.728  1.00 0.00 ? 68  ASN A O    3  
ATOM 4666  C CB   . ASN A 1 68  ? -3.472  2.987   -0.192  1.00 0.00 ? 68  ASN A CB   3  
ATOM 4667  C CG   . ASN A 1 68  ? -3.837  3.146   1.271   1.00 0.00 ? 68  ASN A CG   3  
ATOM 4668  O OD1  . ASN A 1 68  ? -3.319  2.437   2.133   1.00 0.00 ? 68  ASN A OD1  3  
ATOM 4669  N ND2  . ASN A 1 68  ? -4.735  4.082   1.557   1.00 0.00 ? 68  ASN A ND2  3  
ATOM 4670  H H    . ASN A 1 68  ? -0.630  2.144   0.999   1.00 0.00 ? 68  ASN A H    3  
ATOM 4671  H HA   . ASN A 1 68  ? -2.415  1.137   0.011   1.00 0.00 ? 68  ASN A HA   3  
ATOM 4672  H HB2  . ASN A 1 68  ? -3.291  3.968   -0.607  1.00 0.00 ? 68  ASN A HB2  3  
ATOM 4673  H HB3  . ASN A 1 68  ? -4.306  2.532   -0.706  1.00 0.00 ? 68  ASN A HB3  3  
ATOM 4674  H HD21 . ASN A 1 68  ? -5.106  4.609   0.820   1.00 0.00 ? 68  ASN A HD21 3  
ATOM 4675  H HD22 . ASN A 1 68  ? -4.989  4.207   2.496   1.00 0.00 ? 68  ASN A HD22 3  
ATOM 4676  N N    . ASP A 1 69  ? -0.688  1.587   -2.189  1.00 0.00 ? 69  ASP A N    3  
ATOM 4677  C CA   . ASP A 1 69  ? -0.264  1.423   -3.574  1.00 0.00 ? 69  ASP A CA   3  
ATOM 4678  C C    . ASP A 1 69  ? 0.459   0.093   -3.766  1.00 0.00 ? 69  ASP A C    3  
ATOM 4679  O O    . ASP A 1 69  ? 0.989   -0.481  -2.815  1.00 0.00 ? 69  ASP A O    3  
ATOM 4680  C CB   . ASP A 1 69  ? 0.648   2.578   -3.991  1.00 0.00 ? 69  ASP A CB   3  
ATOM 4681  C CG   . ASP A 1 69  ? 0.536   2.899   -5.469  1.00 0.00 ? 69  ASP A CG   3  
ATOM 4682  O OD1  . ASP A 1 69  ? 0.329   1.960   -6.265  1.00 0.00 ? 69  ASP A OD1  3  
ATOM 4683  O OD2  . ASP A 1 69  ? 0.656   4.089   -5.828  1.00 0.00 ? 69  ASP A OD2  3  
ATOM 4684  H H    . ASP A 1 69  ? -0.053  1.393   -1.468  1.00 0.00 ? 69  ASP A H    3  
ATOM 4685  H HA   . ASP A 1 69  ? -1.147  1.431   -4.195  1.00 0.00 ? 69  ASP A HA   3  
ATOM 4686  H HB2  . ASP A 1 69  ? 0.380   3.461   -3.429  1.00 0.00 ? 69  ASP A HB2  3  
ATOM 4687  H HB3  . ASP A 1 69  ? 1.673   2.316   -3.775  1.00 0.00 ? 69  ASP A HB3  3  
ATOM 4688  N N    . LYS A 1 70  ? 0.476   -0.392  -5.003  1.00 0.00 ? 70  LYS A N    3  
ATOM 4689  C CA   . LYS A 1 70  ? 1.133   -1.654  -5.322  1.00 0.00 ? 70  LYS A CA   3  
ATOM 4690  C C    . LYS A 1 70  ? 2.303   -1.432  -6.276  1.00 0.00 ? 70  LYS A C    3  
ATOM 4691  O O    . LYS A 1 70  ? 2.111   -1.047  -7.430  1.00 0.00 ? 70  LYS A O    3  
ATOM 4692  C CB   . LYS A 1 70  ? 0.133   -2.631  -5.944  1.00 0.00 ? 70  LYS A CB   3  
ATOM 4693  C CG   . LYS A 1 70  ? 0.567   -4.083  -5.857  1.00 0.00 ? 70  LYS A CG   3  
ATOM 4694  C CD   . LYS A 1 70  ? -0.242  -4.965  -6.793  1.00 0.00 ? 70  LYS A CD   3  
ATOM 4695  C CE   . LYS A 1 70  ? 0.409   -5.066  -8.164  1.00 0.00 ? 70  LYS A CE   3  
ATOM 4696  N NZ   . LYS A 1 70  ? -0.466  -5.768  -9.143  1.00 0.00 ? 70  LYS A NZ   3  
ATOM 4697  H H    . LYS A 1 70  ? 0.036   0.112   -5.720  1.00 0.00 ? 70  LYS A H    3  
ATOM 4698  H HA   . LYS A 1 70  ? 1.509   -2.074  -4.402  1.00 0.00 ? 70  LYS A HA   3  
ATOM 4699  H HB2  . LYS A 1 70  ? -0.815  -2.528  -5.436  1.00 0.00 ? 70  LYS A HB2  3  
ATOM 4700  H HB3  . LYS A 1 70  ? 0.002   -2.378  -6.987  1.00 0.00 ? 70  LYS A HB3  3  
ATOM 4701  H HG2  . LYS A 1 70  ? 1.611   -4.155  -6.125  1.00 0.00 ? 70  LYS A HG2  3  
ATOM 4702  H HG3  . LYS A 1 70  ? 0.429   -4.430  -4.842  1.00 0.00 ? 70  LYS A HG3  3  
ATOM 4703  H HD2  . LYS A 1 70  ? -0.316  -5.955  -6.369  1.00 0.00 ? 70  LYS A HD2  3  
ATOM 4704  H HD3  . LYS A 1 70  ? -1.232  -4.544  -6.904  1.00 0.00 ? 70  LYS A HD3  3  
ATOM 4705  H HE2  . LYS A 1 70  ? 0.612   -4.070  -8.526  1.00 0.00 ? 70  LYS A HE2  3  
ATOM 4706  H HE3  . LYS A 1 70  ? 1.337   -5.610  -8.068  1.00 0.00 ? 70  LYS A HE3  3  
ATOM 4707  H HZ1  . LYS A 1 70  ? -1.091  -6.437  -8.648  1.00 0.00 ? 70  LYS A HZ1  3  
ATOM 4708  H HZ2  . LYS A 1 70  ? 0.114   -6.295  -9.827  1.00 0.00 ? 70  LYS A HZ2  3  
ATOM 4709  H HZ3  . LYS A 1 70  ? -1.051  -5.080  -9.659  1.00 0.00 ? 70  LYS A HZ3  3  
ATOM 4710  N N    . ILE A 1 71  ? 3.514   -1.678  -5.787  1.00 0.00 ? 71  ILE A N    3  
ATOM 4711  C CA   . ILE A 1 71  ? 4.713   -1.507  -6.597  1.00 0.00 ? 71  ILE A CA   3  
ATOM 4712  C C    . ILE A 1 71  ? 4.980   -2.742  -7.451  1.00 0.00 ? 71  ILE A C    3  
ATOM 4713  O O    . ILE A 1 71  ? 5.150   -3.845  -6.930  1.00 0.00 ? 71  ILE A O    3  
ATOM 4714  C CB   . ILE A 1 71  ? 5.949   -1.225  -5.721  1.00 0.00 ? 71  ILE A CB   3  
ATOM 4715  C CG1  . ILE A 1 71  ? 5.721   0.023   -4.866  1.00 0.00 ? 71  ILE A CG1  3  
ATOM 4716  C CG2  . ILE A 1 71  ? 7.187   -1.060  -6.590  1.00 0.00 ? 71  ILE A CG2  3  
ATOM 4717  C CD1  . ILE A 1 71  ? 4.981   -0.255  -3.577  1.00 0.00 ? 71  ILE A CD1  3  
ATOM 4718  H H    . ILE A 1 71  ? 3.602   -1.982  -4.860  1.00 0.00 ? 71  ILE A H    3  
ATOM 4719  H HA   . ILE A 1 71  ? 4.558   -0.659  -7.248  1.00 0.00 ? 71  ILE A HA   3  
ATOM 4720  H HB   . ILE A 1 71  ? 6.104   -2.074  -5.073  1.00 0.00 ? 71  ILE A HB   3  
ATOM 4721  H HG12 . ILE A 1 71  ? 6.675   0.458   -4.614  1.00 0.00 ? 71  ILE A HG12 3  
ATOM 4722  H HG13 . ILE A 1 71  ? 5.143   0.738   -5.434  1.00 0.00 ? 71  ILE A HG13 3  
ATOM 4723  H HG21 . ILE A 1 71  ? 8.011   -1.600  -6.148  1.00 0.00 ? 71  ILE A HG21 3  
ATOM 4724  H HG22 . ILE A 1 71  ? 6.989   -1.451  -7.576  1.00 0.00 ? 71  ILE A HG22 3  
ATOM 4725  H HG23 . ILE A 1 71  ? 7.440   -0.013  -6.661  1.00 0.00 ? 71  ILE A HG23 3  
ATOM 4726  H HD11 . ILE A 1 71  ? 5.467   0.263   -2.763  1.00 0.00 ? 71  ILE A HD11 3  
ATOM 4727  H HD12 . ILE A 1 71  ? 3.961   0.087   -3.665  1.00 0.00 ? 71  ILE A HD12 3  
ATOM 4728  H HD13 . ILE A 1 71  ? 4.988   -1.318  -3.380  1.00 0.00 ? 71  ILE A HD13 3  
ATOM 4729  N N    . VAL A 1 72  ? 5.019   -2.549  -8.765  1.00 0.00 ? 72  VAL A N    3  
ATOM 4730  C CA   . VAL A 1 72  ? 5.268   -3.647  -9.692  1.00 0.00 ? 72  VAL A CA   3  
ATOM 4731  C C    . VAL A 1 72  ? 6.682   -3.577  -10.258 1.00 0.00 ? 72  VAL A C    3  
ATOM 4732  O O    . VAL A 1 72  ? 7.275   -4.599  -10.602 1.00 0.00 ? 72  VAL A O    3  
ATOM 4733  C CB   . VAL A 1 72  ? 4.260   -3.638  -10.856 1.00 0.00 ? 72  VAL A CB   3  
ATOM 4734  C CG1  . VAL A 1 72  ? 2.889   -4.092  -10.379 1.00 0.00 ? 72  VAL A CG1  3  
ATOM 4735  C CG2  . VAL A 1 72  ? 4.184   -2.255  -11.485 1.00 0.00 ? 72  VAL A CG2  3  
ATOM 4736  H H    . VAL A 1 72  ? 4.876   -1.647  -9.120  1.00 0.00 ? 72  VAL A H    3  
ATOM 4737  H HA   . VAL A 1 72  ? 5.153   -4.574  -9.150  1.00 0.00 ? 72  VAL A HA   3  
ATOM 4738  H HB   . VAL A 1 72  ? 4.603   -4.334  -11.608 1.00 0.00 ? 72  VAL A HB   3  
ATOM 4739  H HG11 . VAL A 1 72  ? 2.564   -3.459  -9.565  1.00 0.00 ? 72  VAL A HG11 3  
ATOM 4740  H HG12 . VAL A 1 72  ? 2.183   -4.024  -11.193 1.00 0.00 ? 72  VAL A HG12 3  
ATOM 4741  H HG13 . VAL A 1 72  ? 2.947   -5.115  -10.037 1.00 0.00 ? 72  VAL A HG13 3  
ATOM 4742  H HG21 . VAL A 1 72  ? 5.167   -1.809  -11.491 1.00 0.00 ? 72  VAL A HG21 3  
ATOM 4743  H HG22 . VAL A 1 72  ? 3.822   -2.340  -12.500 1.00 0.00 ? 72  VAL A HG22 3  
ATOM 4744  H HG23 . VAL A 1 72  ? 3.510   -1.636  -10.913 1.00 0.00 ? 72  VAL A HG23 3  
ATOM 4745  N N    . ALA A 1 73  ? 7.217   -2.364  -10.353 1.00 0.00 ? 73  ALA A N    3  
ATOM 4746  C CA   . ALA A 1 73  ? 8.562   -2.161  -10.875 1.00 0.00 ? 73  ALA A CA   3  
ATOM 4747  C C    . ALA A 1 73  ? 9.248   -0.988  -10.182 1.00 0.00 ? 73  ALA A C    3  
ATOM 4748  O O    . ALA A 1 73  ? 8.613   0.020   -9.870  1.00 0.00 ? 73  ALA A O    3  
ATOM 4749  C CB   . ALA A 1 73  ? 8.516   -1.935  -12.379 1.00 0.00 ? 73  ALA A CB   3  
ATOM 4750  H H    . ALA A 1 73  ? 6.694   -1.588  -10.063 1.00 0.00 ? 73  ALA A H    3  
ATOM 4751  H HA   . ALA A 1 73  ? 9.132   -3.060  -10.688 1.00 0.00 ? 73  ALA A HA   3  
ATOM 4752  H HB1  . ALA A 1 73  ? 7.543   -1.556  -12.655 1.00 0.00 ? 73  ALA A HB1  3  
ATOM 4753  H HB2  . ALA A 1 73  ? 9.275   -1.219  -12.658 1.00 0.00 ? 73  ALA A HB2  3  
ATOM 4754  H HB3  . ALA A 1 73  ? 8.697   -2.869  -12.888 1.00 0.00 ? 73  ALA A HB3  3  
ATOM 4755  N N    . VAL A 1 74  ? 10.549  -1.126  -9.944  1.00 0.00 ? 74  VAL A N    3  
ATOM 4756  C CA   . VAL A 1 74  ? 11.321  -0.077  -9.289  1.00 0.00 ? 74  VAL A CA   3  
ATOM 4757  C C    . VAL A 1 74  ? 12.580  0.255   -10.082 1.00 0.00 ? 74  VAL A C    3  
ATOM 4758  O O    . VAL A 1 74  ? 13.442  -0.600  -10.285 1.00 0.00 ? 74  VAL A O    3  
ATOM 4759  C CB   . VAL A 1 74  ? 11.722  -0.485  -7.859  1.00 0.00 ? 74  VAL A CB   3  
ATOM 4760  C CG1  . VAL A 1 74  ? 12.571  0.598   -7.212  1.00 0.00 ? 74  VAL A CG1  3  
ATOM 4761  C CG2  . VAL A 1 74  ? 10.485  -0.776  -7.022  1.00 0.00 ? 74  VAL A CG2  3  
ATOM 4762  H H    . VAL A 1 74  ? 11.000  -1.952  -10.217 1.00 0.00 ? 74  VAL A H    3  
ATOM 4763  H HA   . VAL A 1 74  ? 10.702  0.806   -9.229  1.00 0.00 ? 74  VAL A HA   3  
ATOM 4764  H HB   . VAL A 1 74  ? 12.312  -1.388  -7.916  1.00 0.00 ? 74  VAL A HB   3  
ATOM 4765  H HG11 . VAL A 1 74  ? 11.938  1.250   -6.628  1.00 0.00 ? 74  VAL A HG11 3  
ATOM 4766  H HG12 . VAL A 1 74  ? 13.310  0.142   -6.570  1.00 0.00 ? 74  VAL A HG12 3  
ATOM 4767  H HG13 . VAL A 1 74  ? 13.067  1.174   -7.980  1.00 0.00 ? 74  VAL A HG13 3  
ATOM 4768  H HG21 . VAL A 1 74  ? 9.615   -0.790  -7.661  1.00 0.00 ? 74  VAL A HG21 3  
ATOM 4769  H HG22 . VAL A 1 74  ? 10.594  -1.737  -6.540  1.00 0.00 ? 74  VAL A HG22 3  
ATOM 4770  H HG23 . VAL A 1 74  ? 10.369  -0.008  -6.272  1.00 0.00 ? 74  VAL A HG23 3  
ATOM 4771  N N    . ASP A 1 75  ? 12.679  1.503   -10.528 1.00 0.00 ? 75  ASP A N    3  
ATOM 4772  C CA   . ASP A 1 75  ? 13.834  1.950   -11.299 1.00 0.00 ? 75  ASP A CA   3  
ATOM 4773  C C    . ASP A 1 75  ? 13.928  1.199   -12.623 1.00 0.00 ? 75  ASP A C    3  
ATOM 4774  O O    . ASP A 1 75  ? 15.020  0.894   -13.100 1.00 0.00 ? 75  ASP A O    3  
ATOM 4775  C CB   . ASP A 1 75  ? 15.119  1.751   -10.494 1.00 0.00 ? 75  ASP A CB   3  
ATOM 4776  C CG   . ASP A 1 75  ? 16.208  2.729   -10.889 1.00 0.00 ? 75  ASP A CG   3  
ATOM 4777  O OD1  . ASP A 1 75  ? 16.021  3.944   -10.669 1.00 0.00 ? 75  ASP A OD1  3  
ATOM 4778  O OD2  . ASP A 1 75  ? 17.245  2.280   -11.420 1.00 0.00 ? 75  ASP A OD2  3  
ATOM 4779  H H    . ASP A 1 75  ? 11.959  2.139   -10.334 1.00 0.00 ? 75  ASP A H    3  
ATOM 4780  H HA   . ASP A 1 75  ? 13.708  3.002   -11.504 1.00 0.00 ? 75  ASP A HA   3  
ATOM 4781  H HB2  . ASP A 1 75  ? 14.903  1.887   -9.444  1.00 0.00 ? 75  ASP A HB2  3  
ATOM 4782  H HB3  . ASP A 1 75  ? 15.485  0.748   -10.654 1.00 0.00 ? 75  ASP A HB3  3  
ATOM 4783  N N    . GLY A 1 76  ? 12.773  0.902   -13.212 1.00 0.00 ? 76  GLY A N    3  
ATOM 4784  C CA   . GLY A 1 76  ? 12.747  0.187   -14.475 1.00 0.00 ? 76  GLY A CA   3  
ATOM 4785  C C    . GLY A 1 76  ? 13.062  -1.286  -14.314 1.00 0.00 ? 76  GLY A C    3  
ATOM 4786  O O    . GLY A 1 76  ? 13.534  -1.934  -15.250 1.00 0.00 ? 76  GLY A O    3  
ATOM 4787  H H    . GLY A 1 76  ? 11.932  1.170   -12.786 1.00 0.00 ? 76  GLY A H    3  
ATOM 4788  H HA2  . GLY A 1 76  ? 11.766  0.289   -14.914 1.00 0.00 ? 76  GLY A HA2  3  
ATOM 4789  H HA3  . GLY A 1 76  ? 13.475  0.629   -15.140 1.00 0.00 ? 76  GLY A HA3  3  
ATOM 4790  N N    . VAL A 1 77  ? 12.803  -1.819  -13.124 1.00 0.00 ? 77  VAL A N    3  
ATOM 4791  C CA   . VAL A 1 77  ? 13.063  -3.226  -12.844 1.00 0.00 ? 77  VAL A CA   3  
ATOM 4792  C C    . VAL A 1 77  ? 11.808  -3.926  -12.336 1.00 0.00 ? 77  VAL A C    3  
ATOM 4793  O O    . VAL A 1 77  ? 11.283  -3.589  -11.275 1.00 0.00 ? 77  VAL A O    3  
ATOM 4794  C CB   . VAL A 1 77  ? 14.187  -3.393  -11.804 1.00 0.00 ? 77  VAL A CB   3  
ATOM 4795  C CG1  . VAL A 1 77  ? 14.366  -4.859  -11.441 1.00 0.00 ? 77  VAL A CG1  3  
ATOM 4796  C CG2  . VAL A 1 77  ? 15.488  -2.801  -12.326 1.00 0.00 ? 77  VAL A CG2  3  
ATOM 4797  H H    . VAL A 1 77  ? 12.428  -1.252  -12.419 1.00 0.00 ? 77  VAL A H    3  
ATOM 4798  H HA   . VAL A 1 77  ? 13.379  -3.697  -13.763 1.00 0.00 ? 77  VAL A HA   3  
ATOM 4799  H HB   . VAL A 1 77  ? 13.905  -2.856  -10.910 1.00 0.00 ? 77  VAL A HB   3  
ATOM 4800  H HG11 . VAL A 1 77  ? 14.638  -5.417  -12.325 1.00 0.00 ? 77  VAL A HG11 3  
ATOM 4801  H HG12 . VAL A 1 77  ? 15.146  -4.954  -10.699 1.00 0.00 ? 77  VAL A HG12 3  
ATOM 4802  H HG13 . VAL A 1 77  ? 13.440  -5.246  -11.042 1.00 0.00 ? 77  VAL A HG13 3  
ATOM 4803  H HG21 . VAL A 1 77  ? 15.887  -3.439  -13.100 1.00 0.00 ? 77  VAL A HG21 3  
ATOM 4804  H HG22 . VAL A 1 77  ? 15.299  -1.818  -12.732 1.00 0.00 ? 77  VAL A HG22 3  
ATOM 4805  H HG23 . VAL A 1 77  ? 16.200  -2.726  -11.518 1.00 0.00 ? 77  VAL A HG23 3  
ATOM 4806  N N    . ASN A 1 78  ? 11.331  -4.903  -13.100 1.00 0.00 ? 78  ASN A N    3  
ATOM 4807  C CA   . ASN A 1 78  ? 10.136  -5.651  -12.728 1.00 0.00 ? 78  ASN A CA   3  
ATOM 4808  C C    . ASN A 1 78  ? 10.356  -6.413  -11.424 1.00 0.00 ? 78  ASN A C    3  
ATOM 4809  O O    . ASN A 1 78  ? 10.908  -7.514  -11.422 1.00 0.00 ? 78  ASN A O    3  
ATOM 4810  C CB   . ASN A 1 78  ? 9.751   -6.626  -13.842 1.00 0.00 ? 78  ASN A CB   3  
ATOM 4811  C CG   . ASN A 1 78  ? 8.330   -7.136  -13.700 1.00 0.00 ? 78  ASN A CG   3  
ATOM 4812  O OD1  . ASN A 1 78  ? 7.400   -6.360  -13.479 1.00 0.00 ? 78  ASN A OD1  3  
ATOM 4813  N ND2  . ASN A 1 78  ? 8.156   -8.446  -13.826 1.00 0.00 ? 78  ASN A ND2  3  
ATOM 4814  H H    . ASN A 1 78  ? 11.793  -5.126  -13.935 1.00 0.00 ? 78  ASN A H    3  
ATOM 4815  H HA   . ASN A 1 78  ? 9.333   -4.944  -12.587 1.00 0.00 ? 78  ASN A HA   3  
ATOM 4816  H HB2  . ASN A 1 78  ? 9.840   -6.126  -14.796 1.00 0.00 ? 78  ASN A HB2  3  
ATOM 4817  H HB3  . ASN A 1 78  ? 10.422  -7.472  -13.821 1.00 0.00 ? 78  ASN A HB3  3  
ATOM 4818  H HD21 . ASN A 1 78  ? 8.943   -9.003  -14.002 1.00 0.00 ? 78  ASN A HD21 3  
ATOM 4819  H HD22 . ASN A 1 78  ? 7.247   -8.802  -13.739 1.00 0.00 ? 78  ASN A HD22 3  
ATOM 4820  N N    . ILE A 1 79  ? 9.919   -5.820  -10.318 1.00 0.00 ? 79  ILE A N    3  
ATOM 4821  C CA   . ILE A 1 79  ? 10.066  -6.443  -9.009  1.00 0.00 ? 79  ILE A CA   3  
ATOM 4822  C C    . ILE A 1 79  ? 8.895   -7.371  -8.706  1.00 0.00 ? 79  ILE A C    3  
ATOM 4823  O O    . ILE A 1 79  ? 8.683   -7.765  -7.560  1.00 0.00 ? 79  ILE A O    3  
ATOM 4824  C CB   . ILE A 1 79  ? 10.173  -5.388  -7.892  1.00 0.00 ? 79  ILE A CB   3  
ATOM 4825  C CG1  . ILE A 1 79  ? 8.884   -4.567  -7.811  1.00 0.00 ? 79  ILE A CG1  3  
ATOM 4826  C CG2  . ILE A 1 79  ? 11.370  -4.481  -8.132  1.00 0.00 ? 79  ILE A CG2  3  
ATOM 4827  C CD1  . ILE A 1 79  ? 8.572   -4.067  -6.418  1.00 0.00 ? 79  ILE A CD1  3  
ATOM 4828  H H    . ILE A 1 79  ? 9.487   -4.943  -10.384 1.00 0.00 ? 79  ILE A H    3  
ATOM 4829  H HA   . ILE A 1 79  ? 10.978  -7.023  -9.017  1.00 0.00 ? 79  ILE A HA   3  
ATOM 4830  H HB   . ILE A 1 79  ? 10.323  -5.902  -6.955  1.00 0.00 ? 79  ILE A HB   3  
ATOM 4831  H HG12 . ILE A 1 79  ? 8.969   -3.710  -8.460  1.00 0.00 ? 79  ILE A HG12 3  
ATOM 4832  H HG13 . ILE A 1 79  ? 8.056   -5.180  -8.138  1.00 0.00 ? 79  ILE A HG13 3  
ATOM 4833  H HG21 . ILE A 1 79  ? 11.478  -4.300  -9.191  1.00 0.00 ? 79  ILE A HG21 3  
ATOM 4834  H HG22 . ILE A 1 79  ? 11.219  -3.543  -7.621  1.00 0.00 ? 79  ILE A HG22 3  
ATOM 4835  H HG23 . ILE A 1 79  ? 12.264  -4.957  -7.756  1.00 0.00 ? 79  ILE A HG23 3  
ATOM 4836  H HD11 . ILE A 1 79  ? 9.353   -3.395  -6.094  1.00 0.00 ? 79  ILE A HD11 3  
ATOM 4837  H HD12 . ILE A 1 79  ? 7.627   -3.545  -6.426  1.00 0.00 ? 79  ILE A HD12 3  
ATOM 4838  H HD13 . ILE A 1 79  ? 8.516   -4.905  -5.739  1.00 0.00 ? 79  ILE A HD13 3  
ATOM 4839  N N    . GLN A 1 80  ? 8.138   -7.717  -9.743  1.00 0.00 ? 80  GLN A N    3  
ATOM 4840  C CA   . GLN A 1 80  ? 6.988   -8.600  -9.588  1.00 0.00 ? 80  GLN A CA   3  
ATOM 4841  C C    . GLN A 1 80  ? 7.402   -9.928  -8.963  1.00 0.00 ? 80  GLN A C    3  
ATOM 4842  O O    . GLN A 1 80  ? 7.792   -10.860 -9.664  1.00 0.00 ? 80  GLN A O    3  
ATOM 4843  C CB   . GLN A 1 80  ? 6.321   -8.846  -10.943 1.00 0.00 ? 80  GLN A CB   3  
ATOM 4844  C CG   . GLN A 1 80  ? 5.417   -7.709  -11.391 1.00 0.00 ? 80  GLN A CG   3  
ATOM 4845  C CD   . GLN A 1 80  ? 4.350   -8.163  -12.367 1.00 0.00 ? 80  GLN A CD   3  
ATOM 4846  O OE1  . GLN A 1 80  ? 4.317   -9.325  -12.773 1.00 0.00 ? 80  GLN A OE1  3  
ATOM 4847  N NE2  . GLN A 1 80  ? 3.469   -7.246  -12.750 1.00 0.00 ? 80  GLN A NE2  3  
ATOM 4848  H H    . GLN A 1 80  ? 8.358   -7.370  -10.632 1.00 0.00 ? 80  GLN A H    3  
ATOM 4849  H HA   . GLN A 1 80  ? 6.282   -8.112  -8.933  1.00 0.00 ? 80  GLN A HA   3  
ATOM 4850  H HB2  . GLN A 1 80  ? 7.089   -8.983  -11.689 1.00 0.00 ? 80  GLN A HB2  3  
ATOM 4851  H HB3  . GLN A 1 80  ? 5.727   -9.746  -10.880 1.00 0.00 ? 80  GLN A HB3  3  
ATOM 4852  H HG2  . GLN A 1 80  ? 4.933   -7.287  -10.523 1.00 0.00 ? 80  GLN A HG2  3  
ATOM 4853  H HG3  . GLN A 1 80  ? 6.022   -6.952  -11.868 1.00 0.00 ? 80  GLN A HG3  3  
ATOM 4854  H HE21 . GLN A 1 80  ? 3.557   -6.340  -12.386 1.00 0.00 ? 80  GLN A HE21 3  
ATOM 4855  H HE22 . GLN A 1 80  ? 2.768   -7.511  -13.381 1.00 0.00 ? 80  GLN A HE22 3  
ATOM 4856  N N    . GLY A 1 81  ? 7.314   -10.006 -7.638  1.00 0.00 ? 81  GLY A N    3  
ATOM 4857  C CA   . GLY A 1 81  ? 7.683   -11.224 -6.941  1.00 0.00 ? 81  GLY A CA   3  
ATOM 4858  C C    . GLY A 1 81  ? 8.823   -11.010 -5.965  1.00 0.00 ? 81  GLY A C    3  
ATOM 4859  O O    . GLY A 1 81  ? 8.962   -11.749 -4.990  1.00 0.00 ? 81  GLY A O    3  
ATOM 4860  H H    . GLY A 1 81  ? 6.996   -9.230  -7.131  1.00 0.00 ? 81  GLY A H    3  
ATOM 4861  H HA2  . GLY A 1 81  ? 6.823   -11.590 -6.400  1.00 0.00 ? 81  GLY A HA2  3  
ATOM 4862  H HA3  . GLY A 1 81  ? 7.981   -11.965 -7.668  1.00 0.00 ? 81  GLY A HA3  3  
ATOM 4863  N N    . PHE A 1 82  ? 9.643   -9.998  -6.228  1.00 0.00 ? 82  PHE A N    3  
ATOM 4864  C CA   . PHE A 1 82  ? 10.779  -9.691  -5.367  1.00 0.00 ? 82  PHE A CA   3  
ATOM 4865  C C    . PHE A 1 82  ? 10.359  -9.666  -3.900  1.00 0.00 ? 82  PHE A C    3  
ATOM 4866  O O    . PHE A 1 82  ? 9.371   -9.028  -3.537  1.00 0.00 ? 82  PHE A O    3  
ATOM 4867  C CB   . PHE A 1 82  ? 11.391  -8.344  -5.756  1.00 0.00 ? 82  PHE A CB   3  
ATOM 4868  C CG   . PHE A 1 82  ? 12.393  -8.440  -6.871  1.00 0.00 ? 82  PHE A CG   3  
ATOM 4869  C CD1  . PHE A 1 82  ? 12.037  -8.983  -8.095  1.00 0.00 ? 82  PHE A CD1  3  
ATOM 4870  C CD2  . PHE A 1 82  ? 13.691  -7.989  -6.695  1.00 0.00 ? 82  PHE A CD2  3  
ATOM 4871  C CE1  . PHE A 1 82  ? 12.956  -9.073  -9.123  1.00 0.00 ? 82  PHE A CE1  3  
ATOM 4872  C CE2  . PHE A 1 82  ? 14.615  -8.076  -7.719  1.00 0.00 ? 82  PHE A CE2  3  
ATOM 4873  C CZ   . PHE A 1 82  ? 14.247  -8.620  -8.934  1.00 0.00 ? 82  PHE A CZ   3  
ATOM 4874  H H    . PHE A 1 82  ? 9.480   -9.444  -7.020  1.00 0.00 ? 82  PHE A H    3  
ATOM 4875  H HA   . PHE A 1 82  ? 11.517  -10.465 -5.504  1.00 0.00 ? 82  PHE A HA   3  
ATOM 4876  H HB2  . PHE A 1 82  ? 10.604  -7.677  -6.075  1.00 0.00 ? 82  PHE A HB2  3  
ATOM 4877  H HB3  . PHE A 1 82  ? 11.889  -7.921  -4.896  1.00 0.00 ? 82  PHE A HB3  3  
ATOM 4878  H HD1  . PHE A 1 82  ? 11.027  -9.339  -8.243  1.00 0.00 ? 82  PHE A HD1  3  
ATOM 4879  H HD2  . PHE A 1 82  ? 13.981  -7.564  -5.745  1.00 0.00 ? 82  PHE A HD2  3  
ATOM 4880  H HE1  . PHE A 1 82  ? 12.665  -9.499  -10.072 1.00 0.00 ? 82  PHE A HE1  3  
ATOM 4881  H HE2  . PHE A 1 82  ? 15.623  -7.721  -7.569  1.00 0.00 ? 82  PHE A HE2  3  
ATOM 4882  H HZ   . PHE A 1 82  ? 14.967  -8.689  -9.736  1.00 0.00 ? 82  PHE A HZ   3  
ATOM 4883  N N    . ALA A 1 83  ? 11.116  -10.367 -3.062  1.00 0.00 ? 83  ALA A N    3  
ATOM 4884  C CA   . ALA A 1 83  ? 10.824  -10.425 -1.635  1.00 0.00 ? 83  ALA A CA   3  
ATOM 4885  C C    . ALA A 1 83  ? 11.050  -9.070  -0.973  1.00 0.00 ? 83  ALA A C    3  
ATOM 4886  O O    . ALA A 1 83  ? 11.658  -8.176  -1.559  1.00 0.00 ? 83  ALA A O    3  
ATOM 4887  C CB   . ALA A 1 83  ? 11.677  -11.491 -0.965  1.00 0.00 ? 83  ALA A CB   3  
ATOM 4888  H H    . ALA A 1 83  ? 11.890  -10.855 -3.412  1.00 0.00 ? 83  ALA A H    3  
ATOM 4889  H HA   . ALA A 1 83  ? 9.786   -10.703 -1.518  1.00 0.00 ? 83  ALA A HA   3  
ATOM 4890  H HB1  . ALA A 1 83  ? 12.689  -11.429 -1.339  1.00 0.00 ? 83  ALA A HB1  3  
ATOM 4891  H HB2  . ALA A 1 83  ? 11.677  -11.333 0.103   1.00 0.00 ? 83  ALA A HB2  3  
ATOM 4892  H HB3  . ALA A 1 83  ? 11.272  -12.467 -1.185  1.00 0.00 ? 83  ALA A HB3  3  
ATOM 4893  N N    . ASN A 1 84  ? 10.555  -8.925  0.252   1.00 0.00 ? 84  ASN A N    3  
ATOM 4894  C CA   . ASN A 1 84  ? 10.702  -7.678  0.993   1.00 0.00 ? 84  ASN A CA   3  
ATOM 4895  C C    . ASN A 1 84  ? 12.111  -7.115  0.837   1.00 0.00 ? 84  ASN A C    3  
ATOM 4896  O O    . ASN A 1 84  ? 12.296  -6.005  0.337   1.00 0.00 ? 84  ASN A O    3  
ATOM 4897  C CB   . ASN A 1 84  ? 10.392  -7.902  2.475   1.00 0.00 ? 84  ASN A CB   3  
ATOM 4898  C CG   . ASN A 1 84  ? 10.215  -6.599  3.232   1.00 0.00 ? 84  ASN A CG   3  
ATOM 4899  O OD1  . ASN A 1 84  ? 11.163  -6.075  3.816   1.00 0.00 ? 84  ASN A OD1  3  
ATOM 4900  N ND2  . ASN A 1 84  ? 8.997   -6.072  3.224   1.00 0.00 ? 84  ASN A ND2  3  
ATOM 4901  H H    . ASN A 1 84  ? 10.079  -9.675  0.667   1.00 0.00 ? 84  ASN A H    3  
ATOM 4902  H HA   . ASN A 1 84  ? 9.996   -6.968  0.590   1.00 0.00 ? 84  ASN A HA   3  
ATOM 4903  H HB2  . ASN A 1 84  ? 9.479   -8.473  2.563   1.00 0.00 ? 84  ASN A HB2  3  
ATOM 4904  H HB3  . ASN A 1 84  ? 11.202  -8.453  2.927   1.00 0.00 ? 84  ASN A HB3  3  
ATOM 4905  H HD21 . ASN A 1 84  ? 8.290   -6.545  2.738   1.00 0.00 ? 84  ASN A HD21 3  
ATOM 4906  H HD22 . ASN A 1 84  ? 8.854   -5.230  3.705   1.00 0.00 ? 84  ASN A HD22 3  
ATOM 4907  N N    . HIS A 1 85  ? 13.103  -7.889  1.266   1.00 0.00 ? 85  HIS A N    3  
ATOM 4908  C CA   . HIS A 1 85  ? 14.496  -7.468  1.173   1.00 0.00 ? 85  HIS A CA   3  
ATOM 4909  C C    . HIS A 1 85  ? 14.912  -7.286  -0.284  1.00 0.00 ? 85  HIS A C    3  
ATOM 4910  O O    . HIS A 1 85  ? 15.549  -6.294  -0.638  1.00 0.00 ? 85  HIS A O    3  
ATOM 4911  C CB   . HIS A 1 85  ? 15.407  -8.493  1.850   1.00 0.00 ? 85  HIS A CB   3  
ATOM 4912  C CG   . HIS A 1 85  ? 15.058  -9.912  1.525   1.00 0.00 ? 85  HIS A CG   3  
ATOM 4913  N ND1  . HIS A 1 85  ? 14.032  -10.596 2.144   1.00 0.00 ? 85  HIS A ND1  3  
ATOM 4914  C CD2  . HIS A 1 85  ? 15.604  -10.777 0.639   1.00 0.00 ? 85  HIS A CD2  3  
ATOM 4915  C CE1  . HIS A 1 85  ? 13.963  -11.820 1.653   1.00 0.00 ? 85  HIS A CE1  3  
ATOM 4916  N NE2  . HIS A 1 85  ? 14.906  -11.956 0.738   1.00 0.00 ? 85  HIS A NE2  3  
ATOM 4917  H H    . HIS A 1 85  ? 12.892  -8.763  1.655   1.00 0.00 ? 85  HIS A H    3  
ATOM 4918  H HA   . HIS A 1 85  ? 14.592  -6.522  1.683   1.00 0.00 ? 85  HIS A HA   3  
ATOM 4919  H HB2  . HIS A 1 85  ? 16.426  -8.322  1.536   1.00 0.00 ? 85  HIS A HB2  3  
ATOM 4920  H HB3  . HIS A 1 85  ? 15.340  -8.371  2.922   1.00 0.00 ? 85  HIS A HB3  3  
ATOM 4921  H HD1  . HIS A 1 85  ? 13.444  -10.237 2.840   1.00 0.00 ? 85  HIS A HD1  3  
ATOM 4922  H HD2  . HIS A 1 85  ? 16.434  -10.579 -0.024  1.00 0.00 ? 85  HIS A HD2  3  
ATOM 4923  H HE1  . HIS A 1 85  ? 13.257  -12.581 1.949   1.00 0.00 ? 85  HIS A HE1  3  
ATOM 4924  H HE2  . HIS A 1 85  ? 15.131  -12.792 0.279   1.00 0.00 ? 85  HIS A HE2  3  
ATOM 4925  N N    . ASP A 1 86  ? 14.547  -8.249  -1.123  1.00 0.00 ? 86  ASP A N    3  
ATOM 4926  C CA   . ASP A 1 86  ? 14.882  -8.194  -2.541  1.00 0.00 ? 86  ASP A CA   3  
ATOM 4927  C C    . ASP A 1 86  ? 14.525  -6.833  -3.132  1.00 0.00 ? 86  ASP A C    3  
ATOM 4928  O O    . ASP A 1 86  ? 15.193  -6.347  -4.045  1.00 0.00 ? 86  ASP A O    3  
ATOM 4929  C CB   . ASP A 1 86  ? 14.152  -9.301  -3.303  1.00 0.00 ? 86  ASP A CB   3  
ATOM 4930  C CG   . ASP A 1 86  ? 14.893  -10.623 -3.253  1.00 0.00 ? 86  ASP A CG   3  
ATOM 4931  O OD1  . ASP A 1 86  ? 16.100  -10.638 -3.571  1.00 0.00 ? 86  ASP A OD1  3  
ATOM 4932  O OD2  . ASP A 1 86  ? 14.265  -11.643 -2.898  1.00 0.00 ? 86  ASP A OD2  3  
ATOM 4933  H H    . ASP A 1 86  ? 14.040  -9.014  -0.781  1.00 0.00 ? 86  ASP A H    3  
ATOM 4934  H HA   . ASP A 1 86  ? 15.947  -8.346  -2.637  1.00 0.00 ? 86  ASP A HA   3  
ATOM 4935  H HB2  . ASP A 1 86  ? 13.173  -9.443  -2.868  1.00 0.00 ? 86  ASP A HB2  3  
ATOM 4936  H HB3  . ASP A 1 86  ? 14.044  -9.008  -4.336  1.00 0.00 ? 86  ASP A HB3  3  
ATOM 4937  N N    . VAL A 1 87  ? 13.468  -6.224  -2.605  1.00 0.00 ? 87  VAL A N    3  
ATOM 4938  C CA   . VAL A 1 87  ? 13.022  -4.919  -3.079  1.00 0.00 ? 87  VAL A CA   3  
ATOM 4939  C C    . VAL A 1 87  ? 13.825  -3.796  -2.433  1.00 0.00 ? 87  VAL A C    3  
ATOM 4940  O O    . VAL A 1 87  ? 14.164  -2.807  -3.084  1.00 0.00 ? 87  VAL A O    3  
ATOM 4941  C CB   . VAL A 1 87  ? 11.525  -4.698  -2.790  1.00 0.00 ? 87  VAL A CB   3  
ATOM 4942  C CG1  . VAL A 1 87  ? 11.095  -3.309  -3.235  1.00 0.00 ? 87  VAL A CG1  3  
ATOM 4943  C CG2  . VAL A 1 87  ? 10.687  -5.769  -3.472  1.00 0.00 ? 87  VAL A CG2  3  
ATOM 4944  H H    . VAL A 1 87  ? 12.976  -6.662  -1.879  1.00 0.00 ? 87  VAL A H    3  
ATOM 4945  H HA   . VAL A 1 87  ? 13.169  -4.885  -4.149  1.00 0.00 ? 87  VAL A HA   3  
ATOM 4946  H HB   . VAL A 1 87  ? 11.371  -4.775  -1.724  1.00 0.00 ? 87  VAL A HB   3  
ATOM 4947  H HG11 . VAL A 1 87  ? 10.343  -2.931  -2.558  1.00 0.00 ? 87  VAL A HG11 3  
ATOM 4948  H HG12 . VAL A 1 87  ? 11.949  -2.648  -3.231  1.00 0.00 ? 87  VAL A HG12 3  
ATOM 4949  H HG13 . VAL A 1 87  ? 10.685  -3.362  -4.233  1.00 0.00 ? 87  VAL A HG13 3  
ATOM 4950  H HG21 . VAL A 1 87  ? 11.136  -6.737  -3.304  1.00 0.00 ? 87  VAL A HG21 3  
ATOM 4951  H HG22 . VAL A 1 87  ? 9.687   -5.760  -3.063  1.00 0.00 ? 87  VAL A HG22 3  
ATOM 4952  H HG23 . VAL A 1 87  ? 10.644  -5.572  -4.532  1.00 0.00 ? 87  VAL A HG23 3  
ATOM 4953  N N    . VAL A 1 88  ? 14.127  -3.955  -1.149  1.00 0.00 ? 88  VAL A N    3  
ATOM 4954  C CA   . VAL A 1 88  ? 14.891  -2.954  -0.414  1.00 0.00 ? 88  VAL A CA   3  
ATOM 4955  C C    . VAL A 1 88  ? 16.236  -2.691  -1.082  1.00 0.00 ? 88  VAL A C    3  
ATOM 4956  O O    . VAL A 1 88  ? 16.605  -1.542  -1.323  1.00 0.00 ? 88  VAL A O    3  
ATOM 4957  C CB   . VAL A 1 88  ? 15.132  -3.391  1.044   1.00 0.00 ? 88  VAL A CB   3  
ATOM 4958  C CG1  . VAL A 1 88  ? 16.087  -2.432  1.738   1.00 0.00 ? 88  VAL A CG1  3  
ATOM 4959  C CG2  . VAL A 1 88  ? 13.813  -3.481  1.797   1.00 0.00 ? 88  VAL A CG2  3  
ATOM 4960  H H    . VAL A 1 88  ? 13.828  -4.764  -0.684  1.00 0.00 ? 88  VAL A H    3  
ATOM 4961  H HA   . VAL A 1 88  ? 14.319  -2.038  -0.404  1.00 0.00 ? 88  VAL A HA   3  
ATOM 4962  H HB   . VAL A 1 88  ? 15.585  -4.371  1.035   1.00 0.00 ? 88  VAL A HB   3  
ATOM 4963  H HG11 . VAL A 1 88  ? 16.953  -2.271  1.112   1.00 0.00 ? 88  VAL A HG11 3  
ATOM 4964  H HG12 . VAL A 1 88  ? 15.587  -1.490  1.913   1.00 0.00 ? 88  VAL A HG12 3  
ATOM 4965  H HG13 . VAL A 1 88  ? 16.399  -2.855  2.681   1.00 0.00 ? 88  VAL A HG13 3  
ATOM 4966  H HG21 . VAL A 1 88  ? 13.209  -4.268  1.370   1.00 0.00 ? 88  VAL A HG21 3  
ATOM 4967  H HG22 . VAL A 1 88  ? 14.006  -3.699  2.837   1.00 0.00 ? 88  VAL A HG22 3  
ATOM 4968  H HG23 . VAL A 1 88  ? 13.288  -2.541  1.718   1.00 0.00 ? 88  VAL A HG23 3  
ATOM 4969  N N    . GLU A 1 89  ? 16.964  -3.763  -1.379  1.00 0.00 ? 89  GLU A N    3  
ATOM 4970  C CA   . GLU A 1 89  ? 18.268  -3.647  -2.020  1.00 0.00 ? 89  GLU A CA   3  
ATOM 4971  C C    . GLU A 1 89  ? 18.154  -2.929  -3.361  1.00 0.00 ? 89  GLU A C    3  
ATOM 4972  O O    . GLU A 1 89  ? 19.009  -2.120  -3.721  1.00 0.00 ? 89  GLU A O    3  
ATOM 4973  C CB   . GLU A 1 89  ? 18.888  -5.031  -2.221  1.00 0.00 ? 89  GLU A CB   3  
ATOM 4974  C CG   . GLU A 1 89  ? 18.163  -5.878  -3.253  1.00 0.00 ? 89  GLU A CG   3  
ATOM 4975  C CD   . GLU A 1 89  ? 18.712  -7.289  -3.340  1.00 0.00 ? 89  GLU A CD   3  
ATOM 4976  O OE1  . GLU A 1 89  ? 19.856  -7.509  -2.890  1.00 0.00 ? 89  GLU A OE1  3  
ATOM 4977  O OE2  . GLU A 1 89  ? 17.997  -8.172  -3.858  1.00 0.00 ? 89  GLU A OE2  3  
ATOM 4978  H H    . GLU A 1 89  ? 16.615  -4.653  -1.162  1.00 0.00 ? 89  GLU A H    3  
ATOM 4979  H HA   . GLU A 1 89  ? 18.907  -3.068  -1.369  1.00 0.00 ? 89  GLU A HA   3  
ATOM 4980  H HB2  . GLU A 1 89  ? 19.913  -4.911  -2.539  1.00 0.00 ? 89  GLU A HB2  3  
ATOM 4981  H HB3  . GLU A 1 89  ? 18.873  -5.559  -1.278  1.00 0.00 ? 89  GLU A HB3  3  
ATOM 4982  H HG2  . GLU A 1 89  ? 17.118  -5.932  -2.986  1.00 0.00 ? 89  GLU A HG2  3  
ATOM 4983  H HG3  . GLU A 1 89  ? 18.262  -5.408  -4.220  1.00 0.00 ? 89  GLU A HG3  3  
ATOM 4984  N N    . VAL A 1 90  ? 17.089  -3.231  -4.099  1.00 0.00 ? 90  VAL A N    3  
ATOM 4985  C CA   . VAL A 1 90  ? 16.861  -2.616  -5.400  1.00 0.00 ? 90  VAL A CA   3  
ATOM 4986  C C    . VAL A 1 90  ? 16.842  -1.095  -5.293  1.00 0.00 ? 90  VAL A C    3  
ATOM 4987  O O    . VAL A 1 90  ? 17.415  -0.395  -6.130  1.00 0.00 ? 90  VAL A O    3  
ATOM 4988  C CB   . VAL A 1 90  ? 15.535  -3.092  -6.022  1.00 0.00 ? 90  VAL A CB   3  
ATOM 4989  C CG1  . VAL A 1 90  ? 15.285  -2.392  -7.349  1.00 0.00 ? 90  VAL A CG1  3  
ATOM 4990  C CG2  . VAL A 1 90  ? 15.543  -4.603  -6.200  1.00 0.00 ? 90  VAL A CG2  3  
ATOM 4991  H H    . VAL A 1 90  ? 16.442  -3.883  -3.758  1.00 0.00 ? 90  VAL A H    3  
ATOM 4992  H HA   . VAL A 1 90  ? 17.668  -2.911  -6.055  1.00 0.00 ? 90  VAL A HA   3  
ATOM 4993  H HB   . VAL A 1 90  ? 14.732  -2.835  -5.347  1.00 0.00 ? 90  VAL A HB   3  
ATOM 4994  H HG11 . VAL A 1 90  ? 14.238  -2.469  -7.605  1.00 0.00 ? 90  VAL A HG11 3  
ATOM 4995  H HG12 . VAL A 1 90  ? 15.560  -1.351  -7.264  1.00 0.00 ? 90  VAL A HG12 3  
ATOM 4996  H HG13 . VAL A 1 90  ? 15.878  -2.860  -8.120  1.00 0.00 ? 90  VAL A HG13 3  
ATOM 4997  H HG21 . VAL A 1 90  ? 15.688  -4.841  -7.243  1.00 0.00 ? 90  VAL A HG21 3  
ATOM 4998  H HG22 . VAL A 1 90  ? 16.347  -5.030  -5.619  1.00 0.00 ? 90  VAL A HG22 3  
ATOM 4999  H HG23 . VAL A 1 90  ? 14.601  -5.010  -5.865  1.00 0.00 ? 90  VAL A HG23 3  
ATOM 5000  N N    . LEU A 1 91  ? 16.180  -0.588  -4.259  1.00 0.00 ? 91  LEU A N    3  
ATOM 5001  C CA   . LEU A 1 91  ? 16.086  0.851   -4.041  1.00 0.00 ? 91  LEU A CA   3  
ATOM 5002  C C    . LEU A 1 91  ? 17.464  1.454   -3.784  1.00 0.00 ? 91  LEU A C    3  
ATOM 5003  O O    . LEU A 1 91  ? 17.829  2.468   -4.379  1.00 0.00 ? 91  LEU A O    3  
ATOM 5004  C CB   . LEU A 1 91  ? 15.159  1.149   -2.862  1.00 0.00 ? 91  LEU A CB   3  
ATOM 5005  C CG   . LEU A 1 91  ? 13.770  0.513   -2.923  1.00 0.00 ? 91  LEU A CG   3  
ATOM 5006  C CD1  . LEU A 1 91  ? 13.092  0.579   -1.563  1.00 0.00 ? 91  LEU A CD1  3  
ATOM 5007  C CD2  . LEU A 1 91  ? 12.916  1.198   -3.980  1.00 0.00 ? 91  LEU A CD2  3  
ATOM 5008  H H    . LEU A 1 91  ? 15.744  -1.196  -3.626  1.00 0.00 ? 91  LEU A H    3  
ATOM 5009  H HA   . LEU A 1 91  ? 15.673  1.295   -4.935  1.00 0.00 ? 91  LEU A HA   3  
ATOM 5010  H HB2  . LEU A 1 91  ? 15.643  0.798   -1.963  1.00 0.00 ? 91  LEU A HB2  3  
ATOM 5011  H HB3  . LEU A 1 91  ? 15.031  2.221   -2.805  1.00 0.00 ? 91  LEU A HB3  3  
ATOM 5012  H HG   . LEU A 1 91  ? 13.869  -0.529  -3.196  1.00 0.00 ? 91  LEU A HG   3  
ATOM 5013  H HD11 . LEU A 1 91  ? 12.466  1.457   -1.515  1.00 0.00 ? 91  LEU A HD11 3  
ATOM 5014  H HD12 . LEU A 1 91  ? 13.843  0.629   -0.789  1.00 0.00 ? 91  LEU A HD12 3  
ATOM 5015  H HD13 . LEU A 1 91  ? 12.486  -0.304  -1.420  1.00 0.00 ? 91  LEU A HD13 3  
ATOM 5016  H HD21 . LEU A 1 91  ? 12.174  1.816   -3.498  1.00 0.00 ? 91  LEU A HD21 3  
ATOM 5017  H HD22 . LEU A 1 91  ? 12.423  0.450   -4.585  1.00 0.00 ? 91  LEU A HD22 3  
ATOM 5018  H HD23 . LEU A 1 91  ? 13.544  1.812   -4.608  1.00 0.00 ? 91  LEU A HD23 3  
ATOM 5019  N N    . ARG A 1 92  ? 18.225  0.822   -2.897  1.00 0.00 ? 92  ARG A N    3  
ATOM 5020  C CA   . ARG A 1 92  ? 19.562  1.295   -2.562  1.00 0.00 ? 92  ARG A CA   3  
ATOM 5021  C C    . ARG A 1 92  ? 20.453  1.327   -3.800  1.00 0.00 ? 92  ARG A C    3  
ATOM 5022  O O    . ARG A 1 92  ? 21.198  2.281   -4.017  1.00 0.00 ? 92  ARG A O    3  
ATOM 5023  C CB   . ARG A 1 92  ? 20.190  0.400   -1.492  1.00 0.00 ? 92  ARG A CB   3  
ATOM 5024  C CG   . ARG A 1 92  ? 19.378  0.323   -0.209  1.00 0.00 ? 92  ARG A CG   3  
ATOM 5025  C CD   . ARG A 1 92  ? 20.219  -0.179  0.954   1.00 0.00 ? 92  ARG A CD   3  
ATOM 5026  N NE   . ARG A 1 92  ? 21.191  0.817   1.397   1.00 0.00 ? 92  ARG A NE   3  
ATOM 5027  C CZ   . ARG A 1 92  ? 22.023  0.630   2.415   1.00 0.00 ? 92  ARG A CZ   3  
ATOM 5028  N NH1  . ARG A 1 92  ? 22.003  -0.511  3.091   1.00 0.00 ? 92  ARG A NH1  3  
ATOM 5029  N NH2  . ARG A 1 92  ? 22.879  1.584   2.759   1.00 0.00 ? 92  ARG A NH2  3  
ATOM 5030  H H    . ARG A 1 92  ? 17.878  0.018   -2.455  1.00 0.00 ? 92  ARG A H    3  
ATOM 5031  H HA   . ARG A 1 92  ? 19.472  2.298   -2.172  1.00 0.00 ? 92  ARG A HA   3  
ATOM 5032  H HB2  . ARG A 1 92  ? 20.291  -0.600  -1.888  1.00 0.00 ? 92  ARG A HB2  3  
ATOM 5033  H HB3  . ARG A 1 92  ? 21.170  0.783   -1.249  1.00 0.00 ? 92  ARG A HB3  3  
ATOM 5034  H HG2  . ARG A 1 92  ? 19.006  1.308   0.030   1.00 0.00 ? 92  ARG A HG2  3  
ATOM 5035  H HG3  . ARG A 1 92  ? 18.548  -0.351  -0.360  1.00 0.00 ? 92  ARG A HG3  3  
ATOM 5036  H HD2  . ARG A 1 92  ? 19.564  -0.420  1.777   1.00 0.00 ? 92  ARG A HD2  3  
ATOM 5037  H HD3  . ARG A 1 92  ? 20.746  -1.068  0.641   1.00 0.00 ? 92  ARG A HD3  3  
ATOM 5038  H HE   . ARG A 1 92  ? 21.222  1.667   0.912   1.00 0.00 ? 92  ARG A HE   3  
ATOM 5039  H HH11 . ARG A 1 92  ? 21.360  -1.232  2.834   1.00 0.00 ? 92  ARG A HH11 3  
ATOM 5040  H HH12 . ARG A 1 92  ? 22.632  -0.650  3.856   1.00 0.00 ? 92  ARG A HH12 3  
ATOM 5041  H HH21 . ARG A 1 92  ? 22.897  2.445   2.251   1.00 0.00 ? 92  ARG A HH21 3  
ATOM 5042  H HH22 . ARG A 1 92  ? 23.504  1.442   3.525   1.00 0.00 ? 92  ARG A HH22 3  
ATOM 5043  N N    . ASN A 1 93  ? 20.371  0.275   -4.609  1.00 0.00 ? 93  ASN A N    3  
ATOM 5044  C CA   . ASN A 1 93  ? 21.171  0.182   -5.826  1.00 0.00 ? 93  ASN A CA   3  
ATOM 5045  C C    . ASN A 1 93  ? 20.842  1.325   -6.782  1.00 0.00 ? 93  ASN A C    3  
ATOM 5046  O O    . ASN A 1 93  ? 21.730  1.891   -7.417  1.00 0.00 ? 93  ASN A O    3  
ATOM 5047  C CB   . ASN A 1 93  ? 20.930  -1.162  -6.517  1.00 0.00 ? 93  ASN A CB   3  
ATOM 5048  C CG   . ASN A 1 93  ? 21.866  -2.245  -6.016  1.00 0.00 ? 93  ASN A CG   3  
ATOM 5049  O OD1  . ASN A 1 93  ? 23.051  -2.260  -6.351  1.00 0.00 ? 93  ASN A OD1  3  
ATOM 5050  N ND2  . ASN A 1 93  ? 21.337  -3.158  -5.210  1.00 0.00 ? 93  ASN A ND2  3  
ATOM 5051  H H    . ASN A 1 93  ? 19.758  -0.456  -4.383  1.00 0.00 ? 93  ASN A H    3  
ATOM 5052  H HA   . ASN A 1 93  ? 22.210  0.251   -5.544  1.00 0.00 ? 93  ASN A HA   3  
ATOM 5053  H HB2  . ASN A 1 93  ? 19.914  -1.478  -6.332  1.00 0.00 ? 93  ASN A HB2  3  
ATOM 5054  H HB3  . ASN A 1 93  ? 21.080  -1.045  -7.580  1.00 0.00 ? 93  ASN A HB3  3  
ATOM 5055  H HD21 . ASN A 1 93  ? 20.386  -3.082  -4.986  1.00 0.00 ? 93  ASN A HD21 3  
ATOM 5056  H HD22 . ASN A 1 93  ? 21.920  -3.869  -4.871  1.00 0.00 ? 93  ASN A HD22 3  
ATOM 5057  N N    . ALA A 1 94  ? 19.559  1.658   -6.878  1.00 0.00 ? 94  ALA A N    3  
ATOM 5058  C CA   . ALA A 1 94  ? 19.112  2.734   -7.753  1.00 0.00 ? 94  ALA A CA   3  
ATOM 5059  C C    . ALA A 1 94  ? 19.929  4.002   -7.525  1.00 0.00 ? 94  ALA A C    3  
ATOM 5060  O O    . ALA A 1 94  ? 20.527  4.184   -6.466  1.00 0.00 ? 94  ALA A O    3  
ATOM 5061  C CB   . ALA A 1 94  ? 17.632  3.011   -7.537  1.00 0.00 ? 94  ALA A CB   3  
ATOM 5062  H H    . ALA A 1 94  ? 18.897  1.169   -6.345  1.00 0.00 ? 94  ALA A H    3  
ATOM 5063  H HA   . ALA A 1 94  ? 19.247  2.410   -8.775  1.00 0.00 ? 94  ALA A HA   3  
ATOM 5064  H HB1  . ALA A 1 94  ? 17.047  2.308   -8.112  1.00 0.00 ? 94  ALA A HB1  3  
ATOM 5065  H HB2  . ALA A 1 94  ? 17.396  2.905   -6.489  1.00 0.00 ? 94  ALA A HB2  3  
ATOM 5066  H HB3  . ALA A 1 94  ? 17.404  4.016   -7.858  1.00 0.00 ? 94  ALA A HB3  3  
ATOM 5067  N N    . GLY A 1 95  ? 19.949  4.876   -8.527  1.00 0.00 ? 95  GLY A N    3  
ATOM 5068  C CA   . GLY A 1 95  ? 20.696  6.115   -8.416  1.00 0.00 ? 95  GLY A CA   3  
ATOM 5069  C C    . GLY A 1 95  ? 19.794  7.322   -8.251  1.00 0.00 ? 95  GLY A C    3  
ATOM 5070  O O    . GLY A 1 95  ? 18.661  7.199   -7.788  1.00 0.00 ? 95  GLY A O    3  
ATOM 5071  H H    . GLY A 1 95  ? 19.452  4.677   -9.349  1.00 0.00 ? 95  GLY A H    3  
ATOM 5072  H HA2  . GLY A 1 95  ? 21.354  6.050   -7.562  1.00 0.00 ? 95  GLY A HA2  3  
ATOM 5073  H HA3  . GLY A 1 95  ? 21.291  6.244   -9.308  1.00 0.00 ? 95  GLY A HA3  3  
ATOM 5074  N N    . GLN A 1 96  ? 20.299  8.492   -8.630  1.00 0.00 ? 96  GLN A N    3  
ATOM 5075  C CA   . GLN A 1 96  ? 19.532  9.727   -8.519  1.00 0.00 ? 96  GLN A CA   3  
ATOM 5076  C C    . GLN A 1 96  ? 18.147  9.564   -9.136  1.00 0.00 ? 96  GLN A C    3  
ATOM 5077  O O    . GLN A 1 96  ? 17.132  9.697   -8.452  1.00 0.00 ? 96  GLN A O    3  
ATOM 5078  C CB   . GLN A 1 96  ? 20.275  10.877  -9.201  1.00 0.00 ? 96  GLN A CB   3  
ATOM 5079  C CG   . GLN A 1 96  ? 19.890  12.249  -8.670  1.00 0.00 ? 96  GLN A CG   3  
ATOM 5080  C CD   . GLN A 1 96  ? 21.026  13.249  -8.761  1.00 0.00 ? 96  GLN A CD   3  
ATOM 5081  O OE1  . GLN A 1 96  ? 21.651  13.403  -9.810  1.00 0.00 ? 96  GLN A OE1  3  
ATOM 5082  N NE2  . GLN A 1 96  ? 21.299  13.936  -7.657  1.00 0.00 ? 96  GLN A NE2  3  
ATOM 5083  H H    . GLN A 1 96  ? 21.209  8.525   -8.991  1.00 0.00 ? 96  GLN A H    3  
ATOM 5084  H HA   . GLN A 1 96  ? 19.420  9.954   -7.470  1.00 0.00 ? 96  GLN A HA   3  
ATOM 5085  H HB2  . GLN A 1 96  ? 21.336  10.742  -9.053  1.00 0.00 ? 96  GLN A HB2  3  
ATOM 5086  H HB3  . GLN A 1 96  ? 20.061  10.851  -10.259 1.00 0.00 ? 96  GLN A HB3  3  
ATOM 5087  H HG2  . GLN A 1 96  ? 19.056  12.622  -9.246  1.00 0.00 ? 96  GLN A HG2  3  
ATOM 5088  H HG3  . GLN A 1 96  ? 19.597  12.151  -7.636  1.00 0.00 ? 96  GLN A HG3  3  
ATOM 5089  H HE21 . GLN A 1 96  ? 20.760  13.759  -6.858  1.00 0.00 ? 96  GLN A HE21 3  
ATOM 5090  H HE22 . GLN A 1 96  ? 22.029  14.588  -7.687  1.00 0.00 ? 96  GLN A HE22 3  
ATOM 5091  N N    . VAL A 1 97  ? 18.112  9.276   -10.433 1.00 0.00 ? 97  VAL A N    3  
ATOM 5092  C CA   . VAL A 1 97  ? 16.852  9.094   -11.143 1.00 0.00 ? 97  VAL A CA   3  
ATOM 5093  C C    . VAL A 1 97  ? 16.201  7.765   -10.776 1.00 0.00 ? 97  VAL A C    3  
ATOM 5094  O O    . VAL A 1 97  ? 16.521  6.725   -11.353 1.00 0.00 ? 97  VAL A O    3  
ATOM 5095  C CB   . VAL A 1 97  ? 17.053  9.151   -12.669 1.00 0.00 ? 97  VAL A CB   3  
ATOM 5096  C CG1  . VAL A 1 97  ? 15.750  8.844   -13.391 1.00 0.00 ? 97  VAL A CG1  3  
ATOM 5097  C CG2  . VAL A 1 97  ? 17.594  10.511  -13.084 1.00 0.00 ? 97  VAL A CG2  3  
ATOM 5098  H H    . VAL A 1 97  ? 18.955  9.182   -10.924 1.00 0.00 ? 97  VAL A H    3  
ATOM 5099  H HA   . VAL A 1 97  ? 16.189  9.899   -10.858 1.00 0.00 ? 97  VAL A HA   3  
ATOM 5100  H HB   . VAL A 1 97  ? 17.778  8.399   -12.944 1.00 0.00 ? 97  VAL A HB   3  
ATOM 5101  H HG11 . VAL A 1 97  ? 15.644  9.506   -14.238 1.00 0.00 ? 97  VAL A HG11 3  
ATOM 5102  H HG12 . VAL A 1 97  ? 15.761  7.819   -13.733 1.00 0.00 ? 97  VAL A HG12 3  
ATOM 5103  H HG13 . VAL A 1 97  ? 14.921  8.989   -12.715 1.00 0.00 ? 97  VAL A HG13 3  
ATOM 5104  H HG21 . VAL A 1 97  ? 18.673  10.474  -13.116 1.00 0.00 ? 97  VAL A HG21 3  
ATOM 5105  H HG22 . VAL A 1 97  ? 17.214  10.767  -14.062 1.00 0.00 ? 97  VAL A HG22 3  
ATOM 5106  H HG23 . VAL A 1 97  ? 17.280  11.257  -12.369 1.00 0.00 ? 97  VAL A HG23 3  
ATOM 5107  N N    . VAL A 1 98  ? 15.286  7.806   -9.813  1.00 0.00 ? 98  VAL A N    3  
ATOM 5108  C CA   . VAL A 1 98  ? 14.588  6.605   -9.370  1.00 0.00 ? 98  VAL A CA   3  
ATOM 5109  C C    . VAL A 1 98  ? 13.159  6.571   -9.901  1.00 0.00 ? 98  VAL A C    3  
ATOM 5110  O O    . VAL A 1 98  ? 12.268  7.223   -9.356  1.00 0.00 ? 98  VAL A O    3  
ATOM 5111  C CB   . VAL A 1 98  ? 14.555  6.509   -7.833  1.00 0.00 ? 98  VAL A CB   3  
ATOM 5112  C CG1  . VAL A 1 98  ? 13.787  5.274   -7.391  1.00 0.00 ? 98  VAL A CG1  3  
ATOM 5113  C CG2  . VAL A 1 98  ? 15.969  6.498   -7.270  1.00 0.00 ? 98  VAL A CG2  3  
ATOM 5114  H H    . VAL A 1 98  ? 15.074  8.664   -9.391  1.00 0.00 ? 98  VAL A H    3  
ATOM 5115  H HA   . VAL A 1 98  ? 15.124  5.747   -9.752  1.00 0.00 ? 98  VAL A HA   3  
ATOM 5116  H HB   . VAL A 1 98  ? 14.045  7.380   -7.449  1.00 0.00 ? 98  VAL A HB   3  
ATOM 5117  H HG11 . VAL A 1 98  ? 12.726  5.468   -7.454  1.00 0.00 ? 98  VAL A HG11 3  
ATOM 5118  H HG12 . VAL A 1 98  ? 14.041  4.442   -8.032  1.00 0.00 ? 98  VAL A HG12 3  
ATOM 5119  H HG13 . VAL A 1 98  ? 14.047  5.034   -6.370  1.00 0.00 ? 98  VAL A HG13 3  
ATOM 5120  H HG21 . VAL A 1 98  ? 15.946  6.147   -6.249  1.00 0.00 ? 98  VAL A HG21 3  
ATOM 5121  H HG22 . VAL A 1 98  ? 16.588  5.840   -7.863  1.00 0.00 ? 98  VAL A HG22 3  
ATOM 5122  H HG23 . VAL A 1 98  ? 16.376  7.497   -7.299  1.00 0.00 ? 98  VAL A HG23 3  
ATOM 5123  N N    . HIS A 1 99  ? 12.948  5.808   -10.968 1.00 0.00 ? 99  HIS A N    3  
ATOM 5124  C CA   . HIS A 1 99  ? 11.626  5.688   -11.573 1.00 0.00 ? 99  HIS A CA   3  
ATOM 5125  C C    . HIS A 1 99  ? 10.816  4.588   -10.895 1.00 0.00 ? 99  HIS A C    3  
ATOM 5126  O O    . HIS A 1 99  ? 10.995  3.404   -11.182 1.00 0.00 ? 99  HIS A O    3  
ATOM 5127  C CB   . HIS A 1 99  ? 11.751  5.397   -13.069 1.00 0.00 ? 99  HIS A CB   3  
ATOM 5128  C CG   . HIS A 1 99  ? 11.843  6.631   -13.914 1.00 0.00 ? 99  HIS A CG   3  
ATOM 5129  N ND1  . HIS A 1 99  ? 12.873  6.860   -14.801 1.00 0.00 ? 99  HIS A ND1  3  
ATOM 5130  C CD2  . HIS A 1 99  ? 11.025  7.705   -14.003 1.00 0.00 ? 99  HIS A CD2  3  
ATOM 5131  C CE1  . HIS A 1 99  ? 12.686  8.023   -15.399 1.00 0.00 ? 99  HIS A CE1  3  
ATOM 5132  N NE2  . HIS A 1 99  ? 11.570  8.556   -14.933 1.00 0.00 ? 99  HIS A NE2  3  
ATOM 5133  H H    . HIS A 1 99  ? 13.699  5.313   -11.358 1.00 0.00 ? 99  HIS A H    3  
ATOM 5134  H HA   . HIS A 1 99  ? 11.114  6.629   -11.440 1.00 0.00 ? 99  HIS A HA   3  
ATOM 5135  H HB2  . HIS A 1 99  ? 12.641  4.810   -13.242 1.00 0.00 ? 99  HIS A HB2  3  
ATOM 5136  H HB3  . HIS A 1 99  ? 10.887  4.836   -13.393 1.00 0.00 ? 99  HIS A HB3  3  
ATOM 5137  H HD1  . HIS A 1 99  ? 13.630  6.260   -14.967 1.00 0.00 ? 99  HIS A HD1  3  
ATOM 5138  H HD2  . HIS A 1 99  ? 10.112  7.865   -13.447 1.00 0.00 ? 99  HIS A HD2  3  
ATOM 5139  H HE1  . HIS A 1 99  ? 13.333  8.463   -16.143 1.00 0.00 ? 99  HIS A HE1  3  
ATOM 5140  H HE2  . HIS A 1 99  ? 11.243  9.455   -15.145 1.00 0.00 ? 99  HIS A HE2  3  
ATOM 5141  N N    . LEU A 1 100 ? 9.925   4.986   -9.994  1.00 0.00 ? 100 LEU A N    3  
ATOM 5142  C CA   . LEU A 1 100 ? 9.087   4.034   -9.273  1.00 0.00 ? 100 LEU A CA   3  
ATOM 5143  C C    . LEU A 1 100 ? 7.835   3.694   -10.076 1.00 0.00 ? 100 LEU A C    3  
ATOM 5144  O O    . LEU A 1 100 ? 7.152   4.582   -10.589 1.00 0.00 ? 100 LEU A O    3  
ATOM 5145  C CB   . LEU A 1 100 ? 8.692   4.602   -7.909  1.00 0.00 ? 100 LEU A CB   3  
ATOM 5146  C CG   . LEU A 1 100 ? 8.625   3.597   -6.758  1.00 0.00 ? 100 LEU A CG   3  
ATOM 5147  C CD1  . LEU A 1 100 ? 7.688   2.450   -7.104  1.00 0.00 ? 100 LEU A CD1  3  
ATOM 5148  C CD2  . LEU A 1 100 ? 10.015  3.072   -6.427  1.00 0.00 ? 100 LEU A CD2  3  
ATOM 5149  H H    . LEU A 1 100 ? 9.827   5.943   -9.808  1.00 0.00 ? 100 LEU A H    3  
ATOM 5150  H HA   . LEU A 1 100 ? 9.661   3.132   -9.127  1.00 0.00 ? 100 LEU A HA   3  
ATOM 5151  H HB2  . LEU A 1 100 ? 9.415   5.359   -7.645  1.00 0.00 ? 100 LEU A HB2  3  
ATOM 5152  H HB3  . LEU A 1 100 ? 7.717   5.056   -8.010  1.00 0.00 ? 100 LEU A HB3  3  
ATOM 5153  H HG   . LEU A 1 100 ? 8.236   4.092   -5.879  1.00 0.00 ? 100 LEU A HG   3  
ATOM 5154  H HD11 . LEU A 1 100 ? 6.804   2.841   -7.584  1.00 0.00 ? 100 LEU A HD11 3  
ATOM 5155  H HD12 . LEU A 1 100 ? 7.408   1.929   -6.201  1.00 0.00 ? 100 LEU A HD12 3  
ATOM 5156  H HD13 . LEU A 1 100 ? 8.189   1.766   -7.773  1.00 0.00 ? 100 LEU A HD13 3  
ATOM 5157  H HD21 . LEU A 1 100 ? 10.166  2.122   -6.918  1.00 0.00 ? 100 LEU A HD21 3  
ATOM 5158  H HD22 . LEU A 1 100 ? 10.105  2.942   -5.358  1.00 0.00 ? 100 LEU A HD22 3  
ATOM 5159  H HD23 . LEU A 1 100 ? 10.757  3.777   -6.769  1.00 0.00 ? 100 LEU A HD23 3  
ATOM 5160  N N    . THR A 1 101 ? 7.537   2.402   -10.180 1.00 0.00 ? 101 THR A N    3  
ATOM 5161  C CA   . THR A 1 101 ? 6.368   1.945   -10.919 1.00 0.00 ? 101 THR A CA   3  
ATOM 5162  C C    . THR A 1 101 ? 5.262   1.492   -9.973  1.00 0.00 ? 101 THR A C    3  
ATOM 5163  O O    . THR A 1 101 ? 5.377   0.455   -9.318  1.00 0.00 ? 101 THR A O    3  
ATOM 5164  C CB   . THR A 1 101 ? 6.721   0.785   -11.869 1.00 0.00 ? 101 THR A CB   3  
ATOM 5165  O OG1  . THR A 1 101 ? 7.911   1.098   -12.602 1.00 0.00 ? 101 THR A OG1  3  
ATOM 5166  C CG2  . THR A 1 101 ? 5.580   0.511   -12.837 1.00 0.00 ? 101 THR A CG2  3  
ATOM 5167  H H    . THR A 1 101 ? 8.120   1.743   -9.749  1.00 0.00 ? 101 THR A H    3  
ATOM 5168  H HA   . THR A 1 101 ? 6.004   2.771   -11.513 1.00 0.00 ? 101 THR A HA   3  
ATOM 5169  H HB   . THR A 1 101 ? 6.894   -0.104  -11.279 1.00 0.00 ? 101 THR A HB   3  
ATOM 5170  H HG1  . THR A 1 101 ? 7.982   2.050   -12.706 1.00 0.00 ? 101 THR A HG1  3  
ATOM 5171  H HG21 . THR A 1 101 ? 5.944   -0.080  -13.665 1.00 0.00 ? 101 THR A HG21 3  
ATOM 5172  H HG22 . THR A 1 101 ? 5.190   1.447   -13.207 1.00 0.00 ? 101 THR A HG22 3  
ATOM 5173  H HG23 . THR A 1 101 ? 4.798   -0.029  -12.327 1.00 0.00 ? 101 THR A HG23 3  
ATOM 5174  N N    . LEU A 1 102 ? 4.190   2.274   -9.905  1.00 0.00 ? 102 LEU A N    3  
ATOM 5175  C CA   . LEU A 1 102 ? 3.062   1.952   -9.038  1.00 0.00 ? 102 LEU A CA   3  
ATOM 5176  C C    . LEU A 1 102 ? 1.780   1.792   -9.849  1.00 0.00 ? 102 LEU A C    3  
ATOM 5177  O O    . LEU A 1 102 ? 1.672   2.300   -10.966 1.00 0.00 ? 102 LEU A O    3  
ATOM 5178  C CB   . LEU A 1 102 ? 2.878   3.044   -7.982  1.00 0.00 ? 102 LEU A CB   3  
ATOM 5179  C CG   . LEU A 1 102 ? 4.153   3.538   -7.298  1.00 0.00 ? 102 LEU A CG   3  
ATOM 5180  C CD1  . LEU A 1 102 ? 4.814   4.629   -8.127  1.00 0.00 ? 102 LEU A CD1  3  
ATOM 5181  C CD2  . LEU A 1 102 ? 3.845   4.044   -5.896  1.00 0.00 ? 102 LEU A CD2  3  
ATOM 5182  H H    . LEU A 1 102 ? 4.156   3.087   -10.450 1.00 0.00 ? 102 LEU A H    3  
ATOM 5183  H HA   . LEU A 1 102 ? 3.280   1.017   -8.544  1.00 0.00 ? 102 LEU A HA   3  
ATOM 5184  H HB2  . LEU A 1 102 ? 2.409   3.890   -8.459  1.00 0.00 ? 102 LEU A HB2  3  
ATOM 5185  H HB3  . LEU A 1 102 ? 2.220   2.655   -7.217  1.00 0.00 ? 102 LEU A HB3  3  
ATOM 5186  H HG   . LEU A 1 102 ? 4.850   2.716   -7.213  1.00 0.00 ? 102 LEU A HG   3  
ATOM 5187  H HD11 . LEU A 1 102 ? 4.975   5.501   -7.511  1.00 0.00 ? 102 LEU A HD11 3  
ATOM 5188  H HD12 . LEU A 1 102 ? 4.174   4.888   -8.957  1.00 0.00 ? 102 LEU A HD12 3  
ATOM 5189  H HD13 . LEU A 1 102 ? 5.762   4.272   -8.502  1.00 0.00 ? 102 LEU A HD13 3  
ATOM 5190  H HD21 . LEU A 1 102 ? 4.665   3.798   -5.238  1.00 0.00 ? 102 LEU A HD21 3  
ATOM 5191  H HD22 . LEU A 1 102 ? 2.941   3.575   -5.535  1.00 0.00 ? 102 LEU A HD22 3  
ATOM 5192  H HD23 . LEU A 1 102 ? 3.711   5.115   -5.921  1.00 0.00 ? 102 LEU A HD23 3  
ATOM 5193  N N    . VAL A 1 103 ? 0.810   1.085   -9.280  1.00 0.00 ? 103 VAL A N    3  
ATOM 5194  C CA   . VAL A 1 103 ? -0.467  0.861   -9.948  1.00 0.00 ? 103 VAL A CA   3  
ATOM 5195  C C    . VAL A 1 103 ? -1.623  0.915   -8.957  1.00 0.00 ? 103 VAL A C    3  
ATOM 5196  O O    . VAL A 1 103 ? -1.757  0.047   -8.095  1.00 0.00 ? 103 VAL A O    3  
ATOM 5197  C CB   . VAL A 1 103 ? -0.490  -0.498  -10.673 1.00 0.00 ? 103 VAL A CB   3  
ATOM 5198  C CG1  . VAL A 1 103 ? -0.057  -1.612  -9.732  1.00 0.00 ? 103 VAL A CG1  3  
ATOM 5199  C CG2  . VAL A 1 103 ? -1.873  -0.775  -11.240 1.00 0.00 ? 103 VAL A CG2  3  
ATOM 5200  H H    . VAL A 1 103 ? 0.955   0.705   -8.388  1.00 0.00 ? 103 VAL A H    3  
ATOM 5201  H HA   . VAL A 1 103 ? -0.599  1.640   -10.684 1.00 0.00 ? 103 VAL A HA   3  
ATOM 5202  H HB   . VAL A 1 103 ? 0.212   -0.457  -11.494 1.00 0.00 ? 103 VAL A HB   3  
ATOM 5203  H HG11 . VAL A 1 103 ? -0.915  -2.210  -9.464  1.00 0.00 ? 103 VAL A HG11 3  
ATOM 5204  H HG12 . VAL A 1 103 ? 0.677   -2.234  -10.224 1.00 0.00 ? 103 VAL A HG12 3  
ATOM 5205  H HG13 . VAL A 1 103 ? 0.374   -1.183  -8.840  1.00 0.00 ? 103 VAL A HG13 3  
ATOM 5206  H HG21 . VAL A 1 103 ? -2.341  0.157   -11.518 1.00 0.00 ? 103 VAL A HG21 3  
ATOM 5207  H HG22 . VAL A 1 103 ? -1.786  -1.407  -12.112 1.00 0.00 ? 103 VAL A HG22 3  
ATOM 5208  H HG23 . VAL A 1 103 ? -2.475  -1.273  -10.495 1.00 0.00 ? 103 VAL A HG23 3  
ATOM 5209  N N    . ARG A 1 104 ? -2.458  1.941   -9.085  1.00 0.00 ? 104 ARG A N    3  
ATOM 5210  C CA   . ARG A 1 104 ? -3.604  2.110   -8.200  1.00 0.00 ? 104 ARG A CA   3  
ATOM 5211  C C    . ARG A 1 104 ? -4.912  1.908   -8.960  1.00 0.00 ? 104 ARG A C    3  
ATOM 5212  O O    . ARG A 1 104 ? -4.968  2.084   -10.177 1.00 0.00 ? 104 ARG A O    3  
ATOM 5213  C CB   . ARG A 1 104 ? -3.582  3.500   -7.561  1.00 0.00 ? 104 ARG A CB   3  
ATOM 5214  C CG   . ARG A 1 104 ? -2.357  3.755   -6.699  1.00 0.00 ? 104 ARG A CG   3  
ATOM 5215  C CD   . ARG A 1 104 ? -2.112  5.243   -6.504  1.00 0.00 ? 104 ARG A CD   3  
ATOM 5216  N NE   . ARG A 1 104 ? -2.967  5.806   -5.462  1.00 0.00 ? 104 ARG A NE   3  
ATOM 5217  C CZ   . ARG A 1 104 ? -3.153  7.110   -5.289  1.00 0.00 ? 104 ARG A CZ   3  
ATOM 5218  N NH1  . ARG A 1 104 ? -2.549  7.980   -6.086  1.00 0.00 ? 104 ARG A NH1  3  
ATOM 5219  N NH2  . ARG A 1 104 ? -3.946  7.545   -4.318  1.00 0.00 ? 104 ARG A NH2  3  
ATOM 5220  H H    . ARG A 1 104 ? -2.299  2.602   -9.792  1.00 0.00 ? 104 ARG A H    3  
ATOM 5221  H HA   . ARG A 1 104 ? -3.535  1.365   -7.422  1.00 0.00 ? 104 ARG A HA   3  
ATOM 5222  H HB2  . ARG A 1 104 ? -3.605  4.244   -8.344  1.00 0.00 ? 104 ARG A HB2  3  
ATOM 5223  H HB3  . ARG A 1 104 ? -4.460  3.612   -6.943  1.00 0.00 ? 104 ARG A HB3  3  
ATOM 5224  H HG2  . ARG A 1 104 ? -2.506  3.296   -5.733  1.00 0.00 ? 104 ARG A HG2  3  
ATOM 5225  H HG3  . ARG A 1 104 ? -1.494  3.316   -7.178  1.00 0.00 ? 104 ARG A HG3  3  
ATOM 5226  H HD2  . ARG A 1 104 ? -1.079  5.391   -6.228  1.00 0.00 ? 104 ARG A HD2  3  
ATOM 5227  H HD3  . ARG A 1 104 ? -2.313  5.752   -7.435  1.00 0.00 ? 104 ARG A HD3  3  
ATOM 5228  H HE   . ARG A 1 104 ? -3.423  5.180   -4.862  1.00 0.00 ? 104 ARG A HE   3  
ATOM 5229  H HH11 . ARG A 1 104 ? -1.952  7.655   -6.819  1.00 0.00 ? 104 ARG A HH11 3  
ATOM 5230  H HH12 . ARG A 1 104 ? -2.692  8.962   -5.954  1.00 0.00 ? 104 ARG A HH12 3  
ATOM 5231  H HH21 . ARG A 1 104 ? -4.403  6.891   -3.716  1.00 0.00 ? 104 ARG A HH21 3  
ATOM 5232  H HH22 . ARG A 1 104 ? -4.085  8.526   -4.189  1.00 0.00 ? 104 ARG A HH22 3  
ATOM 5233  N N    . ARG A 1 105 ? -5.961  1.537   -8.233  1.00 0.00 ? 105 ARG A N    3  
ATOM 5234  C CA   . ARG A 1 105 ? -7.268  1.310   -8.838  1.00 0.00 ? 105 ARG A CA   3  
ATOM 5235  C C    . ARG A 1 105 ? -7.871  2.619   -9.338  1.00 0.00 ? 105 ARG A C    3  
ATOM 5236  O O    . ARG A 1 105 ? -8.052  3.565   -8.572  1.00 0.00 ? 105 ARG A O    3  
ATOM 5237  C CB   . ARG A 1 105 ? -8.213  0.653   -7.830  1.00 0.00 ? 105 ARG A CB   3  
ATOM 5238  C CG   . ARG A 1 105 ? -9.442  0.025   -8.467  1.00 0.00 ? 105 ARG A CG   3  
ATOM 5239  C CD   . ARG A 1 105 ? -10.003 -1.097  -7.608  1.00 0.00 ? 105 ARG A CD   3  
ATOM 5240  N NE   . ARG A 1 105 ? -10.418 -0.623  -6.290  1.00 0.00 ? 105 ARG A NE   3  
ATOM 5241  C CZ   . ARG A 1 105 ? -10.859 -1.424  -5.327  1.00 0.00 ? 105 ARG A CZ   3  
ATOM 5242  N NH1  . ARG A 1 105 ? -10.940 -2.731  -5.531  1.00 0.00 ? 105 ARG A NH1  3  
ATOM 5243  N NH2  . ARG A 1 105 ? -11.219 -0.917  -4.154  1.00 0.00 ? 105 ARG A NH2  3  
ATOM 5244  H H    . ARG A 1 105 ? -5.854  1.413   -7.266  1.00 0.00 ? 105 ARG A H    3  
ATOM 5245  H HA   . ARG A 1 105 ? -7.133  0.645   -9.678  1.00 0.00 ? 105 ARG A HA   3  
ATOM 5246  H HB2  . ARG A 1 105 ? -7.675  -0.119  -7.300  1.00 0.00 ? 105 ARG A HB2  3  
ATOM 5247  H HB3  . ARG A 1 105 ? -8.542  1.400   -7.124  1.00 0.00 ? 105 ARG A HB3  3  
ATOM 5248  H HG2  . ARG A 1 105 ? -10.201 0.784   -8.588  1.00 0.00 ? 105 ARG A HG2  3  
ATOM 5249  H HG3  . ARG A 1 105 ? -9.171  -0.373  -9.433  1.00 0.00 ? 105 ARG A HG3  3  
ATOM 5250  H HD2  . ARG A 1 105 ? -10.856 -1.526  -8.111  1.00 0.00 ? 105 ARG A HD2  3  
ATOM 5251  H HD3  . ARG A 1 105 ? -9.241  -1.853  -7.484  1.00 0.00 ? 105 ARG A HD3  3  
ATOM 5252  H HE   . ARG A 1 105 ? -10.366 0.340   -6.118  1.00 0.00 ? 105 ARG A HE   3  
ATOM 5253  H HH11 . ARG A 1 105 ? -10.669 -3.116  -6.413  1.00 0.00 ? 105 ARG A HH11 3  
ATOM 5254  H HH12 . ARG A 1 105 ? -11.271 -3.332  -4.803  1.00 0.00 ? 105 ARG A HH12 3  
ATOM 5255  H HH21 . ARG A 1 105 ? -11.159 0.068   -3.996  1.00 0.00 ? 105 ARG A HH21 3  
ATOM 5256  H HH22 . ARG A 1 105 ? -11.550 -1.520  -3.429  1.00 0.00 ? 105 ARG A HH22 3  
ATOM 5257  N N    . LYS A 1 106 ? -8.179  2.667   -10.630 1.00 0.00 ? 106 LYS A N    3  
ATOM 5258  C CA   . LYS A 1 106 ? -8.763  3.858   -11.234 1.00 0.00 ? 106 LYS A CA   3  
ATOM 5259  C C    . LYS A 1 106 ? -10.093 4.208   -10.575 1.00 0.00 ? 106 LYS A C    3  
ATOM 5260  O O    . LYS A 1 106 ? -10.361 5.370   -10.270 1.00 0.00 ? 106 LYS A O    3  
ATOM 5261  C CB   . LYS A 1 106 ? -8.966  3.646   -12.736 1.00 0.00 ? 106 LYS A CB   3  
ATOM 5262  C CG   . LYS A 1 106 ? -7.685  3.317   -13.483 1.00 0.00 ? 106 LYS A CG   3  
ATOM 5263  C CD   . LYS A 1 106 ? -7.963  2.511   -14.740 1.00 0.00 ? 106 LYS A CD   3  
ATOM 5264  C CE   . LYS A 1 106 ? -6.893  2.738   -15.797 1.00 0.00 ? 106 LYS A CE   3  
ATOM 5265  N NZ   . LYS A 1 106 ? -7.384  2.409   -17.163 1.00 0.00 ? 106 LYS A NZ   3  
ATOM 5266  H H    . LYS A 1 106 ? -8.012  1.880   -11.191 1.00 0.00 ? 106 LYS A H    3  
ATOM 5267  H HA   . LYS A 1 106 ? -8.075  4.677   -11.085 1.00 0.00 ? 106 LYS A HA   3  
ATOM 5268  H HB2  . LYS A 1 106 ? -9.662  2.834   -12.882 1.00 0.00 ? 106 LYS A HB2  3  
ATOM 5269  H HB3  . LYS A 1 106 ? -9.384  4.548   -13.161 1.00 0.00 ? 106 LYS A HB3  3  
ATOM 5270  H HG2  . LYS A 1 106 ? -7.194  4.238   -13.760 1.00 0.00 ? 106 LYS A HG2  3  
ATOM 5271  H HG3  . LYS A 1 106 ? -7.038  2.744   -12.834 1.00 0.00 ? 106 LYS A HG3  3  
ATOM 5272  H HD2  . LYS A 1 106 ? -7.986  1.461   -14.487 1.00 0.00 ? 106 LYS A HD2  3  
ATOM 5273  H HD3  . LYS A 1 106 ? -8.922  2.806   -15.142 1.00 0.00 ? 106 LYS A HD3  3  
ATOM 5274  H HE2  . LYS A 1 106 ? -6.595  3.775   -15.771 1.00 0.00 ? 106 LYS A HE2  3  
ATOM 5275  H HE3  . LYS A 1 106 ? -6.042  2.113   -15.569 1.00 0.00 ? 106 LYS A HE3  3  
ATOM 5276  H HZ1  . LYS A 1 106 ? -6.660  2.648   -17.870 1.00 0.00 ? 106 LYS A HZ1  3  
ATOM 5277  H HZ2  . LYS A 1 106 ? -8.248  2.949   -17.373 1.00 0.00 ? 106 LYS A HZ2  3  
ATOM 5278  H HZ3  . LYS A 1 106 ? -7.598  1.393   -17.231 1.00 0.00 ? 106 LYS A HZ3  3  
ATOM 5279  N N    . THR A 1 107 ? -10.924 3.193   -10.356 1.00 0.00 ? 107 THR A N    3  
ATOM 5280  C CA   . THR A 1 107 ? -12.226 3.393   -9.732  1.00 0.00 ? 107 THR A CA   3  
ATOM 5281  C C    . THR A 1 107 ? -12.151 4.438   -8.625  1.00 0.00 ? 107 THR A C    3  
ATOM 5282  O O    . THR A 1 107 ? -11.186 4.479   -7.862  1.00 0.00 ? 107 THR A O    3  
ATOM 5283  C CB   . THR A 1 107 ? -12.776 2.079   -9.146  1.00 0.00 ? 107 THR A CB   3  
ATOM 5284  O OG1  . THR A 1 107 ? -12.937 1.108   -10.186 1.00 0.00 ? 107 THR A OG1  3  
ATOM 5285  C CG2  . THR A 1 107 ? -14.109 2.312   -8.452  1.00 0.00 ? 107 THR A CG2  3  
ATOM 5286  H H    . THR A 1 107 ? -10.654 2.289   -10.621 1.00 0.00 ? 107 THR A H    3  
ATOM 5287  H HA   . THR A 1 107 ? -12.911 3.737   -10.493 1.00 0.00 ? 107 THR A HA   3  
ATOM 5288  H HB   . THR A 1 107 ? -12.069 1.703   -8.419  1.00 0.00 ? 107 THR A HB   3  
ATOM 5289  H HG1  . THR A 1 107 ? -13.856 1.085   -10.463 1.00 0.00 ? 107 THR A HG1  3  
ATOM 5290  H HG21 . THR A 1 107 ? -14.908 2.243   -9.175  1.00 0.00 ? 107 THR A HG21 3  
ATOM 5291  H HG22 . THR A 1 107 ? -14.114 3.293   -8.002  1.00 0.00 ? 107 THR A HG22 3  
ATOM 5292  H HG23 . THR A 1 107 ? -14.252 1.563   -7.687  1.00 0.00 ? 107 THR A HG23 3  
ATOM 5293  N N    . SER A 1 108 ? -13.176 5.280   -8.542  1.00 0.00 ? 108 SER A N    3  
ATOM 5294  C CA   . SER A 1 108 ? -13.224 6.328   -7.529  1.00 0.00 ? 108 SER A CA   3  
ATOM 5295  C C    . SER A 1 108 ? -13.103 5.735   -6.128  1.00 0.00 ? 108 SER A C    3  
ATOM 5296  O O    . SER A 1 108 ? -13.114 4.517   -5.955  1.00 0.00 ? 108 SER A O    3  
ATOM 5297  C CB   . SER A 1 108 ? -14.526 7.122   -7.648  1.00 0.00 ? 108 SER A CB   3  
ATOM 5298  O OG   . SER A 1 108 ? -15.652 6.261   -7.639  1.00 0.00 ? 108 SER A OG   3  
ATOM 5299  H H    . SER A 1 108 ? -13.916 5.196   -9.179  1.00 0.00 ? 108 SER A H    3  
ATOM 5300  H HA   . SER A 1 108 ? -12.390 6.992   -7.699  1.00 0.00 ? 108 SER A HA   3  
ATOM 5301  H HB2  . SER A 1 108 ? -14.605 7.806   -6.817  1.00 0.00 ? 108 SER A HB2  3  
ATOM 5302  H HB3  . SER A 1 108 ? -14.521 7.679   -8.574  1.00 0.00 ? 108 SER A HB3  3  
ATOM 5303  H HG   . SER A 1 108 ? -16.204 6.465   -6.881  1.00 0.00 ? 108 SER A HG   3  
ATOM 5304  N N    . SER A 1 109 ? -12.987 6.607   -5.132  1.00 0.00 ? 109 SER A N    3  
ATOM 5305  C CA   . SER A 1 109 ? -12.859 6.172   -3.746  1.00 0.00 ? 109 SER A CA   3  
ATOM 5306  C C    . SER A 1 109 ? -14.211 6.206   -3.039  1.00 0.00 ? 109 SER A C    3  
ATOM 5307  O O    . SER A 1 109 ? -15.207 6.659   -3.603  1.00 0.00 ? 109 SER A O    3  
ATOM 5308  C CB   . SER A 1 109 ? -11.859 7.057   -3.001  1.00 0.00 ? 109 SER A CB   3  
ATOM 5309  O OG   . SER A 1 109 ? -11.443 6.450   -1.790  1.00 0.00 ? 109 SER A OG   3  
ATOM 5310  H H    . SER A 1 109 ? -12.984 7.566   -5.334  1.00 0.00 ? 109 SER A H    3  
ATOM 5311  H HA   . SER A 1 109 ? -12.494 5.155   -3.750  1.00 0.00 ? 109 SER A HA   3  
ATOM 5312  H HB2  . SER A 1 109 ? -10.992 7.220   -3.623  1.00 0.00 ? 109 SER A HB2  3  
ATOM 5313  H HB3  . SER A 1 109 ? -12.322 8.006   -2.773  1.00 0.00 ? 109 SER A HB3  3  
ATOM 5314  H HG   . SER A 1 109 ? -10.692 5.877   -1.960  1.00 0.00 ? 109 SER A HG   3  
ATOM 5315  N N    . SER A 1 110 ? -14.237 5.723   -1.801  1.00 0.00 ? 110 SER A N    3  
ATOM 5316  C CA   . SER A 1 110 ? -15.466 5.694   -1.017  1.00 0.00 ? 110 SER A CA   3  
ATOM 5317  C C    . SER A 1 110 ? -16.056 7.095   -0.880  1.00 0.00 ? 110 SER A C    3  
ATOM 5318  O O    . SER A 1 110 ? -15.392 8.092   -1.167  1.00 0.00 ? 110 SER A O    3  
ATOM 5319  C CB   . SER A 1 110 ? -15.199 5.103   0.368   1.00 0.00 ? 110 SER A CB   3  
ATOM 5320  O OG   . SER A 1 110 ? -14.451 6.000   1.170   1.00 0.00 ? 110 SER A OG   3  
ATOM 5321  H H    . SER A 1 110 ? -13.409 5.376   -1.407  1.00 0.00 ? 110 SER A H    3  
ATOM 5322  H HA   . SER A 1 110 ? -16.176 5.067   -1.537  1.00 0.00 ? 110 SER A HA   3  
ATOM 5323  H HB2  . SER A 1 110 ? -16.139 4.900   0.857   1.00 0.00 ? 110 SER A HB2  3  
ATOM 5324  H HB3  . SER A 1 110 ? -14.642 4.183   0.262   1.00 0.00 ? 110 SER A HB3  3  
ATOM 5325  H HG   . SER A 1 110 ? -15.016 6.721   1.457   1.00 0.00 ? 110 SER A HG   3  
ATOM 5326  N N    . THR A 1 111 ? -17.308 7.162   -0.439  1.00 0.00 ? 111 THR A N    3  
ATOM 5327  C CA   . THR A 1 111 ? -17.989 8.439   -0.264  1.00 0.00 ? 111 THR A CA   3  
ATOM 5328  C C    . THR A 1 111 ? -17.258 9.318   0.745   1.00 0.00 ? 111 THR A C    3  
ATOM 5329  O O    . THR A 1 111 ? -16.739 8.829   1.748   1.00 0.00 ? 111 THR A O    3  
ATOM 5330  C CB   . THR A 1 111 ? -19.443 8.240   0.204   1.00 0.00 ? 111 THR A CB   3  
ATOM 5331  O OG1  . THR A 1 111 ? -20.120 9.501   0.249   1.00 0.00 ? 111 THR A OG1  3  
ATOM 5332  C CG2  . THR A 1 111 ? -19.485 7.587   1.577   1.00 0.00 ? 111 THR A CG2  3  
ATOM 5333  H H    . THR A 1 111 ? -17.784 6.332   -0.227  1.00 0.00 ? 111 THR A H    3  
ATOM 5334  H HA   . THR A 1 111 ? -18.006 8.941   -1.220  1.00 0.00 ? 111 THR A HA   3  
ATOM 5335  H HB   . THR A 1 111 ? -19.947 7.595   -0.501  1.00 0.00 ? 111 THR A HB   3  
ATOM 5336  H HG1  . THR A 1 111 ? -20.836 9.458   0.887   1.00 0.00 ? 111 THR A HG1  3  
ATOM 5337  H HG21 . THR A 1 111 ? -19.219 8.314   2.330   1.00 0.00 ? 111 THR A HG21 3  
ATOM 5338  H HG22 . THR A 1 111 ? -18.785 6.765   1.607   1.00 0.00 ? 111 THR A HG22 3  
ATOM 5339  H HG23 . THR A 1 111 ? -20.482 7.218   1.769   1.00 0.00 ? 111 THR A HG23 3  
ATOM 5340  N N    . SER A 1 112 ? -17.222 10.618  0.472   1.00 0.00 ? 112 SER A N    3  
ATOM 5341  C CA   . SER A 1 112 ? -16.552 11.566  1.355   1.00 0.00 ? 112 SER A CA   3  
ATOM 5342  C C    . SER A 1 112 ? -15.073 11.221  1.500   1.00 0.00 ? 112 SER A C    3  
ATOM 5343  O O    . SER A 1 112 ? -14.555 11.046  2.603   1.00 0.00 ? 112 SER A O    3  
ATOM 5344  C CB   . SER A 1 112 ? -17.222 11.576  2.730   1.00 0.00 ? 112 SER A CB   3  
ATOM 5345  O OG   . SER A 1 112 ? -18.430 12.316  2.704   1.00 0.00 ? 112 SER A OG   3  
ATOM 5346  H H    . SER A 1 112 ? -17.655 10.948  -0.343  1.00 0.00 ? 112 SER A H    3  
ATOM 5347  H HA   . SER A 1 112 ? -16.639 12.548  0.914   1.00 0.00 ? 112 SER A HA   3  
ATOM 5348  H HB2  . SER A 1 112 ? -17.441 10.562  3.028   1.00 0.00 ? 112 SER A HB2  3  
ATOM 5349  H HB3  . SER A 1 112 ? -16.554 12.026  3.450   1.00 0.00 ? 112 SER A HB3  3  
ATOM 5350  H HG   . SER A 1 112 ? -18.529 12.798  3.528   1.00 0.00 ? 112 SER A HG   3  
ATOM 5351  N N    . PRO A 1 113 ? -14.376 11.120  0.358   1.00 0.00 ? 113 PRO A N    3  
ATOM 5352  C CA   . PRO A 1 113 ? -12.946 10.796  0.330   1.00 0.00 ? 113 PRO A CA   3  
ATOM 5353  C C    . PRO A 1 113 ? -12.084 11.931  0.872   1.00 0.00 ? 113 PRO A C    3  
ATOM 5354  O O    . PRO A 1 113 ? -12.597 12.907  1.420   1.00 0.00 ? 113 PRO A O    3  
ATOM 5355  C CB   . PRO A 1 113 ? -12.663 10.572  -1.157  1.00 0.00 ? 113 PRO A CB   3  
ATOM 5356  C CG   . PRO A 1 113 ? -13.705 11.367  -1.865  1.00 0.00 ? 113 PRO A CG   3  
ATOM 5357  C CD   . PRO A 1 113 ? -14.928 11.316  -0.992  1.00 0.00 ? 113 PRO A CD   3  
ATOM 5358  H HA   . PRO A 1 113 ? -12.734 9.890   0.879   1.00 0.00 ? 113 PRO A HA   3  
ATOM 5359  H HB2  . PRO A 1 113 ? -11.668 10.924  -1.394  1.00 0.00 ? 113 PRO A HB2  3  
ATOM 5360  H HB3  . PRO A 1 113 ? -12.743 9.521   -1.388  1.00 0.00 ? 113 PRO A HB3  3  
ATOM 5361  H HG2  . PRO A 1 113 ? -13.372 12.386  -1.985  1.00 0.00 ? 113 PRO A HG2  3  
ATOM 5362  H HG3  . PRO A 1 113 ? -13.913 10.923  -2.828  1.00 0.00 ? 113 PRO A HG3  3  
ATOM 5363  H HD2  . PRO A 1 113 ? -15.475 12.245  -1.055  1.00 0.00 ? 113 PRO A HD2  3  
ATOM 5364  H HD3  . PRO A 1 113 ? -15.559 10.486  -1.274  1.00 0.00 ? 113 PRO A HD3  3  
ATOM 5365  N N    . LEU A 1 114 ? -10.771 11.797  0.715   1.00 0.00 ? 114 LEU A N    3  
ATOM 5366  C CA   . LEU A 1 114 ? -9.836  12.812  1.189   1.00 0.00 ? 114 LEU A CA   3  
ATOM 5367  C C    . LEU A 1 114 ? -9.287  13.631  0.025   1.00 0.00 ? 114 LEU A C    3  
ATOM 5368  O O    . LEU A 1 114 ? -9.408  14.855  0.005   1.00 0.00 ? 114 LEU A O    3  
ATOM 5369  C CB   . LEU A 1 114 ? -8.686  12.156  1.954   1.00 0.00 ? 114 LEU A CB   3  
ATOM 5370  C CG   . LEU A 1 114 ? -9.018  11.643  3.355   1.00 0.00 ? 114 LEU A CG   3  
ATOM 5371  C CD1  . LEU A 1 114 ? -7.972  10.640  3.818   1.00 0.00 ? 114 LEU A CD1  3  
ATOM 5372  C CD2  . LEU A 1 114 ? -9.119  12.802  4.337   1.00 0.00 ? 114 LEU A CD2  3  
ATOM 5373  H H    . LEU A 1 114 ? -10.422 10.997  0.271   1.00 0.00 ? 114 LEU A H    3  
ATOM 5374  H HA   . LEU A 1 114 ? -10.373 13.470  1.856   1.00 0.00 ? 114 LEU A HA   3  
ATOM 5375  H HB2  . LEU A 1 114 ? -8.335  11.319  1.370   1.00 0.00 ? 114 LEU A HB2  3  
ATOM 5376  H HB3  . LEU A 1 114 ? -7.893  12.885  2.046   1.00 0.00 ? 114 LEU A HB3  3  
ATOM 5377  H HG   . LEU A 1 114 ? -9.974  11.140  3.331   1.00 0.00 ? 114 LEU A HG   3  
ATOM 5378  H HD11 . LEU A 1 114 ? -7.950  10.616  4.897   1.00 0.00 ? 114 LEU A HD11 3  
ATOM 5379  H HD12 . LEU A 1 114 ? -7.002  10.932  3.444   1.00 0.00 ? 114 LEU A HD12 3  
ATOM 5380  H HD13 . LEU A 1 114 ? -8.223  9.659   3.441   1.00 0.00 ? 114 LEU A HD13 3  
ATOM 5381  H HD21 . LEU A 1 114 ? -9.079  13.736  3.796   1.00 0.00 ? 114 LEU A HD21 3  
ATOM 5382  H HD22 . LEU A 1 114 ? -8.296  12.755  5.035   1.00 0.00 ? 114 LEU A HD22 3  
ATOM 5383  H HD23 . LEU A 1 114 ? -10.053 12.737  4.875   1.00 0.00 ? 114 LEU A HD23 3  
ATOM 5384  N N    . GLU A 1 115 ? -8.686  12.946  -0.943  1.00 0.00 ? 115 GLU A N    3  
ATOM 5385  C CA   . GLU A 1 115 ? -8.120  13.612  -2.110  1.00 0.00 ? 115 GLU A CA   3  
ATOM 5386  C C    . GLU A 1 115 ? -8.751  13.085  -3.396  1.00 0.00 ? 115 GLU A C    3  
ATOM 5387  O O    . GLU A 1 115 ? -8.092  12.466  -4.232  1.00 0.00 ? 115 GLU A O    3  
ATOM 5388  C CB   . GLU A 1 115 ? -6.603  13.411  -2.154  1.00 0.00 ? 115 GLU A CB   3  
ATOM 5389  C CG   . GLU A 1 115 ? -6.181  11.952  -2.103  1.00 0.00 ? 115 GLU A CG   3  
ATOM 5390  C CD   . GLU A 1 115 ? -6.464  11.310  -0.759  1.00 0.00 ? 115 GLU A CD   3  
ATOM 5391  O OE1  . GLU A 1 115 ? -6.092  11.906  0.273   1.00 0.00 ? 115 GLU A OE1  3  
ATOM 5392  O OE2  . GLU A 1 115 ? -7.056  10.211  -0.739  1.00 0.00 ? 115 GLU A OE2  3  
ATOM 5393  H H    . GLU A 1 115 ? -8.621  11.971  -0.870  1.00 0.00 ? 115 GLU A H    3  
ATOM 5394  H HA   . GLU A 1 115 ? -8.332  14.667  -2.026  1.00 0.00 ? 115 GLU A HA   3  
ATOM 5395  H HB2  . GLU A 1 115 ? -6.221  13.844  -3.066  1.00 0.00 ? 115 GLU A HB2  3  
ATOM 5396  H HB3  . GLU A 1 115 ? -6.161  13.922  -1.311  1.00 0.00 ? 115 GLU A HB3  3  
ATOM 5397  H HG2  . GLU A 1 115 ? -6.718  11.408  -2.865  1.00 0.00 ? 115 GLU A HG2  3  
ATOM 5398  H HG3  . GLU A 1 115 ? -5.120  11.891  -2.299  1.00 0.00 ? 115 GLU A HG3  3  
ATOM 5399  N N    . PRO A 1 116 ? -10.058 13.335  -3.558  1.00 0.00 ? 116 PRO A N    3  
ATOM 5400  C CA   . PRO A 1 116 ? -10.808 12.895  -4.739  1.00 0.00 ? 116 PRO A CA   3  
ATOM 5401  C C    . PRO A 1 116 ? -10.406 13.656  -5.997  1.00 0.00 ? 116 PRO A C    3  
ATOM 5402  O O    . PRO A 1 116 ? -10.117 14.852  -5.963  1.00 0.00 ? 116 PRO A O    3  
ATOM 5403  C CB   . PRO A 1 116 ? -12.262 13.200  -4.370  1.00 0.00 ? 116 PRO A CB   3  
ATOM 5404  C CG   . PRO A 1 116 ? -12.176 14.303  -3.372  1.00 0.00 ? 116 PRO A CG   3  
ATOM 5405  C CD   . PRO A 1 116 ? -10.906 14.066  -2.602  1.00 0.00 ? 116 PRO A CD   3  
ATOM 5406  H HA   . PRO A 1 116 ? -10.693 11.834  -4.909  1.00 0.00 ? 116 PRO A HA   3  
ATOM 5407  H HB2  . PRO A 1 116 ? -12.803 13.507  -5.254  1.00 0.00 ? 116 PRO A HB2  3  
ATOM 5408  H HB3  . PRO A 1 116 ? -12.722 12.320  -3.947  1.00 0.00 ? 116 PRO A HB3  3  
ATOM 5409  H HG2  . PRO A 1 116 ? -12.135 15.255  -3.879  1.00 0.00 ? 116 PRO A HG2  3  
ATOM 5410  H HG3  . PRO A 1 116 ? -13.028 14.265  -2.710  1.00 0.00 ? 116 PRO A HG3  3  
ATOM 5411  H HD2  . PRO A 1 116 ? -10.452 15.006  -2.325  1.00 0.00 ? 116 PRO A HD2  3  
ATOM 5412  H HD3  . PRO A 1 116 ? -11.103 13.467  -1.725  1.00 0.00 ? 116 PRO A HD3  3  
ATOM 5413  N N    . PRO A 1 117 ? -10.387 12.949  -7.137  1.00 0.00 ? 117 PRO A N    3  
ATOM 5414  C CA   . PRO A 1 117 ? -10.023 13.539  -8.429  1.00 0.00 ? 117 PRO A CA   3  
ATOM 5415  C C    . PRO A 1 117 ? -11.077 14.515  -8.938  1.00 0.00 ? 117 PRO A C    3  
ATOM 5416  O O    . PRO A 1 117 ? -12.248 14.163  -9.076  1.00 0.00 ? 117 PRO A O    3  
ATOM 5417  C CB   . PRO A 1 117 ? -9.925  12.326  -9.357  1.00 0.00 ? 117 PRO A CB   3  
ATOM 5418  C CG   . PRO A 1 117 ? -10.811 11.301  -8.737  1.00 0.00 ? 117 PRO A CG   3  
ATOM 5419  C CD   . PRO A 1 117 ? -10.720 11.519  -7.252  1.00 0.00 ? 117 PRO A CD   3  
ATOM 5420  H HA   . PRO A 1 117 ? -9.065  14.036  -8.382  1.00 0.00 ? 117 PRO A HA   3  
ATOM 5421  H HB2  . PRO A 1 117 ? -10.266 12.598  -10.346 1.00 0.00 ? 117 PRO A HB2  3  
ATOM 5422  H HB3  . PRO A 1 117 ? -8.901  11.986  -9.404  1.00 0.00 ? 117 PRO A HB3  3  
ATOM 5423  H HG2  . PRO A 1 117 ? -11.826 11.441  -9.075  1.00 0.00 ? 117 PRO A HG2  3  
ATOM 5424  H HG3  . PRO A 1 117 ? -10.462 10.312  -8.993  1.00 0.00 ? 117 PRO A HG3  3  
ATOM 5425  H HD2  . PRO A 1 117 ? -11.667 11.304  -6.781  1.00 0.00 ? 117 PRO A HD2  3  
ATOM 5426  H HD3  . PRO A 1 117 ? -9.937  10.906  -6.828  1.00 0.00 ? 117 PRO A HD3  3  
ATOM 5427  N N    . SER A 1 118 ? -10.654 15.744  -9.215  1.00 0.00 ? 118 SER A N    3  
ATOM 5428  C CA   . SER A 1 118 ? -11.563 16.773  -9.706  1.00 0.00 ? 118 SER A CA   3  
ATOM 5429  C C    . SER A 1 118 ? -11.412 16.958  -11.213 1.00 0.00 ? 118 SER A C    3  
ATOM 5430  O O    . SER A 1 118 ? -11.441 18.080  -11.718 1.00 0.00 ? 118 SER A O    3  
ATOM 5431  C CB   . SER A 1 118 ? -11.301 18.099  -8.989  1.00 0.00 ? 118 SER A CB   3  
ATOM 5432  O OG   . SER A 1 118 ? -9.928  18.446  -9.045  1.00 0.00 ? 118 SER A OG   3  
ATOM 5433  H H    . SER A 1 118 ? -9.708  15.965  -9.084  1.00 0.00 ? 118 SER A H    3  
ATOM 5434  H HA   . SER A 1 118 ? -12.572 16.453  -9.494  1.00 0.00 ? 118 SER A HA   3  
ATOM 5435  H HB2  . SER A 1 118 ? -11.876 18.881  -9.462  1.00 0.00 ? 118 SER A HB2  3  
ATOM 5436  H HB3  . SER A 1 118 ? -11.597 18.010  -7.954  1.00 0.00 ? 118 SER A HB3  3  
ATOM 5437  H HG   . SER A 1 118 ? -9.835  19.399  -8.972  1.00 0.00 ? 118 SER A HG   3  
ATOM 5438  N N    . ASP A 1 119 ? -11.249 15.848  -11.925 1.00 0.00 ? 119 ASP A N    3  
ATOM 5439  C CA   . ASP A 1 119 ? -11.094 15.886  -13.375 1.00 0.00 ? 119 ASP A CA   3  
ATOM 5440  C C    . ASP A 1 119 ? -11.687 14.636  -14.017 1.00 0.00 ? 119 ASP A C    3  
ATOM 5441  O O    . ASP A 1 119 ? -11.485 13.522  -13.534 1.00 0.00 ? 119 ASP A O    3  
ATOM 5442  C CB   . ASP A 1 119 ? -9.617  16.015  -13.748 1.00 0.00 ? 119 ASP A CB   3  
ATOM 5443  C CG   . ASP A 1 119 ? -9.086  17.419  -13.537 1.00 0.00 ? 119 ASP A CG   3  
ATOM 5444  O OD1  . ASP A 1 119 ? -8.622  17.716  -12.417 1.00 0.00 ? 119 ASP A OD1  3  
ATOM 5445  O OD2  . ASP A 1 119 ? -9.137  18.222  -14.493 1.00 0.00 ? 119 ASP A OD2  3  
ATOM 5446  H H    . ASP A 1 119 ? -11.234 14.983  -11.465 1.00 0.00 ? 119 ASP A H    3  
ATOM 5447  H HA   . ASP A 1 119 ? -11.625 16.751  -13.743 1.00 0.00 ? 119 ASP A HA   3  
ATOM 5448  H HB2  . ASP A 1 119 ? -9.038  15.336  -13.138 1.00 0.00 ? 119 ASP A HB2  3  
ATOM 5449  H HB3  . ASP A 1 119 ? -9.491  15.753  -14.788 1.00 0.00 ? 119 ASP A HB3  3  
ATOM 5450  N N    . ARG A 1 120 ? -12.421 14.829  -15.109 1.00 0.00 ? 120 ARG A N    3  
ATOM 5451  C CA   . ARG A 1 120 ? -13.045 13.717  -15.816 1.00 0.00 ? 120 ARG A CA   3  
ATOM 5452  C C    . ARG A 1 120 ? -12.016 12.955  -16.647 1.00 0.00 ? 120 ARG A C    3  
ATOM 5453  O O    . ARG A 1 120 ? -11.565 13.435  -17.686 1.00 0.00 ? 120 ARG A O    3  
ATOM 5454  C CB   . ARG A 1 120 ? -14.169 14.227  -16.719 1.00 0.00 ? 120 ARG A CB   3  
ATOM 5455  C CG   . ARG A 1 120 ? -15.441 14.582  -15.966 1.00 0.00 ? 120 ARG A CG   3  
ATOM 5456  C CD   . ARG A 1 120 ? -15.282 15.875  -15.182 1.00 0.00 ? 120 ARG A CD   3  
ATOM 5457  N NE   . ARG A 1 120 ? -16.420 16.124  -14.301 1.00 0.00 ? 120 ARG A NE   3  
ATOM 5458  C CZ   . ARG A 1 120 ? -17.539 16.719  -14.697 1.00 0.00 ? 120 ARG A CZ   3  
ATOM 5459  N NH1  . ARG A 1 120 ? -17.671 17.125  -15.952 1.00 0.00 ? 120 ARG A NH1  3  
ATOM 5460  N NH2  . ARG A 1 120 ? -18.531 16.911  -13.836 1.00 0.00 ? 120 ARG A NH2  3  
ATOM 5461  H H    . ARG A 1 120 ? -12.546 15.741  -15.446 1.00 0.00 ? 120 ARG A H    3  
ATOM 5462  H HA   . ARG A 1 120 ? -13.462 13.048  -15.079 1.00 0.00 ? 120 ARG A HA   3  
ATOM 5463  H HB2  . ARG A 1 120 ? -13.827 15.110  -17.238 1.00 0.00 ? 120 ARG A HB2  3  
ATOM 5464  H HB3  . ARG A 1 120 ? -14.407 13.462  -17.444 1.00 0.00 ? 120 ARG A HB3  3  
ATOM 5465  H HG2  . ARG A 1 120 ? -16.247 14.701  -16.676 1.00 0.00 ? 120 ARG A HG2  3  
ATOM 5466  H HG3  . ARG A 1 120 ? -15.678 13.781  -15.281 1.00 0.00 ? 120 ARG A HG3  3  
ATOM 5467  H HD2  . ARG A 1 120 ? -14.385 15.810  -14.585 1.00 0.00 ? 120 ARG A HD2  3  
ATOM 5468  H HD3  . ARG A 1 120 ? -15.193 16.694  -15.879 1.00 0.00 ? 120 ARG A HD3  3  
ATOM 5469  H HE   . ARG A 1 120 ? -16.345 15.832  -13.369 1.00 0.00 ? 120 ARG A HE   3  
ATOM 5470  H HH11 . ARG A 1 120 ? -16.926 16.981  -16.603 1.00 0.00 ? 120 ARG A HH11 3  
ATOM 5471  H HH12 . ARG A 1 120 ? -18.515 17.572  -16.248 1.00 0.00 ? 120 ARG A HH12 3  
ATOM 5472  H HH21 . ARG A 1 120 ? -18.436 16.606  -12.888 1.00 0.00 ? 120 ARG A HH21 3  
ATOM 5473  H HH22 . ARG A 1 120 ? -19.373 17.359  -14.134 1.00 0.00 ? 120 ARG A HH22 3  
ATOM 5474  N N    . GLY A 1 121 ? -11.650 11.766  -16.180 1.00 0.00 ? 121 GLY A N    3  
ATOM 5475  C CA   . GLY A 1 121 ? -10.677 10.957  -16.892 1.00 0.00 ? 121 GLY A CA   3  
ATOM 5476  C C    . GLY A 1 121 ? -11.291 10.198  -18.051 1.00 0.00 ? 121 GLY A C    3  
ATOM 5477  O O    . GLY A 1 121 ? -12.514 10.098  -18.160 1.00 0.00 ? 121 GLY A O    3  
ATOM 5478  H H    . GLY A 1 121 ? -12.043 11.434  -15.346 1.00 0.00 ? 121 GLY A H    3  
ATOM 5479  H HA2  . GLY A 1 121 ? -9.897  11.601  -17.269 1.00 0.00 ? 121 GLY A HA2  3  
ATOM 5480  H HA3  . GLY A 1 121 ? -10.242 10.248  -16.202 1.00 0.00 ? 121 GLY A HA3  3  
ATOM 5481  N N    . THR A 1 122 ? -10.442 9.662   -18.922 1.00 0.00 ? 122 THR A N    3  
ATOM 5482  C CA   . THR A 1 122 ? -10.907 8.911   -20.081 1.00 0.00 ? 122 THR A CA   3  
ATOM 5483  C C    . THR A 1 122 ? -11.676 7.665   -19.655 1.00 0.00 ? 122 THR A C    3  
ATOM 5484  O O    . THR A 1 122 ? -11.239 6.923   -18.776 1.00 0.00 ? 122 THR A O    3  
ATOM 5485  C CB   . THR A 1 122 ? -9.734  8.491   -20.987 1.00 0.00 ? 122 THR A CB   3  
ATOM 5486  O OG1  . THR A 1 122 ? -8.813  7.679   -20.251 1.00 0.00 ? 122 THR A OG1  3  
ATOM 5487  C CG2  . THR A 1 122 ? -9.013  9.712   -21.538 1.00 0.00 ? 122 THR A CG2  3  
ATOM 5488  H H    . THR A 1 122 ? -9.479  9.776   -18.781 1.00 0.00 ? 122 THR A H    3  
ATOM 5489  H HA   . THR A 1 122 ? -11.565 9.551   -20.651 1.00 0.00 ? 122 THR A HA   3  
ATOM 5490  H HB   . THR A 1 122 ? -10.126 7.918   -21.815 1.00 0.00 ? 122 THR A HB   3  
ATOM 5491  H HG1  . THR A 1 122 ? -8.815  6.788   -20.610 1.00 0.00 ? 122 THR A HG1  3  
ATOM 5492  H HG21 . THR A 1 122 ? -9.565  10.604  -21.279 1.00 0.00 ? 122 THR A HG21 3  
ATOM 5493  H HG22 . THR A 1 122 ? -8.941  9.633   -22.613 1.00 0.00 ? 122 THR A HG22 3  
ATOM 5494  H HG23 . THR A 1 122 ? -8.022  9.766   -21.114 1.00 0.00 ? 122 THR A HG23 3  
ATOM 5495  N N    . VAL A 1 123 ? -12.825 7.441   -20.285 1.00 0.00 ? 123 VAL A N    3  
ATOM 5496  C CA   . VAL A 1 123 ? -13.655 6.284   -19.973 1.00 0.00 ? 123 VAL A CA   3  
ATOM 5497  C C    . VAL A 1 123 ? -13.283 5.089   -20.844 1.00 0.00 ? 123 VAL A C    3  
ATOM 5498  O O    . VAL A 1 123 ? -13.187 5.205   -22.066 1.00 0.00 ? 123 VAL A O    3  
ATOM 5499  C CB   . VAL A 1 123 ? -15.151 6.597   -20.164 1.00 0.00 ? 123 VAL A CB   3  
ATOM 5500  C CG1  . VAL A 1 123 ? -15.464 6.832   -21.634 1.00 0.00 ? 123 VAL A CG1  3  
ATOM 5501  C CG2  . VAL A 1 123 ? -16.007 5.473   -19.601 1.00 0.00 ? 123 VAL A CG2  3  
ATOM 5502  H H    . VAL A 1 123 ? -13.122 8.069   -20.977 1.00 0.00 ? 123 VAL A H    3  
ATOM 5503  H HA   . VAL A 1 123 ? -13.492 6.026   -18.937 1.00 0.00 ? 123 VAL A HA   3  
ATOM 5504  H HB   . VAL A 1 123 ? -15.380 7.503   -19.621 1.00 0.00 ? 123 VAL A HB   3  
ATOM 5505  H HG11 . VAL A 1 123 ? -16.323 7.482   -21.719 1.00 0.00 ? 123 VAL A HG11 3  
ATOM 5506  H HG12 . VAL A 1 123 ? -14.614 7.292   -22.114 1.00 0.00 ? 123 VAL A HG12 3  
ATOM 5507  H HG13 . VAL A 1 123 ? -15.680 5.887   -22.111 1.00 0.00 ? 123 VAL A HG13 3  
ATOM 5508  H HG21 . VAL A 1 123 ? -16.239 5.681   -18.567 1.00 0.00 ? 123 VAL A HG21 3  
ATOM 5509  H HG22 . VAL A 1 123 ? -16.924 5.400   -20.167 1.00 0.00 ? 123 VAL A HG22 3  
ATOM 5510  H HG23 . VAL A 1 123 ? -15.467 4.540   -19.669 1.00 0.00 ? 123 VAL A HG23 3  
ATOM 5511  N N    . SER A 1 124 ? -13.074 3.941   -20.207 1.00 0.00 ? 124 SER A N    3  
ATOM 5512  C CA   . SER A 1 124 ? -12.708 2.725   -20.924 1.00 0.00 ? 124 SER A CA   3  
ATOM 5513  C C    . SER A 1 124 ? -13.451 2.634   -22.254 1.00 0.00 ? 124 SER A C    3  
ATOM 5514  O O    . SER A 1 124 ? -14.651 2.894   -22.327 1.00 0.00 ? 124 SER A O    3  
ATOM 5515  C CB   . SER A 1 124 ? -13.015 1.493   -20.070 1.00 0.00 ? 124 SER A CB   3  
ATOM 5516  O OG   . SER A 1 124 ? -12.003 1.278   -19.102 1.00 0.00 ? 124 SER A OG   3  
ATOM 5517  H H    . SER A 1 124 ? -13.166 3.913   -19.232 1.00 0.00 ? 124 SER A H    3  
ATOM 5518  H HA   . SER A 1 124 ? -11.647 2.762   -21.119 1.00 0.00 ? 124 SER A HA   3  
ATOM 5519  H HB2  . SER A 1 124 ? -13.957 1.636   -19.562 1.00 0.00 ? 124 SER A HB2  3  
ATOM 5520  H HB3  . SER A 1 124 ? -13.078 0.623   -20.708 1.00 0.00 ? 124 SER A HB3  3  
ATOM 5521  H HG   . SER A 1 124 ? -11.145 1.268   -19.533 1.00 0.00 ? 124 SER A HG   3  
ATOM 5522  N N    . GLY A 1 125 ? -12.726 2.263   -23.305 1.00 0.00 ? 125 GLY A N    3  
ATOM 5523  C CA   . GLY A 1 125 ? -13.331 2.144   -24.618 1.00 0.00 ? 125 GLY A CA   3  
ATOM 5524  C C    . GLY A 1 125 ? -13.860 0.749   -24.889 1.00 0.00 ? 125 GLY A C    3  
ATOM 5525  O O    . GLY A 1 125 ? -13.853 -0.121  -24.017 1.00 0.00 ? 125 GLY A O    3  
ATOM 5526  H H    . GLY A 1 125 ? -11.773 2.068   -23.187 1.00 0.00 ? 125 GLY A H    3  
ATOM 5527  H HA2  . GLY A 1 125 ? -14.146 2.848   -24.692 1.00 0.00 ? 125 GLY A HA2  3  
ATOM 5528  H HA3  . GLY A 1 125 ? -12.591 2.386   -25.366 1.00 0.00 ? 125 GLY A HA3  3  
ATOM 5529  N N    . PRO A 1 126 ? -14.335 0.521   -26.122 1.00 0.00 ? 126 PRO A N    3  
ATOM 5530  C CA   . PRO A 1 126 ? -14.881 -0.776  -26.533 1.00 0.00 ? 126 PRO A CA   3  
ATOM 5531  C C    . PRO A 1 126 ? -13.804 -1.850  -26.643 1.00 0.00 ? 126 PRO A C    3  
ATOM 5532  O O    . PRO A 1 126 ? -12.829 -1.692  -27.378 1.00 0.00 ? 126 PRO A O    3  
ATOM 5533  C CB   . PRO A 1 126 ? -15.488 -0.486  -27.908 1.00 0.00 ? 126 PRO A CB   3  
ATOM 5534  C CG   . PRO A 1 126 ? -14.726 0.688   -28.419 1.00 0.00 ? 126 PRO A CG   3  
ATOM 5535  C CD   . PRO A 1 126 ? -14.375 1.512   -27.211 1.00 0.00 ? 126 PRO A CD   3  
ATOM 5536  H HA   . PRO A 1 126 ? -15.655 -1.112  -25.859 1.00 0.00 ? 126 PRO A HA   3  
ATOM 5537  H HB2  . PRO A 1 126 ? -15.365 -1.348  -28.548 1.00 0.00 ? 126 PRO A HB2  3  
ATOM 5538  H HB3  . PRO A 1 126 ? -16.538 -0.257  -27.801 1.00 0.00 ? 126 PRO A HB3  3  
ATOM 5539  H HG2  . PRO A 1 126 ? -13.829 0.353   -28.919 1.00 0.00 ? 126 PRO A HG2  3  
ATOM 5540  H HG3  . PRO A 1 126 ? -15.343 1.260   -29.096 1.00 0.00 ? 126 PRO A HG3  3  
ATOM 5541  H HD2  . PRO A 1 126 ? -13.411 1.981   -27.341 1.00 0.00 ? 126 PRO A HD2  3  
ATOM 5542  H HD3  . PRO A 1 126 ? -15.137 2.255   -27.027 1.00 0.00 ? 126 PRO A HD3  3  
ATOM 5543  N N    . SER A 1 127 ? -13.986 -2.942  -25.908 1.00 0.00 ? 127 SER A N    3  
ATOM 5544  C CA   . SER A 1 127 ? -13.027 -4.040  -25.920 1.00 0.00 ? 127 SER A CA   3  
ATOM 5545  C C    . SER A 1 127 ? -13.677 -5.322  -26.433 1.00 0.00 ? 127 SER A C    3  
ATOM 5546  O O    . SER A 1 127 ? -14.333 -6.042  -25.681 1.00 0.00 ? 127 SER A O    3  
ATOM 5547  C CB   . SER A 1 127 ? -12.462 -4.268  -24.517 1.00 0.00 ? 127 SER A CB   3  
ATOM 5548  O OG   . SER A 1 127 ? -11.608 -5.399  -24.488 1.00 0.00 ? 127 SER A OG   3  
ATOM 5549  H H    . SER A 1 127 ? -14.783 -3.008  -25.341 1.00 0.00 ? 127 SER A H    3  
ATOM 5550  H HA   . SER A 1 127 ? -12.220 -3.769  -26.584 1.00 0.00 ? 127 SER A HA   3  
ATOM 5551  H HB2  . SER A 1 127 ? -11.898 -3.399  -24.213 1.00 0.00 ? 127 SER A HB2  3  
ATOM 5552  H HB3  . SER A 1 127 ? -13.276 -4.428  -23.825 1.00 0.00 ? 127 SER A HB3  3  
ATOM 5553  H HG   . SER A 1 127 ? -10.722 -5.125  -24.241 1.00 0.00 ? 127 SER A HG   3  
ATOM 5554  N N    . SER A 1 128 ? -13.488 -5.600  -27.719 1.00 0.00 ? 128 SER A N    3  
ATOM 5555  C CA   . SER A 1 128 ? -14.058 -6.792  -28.335 1.00 0.00 ? 128 SER A CA   3  
ATOM 5556  C C    . SER A 1 128 ? -13.168 -8.007  -28.093 1.00 0.00 ? 128 SER A C    3  
ATOM 5557  O O    . SER A 1 128 ? -11.950 -7.884  -27.972 1.00 0.00 ? 128 SER A O    3  
ATOM 5558  C CB   . SER A 1 128 ? -14.246 -6.576  -29.838 1.00 0.00 ? 128 SER A CB   3  
ATOM 5559  O OG   . SER A 1 128 ? -15.186 -5.545  -30.090 1.00 0.00 ? 128 SER A OG   3  
ATOM 5560  H H    . SER A 1 128 ? -12.954 -4.987  -28.267 1.00 0.00 ? 128 SER A H    3  
ATOM 5561  H HA   . SER A 1 128 ? -15.022 -6.971  -27.882 1.00 0.00 ? 128 SER A HA   3  
ATOM 5562  H HB2  . SER A 1 128 ? -13.301 -6.301  -30.280 1.00 0.00 ? 128 SER A HB2  3  
ATOM 5563  H HB3  . SER A 1 128 ? -14.603 -7.490  -30.288 1.00 0.00 ? 128 SER A HB3  3  
ATOM 5564  H HG   . SER A 1 128 ? -15.125 -4.880  -29.401 1.00 0.00 ? 128 SER A HG   3  
ATOM 5565  N N    . GLY A 1 129 ? -13.786 -9.182  -28.023 1.00 0.00 ? 129 GLY A N    3  
ATOM 5566  C CA   . GLY A 1 129 ? -13.036 -10.404 -27.796 1.00 0.00 ? 129 GLY A CA   3  
ATOM 5567  C C    . GLY A 1 129 ? -11.991 -10.248 -26.708 1.00 0.00 ? 129 GLY A C    3  
ATOM 5568  O O    . GLY A 1 129 ? -10.794 -10.211 -26.990 1.00 0.00 ? 129 GLY A O    3  
ATOM 5569  H H    . GLY A 1 129 ? -14.760 -9.220  -28.127 1.00 0.00 ? 129 GLY A H    3  
ATOM 5570  H HA2  . GLY A 1 129 ? -13.722 -11.187 -27.512 1.00 0.00 ? 129 GLY A HA2  3  
ATOM 5571  H HA3  . GLY A 1 129 ? -12.543 -10.686 -28.714 1.00 0.00 ? 129 GLY A HA3  3  
ATOM 5572  N N    . GLY A 1 1   ? -15.512 0.196   -39.788 1.00 0.00 ? 1   GLY A N    4  
ATOM 5573  C CA   . GLY A 1 1   ? -16.525 0.935   -39.057 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5574  C C    . GLY A 1 1   ? -15.973 1.603   -37.814 1.00 0.00 ? 1   GLY A C    4  
ATOM 5575  O O    . GLY A 1 1   ? -14.771 1.545   -37.552 1.00 0.00 ? 1   GLY A O    4  
ATOM 5576  H H1   . GLY A 1 1   ? -14.667 0.632   -40.026 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5577  H HA2  . GLY A 1 1   ? -16.941 1.692   -39.706 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5578  H HA3  . GLY A 1 1   ? -17.311 0.253   -38.766 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5579  N N    . SER A 1 2   ? -16.851 2.240   -37.046 1.00 0.00 ? 2   SER A N    4  
ATOM 5580  C CA   . SER A 1 2   ? -16.443 2.926   -35.826 1.00 0.00 ? 2   SER A CA   4  
ATOM 5581  C C    . SER A 1 2   ? -17.169 2.355   -34.612 1.00 0.00 ? 2   SER A C    4  
ATOM 5582  O O    . SER A 1 2   ? -18.189 2.889   -34.176 1.00 0.00 ? 2   SER A O    4  
ATOM 5583  C CB   . SER A 1 2   ? -16.723 4.426   -35.942 1.00 0.00 ? 2   SER A CB   4  
ATOM 5584  O OG   . SER A 1 2   ? -16.132 5.139   -34.870 1.00 0.00 ? 2   SER A OG   4  
ATOM 5585  H H    . SER A 1 2   ? -17.795 2.250   -37.308 1.00 0.00 ? 2   SER A H    4  
ATOM 5586  H HA   . SER A 1 2   ? -15.381 2.775   -35.700 1.00 0.00 ? 2   SER A HA   4  
ATOM 5587  H HB2  . SER A 1 2   ? -16.315 4.795   -36.871 1.00 0.00 ? 2   SER A HB2  4  
ATOM 5588  H HB3  . SER A 1 2   ? -17.790 4.593   -35.926 1.00 0.00 ? 2   SER A HB3  4  
ATOM 5589  H HG   . SER A 1 2   ? -16.398 4.743   -34.037 1.00 0.00 ? 2   SER A HG   4  
ATOM 5590  N N    . SER A 1 3   ? -16.636 1.264   -34.071 1.00 0.00 ? 3   SER A N    4  
ATOM 5591  C CA   . SER A 1 3   ? -17.235 0.616   -32.910 1.00 0.00 ? 3   SER A CA   4  
ATOM 5592  C C    . SER A 1 3   ? -17.470 1.623   -31.787 1.00 0.00 ? 3   SER A C    4  
ATOM 5593  O O    . SER A 1 3   ? -16.608 2.447   -31.487 1.00 0.00 ? 3   SER A O    4  
ATOM 5594  C CB   . SER A 1 3   ? -16.336 -0.518  -32.413 1.00 0.00 ? 3   SER A CB   4  
ATOM 5595  O OG   . SER A 1 3   ? -15.020 -0.056  -32.166 1.00 0.00 ? 3   SER A OG   4  
ATOM 5596  H H    . SER A 1 3   ? -15.822 0.885   -34.464 1.00 0.00 ? 3   SER A H    4  
ATOM 5597  H HA   . SER A 1 3   ? -18.185 0.204   -33.213 1.00 0.00 ? 3   SER A HA   4  
ATOM 5598  H HB2  . SER A 1 3   ? -16.741 -0.920  -31.497 1.00 0.00 ? 3   SER A HB2  4  
ATOM 5599  H HB3  . SER A 1 3   ? -16.297 -1.297  -33.161 1.00 0.00 ? 3   SER A HB3  4  
ATOM 5600  H HG   . SER A 1 3   ? -14.626 0.245   -32.989 1.00 0.00 ? 3   SER A HG   4  
ATOM 5601  N N    . GLY A 1 4   ? -18.645 1.548   -31.170 1.00 0.00 ? 4   GLY A N    4  
ATOM 5602  C CA   . GLY A 1 4   ? -18.974 2.457   -30.088 1.00 0.00 ? 4   GLY A CA   4  
ATOM 5603  C C    . GLY A 1 4   ? -18.483 1.959   -28.743 1.00 0.00 ? 4   GLY A C    4  
ATOM 5604  O O    . GLY A 1 4   ? -17.366 2.269   -28.329 1.00 0.00 ? 4   GLY A O    4  
ATOM 5605  H H    . GLY A 1 4   ? -19.294 0.869   -31.452 1.00 0.00 ? 4   GLY A H    4  
ATOM 5606  H HA2  . GLY A 1 4   ? -18.525 3.418   -30.291 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5607  H HA3  . GLY A 1 4   ? -20.047 2.574   -30.046 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5608  N N    . SER A 1 5   ? -19.321 1.186   -28.058 1.00 0.00 ? 5   SER A N    4  
ATOM 5609  C CA   . SER A 1 5   ? -18.968 0.649   -26.749 1.00 0.00 ? 5   SER A CA   4  
ATOM 5610  C C    . SER A 1 5   ? -19.104 -0.871  -26.731 1.00 0.00 ? 5   SER A C    4  
ATOM 5611  O O    . SER A 1 5   ? -20.178 -1.412  -26.992 1.00 0.00 ? 5   SER A O    4  
ATOM 5612  C CB   . SER A 1 5   ? -19.855 1.265   -25.666 1.00 0.00 ? 5   SER A CB   4  
ATOM 5613  O OG   . SER A 1 5   ? -19.244 1.170   -24.391 1.00 0.00 ? 5   SER A OG   4  
ATOM 5614  H H    . SER A 1 5   ? -20.198 0.975   -28.442 1.00 0.00 ? 5   SER A H    4  
ATOM 5615  H HA   . SER A 1 5   ? -17.939 0.909   -26.551 1.00 0.00 ? 5   SER A HA   4  
ATOM 5616  H HB2  . SER A 1 5   ? -20.026 2.306   -25.893 1.00 0.00 ? 5   SER A HB2  4  
ATOM 5617  H HB3  . SER A 1 5   ? -20.801 0.742   -25.639 1.00 0.00 ? 5   SER A HB3  4  
ATOM 5618  H HG   . SER A 1 5   ? -19.646 1.806   -23.795 1.00 0.00 ? 5   SER A HG   4  
ATOM 5619  N N    . SER A 1 6   ? -18.006 -1.553  -26.422 1.00 0.00 ? 6   SER A N    4  
ATOM 5620  C CA   . SER A 1 6   ? -18.000 -3.010  -26.373 1.00 0.00 ? 6   SER A CA   4  
ATOM 5621  C C    . SER A 1 6   ? -19.022 -3.524  -25.363 1.00 0.00 ? 6   SER A C    4  
ATOM 5622  O O    . SER A 1 6   ? -19.798 -4.433  -25.656 1.00 0.00 ? 6   SER A O    4  
ATOM 5623  C CB   . SER A 1 6   ? -16.605 -3.524  -26.011 1.00 0.00 ? 6   SER A CB   4  
ATOM 5624  O OG   . SER A 1 6   ? -15.631 -3.038  -26.918 1.00 0.00 ? 6   SER A OG   4  
ATOM 5625  H H    . SER A 1 6   ? -17.180 -1.064  -26.224 1.00 0.00 ? 6   SER A H    4  
ATOM 5626  H HA   . SER A 1 6   ? -18.266 -3.376  -27.354 1.00 0.00 ? 6   SER A HA   4  
ATOM 5627  H HB2  . SER A 1 6   ? -16.350 -3.193  -25.016 1.00 0.00 ? 6   SER A HB2  4  
ATOM 5628  H HB3  . SER A 1 6   ? -16.603 -4.604  -26.043 1.00 0.00 ? 6   SER A HB3  4  
ATOM 5629  H HG   . SER A 1 6   ? -15.898 -3.246  -27.816 1.00 0.00 ? 6   SER A HG   4  
ATOM 5630  N N    . GLY A 1 7   ? -19.015 -2.934  -24.172 1.00 0.00 ? 7   GLY A N    4  
ATOM 5631  C CA   . GLY A 1 7   ? -19.945 -3.345  -23.136 1.00 0.00 ? 7   GLY A CA   4  
ATOM 5632  C C    . GLY A 1 7   ? -19.256 -3.615  -21.813 1.00 0.00 ? 7   GLY A C    4  
ATOM 5633  O O    . GLY A 1 7   ? -19.431 -4.678  -21.219 1.00 0.00 ? 7   GLY A O    4  
ATOM 5634  H H    . GLY A 1 7   ? -18.374 -2.215  -23.995 1.00 0.00 ? 7   GLY A H    4  
ATOM 5635  H HA2  . GLY A 1 7   ? -20.678 -2.565  -22.995 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5636  H HA3  . GLY A 1 7   ? -20.448 -4.245  -23.456 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5637  N N    . GLY A 1 8   ? -18.468 -2.649  -21.349 1.00 0.00 ? 8   GLY A N    4  
ATOM 5638  C CA   . GLY A 1 8   ? -17.761 -2.808  -20.092 1.00 0.00 ? 8   GLY A CA   4  
ATOM 5639  C C    . GLY A 1 8   ? -16.645 -3.831  -20.180 1.00 0.00 ? 8   GLY A C    4  
ATOM 5640  O O    . GLY A 1 8   ? -16.881 -4.989  -20.522 1.00 0.00 ? 8   GLY A O    4  
ATOM 5641  H H    . GLY A 1 8   ? -18.366 -1.822  -21.865 1.00 0.00 ? 8   GLY A H    4  
ATOM 5642  H HA2  . GLY A 1 8   ? -17.341 -1.856  -19.805 1.00 0.00 ? 8   GLY A HA2  4  
ATOM 5643  H HA3  . GLY A 1 8   ? -18.463 -3.124  -19.334 1.00 0.00 ? 8   GLY A HA3  4  
ATOM 5644  N N    . SER A 1 9   ? -15.426 -3.401  -19.872 1.00 0.00 ? 9   SER A N    4  
ATOM 5645  C CA   . SER A 1 9   ? -14.268 -4.286  -19.923 1.00 0.00 ? 9   SER A CA   4  
ATOM 5646  C C    . SER A 1 9   ? -13.519 -4.279  -18.593 1.00 0.00 ? 9   SER A C    4  
ATOM 5647  O O    . SER A 1 9   ? -13.334 -3.229  -17.978 1.00 0.00 ? 9   SER A O    4  
ATOM 5648  C CB   . SER A 1 9   ? -13.327 -3.865  -21.053 1.00 0.00 ? 9   SER A CB   4  
ATOM 5649  O OG   . SER A 1 9   ? -12.345 -4.858  -21.296 1.00 0.00 ? 9   SER A OG   4  
ATOM 5650  H H    . SER A 1 9   ? -15.301 -2.466  -19.606 1.00 0.00 ? 9   SER A H    4  
ATOM 5651  H HA   . SER A 1 9   ? -14.624 -5.287  -20.116 1.00 0.00 ? 9   SER A HA   4  
ATOM 5652  H HB2  . SER A 1 9   ? -13.898 -3.713  -21.956 1.00 0.00 ? 9   SER A HB2  4  
ATOM 5653  H HB3  . SER A 1 9   ? -12.831 -2.945  -20.781 1.00 0.00 ? 9   SER A HB3  4  
ATOM 5654  H HG   . SER A 1 9   ? -12.615 -5.400  -22.041 1.00 0.00 ? 9   SER A HG   4  
ATOM 5655  N N    . ASP A 1 10  ? -13.092 -5.458  -18.156 1.00 0.00 ? 10  ASP A N    4  
ATOM 5656  C CA   . ASP A 1 10  ? -12.362 -5.590  -16.900 1.00 0.00 ? 10  ASP A CA   4  
ATOM 5657  C C    . ASP A 1 10  ? -10.924 -6.032  -17.151 1.00 0.00 ? 10  ASP A C    4  
ATOM 5658  O O    . ASP A 1 10  ? -10.447 -6.995  -16.550 1.00 0.00 ? 10  ASP A O    4  
ATOM 5659  C CB   . ASP A 1 10  ? -13.064 -6.590  -15.980 1.00 0.00 ? 10  ASP A CB   4  
ATOM 5660  C CG   . ASP A 1 10  ? -12.848 -6.277  -14.512 1.00 0.00 ? 10  ASP A CG   4  
ATOM 5661  O OD1  . ASP A 1 10  ? -13.297 -5.201  -14.063 1.00 0.00 ? 10  ASP A OD1  4  
ATOM 5662  O OD2  . ASP A 1 10  ? -12.230 -7.106  -13.813 1.00 0.00 ? 10  ASP A OD2  4  
ATOM 5663  H H    . ASP A 1 10  ? -13.271 -6.260  -18.691 1.00 0.00 ? 10  ASP A H    4  
ATOM 5664  H HA   . ASP A 1 10  ? -12.349 -4.622  -16.421 1.00 0.00 ? 10  ASP A HA   4  
ATOM 5665  H HB2  . ASP A 1 10  ? -14.126 -6.570  -16.180 1.00 0.00 ? 10  ASP A HB2  4  
ATOM 5666  H HB3  . ASP A 1 10  ? -12.683 -7.580  -16.179 1.00 0.00 ? 10  ASP A HB3  4  
ATOM 5667  N N    . SER A 1 11  ? -10.239 -5.324  -18.042 1.00 0.00 ? 11  SER A N    4  
ATOM 5668  C CA   . SER A 1 11  ? -8.857  -5.647  -18.376 1.00 0.00 ? 11  SER A CA   4  
ATOM 5669  C C    . SER A 1 11  ? -7.890  -4.728  -17.635 1.00 0.00 ? 11  SER A C    4  
ATOM 5670  O O    . SER A 1 11  ? -7.067  -5.185  -16.842 1.00 0.00 ? 11  SER A O    4  
ATOM 5671  C CB   . SER A 1 11  ? -8.634  -5.530  -19.885 1.00 0.00 ? 11  SER A CB   4  
ATOM 5672  O OG   . SER A 1 11  ? -7.352  -6.012  -20.250 1.00 0.00 ? 11  SER A OG   4  
ATOM 5673  H H    . SER A 1 11  ? -10.675 -4.567  -18.488 1.00 0.00 ? 11  SER A H    4  
ATOM 5674  H HA   . SER A 1 11  ? -8.672  -6.666  -18.071 1.00 0.00 ? 11  SER A HA   4  
ATOM 5675  H HB2  . SER A 1 11  ? -9.384  -6.108  -20.403 1.00 0.00 ? 11  SER A HB2  4  
ATOM 5676  H HB3  . SER A 1 11  ? -8.712  -4.493  -20.179 1.00 0.00 ? 11  SER A HB3  4  
ATOM 5677  H HG   . SER A 1 11  ? -7.036  -6.621  -19.579 1.00 0.00 ? 11  SER A HG   4  
ATOM 5678  N N    . SER A 1 12  ? -7.996  -3.430  -17.901 1.00 0.00 ? 12  SER A N    4  
ATOM 5679  C CA   . SER A 1 12  ? -7.129  -2.446  -17.263 1.00 0.00 ? 12  SER A CA   4  
ATOM 5680  C C    . SER A 1 12  ? -7.865  -1.720  -16.141 1.00 0.00 ? 12  SER A C    4  
ATOM 5681  O O    . SER A 1 12  ? -8.143  -0.523  -16.238 1.00 0.00 ? 12  SER A O    4  
ATOM 5682  C CB   . SER A 1 12  ? -6.624  -1.436  -18.294 1.00 0.00 ? 12  SER A CB   4  
ATOM 5683  O OG   . SER A 1 12  ? -6.073  -2.092  -19.423 1.00 0.00 ? 12  SER A OG   4  
ATOM 5684  H H    . SER A 1 12  ? -8.672  -3.127  -18.543 1.00 0.00 ? 12  SER A H    4  
ATOM 5685  H HA   . SER A 1 12  ? -6.285  -2.971  -16.842 1.00 0.00 ? 12  SER A HA   4  
ATOM 5686  H HB2  . SER A 1 12  ? -7.445  -0.815  -18.619 1.00 0.00 ? 12  SER A HB2  4  
ATOM 5687  H HB3  . SER A 1 12  ? -5.861  -0.817  -17.844 1.00 0.00 ? 12  SER A HB3  4  
ATOM 5688  H HG   . SER A 1 12  ? -5.540  -2.836  -19.133 1.00 0.00 ? 12  SER A HG   4  
ATOM 5689  N N    . LEU A 1 13  ? -8.179  -2.451  -15.077 1.00 0.00 ? 13  LEU A N    4  
ATOM 5690  C CA   . LEU A 1 13  ? -8.883  -1.878  -13.936 1.00 0.00 ? 13  LEU A CA   4  
ATOM 5691  C C    . LEU A 1 13  ? -8.015  -0.846  -13.222 1.00 0.00 ? 13  LEU A C    4  
ATOM 5692  O O    . LEU A 1 13  ? -8.522  0.128   -12.665 1.00 0.00 ? 13  LEU A O    4  
ATOM 5693  C CB   . LEU A 1 13  ? -9.292  -2.981  -12.958 1.00 0.00 ? 13  LEU A CB   4  
ATOM 5694  C CG   . LEU A 1 13  ? -10.409 -3.913  -13.427 1.00 0.00 ? 13  LEU A CG   4  
ATOM 5695  C CD1  . LEU A 1 13  ? -11.689 -3.130  -13.675 1.00 0.00 ? 13  LEU A CD1  4  
ATOM 5696  C CD2  . LEU A 1 13  ? -9.988  -4.661  -14.683 1.00 0.00 ? 13  LEU A CD2  4  
ATOM 5697  H H    . LEU A 1 13  ? -7.931  -3.398  -15.058 1.00 0.00 ? 13  LEU A H    4  
ATOM 5698  H HA   . LEU A 1 13  ? -9.772  -1.389  -14.306 1.00 0.00 ? 13  LEU A HA   4  
ATOM 5699  H HB2  . LEU A 1 13  ? -8.420  -3.585  -12.757 1.00 0.00 ? 13  LEU A HB2  4  
ATOM 5700  H HB3  . LEU A 1 13  ? -9.618  -2.506  -12.043 1.00 0.00 ? 13  LEU A HB3  4  
ATOM 5701  H HG   . LEU A 1 13  ? -10.610 -4.642  -12.653 1.00 0.00 ? 13  LEU A HG   4  
ATOM 5702  H HD11 . LEU A 1 13  ? -11.502 -2.078  -13.523 1.00 0.00 ? 13  LEU A HD11 4  
ATOM 5703  H HD12 . LEU A 1 13  ? -12.454 -3.463  -12.988 1.00 0.00 ? 13  LEU A HD12 4  
ATOM 5704  H HD13 . LEU A 1 13  ? -12.021 -3.295  -14.690 1.00 0.00 ? 13  LEU A HD13 4  
ATOM 5705  H HD21 . LEU A 1 13  ? -10.658 -5.492  -14.849 1.00 0.00 ? 13  LEU A HD21 4  
ATOM 5706  H HD22 . LEU A 1 13  ? -8.980  -5.032  -14.560 1.00 0.00 ? 13  LEU A HD22 4  
ATOM 5707  H HD23 . LEU A 1 13  ? -10.025 -3.993  -15.530 1.00 0.00 ? 13  LEU A HD23 4  
ATOM 5708  N N    . PHE A 1 14  ? -6.705  -1.066  -13.245 1.00 0.00 ? 14  PHE A N    4  
ATOM 5709  C CA   . PHE A 1 14  ? -5.766  -0.155  -12.601 1.00 0.00 ? 14  PHE A CA   4  
ATOM 5710  C C    . PHE A 1 14  ? -4.889  0.543   -13.637 1.00 0.00 ? 14  PHE A C    4  
ATOM 5711  O O    . PHE A 1 14  ? -4.752  0.074   -14.766 1.00 0.00 ? 14  PHE A O    4  
ATOM 5712  C CB   . PHE A 1 14  ? -4.889  -0.913  -11.602 1.00 0.00 ? 14  PHE A CB   4  
ATOM 5713  C CG   . PHE A 1 14  ? -5.660  -1.858  -10.726 1.00 0.00 ? 14  PHE A CG   4  
ATOM 5714  C CD1  . PHE A 1 14  ? -6.044  -3.104  -11.197 1.00 0.00 ? 14  PHE A CD1  4  
ATOM 5715  C CD2  . PHE A 1 14  ? -6.000  -1.502  -9.431  1.00 0.00 ? 14  PHE A CD2  4  
ATOM 5716  C CE1  . PHE A 1 14  ? -6.754  -3.975  -10.392 1.00 0.00 ? 14  PHE A CE1  4  
ATOM 5717  C CE2  . PHE A 1 14  ? -6.710  -2.369  -8.622  1.00 0.00 ? 14  PHE A CE2  4  
ATOM 5718  C CZ   . PHE A 1 14  ? -7.086  -3.608  -9.103  1.00 0.00 ? 14  PHE A CZ   4  
ATOM 5719  H H    . PHE A 1 14  ? -6.361  -1.861  -13.705 1.00 0.00 ? 14  PHE A H    4  
ATOM 5720  H HA   . PHE A 1 14  ? -6.338  0.591   -12.071 1.00 0.00 ? 14  PHE A HA   4  
ATOM 5721  H HB2  . PHE A 1 14  ? -4.154  -1.489  -12.144 1.00 0.00 ? 14  PHE A HB2  4  
ATOM 5722  H HB3  . PHE A 1 14  ? -4.386  -0.203  -10.965 1.00 0.00 ? 14  PHE A HB3  4  
ATOM 5723  H HD1  . PHE A 1 14  ? -5.784  -3.393  -12.204 1.00 0.00 ? 14  PHE A HD1  4  
ATOM 5724  H HD2  . PHE A 1 14  ? -5.706  -0.533  -9.053  1.00 0.00 ? 14  PHE A HD2  4  
ATOM 5725  H HE1  . PHE A 1 14  ? -7.046  -4.943  -10.771 1.00 0.00 ? 14  PHE A HE1  4  
ATOM 5726  H HE2  . PHE A 1 14  ? -6.968  -2.079  -7.614  1.00 0.00 ? 14  PHE A HE2  4  
ATOM 5727  H HZ   . PHE A 1 14  ? -7.641  -4.287  -8.473  1.00 0.00 ? 14  PHE A HZ   4  
ATOM 5728  N N    . GLU A 1 15  ? -4.299  1.667   -13.243 1.00 0.00 ? 15  GLU A N    4  
ATOM 5729  C CA   . GLU A 1 15  ? -3.436  2.431   -14.137 1.00 0.00 ? 15  GLU A CA   4  
ATOM 5730  C C    . GLU A 1 15  ? -2.021  2.531   -13.575 1.00 0.00 ? 15  GLU A C    4  
ATOM 5731  O O    . GLU A 1 15  ? -1.829  2.826   -12.395 1.00 0.00 ? 15  GLU A O    4  
ATOM 5732  C CB   . GLU A 1 15  ? -4.009  3.832   -14.360 1.00 0.00 ? 15  GLU A CB   4  
ATOM 5733  C CG   . GLU A 1 15  ? -4.290  4.587   -13.072 1.00 0.00 ? 15  GLU A CG   4  
ATOM 5734  C CD   . GLU A 1 15  ? -4.210  6.091   -13.248 1.00 0.00 ? 15  GLU A CD   4  
ATOM 5735  O OE1  . GLU A 1 15  ? -5.163  6.674   -13.806 1.00 0.00 ? 15  GLU A OE1  4  
ATOM 5736  O OE2  . GLU A 1 15  ? -3.195  6.685   -12.828 1.00 0.00 ? 15  GLU A OE2  4  
ATOM 5737  H H    . GLU A 1 15  ? -4.447  1.991   -12.330 1.00 0.00 ? 15  GLU A H    4  
ATOM 5738  H HA   . GLU A 1 15  ? -3.398  1.913   -15.084 1.00 0.00 ? 15  GLU A HA   4  
ATOM 5739  H HB2  . GLU A 1 15  ? -3.305  4.407   -14.944 1.00 0.00 ? 15  GLU A HB2  4  
ATOM 5740  H HB3  . GLU A 1 15  ? -4.934  3.746   -14.911 1.00 0.00 ? 15  GLU A HB3  4  
ATOM 5741  H HG2  . GLU A 1 15  ? -5.282  4.333   -12.730 1.00 0.00 ? 15  GLU A HG2  4  
ATOM 5742  H HG3  . GLU A 1 15  ? -3.566  4.287   -12.329 1.00 0.00 ? 15  GLU A HG3  4  
ATOM 5743  N N    . THR A 1 16  ? -1.032  2.282   -14.428 1.00 0.00 ? 16  THR A N    4  
ATOM 5744  C CA   . THR A 1 16  ? 0.365   2.343   -14.017 1.00 0.00 ? 16  THR A CA   4  
ATOM 5745  C C    . THR A 1 16  ? 0.998   3.671   -14.414 1.00 0.00 ? 16  THR A C    4  
ATOM 5746  O O    . THR A 1 16  ? 0.702   4.218   -15.477 1.00 0.00 ? 16  THR A O    4  
ATOM 5747  C CB   . THR A 1 16  ? 1.182   1.193   -14.635 1.00 0.00 ? 16  THR A CB   4  
ATOM 5748  O OG1  . THR A 1 16  ? 0.562   -0.064  -14.339 1.00 0.00 ? 16  THR A OG1  4  
ATOM 5749  C CG2  . THR A 1 16  ? 2.608   1.197   -14.107 1.00 0.00 ? 16  THR A CG2  4  
ATOM 5750  H H    . THR A 1 16  ? -1.249  2.053   -15.355 1.00 0.00 ? 16  THR A H    4  
ATOM 5751  H HA   . THR A 1 16  ? 0.401   2.244   -12.942 1.00 0.00 ? 16  THR A HA   4  
ATOM 5752  H HB   . THR A 1 16  ? 1.211   1.327   -15.707 1.00 0.00 ? 16  THR A HB   4  
ATOM 5753  H HG1  . THR A 1 16  ? -0.393  0.043   -14.336 1.00 0.00 ? 16  THR A HG1  4  
ATOM 5754  H HG21 . THR A 1 16  ? 2.721   1.990   -13.382 1.00 0.00 ? 16  THR A HG21 4  
ATOM 5755  H HG22 . THR A 1 16  ? 3.295   1.355   -14.925 1.00 0.00 ? 16  THR A HG22 4  
ATOM 5756  H HG23 . THR A 1 16  ? 2.820   0.249   -13.637 1.00 0.00 ? 16  THR A HG23 4  
ATOM 5757  N N    . TYR A 1 17  ? 1.869   4.186   -13.554 1.00 0.00 ? 17  TYR A N    4  
ATOM 5758  C CA   . TYR A 1 17  ? 2.543   5.452   -13.815 1.00 0.00 ? 17  TYR A CA   4  
ATOM 5759  C C    . TYR A 1 17  ? 3.974   5.427   -13.286 1.00 0.00 ? 17  TYR A C    4  
ATOM 5760  O O    . TYR A 1 17  ? 4.255   4.824   -12.251 1.00 0.00 ? 17  TYR A O    4  
ATOM 5761  C CB   . TYR A 1 17  ? 1.771   6.606   -13.173 1.00 0.00 ? 17  TYR A CB   4  
ATOM 5762  C CG   . TYR A 1 17  ? 1.508   6.412   -11.697 1.00 0.00 ? 17  TYR A CG   4  
ATOM 5763  C CD1  . TYR A 1 17  ? 0.436   5.645   -11.258 1.00 0.00 ? 17  TYR A CD1  4  
ATOM 5764  C CD2  . TYR A 1 17  ? 2.330   6.996   -10.741 1.00 0.00 ? 17  TYR A CD2  4  
ATOM 5765  C CE1  . TYR A 1 17  ? 0.191   5.465   -9.910  1.00 0.00 ? 17  TYR A CE1  4  
ATOM 5766  C CE2  . TYR A 1 17  ? 2.094   6.820   -9.392  1.00 0.00 ? 17  TYR A CE2  4  
ATOM 5767  C CZ   . TYR A 1 17  ? 1.023   6.054   -8.981  1.00 0.00 ? 17  TYR A CZ   4  
ATOM 5768  O OH   . TYR A 1 17  ? 0.783   5.878   -7.638  1.00 0.00 ? 17  TYR A OH   4  
ATOM 5769  H H    . TYR A 1 17  ? 2.064   3.704   -12.723 1.00 0.00 ? 17  TYR A H    4  
ATOM 5770  H HA   . TYR A 1 17  ? 2.569   5.600   -14.884 1.00 0.00 ? 17  TYR A HA   4  
ATOM 5771  H HB2  . TYR A 1 17  ? 2.336   7.518   -13.291 1.00 0.00 ? 17  TYR A HB2  4  
ATOM 5772  H HB3  . TYR A 1 17  ? 0.818   6.713   -13.669 1.00 0.00 ? 17  TYR A HB3  4  
ATOM 5773  H HD1  . TYR A 1 17  ? -0.214  5.184   -11.988 1.00 0.00 ? 17  TYR A HD1  4  
ATOM 5774  H HD2  . TYR A 1 17  ? 3.168   7.596   -11.067 1.00 0.00 ? 17  TYR A HD2  4  
ATOM 5775  H HE1  . TYR A 1 17  ? -0.648  4.865   -9.588  1.00 0.00 ? 17  TYR A HE1  4  
ATOM 5776  H HE2  . TYR A 1 17  ? 2.745   7.282   -8.664  1.00 0.00 ? 17  TYR A HE2  4  
ATOM 5777  H HH   . TYR A 1 17  ? 1.209   6.581   -7.142  1.00 0.00 ? 17  TYR A HH   4  
ATOM 5778  N N    . ASN A 1 18  ? 4.876   6.088   -14.006 1.00 0.00 ? 18  ASN A N    4  
ATOM 5779  C CA   . ASN A 1 18  ? 6.278   6.142   -13.610 1.00 0.00 ? 18  ASN A CA   4  
ATOM 5780  C C    . ASN A 1 18  ? 6.577   7.424   -12.839 1.00 0.00 ? 18  ASN A C    4  
ATOM 5781  O O    . ASN A 1 18  ? 6.186   8.515   -13.252 1.00 0.00 ? 18  ASN A O    4  
ATOM 5782  C CB   . ASN A 1 18  ? 7.181   6.053   -14.843 1.00 0.00 ? 18  ASN A CB   4  
ATOM 5783  C CG   . ASN A 1 18  ? 7.295   4.638   -15.375 1.00 0.00 ? 18  ASN A CG   4  
ATOM 5784  O OD1  . ASN A 1 18  ? 8.380   4.056   -15.396 1.00 0.00 ? 18  ASN A OD1  4  
ATOM 5785  N ND2  . ASN A 1 18  ? 6.172   4.076   -15.808 1.00 0.00 ? 18  ASN A ND2  4  
ATOM 5786  H H    . ASN A 1 18  ? 4.591   6.550   -14.822 1.00 0.00 ? 18  ASN A H    4  
ATOM 5787  H HA   . ASN A 1 18  ? 6.475   5.296   -12.969 1.00 0.00 ? 18  ASN A HA   4  
ATOM 5788  H HB2  . ASN A 1 18  ? 6.775   6.679   -15.624 1.00 0.00 ? 18  ASN A HB2  4  
ATOM 5789  H HB3  . ASN A 1 18  ? 8.169   6.402   -14.584 1.00 0.00 ? 18  ASN A HB3  4  
ATOM 5790  H HD21 . ASN A 1 18  ? 5.345   4.599   -15.761 1.00 0.00 ? 18  ASN A HD21 4  
ATOM 5791  H HD22 . ASN A 1 18  ? 6.217   3.161   -16.157 1.00 0.00 ? 18  ASN A HD22 4  
ATOM 5792  N N    . VAL A 1 19  ? 7.274   7.284   -11.716 1.00 0.00 ? 19  VAL A N    4  
ATOM 5793  C CA   . VAL A 1 19  ? 7.627   8.430   -10.887 1.00 0.00 ? 19  VAL A CA   4  
ATOM 5794  C C    . VAL A 1 19  ? 9.140   8.574   -10.764 1.00 0.00 ? 19  VAL A C    4  
ATOM 5795  O O    . VAL A 1 19  ? 9.807   7.731   -10.166 1.00 0.00 ? 19  VAL A O    4  
ATOM 5796  C CB   . VAL A 1 19  ? 7.018   8.312   -9.477  1.00 0.00 ? 19  VAL A CB   4  
ATOM 5797  C CG1  . VAL A 1 19  ? 6.943   9.678   -8.812  1.00 0.00 ? 19  VAL A CG1  4  
ATOM 5798  C CG2  . VAL A 1 19  ? 5.642   7.666   -9.544  1.00 0.00 ? 19  VAL A CG2  4  
ATOM 5799  H H    . VAL A 1 19  ? 7.558   6.388   -11.438 1.00 0.00 ? 19  VAL A H    4  
ATOM 5800  H HA   . VAL A 1 19  ? 7.227   9.317   -11.356 1.00 0.00 ? 19  VAL A HA   4  
ATOM 5801  H HB   . VAL A 1 19  ? 7.660   7.681   -8.881  1.00 0.00 ? 19  VAL A HB   4  
ATOM 5802  H HG11 . VAL A 1 19  ? 7.707   10.321  -9.223  1.00 0.00 ? 19  VAL A HG11 4  
ATOM 5803  H HG12 . VAL A 1 19  ? 5.970   10.113  -8.990  1.00 0.00 ? 19  VAL A HG12 4  
ATOM 5804  H HG13 . VAL A 1 19  ? 7.100   9.569   -7.749  1.00 0.00 ? 19  VAL A HG13 4  
ATOM 5805  H HG21 . VAL A 1 19  ? 5.694   6.667   -9.138  1.00 0.00 ? 19  VAL A HG21 4  
ATOM 5806  H HG22 . VAL A 1 19  ? 4.940   8.253   -8.968  1.00 0.00 ? 19  VAL A HG22 4  
ATOM 5807  H HG23 . VAL A 1 19  ? 5.315   7.621   -10.572 1.00 0.00 ? 19  VAL A HG23 4  
ATOM 5808  N N    . GLU A 1 20  ? 9.674   9.649   -11.335 1.00 0.00 ? 20  GLU A N    4  
ATOM 5809  C CA   . GLU A 1 20  ? 11.109  9.904   -11.289 1.00 0.00 ? 20  GLU A CA   4  
ATOM 5810  C C    . GLU A 1 20  ? 11.483  10.691  -10.037 1.00 0.00 ? 20  GLU A C    4  
ATOM 5811  O O    . GLU A 1 20  ? 11.424  11.921  -10.022 1.00 0.00 ? 20  GLU A O    4  
ATOM 5812  C CB   . GLU A 1 20  ? 11.554  10.669  -12.538 1.00 0.00 ? 20  GLU A CB   4  
ATOM 5813  C CG   . GLU A 1 20  ? 13.063  10.789  -12.672 1.00 0.00 ? 20  GLU A CG   4  
ATOM 5814  C CD   . GLU A 1 20  ? 13.611  12.033  -12.001 1.00 0.00 ? 20  GLU A CD   4  
ATOM 5815  O OE1  . GLU A 1 20  ? 13.030  13.120  -12.200 1.00 0.00 ? 20  GLU A OE1  4  
ATOM 5816  O OE2  . GLU A 1 20  ? 14.622  11.919  -11.277 1.00 0.00 ? 20  GLU A OE2  4  
ATOM 5817  H H    . GLU A 1 20  ? 9.090   10.286  -11.797 1.00 0.00 ? 20  GLU A H    4  
ATOM 5818  H HA   . GLU A 1 20  ? 11.615  8.950   -11.264 1.00 0.00 ? 20  GLU A HA   4  
ATOM 5819  H HB2  . GLU A 1 20  ? 11.174  10.160  -13.411 1.00 0.00 ? 20  GLU A HB2  4  
ATOM 5820  H HB3  . GLU A 1 20  ? 11.137  11.664  -12.502 1.00 0.00 ? 20  GLU A HB3  4  
ATOM 5821  H HG2  . GLU A 1 20  ? 13.522  9.923   -12.220 1.00 0.00 ? 20  GLU A HG2  4  
ATOM 5822  H HG3  . GLU A 1 20  ? 13.316  10.823  -13.722 1.00 0.00 ? 20  GLU A HG3  4  
ATOM 5823  N N    . LEU A 1 21  ? 11.867  9.974   -8.987  1.00 0.00 ? 21  LEU A N    4  
ATOM 5824  C CA   . LEU A 1 21  ? 12.250  10.604  -7.728  1.00 0.00 ? 21  LEU A CA   4  
ATOM 5825  C C    . LEU A 1 21  ? 13.706  11.057  -7.767  1.00 0.00 ? 21  LEU A C    4  
ATOM 5826  O O    . LEU A 1 21  ? 14.563  10.378  -8.333  1.00 0.00 ? 21  LEU A O    4  
ATOM 5827  C CB   . LEU A 1 21  ? 12.036  9.635   -6.564  1.00 0.00 ? 21  LEU A CB   4  
ATOM 5828  C CG   . LEU A 1 21  ? 10.616  9.092   -6.394  1.00 0.00 ? 21  LEU A CG   4  
ATOM 5829  C CD1  . LEU A 1 21  ? 10.596  7.958   -5.381  1.00 0.00 ? 21  LEU A CD1  4  
ATOM 5830  C CD2  . LEU A 1 21  ? 9.667   10.204  -5.971  1.00 0.00 ? 21  LEU A CD2  4  
ATOM 5831  H H    . LEU A 1 21  ? 11.893  8.997   -9.058  1.00 0.00 ? 21  LEU A H    4  
ATOM 5832  H HA   . LEU A 1 21  ? 11.620  11.469  -7.586  1.00 0.00 ? 21  LEU A HA   4  
ATOM 5833  H HB2  . LEU A 1 21  ? 12.696  8.793   -6.709  1.00 0.00 ? 21  LEU A HB2  4  
ATOM 5834  H HB3  . LEU A 1 21  ? 12.306  10.149  -5.653  1.00 0.00 ? 21  LEU A HB3  4  
ATOM 5835  H HG   . LEU A 1 21  ? 10.272  8.700   -7.341  1.00 0.00 ? 21  LEU A HG   4  
ATOM 5836  H HD11 . LEU A 1 21  ? 10.037  7.127   -5.783  1.00 0.00 ? 21  LEU A HD11 4  
ATOM 5837  H HD12 . LEU A 1 21  ? 10.129  8.299   -4.469  1.00 0.00 ? 21  LEU A HD12 4  
ATOM 5838  H HD13 . LEU A 1 21  ? 11.608  7.645   -5.172  1.00 0.00 ? 21  LEU A HD13 4  
ATOM 5839  H HD21 . LEU A 1 21  ? 8.811   9.776   -5.473  1.00 0.00 ? 21  LEU A HD21 4  
ATOM 5840  H HD22 . LEU A 1 21  ? 9.340   10.749  -6.845  1.00 0.00 ? 21  LEU A HD22 4  
ATOM 5841  H HD23 . LEU A 1 21  ? 10.178  10.876  -5.298  1.00 0.00 ? 21  LEU A HD23 4  
ATOM 5842  N N    . VAL A 1 22  ? 13.979  12.207  -7.159  1.00 0.00 ? 22  VAL A N    4  
ATOM 5843  C CA   . VAL A 1 22  ? 15.332  12.749  -7.121  1.00 0.00 ? 22  VAL A CA   4  
ATOM 5844  C C    . VAL A 1 22  ? 15.928  12.640  -5.722  1.00 0.00 ? 22  VAL A C    4  
ATOM 5845  O O    . VAL A 1 22  ? 15.239  12.851  -4.724  1.00 0.00 ? 22  VAL A O    4  
ATOM 5846  C CB   . VAL A 1 22  ? 15.358  14.224  -7.565  1.00 0.00 ? 22  VAL A CB   4  
ATOM 5847  C CG1  . VAL A 1 22  ? 14.523  15.079  -6.624  1.00 0.00 ? 22  VAL A CG1  4  
ATOM 5848  C CG2  . VAL A 1 22  ? 16.790  14.734  -7.633  1.00 0.00 ? 22  VAL A CG2  4  
ATOM 5849  H H    . VAL A 1 22  ? 13.253  12.702  -6.725  1.00 0.00 ? 22  VAL A H    4  
ATOM 5850  H HA   . VAL A 1 22  ? 15.940  12.178  -7.807  1.00 0.00 ? 22  VAL A HA   4  
ATOM 5851  H HB   . VAL A 1 22  ? 14.927  14.289  -8.553  1.00 0.00 ? 22  VAL A HB   4  
ATOM 5852  H HG11 . VAL A 1 22  ? 14.866  14.938  -5.610  1.00 0.00 ? 22  VAL A HG11 4  
ATOM 5853  H HG12 . VAL A 1 22  ? 14.624  16.119  -6.898  1.00 0.00 ? 22  VAL A HG12 4  
ATOM 5854  H HG13 . VAL A 1 22  ? 13.486  14.787  -6.697  1.00 0.00 ? 22  VAL A HG13 4  
ATOM 5855  H HG21 . VAL A 1 22  ? 16.813  15.776  -7.352  1.00 0.00 ? 22  VAL A HG21 4  
ATOM 5856  H HG22 . VAL A 1 22  ? 17.408  14.164  -6.954  1.00 0.00 ? 22  VAL A HG22 4  
ATOM 5857  H HG23 . VAL A 1 22  ? 17.164  14.623  -8.640  1.00 0.00 ? 22  VAL A HG23 4  
ATOM 5858  N N    . ARG A 1 23  ? 17.214  12.309  -5.658  1.00 0.00 ? 23  ARG A N    4  
ATOM 5859  C CA   . ARG A 1 23  ? 17.904  12.171  -4.381  1.00 0.00 ? 23  ARG A CA   4  
ATOM 5860  C C    . ARG A 1 23  ? 18.871  13.329  -4.157  1.00 0.00 ? 23  ARG A C    4  
ATOM 5861  O O    . ARG A 1 23  ? 19.933  13.394  -4.776  1.00 0.00 ? 23  ARG A O    4  
ATOM 5862  C CB   . ARG A 1 23  ? 18.661  10.843  -4.327  1.00 0.00 ? 23  ARG A CB   4  
ATOM 5863  C CG   . ARG A 1 23  ? 17.773  9.626   -4.531  1.00 0.00 ? 23  ARG A CG   4  
ATOM 5864  C CD   . ARG A 1 23  ? 18.311  8.413   -3.790  1.00 0.00 ? 23  ARG A CD   4  
ATOM 5865  N NE   . ARG A 1 23  ? 19.614  7.993   -4.301  1.00 0.00 ? 23  ARG A NE   4  
ATOM 5866  C CZ   . ARG A 1 23  ? 20.488  7.286   -3.593  1.00 0.00 ? 23  ARG A CZ   4  
ATOM 5867  N NH1  . ARG A 1 23  ? 20.200  6.922   -2.351  1.00 0.00 ? 23  ARG A NH1  4  
ATOM 5868  N NH2  . ARG A 1 23  ? 21.653  6.942   -4.127  1.00 0.00 ? 23  ARG A NH2  4  
ATOM 5869  H H    . ARG A 1 23  ? 17.710  12.153  -6.488  1.00 0.00 ? 23  ARG A H    4  
ATOM 5870  H HA   . ARG A 1 23  ? 17.160  12.183  -3.598  1.00 0.00 ? 23  ARG A HA   4  
ATOM 5871  H HB2  . ARG A 1 23  ? 19.418  10.841  -5.098  1.00 0.00 ? 23  ARG A HB2  4  
ATOM 5872  H HB3  . ARG A 1 23  ? 19.140  10.754  -3.364  1.00 0.00 ? 23  ARG A HB3  4  
ATOM 5873  H HG2  . ARG A 1 23  ? 16.782  9.849   -4.161  1.00 0.00 ? 23  ARG A HG2  4  
ATOM 5874  H HG3  . ARG A 1 23  ? 17.723  9.401   -5.585  1.00 0.00 ? 23  ARG A HG3  4  
ATOM 5875  H HD2  . ARG A 1 23  ? 18.409  8.660   -2.743  1.00 0.00 ? 23  ARG A HD2  4  
ATOM 5876  H HD3  . ARG A 1 23  ? 17.611  7.599   -3.903  1.00 0.00 ? 23  ARG A HD3  4  
ATOM 5877  H HE   . ARG A 1 23  ? 19.847  8.251   -5.216  1.00 0.00 ? 23  ARG A HE   4  
ATOM 5878  H HH11 . ARG A 1 23  ? 19.323  7.179   -1.946  1.00 0.00 ? 23  ARG A HH11 4  
ATOM 5879  H HH12 . ARG A 1 23  ? 20.860  6.389   -1.820  1.00 0.00 ? 23  ARG A HH12 4  
ATOM 5880  H HH21 . ARG A 1 23  ? 21.873  7.215   -5.063  1.00 0.00 ? 23  ARG A HH21 4  
ATOM 5881  H HH22 . ARG A 1 23  ? 22.310  6.411   -3.594  1.00 0.00 ? 23  ARG A HH22 4  
ATOM 5882  N N    . LYS A 1 24  ? 18.496  14.244  -3.269  1.00 0.00 ? 24  LYS A N    4  
ATOM 5883  C CA   . LYS A 1 24  ? 19.329  15.400  -2.962  1.00 0.00 ? 24  LYS A CA   4  
ATOM 5884  C C    . LYS A 1 24  ? 20.739  14.967  -2.572  1.00 0.00 ? 24  LYS A C    4  
ATOM 5885  O O    . LYS A 1 24  ? 21.013  13.776  -2.421  1.00 0.00 ? 24  LYS A O    4  
ATOM 5886  C CB   . LYS A 1 24  ? 18.704  16.219  -1.830  1.00 0.00 ? 24  LYS A CB   4  
ATOM 5887  C CG   . LYS A 1 24  ? 17.727  17.277  -2.313  1.00 0.00 ? 24  LYS A CG   4  
ATOM 5888  C CD   . LYS A 1 24  ? 17.543  18.378  -1.282  1.00 0.00 ? 24  LYS A CD   4  
ATOM 5889  C CE   . LYS A 1 24  ? 16.314  19.222  -1.582  1.00 0.00 ? 24  LYS A CE   4  
ATOM 5890  N NZ   . LYS A 1 24  ? 15.052  18.459  -1.374  1.00 0.00 ? 24  LYS A NZ   4  
ATOM 5891  H H    . LYS A 1 24  ? 17.638  14.137  -2.807  1.00 0.00 ? 24  LYS A H    4  
ATOM 5892  H HA   . LYS A 1 24  ? 19.387  16.013  -3.849  1.00 0.00 ? 24  LYS A HA   4  
ATOM 5893  H HB2  . LYS A 1 24  ? 18.179  15.550  -1.166  1.00 0.00 ? 24  LYS A HB2  4  
ATOM 5894  H HB3  . LYS A 1 24  ? 19.494  16.712  -1.281  1.00 0.00 ? 24  LYS A HB3  4  
ATOM 5895  H HG2  . LYS A 1 24  ? 18.104  17.713  -3.226  1.00 0.00 ? 24  LYS A HG2  4  
ATOM 5896  H HG3  . LYS A 1 24  ? 16.771  16.810  -2.503  1.00 0.00 ? 24  LYS A HG3  4  
ATOM 5897  H HD2  . LYS A 1 24  ? 17.429  17.930  -0.306  1.00 0.00 ? 24  LYS A HD2  4  
ATOM 5898  H HD3  . LYS A 1 24  ? 18.417  19.014  -1.288  1.00 0.00 ? 24  LYS A HD3  4  
ATOM 5899  H HE2  . LYS A 1 24  ? 16.317  20.082  -0.930  1.00 0.00 ? 24  LYS A HE2  4  
ATOM 5900  H HE3  . LYS A 1 24  ? 16.361  19.550  -2.610  1.00 0.00 ? 24  LYS A HE3  4  
ATOM 5901  H HZ1  . LYS A 1 24  ? 15.204  17.453  -1.589  1.00 0.00 ? 24  LYS A HZ1  4  
ATOM 5902  H HZ2  . LYS A 1 24  ? 14.306  18.826  -1.998  1.00 0.00 ? 24  LYS A HZ2  4  
ATOM 5903  H HZ3  . LYS A 1 24  ? 14.739  18.549  -0.387  1.00 0.00 ? 24  LYS A HZ3  4  
ATOM 5904  N N    . ASP A 1 25  ? 21.628  15.940  -2.409  1.00 0.00 ? 25  ASP A N    4  
ATOM 5905  C CA   . ASP A 1 25  ? 23.009  15.660  -2.034  1.00 0.00 ? 25  ASP A CA   4  
ATOM 5906  C C    . ASP A 1 25  ? 23.073  14.960  -0.680  1.00 0.00 ? 25  ASP A C    4  
ATOM 5907  O O    . ASP A 1 25  ? 23.173  15.609  0.361   1.00 0.00 ? 25  ASP A O    4  
ATOM 5908  C CB   . ASP A 1 25  ? 23.822  16.955  -1.992  1.00 0.00 ? 25  ASP A CB   4  
ATOM 5909  C CG   . ASP A 1 25  ? 23.839  17.671  -3.328  1.00 0.00 ? 25  ASP A CG   4  
ATOM 5910  O OD1  . ASP A 1 25  ? 24.343  17.086  -4.309  1.00 0.00 ? 25  ASP A OD1  4  
ATOM 5911  O OD2  . ASP A 1 25  ? 23.346  18.817  -3.392  1.00 0.00 ? 25  ASP A OD2  4  
ATOM 5912  H H    . ASP A 1 25  ? 21.349  16.870  -2.544  1.00 0.00 ? 25  ASP A H    4  
ATOM 5913  H HA   . ASP A 1 25  ? 23.430  15.006  -2.783  1.00 0.00 ? 25  ASP A HA   4  
ATOM 5914  H HB2  . ASP A 1 25  ? 23.393  17.617  -1.254  1.00 0.00 ? 25  ASP A HB2  4  
ATOM 5915  H HB3  . ASP A 1 25  ? 24.840  16.724  -1.714  1.00 0.00 ? 25  ASP A HB3  4  
ATOM 5916  N N    . GLY A 1 26  ? 23.013  13.632  -0.701  1.00 0.00 ? 26  GLY A N    4  
ATOM 5917  C CA   . GLY A 1 26  ? 23.064  12.867  0.531   1.00 0.00 ? 26  GLY A CA   4  
ATOM 5918  C C    . GLY A 1 26  ? 21.685  12.580  1.092   1.00 0.00 ? 26  GLY A C    4  
ATOM 5919  O O    . GLY A 1 26  ? 21.467  12.682  2.299   1.00 0.00 ? 26  GLY A O    4  
ATOM 5920  H H    . GLY A 1 26  ? 22.933  13.168  -1.561  1.00 0.00 ? 26  GLY A H    4  
ATOM 5921  H HA2  . GLY A 1 26  ? 23.566  11.931  0.340   1.00 0.00 ? 26  GLY A HA2  4  
ATOM 5922  H HA3  . GLY A 1 26  ? 23.629  13.424  1.264   1.00 0.00 ? 26  GLY A HA3  4  
ATOM 5923  N N    . GLN A 1 27  ? 20.754  12.222  0.215   1.00 0.00 ? 27  GLN A N    4  
ATOM 5924  C CA   . GLN A 1 27  ? 19.389  11.921  0.630   1.00 0.00 ? 27  GLN A CA   4  
ATOM 5925  C C    . GLN A 1 27  ? 19.017  10.484  0.281   1.00 0.00 ? 27  GLN A C    4  
ATOM 5926  O O    . GLN A 1 27  ? 19.642  9.862   -0.578  1.00 0.00 ? 27  GLN A O    4  
ATOM 5927  C CB   . GLN A 1 27  ? 18.407  12.890  -0.032  1.00 0.00 ? 27  GLN A CB   4  
ATOM 5928  C CG   . GLN A 1 27  ? 16.974  12.727  0.449   1.00 0.00 ? 27  GLN A CG   4  
ATOM 5929  C CD   . GLN A 1 27  ? 16.132  13.964  0.205   1.00 0.00 ? 27  GLN A CD   4  
ATOM 5930  O OE1  . GLN A 1 27  ? 16.434  15.044  0.714   1.00 0.00 ? 27  GLN A OE1  4  
ATOM 5931  N NE2  . GLN A 1 27  ? 15.070  13.813  -0.577  1.00 0.00 ? 27  GLN A NE2  4  
ATOM 5932  H H    . GLN A 1 27  ? 20.989  12.158  -0.734  1.00 0.00 ? 27  GLN A H    4  
ATOM 5933  H HA   . GLN A 1 27  ? 19.334  12.044  1.701   1.00 0.00 ? 27  GLN A HA   4  
ATOM 5934  H HB2  . GLN A 1 27  ? 18.721  13.901  0.177   1.00 0.00 ? 27  GLN A HB2  4  
ATOM 5935  H HB3  . GLN A 1 27  ? 18.425  12.728  -1.099  1.00 0.00 ? 27  GLN A HB3  4  
ATOM 5936  H HG2  . GLN A 1 27  ? 16.524  11.896  -0.074  1.00 0.00 ? 27  GLN A HG2  4  
ATOM 5937  H HG3  . GLN A 1 27  ? 16.985  12.520  1.509   1.00 0.00 ? 27  GLN A HG3  4  
ATOM 5938  H HE21 . GLN A 1 27  ? 14.891  12.922  -0.946  1.00 0.00 ? 27  GLN A HE21 4  
ATOM 5939  H HE22 . GLN A 1 27  ? 14.508  14.595  -0.751  1.00 0.00 ? 27  GLN A HE22 4  
ATOM 5940  N N    . SER A 1 28  ? 17.996  9.962   0.954   1.00 0.00 ? 28  SER A N    4  
ATOM 5941  C CA   . SER A 1 28  ? 17.544  8.596   0.718   1.00 0.00 ? 28  SER A CA   4  
ATOM 5942  C C    . SER A 1 28  ? 16.150  8.585   0.097   1.00 0.00 ? 28  SER A C    4  
ATOM 5943  O O    . SER A 1 28  ? 15.553  9.637   -0.136  1.00 0.00 ? 28  SER A O    4  
ATOM 5944  C CB   . SER A 1 28  ? 17.538  7.805   2.027   1.00 0.00 ? 28  SER A CB   4  
ATOM 5945  O OG   . SER A 1 28  ? 16.643  8.378   2.965   1.00 0.00 ? 28  SER A OG   4  
ATOM 5946  H H    . SER A 1 28  ? 17.538  10.508  1.627   1.00 0.00 ? 28  SER A H    4  
ATOM 5947  H HA   . SER A 1 28  ? 18.235  8.132   0.030   1.00 0.00 ? 28  SER A HA   4  
ATOM 5948  H HB2  . SER A 1 28  ? 17.231  6.789   1.830   1.00 0.00 ? 28  SER A HB2  4  
ATOM 5949  H HB3  . SER A 1 28  ? 18.532  7.805   2.449   1.00 0.00 ? 28  SER A HB3  4  
ATOM 5950  H HG   . SER A 1 28  ? 16.671  7.876   3.783   1.00 0.00 ? 28  SER A HG   4  
ATOM 5951  N N    . LEU A 1 29  ? 15.637  7.389   -0.168  1.00 0.00 ? 29  LEU A N    4  
ATOM 5952  C CA   . LEU A 1 29  ? 14.313  7.238   -0.762  1.00 0.00 ? 29  LEU A CA   4  
ATOM 5953  C C    . LEU A 1 29  ? 13.221  7.516   0.265   1.00 0.00 ? 29  LEU A C    4  
ATOM 5954  O O    . LEU A 1 29  ? 12.309  8.305   0.020   1.00 0.00 ? 29  LEU A O    4  
ATOM 5955  C CB   . LEU A 1 29  ? 14.146  5.829   -1.333  1.00 0.00 ? 29  LEU A CB   4  
ATOM 5956  C CG   . LEU A 1 29  ? 13.216  5.700   -2.540  1.00 0.00 ? 29  LEU A CG   4  
ATOM 5957  C CD1  . LEU A 1 29  ? 13.795  6.432   -3.741  1.00 0.00 ? 29  LEU A CD1  4  
ATOM 5958  C CD2  . LEU A 1 29  ? 12.973  4.235   -2.872  1.00 0.00 ? 29  LEU A CD2  4  
ATOM 5959  H H    . LEU A 1 29  ? 16.160  6.587   0.040   1.00 0.00 ? 29  LEU A H    4  
ATOM 5960  H HA   . LEU A 1 29  ? 14.227  7.956   -1.565  1.00 0.00 ? 29  LEU A HA   4  
ATOM 5961  H HB2  . LEU A 1 29  ? 15.121  5.474   -1.628  1.00 0.00 ? 29  LEU A HB2  4  
ATOM 5962  H HB3  . LEU A 1 29  ? 13.758  5.198   -0.546  1.00 0.00 ? 29  LEU A HB3  4  
ATOM 5963  H HG   . LEU A 1 29  ? 12.263  6.152   -2.302  1.00 0.00 ? 29  LEU A HG   4  
ATOM 5964  H HD11 . LEU A 1 29  ? 14.801  6.751   -3.517  1.00 0.00 ? 29  LEU A HD11 4  
ATOM 5965  H HD12 . LEU A 1 29  ? 13.185  7.294   -3.965  1.00 0.00 ? 29  LEU A HD12 4  
ATOM 5966  H HD13 . LEU A 1 29  ? 13.808  5.769   -4.594  1.00 0.00 ? 29  LEU A HD13 4  
ATOM 5967  H HD21 . LEU A 1 29  ? 13.658  3.924   -3.647  1.00 0.00 ? 29  LEU A HD21 4  
ATOM 5968  H HD22 . LEU A 1 29  ? 11.957  4.107   -3.217  1.00 0.00 ? 29  LEU A HD22 4  
ATOM 5969  H HD23 . LEU A 1 29  ? 13.132  3.634   -1.989  1.00 0.00 ? 29  LEU A HD23 4  
ATOM 5970  N N    . GLY A 1 30  ? 13.321  6.863   1.420   1.00 0.00 ? 30  GLY A N    4  
ATOM 5971  C CA   . GLY A 1 30  ? 12.336  7.055   2.468   1.00 0.00 ? 30  GLY A CA   4  
ATOM 5972  C C    . GLY A 1 30  ? 10.986  6.466   2.111   1.00 0.00 ? 30  GLY A C    4  
ATOM 5973  O O    . GLY A 1 30  ? 9.951   7.100   2.314   1.00 0.00 ? 30  GLY A O    4  
ATOM 5974  H H    . GLY A 1 30  ? 14.070  6.246   1.560   1.00 0.00 ? 30  GLY A H    4  
ATOM 5975  H HA2  . GLY A 1 30  ? 12.694  6.587   3.373   1.00 0.00 ? 30  GLY A HA2  4  
ATOM 5976  H HA3  . GLY A 1 30  ? 12.218  8.114   2.646   1.00 0.00 ? 30  GLY A HA3  4  
ATOM 5977  N N    . ILE A 1 31  ? 10.997  5.250   1.575   1.00 0.00 ? 31  ILE A N    4  
ATOM 5978  C CA   . ILE A 1 31  ? 9.763   4.576   1.188   1.00 0.00 ? 31  ILE A CA   4  
ATOM 5979  C C    . ILE A 1 31  ? 9.699   3.169   1.773   1.00 0.00 ? 31  ILE A C    4  
ATOM 5980  O O    . ILE A 1 31  ? 10.298  2.236   1.239   1.00 0.00 ? 31  ILE A O    4  
ATOM 5981  C CB   . ILE A 1 31  ? 9.626   4.489   -0.344  1.00 0.00 ? 31  ILE A CB   4  
ATOM 5982  C CG1  . ILE A 1 31  ? 9.571   5.892   -0.953  1.00 0.00 ? 31  ILE A CG1  4  
ATOM 5983  C CG2  . ILE A 1 31  ? 8.386   3.693   -0.720  1.00 0.00 ? 31  ILE A CG2  4  
ATOM 5984  C CD1  . ILE A 1 31  ? 9.572   5.894   -2.466  1.00 0.00 ? 31  ILE A CD1  4  
ATOM 5985  H H    . ILE A 1 31  ? 11.853  4.795   1.437   1.00 0.00 ? 31  ILE A H    4  
ATOM 5986  H HA   . ILE A 1 31  ? 8.934   5.152   1.571   1.00 0.00 ? 31  ILE A HA   4  
ATOM 5987  H HB   . ILE A 1 31  ? 10.489  3.970   -0.732  1.00 0.00 ? 31  ILE A HB   4  
ATOM 5988  H HG12 . ILE A 1 31  ? 8.671   6.386   -0.622  1.00 0.00 ? 31  ILE A HG12 4  
ATOM 5989  H HG13 . ILE A 1 31  ? 10.430  6.455   -0.618  1.00 0.00 ? 31  ILE A HG13 4  
ATOM 5990  H HG21 . ILE A 1 31  ? 7.840   4.219   -1.489  1.00 0.00 ? 31  ILE A HG21 4  
ATOM 5991  H HG22 . ILE A 1 31  ? 8.680   2.722   -1.090  1.00 0.00 ? 31  ILE A HG22 4  
ATOM 5992  H HG23 . ILE A 1 31  ? 7.757   3.573   0.149   1.00 0.00 ? 31  ILE A HG23 4  
ATOM 5993  H HD11 . ILE A 1 31  ? 8.648   5.468   -2.828  1.00 0.00 ? 31  ILE A HD11 4  
ATOM 5994  H HD12 . ILE A 1 31  ? 9.667   6.908   -2.824  1.00 0.00 ? 31  ILE A HD12 4  
ATOM 5995  H HD13 . ILE A 1 31  ? 10.404  5.306   -2.825  1.00 0.00 ? 31  ILE A HD13 4  
ATOM 5996  N N    . ARG A 1 32  ? 8.966   3.025   2.872   1.00 0.00 ? 32  ARG A N    4  
ATOM 5997  C CA   . ARG A 1 32  ? 8.822   1.731   3.530   1.00 0.00 ? 32  ARG A CA   4  
ATOM 5998  C C    . ARG A 1 32  ? 7.926   0.804   2.715   1.00 0.00 ? 32  ARG A C    4  
ATOM 5999  O O    . ARG A 1 32  ? 6.854   1.203   2.258   1.00 0.00 ? 32  ARG A O    4  
ATOM 6000  C CB   . ARG A 1 32  ? 8.245   1.911   4.935   1.00 0.00 ? 32  ARG A CB   4  
ATOM 6001  C CG   . ARG A 1 32  ? 9.187   2.619   5.895   1.00 0.00 ? 32  ARG A CG   4  
ATOM 6002  C CD   . ARG A 1 32  ? 10.514  1.886   6.015   1.00 0.00 ? 32  ARG A CD   4  
ATOM 6003  N NE   . ARG A 1 32  ? 11.309  2.374   7.138   1.00 0.00 ? 32  ARG A NE   4  
ATOM 6004  C CZ   . ARG A 1 32  ? 12.632  2.272   7.202   1.00 0.00 ? 32  ARG A CZ   4  
ATOM 6005  N NH1  . ARG A 1 32  ? 13.304  1.702   6.211   1.00 0.00 ? 32  ARG A NH1  4  
ATOM 6006  N NH2  . ARG A 1 32  ? 13.285  2.741   8.257   1.00 0.00 ? 32  ARG A NH2  4  
ATOM 6007  H H    . ARG A 1 32  ? 8.512   3.806   3.250   1.00 0.00 ? 32  ARG A H    4  
ATOM 6008  H HA   . ARG A 1 32  ? 9.803   1.288   3.608   1.00 0.00 ? 32  ARG A HA   4  
ATOM 6009  H HB2  . ARG A 1 32  ? 7.335   2.490   4.866   1.00 0.00 ? 32  ARG A HB2  4  
ATOM 6010  H HB3  . ARG A 1 32  ? 8.013   0.939   5.343   1.00 0.00 ? 32  ARG A HB3  4  
ATOM 6011  H HG2  . ARG A 1 32  ? 9.373   3.619   5.531   1.00 0.00 ? 32  ARG A HG2  4  
ATOM 6012  H HG3  . ARG A 1 32  ? 8.723   2.669   6.868   1.00 0.00 ? 32  ARG A HG3  4  
ATOM 6013  H HD2  . ARG A 1 32  ? 10.317  0.834   6.157   1.00 0.00 ? 32  ARG A HD2  4  
ATOM 6014  H HD3  . ARG A 1 32  ? 11.072  2.028   5.102   1.00 0.00 ? 32  ARG A HD3  4  
ATOM 6015  H HE   . ARG A 1 32  ? 10.832  2.799   7.881   1.00 0.00 ? 32  ARG A HE   4  
ATOM 6016  H HH11 . ARG A 1 32  ? 12.815  1.349   5.414   1.00 0.00 ? 32  ARG A HH11 4  
ATOM 6017  H HH12 . ARG A 1 32  ? 14.301  1.628   6.261   1.00 0.00 ? 32  ARG A HH12 4  
ATOM 6018  H HH21 . ARG A 1 32  ? 12.782  3.171   9.006   1.00 0.00 ? 32  ARG A HH21 4  
ATOM 6019  H HH22 . ARG A 1 32  ? 14.280  2.663   8.304   1.00 0.00 ? 32  ARG A HH22 4  
ATOM 6020  N N    . ILE A 1 33  ? 8.372   -0.435  2.536   1.00 0.00 ? 33  ILE A N    4  
ATOM 6021  C CA   . ILE A 1 33  ? 7.611   -1.419  1.777   1.00 0.00 ? 33  ILE A CA   4  
ATOM 6022  C C    . ILE A 1 33  ? 7.043   -2.499  2.691   1.00 0.00 ? 33  ILE A C    4  
ATOM 6023  O O    . ILE A 1 33  ? 7.489   -2.664  3.827   1.00 0.00 ? 33  ILE A O    4  
ATOM 6024  C CB   . ILE A 1 33  ? 8.476   -2.084  0.690   1.00 0.00 ? 33  ILE A CB   4  
ATOM 6025  C CG1  . ILE A 1 33  ? 9.679   -2.785  1.323   1.00 0.00 ? 33  ILE A CG1  4  
ATOM 6026  C CG2  . ILE A 1 33  ? 8.933   -1.050  -0.329  1.00 0.00 ? 33  ILE A CG2  4  
ATOM 6027  C CD1  . ILE A 1 33  ? 10.183  -3.964  0.520   1.00 0.00 ? 33  ILE A CD1  4  
ATOM 6028  H H    . ILE A 1 33  ? 9.234   -0.693  2.924   1.00 0.00 ? 33  ILE A H    4  
ATOM 6029  H HA   . ILE A 1 33  ? 6.792   -0.905  1.293   1.00 0.00 ? 33  ILE A HA   4  
ATOM 6030  H HB   . ILE A 1 33  ? 7.870   -2.815  0.177   1.00 0.00 ? 33  ILE A HB   4  
ATOM 6031  H HG12 . ILE A 1 33  ? 10.489  -2.080  1.419   1.00 0.00 ? 33  ILE A HG12 4  
ATOM 6032  H HG13 . ILE A 1 33  ? 9.402   -3.145  2.303   1.00 0.00 ? 33  ILE A HG13 4  
ATOM 6033  H HG21 . ILE A 1 33  ? 9.975   -0.818  -0.162  1.00 0.00 ? 33  ILE A HG21 4  
ATOM 6034  H HG22 . ILE A 1 33  ? 8.809   -1.447  -1.325  1.00 0.00 ? 33  ILE A HG22 4  
ATOM 6035  H HG23 . ILE A 1 33  ? 8.343   -0.153  -0.222  1.00 0.00 ? 33  ILE A HG23 4  
ATOM 6036  H HD11 . ILE A 1 33  ? 10.953  -3.634  -0.161  1.00 0.00 ? 33  ILE A HD11 4  
ATOM 6037  H HD12 . ILE A 1 33  ? 10.587  -4.709  1.188   1.00 0.00 ? 33  ILE A HD12 4  
ATOM 6038  H HD13 . ILE A 1 33  ? 9.365   -4.391  -0.043  1.00 0.00 ? 33  ILE A HD13 4  
ATOM 6039  N N    . VAL A 1 34  ? 6.059   -3.236  2.187   1.00 0.00 ? 34  VAL A N    4  
ATOM 6040  C CA   . VAL A 1 34  ? 5.432   -4.304  2.957   1.00 0.00 ? 34  VAL A CA   4  
ATOM 6041  C C    . VAL A 1 34  ? 5.242   -5.556  2.107   1.00 0.00 ? 34  VAL A C    4  
ATOM 6042  O O    . VAL A 1 34  ? 4.937   -5.471  0.918   1.00 0.00 ? 34  VAL A O    4  
ATOM 6043  C CB   . VAL A 1 34  ? 4.066   -3.865  3.517   1.00 0.00 ? 34  VAL A CB   4  
ATOM 6044  C CG1  . VAL A 1 34  ? 3.015   -3.858  2.417   1.00 0.00 ? 34  VAL A CG1  4  
ATOM 6045  C CG2  . VAL A 1 34  ? 3.644   -4.772  4.662   1.00 0.00 ? 34  VAL A CG2  4  
ATOM 6046  H H    . VAL A 1 34  ? 5.747   -3.058  1.275   1.00 0.00 ? 34  VAL A H    4  
ATOM 6047  H HA   . VAL A 1 34  ? 6.079   -4.541  3.789   1.00 0.00 ? 34  VAL A HA   4  
ATOM 6048  H HB   . VAL A 1 34  ? 4.162   -2.859  3.898   1.00 0.00 ? 34  VAL A HB   4  
ATOM 6049  H HG11 . VAL A 1 34  ? 3.039   -4.800  1.890   1.00 0.00 ? 34  VAL A HG11 4  
ATOM 6050  H HG12 . VAL A 1 34  ? 2.038   -3.712  2.853   1.00 0.00 ? 34  VAL A HG12 4  
ATOM 6051  H HG13 . VAL A 1 34  ? 3.224   -3.055  1.725   1.00 0.00 ? 34  VAL A HG13 4  
ATOM 6052  H HG21 . VAL A 1 34  ? 4.173   -4.488  5.560   1.00 0.00 ? 34  VAL A HG21 4  
ATOM 6053  H HG22 . VAL A 1 34  ? 2.580   -4.676  4.826   1.00 0.00 ? 34  VAL A HG22 4  
ATOM 6054  H HG23 . VAL A 1 34  ? 3.878   -5.797  4.416   1.00 0.00 ? 34  VAL A HG23 4  
ATOM 6055  N N    . GLY A 1 35  ? 5.424   -6.718  2.726   1.00 0.00 ? 35  GLY A N    4  
ATOM 6056  C CA   . GLY A 1 35  ? 5.268   -7.972  2.011   1.00 0.00 ? 35  GLY A CA   4  
ATOM 6057  C C    . GLY A 1 35  ? 3.963   -8.669  2.342   1.00 0.00 ? 35  GLY A C    4  
ATOM 6058  O O    . GLY A 1 35  ? 3.788   -9.182  3.447   1.00 0.00 ? 35  GLY A O    4  
ATOM 6059  H H    . GLY A 1 35  ? 5.666   -6.725  3.676   1.00 0.00 ? 35  GLY A H    4  
ATOM 6060  H HA2  . GLY A 1 35  ? 5.300   -7.775  0.950   1.00 0.00 ? 35  GLY A HA2  4  
ATOM 6061  H HA3  . GLY A 1 35  ? 6.088   -8.625  2.271   1.00 0.00 ? 35  GLY A HA3  4  
ATOM 6062  N N    . TYR A 1 36  ? 3.045   -8.687  1.382   1.00 0.00 ? 36  TYR A N    4  
ATOM 6063  C CA   . TYR A 1 36  ? 1.747   -9.323  1.578   1.00 0.00 ? 36  TYR A CA   4  
ATOM 6064  C C    . TYR A 1 36  ? 1.696   -10.681 0.885   1.00 0.00 ? 36  TYR A C    4  
ATOM 6065  O O    . TYR A 1 36  ? 2.275   -10.867 -0.185  1.00 0.00 ? 36  TYR A O    4  
ATOM 6066  C CB   . TYR A 1 36  ? 0.630   -8.424  1.047   1.00 0.00 ? 36  TYR A CB   4  
ATOM 6067  C CG   . TYR A 1 36  ? -0.010  -7.560  2.110   1.00 0.00 ? 36  TYR A CG   4  
ATOM 6068  C CD1  . TYR A 1 36  ? 0.611   -6.400  2.556   1.00 0.00 ? 36  TYR A CD1  4  
ATOM 6069  C CD2  . TYR A 1 36  ? -1.234  -7.904  2.669   1.00 0.00 ? 36  TYR A CD2  4  
ATOM 6070  C CE1  . TYR A 1 36  ? 0.031   -5.608  3.528   1.00 0.00 ? 36  TYR A CE1  4  
ATOM 6071  C CE2  . TYR A 1 36  ? -1.823  -7.118  3.641   1.00 0.00 ? 36  TYR A CE2  4  
ATOM 6072  C CZ   . TYR A 1 36  ? -1.186  -5.970  4.067   1.00 0.00 ? 36  TYR A CZ   4  
ATOM 6073  O OH   . TYR A 1 36  ? -1.768  -5.185  5.035   1.00 0.00 ? 36  TYR A OH   4  
ATOM 6074  H H    . TYR A 1 36  ? 3.243   -8.261  0.522   1.00 0.00 ? 36  TYR A H    4  
ATOM 6075  H HA   . TYR A 1 36  ? 1.606   -9.467  2.639   1.00 0.00 ? 36  TYR A HA   4  
ATOM 6076  H HB2  . TYR A 1 36  ? 1.032   -7.771  0.288   1.00 0.00 ? 36  TYR A HB2  4  
ATOM 6077  H HB3  . TYR A 1 36  ? -0.143  -9.041  0.611   1.00 0.00 ? 36  TYR A HB3  4  
ATOM 6078  H HD1  . TYR A 1 36  ? 1.564   -6.118  2.132   1.00 0.00 ? 36  TYR A HD1  4  
ATOM 6079  H HD2  . TYR A 1 36  ? -1.730  -8.804  2.334   1.00 0.00 ? 36  TYR A HD2  4  
ATOM 6080  H HE1  . TYR A 1 36  ? 0.528   -4.709  3.862   1.00 0.00 ? 36  TYR A HE1  4  
ATOM 6081  H HE2  . TYR A 1 36  ? -2.775  -7.402  4.063   1.00 0.00 ? 36  TYR A HE2  4  
ATOM 6082  H HH   . TYR A 1 36  ? -1.094  -4.877  5.645   1.00 0.00 ? 36  TYR A HH   4  
ATOM 6083  N N    . VAL A 1 37  ? 0.998   -11.628 1.504   1.00 0.00 ? 37  VAL A N    4  
ATOM 6084  C CA   . VAL A 1 37  ? 0.868   -12.969 0.947   1.00 0.00 ? 37  VAL A CA   4  
ATOM 6085  C C    . VAL A 1 37  ? -0.577  -13.268 0.565   1.00 0.00 ? 37  VAL A C    4  
ATOM 6086  O O    . VAL A 1 37  ? -0.840  -13.975 -0.407  1.00 0.00 ? 37  VAL A O    4  
ATOM 6087  C CB   . VAL A 1 37  ? 1.356   -14.039 1.941   1.00 0.00 ? 37  VAL A CB   4  
ATOM 6088  C CG1  . VAL A 1 37  ? 1.222   -15.429 1.339   1.00 0.00 ? 37  VAL A CG1  4  
ATOM 6089  C CG2  . VAL A 1 37  ? 2.794   -13.765 2.355   1.00 0.00 ? 37  VAL A CG2  4  
ATOM 6090  H H    . VAL A 1 37  ? 0.559   -11.419 2.355   1.00 0.00 ? 37  VAL A H    4  
ATOM 6091  H HA   . VAL A 1 37  ? 1.483   -13.024 0.061   1.00 0.00 ? 37  VAL A HA   4  
ATOM 6092  H HB   . VAL A 1 37  ? 0.735   -13.992 2.824   1.00 0.00 ? 37  VAL A HB   4  
ATOM 6093  H HG11 . VAL A 1 37  ? 1.088   -16.153 2.129   1.00 0.00 ? 37  VAL A HG11 4  
ATOM 6094  H HG12 . VAL A 1 37  ? 0.369   -15.454 0.677   1.00 0.00 ? 37  VAL A HG12 4  
ATOM 6095  H HG13 . VAL A 1 37  ? 2.117   -15.668 0.782   1.00 0.00 ? 37  VAL A HG13 4  
ATOM 6096  H HG21 . VAL A 1 37  ? 2.802   -13.123 3.224   1.00 0.00 ? 37  VAL A HG21 4  
ATOM 6097  H HG22 . VAL A 1 37  ? 3.285   -14.698 2.593   1.00 0.00 ? 37  VAL A HG22 4  
ATOM 6098  H HG23 . VAL A 1 37  ? 3.317   -13.280 1.544   1.00 0.00 ? 37  VAL A HG23 4  
ATOM 6099  N N    . GLY A 1 38  ? -1.513  -12.724 1.337   1.00 0.00 ? 38  GLY A N    4  
ATOM 6100  C CA   . GLY A 1 38  ? -2.921  -12.943 1.064   1.00 0.00 ? 38  GLY A CA   4  
ATOM 6101  C C    . GLY A 1 38  ? -3.407  -14.288 1.568   1.00 0.00 ? 38  GLY A C    4  
ATOM 6102  O O    . GLY A 1 38  ? -2.982  -15.334 1.077   1.00 0.00 ? 38  GLY A O    4  
ATOM 6103  H H    . GLY A 1 38  ? -1.244  -12.169 2.100   1.00 0.00 ? 38  GLY A H    4  
ATOM 6104  H HA2  . GLY A 1 38  ? -3.495  -12.163 1.540   1.00 0.00 ? 38  GLY A HA2  4  
ATOM 6105  H HA3  . GLY A 1 38  ? -3.080  -12.893 -0.004  1.00 0.00 ? 38  GLY A HA3  4  
ATOM 6106  N N    . THR A 1 39  ? -4.300  -14.261 2.553   1.00 0.00 ? 39  THR A N    4  
ATOM 6107  C CA   . THR A 1 39  ? -4.842  -15.486 3.126   1.00 0.00 ? 39  THR A CA   4  
ATOM 6108  C C    . THR A 1 39  ? -5.992  -16.026 2.283   1.00 0.00 ? 39  THR A C    4  
ATOM 6109  O O    . THR A 1 39  ? -6.967  -16.557 2.814   1.00 0.00 ? 39  THR A O    4  
ATOM 6110  C CB   . THR A 1 39  ? -5.338  -15.261 4.567   1.00 0.00 ? 39  THR A CB   4  
ATOM 6111  O OG1  . THR A 1 39  ? -5.750  -16.505 5.143   1.00 0.00 ? 39  THR A OG1  4  
ATOM 6112  C CG2  . THR A 1 39  ? -6.497  -14.276 4.592   1.00 0.00 ? 39  THR A CG2  4  
ATOM 6113  H H    . THR A 1 39  ? -4.599  -13.396 2.901   1.00 0.00 ? 39  THR A H    4  
ATOM 6114  H HA   . THR A 1 39  ? -4.051  -16.222 3.151   1.00 0.00 ? 39  THR A HA   4  
ATOM 6115  H HB   . THR A 1 39  ? -4.526  -14.854 5.151   1.00 0.00 ? 39  THR A HB   4  
ATOM 6116  H HG1  . THR A 1 39  ? -5.259  -16.661 5.954   1.00 0.00 ? 39  THR A HG1  4  
ATOM 6117  H HG21 . THR A 1 39  ? -7.089  -14.440 5.480   1.00 0.00 ? 39  THR A HG21 4  
ATOM 6118  H HG22 . THR A 1 39  ? -7.112  -14.422 3.717   1.00 0.00 ? 39  THR A HG22 4  
ATOM 6119  H HG23 . THR A 1 39  ? -6.112  -13.268 4.598   1.00 0.00 ? 39  THR A HG23 4  
ATOM 6120  N N    . SER A 1 40  ? -5.871  -15.887 0.967   1.00 0.00 ? 40  SER A N    4  
ATOM 6121  C CA   . SER A 1 40  ? -6.902  -16.358 0.050   1.00 0.00 ? 40  SER A CA   4  
ATOM 6122  C C    . SER A 1 40  ? -6.350  -16.497 -1.365  1.00 0.00 ? 40  SER A C    4  
ATOM 6123  O O    . SER A 1 40  ? -5.517  -15.700 -1.800  1.00 0.00 ? 40  SER A O    4  
ATOM 6124  C CB   . SER A 1 40  ? -8.094  -15.398 0.053   1.00 0.00 ? 40  SER A CB   4  
ATOM 6125  O OG   . SER A 1 40  ? -9.270  -16.044 -0.401  1.00 0.00 ? 40  SER A OG   4  
ATOM 6126  H H    . SER A 1 40  ? -5.069  -15.455 0.604   1.00 0.00 ? 40  SER A H    4  
ATOM 6127  H HA   . SER A 1 40  ? -7.232  -17.328 0.392   1.00 0.00 ? 40  SER A HA   4  
ATOM 6128  H HB2  . SER A 1 40  ? -8.259  -15.037 1.056   1.00 0.00 ? 40  SER A HB2  4  
ATOM 6129  H HB3  . SER A 1 40  ? -7.881  -14.563 -0.600  1.00 0.00 ? 40  SER A HB3  4  
ATOM 6130  H HG   . SER A 1 40  ? -9.766  -15.447 -0.966  1.00 0.00 ? 40  SER A HG   4  
ATOM 6131  N N    . HIS A 1 41  ? -6.818  -17.515 -2.080  1.00 0.00 ? 41  HIS A N    4  
ATOM 6132  C CA   . HIS A 1 41  ? -6.372  -17.759 -3.447  1.00 0.00 ? 41  HIS A CA   4  
ATOM 6133  C C    . HIS A 1 41  ? -6.715  -16.578 -4.349  1.00 0.00 ? 41  HIS A C    4  
ATOM 6134  O O    . HIS A 1 41  ? -5.933  -16.205 -5.225  1.00 0.00 ? 41  HIS A O    4  
ATOM 6135  C CB   . HIS A 1 41  ? -7.011  -19.036 -3.994  1.00 0.00 ? 41  HIS A CB   4  
ATOM 6136  C CG   . HIS A 1 41  ? -8.397  -19.279 -3.481  1.00 0.00 ? 41  HIS A CG   4  
ATOM 6137  N ND1  . HIS A 1 41  ? -8.736  -20.378 -2.720  1.00 0.00 ? 41  HIS A ND1  4  
ATOM 6138  C CD2  . HIS A 1 41  ? -9.533  -18.557 -3.623  1.00 0.00 ? 41  HIS A CD2  4  
ATOM 6139  C CE1  . HIS A 1 41  ? -10.021 -20.322 -2.417  1.00 0.00 ? 41  HIS A CE1  4  
ATOM 6140  N NE2  . HIS A 1 41  ? -10.527 -19.226 -2.953  1.00 0.00 ? 41  HIS A NE2  4  
ATOM 6141  H H    . HIS A 1 41  ? -7.480  -18.116 -1.678  1.00 0.00 ? 41  HIS A H    4  
ATOM 6142  H HA   . HIS A 1 41  ? -5.300  -17.883 -3.428  1.00 0.00 ? 41  HIS A HA   4  
ATOM 6143  H HB2  . HIS A 1 41  ? -7.063  -18.972 -5.070  1.00 0.00 ? 41  HIS A HB2  4  
ATOM 6144  H HB3  . HIS A 1 41  ? -6.401  -19.884 -3.717  1.00 0.00 ? 41  HIS A HB3  4  
ATOM 6145  H HD1  . HIS A 1 41  ? -8.126  -21.093 -2.444  1.00 0.00 ? 41  HIS A HD1  4  
ATOM 6146  H HD2  . HIS A 1 41  ? -9.639  -17.626 -4.163  1.00 0.00 ? 41  HIS A HD2  4  
ATOM 6147  H HE1  . HIS A 1 41  ? -10.565 -21.047 -1.831  1.00 0.00 ? 41  HIS A HE1  4  
ATOM 6148  H HE2  . HIS A 1 41  ? -11.477 -18.985 -2.953  1.00 0.00 ? 41  HIS A HE2  4  
ATOM 6149  N N    . THR A 1 42  ? -7.888  -15.993 -4.131  1.00 0.00 ? 42  THR A N    4  
ATOM 6150  C CA   . THR A 1 42  ? -8.335  -14.856 -4.925  1.00 0.00 ? 42  THR A CA   4  
ATOM 6151  C C    . THR A 1 42  ? -9.204  -13.915 -4.098  1.00 0.00 ? 42  THR A C    4  
ATOM 6152  O O    . THR A 1 42  ? -10.280 -14.293 -3.637  1.00 0.00 ? 42  THR A O    4  
ATOM 6153  C CB   . THR A 1 42  ? -9.128  -15.313 -6.164  1.00 0.00 ? 42  THR A CB   4  
ATOM 6154  O OG1  . THR A 1 42  ? -10.268 -16.079 -5.761  1.00 0.00 ? 42  THR A OG1  4  
ATOM 6155  C CG2  . THR A 1 42  ? -8.253  -16.145 -7.090  1.00 0.00 ? 42  THR A CG2  4  
ATOM 6156  H H    . THR A 1 42  ? -8.467  -16.336 -3.418  1.00 0.00 ? 42  THR A H    4  
ATOM 6157  H HA   . THR A 1 42  ? -7.460  -14.319 -5.262  1.00 0.00 ? 42  THR A HA   4  
ATOM 6158  H HB   . THR A 1 42  ? -9.464  -14.437 -6.701  1.00 0.00 ? 42  THR A HB   4  
ATOM 6159  H HG1  . THR A 1 42  ? -10.141 -16.998 -6.011  1.00 0.00 ? 42  THR A HG1  4  
ATOM 6160  H HG21 . THR A 1 42  ? -7.624  -16.796 -6.502  1.00 0.00 ? 42  THR A HG21 4  
ATOM 6161  H HG22 . THR A 1 42  ? -7.635  -15.490 -7.686  1.00 0.00 ? 42  THR A HG22 4  
ATOM 6162  H HG23 . THR A 1 42  ? -8.879  -16.739 -7.739  1.00 0.00 ? 42  THR A HG23 4  
ATOM 6163  N N    . GLY A 1 43  ? -8.730  -12.687 -3.915  1.00 0.00 ? 43  GLY A N    4  
ATOM 6164  C CA   . GLY A 1 43  ? -9.477  -11.710 -3.144  1.00 0.00 ? 43  GLY A CA   4  
ATOM 6165  C C    . GLY A 1 43  ? -8.583  -10.856 -2.267  1.00 0.00 ? 43  GLY A C    4  
ATOM 6166  O O    . GLY A 1 43  ? -8.712  -9.633  -2.244  1.00 0.00 ? 43  GLY A O    4  
ATOM 6167  H H    . GLY A 1 43  ? -7.865  -12.441 -4.306  1.00 0.00 ? 43  GLY A H    4  
ATOM 6168  H HA2  . GLY A 1 43  ? -10.017 -11.068 -3.823  1.00 0.00 ? 43  GLY A HA2  4  
ATOM 6169  H HA3  . GLY A 1 43  ? -10.186 -12.231 -2.516  1.00 0.00 ? 43  GLY A HA3  4  
ATOM 6170  N N    . GLU A 1 44  ? -7.675  -11.503 -1.543  1.00 0.00 ? 44  GLU A N    4  
ATOM 6171  C CA   . GLU A 1 44  ? -6.758  -10.794 -0.658  1.00 0.00 ? 44  GLU A CA   4  
ATOM 6172  C C    . GLU A 1 44  ? -5.610  -10.172 -1.449  1.00 0.00 ? 44  GLU A C    4  
ATOM 6173  O O    . GLU A 1 44  ? -5.065  -10.792 -2.362  1.00 0.00 ? 44  GLU A O    4  
ATOM 6174  C CB   . GLU A 1 44  ? -6.203  -11.743 0.406   1.00 0.00 ? 44  GLU A CB   4  
ATOM 6175  C CG   . GLU A 1 44  ? -5.839  -11.051 1.708   1.00 0.00 ? 44  GLU A CG   4  
ATOM 6176  C CD   . GLU A 1 44  ? -7.006  -10.298 2.315   1.00 0.00 ? 44  GLU A CD   4  
ATOM 6177  O OE1  . GLU A 1 44  ? -7.850  -10.943 2.973   1.00 0.00 ? 44  GLU A OE1  4  
ATOM 6178  O OE2  . GLU A 1 44  ? -7.077  -9.065  2.133   1.00 0.00 ? 44  GLU A OE2  4  
ATOM 6179  H H    . GLU A 1 44  ? -7.621  -12.479 -1.604  1.00 0.00 ? 44  GLU A H    4  
ATOM 6180  H HA   . GLU A 1 44  ? -7.311  -10.005 -0.171  1.00 0.00 ? 44  GLU A HA   4  
ATOM 6181  H HB2  . GLU A 1 44  ? -6.945  -12.499 0.618   1.00 0.00 ? 44  GLU A HB2  4  
ATOM 6182  H HB3  . GLU A 1 44  ? -5.316  -12.221 0.016   1.00 0.00 ? 44  GLU A HB3  4  
ATOM 6183  H HG2  . GLU A 1 44  ? -5.504  -11.796 2.415   1.00 0.00 ? 44  GLU A HG2  4  
ATOM 6184  H HG3  . GLU A 1 44  ? -5.038  -10.352 1.518   1.00 0.00 ? 44  GLU A HG3  4  
ATOM 6185  N N    . ALA A 1 45  ? -5.250  -8.944  -1.092  1.00 0.00 ? 45  ALA A N    4  
ATOM 6186  C CA   . ALA A 1 45  ? -4.167  -8.239  -1.767  1.00 0.00 ? 45  ALA A CA   4  
ATOM 6187  C C    . ALA A 1 45  ? -2.834  -8.949  -1.556  1.00 0.00 ? 45  ALA A C    4  
ATOM 6188  O O    . ALA A 1 45  ? -2.404  -9.156  -0.421  1.00 0.00 ? 45  ALA A O    4  
ATOM 6189  C CB   . ALA A 1 45  ? -4.086  -6.802  -1.274  1.00 0.00 ? 45  ALA A CB   4  
ATOM 6190  H H    . ALA A 1 45  ? -5.723  -8.502  -0.357  1.00 0.00 ? 45  ALA A H    4  
ATOM 6191  H HA   . ALA A 1 45  ? -4.390  -8.219  -2.824  1.00 0.00 ? 45  ALA A HA   4  
ATOM 6192  H HB1  . ALA A 1 45  ? -3.406  -6.245  -1.903  1.00 0.00 ? 45  ALA A HB1  4  
ATOM 6193  H HB2  . ALA A 1 45  ? -5.066  -6.351  -1.315  1.00 0.00 ? 45  ALA A HB2  4  
ATOM 6194  H HB3  . ALA A 1 45  ? -3.726  -6.790  -0.257  1.00 0.00 ? 45  ALA A HB3  4  
ATOM 6195  N N    . SER A 1 46  ? -2.186  -9.320  -2.655  1.00 0.00 ? 46  SER A N    4  
ATOM 6196  C CA   . SER A 1 46  ? -0.904  -10.011 -2.590  1.00 0.00 ? 46  SER A CA   4  
ATOM 6197  C C    . SER A 1 46  ? 0.162   -9.255  -3.377  1.00 0.00 ? 46  SER A C    4  
ATOM 6198  O O    . SER A 1 46  ? -0.041  -8.903  -4.538  1.00 0.00 ? 46  SER A O    4  
ATOM 6199  C CB   . SER A 1 46  ? -1.040  -11.435 -3.132  1.00 0.00 ? 46  SER A CB   4  
ATOM 6200  O OG   . SER A 1 46  ? -1.434  -11.428 -4.493  1.00 0.00 ? 46  SER A OG   4  
ATOM 6201  H H    . SER A 1 46  ? -2.581  -9.126  -3.531  1.00 0.00 ? 46  SER A H    4  
ATOM 6202  H HA   . SER A 1 46  ? -0.604  -10.057 -1.553  1.00 0.00 ? 46  SER A HA   4  
ATOM 6203  H HB2  . SER A 1 46  ? -0.090  -11.942 -3.047  1.00 0.00 ? 46  SER A HB2  4  
ATOM 6204  H HB3  . SER A 1 46  ? -1.784  -11.967 -2.556  1.00 0.00 ? 46  SER A HB3  4  
ATOM 6205  H HG   . SER A 1 46  ? -1.213  -10.580 -4.885  1.00 0.00 ? 46  SER A HG   4  
ATOM 6206  N N    . GLY A 1 47  ? 1.300   -9.008  -2.735  1.00 0.00 ? 47  GLY A N    4  
ATOM 6207  C CA   . GLY A 1 47  ? 2.381   -8.295  -3.390  1.00 0.00 ? 47  GLY A CA   4  
ATOM 6208  C C    . GLY A 1 47  ? 3.040   -7.278  -2.479  1.00 0.00 ? 47  GLY A C    4  
ATOM 6209  O O    . GLY A 1 47  ? 2.900   -7.347  -1.257  1.00 0.00 ? 47  GLY A O    4  
ATOM 6210  H H    . GLY A 1 47  ? 1.406   -9.313  -1.810  1.00 0.00 ? 47  GLY A H    4  
ATOM 6211  H HA2  . GLY A 1 47  ? 3.125   -9.008  -3.713  1.00 0.00 ? 47  GLY A HA2  4  
ATOM 6212  H HA3  . GLY A 1 47  ? 1.987   -7.783  -4.256  1.00 0.00 ? 47  GLY A HA3  4  
ATOM 6213  N N    . ILE A 1 48  ? 3.762   -6.334  -3.073  1.00 0.00 ? 48  ILE A N    4  
ATOM 6214  C CA   . ILE A 1 48  ? 4.445   -5.299  -2.306  1.00 0.00 ? 48  ILE A CA   4  
ATOM 6215  C C    . ILE A 1 48  ? 3.640   -4.004  -2.291  1.00 0.00 ? 48  ILE A C    4  
ATOM 6216  O O    . ILE A 1 48  ? 3.047   -3.618  -3.299  1.00 0.00 ? 48  ILE A O    4  
ATOM 6217  C CB   . ILE A 1 48  ? 5.848   -5.012  -2.874  1.00 0.00 ? 48  ILE A CB   4  
ATOM 6218  C CG1  . ILE A 1 48  ? 6.649   -6.310  -2.994  1.00 0.00 ? 48  ILE A CG1  4  
ATOM 6219  C CG2  . ILE A 1 48  ? 6.580   -4.011  -1.993  1.00 0.00 ? 48  ILE A CG2  4  
ATOM 6220  C CD1  . ILE A 1 48  ? 6.987   -6.937  -1.659  1.00 0.00 ? 48  ILE A CD1  4  
ATOM 6221  H H    . ILE A 1 48  ? 3.835   -6.332  -4.050  1.00 0.00 ? 48  ILE A H    4  
ATOM 6222  H HA   . ILE A 1 48  ? 4.554   -5.654  -1.292  1.00 0.00 ? 48  ILE A HA   4  
ATOM 6223  H HB   . ILE A 1 48  ? 5.733   -4.576  -3.854  1.00 0.00 ? 48  ILE A HB   4  
ATOM 6224  H HG12 . ILE A 1 48  ? 6.077   -7.028  -3.560  1.00 0.00 ? 48  ILE A HG12 4  
ATOM 6225  H HG13 . ILE A 1 48  ? 7.575   -6.106  -3.510  1.00 0.00 ? 48  ILE A HG13 4  
ATOM 6226  H HG21 . ILE A 1 48  ? 5.972   -3.776  -1.132  1.00 0.00 ? 48  ILE A HG21 4  
ATOM 6227  H HG22 . ILE A 1 48  ? 7.516   -4.437  -1.666  1.00 0.00 ? 48  ILE A HG22 4  
ATOM 6228  H HG23 . ILE A 1 48  ? 6.771   -3.109  -2.555  1.00 0.00 ? 48  ILE A HG23 4  
ATOM 6229  H HD11 . ILE A 1 48  ? 6.886   -6.198  -0.878  1.00 0.00 ? 48  ILE A HD11 4  
ATOM 6230  H HD12 . ILE A 1 48  ? 6.317   -7.760  -1.467  1.00 0.00 ? 48  ILE A HD12 4  
ATOM 6231  H HD13 . ILE A 1 48  ? 8.005   -7.299  -1.680  1.00 0.00 ? 48  ILE A HD13 4  
ATOM 6232  N N    . TYR A 1 49  ? 3.625   -3.337  -1.143  1.00 0.00 ? 49  TYR A N    4  
ATOM 6233  C CA   . TYR A 1 49  ? 2.892   -2.085  -0.996  1.00 0.00 ? 49  TYR A CA   4  
ATOM 6234  C C    . TYR A 1 49  ? 3.655   -1.109  -0.105  1.00 0.00 ? 49  TYR A C    4  
ATOM 6235  O O    . TYR A 1 49  ? 4.522   -1.507  0.672   1.00 0.00 ? 49  TYR A O    4  
ATOM 6236  C CB   . TYR A 1 49  ? 1.503   -2.348  -0.412  1.00 0.00 ? 49  TYR A CB   4  
ATOM 6237  C CG   . TYR A 1 49  ? 0.686   -3.335  -1.214  1.00 0.00 ? 49  TYR A CG   4  
ATOM 6238  C CD1  . TYR A 1 49  ? 1.002   -4.688  -1.216  1.00 0.00 ? 49  TYR A CD1  4  
ATOM 6239  C CD2  . TYR A 1 49  ? -0.401  -2.915  -1.970  1.00 0.00 ? 49  TYR A CD2  4  
ATOM 6240  C CE1  . TYR A 1 49  ? 0.259   -5.594  -1.947  1.00 0.00 ? 49  TYR A CE1  4  
ATOM 6241  C CE2  . TYR A 1 49  ? -1.151  -3.814  -2.703  1.00 0.00 ? 49  TYR A CE2  4  
ATOM 6242  C CZ   . TYR A 1 49  ? -0.817  -5.152  -2.689  1.00 0.00 ? 49  TYR A CZ   4  
ATOM 6243  O OH   . TYR A 1 49  ? -1.560  -6.051  -3.420  1.00 0.00 ? 49  TYR A OH   4  
ATOM 6244  H H    . TYR A 1 49  ? 4.117   -3.695  -0.375  1.00 0.00 ? 49  TYR A H    4  
ATOM 6245  H HA   . TYR A 1 49  ? 2.782   -1.648  -1.978  1.00 0.00 ? 49  TYR A HA   4  
ATOM 6246  H HB2  . TYR A 1 49  ? 1.609   -2.740  0.588   1.00 0.00 ? 49  TYR A HB2  4  
ATOM 6247  H HB3  . TYR A 1 49  ? 0.955   -1.418  -0.372  1.00 0.00 ? 49  TYR A HB3  4  
ATOM 6248  H HD1  . TYR A 1 49  ? 1.845   -5.031  -0.634  1.00 0.00 ? 49  TYR A HD1  4  
ATOM 6249  H HD2  . TYR A 1 49  ? -0.659  -1.866  -1.979  1.00 0.00 ? 49  TYR A HD2  4  
ATOM 6250  H HE1  . TYR A 1 49  ? 0.520   -6.642  -1.936  1.00 0.00 ? 49  TYR A HE1  4  
ATOM 6251  H HE2  . TYR A 1 49  ? -1.993  -3.468  -3.285  1.00 0.00 ? 49  TYR A HE2  4  
ATOM 6252  H HH   . TYR A 1 49  ? -1.747  -5.682  -4.286  1.00 0.00 ? 49  TYR A HH   4  
ATOM 6253  N N    . VAL A 1 50  ? 3.324   0.173   -0.224  1.00 0.00 ? 50  VAL A N    4  
ATOM 6254  C CA   . VAL A 1 50  ? 3.975   1.208   0.571   1.00 0.00 ? 50  VAL A CA   4  
ATOM 6255  C C    . VAL A 1 50  ? 3.425   1.236   1.993   1.00 0.00 ? 50  VAL A C    4  
ATOM 6256  O O    . VAL A 1 50  ? 2.309   1.699   2.230   1.00 0.00 ? 50  VAL A O    4  
ATOM 6257  C CB   . VAL A 1 50  ? 3.797   2.599   -0.065  1.00 0.00 ? 50  VAL A CB   4  
ATOM 6258  C CG1  . VAL A 1 50  ? 4.318   3.683   0.867   1.00 0.00 ? 50  VAL A CG1  4  
ATOM 6259  C CG2  . VAL A 1 50  ? 4.497   2.662   -1.414  1.00 0.00 ? 50  VAL A CG2  4  
ATOM 6260  H H    . VAL A 1 50  ? 2.625   0.429   -0.861  1.00 0.00 ? 50  VAL A H    4  
ATOM 6261  H HA   . VAL A 1 50  ? 5.031   0.985   0.608   1.00 0.00 ? 50  VAL A HA   4  
ATOM 6262  H HB   . VAL A 1 50  ? 2.741   2.768   -0.222  1.00 0.00 ? 50  VAL A HB   4  
ATOM 6263  H HG11 . VAL A 1 50  ? 4.849   4.427   0.291   1.00 0.00 ? 50  VAL A HG11 4  
ATOM 6264  H HG12 . VAL A 1 50  ? 3.489   4.147   1.380   1.00 0.00 ? 50  VAL A HG12 4  
ATOM 6265  H HG13 . VAL A 1 50  ? 4.989   3.243   1.591   1.00 0.00 ? 50  VAL A HG13 4  
ATOM 6266  H HG21 . VAL A 1 50  ? 4.215   1.803   -2.005  1.00 0.00 ? 50  VAL A HG21 4  
ATOM 6267  H HG22 . VAL A 1 50  ? 4.205   3.566   -1.930  1.00 0.00 ? 50  VAL A HG22 4  
ATOM 6268  H HG23 . VAL A 1 50  ? 5.566   2.662   -1.265  1.00 0.00 ? 50  VAL A HG23 4  
ATOM 6269  N N    . LYS A 1 51  ? 4.216   0.738   2.937   1.00 0.00 ? 51  LYS A N    4  
ATOM 6270  C CA   . LYS A 1 51  ? 3.811   0.707   4.337   1.00 0.00 ? 51  LYS A CA   4  
ATOM 6271  C C    . LYS A 1 51  ? 3.766   2.115   4.922   1.00 0.00 ? 51  LYS A C    4  
ATOM 6272  O O    . LYS A 1 51  ? 2.792   2.497   5.570   1.00 0.00 ? 51  LYS A O    4  
ATOM 6273  C CB   . LYS A 1 51  ? 4.773   -0.163  5.149   1.00 0.00 ? 51  LYS A CB   4  
ATOM 6274  C CG   . LYS A 1 51  ? 4.430   -0.234  6.627   1.00 0.00 ? 51  LYS A CG   4  
ATOM 6275  C CD   . LYS A 1 51  ? 3.491   -1.390  6.927   1.00 0.00 ? 51  LYS A CD   4  
ATOM 6276  C CE   . LYS A 1 51  ? 4.258   -2.645  7.313   1.00 0.00 ? 51  LYS A CE   4  
ATOM 6277  N NZ   . LYS A 1 51  ? 3.346   -3.790  7.587   1.00 0.00 ? 51  LYS A NZ   4  
ATOM 6278  H H    . LYS A 1 51  ? 5.095   0.383   2.686   1.00 0.00 ? 51  LYS A H    4  
ATOM 6279  H HA   . LYS A 1 51  ? 2.821   0.278   4.387   1.00 0.00 ? 51  LYS A HA   4  
ATOM 6280  H HB2  . LYS A 1 51  ? 4.757   -1.167  4.749   1.00 0.00 ? 51  LYS A HB2  4  
ATOM 6281  H HB3  . LYS A 1 51  ? 5.771   0.238   5.051   1.00 0.00 ? 51  LYS A HB3  4  
ATOM 6282  H HG2  . LYS A 1 51  ? 5.340   -0.367  7.192   1.00 0.00 ? 51  LYS A HG2  4  
ATOM 6283  H HG3  . LYS A 1 51  ? 3.953   0.691   6.921   1.00 0.00 ? 51  LYS A HG3  4  
ATOM 6284  H HD2  . LYS A 1 51  ? 2.842   -1.113  7.744   1.00 0.00 ? 51  LYS A HD2  4  
ATOM 6285  H HD3  . LYS A 1 51  ? 2.897   -1.598  6.048   1.00 0.00 ? 51  LYS A HD3  4  
ATOM 6286  H HE2  . LYS A 1 51  ? 4.921   -2.910  6.504   1.00 0.00 ? 51  LYS A HE2  4  
ATOM 6287  H HE3  . LYS A 1 51  ? 4.838   -2.438  8.201   1.00 0.00 ? 51  LYS A HE3  4  
ATOM 6288  H HZ1  . LYS A 1 51  ? 2.709   -3.559  8.376   1.00 0.00 ? 51  LYS A HZ1  4  
ATOM 6289  H HZ2  . LYS A 1 51  ? 3.898   -4.635  7.838   1.00 0.00 ? 51  LYS A HZ2  4  
ATOM 6290  H HZ3  . LYS A 1 51  ? 2.774   -4.001  6.744   1.00 0.00 ? 51  LYS A HZ3  4  
ATOM 6291  N N    . SER A 1 52  ? 4.825   2.882   4.687   1.00 0.00 ? 52  SER A N    4  
ATOM 6292  C CA   . SER A 1 52  ? 4.907   4.248   5.193   1.00 0.00 ? 52  SER A CA   4  
ATOM 6293  C C    . SER A 1 52  ? 5.699   5.134   4.237   1.00 0.00 ? 52  SER A C    4  
ATOM 6294  O O    . SER A 1 52  ? 6.360   4.645   3.321   1.00 0.00 ? 52  SER A O    4  
ATOM 6295  C CB   . SER A 1 52  ? 5.557   4.263   6.578   1.00 0.00 ? 52  SER A CB   4  
ATOM 6296  O OG   . SER A 1 52  ? 6.945   3.987   6.493   1.00 0.00 ? 52  SER A OG   4  
ATOM 6297  H H    . SER A 1 52  ? 5.571   2.520   4.163   1.00 0.00 ? 52  SER A H    4  
ATOM 6298  H HA   . SER A 1 52  ? 3.901   4.633   5.272   1.00 0.00 ? 52  SER A HA   4  
ATOM 6299  H HB2  . SER A 1 52  ? 5.423   5.236   7.025   1.00 0.00 ? 52  SER A HB2  4  
ATOM 6300  H HB3  . SER A 1 52  ? 5.090   3.513   7.200   1.00 0.00 ? 52  SER A HB3  4  
ATOM 6301  H HG   . SER A 1 52  ? 7.344   4.554   5.829   1.00 0.00 ? 52  SER A HG   4  
ATOM 6302  N N    . VAL A 1 53  ? 5.628   6.443   4.457   1.00 0.00 ? 53  VAL A N    4  
ATOM 6303  C CA   . VAL A 1 53  ? 6.338   7.400   3.617   1.00 0.00 ? 53  VAL A CA   4  
ATOM 6304  C C    . VAL A 1 53  ? 7.080   8.429   4.462   1.00 0.00 ? 53  VAL A C    4  
ATOM 6305  O O    . VAL A 1 53  ? 6.559   9.509   4.742   1.00 0.00 ? 53  VAL A O    4  
ATOM 6306  C CB   . VAL A 1 53  ? 5.376   8.133   2.664   1.00 0.00 ? 53  VAL A CB   4  
ATOM 6307  C CG1  . VAL A 1 53  ? 6.130   9.151   1.822   1.00 0.00 ? 53  VAL A CG1  4  
ATOM 6308  C CG2  . VAL A 1 53  ? 4.641   7.137   1.779   1.00 0.00 ? 53  VAL A CG2  4  
ATOM 6309  H H    . VAL A 1 53  ? 5.085   6.773   5.203   1.00 0.00 ? 53  VAL A H    4  
ATOM 6310  H HA   . VAL A 1 53  ? 7.055   6.854   3.021   1.00 0.00 ? 53  VAL A HA   4  
ATOM 6311  H HB   . VAL A 1 53  ? 4.645   8.661   3.258   1.00 0.00 ? 53  VAL A HB   4  
ATOM 6312  H HG11 . VAL A 1 53  ? 6.977   9.522   2.380   1.00 0.00 ? 53  VAL A HG11 4  
ATOM 6313  H HG12 . VAL A 1 53  ? 6.475   8.681   0.912   1.00 0.00 ? 53  VAL A HG12 4  
ATOM 6314  H HG13 . VAL A 1 53  ? 5.473   9.972   1.577   1.00 0.00 ? 53  VAL A HG13 4  
ATOM 6315  H HG21 . VAL A 1 53  ? 4.717   7.448   0.748   1.00 0.00 ? 53  VAL A HG21 4  
ATOM 6316  H HG22 . VAL A 1 53  ? 5.086   6.158   1.892   1.00 0.00 ? 53  VAL A HG22 4  
ATOM 6317  H HG23 . VAL A 1 53  ? 3.602   7.095   2.069   1.00 0.00 ? 53  VAL A HG23 4  
ATOM 6318  N N    . ILE A 1 54  ? 8.299   8.087   4.866   1.00 0.00 ? 54  ILE A N    4  
ATOM 6319  C CA   . ILE A 1 54  ? 9.114   8.982   5.679   1.00 0.00 ? 54  ILE A CA   4  
ATOM 6320  C C    . ILE A 1 54  ? 9.128   10.392  5.097   1.00 0.00 ? 54  ILE A C    4  
ATOM 6321  O O    . ILE A 1 54  ? 9.347   10.595  3.902   1.00 0.00 ? 54  ILE A O    4  
ATOM 6322  C CB   . ILE A 1 54  ? 10.562  8.473   5.798   1.00 0.00 ? 54  ILE A CB   4  
ATOM 6323  C CG1  . ILE A 1 54  ? 10.589  7.102   6.477   1.00 0.00 ? 54  ILE A CG1  4  
ATOM 6324  C CG2  . ILE A 1 54  ? 11.412  9.470   6.571   1.00 0.00 ? 54  ILE A CG2  4  
ATOM 6325  C CD1  . ILE A 1 54  ? 10.335  5.952   5.527   1.00 0.00 ? 54  ILE A CD1  4  
ATOM 6326  H H    . ILE A 1 54  ? 8.659   7.212   4.611   1.00 0.00 ? 54  ILE A H    4  
ATOM 6327  H HA   . ILE A 1 54  ? 8.683   9.017   6.669   1.00 0.00 ? 54  ILE A HA   4  
ATOM 6328  H HB   . ILE A 1 54  ? 10.971  8.382   4.803   1.00 0.00 ? 54  ILE A HB   4  
ATOM 6329  H HG12 . ILE A 1 54  ? 11.557  6.950   6.929   1.00 0.00 ? 54  ILE A HG12 4  
ATOM 6330  H HG13 . ILE A 1 54  ? 9.829   7.074   7.244   1.00 0.00 ? 54  ILE A HG13 4  
ATOM 6331  H HG21 . ILE A 1 54  ? 12.450  9.345   6.299   1.00 0.00 ? 54  ILE A HG21 4  
ATOM 6332  H HG22 . ILE A 1 54  ? 11.097  10.474  6.330   1.00 0.00 ? 54  ILE A HG22 4  
ATOM 6333  H HG23 . ILE A 1 54  ? 11.294  9.299   7.630   1.00 0.00 ? 54  ILE A HG23 4  
ATOM 6334  H HD11 . ILE A 1 54  ? 10.507  6.278   4.512   1.00 0.00 ? 54  ILE A HD11 4  
ATOM 6335  H HD12 . ILE A 1 54  ? 11.001  5.136   5.762   1.00 0.00 ? 54  ILE A HD12 4  
ATOM 6336  H HD13 . ILE A 1 54  ? 9.311   5.621   5.629   1.00 0.00 ? 54  ILE A HD13 4  
ATOM 6337  N N    . PRO A 1 55  ? 8.893   11.391  5.960   1.00 0.00 ? 55  PRO A N    4  
ATOM 6338  C CA   . PRO A 1 55  ? 8.876   12.799  5.555   1.00 0.00 ? 55  PRO A CA   4  
ATOM 6339  C C    . PRO A 1 55  ? 10.264  13.313  5.188   1.00 0.00 ? 55  PRO A C    4  
ATOM 6340  O O    . PRO A 1 55  ? 11.273  12.691  5.515   1.00 0.00 ? 55  PRO A O    4  
ATOM 6341  C CB   . PRO A 1 55  ? 8.351   13.520  6.800   1.00 0.00 ? 55  PRO A CB   4  
ATOM 6342  C CG   . PRO A 1 55  ? 8.708   12.624  7.935   1.00 0.00 ? 55  PRO A CG   4  
ATOM 6343  C CD   . PRO A 1 55  ? 8.624   11.222  7.398   1.00 0.00 ? 55  PRO A CD   4  
ATOM 6344  H HA   . PRO A 1 55  ? 8.201   12.967  4.729   1.00 0.00 ? 55  PRO A HA   4  
ATOM 6345  H HB2  . PRO A 1 55  ? 8.831   14.484  6.890   1.00 0.00 ? 55  PRO A HB2  4  
ATOM 6346  H HB3  . PRO A 1 55  ? 7.282   13.650  6.721   1.00 0.00 ? 55  PRO A HB3  4  
ATOM 6347  H HG2  . PRO A 1 55  ? 9.711   12.838  8.270   1.00 0.00 ? 55  PRO A HG2  4  
ATOM 6348  H HG3  . PRO A 1 55  ? 8.004   12.758  8.743   1.00 0.00 ? 55  PRO A HG3  4  
ATOM 6349  H HD2  . PRO A 1 55  ? 9.374   10.596  7.859   1.00 0.00 ? 55  PRO A HD2  4  
ATOM 6350  H HD3  . PRO A 1 55  ? 7.638   10.814  7.560   1.00 0.00 ? 55  PRO A HD3  4  
ATOM 6351  N N    . GLY A 1 56  ? 10.306  14.454  4.507   1.00 0.00 ? 56  GLY A N    4  
ATOM 6352  C CA   . GLY A 1 56  ? 11.576  15.033  4.107   1.00 0.00 ? 56  GLY A CA   4  
ATOM 6353  C C    . GLY A 1 56  ? 12.374  14.112  3.206   1.00 0.00 ? 56  GLY A C    4  
ATOM 6354  O O    . GLY A 1 56  ? 13.583  14.282  3.047   1.00 0.00 ? 56  GLY A O    4  
ATOM 6355  H H    . GLY A 1 56  ? 9.469   14.907  4.273   1.00 0.00 ? 56  GLY A H    4  
ATOM 6356  H HA2  . GLY A 1 56  ? 11.388  15.958  3.583   1.00 0.00 ? 56  GLY A HA2  4  
ATOM 6357  H HA3  . GLY A 1 56  ? 12.157  15.243  4.993   1.00 0.00 ? 56  GLY A HA3  4  
ATOM 6358  N N    . SER A 1 57  ? 11.698  13.132  2.615   1.00 0.00 ? 57  SER A N    4  
ATOM 6359  C CA   . SER A 1 57  ? 12.353  12.177  1.729   1.00 0.00 ? 57  SER A CA   4  
ATOM 6360  C C    . SER A 1 57  ? 11.908  12.382  0.285   1.00 0.00 ? 57  SER A C    4  
ATOM 6361  O O    . SER A 1 57  ? 10.875  12.997  0.023   1.00 0.00 ? 57  SER A O    4  
ATOM 6362  C CB   . SER A 1 57  ? 12.045  10.745  2.172   1.00 0.00 ? 57  SER A CB   4  
ATOM 6363  O OG   . SER A 1 57  ? 10.872  10.258  1.544   1.00 0.00 ? 57  SER A OG   4  
ATOM 6364  H H    . SER A 1 57  ? 10.735  13.048  2.781   1.00 0.00 ? 57  SER A H    4  
ATOM 6365  H HA   . SER A 1 57  ? 13.418  12.343  1.793   1.00 0.00 ? 57  SER A HA   4  
ATOM 6366  H HB2  . SER A 1 57  ? 12.872  10.103  1.907   1.00 0.00 ? 57  SER A HB2  4  
ATOM 6367  H HB3  . SER A 1 57  ? 11.902  10.725  3.242   1.00 0.00 ? 57  SER A HB3  4  
ATOM 6368  H HG   . SER A 1 57  ? 10.134  10.316  2.156   1.00 0.00 ? 57  SER A HG   4  
ATOM 6369  N N    . ALA A 1 58  ? 12.697  11.861  -0.650  1.00 0.00 ? 58  ALA A N    4  
ATOM 6370  C CA   . ALA A 1 58  ? 12.384  11.984  -2.068  1.00 0.00 ? 58  ALA A CA   4  
ATOM 6371  C C    . ALA A 1 58  ? 10.913  11.685  -2.334  1.00 0.00 ? 58  ALA A C    4  
ATOM 6372  O O    . ALA A 1 58  ? 10.235  12.432  -3.040  1.00 0.00 ? 58  ALA A O    4  
ATOM 6373  C CB   . ALA A 1 58  ? 13.270  11.056  -2.887  1.00 0.00 ? 58  ALA A CB   4  
ATOM 6374  H H    . ALA A 1 58  ? 13.507  11.381  -0.379  1.00 0.00 ? 58  ALA A H    4  
ATOM 6375  H HA   . ALA A 1 58  ? 12.594  13.000  -2.369  1.00 0.00 ? 58  ALA A HA   4  
ATOM 6376  H HB1  . ALA A 1 58  ? 14.293  11.399  -2.836  1.00 0.00 ? 58  ALA A HB1  4  
ATOM 6377  H HB2  . ALA A 1 58  ? 13.205  10.054  -2.489  1.00 0.00 ? 58  ALA A HB2  4  
ATOM 6378  H HB3  . ALA A 1 58  ? 12.940  11.058  -3.915  1.00 0.00 ? 58  ALA A HB3  4  
ATOM 6379  N N    . ALA A 1 59  ? 10.424  10.588  -1.765  1.00 0.00 ? 59  ALA A N    4  
ATOM 6380  C CA   . ALA A 1 59  ? 9.033   10.191  -1.940  1.00 0.00 ? 59  ALA A CA   4  
ATOM 6381  C C    . ALA A 1 59  ? 8.085   11.289  -1.468  1.00 0.00 ? 59  ALA A C    4  
ATOM 6382  O O    . ALA A 1 59  ? 7.264   11.787  -2.239  1.00 0.00 ? 59  ALA A O    4  
ATOM 6383  C CB   . ALA A 1 59  ? 8.756   8.895   -1.193  1.00 0.00 ? 59  ALA A CB   4  
ATOM 6384  H H    . ALA A 1 59  ? 11.014  10.033  -1.214  1.00 0.00 ? 59  ALA A H    4  
ATOM 6385  H HA   . ALA A 1 59  ? 8.866   10.013  -2.993  1.00 0.00 ? 59  ALA A HA   4  
ATOM 6386  H HB1  . ALA A 1 59  ? 9.638   8.272   -1.215  1.00 0.00 ? 59  ALA A HB1  4  
ATOM 6387  H HB2  . ALA A 1 59  ? 8.498   9.118   -0.169  1.00 0.00 ? 59  ALA A HB2  4  
ATOM 6388  H HB3  . ALA A 1 59  ? 7.936   8.375   -1.666  1.00 0.00 ? 59  ALA A HB3  4  
ATOM 6389  N N    . TYR A 1 60  ? 8.204   11.660  -0.199  1.00 0.00 ? 60  TYR A N    4  
ATOM 6390  C CA   . TYR A 1 60  ? 7.356   12.697  0.377   1.00 0.00 ? 60  TYR A CA   4  
ATOM 6391  C C    . TYR A 1 60  ? 7.433   13.982  -0.443  1.00 0.00 ? 60  TYR A C    4  
ATOM 6392  O O    . TYR A 1 60  ? 6.415   14.504  -0.898  1.00 0.00 ? 60  TYR A O    4  
ATOM 6393  C CB   . TYR A 1 60  ? 7.766   12.977  1.823   1.00 0.00 ? 60  TYR A CB   4  
ATOM 6394  C CG   . TYR A 1 60  ? 6.971   14.086  2.475   1.00 0.00 ? 60  TYR A CG   4  
ATOM 6395  C CD1  . TYR A 1 60  ? 7.394   15.408  2.399   1.00 0.00 ? 60  TYR A CD1  4  
ATOM 6396  C CD2  . TYR A 1 60  ? 5.798   13.813  3.167   1.00 0.00 ? 60  TYR A CD2  4  
ATOM 6397  C CE1  . TYR A 1 60  ? 6.672   16.424  2.993   1.00 0.00 ? 60  TYR A CE1  4  
ATOM 6398  C CE2  . TYR A 1 60  ? 5.068   14.823  3.762   1.00 0.00 ? 60  TYR A CE2  4  
ATOM 6399  C CZ   . TYR A 1 60  ? 5.509   16.127  3.673   1.00 0.00 ? 60  TYR A CZ   4  
ATOM 6400  O OH   . TYR A 1 60  ? 4.786   17.136  4.266   1.00 0.00 ? 60  TYR A OH   4  
ATOM 6401  H H    . TYR A 1 60  ? 8.877   11.226  0.366   1.00 0.00 ? 60  TYR A H    4  
ATOM 6402  H HA   . TYR A 1 60  ? 6.338   12.337  0.365   1.00 0.00 ? 60  TYR A HA   4  
ATOM 6403  H HB2  . TYR A 1 60  ? 7.628   12.082  2.409   1.00 0.00 ? 60  TYR A HB2  4  
ATOM 6404  H HB3  . TYR A 1 60  ? 8.809   13.259  1.846   1.00 0.00 ? 60  TYR A HB3  4  
ATOM 6405  H HD1  . TYR A 1 60  ? 8.305   15.638  1.865   1.00 0.00 ? 60  TYR A HD1  4  
ATOM 6406  H HD2  . TYR A 1 60  ? 5.456   12.790  3.235   1.00 0.00 ? 60  TYR A HD2  4  
ATOM 6407  H HE1  . TYR A 1 60  ? 7.016   17.445  2.923   1.00 0.00 ? 60  TYR A HE1  4  
ATOM 6408  H HE2  . TYR A 1 60  ? 4.158   14.590  4.296   1.00 0.00 ? 60  TYR A HE2  4  
ATOM 6409  H HH   . TYR A 1 60  ? 4.055   17.384  3.695   1.00 0.00 ? 60  TYR A HH   4  
ATOM 6410  N N    . HIS A 1 61  ? 8.649   14.485  -0.629  1.00 0.00 ? 61  HIS A N    4  
ATOM 6411  C CA   . HIS A 1 61  ? 8.862   15.708  -1.395  1.00 0.00 ? 61  HIS A CA   4  
ATOM 6412  C C    . HIS A 1 61  ? 8.146   15.637  -2.741  1.00 0.00 ? 61  HIS A C    4  
ATOM 6413  O O    . HIS A 1 61  ? 7.353   16.515  -3.080  1.00 0.00 ? 61  HIS A O    4  
ATOM 6414  C CB   . HIS A 1 61  ? 10.356  15.946  -1.612  1.00 0.00 ? 61  HIS A CB   4  
ATOM 6415  C CG   . HIS A 1 61  ? 11.032  16.605  -0.449  1.00 0.00 ? 61  HIS A CG   4  
ATOM 6416  N ND1  . HIS A 1 61  ? 10.446  17.608  0.293   1.00 0.00 ? 61  HIS A ND1  4  
ATOM 6417  C CD2  . HIS A 1 61  ? 12.252  16.396  0.100   1.00 0.00 ? 61  HIS A CD2  4  
ATOM 6418  C CE1  . HIS A 1 61  ? 11.277  17.990  1.247   1.00 0.00 ? 61  HIS A CE1  4  
ATOM 6419  N NE2  . HIS A 1 61  ? 12.380  17.270  1.152   1.00 0.00 ? 61  HIS A NE2  4  
ATOM 6420  H H    . HIS A 1 61  ? 9.422   14.023  -0.242  1.00 0.00 ? 61  HIS A H    4  
ATOM 6421  H HA   . HIS A 1 61  ? 8.453   16.530  -0.827  1.00 0.00 ? 61  HIS A HA   4  
ATOM 6422  H HB2  . HIS A 1 61  ? 10.844  14.998  -1.785  1.00 0.00 ? 61  HIS A HB2  4  
ATOM 6423  H HB3  . HIS A 1 61  ? 10.492  16.579  -2.477  1.00 0.00 ? 61  HIS A HB3  4  
ATOM 6424  H HD1  . HIS A 1 61  ? 9.555   17.986  0.142   1.00 0.00 ? 61  HIS A HD1  4  
ATOM 6425  H HD2  . HIS A 1 61  ? 12.989  15.677  -0.228  1.00 0.00 ? 61  HIS A HD2  4  
ATOM 6426  H HE1  . HIS A 1 61  ? 11.087  18.760  1.980   1.00 0.00 ? 61  HIS A HE1  4  
ATOM 6427  H HE2  . HIS A 1 61  ? 13.191  17.408  1.683   1.00 0.00 ? 61  HIS A HE2  4  
ATOM 6428  N N    . ASN A 1 62  ? 8.431   14.587  -3.503  1.00 0.00 ? 62  ASN A N    4  
ATOM 6429  C CA   . ASN A 1 62  ? 7.816   14.402  -4.812  1.00 0.00 ? 62  ASN A CA   4  
ATOM 6430  C C    . ASN A 1 62  ? 6.296   14.497  -4.717  1.00 0.00 ? 62  ASN A C    4  
ATOM 6431  O O    . ASN A 1 62  ? 5.653   15.165  -5.525  1.00 0.00 ? 62  ASN A O    4  
ATOM 6432  C CB   . ASN A 1 62  ? 8.218   13.049  -5.402  1.00 0.00 ? 62  ASN A CB   4  
ATOM 6433  C CG   . ASN A 1 62  ? 8.294   13.077  -6.916  1.00 0.00 ? 62  ASN A CG   4  
ATOM 6434  O OD1  . ASN A 1 62  ? 8.907   13.970  -7.501  1.00 0.00 ? 62  ASN A OD1  4  
ATOM 6435  N ND2  . ASN A 1 62  ? 7.668   12.098  -7.558  1.00 0.00 ? 62  ASN A ND2  4  
ATOM 6436  H H    . ASN A 1 62  ? 9.072   13.920  -3.178  1.00 0.00 ? 62  ASN A H    4  
ATOM 6437  H HA   . ASN A 1 62  ? 8.174   15.188  -5.460  1.00 0.00 ? 62  ASN A HA   4  
ATOM 6438  H HB2  . ASN A 1 62  ? 9.188   12.769  -5.017  1.00 0.00 ? 62  ASN A HB2  4  
ATOM 6439  H HB3  . ASN A 1 62  ? 7.491   12.305  -5.110  1.00 0.00 ? 62  ASN A HB3  4  
ATOM 6440  H HD21 . ASN A 1 62  ? 7.199   11.421  -7.027  1.00 0.00 ? 62  ASN A HD21 4  
ATOM 6441  H HD22 . ASN A 1 62  ? 7.702   12.091  -8.538  1.00 0.00 ? 62  ASN A HD22 4  
ATOM 6442  N N    . GLY A 1 63  ? 5.728   13.822  -3.722  1.00 0.00 ? 63  GLY A N    4  
ATOM 6443  C CA   . GLY A 1 63  ? 4.288   13.844  -3.538  1.00 0.00 ? 63  GLY A CA   4  
ATOM 6444  C C    . GLY A 1 63  ? 3.560   13.004  -4.569  1.00 0.00 ? 63  GLY A C    4  
ATOM 6445  O O    . GLY A 1 63  ? 2.463   13.356  -5.004  1.00 0.00 ? 63  GLY A O    4  
ATOM 6446  H H    . GLY A 1 63  ? 6.290   13.306  -3.107  1.00 0.00 ? 63  GLY A H    4  
ATOM 6447  H HA2  . GLY A 1 63  ? 4.056   13.467  -2.553  1.00 0.00 ? 63  GLY A HA2  4  
ATOM 6448  H HA3  . GLY A 1 63  ? 3.943   14.864  -3.613  1.00 0.00 ? 63  GLY A HA3  4  
ATOM 6449  N N    . HIS A 1 64  ? 4.171   11.891  -4.962  1.00 0.00 ? 64  HIS A N    4  
ATOM 6450  C CA   . HIS A 1 64  ? 3.574   11.000  -5.950  1.00 0.00 ? 64  HIS A CA   4  
ATOM 6451  C C    . HIS A 1 64  ? 3.366   9.605   -5.367  1.00 0.00 ? 64  HIS A C    4  
ATOM 6452  O O    . HIS A 1 64  ? 2.356   8.954   -5.637  1.00 0.00 ? 64  HIS A O    4  
ATOM 6453  C CB   . HIS A 1 64  ? 4.457   10.919  -7.195  1.00 0.00 ? 64  HIS A CB   4  
ATOM 6454  C CG   . HIS A 1 64  ? 4.514   12.197  -7.974  1.00 0.00 ? 64  HIS A CG   4  
ATOM 6455  N ND1  . HIS A 1 64  ? 3.740   12.432  -9.091  1.00 0.00 ? 64  HIS A ND1  4  
ATOM 6456  C CD2  . HIS A 1 64  ? 5.256   13.313  -7.790  1.00 0.00 ? 64  HIS A CD2  4  
ATOM 6457  C CE1  . HIS A 1 64  ? 4.006   13.638  -9.562  1.00 0.00 ? 64  HIS A CE1  4  
ATOM 6458  N NE2  . HIS A 1 64  ? 4.922   14.194  -8.790  1.00 0.00 ? 64  HIS A NE2  4  
ATOM 6459  H H    . HIS A 1 64  ? 5.044   11.665  -4.579  1.00 0.00 ? 64  HIS A H    4  
ATOM 6460  H HA   . HIS A 1 64  ? 2.613   11.407  -6.227  1.00 0.00 ? 64  HIS A HA   4  
ATOM 6461  H HB2  . HIS A 1 64  ? 5.464   10.667  -6.898  1.00 0.00 ? 64  HIS A HB2  4  
ATOM 6462  H HB3  . HIS A 1 64  ? 4.077   10.147  -7.849  1.00 0.00 ? 64  HIS A HB3  4  
ATOM 6463  H HD1  . HIS A 1 64  ? 3.094   11.808  -9.482  1.00 0.00 ? 64  HIS A HD1  4  
ATOM 6464  H HD2  . HIS A 1 64  ? 5.978   13.481  -7.003  1.00 0.00 ? 64  HIS A HD2  4  
ATOM 6465  H HE1  . HIS A 1 64  ? 3.552   14.092  -10.429 1.00 0.00 ? 64  HIS A HE1  4  
ATOM 6466  H HE2  . HIS A 1 64  ? 5.361   15.052  -8.964  1.00 0.00 ? 64  HIS A HE2  4  
ATOM 6467  N N    . ILE A 1 65  ? 4.327   9.154   -4.569  1.00 0.00 ? 65  ILE A N    4  
ATOM 6468  C CA   . ILE A 1 65  ? 4.248   7.837   -3.949  1.00 0.00 ? 65  ILE A CA   4  
ATOM 6469  C C    . ILE A 1 65  ? 3.726   7.933   -2.519  1.00 0.00 ? 65  ILE A C    4  
ATOM 6470  O O    . ILE A 1 65  ? 4.301   8.630   -1.684  1.00 0.00 ? 65  ILE A O    4  
ATOM 6471  C CB   . ILE A 1 65  ? 5.621   7.138   -3.936  1.00 0.00 ? 65  ILE A CB   4  
ATOM 6472  C CG1  . ILE A 1 65  ? 6.114   6.908   -5.366  1.00 0.00 ? 65  ILE A CG1  4  
ATOM 6473  C CG2  . ILE A 1 65  ? 5.537   5.819   -3.181  1.00 0.00 ? 65  ILE A CG2  4  
ATOM 6474  C CD1  . ILE A 1 65  ? 7.621   6.921   -5.495  1.00 0.00 ? 65  ILE A CD1  4  
ATOM 6475  H H    . ILE A 1 65  ? 5.107   9.719   -4.392  1.00 0.00 ? 65  ILE A H    4  
ATOM 6476  H HA   . ILE A 1 65  ? 3.565   7.235   -4.531  1.00 0.00 ? 65  ILE A HA   4  
ATOM 6477  H HB   . ILE A 1 65  ? 6.320   7.776   -3.420  1.00 0.00 ? 65  ILE A HB   4  
ATOM 6478  H HG12 . ILE A 1 65  ? 5.760   5.951   -5.713  1.00 0.00 ? 65  ILE A HG12 4  
ATOM 6479  H HG13 . ILE A 1 65  ? 5.719   7.686   -6.004  1.00 0.00 ? 65  ILE A HG13 4  
ATOM 6480  H HG21 . ILE A 1 65  ? 5.691   5.001   -3.869  1.00 0.00 ? 65  ILE A HG21 4  
ATOM 6481  H HG22 . ILE A 1 65  ? 6.297   5.794   -2.416  1.00 0.00 ? 65  ILE A HG22 4  
ATOM 6482  H HG23 . ILE A 1 65  ? 4.563   5.727   -2.725  1.00 0.00 ? 65  ILE A HG23 4  
ATOM 6483  H HD11 . ILE A 1 65  ? 8.017   7.800   -5.009  1.00 0.00 ? 65  ILE A HD11 4  
ATOM 6484  H HD12 . ILE A 1 65  ? 8.030   6.036   -5.031  1.00 0.00 ? 65  ILE A HD12 4  
ATOM 6485  H HD13 . ILE A 1 65  ? 7.892   6.937   -6.541  1.00 0.00 ? 65  ILE A HD13 4  
ATOM 6486  N N    . GLN A 1 66  ? 2.634   7.226   -2.245  1.00 0.00 ? 66  GLN A N    4  
ATOM 6487  C CA   . GLN A 1 66  ? 2.035   7.231   -0.916  1.00 0.00 ? 66  GLN A CA   4  
ATOM 6488  C C    . GLN A 1 66  ? 1.537   5.840   -0.538  1.00 0.00 ? 66  GLN A C    4  
ATOM 6489  O O    . GLN A 1 66  ? 1.432   4.955   -1.387  1.00 0.00 ? 66  GLN A O    4  
ATOM 6490  C CB   . GLN A 1 66  ? 0.881   8.233   -0.857  1.00 0.00 ? 66  GLN A CB   4  
ATOM 6491  C CG   . GLN A 1 66  ? 1.243   9.610   -1.389  1.00 0.00 ? 66  GLN A CG   4  
ATOM 6492  C CD   . GLN A 1 66  ? 0.965   9.755   -2.872  1.00 0.00 ? 66  GLN A CD   4  
ATOM 6493  O OE1  . GLN A 1 66  ? 0.050   9.129   -3.408  1.00 0.00 ? 66  GLN A OE1  4  
ATOM 6494  N NE2  . GLN A 1 66  ? 1.756   10.583  -3.545  1.00 0.00 ? 66  GLN A NE2  4  
ATOM 6495  H H    . GLN A 1 66  ? 2.222   6.690   -2.953  1.00 0.00 ? 66  GLN A H    4  
ATOM 6496  H HA   . GLN A 1 66  ? 2.796   7.531   -0.211  1.00 0.00 ? 66  GLN A HA   4  
ATOM 6497  H HB2  . GLN A 1 66  ? 0.057   7.850   -1.442  1.00 0.00 ? 66  GLN A HB2  4  
ATOM 6498  H HB3  . GLN A 1 66  ? 0.564   8.340   0.170   1.00 0.00 ? 66  GLN A HB3  4  
ATOM 6499  H HG2  . GLN A 1 66  ? 0.665   10.351  -0.857  1.00 0.00 ? 66  GLN A HG2  4  
ATOM 6500  H HG3  . GLN A 1 66  ? 2.295   9.784   -1.215  1.00 0.00 ? 66  GLN A HG3  4  
ATOM 6501  H HE21 . GLN A 1 66  ? 2.465   11.048  -3.052  1.00 0.00 ? 66  GLN A HE21 4  
ATOM 6502  H HE22 . GLN A 1 66  ? 1.599   10.695  -4.505  1.00 0.00 ? 66  GLN A HE22 4  
ATOM 6503  N N    . VAL A 1 67  ? 1.231   5.654   0.742   1.00 0.00 ? 67  VAL A N    4  
ATOM 6504  C CA   . VAL A 1 67  ? 0.743   4.371   1.232   1.00 0.00 ? 67  VAL A CA   4  
ATOM 6505  C C    . VAL A 1 67  ? -0.448  3.886   0.412   1.00 0.00 ? 67  VAL A C    4  
ATOM 6506  O O    . VAL A 1 67  ? -0.965  4.610   -0.437  1.00 0.00 ? 67  VAL A O    4  
ATOM 6507  C CB   . VAL A 1 67  ? 0.330   4.456   2.714   1.00 0.00 ? 67  VAL A CB   4  
ATOM 6508  C CG1  . VAL A 1 67  ? 1.533   4.786   3.585   1.00 0.00 ? 67  VAL A CG1  4  
ATOM 6509  C CG2  . VAL A 1 67  ? -0.773  5.487   2.901   1.00 0.00 ? 67  VAL A CG2  4  
ATOM 6510  H H    . VAL A 1 67  ? 1.335   6.398   1.371   1.00 0.00 ? 67  VAL A H    4  
ATOM 6511  H HA   . VAL A 1 67  ? 1.545   3.652   1.144   1.00 0.00 ? 67  VAL A HA   4  
ATOM 6512  H HB   . VAL A 1 67  ? -0.051  3.492   3.017   1.00 0.00 ? 67  VAL A HB   4  
ATOM 6513  H HG11 . VAL A 1 67  ? 1.457   4.252   4.520   1.00 0.00 ? 67  VAL A HG11 4  
ATOM 6514  H HG12 . VAL A 1 67  ? 2.439   4.494   3.074   1.00 0.00 ? 67  VAL A HG12 4  
ATOM 6515  H HG13 . VAL A 1 67  ? 1.555   5.849   3.779   1.00 0.00 ? 67  VAL A HG13 4  
ATOM 6516  H HG21 . VAL A 1 67  ? -1.066  5.514   3.940   1.00 0.00 ? 67  VAL A HG21 4  
ATOM 6517  H HG22 . VAL A 1 67  ? -0.411  6.460   2.604   1.00 0.00 ? 67  VAL A HG22 4  
ATOM 6518  H HG23 . VAL A 1 67  ? -1.624  5.218   2.293   1.00 0.00 ? 67  VAL A HG23 4  
ATOM 6519  N N    . ASN A 1 68  ? -0.877  2.655   0.673   1.00 0.00 ? 68  ASN A N    4  
ATOM 6520  C CA   . ASN A 1 68  ? -2.007  2.072   -0.041  1.00 0.00 ? 68  ASN A CA   4  
ATOM 6521  C C    . ASN A 1 68  ? -1.729  2.010   -1.540  1.00 0.00 ? 68  ASN A C    4  
ATOM 6522  O O    . ASN A 1 68  ? -2.639  2.158   -2.357  1.00 0.00 ? 68  ASN A O    4  
ATOM 6523  C CB   . ASN A 1 68  ? -3.276  2.885   0.220   1.00 0.00 ? 68  ASN A CB   4  
ATOM 6524  C CG   . ASN A 1 68  ? -3.572  3.035   1.700   1.00 0.00 ? 68  ASN A CG   4  
ATOM 6525  O OD1  . ASN A 1 68  ? -2.696  2.840   2.542   1.00 0.00 ? 68  ASN A OD1  4  
ATOM 6526  N ND2  . ASN A 1 68  ? -4.813  3.383   2.023   1.00 0.00 ? 68  ASN A ND2  4  
ATOM 6527  H H    . ASN A 1 68  ? -0.423  2.126   1.362   1.00 0.00 ? 68  ASN A H    4  
ATOM 6528  H HA   . ASN A 1 68  ? -2.150  1.068   0.328   1.00 0.00 ? 68  ASN A HA   4  
ATOM 6529  H HB2  . ASN A 1 68  ? -3.159  3.872   -0.205  1.00 0.00 ? 68  ASN A HB2  4  
ATOM 6530  H HB3  . ASN A 1 68  ? -4.115  2.393   -0.248  1.00 0.00 ? 68  ASN A HB3  4  
ATOM 6531  H HD21 . ASN A 1 68  ? -5.458  3.522   1.299   1.00 0.00 ? 68  ASN A HD21 4  
ATOM 6532  H HD22 . ASN A 1 68  ? -5.031  3.488   2.973   1.00 0.00 ? 68  ASN A HD22 4  
ATOM 6533  N N    . ASP A 1 69  ? -0.468  1.791   -1.894  1.00 0.00 ? 69  ASP A N    4  
ATOM 6534  C CA   . ASP A 1 69  ? -0.070  1.707   -3.295  1.00 0.00 ? 69  ASP A CA   4  
ATOM 6535  C C    . ASP A 1 69  ? 0.631   0.383   -3.582  1.00 0.00 ? 69  ASP A C    4  
ATOM 6536  O O    . ASP A 1 69  ? 1.318   -0.168  -2.722  1.00 0.00 ? 69  ASP A O    4  
ATOM 6537  C CB   . ASP A 1 69  ? 0.850   2.875   -3.656  1.00 0.00 ? 69  ASP A CB   4  
ATOM 6538  C CG   . ASP A 1 69  ? 0.080   4.105   -4.093  1.00 0.00 ? 69  ASP A CG   4  
ATOM 6539  O OD1  . ASP A 1 69  ? -0.419  4.837   -3.212  1.00 0.00 ? 69  ASP A OD1  4  
ATOM 6540  O OD2  . ASP A 1 69  ? -0.023  4.337   -5.315  1.00 0.00 ? 69  ASP A OD2  4  
ATOM 6541  H H    . ASP A 1 69  ? 0.212   1.682   -1.196  1.00 0.00 ? 69  ASP A H    4  
ATOM 6542  H HA   . ASP A 1 69  ? -0.964  1.766   -3.897  1.00 0.00 ? 69  ASP A HA   4  
ATOM 6543  H HB2  . ASP A 1 69  ? 1.448   3.134   -2.794  1.00 0.00 ? 69  ASP A HB2  4  
ATOM 6544  H HB3  . ASP A 1 69  ? 1.502   2.574   -4.463  1.00 0.00 ? 69  ASP A HB3  4  
ATOM 6545  N N    . LYS A 1 70  ? 0.451   -0.123  -4.797  1.00 0.00 ? 70  LYS A N    4  
ATOM 6546  C CA   . LYS A 1 70  ? 1.065   -1.383  -5.200  1.00 0.00 ? 70  LYS A CA   4  
ATOM 6547  C C    . LYS A 1 70  ? 2.190   -1.144  -6.203  1.00 0.00 ? 70  LYS A C    4  
ATOM 6548  O O    . LYS A 1 70  ? 1.965   -0.596  -7.283  1.00 0.00 ? 70  LYS A O    4  
ATOM 6549  C CB   . LYS A 1 70  ? 0.015   -2.315  -5.808  1.00 0.00 ? 70  LYS A CB   4  
ATOM 6550  C CG   . LYS A 1 70  ? 0.360   -3.788  -5.678  1.00 0.00 ? 70  LYS A CG   4  
ATOM 6551  C CD   . LYS A 1 70  ? -0.247  -4.605  -6.806  1.00 0.00 ? 70  LYS A CD   4  
ATOM 6552  C CE   . LYS A 1 70  ? 0.696   -4.701  -7.995  1.00 0.00 ? 70  LYS A CE   4  
ATOM 6553  N NZ   . LYS A 1 70  ? -0.004  -5.175  -9.221  1.00 0.00 ? 70  LYS A NZ   4  
ATOM 6554  H H    . LYS A 1 70  ? -0.108  0.362   -5.440  1.00 0.00 ? 70  LYS A H    4  
ATOM 6555  H HA   . LYS A 1 70  ? 1.479   -1.848  -4.318  1.00 0.00 ? 70  LYS A HA   4  
ATOM 6556  H HB2  . LYS A 1 70  ? -0.930  -2.143  -5.315  1.00 0.00 ? 70  LYS A HB2  4  
ATOM 6557  H HB3  . LYS A 1 70  ? -0.090  -2.083  -6.859  1.00 0.00 ? 70  LYS A HB3  4  
ATOM 6558  H HG2  . LYS A 1 70  ? 1.434   -3.901  -5.704  1.00 0.00 ? 70  LYS A HG2  4  
ATOM 6559  H HG3  . LYS A 1 70  ? -0.019  -4.155  -4.735  1.00 0.00 ? 70  LYS A HG3  4  
ATOM 6560  H HD2  . LYS A 1 70  ? -0.455  -5.602  -6.445  1.00 0.00 ? 70  LYS A HD2  4  
ATOM 6561  H HD3  . LYS A 1 70  ? -1.167  -4.136  -7.124  1.00 0.00 ? 70  LYS A HD3  4  
ATOM 6562  H HE2  . LYS A 1 70  ? 1.114   -3.724  -8.186  1.00 0.00 ? 70  LYS A HE2  4  
ATOM 6563  H HE3  . LYS A 1 70  ? 1.490   -5.392  -7.754  1.00 0.00 ? 70  LYS A HE3  4  
ATOM 6564  H HZ1  . LYS A 1 70  ? -0.772  -4.520  -9.470  1.00 0.00 ? 70  LYS A HZ1  4  
ATOM 6565  H HZ2  . LYS A 1 70  ? -0.408  -6.120  -9.059  1.00 0.00 ? 70  LYS A HZ2  4  
ATOM 6566  H HZ3  . LYS A 1 70  ? 0.664   -5.228  -10.017 1.00 0.00 ? 70  LYS A HZ3  4  
ATOM 6567  N N    . ILE A 1 71  ? 3.398   -1.559  -5.840  1.00 0.00 ? 71  ILE A N    4  
ATOM 6568  C CA   . ILE A 1 71  ? 4.556   -1.392  -6.709  1.00 0.00 ? 71  ILE A CA   4  
ATOM 6569  C C    . ILE A 1 71  ? 4.768   -2.622  -7.585  1.00 0.00 ? 71  ILE A C    4  
ATOM 6570  O O    . ILE A 1 71  ? 4.896   -3.739  -7.084  1.00 0.00 ? 71  ILE A O    4  
ATOM 6571  C CB   . ILE A 1 71  ? 5.837   -1.127  -5.896  1.00 0.00 ? 71  ILE A CB   4  
ATOM 6572  C CG1  . ILE A 1 71  ? 5.667   0.119   -5.025  1.00 0.00 ? 71  ILE A CG1  4  
ATOM 6573  C CG2  . ILE A 1 71  ? 7.032   -0.971  -6.825  1.00 0.00 ? 71  ILE A CG2  4  
ATOM 6574  C CD1  . ILE A 1 71  ? 4.834   -0.119  -3.785  1.00 0.00 ? 71  ILE A CD1  4  
ATOM 6575  H H    . ILE A 1 71  ? 3.514   -1.988  -4.967  1.00 0.00 ? 71  ILE A H    4  
ATOM 6576  H HA   . ILE A 1 71  ? 4.375   -0.537  -7.345  1.00 0.00 ? 71  ILE A HA   4  
ATOM 6577  H HB   . ILE A 1 71  ? 6.016   -1.981  -5.260  1.00 0.00 ? 71  ILE A HB   4  
ATOM 6578  H HG12 . ILE A 1 71  ? 6.638   0.466   -4.710  1.00 0.00 ? 71  ILE A HG12 4  
ATOM 6579  H HG13 . ILE A 1 71  ? 5.184   0.892   -5.606  1.00 0.00 ? 71  ILE A HG13 4  
ATOM 6580  H HG21 . ILE A 1 71  ? 6.947   -1.674  -7.641  1.00 0.00 ? 71  ILE A HG21 4  
ATOM 6581  H HG22 . ILE A 1 71  ? 7.052   0.034   -7.219  1.00 0.00 ? 71  ILE A HG22 4  
ATOM 6582  H HG23 . ILE A 1 71  ? 7.942   -1.163  -6.278  1.00 0.00 ? 71  ILE A HG23 4  
ATOM 6583  H HD11 . ILE A 1 71  ? 5.333   0.309   -2.928  1.00 0.00 ? 71  ILE A HD11 4  
ATOM 6584  H HD12 . ILE A 1 71  ? 3.866   0.341   -3.907  1.00 0.00 ? 71  ILE A HD12 4  
ATOM 6585  H HD13 . ILE A 1 71  ? 4.710   -1.182  -3.634  1.00 0.00 ? 71  ILE A HD13 4  
ATOM 6586  N N    . VAL A 1 72  ? 4.806   -2.408  -8.896  1.00 0.00 ? 72  VAL A N    4  
ATOM 6587  C CA   . VAL A 1 72  ? 5.006   -3.499  -9.843  1.00 0.00 ? 72  VAL A CA   4  
ATOM 6588  C C    . VAL A 1 72  ? 6.421   -3.483  -10.409 1.00 0.00 ? 72  VAL A C    4  
ATOM 6589  O O    . VAL A 1 72  ? 6.921   -4.501  -10.887 1.00 0.00 ? 72  VAL A O    4  
ATOM 6590  C CB   . VAL A 1 72  ? 3.999   -3.424  -11.006 1.00 0.00 ? 72  VAL A CB   4  
ATOM 6591  C CG1  . VAL A 1 72  ? 2.609   -3.829  -10.536 1.00 0.00 ? 72  VAL A CG1  4  
ATOM 6592  C CG2  . VAL A 1 72  ? 3.982   -2.027  -11.607 1.00 0.00 ? 72  VAL A CG2  4  
ATOM 6593  H H    . VAL A 1 72  ? 4.698   -1.495  -9.235  1.00 0.00 ? 72  VAL A H    4  
ATOM 6594  H HA   . VAL A 1 72  ? 4.849   -4.430  -9.318  1.00 0.00 ? 72  VAL A HA   4  
ATOM 6595  H HB   . VAL A 1 72  ? 4.312   -4.119  -11.772 1.00 0.00 ? 72  VAL A HB   4  
ATOM 6596  H HG11 . VAL A 1 72  ? 1.906   -3.708  -11.347 1.00 0.00 ? 72  VAL A HG11 4  
ATOM 6597  H HG12 . VAL A 1 72  ? 2.622   -4.861  -10.220 1.00 0.00 ? 72  VAL A HG12 4  
ATOM 6598  H HG13 . VAL A 1 72  ? 2.313   -3.202  -9.708  1.00 0.00 ? 72  VAL A HG13 4  
ATOM 6599  H HG21 . VAL A 1 72  ? 3.735   -2.090  -12.656 1.00 0.00 ? 72  VAL A HG21 4  
ATOM 6600  H HG22 . VAL A 1 72  ? 3.242   -1.425  -11.099 1.00 0.00 ? 72  VAL A HG22 4  
ATOM 6601  H HG23 . VAL A 1 72  ? 4.955   -1.573  -11.492 1.00 0.00 ? 72  VAL A HG23 4  
ATOM 6602  N N    . ALA A 1 73  ? 7.063   -2.321  -10.351 1.00 0.00 ? 73  ALA A N    4  
ATOM 6603  C CA   . ALA A 1 73  ? 8.422   -2.172  -10.856 1.00 0.00 ? 73  ALA A CA   4  
ATOM 6604  C C    . ALA A 1 73  ? 9.127   -0.993  -10.195 1.00 0.00 ? 73  ALA A C    4  
ATOM 6605  O O    . ALA A 1 73  ? 8.521   0.052   -9.957  1.00 0.00 ? 73  ALA A O    4  
ATOM 6606  C CB   . ALA A 1 73  ? 8.408   -2.002  -12.368 1.00 0.00 ? 73  ALA A CB   4  
ATOM 6607  H H    . ALA A 1 73  ? 6.611   -1.545  -9.959  1.00 0.00 ? 73  ALA A H    4  
ATOM 6608  H HA   . ALA A 1 73  ? 8.964   -3.078  -10.626 1.00 0.00 ? 73  ALA A HA   4  
ATOM 6609  H HB1  . ALA A 1 73  ? 9.226   -1.362  -12.665 1.00 0.00 ? 73  ALA A HB1  4  
ATOM 6610  H HB2  . ALA A 1 73  ? 8.516   -2.967  -12.840 1.00 0.00 ? 73  ALA A HB2  4  
ATOM 6611  H HB3  . ALA A 1 73  ? 7.473   -1.555  -12.671 1.00 0.00 ? 73  ALA A HB3  4  
ATOM 6612  N N    . VAL A 1 74  ? 10.412  -1.167  -9.901  1.00 0.00 ? 74  VAL A N    4  
ATOM 6613  C CA   . VAL A 1 74  ? 11.200  -0.116  -9.268  1.00 0.00 ? 74  VAL A CA   4  
ATOM 6614  C C    . VAL A 1 74  ? 12.438  0.215   -10.093 1.00 0.00 ? 74  VAL A C    4  
ATOM 6615  O O    . VAL A 1 74  ? 13.249  -0.661  -10.394 1.00 0.00 ? 74  VAL A O    4  
ATOM 6616  C CB   . VAL A 1 74  ? 11.637  -0.521  -7.847  1.00 0.00 ? 74  VAL A CB   4  
ATOM 6617  C CG1  . VAL A 1 74  ? 12.488  0.572   -7.219  1.00 0.00 ? 74  VAL A CG1  4  
ATOM 6618  C CG2  . VAL A 1 74  ? 10.422  -0.825  -6.984  1.00 0.00 ? 74  VAL A CG2  4  
ATOM 6619  H H    . VAL A 1 74  ? 10.840  -2.022  -10.116 1.00 0.00 ? 74  VAL A H    4  
ATOM 6620  H HA   . VAL A 1 74  ? 10.582  0.767   -9.194  1.00 0.00 ? 74  VAL A HA   4  
ATOM 6621  H HB   . VAL A 1 74  ? 12.235  -1.417  -7.918  1.00 0.00 ? 74  VAL A HB   4  
ATOM 6622  H HG11 . VAL A 1 74  ? 13.196  0.127   -6.535  1.00 0.00 ? 74  VAL A HG11 4  
ATOM 6623  H HG12 . VAL A 1 74  ? 13.019  1.105   -7.993  1.00 0.00 ? 74  VAL A HG12 4  
ATOM 6624  H HG13 . VAL A 1 74  ? 11.851  1.258   -6.680  1.00 0.00 ? 74  VAL A HG13 4  
ATOM 6625  H HG21 . VAL A 1 74  ? 10.581  -1.753  -6.454  1.00 0.00 ? 74  VAL A HG21 4  
ATOM 6626  H HG22 . VAL A 1 74  ? 10.276  -0.025  -6.272  1.00 0.00 ? 74  VAL A HG22 4  
ATOM 6627  H HG23 . VAL A 1 74  ? 9.547   -0.914  -7.610  1.00 0.00 ? 74  VAL A HG23 4  
ATOM 6628  N N    . ASP A 1 75  ? 12.578  1.485   -10.457 1.00 0.00 ? 75  ASP A N    4  
ATOM 6629  C CA   . ASP A 1 75  ? 13.719  1.934   -11.247 1.00 0.00 ? 75  ASP A CA   4  
ATOM 6630  C C    . ASP A 1 75  ? 13.732  1.257   -12.614 1.00 0.00 ? 75  ASP A C    4  
ATOM 6631  O O    . ASP A 1 75  ? 14.793  1.035   -13.197 1.00 0.00 ? 75  ASP A O    4  
ATOM 6632  C CB   . ASP A 1 75  ? 15.025  1.642   -10.506 1.00 0.00 ? 75  ASP A CB   4  
ATOM 6633  C CG   . ASP A 1 75  ? 16.114  2.643   -10.838 1.00 0.00 ? 75  ASP A CG   4  
ATOM 6634  O OD1  . ASP A 1 75  ? 16.815  2.444   -11.852 1.00 0.00 ? 75  ASP A OD1  4  
ATOM 6635  O OD2  . ASP A 1 75  ? 16.264  3.627   -10.083 1.00 0.00 ? 75  ASP A OD2  4  
ATOM 6636  H H    . ASP A 1 75  ? 11.897  2.137   -10.187 1.00 0.00 ? 75  ASP A H    4  
ATOM 6637  H HA   . ASP A 1 75  ? 13.626  3.000   -11.388 1.00 0.00 ? 75  ASP A HA   4  
ATOM 6638  H HB2  . ASP A 1 75  ? 14.843  1.675   -9.442  1.00 0.00 ? 75  ASP A HB2  4  
ATOM 6639  H HB3  . ASP A 1 75  ? 15.372  0.656   -10.777 1.00 0.00 ? 75  ASP A HB3  4  
ATOM 6640  N N    . GLY A 1 76  ? 12.547  0.931   -13.119 1.00 0.00 ? 76  GLY A N    4  
ATOM 6641  C CA   . GLY A 1 76  ? 12.445  0.282   -14.413 1.00 0.00 ? 76  GLY A CA   4  
ATOM 6642  C C    . GLY A 1 76  ? 12.717  -1.208  -14.338 1.00 0.00 ? 76  GLY A C    4  
ATOM 6643  O O    . GLY A 1 76  ? 13.048  -1.837  -15.342 1.00 0.00 ? 76  GLY A O    4  
ATOM 6644  H H    . GLY A 1 76  ? 11.734  1.133   -12.609 1.00 0.00 ? 76  GLY A H    4  
ATOM 6645  H HA2  . GLY A 1 76  ? 11.450  0.436   -14.804 1.00 0.00 ? 76  GLY A HA2  4  
ATOM 6646  H HA3  . GLY A 1 76  ? 13.160  0.733   -15.086 1.00 0.00 ? 76  GLY A HA3  4  
ATOM 6647  N N    . VAL A 1 77  ? 12.578  -1.773  -13.143 1.00 0.00 ? 77  VAL A N    4  
ATOM 6648  C CA   . VAL A 1 77  ? 12.812  -3.198  -12.940 1.00 0.00 ? 77  VAL A CA   4  
ATOM 6649  C C    . VAL A 1 77  ? 11.560  -3.890  -12.413 1.00 0.00 ? 77  VAL A C    4  
ATOM 6650  O O    . VAL A 1 77  ? 11.036  -3.531  -11.360 1.00 0.00 ? 77  VAL A O    4  
ATOM 6651  C CB   . VAL A 1 77  ? 13.972  -3.442  -11.956 1.00 0.00 ? 77  VAL A CB   4  
ATOM 6652  C CG1  . VAL A 1 77  ? 14.114  -4.926  -11.656 1.00 0.00 ? 77  VAL A CG1  4  
ATOM 6653  C CG2  . VAL A 1 77  ? 15.269  -2.875  -12.513 1.00 0.00 ? 77  VAL A CG2  4  
ATOM 6654  H H    . VAL A 1 77  ? 12.311  -1.219  -12.380 1.00 0.00 ? 77  VAL A H    4  
ATOM 6655  H HA   . VAL A 1 77  ? 13.078  -3.632  -13.893 1.00 0.00 ? 77  VAL A HA   4  
ATOM 6656  H HB   . VAL A 1 77  ? 13.747  -2.930  -11.032 1.00 0.00 ? 77  VAL A HB   4  
ATOM 6657  H HG11 . VAL A 1 77  ? 13.221  -5.281  -11.163 1.00 0.00 ? 77  VAL A HG11 4  
ATOM 6658  H HG12 . VAL A 1 77  ? 14.257  -5.468  -12.579 1.00 0.00 ? 77  VAL A HG12 4  
ATOM 6659  H HG13 . VAL A 1 77  ? 14.967  -5.082  -11.011 1.00 0.00 ? 77  VAL A HG13 4  
ATOM 6660  H HG21 . VAL A 1 77  ? 15.102  -1.865  -12.857 1.00 0.00 ? 77  VAL A HG21 4  
ATOM 6661  H HG22 . VAL A 1 77  ? 16.022  -2.870  -11.738 1.00 0.00 ? 77  VAL A HG22 4  
ATOM 6662  H HG23 . VAL A 1 77  ? 15.606  -3.486  -13.337 1.00 0.00 ? 77  VAL A HG23 4  
ATOM 6663  N N    . ASN A 1 78  ? 11.085  -4.886  -13.154 1.00 0.00 ? 78  ASN A N    4  
ATOM 6664  C CA   . ASN A 1 78  ? 9.894   -5.630  -12.762 1.00 0.00 ? 78  ASN A CA   4  
ATOM 6665  C C    . ASN A 1 78  ? 10.142  -6.419  -11.481 1.00 0.00 ? 78  ASN A C    4  
ATOM 6666  O O    . ASN A 1 78  ? 10.642  -7.544  -11.519 1.00 0.00 ? 78  ASN A O    4  
ATOM 6667  C CB   . ASN A 1 78  ? 9.467   -6.579  -13.884 1.00 0.00 ? 78  ASN A CB   4  
ATOM 6668  C CG   . ASN A 1 78  ? 8.308   -7.470  -13.479 1.00 0.00 ? 78  ASN A CG   4  
ATOM 6669  O OD1  . ASN A 1 78  ? 7.199   -6.993  -13.242 1.00 0.00 ? 78  ASN A OD1  4  
ATOM 6670  N ND2  . ASN A 1 78  ? 8.562   -8.771  -13.399 1.00 0.00 ? 78  ASN A ND2  4  
ATOM 6671  H H    . ASN A 1 78  ? 11.547  -5.127  -13.985 1.00 0.00 ? 78  ASN A H    4  
ATOM 6672  H HA   . ASN A 1 78  ? 9.102   -4.918  -12.585 1.00 0.00 ? 78  ASN A HA   4  
ATOM 6673  H HB2  . ASN A 1 78  ? 9.166   -5.998  -14.744 1.00 0.00 ? 78  ASN A HB2  4  
ATOM 6674  H HB3  . ASN A 1 78  ? 10.303  -7.207  -14.154 1.00 0.00 ? 78  ASN A HB3  4  
ATOM 6675  H HD21 . ASN A 1 78  ? 9.470   -9.079  -13.602 1.00 0.00 ? 78  ASN A HD21 4  
ATOM 6676  H HD22 . ASN A 1 78  ? 7.831   -9.369  -13.140 1.00 0.00 ? 78  ASN A HD22 4  
ATOM 6677  N N    . ILE A 1 79  ? 9.790   -5.823  -10.347 1.00 0.00 ? 79  ILE A N    4  
ATOM 6678  C CA   . ILE A 1 79  ? 9.973   -6.470  -9.054  1.00 0.00 ? 79  ILE A CA   4  
ATOM 6679  C C    . ILE A 1 79  ? 8.743   -7.285  -8.668  1.00 0.00 ? 79  ILE A C    4  
ATOM 6680  O O    . ILE A 1 79  ? 8.560   -7.636  -7.503  1.00 0.00 ? 79  ILE A O    4  
ATOM 6681  C CB   . ILE A 1 79  ? 10.262  -5.441  -7.945  1.00 0.00 ? 79  ILE A CB   4  
ATOM 6682  C CG1  . ILE A 1 79  ? 9.030   -4.569  -7.695  1.00 0.00 ? 79  ILE A CG1  4  
ATOM 6683  C CG2  . ILE A 1 79  ? 11.459  -4.581  -8.319  1.00 0.00 ? 79  ILE A CG2  4  
ATOM 6684  C CD1  . ILE A 1 79  ? 8.914   -4.081  -6.268  1.00 0.00 ? 79  ILE A CD1  4  
ATOM 6685  H H    . ILE A 1 79  ? 9.396   -4.926  -10.381 1.00 0.00 ? 79  ILE A H    4  
ATOM 6686  H HA   . ILE A 1 79  ? 10.822  -7.134  -9.132  1.00 0.00 ? 79  ILE A HA   4  
ATOM 6687  H HB   . ILE A 1 79  ? 10.503  -5.978  -7.041  1.00 0.00 ? 79  ILE A HB   4  
ATOM 6688  H HG12 . ILE A 1 79  ? 9.072   -3.704  -8.338  1.00 0.00 ? 79  ILE A HG12 4  
ATOM 6689  H HG13 . ILE A 1 79  ? 8.141   -5.140  -7.924  1.00 0.00 ? 79  ILE A HG13 4  
ATOM 6690  H HG21 . ILE A 1 79  ? 12.221  -5.201  -8.770  1.00 0.00 ? 79  ILE A HG21 4  
ATOM 6691  H HG22 . ILE A 1 79  ? 11.151  -3.823  -9.024  1.00 0.00 ? 79  ILE A HG22 4  
ATOM 6692  H HG23 . ILE A 1 79  ? 11.856  -4.110  -7.433  1.00 0.00 ? 79  ILE A HG23 4  
ATOM 6693  H HD11 . ILE A 1 79  ? 9.813   -4.336  -5.726  1.00 0.00 ? 79  ILE A HD11 4  
ATOM 6694  H HD12 . ILE A 1 79  ? 8.780   -3.010  -6.262  1.00 0.00 ? 79  ILE A HD12 4  
ATOM 6695  H HD13 . ILE A 1 79  ? 8.065   -4.552  -5.794  1.00 0.00 ? 79  ILE A HD13 4  
ATOM 6696  N N    . GLN A 1 80  ? 7.904   -7.584  -9.655  1.00 0.00 ? 80  GLN A N    4  
ATOM 6697  C CA   . GLN A 1 80  ? 6.692   -8.359  -9.419  1.00 0.00 ? 80  GLN A CA   4  
ATOM 6698  C C    . GLN A 1 80  ? 7.028   -9.735  -8.852  1.00 0.00 ? 80  GLN A C    4  
ATOM 6699  O O    . GLN A 1 80  ? 7.241   -10.689 -9.598  1.00 0.00 ? 80  GLN A O    4  
ATOM 6700  C CB   . GLN A 1 80  ? 5.896   -8.509  -10.716 1.00 0.00 ? 80  GLN A CB   4  
ATOM 6701  C CG   . GLN A 1 80  ? 5.090   -7.273  -11.082 1.00 0.00 ? 80  GLN A CG   4  
ATOM 6702  C CD   . GLN A 1 80  ? 3.701   -7.282  -10.477 1.00 0.00 ? 80  GLN A CD   4  
ATOM 6703  O OE1  . GLN A 1 80  ? 2.736   -7.705  -11.115 1.00 0.00 ? 80  GLN A OE1  4  
ATOM 6704  N NE2  . GLN A 1 80  ? 3.591   -6.815  -9.239  1.00 0.00 ? 80  GLN A NE2  4  
ATOM 6705  H H    . GLN A 1 80  ? 8.105   -7.276  -10.563 1.00 0.00 ? 80  GLN A H    4  
ATOM 6706  H HA   . GLN A 1 80  ? 6.092   -7.824  -8.699  1.00 0.00 ? 80  GLN A HA   4  
ATOM 6707  H HB2  . GLN A 1 80  ? 6.582   -8.718  -11.523 1.00 0.00 ? 80  GLN A HB2  4  
ATOM 6708  H HB3  . GLN A 1 80  ? 5.213   -9.339  -10.611 1.00 0.00 ? 80  GLN A HB3  4  
ATOM 6709  H HG2  . GLN A 1 80  ? 5.615   -6.399  -10.727 1.00 0.00 ? 80  GLN A HG2  4  
ATOM 6710  H HG3  . GLN A 1 80  ? 4.999   -7.225  -12.157 1.00 0.00 ? 80  GLN A HG3  4  
ATOM 6711  H HE21 . GLN A 1 80  ? 4.402   -6.494  -8.792  1.00 0.00 ? 80  GLN A HE21 4  
ATOM 6712  H HE22 . GLN A 1 80  ? 2.704   -6.809  -8.824  1.00 0.00 ? 80  GLN A HE22 4  
ATOM 6713  N N    . GLY A 1 81  ? 7.073   -9.828  -7.526  1.00 0.00 ? 81  GLY A N    4  
ATOM 6714  C CA   . GLY A 1 81  ? 7.384   -11.091 -6.882  1.00 0.00 ? 81  GLY A CA   4  
ATOM 6715  C C    . GLY A 1 81  ? 8.621   -11.008 -6.010  1.00 0.00 ? 81  GLY A C    4  
ATOM 6716  O O    . GLY A 1 81  ? 8.861   -11.881 -5.176  1.00 0.00 ? 81  GLY A O    4  
ATOM 6717  H H    . GLY A 1 81  ? 6.894   -9.033  -6.981  1.00 0.00 ? 81  GLY A H    4  
ATOM 6718  H HA2  . GLY A 1 81  ? 6.544   -11.387 -6.270  1.00 0.00 ? 81  GLY A HA2  4  
ATOM 6719  H HA3  . GLY A 1 81  ? 7.543   -11.841 -7.643  1.00 0.00 ? 81  GLY A HA3  4  
ATOM 6720  N N    . PHE A 1 82  ? 9.409   -9.956  -6.203  1.00 0.00 ? 82  PHE A N    4  
ATOM 6721  C CA   . PHE A 1 82  ? 10.631  -9.764  -5.430  1.00 0.00 ? 82  PHE A CA   4  
ATOM 6722  C C    . PHE A 1 82  ? 10.340  -9.813  -3.933  1.00 0.00 ? 82  PHE A C    4  
ATOM 6723  O O    . PHE A 1 82  ? 9.397   -9.185  -3.452  1.00 0.00 ? 82  PHE A O    4  
ATOM 6724  C CB   . PHE A 1 82  ? 11.283  -8.427  -5.790  1.00 0.00 ? 82  PHE A CB   4  
ATOM 6725  C CG   . PHE A 1 82  ? 12.251  -8.522  -6.935  1.00 0.00 ? 82  PHE A CG   4  
ATOM 6726  C CD1  . PHE A 1 82  ? 11.893  -9.160  -8.111  1.00 0.00 ? 82  PHE A CD1  4  
ATOM 6727  C CD2  . PHE A 1 82  ? 13.519  -7.973  -6.833  1.00 0.00 ? 82  PHE A CD2  4  
ATOM 6728  C CE1  . PHE A 1 82  ? 12.782  -9.249  -9.166  1.00 0.00 ? 82  PHE A CE1  4  
ATOM 6729  C CE2  . PHE A 1 82  ? 14.412  -8.059  -7.885  1.00 0.00 ? 82  PHE A CE2  4  
ATOM 6730  C CZ   . PHE A 1 82  ? 14.043  -8.698  -9.052  1.00 0.00 ? 82  PHE A CZ   4  
ATOM 6731  H H    . PHE A 1 82  ? 9.164   -9.293  -6.883  1.00 0.00 ? 82  PHE A H    4  
ATOM 6732  H HA   . PHE A 1 82  ? 11.309  -10.565 -5.679  1.00 0.00 ? 82  PHE A HA   4  
ATOM 6733  H HB2  . PHE A 1 82  ? 10.513  -7.722  -6.065  1.00 0.00 ? 82  PHE A HB2  4  
ATOM 6734  H HB3  . PHE A 1 82  ? 11.818  -8.053  -4.931  1.00 0.00 ? 82  PHE A HB3  4  
ATOM 6735  H HD1  . PHE A 1 82  ? 10.906  -9.592  -8.201  1.00 0.00 ? 82  PHE A HD1  4  
ATOM 6736  H HD2  . PHE A 1 82  ? 13.810  -7.474  -5.921  1.00 0.00 ? 82  PHE A HD2  4  
ATOM 6737  H HE1  . PHE A 1 82  ? 12.490  -9.750  -10.077 1.00 0.00 ? 82  PHE A HE1  4  
ATOM 6738  H HE2  . PHE A 1 82  ? 15.398  -7.628  -7.793  1.00 0.00 ? 82  PHE A HE2  4  
ATOM 6739  H HZ   . PHE A 1 82  ? 14.739  -8.766  -9.876  1.00 0.00 ? 82  PHE A HZ   4  
ATOM 6740  N N    . ALA A 1 83  ? 11.156  -10.565 -3.202  1.00 0.00 ? 83  ALA A N    4  
ATOM 6741  C CA   . ALA A 1 83  ? 10.988  -10.696 -1.760  1.00 0.00 ? 83  ALA A CA   4  
ATOM 6742  C C    . ALA A 1 83  ? 11.260  -9.372  -1.053  1.00 0.00 ? 83  ALA A C    4  
ATOM 6743  O O    . ALA A 1 83  ? 11.917  -8.489  -1.601  1.00 0.00 ? 83  ALA A O    4  
ATOM 6744  C CB   . ALA A 1 83  ? 11.904  -11.783 -1.218  1.00 0.00 ? 83  ALA A CB   4  
ATOM 6745  H H    . ALA A 1 83  ? 11.889  -11.042 -3.643  1.00 0.00 ? 83  ALA A H    4  
ATOM 6746  H HA   . ALA A 1 83  ? 9.966   -10.992 -1.568  1.00 0.00 ? 83  ALA A HA   4  
ATOM 6747  H HB1  . ALA A 1 83  ? 12.281  -11.486 -0.251  1.00 0.00 ? 83  ALA A HB1  4  
ATOM 6748  H HB2  . ALA A 1 83  ? 11.350  -12.705 -1.122  1.00 0.00 ? 83  ALA A HB2  4  
ATOM 6749  H HB3  . ALA A 1 83  ? 12.730  -11.929 -1.898  1.00 0.00 ? 83  ALA A HB3  4  
ATOM 6750  N N    . ASN A 1 84  ? 10.748  -9.242  0.167   1.00 0.00 ? 84  ASN A N    4  
ATOM 6751  C CA   . ASN A 1 84  ? 10.935  -8.025  0.948   1.00 0.00 ? 84  ASN A CA   4  
ATOM 6752  C C    . ASN A 1 84  ? 12.350  -7.480  0.776   1.00 0.00 ? 84  ASN A C    4  
ATOM 6753  O O    . ASN A 1 84  ? 12.539  -6.318  0.415   1.00 0.00 ? 84  ASN A O    4  
ATOM 6754  C CB   . ASN A 1 84  ? 10.658  -8.297  2.428   1.00 0.00 ? 84  ASN A CB   4  
ATOM 6755  C CG   . ASN A 1 84  ? 10.728  -7.037  3.270   1.00 0.00 ? 84  ASN A CG   4  
ATOM 6756  O OD1  . ASN A 1 84  ? 11.715  -6.796  3.965   1.00 0.00 ? 84  ASN A OD1  4  
ATOM 6757  N ND2  . ASN A 1 84  ? 9.677   -6.228  3.211   1.00 0.00 ? 84  ASN A ND2  4  
ATOM 6758  H H    . ASN A 1 84  ? 10.233  -9.982  0.551   1.00 0.00 ? 84  ASN A H    4  
ATOM 6759  H HA   . ASN A 1 84  ? 10.232  -7.289  0.588   1.00 0.00 ? 84  ASN A HA   4  
ATOM 6760  H HB2  . ASN A 1 84  ? 9.670   -8.721  2.531   1.00 0.00 ? 84  ASN A HB2  4  
ATOM 6761  H HB3  . ASN A 1 84  ? 11.387  -8.999  2.802   1.00 0.00 ? 84  ASN A HB3  4  
ATOM 6762  H HD21 . ASN A 1 84  ? 8.926   -6.484  2.636   1.00 0.00 ? 84  ASN A HD21 4  
ATOM 6763  H HD22 . ASN A 1 84  ? 9.695   -5.406  3.745   1.00 0.00 ? 84  ASN A HD22 4  
ATOM 6764  N N    . HIS A 1 85  ? 13.340  -8.327  1.037   1.00 0.00 ? 85  HIS A N    4  
ATOM 6765  C CA   . HIS A 1 85  ? 14.738  -7.931  0.909   1.00 0.00 ? 85  HIS A CA   4  
ATOM 6766  C C    . HIS A 1 85  ? 15.105  -7.694  -0.553  1.00 0.00 ? 85  HIS A C    4  
ATOM 6767  O O    . HIS A 1 85  ? 15.753  -6.702  -0.887  1.00 0.00 ? 85  HIS A O    4  
ATOM 6768  C CB   . HIS A 1 85  ? 15.650  -9.001  1.509   1.00 0.00 ? 85  HIS A CB   4  
ATOM 6769  C CG   . HIS A 1 85  ? 15.308  -10.393 1.073   1.00 0.00 ? 85  HIS A CG   4  
ATOM 6770  N ND1  . HIS A 1 85  ? 14.326  -11.150 1.676   1.00 0.00 ? 85  HIS A ND1  4  
ATOM 6771  C CD2  . HIS A 1 85  ? 15.822  -11.163 0.086   1.00 0.00 ? 85  HIS A CD2  4  
ATOM 6772  C CE1  . HIS A 1 85  ? 14.252  -12.326 1.080   1.00 0.00 ? 85  HIS A CE1  4  
ATOM 6773  N NE2  . HIS A 1 85  ? 15.149  -12.360 0.111   1.00 0.00 ? 85  HIS A NE2  4  
ATOM 6774  H H    . HIS A 1 85  ? 13.126  -9.240  1.321   1.00 0.00 ? 85  HIS A H    4  
ATOM 6775  H HA   . HIS A 1 85  ? 14.873  -7.009  1.455   1.00 0.00 ? 85  HIS A HA   4  
ATOM 6776  H HB2  . HIS A 1 85  ? 16.670  -8.803  1.213   1.00 0.00 ? 85  HIS A HB2  4  
ATOM 6777  H HB3  . HIS A 1 85  ? 15.579  -8.963  2.587   1.00 0.00 ? 85  HIS A HB3  4  
ATOM 6778  H HD1  . HIS A 1 85  ? 13.767  -10.868 2.430   1.00 0.00 ? 85  HIS A HD1  4  
ATOM 6779  H HD2  . HIS A 1 85  ? 16.615  -10.889 -0.595  1.00 0.00 ? 85  HIS A HD2  4  
ATOM 6780  H HE1  . HIS A 1 85  ? 13.573  -13.125 1.339   1.00 0.00 ? 85  HIS A HE1  4  
ATOM 6781  H HE2  . HIS A 1 85  ? 15.364  -13.146 -0.432  1.00 0.00 ? 85  HIS A HE2  4  
ATOM 6782  N N    . ASP A 1 86  ? 14.687  -8.611  -1.418  1.00 0.00 ? 86  ASP A N    4  
ATOM 6783  C CA   . ASP A 1 86  ? 14.971  -8.502  -2.844  1.00 0.00 ? 86  ASP A CA   4  
ATOM 6784  C C    . ASP A 1 86  ? 14.612  -7.114  -3.365  1.00 0.00 ? 86  ASP A C    4  
ATOM 6785  O O    . ASP A 1 86  ? 15.262  -6.592  -4.271  1.00 0.00 ? 86  ASP A O    4  
ATOM 6786  C CB   . ASP A 1 86  ? 14.199  -9.568  -3.623  1.00 0.00 ? 86  ASP A CB   4  
ATOM 6787  C CG   . ASP A 1 86  ? 14.934  -10.893 -3.677  1.00 0.00 ? 86  ASP A CG   4  
ATOM 6788  O OD1  . ASP A 1 86  ? 15.660  -11.209 -2.710  1.00 0.00 ? 86  ASP A OD1  4  
ATOM 6789  O OD2  . ASP A 1 86  ? 14.784  -11.614 -4.685  1.00 0.00 ? 86  ASP A OD2  4  
ATOM 6790  H H    . ASP A 1 86  ? 14.174  -9.379  -1.090  1.00 0.00 ? 86  ASP A H    4  
ATOM 6791  H HA   . ASP A 1 86  ? 16.029  -8.663  -2.985  1.00 0.00 ? 86  ASP A HA   4  
ATOM 6792  H HB2  . ASP A 1 86  ? 13.242  -9.729  -3.148  1.00 0.00 ? 86  ASP A HB2  4  
ATOM 6793  H HB3  . ASP A 1 86  ? 14.041  -9.223  -4.634  1.00 0.00 ? 86  ASP A HB3  4  
ATOM 6794  N N    . VAL A 1 87  ? 13.572  -6.521  -2.788  1.00 0.00 ? 87  VAL A N    4  
ATOM 6795  C CA   . VAL A 1 87  ? 13.126  -5.194  -3.193  1.00 0.00 ? 87  VAL A CA   4  
ATOM 6796  C C    . VAL A 1 87  ? 13.979  -4.107  -2.548  1.00 0.00 ? 87  VAL A C    4  
ATOM 6797  O O    . VAL A 1 87  ? 14.311  -3.105  -3.182  1.00 0.00 ? 87  VAL A O    4  
ATOM 6798  C CB   . VAL A 1 87  ? 11.650  -4.960  -2.823  1.00 0.00 ? 87  VAL A CB   4  
ATOM 6799  C CG1  . VAL A 1 87  ? 11.230  -3.540  -3.172  1.00 0.00 ? 87  VAL A CG1  4  
ATOM 6800  C CG2  . VAL A 1 87  ? 10.758  -5.976  -3.522  1.00 0.00 ? 87  VAL A CG2  4  
ATOM 6801  H H    . VAL A 1 87  ? 13.094  -6.988  -2.071  1.00 0.00 ? 87  VAL A H    4  
ATOM 6802  H HA   . VAL A 1 87  ? 13.222  -5.123  -4.267  1.00 0.00 ? 87  VAL A HA   4  
ATOM 6803  H HB   . VAL A 1 87  ? 11.542  -5.091  -1.756  1.00 0.00 ? 87  VAL A HB   4  
ATOM 6804  H HG11 . VAL A 1 87  ? 10.667  -3.120  -2.352  1.00 0.00 ? 87  VAL A HG11 4  
ATOM 6805  H HG12 . VAL A 1 87  ? 12.108  -2.939  -3.354  1.00 0.00 ? 87  VAL A HG12 4  
ATOM 6806  H HG13 . VAL A 1 87  ? 10.614  -3.555  -4.059  1.00 0.00 ? 87  VAL A HG13 4  
ATOM 6807  H HG21 . VAL A 1 87  ? 10.949  -5.950  -4.584  1.00 0.00 ? 87  VAL A HG21 4  
ATOM 6808  H HG22 . VAL A 1 87  ? 10.972  -6.964  -3.142  1.00 0.00 ? 87  VAL A HG22 4  
ATOM 6809  H HG23 . VAL A 1 87  ? 9.723   -5.735  -3.335  1.00 0.00 ? 87  VAL A HG23 4  
ATOM 6810  N N    . VAL A 1 88  ? 14.331  -4.311  -1.283  1.00 0.00 ? 88  VAL A N    4  
ATOM 6811  C CA   . VAL A 1 88  ? 15.147  -3.350  -0.551  1.00 0.00 ? 88  VAL A CA   4  
ATOM 6812  C C    . VAL A 1 88  ? 16.460  -3.079  -1.276  1.00 0.00 ? 88  VAL A C    4  
ATOM 6813  O O    . VAL A 1 88  ? 16.837  -1.927  -1.490  1.00 0.00 ? 88  VAL A O    4  
ATOM 6814  C CB   . VAL A 1 88  ? 15.453  -3.843  0.875   1.00 0.00 ? 88  VAL A CB   4  
ATOM 6815  C CG1  . VAL A 1 88  ? 16.375  -2.868  1.592   1.00 0.00 ? 88  VAL A CG1  4  
ATOM 6816  C CG2  . VAL A 1 88  ? 14.164  -4.044  1.657   1.00 0.00 ? 88  VAL A CG2  4  
ATOM 6817  H H    . VAL A 1 88  ? 14.036  -5.129  -0.831  1.00 0.00 ? 88  VAL A H    4  
ATOM 6818  H HA   . VAL A 1 88  ? 14.590  -2.427  -0.479  1.00 0.00 ? 88  VAL A HA   4  
ATOM 6819  H HB   . VAL A 1 88  ? 15.958  -4.796  0.804   1.00 0.00 ? 88  VAL A HB   4  
ATOM 6820  H HG11 . VAL A 1 88  ? 16.234  -2.958  2.659   1.00 0.00 ? 88  VAL A HG11 4  
ATOM 6821  H HG12 . VAL A 1 88  ? 17.401  -3.094  1.342   1.00 0.00 ? 88  VAL A HG12 4  
ATOM 6822  H HG13 . VAL A 1 88  ? 16.142  -1.860  1.282   1.00 0.00 ? 88  VAL A HG13 4  
ATOM 6823  H HG21 . VAL A 1 88  ? 13.320  -3.929  0.994   1.00 0.00 ? 88  VAL A HG21 4  
ATOM 6824  H HG22 . VAL A 1 88  ? 14.152  -5.036  2.086   1.00 0.00 ? 88  VAL A HG22 4  
ATOM 6825  H HG23 . VAL A 1 88  ? 14.103  -3.310  2.447   1.00 0.00 ? 88  VAL A HG23 4  
ATOM 6826  N N    . GLU A 1 89  ? 17.154  -4.149  -1.653  1.00 0.00 ? 89  GLU A N    4  
ATOM 6827  C CA   . GLU A 1 89  ? 18.426  -4.026  -2.354  1.00 0.00 ? 89  GLU A CA   4  
ATOM 6828  C C    . GLU A 1 89  ? 18.252  -3.271  -3.669  1.00 0.00 ? 89  GLU A C    4  
ATOM 6829  O O    . GLU A 1 89  ? 19.113  -2.485  -4.065  1.00 0.00 ? 89  GLU A O    4  
ATOM 6830  C CB   . GLU A 1 89  ? 19.021  -5.410  -2.623  1.00 0.00 ? 89  GLU A CB   4  
ATOM 6831  C CG   . GLU A 1 89  ? 18.202  -6.247  -3.592  1.00 0.00 ? 89  GLU A CG   4  
ATOM 6832  C CD   . GLU A 1 89  ? 18.908  -7.526  -3.998  1.00 0.00 ? 89  GLU A CD   4  
ATOM 6833  O OE1  . GLU A 1 89  ? 20.119  -7.467  -4.298  1.00 0.00 ? 89  GLU A OE1  4  
ATOM 6834  O OE2  . GLU A 1 89  ? 18.249  -8.587  -4.016  1.00 0.00 ? 89  GLU A OE2  4  
ATOM 6835  H H    . GLU A 1 89  ? 16.801  -5.042  -1.454  1.00 0.00 ? 89  GLU A H    4  
ATOM 6836  H HA   . GLU A 1 89  ? 19.102  -3.471  -1.721  1.00 0.00 ? 89  GLU A HA   4  
ATOM 6837  H HB2  . GLU A 1 89  ? 20.013  -5.289  -3.033  1.00 0.00 ? 89  GLU A HB2  4  
ATOM 6838  H HB3  . GLU A 1 89  ? 19.092  -5.946  -1.688  1.00 0.00 ? 89  GLU A HB3  4  
ATOM 6839  H HG2  . GLU A 1 89  ? 17.265  -6.505  -3.122  1.00 0.00 ? 89  GLU A HG2  4  
ATOM 6840  H HG3  . GLU A 1 89  ? 18.009  -5.662  -4.479  1.00 0.00 ? 89  GLU A HG3  4  
ATOM 6841  N N    . VAL A 1 90  ? 17.132  -3.516  -4.341  1.00 0.00 ? 90  VAL A N    4  
ATOM 6842  C CA   . VAL A 1 90  ? 16.843  -2.860  -5.611  1.00 0.00 ? 90  VAL A CA   4  
ATOM 6843  C C    . VAL A 1 90  ? 16.842  -1.343  -5.458  1.00 0.00 ? 90  VAL A C    4  
ATOM 6844  O O    . VAL A 1 90  ? 17.419  -0.624  -6.275  1.00 0.00 ? 90  VAL A O    4  
ATOM 6845  C CB   . VAL A 1 90  ? 15.484  -3.309  -6.179  1.00 0.00 ? 90  VAL A CB   4  
ATOM 6846  C CG1  . VAL A 1 90  ? 15.183  -2.583  -7.482  1.00 0.00 ? 90  VAL A CG1  4  
ATOM 6847  C CG2  . VAL A 1 90  ? 15.464  -4.816  -6.382  1.00 0.00 ? 90  VAL A CG2  4  
ATOM 6848  H H    . VAL A 1 90  ? 16.484  -4.153  -3.975  1.00 0.00 ? 90  VAL A H    4  
ATOM 6849  H HA   . VAL A 1 90  ? 17.614  -3.140  -6.315  1.00 0.00 ? 90  VAL A HA   4  
ATOM 6850  H HB   . VAL A 1 90  ? 14.716  -3.052  -5.464  1.00 0.00 ? 90  VAL A HB   4  
ATOM 6851  H HG11 . VAL A 1 90  ? 14.116  -2.445  -7.578  1.00 0.00 ? 90  VAL A HG11 4  
ATOM 6852  H HG12 . VAL A 1 90  ? 15.674  -1.621  -7.480  1.00 0.00 ? 90  VAL A HG12 4  
ATOM 6853  H HG13 . VAL A 1 90  ? 15.546  -3.171  -8.312  1.00 0.00 ? 90  VAL A HG13 4  
ATOM 6854  H HG21 . VAL A 1 90  ? 14.490  -5.201  -6.118  1.00 0.00 ? 90  VAL A HG21 4  
ATOM 6855  H HG22 . VAL A 1 90  ? 15.672  -5.044  -7.417  1.00 0.00 ? 90  VAL A HG22 4  
ATOM 6856  H HG23 . VAL A 1 90  ? 16.214  -5.274  -5.755  1.00 0.00 ? 90  VAL A HG23 4  
ATOM 6857  N N    . LEU A 1 91  ? 16.189  -0.861  -4.406  1.00 0.00 ? 91  LEU A N    4  
ATOM 6858  C CA   . LEU A 1 91  ? 16.112  0.572   -4.143  1.00 0.00 ? 91  LEU A CA   4  
ATOM 6859  C C    . LEU A 1 91  ? 17.497  1.151   -3.871  1.00 0.00 ? 91  LEU A C    4  
ATOM 6860  O O    . LEU A 1 91  ? 17.866  2.189   -4.422  1.00 0.00 ? 91  LEU A O    4  
ATOM 6861  C CB   . LEU A 1 91  ? 15.190  0.844   -2.953  1.00 0.00 ? 91  LEU A CB   4  
ATOM 6862  C CG   . LEU A 1 91  ? 13.815  0.177   -3.003  1.00 0.00 ? 91  LEU A CG   4  
ATOM 6863  C CD1  . LEU A 1 91  ? 13.190  0.137   -1.617  1.00 0.00 ? 91  LEU A CD1  4  
ATOM 6864  C CD2  . LEU A 1 91  ? 12.904  0.906   -3.980  1.00 0.00 ? 91  LEU A CD2  4  
ATOM 6865  H H    . LEU A 1 91  ? 15.749  -1.483  -3.790  1.00 0.00 ? 91  LEU A H    4  
ATOM 6866  H HA   . LEU A 1 91  ? 15.702  1.048   -5.022  1.00 0.00 ? 91  LEU A HA   4  
ATOM 6867  H HB2  . LEU A 1 91  ? 15.692  0.500   -2.062  1.00 0.00 ? 91  LEU A HB2  4  
ATOM 6868  H HB3  . LEU A 1 91  ? 15.039  1.912   -2.890  1.00 0.00 ? 91  LEU A HB3  4  
ATOM 6869  H HG   . LEU A 1 91  ? 13.928  -0.842  -3.347  1.00 0.00 ? 91  LEU A HG   4  
ATOM 6870  H HD11 . LEU A 1 91  ? 12.949  1.141   -1.303  1.00 0.00 ? 91  LEU A HD11 4  
ATOM 6871  H HD12 . LEU A 1 91  ? 13.889  -0.300  -0.920  1.00 0.00 ? 91  LEU A HD12 4  
ATOM 6872  H HD13 . LEU A 1 91  ? 12.290  -0.458  -1.646  1.00 0.00 ? 91  LEU A HD13 4  
ATOM 6873  H HD21 . LEU A 1 91  ? 13.491  1.590   -4.576  1.00 0.00 ? 91  LEU A HD21 4  
ATOM 6874  H HD22 . LEU A 1 91  ? 12.156  1.459   -3.431  1.00 0.00 ? 91  LEU A HD22 4  
ATOM 6875  H HD23 . LEU A 1 91  ? 12.421  0.189   -4.626  1.00 0.00 ? 91  LEU A HD23 4  
ATOM 6876  N N    . ARG A 1 92  ? 18.260  0.472   -3.021  1.00 0.00 ? 92  ARG A N    4  
ATOM 6877  C CA   . ARG A 1 92  ? 19.604  0.918   -2.677  1.00 0.00 ? 92  ARG A CA   4  
ATOM 6878  C C    . ARG A 1 92  ? 20.498  0.957   -3.913  1.00 0.00 ? 92  ARG A C    4  
ATOM 6879  O O    . ARG A 1 92  ? 21.288  1.882   -4.092  1.00 0.00 ? 92  ARG A O    4  
ATOM 6880  C CB   . ARG A 1 92  ? 20.216  -0.004  -1.621  1.00 0.00 ? 92  ARG A CB   4  
ATOM 6881  C CG   . ARG A 1 92  ? 19.379  -0.123  -0.358  1.00 0.00 ? 92  ARG A CG   4  
ATOM 6882  C CD   . ARG A 1 92  ? 20.122  -0.878  0.734   1.00 0.00 ? 92  ARG A CD   4  
ATOM 6883  N NE   . ARG A 1 92  ? 21.328  -0.174  1.162   1.00 0.00 ? 92  ARG A NE   4  
ATOM 6884  C CZ   . ARG A 1 92  ? 21.932  -0.391  2.325   1.00 0.00 ? 92  ARG A CZ   4  
ATOM 6885  N NH1  . ARG A 1 92  ? 21.444  -1.288  3.171   1.00 0.00 ? 92  ARG A NH1  4  
ATOM 6886  N NH2  . ARG A 1 92  ? 23.025  0.289   2.644   1.00 0.00 ? 92  ARG A NH2  4  
ATOM 6887  H H    . ARG A 1 92  ? 17.910  -0.348  -2.614  1.00 0.00 ? 92  ARG A H    4  
ATOM 6888  H HA   . ARG A 1 92  ? 19.529  1.916   -2.271  1.00 0.00 ? 92  ARG A HA   4  
ATOM 6889  H HB2  . ARG A 1 92  ? 20.331  -0.991  -2.044  1.00 0.00 ? 92  ARG A HB2  4  
ATOM 6890  H HB3  . ARG A 1 92  ? 21.189  0.377   -1.348  1.00 0.00 ? 92  ARG A HB3  4  
ATOM 6891  H HG2  . ARG A 1 92  ? 19.144  0.868   0.002   1.00 0.00 ? 92  ARG A HG2  4  
ATOM 6892  H HG3  . ARG A 1 92  ? 18.466  -0.650  -0.591  1.00 0.00 ? 92  ARG A HG3  4  
ATOM 6893  H HD2  . ARG A 1 92  ? 19.465  -0.996  1.582   1.00 0.00 ? 92  ARG A HD2  4  
ATOM 6894  H HD3  . ARG A 1 92  ? 20.399  -1.850  0.355   1.00 0.00 ? 92  ARG A HD3  4  
ATOM 6895  H HE   . ARG A 1 92  ? 21.705  0.493   0.552   1.00 0.00 ? 92  ARG A HE   4  
ATOM 6896  H HH11 . ARG A 1 92  ? 20.621  -1.803  2.934   1.00 0.00 ? 92  ARG A HH11 4  
ATOM 6897  H HH12 . ARG A 1 92  ? 21.902  -1.451  4.046   1.00 0.00 ? 92  ARG A HH12 4  
ATOM 6898  H HH21 . ARG A 1 92  ? 23.396  0.966   2.008   1.00 0.00 ? 92  ARG A HH21 4  
ATOM 6899  H HH22 . ARG A 1 92  ? 23.479  0.125   3.519   1.00 0.00 ? 92  ARG A HH22 4  
ATOM 6900  N N    . ASN A 1 93  ? 20.366  -0.056  -4.764  1.00 0.00 ? 93  ASN A N    4  
ATOM 6901  C CA   . ASN A 1 93  ? 21.162  -0.139  -5.983  1.00 0.00 ? 93  ASN A CA   4  
ATOM 6902  C C    . ASN A 1 93  ? 20.869  1.041   -6.905  1.00 0.00 ? 93  ASN A C    4  
ATOM 6903  O O    . ASN A 1 93  ? 21.770  1.576   -7.550  1.00 0.00 ? 93  ASN A O    4  
ATOM 6904  C CB   . ASN A 1 93  ? 20.879  -1.454  -6.713  1.00 0.00 ? 93  ASN A CB   4  
ATOM 6905  C CG   . ASN A 1 93  ? 21.708  -2.604  -6.175  1.00 0.00 ? 93  ASN A CG   4  
ATOM 6906  O OD1  . ASN A 1 93  ? 22.931  -2.621  -6.315  1.00 0.00 ? 93  ASN A OD1  4  
ATOM 6907  N ND2  . ASN A 1 93  ? 21.044  -3.573  -5.556  1.00 0.00 ? 93  ASN A ND2  4  
ATOM 6908  H H    . ASN A 1 93  ? 19.719  -0.765  -4.567  1.00 0.00 ? 93  ASN A H    4  
ATOM 6909  H HA   . ASN A 1 93  ? 22.203  -0.111  -5.701  1.00 0.00 ? 93  ASN A HA   4  
ATOM 6910  H HB2  . ASN A 1 93  ? 19.834  -1.704  -6.599  1.00 0.00 ? 93  ASN A HB2  4  
ATOM 6911  H HB3  . ASN A 1 93  ? 21.103  -1.332  -7.762  1.00 0.00 ? 93  ASN A HB3  4  
ATOM 6912  H HD21 . ASN A 1 93  ? 20.069  -3.493  -5.482  1.00 0.00 ? 93  ASN A HD21 4  
ATOM 6913  H HD22 . ASN A 1 93  ? 21.555  -4.328  -5.198  1.00 0.00 ? 93  ASN A HD22 4  
ATOM 6914  N N    . ALA A 1 94  ? 19.603  1.441   -6.961  1.00 0.00 ? 94  ALA A N    4  
ATOM 6915  C CA   . ALA A 1 94  ? 19.192  2.559   -7.801  1.00 0.00 ? 94  ALA A CA   4  
ATOM 6916  C C    . ALA A 1 94  ? 19.973  3.822   -7.455  1.00 0.00 ? 94  ALA A C    4  
ATOM 6917  O O    . ALA A 1 94  ? 20.425  3.994   -6.323  1.00 0.00 ? 94  ALA A O    4  
ATOM 6918  C CB   . ALA A 1 94  ? 17.697  2.805   -7.658  1.00 0.00 ? 94  ALA A CB   4  
ATOM 6919  H H    . ALA A 1 94  ? 18.930  0.975   -6.423  1.00 0.00 ? 94  ALA A H    4  
ATOM 6920  H HA   . ALA A 1 94  ? 19.392  2.295   -8.829  1.00 0.00 ? 94  ALA A HA   4  
ATOM 6921  H HB1  . ALA A 1 94  ? 17.398  2.617   -6.637  1.00 0.00 ? 94  ALA A HB1  4  
ATOM 6922  H HB2  . ALA A 1 94  ? 17.474  3.829   -7.917  1.00 0.00 ? 94  ALA A HB2  4  
ATOM 6923  H HB3  . ALA A 1 94  ? 17.159  2.141   -8.318  1.00 0.00 ? 94  ALA A HB3  4  
ATOM 6924  N N    . GLY A 1 95  ? 20.128  4.705   -8.437  1.00 0.00 ? 95  GLY A N    4  
ATOM 6925  C CA   . GLY A 1 95  ? 20.856  5.941   -8.216  1.00 0.00 ? 95  GLY A CA   4  
ATOM 6926  C C    . GLY A 1 95  ? 19.935  7.129   -8.025  1.00 0.00 ? 95  GLY A C    4  
ATOM 6927  O O    . GLY A 1 95  ? 18.816  6.982   -7.534  1.00 0.00 ? 95  GLY A O    4  
ATOM 6928  H H    . GLY A 1 95  ? 19.746  4.515   -9.319  1.00 0.00 ? 95  GLY A H    4  
ATOM 6929  H HA2  . GLY A 1 95  ? 21.472  5.831   -7.336  1.00 0.00 ? 95  GLY A HA2  4  
ATOM 6930  H HA3  . GLY A 1 95  ? 21.493  6.127   -9.068  1.00 0.00 ? 95  GLY A HA3  4  
ATOM 6931  N N    . GLN A 1 96  ? 20.407  8.310   -8.412  1.00 0.00 ? 96  GLN A N    4  
ATOM 6932  C CA   . GLN A 1 96  ? 19.618  9.529   -8.278  1.00 0.00 ? 96  GLN A CA   4  
ATOM 6933  C C    . GLN A 1 96  ? 18.256  9.373   -8.948  1.00 0.00 ? 96  GLN A C    4  
ATOM 6934  O O    . GLN A 1 96  ? 17.217  9.494   -8.300  1.00 0.00 ? 96  GLN A O    4  
ATOM 6935  C CB   . GLN A 1 96  ? 20.366  10.716  -8.887  1.00 0.00 ? 96  GLN A CB   4  
ATOM 6936  C CG   . GLN A 1 96  ? 19.973  12.056  -8.287  1.00 0.00 ? 96  GLN A CG   4  
ATOM 6937  C CD   . GLN A 1 96  ? 21.075  13.090  -8.397  1.00 0.00 ? 96  GLN A CD   4  
ATOM 6938  O OE1  . GLN A 1 96  ? 21.731  13.208  -9.432  1.00 0.00 ? 96  GLN A OE1  4  
ATOM 6939  N NE2  . GLN A 1 96  ? 21.286  13.848  -7.326  1.00 0.00 ? 96  GLN A NE2  4  
ATOM 6940  H H    . GLN A 1 96  ? 21.306  8.363   -8.796  1.00 0.00 ? 96  GLN A H    4  
ATOM 6941  H HA   . GLN A 1 96  ? 19.468  9.712   -7.225  1.00 0.00 ? 96  GLN A HA   4  
ATOM 6942  H HB2  . GLN A 1 96  ? 21.425  10.574  -8.735  1.00 0.00 ? 96  GLN A HB2  4  
ATOM 6943  H HB3  . GLN A 1 96  ? 20.163  10.747  -9.948  1.00 0.00 ? 96  GLN A HB3  4  
ATOM 6944  H HG2  . GLN A 1 96  ? 19.101  12.426  -8.806  1.00 0.00 ? 96  GLN A HG2  4  
ATOM 6945  H HG3  . GLN A 1 96  ? 19.736  11.913  -7.243  1.00 0.00 ? 96  GLN A HG3  4  
ATOM 6946  H HE21 . GLN A 1 96  ? 20.725  13.696  -6.536  1.00 0.00 ? 96  GLN A HE21 4  
ATOM 6947  H HE22 . GLN A 1 96  ? 21.993  14.524  -7.369  1.00 0.00 ? 96  GLN A HE22 4  
ATOM 6948  N N    . VAL A 1 97  ? 18.270  9.103   -10.249 1.00 0.00 ? 97  VAL A N    4  
ATOM 6949  C CA   . VAL A 1 97  ? 17.037  8.929   -11.007 1.00 0.00 ? 97  VAL A CA   4  
ATOM 6950  C C    . VAL A 1 97  ? 16.376  7.594   -10.683 1.00 0.00 ? 97  VAL A C    4  
ATOM 6951  O O    . VAL A 1 97  ? 16.734  6.559   -11.245 1.00 0.00 ? 97  VAL A O    4  
ATOM 6952  C CB   . VAL A 1 97  ? 17.294  9.008   -12.524 1.00 0.00 ? 97  VAL A CB   4  
ATOM 6953  C CG1  . VAL A 1 97  ? 16.018  8.716   -13.298 1.00 0.00 ? 97  VAL A CG1  4  
ATOM 6954  C CG2  . VAL A 1 97  ? 17.855  10.371  -12.899 1.00 0.00 ? 97  VAL A CG2  4  
ATOM 6955  H H    . VAL A 1 97  ? 19.131  9.018   -10.710 1.00 0.00 ? 97  VAL A H    4  
ATOM 6956  H HA   . VAL A 1 97  ? 16.363  9.729   -10.736 1.00 0.00 ? 97  VAL A HA   4  
ATOM 6957  H HB   . VAL A 1 97  ? 18.026  8.257   -12.783 1.00 0.00 ? 97  VAL A HB   4  
ATOM 6958  H HG11 . VAL A 1 97  ? 15.943  9.393   -14.136 1.00 0.00 ? 97  VAL A HG11 4  
ATOM 6959  H HG12 . VAL A 1 97  ? 16.039  7.697   -13.657 1.00 0.00 ? 97  VAL A HG12 4  
ATOM 6960  H HG13 . VAL A 1 97  ? 15.165  8.852   -12.649 1.00 0.00 ? 97  VAL A HG13 4  
ATOM 6961  H HG21 . VAL A 1 97  ? 17.347  11.137  -12.331 1.00 0.00 ? 97  VAL A HG21 4  
ATOM 6962  H HG22 . VAL A 1 97  ? 18.912  10.400  -12.676 1.00 0.00 ? 97  VAL A HG22 4  
ATOM 6963  H HG23 . VAL A 1 97  ? 17.705  10.545  -13.954 1.00 0.00 ? 97  VAL A HG23 4  
ATOM 6964  N N    . VAL A 1 98  ? 15.408  7.625   -9.772  1.00 0.00 ? 98  VAL A N    4  
ATOM 6965  C CA   . VAL A 1 98  ? 14.695  6.417   -9.374  1.00 0.00 ? 98  VAL A CA   4  
ATOM 6966  C C    . VAL A 1 98  ? 13.260  6.431   -9.888  1.00 0.00 ? 98  VAL A C    4  
ATOM 6967  O O    . VAL A 1 98  ? 12.386  7.071   -9.303  1.00 0.00 ? 98  VAL A O    4  
ATOM 6968  C CB   . VAL A 1 98  ? 14.679  6.254   -7.842  1.00 0.00 ? 98  VAL A CB   4  
ATOM 6969  C CG1  . VAL A 1 98  ? 13.809  5.073   -7.440  1.00 0.00 ? 98  VAL A CG1  4  
ATOM 6970  C CG2  . VAL A 1 98  ? 16.094  6.091   -7.309  1.00 0.00 ? 98  VAL A CG2  4  
ATOM 6971  H H    . VAL A 1 98  ? 15.167  8.480   -9.359  1.00 0.00 ? 98  VAL A H    4  
ATOM 6972  H HA   . VAL A 1 98  ? 15.211  5.569   -9.799  1.00 0.00 ? 98  VAL A HA   4  
ATOM 6973  H HB   . VAL A 1 98  ? 14.255  7.149   -7.410  1.00 0.00 ? 98  VAL A HB   4  
ATOM 6974  H HG11 . VAL A 1 98  ? 12.774  5.302   -7.646  1.00 0.00 ? 98  VAL A HG11 4  
ATOM 6975  H HG12 . VAL A 1 98  ? 14.105  4.200   -8.003  1.00 0.00 ? 98  VAL A HG12 4  
ATOM 6976  H HG13 . VAL A 1 98  ? 13.930  4.880   -6.384  1.00 0.00 ? 98  VAL A HG13 4  
ATOM 6977  H HG21 . VAL A 1 98  ? 16.231  5.079   -6.958  1.00 0.00 ? 98  VAL A HG21 4  
ATOM 6978  H HG22 . VAL A 1 98  ? 16.803  6.297   -8.098  1.00 0.00 ? 98  VAL A HG22 4  
ATOM 6979  H HG23 . VAL A 1 98  ? 16.254  6.781   -6.494  1.00 0.00 ? 98  VAL A HG23 4  
ATOM 6980  N N    . HIS A 1 99  ? 13.023  5.720   -10.986 1.00 0.00 ? 99  HIS A N    4  
ATOM 6981  C CA   . HIS A 1 99  ? 11.693  5.650   -11.579 1.00 0.00 ? 99  HIS A CA   4  
ATOM 6982  C C    . HIS A 1 99  ? 10.855  4.567   -10.907 1.00 0.00 ? 99  HIS A C    4  
ATOM 6983  O O    . HIS A 1 99  ? 11.040  3.376   -11.161 1.00 0.00 ? 99  HIS A O    4  
ATOM 6984  C CB   . HIS A 1 99  ? 11.794  5.374   -13.080 1.00 0.00 ? 99  HIS A CB   4  
ATOM 6985  C CG   . HIS A 1 99  ? 11.989  6.610   -13.904 1.00 0.00 ? 99  HIS A CG   4  
ATOM 6986  N ND1  . HIS A 1 99  ? 13.108  6.830   -14.678 1.00 0.00 ? 99  HIS A ND1  4  
ATOM 6987  C CD2  . HIS A 1 99  ? 11.197  7.695   -14.073 1.00 0.00 ? 99  HIS A CD2  4  
ATOM 6988  C CE1  . HIS A 1 99  ? 12.998  7.997   -15.287 1.00 0.00 ? 99  HIS A CE1  4  
ATOM 6989  N NE2  . HIS A 1 99  ? 11.847  8.542   -14.936 1.00 0.00 ? 99  HIS A NE2  4  
ATOM 6990  H H    . HIS A 1 99  ? 13.761  5.231   -11.407 1.00 0.00 ? 99  HIS A H    4  
ATOM 6991  H HA   . HIS A 1 99  ? 11.212  6.604   -11.429 1.00 0.00 ? 99  HIS A HA   4  
ATOM 6992  H HB2  . HIS A 1 99  ? 12.633  4.719   -13.263 1.00 0.00 ? 99  HIS A HB2  4  
ATOM 6993  H HB3  . HIS A 1 99  ? 10.887  4.892   -13.413 1.00 0.00 ? 99  HIS A HB3  4  
ATOM 6994  H HD1  . HIS A 1 99  ? 13.871  6.221   -14.767 1.00 0.00 ? 99  HIS A HD1  4  
ATOM 6995  H HD2  . HIS A 1 99  ? 10.233  7.864   -13.614 1.00 0.00 ? 99  HIS A HD2  4  
ATOM 6996  H HE1  . HIS A 1 99  ? 13.724  8.432   -15.957 1.00 0.00 ? 99  HIS A HE1  4  
ATOM 6997  H HE2  . HIS A 1 99  ? 11.554  9.446   -15.177 1.00 0.00 ? 99  HIS A HE2  4  
ATOM 6998  N N    . LEU A 1 100 ? 9.933   4.987   -10.047 1.00 0.00 ? 100 LEU A N    4  
ATOM 6999  C CA   . LEU A 1 100 ? 9.067   4.053   -9.337  1.00 0.00 ? 100 LEU A CA   4  
ATOM 7000  C C    . LEU A 1 100 ? 7.814   3.745   -10.151 1.00 0.00 ? 100 LEU A C    4  
ATOM 7001  O O    . LEU A 1 100 ? 7.148   4.652   -10.654 1.00 0.00 ? 100 LEU A O    4  
ATOM 7002  C CB   . LEU A 1 100 ? 8.675   4.625   -7.974  1.00 0.00 ? 100 LEU A CB   4  
ATOM 7003  C CG   . LEU A 1 100 ? 8.487   3.608   -6.848  1.00 0.00 ? 100 LEU A CG   4  
ATOM 7004  C CD1  . LEU A 1 100 ? 7.636   2.440   -7.320  1.00 0.00 ? 100 LEU A CD1  4  
ATOM 7005  C CD2  . LEU A 1 100 ? 9.835   3.118   -6.341  1.00 0.00 ? 100 LEU A CD2  4  
ATOM 7006  H H    . LEU A 1 100 ? 9.832   5.948   -9.886  1.00 0.00 ? 100 LEU A H    4  
ATOM 7007  H HA   . LEU A 1 100 ? 9.619   3.136   -9.188  1.00 0.00 ? 100 LEU A HA   4  
ATOM 7008  H HB2  . LEU A 1 100 ? 9.448   5.315   -7.671  1.00 0.00 ? 100 LEU A HB2  4  
ATOM 7009  H HB3  . LEU A 1 100 ? 7.744   5.161   -8.096  1.00 0.00 ? 100 LEU A HB3  4  
ATOM 7010  H HG   . LEU A 1 100 ? 7.971   4.084   -6.024  1.00 0.00 ? 100 LEU A HG   4  
ATOM 7011  H HD11 . LEU A 1 100 ? 7.294   1.875   -6.466  1.00 0.00 ? 100 LEU A HD11 4  
ATOM 7012  H HD12 . LEU A 1 100 ? 8.226   1.802   -7.962  1.00 0.00 ? 100 LEU A HD12 4  
ATOM 7013  H HD13 . LEU A 1 100 ? 6.784   2.814   -7.870  1.00 0.00 ? 100 LEU A HD13 4  
ATOM 7014  H HD21 . LEU A 1 100 ? 10.380  3.946   -5.912  1.00 0.00 ? 100 LEU A HD21 4  
ATOM 7015  H HD22 . LEU A 1 100 ? 10.400  2.703   -7.163  1.00 0.00 ? 100 LEU A HD22 4  
ATOM 7016  H HD23 . LEU A 1 100 ? 9.682   2.359   -5.588  1.00 0.00 ? 100 LEU A HD23 4  
ATOM 7017  N N    . THR A 1 101 ? 7.496   2.460   -10.277 1.00 0.00 ? 101 THR A N    4  
ATOM 7018  C CA   . THR A 1 101 ? 6.323   2.033   -11.028 1.00 0.00 ? 101 THR A CA   4  
ATOM 7019  C C    . THR A 1 101 ? 5.218   1.551   -10.096 1.00 0.00 ? 101 THR A C    4  
ATOM 7020  O O    . THR A 1 101 ? 5.345   0.508   -9.452  1.00 0.00 ? 101 THR A O    4  
ATOM 7021  C CB   . THR A 1 101 ? 6.671   0.906   -12.020 1.00 0.00 ? 101 THR A CB   4  
ATOM 7022  O OG1  . THR A 1 101 ? 7.885   1.220   -12.711 1.00 0.00 ? 101 THR A OG1  4  
ATOM 7023  C CG2  . THR A 1 101 ? 5.547   0.704   -13.025 1.00 0.00 ? 101 THR A CG2  4  
ATOM 7024  H H    . THR A 1 101 ? 8.066   1.785   -9.853  1.00 0.00 ? 101 THR A H    4  
ATOM 7025  H HA   . THR A 1 101 ? 5.961   2.881   -11.592 1.00 0.00 ? 101 THR A HA   4  
ATOM 7026  H HB   . THR A 1 101 ? 6.807   -0.011  -11.465 1.00 0.00 ? 101 THR A HB   4  
ATOM 7027  H HG1  . THR A 1 101 ? 8.451   1.746   -12.141 1.00 0.00 ? 101 THR A HG1  4  
ATOM 7028  H HG21 . THR A 1 101 ? 5.900   0.090   -13.840 1.00 0.00 ? 101 THR A HG21 4  
ATOM 7029  H HG22 . THR A 1 101 ? 5.229   1.663   -13.407 1.00 0.00 ? 101 THR A HG22 4  
ATOM 7030  H HG23 . THR A 1 101 ? 4.715   0.215   -12.540 1.00 0.00 ? 101 THR A HG23 4  
ATOM 7031  N N    . LEU A 1 102 ? 4.133   2.315   -10.027 1.00 0.00 ? 102 LEU A N    4  
ATOM 7032  C CA   . LEU A 1 102 ? 3.004   1.964   -9.173  1.00 0.00 ? 102 LEU A CA   4  
ATOM 7033  C C    . LEU A 1 102 ? 1.736   1.770   -9.999  1.00 0.00 ? 102 LEU A C    4  
ATOM 7034  O O    . LEU A 1 102 ? 1.636   2.255   -11.126 1.00 0.00 ? 102 LEU A O    4  
ATOM 7035  C CB   . LEU A 1 102 ? 2.779   3.051   -8.120  1.00 0.00 ? 102 LEU A CB   4  
ATOM 7036  C CG   . LEU A 1 102 ? 4.034   3.592   -7.435  1.00 0.00 ? 102 LEU A CG   4  
ATOM 7037  C CD1  . LEU A 1 102 ? 4.699   4.652   -8.298  1.00 0.00 ? 102 LEU A CD1  4  
ATOM 7038  C CD2  . LEU A 1 102 ? 3.692   4.155   -6.063  1.00 0.00 ? 102 LEU A CD2  4  
ATOM 7039  H H    . LEU A 1 102 ? 4.089   3.133   -10.563 1.00 0.00 ? 102 LEU A H    4  
ATOM 7040  H HA   . LEU A 1 102 ? 3.240   1.036   -8.675  1.00 0.00 ? 102 LEU A HA   4  
ATOM 7041  H HB2  . LEU A 1 102 ? 2.283   3.880   -8.601  1.00 0.00 ? 102 LEU A HB2  4  
ATOM 7042  H HB3  . LEU A 1 102 ? 2.134   2.642   -7.356  1.00 0.00 ? 102 LEU A HB3  4  
ATOM 7043  H HG   . LEU A 1 102 ? 4.739   2.783   -7.299  1.00 0.00 ? 102 LEU A HG   4  
ATOM 7044  H HD11 . LEU A 1 102 ? 5.686   4.319   -8.581  1.00 0.00 ? 102 LEU A HD11 4  
ATOM 7045  H HD12 . LEU A 1 102 ? 4.777   5.574   -7.741  1.00 0.00 ? 102 LEU A HD12 4  
ATOM 7046  H HD13 . LEU A 1 102 ? 4.106   4.818   -9.186  1.00 0.00 ? 102 LEU A HD13 4  
ATOM 7047  H HD21 . LEU A 1 102 ? 3.543   5.222   -6.140  1.00 0.00 ? 102 LEU A HD21 4  
ATOM 7048  H HD22 . LEU A 1 102 ? 4.504   3.954   -5.379  1.00 0.00 ? 102 LEU A HD22 4  
ATOM 7049  H HD23 . LEU A 1 102 ? 2.789   3.690   -5.698  1.00 0.00 ? 102 LEU A HD23 4  
ATOM 7050  N N    . VAL A 1 103 ? 0.768   1.059   -9.429  1.00 0.00 ? 103 VAL A N    4  
ATOM 7051  C CA   . VAL A 1 103 ? -0.495  0.804   -10.111 1.00 0.00 ? 103 VAL A CA   4  
ATOM 7052  C C    . VAL A 1 103 ? -1.669  0.881   -9.140  1.00 0.00 ? 103 VAL A C    4  
ATOM 7053  O O    . VAL A 1 103 ? -1.815  0.035   -8.258  1.00 0.00 ? 103 VAL A O    4  
ATOM 7054  C CB   . VAL A 1 103 ? -0.496  -0.578  -10.791 1.00 0.00 ? 103 VAL A CB   4  
ATOM 7055  C CG1  . VAL A 1 103 ? 0.192   -1.608  -9.909  1.00 0.00 ? 103 VAL A CG1  4  
ATOM 7056  C CG2  . VAL A 1 103 ? -1.918  -1.009  -11.118 1.00 0.00 ? 103 VAL A CG2  4  
ATOM 7057  H H    . VAL A 1 103 ? 0.906   0.699   -8.528  1.00 0.00 ? 103 VAL A H    4  
ATOM 7058  H HA   . VAL A 1 103 ? -0.622  1.558   -10.874 1.00 0.00 ? 103 VAL A HA   4  
ATOM 7059  H HB   . VAL A 1 103 ? 0.056   -0.501  -11.716 1.00 0.00 ? 103 VAL A HB   4  
ATOM 7060  H HG11 . VAL A 1 103 ? 0.322   -2.526  -10.463 1.00 0.00 ? 103 VAL A HG11 4  
ATOM 7061  H HG12 . VAL A 1 103 ? 1.157   -1.232  -9.602  1.00 0.00 ? 103 VAL A HG12 4  
ATOM 7062  H HG13 . VAL A 1 103 ? -0.415  -1.798  -9.037  1.00 0.00 ? 103 VAL A HG13 4  
ATOM 7063  H HG21 . VAL A 1 103 ? -2.464  -1.172  -10.201 1.00 0.00 ? 103 VAL A HG21 4  
ATOM 7064  H HG22 . VAL A 1 103 ? -2.406  -0.236  -11.695 1.00 0.00 ? 103 VAL A HG22 4  
ATOM 7065  H HG23 . VAL A 1 103 ? -1.895  -1.924  -11.692 1.00 0.00 ? 103 VAL A HG23 4  
ATOM 7066  N N    . ARG A 1 104 ? -2.503  1.902   -9.310  1.00 0.00 ? 104 ARG A N    4  
ATOM 7067  C CA   . ARG A 1 104 ? -3.664  2.090   -8.448  1.00 0.00 ? 104 ARG A CA   4  
ATOM 7068  C C    . ARG A 1 104 ? -4.959  1.898   -9.232  1.00 0.00 ? 104 ARG A C    4  
ATOM 7069  O O    . ARG A 1 104 ? -4.971  1.978   -10.460 1.00 0.00 ? 104 ARG A O    4  
ATOM 7070  C CB   . ARG A 1 104 ? -3.639  3.484   -7.820  1.00 0.00 ? 104 ARG A CB   4  
ATOM 7071  C CG   . ARG A 1 104 ? -3.803  4.610   -8.827  1.00 0.00 ? 104 ARG A CG   4  
ATOM 7072  C CD   . ARG A 1 104 ? -3.626  5.972   -8.175  1.00 0.00 ? 104 ARG A CD   4  
ATOM 7073  N NE   . ARG A 1 104 ? -4.591  6.196   -7.102  1.00 0.00 ? 104 ARG A NE   4  
ATOM 7074  C CZ   . ARG A 1 104 ? -4.914  7.399   -6.643  1.00 0.00 ? 104 ARG A CZ   4  
ATOM 7075  N NH1  . ARG A 1 104 ? -4.351  8.483   -7.161  1.00 0.00 ? 104 ARG A NH1  4  
ATOM 7076  N NH2  . ARG A 1 104 ? -5.801  7.521   -5.664  1.00 0.00 ? 104 ARG A NH2  4  
ATOM 7077  H H    . ARG A 1 104 ? -2.334  2.544   -10.030 1.00 0.00 ? 104 ARG A H    4  
ATOM 7078  H HA   . ARG A 1 104 ? -3.619  1.350   -7.663  1.00 0.00 ? 104 ARG A HA   4  
ATOM 7079  H HB2  . ARG A 1 104 ? -4.440  3.557   -7.099  1.00 0.00 ? 104 ARG A HB2  4  
ATOM 7080  H HB3  . ARG A 1 104 ? -2.695  3.620   -7.312  1.00 0.00 ? 104 ARG A HB3  4  
ATOM 7081  H HG2  . ARG A 1 104 ? -3.062  4.496   -9.605  1.00 0.00 ? 104 ARG A HG2  4  
ATOM 7082  H HG3  . ARG A 1 104 ? -4.792  4.553   -9.258  1.00 0.00 ? 104 ARG A HG3  4  
ATOM 7083  H HD2  . ARG A 1 104 ? -2.628  6.034   -7.767  1.00 0.00 ? 104 ARG A HD2  4  
ATOM 7084  H HD3  . ARG A 1 104 ? -3.754  6.736   -8.928  1.00 0.00 ? 104 ARG A HD3  4  
ATOM 7085  H HE   . ARG A 1 104 ? -5.018  5.409   -6.705  1.00 0.00 ? 104 ARG A HE   4  
ATOM 7086  H HH11 . ARG A 1 104 ? -3.683  8.394   -7.899  1.00 0.00 ? 104 ARG A HH11 4  
ATOM 7087  H HH12 . ARG A 1 104 ? -4.597  9.388   -6.814  1.00 0.00 ? 104 ARG A HH12 4  
ATOM 7088  H HH21 . ARG A 1 104 ? -6.227  6.707   -5.271  1.00 0.00 ? 104 ARG A HH21 4  
ATOM 7089  H HH22 . ARG A 1 104 ? -6.043  8.428   -5.319  1.00 0.00 ? 104 ARG A HH22 4  
ATOM 7090  N N    . ARG A 1 105 ? -6.048  1.643   -8.512  1.00 0.00 ? 105 ARG A N    4  
ATOM 7091  C CA   . ARG A 1 105 ? -7.347  1.437   -9.140  1.00 0.00 ? 105 ARG A CA   4  
ATOM 7092  C C    . ARG A 1 105 ? -7.836  2.718   -9.810  1.00 0.00 ? 105 ARG A C    4  
ATOM 7093  O O    . ARG A 1 105 ? -7.805  3.794   -9.214  1.00 0.00 ? 105 ARG A O    4  
ATOM 7094  C CB   . ARG A 1 105 ? -8.370  0.969   -8.103  1.00 0.00 ? 105 ARG A CB   4  
ATOM 7095  C CG   . ARG A 1 105 ? -9.576  0.269   -8.709  1.00 0.00 ? 105 ARG A CG   4  
ATOM 7096  C CD   . ARG A 1 105 ? -10.291 -0.597  -7.684  1.00 0.00 ? 105 ARG A CD   4  
ATOM 7097  N NE   . ARG A 1 105 ? -11.721 -0.701  -7.958  1.00 0.00 ? 105 ARG A NE   4  
ATOM 7098  C CZ   . ARG A 1 105 ? -12.628 -0.995  -7.033  1.00 0.00 ? 105 ARG A CZ   4  
ATOM 7099  N NH1  . ARG A 1 105 ? -12.254 -1.212  -5.780  1.00 0.00 ? 105 ARG A NH1  4  
ATOM 7100  N NH2  . ARG A 1 105 ? -13.911 -1.072  -7.360  1.00 0.00 ? 105 ARG A NH2  4  
ATOM 7101  H H    . ARG A 1 105 ? -5.975  1.591   -7.536  1.00 0.00 ? 105 ARG A H    4  
ATOM 7102  H HA   . ARG A 1 105 ? -7.235  0.671   -9.893  1.00 0.00 ? 105 ARG A HA   4  
ATOM 7103  H HB2  . ARG A 1 105 ? -7.887  0.282   -7.423  1.00 0.00 ? 105 ARG A HB2  4  
ATOM 7104  H HB3  . ARG A 1 105 ? -8.720  1.826   -7.548  1.00 0.00 ? 105 ARG A HB3  4  
ATOM 7105  H HG2  . ARG A 1 105 ? -10.265 1.014   -9.078  1.00 0.00 ? 105 ARG A HG2  4  
ATOM 7106  H HG3  . ARG A 1 105 ? -9.245  -0.354  -9.527  1.00 0.00 ? 105 ARG A HG3  4  
ATOM 7107  H HD2  . ARG A 1 105 ? -9.858  -1.586  -7.703  1.00 0.00 ? 105 ARG A HD2  4  
ATOM 7108  H HD3  . ARG A 1 105 ? -10.152 -0.162  -6.706  1.00 0.00 ? 105 ARG A HD3  4  
ATOM 7109  H HE   . ARG A 1 105 ? -12.020 -0.544  -8.878  1.00 0.00 ? 105 ARG A HE   4  
ATOM 7110  H HH11 . ARG A 1 105 ? -11.287 -1.154  -5.530  1.00 0.00 ? 105 ARG A HH11 4  
ATOM 7111  H HH12 . ARG A 1 105 ? -12.938 -1.432  -5.084  1.00 0.00 ? 105 ARG A HH12 4  
ATOM 7112  H HH21 . ARG A 1 105 ? -14.197 -0.908  -8.304  1.00 0.00 ? 105 ARG A HH21 4  
ATOM 7113  H HH22 . ARG A 1 105 ? -14.592 -1.293  -6.663  1.00 0.00 ? 105 ARG A HH22 4  
ATOM 7114  N N    . LYS A 1 106 ? -8.288  2.593   -11.054 1.00 0.00 ? 106 LYS A N    4  
ATOM 7115  C CA   . LYS A 1 106 ? -8.784  3.739   -11.806 1.00 0.00 ? 106 LYS A CA   4  
ATOM 7116  C C    . LYS A 1 106 ? -10.166 4.157   -11.312 1.00 0.00 ? 106 LYS A C    4  
ATOM 7117  O O    . LYS A 1 106 ? -10.860 3.385   -10.651 1.00 0.00 ? 106 LYS A O    4  
ATOM 7118  C CB   . LYS A 1 106 ? -8.843  3.408   -13.299 1.00 0.00 ? 106 LYS A CB   4  
ATOM 7119  C CG   . LYS A 1 106 ? -7.549  2.831   -13.846 1.00 0.00 ? 106 LYS A CG   4  
ATOM 7120  C CD   . LYS A 1 106 ? -7.805  1.905   -15.023 1.00 0.00 ? 106 LYS A CD   4  
ATOM 7121  C CE   . LYS A 1 106 ? -7.784  2.661   -16.342 1.00 0.00 ? 106 LYS A CE   4  
ATOM 7122  N NZ   . LYS A 1 106 ? -8.679  2.034   -17.355 1.00 0.00 ? 106 LYS A NZ   4  
ATOM 7123  H H    . LYS A 1 106 ? -8.288  1.708   -11.476 1.00 0.00 ? 106 LYS A H    4  
ATOM 7124  H HA   . LYS A 1 106 ? -8.098  4.558   -11.655 1.00 0.00 ? 106 LYS A HA   4  
ATOM 7125  H HB2  . LYS A 1 106 ? -9.632  2.690   -13.465 1.00 0.00 ? 106 LYS A HB2  4  
ATOM 7126  H HB3  . LYS A 1 106 ? -9.070  4.312   -13.847 1.00 0.00 ? 106 LYS A HB3  4  
ATOM 7127  H HG2  . LYS A 1 106 ? -6.913  3.642   -14.171 1.00 0.00 ? 106 LYS A HG2  4  
ATOM 7128  H HG3  . LYS A 1 106 ? -7.054  2.275   -13.062 1.00 0.00 ? 106 LYS A HG3  4  
ATOM 7129  H HD2  . LYS A 1 106 ? -7.038  1.144   -15.045 1.00 0.00 ? 106 LYS A HD2  4  
ATOM 7130  H HD3  . LYS A 1 106 ? -8.773  1.439   -14.899 1.00 0.00 ? 106 LYS A HD3  4  
ATOM 7131  H HE2  . LYS A 1 106 ? -8.109  3.675   -16.167 1.00 0.00 ? 106 LYS A HE2  4  
ATOM 7132  H HE3  . LYS A 1 106 ? -6.773  2.667   -16.722 1.00 0.00 ? 106 LYS A HE3  4  
ATOM 7133  H HZ1  . LYS A 1 106 ? -9.633  2.444   -17.290 1.00 0.00 ? 106 LYS A HZ1  4  
ATOM 7134  H HZ2  . LYS A 1 106 ? -8.742  1.009   -17.190 1.00 0.00 ? 106 LYS A HZ2  4  
ATOM 7135  H HZ3  . LYS A 1 106 ? -8.306  2.198   -18.312 1.00 0.00 ? 106 LYS A HZ3  4  
ATOM 7136  N N    . THR A 1 107 ? -10.560 5.384   -11.639 1.00 0.00 ? 107 THR A N    4  
ATOM 7137  C CA   . THR A 1 107 ? -11.858 5.904   -11.229 1.00 0.00 ? 107 THR A CA   4  
ATOM 7138  C C    . THR A 1 107 ? -12.994 5.081   -11.825 1.00 0.00 ? 107 THR A C    4  
ATOM 7139  O O    . THR A 1 107 ? -13.300 5.196   -13.012 1.00 0.00 ? 107 THR A O    4  
ATOM 7140  C CB   . THR A 1 107 ? -12.031 7.376   -11.648 1.00 0.00 ? 107 THR A CB   4  
ATOM 7141  O OG1  . THR A 1 107 ? -11.912 7.498   -13.070 1.00 0.00 ? 107 THR A OG1  4  
ATOM 7142  C CG2  . THR A 1 107 ? -10.994 8.258   -10.970 1.00 0.00 ? 107 THR A CG2  4  
ATOM 7143  H H    . THR A 1 107 ? -9.961  5.952   -12.167 1.00 0.00 ? 107 THR A H    4  
ATOM 7144  H HA   . THR A 1 107 ? -11.914 5.850   -10.151 1.00 0.00 ? 107 THR A HA   4  
ATOM 7145  H HB   . THR A 1 107 ? -13.015 7.707   -11.348 1.00 0.00 ? 107 THR A HB   4  
ATOM 7146  H HG1  . THR A 1 107 ? -12.502 8.188   -13.383 1.00 0.00 ? 107 THR A HG1  4  
ATOM 7147  H HG21 . THR A 1 107 ? -11.340 8.526   -9.982  1.00 0.00 ? 107 THR A HG21 4  
ATOM 7148  H HG22 . THR A 1 107 ? -10.845 9.154   -11.554 1.00 0.00 ? 107 THR A HG22 4  
ATOM 7149  H HG23 . THR A 1 107 ? -10.061 7.720   -10.890 1.00 0.00 ? 107 THR A HG23 4  
ATOM 7150  N N    . SER A 1 108 ? -13.616 4.251   -10.994 1.00 0.00 ? 108 SER A N    4  
ATOM 7151  C CA   . SER A 1 108 ? -14.717 3.405   -11.441 1.00 0.00 ? 108 SER A CA   4  
ATOM 7152  C C    . SER A 1 108 ? -15.519 2.885   -10.252 1.00 0.00 ? 108 SER A C    4  
ATOM 7153  O O    . SER A 1 108 ? -14.966 2.281   -9.332  1.00 0.00 ? 108 SER A O    4  
ATOM 7154  C CB   . SER A 1 108 ? -14.184 2.231   -12.264 1.00 0.00 ? 108 SER A CB   4  
ATOM 7155  O OG   . SER A 1 108 ? -14.031 2.591   -13.626 1.00 0.00 ? 108 SER A OG   4  
ATOM 7156  H H    . SER A 1 108 ? -13.326 4.204   -10.059 1.00 0.00 ? 108 SER A H    4  
ATOM 7157  H HA   . SER A 1 108 ? -15.364 4.005   -12.062 1.00 0.00 ? 108 SER A HA   4  
ATOM 7158  H HB2  . SER A 1 108 ? -13.224 1.927   -11.875 1.00 0.00 ? 108 SER A HB2  4  
ATOM 7159  H HB3  . SER A 1 108 ? -14.877 1.405   -12.198 1.00 0.00 ? 108 SER A HB3  4  
ATOM 7160  H HG   . SER A 1 108 ? -14.837 3.008   -13.939 1.00 0.00 ? 108 SER A HG   4  
ATOM 7161  N N    . SER A 1 109 ? -16.826 3.124   -10.278 1.00 0.00 ? 109 SER A N    4  
ATOM 7162  C CA   . SER A 1 109 ? -17.706 2.684   -9.201  1.00 0.00 ? 109 SER A CA   4  
ATOM 7163  C C    . SER A 1 109 ? -18.385 1.365   -9.559  1.00 0.00 ? 109 SER A C    4  
ATOM 7164  O O    . SER A 1 109 ? -18.265 0.878   -10.683 1.00 0.00 ? 109 SER A O    4  
ATOM 7165  C CB   . SER A 1 109 ? -18.761 3.751   -8.908  1.00 0.00 ? 109 SER A CB   4  
ATOM 7166  O OG   . SER A 1 109 ? -19.698 3.847   -9.967  1.00 0.00 ? 109 SER A OG   4  
ATOM 7167  H H    . SER A 1 109 ? -17.208 3.611   -11.038 1.00 0.00 ? 109 SER A H    4  
ATOM 7168  H HA   . SER A 1 109 ? -17.101 2.536   -8.319  1.00 0.00 ? 109 SER A HA   4  
ATOM 7169  H HB2  . SER A 1 109 ? -19.287 3.494   -8.001  1.00 0.00 ? 109 SER A HB2  4  
ATOM 7170  H HB3  . SER A 1 109 ? -18.276 4.709   -8.784  1.00 0.00 ? 109 SER A HB3  4  
ATOM 7171  H HG   . SER A 1 109 ? -19.297 3.526   -10.779 1.00 0.00 ? 109 SER A HG   4  
ATOM 7172  N N    . SER A 1 110 ? -19.098 0.793   -8.595  1.00 0.00 ? 110 SER A N    4  
ATOM 7173  C CA   . SER A 1 110 ? -19.794 -0.471  -8.806  1.00 0.00 ? 110 SER A CA   4  
ATOM 7174  C C    . SER A 1 110 ? -21.304 -0.282  -8.709  1.00 0.00 ? 110 SER A C    4  
ATOM 7175  O O    . SER A 1 110 ? -21.787 0.624   -8.028  1.00 0.00 ? 110 SER A O    4  
ATOM 7176  C CB   . SER A 1 110 ? -19.331 -1.509  -7.781  1.00 0.00 ? 110 SER A CB   4  
ATOM 7177  O OG   . SER A 1 110 ? -20.052 -2.721  -7.922  1.00 0.00 ? 110 SER A OG   4  
ATOM 7178  H H    . SER A 1 110 ? -19.155 1.231   -7.719  1.00 0.00 ? 110 SER A H    4  
ATOM 7179  H HA   . SER A 1 110 ? -19.549 -0.822  -9.797  1.00 0.00 ? 110 SER A HA   4  
ATOM 7180  H HB2  . SER A 1 110 ? -18.281 -1.710  -7.925  1.00 0.00 ? 110 SER A HB2  4  
ATOM 7181  H HB3  . SER A 1 110 ? -19.491 -1.123  -6.785  1.00 0.00 ? 110 SER A HB3  4  
ATOM 7182  H HG   . SER A 1 110 ? -20.991 -2.531  -7.977  1.00 0.00 ? 110 SER A HG   4  
ATOM 7183  N N    . THR A 1 111 ? -22.048 -1.145  -9.395  1.00 0.00 ? 111 THR A N    4  
ATOM 7184  C CA   . THR A 1 111 ? -23.503 -1.074  -9.388  1.00 0.00 ? 111 THR A CA   4  
ATOM 7185  C C    . THR A 1 111 ? -24.051 -1.153  -7.968  1.00 0.00 ? 111 THR A C    4  
ATOM 7186  O O    . THR A 1 111 ? -23.612 -1.979  -7.168  1.00 0.00 ? 111 THR A O    4  
ATOM 7187  C CB   . THR A 1 111 ? -24.124 -2.205  -10.230 1.00 0.00 ? 111 THR A CB   4  
ATOM 7188  O OG1  . THR A 1 111 ? -25.551 -2.082  -10.238 1.00 0.00 ? 111 THR A OG1  4  
ATOM 7189  C CG2  . THR A 1 111 ? -23.731 -3.568  -9.679  1.00 0.00 ? 111 THR A CG2  4  
ATOM 7190  H H    . THR A 1 111 ? -21.605 -1.845  -9.918  1.00 0.00 ? 111 THR A H    4  
ATOM 7191  H HA   . THR A 1 111 ? -23.793 -0.129  -9.824  1.00 0.00 ? 111 THR A HA   4  
ATOM 7192  H HB   . THR A 1 111 ? -23.757 -2.123  -11.243 1.00 0.00 ? 111 THR A HB   4  
ATOM 7193  H HG1  . THR A 1 111 ? -25.792 -1.158  -10.343 1.00 0.00 ? 111 THR A HG1  4  
ATOM 7194  H HG21 . THR A 1 111 ? -23.744 -4.296  -10.477 1.00 0.00 ? 111 THR A HG21 4  
ATOM 7195  H HG22 . THR A 1 111 ? -24.432 -3.862  -8.912  1.00 0.00 ? 111 THR A HG22 4  
ATOM 7196  H HG23 . THR A 1 111 ? -22.738 -3.513  -9.259  1.00 0.00 ? 111 THR A HG23 4  
ATOM 7197  N N    . SER A 1 112 ? -25.014 -0.290  -7.661  1.00 0.00 ? 112 SER A N    4  
ATOM 7198  C CA   . SER A 1 112 ? -25.620 -0.260  -6.335  1.00 0.00 ? 112 SER A CA   4  
ATOM 7199  C C    . SER A 1 112 ? -27.123 -0.016  -6.430  1.00 0.00 ? 112 SER A C    4  
ATOM 7200  O O    . SER A 1 112 ? -27.601 0.754   -7.263  1.00 0.00 ? 112 SER A O    4  
ATOM 7201  C CB   . SER A 1 112 ? -24.969 0.827   -5.478  1.00 0.00 ? 112 SER A CB   4  
ATOM 7202  O OG   . SER A 1 112 ? -25.363 2.119   -5.907  1.00 0.00 ? 112 SER A OG   4  
ATOM 7203  H H    . SER A 1 112 ? -25.322 0.345   -8.342  1.00 0.00 ? 112 SER A H    4  
ATOM 7204  H HA   . SER A 1 112 ? -25.451 -1.221  -5.872  1.00 0.00 ? 112 SER A HA   4  
ATOM 7205  H HB2  . SER A 1 112 ? -25.266 0.697   -4.448  1.00 0.00 ? 112 SER A HB2  4  
ATOM 7206  H HB3  . SER A 1 112 ? -23.894 0.747   -5.555  1.00 0.00 ? 112 SER A HB3  4  
ATOM 7207  H HG   . SER A 1 112 ? -25.446 2.698   -5.145  1.00 0.00 ? 112 SER A HG   4  
ATOM 7208  N N    . PRO A 1 113 ? -27.887 -0.688  -5.556  1.00 0.00 ? 113 PRO A N    4  
ATOM 7209  C CA   . PRO A 1 113 ? -29.347 -0.562  -5.520  1.00 0.00 ? 113 PRO A CA   4  
ATOM 7210  C C    . PRO A 1 113 ? -29.798 0.804   -5.014  1.00 0.00 ? 113 PRO A C    4  
ATOM 7211  O O    . PRO A 1 113 ? -28.992 1.726   -4.882  1.00 0.00 ? 113 PRO A O    4  
ATOM 7212  C CB   . PRO A 1 113 ? -29.774 -1.661  -4.545  1.00 0.00 ? 113 PRO A CB   4  
ATOM 7213  C CG   . PRO A 1 113 ? -28.588 -1.873  -3.669  1.00 0.00 ? 113 PRO A CG   4  
ATOM 7214  C CD   . PRO A 1 113 ? -27.384 -1.623  -4.535  1.00 0.00 ? 113 PRO A CD   4  
ATOM 7215  H HA   . PRO A 1 113 ? -29.785 -0.748  -6.490  1.00 0.00 ? 113 PRO A HA   4  
ATOM 7216  H HB2  . PRO A 1 113 ? -30.631 -1.328  -3.976  1.00 0.00 ? 113 PRO A HB2  4  
ATOM 7217  H HB3  . PRO A 1 113 ? -30.025 -2.556  -5.093  1.00 0.00 ? 113 PRO A HB3  4  
ATOM 7218  H HG2  . PRO A 1 113 ? -28.609 -1.175  -2.846  1.00 0.00 ? 113 PRO A HG2  4  
ATOM 7219  H HG3  . PRO A 1 113 ? -28.580 -2.888  -3.302  1.00 0.00 ? 113 PRO A HG3  4  
ATOM 7220  H HD2  . PRO A 1 113 ? -26.591 -1.172  -3.958  1.00 0.00 ? 113 PRO A HD2  4  
ATOM 7221  H HD3  . PRO A 1 113 ? -27.048 -2.543  -4.989  1.00 0.00 ? 113 PRO A HD3  4  
ATOM 7222  N N    . LEU A 1 114 ? -31.090 0.928   -4.732  1.00 0.00 ? 114 LEU A N    4  
ATOM 7223  C CA   . LEU A 1 114 ? -31.649 2.183   -4.239  1.00 0.00 ? 114 LEU A CA   4  
ATOM 7224  C C    . LEU A 1 114 ? -31.669 2.208   -2.714  1.00 0.00 ? 114 LEU A C    4  
ATOM 7225  O O    . LEU A 1 114 ? -31.510 3.263   -2.100  1.00 0.00 ? 114 LEU A O    4  
ATOM 7226  C CB   . LEU A 1 114 ? -33.065 2.381   -4.783  1.00 0.00 ? 114 LEU A CB   4  
ATOM 7227  C CG   . LEU A 1 114 ? -34.147 1.485   -4.179  1.00 0.00 ? 114 LEU A CG   4  
ATOM 7228  C CD1  . LEU A 1 114 ? -35.493 2.193   -4.188  1.00 0.00 ? 114 LEU A CD1  4  
ATOM 7229  C CD2  . LEU A 1 114 ? -34.231 0.167   -4.936  1.00 0.00 ? 114 LEU A CD2  4  
ATOM 7230  H H    . LEU A 1 114 ? -31.683 0.159   -4.857  1.00 0.00 ? 114 LEU A H    4  
ATOM 7231  H HA   . LEU A 1 114 ? -31.021 2.986   -4.593  1.00 0.00 ? 114 LEU A HA   4  
ATOM 7232  H HB2  . LEU A 1 114 ? -33.348 3.407   -4.603  1.00 0.00 ? 114 LEU A HB2  4  
ATOM 7233  H HB3  . LEU A 1 114 ? -33.039 2.198   -5.848  1.00 0.00 ? 114 LEU A HB3  4  
ATOM 7234  H HG   . LEU A 1 114 ? -33.893 1.266   -3.151  1.00 0.00 ? 114 LEU A HG   4  
ATOM 7235  H HD11 . LEU A 1 114 ? -35.969 2.049   -5.146  1.00 0.00 ? 114 LEU A HD11 4  
ATOM 7236  H HD12 . LEU A 1 114 ? -35.345 3.248   -4.014  1.00 0.00 ? 114 LEU A HD12 4  
ATOM 7237  H HD13 . LEU A 1 114 ? -36.120 1.784   -3.409  1.00 0.00 ? 114 LEU A HD13 4  
ATOM 7238  H HD21 . LEU A 1 114 ? -35.192 -0.291  -4.755  1.00 0.00 ? 114 LEU A HD21 4  
ATOM 7239  H HD22 . LEU A 1 114 ? -33.448 -0.494  -4.594  1.00 0.00 ? 114 LEU A HD22 4  
ATOM 7240  H HD23 . LEU A 1 114 ? -34.112 0.350   -5.993  1.00 0.00 ? 114 LEU A HD23 4  
ATOM 7241  N N    . GLU A 1 115 ? -31.863 1.040   -2.110  1.00 0.00 ? 115 GLU A N    4  
ATOM 7242  C CA   . GLU A 1 115 ? -31.901 0.929   -0.657  1.00 0.00 ? 115 GLU A CA   4  
ATOM 7243  C C    . GLU A 1 115 ? -31.076 -0.262  -0.180  1.00 0.00 ? 115 GLU A C    4  
ATOM 7244  O O    . GLU A 1 115 ? -31.608 -1.277  0.271   1.00 0.00 ? 115 GLU A O    4  
ATOM 7245  C CB   . GLU A 1 115 ? -33.346 0.790   -0.172  1.00 0.00 ? 115 GLU A CB   4  
ATOM 7246  C CG   . GLU A 1 115 ? -33.469 0.602   1.330   1.00 0.00 ? 115 GLU A CG   4  
ATOM 7247  C CD   . GLU A 1 115 ? -34.781 1.127   1.879   1.00 0.00 ? 115 GLU A CD   4  
ATOM 7248  O OE1  . GLU A 1 115 ? -35.242 2.185   1.401   1.00 0.00 ? 115 GLU A OE1  4  
ATOM 7249  O OE2  . GLU A 1 115 ? -35.346 0.482   2.786   1.00 0.00 ? 115 GLU A OE2  4  
ATOM 7250  H H    . GLU A 1 115 ? -31.983 0.234   -2.655  1.00 0.00 ? 115 GLU A H    4  
ATOM 7251  H HA   . GLU A 1 115 ? -31.479 1.833   -0.244  1.00 0.00 ? 115 GLU A HA   4  
ATOM 7252  H HB2  . GLU A 1 115 ? -33.894 1.679   -0.449  1.00 0.00 ? 115 GLU A HB2  4  
ATOM 7253  H HB3  . GLU A 1 115 ? -33.795 -0.064  -0.658  1.00 0.00 ? 115 GLU A HB3  4  
ATOM 7254  H HG2  . GLU A 1 115 ? -33.398 -0.452  1.556   1.00 0.00 ? 115 GLU A HG2  4  
ATOM 7255  H HG3  . GLU A 1 115 ? -32.657 1.127   1.813   1.00 0.00 ? 115 GLU A HG3  4  
ATOM 7256  N N    . PRO A 1 116 ? -29.745 -0.137  -0.281  1.00 0.00 ? 116 PRO A N    4  
ATOM 7257  C CA   . PRO A 1 116 ? -28.817 -1.193  0.135   1.00 0.00 ? 116 PRO A CA   4  
ATOM 7258  C C    . PRO A 1 116 ? -28.783 -1.373  1.649   1.00 0.00 ? 116 PRO A C    4  
ATOM 7259  O O    . PRO A 1 116 ? -28.926 -0.419  2.414   1.00 0.00 ? 116 PRO A O    4  
ATOM 7260  C CB   . PRO A 1 116 ? -27.462 -0.696  -0.375  1.00 0.00 ? 116 PRO A CB   4  
ATOM 7261  C CG   . PRO A 1 116 ? -27.605 0.785   -0.448  1.00 0.00 ? 116 PRO A CG   4  
ATOM 7262  C CD   . PRO A 1 116 ? -29.042 1.044   -0.808  1.00 0.00 ? 116 PRO A CD   4  
ATOM 7263  H HA   . PRO A 1 116 ? -29.055 -2.137  -0.333  1.00 0.00 ? 116 PRO A HA   4  
ATOM 7264  H HB2  . PRO A 1 116 ? -26.685 -0.984  0.320   1.00 0.00 ? 116 PRO A HB2  4  
ATOM 7265  H HB3  . PRO A 1 116 ? -27.260 -1.122  -1.346  1.00 0.00 ? 116 PRO A HB3  4  
ATOM 7266  H HG2  . PRO A 1 116 ? -27.373 1.225   0.510   1.00 0.00 ? 116 PRO A HG2  4  
ATOM 7267  H HG3  . PRO A 1 116 ? -26.951 1.179   -1.212  1.00 0.00 ? 116 PRO A HG3  4  
ATOM 7268  H HD2  . PRO A 1 116 ? -29.394 1.947   -0.331  1.00 0.00 ? 116 PRO A HD2  4  
ATOM 7269  H HD3  . PRO A 1 116 ? -29.156 1.113   -1.880  1.00 0.00 ? 116 PRO A HD3  4  
ATOM 7270  N N    . PRO A 1 117 ? -28.589 -2.623  2.093   1.00 0.00 ? 117 PRO A N    4  
ATOM 7271  C CA   . PRO A 1 117 ? -28.532 -2.956  3.520   1.00 0.00 ? 117 PRO A CA   4  
ATOM 7272  C C    . PRO A 1 117 ? -27.272 -2.418  4.190   1.00 0.00 ? 117 PRO A C    4  
ATOM 7273  O O    . PRO A 1 117 ? -26.212 -3.040  4.131   1.00 0.00 ? 117 PRO A O    4  
ATOM 7274  C CB   . PRO A 1 117 ? -28.529 -4.487  3.527   1.00 0.00 ? 117 PRO A CB   4  
ATOM 7275  C CG   . PRO A 1 117 ? -27.964 -4.871  2.203   1.00 0.00 ? 117 PRO A CG   4  
ATOM 7276  C CD   . PRO A 1 117 ? -28.411 -3.808  1.238   1.00 0.00 ? 117 PRO A CD   4  
ATOM 7277  H HA   . PRO A 1 117 ? -29.402 -2.594  4.047   1.00 0.00 ? 117 PRO A HA   4  
ATOM 7278  H HB2  . PRO A 1 117 ? -27.912 -4.844  4.340   1.00 0.00 ? 117 PRO A HB2  4  
ATOM 7279  H HB3  . PRO A 1 117 ? -29.538 -4.852  3.646   1.00 0.00 ? 117 PRO A HB3  4  
ATOM 7280  H HG2  . PRO A 1 117 ? -26.886 -4.898  2.258   1.00 0.00 ? 117 PRO A HG2  4  
ATOM 7281  H HG3  . PRO A 1 117 ? -28.350 -5.834  1.905   1.00 0.00 ? 117 PRO A HG3  4  
ATOM 7282  H HD2  . PRO A 1 117 ? -27.652 -3.633  0.490   1.00 0.00 ? 117 PRO A HD2  4  
ATOM 7283  H HD3  . PRO A 1 117 ? -29.344 -4.090  0.772   1.00 0.00 ? 117 PRO A HD3  4  
ATOM 7284  N N    . SER A 1 118 ? -27.396 -1.258  4.828   1.00 0.00 ? 118 SER A N    4  
ATOM 7285  C CA   . SER A 1 118 ? -26.266 -0.635  5.507   1.00 0.00 ? 118 SER A CA   4  
ATOM 7286  C C    . SER A 1 118 ? -26.358 -0.841  7.016   1.00 0.00 ? 118 SER A C    4  
ATOM 7287  O O    . SER A 1 118 ? -25.424 -1.340  7.643   1.00 0.00 ? 118 SER A O    4  
ATOM 7288  C CB   . SER A 1 118 ? -26.214 0.860   5.187   1.00 0.00 ? 118 SER A CB   4  
ATOM 7289  O OG   . SER A 1 118 ? -26.007 1.079   3.803   1.00 0.00 ? 118 SER A OG   4  
ATOM 7290  H H    . SER A 1 118 ? -28.268 -0.810  4.839   1.00 0.00 ? 118 SER A H    4  
ATOM 7291  H HA   . SER A 1 118 ? -25.363 -1.103  5.146   1.00 0.00 ? 118 SER A HA   4  
ATOM 7292  H HB2  . SER A 1 118 ? -27.146 1.321   5.477   1.00 0.00 ? 118 SER A HB2  4  
ATOM 7293  H HB3  . SER A 1 118 ? -25.402 1.315   5.737   1.00 0.00 ? 118 SER A HB3  4  
ATOM 7294  H HG   . SER A 1 118 ? -25.587 0.308   3.416   1.00 0.00 ? 118 SER A HG   4  
ATOM 7295  N N    . ASP A 1 119 ? -27.491 -0.453  7.591   1.00 0.00 ? 119 ASP A N    4  
ATOM 7296  C CA   . ASP A 1 119 ? -27.707 -0.596  9.027   1.00 0.00 ? 119 ASP A CA   4  
ATOM 7297  C C    . ASP A 1 119 ? -28.894 -1.511  9.309   1.00 0.00 ? 119 ASP A C    4  
ATOM 7298  O O    . ASP A 1 119 ? -30.047 -1.132  9.098   1.00 0.00 ? 119 ASP A O    4  
ATOM 7299  C CB   . ASP A 1 119 ? -27.938 0.773   9.668   1.00 0.00 ? 119 ASP A CB   4  
ATOM 7300  C CG   . ASP A 1 119 ? -26.650 1.551   9.853   1.00 0.00 ? 119 ASP A CG   4  
ATOM 7301  O OD1  . ASP A 1 119 ? -25.943 1.298   10.852  1.00 0.00 ? 119 ASP A OD1  4  
ATOM 7302  O OD2  . ASP A 1 119 ? -26.348 2.411   9.000   1.00 0.00 ? 119 ASP A OD2  4  
ATOM 7303  H H    . ASP A 1 119 ? -28.199 -0.062  7.038   1.00 0.00 ? 119 ASP A H    4  
ATOM 7304  H HA   . ASP A 1 119 ? -26.819 -1.037  9.453   1.00 0.00 ? 119 ASP A HA   4  
ATOM 7305  H HB2  . ASP A 1 119 ? -28.598 1.352   9.037   1.00 0.00 ? 119 ASP A HB2  4  
ATOM 7306  H HB3  . ASP A 1 119 ? -28.399 0.637   10.635  1.00 0.00 ? 119 ASP A HB3  4  
ATOM 7307  N N    . ARG A 1 120 ? -28.605 -2.717  9.786   1.00 0.00 ? 120 ARG A N    4  
ATOM 7308  C CA   . ARG A 1 120 ? -29.649 -3.687  10.095  1.00 0.00 ? 120 ARG A CA   4  
ATOM 7309  C C    . ARG A 1 120 ? -30.662 -3.102  11.075  1.00 0.00 ? 120 ARG A C    4  
ATOM 7310  O O    . ARG A 1 120 ? -31.870 -3.191  10.861  1.00 0.00 ? 120 ARG A O    4  
ATOM 7311  C CB   . ARG A 1 120 ? -29.035 -4.960  10.680  1.00 0.00 ? 120 ARG A CB   4  
ATOM 7312  C CG   . ARG A 1 120 ? -30.020 -6.111  10.802  1.00 0.00 ? 120 ARG A CG   4  
ATOM 7313  C CD   . ARG A 1 120 ? -30.181 -6.848  9.481   1.00 0.00 ? 120 ARG A CD   4  
ATOM 7314  N NE   . ARG A 1 120 ? -31.298 -7.789  9.512   1.00 0.00 ? 120 ARG A NE   4  
ATOM 7315  C CZ   . ARG A 1 120 ? -31.424 -8.808  8.670   1.00 0.00 ? 120 ARG A CZ   4  
ATOM 7316  N NH1  . ARG A 1 120 ? -30.507 -9.018  7.736   1.00 0.00 ? 120 ARG A NH1  4  
ATOM 7317  N NH2  . ARG A 1 120 ? -32.469 -9.620  8.761   1.00 0.00 ? 120 ARG A NH2  4  
ATOM 7318  H H    . ARG A 1 120 ? -27.668 -2.961  9.934   1.00 0.00 ? 120 ARG A H    4  
ATOM 7319  H HA   . ARG A 1 120 ? -30.157 -3.933  9.175   1.00 0.00 ? 120 ARG A HA   4  
ATOM 7320  H HB2  . ARG A 1 120 ? -28.221 -5.278  10.045  1.00 0.00 ? 120 ARG A HB2  4  
ATOM 7321  H HB3  . ARG A 1 120 ? -28.649 -4.740  11.664  1.00 0.00 ? 120 ARG A HB3  4  
ATOM 7322  H HG2  . ARG A 1 120 ? -29.659 -6.805  11.547  1.00 0.00 ? 120 ARG A HG2  4  
ATOM 7323  H HG3  . ARG A 1 120 ? -30.980 -5.721  11.106  1.00 0.00 ? 120 ARG A HG3  4  
ATOM 7324  H HD2  . ARG A 1 120 ? -30.354 -6.125  8.699   1.00 0.00 ? 120 ARG A HD2  4  
ATOM 7325  H HD3  . ARG A 1 120 ? -29.271 -7.391  9.274   1.00 0.00 ? 120 ARG A HD3  4  
ATOM 7326  H HE   . ARG A 1 120 ? -31.988 -7.652  10.194  1.00 0.00 ? 120 ARG A HE   4  
ATOM 7327  H HH11 . ARG A 1 120 ? -29.717 -8.408  7.666   1.00 0.00 ? 120 ARG A HH11 4  
ATOM 7328  H HH12 . ARG A 1 120 ? -30.603 -9.787  7.104   1.00 0.00 ? 120 ARG A HH12 4  
ATOM 7329  H HH21 . ARG A 1 120 ? -33.163 -9.465  9.464   1.00 0.00 ? 120 ARG A HH21 4  
ATOM 7330  H HH22 . ARG A 1 120 ? -32.563 -10.387 8.127   1.00 0.00 ? 120 ARG A HH22 4  
ATOM 7331  N N    . GLY A 1 121 ? -30.160 -2.503  12.151  1.00 0.00 ? 121 GLY A N    4  
ATOM 7332  C CA   . GLY A 1 121 ? -31.034 -1.913  13.148  1.00 0.00 ? 121 GLY A CA   4  
ATOM 7333  C C    . GLY A 1 121 ? -30.736 -0.446  13.384  1.00 0.00 ? 121 GLY A C    4  
ATOM 7334  O O    . GLY A 1 121 ? -30.580 0.325   12.437  1.00 0.00 ? 121 GLY A O    4  
ATOM 7335  H H    . GLY A 1 121 ? -29.188 -2.462  12.269  1.00 0.00 ? 121 GLY A H    4  
ATOM 7336  H HA2  . GLY A 1 121 ? -32.057 -2.013  12.818  1.00 0.00 ? 121 GLY A HA2  4  
ATOM 7337  H HA3  . GLY A 1 121 ? -30.913 -2.448  14.078  1.00 0.00 ? 121 GLY A HA3  4  
ATOM 7338  N N    . THR A 1 122 ? -30.658 -0.057  14.653  1.00 0.00 ? 122 THR A N    4  
ATOM 7339  C CA   . THR A 1 122 ? -30.380 1.328   15.012  1.00 0.00 ? 122 THR A CA   4  
ATOM 7340  C C    . THR A 1 122 ? -29.699 1.418   16.373  1.00 0.00 ? 122 THR A C    4  
ATOM 7341  O O    . THR A 1 122 ? -29.897 0.561   17.235  1.00 0.00 ? 122 THR A O    4  
ATOM 7342  C CB   . THR A 1 122 ? -31.669 2.171   15.040  1.00 0.00 ? 122 THR A CB   4  
ATOM 7343  O OG1  . THR A 1 122 ? -31.366 3.517   15.425  1.00 0.00 ? 122 THR A OG1  4  
ATOM 7344  C CG2  . THR A 1 122 ? -32.683 1.578   16.006  1.00 0.00 ? 122 THR A CG2  4  
ATOM 7345  H H    . THR A 1 122 ? -30.792 -0.718  15.364  1.00 0.00 ? 122 THR A H    4  
ATOM 7346  H HA   . THR A 1 122 ? -29.721 1.741   14.263  1.00 0.00 ? 122 THR A HA   4  
ATOM 7347  H HB   . THR A 1 122 ? -32.099 2.177   14.048  1.00 0.00 ? 122 THR A HB   4  
ATOM 7348  H HG1  . THR A 1 122 ? -31.652 3.663   16.330  1.00 0.00 ? 122 THR A HG1  4  
ATOM 7349  H HG21 . THR A 1 122 ? -32.560 0.506   16.043  1.00 0.00 ? 122 THR A HG21 4  
ATOM 7350  H HG22 . THR A 1 122 ? -33.681 1.815   15.670  1.00 0.00 ? 122 THR A HG22 4  
ATOM 7351  H HG23 . THR A 1 122 ? -32.527 1.992   16.990  1.00 0.00 ? 122 THR A HG23 4  
ATOM 7352  N N    . VAL A 1 123 ? -28.896 2.460   16.561  1.00 0.00 ? 123 VAL A N    4  
ATOM 7353  C CA   . VAL A 1 123 ? -28.186 2.662   17.818  1.00 0.00 ? 123 VAL A CA   4  
ATOM 7354  C C    . VAL A 1 123 ? -27.624 1.348   18.349  1.00 0.00 ? 123 VAL A C    4  
ATOM 7355  O O    . VAL A 1 123 ? -27.619 1.106   19.556  1.00 0.00 ? 123 VAL A O    4  
ATOM 7356  C CB   . VAL A 1 123 ? -29.105 3.285   18.887  1.00 0.00 ? 123 VAL A CB   4  
ATOM 7357  C CG1  . VAL A 1 123 ? -29.633 4.632   18.418  1.00 0.00 ? 123 VAL A CG1  4  
ATOM 7358  C CG2  . VAL A 1 123 ? -30.250 2.340   19.220  1.00 0.00 ? 123 VAL A CG2  4  
ATOM 7359  H H    . VAL A 1 123 ? -28.778 3.109   15.836  1.00 0.00 ? 123 VAL A H    4  
ATOM 7360  H HA   . VAL A 1 123 ? -27.369 3.344   17.635  1.00 0.00 ? 123 VAL A HA   4  
ATOM 7361  H HB   . VAL A 1 123 ? -28.524 3.443   19.784  1.00 0.00 ? 123 VAL A HB   4  
ATOM 7362  H HG11 . VAL A 1 123 ? -28.813 5.329   18.332  1.00 0.00 ? 123 VAL A HG11 4  
ATOM 7363  H HG12 . VAL A 1 123 ? -30.112 4.516   17.457  1.00 0.00 ? 123 VAL A HG12 4  
ATOM 7364  H HG13 . VAL A 1 123 ? -30.350 5.006   19.135  1.00 0.00 ? 123 VAL A HG13 4  
ATOM 7365  H HG21 . VAL A 1 123 ? -29.853 1.364   19.459  1.00 0.00 ? 123 VAL A HG21 4  
ATOM 7366  H HG22 . VAL A 1 123 ? -30.797 2.723   20.070  1.00 0.00 ? 123 VAL A HG22 4  
ATOM 7367  H HG23 . VAL A 1 123 ? -30.912 2.262   18.371  1.00 0.00 ? 123 VAL A HG23 4  
ATOM 7368  N N    . SER A 1 124 ? -27.151 0.503   17.440  1.00 0.00 ? 124 SER A N    4  
ATOM 7369  C CA   . SER A 1 124 ? -26.589 -0.789  17.816  1.00 0.00 ? 124 SER A CA   4  
ATOM 7370  C C    . SER A 1 124 ? -25.072 -0.790  17.654  1.00 0.00 ? 124 SER A C    4  
ATOM 7371  O O    . SER A 1 124 ? -24.551 -0.483  16.583  1.00 0.00 ? 124 SER A O    4  
ATOM 7372  C CB   . SER A 1 124 ? -27.204 -1.904  16.967  1.00 0.00 ? 124 SER A CB   4  
ATOM 7373  O OG   . SER A 1 124 ? -28.557 -2.129  17.324  1.00 0.00 ? 124 SER A OG   4  
ATOM 7374  H H    . SER A 1 124 ? -27.183 0.753   16.492  1.00 0.00 ? 124 SER A H    4  
ATOM 7375  H HA   . SER A 1 124 ? -26.829 -0.965  18.854  1.00 0.00 ? 124 SER A HA   4  
ATOM 7376  H HB2  . SER A 1 124 ? -27.161 -1.625  15.926  1.00 0.00 ? 124 SER A HB2  4  
ATOM 7377  H HB3  . SER A 1 124 ? -26.647 -2.817  17.119  1.00 0.00 ? 124 SER A HB3  4  
ATOM 7378  H HG   . SER A 1 124 ? -29.132 -1.726  16.670  1.00 0.00 ? 124 SER A HG   4  
ATOM 7379  N N    . GLY A 1 125 ? -24.368 -1.136  18.728  1.00 0.00 ? 125 GLY A N    4  
ATOM 7380  C CA   . GLY A 1 125 ? -22.918 -1.170  18.686  1.00 0.00 ? 125 GLY A CA   4  
ATOM 7381  C C    . GLY A 1 125 ? -22.289 -0.012  19.434  1.00 0.00 ? 125 GLY A C    4  
ATOM 7382  O O    . GLY A 1 125 ? -22.197 1.106   18.927  1.00 0.00 ? 125 GLY A O    4  
ATOM 7383  H H    . GLY A 1 125 ? -24.838 -1.370  19.556  1.00 0.00 ? 125 GLY A H    4  
ATOM 7384  H HA2  . GLY A 1 125 ? -22.578 -2.096  19.124  1.00 0.00 ? 125 GLY A HA2  4  
ATOM 7385  H HA3  . GLY A 1 125 ? -22.599 -1.133  17.654  1.00 0.00 ? 125 GLY A HA3  4  
ATOM 7386  N N    . PRO A 1 126 ? -21.844 -0.274  20.672  1.00 0.00 ? 126 PRO A N    4  
ATOM 7387  C CA   . PRO A 1 126 ? -21.213 0.743   21.518  1.00 0.00 ? 126 PRO A CA   4  
ATOM 7388  C C    . PRO A 1 126 ? -19.837 1.153   21.005  1.00 0.00 ? 126 PRO A C    4  
ATOM 7389  O O    . PRO A 1 126 ? -19.200 0.417   20.252  1.00 0.00 ? 126 PRO A O    4  
ATOM 7390  C CB   . PRO A 1 126 ? -21.091 0.048   22.877  1.00 0.00 ? 126 PRO A CB   4  
ATOM 7391  C CG   . PRO A 1 126 ? -21.055 -1.407  22.556  1.00 0.00 ? 126 PRO A CG   4  
ATOM 7392  C CD   . PRO A 1 126 ? -21.921 -1.584  21.340  1.00 0.00 ? 126 PRO A CD   4  
ATOM 7393  H HA   . PRO A 1 126 ? -21.836 1.620   21.616  1.00 0.00 ? 126 PRO A HA   4  
ATOM 7394  H HB2  . PRO A 1 126 ? -20.183 0.368   23.367  1.00 0.00 ? 126 PRO A HB2  4  
ATOM 7395  H HB3  . PRO A 1 126 ? -21.945 0.295   23.490  1.00 0.00 ? 126 PRO A HB3  4  
ATOM 7396  H HG2  . PRO A 1 126 ? -20.041 -1.710  22.343  1.00 0.00 ? 126 PRO A HG2  4  
ATOM 7397  H HG3  . PRO A 1 126 ? -21.451 -1.975  23.384  1.00 0.00 ? 126 PRO A HG3  4  
ATOM 7398  H HD2  . PRO A 1 126 ? -21.525 -2.364  20.706  1.00 0.00 ? 126 PRO A HD2  4  
ATOM 7399  H HD3  . PRO A 1 126 ? -22.936 -1.809  21.629  1.00 0.00 ? 126 PRO A HD3  4  
ATOM 7400  N N    . SER A 1 127 ? -19.385 2.333   21.416  1.00 0.00 ? 127 SER A N    4  
ATOM 7401  C CA   . SER A 1 127 ? -18.085 2.843   20.994  1.00 0.00 ? 127 SER A CA   4  
ATOM 7402  C C    . SER A 1 127 ? -16.958 1.970   21.535  1.00 0.00 ? 127 SER A C    4  
ATOM 7403  O O    . SER A 1 127 ? -17.017 1.490   22.667  1.00 0.00 ? 127 SER A O    4  
ATOM 7404  C CB   . SER A 1 127 ? -17.901 4.286   21.470  1.00 0.00 ? 127 SER A CB   4  
ATOM 7405  O OG   . SER A 1 127 ? -16.720 4.853   20.931  1.00 0.00 ? 127 SER A OG   4  
ATOM 7406  H H    . SER A 1 127 ? -19.940 2.875   22.016  1.00 0.00 ? 127 SER A H    4  
ATOM 7407  H HA   . SER A 1 127 ? -18.056 2.822   19.915  1.00 0.00 ? 127 SER A HA   4  
ATOM 7408  H HB2  . SER A 1 127 ? -18.747 4.877   21.153  1.00 0.00 ? 127 SER A HB2  4  
ATOM 7409  H HB3  . SER A 1 127 ? -17.834 4.301   22.548  1.00 0.00 ? 127 SER A HB3  4  
ATOM 7410  H HG   . SER A 1 127 ? -16.173 5.193   21.643  1.00 0.00 ? 127 SER A HG   4  
ATOM 7411  N N    . SER A 1 128 ? -15.930 1.767   20.716  1.00 0.00 ? 128 SER A N    4  
ATOM 7412  C CA   . SER A 1 128 ? -14.789 0.948   21.110  1.00 0.00 ? 128 SER A CA   4  
ATOM 7413  C C    . SER A 1 128 ? -13.753 1.783   21.855  1.00 0.00 ? 128 SER A C    4  
ATOM 7414  O O    . SER A 1 128 ? -13.492 2.932   21.499  1.00 0.00 ? 128 SER A O    4  
ATOM 7415  C CB   . SER A 1 128 ? -14.151 0.301   19.879  1.00 0.00 ? 128 SER A CB   4  
ATOM 7416  O OG   . SER A 1 128 ? -15.114 -0.408  19.119  1.00 0.00 ? 128 SER A OG   4  
ATOM 7417  H H    . SER A 1 128 ? -15.941 2.176   19.826  1.00 0.00 ? 128 SER A H    4  
ATOM 7418  H HA   . SER A 1 128 ? -15.150 0.172   21.768  1.00 0.00 ? 128 SER A HA   4  
ATOM 7419  H HB2  . SER A 1 128 ? -13.713 1.068   19.258  1.00 0.00 ? 128 SER A HB2  4  
ATOM 7420  H HB3  . SER A 1 128 ? -13.382 -0.388  20.197  1.00 0.00 ? 128 SER A HB3  4  
ATOM 7421  H HG   . SER A 1 128 ? -14.671 -1.059  18.568  1.00 0.00 ? 128 SER A HG   4  
ATOM 7422  N N    . GLY A 1 129 ? -13.163 1.196   22.892  1.00 0.00 ? 129 GLY A N    4  
ATOM 7423  C CA   . GLY A 1 129 ? -12.162 1.899   23.672  1.00 0.00 ? 129 GLY A CA   4  
ATOM 7424  C C    . GLY A 1 129 ? -11.151 0.959   24.300  1.00 0.00 ? 129 GLY A C    4  
ATOM 7425  O O    . GLY A 1 129 ? -11.521 0.023   25.008  1.00 0.00 ? 129 GLY A O    4  
ATOM 7426  H H    . GLY A 1 129 ? -13.411 0.277   23.130  1.00 0.00 ? 129 GLY A H    4  
ATOM 7427  H HA2  . GLY A 1 129 ? -11.642 2.592   23.029  1.00 0.00 ? 129 GLY A HA2  4  
ATOM 7428  H HA3  . GLY A 1 129 ? -12.656 2.452   24.457  1.00 0.00 ? 129 GLY A HA3  4  
ATOM 7429  N N    . GLY A 1 1   ? -10.885 22.256  -27.723 1.00 0.00 ? 1   GLY A N    5  
ATOM 7430  C CA   . GLY A 1 1   ? -11.466 21.064  -28.314 1.00 0.00 ? 1   GLY A CA   5  
ATOM 7431  C C    . GLY A 1 1   ? -12.092 20.150  -27.279 1.00 0.00 ? 1   GLY A C    5  
ATOM 7432  O O    . GLY A 1 1   ? -12.022 20.419  -26.080 1.00 0.00 ? 1   GLY A O    5  
ATOM 7433  H H1   . GLY A 1 1   ? -10.565 22.235  -26.797 1.00 0.00 ? 1   GLY A H1   5  
ATOM 7434  H HA2  . GLY A 1 1   ? -12.224 21.360  -29.023 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7435  H HA3  . GLY A 1 1   ? -10.692 20.521  -28.836 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7436  N N    . SER A 1 2   ? -12.706 19.067  -27.744 1.00 0.00 ? 2   SER A N    5  
ATOM 7437  C CA   . SER A 1 2   ? -13.352 18.112  -26.850 1.00 0.00 ? 2   SER A CA   5  
ATOM 7438  C C    . SER A 1 2   ? -13.451 16.737  -27.504 1.00 0.00 ? 2   SER A C    5  
ATOM 7439  O O    . SER A 1 2   ? -13.385 16.613  -28.727 1.00 0.00 ? 2   SER A O    5  
ATOM 7440  C CB   . SER A 1 2   ? -14.747 18.607  -26.463 1.00 0.00 ? 2   SER A CB   5  
ATOM 7441  O OG   . SER A 1 2   ? -14.669 19.692  -25.554 1.00 0.00 ? 2   SER A OG   5  
ATOM 7442  H H    . SER A 1 2   ? -12.728 18.907  -28.710 1.00 0.00 ? 2   SER A H    5  
ATOM 7443  H HA   . SER A 1 2   ? -12.748 18.031  -25.959 1.00 0.00 ? 2   SER A HA   5  
ATOM 7444  H HB2  . SER A 1 2   ? -15.270 18.933  -27.349 1.00 0.00 ? 2   SER A HB2  5  
ATOM 7445  H HB3  . SER A 1 2   ? -15.295 17.801  -25.997 1.00 0.00 ? 2   SER A HB3  5  
ATOM 7446  H HG   . SER A 1 2   ? -14.992 20.490  -25.980 1.00 0.00 ? 2   SER A HG   5  
ATOM 7447  N N    . SER A 1 3   ? -13.611 15.707  -26.679 1.00 0.00 ? 3   SER A N    5  
ATOM 7448  C CA   . SER A 1 3   ? -13.716 14.340  -27.175 1.00 0.00 ? 3   SER A CA   5  
ATOM 7449  C C    . SER A 1 3   ? -15.059 13.725  -26.794 1.00 0.00 ? 3   SER A C    5  
ATOM 7450  O O    . SER A 1 3   ? -15.846 14.328  -26.065 1.00 0.00 ? 3   SER A O    5  
ATOM 7451  C CB   . SER A 1 3   ? -12.575 13.485  -26.621 1.00 0.00 ? 3   SER A CB   5  
ATOM 7452  O OG   . SER A 1 3   ? -12.423 12.291  -27.368 1.00 0.00 ? 3   SER A OG   5  
ATOM 7453  H H    . SER A 1 3   ? -13.657 15.871  -25.714 1.00 0.00 ? 3   SER A H    5  
ATOM 7454  H HA   . SER A 1 3   ? -13.641 14.372  -28.252 1.00 0.00 ? 3   SER A HA   5  
ATOM 7455  H HB2  . SER A 1 3   ? -11.653 14.044  -26.668 1.00 0.00 ? 3   SER A HB2  5  
ATOM 7456  H HB3  . SER A 1 3   ? -12.788 13.228  -25.593 1.00 0.00 ? 3   SER A HB3  5  
ATOM 7457  H HG   . SER A 1 3   ? -11.649 11.815  -27.058 1.00 0.00 ? 3   SER A HG   5  
ATOM 7458  N N    . GLY A 1 4   ? -15.315 12.520  -27.294 1.00 0.00 ? 4   GLY A N    5  
ATOM 7459  C CA   . GLY A 1 4   ? -16.563 11.842  -26.996 1.00 0.00 ? 4   GLY A CA   5  
ATOM 7460  C C    . GLY A 1 4   ? -16.472 10.343  -27.201 1.00 0.00 ? 4   GLY A C    5  
ATOM 7461  O O    . GLY A 1 4   ? -16.711 9.844   -28.300 1.00 0.00 ? 4   GLY A O    5  
ATOM 7462  H H    . GLY A 1 4   ? -14.650 12.087  -27.870 1.00 0.00 ? 4   GLY A H    5  
ATOM 7463  H HA2  . GLY A 1 4   ? -16.830 12.039  -25.968 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7464  H HA3  . GLY A 1 4   ? -17.336 12.236  -27.640 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7465  N N    . SER A 1 5   ? -16.124 9.622   -26.139 1.00 0.00 ? 5   SER A N    5  
ATOM 7466  C CA   . SER A 1 5   ? -15.997 8.171   -26.209 1.00 0.00 ? 5   SER A CA   5  
ATOM 7467  C C    . SER A 1 5   ? -16.506 7.519   -24.927 1.00 0.00 ? 5   SER A C    5  
ATOM 7468  O O    . SER A 1 5   ? -16.306 8.041   -23.831 1.00 0.00 ? 5   SER A O    5  
ATOM 7469  C CB   . SER A 1 5   ? -14.539 7.777   -26.451 1.00 0.00 ? 5   SER A CB   5  
ATOM 7470  O OG   . SER A 1 5   ? -13.772 7.905   -25.266 1.00 0.00 ? 5   SER A OG   5  
ATOM 7471  H H    . SER A 1 5   ? -15.947 10.078  -25.290 1.00 0.00 ? 5   SER A H    5  
ATOM 7472  H HA   . SER A 1 5   ? -16.597 7.825   -27.038 1.00 0.00 ? 5   SER A HA   5  
ATOM 7473  H HB2  . SER A 1 5   ? -14.496 6.751   -26.784 1.00 0.00 ? 5   SER A HB2  5  
ATOM 7474  H HB3  . SER A 1 5   ? -14.116 8.420   -27.210 1.00 0.00 ? 5   SER A HB3  5  
ATOM 7475  H HG   . SER A 1 5   ? -12.896 7.540   -25.410 1.00 0.00 ? 5   SER A HG   5  
ATOM 7476  N N    . SER A 1 6   ? -17.165 6.374   -25.075 1.00 0.00 ? 6   SER A N    5  
ATOM 7477  C CA   . SER A 1 6   ? -17.707 5.651   -23.930 1.00 0.00 ? 6   SER A CA   5  
ATOM 7478  C C    . SER A 1 6   ? -17.605 4.144   -24.142 1.00 0.00 ? 6   SER A C    5  
ATOM 7479  O O    . SER A 1 6   ? -17.526 3.669   -25.274 1.00 0.00 ? 6   SER A O    5  
ATOM 7480  C CB   . SER A 1 6   ? -19.166 6.047   -23.694 1.00 0.00 ? 6   SER A CB   5  
ATOM 7481  O OG   . SER A 1 6   ? -19.275 7.422   -23.371 1.00 0.00 ? 6   SER A OG   5  
ATOM 7482  H H    . SER A 1 6   ? -17.292 6.009   -25.976 1.00 0.00 ? 6   SER A H    5  
ATOM 7483  H HA   . SER A 1 6   ? -17.125 5.921   -23.062 1.00 0.00 ? 6   SER A HA   5  
ATOM 7484  H HB2  . SER A 1 6   ? -19.738 5.853   -24.589 1.00 0.00 ? 6   SER A HB2  5  
ATOM 7485  H HB3  . SER A 1 6   ? -19.566 5.464   -22.877 1.00 0.00 ? 6   SER A HB3  5  
ATOM 7486  H HG   . SER A 1 6   ? -18.449 7.866   -23.575 1.00 0.00 ? 6   SER A HG   5  
ATOM 7487  N N    . GLY A 1 7   ? -17.607 3.396   -23.042 1.00 0.00 ? 7   GLY A N    5  
ATOM 7488  C CA   . GLY A 1 7   ? -17.514 1.951   -23.128 1.00 0.00 ? 7   GLY A CA   5  
ATOM 7489  C C    . GLY A 1 7   ? -16.854 1.339   -21.908 1.00 0.00 ? 7   GLY A C    5  
ATOM 7490  O O    . GLY A 1 7   ? -17.369 1.446   -20.796 1.00 0.00 ? 7   GLY A O    5  
ATOM 7491  H H    . GLY A 1 7   ? -17.672 3.830   -22.166 1.00 0.00 ? 7   GLY A H    5  
ATOM 7492  H HA2  . GLY A 1 7   ? -18.508 1.542   -23.230 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7493  H HA3  . GLY A 1 7   ? -16.937 1.690   -24.003 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7494  N N    . GLY A 1 8   ? -15.711 0.693   -22.117 1.00 0.00 ? 8   GLY A N    5  
ATOM 7495  C CA   . GLY A 1 8   ? -14.999 0.069   -21.016 1.00 0.00 ? 8   GLY A CA   5  
ATOM 7496  C C    . GLY A 1 8   ? -15.608 -1.258  -20.611 1.00 0.00 ? 8   GLY A C    5  
ATOM 7497  O O    . GLY A 1 8   ? -16.747 -1.311  -20.147 1.00 0.00 ? 8   GLY A O    5  
ATOM 7498  H H    . GLY A 1 8   ? -15.347 0.639   -23.026 1.00 0.00 ? 8   GLY A H    5  
ATOM 7499  H HA2  . GLY A 1 8   ? -13.973 -0.092  -21.311 1.00 0.00 ? 8   GLY A HA2  5  
ATOM 7500  H HA3  . GLY A 1 8   ? -15.019 0.736   -20.166 1.00 0.00 ? 8   GLY A HA3  5  
ATOM 7501  N N    . SER A 1 9   ? -14.848 -2.335  -20.787 1.00 0.00 ? 9   SER A N    5  
ATOM 7502  C CA   . SER A 1 9   ? -15.322 -3.670  -20.440 1.00 0.00 ? 9   SER A CA   5  
ATOM 7503  C C    . SER A 1 9   ? -14.561 -4.221  -19.238 1.00 0.00 ? 9   SER A C    5  
ATOM 7504  O O    . SER A 1 9   ? -14.182 -5.392  -19.214 1.00 0.00 ? 9   SER A O    5  
ATOM 7505  C CB   . SER A 1 9   ? -15.166 -4.614  -21.634 1.00 0.00 ? 9   SER A CB   5  
ATOM 7506  O OG   . SER A 1 9   ? -15.726 -5.886  -21.354 1.00 0.00 ? 9   SER A OG   5  
ATOM 7507  H H    . SER A 1 9   ? -13.949 -2.228  -21.161 1.00 0.00 ? 9   SER A H    5  
ATOM 7508  H HA   . SER A 1 9   ? -16.369 -3.594  -20.186 1.00 0.00 ? 9   SER A HA   5  
ATOM 7509  H HB2  . SER A 1 9   ? -15.670 -4.193  -22.491 1.00 0.00 ? 9   SER A HB2  5  
ATOM 7510  H HB3  . SER A 1 9   ? -14.117 -4.737  -21.857 1.00 0.00 ? 9   SER A HB3  5  
ATOM 7511  H HG   . SER A 1 9   ? -15.247 -6.561  -21.841 1.00 0.00 ? 9   SER A HG   5  
ATOM 7512  N N    . ASP A 1 10  ? -14.343 -3.369  -18.243 1.00 0.00 ? 10  ASP A N    5  
ATOM 7513  C CA   . ASP A 1 10  ? -13.628 -3.769  -17.037 1.00 0.00 ? 10  ASP A CA   5  
ATOM 7514  C C    . ASP A 1 10  ? -12.281 -4.395  -17.385 1.00 0.00 ? 10  ASP A C    5  
ATOM 7515  O O    . ASP A 1 10  ? -11.889 -5.409  -16.808 1.00 0.00 ? 10  ASP A O    5  
ATOM 7516  C CB   . ASP A 1 10  ? -14.468 -4.757  -16.225 1.00 0.00 ? 10  ASP A CB   5  
ATOM 7517  C CG   . ASP A 1 10  ? -15.948 -4.432  -16.270 1.00 0.00 ? 10  ASP A CG   5  
ATOM 7518  O OD1  . ASP A 1 10  ? -16.373 -3.498  -15.557 1.00 0.00 ? 10  ASP A OD1  5  
ATOM 7519  O OD2  . ASP A 1 10  ? -16.682 -5.110  -17.019 1.00 0.00 ? 10  ASP A OD2  5  
ATOM 7520  H H    . ASP A 1 10  ? -14.670 -2.448  -18.322 1.00 0.00 ? 10  ASP A H    5  
ATOM 7521  H HA   . ASP A 1 10  ? -13.457 -2.884  -16.443 1.00 0.00 ? 10  ASP A HA   5  
ATOM 7522  H HB2  . ASP A 1 10  ? -14.326 -5.752  -16.621 1.00 0.00 ? 10  ASP A HB2  5  
ATOM 7523  H HB3  . ASP A 1 10  ? -14.144 -4.734  -15.195 1.00 0.00 ? 10  ASP A HB3  5  
ATOM 7524  N N    . SER A 1 11  ? -11.578 -3.783  -18.332 1.00 0.00 ? 11  SER A N    5  
ATOM 7525  C CA   . SER A 1 11  ? -10.277 -4.282  -18.761 1.00 0.00 ? 11  SER A CA   5  
ATOM 7526  C C    . SER A 1 11  ? -9.149  -3.542  -18.048 1.00 0.00 ? 11  SER A C    5  
ATOM 7527  O O    . SER A 1 11  ? -8.301  -4.156  -17.401 1.00 0.00 ? 11  SER A O    5  
ATOM 7528  C CB   . SER A 1 11  ? -10.123 -4.132  -20.276 1.00 0.00 ? 11  SER A CB   5  
ATOM 7529  O OG   . SER A 1 11  ? -10.363 -2.796  -20.683 1.00 0.00 ? 11  SER A OG   5  
ATOM 7530  H H    . SER A 1 11  ? -11.944 -2.978  -18.755 1.00 0.00 ? 11  SER A H    5  
ATOM 7531  H HA   . SER A 1 11  ? -10.223 -5.330  -18.505 1.00 0.00 ? 11  SER A HA   5  
ATOM 7532  H HB2  . SER A 1 11  ? -9.120  -4.407  -20.563 1.00 0.00 ? 11  SER A HB2  5  
ATOM 7533  H HB3  . SER A 1 11  ? -10.830 -4.780  -20.773 1.00 0.00 ? 11  SER A HB3  5  
ATOM 7534  H HG   . SER A 1 11  ? -10.137 -2.698  -21.610 1.00 0.00 ? 11  SER A HG   5  
ATOM 7535  N N    . SER A 1 12  ? -9.147  -2.219  -18.172 1.00 0.00 ? 12  SER A N    5  
ATOM 7536  C CA   . SER A 1 12  ? -8.122  -1.394  -17.544 1.00 0.00 ? 12  SER A CA   5  
ATOM 7537  C C    . SER A 1 12  ? -8.675  -0.685  -16.311 1.00 0.00 ? 12  SER A C    5  
ATOM 7538  O O    . SER A 1 12  ? -8.893  0.527   -16.323 1.00 0.00 ? 12  SER A O    5  
ATOM 7539  C CB   . SER A 1 12  ? -7.584  -0.365  -18.539 1.00 0.00 ? 12  SER A CB   5  
ATOM 7540  O OG   . SER A 1 12  ? -7.278  -0.970  -19.784 1.00 0.00 ? 12  SER A OG   5  
ATOM 7541  H H    . SER A 1 12  ? -9.850  -1.788  -18.701 1.00 0.00 ? 12  SER A H    5  
ATOM 7542  H HA   . SER A 1 12  ? -7.315  -2.043  -17.239 1.00 0.00 ? 12  SER A HA   5  
ATOM 7543  H HB2  . SER A 1 12  ? -8.328  0.401   -18.699 1.00 0.00 ? 12  SER A HB2  5  
ATOM 7544  H HB3  . SER A 1 12  ? -6.686  0.083   -18.140 1.00 0.00 ? 12  SER A HB3  5  
ATOM 7545  H HG   . SER A 1 12  ? -7.098  -0.289  -20.436 1.00 0.00 ? 12  SER A HG   5  
ATOM 7546  N N    . LEU A 1 13  ? -8.902  -1.450  -15.249 1.00 0.00 ? 13  LEU A N    5  
ATOM 7547  C CA   . LEU A 1 13  ? -9.430  -0.896  -14.007 1.00 0.00 ? 13  LEU A CA   5  
ATOM 7548  C C    . LEU A 1 13  ? -8.360  -0.101  -13.266 1.00 0.00 ? 13  LEU A C    5  
ATOM 7549  O O    . LEU A 1 13  ? -8.666  0.843   -12.537 1.00 0.00 ? 13  LEU A O    5  
ATOM 7550  C CB   . LEU A 1 13  ? -9.960  -2.017  -13.111 1.00 0.00 ? 13  LEU A CB   5  
ATOM 7551  C CG   . LEU A 1 13  ? -11.300 -2.629  -13.523 1.00 0.00 ? 13  LEU A CG   5  
ATOM 7552  C CD1  . LEU A 1 13  ? -12.370 -1.552  -13.622 1.00 0.00 ? 13  LEU A CD1  5  
ATOM 7553  C CD2  . LEU A 1 13  ? -11.164 -3.371  -14.844 1.00 0.00 ? 13  LEU A CD2  5  
ATOM 7554  H H    . LEU A 1 13  ? -8.709  -2.409  -15.299 1.00 0.00 ? 13  LEU A H    5  
ATOM 7555  H HA   . LEU A 1 13  ? -10.244 -0.233  -14.259 1.00 0.00 ? 13  LEU A HA   5  
ATOM 7556  H HB2  . LEU A 1 13  ? -9.226  -2.808  -13.101 1.00 0.00 ? 13  LEU A HB2  5  
ATOM 7557  H HB3  . LEU A 1 13  ? -10.071 -1.618  -12.113 1.00 0.00 ? 13  LEU A HB3  5  
ATOM 7558  H HG   . LEU A 1 13  ? -11.611 -3.339  -12.769 1.00 0.00 ? 13  LEU A HG   5  
ATOM 7559  H HD11 . LEU A 1 13  ? -11.957 -0.605  -13.310 1.00 0.00 ? 13  LEU A HD11 5  
ATOM 7560  H HD12 . LEU A 1 13  ? -13.201 -1.811  -12.982 1.00 0.00 ? 13  LEU A HD12 5  
ATOM 7561  H HD13 . LEU A 1 13  ? -12.712 -1.478  -14.644 1.00 0.00 ? 13  LEU A HD13 5  
ATOM 7562  H HD21 . LEU A 1 13  ? -12.120 -3.791  -15.120 1.00 0.00 ? 13  LEU A HD21 5  
ATOM 7563  H HD22 . LEU A 1 13  ? -10.439 -4.165  -14.737 1.00 0.00 ? 13  LEU A HD22 5  
ATOM 7564  H HD23 . LEU A 1 13  ? -10.837 -2.685  -15.611 1.00 0.00 ? 13  LEU A HD23 5  
ATOM 7565  N N    . PHE A 1 14  ? -7.103  -0.488  -13.458 1.00 0.00 ? 14  PHE A N    5  
ATOM 7566  C CA   . PHE A 1 14  ? -5.987  0.189   -12.809 1.00 0.00 ? 14  PHE A CA   5  
ATOM 7567  C C    . PHE A 1 14  ? -5.049  0.805   -13.844 1.00 0.00 ? 14  PHE A C    5  
ATOM 7568  O O    . PHE A 1 14  ? -4.938  0.313   -14.966 1.00 0.00 ? 14  PHE A O    5  
ATOM 7569  C CB   . PHE A 1 14  ? -5.214  -0.790  -11.923 1.00 0.00 ? 14  PHE A CB   5  
ATOM 7570  C CG   . PHE A 1 14  ? -6.096  -1.609  -11.024 1.00 0.00 ? 14  PHE A CG   5  
ATOM 7571  C CD1  . PHE A 1 14  ? -6.814  -2.682  -11.527 1.00 0.00 ? 14  PHE A CD1  5  
ATOM 7572  C CD2  . PHE A 1 14  ? -6.208  -1.305  -9.677  1.00 0.00 ? 14  PHE A CD2  5  
ATOM 7573  C CE1  . PHE A 1 14  ? -7.627  -3.437  -10.703 1.00 0.00 ? 14  PHE A CE1  5  
ATOM 7574  C CE2  . PHE A 1 14  ? -7.019  -2.057  -8.847  1.00 0.00 ? 14  PHE A CE2  5  
ATOM 7575  C CZ   . PHE A 1 14  ? -7.728  -3.125  -9.361  1.00 0.00 ? 14  PHE A CZ   5  
ATOM 7576  H H    . PHE A 1 14  ? -6.923  -1.248  -14.051 1.00 0.00 ? 14  PHE A H    5  
ATOM 7577  H HA   . PHE A 1 14  ? -6.391  0.978   -12.194 1.00 0.00 ? 14  PHE A HA   5  
ATOM 7578  H HB2  . PHE A 1 14  ? -4.658  -1.470  -12.550 1.00 0.00 ? 14  PHE A HB2  5  
ATOM 7579  H HB3  . PHE A 1 14  ? -4.528  -0.236  -11.301 1.00 0.00 ? 14  PHE A HB3  5  
ATOM 7580  H HD1  . PHE A 1 14  ? -6.734  -2.928  -12.576 1.00 0.00 ? 14  PHE A HD1  5  
ATOM 7581  H HD2  . PHE A 1 14  ? -5.652  -0.470  -9.274  1.00 0.00 ? 14  PHE A HD2  5  
ATOM 7582  H HE1  . PHE A 1 14  ? -8.180  -4.271  -11.106 1.00 0.00 ? 14  PHE A HE1  5  
ATOM 7583  H HE2  . PHE A 1 14  ? -7.096  -1.810  -7.799  1.00 0.00 ? 14  PHE A HE2  5  
ATOM 7584  H HZ   . PHE A 1 14  ? -8.363  -3.713  -8.715  1.00 0.00 ? 14  PHE A HZ   5  
ATOM 7585  N N    . GLU A 1 15  ? -4.377  1.885   -13.456 1.00 0.00 ? 15  GLU A N    5  
ATOM 7586  C CA   . GLU A 1 15  ? -3.450  2.569   -14.350 1.00 0.00 ? 15  GLU A CA   5  
ATOM 7587  C C    . GLU A 1 15  ? -2.028  2.522   -13.799 1.00 0.00 ? 15  GLU A C    5  
ATOM 7588  O O    . GLU A 1 15  ? -1.813  2.642   -12.592 1.00 0.00 ? 15  GLU A O    5  
ATOM 7589  C CB   . GLU A 1 15  ? -3.883  4.022   -14.555 1.00 0.00 ? 15  GLU A CB   5  
ATOM 7590  C CG   . GLU A 1 15  ? -4.121  4.775   -13.256 1.00 0.00 ? 15  GLU A CG   5  
ATOM 7591  C CD   . GLU A 1 15  ? -4.032  6.278   -13.429 1.00 0.00 ? 15  GLU A CD   5  
ATOM 7592  O OE1  . GLU A 1 15  ? -4.344  6.768   -14.535 1.00 0.00 ? 15  GLU A OE1  5  
ATOM 7593  O OE2  . GLU A 1 15  ? -3.650  6.966   -12.459 1.00 0.00 ? 15  GLU A OE2  5  
ATOM 7594  H H    . GLU A 1 15  ? -4.509  2.230   -12.549 1.00 0.00 ? 15  GLU A H    5  
ATOM 7595  H HA   . GLU A 1 15  ? -3.471  2.060   -15.302 1.00 0.00 ? 15  GLU A HA   5  
ATOM 7596  H HB2  . GLU A 1 15  ? -3.114  4.539   -15.111 1.00 0.00 ? 15  GLU A HB2  5  
ATOM 7597  H HB3  . GLU A 1 15  ? -4.798  4.035   -15.127 1.00 0.00 ? 15  GLU A HB3  5  
ATOM 7598  H HG2  . GLU A 1 15  ? -5.105  4.528   -12.888 1.00 0.00 ? 15  GLU A HG2  5  
ATOM 7599  H HG3  . GLU A 1 15  ? -3.379  4.465   -12.535 1.00 0.00 ? 15  GLU A HG3  5  
ATOM 7600  N N    . THR A 1 16  ? -1.059  2.346   -14.691 1.00 0.00 ? 16  THR A N    5  
ATOM 7601  C CA   . THR A 1 16  ? 0.342   2.282   -14.296 1.00 0.00 ? 16  THR A CA   5  
ATOM 7602  C C    . THR A 1 16  ? 1.099   3.525   -14.748 1.00 0.00 ? 16  THR A C    5  
ATOM 7603  O O    . THR A 1 16  ? 0.823   4.079   -15.812 1.00 0.00 ? 16  THR A O    5  
ATOM 7604  C CB   . THR A 1 16  ? 1.034   1.034   -14.877 1.00 0.00 ? 16  THR A CB   5  
ATOM 7605  O OG1  . THR A 1 16  ? 0.281   -0.139  -14.552 1.00 0.00 ? 16  THR A OG1  5  
ATOM 7606  C CG2  . THR A 1 16  ? 2.450   0.900   -14.339 1.00 0.00 ? 16  THR A CG2  5  
ATOM 7607  H H    . THR A 1 16  ? -1.293  2.257   -15.639 1.00 0.00 ? 16  THR A H    5  
ATOM 7608  H HA   . THR A 1 16  ? 0.382   2.220   -13.218 1.00 0.00 ? 16  THR A HA   5  
ATOM 7609  H HB   . THR A 1 16  ? 1.081   1.136   -15.952 1.00 0.00 ? 16  THR A HB   5  
ATOM 7610  H HG1  . THR A 1 16  ? -0.313  0.053   -13.822 1.00 0.00 ? 16  THR A HG1  5  
ATOM 7611  H HG21 . THR A 1 16  ? 3.145   1.340   -15.039 1.00 0.00 ? 16  THR A HG21 5  
ATOM 7612  H HG22 . THR A 1 16  ? 2.687   -0.145  -14.205 1.00 0.00 ? 16  THR A HG22 5  
ATOM 7613  H HG23 . THR A 1 16  ? 2.524   1.410   -13.390 1.00 0.00 ? 16  THR A HG23 5  
ATOM 7614  N N    . TYR A 1 17  ? 2.055   3.959   -13.933 1.00 0.00 ? 17  TYR A N    5  
ATOM 7615  C CA   . TYR A 1 17  ? 2.851   5.139   -14.249 1.00 0.00 ? 17  TYR A CA   5  
ATOM 7616  C C    . TYR A 1 17  ? 4.201   5.091   -13.541 1.00 0.00 ? 17  TYR A C    5  
ATOM 7617  O O    . TYR A 1 17  ? 4.332   4.501   -12.470 1.00 0.00 ? 17  TYR A O    5  
ATOM 7618  C CB   . TYR A 1 17  ? 2.098   6.410   -13.850 1.00 0.00 ? 17  TYR A CB   5  
ATOM 7619  C CG   . TYR A 1 17  ? 1.714   6.452   -12.388 1.00 0.00 ? 17  TYR A CG   5  
ATOM 7620  C CD1  . TYR A 1 17  ? 2.572   6.995   -11.440 1.00 0.00 ? 17  TYR A CD1  5  
ATOM 7621  C CD2  . TYR A 1 17  ? 0.493   5.950   -11.956 1.00 0.00 ? 17  TYR A CD2  5  
ATOM 7622  C CE1  . TYR A 1 17  ? 2.225   7.035   -10.103 1.00 0.00 ? 17  TYR A CE1  5  
ATOM 7623  C CE2  . TYR A 1 17  ? 0.137   5.987   -10.622 1.00 0.00 ? 17  TYR A CE2  5  
ATOM 7624  C CZ   . TYR A 1 17  ? 1.007   6.530   -9.699  1.00 0.00 ? 17  TYR A CZ   5  
ATOM 7625  O OH   . TYR A 1 17  ? 0.657   6.569   -8.369  1.00 0.00 ? 17  TYR A OH   5  
ATOM 7626  H H    . TYR A 1 17  ? 2.228   3.476   -13.099 1.00 0.00 ? 17  TYR A H    5  
ATOM 7627  H HA   . TYR A 1 17  ? 3.017   5.152   -15.317 1.00 0.00 ? 17  TYR A HA   5  
ATOM 7628  H HB2  . TYR A 1 17  ? 2.720   7.268   -14.054 1.00 0.00 ? 17  TYR A HB2  5  
ATOM 7629  H HB3  . TYR A 1 17  ? 1.192   6.482   -14.434 1.00 0.00 ? 17  TYR A HB3  5  
ATOM 7630  H HD1  . TYR A 1 17  ? 3.525   7.390   -11.760 1.00 0.00 ? 17  TYR A HD1  5  
ATOM 7631  H HD2  . TYR A 1 17  ? -0.186  5.525   -12.681 1.00 0.00 ? 17  TYR A HD2  5  
ATOM 7632  H HE1  . TYR A 1 17  ? 2.906   7.461   -9.381  1.00 0.00 ? 17  TYR A HE1  5  
ATOM 7633  H HE2  . TYR A 1 17  ? -0.816  5.591   -10.305 1.00 0.00 ? 17  TYR A HE2  5  
ATOM 7634  H HH   . TYR A 1 17  ? 1.435   6.763   -7.839  1.00 0.00 ? 17  TYR A HH   5  
ATOM 7635  N N    . ASN A 1 18  ? 5.203   5.718   -14.150 1.00 0.00 ? 18  ASN A N    5  
ATOM 7636  C CA   . ASN A 1 18  ? 6.545   5.747   -13.579 1.00 0.00 ? 18  ASN A CA   5  
ATOM 7637  C C    . ASN A 1 18  ? 6.814   7.082   -12.891 1.00 0.00 ? 18  ASN A C    5  
ATOM 7638  O O    . ASN A 1 18  ? 6.508   8.145   -13.433 1.00 0.00 ? 18  ASN A O    5  
ATOM 7639  C CB   . ASN A 1 18  ? 7.591   5.501   -14.668 1.00 0.00 ? 18  ASN A CB   5  
ATOM 7640  C CG   . ASN A 1 18  ? 7.140   6.003   -16.026 1.00 0.00 ? 18  ASN A CG   5  
ATOM 7641  O OD1  . ASN A 1 18  ? 7.431   7.136   -16.409 1.00 0.00 ? 18  ASN A OD1  5  
ATOM 7642  N ND2  . ASN A 1 18  ? 6.426   5.159   -16.761 1.00 0.00 ? 18  ASN A ND2  5  
ATOM 7643  H H    . ASN A 1 18  ? 5.037   6.170   -15.003 1.00 0.00 ? 18  ASN A H    5  
ATOM 7644  H HA   . ASN A 1 18  ? 6.610   4.958   -12.845 1.00 0.00 ? 18  ASN A HA   5  
ATOM 7645  H HB2  . ASN A 1 18  ? 8.505   6.012   -14.402 1.00 0.00 ? 18  ASN A HB2  5  
ATOM 7646  H HB3  . ASN A 1 18  ? 7.784   4.441   -14.741 1.00 0.00 ? 18  ASN A HB3  5  
ATOM 7647  H HD21 . ASN A 1 18  ? 6.232   4.272   -16.391 1.00 0.00 ? 18  ASN A HD21 5  
ATOM 7648  H HD22 . ASN A 1 18  ? 6.122   5.457   -17.644 1.00 0.00 ? 18  ASN A HD22 5  
ATOM 7649  N N    . VAL A 1 19  ? 7.390   7.020   -11.695 1.00 0.00 ? 19  VAL A N    5  
ATOM 7650  C CA   . VAL A 1 19  ? 7.703   8.224   -10.934 1.00 0.00 ? 19  VAL A CA   5  
ATOM 7651  C C    . VAL A 1 19  ? 9.210   8.404   -10.785 1.00 0.00 ? 19  VAL A C    5  
ATOM 7652  O O    . VAL A 1 19  ? 9.889   7.569   -10.190 1.00 0.00 ? 19  VAL A O    5  
ATOM 7653  C CB   . VAL A 1 19  ? 7.061   8.185   -9.534  1.00 0.00 ? 19  VAL A CB   5  
ATOM 7654  C CG1  . VAL A 1 19  ? 6.915   9.592   -8.975  1.00 0.00 ? 19  VAL A CG1  5  
ATOM 7655  C CG2  . VAL A 1 19  ? 5.715   7.480   -9.585  1.00 0.00 ? 19  VAL A CG2  5  
ATOM 7656  H H    . VAL A 1 19  ? 7.611   6.144   -11.315 1.00 0.00 ? 19  VAL A H    5  
ATOM 7657  H HA   . VAL A 1 19  ? 7.300   9.072   -11.468 1.00 0.00 ? 19  VAL A HA   5  
ATOM 7658  H HB   . VAL A 1 19  ? 7.712   7.627   -8.877  1.00 0.00 ? 19  VAL A HB   5  
ATOM 7659  H HG11 . VAL A 1 19  ? 7.766   10.188  -9.271  1.00 0.00 ? 19  VAL A HG11 5  
ATOM 7660  H HG12 . VAL A 1 19  ? 6.010   10.040  -9.358  1.00 0.00 ? 19  VAL A HG12 5  
ATOM 7661  H HG13 . VAL A 1 19  ? 6.866   9.547   -7.897  1.00 0.00 ? 19  VAL A HG13 5  
ATOM 7662  H HG21 . VAL A 1 19  ? 4.966   8.101   -9.117  1.00 0.00 ? 19  VAL A HG21 5  
ATOM 7663  H HG22 . VAL A 1 19  ? 5.441   7.300   -10.614 1.00 0.00 ? 19  VAL A HG22 5  
ATOM 7664  H HG23 . VAL A 1 19  ? 5.781   6.538   -9.061  1.00 0.00 ? 19  VAL A HG23 5  
ATOM 7665  N N    . GLU A 1 20  ? 9.725   9.501   -11.331 1.00 0.00 ? 20  GLU A N    5  
ATOM 7666  C CA   . GLU A 1 20  ? 11.153  9.791   -11.260 1.00 0.00 ? 20  GLU A CA   5  
ATOM 7667  C C    . GLU A 1 20  ? 11.471  10.659  -10.046 1.00 0.00 ? 20  GLU A C    5  
ATOM 7668  O O    . GLU A 1 20  ? 11.453  11.888  -10.125 1.00 0.00 ? 20  GLU A O    5  
ATOM 7669  C CB   . GLU A 1 20  ? 11.619  10.491  -12.538 1.00 0.00 ? 20  GLU A CB   5  
ATOM 7670  C CG   . GLU A 1 20  ? 13.060  10.968  -12.480 1.00 0.00 ? 20  GLU A CG   5  
ATOM 7671  C CD   . GLU A 1 20  ? 13.360  12.043  -13.506 1.00 0.00 ? 20  GLU A CD   5  
ATOM 7672  O OE1  . GLU A 1 20  ? 13.030  13.220  -13.246 1.00 0.00 ? 20  GLU A OE1  5  
ATOM 7673  O OE2  . GLU A 1 20  ? 13.925  11.709  -14.568 1.00 0.00 ? 20  GLU A OE2  5  
ATOM 7674  H H    . GLU A 1 20  ? 9.132   10.130  -11.793 1.00 0.00 ? 20  GLU A H    5  
ATOM 7675  H HA   . GLU A 1 20  ? 11.677  8.852   -11.163 1.00 0.00 ? 20  GLU A HA   5  
ATOM 7676  H HB2  . GLU A 1 20  ? 11.521  9.805   -13.366 1.00 0.00 ? 20  GLU A HB2  5  
ATOM 7677  H HB3  . GLU A 1 20  ? 10.985  11.348  -12.715 1.00 0.00 ? 20  GLU A HB3  5  
ATOM 7678  H HG2  . GLU A 1 20  ? 13.255  11.367  -11.496 1.00 0.00 ? 20  GLU A HG2  5  
ATOM 7679  H HG3  . GLU A 1 20  ? 13.712  10.126  -12.661 1.00 0.00 ? 20  GLU A HG3  5  
ATOM 7680  N N    . LEU A 1 21  ? 11.762  10.012  -8.923  1.00 0.00 ? 21  LEU A N    5  
ATOM 7681  C CA   . LEU A 1 21  ? 12.085  10.723  -7.691  1.00 0.00 ? 21  LEU A CA   5  
ATOM 7682  C C    . LEU A 1 21  ? 13.520  11.240  -7.720  1.00 0.00 ? 21  LEU A C    5  
ATOM 7683  O O    . LEU A 1 21  ? 14.403  10.618  -8.312  1.00 0.00 ? 21  LEU A O    5  
ATOM 7684  C CB   . LEU A 1 21  ? 11.885  9.808   -6.482  1.00 0.00 ? 21  LEU A CB   5  
ATOM 7685  C CG   . LEU A 1 21  ? 10.487  9.210   -6.318  1.00 0.00 ? 21  LEU A CG   5  
ATOM 7686  C CD1  . LEU A 1 21  ? 10.454  8.244   -5.143  1.00 0.00 ? 21  LEU A CD1  5  
ATOM 7687  C CD2  . LEU A 1 21  ? 9.454   10.311  -6.133  1.00 0.00 ? 21  LEU A CD2  5  
ATOM 7688  H H    . LEU A 1 21  ? 11.761  9.032   -8.921  1.00 0.00 ? 21  LEU A H    5  
ATOM 7689  H HA   . LEU A 1 21  ? 11.414  11.565  -7.610  1.00 0.00 ? 21  LEU A HA   5  
ATOM 7690  H HB2  . LEU A 1 21  ? 12.585  8.991   -6.566  1.00 0.00 ? 21  LEU A HB2  5  
ATOM 7691  H HB3  . LEU A 1 21  ? 12.107  10.381  -5.594  1.00 0.00 ? 21  LEU A HB3  5  
ATOM 7692  H HG   . LEU A 1 21  ? 10.231  8.656   -7.211  1.00 0.00 ? 21  LEU A HG   5  
ATOM 7693  H HD11 . LEU A 1 21  ? 11.464  7.991   -4.858  1.00 0.00 ? 21  LEU A HD11 5  
ATOM 7694  H HD12 . LEU A 1 21  ? 9.925   7.347   -5.429  1.00 0.00 ? 21  LEU A HD12 5  
ATOM 7695  H HD13 . LEU A 1 21  ? 9.950   8.709   -4.309  1.00 0.00 ? 21  LEU A HD13 5  
ATOM 7696  H HD21 . LEU A 1 21  ? 9.052   10.263  -5.132  1.00 0.00 ? 21  LEU A HD21 5  
ATOM 7697  H HD22 . LEU A 1 21  ? 8.655   10.179  -6.849  1.00 0.00 ? 21  LEU A HD22 5  
ATOM 7698  H HD23 . LEU A 1 21  ? 9.921   11.273  -6.289  1.00 0.00 ? 21  LEU A HD23 5  
ATOM 7699  N N    . VAL A 1 22  ? 13.747  12.379  -7.075  1.00 0.00 ? 22  VAL A N    5  
ATOM 7700  C CA   . VAL A 1 22  ? 15.075  12.978  -7.023  1.00 0.00 ? 22  VAL A CA   5  
ATOM 7701  C C    . VAL A 1 22  ? 15.651  12.919  -5.613  1.00 0.00 ? 22  VAL A C    5  
ATOM 7702  O O    . VAL A 1 22  ? 14.979  13.270  -4.642  1.00 0.00 ? 22  VAL A O    5  
ATOM 7703  C CB   . VAL A 1 22  ? 15.049  14.444  -7.494  1.00 0.00 ? 22  VAL A CB   5  
ATOM 7704  C CG1  . VAL A 1 22  ? 14.320  15.316  -6.484  1.00 0.00 ? 22  VAL A CG1  5  
ATOM 7705  C CG2  . VAL A 1 22  ? 16.463  14.953  -7.728  1.00 0.00 ? 22  VAL A CG2  5  
ATOM 7706  H H    . VAL A 1 22  ? 13.003  12.828  -6.621  1.00 0.00 ? 22  VAL A H    5  
ATOM 7707  H HA   . VAL A 1 22  ? 15.719  12.420  -7.688  1.00 0.00 ? 22  VAL A HA   5  
ATOM 7708  H HB   . VAL A 1 22  ? 14.513  14.491  -8.431  1.00 0.00 ? 22  VAL A HB   5  
ATOM 7709  H HG11 . VAL A 1 22  ? 13.358  14.878  -6.258  1.00 0.00 ? 22  VAL A HG11 5  
ATOM 7710  H HG12 . VAL A 1 22  ? 14.906  15.387  -5.580  1.00 0.00 ? 22  VAL A HG12 5  
ATOM 7711  H HG13 . VAL A 1 22  ? 14.176  16.303  -6.899  1.00 0.00 ? 22  VAL A HG13 5  
ATOM 7712  H HG21 . VAL A 1 22  ? 17.014  14.229  -8.310  1.00 0.00 ? 22  VAL A HG21 5  
ATOM 7713  H HG22 . VAL A 1 22  ? 16.425  15.891  -8.264  1.00 0.00 ? 22  VAL A HG22 5  
ATOM 7714  H HG23 . VAL A 1 22  ? 16.954  15.102  -6.778  1.00 0.00 ? 22  VAL A HG23 5  
ATOM 7715  N N    . ARG A 1 23  ? 16.898  12.472  -5.507  1.00 0.00 ? 23  ARG A N    5  
ATOM 7716  C CA   . ARG A 1 23  ? 17.564  12.367  -4.214  1.00 0.00 ? 23  ARG A CA   5  
ATOM 7717  C C    . ARG A 1 23  ? 18.689  13.390  -4.097  1.00 0.00 ? 23  ARG A C    5  
ATOM 7718  O O    . ARG A 1 23  ? 19.739  13.250  -4.725  1.00 0.00 ? 23  ARG A O    5  
ATOM 7719  C CB   . ARG A 1 23  ? 18.122  10.956  -4.018  1.00 0.00 ? 23  ARG A CB   5  
ATOM 7720  C CG   . ARG A 1 23  ? 17.070  9.864   -4.133  1.00 0.00 ? 23  ARG A CG   5  
ATOM 7721  C CD   . ARG A 1 23  ? 17.707  8.488   -4.251  1.00 0.00 ? 23  ARG A CD   5  
ATOM 7722  N NE   . ARG A 1 23  ? 18.760  8.285   -3.260  1.00 0.00 ? 23  ARG A NE   5  
ATOM 7723  C CZ   . ARG A 1 23  ? 19.140  7.088   -2.826  1.00 0.00 ? 23  ARG A CZ   5  
ATOM 7724  N NH1  . ARG A 1 23  ? 18.558  5.994   -3.295  1.00 0.00 ? 23  ARG A NH1  5  
ATOM 7725  N NH2  . ARG A 1 23  ? 20.106  6.985   -1.922  1.00 0.00 ? 23  ARG A NH2  5  
ATOM 7726  H H    . ARG A 1 23  ? 17.382  12.207  -6.317  1.00 0.00 ? 23  ARG A H    5  
ATOM 7727  H HA   . ARG A 1 23  ? 16.832  12.565  -3.446  1.00 0.00 ? 23  ARG A HA   5  
ATOM 7728  H HB2  . ARG A 1 23  ? 18.881  10.774  -4.765  1.00 0.00 ? 23  ARG A HB2  5  
ATOM 7729  H HB3  . ARG A 1 23  ? 18.569  10.892  -3.038  1.00 0.00 ? 23  ARG A HB3  5  
ATOM 7730  H HG2  . ARG A 1 23  ? 16.445  9.885   -3.253  1.00 0.00 ? 23  ARG A HG2  5  
ATOM 7731  H HG3  . ARG A 1 23  ? 16.468  10.049  -5.010  1.00 0.00 ? 23  ARG A HG3  5  
ATOM 7732  H HD2  . ARG A 1 23  ? 16.942  7.739   -4.108  1.00 0.00 ? 23  ARG A HD2  5  
ATOM 7733  H HD3  . ARG A 1 23  ? 18.131  8.386   -5.239  1.00 0.00 ? 23  ARG A HD3  5  
ATOM 7734  H HE   . ARG A 1 23  ? 19.204  9.081   -2.900  1.00 0.00 ? 23  ARG A HE   5  
ATOM 7735  H HH11 . ARG A 1 23  ? 17.831  6.068   -3.977  1.00 0.00 ? 23  ARG A HH11 5  
ATOM 7736  H HH12 . ARG A 1 23  ? 18.847  5.094   -2.968  1.00 0.00 ? 23  ARG A HH12 5  
ATOM 7737  H HH21 . ARG A 1 23  ? 20.548  7.808   -1.566  1.00 0.00 ? 23  ARG A HH21 5  
ATOM 7738  H HH22 . ARG A 1 23  ? 20.392  6.085   -1.596  1.00 0.00 ? 23  ARG A HH22 5  
ATOM 7739  N N    . LYS A 1 24  ? 18.463  14.421  -3.289  1.00 0.00 ? 24  LYS A N    5  
ATOM 7740  C CA   . LYS A 1 24  ? 19.457  15.468  -3.088  1.00 0.00 ? 24  LYS A CA   5  
ATOM 7741  C C    . LYS A 1 24  ? 20.807  14.872  -2.705  1.00 0.00 ? 24  LYS A C    5  
ATOM 7742  O O    . LYS A 1 24  ? 20.960  13.652  -2.634  1.00 0.00 ? 24  LYS A O    5  
ATOM 7743  C CB   . LYS A 1 24  ? 18.990  16.440  -2.001  1.00 0.00 ? 24  LYS A CB   5  
ATOM 7744  C CG   . LYS A 1 24  ? 17.858  17.350  -2.445  1.00 0.00 ? 24  LYS A CG   5  
ATOM 7745  C CD   . LYS A 1 24  ? 18.384  18.637  -3.058  1.00 0.00 ? 24  LYS A CD   5  
ATOM 7746  C CE   . LYS A 1 24  ? 17.250  19.560  -3.477  1.00 0.00 ? 24  LYS A CE   5  
ATOM 7747  N NZ   . LYS A 1 24  ? 16.449  18.983  -4.591  1.00 0.00 ? 24  LYS A NZ   5  
ATOM 7748  H H    . LYS A 1 24  ? 17.606  14.477  -2.815  1.00 0.00 ? 24  LYS A H    5  
ATOM 7749  H HA   . LYS A 1 24  ? 19.565  16.006  -4.017  1.00 0.00 ? 24  LYS A HA   5  
ATOM 7750  H HB2  . LYS A 1 24  ? 18.654  15.872  -1.147  1.00 0.00 ? 24  LYS A HB2  5  
ATOM 7751  H HB3  . LYS A 1 24  ? 19.826  17.058  -1.705  1.00 0.00 ? 24  LYS A HB3  5  
ATOM 7752  H HG2  . LYS A 1 24  ? 17.259  16.833  -3.179  1.00 0.00 ? 24  LYS A HG2  5  
ATOM 7753  H HG3  . LYS A 1 24  ? 17.248  17.594  -1.587  1.00 0.00 ? 24  LYS A HG3  5  
ATOM 7754  H HD2  . LYS A 1 24  ? 18.998  19.148  -2.331  1.00 0.00 ? 24  LYS A HD2  5  
ATOM 7755  H HD3  . LYS A 1 24  ? 18.979  18.395  -3.927  1.00 0.00 ? 24  LYS A HD3  5  
ATOM 7756  H HE2  . LYS A 1 24  ? 16.604  19.723  -2.628  1.00 0.00 ? 24  LYS A HE2  5  
ATOM 7757  H HE3  . LYS A 1 24  ? 17.669  20.502  -3.796  1.00 0.00 ? 24  LYS A HE3  5  
ATOM 7758  H HZ1  . LYS A 1 24  ? 17.015  18.284  -5.114  1.00 0.00 ? 24  LYS A HZ1  5  
ATOM 7759  H HZ2  . LYS A 1 24  ? 16.156  19.734  -5.247  1.00 0.00 ? 24  LYS A HZ2  5  
ATOM 7760  H HZ3  . LYS A 1 24  ? 15.600  18.514  -4.216  1.00 0.00 ? 24  LYS A HZ3  5  
ATOM 7761  N N    . ASP A 1 25  ? 21.783  15.738  -2.458  1.00 0.00 ? 25  ASP A N    5  
ATOM 7762  C CA   . ASP A 1 25  ? 23.121  15.296  -2.080  1.00 0.00 ? 25  ASP A CA   5  
ATOM 7763  C C    . ASP A 1 25  ? 23.130  14.749  -0.656  1.00 0.00 ? 25  ASP A C    5  
ATOM 7764  O O    . ASP A 1 25  ? 23.484  15.454  0.288   1.00 0.00 ? 25  ASP A O    5  
ATOM 7765  C CB   . ASP A 1 25  ? 24.116  16.451  -2.202  1.00 0.00 ? 25  ASP A CB   5  
ATOM 7766  C CG   . ASP A 1 25  ? 25.542  16.019  -1.921  1.00 0.00 ? 25  ASP A CG   5  
ATOM 7767  O OD1  . ASP A 1 25  ? 26.168  15.421  -2.820  1.00 0.00 ? 25  ASP A OD1  5  
ATOM 7768  O OD2  . ASP A 1 25  ? 26.030  16.277  -0.801  1.00 0.00 ? 25  ASP A OD2  5  
ATOM 7769  H H    . ASP A 1 25  ? 21.600  16.698  -2.532  1.00 0.00 ? 25  ASP A H    5  
ATOM 7770  H HA   . ASP A 1 25  ? 23.413  14.508  -2.757  1.00 0.00 ? 25  ASP A HA   5  
ATOM 7771  H HB2  . ASP A 1 25  ? 24.073  16.851  -3.205  1.00 0.00 ? 25  ASP A HB2  5  
ATOM 7772  H HB3  . ASP A 1 25  ? 23.848  17.225  -1.499  1.00 0.00 ? 25  ASP A HB3  5  
ATOM 7773  N N    . GLY A 1 26  ? 22.736  13.488  -0.509  1.00 0.00 ? 26  GLY A N    5  
ATOM 7774  C CA   . GLY A 1 26  ? 22.705  12.868  0.802   1.00 0.00 ? 26  GLY A CA   5  
ATOM 7775  C C    . GLY A 1 26  ? 21.351  12.271  1.130   1.00 0.00 ? 26  GLY A C    5  
ATOM 7776  O O    . GLY A 1 26  ? 21.266  11.163  1.659   1.00 0.00 ? 26  GLY A O    5  
ATOM 7777  H H    . GLY A 1 26  ? 22.464  12.974  -1.299  1.00 0.00 ? 26  GLY A H    5  
ATOM 7778  H HA2  . GLY A 1 26  ? 23.449  12.087  0.837   1.00 0.00 ? 26  GLY A HA2  5  
ATOM 7779  H HA3  . GLY A 1 26  ? 22.945  13.614  1.546   1.00 0.00 ? 26  GLY A HA3  5  
ATOM 7780  N N    . GLN A 1 27  ? 20.290  13.007  0.816   1.00 0.00 ? 27  GLN A N    5  
ATOM 7781  C CA   . GLN A 1 27  ? 18.933  12.543  1.082   1.00 0.00 ? 27  GLN A CA   5  
ATOM 7782  C C    . GLN A 1 27  ? 18.707  11.154  0.496   1.00 0.00 ? 27  GLN A C    5  
ATOM 7783  O O    . GLN A 1 27  ? 19.166  10.852  -0.606  1.00 0.00 ? 27  GLN A O    5  
ATOM 7784  C CB   . GLN A 1 27  ? 17.913  13.526  0.504   1.00 0.00 ? 27  GLN A CB   5  
ATOM 7785  C CG   . GLN A 1 27  ? 16.472  13.068  0.659   1.00 0.00 ? 27  GLN A CG   5  
ATOM 7786  C CD   . GLN A 1 27  ? 15.483  14.030  0.032   1.00 0.00 ? 27  GLN A CD   5  
ATOM 7787  O OE1  . GLN A 1 27  ? 14.852  14.830  0.724   1.00 0.00 ? 27  GLN A OE1  5  
ATOM 7788  N NE2  . GLN A 1 27  ? 15.342  13.959  -1.287  1.00 0.00 ? 27  GLN A NE2  5  
ATOM 7789  H H    . GLN A 1 27  ? 20.422  13.882  0.396   1.00 0.00 ? 27  GLN A H    5  
ATOM 7790  H HA   . GLN A 1 27  ? 18.804  12.494  2.153   1.00 0.00 ? 27  GLN A HA   5  
ATOM 7791  H HB2  . GLN A 1 27  ? 18.022  14.476  1.005   1.00 0.00 ? 27  GLN A HB2  5  
ATOM 7792  H HB3  . GLN A 1 27  ? 18.115  13.657  -0.549  1.00 0.00 ? 27  GLN A HB3  5  
ATOM 7793  H HG2  . GLN A 1 27  ? 16.361  12.103  0.186   1.00 0.00 ? 27  GLN A HG2  5  
ATOM 7794  H HG3  . GLN A 1 27  ? 16.247  12.979  1.712   1.00 0.00 ? 27  GLN A HG3  5  
ATOM 7795  H HE21 . GLN A 1 27  ? 15.876  13.296  -1.773  1.00 0.00 ? 27  GLN A HE21 5  
ATOM 7796  H HE22 . GLN A 1 27  ? 14.709  14.568  -1.718  1.00 0.00 ? 27  GLN A HE22 5  
ATOM 7797  N N    . SER A 1 28  ? 17.999  10.311  1.240   1.00 0.00 ? 28  SER A N    5  
ATOM 7798  C CA   . SER A 1 28  ? 17.716  8.951   0.796   1.00 0.00 ? 28  SER A CA   5  
ATOM 7799  C C    . SER A 1 28  ? 16.293  8.841   0.256   1.00 0.00 ? 28  SER A C    5  
ATOM 7800  O O    . SER A 1 28  ? 15.436  9.673   0.557   1.00 0.00 ? 28  SER A O    5  
ATOM 7801  C CB   . SER A 1 28  ? 17.915  7.964   1.947   1.00 0.00 ? 28  SER A CB   5  
ATOM 7802  O OG   . SER A 1 28  ? 19.288  7.667   2.133   1.00 0.00 ? 28  SER A OG   5  
ATOM 7803  H H    . SER A 1 28  ? 17.660  10.610  2.110   1.00 0.00 ? 28  SER A H    5  
ATOM 7804  H HA   . SER A 1 28  ? 18.408  8.710   0.003   1.00 0.00 ? 28  SER A HA   5  
ATOM 7805  H HB2  . SER A 1 28  ? 17.525  8.393   2.858   1.00 0.00 ? 28  SER A HB2  5  
ATOM 7806  H HB3  . SER A 1 28  ? 17.387  7.047   1.727   1.00 0.00 ? 28  SER A HB3  5  
ATOM 7807  H HG   . SER A 1 28  ? 19.525  6.902   1.604   1.00 0.00 ? 28  SER A HG   5  
ATOM 7808  N N    . LEU A 1 29  ? 16.048  7.808   -0.542  1.00 0.00 ? 29  LEU A N    5  
ATOM 7809  C CA   . LEU A 1 29  ? 14.729  7.586   -1.125  1.00 0.00 ? 29  LEU A CA   5  
ATOM 7810  C C    . LEU A 1 29  ? 13.628  7.946   -0.132  1.00 0.00 ? 29  LEU A C    5  
ATOM 7811  O O    . LEU A 1 29  ? 12.916  8.934   -0.311  1.00 0.00 ? 29  LEU A O    5  
ATOM 7812  C CB   . LEU A 1 29  ? 14.581  6.128   -1.562  1.00 0.00 ? 29  LEU A CB   5  
ATOM 7813  C CG   . LEU A 1 29  ? 13.443  5.833   -2.539  1.00 0.00 ? 29  LEU A CG   5  
ATOM 7814  C CD1  . LEU A 1 29  ? 13.721  6.471   -3.891  1.00 0.00 ? 29  LEU A CD1  5  
ATOM 7815  C CD2  . LEU A 1 29  ? 13.243  4.331   -2.687  1.00 0.00 ? 29  LEU A CD2  5  
ATOM 7816  H H    . LEU A 1 29  ? 16.771  7.178   -0.745  1.00 0.00 ? 29  LEU A H    5  
ATOM 7817  H HA   . LEU A 1 29  ? 14.639  8.224   -1.991  1.00 0.00 ? 29  LEU A HA   5  
ATOM 7818  H HB2  . LEU A 1 29  ? 15.505  5.828   -2.031  1.00 0.00 ? 29  LEU A HB2  5  
ATOM 7819  H HB3  . LEU A 1 29  ? 14.419  5.533   -0.674  1.00 0.00 ? 29  LEU A HB3  5  
ATOM 7820  H HG   . LEU A 1 29  ? 12.526  6.257   -2.153  1.00 0.00 ? 29  LEU A HG   5  
ATOM 7821  H HD11 . LEU A 1 29  ? 12.855  6.361   -4.526  1.00 0.00 ? 29  LEU A HD11 5  
ATOM 7822  H HD12 . LEU A 1 29  ? 14.569  5.985   -4.351  1.00 0.00 ? 29  LEU A HD12 5  
ATOM 7823  H HD13 . LEU A 1 29  ? 13.938  7.521   -3.756  1.00 0.00 ? 29  LEU A HD13 5  
ATOM 7824  H HD21 . LEU A 1 29  ? 12.444  4.143   -3.389  1.00 0.00 ? 29  LEU A HD21 5  
ATOM 7825  H HD22 . LEU A 1 29  ? 12.987  3.906   -1.728  1.00 0.00 ? 29  LEU A HD22 5  
ATOM 7826  H HD23 . LEU A 1 29  ? 14.155  3.881   -3.050  1.00 0.00 ? 29  LEU A HD23 5  
ATOM 7827  N N    . GLY A 1 30  ? 13.496  7.139   0.916   1.00 0.00 ? 30  GLY A N    5  
ATOM 7828  C CA   . GLY A 1 30  ? 12.482  7.391   1.923   1.00 0.00 ? 30  GLY A CA   5  
ATOM 7829  C C    . GLY A 1 30  ? 11.165  6.712   1.601   1.00 0.00 ? 30  GLY A C    5  
ATOM 7830  O O    . GLY A 1 30  ? 10.123  7.364   1.535   1.00 0.00 ? 30  GLY A O    5  
ATOM 7831  H H    . GLY A 1 30  ? 14.093  6.367   1.007   1.00 0.00 ? 30  GLY A H    5  
ATOM 7832  H HA2  . GLY A 1 30  ? 12.838  7.029   2.875   1.00 0.00 ? 30  GLY A HA2  5  
ATOM 7833  H HA3  . GLY A 1 30  ? 12.316  8.456   1.992   1.00 0.00 ? 30  GLY A HA3  5  
ATOM 7834  N N    . ILE A 1 31  ? 11.212  5.399   1.399   1.00 0.00 ? 31  ILE A N    5  
ATOM 7835  C CA   . ILE A 1 31  ? 10.013  4.633   1.081   1.00 0.00 ? 31  ILE A CA   5  
ATOM 7836  C C    . ILE A 1 31  ? 10.051  3.257   1.738   1.00 0.00 ? 31  ILE A C    5  
ATOM 7837  O O    . ILE A 1 31  ? 11.008  2.502   1.566   1.00 0.00 ? 31  ILE A O    5  
ATOM 7838  C CB   . ILE A 1 31  ? 9.843   4.459   -0.439  1.00 0.00 ? 31  ILE A CB   5  
ATOM 7839  C CG1  . ILE A 1 31  ? 9.781   5.824   -1.127  1.00 0.00 ? 31  ILE A CG1  5  
ATOM 7840  C CG2  . ILE A 1 31  ? 8.590   3.650   -0.742  1.00 0.00 ? 31  ILE A CG2  5  
ATOM 7841  C CD1  . ILE A 1 31  ? 9.964   5.754   -2.627  1.00 0.00 ? 31  ILE A CD1  5  
ATOM 7842  H H    . ILE A 1 31  ? 12.072  4.936   1.466   1.00 0.00 ? 31  ILE A H    5  
ATOM 7843  H HA   . ILE A 1 31  ? 9.160   5.177   1.460   1.00 0.00 ? 31  ILE A HA   5  
ATOM 7844  H HB   . ILE A 1 31  ? 10.694  3.913   -0.815  1.00 0.00 ? 31  ILE A HB   5  
ATOM 7845  H HG12 . ILE A 1 31  ? 8.821   6.276   -0.931  1.00 0.00 ? 31  ILE A HG12 5  
ATOM 7846  H HG13 . ILE A 1 31  ? 10.560  6.456   -0.726  1.00 0.00 ? 31  ILE A HG13 5  
ATOM 7847  H HG21 . ILE A 1 31  ? 7.892   4.261   -1.294  1.00 0.00 ? 31  ILE A HG21 5  
ATOM 7848  H HG22 . ILE A 1 31  ? 8.855   2.785   -1.333  1.00 0.00 ? 31  ILE A HG22 5  
ATOM 7849  H HG23 . ILE A 1 31  ? 8.136   3.329   0.183   1.00 0.00 ? 31  ILE A HG23 5  
ATOM 7850  H HD11 . ILE A 1 31  ? 9.011   5.562   -3.098  1.00 0.00 ? 31  ILE A HD11 5  
ATOM 7851  H HD12 . ILE A 1 31  ? 10.362  6.691   -2.986  1.00 0.00 ? 31  ILE A HD12 5  
ATOM 7852  H HD13 . ILE A 1 31  ? 10.650  4.955   -2.869  1.00 0.00 ? 31  ILE A HD13 5  
ATOM 7853  N N    . ARG A 1 32  ? 9.003   2.937   2.490   1.00 0.00 ? 32  ARG A N    5  
ATOM 7854  C CA   . ARG A 1 32  ? 8.916   1.652   3.173   1.00 0.00 ? 32  ARG A CA   5  
ATOM 7855  C C    . ARG A 1 32  ? 8.027   0.684   2.397   1.00 0.00 ? 32  ARG A C    5  
ATOM 7856  O O    . ARG A 1 32  ? 6.978   1.068   1.880   1.00 0.00 ? 32  ARG A O    5  
ATOM 7857  C CB   . ARG A 1 32  ? 8.370   1.838   4.589   1.00 0.00 ? 32  ARG A CB   5  
ATOM 7858  C CG   . ARG A 1 32  ? 9.351   2.509   5.537   1.00 0.00 ? 32  ARG A CG   5  
ATOM 7859  C CD   . ARG A 1 32  ? 10.268  1.493   6.200   1.00 0.00 ? 32  ARG A CD   5  
ATOM 7860  N NE   . ARG A 1 32  ? 9.610   0.801   7.304   1.00 0.00 ? 32  ARG A NE   5  
ATOM 7861  C CZ   . ARG A 1 32  ? 10.266  0.210   8.297   1.00 0.00 ? 32  ARG A CZ   5  
ATOM 7862  N NH1  . ARG A 1 32  ? 11.592  0.229   8.323   1.00 0.00 ? 32  ARG A NH1  5  
ATOM 7863  N NH2  . ARG A 1 32  ? 9.597   -0.400  9.266   1.00 0.00 ? 32  ARG A NH2  5  
ATOM 7864  H H    . ARG A 1 32  ? 8.271   3.582   2.590   1.00 0.00 ? 32  ARG A H    5  
ATOM 7865  H HA   . ARG A 1 32  ? 9.912   1.239   3.231   1.00 0.00 ? 32  ARG A HA   5  
ATOM 7866  H HB2  . ARG A 1 32  ? 7.478   2.445   4.542   1.00 0.00 ? 32  ARG A HB2  5  
ATOM 7867  H HB3  . ARG A 1 32  ? 8.116   0.871   4.995   1.00 0.00 ? 32  ARG A HB3  5  
ATOM 7868  H HG2  . ARG A 1 32  ? 9.954   3.211   4.979   1.00 0.00 ? 32  ARG A HG2  5  
ATOM 7869  H HG3  . ARG A 1 32  ? 8.798   3.034   6.301   1.00 0.00 ? 32  ARG A HG3  5  
ATOM 7870  H HD2  . ARG A 1 32  ? 10.571  0.766   5.461   1.00 0.00 ? 32  ARG A HD2  5  
ATOM 7871  H HD3  . ARG A 1 32  ? 11.139  2.007   6.577   1.00 0.00 ? 32  ARG A HD3  5  
ATOM 7872  H HE   . ARG A 1 32  ? 8.631   0.775   7.305   1.00 0.00 ? 32  ARG A HE   5  
ATOM 7873  H HH11 . ARG A 1 32  ? 12.099  0.689   7.595   1.00 0.00 ? 32  ARG A HH11 5  
ATOM 7874  H HH12 . ARG A 1 32  ? 12.084  -0.215  9.072   1.00 0.00 ? 32  ARG A HH12 5  
ATOM 7875  H HH21 . ARG A 1 32  ? 8.598   -0.416  9.250   1.00 0.00 ? 32  ARG A HH21 5  
ATOM 7876  H HH22 . ARG A 1 32  ? 10.092  -0.844  10.013  1.00 0.00 ? 32  ARG A HH22 5  
ATOM 7877  N N    . ILE A 1 33  ? 8.455   -0.572  2.320   1.00 0.00 ? 33  ILE A N    5  
ATOM 7878  C CA   . ILE A 1 33  ? 7.697   -1.594  1.608   1.00 0.00 ? 33  ILE A CA   5  
ATOM 7879  C C    . ILE A 1 33  ? 7.240   -2.698  2.555   1.00 0.00 ? 33  ILE A C    5  
ATOM 7880  O O    . ILE A 1 33  ? 7.746   -2.824  3.670   1.00 0.00 ? 33  ILE A O    5  
ATOM 7881  C CB   . ILE A 1 33  ? 8.527   -2.219  0.471   1.00 0.00 ? 33  ILE A CB   5  
ATOM 7882  C CG1  . ILE A 1 33  ? 9.747   -2.945  1.040   1.00 0.00 ? 33  ILE A CG1  5  
ATOM 7883  C CG2  . ILE A 1 33  ? 8.955   -1.149  -0.522  1.00 0.00 ? 33  ILE A CG2  5  
ATOM 7884  C CD1  . ILE A 1 33  ? 10.197  -4.120  0.200   1.00 0.00 ? 33  ILE A CD1  5  
ATOM 7885  H H    . ILE A 1 33  ? 9.299   -0.817  2.753   1.00 0.00 ? 33  ILE A H    5  
ATOM 7886  H HA   . ILE A 1 33  ? 6.827   -1.122  1.175   1.00 0.00 ? 33  ILE A HA   5  
ATOM 7887  H HB   . ILE A 1 33  ? 7.904   -2.930  -0.050  1.00 0.00 ? 33  ILE A HB   5  
ATOM 7888  H HG12 . ILE A 1 33  ? 10.571  -2.252  1.109   1.00 0.00 ? 33  ILE A HG12 5  
ATOM 7889  H HG13 . ILE A 1 33  ? 9.509   -3.314  2.027   1.00 0.00 ? 33  ILE A HG13 5  
ATOM 7890  H HG21 . ILE A 1 33  ? 10.012  -0.954  -0.407  1.00 0.00 ? 33  ILE A HG21 5  
ATOM 7891  H HG22 . ILE A 1 33  ? 8.761   -1.492  -1.527  1.00 0.00 ? 33  ILE A HG22 5  
ATOM 7892  H HG23 . ILE A 1 33  ? 8.400   -0.242  -0.337  1.00 0.00 ? 33  ILE A HG23 5  
ATOM 7893  H HD11 . ILE A 1 33  ? 10.013  -5.039  0.737   1.00 0.00 ? 33  ILE A HD11 5  
ATOM 7894  H HD12 . ILE A 1 33  ? 9.649   -4.129  -0.730  1.00 0.00 ? 33  ILE A HD12 5  
ATOM 7895  H HD13 . ILE A 1 33  ? 11.254  -4.031  -0.006  1.00 0.00 ? 33  ILE A HD13 5  
ATOM 7896  N N    . VAL A 1 34  ? 6.280   -3.498  2.102   1.00 0.00 ? 34  VAL A N    5  
ATOM 7897  C CA   . VAL A 1 34  ? 5.756   -4.595  2.907   1.00 0.00 ? 34  VAL A CA   5  
ATOM 7898  C C    . VAL A 1 34  ? 5.598   -5.862  2.074   1.00 0.00 ? 34  VAL A C    5  
ATOM 7899  O O    . VAL A 1 34  ? 5.538   -5.807  0.847   1.00 0.00 ? 34  VAL A O    5  
ATOM 7900  C CB   . VAL A 1 34  ? 4.396   -4.232  3.533   1.00 0.00 ? 34  VAL A CB   5  
ATOM 7901  C CG1  . VAL A 1 34  ? 3.282   -4.374  2.507   1.00 0.00 ? 34  VAL A CG1  5  
ATOM 7902  C CG2  . VAL A 1 34  ? 4.123   -5.099  4.753   1.00 0.00 ? 34  VAL A CG2  5  
ATOM 7903  H H    . VAL A 1 34  ? 5.916   -3.348  1.205   1.00 0.00 ? 34  VAL A H    5  
ATOM 7904  H HA   . VAL A 1 34  ? 6.457   -4.787  3.707   1.00 0.00 ? 34  VAL A HA   5  
ATOM 7905  H HB   . VAL A 1 34  ? 4.433   -3.201  3.851   1.00 0.00 ? 34  VAL A HB   5  
ATOM 7906  H HG11 . VAL A 1 34  ? 3.305   -5.368  2.086   1.00 0.00 ? 34  VAL A HG11 5  
ATOM 7907  H HG12 . VAL A 1 34  ? 2.328   -4.206  2.986   1.00 0.00 ? 34  VAL A HG12 5  
ATOM 7908  H HG13 . VAL A 1 34  ? 3.423   -3.647  1.721   1.00 0.00 ? 34  VAL A HG13 5  
ATOM 7909  H HG21 . VAL A 1 34  ? 5.002   -5.681  4.984   1.00 0.00 ? 34  VAL A HG21 5  
ATOM 7910  H HG22 . VAL A 1 34  ? 3.877   -4.469  5.595   1.00 0.00 ? 34  VAL A HG22 5  
ATOM 7911  H HG23 . VAL A 1 34  ? 3.296   -5.762  4.546   1.00 0.00 ? 34  VAL A HG23 5  
ATOM 7912  N N    . GLY A 1 35  ? 5.530   -7.005  2.751   1.00 0.00 ? 35  GLY A N    5  
ATOM 7913  C CA   . GLY A 1 35  ? 5.379   -8.270  2.057   1.00 0.00 ? 35  GLY A CA   5  
ATOM 7914  C C    . GLY A 1 35  ? 4.083   -8.973  2.408   1.00 0.00 ? 35  GLY A C    5  
ATOM 7915  O O    . GLY A 1 35  ? 4.049   -9.817  3.304   1.00 0.00 ? 35  GLY A O    5  
ATOM 7916  H H    . GLY A 1 35  ? 5.583   -6.988  3.730   1.00 0.00 ? 35  GLY A H    5  
ATOM 7917  H HA2  . GLY A 1 35  ? 5.402   -8.089  0.992   1.00 0.00 ? 35  GLY A HA2  5  
ATOM 7918  H HA3  . GLY A 1 35  ? 6.206   -8.913  2.320   1.00 0.00 ? 35  GLY A HA3  5  
ATOM 7919  N N    . TYR A 1 36  ? 3.013   -8.624  1.702   1.00 0.00 ? 36  TYR A N    5  
ATOM 7920  C CA   . TYR A 1 36  ? 1.707   -9.224  1.947   1.00 0.00 ? 36  TYR A CA   5  
ATOM 7921  C C    . TYR A 1 36  ? 1.632   -10.627 1.353   1.00 0.00 ? 36  TYR A C    5  
ATOM 7922  O O    . TYR A 1 36  ? 2.238   -10.910 0.320   1.00 0.00 ? 36  TYR A O    5  
ATOM 7923  C CB   . TYR A 1 36  ? 0.601   -8.348  1.355   1.00 0.00 ? 36  TYR A CB   5  
ATOM 7924  C CG   . TYR A 1 36  ? -0.016  -7.395  2.354   1.00 0.00 ? 36  TYR A CG   5  
ATOM 7925  C CD1  . TYR A 1 36  ? 0.503   -6.119  2.537   1.00 0.00 ? 36  TYR A CD1  5  
ATOM 7926  C CD2  . TYR A 1 36  ? -1.116  -7.770  3.114   1.00 0.00 ? 36  TYR A CD2  5  
ATOM 7927  C CE1  . TYR A 1 36  ? -0.057  -5.244  3.448   1.00 0.00 ? 36  TYR A CE1  5  
ATOM 7928  C CE2  . TYR A 1 36  ? -1.683  -6.901  4.027   1.00 0.00 ? 36  TYR A CE2  5  
ATOM 7929  C CZ   . TYR A 1 36  ? -1.150  -5.640  4.190   1.00 0.00 ? 36  TYR A CZ   5  
ATOM 7930  O OH   . TYR A 1 36  ? -1.711  -4.773  5.100   1.00 0.00 ? 36  TYR A OH   5  
ATOM 7931  H H    . TYR A 1 36  ? 3.103   -7.945  1.001   1.00 0.00 ? 36  TYR A H    5  
ATOM 7932  H HA   . TYR A 1 36  ? 1.567   -9.290  3.016   1.00 0.00 ? 36  TYR A HA   5  
ATOM 7933  H HB2  . TYR A 1 36  ? 1.009   -7.762  0.546   1.00 0.00 ? 36  TYR A HB2  5  
ATOM 7934  H HB3  . TYR A 1 36  ? -0.185  -8.983  0.973   1.00 0.00 ? 36  TYR A HB3  5  
ATOM 7935  H HD1  . TYR A 1 36  ? 1.359   -5.812  1.954   1.00 0.00 ? 36  TYR A HD1  5  
ATOM 7936  H HD2  . TYR A 1 36  ? -1.531  -8.759  2.984   1.00 0.00 ? 36  TYR A HD2  5  
ATOM 7937  H HE1  . TYR A 1 36  ? 0.360   -4.256  3.576   1.00 0.00 ? 36  TYR A HE1  5  
ATOM 7938  H HE2  . TYR A 1 36  ? -2.539  -7.211  4.609   1.00 0.00 ? 36  TYR A HE2  5  
ATOM 7939  H HH   . TYR A 1 36  ? -2.272  -5.263  5.705   1.00 0.00 ? 36  TYR A HH   5  
ATOM 7940  N N    . VAL A 1 37  ? 0.883   -11.504 2.015   1.00 0.00 ? 37  VAL A N    5  
ATOM 7941  C CA   . VAL A 1 37  ? 0.726   -12.878 1.553   1.00 0.00 ? 37  VAL A CA   5  
ATOM 7942  C C    . VAL A 1 37  ? -0.744  -13.225 1.350   1.00 0.00 ? 37  VAL A C    5  
ATOM 7943  O O    . VAL A 1 37  ? -1.091  -14.019 0.477   1.00 0.00 ? 37  VAL A O    5  
ATOM 7944  C CB   . VAL A 1 37  ? 1.346   -13.878 2.547   1.00 0.00 ? 37  VAL A CB   5  
ATOM 7945  C CG1  . VAL A 1 37  ? 1.066   -15.308 2.110   1.00 0.00 ? 37  VAL A CG1  5  
ATOM 7946  C CG2  . VAL A 1 37  ? 2.842   -13.636 2.682   1.00 0.00 ? 37  VAL A CG2  5  
ATOM 7947  H H    . VAL A 1 37  ? 0.424   -11.219 2.832   1.00 0.00 ? 37  VAL A H    5  
ATOM 7948  H HA   . VAL A 1 37  ? 1.243   -12.974 0.609   1.00 0.00 ? 37  VAL A HA   5  
ATOM 7949  H HB   . VAL A 1 37  ? 0.889   -13.724 3.513   1.00 0.00 ? 37  VAL A HB   5  
ATOM 7950  H HG11 . VAL A 1 37  ? 0.336   -15.750 2.773   1.00 0.00 ? 37  VAL A HG11 5  
ATOM 7951  H HG12 . VAL A 1 37  ? 0.684   -15.308 1.100   1.00 0.00 ? 37  VAL A HG12 5  
ATOM 7952  H HG13 . VAL A 1 37  ? 1.980   -15.882 2.150   1.00 0.00 ? 37  VAL A HG13 5  
ATOM 7953  H HG21 . VAL A 1 37  ? 3.333   -14.562 2.942   1.00 0.00 ? 37  VAL A HG21 5  
ATOM 7954  H HG22 . VAL A 1 37  ? 3.234   -13.271 1.744   1.00 0.00 ? 37  VAL A HG22 5  
ATOM 7955  H HG23 . VAL A 1 37  ? 3.020   -12.904 3.456   1.00 0.00 ? 37  VAL A HG23 5  
ATOM 7956  N N    . GLY A 1 38  ? -1.607  -12.623 2.163   1.00 0.00 ? 38  GLY A N    5  
ATOM 7957  C CA   . GLY A 1 38  ? -3.031  -12.881 2.057   1.00 0.00 ? 38  GLY A CA   5  
ATOM 7958  C C    . GLY A 1 38  ? -3.497  -13.965 3.008   1.00 0.00 ? 38  GLY A C    5  
ATOM 7959  O O    . GLY A 1 38  ? -2.831  -14.988 3.170   1.00 0.00 ? 38  GLY A O    5  
ATOM 7960  H H    . GLY A 1 38  ? -1.273  -11.998 2.841   1.00 0.00 ? 38  GLY A H    5  
ATOM 7961  H HA2  . GLY A 1 38  ? -3.568  -11.970 2.275   1.00 0.00 ? 38  GLY A HA2  5  
ATOM 7962  H HA3  . GLY A 1 38  ? -3.255  -13.185 1.045   1.00 0.00 ? 38  GLY A HA3  5  
ATOM 7963  N N    . THR A 1 39  ? -4.643  -13.741 3.643   1.00 0.00 ? 39  THR A N    5  
ATOM 7964  C CA   . THR A 1 39  ? -5.196  -14.705 4.585   1.00 0.00 ? 39  THR A CA   5  
ATOM 7965  C C    . THR A 1 39  ? -6.719  -14.722 4.525   1.00 0.00 ? 39  THR A C    5  
ATOM 7966  O O    . THR A 1 39  ? -7.326  -14.005 3.730   1.00 0.00 ? 39  THR A O    5  
ATOM 7967  C CB   . THR A 1 39  ? -4.755  -14.396 6.029   1.00 0.00 ? 39  THR A CB   5  
ATOM 7968  O OG1  . THR A 1 39  ? -5.166  -15.453 6.903   1.00 0.00 ? 39  THR A OG1  5  
ATOM 7969  C CG2  . THR A 1 39  ? -5.345  -13.078 6.505   1.00 0.00 ? 39  THR A CG2  5  
ATOM 7970  H H    . THR A 1 39  ? -5.128  -12.906 3.472   1.00 0.00 ? 39  THR A H    5  
ATOM 7971  H HA   . THR A 1 39  ? -4.824  -15.684 4.319   1.00 0.00 ? 39  THR A HA   5  
ATOM 7972  H HB   . THR A 1 39  ? -3.677  -14.320 6.050   1.00 0.00 ? 39  THR A HB   5  
ATOM 7973  H HG1  . THR A 1 39  ? -4.502  -16.147 6.901   1.00 0.00 ? 39  THR A HG1  5  
ATOM 7974  H HG21 . THR A 1 39  ? -5.172  -12.968 7.565   1.00 0.00 ? 39  THR A HG21 5  
ATOM 7975  H HG22 . THR A 1 39  ? -6.407  -13.068 6.310   1.00 0.00 ? 39  THR A HG22 5  
ATOM 7976  H HG23 . THR A 1 39  ? -4.875  -12.262 5.977   1.00 0.00 ? 39  THR A HG23 5  
ATOM 7977  N N    . SER A 1 40  ? -7.331  -15.546 5.370   1.00 0.00 ? 40  SER A N    5  
ATOM 7978  C CA   . SER A 1 40  ? -8.785  -15.658 5.410   1.00 0.00 ? 40  SER A CA   5  
ATOM 7979  C C    . SER A 1 40  ? -9.331  -16.127 4.065   1.00 0.00 ? 40  SER A C    5  
ATOM 7980  O O    . SER A 1 40  ? -10.462 -15.810 3.696   1.00 0.00 ? 40  SER A O    5  
ATOM 7981  C CB   . SER A 1 40  ? -9.411  -14.314 5.787   1.00 0.00 ? 40  SER A CB   5  
ATOM 7982  O OG   . SER A 1 40  ? -9.448  -14.145 7.193   1.00 0.00 ? 40  SER A OG   5  
ATOM 7983  H H    . SER A 1 40  ? -6.792  -16.092 5.979   1.00 0.00 ? 40  SER A H    5  
ATOM 7984  H HA   . SER A 1 40  ? -9.040  -16.389 6.163   1.00 0.00 ? 40  SER A HA   5  
ATOM 7985  H HB2  . SER A 1 40  ? -8.829  -13.515 5.355   1.00 0.00 ? 40  SER A HB2  5  
ATOM 7986  H HB3  . SER A 1 40  ? -10.421 -14.271 5.404   1.00 0.00 ? 40  SER A HB3  5  
ATOM 7987  H HG   . SER A 1 40  ? -10.199 -14.622 7.554   1.00 0.00 ? 40  SER A HG   5  
ATOM 7988  N N    . HIS A 1 41  ? -8.518  -16.885 3.335   1.00 0.00 ? 41  HIS A N    5  
ATOM 7989  C CA   . HIS A 1 41  ? -8.918  -17.399 2.030   1.00 0.00 ? 41  HIS A CA   5  
ATOM 7990  C C    . HIS A 1 41  ? -9.559  -16.301 1.187   1.00 0.00 ? 41  HIS A C    5  
ATOM 7991  O O    . HIS A 1 41  ? -10.527 -16.542 0.465   1.00 0.00 ? 41  HIS A O    5  
ATOM 7992  C CB   . HIS A 1 41  ? -9.893  -18.565 2.195   1.00 0.00 ? 41  HIS A CB   5  
ATOM 7993  C CG   . HIS A 1 41  ? -11.142 -18.202 2.937   1.00 0.00 ? 41  HIS A CG   5  
ATOM 7994  N ND1  . HIS A 1 41  ? -11.395 -18.610 4.230   1.00 0.00 ? 41  HIS A ND1  5  
ATOM 7995  C CD2  . HIS A 1 41  ? -12.211 -17.461 2.562   1.00 0.00 ? 41  HIS A CD2  5  
ATOM 7996  C CE1  . HIS A 1 41  ? -12.567 -18.139 4.616   1.00 0.00 ? 41  HIS A CE1  5  
ATOM 7997  N NE2  . HIS A 1 41  ? -13.082 -17.437 3.623   1.00 0.00 ? 41  HIS A NE2  5  
ATOM 7998  H H    . HIS A 1 41  ? -7.628  -17.103 3.682   1.00 0.00 ? 41  HIS A H    5  
ATOM 7999  H HA   . HIS A 1 41  ? -8.031  -17.751 1.526   1.00 0.00 ? 41  HIS A HA   5  
ATOM 8000  H HB2  . HIS A 1 41  ? -10.181 -18.926 1.219   1.00 0.00 ? 41  HIS A HB2  5  
ATOM 8001  H HB3  . HIS A 1 41  ? -9.403  -19.361 2.738   1.00 0.00 ? 41  HIS A HB3  5  
ATOM 8002  H HD1  . HIS A 1 41  ? -10.805 -19.165 4.780   1.00 0.00 ? 41  HIS A HD1  5  
ATOM 8003  H HD2  . HIS A 1 41  ? -12.353 -16.978 1.605   1.00 0.00 ? 41  HIS A HD2  5  
ATOM 8004  H HE1  . HIS A 1 41  ? -13.026 -18.298 5.581   1.00 0.00 ? 41  HIS A HE1  5  
ATOM 8005  H HE2  . HIS A 1 41  ? -13.982 -17.049 3.613   1.00 0.00 ? 41  HIS A HE2  5  
ATOM 8006  N N    . THR A 1 42  ? -9.013  -15.092 1.283   1.00 0.00 ? 42  THR A N    5  
ATOM 8007  C CA   . THR A 1 42  ? -9.532  -13.957 0.531   1.00 0.00 ? 42  THR A CA   5  
ATOM 8008  C C    . THR A 1 42  ? -8.784  -13.782 -0.786  1.00 0.00 ? 42  THR A C    5  
ATOM 8009  O O    . THR A 1 42  ? -9.387  -13.498 -1.820  1.00 0.00 ? 42  THR A O    5  
ATOM 8010  C CB   . THR A 1 42  ? -9.430  -12.652 1.343   1.00 0.00 ? 42  THR A CB   5  
ATOM 8011  O OG1  . THR A 1 42  ? -8.078  -12.442 1.767   1.00 0.00 ? 42  THR A OG1  5  
ATOM 8012  C CG2  . THR A 1 42  ? -10.346 -12.697 2.556   1.00 0.00 ? 42  THR A CG2  5  
ATOM 8013  H H    . THR A 1 42  ? -8.243  -14.963 1.875   1.00 0.00 ? 42  THR A H    5  
ATOM 8014  H HA   . THR A 1 42  ? -10.574 -14.145 0.320   1.00 0.00 ? 42  THR A HA   5  
ATOM 8015  H HB   . THR A 1 42  ? -9.733  -11.829 0.712   1.00 0.00 ? 42  THR A HB   5  
ATOM 8016  H HG1  . THR A 1 42  ? -8.008  -11.588 2.201   1.00 0.00 ? 42  THR A HG1  5  
ATOM 8017  H HG21 . THR A 1 42  ? -9.812  -12.341 3.425   1.00 0.00 ? 42  THR A HG21 5  
ATOM 8018  H HG22 . THR A 1 42  ? -10.671 -13.713 2.725   1.00 0.00 ? 42  THR A HG22 5  
ATOM 8019  H HG23 . THR A 1 42  ? -11.206 -12.068 2.381   1.00 0.00 ? 42  THR A HG23 5  
ATOM 8020  N N    . GLY A 1 43  ? -7.467  -13.955 -0.741  1.00 0.00 ? 43  GLY A N    5  
ATOM 8021  C CA   . GLY A 1 43  ? -6.659  -13.812 -1.939  1.00 0.00 ? 43  GLY A CA   5  
ATOM 8022  C C    . GLY A 1 43  ? -7.032  -12.586 -2.748  1.00 0.00 ? 43  GLY A C    5  
ATOM 8023  O O    . GLY A 1 43  ? -7.115  -12.646 -3.974  1.00 0.00 ? 43  GLY A O    5  
ATOM 8024  H H    . GLY A 1 43  ? -7.040  -14.180 0.111   1.00 0.00 ? 43  GLY A H    5  
ATOM 8025  H HA2  . GLY A 1 43  ? -5.620  -13.739 -1.652  1.00 0.00 ? 43  GLY A HA2  5  
ATOM 8026  H HA3  . GLY A 1 43  ? -6.791  -14.689 -2.555  1.00 0.00 ? 43  GLY A HA3  5  
ATOM 8027  N N    . GLU A 1 44  ? -7.260  -11.471 -2.059  1.00 0.00 ? 44  GLU A N    5  
ATOM 8028  C CA   . GLU A 1 44  ? -7.629  -10.227 -2.723  1.00 0.00 ? 44  GLU A CA   5  
ATOM 8029  C C    . GLU A 1 44  ? -6.558  -9.161  -2.515  1.00 0.00 ? 44  GLU A C    5  
ATOM 8030  O O    . GLU A 1 44  ? -6.785  -7.979  -2.773  1.00 0.00 ? 44  GLU A O    5  
ATOM 8031  C CB   . GLU A 1 44  ? -8.975  -9.722  -2.197  1.00 0.00 ? 44  GLU A CB   5  
ATOM 8032  C CG   . GLU A 1 44  ? -9.011  -9.545  -0.689  1.00 0.00 ? 44  GLU A CG   5  
ATOM 8033  C CD   . GLU A 1 44  ? -8.599  -8.151  -0.255  1.00 0.00 ? 44  GLU A CD   5  
ATOM 8034  O OE1  . GLU A 1 44  ? -9.105  -7.173  -0.846  1.00 0.00 ? 44  GLU A OE1  5  
ATOM 8035  O OE2  . GLU A 1 44  ? -7.772  -8.037  0.673   1.00 0.00 ? 44  GLU A OE2  5  
ATOM 8036  H H    . GLU A 1 44  ? -7.178  -11.487 -1.083  1.00 0.00 ? 44  GLU A H    5  
ATOM 8037  H HA   . GLU A 1 44  ? -7.719  -10.428 -3.780  1.00 0.00 ? 44  GLU A HA   5  
ATOM 8038  H HB2  . GLU A 1 44  ? -9.193  -8.770  -2.657  1.00 0.00 ? 44  GLU A HB2  5  
ATOM 8039  H HB3  . GLU A 1 44  ? -9.743  -10.429 -2.473  1.00 0.00 ? 44  GLU A HB3  5  
ATOM 8040  H HG2  . GLU A 1 44  ? -10.016 -9.731  -0.341  1.00 0.00 ? 44  GLU A HG2  5  
ATOM 8041  H HG3  . GLU A 1 44  ? -8.337  -10.259 -0.239  1.00 0.00 ? 44  GLU A HG3  5  
ATOM 8042  N N    . ALA A 1 45  ? -5.389  -9.588  -2.047  1.00 0.00 ? 45  ALA A N    5  
ATOM 8043  C CA   . ALA A 1 45  ? -4.282  -8.671  -1.806  1.00 0.00 ? 45  ALA A CA   5  
ATOM 8044  C C    . ALA A 1 45  ? -3.013  -9.430  -1.432  1.00 0.00 ? 45  ALA A C    5  
ATOM 8045  O O    . ALA A 1 45  ? -2.899  -9.960  -0.327  1.00 0.00 ? 45  ALA A O    5  
ATOM 8046  C CB   . ALA A 1 45  ? -4.647  -7.678  -0.712  1.00 0.00 ? 45  ALA A CB   5  
ATOM 8047  H H    . ALA A 1 45  ? -5.269  -10.542 -1.860  1.00 0.00 ? 45  ALA A H    5  
ATOM 8048  H HA   . ALA A 1 45  ? -4.103  -8.117  -2.716  1.00 0.00 ? 45  ALA A HA   5  
ATOM 8049  H HB1  . ALA A 1 45  ? -3.785  -7.499  -0.087  1.00 0.00 ? 45  ALA A HB1  5  
ATOM 8050  H HB2  . ALA A 1 45  ? -4.966  -6.749  -1.161  1.00 0.00 ? 45  ALA A HB2  5  
ATOM 8051  H HB3  . ALA A 1 45  ? -5.449  -8.082  -0.113  1.00 0.00 ? 45  ALA A HB3  5  
ATOM 8052  N N    . SER A 1 46  ? -2.063  -9.477  -2.359  1.00 0.00 ? 46  SER A N    5  
ATOM 8053  C CA   . SER A 1 46  ? -0.803  -10.175 -2.128  1.00 0.00 ? 46  SER A CA   5  
ATOM 8054  C C    . SER A 1 46  ? 0.311   -9.584  -2.987  1.00 0.00 ? 46  SER A C    5  
ATOM 8055  O O    . SER A 1 46  ? 0.298   -9.708  -4.211  1.00 0.00 ? 46  SER A O    5  
ATOM 8056  C CB   . SER A 1 46  ? -0.959  -11.667 -2.431  1.00 0.00 ? 46  SER A CB   5  
ATOM 8057  O OG   . SER A 1 46  ? -0.930  -11.910 -3.826  1.00 0.00 ? 46  SER A OG   5  
ATOM 8058  H H    . SER A 1 46  ? -2.213  -9.034  -3.221  1.00 0.00 ? 46  SER A H    5  
ATOM 8059  H HA   . SER A 1 46  ? -0.543  -10.053 -1.087  1.00 0.00 ? 46  SER A HA   5  
ATOM 8060  H HB2  . SER A 1 46  ? -0.153  -12.212 -1.965  1.00 0.00 ? 46  SER A HB2  5  
ATOM 8061  H HB3  . SER A 1 46  ? -1.903  -12.014 -2.036  1.00 0.00 ? 46  SER A HB3  5  
ATOM 8062  H HG   . SER A 1 46  ? -0.616  -12.802 -3.989  1.00 0.00 ? 46  SER A HG   5  
ATOM 8063  N N    . GLY A 1 47  ? 1.274   -8.941  -2.335  1.00 0.00 ? 47  GLY A N    5  
ATOM 8064  C CA   . GLY A 1 47  ? 2.383   -8.340  -3.053  1.00 0.00 ? 47  GLY A CA   5  
ATOM 8065  C C    . GLY A 1 47  ? 3.126   -7.315  -2.221  1.00 0.00 ? 47  GLY A C    5  
ATOM 8066  O O    . GLY A 1 47  ? 3.138   -7.394  -0.992  1.00 0.00 ? 47  GLY A O    5  
ATOM 8067  H H    . GLY A 1 47  ? 1.232   -8.874  -1.358  1.00 0.00 ? 47  GLY A H    5  
ATOM 8068  H HA2  . GLY A 1 47  ? 3.072   -9.118  -3.347  1.00 0.00 ? 47  GLY A HA2  5  
ATOM 8069  H HA3  . GLY A 1 47  ? 2.002   -7.857  -3.941  1.00 0.00 ? 47  GLY A HA3  5  
ATOM 8070  N N    . ILE A 1 48  ? 3.749   -6.351  -2.889  1.00 0.00 ? 48  ILE A N    5  
ATOM 8071  C CA   . ILE A 1 48  ? 4.498   -5.306  -2.202  1.00 0.00 ? 48  ILE A CA   5  
ATOM 8072  C C    . ILE A 1 48  ? 3.703   -4.007  -2.144  1.00 0.00 ? 48  ILE A C    5  
ATOM 8073  O O    . ILE A 1 48  ? 3.279   -3.479  -3.173  1.00 0.00 ? 48  ILE A O    5  
ATOM 8074  C CB   . ILE A 1 48  ? 5.850   -5.037  -2.891  1.00 0.00 ? 48  ILE A CB   5  
ATOM 8075  C CG1  . ILE A 1 48  ? 6.687   -6.316  -2.936  1.00 0.00 ? 48  ILE A CG1  5  
ATOM 8076  C CG2  . ILE A 1 48  ? 6.602   -3.930  -2.167  1.00 0.00 ? 48  ILE A CG2  5  
ATOM 8077  C CD1  . ILE A 1 48  ? 7.010   -6.877  -1.569  1.00 0.00 ? 48  ILE A CD1  5  
ATOM 8078  H H    . ILE A 1 48  ? 3.703   -6.341  -3.868  1.00 0.00 ? 48  ILE A H    5  
ATOM 8079  H HA   . ILE A 1 48  ? 4.692   -5.643  -1.194  1.00 0.00 ? 48  ILE A HA   5  
ATOM 8080  H HB   . ILE A 1 48  ? 5.655   -4.706  -3.900  1.00 0.00 ? 48  ILE A HB   5  
ATOM 8081  H HG12 . ILE A 1 48  ? 6.149   -7.073  -3.485  1.00 0.00 ? 48  ILE A HG12 5  
ATOM 8082  H HG13 . ILE A 1 48  ? 7.621   -6.109  -3.439  1.00 0.00 ? 48  ILE A HG13 5  
ATOM 8083  H HG21 . ILE A 1 48  ? 7.602   -4.267  -1.935  1.00 0.00 ? 48  ILE A HG21 5  
ATOM 8084  H HG22 . ILE A 1 48  ? 6.654   -3.058  -2.800  1.00 0.00 ? 48  ILE A HG22 5  
ATOM 8085  H HG23 . ILE A 1 48  ? 6.085   -3.682  -1.252  1.00 0.00 ? 48  ILE A HG23 5  
ATOM 8086  H HD11 . ILE A 1 48  ? 7.302   -6.073  -0.909  1.00 0.00 ? 48  ILE A HD11 5  
ATOM 8087  H HD12 . ILE A 1 48  ? 6.139   -7.374  -1.168  1.00 0.00 ? 48  ILE A HD12 5  
ATOM 8088  H HD13 . ILE A 1 48  ? 7.822   -7.585  -1.652  1.00 0.00 ? 48  ILE A HD13 5  
ATOM 8089  N N    . TYR A 1 49  ? 3.505   -3.494  -0.934  1.00 0.00 ? 49  TYR A N    5  
ATOM 8090  C CA   . TYR A 1 49  ? 2.760   -2.256  -0.741  1.00 0.00 ? 49  TYR A CA   5  
ATOM 8091  C C    . TYR A 1 49  ? 3.534   -1.287  0.147   1.00 0.00 ? 49  TYR A C    5  
ATOM 8092  O O    . TYR A 1 49  ? 4.242   -1.699  1.066   1.00 0.00 ? 49  TYR A O    5  
ATOM 8093  C CB   . TYR A 1 49  ? 1.392   -2.551  -0.123  1.00 0.00 ? 49  TYR A CB   5  
ATOM 8094  C CG   . TYR A 1 49  ? 0.514   -3.429  -0.986  1.00 0.00 ? 49  TYR A CG   5  
ATOM 8095  C CD1  . TYR A 1 49  ? 0.676   -4.809  -0.997  1.00 0.00 ? 49  TYR A CD1  5  
ATOM 8096  C CD2  . TYR A 1 49  ? -0.476  -2.879  -1.790  1.00 0.00 ? 49  TYR A CD2  5  
ATOM 8097  C CE1  . TYR A 1 49  ? -0.123  -5.615  -1.784  1.00 0.00 ? 49  TYR A CE1  5  
ATOM 8098  C CE2  . TYR A 1 49  ? -1.281  -3.678  -2.579  1.00 0.00 ? 49  TYR A CE2  5  
ATOM 8099  C CZ   . TYR A 1 49  ? -1.100  -5.045  -2.573  1.00 0.00 ? 49  TYR A CZ   5  
ATOM 8100  O OH   . TYR A 1 49  ? -1.899  -5.844  -3.359  1.00 0.00 ? 49  TYR A OH   5  
ATOM 8101  H H    . TYR A 1 49  ? 3.868   -3.960  -0.153  1.00 0.00 ? 49  TYR A H    5  
ATOM 8102  H HA   . TYR A 1 49  ? 2.616   -1.801  -1.710  1.00 0.00 ? 49  TYR A HA   5  
ATOM 8103  H HB2  . TYR A 1 49  ? 1.532   -3.050  0.823   1.00 0.00 ? 49  TYR A HB2  5  
ATOM 8104  H HB3  . TYR A 1 49  ? 0.871   -1.619  0.041   1.00 0.00 ? 49  TYR A HB3  5  
ATOM 8105  H HD1  . TYR A 1 49  ? 1.442   -5.253  -0.378  1.00 0.00 ? 49  TYR A HD1  5  
ATOM 8106  H HD2  . TYR A 1 49  ? -0.614  -1.807  -1.793  1.00 0.00 ? 49  TYR A HD2  5  
ATOM 8107  H HE1  . TYR A 1 49  ? 0.017   -6.686  -1.779  1.00 0.00 ? 49  TYR A HE1  5  
ATOM 8108  H HE2  . TYR A 1 49  ? -2.045  -3.231  -3.198  1.00 0.00 ? 49  TYR A HE2  5  
ATOM 8109  H HH   . TYR A 1 49  ? -1.944  -5.478  -4.245  1.00 0.00 ? 49  TYR A HH   5  
ATOM 8110  N N    . VAL A 1 50  ? 3.393   0.004   -0.133  1.00 0.00 ? 50  VAL A N    5  
ATOM 8111  C CA   . VAL A 1 50  ? 4.077   1.034   0.640   1.00 0.00 ? 50  VAL A CA   5  
ATOM 8112  C C    . VAL A 1 50  ? 3.554   1.084   2.071   1.00 0.00 ? 50  VAL A C    5  
ATOM 8113  O O    . VAL A 1 50  ? 2.464   1.595   2.329   1.00 0.00 ? 50  VAL A O    5  
ATOM 8114  C CB   . VAL A 1 50  ? 3.911   2.423   -0.004  1.00 0.00 ? 50  VAL A CB   5  
ATOM 8115  C CG1  . VAL A 1 50  ? 4.429   3.509   0.927   1.00 0.00 ? 50  VAL A CG1  5  
ATOM 8116  C CG2  . VAL A 1 50  ? 4.624   2.476   -1.347  1.00 0.00 ? 50  VAL A CG2  5  
ATOM 8117  H H    . VAL A 1 50  ? 2.815   0.271   -0.878  1.00 0.00 ? 50  VAL A H    5  
ATOM 8118  H HA   . VAL A 1 50  ? 5.130   0.793   0.660   1.00 0.00 ? 50  VAL A HA   5  
ATOM 8119  H HB   . VAL A 1 50  ? 2.858   2.596   -0.172  1.00 0.00 ? 50  VAL A HB   5  
ATOM 8120  H HG11 . VAL A 1 50  ? 4.752   4.359   0.343   1.00 0.00 ? 50  VAL A HG11 5  
ATOM 8121  H HG12 . VAL A 1 50  ? 3.642   3.811   1.601   1.00 0.00 ? 50  VAL A HG12 5  
ATOM 8122  H HG13 . VAL A 1 50  ? 5.264   3.127   1.496   1.00 0.00 ? 50  VAL A HG13 5  
ATOM 8123  H HG21 . VAL A 1 50  ? 5.592   2.006   -1.259  1.00 0.00 ? 50  VAL A HG21 5  
ATOM 8124  H HG22 . VAL A 1 50  ? 4.036   1.952   -2.088  1.00 0.00 ? 50  VAL A HG22 5  
ATOM 8125  H HG23 . VAL A 1 50  ? 4.748   3.505   -1.649  1.00 0.00 ? 50  VAL A HG23 5  
ATOM 8126  N N    . LYS A 1 51  ? 4.339   0.550   3.001   1.00 0.00 ? 51  LYS A N    5  
ATOM 8127  C CA   . LYS A 1 51  ? 3.958   0.535   4.408   1.00 0.00 ? 51  LYS A CA   5  
ATOM 8128  C C    . LYS A 1 51  ? 3.943   1.947   4.983   1.00 0.00 ? 51  LYS A C    5  
ATOM 8129  O O    . LYS A 1 51  ? 3.077   2.290   5.789   1.00 0.00 ? 51  LYS A O    5  
ATOM 8130  C CB   . LYS A 1 51  ? 4.922   -0.343  5.209   1.00 0.00 ? 51  LYS A CB   5  
ATOM 8131  C CG   . LYS A 1 51  ? 4.570   -0.445  6.683   1.00 0.00 ? 51  LYS A CG   5  
ATOM 8132  C CD   . LYS A 1 51  ? 3.366   -1.344  6.908   1.00 0.00 ? 51  LYS A CD   5  
ATOM 8133  C CE   . LYS A 1 51  ? 3.205   -1.703  8.377   1.00 0.00 ? 51  LYS A CE   5  
ATOM 8134  N NZ   . LYS A 1 51  ? 2.470   -0.649  9.129   1.00 0.00 ? 51  LYS A NZ   5  
ATOM 8135  H H    . LYS A 1 51  ? 5.197   0.158   2.734   1.00 0.00 ? 51  LYS A H    5  
ATOM 8136  H HA   . LYS A 1 51  ? 2.964   0.119   4.478   1.00 0.00 ? 51  LYS A HA   5  
ATOM 8137  H HB2  . LYS A 1 51  ? 4.917   -1.338  4.790   1.00 0.00 ? 51  LYS A HB2  5  
ATOM 8138  H HB3  . LYS A 1 51  ? 5.918   0.068   5.126   1.00 0.00 ? 51  LYS A HB3  5  
ATOM 8139  H HG2  . LYS A 1 51  ? 5.415   -0.853  7.219   1.00 0.00 ? 51  LYS A HG2  5  
ATOM 8140  H HG3  . LYS A 1 51  ? 4.346   0.543   7.060   1.00 0.00 ? 51  LYS A HG3  5  
ATOM 8141  H HD2  . LYS A 1 51  ? 2.476   -0.830  6.575   1.00 0.00 ? 51  LYS A HD2  5  
ATOM 8142  H HD3  . LYS A 1 51  ? 3.494   -2.252  6.336   1.00 0.00 ? 51  LYS A HD3  5  
ATOM 8143  H HE2  . LYS A 1 51  ? 2.659   -2.632  8.450   1.00 0.00 ? 51  LYS A HE2  5  
ATOM 8144  H HE3  . LYS A 1 51  ? 4.185   -1.828  8.813   1.00 0.00 ? 51  LYS A HE3  5  
ATOM 8145  H HZ1  . LYS A 1 51  ? 1.891   -1.081  9.877   1.00 0.00 ? 51  LYS A HZ1  5  
ATOM 8146  H HZ2  . LYS A 1 51  ? 1.846   -0.121  8.486   1.00 0.00 ? 51  LYS A HZ2  5  
ATOM 8147  H HZ3  . LYS A 1 51  ? 3.142   0.014   9.565   1.00 0.00 ? 51  LYS A HZ3  5  
ATOM 8148  N N    . SER A 1 52  ? 4.904   2.763   4.564   1.00 0.00 ? 52  SER A N    5  
ATOM 8149  C CA   . SER A 1 52  ? 5.002   4.138   5.039   1.00 0.00 ? 52  SER A CA   5  
ATOM 8150  C C    . SER A 1 52  ? 5.944   4.952   4.157   1.00 0.00 ? 52  SER A C    5  
ATOM 8151  O O    . SER A 1 52  ? 6.563   4.422   3.234   1.00 0.00 ? 52  SER A O    5  
ATOM 8152  C CB   . SER A 1 52  ? 5.492   4.165   6.488   1.00 0.00 ? 52  SER A CB   5  
ATOM 8153  O OG   . SER A 1 52  ? 4.411   4.037   7.395   1.00 0.00 ? 52  SER A OG   5  
ATOM 8154  H H    . SER A 1 52  ? 5.565   2.431   3.920   1.00 0.00 ? 52  SER A H    5  
ATOM 8155  H HA   . SER A 1 52  ? 4.016   4.575   4.993   1.00 0.00 ? 52  SER A HA   5  
ATOM 8156  H HB2  . SER A 1 52  ? 6.179   3.348   6.649   1.00 0.00 ? 52  SER A HB2  5  
ATOM 8157  H HB3  . SER A 1 52  ? 5.996   5.102   6.677   1.00 0.00 ? 52  SER A HB3  5  
ATOM 8158  H HG   . SER A 1 52  ? 3.649   3.676   6.935   1.00 0.00 ? 52  SER A HG   5  
ATOM 8159  N N    . VAL A 1 53  ? 6.046   6.245   4.447   1.00 0.00 ? 53  VAL A N    5  
ATOM 8160  C CA   . VAL A 1 53  ? 6.912   7.134   3.681   1.00 0.00 ? 53  VAL A CA   5  
ATOM 8161  C C    . VAL A 1 53  ? 7.566   8.175   4.583   1.00 0.00 ? 53  VAL A C    5  
ATOM 8162  O O    . VAL A 1 53  ? 6.889   9.033   5.150   1.00 0.00 ? 53  VAL A O    5  
ATOM 8163  C CB   . VAL A 1 53  ? 6.131   7.855   2.566   1.00 0.00 ? 53  VAL A CB   5  
ATOM 8164  C CG1  . VAL A 1 53  ? 7.035   8.830   1.826   1.00 0.00 ? 53  VAL A CG1  5  
ATOM 8165  C CG2  . VAL A 1 53  ? 5.521   6.846   1.606   1.00 0.00 ? 53  VAL A CG2  5  
ATOM 8166  H H    . VAL A 1 53  ? 5.527   6.610   5.194   1.00 0.00 ? 53  VAL A H    5  
ATOM 8167  H HA   . VAL A 1 53  ? 7.684   6.534   3.222   1.00 0.00 ? 53  VAL A HA   5  
ATOM 8168  H HB   . VAL A 1 53  ? 5.330   8.418   3.022   1.00 0.00 ? 53  VAL A HB   5  
ATOM 8169  H HG11 . VAL A 1 53  ? 6.504   9.755   1.657   1.00 0.00 ? 53  VAL A HG11 5  
ATOM 8170  H HG12 . VAL A 1 53  ? 7.918   9.022   2.417   1.00 0.00 ? 53  VAL A HG12 5  
ATOM 8171  H HG13 . VAL A 1 53  ? 7.323   8.402   0.877   1.00 0.00 ? 53  VAL A HG13 5  
ATOM 8172  H HG21 . VAL A 1 53  ? 4.485   6.684   1.865   1.00 0.00 ? 53  VAL A HG21 5  
ATOM 8173  H HG22 . VAL A 1 53  ? 5.584   7.226   0.596   1.00 0.00 ? 53  VAL A HG22 5  
ATOM 8174  H HG23 . VAL A 1 53  ? 6.060   5.913   1.673   1.00 0.00 ? 53  VAL A HG23 5  
ATOM 8175  N N    . ILE A 1 54  ? 8.886   8.093   4.712   1.00 0.00 ? 54  ILE A N    5  
ATOM 8176  C CA   . ILE A 1 54  ? 9.632   9.029   5.544   1.00 0.00 ? 54  ILE A CA   5  
ATOM 8177  C C    . ILE A 1 54  ? 9.408   10.467  5.089   1.00 0.00 ? 54  ILE A C    5  
ATOM 8178  O O    . ILE A 1 54  ? 9.490   10.790  3.904   1.00 0.00 ? 54  ILE A O    5  
ATOM 8179  C CB   . ILE A 1 54  ? 11.141  8.724   5.520   1.00 0.00 ? 54  ILE A CB   5  
ATOM 8180  C CG1  . ILE A 1 54  ? 11.409  7.322   6.071   1.00 0.00 ? 54  ILE A CG1  5  
ATOM 8181  C CG2  . ILE A 1 54  ? 11.905  9.768   6.321   1.00 0.00 ? 54  ILE A CG2  5  
ATOM 8182  C CD1  . ILE A 1 54  ? 11.182  6.221   5.058   1.00 0.00 ? 54  ILE A CD1  5  
ATOM 8183  H H    . ILE A 1 54  ? 9.369   7.387   4.235   1.00 0.00 ? 54  ILE A H    5  
ATOM 8184  H HA   . ILE A 1 54  ? 9.279   8.925   6.560   1.00 0.00 ? 54  ILE A HA   5  
ATOM 8185  H HB   . ILE A 1 54  ? 11.479  8.772   4.496   1.00 0.00 ? 54  ILE A HB   5  
ATOM 8186  H HG12 . ILE A 1 54  ? 12.434  7.261   6.401   1.00 0.00 ? 54  ILE A HG12 5  
ATOM 8187  H HG13 . ILE A 1 54  ? 10.753  7.141   6.910   1.00 0.00 ? 54  ILE A HG13 5  
ATOM 8188  H HG21 . ILE A 1 54  ? 11.810  9.553   7.375   1.00 0.00 ? 54  ILE A HG21 5  
ATOM 8189  H HG22 . ILE A 1 54  ? 12.948  9.743   6.042   1.00 0.00 ? 54  ILE A HG22 5  
ATOM 8190  H HG23 . ILE A 1 54  ? 11.500  10.747  6.115   1.00 0.00 ? 54  ILE A HG23 5  
ATOM 8191  H HD11 . ILE A 1 54  ? 12.008  5.526   5.090   1.00 0.00 ? 54  ILE A HD11 5  
ATOM 8192  H HD12 . ILE A 1 54  ? 10.264  5.703   5.288   1.00 0.00 ? 54  ILE A HD12 5  
ATOM 8193  H HD13 . ILE A 1 54  ? 11.114  6.651   4.069   1.00 0.00 ? 54  ILE A HD13 5  
ATOM 8194  N N    . PRO A 1 55  ? 9.120   11.354  6.054   1.00 0.00 ? 55  PRO A N    5  
ATOM 8195  C CA   . PRO A 1 55  ? 8.881   12.774  5.777   1.00 0.00 ? 55  PRO A CA   5  
ATOM 8196  C C    . PRO A 1 55  ? 10.150  13.503  5.349   1.00 0.00 ? 55  PRO A C    5  
ATOM 8197  O O    . PRO A 1 55  ? 11.260  13.060  5.641   1.00 0.00 ? 55  PRO A O    5  
ATOM 8198  C CB   . PRO A 1 55  ? 8.379   13.317  7.118   1.00 0.00 ? 55  PRO A CB   5  
ATOM 8199  C CG   . PRO A 1 55  ? 8.952   12.394  8.138   1.00 0.00 ? 55  PRO A CG   5  
ATOM 8200  C CD   . PRO A 1 55  ? 9.007   11.040  7.488   1.00 0.00 ? 55  PRO A CD   5  
ATOM 8201  H HA   . PRO A 1 55  ? 8.119   12.909  5.024   1.00 0.00 ? 55  PRO A HA   5  
ATOM 8202  H HB2  . PRO A 1 55  ? 8.734   14.328  7.255   1.00 0.00 ? 55  PRO A HB2  5  
ATOM 8203  H HB3  . PRO A 1 55  ? 7.300   13.302  7.134   1.00 0.00 ? 55  PRO A HB3  5  
ATOM 8204  H HG2  . PRO A 1 55  ? 9.944   12.720  8.411   1.00 0.00 ? 55  PRO A HG2  5  
ATOM 8205  H HG3  . PRO A 1 55  ? 8.312   12.367  9.007   1.00 0.00 ? 55  PRO A HG3  5  
ATOM 8206  H HD2  . PRO A 1 55  ? 9.871   10.491  7.832   1.00 0.00 ? 55  PRO A HD2  5  
ATOM 8207  H HD3  . PRO A 1 55  ? 8.101   10.487  7.690   1.00 0.00 ? 55  PRO A HD3  5  
ATOM 8208  N N    . GLY A 1 56  ? 9.978   14.624  4.656   1.00 0.00 ? 56  GLY A N    5  
ATOM 8209  C CA   . GLY A 1 56  ? 11.119  15.397  4.199   1.00 0.00 ? 56  GLY A CA   5  
ATOM 8210  C C    . GLY A 1 56  ? 12.043  14.593  3.306   1.00 0.00 ? 56  GLY A C    5  
ATOM 8211  O O    . GLY A 1 56  ? 13.255  14.809  3.300   1.00 0.00 ? 56  GLY A O    5  
ATOM 8212  H H    . GLY A 1 56  ? 9.069   14.929  4.452   1.00 0.00 ? 56  GLY A H    5  
ATOM 8213  H HA2  . GLY A 1 56  ? 10.762  16.256  3.651   1.00 0.00 ? 56  GLY A HA2  5  
ATOM 8214  H HA3  . GLY A 1 56  ? 11.676  15.737  5.060   1.00 0.00 ? 56  GLY A HA3  5  
ATOM 8215  N N    . SER A 1 57  ? 11.470  13.663  2.549   1.00 0.00 ? 57  SER A N    5  
ATOM 8216  C CA   . SER A 1 57  ? 12.252  12.820  1.651   1.00 0.00 ? 57  SER A CA   5  
ATOM 8217  C C    . SER A 1 57  ? 11.818  13.021  0.202   1.00 0.00 ? 57  SER A C    5  
ATOM 8218  O O    . SER A 1 57  ? 10.965  13.858  -0.091  1.00 0.00 ? 57  SER A O    5  
ATOM 8219  C CB   . SER A 1 57  ? 12.103  11.348  2.040   1.00 0.00 ? 57  SER A CB   5  
ATOM 8220  O OG   . SER A 1 57  ? 10.860  10.828  1.601   1.00 0.00 ? 57  SER A OG   5  
ATOM 8221  H H    . SER A 1 57  ? 10.499  13.538  2.598   1.00 0.00 ? 57  SER A H    5  
ATOM 8222  H HA   . SER A 1 57  ? 13.289  13.106  1.747   1.00 0.00 ? 57  SER A HA   5  
ATOM 8223  H HB2  . SER A 1 57  ? 12.898  10.776  1.588   1.00 0.00 ? 57  SER A HB2  5  
ATOM 8224  H HB3  . SER A 1 57  ? 12.159  11.255  3.115   1.00 0.00 ? 57  SER A HB3  5  
ATOM 8225  H HG   . SER A 1 57  ? 10.164  11.114  2.198   1.00 0.00 ? 57  SER A HG   5  
ATOM 8226  N N    . ALA A 1 58  ? 12.412  12.247  -0.699  1.00 0.00 ? 58  ALA A N    5  
ATOM 8227  C CA   . ALA A 1 58  ? 12.086  12.337  -2.117  1.00 0.00 ? 58  ALA A CA   5  
ATOM 8228  C C    . ALA A 1 58  ? 10.665  11.855  -2.386  1.00 0.00 ? 58  ALA A C    5  
ATOM 8229  O O    . ALA A 1 58  ? 9.869   12.557  -3.009  1.00 0.00 ? 58  ALA A O    5  
ATOM 8230  C CB   . ALA A 1 58  ? 13.083  11.534  -2.940  1.00 0.00 ? 58  ALA A CB   5  
ATOM 8231  H H    . ALA A 1 58  ? 13.084  11.598  -0.404  1.00 0.00 ? 58  ALA A H    5  
ATOM 8232  H HA   . ALA A 1 58  ? 12.166  13.374  -2.412  1.00 0.00 ? 58  ALA A HA   5  
ATOM 8233  H HB1  . ALA A 1 58  ? 12.805  10.491  -2.922  1.00 0.00 ? 58  ALA A HB1  5  
ATOM 8234  H HB2  . ALA A 1 58  ? 13.079  11.891  -3.959  1.00 0.00 ? 58  ALA A HB2  5  
ATOM 8235  H HB3  . ALA A 1 58  ? 14.071  11.651  -2.522  1.00 0.00 ? 58  ALA A HB3  5  
ATOM 8236  N N    . ALA A 1 59  ? 10.354  10.652  -1.914  1.00 0.00 ? 59  ALA A N    5  
ATOM 8237  C CA   . ALA A 1 59  ? 9.028   10.077  -2.102  1.00 0.00 ? 59  ALA A CA   5  
ATOM 8238  C C    . ALA A 1 59  ? 7.948   10.984  -1.523  1.00 0.00 ? 59  ALA A C    5  
ATOM 8239  O O    . ALA A 1 59  ? 6.932   11.246  -2.167  1.00 0.00 ? 59  ALA A O    5  
ATOM 8240  C CB   . ALA A 1 59  ? 8.957   8.696   -1.467  1.00 0.00 ? 59  ALA A CB   5  
ATOM 8241  H H    . ALA A 1 59  ? 11.032  10.141  -1.425  1.00 0.00 ? 59  ALA A H    5  
ATOM 8242  H HA   . ALA A 1 59  ? 8.860   9.967   -3.164  1.00 0.00 ? 59  ALA A HA   5  
ATOM 8243  H HB1  . ALA A 1 59  ? 8.831   8.798   -0.399  1.00 0.00 ? 59  ALA A HB1  5  
ATOM 8244  H HB2  . ALA A 1 59  ? 8.119   8.154   -1.879  1.00 0.00 ? 59  ALA A HB2  5  
ATOM 8245  H HB3  . ALA A 1 59  ? 9.870   8.158   -1.673  1.00 0.00 ? 59  ALA A HB3  5  
ATOM 8246  N N    . TYR A 1 60  ? 8.175   11.461  -0.303  1.00 0.00 ? 60  TYR A N    5  
ATOM 8247  C CA   . TYR A 1 60  ? 7.219   12.337  0.364   1.00 0.00 ? 60  TYR A CA   5  
ATOM 8248  C C    . TYR A 1 60  ? 7.054   13.647  -0.400  1.00 0.00 ? 60  TYR A C    5  
ATOM 8249  O O    . TYR A 1 60  ? 5.945   14.022  -0.782  1.00 0.00 ? 60  TYR A O    5  
ATOM 8250  C CB   . TYR A 1 60  ? 7.672   12.623  1.797   1.00 0.00 ? 60  TYR A CB   5  
ATOM 8251  C CG   . TYR A 1 60  ? 6.699   13.473  2.581   1.00 0.00 ? 60  TYR A CG   5  
ATOM 8252  C CD1  . TYR A 1 60  ? 5.587   12.907  3.193   1.00 0.00 ? 60  TYR A CD1  5  
ATOM 8253  C CD2  . TYR A 1 60  ? 6.892   14.843  2.712   1.00 0.00 ? 60  TYR A CD2  5  
ATOM 8254  C CE1  . TYR A 1 60  ? 4.695   13.681  3.910   1.00 0.00 ? 60  TYR A CE1  5  
ATOM 8255  C CE2  . TYR A 1 60  ? 6.005   15.624  3.428   1.00 0.00 ? 60  TYR A CE2  5  
ATOM 8256  C CZ   . TYR A 1 60  ? 4.909   15.038  4.025   1.00 0.00 ? 60  TYR A CZ   5  
ATOM 8257  O OH   . TYR A 1 60  ? 4.023   15.812  4.740   1.00 0.00 ? 60  TYR A OH   5  
ATOM 8258  H H    . TYR A 1 60  ? 9.003   11.217  0.159   1.00 0.00 ? 60  TYR A H    5  
ATOM 8259  H HA   . TYR A 1 60  ? 6.267   11.828  0.393   1.00 0.00 ? 60  TYR A HA   5  
ATOM 8260  H HB2  . TYR A 1 60  ? 7.793   11.688  2.322   1.00 0.00 ? 60  TYR A HB2  5  
ATOM 8261  H HB3  . TYR A 1 60  ? 8.620   13.141  1.771   1.00 0.00 ? 60  TYR A HB3  5  
ATOM 8262  H HD1  . TYR A 1 60  ? 5.424   11.843  3.102   1.00 0.00 ? 60  TYR A HD1  5  
ATOM 8263  H HD2  . TYR A 1 60  ? 7.752   15.299  2.243   1.00 0.00 ? 60  TYR A HD2  5  
ATOM 8264  H HE1  . TYR A 1 60  ? 3.837   13.222  4.378   1.00 0.00 ? 60  TYR A HE1  5  
ATOM 8265  H HE2  . TYR A 1 60  ? 6.172   16.688  3.518   1.00 0.00 ? 60  TYR A HE2  5  
ATOM 8266  H HH   . TYR A 1 60  ? 3.689   16.516  4.179   1.00 0.00 ? 60  TYR A HH   5  
ATOM 8267  N N    . HIS A 1 61  ? 8.167   14.340  -0.621  1.00 0.00 ? 61  HIS A N    5  
ATOM 8268  C CA   . HIS A 1 61  ? 8.148   15.608  -1.341  1.00 0.00 ? 61  HIS A CA   5  
ATOM 8269  C C    . HIS A 1 61  ? 7.383   15.475  -2.655  1.00 0.00 ? 61  HIS A C    5  
ATOM 8270  O O    . HIS A 1 61  ? 6.429   16.210  -2.905  1.00 0.00 ? 61  HIS A O    5  
ATOM 8271  C CB   . HIS A 1 61  ? 9.575   16.085  -1.614  1.00 0.00 ? 61  HIS A CB   5  
ATOM 8272  C CG   . HIS A 1 61  ? 10.207  16.780  -0.448  1.00 0.00 ? 61  HIS A CG   5  
ATOM 8273  N ND1  . HIS A 1 61  ? 9.545   17.714  0.320   1.00 0.00 ? 61  HIS A ND1  5  
ATOM 8274  C CD2  . HIS A 1 61  ? 11.449  16.672  0.080   1.00 0.00 ? 61  HIS A CD2  5  
ATOM 8275  C CE1  . HIS A 1 61  ? 10.353  18.152  1.270   1.00 0.00 ? 61  HIS A CE1  5  
ATOM 8276  N NE2  . HIS A 1 61  ? 11.514  17.535  1.147   1.00 0.00 ? 61  HIS A NE2  5  
ATOM 8277  H H    . HIS A 1 61  ? 9.021   13.989  -0.292  1.00 0.00 ? 61  HIS A H    5  
ATOM 8278  H HA   . HIS A 1 61  ? 7.648   16.335  -0.720  1.00 0.00 ? 61  HIS A HA   5  
ATOM 8279  H HB2  . HIS A 1 61  ? 10.190  15.234  -1.865  1.00 0.00 ? 61  HIS A HB2  5  
ATOM 8280  H HB3  . HIS A 1 61  ? 9.564   16.774  -2.447  1.00 0.00 ? 61  HIS A HB3  5  
ATOM 8281  H HD1  . HIS A 1 61  ? 8.622   18.013  0.188   1.00 0.00 ? 61  HIS A HD1  5  
ATOM 8282  H HD2  . HIS A 1 61  ? 12.242  16.028  -0.271  1.00 0.00 ? 61  HIS A HD2  5  
ATOM 8283  H HE1  . HIS A 1 61  ? 10.106  18.888  2.020   1.00 0.00 ? 61  HIS A HE1  5  
ATOM 8284  H HE2  . HIS A 1 61  ? 12.318  17.736  1.670   1.00 0.00 ? 61  HIS A HE2  5  
ATOM 8285  N N    . ASN A 1 62  ? 7.810   14.534  -3.490  1.00 0.00 ? 62  ASN A N    5  
ATOM 8286  C CA   . ASN A 1 62  ? 7.166   14.306  -4.779  1.00 0.00 ? 62  ASN A CA   5  
ATOM 8287  C C    . ASN A 1 62  ? 5.650   14.233  -4.624  1.00 0.00 ? 62  ASN A C    5  
ATOM 8288  O O    . ASN A 1 62  ? 4.908   14.856  -5.382  1.00 0.00 ? 62  ASN A O    5  
ATOM 8289  C CB   . ASN A 1 62  ? 7.688   13.015  -5.412  1.00 0.00 ? 62  ASN A CB   5  
ATOM 8290  C CG   . ASN A 1 62  ? 7.676   13.068  -6.928  1.00 0.00 ? 62  ASN A CG   5  
ATOM 8291  O OD1  . ASN A 1 62  ? 8.071   14.068  -7.528  1.00 0.00 ? 62  ASN A OD1  5  
ATOM 8292  N ND2  . ASN A 1 62  ? 7.221   11.990  -7.554  1.00 0.00 ? 62  ASN A ND2  5  
ATOM 8293  H H    . ASN A 1 62  ? 8.577   13.979  -3.234  1.00 0.00 ? 62  ASN A H    5  
ATOM 8294  H HA   . ASN A 1 62  ? 7.411   15.137  -5.423  1.00 0.00 ? 62  ASN A HA   5  
ATOM 8295  H HB2  . ASN A 1 62  ? 8.704   12.846  -5.085  1.00 0.00 ? 62  ASN A HB2  5  
ATOM 8296  H HB3  . ASN A 1 62  ? 7.070   12.189  -5.094  1.00 0.00 ? 62  ASN A HB3  5  
ATOM 8297  H HD21 . ASN A 1 62  ? 6.923   11.230  -7.011  1.00 0.00 ? 62  ASN A HD21 5  
ATOM 8298  H HD22 . ASN A 1 62  ? 7.203   11.997  -8.534  1.00 0.00 ? 62  ASN A HD22 5  
ATOM 8299  N N    . GLY A 1 63  ? 5.198   13.468  -3.635  1.00 0.00 ? 63  GLY A N    5  
ATOM 8300  C CA   . GLY A 1 63  ? 3.773   13.328  -3.398  1.00 0.00 ? 63  GLY A CA   5  
ATOM 8301  C C    . GLY A 1 63  ? 3.102   12.426  -4.414  1.00 0.00 ? 63  GLY A C    5  
ATOM 8302  O O    . GLY A 1 63  ? 1.951   12.650  -4.791  1.00 0.00 ? 63  GLY A O    5  
ATOM 8303  H H    . GLY A 1 63  ? 5.837   12.995  -3.061  1.00 0.00 ? 63  GLY A H    5  
ATOM 8304  H HA2  . GLY A 1 63  ? 3.622   12.916  -2.411  1.00 0.00 ? 63  GLY A HA2  5  
ATOM 8305  H HA3  . GLY A 1 63  ? 3.314   14.305  -3.443  1.00 0.00 ? 63  GLY A HA3  5  
ATOM 8306  N N    . HIS A 1 64  ? 3.823   11.402  -4.861  1.00 0.00 ? 64  HIS A N    5  
ATOM 8307  C CA   . HIS A 1 64  ? 3.290   10.462  -5.841  1.00 0.00 ? 64  HIS A CA   5  
ATOM 8308  C C    . HIS A 1 64  ? 3.348   9.033   -5.311  1.00 0.00 ? 64  HIS A C    5  
ATOM 8309  O O    . HIS A 1 64  ? 2.496   8.205   -5.636  1.00 0.00 ? 64  HIS A O    5  
ATOM 8310  C CB   . HIS A 1 64  ? 4.070   10.565  -7.153  1.00 0.00 ? 64  HIS A CB   5  
ATOM 8311  C CG   . HIS A 1 64  ? 3.734   11.784  -7.955  1.00 0.00 ? 64  HIS A CG   5  
ATOM 8312  N ND1  . HIS A 1 64  ? 2.755   11.799  -8.927  1.00 0.00 ? 64  HIS A ND1  5  
ATOM 8313  C CD2  . HIS A 1 64  ? 4.252   13.034  -7.925  1.00 0.00 ? 64  HIS A CD2  5  
ATOM 8314  C CE1  . HIS A 1 64  ? 2.687   13.006  -9.461  1.00 0.00 ? 64  HIS A CE1  5  
ATOM 8315  N NE2  . HIS A 1 64  ? 3.585   13.774  -8.870  1.00 0.00 ? 64  HIS A NE2  5  
ATOM 8316  H H    . HIS A 1 64  ? 4.734   11.275  -4.523  1.00 0.00 ? 64  HIS A H    5  
ATOM 8317  H HA   . HIS A 1 64  ? 2.259   10.723  -6.024  1.00 0.00 ? 64  HIS A HA   5  
ATOM 8318  H HB2  . HIS A 1 64  ? 5.127   10.593  -6.934  1.00 0.00 ? 64  HIS A HB2  5  
ATOM 8319  H HB3  . HIS A 1 64  ? 3.855   9.697   -7.760  1.00 0.00 ? 64  HIS A HB3  5  
ATOM 8320  H HD1  . HIS A 1 64  ? 2.195   11.039  -9.187  1.00 0.00 ? 64  HIS A HD1  5  
ATOM 8321  H HD2  . HIS A 1 64  ? 5.044   13.385  -7.279  1.00 0.00 ? 64  HIS A HD2  5  
ATOM 8322  H HE1  . HIS A 1 64  ? 2.013   13.313  -10.246 1.00 0.00 ? 64  HIS A HE1  5  
ATOM 8323  H HE2  . HIS A 1 64  ? 3.804   14.691  -9.135  1.00 0.00 ? 64  HIS A HE2  5  
ATOM 8324  N N    . ILE A 1 65  ? 4.358   8.750   -4.495  1.00 0.00 ? 65  ILE A N    5  
ATOM 8325  C CA   . ILE A 1 65  ? 4.526   7.421   -3.921  1.00 0.00 ? 65  ILE A CA   5  
ATOM 8326  C C    . ILE A 1 65  ? 4.289   7.439   -2.415  1.00 0.00 ? 65  ILE A C    5  
ATOM 8327  O O    . ILE A 1 65  ? 5.154   7.858   -1.646  1.00 0.00 ? 65  ILE A O    5  
ATOM 8328  C CB   . ILE A 1 65  ? 5.933   6.861   -4.201  1.00 0.00 ? 65  ILE A CB   5  
ATOM 8329  C CG1  . ILE A 1 65  ? 6.190   6.796   -5.708  1.00 0.00 ? 65  ILE A CG1  5  
ATOM 8330  C CG2  . ILE A 1 65  ? 6.090   5.484   -3.572  1.00 0.00 ? 65  ILE A CG2  5  
ATOM 8331  C CD1  . ILE A 1 65  ? 7.651   6.921   -6.078  1.00 0.00 ? 65  ILE A CD1  5  
ATOM 8332  H H    . ILE A 1 65  ? 5.005   9.452   -4.274  1.00 0.00 ? 65  ILE A H    5  
ATOM 8333  H HA   . ILE A 1 65  ? 3.801   6.765   -4.381  1.00 0.00 ? 65  ILE A HA   5  
ATOM 8334  H HB   . ILE A 1 65  ? 6.657   7.522   -3.748  1.00 0.00 ? 65  ILE A HB   5  
ATOM 8335  H HG12 . ILE A 1 65  ? 5.832   5.852   -6.088  1.00 0.00 ? 65  ILE A HG12 5  
ATOM 8336  H HG13 . ILE A 1 65  ? 5.654   7.601   -6.191  1.00 0.00 ? 65  ILE A HG13 5  
ATOM 8337  H HG21 . ILE A 1 65  ? 5.212   5.253   -2.988  1.00 0.00 ? 65  ILE A HG21 5  
ATOM 8338  H HG22 . ILE A 1 65  ? 6.209   4.745   -4.350  1.00 0.00 ? 65  ILE A HG22 5  
ATOM 8339  H HG23 . ILE A 1 65  ? 6.960   5.478   -2.932  1.00 0.00 ? 65  ILE A HG23 5  
ATOM 8340  H HD11 . ILE A 1 65  ? 7.781   6.674   -7.122  1.00 0.00 ? 65  ILE A HD11 5  
ATOM 8341  H HD12 . ILE A 1 65  ? 7.982   7.933   -5.903  1.00 0.00 ? 65  ILE A HD12 5  
ATOM 8342  H HD13 . ILE A 1 65  ? 8.235   6.242   -5.473  1.00 0.00 ? 65  ILE A HD13 5  
ATOM 8343  N N    . GLN A 1 66  ? 3.112   6.981   -2.001  1.00 0.00 ? 66  GLN A N    5  
ATOM 8344  C CA   . GLN A 1 66  ? 2.762   6.943   -0.586  1.00 0.00 ? 66  GLN A CA   5  
ATOM 8345  C C    . GLN A 1 66  ? 1.995   5.669   -0.249  1.00 0.00 ? 66  GLN A C    5  
ATOM 8346  O O    . GLN A 1 66  ? 1.680   4.870   -1.131  1.00 0.00 ? 66  GLN A O    5  
ATOM 8347  C CB   . GLN A 1 66  ? 1.926   8.169   -0.214  1.00 0.00 ? 66  GLN A CB   5  
ATOM 8348  C CG   . GLN A 1 66  ? 0.900   8.550   -1.269  1.00 0.00 ? 66  GLN A CG   5  
ATOM 8349  C CD   . GLN A 1 66  ? 1.465   9.482   -2.323  1.00 0.00 ? 66  GLN A CD   5  
ATOM 8350  O OE1  . GLN A 1 66  ? 2.321   10.319  -2.033  1.00 0.00 ? 66  GLN A OE1  5  
ATOM 8351  N NE2  . GLN A 1 66  ? 0.988   9.342   -3.554  1.00 0.00 ? 66  GLN A NE2  5  
ATOM 8352  H H    . GLN A 1 66  ? 2.465   6.661   -2.663  1.00 0.00 ? 66  GLN A H    5  
ATOM 8353  H HA   . GLN A 1 66  ? 3.679   6.958   -0.017  1.00 0.00 ? 66  GLN A HA   5  
ATOM 8354  H HB2  . GLN A 1 66  ? 1.403   7.967   0.709   1.00 0.00 ? 66  GLN A HB2  5  
ATOM 8355  H HB3  . GLN A 1 66  ? 2.587   9.010   -0.066  1.00 0.00 ? 66  GLN A HB3  5  
ATOM 8356  H HG2  . GLN A 1 66  ? 0.552   7.650   -1.756  1.00 0.00 ? 66  GLN A HG2  5  
ATOM 8357  H HG3  . GLN A 1 66  ? 0.069   9.039   -0.784  1.00 0.00 ? 66  GLN A HG3  5  
ATOM 8358  H HE21 . GLN A 1 66  ? 0.306   8.655   -3.711  1.00 0.00 ? 66  GLN A HE21 5  
ATOM 8359  H HE22 . GLN A 1 66  ? 1.335   9.932   -4.254  1.00 0.00 ? 66  GLN A HE22 5  
ATOM 8360  N N    . VAL A 1 67  ? 1.699   5.484   1.034   1.00 0.00 ? 67  VAL A N    5  
ATOM 8361  C CA   . VAL A 1 67  ? 0.969   4.307   1.488   1.00 0.00 ? 67  VAL A CA   5  
ATOM 8362  C C    . VAL A 1 67  ? -0.183  3.977   0.546   1.00 0.00 ? 67  VAL A C    5  
ATOM 8363  O O    . VAL A 1 67  ? -0.579  4.800   -0.279  1.00 0.00 ? 67  VAL A O    5  
ATOM 8364  C CB   . VAL A 1 67  ? 0.413   4.506   2.911   1.00 0.00 ? 67  VAL A CB   5  
ATOM 8365  C CG1  . VAL A 1 67  ? 1.546   4.728   3.901   1.00 0.00 ? 67  VAL A CG1  5  
ATOM 8366  C CG2  . VAL A 1 67  ? -0.568  5.667   2.941   1.00 0.00 ? 67  VAL A CG2  5  
ATOM 8367  H H    . VAL A 1 67  ? 1.978   6.156   1.690   1.00 0.00 ? 67  VAL A H    5  
ATOM 8368  H HA   . VAL A 1 67  ? 1.657   3.474   1.506   1.00 0.00 ? 67  VAL A HA   5  
ATOM 8369  H HB   . VAL A 1 67  ? -0.115  3.608   3.198   1.00 0.00 ? 67  VAL A HB   5  
ATOM 8370  H HG11 . VAL A 1 67  ? 2.060   3.794   4.075   1.00 0.00 ? 67  VAL A HG11 5  
ATOM 8371  H HG12 . VAL A 1 67  ? 2.239   5.453   3.499   1.00 0.00 ? 67  VAL A HG12 5  
ATOM 8372  H HG13 . VAL A 1 67  ? 1.142   5.094   4.833   1.00 0.00 ? 67  VAL A HG13 5  
ATOM 8373  H HG21 . VAL A 1 67  ? -0.890  5.839   3.958   1.00 0.00 ? 67  VAL A HG21 5  
ATOM 8374  H HG22 . VAL A 1 67  ? -0.086  6.557   2.561   1.00 0.00 ? 67  VAL A HG22 5  
ATOM 8375  H HG23 . VAL A 1 67  ? -1.424  5.432   2.327   1.00 0.00 ? 67  VAL A HG23 5  
ATOM 8376  N N    . ASN A 1 68  ? -0.717  2.767   0.674   1.00 0.00 ? 68  ASN A N    5  
ATOM 8377  C CA   . ASN A 1 68  ? -1.825  2.327   -0.167  1.00 0.00 ? 68  ASN A CA   5  
ATOM 8378  C C    . ASN A 1 68  ? -1.427  2.337   -1.639  1.00 0.00 ? 68  ASN A C    5  
ATOM 8379  O O    . ASN A 1 68  ? -2.172  2.820   -2.491  1.00 0.00 ? 68  ASN A O    5  
ATOM 8380  C CB   . ASN A 1 68  ? -3.044  3.226   0.049   1.00 0.00 ? 68  ASN A CB   5  
ATOM 8381  C CG   . ASN A 1 68  ? -3.906  2.761   1.207   1.00 0.00 ? 68  ASN A CG   5  
ATOM 8382  O OD1  . ASN A 1 68  ? -4.335  1.608   1.253   1.00 0.00 ? 68  ASN A OD1  5  
ATOM 8383  N ND2  . ASN A 1 68  ? -4.165  3.660   2.150   1.00 0.00 ? 68  ASN A ND2  5  
ATOM 8384  H H    . ASN A 1 68  ? -0.358  2.155   1.350   1.00 0.00 ? 68  ASN A H    5  
ATOM 8385  H HA   . ASN A 1 68  ? -2.077  1.317   0.120   1.00 0.00 ? 68  ASN A HA   5  
ATOM 8386  H HB2  . ASN A 1 68  ? -2.710  4.232   0.256   1.00 0.00 ? 68  ASN A HB2  5  
ATOM 8387  H HB3  . ASN A 1 68  ? -3.646  3.227   -0.846  1.00 0.00 ? 68  ASN A HB3  5  
ATOM 8388  H HD21 . ASN A 1 68  ? -3.790  4.560   2.047   1.00 0.00 ? 68  ASN A HD21 5  
ATOM 8389  H HD22 . ASN A 1 68  ? -4.720  3.386   2.910   1.00 0.00 ? 68  ASN A HD22 5  
ATOM 8390  N N    . ASP A 1 69  ? -0.247  1.799   -1.931  1.00 0.00 ? 69  ASP A N    5  
ATOM 8391  C CA   . ASP A 1 69  ? 0.250   1.744   -3.301  1.00 0.00 ? 69  ASP A CA   5  
ATOM 8392  C C    . ASP A 1 69  ? 0.910   0.398   -3.586  1.00 0.00 ? 69  ASP A C    5  
ATOM 8393  O O    . ASP A 1 69  ? 1.678   -0.113  -2.771  1.00 0.00 ? 69  ASP A O    5  
ATOM 8394  C CB   . ASP A 1 69  ? 1.246   2.877   -3.551  1.00 0.00 ? 69  ASP A CB   5  
ATOM 8395  C CG   . ASP A 1 69  ? 0.564   4.166   -3.968  1.00 0.00 ? 69  ASP A CG   5  
ATOM 8396  O OD1  . ASP A 1 69  ? 0.192   4.956   -3.075  1.00 0.00 ? 69  ASP A OD1  5  
ATOM 8397  O OD2  . ASP A 1 69  ? 0.403   4.384   -5.187  1.00 0.00 ? 69  ASP A OD2  5  
ATOM 8398  H H    . ASP A 1 69  ? 0.302   1.430   -1.208  1.00 0.00 ? 69  ASP A H    5  
ATOM 8399  H HA   . ASP A 1 69  ? -0.593  1.865   -3.965  1.00 0.00 ? 69  ASP A HA   5  
ATOM 8400  H HB2  . ASP A 1 69  ? 1.804   3.064   -2.645  1.00 0.00 ? 69  ASP A HB2  5  
ATOM 8401  H HB3  . ASP A 1 69  ? 1.928   2.582   -4.334  1.00 0.00 ? 69  ASP A HB3  5  
ATOM 8402  N N    . LYS A 1 70  ? 0.604   -0.171  -4.746  1.00 0.00 ? 70  LYS A N    5  
ATOM 8403  C CA   . LYS A 1 70  ? 1.166   -1.457  -5.140  1.00 0.00 ? 70  LYS A CA   5  
ATOM 8404  C C    . LYS A 1 70  ? 2.286   -1.273  -6.159  1.00 0.00 ? 70  LYS A C    5  
ATOM 8405  O O    . LYS A 1 70  ? 2.049   -0.824  -7.281  1.00 0.00 ? 70  LYS A O    5  
ATOM 8406  C CB   . LYS A 1 70  ? 0.075   -2.358  -5.724  1.00 0.00 ? 70  LYS A CB   5  
ATOM 8407  C CG   . LYS A 1 70  ? 0.328   -3.839  -5.505  1.00 0.00 ? 70  LYS A CG   5  
ATOM 8408  C CD   . LYS A 1 70  ? -0.379  -4.686  -6.551  1.00 0.00 ? 70  LYS A CD   5  
ATOM 8409  C CE   . LYS A 1 70  ? 0.504   -4.925  -7.765  1.00 0.00 ? 70  LYS A CE   5  
ATOM 8410  N NZ   . LYS A 1 70  ? -0.293  -5.294  -8.967  1.00 0.00 ? 70  LYS A NZ   5  
ATOM 8411  H H    . LYS A 1 70  ? -0.016  0.286   -5.354  1.00 0.00 ? 70  LYS A H    5  
ATOM 8412  H HA   . LYS A 1 70  ? 1.574   -1.926  -4.257  1.00 0.00 ? 70  LYS A HA   5  
ATOM 8413  H HB2  . LYS A 1 70  ? -0.869  -2.103  -5.264  1.00 0.00 ? 70  LYS A HB2  5  
ATOM 8414  H HB3  . LYS A 1 70  ? 0.008   -2.178  -6.787  1.00 0.00 ? 70  LYS A HB3  5  
ATOM 8415  H HG2  . LYS A 1 70  ? 1.390   -4.027  -5.564  1.00 0.00 ? 70  LYS A HG2  5  
ATOM 8416  H HG3  . LYS A 1 70  ? -0.035  -4.117  -4.526  1.00 0.00 ? 70  LYS A HG3  5  
ATOM 8417  H HD2  . LYS A 1 70  ? -0.638  -5.639  -6.115  1.00 0.00 ? 70  LYS A HD2  5  
ATOM 8418  H HD3  . LYS A 1 70  ? -1.279  -4.176  -6.866  1.00 0.00 ? 70  LYS A HD3  5  
ATOM 8419  H HE2  . LYS A 1 70  ? 1.058   -4.022  -7.975  1.00 0.00 ? 70  LYS A HE2  5  
ATOM 8420  H HE3  . LYS A 1 70  ? 1.193   -5.725  -7.541  1.00 0.00 ? 70  LYS A HE3  5  
ATOM 8421  H HZ1  . LYS A 1 70  ? -0.154  -6.300  -9.192  1.00 0.00 ? 70  LYS A HZ1  5  
ATOM 8422  H HZ2  . LYS A 1 70  ? 0.006   -4.724  -9.784  1.00 0.00 ? 70  LYS A HZ2  5  
ATOM 8423  H HZ3  . LYS A 1 70  ? -1.304  -5.125  -8.792  1.00 0.00 ? 70  LYS A HZ3  5  
ATOM 8424  N N    . ILE A 1 71  ? 3.505   -1.622  -5.762  1.00 0.00 ? 71  ILE A N    5  
ATOM 8425  C CA   . ILE A 1 71  ? 4.660   -1.496  -6.642  1.00 0.00 ? 71  ILE A CA   5  
ATOM 8426  C C    . ILE A 1 71  ? 4.822   -2.735  -7.517  1.00 0.00 ? 71  ILE A C    5  
ATOM 8427  O O    . ILE A 1 71  ? 4.916   -3.855  -7.015  1.00 0.00 ? 71  ILE A O    5  
ATOM 8428  C CB   . ILE A 1 71  ? 5.957   -1.275  -5.841  1.00 0.00 ? 71  ILE A CB   5  
ATOM 8429  C CG1  . ILE A 1 71  ? 5.831   -0.032  -4.959  1.00 0.00 ? 71  ILE A CG1  5  
ATOM 8430  C CG2  . ILE A 1 71  ? 7.145   -1.145  -6.783  1.00 0.00 ? 71  ILE A CG2  5  
ATOM 8431  C CD1  . ILE A 1 71  ? 5.174   -0.302  -3.623  1.00 0.00 ? 71  ILE A CD1  5  
ATOM 8432  H H    . ILE A 1 71  ? 3.630   -1.973  -4.856  1.00 0.00 ? 71  ILE A H    5  
ATOM 8433  H HA   . ILE A 1 71  ? 4.502   -0.637  -7.278  1.00 0.00 ? 71  ILE A HA   5  
ATOM 8434  H HB   . ILE A 1 71  ? 6.118   -2.138  -5.214  1.00 0.00 ? 71  ILE A HB   5  
ATOM 8435  H HG12 . ILE A 1 71  ? 6.814   0.369   -4.769  1.00 0.00 ? 71  ILE A HG12 5  
ATOM 8436  H HG13 . ILE A 1 71  ? 5.239   0.710   -5.477  1.00 0.00 ? 71  ILE A HG13 5  
ATOM 8437  H HG21 . ILE A 1 71  ? 7.250   -2.054  -7.357  1.00 0.00 ? 71  ILE A HG21 5  
ATOM 8438  H HG22 . ILE A 1 71  ? 6.984   -0.313  -7.452  1.00 0.00 ? 71  ILE A HG22 5  
ATOM 8439  H HG23 . ILE A 1 71  ? 8.043   -0.977  -6.208  1.00 0.00 ? 71  ILE A HG23 5  
ATOM 8440  H HD11 . ILE A 1 71  ? 4.116   -0.097  -3.694  1.00 0.00 ? 71  ILE A HD11 5  
ATOM 8441  H HD12 . ILE A 1 71  ? 5.324   -1.336  -3.351  1.00 0.00 ? 71  ILE A HD12 5  
ATOM 8442  H HD13 . ILE A 1 71  ? 5.614   0.336   -2.870  1.00 0.00 ? 71  ILE A HD13 5  
ATOM 8443  N N    . VAL A 1 72  ? 4.854   -2.525  -8.830  1.00 0.00 ? 72  VAL A N    5  
ATOM 8444  C CA   . VAL A 1 72  ? 5.007   -3.624  -9.776  1.00 0.00 ? 72  VAL A CA   5  
ATOM 8445  C C    . VAL A 1 72  ? 6.418   -3.661  -10.352 1.00 0.00 ? 72  VAL A C    5  
ATOM 8446  O O    . VAL A 1 72  ? 6.878   -4.698  -10.829 1.00 0.00 ? 72  VAL A O    5  
ATOM 8447  C CB   . VAL A 1 72  ? 3.995   -3.514  -10.932 1.00 0.00 ? 72  VAL A CB   5  
ATOM 8448  C CG1  . VAL A 1 72  ? 2.608   -3.934  -10.469 1.00 0.00 ? 72  VAL A CG1  5  
ATOM 8449  C CG2  . VAL A 1 72  ? 3.975   -2.099  -11.489 1.00 0.00 ? 72  VAL A CG2  5  
ATOM 8450  H H    . VAL A 1 72  ? 4.774   -1.610  -9.169  1.00 0.00 ? 72  VAL A H    5  
ATOM 8451  H HA   . VAL A 1 72  ? 4.820   -4.548  -9.248  1.00 0.00 ? 72  VAL A HA   5  
ATOM 8452  H HB   . VAL A 1 72  ? 4.306   -4.185  -11.720 1.00 0.00 ? 72  VAL A HB   5  
ATOM 8453  H HG11 . VAL A 1 72  ? 2.398   -3.484  -9.510  1.00 0.00 ? 72  VAL A HG11 5  
ATOM 8454  H HG12 . VAL A 1 72  ? 1.874   -3.608  -11.191 1.00 0.00 ? 72  VAL A HG12 5  
ATOM 8455  H HG13 . VAL A 1 72  ? 2.570   -5.009  -10.377 1.00 0.00 ? 72  VAL A HG13 5  
ATOM 8456  H HG21 . VAL A 1 72  ? 4.910   -1.610  -11.261 1.00 0.00 ? 72  VAL A HG21 5  
ATOM 8457  H HG22 . VAL A 1 72  ? 3.840   -2.136  -12.561 1.00 0.00 ? 72  VAL A HG22 5  
ATOM 8458  H HG23 . VAL A 1 72  ? 3.161   -1.548  -11.043 1.00 0.00 ? 72  VAL A HG23 5  
ATOM 8459  N N    . ALA A 1 73  ? 7.101   -2.522  -10.303 1.00 0.00 ? 73  ALA A N    5  
ATOM 8460  C CA   . ALA A 1 73  ? 8.461   -2.424  -10.817 1.00 0.00 ? 73  ALA A CA   5  
ATOM 8461  C C    . ALA A 1 73  ? 9.197   -1.238  -10.202 1.00 0.00 ? 73  ALA A C    5  
ATOM 8462  O O    . ALA A 1 73  ? 8.582   -0.239  -9.828  1.00 0.00 ? 73  ALA A O    5  
ATOM 8463  C CB   . ALA A 1 73  ? 8.445   -2.307  -12.334 1.00 0.00 ? 73  ALA A CB   5  
ATOM 8464  H H    . ALA A 1 73  ? 6.680   -1.729  -9.910  1.00 0.00 ? 73  ALA A H    5  
ATOM 8465  H HA   . ALA A 1 73  ? 8.983   -3.333  -10.556 1.00 0.00 ? 73  ALA A HA   5  
ATOM 8466  H HB1  . ALA A 1 73  ? 7.457   -2.016  -12.661 1.00 0.00 ? 73  ALA A HB1  5  
ATOM 8467  H HB2  . ALA A 1 73  ? 9.162   -1.563  -12.646 1.00 0.00 ? 73  ALA A HB2  5  
ATOM 8468  H HB3  . ALA A 1 73  ? 8.702   -3.261  -12.771 1.00 0.00 ? 73  ALA A HB3  5  
ATOM 8469  N N    . VAL A 1 74  ? 10.517  -1.355  -10.100 1.00 0.00 ? 74  VAL A N    5  
ATOM 8470  C CA   . VAL A 1 74  ? 11.337  -0.293  -9.530  1.00 0.00 ? 74  VAL A CA   5  
ATOM 8471  C C    . VAL A 1 74  ? 12.537  0.013   -10.420 1.00 0.00 ? 74  VAL A C    5  
ATOM 8472  O O    . VAL A 1 74  ? 13.375  -0.854  -10.668 1.00 0.00 ? 74  VAL A O    5  
ATOM 8473  C CB   . VAL A 1 74  ? 11.838  -0.664  -8.121  1.00 0.00 ? 74  VAL A CB   5  
ATOM 8474  C CG1  . VAL A 1 74  ? 12.758  0.418   -7.579  1.00 0.00 ? 74  VAL A CG1  5  
ATOM 8475  C CG2  . VAL A 1 74  ? 10.663  -0.896  -7.183  1.00 0.00 ? 74  VAL A CG2  5  
ATOM 8476  H H    . VAL A 1 74  ? 10.950  -2.176  -10.416 1.00 0.00 ? 74  VAL A H    5  
ATOM 8477  H HA   . VAL A 1 74  ? 10.726  0.594   -9.449  1.00 0.00 ? 74  VAL A HA   5  
ATOM 8478  H HB   . VAL A 1 74  ? 12.402  -1.583  -8.192  1.00 0.00 ? 74  VAL A HB   5  
ATOM 8479  H HG11 . VAL A 1 74  ? 12.183  1.308   -7.370  1.00 0.00 ? 74  VAL A HG11 5  
ATOM 8480  H HG12 . VAL A 1 74  ? 13.228  0.070   -6.671  1.00 0.00 ? 74  VAL A HG12 5  
ATOM 8481  H HG13 . VAL A 1 74  ? 13.518  0.646   -8.313  1.00 0.00 ? 74  VAL A HG13 5  
ATOM 8482  H HG21 . VAL A 1 74  ? 10.374  0.041   -6.731  1.00 0.00 ? 74  VAL A HG21 5  
ATOM 8483  H HG22 . VAL A 1 74  ? 9.830   -1.299  -7.741  1.00 0.00 ? 74  VAL A HG22 5  
ATOM 8484  H HG23 . VAL A 1 74  ? 10.951  -1.595  -6.411  1.00 0.00 ? 74  VAL A HG23 5  
ATOM 8485  N N    . ASP A 1 75  ? 12.613  1.251   -10.896 1.00 0.00 ? 75  ASP A N    5  
ATOM 8486  C CA   . ASP A 1 75  ? 13.711  1.672   -11.757 1.00 0.00 ? 75  ASP A CA   5  
ATOM 8487  C C    . ASP A 1 75  ? 13.756  0.833   -13.030 1.00 0.00 ? 75  ASP A C    5  
ATOM 8488  O O    . ASP A 1 75  ? 14.830  0.518   -13.540 1.00 0.00 ? 75  ASP A O    5  
ATOM 8489  C CB   . ASP A 1 75  ? 15.043  1.563   -11.012 1.00 0.00 ? 75  ASP A CB   5  
ATOM 8490  C CG   . ASP A 1 75  ? 15.400  2.838   -10.274 1.00 0.00 ? 75  ASP A CG   5  
ATOM 8491  O OD1  . ASP A 1 75  ? 14.836  3.070   -9.184  1.00 0.00 ? 75  ASP A OD1  5  
ATOM 8492  O OD2  . ASP A 1 75  ? 16.242  3.605   -10.787 1.00 0.00 ? 75  ASP A OD2  5  
ATOM 8493  H H    . ASP A 1 75  ? 11.914  1.897   -10.661 1.00 0.00 ? 75  ASP A H    5  
ATOM 8494  H HA   . ASP A 1 75  ? 13.544  2.704   -12.027 1.00 0.00 ? 75  ASP A HA   5  
ATOM 8495  H HB2  . ASP A 1 75  ? 14.981  0.759   -10.294 1.00 0.00 ? 75  ASP A HB2  5  
ATOM 8496  H HB3  . ASP A 1 75  ? 15.828  1.347   -11.722 1.00 0.00 ? 75  ASP A HB3  5  
ATOM 8497  N N    . GLY A 1 76  ? 12.581  0.474   -13.538 1.00 0.00 ? 76  GLY A N    5  
ATOM 8498  C CA   . GLY A 1 76  ? 12.509  -0.326  -14.747 1.00 0.00 ? 76  GLY A CA   5  
ATOM 8499  C C    . GLY A 1 76  ? 12.812  -1.789  -14.493 1.00 0.00 ? 76  GLY A C    5  
ATOM 8500  O O    . GLY A 1 76  ? 13.270  -2.500  -15.387 1.00 0.00 ? 76  GLY A O    5  
ATOM 8501  H H    . GLY A 1 76  ? 11.757  0.755   -13.089 1.00 0.00 ? 76  GLY A H    5  
ATOM 8502  H HA2  . GLY A 1 76  ? 11.516  -0.242  -15.162 1.00 0.00 ? 76  GLY A HA2  5  
ATOM 8503  H HA3  . GLY A 1 76  ? 13.221  0.058   -15.462 1.00 0.00 ? 76  GLY A HA3  5  
ATOM 8504  N N    . VAL A 1 77  ? 12.557  -2.240  -13.268 1.00 0.00 ? 77  VAL A N    5  
ATOM 8505  C CA   . VAL A 1 77  ? 12.806  -3.629  -12.898 1.00 0.00 ? 77  VAL A CA   5  
ATOM 8506  C C    . VAL A 1 77  ? 11.546  -4.285  -12.347 1.00 0.00 ? 77  VAL A C    5  
ATOM 8507  O O    . VAL A 1 77  ? 11.007  -3.858  -11.327 1.00 0.00 ? 77  VAL A O    5  
ATOM 8508  C CB   . VAL A 1 77  ? 13.929  -3.737  -11.849 1.00 0.00 ? 77  VAL A CB   5  
ATOM 8509  C CG1  . VAL A 1 77  ? 14.095  -5.178  -11.391 1.00 0.00 ? 77  VAL A CG1  5  
ATOM 8510  C CG2  . VAL A 1 77  ? 15.235  -3.193  -12.409 1.00 0.00 ? 77  VAL A CG2  5  
ATOM 8511  H H    . VAL A 1 77  ? 12.192  -1.625  -12.599 1.00 0.00 ? 77  VAL A H    5  
ATOM 8512  H HA   . VAL A 1 77  ? 13.119  -4.160  -13.786 1.00 0.00 ? 77  VAL A HA   5  
ATOM 8513  H HB   . VAL A 1 77  ? 13.653  -3.140  -10.993 1.00 0.00 ? 77  VAL A HB   5  
ATOM 8514  H HG11 . VAL A 1 77  ? 13.973  -5.230  -10.319 1.00 0.00 ? 77  VAL A HG11 5  
ATOM 8515  H HG12 . VAL A 1 77  ? 13.350  -5.796  -11.870 1.00 0.00 ? 77  VAL A HG12 5  
ATOM 8516  H HG13 . VAL A 1 77  ? 15.081  -5.529  -11.658 1.00 0.00 ? 77  VAL A HG13 5  
ATOM 8517  H HG21 . VAL A 1 77  ? 15.942  -3.058  -11.605 1.00 0.00 ? 77  VAL A HG21 5  
ATOM 8518  H HG22 . VAL A 1 77  ? 15.638  -3.892  -13.129 1.00 0.00 ? 77  VAL A HG22 5  
ATOM 8519  H HG23 . VAL A 1 77  ? 15.053  -2.245  -12.893 1.00 0.00 ? 77  VAL A HG23 5  
ATOM 8520  N N    . ASN A 1 78  ? 11.081  -5.327  -13.029 1.00 0.00 ? 78  ASN A N    5  
ATOM 8521  C CA   . ASN A 1 78  ? 9.883   -6.044  -12.607 1.00 0.00 ? 78  ASN A CA   5  
ATOM 8522  C C    . ASN A 1 78  ? 10.116  -6.759  -11.279 1.00 0.00 ? 78  ASN A C    5  
ATOM 8523  O O    . ASN A 1 78  ? 10.645  -7.870  -11.246 1.00 0.00 ? 78  ASN A O    5  
ATOM 8524  C CB   . ASN A 1 78  ? 9.465   -7.054  -13.677 1.00 0.00 ? 78  ASN A CB   5  
ATOM 8525  C CG   . ASN A 1 78  ? 8.132   -7.707  -13.366 1.00 0.00 ? 78  ASN A CG   5  
ATOM 8526  O OD1  . ASN A 1 78  ? 8.079   -8.796  -12.794 1.00 0.00 ? 78  ASN A OD1  5  
ATOM 8527  N ND2  . ASN A 1 78  ? 7.046   -7.043  -13.744 1.00 0.00 ? 78  ASN A ND2  5  
ATOM 8528  H H    . ASN A 1 78  ? 11.555  -5.621  -13.834 1.00 0.00 ? 78  ASN A H    5  
ATOM 8529  H HA   . ASN A 1 78  ? 9.092   -5.320  -12.479 1.00 0.00 ? 78  ASN A HA   5  
ATOM 8530  H HB2  . ASN A 1 78  ? 9.383   -6.549  -14.628 1.00 0.00 ? 78  ASN A HB2  5  
ATOM 8531  H HB3  . ASN A 1 78  ? 10.216  -7.827  -13.747 1.00 0.00 ? 78  ASN A HB3  5  
ATOM 8532  H HD21 . ASN A 1 78  ? 7.164   -6.181  -14.195 1.00 0.00 ? 78  ASN A HD21 5  
ATOM 8533  H HD22 . ASN A 1 78  ? 6.171   -7.441  -13.555 1.00 0.00 ? 78  ASN A HD22 5  
ATOM 8534  N N    . ILE A 1 79  ? 9.716   -6.114  -10.188 1.00 0.00 ? 79  ILE A N    5  
ATOM 8535  C CA   . ILE A 1 79  ? 9.880   -6.689  -8.859  1.00 0.00 ? 79  ILE A CA   5  
ATOM 8536  C C    . ILE A 1 79  ? 8.636   -7.465  -8.439  1.00 0.00 ? 79  ILE A C    5  
ATOM 8537  O O    . ILE A 1 79  ? 8.435   -7.739  -7.256  1.00 0.00 ? 79  ILE A O    5  
ATOM 8538  C CB   . ILE A 1 79  ? 10.173  -5.603  -7.808  1.00 0.00 ? 79  ILE A CB   5  
ATOM 8539  C CG1  . ILE A 1 79  ? 8.952   -4.700  -7.621  1.00 0.00 ? 79  ILE A CG1  5  
ATOM 8540  C CG2  . ILE A 1 79  ? 11.387  -4.782  -8.219  1.00 0.00 ? 79  ILE A CG2  5  
ATOM 8541  C CD1  . ILE A 1 79  ? 8.830   -4.130  -6.225  1.00 0.00 ? 79  ILE A CD1  5  
ATOM 8542  H H    . ILE A 1 79  ? 9.301   -5.232  -10.280 1.00 0.00 ? 79  ILE A H    5  
ATOM 8543  H HA   . ILE A 1 79  ? 10.720  -7.368  -8.891  1.00 0.00 ? 79  ILE A HA   5  
ATOM 8544  H HB   . ILE A 1 79  ? 10.399  -6.090  -6.872  1.00 0.00 ? 79  ILE A HB   5  
ATOM 8545  H HG12 . ILE A 1 79  ? 9.013   -3.875  -8.312  1.00 0.00 ? 79  ILE A HG12 5  
ATOM 8546  H HG13 . ILE A 1 79  ? 8.058   -5.271  -7.826  1.00 0.00 ? 79  ILE A HG13 5  
ATOM 8547  H HG21 . ILE A 1 79  ? 11.298  -3.783  -7.818  1.00 0.00 ? 79  ILE A HG21 5  
ATOM 8548  H HG22 . ILE A 1 79  ? 12.282  -5.246  -7.831  1.00 0.00 ? 79  ILE A HG22 5  
ATOM 8549  H HG23 . ILE A 1 79  ? 11.442  -4.735  -9.296  1.00 0.00 ? 79  ILE A HG23 5  
ATOM 8550  H HD11 . ILE A 1 79  ? 9.739   -4.326  -5.675  1.00 0.00 ? 79  ILE A HD11 5  
ATOM 8551  H HD12 . ILE A 1 79  ? 8.668   -3.064  -6.284  1.00 0.00 ? 79  ILE A HD12 5  
ATOM 8552  H HD13 . ILE A 1 79  ? 7.996   -4.593  -5.718  1.00 0.00 ? 79  ILE A HD13 5  
ATOM 8553  N N    . GLN A 1 80  ? 7.806   -7.816  -9.416  1.00 0.00 ? 80  GLN A N    5  
ATOM 8554  C CA   . GLN A 1 80  ? 6.582   -8.561  -9.147  1.00 0.00 ? 80  GLN A CA   5  
ATOM 8555  C C    . GLN A 1 80  ? 6.893   -9.896  -8.477  1.00 0.00 ? 80  GLN A C    5  
ATOM 8556  O O    . GLN A 1 80  ? 7.150   -10.894 -9.150  1.00 0.00 ? 80  GLN A O    5  
ATOM 8557  C CB   . GLN A 1 80  ? 5.807   -8.796  -10.444 1.00 0.00 ? 80  GLN A CB   5  
ATOM 8558  C CG   . GLN A 1 80  ? 5.023   -7.582  -10.913 1.00 0.00 ? 80  GLN A CG   5  
ATOM 8559  C CD   . GLN A 1 80  ? 3.775   -7.956  -11.688 1.00 0.00 ? 80  GLN A CD   5  
ATOM 8560  O OE1  . GLN A 1 80  ? 3.111   -8.945  -11.377 1.00 0.00 ? 80  GLN A OE1  5  
ATOM 8561  N NE2  . GLN A 1 80  ? 3.448   -7.165  -12.703 1.00 0.00 ? 80  GLN A NE2  5  
ATOM 8562  H H    . GLN A 1 80  ? 8.022   -7.568  -10.338 1.00 0.00 ? 80  GLN A H    5  
ATOM 8563  H HA   . GLN A 1 80  ? 5.975   -7.971  -8.478  1.00 0.00 ? 80  GLN A HA   5  
ATOM 8564  H HB2  . GLN A 1 80  ? 6.505   -9.070  -11.222 1.00 0.00 ? 80  GLN A HB2  5  
ATOM 8565  H HB3  . GLN A 1 80  ? 5.113   -9.609  -10.293 1.00 0.00 ? 80  GLN A HB3  5  
ATOM 8566  H HG2  . GLN A 1 80  ? 4.732   -7.002  -10.050 1.00 0.00 ? 80  GLN A HG2  5  
ATOM 8567  H HG3  . GLN A 1 80  ? 5.658   -6.983  -11.550 1.00 0.00 ? 80  GLN A HG3  5  
ATOM 8568  H HE21 . GLN A 1 80  ? 4.025   -6.395  -12.893 1.00 0.00 ? 80  GLN A HE21 5  
ATOM 8569  H HE22 . GLN A 1 80  ? 2.647   -7.384  -13.221 1.00 0.00 ? 80  GLN A HE22 5  
ATOM 8570  N N    . GLY A 1 81  ? 6.869   -9.906  -7.148  1.00 0.00 ? 81  GLY A N    5  
ATOM 8571  C CA   . GLY A 1 81  ? 7.151   -11.123 -6.410  1.00 0.00 ? 81  GLY A CA   5  
ATOM 8572  C C    . GLY A 1 81  ? 8.400   -11.009 -5.559  1.00 0.00 ? 81  GLY A C    5  
ATOM 8573  O O    . GLY A 1 81  ? 8.593   -11.782 -4.620  1.00 0.00 ? 81  GLY A O    5  
ATOM 8574  H H    . GLY A 1 81  ? 6.658   -9.080  -6.664  1.00 0.00 ? 81  GLY A H    5  
ATOM 8575  H HA2  . GLY A 1 81  ? 6.311   -11.346 -5.769  1.00 0.00 ? 81  GLY A HA2  5  
ATOM 8576  H HA3  . GLY A 1 81  ? 7.280   -11.934 -7.112  1.00 0.00 ? 81  GLY A HA3  5  
ATOM 8577  N N    . PHE A 1 82  ? 9.253   -10.045 -5.889  1.00 0.00 ? 82  PHE A N    5  
ATOM 8578  C CA   . PHE A 1 82  ? 10.492  -9.834  -5.150  1.00 0.00 ? 82  PHE A CA   5  
ATOM 8579  C C    . PHE A 1 82  ? 10.233  -9.823  -3.646  1.00 0.00 ? 82  PHE A C    5  
ATOM 8580  O O    . PHE A 1 82  ? 9.298   -9.179  -3.172  1.00 0.00 ? 82  PHE A O    5  
ATOM 8581  C CB   . PHE A 1 82  ? 11.148  -8.519  -5.576  1.00 0.00 ? 82  PHE A CB   5  
ATOM 8582  C CG   . PHE A 1 82  ? 12.054  -8.659  -6.766  1.00 0.00 ? 82  PHE A CG   5  
ATOM 8583  C CD1  . PHE A 1 82  ? 11.666  -9.408  -7.865  1.00 0.00 ? 82  PHE A CD1  5  
ATOM 8584  C CD2  . PHE A 1 82  ? 13.294  -8.041  -6.785  1.00 0.00 ? 82  PHE A CD2  5  
ATOM 8585  C CE1  . PHE A 1 82  ? 12.497  -9.539  -8.961  1.00 0.00 ? 82  PHE A CE1  5  
ATOM 8586  C CE2  . PHE A 1 82  ? 14.129  -8.168  -7.879  1.00 0.00 ? 82  PHE A CE2  5  
ATOM 8587  C CZ   . PHE A 1 82  ? 13.731  -8.918  -8.968  1.00 0.00 ? 82  PHE A CZ   5  
ATOM 8588  H H    . PHE A 1 82  ? 9.043   -9.461  -6.648  1.00 0.00 ? 82  PHE A H    5  
ATOM 8589  H HA   . PHE A 1 82  ? 11.158  -10.651 -5.382  1.00 0.00 ? 82  PHE A HA   5  
ATOM 8590  H HB2  . PHE A 1 82  ? 10.377  -7.806  -5.829  1.00 0.00 ? 82  PHE A HB2  5  
ATOM 8591  H HB3  . PHE A 1 82  ? 11.733  -8.134  -4.755  1.00 0.00 ? 82  PHE A HB3  5  
ATOM 8592  H HD1  . PHE A 1 82  ? 10.700  -9.895  -7.860  1.00 0.00 ? 82  PHE A HD1  5  
ATOM 8593  H HD2  . PHE A 1 82  ? 13.608  -7.455  -5.934  1.00 0.00 ? 82  PHE A HD2  5  
ATOM 8594  H HE1  . PHE A 1 82  ? 12.182  -10.127 -9.811  1.00 0.00 ? 82  PHE A HE1  5  
ATOM 8595  H HE2  . PHE A 1 82  ? 15.094  -7.682  -7.882  1.00 0.00 ? 82  PHE A HE2  5  
ATOM 8596  H HZ   . PHE A 1 82  ? 14.381  -9.018  -9.824  1.00 0.00 ? 82  PHE A HZ   5  
ATOM 8597  N N    . ALA A 1 83  ? 11.070  -10.540 -2.903  1.00 0.00 ? 83  ALA A N    5  
ATOM 8598  C CA   . ALA A 1 83  ? 10.933  -10.611 -1.453  1.00 0.00 ? 83  ALA A CA   5  
ATOM 8599  C C    . ALA A 1 83  ? 11.317  -9.288  -0.799  1.00 0.00 ? 83  ALA A C    5  
ATOM 8600  O O    . ALA A 1 83  ? 12.113  -8.525  -1.343  1.00 0.00 ? 83  ALA A O    5  
ATOM 8601  C CB   . ALA A 1 83  ? 11.785  -11.743 -0.898  1.00 0.00 ? 83  ALA A CB   5  
ATOM 8602  H H    . ALA A 1 83  ? 11.796  -11.031 -3.339  1.00 0.00 ? 83  ALA A H    5  
ATOM 8603  H HA   . ALA A 1 83  ? 9.899   -10.827 -1.225  1.00 0.00 ? 83  ALA A HA   5  
ATOM 8604  H HB1  . ALA A 1 83  ? 11.931  -11.596 0.162   1.00 0.00 ? 83  ALA A HB1  5  
ATOM 8605  H HB2  . ALA A 1 83  ? 11.285  -12.685 -1.066  1.00 0.00 ? 83  ALA A HB2  5  
ATOM 8606  H HB3  . ALA A 1 83  ? 12.743  -11.749 -1.396  1.00 0.00 ? 83  ALA A HB3  5  
ATOM 8607  N N    . ASN A 1 84  ? 10.744  -9.023  0.370   1.00 0.00 ? 84  ASN A N    5  
ATOM 8608  C CA   . ASN A 1 84  ? 11.025  -7.791  1.097   1.00 0.00 ? 84  ASN A CA   5  
ATOM 8609  C C    . ASN A 1 84  ? 12.475  -7.359  0.896   1.00 0.00 ? 84  ASN A C    5  
ATOM 8610  O O    . ASN A 1 84  ? 12.745  -6.250  0.433   1.00 0.00 ? 84  ASN A O    5  
ATOM 8611  C CB   . ASN A 1 84  ? 10.740  -7.978  2.589   1.00 0.00 ? 84  ASN A CB   5  
ATOM 8612  C CG   . ASN A 1 84  ? 10.931  -6.697  3.379   1.00 0.00 ? 84  ASN A CG   5  
ATOM 8613  O OD1  . ASN A 1 84  ? 11.850  -6.588  4.192   1.00 0.00 ? 84  ASN A OD1  5  
ATOM 8614  N ND2  . ASN A 1 84  ? 10.062  -5.722  3.144   1.00 0.00 ? 84  ASN A ND2  5  
ATOM 8615  H H    . ASN A 1 84  ? 10.117  -9.671  0.754   1.00 0.00 ? 84  ASN A H    5  
ATOM 8616  H HA   . ASN A 1 84  ? 10.375  -7.021  0.709   1.00 0.00 ? 84  ASN A HA   5  
ATOM 8617  H HB2  . ASN A 1 84  ? 9.719   -8.307  2.715   1.00 0.00 ? 84  ASN A HB2  5  
ATOM 8618  H HB3  . ASN A 1 84  ? 11.407  -8.728  2.986   1.00 0.00 ? 84  ASN A HB3  5  
ATOM 8619  H HD21 . ASN A 1 84  ? 9.356   -5.880  2.483   1.00 0.00 ? 84  ASN A HD21 5  
ATOM 8620  H HD22 . ASN A 1 84  ? 10.163  -4.883  3.640   1.00 0.00 ? 84  ASN A HD22 5  
ATOM 8621  N N    . HIS A 1 85  ? 13.404  -8.243  1.246   1.00 0.00 ? 85  HIS A N    5  
ATOM 8622  C CA   . HIS A 1 85  ? 14.826  -7.954  1.102   1.00 0.00 ? 85  HIS A CA   5  
ATOM 8623  C C    . HIS A 1 85  ? 15.202  -7.792  -0.368  1.00 0.00 ? 85  HIS A C    5  
ATOM 8624  O O    . HIS A 1 85  ? 15.897  -6.847  -0.741  1.00 0.00 ? 85  HIS A O    5  
ATOM 8625  C CB   . HIS A 1 85  ? 15.661  -9.068  1.734   1.00 0.00 ? 85  HIS A CB   5  
ATOM 8626  C CG   . HIS A 1 85  ? 15.159  -10.444 1.421   1.00 0.00 ? 85  HIS A CG   5  
ATOM 8627  N ND1  . HIS A 1 85  ? 14.109  -11.033 2.093   1.00 0.00 ? 85  HIS A ND1  5  
ATOM 8628  C CD2  . HIS A 1 85  ? 15.569  -11.347 0.499   1.00 0.00 ? 85  HIS A CD2  5  
ATOM 8629  C CE1  . HIS A 1 85  ? 13.895  -12.240 1.599   1.00 0.00 ? 85  HIS A CE1  5  
ATOM 8630  N NE2  . HIS A 1 85  ? 14.767  -12.455 0.631   1.00 0.00 ? 85  HIS A NE2  5  
ATOM 8631  H H    . HIS A 1 85  ? 13.126  -9.109  1.609   1.00 0.00 ? 85  HIS A H    5  
ATOM 8632  H HA   . HIS A 1 85  ? 15.030  -7.027  1.616   1.00 0.00 ? 85  HIS A HA   5  
ATOM 8633  H HB2  . HIS A 1 85  ? 16.677  -8.996  1.374   1.00 0.00 ? 85  HIS A HB2  5  
ATOM 8634  H HB3  . HIS A 1 85  ? 15.655  -8.948  2.808   1.00 0.00 ? 85  HIS A HB3  5  
ATOM 8635  H HD1  . HIS A 1 85  ? 13.598  -10.628 2.823   1.00 0.00 ? 85  HIS A HD1  5  
ATOM 8636  H HD2  . HIS A 1 85  ? 16.376  -11.221 -0.208  1.00 0.00 ? 85  HIS A HD2  5  
ATOM 8637  H HE1  . HIS A 1 85  ? 13.137  -12.933 1.930   1.00 0.00 ? 85  HIS A HE1  5  
ATOM 8638  H HE2  . HIS A 1 85  ? 14.885  -13.303 0.155   1.00 0.00 ? 85  HIS A HE2  5  
ATOM 8639  N N    . ASP A 1 86  ? 14.739  -8.721  -1.197  1.00 0.00 ? 86  ASP A N    5  
ATOM 8640  C CA   . ASP A 1 86  ? 15.026  -8.681  -2.627  1.00 0.00 ? 86  ASP A CA   5  
ATOM 8641  C C    . ASP A 1 86  ? 14.682  -7.315  -3.213  1.00 0.00 ? 86  ASP A C    5  
ATOM 8642  O O    . ASP A 1 86  ? 15.333  -6.847  -4.146  1.00 0.00 ? 86  ASP A O    5  
ATOM 8643  C CB   . ASP A 1 86  ? 14.244  -9.775  -3.356  1.00 0.00 ? 86  ASP A CB   5  
ATOM 8644  C CG   . ASP A 1 86  ? 14.948  -11.116 -3.314  1.00 0.00 ? 86  ASP A CG   5  
ATOM 8645  O OD1  . ASP A 1 86  ? 14.836  -11.814 -2.284  1.00 0.00 ? 86  ASP A OD1  5  
ATOM 8646  O OD2  . ASP A 1 86  ? 15.611  -11.469 -4.312  1.00 0.00 ? 86  ASP A OD2  5  
ATOM 8647  H H    . ASP A 1 86  ? 14.190  -9.450  -0.840  1.00 0.00 ? 86  ASP A H    5  
ATOM 8648  H HA   . ASP A 1 86  ? 16.082  -8.859  -2.758  1.00 0.00 ? 86  ASP A HA   5  
ATOM 8649  H HB2  . ASP A 1 86  ? 13.274  -9.884  -2.893  1.00 0.00 ? 86  ASP A HB2  5  
ATOM 8650  H HB3  . ASP A 1 86  ? 14.115  -9.488  -4.389  1.00 0.00 ? 86  ASP A HB3  5  
ATOM 8651  N N    . VAL A 1 87  ? 13.652  -6.682  -2.659  1.00 0.00 ? 87  VAL A N    5  
ATOM 8652  C CA   . VAL A 1 87  ? 13.221  -5.370  -3.126  1.00 0.00 ? 87  VAL A CA   5  
ATOM 8653  C C    . VAL A 1 87  ? 14.080  -4.263  -2.525  1.00 0.00 ? 87  VAL A C    5  
ATOM 8654  O O    . VAL A 1 87  ? 14.333  -3.242  -3.164  1.00 0.00 ? 87  VAL A O    5  
ATOM 8655  C CB   . VAL A 1 87  ? 11.744  -5.107  -2.776  1.00 0.00 ? 87  VAL A CB   5  
ATOM 8656  C CG1  . VAL A 1 87  ? 11.364  -3.672  -3.108  1.00 0.00 ? 87  VAL A CG1  5  
ATOM 8657  C CG2  . VAL A 1 87  ? 10.841  -6.089  -3.507  1.00 0.00 ? 87  VAL A CG2  5  
ATOM 8658  H H    . VAL A 1 87  ? 13.172  -7.107  -1.918  1.00 0.00 ? 87  VAL A H    5  
ATOM 8659  H HA   . VAL A 1 87  ? 13.324  -5.348  -4.202  1.00 0.00 ? 87  VAL A HA   5  
ATOM 8660  H HB   . VAL A 1 87  ? 11.616  -5.254  -1.714  1.00 0.00 ? 87  VAL A HB   5  
ATOM 8661  H HG11 . VAL A 1 87  ? 10.378  -3.654  -3.547  1.00 0.00 ? 87  VAL A HG11 5  
ATOM 8662  H HG12 . VAL A 1 87  ? 11.368  -3.080  -2.204  1.00 0.00 ? 87  VAL A HG12 5  
ATOM 8663  H HG13 . VAL A 1 87  ? 12.077  -3.264  -3.809  1.00 0.00 ? 87  VAL A HG13 5  
ATOM 8664  H HG21 . VAL A 1 87  ? 11.059  -7.093  -3.175  1.00 0.00 ? 87  VAL A HG21 5  
ATOM 8665  H HG22 . VAL A 1 87  ? 9.808   -5.856  -3.293  1.00 0.00 ? 87  VAL A HG22 5  
ATOM 8666  H HG23 . VAL A 1 87  ? 11.013  -6.015  -4.570  1.00 0.00 ? 87  VAL A HG23 5  
ATOM 8667  N N    . VAL A 1 88  ? 14.526  -4.472  -1.291  1.00 0.00 ? 88  VAL A N    5  
ATOM 8668  C CA   . VAL A 1 88  ? 15.358  -3.493  -0.602  1.00 0.00 ? 88  VAL A CA   5  
ATOM 8669  C C    . VAL A 1 88  ? 16.638  -3.214  -1.382  1.00 0.00 ? 88  VAL A C    5  
ATOM 8670  O O    . VAL A 1 88  ? 16.974  -2.061  -1.650  1.00 0.00 ? 88  VAL A O    5  
ATOM 8671  C CB   . VAL A 1 88  ? 15.728  -3.968  0.816   1.00 0.00 ? 88  VAL A CB   5  
ATOM 8672  C CG1  . VAL A 1 88  ? 16.716  -3.007  1.460   1.00 0.00 ? 88  VAL A CG1  5  
ATOM 8673  C CG2  . VAL A 1 88  ? 14.478  -4.113  1.671   1.00 0.00 ? 88  VAL A CG2  5  
ATOM 8674  H H    . VAL A 1 88  ? 14.291  -5.306  -0.832  1.00 0.00 ? 88  VAL A H    5  
ATOM 8675  H HA   . VAL A 1 88  ? 14.793  -2.576  -0.516  1.00 0.00 ? 88  VAL A HA   5  
ATOM 8676  H HB   . VAL A 1 88  ? 16.200  -4.936  0.738   1.00 0.00 ? 88  VAL A HB   5  
ATOM 8677  H HG11 . VAL A 1 88  ? 16.203  -2.098  1.740   1.00 0.00 ? 88  VAL A HG11 5  
ATOM 8678  H HG12 . VAL A 1 88  ? 17.143  -3.466  2.339   1.00 0.00 ? 88  VAL A HG12 5  
ATOM 8679  H HG13 . VAL A 1 88  ? 17.502  -2.774  0.757   1.00 0.00 ? 88  VAL A HG13 5  
ATOM 8680  H HG21 . VAL A 1 88  ? 14.255  -5.161  1.806   1.00 0.00 ? 88  VAL A HG21 5  
ATOM 8681  H HG22 . VAL A 1 88  ? 14.645  -3.653  2.634   1.00 0.00 ? 88  VAL A HG22 5  
ATOM 8682  H HG23 . VAL A 1 88  ? 13.647  -3.628  1.180   1.00 0.00 ? 88  VAL A HG23 5  
ATOM 8683  N N    . GLU A 1 89  ? 17.348  -4.278  -1.745  1.00 0.00 ? 89  GLU A N    5  
ATOM 8684  C CA   . GLU A 1 89  ? 18.592  -4.147  -2.494  1.00 0.00 ? 89  GLU A CA   5  
ATOM 8685  C C    . GLU A 1 89  ? 18.372  -3.350  -3.777  1.00 0.00 ? 89  GLU A C    5  
ATOM 8686  O O    . GLU A 1 89  ? 19.192  -2.509  -4.147  1.00 0.00 ? 89  GLU A O    5  
ATOM 8687  C CB   . GLU A 1 89  ? 19.159  -5.528  -2.829  1.00 0.00 ? 89  GLU A CB   5  
ATOM 8688  C CG   . GLU A 1 89  ? 18.455  -6.210  -3.990  1.00 0.00 ? 89  GLU A CG   5  
ATOM 8689  C CD   . GLU A 1 89  ? 18.746  -7.697  -4.057  1.00 0.00 ? 89  GLU A CD   5  
ATOM 8690  O OE1  . GLU A 1 89  ? 19.805  -8.118  -3.547  1.00 0.00 ? 89  GLU A OE1  5  
ATOM 8691  O OE2  . GLU A 1 89  ? 17.915  -8.439  -4.621  1.00 0.00 ? 89  GLU A OE2  5  
ATOM 8692  H H    . GLU A 1 89  ? 17.028  -5.172  -1.502  1.00 0.00 ? 89  GLU A H    5  
ATOM 8693  H HA   . GLU A 1 89  ? 19.299  -3.619  -1.873  1.00 0.00 ? 89  GLU A HA   5  
ATOM 8694  H HB2  . GLU A 1 89  ? 20.204  -5.423  -3.080  1.00 0.00 ? 89  GLU A HB2  5  
ATOM 8695  H HB3  . GLU A 1 89  ? 19.069  -6.161  -1.959  1.00 0.00 ? 89  GLU A HB3  5  
ATOM 8696  H HG2  . GLU A 1 89  ? 17.390  -6.073  -3.880  1.00 0.00 ? 89  GLU A HG2  5  
ATOM 8697  H HG3  . GLU A 1 89  ? 18.782  -5.752  -4.912  1.00 0.00 ? 89  GLU A HG3  5  
ATOM 8698  N N    . VAL A 1 90  ? 17.260  -3.622  -4.453  1.00 0.00 ? 90  VAL A N    5  
ATOM 8699  C CA   . VAL A 1 90  ? 16.931  -2.931  -5.694  1.00 0.00 ? 90  VAL A CA   5  
ATOM 8700  C C    . VAL A 1 90  ? 16.903  -1.420  -5.491  1.00 0.00 ? 90  VAL A C    5  
ATOM 8701  O O    . VAL A 1 90  ? 17.360  -0.659  -6.345  1.00 0.00 ? 90  VAL A O    5  
ATOM 8702  C CB   . VAL A 1 90  ? 15.569  -3.390  -6.248  1.00 0.00 ? 90  VAL A CB   5  
ATOM 8703  C CG1  . VAL A 1 90  ? 15.231  -2.636  -7.525  1.00 0.00 ? 90  VAL A CG1  5  
ATOM 8704  C CG2  . VAL A 1 90  ? 15.571  -4.891  -6.490  1.00 0.00 ? 90  VAL A CG2  5  
ATOM 8705  H H    . VAL A 1 90  ? 16.645  -4.303  -4.108  1.00 0.00 ? 90  VAL A H    5  
ATOM 8706  H HA   . VAL A 1 90  ? 17.692  -3.172  -6.422  1.00 0.00 ? 90  VAL A HA   5  
ATOM 8707  H HB   . VAL A 1 90  ? 14.810  -3.166  -5.512  1.00 0.00 ? 90  VAL A HB   5  
ATOM 8708  H HG11 . VAL A 1 90  ? 14.335  -2.052  -7.371  1.00 0.00 ? 90  VAL A HG11 5  
ATOM 8709  H HG12 . VAL A 1 90  ? 16.049  -1.981  -7.784  1.00 0.00 ? 90  VAL A HG12 5  
ATOM 8710  H HG13 . VAL A 1 90  ? 15.066  -3.342  -8.326  1.00 0.00 ? 90  VAL A HG13 5  
ATOM 8711  H HG21 . VAL A 1 90  ? 16.124  -5.109  -7.391  1.00 0.00 ? 90  VAL A HG21 5  
ATOM 8712  H HG22 . VAL A 1 90  ? 16.037  -5.391  -5.652  1.00 0.00 ? 90  VAL A HG22 5  
ATOM 8713  H HG23 . VAL A 1 90  ? 14.555  -5.241  -6.596  1.00 0.00 ? 90  VAL A HG23 5  
ATOM 8714  N N    . LEU A 1 91  ? 16.363  -0.992  -4.355  1.00 0.00 ? 91  LEU A N    5  
ATOM 8715  C CA   . LEU A 1 91  ? 16.275  0.429   -4.039  1.00 0.00 ? 91  LEU A CA   5  
ATOM 8716  C C    . LEU A 1 91  ? 17.663  1.033   -3.853  1.00 0.00 ? 91  LEU A C    5  
ATOM 8717  O O    . LEU A 1 91  ? 17.967  2.094   -4.399  1.00 0.00 ? 91  LEU A O    5  
ATOM 8718  C CB   . LEU A 1 91  ? 15.441  0.639   -2.773  1.00 0.00 ? 91  LEU A CB   5  
ATOM 8719  C CG   . LEU A 1 91  ? 14.055  -0.006  -2.767  1.00 0.00 ? 91  LEU A CG   5  
ATOM 8720  C CD1  . LEU A 1 91  ? 13.442  0.059   -1.377  1.00 0.00 ? 91  LEU A CD1  5  
ATOM 8721  C CD2  . LEU A 1 91  ? 13.148  0.670   -3.785  1.00 0.00 ? 91  LEU A CD2  5  
ATOM 8722  H H    . LEU A 1 91  ? 16.015  -1.646  -3.714  1.00 0.00 ? 91  LEU A H    5  
ATOM 8723  H HA   . LEU A 1 91  ? 15.788  0.924   -4.866  1.00 0.00 ? 91  LEU A HA   5  
ATOM 8724  H HB2  . LEU A 1 91  ? 15.997  0.236   -1.941  1.00 0.00 ? 91  LEU A HB2  5  
ATOM 8725  H HB3  . LEU A 1 91  ? 15.312  1.704   -2.636  1.00 0.00 ? 91  LEU A HB3  5  
ATOM 8726  H HG   . LEU A 1 91  ? 14.149  -1.048  -3.042  1.00 0.00 ? 91  LEU A HG   5  
ATOM 8727  H HD11 . LEU A 1 91  ? 14.223  0.196   -0.645  1.00 0.00 ? 91  LEU A HD11 5  
ATOM 8728  H HD12 . LEU A 1 91  ? 12.915  -0.861  -1.173  1.00 0.00 ? 91  LEU A HD12 5  
ATOM 8729  H HD13 . LEU A 1 91  ? 12.751  0.888   -1.327  1.00 0.00 ? 91  LEU A HD13 5  
ATOM 8730  H HD21 . LEU A 1 91  ? 13.609  0.629   -4.760  1.00 0.00 ? 91  LEU A HD21 5  
ATOM 8731  H HD22 . LEU A 1 91  ? 12.995  1.701   -3.501  1.00 0.00 ? 91  LEU A HD22 5  
ATOM 8732  H HD23 . LEU A 1 91  ? 12.197  0.159   -3.815  1.00 0.00 ? 91  LEU A HD23 5  
ATOM 8733  N N    . ARG A 1 92  ? 18.502  0.349   -3.081  1.00 0.00 ? 92  ARG A N    5  
ATOM 8734  C CA   . ARG A 1 92  ? 19.858  0.818   -2.825  1.00 0.00 ? 92  ARG A CA   5  
ATOM 8735  C C    . ARG A 1 92  ? 20.630  0.988   -4.130  1.00 0.00 ? 92  ARG A C    5  
ATOM 8736  O O    . ARG A 1 92  ? 21.336  1.978   -4.320  1.00 0.00 ? 92  ARG A O    5  
ATOM 8737  C CB   . ARG A 1 92  ? 20.594  -0.162  -1.909  1.00 0.00 ? 92  ARG A CB   5  
ATOM 8738  C CG   . ARG A 1 92  ? 20.040  -0.205  -0.494  1.00 0.00 ? 92  ARG A CG   5  
ATOM 8739  C CD   . ARG A 1 92  ? 21.001  -0.899  0.459   1.00 0.00 ? 92  ARG A CD   5  
ATOM 8740  N NE   . ARG A 1 92  ? 21.949  0.038   1.058   1.00 0.00 ? 92  ARG A NE   5  
ATOM 8741  C CZ   . ARG A 1 92  ? 21.681  0.767   2.135   1.00 0.00 ? 92  ARG A CZ   5  
ATOM 8742  N NH1  . ARG A 1 92  ? 20.499  0.668   2.729   1.00 0.00 ? 92  ARG A NH1  5  
ATOM 8743  N NH2  . ARG A 1 92  ? 22.595  1.597   2.621   1.00 0.00 ? 92  ARG A NH2  5  
ATOM 8744  H H    . ARG A 1 92  ? 18.201  -0.490  -2.674  1.00 0.00 ? 92  ARG A H    5  
ATOM 8745  H HA   . ARG A 1 92  ? 19.791  1.776   -2.333  1.00 0.00 ? 92  ARG A HA   5  
ATOM 8746  H HB2  . ARG A 1 92  ? 20.523  -1.154  -2.330  1.00 0.00 ? 92  ARG A HB2  5  
ATOM 8747  H HB3  . ARG A 1 92  ? 21.633  0.125   -1.856  1.00 0.00 ? 92  ARG A HB3  5  
ATOM 8748  H HG2  . ARG A 1 92  ? 19.876  0.805   -0.150  1.00 0.00 ? 92  ARG A HG2  5  
ATOM 8749  H HG3  . ARG A 1 92  ? 19.103  -0.742  -0.501  1.00 0.00 ? 92  ARG A HG3  5  
ATOM 8750  H HD2  . ARG A 1 92  ? 20.430  -1.370  1.245   1.00 0.00 ? 92  ARG A HD2  5  
ATOM 8751  H HD3  . ARG A 1 92  ? 21.549  -1.651  -0.088  1.00 0.00 ? 92  ARG A HD3  5  
ATOM 8752  H HE   . ARG A 1 92  ? 22.828  0.126   0.635   1.00 0.00 ? 92  ARG A HE   5  
ATOM 8753  H HH11 . ARG A 1 92  ? 19.809  0.043   2.366   1.00 0.00 ? 92  ARG A HH11 5  
ATOM 8754  H HH12 . ARG A 1 92  ? 20.300  1.217   3.541   1.00 0.00 ? 92  ARG A HH12 5  
ATOM 8755  H HH21 . ARG A 1 92  ? 23.487  1.674   2.176   1.00 0.00 ? 92  ARG A HH21 5  
ATOM 8756  H HH22 . ARG A 1 92  ? 22.392  2.145   3.431   1.00 0.00 ? 92  ARG A HH22 5  
ATOM 8757  N N    . ASN A 1 93  ? 20.491  0.016   -5.025  1.00 0.00 ? 93  ASN A N    5  
ATOM 8758  C CA   . ASN A 1 93  ? 21.177  0.057   -6.312  1.00 0.00 ? 93  ASN A CA   5  
ATOM 8759  C C    . ASN A 1 93  ? 20.783  1.305   -7.097  1.00 0.00 ? 93  ASN A C    5  
ATOM 8760  O O    . ASN A 1 93  ? 21.606  1.896   -7.796  1.00 0.00 ? 93  ASN A O    5  
ATOM 8761  C CB   . ASN A 1 93  ? 20.852  -1.196  -7.127  1.00 0.00 ? 93  ASN A CB   5  
ATOM 8762  C CG   . ASN A 1 93  ? 21.783  -2.350  -6.809  1.00 0.00 ? 93  ASN A CG   5  
ATOM 8763  O OD1  . ASN A 1 93  ? 22.803  -2.540  -7.472  1.00 0.00 ? 93  ASN A OD1  5  
ATOM 8764  N ND2  . ASN A 1 93  ? 21.434  -3.128  -5.791  1.00 0.00 ? 93  ASN A ND2  5  
ATOM 8765  H H    . ASN A 1 93  ? 19.914  -0.748  -4.816  1.00 0.00 ? 93  ASN A H    5  
ATOM 8766  H HA   . ASN A 1 93  ? 22.239  0.086   -6.121  1.00 0.00 ? 93  ASN A HA   5  
ATOM 8767  H HB2  . ASN A 1 93  ? 19.839  -1.506  -6.912  1.00 0.00 ? 93  ASN A HB2  5  
ATOM 8768  H HB3  . ASN A 1 93  ? 20.937  -0.967  -8.179  1.00 0.00 ? 93  ASN A HB3  5  
ATOM 8769  H HD21 . ASN A 1 93  ? 20.608  -2.916  -5.308  1.00 0.00 ? 93  ASN A HD21 5  
ATOM 8770  H HD22 . ASN A 1 93  ? 22.019  -3.881  -5.563  1.00 0.00 ? 93  ASN A HD22 5  
ATOM 8771  N N    . ALA A 1 94  ? 19.520  1.700   -6.977  1.00 0.00 ? 94  ALA A N    5  
ATOM 8772  C CA   . ALA A 1 94  ? 19.018  2.878   -7.673  1.00 0.00 ? 94  ALA A CA   5  
ATOM 8773  C C    . ALA A 1 94  ? 19.719  4.143   -7.187  1.00 0.00 ? 94  ALA A C    5  
ATOM 8774  O O    . ALA A 1 94  ? 20.063  4.261   -6.011  1.00 0.00 ? 94  ALA A O    5  
ATOM 8775  C CB   . ALA A 1 94  ? 17.513  3.001   -7.485  1.00 0.00 ? 94  ALA A CB   5  
ATOM 8776  H H    . ALA A 1 94  ? 18.912  1.187   -6.405  1.00 0.00 ? 94  ALA A H    5  
ATOM 8777  H HA   . ALA A 1 94  ? 19.216  2.752   -8.727  1.00 0.00 ? 94  ALA A HA   5  
ATOM 8778  H HB1  . ALA A 1 94  ? 17.128  2.083   -7.064  1.00 0.00 ? 94  ALA A HB1  5  
ATOM 8779  H HB2  . ALA A 1 94  ? 17.300  3.822   -6.817  1.00 0.00 ? 94  ALA A HB2  5  
ATOM 8780  H HB3  . ALA A 1 94  ? 17.046  3.182   -8.441  1.00 0.00 ? 94  ALA A HB3  5  
ATOM 8781  N N    . GLY A 1 95  ? 19.927  5.086   -8.100  1.00 0.00 ? 95  GLY A N    5  
ATOM 8782  C CA   . GLY A 1 95  ? 20.586  6.330   -7.744  1.00 0.00 ? 95  GLY A CA   5  
ATOM 8783  C C    . GLY A 1 95  ? 19.617  7.490   -7.640  1.00 0.00 ? 95  GLY A C    5  
ATOM 8784  O O    . GLY A 1 95  ? 18.449  7.303   -7.301  1.00 0.00 ? 95  GLY A O    5  
ATOM 8785  H H    . GLY A 1 95  ? 19.631  4.937   -9.022  1.00 0.00 ? 95  GLY A H    5  
ATOM 8786  H HA2  . GLY A 1 95  ? 21.083  6.202   -6.794  1.00 0.00 ? 95  GLY A HA2  5  
ATOM 8787  H HA3  . GLY A 1 95  ? 21.326  6.559   -8.497  1.00 0.00 ? 95  GLY A HA3  5  
ATOM 8788  N N    . GLN A 1 96  ? 20.103  8.693   -7.931  1.00 0.00 ? 96  GLN A N    5  
ATOM 8789  C CA   . GLN A 1 96  ? 19.272  9.889   -7.866  1.00 0.00 ? 96  GLN A CA   5  
ATOM 8790  C C    . GLN A 1 96  ? 17.953  9.675   -8.602  1.00 0.00 ? 96  GLN A C    5  
ATOM 8791  O O    . GLN A 1 96  ? 16.878  9.756   -8.007  1.00 0.00 ? 96  GLN A O    5  
ATOM 8792  C CB   . GLN A 1 96  ? 20.014  11.085  -8.463  1.00 0.00 ? 96  GLN A CB   5  
ATOM 8793  C CG   . GLN A 1 96  ? 19.483  12.429  -7.991  1.00 0.00 ? 96  GLN A CG   5  
ATOM 8794  C CD   . GLN A 1 96  ? 20.497  13.545  -8.145  1.00 0.00 ? 96  GLN A CD   5  
ATOM 8795  O OE1  . GLN A 1 96  ? 21.126  13.687  -9.194  1.00 0.00 ? 96  GLN A OE1  5  
ATOM 8796  N NE2  . GLN A 1 96  ? 20.662  14.344  -7.098  1.00 0.00 ? 96  GLN A NE2  5  
ATOM 8797  H H    . GLN A 1 96  ? 21.043  8.778   -8.195  1.00 0.00 ? 96  GLN A H    5  
ATOM 8798  H HA   . GLN A 1 96  ? 19.061  10.090  -6.827  1.00 0.00 ? 96  GLN A HA   5  
ATOM 8799  H HB2  . GLN A 1 96  ? 21.057  11.019  -8.191  1.00 0.00 ? 96  GLN A HB2  5  
ATOM 8800  H HB3  . GLN A 1 96  ? 19.928  11.047  -9.539  1.00 0.00 ? 96  GLN A HB3  5  
ATOM 8801  H HG2  . GLN A 1 96  ? 18.606  12.678  -8.570  1.00 0.00 ? 96  GLN A HG2  5  
ATOM 8802  H HG3  . GLN A 1 96  ? 19.213  12.348  -6.948  1.00 0.00 ? 96  GLN A HG3  5  
ATOM 8803  H HE21 . GLN A 1 96  ? 20.127  14.170  -6.294  1.00 0.00 ? 96  GLN A HE21 5  
ATOM 8804  H HE22 . GLN A 1 96  ? 21.312  15.073  -7.169  1.00 0.00 ? 96  GLN A HE22 5  
ATOM 8805  N N    . VAL A 1 97  ? 18.042  9.402   -9.900  1.00 0.00 ? 97  VAL A N    5  
ATOM 8806  C CA   . VAL A 1 97  ? 16.856  9.176   -10.717 1.00 0.00 ? 97  VAL A CA   5  
ATOM 8807  C C    . VAL A 1 97  ? 16.234  7.817   -10.419 1.00 0.00 ? 97  VAL A C    5  
ATOM 8808  O O    . VAL A 1 97  ? 16.716  6.785   -10.889 1.00 0.00 ? 97  VAL A O    5  
ATOM 8809  C CB   . VAL A 1 97  ? 17.185  9.260   -12.219 1.00 0.00 ? 97  VAL A CB   5  
ATOM 8810  C CG1  . VAL A 1 97  ? 15.941  8.999   -13.054 1.00 0.00 ? 97  VAL A CG1  5  
ATOM 8811  C CG2  . VAL A 1 97  ? 17.789  10.615  -12.557 1.00 0.00 ? 97  VAL A CG2  5  
ATOM 8812  H H    . VAL A 1 97  ? 18.927  9.351   -10.318 1.00 0.00 ? 97  VAL A H    5  
ATOM 8813  H HA   . VAL A 1 97  ? 16.138  9.949   -10.484 1.00 0.00 ? 97  VAL A HA   5  
ATOM 8814  H HB   . VAL A 1 97  ? 17.913  8.497   -12.451 1.00 0.00 ? 97  VAL A HB   5  
ATOM 8815  H HG11 . VAL A 1 97  ? 15.549  9.938   -13.419 1.00 0.00 ? 97  VAL A HG11 5  
ATOM 8816  H HG12 . VAL A 1 97  ? 16.194  8.364   -13.890 1.00 0.00 ? 97  VAL A HG12 5  
ATOM 8817  H HG13 . VAL A 1 97  ? 15.194  8.512   -12.444 1.00 0.00 ? 97  VAL A HG13 5  
ATOM 8818  H HG21 . VAL A 1 97  ? 17.468  11.343  -11.828 1.00 0.00 ? 97  VAL A HG21 5  
ATOM 8819  H HG22 . VAL A 1 97  ? 18.867  10.542  -12.542 1.00 0.00 ? 97  VAL A HG22 5  
ATOM 8820  H HG23 . VAL A 1 97  ? 17.463  10.920  -13.540 1.00 0.00 ? 97  VAL A HG23 5  
ATOM 8821  N N    . VAL A 1 98  ? 15.160  7.822   -9.636  1.00 0.00 ? 98  VAL A N    5  
ATOM 8822  C CA   . VAL A 1 98  ? 14.471  6.588   -9.276  1.00 0.00 ? 98  VAL A CA   5  
ATOM 8823  C C    . VAL A 1 98  ? 13.098  6.515   -9.935  1.00 0.00 ? 98  VAL A C    5  
ATOM 8824  O O    . VAL A 1 98  ? 12.156  7.184   -9.508  1.00 0.00 ? 98  VAL A O    5  
ATOM 8825  C CB   . VAL A 1 98  ? 14.303  6.464   -7.750  1.00 0.00 ? 98  VAL A CB   5  
ATOM 8826  C CG1  . VAL A 1 98  ? 13.577  5.175   -7.396  1.00 0.00 ? 98  VAL A CG1  5  
ATOM 8827  C CG2  . VAL A 1 98  ? 15.657  6.529   -7.059  1.00 0.00 ? 98  VAL A CG2  5  
ATOM 8828  H H    . VAL A 1 98  ? 14.823  8.675   -9.292  1.00 0.00 ? 98  VAL A H    5  
ATOM 8829  H HA   . VAL A 1 98  ? 15.070  5.758   -9.621  1.00 0.00 ? 98  VAL A HA   5  
ATOM 8830  H HB   . VAL A 1 98  ? 13.706  7.294   -7.405  1.00 0.00 ? 98  VAL A HB   5  
ATOM 8831  H HG11 . VAL A 1 98  ? 13.202  5.240   -6.385  1.00 0.00 ? 98  VAL A HG11 5  
ATOM 8832  H HG12 . VAL A 1 98  ? 12.752  5.028   -8.078  1.00 0.00 ? 98  VAL A HG12 5  
ATOM 8833  H HG13 . VAL A 1 98  ? 14.261  4.343   -7.473  1.00 0.00 ? 98  VAL A HG13 5  
ATOM 8834  H HG21 . VAL A 1 98  ? 16.187  5.602   -7.219  1.00 0.00 ? 98  VAL A HG21 5  
ATOM 8835  H HG22 . VAL A 1 98  ? 16.232  7.347   -7.469  1.00 0.00 ? 98  VAL A HG22 5  
ATOM 8836  H HG23 . VAL A 1 98  ? 15.514  6.685   -6.000  1.00 0.00 ? 98  VAL A HG23 5  
ATOM 8837  N N    . HIS A 1 99  ? 12.990  5.696   -10.977 1.00 0.00 ? 99  HIS A N    5  
ATOM 8838  C CA   . HIS A 1 99  ? 11.731  5.534   -11.694 1.00 0.00 ? 99  HIS A CA   5  
ATOM 8839  C C    . HIS A 1 99  ? 10.894  4.418   -11.077 1.00 0.00 ? 99  HIS A C    5  
ATOM 8840  O O    . HIS A 1 99  ? 11.037  3.248   -11.435 1.00 0.00 ? 99  HIS A O    5  
ATOM 8841  C CB   . HIS A 1 99  ? 11.996  5.231   -13.170 1.00 0.00 ? 99  HIS A CB   5  
ATOM 8842  C CG   . HIS A 1 99  ? 12.238  6.455   -13.998 1.00 0.00 ? 99  HIS A CG   5  
ATOM 8843  N ND1  . HIS A 1 99  ? 13.361  6.624   -14.780 1.00 0.00 ? 99  HIS A ND1  5  
ATOM 8844  C CD2  . HIS A 1 99  ? 11.494  7.574   -14.164 1.00 0.00 ? 99  HIS A CD2  5  
ATOM 8845  C CE1  . HIS A 1 99  ? 13.298  7.794   -15.390 1.00 0.00 ? 99  HIS A CE1  5  
ATOM 8846  N NE2  . HIS A 1 99  ? 12.174  8.390   -15.034 1.00 0.00 ? 99  HIS A NE2  5  
ATOM 8847  H H    . HIS A 1 99  ? 13.776  5.190   -11.269 1.00 0.00 ? 99  HIS A H    5  
ATOM 8848  H HA   . HIS A 1 99  ? 11.184  6.461   -11.619 1.00 0.00 ? 99  HIS A HA   5  
ATOM 8849  H HB2  . HIS A 1 99  ? 12.868  4.599   -13.250 1.00 0.00 ? 99  HIS A HB2  5  
ATOM 8850  H HB3  . HIS A 1 99  ? 11.142  4.714   -13.583 1.00 0.00 ? 99  HIS A HB3  5  
ATOM 8851  H HD1  . HIS A 1 99  ? 14.096  5.983   -14.873 1.00 0.00 ? 99  HIS A HD1  5  
ATOM 8852  H HD2  . HIS A 1 99  ? 10.542  7.786   -13.699 1.00 0.00 ? 99  HIS A HD2  5  
ATOM 8853  H HE1  . HIS A 1 99  ? 14.038  8.196   -16.066 1.00 0.00 ? 99  HIS A HE1  5  
ATOM 8854  H HE2  . HIS A 1 99  ? 11.920  9.305   -15.275 1.00 0.00 ? 99  HIS A HE2  5  
ATOM 8855  N N    . LEU A 1 100 ? 10.020  4.787   -10.146 1.00 0.00 ? 100 LEU A N    5  
ATOM 8856  C CA   . LEU A 1 100 ? 9.160   3.817   -9.477  1.00 0.00 ? 100 LEU A CA   5  
ATOM 8857  C C    . LEU A 1 100 ? 7.920   3.520   -10.315 1.00 0.00 ? 100 LEU A C    5  
ATOM 8858  O O    . LEU A 1 100 ? 7.257   4.432   -10.808 1.00 0.00 ? 100 LEU A O    5  
ATOM 8859  C CB   . LEU A 1 100 ? 8.746   4.337   -8.100  1.00 0.00 ? 100 LEU A CB   5  
ATOM 8860  C CG   . LEU A 1 100 ? 8.514   3.276   -7.023  1.00 0.00 ? 100 LEU A CG   5  
ATOM 8861  C CD1  . LEU A 1 100 ? 7.640   2.153   -7.561  1.00 0.00 ? 100 LEU A CD1  5  
ATOM 8862  C CD2  . LEU A 1 100 ? 9.841   2.728   -6.520  1.00 0.00 ? 100 LEU A CD2  5  
ATOM 8863  H H    . LEU A 1 100 ? 9.951   5.733   -9.902  1.00 0.00 ? 100 LEU A H    5  
ATOM 8864  H HA   . LEU A 1 100 ? 9.723   2.904   -9.354  1.00 0.00 ? 100 LEU A HA   5  
ATOM 8865  H HB2  . LEU A 1 100 ? 9.523   4.999   -7.749  1.00 0.00 ? 100 LEU A HB2  5  
ATOM 8866  H HB3  . LEU A 1 100 ? 7.828   4.895   -8.220  1.00 0.00 ? 100 LEU A HB3  5  
ATOM 8867  H HG   . LEU A 1 100 ? 7.998   3.728   -6.187  1.00 0.00 ? 100 LEU A HG   5  
ATOM 8868  H HD11 . LEU A 1 100 ? 6.915   2.559   -8.249  1.00 0.00 ? 100 LEU A HD11 5  
ATOM 8869  H HD12 . LEU A 1 100 ? 7.128   1.672   -6.741  1.00 0.00 ? 100 LEU A HD12 5  
ATOM 8870  H HD13 . LEU A 1 100 ? 8.258   1.430   -8.073  1.00 0.00 ? 100 LEU A HD13 5  
ATOM 8871  H HD21 . LEU A 1 100 ? 9.701   2.290   -5.542  1.00 0.00 ? 100 LEU A HD21 5  
ATOM 8872  H HD22 . LEU A 1 100 ? 10.560  3.531   -6.454  1.00 0.00 ? 100 LEU A HD22 5  
ATOM 8873  H HD23 . LEU A 1 100 ? 10.202  1.975   -7.204  1.00 0.00 ? 100 LEU A HD23 5  
ATOM 8874  N N    . THR A 1 101 ? 7.611   2.236   -10.471 1.00 0.00 ? 101 THR A N    5  
ATOM 8875  C CA   . THR A 1 101 ? 6.451   1.818   -11.247 1.00 0.00 ? 101 THR A CA   5  
ATOM 8876  C C    . THR A 1 101 ? 5.334   1.316   -10.340 1.00 0.00 ? 101 THR A C    5  
ATOM 8877  O O    . THR A 1 101 ? 5.448   0.255   -9.725  1.00 0.00 ? 101 THR A O    5  
ATOM 8878  C CB   . THR A 1 101 ? 6.817   0.710   -12.252 1.00 0.00 ? 101 THR A CB   5  
ATOM 8879  O OG1  . THR A 1 101 ? 7.994   1.078   -12.980 1.00 0.00 ? 101 THR A OG1  5  
ATOM 8880  C CG2  . THR A 1 101 ? 5.672   0.459   -13.222 1.00 0.00 ? 101 THR A CG2  5  
ATOM 8881  H H    . THR A 1 101 ? 8.179   1.555   -10.054 1.00 0.00 ? 101 THR A H    5  
ATOM 8882  H HA   . THR A 1 101 ? 6.095   2.674   -11.802 1.00 0.00 ? 101 THR A HA   5  
ATOM 8883  H HB   . THR A 1 101 ? 7.012   -0.202  -11.705 1.00 0.00 ? 101 THR A HB   5  
ATOM 8884  H HG1  . THR A 1 101 ? 7.893   1.969   -13.323 1.00 0.00 ? 101 THR A HG1  5  
ATOM 8885  H HG21 . THR A 1 101 ? 4.731   0.563   -12.703 1.00 0.00 ? 101 THR A HG21 5  
ATOM 8886  H HG22 . THR A 1 101 ? 5.754   -0.540  -13.625 1.00 0.00 ? 101 THR A HG22 5  
ATOM 8887  H HG23 . THR A 1 101 ? 5.720   1.176   -14.028 1.00 0.00 ? 101 THR A HG23 5  
ATOM 8888  N N    . LEU A 1 102 ? 4.253   2.085   -10.260 1.00 0.00 ? 102 LEU A N    5  
ATOM 8889  C CA   . LEU A 1 102 ? 3.113   1.718   -9.427  1.00 0.00 ? 102 LEU A CA   5  
ATOM 8890  C C    . LEU A 1 102 ? 1.838   1.628   -10.258 1.00 0.00 ? 102 LEU A C    5  
ATOM 8891  O O    . LEU A 1 102 ? 1.788   2.107   -11.391 1.00 0.00 ? 102 LEU A O    5  
ATOM 8892  C CB   . LEU A 1 102 ? 2.930   2.736   -8.300  1.00 0.00 ? 102 LEU A CB   5  
ATOM 8893  C CG   . LEU A 1 102 ? 4.212   3.242   -7.638  1.00 0.00 ? 102 LEU A CG   5  
ATOM 8894  C CD1  . LEU A 1 102 ? 4.802   4.398   -8.431  1.00 0.00 ? 102 LEU A CD1  5  
ATOM 8895  C CD2  . LEU A 1 102 ? 3.941   3.662   -6.201  1.00 0.00 ? 102 LEU A CD2  5  
ATOM 8896  H H    . LEU A 1 102 ? 4.220   2.919   -10.772 1.00 0.00 ? 102 LEU A H    5  
ATOM 8897  H HA   . LEU A 1 102 ? 3.316   0.749   -8.996  1.00 0.00 ? 102 LEU A HA   5  
ATOM 8898  H HB2  . LEU A 1 102 ? 2.410   3.589   -8.707  1.00 0.00 ? 102 LEU A HB2  5  
ATOM 8899  H HB3  . LEU A 1 102 ? 2.321   2.276   -7.535  1.00 0.00 ? 102 LEU A HB3  5  
ATOM 8900  H HG   . LEU A 1 102 ? 4.941   2.443   -7.622  1.00 0.00 ? 102 LEU A HG   5  
ATOM 8901  H HD11 . LEU A 1 102 ? 4.217   4.558   -9.324  1.00 0.00 ? 102 LEU A HD11 5  
ATOM 8902  H HD12 . LEU A 1 102 ? 5.820   4.165   -8.705  1.00 0.00 ? 102 LEU A HD12 5  
ATOM 8903  H HD13 . LEU A 1 102 ? 4.789   5.293   -7.826  1.00 0.00 ? 102 LEU A HD13 5  
ATOM 8904  H HD21 . LEU A 1 102 ? 3.251   4.493   -6.194  1.00 0.00 ? 102 LEU A HD21 5  
ATOM 8905  H HD22 . LEU A 1 102 ? 4.867   3.959   -5.732  1.00 0.00 ? 102 LEU A HD22 5  
ATOM 8906  H HD23 . LEU A 1 102 ? 3.511   2.833   -5.659  1.00 0.00 ? 102 LEU A HD23 5  
ATOM 8907  N N    . VAL A 1 103 ? 0.807   1.012   -9.688  1.00 0.00 ? 103 VAL A N    5  
ATOM 8908  C CA   . VAL A 1 103 ? -0.470  0.862   -10.375 1.00 0.00 ? 103 VAL A CA   5  
ATOM 8909  C C    . VAL A 1 103 ? -1.637  1.085   -9.419  1.00 0.00 ? 103 VAL A C    5  
ATOM 8910  O O    . VAL A 1 103 ? -1.932  0.239   -8.575  1.00 0.00 ? 103 VAL A O    5  
ATOM 8911  C CB   . VAL A 1 103 ? -0.604  -0.533  -11.014 1.00 0.00 ? 103 VAL A CB   5  
ATOM 8912  C CG1  . VAL A 1 103 ? -0.134  -1.610  -10.048 1.00 0.00 ? 103 VAL A CG1  5  
ATOM 8913  C CG2  . VAL A 1 103 ? -2.039  -0.784  -11.449 1.00 0.00 ? 103 VAL A CG2  5  
ATOM 8914  H H    . VAL A 1 103 ? 0.908   0.651   -8.782  1.00 0.00 ? 103 VAL A H    5  
ATOM 8915  H HA   . VAL A 1 103 ? -0.515  1.602   -11.161 1.00 0.00 ? 103 VAL A HA   5  
ATOM 8916  H HB   . VAL A 1 103 ? 0.027   -0.566  -11.890 1.00 0.00 ? 103 VAL A HB   5  
ATOM 8917  H HG11 . VAL A 1 103 ? 0.368   -2.392  -10.598 1.00 0.00 ? 103 VAL A HG11 5  
ATOM 8918  H HG12 . VAL A 1 103 ? 0.547   -1.178  -9.330  1.00 0.00 ? 103 VAL A HG12 5  
ATOM 8919  H HG13 . VAL A 1 103 ? -0.987  -2.025  -9.531  1.00 0.00 ? 103 VAL A HG13 5  
ATOM 8920  H HG21 . VAL A 1 103 ? -2.696  -0.677  -10.599 1.00 0.00 ? 103 VAL A HG21 5  
ATOM 8921  H HG22 . VAL A 1 103 ? -2.316  -0.068  -12.210 1.00 0.00 ? 103 VAL A HG22 5  
ATOM 8922  H HG23 . VAL A 1 103 ? -2.125  -1.783  -11.848 1.00 0.00 ? 103 VAL A HG23 5  
ATOM 8923  N N    . ARG A 1 104 ? -2.299  2.229   -9.559  1.00 0.00 ? 104 ARG A N    5  
ATOM 8924  C CA   . ARG A 1 104 ? -3.435  2.564   -8.708  1.00 0.00 ? 104 ARG A CA   5  
ATOM 8925  C C    . ARG A 1 104 ? -4.749  2.394   -9.464  1.00 0.00 ? 104 ARG A C    5  
ATOM 8926  O O    . ARG A 1 104 ? -4.771  2.375   -10.695 1.00 0.00 ? 104 ARG A O    5  
ATOM 8927  C CB   . ARG A 1 104 ? -3.310  4.000   -8.197  1.00 0.00 ? 104 ARG A CB   5  
ATOM 8928  C CG   . ARG A 1 104 ? -2.107  4.222   -7.294  1.00 0.00 ? 104 ARG A CG   5  
ATOM 8929  C CD   . ARG A 1 104 ? -1.764  5.699   -7.177  1.00 0.00 ? 104 ARG A CD   5  
ATOM 8930  N NE   . ARG A 1 104 ? -2.852  6.469   -6.582  1.00 0.00 ? 104 ARG A NE   5  
ATOM 8931  C CZ   . ARG A 1 104 ? -2.682  7.647   -5.991  1.00 0.00 ? 104 ARG A CZ   5  
ATOM 8932  N NH1  . ARG A 1 104 ? -1.474  8.187   -5.917  1.00 0.00 ? 104 ARG A NH1  5  
ATOM 8933  N NH2  . ARG A 1 104 ? -3.723  8.287   -5.472  1.00 0.00 ? 104 ARG A NH2  5  
ATOM 8934  H H    . ARG A 1 104 ? -2.017  2.864   -10.251 1.00 0.00 ? 104 ARG A H    5  
ATOM 8935  H HA   . ARG A 1 104 ? -3.428  1.889   -7.866  1.00 0.00 ? 104 ARG A HA   5  
ATOM 8936  H HB2  . ARG A 1 104 ? -3.224  4.666   -9.043  1.00 0.00 ? 104 ARG A HB2  5  
ATOM 8937  H HB3  . ARG A 1 104 ? -4.201  4.250   -7.641  1.00 0.00 ? 104 ARG A HB3  5  
ATOM 8938  H HG2  . ARG A 1 104 ? -2.331  3.838   -6.310  1.00 0.00 ? 104 ARG A HG2  5  
ATOM 8939  H HG3  . ARG A 1 104 ? -1.259  3.695   -7.704  1.00 0.00 ? 104 ARG A HG3  5  
ATOM 8940  H HD2  . ARG A 1 104 ? -0.883  5.803   -6.561  1.00 0.00 ? 104 ARG A HD2  5  
ATOM 8941  H HD3  . ARG A 1 104 ? -1.559  6.086   -8.164  1.00 0.00 ? 104 ARG A HD3  5  
ATOM 8942  H HE   . ARG A 1 104 ? -3.754  6.089   -6.625  1.00 0.00 ? 104 ARG A HE   5  
ATOM 8943  H HH11 . ARG A 1 104 ? -0.688  7.707   -6.308  1.00 0.00 ? 104 ARG A HH11 5  
ATOM 8944  H HH12 . ARG A 1 104 ? -1.349  9.074   -5.473  1.00 0.00 ? 104 ARG A HH12 5  
ATOM 8945  H HH21 . ARG A 1 104 ? -4.635  7.882   -5.526  1.00 0.00 ? 104 ARG A HH21 5  
ATOM 8946  H HH22 . ARG A 1 104 ? -3.594  9.172   -5.028  1.00 0.00 ? 104 ARG A HH22 5  
ATOM 8947  N N    . ARG A 1 105 ? -5.843  2.271   -8.719  1.00 0.00 ? 105 ARG A N    5  
ATOM 8948  C CA   . ARG A 1 105 ? -7.161  2.102   -9.318  1.00 0.00 ? 105 ARG A CA   5  
ATOM 8949  C C    . ARG A 1 105 ? -7.628  3.395   -9.980  1.00 0.00 ? 105 ARG A C    5  
ATOM 8950  O O    . ARG A 1 105 ? -7.648  4.454   -9.353  1.00 0.00 ? 105 ARG A O    5  
ATOM 8951  C CB   . ARG A 1 105 ? -8.174  1.664   -8.259  1.00 0.00 ? 105 ARG A CB   5  
ATOM 8952  C CG   . ARG A 1 105 ? -9.448  1.074   -8.842  1.00 0.00 ? 105 ARG A CG   5  
ATOM 8953  C CD   . ARG A 1 105 ? -10.093 0.085   -7.883  1.00 0.00 ? 105 ARG A CD   5  
ATOM 8954  N NE   . ARG A 1 105 ? -11.542 0.021   -8.056  1.00 0.00 ? 105 ARG A NE   5  
ATOM 8955  C CZ   . ARG A 1 105 ? -12.387 0.875   -7.489  1.00 0.00 ? 105 ARG A CZ   5  
ATOM 8956  N NH1  . ARG A 1 105 ? -11.931 1.853   -6.719  1.00 0.00 ? 105 ARG A NH1  5  
ATOM 8957  N NH2  . ARG A 1 105 ? -13.693 0.752   -7.694  1.00 0.00 ? 105 ARG A NH2  5  
ATOM 8958  H H    . ARG A 1 105 ? -5.761  2.294   -7.742  1.00 0.00 ? 105 ARG A H    5  
ATOM 8959  H HA   . ARG A 1 105 ? -7.086  1.332   -10.072 1.00 0.00 ? 105 ARG A HA   5  
ATOM 8960  H HB2  . ARG A 1 105 ? -7.716  0.919   -7.625  1.00 0.00 ? 105 ARG A HB2  5  
ATOM 8961  H HB3  . ARG A 1 105 ? -8.441  2.520   -7.659  1.00 0.00 ? 105 ARG A HB3  5  
ATOM 8962  H HG2  . ARG A 1 105 ? -10.146 1.874   -9.039  1.00 0.00 ? 105 ARG A HG2  5  
ATOM 8963  H HG3  . ARG A 1 105 ? -9.209  0.566   -9.764  1.00 0.00 ? 105 ARG A HG3  5  
ATOM 8964  H HD2  . ARG A 1 105 ? -9.675  -0.894  -8.063  1.00 0.00 ? 105 ARG A HD2  5  
ATOM 8965  H HD3  . ARG A 1 105 ? -9.873  0.390   -6.871  1.00 0.00 ? 105 ARG A HD3  5  
ATOM 8966  H HE   . ARG A 1 105 ? -11.901 -0.693  -8.621  1.00 0.00 ? 105 ARG A HE   5  
ATOM 8967  H HH11 . ARG A 1 105 ? -10.948 1.948   -6.564  1.00 0.00 ? 105 ARG A HH11 5  
ATOM 8968  H HH12 . ARG A 1 105 ? -12.570 2.495   -6.294  1.00 0.00 ? 105 ARG A HH12 5  
ATOM 8969  H HH21 . ARG A 1 105 ? -14.040 0.016   -8.274  1.00 0.00 ? 105 ARG A HH21 5  
ATOM 8970  H HH22 . ARG A 1 105 ? -14.328 1.394   -7.267  1.00 0.00 ? 105 ARG A HH22 5  
ATOM 8971  N N    . LYS A 1 106 ? -8.002  3.301   -11.252 1.00 0.00 ? 106 LYS A N    5  
ATOM 8972  C CA   . LYS A 1 106 ? -8.470  4.462   -12.000 1.00 0.00 ? 106 LYS A CA   5  
ATOM 8973  C C    . LYS A 1 106 ? -9.865  4.877   -11.544 1.00 0.00 ? 106 LYS A C    5  
ATOM 8974  O O    . LYS A 1 106 ? -10.534 4.146   -10.813 1.00 0.00 ? 106 LYS A O    5  
ATOM 8975  C CB   . LYS A 1 106 ? -8.481  4.157   -13.500 1.00 0.00 ? 106 LYS A CB   5  
ATOM 8976  C CG   . LYS A 1 106 ? -7.143  3.675   -14.032 1.00 0.00 ? 106 LYS A CG   5  
ATOM 8977  C CD   . LYS A 1 106 ? -7.319  2.725   -15.205 1.00 0.00 ? 106 LYS A CD   5  
ATOM 8978  C CE   . LYS A 1 106 ? -7.267  3.464   -16.534 1.00 0.00 ? 106 LYS A CE   5  
ATOM 8979  N NZ   . LYS A 1 106 ? -6.760  2.595   -17.632 1.00 0.00 ? 106 LYS A NZ   5  
ATOM 8980  H H    . LYS A 1 106 ? -7.964  2.429   -11.698 1.00 0.00 ? 106 LYS A H    5  
ATOM 8981  H HA   . LYS A 1 106 ? -7.785  5.276   -11.812 1.00 0.00 ? 106 LYS A HA   5  
ATOM 8982  H HB2  . LYS A 1 106 ? -9.219  3.393   -13.694 1.00 0.00 ? 106 LYS A HB2  5  
ATOM 8983  H HB3  . LYS A 1 106 ? -8.756  5.055   -14.035 1.00 0.00 ? 106 LYS A HB3  5  
ATOM 8984  H HG2  . LYS A 1 106 ? -6.567  4.528   -14.358 1.00 0.00 ? 106 LYS A HG2  5  
ATOM 8985  H HG3  . LYS A 1 106 ? -6.614  3.162   -13.241 1.00 0.00 ? 106 LYS A HG3  5  
ATOM 8986  H HD2  . LYS A 1 106 ? -6.529  1.990   -15.184 1.00 0.00 ? 106 LYS A HD2  5  
ATOM 8987  H HD3  . LYS A 1 106 ? -8.276  2.230   -15.115 1.00 0.00 ? 106 LYS A HD3  5  
ATOM 8988  H HE2  . LYS A 1 106 ? -8.262  3.800   -16.783 1.00 0.00 ? 106 LYS A HE2  5  
ATOM 8989  H HE3  . LYS A 1 106 ? -6.614  4.318   -16.430 1.00 0.00 ? 106 LYS A HE3  5  
ATOM 8990  H HZ1  . LYS A 1 106 ? -7.417  1.806   -17.795 1.00 0.00 ? 106 LYS A HZ1  5  
ATOM 8991  H HZ2  . LYS A 1 106 ? -5.828  2.209   -17.380 1.00 0.00 ? 106 LYS A HZ2  5  
ATOM 8992  H HZ3  . LYS A 1 106 ? -6.670  3.145   -18.510 1.00 0.00 ? 106 LYS A HZ3  5  
ATOM 8993  N N    . THR A 1 107 ? -10.299 6.056   -11.981 1.00 0.00 ? 107 THR A N    5  
ATOM 8994  C CA   . THR A 1 107 ? -11.614 6.568   -11.618 1.00 0.00 ? 107 THR A CA   5  
ATOM 8995  C C    . THR A 1 107 ? -12.714 5.863   -12.403 1.00 0.00 ? 107 THR A C    5  
ATOM 8996  O O    . THR A 1 107 ? -13.671 5.347   -11.824 1.00 0.00 ? 107 THR A O    5  
ATOM 8997  C CB   . THR A 1 107 ? -11.714 8.085   -11.866 1.00 0.00 ? 107 THR A CB   5  
ATOM 8998  O OG1  . THR A 1 107 ? -10.700 8.770   -11.123 1.00 0.00 ? 107 THR A OG1  5  
ATOM 8999  C CG2  . THR A 1 107 ? -13.085 8.609   -11.466 1.00 0.00 ? 107 THR A CG2  5  
ATOM 9000  H H    . THR A 1 107 ? -9.719  6.592   -12.561 1.00 0.00 ? 107 THR A H    5  
ATOM 9001  H HA   . THR A 1 107 ? -11.764 6.386   -10.564 1.00 0.00 ? 107 THR A HA   5  
ATOM 9002  H HB   . THR A 1 107 ? -11.567 8.273   -12.920 1.00 0.00 ? 107 THR A HB   5  
ATOM 9003  H HG1  . THR A 1 107 ? -10.473 9.588   -11.571 1.00 0.00 ? 107 THR A HG1  5  
ATOM 9004  H HG21 . THR A 1 107 ? -13.846 8.104   -12.042 1.00 0.00 ? 107 THR A HG21 5  
ATOM 9005  H HG22 . THR A 1 107 ? -13.134 9.671   -11.656 1.00 0.00 ? 107 THR A HG22 5  
ATOM 9006  H HG23 . THR A 1 107 ? -13.248 8.424   -10.415 1.00 0.00 ? 107 THR A HG23 5  
ATOM 9007  N N    . SER A 1 108 ? -12.573 5.843   -13.725 1.00 0.00 ? 108 SER A N    5  
ATOM 9008  C CA   . SER A 1 108 ? -13.557 5.203   -14.590 1.00 0.00 ? 108 SER A CA   5  
ATOM 9009  C C    . SER A 1 108 ? -12.888 4.604   -15.823 1.00 0.00 ? 108 SER A C    5  
ATOM 9010  O O    . SER A 1 108 ? -12.028 5.229   -16.442 1.00 0.00 ? 108 SER A O    5  
ATOM 9011  C CB   . SER A 1 108 ? -14.626 6.212   -15.015 1.00 0.00 ? 108 SER A CB   5  
ATOM 9012  O OG   . SER A 1 108 ? -15.643 6.322   -14.034 1.00 0.00 ? 108 SER A OG   5  
ATOM 9013  H H    . SER A 1 108 ? -11.789 6.272   -14.127 1.00 0.00 ? 108 SER A H    5  
ATOM 9014  H HA   . SER A 1 108 ? -14.026 4.410   -14.027 1.00 0.00 ? 108 SER A HA   5  
ATOM 9015  H HB2  . SER A 1 108 ? -14.169 7.180   -15.152 1.00 0.00 ? 108 SER A HB2  5  
ATOM 9016  H HB3  . SER A 1 108 ? -15.072 5.889   -15.944 1.00 0.00 ? 108 SER A HB3  5  
ATOM 9017  H HG   . SER A 1 108 ? -15.245 6.507   -13.180 1.00 0.00 ? 108 SER A HG   5  
ATOM 9018  N N    . SER A 1 109 ? -13.291 3.387   -16.174 1.00 0.00 ? 109 SER A N    5  
ATOM 9019  C CA   . SER A 1 109 ? -12.729 2.699   -17.330 1.00 0.00 ? 109 SER A CA   5  
ATOM 9020  C C    . SER A 1 109 ? -13.434 3.129   -18.613 1.00 0.00 ? 109 SER A C    5  
ATOM 9021  O O    . SER A 1 109 ? -14.639 2.931   -18.769 1.00 0.00 ? 109 SER A O    5  
ATOM 9022  C CB   . SER A 1 109 ? -12.844 1.184   -17.155 1.00 0.00 ? 109 SER A CB   5  
ATOM 9023  O OG   . SER A 1 109 ? -12.567 0.507   -18.369 1.00 0.00 ? 109 SER A OG   5  
ATOM 9024  H H    . SER A 1 109 ? -13.981 2.939   -15.640 1.00 0.00 ? 109 SER A H    5  
ATOM 9025  H HA   . SER A 1 109 ? -11.685 2.967   -17.400 1.00 0.00 ? 109 SER A HA   5  
ATOM 9026  H HB2  . SER A 1 109 ? -12.139 0.856   -16.406 1.00 0.00 ? 109 SER A HB2  5  
ATOM 9027  H HB3  . SER A 1 109 ? -13.847 0.936   -16.839 1.00 0.00 ? 109 SER A HB3  5  
ATOM 9028  H HG   . SER A 1 109 ? -12.068 -0.291  -18.184 1.00 0.00 ? 109 SER A HG   5  
ATOM 9029  N N    . SER A 1 110 ? -12.674 3.719   -19.530 1.00 0.00 ? 110 SER A N    5  
ATOM 9030  C CA   . SER A 1 110 ? -13.225 4.181   -20.798 1.00 0.00 ? 110 SER A CA   5  
ATOM 9031  C C    . SER A 1 110 ? -12.608 3.420   -21.968 1.00 0.00 ? 110 SER A C    5  
ATOM 9032  O O    . SER A 1 110 ? -13.298 3.055   -22.921 1.00 0.00 ? 110 SER A O    5  
ATOM 9033  C CB   . SER A 1 110 ? -12.983 5.682   -20.967 1.00 0.00 ? 110 SER A CB   5  
ATOM 9034  O OG   . SER A 1 110 ? -11.612 6.000   -20.800 1.00 0.00 ? 110 SER A OG   5  
ATOM 9035  H H    . SER A 1 110 ? -11.719 3.849   -19.347 1.00 0.00 ? 110 SER A H    5  
ATOM 9036  H HA   . SER A 1 110 ? -14.289 3.996   -20.785 1.00 0.00 ? 110 SER A HA   5  
ATOM 9037  H HB2  . SER A 1 110 ? -13.292 5.985   -21.956 1.00 0.00 ? 110 SER A HB2  5  
ATOM 9038  H HB3  . SER A 1 110 ? -13.558 6.222   -20.229 1.00 0.00 ? 110 SER A HB3  5  
ATOM 9039  H HG   . SER A 1 110 ? -11.531 6.805   -20.283 1.00 0.00 ? 110 SER A HG   5  
ATOM 9040  N N    . THR A 1 111 ? -11.302 3.184   -21.889 1.00 0.00 ? 111 THR A N    5  
ATOM 9041  C CA   . THR A 1 111 ? -10.590 2.468   -22.941 1.00 0.00 ? 111 THR A CA   5  
ATOM 9042  C C    . THR A 1 111 ? -10.948 0.986   -22.935 1.00 0.00 ? 111 THR A C    5  
ATOM 9043  O O    . THR A 1 111 ? -10.922 0.335   -21.891 1.00 0.00 ? 111 THR A O    5  
ATOM 9044  C CB   . THR A 1 111 ? -9.065  2.617   -22.788 1.00 0.00 ? 111 THR A CB   5  
ATOM 9045  O OG1  . THR A 1 111 ? -8.668  2.258   -21.460 1.00 0.00 ? 111 THR A OG1  5  
ATOM 9046  C CG2  . THR A 1 111 ? -8.629  4.044   -23.085 1.00 0.00 ? 111 THR A CG2  5  
ATOM 9047  H H    . THR A 1 111 ? -10.807 3.500   -21.105 1.00 0.00 ? 111 THR A H    5  
ATOM 9048  H HA   . THR A 1 111 ? -10.880 2.895   -23.890 1.00 0.00 ? 111 THR A HA   5  
ATOM 9049  H HB   . THR A 1 111 ? -8.582  1.954   -23.492 1.00 0.00 ? 111 THR A HB   5  
ATOM 9050  H HG1  . THR A 1 111 ? -9.445  2.192   -20.900 1.00 0.00 ? 111 THR A HG1  5  
ATOM 9051  H HG21 . THR A 1 111 ? -9.382  4.533   -23.685 1.00 0.00 ? 111 THR A HG21 5  
ATOM 9052  H HG22 . THR A 1 111 ? -7.693  4.029   -23.624 1.00 0.00 ? 111 THR A HG22 5  
ATOM 9053  H HG23 . THR A 1 111 ? -8.502  4.581   -22.158 1.00 0.00 ? 111 THR A HG23 5  
ATOM 9054  N N    . SER A 1 112 ? -11.280 0.458   -24.109 1.00 0.00 ? 112 SER A N    5  
ATOM 9055  C CA   . SER A 1 112 ? -11.645 -0.948  -24.239 1.00 0.00 ? 112 SER A CA   5  
ATOM 9056  C C    . SER A 1 112 ? -11.162 -1.514  -25.571 1.00 0.00 ? 112 SER A C    5  
ATOM 9057  O O    . SER A 1 112 ? -11.268 -0.879  -26.620 1.00 0.00 ? 112 SER A O    5  
ATOM 9058  C CB   . SER A 1 112 ? -13.161 -1.116  -24.120 1.00 0.00 ? 112 SER A CB   5  
ATOM 9059  O OG   . SER A 1 112 ? -13.834 -0.420  -25.155 1.00 0.00 ? 112 SER A OG   5  
ATOM 9060  H H    . SER A 1 112 ? -11.281 1.028   -24.906 1.00 0.00 ? 112 SER A H    5  
ATOM 9061  H HA   . SER A 1 112 ? -11.167 -1.490  -23.436 1.00 0.00 ? 112 SER A HA   5  
ATOM 9062  H HB2  . SER A 1 112 ? -13.411 -2.164  -24.186 1.00 0.00 ? 112 SER A HB2  5  
ATOM 9063  H HB3  . SER A 1 112 ? -13.490 -0.727  -23.167 1.00 0.00 ? 112 SER A HB3  5  
ATOM 9064  H HG   . SER A 1 112 ? -13.501 0.479   -25.205 1.00 0.00 ? 112 SER A HG   5  
ATOM 9065  N N    . PRO A 1 113 ? -10.618 -2.739  -25.529 1.00 0.00 ? 113 PRO A N    5  
ATOM 9066  C CA   . PRO A 1 113 ? -10.108 -3.420  -26.724 1.00 0.00 ? 113 PRO A CA   5  
ATOM 9067  C C    . PRO A 1 113 ? -11.224 -3.841  -27.672 1.00 0.00 ? 113 PRO A C    5  
ATOM 9068  O O    . PRO A 1 113 ? -12.358 -3.373  -27.559 1.00 0.00 ? 113 PRO A O    5  
ATOM 9069  C CB   . PRO A 1 113 ? -9.397  -4.650  -26.154 1.00 0.00 ? 113 PRO A CB   5  
ATOM 9070  C CG   . PRO A 1 113 ? -10.068 -4.905  -24.849 1.00 0.00 ? 113 PRO A CG   5  
ATOM 9071  C CD   . PRO A 1 113 ? -10.459 -3.555  -24.314 1.00 0.00 ? 113 PRO A CD   5  
ATOM 9072  H HA   . PRO A 1 113 ? -9.397  -2.806  -27.257 1.00 0.00 ? 113 PRO A HA   5  
ATOM 9073  H HB2  . PRO A 1 113 ? -9.518  -5.484  -26.831 1.00 0.00 ? 113 PRO A HB2  5  
ATOM 9074  H HB3  . PRO A 1 113 ? -8.347  -4.435  -26.023 1.00 0.00 ? 113 PRO A HB3  5  
ATOM 9075  H HG2  . PRO A 1 113 ? -10.944 -5.517  -24.999 1.00 0.00 ? 113 PRO A HG2  5  
ATOM 9076  H HG3  . PRO A 1 113 ? -9.380  -5.391  -24.172 1.00 0.00 ? 113 PRO A HG3  5  
ATOM 9077  H HD2  . PRO A 1 113 ? -11.389 -3.620  -23.769 1.00 0.00 ? 113 PRO A HD2  5  
ATOM 9078  H HD3  . PRO A 1 113 ? -9.677  -3.158  -23.683 1.00 0.00 ? 113 PRO A HD3  5  
ATOM 9079  N N    . LEU A 1 114 ? -10.898 -4.727  -28.607 1.00 0.00 ? 114 LEU A N    5  
ATOM 9080  C CA   . LEU A 1 114 ? -11.874 -5.212  -29.576 1.00 0.00 ? 114 LEU A CA   5  
ATOM 9081  C C    . LEU A 1 114 ? -12.530 -6.501  -29.089 1.00 0.00 ? 114 LEU A C    5  
ATOM 9082  O O    . LEU A 1 114 ? -13.730 -6.702  -29.268 1.00 0.00 ? 114 LEU A O    5  
ATOM 9083  C CB   . LEU A 1 114 ? -11.204 -5.448  -30.931 1.00 0.00 ? 114 LEU A CB   5  
ATOM 9084  C CG   . LEU A 1 114 ? -10.953 -4.201  -31.780 1.00 0.00 ? 114 LEU A CG   5  
ATOM 9085  C CD1  . LEU A 1 114 ? -9.840  -4.456  -32.785 1.00 0.00 ? 114 LEU A CD1  5  
ATOM 9086  C CD2  . LEU A 1 114 ? -12.228 -3.774  -32.491 1.00 0.00 ? 114 LEU A CD2  5  
ATOM 9087  H H    . LEU A 1 114 ? -9.979  -5.063  -28.647 1.00 0.00 ? 114 LEU A H    5  
ATOM 9088  H HA   . LEU A 1 114 ? -12.636 -4.455  -29.686 1.00 0.00 ? 114 LEU A HA   5  
ATOM 9089  H HB2  . LEU A 1 114 ? -10.252 -5.922  -30.750 1.00 0.00 ? 114 LEU A HB2  5  
ATOM 9090  H HB3  . LEU A 1 114 ? -11.836 -6.115  -31.499 1.00 0.00 ? 114 LEU A HB3  5  
ATOM 9091  H HG   . LEU A 1 114 ? -10.640 -3.391  -31.136 1.00 0.00 ? 114 LEU A HG   5  
ATOM 9092  H HD11 . LEU A 1 114 ? -10.264 -4.826  -33.706 1.00 0.00 ? 114 LEU A HD11 5  
ATOM 9093  H HD12 . LEU A 1 114 ? -9.154  -5.189  -32.385 1.00 0.00 ? 114 LEU A HD12 5  
ATOM 9094  H HD13 . LEU A 1 114 ? -9.310  -3.535  -32.977 1.00 0.00 ? 114 LEU A HD13 5  
ATOM 9095  H HD21 . LEU A 1 114 ? -12.764 -4.650  -32.826 1.00 0.00 ? 114 LEU A HD21 5  
ATOM 9096  H HD22 . LEU A 1 114 ? -11.977 -3.159  -33.343 1.00 0.00 ? 114 LEU A HD22 5  
ATOM 9097  H HD23 . LEU A 1 114 ? -12.848 -3.211  -31.810 1.00 0.00 ? 114 LEU A HD23 5  
ATOM 9098  N N    . GLU A 1 115 ? -11.733 -7.368  -28.473 1.00 0.00 ? 115 GLU A N    5  
ATOM 9099  C CA   . GLU A 1 115 ? -12.237 -8.636  -27.960 1.00 0.00 ? 115 GLU A CA   5  
ATOM 9100  C C    . GLU A 1 115 ? -11.909 -8.792  -26.477 1.00 0.00 ? 115 GLU A C    5  
ATOM 9101  O O    . GLU A 1 115 ? -11.115 -9.644  -26.078 1.00 0.00 ? 115 GLU A O    5  
ATOM 9102  C CB   . GLU A 1 115 ? -11.644 -9.804  -28.750 1.00 0.00 ? 115 GLU A CB   5  
ATOM 9103  C CG   . GLU A 1 115 ? -12.007 -9.787  -30.226 1.00 0.00 ? 115 GLU A CG   5  
ATOM 9104  C CD   . GLU A 1 115 ? -13.505 -9.759  -30.458 1.00 0.00 ? 115 GLU A CD   5  
ATOM 9105  O OE1  . GLU A 1 115 ? -14.242 -10.348 -29.640 1.00 0.00 ? 115 GLU A OE1  5  
ATOM 9106  O OE2  . GLU A 1 115 ? -13.940 -9.149  -31.457 1.00 0.00 ? 115 GLU A OE2  5  
ATOM 9107  H H    . GLU A 1 115 ? -10.784 -7.150  -28.361 1.00 0.00 ? 115 GLU A H    5  
ATOM 9108  H HA   . GLU A 1 115 ? -13.310 -8.640  -28.081 1.00 0.00 ? 115 GLU A HA   5  
ATOM 9109  H HB2  . GLU A 1 115 ? -10.568 -9.772  -28.665 1.00 0.00 ? 115 GLU A HB2  5  
ATOM 9110  H HB3  . GLU A 1 115 ? -12.002 -10.730 -28.324 1.00 0.00 ? 115 GLU A HB3  5  
ATOM 9111  H HG2  . GLU A 1 115 ? -11.571 -8.910  -30.680 1.00 0.00 ? 115 GLU A HG2  5  
ATOM 9112  H HG3  . GLU A 1 115 ? -11.601 -10.672 -30.693 1.00 0.00 ? 115 GLU A HG3  5  
ATOM 9113  N N    . PRO A 1 116 ? -12.534 -7.950  -25.642 1.00 0.00 ? 116 PRO A N    5  
ATOM 9114  C CA   . PRO A 1 116 ? -12.325 -7.974  -24.191 1.00 0.00 ? 116 PRO A CA   5  
ATOM 9115  C C    . PRO A 1 116 ? -12.921 -9.218  -23.540 1.00 0.00 ? 116 PRO A C    5  
ATOM 9116  O O    . PRO A 1 116 ? -13.978 -9.710  -23.936 1.00 0.00 ? 116 PRO A O    5  
ATOM 9117  C CB   . PRO A 1 116 ? -13.052 -6.717  -23.707 1.00 0.00 ? 116 PRO A CB   5  
ATOM 9118  C CG   . PRO A 1 116 ? -14.089 -6.456  -24.744 1.00 0.00 ? 116 PRO A CG   5  
ATOM 9119  C CD   . PRO A 1 116 ? -13.494 -6.910  -26.048 1.00 0.00 ? 116 PRO A CD   5  
ATOM 9120  H HA   . PRO A 1 116 ? -11.277 -7.905  -23.940 1.00 0.00 ? 116 PRO A HA   5  
ATOM 9121  H HB2  . PRO A 1 116 ? -13.498 -6.905  -22.740 1.00 0.00 ? 116 PRO A HB2  5  
ATOM 9122  H HB3  . PRO A 1 116 ? -12.353 -5.898  -23.634 1.00 0.00 ? 116 PRO A HB3  5  
ATOM 9123  H HG2  . PRO A 1 116 ? -14.981 -7.022  -24.522 1.00 0.00 ? 116 PRO A HG2  5  
ATOM 9124  H HG3  . PRO A 1 116 ? -14.312 -5.400  -24.782 1.00 0.00 ? 116 PRO A HG3  5  
ATOM 9125  H HD2  . PRO A 1 116 ? -14.259 -7.321  -26.690 1.00 0.00 ? 116 PRO A HD2  5  
ATOM 9126  H HD3  . PRO A 1 116 ? -12.988 -6.090  -26.538 1.00 0.00 ? 116 PRO A HD3  5  
ATOM 9127  N N    . PRO A 1 117 ? -12.230 -9.740  -22.516 1.00 0.00 ? 117 PRO A N    5  
ATOM 9128  C CA   . PRO A 1 117 ? -12.673 -10.932 -21.787 1.00 0.00 ? 117 PRO A CA   5  
ATOM 9129  C C    . PRO A 1 117 ? -13.914 -10.667 -20.942 1.00 0.00 ? 117 PRO A C    5  
ATOM 9130  O O    . PRO A 1 117 ? -14.283 -9.517  -20.708 1.00 0.00 ? 117 PRO A O    5  
ATOM 9131  C CB   . PRO A 1 117 ? -11.477 -11.265 -20.892 1.00 0.00 ? 117 PRO A CB   5  
ATOM 9132  C CG   . PRO A 1 117 ? -10.768 -9.968  -20.709 1.00 0.00 ? 117 PRO A CG   5  
ATOM 9133  C CD   . PRO A 1 117 ? -10.962 -9.205  -21.990 1.00 0.00 ? 117 PRO A CD   5  
ATOM 9134  H HA   . PRO A 1 117 ? -12.864 -11.758 -22.457 1.00 0.00 ? 117 PRO A HA   5  
ATOM 9135  H HB2  . PRO A 1 117 ? -11.829 -11.661 -19.949 1.00 0.00 ? 117 PRO A HB2  5  
ATOM 9136  H HB3  . PRO A 1 117 ? -10.848 -11.993 -21.381 1.00 0.00 ? 117 PRO A HB3  5  
ATOM 9137  H HG2  . PRO A 1 117 ? -11.200 -9.427  -19.881 1.00 0.00 ? 117 PRO A HG2  5  
ATOM 9138  H HG3  . PRO A 1 117 ? -9.717  -10.146 -20.535 1.00 0.00 ? 117 PRO A HG3  5  
ATOM 9139  H HD2  . PRO A 1 117 ? -11.043 -8.147  -21.790 1.00 0.00 ? 117 PRO A HD2  5  
ATOM 9140  H HD3  . PRO A 1 117 ? -10.149 -9.401  -22.673 1.00 0.00 ? 117 PRO A HD3  5  
ATOM 9141  N N    . SER A 1 118 ? -14.553 -11.740 -20.486 1.00 0.00 ? 118 SER A N    5  
ATOM 9142  C CA   . SER A 1 118 ? -15.756 -11.623 -19.669 1.00 0.00 ? 118 SER A CA   5  
ATOM 9143  C C    . SER A 1 118 ? -15.504 -12.140 -18.256 1.00 0.00 ? 118 SER A C    5  
ATOM 9144  O O    . SER A 1 118 ? -15.408 -13.347 -18.033 1.00 0.00 ? 118 SER A O    5  
ATOM 9145  C CB   . SER A 1 118 ? -16.910 -12.396 -20.310 1.00 0.00 ? 118 SER A CB   5  
ATOM 9146  O OG   . SER A 1 118 ? -16.590 -13.769 -20.447 1.00 0.00 ? 118 SER A OG   5  
ATOM 9147  H H    . SER A 1 118 ? -14.210 -12.631 -20.707 1.00 0.00 ? 118 SER A H    5  
ATOM 9148  H HA   . SER A 1 118 ? -16.020 -10.577 -19.616 1.00 0.00 ? 118 SER A HA   5  
ATOM 9149  H HB2  . SER A 1 118 ? -17.789 -12.303 -19.690 1.00 0.00 ? 118 SER A HB2  5  
ATOM 9150  H HB3  . SER A 1 118 ? -17.114 -11.986 -21.288 1.00 0.00 ? 118 SER A HB3  5  
ATOM 9151  H HG   . SER A 1 118 ? -15.637 -13.872 -20.502 1.00 0.00 ? 118 SER A HG   5  
ATOM 9152  N N    . ASP A 1 119 ? -15.400 -11.218 -17.306 1.00 0.00 ? 119 ASP A N    5  
ATOM 9153  C CA   . ASP A 1 119 ? -15.161 -11.579 -15.913 1.00 0.00 ? 119 ASP A CA   5  
ATOM 9154  C C    . ASP A 1 119 ? -16.324 -11.137 -15.030 1.00 0.00 ? 119 ASP A C    5  
ATOM 9155  O O    . ASP A 1 119 ? -17.136 -10.302 -15.428 1.00 0.00 ? 119 ASP A O    5  
ATOM 9156  C CB   . ASP A 1 119 ? -13.859 -10.948 -15.416 1.00 0.00 ? 119 ASP A CB   5  
ATOM 9157  C CG   . ASP A 1 119 ? -13.948 -9.437  -15.319 1.00 0.00 ? 119 ASP A CG   5  
ATOM 9158  O OD1  . ASP A 1 119 ? -14.928 -8.938  -14.727 1.00 0.00 ? 119 ASP A OD1  5  
ATOM 9159  O OD2  . ASP A 1 119 ? -13.039 -8.755  -15.836 1.00 0.00 ? 119 ASP A OD2  5  
ATOM 9160  H H    . ASP A 1 119 ? -15.486 -10.271 -17.546 1.00 0.00 ? 119 ASP A H    5  
ATOM 9161  H HA   . ASP A 1 119 ? -15.073 -12.653 -15.859 1.00 0.00 ? 119 ASP A HA   5  
ATOM 9162  H HB2  . ASP A 1 119 ? -13.628 -11.340 -14.437 1.00 0.00 ? 119 ASP A HB2  5  
ATOM 9163  H HB3  . ASP A 1 119 ? -13.061 -11.200 -16.099 1.00 0.00 ? 119 ASP A HB3  5  
ATOM 9164  N N    . ARG A 1 120 ? -16.398 -11.704 -13.830 1.00 0.00 ? 120 ARG A N    5  
ATOM 9165  C CA   . ARG A 1 120 ? -17.463 -11.370 -12.892 1.00 0.00 ? 120 ARG A CA   5  
ATOM 9166  C C    . ARG A 1 120 ? -16.894 -11.075 -11.507 1.00 0.00 ? 120 ARG A C    5  
ATOM 9167  O O    . ARG A 1 120 ? -15.895 -11.664 -11.097 1.00 0.00 ? 120 ARG A O    5  
ATOM 9168  C CB   . ARG A 1 120 ? -18.474 -12.515 -12.807 1.00 0.00 ? 120 ARG A CB   5  
ATOM 9169  C CG   . ARG A 1 120 ? -19.679 -12.200 -11.937 1.00 0.00 ? 120 ARG A CG   5  
ATOM 9170  C CD   . ARG A 1 120 ? -20.716 -11.387 -12.696 1.00 0.00 ? 120 ARG A CD   5  
ATOM 9171  N NE   . ARG A 1 120 ? -22.044 -11.497 -12.097 1.00 0.00 ? 120 ARG A NE   5  
ATOM 9172  C CZ   . ARG A 1 120 ? -22.847 -12.539 -12.276 1.00 0.00 ? 120 ARG A CZ   5  
ATOM 9173  N NH1  . ARG A 1 120 ? -22.459 -13.557 -13.032 1.00 0.00 ? 120 ARG A NH1  5  
ATOM 9174  N NH2  . ARG A 1 120 ? -24.041 -12.566 -11.697 1.00 0.00 ? 120 ARG A NH2  5  
ATOM 9175  H H    . ARG A 1 120 ? -15.721 -12.363 -13.570 1.00 0.00 ? 120 ARG A H    5  
ATOM 9176  H HA   . ARG A 1 120 ? -17.963 -10.487 -13.258 1.00 0.00 ? 120 ARG A HA   5  
ATOM 9177  H HB2  . ARG A 1 120 ? -18.826 -12.744 -13.802 1.00 0.00 ? 120 ARG A HB2  5  
ATOM 9178  H HB3  . ARG A 1 120 ? -17.981 -13.385 -12.399 1.00 0.00 ? 120 ARG A HB3  5  
ATOM 9179  H HG2  . ARG A 1 120 ? -20.131 -13.126 -11.614 1.00 0.00 ? 120 ARG A HG2  5  
ATOM 9180  H HG3  . ARG A 1 120 ? -19.353 -11.637 -11.076 1.00 0.00 ? 120 ARG A HG3  5  
ATOM 9181  H HD2  . ARG A 1 120 ? -20.415 -10.350 -12.692 1.00 0.00 ? 120 ARG A HD2  5  
ATOM 9182  H HD3  . ARG A 1 120 ? -20.760 -11.745 -13.714 1.00 0.00 ? 120 ARG A HD3  5  
ATOM 9183  H HE   . ARG A 1 120 ? -22.350 -10.756 -11.534 1.00 0.00 ? 120 ARG A HE   5  
ATOM 9184  H HH11 . ARG A 1 120 ? -21.560 -13.540 -13.469 1.00 0.00 ? 120 ARG A HH11 5  
ATOM 9185  H HH12 . ARG A 1 120 ? -23.065 -14.342 -13.164 1.00 0.00 ? 120 ARG A HH12 5  
ATOM 9186  H HH21 . ARG A 1 120 ? -24.336 -11.801 -11.126 1.00 0.00 ? 120 ARG A HH21 5  
ATOM 9187  H HH22 . ARG A 1 120 ? -24.644 -13.351 -11.832 1.00 0.00 ? 120 ARG A HH22 5  
ATOM 9188  N N    . GLY A 1 121 ? -17.539 -10.159 -10.791 1.00 0.00 ? 121 GLY A N    5  
ATOM 9189  C CA   . GLY A 1 121 ? -17.083 -9.802  -9.460  1.00 0.00 ? 121 GLY A CA   5  
ATOM 9190  C C    . GLY A 1 121 ? -18.191 -9.223  -8.603  1.00 0.00 ? 121 GLY A C    5  
ATOM 9191  O O    . GLY A 1 121 ? -19.322 -9.060  -9.063  1.00 0.00 ? 121 GLY A O    5  
ATOM 9192  H H    . GLY A 1 121 ? -18.331 -9.722  -11.169 1.00 0.00 ? 121 GLY A H    5  
ATOM 9193  H HA2  . GLY A 1 121 ? -16.692 -10.684 -8.976  1.00 0.00 ? 121 GLY A HA2  5  
ATOM 9194  H HA3  . GLY A 1 121 ? -16.292 -9.071  -9.548  1.00 0.00 ? 121 GLY A HA3  5  
ATOM 9195  N N    . THR A 1 122 ? -17.869 -8.912  -7.352  1.00 0.00 ? 122 THR A N    5  
ATOM 9196  C CA   . THR A 1 122 ? -18.846 -8.351  -6.428  1.00 0.00 ? 122 THR A CA   5  
ATOM 9197  C C    . THR A 1 122 ? -18.163 -7.740  -5.209  1.00 0.00 ? 122 THR A C    5  
ATOM 9198  O O    . THR A 1 122 ? -17.090 -8.183  -4.799  1.00 0.00 ? 122 THR A O    5  
ATOM 9199  C CB   . THR A 1 122 ? -19.852 -9.418  -5.957  1.00 0.00 ? 122 THR A CB   5  
ATOM 9200  O OG1  . THR A 1 122 ? -20.839 -8.821  -5.109  1.00 0.00 ? 122 THR A OG1  5  
ATOM 9201  C CG2  . THR A 1 122 ? -19.143 -10.537 -5.209  1.00 0.00 ? 122 THR A CG2  5  
ATOM 9202  H H    . THR A 1 122 ? -16.951 -9.065  -7.044  1.00 0.00 ? 122 THR A H    5  
ATOM 9203  H HA   . THR A 1 122 ? -19.391 -7.577  -6.948  1.00 0.00 ? 122 THR A HA   5  
ATOM 9204  H HB   . THR A 1 122 ? -20.340 -9.838  -6.825  1.00 0.00 ? 122 THR A HB   5  
ATOM 9205  H HG1  . THR A 1 122 ? -20.557 -8.887  -4.194  1.00 0.00 ? 122 THR A HG1  5  
ATOM 9206  H HG21 . THR A 1 122 ? -19.673 -10.748 -4.291  1.00 0.00 ? 122 THR A HG21 5  
ATOM 9207  H HG22 . THR A 1 122 ? -18.133 -10.233 -4.980  1.00 0.00 ? 122 THR A HG22 5  
ATOM 9208  H HG23 . THR A 1 122 ? -19.122 -11.424 -5.824  1.00 0.00 ? 122 THR A HG23 5  
ATOM 9209  N N    . VAL A 1 123 ? -18.792 -6.721  -4.632  1.00 0.00 ? 123 VAL A N    5  
ATOM 9210  C CA   . VAL A 1 123 ? -18.245 -6.051  -3.459  1.00 0.00 ? 123 VAL A CA   5  
ATOM 9211  C C    . VAL A 1 123 ? -18.805 -6.650  -2.173  1.00 0.00 ? 123 VAL A C    5  
ATOM 9212  O O    . VAL A 1 123 ? -19.993 -6.959  -2.086  1.00 0.00 ? 123 VAL A O    5  
ATOM 9213  C CB   . VAL A 1 123 ? -18.548 -4.541  -3.483  1.00 0.00 ? 123 VAL A CB   5  
ATOM 9214  C CG1  . VAL A 1 123 ? -20.048 -4.296  -3.415  1.00 0.00 ? 123 VAL A CG1  5  
ATOM 9215  C CG2  . VAL A 1 123 ? -17.832 -3.836  -2.340  1.00 0.00 ? 123 VAL A CG2  5  
ATOM 9216  H H    . VAL A 1 123 ? -19.644 -6.413  -5.005  1.00 0.00 ? 123 VAL A H    5  
ATOM 9217  H HA   . VAL A 1 123 ? -17.173 -6.182  -3.468  1.00 0.00 ? 123 VAL A HA   5  
ATOM 9218  H HB   . VAL A 1 123 ? -18.181 -4.135  -4.414  1.00 0.00 ? 123 VAL A HB   5  
ATOM 9219  H HG11 . VAL A 1 123 ? -20.572 -5.231  -3.545  1.00 0.00 ? 123 VAL A HG11 5  
ATOM 9220  H HG12 . VAL A 1 123 ? -20.301 -3.871  -2.454  1.00 0.00 ? 123 VAL A HG12 5  
ATOM 9221  H HG13 . VAL A 1 123 ? -20.336 -3.611  -4.199  1.00 0.00 ? 123 VAL A HG13 5  
ATOM 9222  H HG21 . VAL A 1 123 ? -16.802 -3.665  -2.613  1.00 0.00 ? 123 VAL A HG21 5  
ATOM 9223  H HG22 . VAL A 1 123 ? -18.314 -2.889  -2.142  1.00 0.00 ? 123 VAL A HG22 5  
ATOM 9224  H HG23 . VAL A 1 123 ? -17.873 -4.452  -1.455  1.00 0.00 ? 123 VAL A HG23 5  
ATOM 9225  N N    . SER A 1 124 ? -17.941 -6.810  -1.176  1.00 0.00 ? 124 SER A N    5  
ATOM 9226  C CA   . SER A 1 124 ? -18.348 -7.376  0.105   1.00 0.00 ? 124 SER A CA   5  
ATOM 9227  C C    . SER A 1 124 ? -18.615 -6.273  1.125   1.00 0.00 ? 124 SER A C    5  
ATOM 9228  O O    . SER A 1 124 ? -18.451 -5.089  0.833   1.00 0.00 ? 124 SER A O    5  
ATOM 9229  C CB   . SER A 1 124 ? -17.270 -8.325  0.633   1.00 0.00 ? 124 SER A CB   5  
ATOM 9230  O OG   . SER A 1 124 ? -17.443 -9.632  0.114   1.00 0.00 ? 124 SER A OG   5  
ATOM 9231  H H    . SER A 1 124 ? -17.006 -6.544  -1.307  1.00 0.00 ? 124 SER A H    5  
ATOM 9232  H HA   . SER A 1 124 ? -19.260 -7.932  -0.053  1.00 0.00 ? 124 SER A HA   5  
ATOM 9233  H HB2  . SER A 1 124 ? -16.298 -7.960  0.340   1.00 0.00 ? 124 SER A HB2  5  
ATOM 9234  H HB3  . SER A 1 124 ? -17.329 -8.367  1.711   1.00 0.00 ? 124 SER A HB3  5  
ATOM 9235  H HG   . SER A 1 124 ? -16.706 -10.184 0.384   1.00 0.00 ? 124 SER A HG   5  
ATOM 9236  N N    . GLY A 1 125 ? -19.028 -6.672  2.324   1.00 0.00 ? 125 GLY A N    5  
ATOM 9237  C CA   . GLY A 1 125 ? -19.312 -5.707  3.370   1.00 0.00 ? 125 GLY A CA   5  
ATOM 9238  C C    . GLY A 1 125 ? -18.331 -5.795  4.522   1.00 0.00 ? 125 GLY A C    5  
ATOM 9239  O O    . GLY A 1 125 ? -18.582 -6.455  5.530   1.00 0.00 ? 125 GLY A O    5  
ATOM 9240  H H    . GLY A 1 125 ? -19.142 -7.630  2.500   1.00 0.00 ? 125 GLY A H    5  
ATOM 9241  H HA2  . GLY A 1 125 ? -19.270 -4.714  2.949   1.00 0.00 ? 125 GLY A HA2  5  
ATOM 9242  H HA3  . GLY A 1 125 ? -20.309 -5.885  3.747   1.00 0.00 ? 125 GLY A HA3  5  
ATOM 9243  N N    . PRO A 1 126 ? -17.181 -5.119  4.378   1.00 0.00 ? 126 PRO A N    5  
ATOM 9244  C CA   . PRO A 1 126 ? -16.135 -5.109  5.405   1.00 0.00 ? 126 PRO A CA   5  
ATOM 9245  C C    . PRO A 1 126 ? -16.551 -4.331  6.649   1.00 0.00 ? 126 PRO A C    5  
ATOM 9246  O O    . PRO A 1 126 ? -17.635 -3.751  6.696   1.00 0.00 ? 126 PRO A O    5  
ATOM 9247  C CB   . PRO A 1 126 ? -14.961 -4.415  4.708   1.00 0.00 ? 126 PRO A CB   5  
ATOM 9248  C CG   . PRO A 1 126 ? -15.592 -3.565  3.659   1.00 0.00 ? 126 PRO A CG   5  
ATOM 9249  C CD   . PRO A 1 126 ? -16.815 -4.311  3.202   1.00 0.00 ? 126 PRO A CD   5  
ATOM 9250  H HA   . PRO A 1 126 ? -15.847 -6.111  5.687   1.00 0.00 ? 126 PRO A HA   5  
ATOM 9251  H HB2  . PRO A 1 126 ? -14.415 -3.819  5.426   1.00 0.00 ? 126 PRO A HB2  5  
ATOM 9252  H HB3  . PRO A 1 126 ? -14.307 -5.156  4.275   1.00 0.00 ? 126 PRO A HB3  5  
ATOM 9253  H HG2  . PRO A 1 126 ? -15.870 -2.610  4.079   1.00 0.00 ? 126 PRO A HG2  5  
ATOM 9254  H HG3  . PRO A 1 126 ? -14.906 -3.431  2.836   1.00 0.00 ? 126 PRO A HG3  5  
ATOM 9255  H HD2  . PRO A 1 126 ? -17.605 -3.620  2.948   1.00 0.00 ? 126 PRO A HD2  5  
ATOM 9256  H HD3  . PRO A 1 126 ? -16.579 -4.944  2.360   1.00 0.00 ? 126 PRO A HD3  5  
ATOM 9257  N N    . SER A 1 127 ? -15.682 -4.324  7.654   1.00 0.00 ? 127 SER A N    5  
ATOM 9258  C CA   . SER A 1 127 ? -15.961 -3.620  8.901   1.00 0.00 ? 127 SER A CA   5  
ATOM 9259  C C    . SER A 1 127 ? -15.051 -2.405  9.054   1.00 0.00 ? 127 SER A C    5  
ATOM 9260  O O    . SER A 1 127 ? -14.116 -2.214  8.276   1.00 0.00 ? 127 SER A O    5  
ATOM 9261  C CB   . SER A 1 127 ? -15.780 -4.561  10.094  1.00 0.00 ? 127 SER A CB   5  
ATOM 9262  O OG   . SER A 1 127 ? -16.592 -4.163  11.184  1.00 0.00 ? 127 SER A OG   5  
ATOM 9263  H H    . SER A 1 127 ? -14.834 -4.806  7.556   1.00 0.00 ? 127 SER A H    5  
ATOM 9264  H HA   . SER A 1 127 ? -16.987 -3.285  8.870   1.00 0.00 ? 127 SER A HA   5  
ATOM 9265  H HB2  . SER A 1 127 ? -16.054 -5.563  9.803   1.00 0.00 ? 127 SER A HB2  5  
ATOM 9266  H HB3  . SER A 1 127 ? -14.745 -4.546  10.406  1.00 0.00 ? 127 SER A HB3  5  
ATOM 9267  H HG   . SER A 1 127 ? -17.516 -4.197  10.925  1.00 0.00 ? 127 SER A HG   5  
ATOM 9268  N N    . SER A 1 128 ? -15.331 -1.587  10.063  1.00 0.00 ? 128 SER A N    5  
ATOM 9269  C CA   . SER A 1 128 ? -14.541 -0.388  10.318  1.00 0.00 ? 128 SER A CA   5  
ATOM 9270  C C    . SER A 1 128 ? -14.612 0.570   9.133   1.00 0.00 ? 128 SER A C    5  
ATOM 9271  O O    . SER A 1 128 ? -13.606 1.153   8.731   1.00 0.00 ? 128 SER A O    5  
ATOM 9272  C CB   . SER A 1 128 ? -13.085 -0.762  10.600  1.00 0.00 ? 128 SER A CB   5  
ATOM 9273  O OG   . SER A 1 128 ? -12.426 0.264   11.322  1.00 0.00 ? 128 SER A OG   5  
ATOM 9274  H H    . SER A 1 128 ? -16.089 -1.794  10.649  1.00 0.00 ? 128 SER A H    5  
ATOM 9275  H HA   . SER A 1 128 ? -14.953 0.102   11.187  1.00 0.00 ? 128 SER A HA   5  
ATOM 9276  H HB2  . SER A 1 128 ? -13.055 -1.670  11.182  1.00 0.00 ? 128 SER A HB2  5  
ATOM 9277  H HB3  . SER A 1 128 ? -12.568 -0.916  9.664   1.00 0.00 ? 128 SER A HB3  5  
ATOM 9278  H HG   . SER A 1 128 ? -12.777 0.304   12.215  1.00 0.00 ? 128 SER A HG   5  
ATOM 9279  N N    . GLY A 1 129 ? -15.809 0.728   8.577   1.00 0.00 ? 129 GLY A N    5  
ATOM 9280  C CA   . GLY A 1 129 ? -15.990 1.616   7.444   1.00 0.00 ? 129 GLY A CA   5  
ATOM 9281  C C    . GLY A 1 129 ? -16.315 0.867   6.166   1.00 0.00 ? 129 GLY A C    5  
ATOM 9282  O O    . GLY A 1 129 ? -16.499 1.475   5.112   1.00 0.00 ? 129 GLY A O    5  
ATOM 9283  H H    . GLY A 1 129 ? -16.576 0.237   8.940   1.00 0.00 ? 129 GLY A H    5  
ATOM 9284  H HA2  . GLY A 1 129 ? -16.796 2.301   7.662   1.00 0.00 ? 129 GLY A HA2  5  
ATOM 9285  H HA3  . GLY A 1 129 ? -15.082 2.180   7.295   1.00 0.00 ? 129 GLY A HA3  5  
ATOM 9286  N N    . GLY A 1 1   ? -1.915  15.387  -41.100 1.00 0.00 ? 1   GLY A N    6  
ATOM 9287  C CA   . GLY A 1 1   ? -1.618  14.671  -39.874 1.00 0.00 ? 1   GLY A CA   6  
ATOM 9288  C C    . GLY A 1 1   ? -2.745  13.751  -39.451 1.00 0.00 ? 1   GLY A C    6  
ATOM 9289  O O    . GLY A 1 1   ? -3.904  13.978  -39.798 1.00 0.00 ? 1   GLY A O    6  
ATOM 9290  H H1   . GLY A 1 1   ? -2.782  15.833  -41.207 1.00 0.00 ? 1   GLY A H1   6  
ATOM 9291  H HA2  . GLY A 1 1   ? -0.723  14.084  -40.021 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9292  H HA3  . GLY A 1 1   ? -1.440  15.388  -39.086 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9293  N N    . SER A 1 2   ? -2.406  12.707  -38.701 1.00 0.00 ? 2   SER A N    6  
ATOM 9294  C CA   . SER A 1 2   ? -3.398  11.745  -38.236 1.00 0.00 ? 2   SER A CA   6  
ATOM 9295  C C    . SER A 1 2   ? -2.799  10.809  -37.191 1.00 0.00 ? 2   SER A C    6  
ATOM 9296  O O    . SER A 1 2   ? -1.589  10.807  -36.964 1.00 0.00 ? 2   SER A O    6  
ATOM 9297  C CB   . SER A 1 2   ? -3.944  10.933  -39.412 1.00 0.00 ? 2   SER A CB   6  
ATOM 9298  O OG   . SER A 1 2   ? -2.935  10.116  -39.979 1.00 0.00 ? 2   SER A OG   6  
ATOM 9299  H H    . SER A 1 2   ? -1.465  12.579  -38.458 1.00 0.00 ? 2   SER A H    6  
ATOM 9300  H HA   . SER A 1 2   ? -4.209  12.298  -37.784 1.00 0.00 ? 2   SER A HA   6  
ATOM 9301  H HB2  . SER A 1 2   ? -4.750  10.303  -39.068 1.00 0.00 ? 2   SER A HB2  6  
ATOM 9302  H HB3  . SER A 1 2   ? -4.313  11.608  -40.171 1.00 0.00 ? 2   SER A HB3  6  
ATOM 9303  H HG   . SER A 1 2   ? -2.686  9.433   -39.352 1.00 0.00 ? 2   SER A HG   6  
ATOM 9304  N N    . SER A 1 3   ? -3.655  10.013  -36.558 1.00 0.00 ? 3   SER A N    6  
ATOM 9305  C CA   . SER A 1 3   ? -3.212  9.074   -35.535 1.00 0.00 ? 3   SER A CA   6  
ATOM 9306  C C    . SER A 1 3   ? -4.329  8.101   -35.170 1.00 0.00 ? 3   SER A C    6  
ATOM 9307  O O    . SER A 1 3   ? -5.505  8.371   -35.409 1.00 0.00 ? 3   SER A O    6  
ATOM 9308  C CB   . SER A 1 3   ? -2.749  9.828   -34.286 1.00 0.00 ? 3   SER A CB   6  
ATOM 9309  O OG   . SER A 1 3   ? -1.754  9.098   -33.590 1.00 0.00 ? 3   SER A OG   6  
ATOM 9310  H H    . SER A 1 3   ? -4.608  10.061  -36.784 1.00 0.00 ? 3   SER A H    6  
ATOM 9311  H HA   . SER A 1 3   ? -2.380  8.514   -35.936 1.00 0.00 ? 3   SER A HA   6  
ATOM 9312  H HB2  . SER A 1 3   ? -2.341  10.784  -34.577 1.00 0.00 ? 3   SER A HB2  6  
ATOM 9313  H HB3  . SER A 1 3   ? -3.593  9.982   -33.629 1.00 0.00 ? 3   SER A HB3  6  
ATOM 9314  H HG   . SER A 1 3   ? -2.124  8.269   -33.278 1.00 0.00 ? 3   SER A HG   6  
ATOM 9315  N N    . GLY A 1 4   ? -3.951  6.966   -34.589 1.00 0.00 ? 4   GLY A N    6  
ATOM 9316  C CA   . GLY A 1 4   ? -4.931  5.969   -34.200 1.00 0.00 ? 4   GLY A CA   6  
ATOM 9317  C C    . GLY A 1 4   ? -4.715  5.463   -32.788 1.00 0.00 ? 4   GLY A C    6  
ATOM 9318  O O    . GLY A 1 4   ? -4.631  6.249   -31.845 1.00 0.00 ? 4   GLY A O    6  
ATOM 9319  H H    . GLY A 1 4   ? -2.999  6.805   -34.423 1.00 0.00 ? 4   GLY A H    6  
ATOM 9320  H HA2  . GLY A 1 4   ? -5.917  6.404   -34.268 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9321  H HA3  . GLY A 1 4   ? -4.869  5.135   -34.883 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9322  N N    . SER A 1 5   ? -4.625  4.145   -32.641 1.00 0.00 ? 5   SER A N    6  
ATOM 9323  C CA   . SER A 1 5   ? -4.423  3.533   -31.333 1.00 0.00 ? 5   SER A CA   6  
ATOM 9324  C C    . SER A 1 5   ? -5.607  3.814   -30.413 1.00 0.00 ? 5   SER A C    6  
ATOM 9325  O O    . SER A 1 5   ? -5.432  4.119   -29.233 1.00 0.00 ? 5   SER A O    6  
ATOM 9326  C CB   . SER A 1 5   ? -3.133  4.056   -30.696 1.00 0.00 ? 5   SER A CB   6  
ATOM 9327  O OG   . SER A 1 5   ? -2.600  3.116   -29.779 1.00 0.00 ? 5   SER A OG   6  
ATOM 9328  H H    . SER A 1 5   ? -4.700  3.570   -33.431 1.00 0.00 ? 5   SER A H    6  
ATOM 9329  H HA   . SER A 1 5   ? -4.337  2.466   -31.475 1.00 0.00 ? 5   SER A HA   6  
ATOM 9330  H HB2  . SER A 1 5   ? -2.403  4.241   -31.469 1.00 0.00 ? 5   SER A HB2  6  
ATOM 9331  H HB3  . SER A 1 5   ? -3.342  4.976   -30.170 1.00 0.00 ? 5   SER A HB3  6  
ATOM 9332  H HG   . SER A 1 5   ? -3.312  2.737   -29.259 1.00 0.00 ? 5   SER A HG   6  
ATOM 9333  N N    . SER A 1 6   ? -6.813  3.708   -30.962 1.00 0.00 ? 6   SER A N    6  
ATOM 9334  C CA   . SER A 1 6   ? -8.027  3.954   -30.193 1.00 0.00 ? 6   SER A CA   6  
ATOM 9335  C C    . SER A 1 6   ? -8.696  2.640   -29.799 1.00 0.00 ? 6   SER A C    6  
ATOM 9336  O O    . SER A 1 6   ? -9.202  1.909   -30.650 1.00 0.00 ? 6   SER A O    6  
ATOM 9337  C CB   . SER A 1 6   ? -9.002  4.813   -31.000 1.00 0.00 ? 6   SER A CB   6  
ATOM 9338  O OG   . SER A 1 6   ? -8.433  6.073   -31.311 1.00 0.00 ? 6   SER A OG   6  
ATOM 9339  H H    . SER A 1 6   ? -6.887  3.461   -31.908 1.00 0.00 ? 6   SER A H    6  
ATOM 9340  H HA   . SER A 1 6   ? -7.749  4.485   -29.295 1.00 0.00 ? 6   SER A HA   6  
ATOM 9341  H HB2  . SER A 1 6   ? -9.249  4.306   -31.920 1.00 0.00 ? 6   SER A HB2  6  
ATOM 9342  H HB3  . SER A 1 6   ? -9.902  4.971   -30.423 1.00 0.00 ? 6   SER A HB3  6  
ATOM 9343  H HG   . SER A 1 6   ? -8.225  6.541   -30.499 1.00 0.00 ? 6   SER A HG   6  
ATOM 9344  N N    . GLY A 1 7   ? -8.694  2.347   -28.502 1.00 0.00 ? 7   GLY A N    6  
ATOM 9345  C CA   . GLY A 1 7   ? -9.303  1.123   -28.017 1.00 0.00 ? 7   GLY A CA   6  
ATOM 9346  C C    . GLY A 1 7   ? -10.038 1.320   -26.706 1.00 0.00 ? 7   GLY A C    6  
ATOM 9347  O O    . GLY A 1 7   ? -10.997 2.087   -26.633 1.00 0.00 ? 7   GLY A O    6  
ATOM 9348  H H    . GLY A 1 7   ? -8.276  2.968   -27.870 1.00 0.00 ? 7   GLY A H    6  
ATOM 9349  H HA2  . GLY A 1 7   ? -10.001 0.762   -28.758 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9350  H HA3  . GLY A 1 7   ? -8.530  0.382   -27.875 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9351  N N    . GLY A 1 8   ? -9.588  0.624   -25.667 1.00 0.00 ? 8   GLY A N    6  
ATOM 9352  C CA   . GLY A 1 8   ? -10.223 0.739   -24.366 1.00 0.00 ? 8   GLY A CA   6  
ATOM 9353  C C    . GLY A 1 8   ? -10.629 -0.607  -23.798 1.00 0.00 ? 8   GLY A C    6  
ATOM 9354  O O    . GLY A 1 8   ? -11.255 -1.414  -24.485 1.00 0.00 ? 8   GLY A O    6  
ATOM 9355  H H    . GLY A 1 8   ? -8.820  0.027   -25.783 1.00 0.00 ? 8   GLY A H    6  
ATOM 9356  H HA2  . GLY A 1 8   ? -9.534  1.213   -23.683 1.00 0.00 ? 8   GLY A HA2  6  
ATOM 9357  H HA3  . GLY A 1 8   ? -11.103 1.357   -24.462 1.00 0.00 ? 8   GLY A HA3  6  
ATOM 9358  N N    . SER A 1 9   ? -10.271 -0.849  -22.542 1.00 0.00 ? 9   SER A N    6  
ATOM 9359  C CA   . SER A 1 9   ? -10.597 -2.109  -21.883 1.00 0.00 ? 9   SER A CA   6  
ATOM 9360  C C    . SER A 1 9   ? -10.742 -1.913  -20.377 1.00 0.00 ? 9   SER A C    6  
ATOM 9361  O O    . SER A 1 9   ? -9.798  -1.509  -19.699 1.00 0.00 ? 9   SER A O    6  
ATOM 9362  C CB   . SER A 1 9   ? -9.518  -3.154  -22.171 1.00 0.00 ? 9   SER A CB   6  
ATOM 9363  O OG   . SER A 1 9   ? -9.331  -3.323  -23.566 1.00 0.00 ? 9   SER A OG   6  
ATOM 9364  H H    . SER A 1 9   ? -9.773  -0.165  -22.046 1.00 0.00 ? 9   SER A H    6  
ATOM 9365  H HA   . SER A 1 9   ? -11.539 -2.457  -22.281 1.00 0.00 ? 9   SER A HA   6  
ATOM 9366  H HB2  . SER A 1 9   ? -8.585  -2.835  -21.731 1.00 0.00 ? 9   SER A HB2  6  
ATOM 9367  H HB3  . SER A 1 9   ? -9.814  -4.100  -21.742 1.00 0.00 ? 9   SER A HB3  6  
ATOM 9368  H HG   . SER A 1 9   ? -10.135 -3.077  -24.029 1.00 0.00 ? 9   SER A HG   6  
ATOM 9369  N N    . ASP A 1 10  ? -11.932 -2.202  -19.861 1.00 0.00 ? 10  ASP A N    6  
ATOM 9370  C CA   . ASP A 1 10  ? -12.202 -2.059  -18.435 1.00 0.00 ? 10  ASP A CA   6  
ATOM 9371  C C    . ASP A 1 10  ? -11.168 -2.816  -17.608 1.00 0.00 ? 10  ASP A C    6  
ATOM 9372  O O    . ASP A 1 10  ? -10.802 -2.389  -16.513 1.00 0.00 ? 10  ASP A O    6  
ATOM 9373  C CB   . ASP A 1 10  ? -13.607 -2.567  -18.108 1.00 0.00 ? 10  ASP A CB   6  
ATOM 9374  C CG   . ASP A 1 10  ? -14.052 -3.679  -19.037 1.00 0.00 ? 10  ASP A CG   6  
ATOM 9375  O OD1  . ASP A 1 10  ? -13.695 -4.847  -18.779 1.00 0.00 ? 10  ASP A OD1  6  
ATOM 9376  O OD2  . ASP A 1 10  ? -14.757 -3.380  -20.024 1.00 0.00 ? 10  ASP A OD2  6  
ATOM 9377  H H    . ASP A 1 10  ? -12.645 -2.520  -20.454 1.00 0.00 ? 10  ASP A H    6  
ATOM 9378  H HA   . ASP A 1 10  ? -12.143 -1.009  -18.190 1.00 0.00 ? 10  ASP A HA   6  
ATOM 9379  H HB2  . ASP A 1 10  ? -13.620 -2.944  -17.095 1.00 0.00 ? 10  ASP A HB2  6  
ATOM 9380  H HB3  . ASP A 1 10  ? -14.307 -1.749  -18.192 1.00 0.00 ? 10  ASP A HB3  6  
ATOM 9381  N N    . SER A 1 11  ? -10.702 -3.942  -18.138 1.00 0.00 ? 11  SER A N    6  
ATOM 9382  C CA   . SER A 1 11  ? -9.713  -4.761  -17.447 1.00 0.00 ? 11  SER A CA   6  
ATOM 9383  C C    . SER A 1 11  ? -8.609  -3.892  -16.851 1.00 0.00 ? 11  SER A C    6  
ATOM 9384  O O    . SER A 1 11  ? -7.989  -4.256  -15.852 1.00 0.00 ? 11  SER A O    6  
ATOM 9385  C CB   . SER A 1 11  ? -9.109  -5.787  -18.406 1.00 0.00 ? 11  SER A CB   6  
ATOM 9386  O OG   . SER A 1 11  ? -8.454  -5.149  -19.489 1.00 0.00 ? 11  SER A OG   6  
ATOM 9387  H H    . SER A 1 11  ? -11.032 -4.229  -19.015 1.00 0.00 ? 11  SER A H    6  
ATOM 9388  H HA   . SER A 1 11  ? -10.217 -5.282  -16.646 1.00 0.00 ? 11  SER A HA   6  
ATOM 9389  H HB2  . SER A 1 11  ? -8.391  -6.394  -17.875 1.00 0.00 ? 11  SER A HB2  6  
ATOM 9390  H HB3  . SER A 1 11  ? -9.895  -6.417  -18.797 1.00 0.00 ? 11  SER A HB3  6  
ATOM 9391  H HG   . SER A 1 11  ? -8.864  -4.297  -19.654 1.00 0.00 ? 11  SER A HG   6  
ATOM 9392  N N    . SER A 1 12  ? -8.369  -2.742  -17.473 1.00 0.00 ? 12  SER A N    6  
ATOM 9393  C CA   . SER A 1 12  ? -7.338  -1.823  -17.007 1.00 0.00 ? 12  SER A CA   6  
ATOM 9394  C C    . SER A 1 12  ? -7.860  -0.951  -15.870 1.00 0.00 ? 12  SER A C    6  
ATOM 9395  O O    . SER A 1 12  ? -7.477  0.212   -15.737 1.00 0.00 ? 12  SER A O    6  
ATOM 9396  C CB   . SER A 1 12  ? -6.854  -0.941  -18.160 1.00 0.00 ? 12  SER A CB   6  
ATOM 9397  O OG   . SER A 1 12  ? -6.053  -1.680  -19.066 1.00 0.00 ? 12  SER A OG   6  
ATOM 9398  H H    . SER A 1 12  ? -8.897  -2.508  -18.265 1.00 0.00 ? 12  SER A H    6  
ATOM 9399  H HA   . SER A 1 12  ? -6.509  -2.411  -16.643 1.00 0.00 ? 12  SER A HA   6  
ATOM 9400  H HB2  . SER A 1 12  ? -7.706  -0.546  -18.691 1.00 0.00 ? 12  SER A HB2  6  
ATOM 9401  H HB3  . SER A 1 12  ? -6.268  -0.124  -17.763 1.00 0.00 ? 12  SER A HB3  6  
ATOM 9402  H HG   . SER A 1 12  ? -5.263  -1.177  -19.279 1.00 0.00 ? 12  SER A HG   6  
ATOM 9403  N N    . LEU A 1 13  ? -8.737  -1.521  -15.051 1.00 0.00 ? 13  LEU A N    6  
ATOM 9404  C CA   . LEU A 1 13  ? -9.313  -0.797  -13.923 1.00 0.00 ? 13  LEU A CA   6  
ATOM 9405  C C    . LEU A 1 13  ? -8.258  0.056   -13.227 1.00 0.00 ? 13  LEU A C    6  
ATOM 9406  O O    . LEU A 1 13  ? -8.572  1.083   -12.626 1.00 0.00 ? 13  LEU A O    6  
ATOM 9407  C CB   . LEU A 1 13  ? -9.932  -1.778  -12.925 1.00 0.00 ? 13  LEU A CB   6  
ATOM 9408  C CG   . LEU A 1 13  ? -10.949 -2.766  -13.498 1.00 0.00 ? 13  LEU A CG   6  
ATOM 9409  C CD1  . LEU A 1 13  ? -11.187 -3.910  -12.525 1.00 0.00 ? 13  LEU A CD1  6  
ATOM 9410  C CD2  . LEU A 1 13  ? -12.257 -2.057  -13.821 1.00 0.00 ? 13  LEU A CD2  6  
ATOM 9411  H H    . LEU A 1 13  ? -9.004  -2.451  -15.207 1.00 0.00 ? 13  LEU A H    6  
ATOM 9412  H HA   . LEU A 1 13  ? -10.087 -0.149  -14.306 1.00 0.00 ? 13  LEU A HA   6  
ATOM 9413  H HB2  . LEU A 1 13  ? -9.131  -2.349  -12.482 1.00 0.00 ? 13  LEU A HB2  6  
ATOM 9414  H HB3  . LEU A 1 13  ? -10.427 -1.199  -12.158 1.00 0.00 ? 13  LEU A HB3  6  
ATOM 9415  H HG   . LEU A 1 13  ? -10.559 -3.183  -14.415 1.00 0.00 ? 13  LEU A HG   6  
ATOM 9416  H HD11 . LEU A 1 13  ? -10.826 -3.633  -11.547 1.00 0.00 ? 13  LEU A HD11 6  
ATOM 9417  H HD12 . LEU A 1 13  ? -10.660 -4.789  -12.868 1.00 0.00 ? 13  LEU A HD12 6  
ATOM 9418  H HD13 . LEU A 1 13  ? -12.245 -4.124  -12.473 1.00 0.00 ? 13  LEU A HD13 6  
ATOM 9419  H HD21 . LEU A 1 13  ? -13.039 -2.437  -13.180 1.00 0.00 ? 13  LEU A HD21 6  
ATOM 9420  H HD22 . LEU A 1 13  ? -12.518 -2.238  -14.853 1.00 0.00 ? 13  LEU A HD22 6  
ATOM 9421  H HD23 . LEU A 1 13  ? -12.141 -0.996  -13.658 1.00 0.00 ? 13  LEU A HD23 6  
ATOM 9422  N N    . PHE A 1 14  ? -7.004  -0.376  -13.314 1.00 0.00 ? 14  PHE A N    6  
ATOM 9423  C CA   . PHE A 1 14  ? -5.901  0.349   -12.693 1.00 0.00 ? 14  PHE A CA   6  
ATOM 9424  C C    . PHE A 1 14  ? -4.994  0.970   -13.752 1.00 0.00 ? 14  PHE A C    6  
ATOM 9425  O O    . PHE A 1 14  ? -4.967  0.525   -14.899 1.00 0.00 ? 14  PHE A O    6  
ATOM 9426  C CB   . PHE A 1 14  ? -5.089  -0.586  -11.795 1.00 0.00 ? 14  PHE A CB   6  
ATOM 9427  C CG   . PHE A 1 14  ? -5.938  -1.483  -10.941 1.00 0.00 ? 14  PHE A CG   6  
ATOM 9428  C CD1  . PHE A 1 14  ? -6.423  -2.681  -11.439 1.00 0.00 ? 14  PHE A CD1  6  
ATOM 9429  C CD2  . PHE A 1 14  ? -6.250  -1.129  -9.638  1.00 0.00 ? 14  PHE A CD2  6  
ATOM 9430  C CE1  . PHE A 1 14  ? -7.205  -3.508  -10.655 1.00 0.00 ? 14  PHE A CE1  6  
ATOM 9431  C CE2  . PHE A 1 14  ? -7.032  -1.951  -8.849  1.00 0.00 ? 14  PHE A CE2  6  
ATOM 9432  C CZ   . PHE A 1 14  ? -7.509  -3.143  -9.358  1.00 0.00 ? 14  PHE A CZ   6  
ATOM 9433  H H    . PHE A 1 14  ? -6.816  -1.202  -13.807 1.00 0.00 ? 14  PHE A H    6  
ATOM 9434  H HA   . PHE A 1 14  ? -6.322  1.138   -12.089 1.00 0.00 ? 14  PHE A HA   6  
ATOM 9435  H HB2  . PHE A 1 14  ? -4.463  -1.213  -12.413 1.00 0.00 ? 14  PHE A HB2  6  
ATOM 9436  H HB3  . PHE A 1 14  ? -4.466  0.005   -11.142 1.00 0.00 ? 14  PHE A HB3  6  
ATOM 9437  H HD1  . PHE A 1 14  ? -6.186  -2.969  -12.453 1.00 0.00 ? 14  PHE A HD1  6  
ATOM 9438  H HD2  . PHE A 1 14  ? -5.877  -0.196  -9.239  1.00 0.00 ? 14  PHE A HD2  6  
ATOM 9439  H HE1  . PHE A 1 14  ? -7.577  -4.440  -11.055 1.00 0.00 ? 14  PHE A HE1  6  
ATOM 9440  H HE2  . PHE A 1 14  ? -7.267  -1.663  -7.835  1.00 0.00 ? 14  PHE A HE2  6  
ATOM 9441  H HZ   . PHE A 1 14  ? -8.120  -3.787  -8.743  1.00 0.00 ? 14  PHE A HZ   6  
ATOM 9442  N N    . GLU A 1 15  ? -4.255  2.002   -13.358 1.00 0.00 ? 15  GLU A N    6  
ATOM 9443  C CA   . GLU A 1 15  ? -3.348  2.685   -14.273 1.00 0.00 ? 15  GLU A CA   6  
ATOM 9444  C C    . GLU A 1 15  ? -1.925  2.698   -13.721 1.00 0.00 ? 15  GLU A C    6  
ATOM 9445  O O    . GLU A 1 15  ? -1.700  3.037   -12.559 1.00 0.00 ? 15  GLU A O    6  
ATOM 9446  C CB   . GLU A 1 15  ? -3.823  4.118   -14.521 1.00 0.00 ? 15  GLU A CB   6  
ATOM 9447  C CG   . GLU A 1 15  ? -4.153  4.880   -13.249 1.00 0.00 ? 15  GLU A CG   6  
ATOM 9448  C CD   . GLU A 1 15  ? -3.997  6.380   -13.409 1.00 0.00 ? 15  GLU A CD   6  
ATOM 9449  O OE1  . GLU A 1 15  ? -4.975  7.035   -13.826 1.00 0.00 ? 15  GLU A OE1  6  
ATOM 9450  O OE2  . GLU A 1 15  ? -2.899  6.898   -13.119 1.00 0.00 ? 15  GLU A OE2  6  
ATOM 9451  H H    . GLU A 1 15  ? -4.320  2.311   -12.430 1.00 0.00 ? 15  GLU A H    6  
ATOM 9452  H HA   . GLU A 1 15  ? -3.353  2.147   -15.208 1.00 0.00 ? 15  GLU A HA   6  
ATOM 9453  H HB2  . GLU A 1 15  ? -3.048  4.656   -15.048 1.00 0.00 ? 15  GLU A HB2  6  
ATOM 9454  H HB3  . GLU A 1 15  ? -4.710  4.088   -15.138 1.00 0.00 ? 15  GLU A HB3  6  
ATOM 9455  H HG2  . GLU A 1 15  ? -5.174  4.667   -12.971 1.00 0.00 ? 15  GLU A HG2  6  
ATOM 9456  H HG3  . GLU A 1 15  ? -3.490  4.546   -12.463 1.00 0.00 ? 15  GLU A HG3  6  
ATOM 9457  N N    . THR A 1 16  ? -0.967  2.325   -14.564 1.00 0.00 ? 16  THR A N    6  
ATOM 9458  C CA   . THR A 1 16  ? 0.434   2.292   -14.161 1.00 0.00 ? 16  THR A CA   6  
ATOM 9459  C C    . THR A 1 16  ? 1.159   3.563   -14.588 1.00 0.00 ? 16  THR A C    6  
ATOM 9460  O O    . THR A 1 16  ? 0.883   4.120   -15.651 1.00 0.00 ? 16  THR A O    6  
ATOM 9461  C CB   . THR A 1 16  ? 1.161   1.073   -14.760 1.00 0.00 ? 16  THR A CB   6  
ATOM 9462  O OG1  . THR A 1 16  ? 0.476   -0.132  -14.401 1.00 0.00 ? 16  THR A OG1  6  
ATOM 9463  C CG2  . THR A 1 16  ? 2.601   1.009   -14.273 1.00 0.00 ? 16  THR A CG2  6  
ATOM 9464  H H    . THR A 1 16  ? -1.209  2.067   -15.477 1.00 0.00 ? 16  THR A H    6  
ATOM 9465  H HA   . THR A 1 16  ? 0.470   2.213   -13.085 1.00 0.00 ? 16  THR A HA   6  
ATOM 9466  H HB   . THR A 1 16  ? 1.165   1.169   -15.837 1.00 0.00 ? 16  THR A HB   6  
ATOM 9467  H HG1  . THR A 1 16  ? 0.687   -0.821  -15.035 1.00 0.00 ? 16  THR A HG1  6  
ATOM 9468  H HG21 . THR A 1 16  ? 3.259   1.380   -15.045 1.00 0.00 ? 16  THR A HG21 6  
ATOM 9469  H HG22 . THR A 1 16  ? 2.857   -0.014  -14.042 1.00 0.00 ? 16  THR A HG22 6  
ATOM 9470  H HG23 . THR A 1 16  ? 2.708   1.617   -13.387 1.00 0.00 ? 16  THR A HG23 6  
ATOM 9471  N N    . TYR A 1 17  ? 2.088   4.016   -13.754 1.00 0.00 ? 17  TYR A N    6  
ATOM 9472  C CA   . TYR A 1 17  ? 2.853   5.224   -14.045 1.00 0.00 ? 17  TYR A CA   6  
ATOM 9473  C C    . TYR A 1 17  ? 4.235   5.161   -13.403 1.00 0.00 ? 17  TYR A C    6  
ATOM 9474  O O    . TYR A 1 17  ? 4.433   4.483   -12.396 1.00 0.00 ? 17  TYR A O    6  
ATOM 9475  C CB   . TYR A 1 17  ? 2.102   6.460   -13.547 1.00 0.00 ? 17  TYR A CB   6  
ATOM 9476  C CG   . TYR A 1 17  ? 1.810   6.434   -12.064 1.00 0.00 ? 17  TYR A CG   6  
ATOM 9477  C CD1  . TYR A 1 17  ? 0.671   5.808   -11.571 1.00 0.00 ? 17  TYR A CD1  6  
ATOM 9478  C CD2  . TYR A 1 17  ? 2.671   7.037   -11.155 1.00 0.00 ? 17  TYR A CD2  6  
ATOM 9479  C CE1  . TYR A 1 17  ? 0.400   5.782   -10.217 1.00 0.00 ? 17  TYR A CE1  6  
ATOM 9480  C CE2  . TYR A 1 17  ? 2.408   7.015   -9.799  1.00 0.00 ? 17  TYR A CE2  6  
ATOM 9481  C CZ   . TYR A 1 17  ? 1.271   6.386   -9.335  1.00 0.00 ? 17  TYR A CZ   6  
ATOM 9482  O OH   . TYR A 1 17  ? 1.005   6.364   -7.985  1.00 0.00 ? 17  TYR A OH   6  
ATOM 9483  H H    . TYR A 1 17  ? 2.264   3.529   -12.922 1.00 0.00 ? 17  TYR A H    6  
ATOM 9484  H HA   . TYR A 1 17  ? 2.969   5.292   -15.117 1.00 0.00 ? 17  TYR A HA   6  
ATOM 9485  H HB2  . TYR A 1 17  ? 2.694   7.339   -13.753 1.00 0.00 ? 17  TYR A HB2  6  
ATOM 9486  H HB3  . TYR A 1 17  ? 1.160   6.536   -14.070 1.00 0.00 ? 17  TYR A HB3  6  
ATOM 9487  H HD1  . TYR A 1 17  ? -0.009  5.335   -12.265 1.00 0.00 ? 17  TYR A HD1  6  
ATOM 9488  H HD2  . TYR A 1 17  ? 3.560   7.529   -11.522 1.00 0.00 ? 17  TYR A HD2  6  
ATOM 9489  H HE1  . TYR A 1 17  ? -0.490  5.290   -9.853  1.00 0.00 ? 17  TYR A HE1  6  
ATOM 9490  H HE2  . TYR A 1 17  ? 3.090   7.489   -9.109  1.00 0.00 ? 17  TYR A HE2  6  
ATOM 9491  H HH   . TYR A 1 17  ? 1.527   5.675   -7.568  1.00 0.00 ? 17  TYR A HH   6  
ATOM 9492  N N    . ASN A 1 18  ? 5.188   5.874   -13.995 1.00 0.00 ? 18  ASN A N    6  
ATOM 9493  C CA   . ASN A 1 18  ? 6.553   5.901   -13.481 1.00 0.00 ? 18  ASN A CA   6  
ATOM 9494  C C    . ASN A 1 18  ? 6.842   7.221   -12.773 1.00 0.00 ? 18  ASN A C    6  
ATOM 9495  O O    . ASN A 1 18  ? 6.554   8.296   -13.299 1.00 0.00 ? 18  ASN A O    6  
ATOM 9496  C CB   . ASN A 1 18  ? 7.552   5.690   -14.621 1.00 0.00 ? 18  ASN A CB   6  
ATOM 9497  C CG   . ASN A 1 18  ? 7.079   6.301   -15.925 1.00 0.00 ? 18  ASN A CG   6  
ATOM 9498  O OD1  . ASN A 1 18  ? 7.492   7.400   -16.296 1.00 0.00 ? 18  ASN A OD1  6  
ATOM 9499  N ND2  . ASN A 1 18  ? 6.207   5.589   -16.630 1.00 0.00 ? 18  ASN A ND2  6  
ATOM 9500  H H    . ASN A 1 18  ? 4.968   6.394   -14.796 1.00 0.00 ? 18  ASN A H    6  
ATOM 9501  H HA   . ASN A 1 18  ? 6.655   5.094   -12.771 1.00 0.00 ? 18  ASN A HA   6  
ATOM 9502  H HB2  . ASN A 1 18  ? 8.494   6.147   -14.353 1.00 0.00 ? 18  ASN A HB2  6  
ATOM 9503  H HB3  . ASN A 1 18  ? 7.700   4.632   -14.772 1.00 0.00 ? 18  ASN A HB3  6  
ATOM 9504  H HD21 . ASN A 1 18  ? 5.922   4.721   -16.273 1.00 0.00 ? 18  ASN A HD21 6  
ATOM 9505  H HD22 . ASN A 1 18  ? 5.884   5.959   -17.477 1.00 0.00 ? 18  ASN A HD22 6  
ATOM 9506  N N    . VAL A 1 19  ? 7.414   7.131   -11.577 1.00 0.00 ? 19  VAL A N    6  
ATOM 9507  C CA   . VAL A 1 19  ? 7.745   8.317   -10.796 1.00 0.00 ? 19  VAL A CA   6  
ATOM 9508  C C    . VAL A 1 19  ? 9.254   8.481   -10.656 1.00 0.00 ? 19  VAL A C    6  
ATOM 9509  O O    . VAL A 1 19  ? 9.909   7.706   -9.960  1.00 0.00 ? 19  VAL A O    6  
ATOM 9510  C CB   . VAL A 1 19  ? 7.113   8.260   -9.393  1.00 0.00 ? 19  VAL A CB   6  
ATOM 9511  C CG1  . VAL A 1 19  ? 6.946   9.661   -8.824  1.00 0.00 ? 19  VAL A CG1  6  
ATOM 9512  C CG2  . VAL A 1 19  ? 5.778   7.531   -9.439  1.00 0.00 ? 19  VAL A CG2  6  
ATOM 9513  H H    . VAL A 1 19  ? 7.620   6.246   -11.211 1.00 0.00 ? 19  VAL A H    6  
ATOM 9514  H HA   . VAL A 1 19  ? 7.345   9.178   -11.313 1.00 0.00 ? 19  VAL A HA   6  
ATOM 9515  H HB   . VAL A 1 19  ? 7.778   7.709   -8.744  1.00 0.00 ? 19  VAL A HB   6  
ATOM 9516  H HG11 . VAL A 1 19  ? 6.085   10.132  -9.277  1.00 0.00 ? 19  VAL A HG11 6  
ATOM 9517  H HG12 . VAL A 1 19  ? 6.805   9.601   -7.755  1.00 0.00 ? 19  VAL A HG12 6  
ATOM 9518  H HG13 . VAL A 1 19  ? 7.829   10.244  -9.040  1.00 0.00 ? 19  VAL A HG13 6  
ATOM 9519  H HG21 . VAL A 1 19  ? 5.467   7.417   -10.467 1.00 0.00 ? 19  VAL A HG21 6  
ATOM 9520  H HG22 . VAL A 1 19  ? 5.884   6.557   -8.984  1.00 0.00 ? 19  VAL A HG22 6  
ATOM 9521  H HG23 . VAL A 1 19  ? 5.037   8.102   -8.899  1.00 0.00 ? 19  VAL A HG23 6  
ATOM 9522  N N    . GLU A 1 20  ? 9.799   9.494   -11.322 1.00 0.00 ? 20  GLU A N    6  
ATOM 9523  C CA   . GLU A 1 20  ? 11.232  9.758   -11.272 1.00 0.00 ? 20  GLU A CA   6  
ATOM 9524  C C    . GLU A 1 20  ? 11.580  10.644  -10.079 1.00 0.00 ? 20  GLU A C    6  
ATOM 9525  O O    . GLU A 1 20  ? 11.611  11.871  -10.190 1.00 0.00 ? 20  GLU A O    6  
ATOM 9526  C CB   . GLU A 1 20  ? 11.696  10.424  -12.569 1.00 0.00 ? 20  GLU A CB   6  
ATOM 9527  C CG   . GLU A 1 20  ? 13.162  10.822  -12.557 1.00 0.00 ? 20  GLU A CG   6  
ATOM 9528  C CD   . GLU A 1 20  ? 13.497  11.846  -13.625 1.00 0.00 ? 20  GLU A CD   6  
ATOM 9529  O OE1  . GLU A 1 20  ? 12.616  12.665  -13.958 1.00 0.00 ? 20  GLU A OE1  6  
ATOM 9530  O OE2  . GLU A 1 20  ? 14.640  11.827  -14.128 1.00 0.00 ? 20  GLU A OE2  6  
ATOM 9531  H H    . GLU A 1 20  ? 9.223   10.077  -11.860 1.00 0.00 ? 20  GLU A H    6  
ATOM 9532  H HA   . GLU A 1 20  ? 11.740  8.812   -11.162 1.00 0.00 ? 20  GLU A HA   6  
ATOM 9533  H HB2  . GLU A 1 20  ? 11.536  9.739   -13.388 1.00 0.00 ? 20  GLU A HB2  6  
ATOM 9534  H HB3  . GLU A 1 20  ? 11.105  11.313  -12.734 1.00 0.00 ? 20  GLU A HB3  6  
ATOM 9535  H HG2  . GLU A 1 20  ? 13.401  11.242  -11.591 1.00 0.00 ? 20  GLU A HG2  6  
ATOM 9536  H HG3  . GLU A 1 20  ? 13.763  9.940   -12.724 1.00 0.00 ? 20  GLU A HG3  6  
ATOM 9537  N N    . LEU A 1 21  ? 11.840  10.015  -8.939  1.00 0.00 ? 21  LEU A N    6  
ATOM 9538  C CA   . LEU A 1 21  ? 12.186  10.745  -7.724  1.00 0.00 ? 21  LEU A CA   6  
ATOM 9539  C C    . LEU A 1 21  ? 13.652  11.168  -7.741  1.00 0.00 ? 21  LEU A C    6  
ATOM 9540  O O    . LEU A 1 21  ? 14.528  10.392  -8.122  1.00 0.00 ? 21  LEU A O    6  
ATOM 9541  C CB   . LEU A 1 21  ? 11.906  9.885   -6.491  1.00 0.00 ? 21  LEU A CB   6  
ATOM 9542  C CG   . LEU A 1 21  ? 10.459  9.429   -6.305  1.00 0.00 ? 21  LEU A CG   6  
ATOM 9543  C CD1  . LEU A 1 21  ? 10.376  8.325   -5.262  1.00 0.00 ? 21  LEU A CD1  6  
ATOM 9544  C CD2  . LEU A 1 21  ? 9.576   10.604  -5.910  1.00 0.00 ? 21  LEU A CD2  6  
ATOM 9545  H H    . LEU A 1 21  ? 11.800  9.037   -8.911  1.00 0.00 ? 21  LEU A H    6  
ATOM 9546  H HA   . LEU A 1 21  ? 11.569  11.631  -7.682  1.00 0.00 ? 21  LEU A HA   6  
ATOM 9547  H HB2  . LEU A 1 21  ? 12.524  9.003   -6.556  1.00 0.00 ? 21  LEU A HB2  6  
ATOM 9548  H HB3  . LEU A 1 21  ? 12.189  10.456  -5.618  1.00 0.00 ? 21  LEU A HB3  6  
ATOM 9549  H HG   . LEU A 1 21  ? 10.090  9.032   -7.241  1.00 0.00 ? 21  LEU A HG   6  
ATOM 9550  H HD11 . LEU A 1 21  ? 9.570   8.536   -4.577  1.00 0.00 ? 21  LEU A HD11 6  
ATOM 9551  H HD12 . LEU A 1 21  ? 11.308  8.273   -4.718  1.00 0.00 ? 21  LEU A HD12 6  
ATOM 9552  H HD13 . LEU A 1 21  ? 10.194  7.380   -5.753  1.00 0.00 ? 21  LEU A HD13 6  
ATOM 9553  H HD21 . LEU A 1 21  ? 8.548   10.278  -5.851  1.00 0.00 ? 21  LEU A HD21 6  
ATOM 9554  H HD22 . LEU A 1 21  ? 9.664   11.385  -6.652  1.00 0.00 ? 21  LEU A HD22 6  
ATOM 9555  H HD23 . LEU A 1 21  ? 9.890   10.983  -4.949  1.00 0.00 ? 21  LEU A HD23 6  
ATOM 9556  N N    . VAL A 1 22  ? 13.911  12.403  -7.323  1.00 0.00 ? 22  VAL A N    6  
ATOM 9557  C CA   . VAL A 1 22  ? 15.270  12.929  -7.287  1.00 0.00 ? 22  VAL A CA   6  
ATOM 9558  C C    . VAL A 1 22  ? 15.827  12.915  -5.868  1.00 0.00 ? 22  VAL A C    6  
ATOM 9559  O O    . VAL A 1 22  ? 15.167  13.354  -4.927  1.00 0.00 ? 22  VAL A O    6  
ATOM 9560  C CB   . VAL A 1 22  ? 15.331  14.366  -7.837  1.00 0.00 ? 22  VAL A CB   6  
ATOM 9561  C CG1  . VAL A 1 22  ? 14.716  15.343  -6.848  1.00 0.00 ? 22  VAL A CG1  6  
ATOM 9562  C CG2  . VAL A 1 22  ? 16.767  14.753  -8.158  1.00 0.00 ? 22  VAL A CG2  6  
ATOM 9563  H H    . VAL A 1 22  ? 13.170  12.975  -7.032  1.00 0.00 ? 22  VAL A H    6  
ATOM 9564  H HA   . VAL A 1 22  ? 15.888  12.300  -7.912  1.00 0.00 ? 22  VAL A HA   6  
ATOM 9565  H HB   . VAL A 1 22  ? 14.758  14.405  -8.752  1.00 0.00 ? 22  VAL A HB   6  
ATOM 9566  H HG11 . VAL A 1 22  ? 13.804  14.924  -6.448  1.00 0.00 ? 22  VAL A HG11 6  
ATOM 9567  H HG12 . VAL A 1 22  ? 15.412  15.528  -6.043  1.00 0.00 ? 22  VAL A HG12 6  
ATOM 9568  H HG13 . VAL A 1 22  ? 14.492  16.272  -7.351  1.00 0.00 ? 22  VAL A HG13 6  
ATOM 9569  H HG21 . VAL A 1 22  ? 16.841  15.827  -8.236  1.00 0.00 ? 22  VAL A HG21 6  
ATOM 9570  H HG22 . VAL A 1 22  ? 17.419  14.404  -7.370  1.00 0.00 ? 22  VAL A HG22 6  
ATOM 9571  H HG23 . VAL A 1 22  ? 17.062  14.303  -9.094  1.00 0.00 ? 22  VAL A HG23 6  
ATOM 9572  N N    . ARG A 1 23  ? 17.048  12.409  -5.722  1.00 0.00 ? 23  ARG A N    6  
ATOM 9573  C CA   . ARG A 1 23  ? 17.694  12.337  -4.418  1.00 0.00 ? 23  ARG A CA   6  
ATOM 9574  C C    . ARG A 1 23  ? 18.715  13.459  -4.254  1.00 0.00 ? 23  ARG A C    6  
ATOM 9575  O O    . ARG A 1 23  ? 19.839  13.368  -4.749  1.00 0.00 ? 23  ARG A O    6  
ATOM 9576  C CB   . ARG A 1 23  ? 18.378  10.981  -4.237  1.00 0.00 ? 23  ARG A CB   6  
ATOM 9577  C CG   . ARG A 1 23  ? 17.484  9.798   -4.575  1.00 0.00 ? 23  ARG A CG   6  
ATOM 9578  C CD   . ARG A 1 23  ? 17.963  8.526   -3.894  1.00 0.00 ? 23  ARG A CD   6  
ATOM 9579  N NE   . ARG A 1 23  ? 19.247  8.072   -4.423  1.00 0.00 ? 23  ARG A NE   6  
ATOM 9580  C CZ   . ARG A 1 23  ? 19.931  7.052   -3.917  1.00 0.00 ? 23  ARG A CZ   6  
ATOM 9581  N NH1  . ARG A 1 23  ? 19.456  6.382   -2.875  1.00 0.00 ? 23  ARG A NH1  6  
ATOM 9582  N NH2  . ARG A 1 23  ? 21.092  6.698   -4.454  1.00 0.00 ? 23  ARG A NH2  6  
ATOM 9583  H H    . ARG A 1 23  ? 17.524  12.074  -6.511  1.00 0.00 ? 23  ARG A H    6  
ATOM 9584  H HA   . ARG A 1 23  ? 16.930  12.449  -3.662  1.00 0.00 ? 23  ARG A HA   6  
ATOM 9585  H HB2  . ARG A 1 23  ? 19.247  10.941  -4.877  1.00 0.00 ? 23  ARG A HB2  6  
ATOM 9586  H HB3  . ARG A 1 23  ? 18.693  10.884  -3.209  1.00 0.00 ? 23  ARG A HB3  6  
ATOM 9587  H HG2  . ARG A 1 23  ? 16.479  10.013  -4.245  1.00 0.00 ? 23  ARG A HG2  6  
ATOM 9588  H HG3  . ARG A 1 23  ? 17.490  9.649   -5.644  1.00 0.00 ? 23  ARG A HG3  6  
ATOM 9589  H HD2  . ARG A 1 23  ? 18.068  8.717   -2.836  1.00 0.00 ? 23  ARG A HD2  6  
ATOM 9590  H HD3  . ARG A 1 23  ? 17.227  7.752   -4.049  1.00 0.00 ? 23  ARG A HD3  6  
ATOM 9591  H HE   . ARG A 1 23  ? 19.616  8.552   -5.193  1.00 0.00 ? 23  ARG A HE   6  
ATOM 9592  H HH11 . ARG A 1 23  ? 18.581  6.646   -2.470  1.00 0.00 ? 23  ARG A HH11 6  
ATOM 9593  H HH12 . ARG A 1 23  ? 19.972  5.614   -2.497  1.00 0.00 ? 23  ARG A HH12 6  
ATOM 9594  H HH21 . ARG A 1 23  ? 21.453  7.200   -5.239  1.00 0.00 ? 23  ARG A HH21 6  
ATOM 9595  H HH22 . ARG A 1 23  ? 21.606  5.931   -4.072  1.00 0.00 ? 23  ARG A HH22 6  
ATOM 9596  N N    . LYS A 1 24  ? 18.316  14.518  -3.558  1.00 0.00 ? 24  LYS A N    6  
ATOM 9597  C CA   . LYS A 1 24  ? 19.195  15.659  -3.328  1.00 0.00 ? 24  LYS A CA   6  
ATOM 9598  C C    . LYS A 1 24  ? 20.544  15.205  -2.779  1.00 0.00 ? 24  LYS A C    6  
ATOM 9599  O O    . LYS A 1 24  ? 20.769  14.012  -2.570  1.00 0.00 ? 24  LYS A O    6  
ATOM 9600  C CB   . LYS A 1 24  ? 18.542  16.644  -2.356  1.00 0.00 ? 24  LYS A CB   6  
ATOM 9601  C CG   . LYS A 1 24  ? 17.258  17.259  -2.884  1.00 0.00 ? 24  LYS A CG   6  
ATOM 9602  C CD   . LYS A 1 24  ? 16.834  18.461  -2.057  1.00 0.00 ? 24  LYS A CD   6  
ATOM 9603  C CE   . LYS A 1 24  ? 16.145  18.036  -0.769  1.00 0.00 ? 24  LYS A CE   6  
ATOM 9604  N NZ   . LYS A 1 24  ? 15.990  19.174  0.179   1.00 0.00 ? 24  LYS A NZ   6  
ATOM 9605  H H    . LYS A 1 24  ? 17.408  14.533  -3.189  1.00 0.00 ? 24  LYS A H    6  
ATOM 9606  H HA   . LYS A 1 24  ? 19.353  16.152  -4.275  1.00 0.00 ? 24  LYS A HA   6  
ATOM 9607  H HB2  . LYS A 1 24  ? 18.317  16.127  -1.435  1.00 0.00 ? 24  LYS A HB2  6  
ATOM 9608  H HB3  . LYS A 1 24  ? 19.240  17.442  -2.149  1.00 0.00 ? 24  LYS A HB3  6  
ATOM 9609  H HG2  . LYS A 1 24  ? 17.414  17.576  -3.905  1.00 0.00 ? 24  LYS A HG2  6  
ATOM 9610  H HG3  . LYS A 1 24  ? 16.474  16.517  -2.852  1.00 0.00 ? 24  LYS A HG3  6  
ATOM 9611  H HD2  . LYS A 1 24  ? 17.709  19.043  -1.808  1.00 0.00 ? 24  LYS A HD2  6  
ATOM 9612  H HD3  . LYS A 1 24  ? 16.151  19.064  -2.638  1.00 0.00 ? 24  LYS A HD3  6  
ATOM 9613  H HE2  . LYS A 1 24  ? 15.169  17.644  -1.011  1.00 0.00 ? 24  LYS A HE2  6  
ATOM 9614  H HE3  . LYS A 1 24  ? 16.736  17.264  -0.298  1.00 0.00 ? 24  LYS A HE3  6  
ATOM 9615  H HZ1  . LYS A 1 24  ? 16.922  19.483  0.521   1.00 0.00 ? 24  LYS A HZ1  6  
ATOM 9616  H HZ2  . LYS A 1 24  ? 15.413  18.883  0.994   1.00 0.00 ? 24  LYS A HZ2  6  
ATOM 9617  H HZ3  . LYS A 1 24  ? 15.523  19.973  -0.295  1.00 0.00 ? 24  LYS A HZ3  6  
ATOM 9618  N N    . ASP A 1 25  ? 21.435  16.161  -2.547  1.00 0.00 ? 25  ASP A N    6  
ATOM 9619  C CA   . ASP A 1 25  ? 22.761  15.859  -2.019  1.00 0.00 ? 25  ASP A CA   6  
ATOM 9620  C C    . ASP A 1 25  ? 22.662  15.194  -0.650  1.00 0.00 ? 25  ASP A C    6  
ATOM 9621  O O    . ASP A 1 25  ? 22.655  15.868  0.380   1.00 0.00 ? 25  ASP A O    6  
ATOM 9622  C CB   . ASP A 1 25  ? 23.597  17.136  -1.921  1.00 0.00 ? 25  ASP A CB   6  
ATOM 9623  C CG   . ASP A 1 25  ? 23.950  17.704  -3.282  1.00 0.00 ? 25  ASP A CG   6  
ATOM 9624  O OD1  . ASP A 1 25  ? 24.841  17.136  -3.949  1.00 0.00 ? 25  ASP A OD1  6  
ATOM 9625  O OD2  . ASP A 1 25  ? 23.334  18.714  -3.680  1.00 0.00 ? 25  ASP A OD2  6  
ATOM 9626  H H    . ASP A 1 25  ? 21.196  17.093  -2.734  1.00 0.00 ? 25  ASP A H    6  
ATOM 9627  H HA   . ASP A 1 25  ? 23.242  15.177  -2.703  1.00 0.00 ? 25  ASP A HA   6  
ATOM 9628  H HB2  . ASP A 1 25  ? 23.039  17.883  -1.374  1.00 0.00 ? 25  ASP A HB2  6  
ATOM 9629  H HB3  . ASP A 1 25  ? 24.514  16.919  -1.393  1.00 0.00 ? 25  ASP A HB3  6  
ATOM 9630  N N    . GLY A 1 26  ? 22.585  13.867  -0.646  1.00 0.00 ? 26  GLY A N    6  
ATOM 9631  C CA   . GLY A 1 26  ? 22.486  13.133  0.602   1.00 0.00 ? 26  GLY A CA   6  
ATOM 9632  C C    . GLY A 1 26  ? 21.088  12.608  0.857   1.00 0.00 ? 26  GLY A C    6  
ATOM 9633  O O    . GLY A 1 26  ? 20.917  11.491  1.344   1.00 0.00 ? 26  GLY A O    6  
ATOM 9634  H H    . GLY A 1 26  ? 22.595  13.382  -1.498  1.00 0.00 ? 26  GLY A H    6  
ATOM 9635  H HA2  . GLY A 1 26  ? 23.173  12.300  0.572   1.00 0.00 ? 26  GLY A HA2  6  
ATOM 9636  H HA3  . GLY A 1 26  ? 22.766  13.788  1.414   1.00 0.00 ? 26  GLY A HA3  6  
ATOM 9637  N N    . GLN A 1 27  ? 20.085  13.416  0.528   1.00 0.00 ? 27  GLN A N    6  
ATOM 9638  C CA   . GLN A 1 27  ? 18.694  13.026  0.727   1.00 0.00 ? 27  GLN A CA   6  
ATOM 9639  C C    . GLN A 1 27  ? 18.434  11.631  0.168   1.00 0.00 ? 27  GLN A C    6  
ATOM 9640  O O    . GLN A 1 27  ? 18.607  11.388  -1.026  1.00 0.00 ? 27  GLN A O    6  
ATOM 9641  C CB   . GLN A 1 27  ? 17.759  14.038  0.062   1.00 0.00 ? 27  GLN A CB   6  
ATOM 9642  C CG   . GLN A 1 27  ? 16.285  13.755  0.304   1.00 0.00 ? 27  GLN A CG   6  
ATOM 9643  C CD   . GLN A 1 27  ? 15.377  14.609  -0.559  1.00 0.00 ? 27  GLN A CD   6  
ATOM 9644  O OE1  . GLN A 1 27  ? 15.291  14.415  -1.771  1.00 0.00 ? 27  GLN A OE1  6  
ATOM 9645  N NE2  . GLN A 1 27  ? 14.693  15.562  0.064   1.00 0.00 ? 27  GLN A NE2  6  
ATOM 9646  H H    . GLN A 1 27  ? 20.285  14.294  0.144   1.00 0.00 ? 27  GLN A H    6  
ATOM 9647  H HA   . GLN A 1 27  ? 18.501  13.017  1.789   1.00 0.00 ? 27  GLN A HA   6  
ATOM 9648  H HB2  . GLN A 1 27  ? 17.982  15.022  0.444   1.00 0.00 ? 27  GLN A HB2  6  
ATOM 9649  H HB3  . GLN A 1 27  ? 17.934  14.025  -1.004  1.00 0.00 ? 27  GLN A HB3  6  
ATOM 9650  H HG2  . GLN A 1 27  ? 16.090  12.715  0.085   1.00 0.00 ? 27  GLN A HG2  6  
ATOM 9651  H HG3  . GLN A 1 27  ? 16.060  13.951  1.342   1.00 0.00 ? 27  GLN A HG3  6  
ATOM 9652  H HE21 . GLN A 1 27  ? 14.812  15.659  1.032   1.00 0.00 ? 27  GLN A HE21 6  
ATOM 9653  H HE22 . GLN A 1 27  ? 14.099  16.129  -0.469  1.00 0.00 ? 27  GLN A HE22 6  
ATOM 9654  N N    . SER A 1 28  ? 18.019  10.718  1.040   1.00 0.00 ? 28  SER A N    6  
ATOM 9655  C CA   . SER A 1 28  ? 17.739  9.345   0.634   1.00 0.00 ? 28  SER A CA   6  
ATOM 9656  C C    . SER A 1 28  ? 16.306  9.210   0.129   1.00 0.00 ? 28  SER A C    6  
ATOM 9657  O O    . SER A 1 28  ? 15.512  10.147  0.218   1.00 0.00 ? 28  SER A O    6  
ATOM 9658  C CB   . SER A 1 28  ? 17.972  8.388   1.805   1.00 0.00 ? 28  SER A CB   6  
ATOM 9659  O OG   . SER A 1 28  ? 19.352  8.117   1.975   1.00 0.00 ? 28  SER A OG   6  
ATOM 9660  H H    . SER A 1 28  ? 17.900  10.973  1.979   1.00 0.00 ? 28  SER A H    6  
ATOM 9661  H HA   . SER A 1 28  ? 18.417  9.092   -0.167  1.00 0.00 ? 28  SER A HA   6  
ATOM 9662  H HB2  . SER A 1 28  ? 17.590  8.832   2.711   1.00 0.00 ? 28  SER A HB2  6  
ATOM 9663  H HB3  . SER A 1 28  ? 17.455  7.458   1.614   1.00 0.00 ? 28  SER A HB3  6  
ATOM 9664  H HG   . SER A 1 28  ? 19.854  8.928   1.864   1.00 0.00 ? 28  SER A HG   6  
ATOM 9665  N N    . LEU A 1 29  ? 15.982  8.036   -0.403  1.00 0.00 ? 29  LEU A N    6  
ATOM 9666  C CA   . LEU A 1 29  ? 14.644  7.776   -0.924  1.00 0.00 ? 29  LEU A CA   6  
ATOM 9667  C C    . LEU A 1 29  ? 13.586  8.017   0.148   1.00 0.00 ? 29  LEU A C    6  
ATOM 9668  O O    . LEU A 1 29  ? 12.768  8.928   0.033   1.00 0.00 ? 29  LEU A O    6  
ATOM 9669  C CB   . LEU A 1 29  ? 14.547  6.338   -1.438  1.00 0.00 ? 29  LEU A CB   6  
ATOM 9670  C CG   . LEU A 1 29  ? 13.569  6.102   -2.590  1.00 0.00 ? 29  LEU A CG   6  
ATOM 9671  C CD1  . LEU A 1 29  ? 13.995  6.887   -3.821  1.00 0.00 ? 29  LEU A CD1  6  
ATOM 9672  C CD2  . LEU A 1 29  ? 13.469  4.618   -2.909  1.00 0.00 ? 29  LEU A CD2  6  
ATOM 9673  H H    . LEU A 1 29  ? 16.657  7.328   -0.446  1.00 0.00 ? 29  LEU A H    6  
ATOM 9674  H HA   . LEU A 1 29  ? 14.470  8.456   -1.744  1.00 0.00 ? 29  LEU A HA   6  
ATOM 9675  H HB2  . LEU A 1 29  ? 15.529  6.040   -1.773  1.00 0.00 ? 29  LEU A HB2  6  
ATOM 9676  H HB3  . LEU A 1 29  ? 14.244  5.712   -0.612  1.00 0.00 ? 29  LEU A HB3  6  
ATOM 9677  H HG   . LEU A 1 29  ? 12.588  6.449   -2.297  1.00 0.00 ? 29  LEU A HG   6  
ATOM 9678  H HD11 . LEU A 1 29  ? 14.896  7.439   -3.602  1.00 0.00 ? 29  LEU A HD11 6  
ATOM 9679  H HD12 . LEU A 1 29  ? 13.210  7.575   -4.099  1.00 0.00 ? 29  LEU A HD12 6  
ATOM 9680  H HD13 . LEU A 1 29  ? 14.179  6.203   -4.637  1.00 0.00 ? 29  LEU A HD13 6  
ATOM 9681  H HD21 . LEU A 1 29  ? 14.405  4.277   -3.328  1.00 0.00 ? 29  LEU A HD21 6  
ATOM 9682  H HD22 . LEU A 1 29  ? 12.675  4.456   -3.623  1.00 0.00 ? 29  LEU A HD22 6  
ATOM 9683  H HD23 . LEU A 1 29  ? 13.258  4.068   -2.004  1.00 0.00 ? 29  LEU A HD23 6  
ATOM 9684  N N    . GLY A 1 30  ? 13.610  7.193   1.192   1.00 0.00 ? 30  GLY A N    6  
ATOM 9685  C CA   . GLY A 1 30  ? 12.649  7.335   2.270   1.00 0.00 ? 30  GLY A CA   6  
ATOM 9686  C C    . GLY A 1 30  ? 11.311  6.704   1.941   1.00 0.00 ? 30  GLY A C    6  
ATOM 9687  O O    . GLY A 1 30  ? 10.274  7.367   1.997   1.00 0.00 ? 30  GLY A O    6  
ATOM 9688  H H    . GLY A 1 30  ? 14.286  6.484   1.230   1.00 0.00 ? 30  GLY A H    6  
ATOM 9689  H HA2  . GLY A 1 30  ? 13.048  6.866   3.157   1.00 0.00 ? 30  GLY A HA2  6  
ATOM 9690  H HA3  . GLY A 1 30  ? 12.499  8.386   2.468   1.00 0.00 ? 30  GLY A HA3  6  
ATOM 9691  N N    . ILE A 1 31  ? 11.332  5.422   1.594   1.00 0.00 ? 31  ILE A N    6  
ATOM 9692  C CA   . ILE A 1 31  ? 10.111  4.703   1.254   1.00 0.00 ? 31  ILE A CA   6  
ATOM 9693  C C    . ILE A 1 31  ? 10.098  3.313   1.883   1.00 0.00 ? 31  ILE A C    6  
ATOM 9694  O O    . ILE A 1 31  ? 10.976  2.492   1.617   1.00 0.00 ? 31  ILE A O    6  
ATOM 9695  C CB   . ILE A 1 31  ? 9.945   4.565   -0.271  1.00 0.00 ? 31  ILE A CB   6  
ATOM 9696  C CG1  . ILE A 1 31  ? 9.895   5.946   -0.928  1.00 0.00 ? 31  ILE A CG1  6  
ATOM 9697  C CG2  . ILE A 1 31  ? 8.689   3.771   -0.598  1.00 0.00 ? 31  ILE A CG2  6  
ATOM 9698  C CD1  . ILE A 1 31  ? 9.956   5.900   -2.438  1.00 0.00 ? 31  ILE A CD1  6  
ATOM 9699  H H    . ILE A 1 31  ? 12.189  4.948   1.568   1.00 0.00 ? 31  ILE A H    6  
ATOM 9700  H HA   . ILE A 1 31  ? 9.274   5.268   1.637   1.00 0.00 ? 31  ILE A HA   6  
ATOM 9701  H HB   . ILE A 1 31  ? 10.795  4.022   -0.656  1.00 0.00 ? 31  ILE A HB   6  
ATOM 9702  H HG12 . ILE A 1 31  ? 8.977   6.438   -0.648  1.00 0.00 ? 31  ILE A HG12 6  
ATOM 9703  H HG13 . ILE A 1 31  ? 10.733  6.532   -0.579  1.00 0.00 ? 31  ILE A HG13 6  
ATOM 9704  H HG21 . ILE A 1 31  ? 8.961   2.867   -1.122  1.00 0.00 ? 31  ILE A HG21 6  
ATOM 9705  H HG22 . ILE A 1 31  ? 8.177   3.515   0.318   1.00 0.00 ? 31  ILE A HG22 6  
ATOM 9706  H HG23 . ILE A 1 31  ? 8.038   4.367   -1.220  1.00 0.00 ? 31  ILE A HG23 6  
ATOM 9707  H HD11 . ILE A 1 31  ? 9.064   5.424   -2.820  1.00 0.00 ? 31  ILE A HD11 6  
ATOM 9708  H HD12 . ILE A 1 31  ? 10.023  6.904   -2.828  1.00 0.00 ? 31  ILE A HD12 6  
ATOM 9709  H HD13 . ILE A 1 31  ? 10.824  5.335   -2.747  1.00 0.00 ? 31  ILE A HD13 6  
ATOM 9710  N N    . ARG A 1 32  ? 9.095   3.057   2.716   1.00 0.00 ? 32  ARG A N    6  
ATOM 9711  C CA   . ARG A 1 32  ? 8.966   1.767   3.383   1.00 0.00 ? 32  ARG A CA   6  
ATOM 9712  C C    . ARG A 1 32  ? 8.015   0.852   2.618   1.00 0.00 ? 32  ARG A C    6  
ATOM 9713  O O    . ARG A 1 32  ? 6.974   1.292   2.128   1.00 0.00 ? 32  ARG A O    6  
ATOM 9714  C CB   . ARG A 1 32  ? 8.466   1.957   4.816   1.00 0.00 ? 32  ARG A CB   6  
ATOM 9715  C CG   . ARG A 1 32  ? 9.357   2.855   5.658   1.00 0.00 ? 32  ARG A CG   6  
ATOM 9716  C CD   . ARG A 1 32  ? 10.441  2.058   6.367   1.00 0.00 ? 32  ARG A CD   6  
ATOM 9717  N NE   . ARG A 1 32  ? 11.642  2.854   6.600   1.00 0.00 ? 32  ARG A NE   6  
ATOM 9718  C CZ   . ARG A 1 32  ? 12.706  2.405   7.257   1.00 0.00 ? 32  ARG A CZ   6  
ATOM 9719  N NH1  . ARG A 1 32  ? 12.717  1.171   7.743   1.00 0.00 ? 32  ARG A NH1  6  
ATOM 9720  N NH2  . ARG A 1 32  ? 13.762  3.190   7.429   1.00 0.00 ? 32  ARG A NH2  6  
ATOM 9721  H H    . ARG A 1 32  ? 8.426   3.752   2.888   1.00 0.00 ? 32  ARG A H    6  
ATOM 9722  H HA   . ARG A 1 32  ? 9.944   1.309   3.410   1.00 0.00 ? 32  ARG A HA   6  
ATOM 9723  H HB2  . ARG A 1 32  ? 7.478   2.394   4.785   1.00 0.00 ? 32  ARG A HB2  6  
ATOM 9724  H HB3  . ARG A 1 32  ? 8.409   0.991   5.295   1.00 0.00 ? 32  ARG A HB3  6  
ATOM 9725  H HG2  . ARG A 1 32  ? 9.826   3.586   5.016   1.00 0.00 ? 32  ARG A HG2  6  
ATOM 9726  H HG3  . ARG A 1 32  ? 8.750   3.358   6.397   1.00 0.00 ? 32  ARG A HG3  6  
ATOM 9727  H HD2  . ARG A 1 32  ? 10.056  1.718   7.317   1.00 0.00 ? 32  ARG A HD2  6  
ATOM 9728  H HD3  . ARG A 1 32  ? 10.698  1.204   5.757   1.00 0.00 ? 32  ARG A HD3  6  
ATOM 9729  H HE   . ARG A 1 32  ? 11.656  3.769   6.250   1.00 0.00 ? 32  ARG A HE   6  
ATOM 9730  H HH11 . ARG A 1 32  ? 11.923  0.577   7.614   1.00 0.00 ? 32  ARG A HH11 6  
ATOM 9731  H HH12 . ARG A 1 32  ? 13.520  0.835   8.236   1.00 0.00 ? 32  ARG A HH12 6  
ATOM 9732  H HH21 . ARG A 1 32  ? 13.757  4.120   7.064   1.00 0.00 ? 32  ARG A HH21 6  
ATOM 9733  H HH22 . ARG A 1 32  ? 14.562  2.851   7.923   1.00 0.00 ? 32  ARG A HH22 6  
ATOM 9734  N N    . ILE A 1 33  ? 8.379   -0.422  2.519   1.00 0.00 ? 33  ILE A N    6  
ATOM 9735  C CA   . ILE A 1 33  ? 7.558   -1.398  1.814   1.00 0.00 ? 33  ILE A CA   6  
ATOM 9736  C C    . ILE A 1 33  ? 7.083   -2.500  2.756   1.00 0.00 ? 33  ILE A C    6  
ATOM 9737  O O    . ILE A 1 33  ? 7.499   -2.564  3.913   1.00 0.00 ? 33  ILE A O    6  
ATOM 9738  C CB   . ILE A 1 33  ? 8.325   -2.037  0.641   1.00 0.00 ? 33  ILE A CB   6  
ATOM 9739  C CG1  . ILE A 1 33  ? 9.617   -2.686  1.141   1.00 0.00 ? 33  ILE A CG1  6  
ATOM 9740  C CG2  . ILE A 1 33  ? 8.627   -0.994  -0.425  1.00 0.00 ? 33  ILE A CG2  6  
ATOM 9741  C CD1  . ILE A 1 33  ? 10.090  -3.834  0.276   1.00 0.00 ? 33  ILE A CD1  6  
ATOM 9742  H H    . ILE A 1 33  ? 9.220   -0.712  2.930   1.00 0.00 ? 33  ILE A H    6  
ATOM 9743  H HA   . ILE A 1 33  ? 6.696   -0.883  1.416   1.00 0.00 ? 33  ILE A HA   6  
ATOM 9744  H HB   . ILE A 1 33  ? 7.697   -2.795  0.199   1.00 0.00 ? 33  ILE A HB   6  
ATOM 9745  H HG12 . ILE A 1 33  ? 10.400  -1.944  1.164   1.00 0.00 ? 33  ILE A HG12 6  
ATOM 9746  H HG13 . ILE A 1 33  ? 9.457   -3.066  2.139   1.00 0.00 ? 33  ILE A HG13 6  
ATOM 9747  H HG21 . ILE A 1 33  ? 8.230   -1.322  -1.374  1.00 0.00 ? 33  ILE A HG21 6  
ATOM 9748  H HG22 . ILE A 1 33  ? 8.170   -0.055  -0.149  1.00 0.00 ? 33  ILE A HG22 6  
ATOM 9749  H HG23 . ILE A 1 33  ? 9.696   -0.863  -0.508  1.00 0.00 ? 33  ILE A HG23 6  
ATOM 9750  H HD11 . ILE A 1 33  ? 10.825  -3.474  -0.429  1.00 0.00 ? 33  ILE A HD11 6  
ATOM 9751  H HD12 . ILE A 1 33  ? 10.531  -4.597  0.899   1.00 0.00 ? 33  ILE A HD12 6  
ATOM 9752  H HD13 . ILE A 1 33  ? 9.250   -4.249  -0.262  1.00 0.00 ? 33  ILE A HD13 6  
ATOM 9753  N N    . VAL A 1 34  ? 6.211   -3.367  2.251   1.00 0.00 ? 34  VAL A N    6  
ATOM 9754  C CA   . VAL A 1 34  ? 5.682   -4.469  3.046   1.00 0.00 ? 34  VAL A CA   6  
ATOM 9755  C C    . VAL A 1 34  ? 5.299   -5.650  2.162   1.00 0.00 ? 34  VAL A C    6  
ATOM 9756  O O    . VAL A 1 34  ? 4.910   -5.475  1.008   1.00 0.00 ? 34  VAL A O    6  
ATOM 9757  C CB   . VAL A 1 34  ? 4.450   -4.031  3.861   1.00 0.00 ? 34  VAL A CB   6  
ATOM 9758  C CG1  . VAL A 1 34  ? 3.193   -4.100  3.008   1.00 0.00 ? 34  VAL A CG1  6  
ATOM 9759  C CG2  . VAL A 1 34  ? 4.305   -4.889  5.109   1.00 0.00 ? 34  VAL A CG2  6  
ATOM 9760  H H    . VAL A 1 34  ? 5.918   -3.264  1.322   1.00 0.00 ? 34  VAL A H    6  
ATOM 9761  H HA   . VAL A 1 34  ? 6.451   -4.782  3.736   1.00 0.00 ? 34  VAL A HA   6  
ATOM 9762  H HB   . VAL A 1 34  ? 4.593   -3.006  4.170   1.00 0.00 ? 34  VAL A HB   6  
ATOM 9763  H HG11 . VAL A 1 34  ? 3.420   -3.767  2.006   1.00 0.00 ? 34  VAL A HG11 6  
ATOM 9764  H HG12 . VAL A 1 34  ? 2.833   -5.118  2.978   1.00 0.00 ? 34  VAL A HG12 6  
ATOM 9765  H HG13 . VAL A 1 34  ? 2.433   -3.462  3.435   1.00 0.00 ? 34  VAL A HG13 6  
ATOM 9766  H HG21 . VAL A 1 34  ? 4.082   -4.257  5.955   1.00 0.00 ? 34  VAL A HG21 6  
ATOM 9767  H HG22 . VAL A 1 34  ? 3.503   -5.599  4.968   1.00 0.00 ? 34  VAL A HG22 6  
ATOM 9768  H HG23 . VAL A 1 34  ? 5.228   -5.421  5.290   1.00 0.00 ? 34  VAL A HG23 6  
ATOM 9769  N N    . GLY A 1 35  ? 5.411   -6.855  2.712   1.00 0.00 ? 35  GLY A N    6  
ATOM 9770  C CA   . GLY A 1 35  ? 5.072   -8.049  1.959   1.00 0.00 ? 35  GLY A CA   6  
ATOM 9771  C C    . GLY A 1 35  ? 3.721   -8.616  2.348   1.00 0.00 ? 35  GLY A C    6  
ATOM 9772  O O    . GLY A 1 35  ? 3.528   -9.058  3.481   1.00 0.00 ? 35  GLY A O    6  
ATOM 9773  H H    . GLY A 1 35  ? 5.726   -6.934  3.637   1.00 0.00 ? 35  GLY A H    6  
ATOM 9774  H HA2  . GLY A 1 35  ? 5.060   -7.806  0.907   1.00 0.00 ? 35  GLY A HA2  6  
ATOM 9775  H HA3  . GLY A 1 35  ? 5.829   -8.799  2.137   1.00 0.00 ? 35  GLY A HA3  6  
ATOM 9776  N N    . TYR A 1 36  ? 2.783   -8.602  1.408   1.00 0.00 ? 36  TYR A N    6  
ATOM 9777  C CA   . TYR A 1 36  ? 1.441   -9.115  1.660   1.00 0.00 ? 36  TYR A CA   6  
ATOM 9778  C C    . TYR A 1 36  ? 1.294   -10.538 1.129   1.00 0.00 ? 36  TYR A C    6  
ATOM 9779  O O    . TYR A 1 36  ? 1.944   -10.921 0.156   1.00 0.00 ? 36  TYR A O    6  
ATOM 9780  C CB   . TYR A 1 36  ? 0.395   -8.206  1.012   1.00 0.00 ? 36  TYR A CB   6  
ATOM 9781  C CG   . TYR A 1 36  ? -0.153  -7.152  1.948   1.00 0.00 ? 36  TYR A CG   6  
ATOM 9782  C CD1  . TYR A 1 36  ? -1.270  -7.405  2.734   1.00 0.00 ? 36  TYR A CD1  6  
ATOM 9783  C CD2  . TYR A 1 36  ? 0.447   -5.902  2.045   1.00 0.00 ? 36  TYR A CD2  6  
ATOM 9784  C CE1  . TYR A 1 36  ? -1.774  -6.445  3.589   1.00 0.00 ? 36  TYR A CE1  6  
ATOM 9785  C CE2  . TYR A 1 36  ? -0.050  -4.936  2.899   1.00 0.00 ? 36  TYR A CE2  6  
ATOM 9786  C CZ   . TYR A 1 36  ? -1.161  -5.212  3.668   1.00 0.00 ? 36  TYR A CZ   6  
ATOM 9787  O OH   . TYR A 1 36  ? -1.659  -4.253  4.520   1.00 0.00 ? 36  TYR A OH   6  
ATOM 9788  H H    . TYR A 1 36  ? 2.997   -8.237  0.524   1.00 0.00 ? 36  TYR A H    6  
ATOM 9789  H HA   . TYR A 1 36  ? 1.284   -9.123  2.728   1.00 0.00 ? 36  TYR A HA   6  
ATOM 9790  H HB2  . TYR A 1 36  ? 0.840   -7.701  0.169   1.00 0.00 ? 36  TYR A HB2  6  
ATOM 9791  H HB3  . TYR A 1 36  ? -0.433  -8.809  0.670   1.00 0.00 ? 36  TYR A HB3  6  
ATOM 9792  H HD1  . TYR A 1 36  ? -1.747  -8.372  2.670   1.00 0.00 ? 36  TYR A HD1  6  
ATOM 9793  H HD2  . TYR A 1 36  ? 1.317   -5.689  1.441   1.00 0.00 ? 36  TYR A HD2  6  
ATOM 9794  H HE1  . TYR A 1 36  ? -2.644  -6.661  4.192   1.00 0.00 ? 36  TYR A HE1  6  
ATOM 9795  H HE2  . TYR A 1 36  ? 0.430   -3.970  2.961   1.00 0.00 ? 36  TYR A HE2  6  
ATOM 9796  H HH   . TYR A 1 36  ? -0.977  -3.993  5.143   1.00 0.00 ? 36  TYR A HH   6  
ATOM 9797  N N    . VAL A 1 37  ? 0.432   -11.317 1.775   1.00 0.00 ? 37  VAL A N    6  
ATOM 9798  C CA   . VAL A 1 37  ? 0.196   -12.697 1.368   1.00 0.00 ? 37  VAL A CA   6  
ATOM 9799  C C    . VAL A 1 37  ? -1.289  -12.957 1.143   1.00 0.00 ? 37  VAL A C    6  
ATOM 9800  O O    . VAL A 1 37  ? -1.666  -13.856 0.393   1.00 0.00 ? 37  VAL A O    6  
ATOM 9801  C CB   . VAL A 1 37  ? 0.726   -13.690 2.419   1.00 0.00 ? 37  VAL A CB   6  
ATOM 9802  C CG1  . VAL A 1 37  ? 2.241   -13.601 2.522   1.00 0.00 ? 37  VAL A CG1  6  
ATOM 9803  C CG2  . VAL A 1 37  ? 0.076   -13.433 3.770   1.00 0.00 ? 37  VAL A CG2  6  
ATOM 9804  H H    . VAL A 1 37  ? -0.057  -10.955 2.543   1.00 0.00 ? 37  VAL A H    6  
ATOM 9805  H HA   . VAL A 1 37  ? 0.726   -12.868 0.442   1.00 0.00 ? 37  VAL A HA   6  
ATOM 9806  H HB   . VAL A 1 37  ? 0.468   -14.690 2.103   1.00 0.00 ? 37  VAL A HB   6  
ATOM 9807  H HG11 . VAL A 1 37  ? 2.649   -13.300 1.568   1.00 0.00 ? 37  VAL A HG11 6  
ATOM 9808  H HG12 . VAL A 1 37  ? 2.509   -12.875 3.275   1.00 0.00 ? 37  VAL A HG12 6  
ATOM 9809  H HG13 . VAL A 1 37  ? 2.641   -14.567 2.794   1.00 0.00 ? 37  VAL A HG13 6  
ATOM 9810  H HG21 . VAL A 1 37  ? -0.857  -12.911 3.626   1.00 0.00 ? 37  VAL A HG21 6  
ATOM 9811  H HG22 . VAL A 1 37  ? -0.111  -14.376 4.265   1.00 0.00 ? 37  VAL A HG22 6  
ATOM 9812  H HG23 . VAL A 1 37  ? 0.735   -12.833 4.379   1.00 0.00 ? 37  VAL A HG23 6  
ATOM 9813  N N    . GLY A 1 38  ? -2.130  -12.162 1.799   1.00 0.00 ? 38  GLY A N    6  
ATOM 9814  C CA   . GLY A 1 38  ? -3.565  -12.322 1.657   1.00 0.00 ? 38  GLY A CA   6  
ATOM 9815  C C    . GLY A 1 38  ? -4.072  -13.600 2.296   1.00 0.00 ? 38  GLY A C    6  
ATOM 9816  O O    . GLY A 1 38  ? -4.002  -14.673 1.697   1.00 0.00 ? 38  GLY A O    6  
ATOM 9817  H H    . GLY A 1 38  ? -1.772  -11.462 2.384   1.00 0.00 ? 38  GLY A H    6  
ATOM 9818  H HA2  . GLY A 1 38  ? -4.058  -11.480 2.120   1.00 0.00 ? 38  GLY A HA2  6  
ATOM 9819  H HA3  . GLY A 1 38  ? -3.812  -12.337 0.605   1.00 0.00 ? 38  GLY A HA3  6  
ATOM 9820  N N    . THR A 1 39  ? -4.584  -13.486 3.518   1.00 0.00 ? 39  THR A N    6  
ATOM 9821  C CA   . THR A 1 39  ? -5.102  -14.641 4.240   1.00 0.00 ? 39  THR A CA   6  
ATOM 9822  C C    . THR A 1 39  ? -6.535  -14.403 4.702   1.00 0.00 ? 39  THR A C    6  
ATOM 9823  O O    . THR A 1 39  ? -7.301  -15.348 4.891   1.00 0.00 ? 39  THR A O    6  
ATOM 9824  C CB   . THR A 1 39  ? -4.229  -14.977 5.463   1.00 0.00 ? 39  THR A CB   6  
ATOM 9825  O OG1  . THR A 1 39  ? -4.697  -16.179 6.084   1.00 0.00 ? 39  THR A OG1  6  
ATOM 9826  C CG2  . THR A 1 39  ? -4.249  -13.838 6.472   1.00 0.00 ? 39  THR A CG2  6  
ATOM 9827  H H    . THR A 1 39  ? -4.612  -12.604 3.943   1.00 0.00 ? 39  THR A H    6  
ATOM 9828  H HA   . THR A 1 39  ? -5.086  -15.488 3.569   1.00 0.00 ? 39  THR A HA   6  
ATOM 9829  H HB   . THR A 1 39  ? -3.211  -15.125 5.131   1.00 0.00 ? 39  THR A HB   6  
ATOM 9830  H HG1  . THR A 1 39  ? -5.635  -16.286 5.908   1.00 0.00 ? 39  THR A HG1  6  
ATOM 9831  H HG21 . THR A 1 39  ? -5.119  -13.933 7.105   1.00 0.00 ? 39  THR A HG21 6  
ATOM 9832  H HG22 . THR A 1 39  ? -4.286  -12.894 5.948   1.00 0.00 ? 39  THR A HG22 6  
ATOM 9833  H HG23 . THR A 1 39  ? -3.357  -13.879 7.078   1.00 0.00 ? 39  THR A HG23 6  
ATOM 9834  N N    . SER A 1 40  ? -6.891  -13.135 4.882   1.00 0.00 ? 40  SER A N    6  
ATOM 9835  C CA   . SER A 1 40  ? -8.232  -12.773 5.326   1.00 0.00 ? 40  SER A CA   6  
ATOM 9836  C C    . SER A 1 40  ? -9.268  -13.122 4.262   1.00 0.00 ? 40  SER A C    6  
ATOM 9837  O O    . SER A 1 40  ? -9.014  -12.990 3.064   1.00 0.00 ? 40  SER A O    6  
ATOM 9838  C CB   . SER A 1 40  ? -8.299  -11.280 5.650   1.00 0.00 ? 40  SER A CB   6  
ATOM 9839  O OG   . SER A 1 40  ? -9.472  -10.969 6.383   1.00 0.00 ? 40  SER A OG   6  
ATOM 9840  H H    . SER A 1 40  ? -6.235  -12.427 4.715   1.00 0.00 ? 40  SER A H    6  
ATOM 9841  H HA   . SER A 1 40  ? -8.448  -13.337 6.221   1.00 0.00 ? 40  SER A HA   6  
ATOM 9842  H HB2  . SER A 1 40  ? -7.438  -11.003 6.238   1.00 0.00 ? 40  SER A HB2  6  
ATOM 9843  H HB3  . SER A 1 40  ? -8.303  -10.714 4.729   1.00 0.00 ? 40  SER A HB3  6  
ATOM 9844  H HG   . SER A 1 40  ? -9.229  -10.562 7.218   1.00 0.00 ? 40  SER A HG   6  
ATOM 9845  N N    . HIS A 1 41  ? -10.439 -13.567 4.708   1.00 0.00 ? 41  HIS A N    6  
ATOM 9846  C CA   . HIS A 1 41  ? -11.515 -13.935 3.795   1.00 0.00 ? 41  HIS A CA   6  
ATOM 9847  C C    . HIS A 1 41  ? -11.909 -12.752 2.915   1.00 0.00 ? 41  HIS A C    6  
ATOM 9848  O O    . HIS A 1 41  ? -11.689 -11.595 3.276   1.00 0.00 ? 41  HIS A O    6  
ATOM 9849  C CB   . HIS A 1 41  ? -12.731 -14.428 4.580   1.00 0.00 ? 41  HIS A CB   6  
ATOM 9850  C CG   . HIS A 1 41  ? -13.080 -13.562 5.751   1.00 0.00 ? 41  HIS A CG   6  
ATOM 9851  N ND1  . HIS A 1 41  ? -13.359 -14.068 7.004   1.00 0.00 ? 41  HIS A ND1  6  
ATOM 9852  C CD2  . HIS A 1 41  ? -13.192 -12.218 5.856   1.00 0.00 ? 41  HIS A CD2  6  
ATOM 9853  C CE1  . HIS A 1 41  ? -13.630 -13.071 7.828   1.00 0.00 ? 41  HIS A CE1  6  
ATOM 9854  N NE2  . HIS A 1 41  ? -13.534 -11.938 7.156   1.00 0.00 ? 41  HIS A NE2  6  
ATOM 9855  H H    . HIS A 1 41  ? -10.581 -13.651 5.674   1.00 0.00 ? 41  HIS A H    6  
ATOM 9856  H HA   . HIS A 1 41  ? -11.157 -14.733 3.164   1.00 0.00 ? 41  HIS A HA   6  
ATOM 9857  H HB2  . HIS A 1 41  ? -13.588 -14.456 3.923   1.00 0.00 ? 41  HIS A HB2  6  
ATOM 9858  H HB3  . HIS A 1 41  ? -12.534 -15.424 4.949   1.00 0.00 ? 41  HIS A HB3  6  
ATOM 9859  H HD1  . HIS A 1 41  ? -13.361 -15.015 7.251   1.00 0.00 ? 41  HIS A HD1  6  
ATOM 9860  H HD2  . HIS A 1 41  ? -13.041 -11.497 5.065   1.00 0.00 ? 41  HIS A HD2  6  
ATOM 9861  H HE1  . HIS A 1 41  ? -13.884 -13.166 8.873   1.00 0.00 ? 41  HIS A HE1  6  
ATOM 9862  H HE2  . HIS A 1 41  ? -13.768 -11.053 7.507   1.00 0.00 ? 41  HIS A HE2  6  
ATOM 9863  N N    . THR A 1 42  ? -12.490 -13.049 1.758   1.00 0.00 ? 42  THR A N    6  
ATOM 9864  C CA   . THR A 1 42  ? -12.912 -12.012 0.825   1.00 0.00 ? 42  THR A CA   6  
ATOM 9865  C C    . THR A 1 42  ? -11.945 -10.834 0.839   1.00 0.00 ? 42  THR A C    6  
ATOM 9866  O O    . THR A 1 42  ? -12.356 -9.682  0.971   1.00 0.00 ? 42  THR A O    6  
ATOM 9867  C CB   . THR A 1 42  ? -14.328 -11.503 1.154   1.00 0.00 ? 42  THR A CB   6  
ATOM 9868  O OG1  . THR A 1 42  ? -14.717 -10.495 0.214   1.00 0.00 ? 42  THR A OG1  6  
ATOM 9869  C CG2  . THR A 1 42  ? -14.386 -10.937 2.565   1.00 0.00 ? 42  THR A CG2  6  
ATOM 9870  H H    . THR A 1 42  ? -12.638 -13.990 1.526   1.00 0.00 ? 42  THR A H    6  
ATOM 9871  H HA   . THR A 1 42  ? -12.928 -12.441 -0.166  1.00 0.00 ? 42  THR A HA   6  
ATOM 9872  H HB   . THR A 1 42  ? -15.017 -12.333 1.086   1.00 0.00 ? 42  THR A HB   6  
ATOM 9873  H HG1  . THR A 1 42  ? -13.933 -10.079 -0.153  1.00 0.00 ? 42  THR A HG1  6  
ATOM 9874  H HG21 . THR A 1 42  ? -13.736 -10.077 2.635   1.00 0.00 ? 42  THR A HG21 6  
ATOM 9875  H HG22 . THR A 1 42  ? -14.063 -11.690 3.268   1.00 0.00 ? 42  THR A HG22 6  
ATOM 9876  H HG23 . THR A 1 42  ? -15.399 -10.642 2.793   1.00 0.00 ? 42  THR A HG23 6  
ATOM 9877  N N    . GLY A 1 43  ? -10.656 -11.130 0.703   1.00 0.00 ? 43  GLY A N    6  
ATOM 9878  C CA   . GLY A 1 43  ? -9.650  -10.084 0.702   1.00 0.00 ? 43  GLY A CA   6  
ATOM 9879  C C    . GLY A 1 43  ? -8.335  -10.545 0.107   1.00 0.00 ? 43  GLY A C    6  
ATOM 9880  O O    . GLY A 1 43  ? -7.277  -10.361 0.708   1.00 0.00 ? 43  GLY A O    6  
ATOM 9881  H H    . GLY A 1 43  ? -10.386 -12.067 0.602   1.00 0.00 ? 43  GLY A H    6  
ATOM 9882  H HA2  . GLY A 1 43  ? -10.019 -9.246  0.129   1.00 0.00 ? 43  GLY A HA2  6  
ATOM 9883  H HA3  . GLY A 1 43  ? -9.479  -9.764  1.719   1.00 0.00 ? 43  GLY A HA3  6  
ATOM 9884  N N    . GLU A 1 44  ? -8.401  -11.146 -1.077  1.00 0.00 ? 44  GLU A N    6  
ATOM 9885  C CA   . GLU A 1 44  ? -7.205  -11.637 -1.752  1.00 0.00 ? 44  GLU A CA   6  
ATOM 9886  C C    . GLU A 1 44  ? -6.280  -10.483 -2.128  1.00 0.00 ? 44  GLU A C    6  
ATOM 9887  O O    . GLU A 1 44  ? -6.664  -9.585  -2.876  1.00 0.00 ? 44  GLU A O    6  
ATOM 9888  C CB   . GLU A 1 44  ? -7.587  -12.428 -3.004  1.00 0.00 ? 44  GLU A CB   6  
ATOM 9889  C CG   . GLU A 1 44  ? -8.164  -13.801 -2.705  1.00 0.00 ? 44  GLU A CG   6  
ATOM 9890  C CD   . GLU A 1 44  ? -7.095  -14.870 -2.583  1.00 0.00 ? 44  GLU A CD   6  
ATOM 9891  O OE1  . GLU A 1 44  ? -6.096  -14.798 -3.330  1.00 0.00 ? 44  GLU A OE1  6  
ATOM 9892  O OE2  . GLU A 1 44  ? -7.257  -15.778 -1.741  1.00 0.00 ? 44  GLU A OE2  6  
ATOM 9893  H H    . GLU A 1 44  ? -9.274  -11.263 -1.506  1.00 0.00 ? 44  GLU A H    6  
ATOM 9894  H HA   . GLU A 1 44  ? -6.684  -12.292 -1.069  1.00 0.00 ? 44  GLU A HA   6  
ATOM 9895  H HB2  . GLU A 1 44  ? -8.322  -11.865 -3.561  1.00 0.00 ? 44  GLU A HB2  6  
ATOM 9896  H HB3  . GLU A 1 44  ? -6.707  -12.557 -3.616  1.00 0.00 ? 44  GLU A HB3  6  
ATOM 9897  H HG2  . GLU A 1 44  ? -8.710  -13.753 -1.774  1.00 0.00 ? 44  GLU A HG2  6  
ATOM 9898  H HG3  . GLU A 1 44  ? -8.838  -14.076 -3.502  1.00 0.00 ? 44  GLU A HG3  6  
ATOM 9899  N N    . ALA A 1 45  ? -5.060  -10.515 -1.603  1.00 0.00 ? 45  ALA A N    6  
ATOM 9900  C CA   . ALA A 1 45  ? -4.079  -9.474  -1.884  1.00 0.00 ? 45  ALA A CA   6  
ATOM 9901  C C    . ALA A 1 45  ? -2.670  -9.936  -1.531  1.00 0.00 ? 45  ALA A C    6  
ATOM 9902  O O    . ALA A 1 45  ? -2.345  -10.127 -0.359  1.00 0.00 ? 45  ALA A O    6  
ATOM 9903  C CB   . ALA A 1 45  ? -4.426  -8.203  -1.123  1.00 0.00 ? 45  ALA A CB   6  
ATOM 9904  H H    . ALA A 1 45  ? -4.812  -11.258 -1.014  1.00 0.00 ? 45  ALA A H    6  
ATOM 9905  H HA   . ALA A 1 45  ? -4.121  -9.253  -2.942  1.00 0.00 ? 45  ALA A HA   6  
ATOM 9906  H HB1  . ALA A 1 45  ? -5.077  -8.446  -0.295  1.00 0.00 ? 45  ALA A HB1  6  
ATOM 9907  H HB2  . ALA A 1 45  ? -3.521  -7.749  -0.749  1.00 0.00 ? 45  ALA A HB2  6  
ATOM 9908  H HB3  . ALA A 1 45  ? -4.929  -7.513  -1.785  1.00 0.00 ? 45  ALA A HB3  6  
ATOM 9909  N N    . SER A 1 46  ? -1.837  -10.115 -2.551  1.00 0.00 ? 46  SER A N    6  
ATOM 9910  C CA   . SER A 1 46  ? -0.464  -10.559 -2.348  1.00 0.00 ? 46  SER A CA   6  
ATOM 9911  C C    . SER A 1 46  ? 0.500   -9.764  -3.223  1.00 0.00 ? 46  SER A C    6  
ATOM 9912  O O    . SER A 1 46  ? 0.465   -9.858  -4.449  1.00 0.00 ? 46  SER A O    6  
ATOM 9913  C CB   . SER A 1 46  ? -0.337  -12.052 -2.657  1.00 0.00 ? 46  SER A CB   6  
ATOM 9914  O OG   . SER A 1 46  ? -0.295  -12.282 -4.055  1.00 0.00 ? 46  SER A OG   6  
ATOM 9915  H H    . SER A 1 46  ? -2.156  -9.945  -3.463  1.00 0.00 ? 46  SER A H    6  
ATOM 9916  H HA   . SER A 1 46  ? -0.211  -10.393 -1.311  1.00 0.00 ? 46  SER A HA   6  
ATOM 9917  H HB2  . SER A 1 46  ? 0.570   -12.434 -2.214  1.00 0.00 ? 46  SER A HB2  6  
ATOM 9918  H HB3  . SER A 1 46  ? -1.188  -12.576 -2.244  1.00 0.00 ? 46  SER A HB3  6  
ATOM 9919  H HG   . SER A 1 46  ? -0.827  -13.052 -4.269  1.00 0.00 ? 46  SER A HG   6  
ATOM 9920  N N    . GLY A 1 47  ? 1.362   -8.979  -2.583  1.00 0.00 ? 47  GLY A N    6  
ATOM 9921  C CA   . GLY A 1 47  ? 2.323   -8.178  -3.318  1.00 0.00 ? 47  GLY A CA   6  
ATOM 9922  C C    . GLY A 1 47  ? 3.065   -7.202  -2.427  1.00 0.00 ? 47  GLY A C    6  
ATOM 9923  O O    . GLY A 1 47  ? 2.972   -7.276  -1.201  1.00 0.00 ? 47  GLY A O    6  
ATOM 9924  H H    . GLY A 1 47  ? 1.344   -8.944  -1.603  1.00 0.00 ? 47  GLY A H    6  
ATOM 9925  H HA2  . GLY A 1 47  ? 3.038   -8.836  -3.788  1.00 0.00 ? 47  GLY A HA2  6  
ATOM 9926  H HA3  . GLY A 1 47  ? 1.801   -7.623  -4.083  1.00 0.00 ? 47  GLY A HA3  6  
ATOM 9927  N N    . ILE A 1 48  ? 3.806   -6.286  -3.043  1.00 0.00 ? 48  ILE A N    6  
ATOM 9928  C CA   . ILE A 1 48  ? 4.567   -5.292  -2.297  1.00 0.00 ? 48  ILE A CA   6  
ATOM 9929  C C    . ILE A 1 48  ? 3.837   -3.954  -2.260  1.00 0.00 ? 48  ILE A C    6  
ATOM 9930  O O    . ILE A 1 48  ? 3.532   -3.373  -3.302  1.00 0.00 ? 48  ILE A O    6  
ATOM 9931  C CB   . ILE A 1 48  ? 5.967   -5.084  -2.904  1.00 0.00 ? 48  ILE A CB   6  
ATOM 9932  C CG1  . ILE A 1 48  ? 6.751   -6.398  -2.895  1.00 0.00 ? 48  ILE A CG1  6  
ATOM 9933  C CG2  . ILE A 1 48  ? 6.721   -4.006  -2.139  1.00 0.00 ? 48  ILE A CG2  6  
ATOM 9934  C CD1  . ILE A 1 48  ? 7.109   -6.879  -1.506  1.00 0.00 ? 48  ILE A CD1  6  
ATOM 9935  H H    . ILE A 1 48  ? 3.840   -6.279  -4.022  1.00 0.00 ? 48  ILE A H    6  
ATOM 9936  H HA   . ILE A 1 48  ? 4.685   -5.654  -1.285  1.00 0.00 ? 48  ILE A HA   6  
ATOM 9937  H HB   . ILE A 1 48  ? 5.848   -4.752  -3.923  1.00 0.00 ? 48  ILE A HB   6  
ATOM 9938  H HG12 . ILE A 1 48  ? 6.161   -7.166  -3.369  1.00 0.00 ? 48  ILE A HG12 6  
ATOM 9939  H HG13 . ILE A 1 48  ? 7.671   -6.264  -3.447  1.00 0.00 ? 48  ILE A HG13 6  
ATOM 9940  H HG21 . ILE A 1 48  ? 6.043   -3.499  -1.469  1.00 0.00 ? 48  ILE A HG21 6  
ATOM 9941  H HG22 . ILE A 1 48  ? 7.517   -4.460  -1.569  1.00 0.00 ? 48  ILE A HG22 6  
ATOM 9942  H HG23 . ILE A 1 48  ? 7.137   -3.294  -2.836  1.00 0.00 ? 48  ILE A HG23 6  
ATOM 9943  H HD11 . ILE A 1 48  ? 8.180   -6.996  -1.429  1.00 0.00 ? 48  ILE A HD11 6  
ATOM 9944  H HD12 . ILE A 1 48  ? 6.771   -6.158  -0.777  1.00 0.00 ? 48  ILE A HD12 6  
ATOM 9945  H HD13 . ILE A 1 48  ? 6.630   -7.830  -1.320  1.00 0.00 ? 48  ILE A HD13 6  
ATOM 9946  N N    . TYR A 1 49  ? 3.561   -3.470  -1.055  1.00 0.00 ? 49  TYR A N    6  
ATOM 9947  C CA   . TYR A 1 49  ? 2.866   -2.200  -0.882  1.00 0.00 ? 49  TYR A CA   6  
ATOM 9948  C C    . TYR A 1 49  ? 3.622   -1.292  0.084   1.00 0.00 ? 49  TYR A C    6  
ATOM 9949  O O    . TYR A 1 49  ? 4.284   -1.764  1.008   1.00 0.00 ? 49  TYR A O    6  
ATOM 9950  C CB   . TYR A 1 49  ? 1.445   -2.438  -0.369  1.00 0.00 ? 49  TYR A CB   6  
ATOM 9951  C CG   . TYR A 1 49  ? 0.612   -3.314  -1.277  1.00 0.00 ? 49  TYR A CG   6  
ATOM 9952  C CD1  . TYR A 1 49  ? 0.813   -4.689  -1.323  1.00 0.00 ? 49  TYR A CD1  6  
ATOM 9953  C CD2  . TYR A 1 49  ? -0.373  -2.769  -2.090  1.00 0.00 ? 49  TYR A CD2  6  
ATOM 9954  C CE1  . TYR A 1 49  ? 0.055   -5.494  -2.151  1.00 0.00 ? 49  TYR A CE1  6  
ATOM 9955  C CE2  . TYR A 1 49  ? -1.137  -3.566  -2.920  1.00 0.00 ? 49  TYR A CE2  6  
ATOM 9956  C CZ   . TYR A 1 49  ? -0.919  -4.928  -2.948  1.00 0.00 ? 49  TYR A CZ   6  
ATOM 9957  O OH   . TYR A 1 49  ? -1.676  -5.725  -3.774  1.00 0.00 ? 49  TYR A OH   6  
ATOM 9958  H H    . TYR A 1 49  ? 3.830   -3.979  -0.262  1.00 0.00 ? 49  TYR A H    6  
ATOM 9959  H HA   . TYR A 1 49  ? 2.814   -1.716  -1.847  1.00 0.00 ? 49  TYR A HA   6  
ATOM 9960  H HB2  . TYR A 1 49  ? 1.494   -2.914  0.598   1.00 0.00 ? 49  TYR A HB2  6  
ATOM 9961  H HB3  . TYR A 1 49  ? 0.941   -1.487  -0.272  1.00 0.00 ? 49  TYR A HB3  6  
ATOM 9962  H HD1  . TYR A 1 49  ? 1.576   -5.129  -0.697  1.00 0.00 ? 49  TYR A HD1  6  
ATOM 9963  H HD2  . TYR A 1 49  ? -0.541  -1.701  -2.067  1.00 0.00 ? 49  TYR A HD2  6  
ATOM 9964  H HE1  . TYR A 1 49  ? 0.225   -6.560  -2.173  1.00 0.00 ? 49  TYR A HE1  6  
ATOM 9965  H HE2  . TYR A 1 49  ? -1.899  -3.123  -3.545  1.00 0.00 ? 49  TYR A HE2  6  
ATOM 9966  H HH   . TYR A 1 49  ? -1.932  -5.226  -4.553  1.00 0.00 ? 49  TYR A HH   6  
ATOM 9967  N N    . VAL A 1 50  ? 3.518   0.015   -0.138  1.00 0.00 ? 50  VAL A N    6  
ATOM 9968  C CA   . VAL A 1 50  ? 4.189   0.990   0.713   1.00 0.00 ? 50  VAL A CA   6  
ATOM 9969  C C    . VAL A 1 50  ? 3.650   0.941   2.138   1.00 0.00 ? 50  VAL A C    6  
ATOM 9970  O O    . VAL A 1 50  ? 2.460   1.156   2.371   1.00 0.00 ? 50  VAL A O    6  
ATOM 9971  C CB   . VAL A 1 50  ? 4.026   2.420   0.163   1.00 0.00 ? 50  VAL A CB   6  
ATOM 9972  C CG1  . VAL A 1 50  ? 4.479   3.443   1.193   1.00 0.00 ? 50  VAL A CG1  6  
ATOM 9973  C CG2  . VAL A 1 50  ? 4.799   2.582   -1.137  1.00 0.00 ? 50  VAL A CG2  6  
ATOM 9974  H H    . VAL A 1 50  ? 2.975   0.330   -0.891  1.00 0.00 ? 50  VAL A H    6  
ATOM 9975  H HA   . VAL A 1 50  ? 5.242   0.751   0.728   1.00 0.00 ? 50  VAL A HA   6  
ATOM 9976  H HB   . VAL A 1 50  ? 2.979   2.588   -0.042  1.00 0.00 ? 50  VAL A HB   6  
ATOM 9977  H HG11 . VAL A 1 50  ? 3.867   3.357   2.079   1.00 0.00 ? 50  VAL A HG11 6  
ATOM 9978  H HG12 . VAL A 1 50  ? 5.513   3.263   1.450   1.00 0.00 ? 50  VAL A HG12 6  
ATOM 9979  H HG13 . VAL A 1 50  ? 4.378   4.437   0.782   1.00 0.00 ? 50  VAL A HG13 6  
ATOM 9980  H HG21 . VAL A 1 50  ? 5.858   2.602   -0.925  1.00 0.00 ? 50  VAL A HG21 6  
ATOM 9981  H HG22 . VAL A 1 50  ? 4.580   1.752   -1.793  1.00 0.00 ? 50  VAL A HG22 6  
ATOM 9982  H HG23 . VAL A 1 50  ? 4.509   3.505   -1.616  1.00 0.00 ? 50  VAL A HG23 6  
ATOM 9983  N N    . LYS A 1 51  ? 4.532   0.656   3.089   1.00 0.00 ? 51  LYS A N    6  
ATOM 9984  C CA   . LYS A 1 51  ? 4.147   0.580   4.493   1.00 0.00 ? 51  LYS A CA   6  
ATOM 9985  C C    . LYS A 1 51  ? 4.021   1.974   5.099   1.00 0.00 ? 51  LYS A C    6  
ATOM 9986  O O    . LYS A 1 51  ? 3.103   2.243   5.874   1.00 0.00 ? 51  LYS A O    6  
ATOM 9987  C CB   . LYS A 1 51  ? 5.172   -0.239  5.281   1.00 0.00 ? 51  LYS A CB   6  
ATOM 9988  C CG   . LYS A 1 51  ? 4.819   -0.406  6.749   1.00 0.00 ? 51  LYS A CG   6  
ATOM 9989  C CD   . LYS A 1 51  ? 3.626   -1.328  6.934   1.00 0.00 ? 51  LYS A CD   6  
ATOM 9990  C CE   . LYS A 1 51  ? 3.660   -2.017  8.290   1.00 0.00 ? 51  LYS A CE   6  
ATOM 9991  N NZ   . LYS A 1 51  ? 2.307   -2.472  8.715   1.00 0.00 ? 51  LYS A NZ   6  
ATOM 9992  H H    . LYS A 1 51  ? 5.467   0.495   2.840   1.00 0.00 ? 51  LYS A H    6  
ATOM 9993  H HA   . LYS A 1 51  ? 3.188   0.088   4.547   1.00 0.00 ? 51  LYS A HA   6  
ATOM 9994  H HB2  . LYS A 1 51  ? 5.248   -1.221  4.837   1.00 0.00 ? 51  LYS A HB2  6  
ATOM 9995  H HB3  . LYS A 1 51  ? 6.133   0.251   5.216   1.00 0.00 ? 51  LYS A HB3  6  
ATOM 9996  H HG2  . LYS A 1 51  ? 5.668   -0.824  7.269   1.00 0.00 ? 51  LYS A HG2  6  
ATOM 9997  H HG3  . LYS A 1 51  ? 4.582   0.563   7.164   1.00 0.00 ? 51  LYS A HG3  6  
ATOM 9998  H HD2  . LYS A 1 51  ? 2.718   -0.748  6.860   1.00 0.00 ? 51  LYS A HD2  6  
ATOM 9999  H HD3  . LYS A 1 51  ? 3.639   -2.080  6.158   1.00 0.00 ? 51  LYS A HD3  6  
ATOM 10000 H HE2  . LYS A 1 51  ? 4.315   -2.872  8.228   1.00 0.00 ? 51  LYS A HE2  6  
ATOM 10001 H HE3  . LYS A 1 51  ? 4.043   -1.322  9.022   1.00 0.00 ? 51  LYS A HE3  6  
ATOM 10002 H HZ1  . LYS A 1 51  ? 1.593   -2.162  8.025   1.00 0.00 ? 51  LYS A HZ1  6  
ATOM 10003 H HZ2  . LYS A 1 51  ? 2.070   -2.071  9.645   1.00 0.00 ? 51  LYS A HZ2  6  
ATOM 10004 H HZ3  . LYS A 1 51  ? 2.283   -3.509  8.780   1.00 0.00 ? 51  LYS A HZ3  6  
ATOM 10005 N N    . SER A 1 52  ? 4.947   2.857   4.740   1.00 0.00 ? 52  SER A N    6  
ATOM 10006 C CA   . SER A 1 52  ? 4.940   4.223   5.251   1.00 0.00 ? 52  SER A CA   6  
ATOM 10007 C C    . SER A 1 52  ? 5.909   5.101   4.465   1.00 0.00 ? 52  SER A C    6  
ATOM 10008 O O    . SER A 1 52  ? 6.709   4.607   3.671   1.00 0.00 ? 52  SER A O    6  
ATOM 10009 C CB   . SER A 1 52  ? 5.310   4.237   6.735   1.00 0.00 ? 52  SER A CB   6  
ATOM 10010 O OG   . SER A 1 52  ? 4.156   4.116   7.549   1.00 0.00 ? 52  SER A OG   6  
ATOM 10011 H H    . SER A 1 52  ? 5.654   2.582   4.119   1.00 0.00 ? 52  SER A H    6  
ATOM 10012 H HA   . SER A 1 52  ? 3.941   4.615   5.134   1.00 0.00 ? 52  SER A HA   6  
ATOM 10013 H HB2  . SER A 1 52  ? 5.973   3.411   6.946   1.00 0.00 ? 52  SER A HB2  6  
ATOM 10014 H HB3  . SER A 1 52  ? 5.807   5.167   6.971   1.00 0.00 ? 52  SER A HB3  6  
ATOM 10015 H HG   . SER A 1 52  ? 3.561   3.467   7.167   1.00 0.00 ? 52  SER A HG   6  
ATOM 10016 N N    . VAL A 1 53  ? 5.831   6.408   4.694   1.00 0.00 ? 53  VAL A N    6  
ATOM 10017 C CA   . VAL A 1 53  ? 6.701   7.357   4.009   1.00 0.00 ? 53  VAL A CA   6  
ATOM 10018 C C    . VAL A 1 53  ? 7.361   8.311   4.999   1.00 0.00 ? 53  VAL A C    6  
ATOM 10019 O O    . VAL A 1 53  ? 6.689   8.915   5.836   1.00 0.00 ? 53  VAL A O    6  
ATOM 10020 C CB   . VAL A 1 53  ? 5.924   8.178   2.963   1.00 0.00 ? 53  VAL A CB   6  
ATOM 10021 C CG1  . VAL A 1 53  ? 6.880   8.987   2.100   1.00 0.00 ? 53  VAL A CG1  6  
ATOM 10022 C CG2  . VAL A 1 53  ? 5.061   7.265   2.105   1.00 0.00 ? 53  VAL A CG2  6  
ATOM 10023 H H    . VAL A 1 53  ? 5.173   6.742   5.339   1.00 0.00 ? 53  VAL A H    6  
ATOM 10024 H HA   . VAL A 1 53  ? 7.470   6.797   3.498   1.00 0.00 ? 53  VAL A HA   6  
ATOM 10025 H HB   . VAL A 1 53  ? 5.275   8.866   3.485   1.00 0.00 ? 53  VAL A HB   6  
ATOM 10026 H HG11 . VAL A 1 53  ? 7.840   9.052   2.592   1.00 0.00 ? 53  VAL A HG11 6  
ATOM 10027 H HG12 . VAL A 1 53  ? 6.997   8.503   1.141   1.00 0.00 ? 53  VAL A HG12 6  
ATOM 10028 H HG13 . VAL A 1 53  ? 6.482   9.981   1.957   1.00 0.00 ? 53  VAL A HG13 6  
ATOM 10029 H HG21 . VAL A 1 53  ? 4.062   7.670   2.043   1.00 0.00 ? 53  VAL A HG21 6  
ATOM 10030 H HG22 . VAL A 1 53  ? 5.484   7.197   1.113   1.00 0.00 ? 53  VAL A HG22 6  
ATOM 10031 H HG23 . VAL A 1 53  ? 5.024   6.282   2.549   1.00 0.00 ? 53  VAL A HG23 6  
ATOM 10032 N N    . ILE A 1 54  ? 8.679   8.442   4.897   1.00 0.00 ? 54  ILE A N    6  
ATOM 10033 C CA   . ILE A 1 54  ? 9.429   9.324   5.783   1.00 0.00 ? 54  ILE A CA   6  
ATOM 10034 C C    . ILE A 1 54  ? 9.245   10.785  5.389   1.00 0.00 ? 54  ILE A C    6  
ATOM 10035 O O    . ILE A 1 54  ? 9.490   11.182  4.249   1.00 0.00 ? 54  ILE A O    6  
ATOM 10036 C CB   . ILE A 1 54  ? 10.932  8.986   5.772   1.00 0.00 ? 54  ILE A CB   6  
ATOM 10037 C CG1  . ILE A 1 54  ? 11.170  7.599   6.372   1.00 0.00 ? 54  ILE A CG1  6  
ATOM 10038 C CG2  . ILE A 1 54  ? 11.717  10.042  6.537   1.00 0.00 ? 54  ILE A CG2  6  
ATOM 10039 C CD1  . ILE A 1 54  ? 10.764  6.467   5.455   1.00 0.00 ? 54  ILE A CD1  6  
ATOM 10040 H H    . ILE A 1 54  ? 9.158   7.934   4.210   1.00 0.00 ? 54  ILE A H    6  
ATOM 10041 H HA   . ILE A 1 54  ? 9.056   9.183   6.787   1.00 0.00 ? 54  ILE A HA   6  
ATOM 10042 H HB   . ILE A 1 54  ? 11.272  8.991   4.748   1.00 0.00 ? 54  ILE A HB   6  
ATOM 10043 H HG12 . ILE A 1 54  ? 12.219  7.485   6.595   1.00 0.00 ? 54  ILE A HG12 6  
ATOM 10044 H HG13 . ILE A 1 54  ? 10.600  7.508   7.286   1.00 0.00 ? 54  ILE A HG13 6  
ATOM 10045 H HG21 . ILE A 1 54  ? 12.626  9.605   6.923   1.00 0.00 ? 54  ILE A HG21 6  
ATOM 10046 H HG22 . ILE A 1 54  ? 11.964  10.857  5.874   1.00 0.00 ? 54  ILE A HG22 6  
ATOM 10047 H HG23 . ILE A 1 54  ? 11.119  10.412  7.356   1.00 0.00 ? 54  ILE A HG23 6  
ATOM 10048 H HD11 . ILE A 1 54  ? 10.758  6.815   4.433   1.00 0.00 ? 54  ILE A HD11 6  
ATOM 10049 H HD12 . ILE A 1 54  ? 11.466  5.653   5.555   1.00 0.00 ? 54  ILE A HD12 6  
ATOM 10050 H HD13 . ILE A 1 54  ? 9.775   6.124   5.723   1.00 0.00 ? 54  ILE A HD13 6  
ATOM 10051 N N    . PRO A 1 55  ? 8.804   11.607  6.353   1.00 0.00 ? 55  PRO A N    6  
ATOM 10052 C CA   . PRO A 1 55  ? 8.579   13.039  6.131   1.00 0.00 ? 55  PRO A CA   6  
ATOM 10053 C C    . PRO A 1 55  ? 9.882   13.807  5.936   1.00 0.00 ? 55  PRO A C    6  
ATOM 10054 O O    . PRO A 1 55  ? 10.756  13.795  6.801   1.00 0.00 ? 55  PRO A O    6  
ATOM 10055 C CB   . PRO A 1 55  ? 7.879   13.491  7.415   1.00 0.00 ? 55  PRO A CB   6  
ATOM 10056 C CG   . PRO A 1 55  ? 8.317   12.513  8.450   1.00 0.00 ? 55  PRO A CG   6  
ATOM 10057 C CD   . PRO A 1 55  ? 8.492   11.202  7.733   1.00 0.00 ? 55  PRO A CD   6  
ATOM 10058 H HA   . PRO A 1 55  ? 7.931   13.212  5.285   1.00 0.00 ? 55  PRO A HA   6  
ATOM 10059 H HB2  . PRO A 1 55  ? 8.190   14.496  7.662   1.00 0.00 ? 55  PRO A HB2  6  
ATOM 10060 H HB3  . PRO A 1 55  ? 6.809   13.464  7.274   1.00 0.00 ? 55  PRO A HB3  6  
ATOM 10061 H HG2  . PRO A 1 55  ? 9.253   12.831  8.883   1.00 0.00 ? 55  PRO A HG2  6  
ATOM 10062 H HG3  . PRO A 1 55  ? 7.559   12.424  9.214   1.00 0.00 ? 55  PRO A HG3  6  
ATOM 10063 H HD2  . PRO A 1 55  ? 9.308   10.642  8.165   1.00 0.00 ? 55  PRO A HD2  6  
ATOM 10064 H HD3  . PRO A 1 55  ? 7.578   10.628  7.769   1.00 0.00 ? 55  PRO A HD3  6  
ATOM 10065 N N    . GLY A 1 56  ? 10.005  14.474  4.793   1.00 0.00 ? 56  GLY A N    6  
ATOM 10066 C CA   . GLY A 1 56  ? 11.205  15.239  4.505   1.00 0.00 ? 56  GLY A CA   6  
ATOM 10067 C C    . GLY A 1 56  ? 12.113  14.541  3.512   1.00 0.00 ? 56  GLY A C    6  
ATOM 10068 O O    . GLY A 1 56  ? 13.288  14.886  3.387   1.00 0.00 ? 56  GLY A O    6  
ATOM 10069 H H    . GLY A 1 56  ? 9.275   14.448  4.139   1.00 0.00 ? 56  GLY A H    6  
ATOM 10070 H HA2  . GLY A 1 56  ? 10.919  16.199  4.103   1.00 0.00 ? 56  GLY A HA2  6  
ATOM 10071 H HA3  . GLY A 1 56  ? 11.749  15.393  5.426   1.00 0.00 ? 56  GLY A HA3  6  
ATOM 10072 N N    . SER A 1 57  ? 11.568  13.556  2.805   1.00 0.00 ? 57  SER A N    6  
ATOM 10073 C CA   . SER A 1 57  ? 12.339  12.805  1.822   1.00 0.00 ? 57  SER A CA   6  
ATOM 10074 C C    . SER A 1 57  ? 11.833  13.079  0.409   1.00 0.00 ? 57  SER A C    6  
ATOM 10075 O O    . SER A 1 57  ? 10.849  13.793  0.219   1.00 0.00 ? 57  SER A O    6  
ATOM 10076 C CB   . SER A 1 57  ? 12.263  11.306  2.120   1.00 0.00 ? 57  SER A CB   6  
ATOM 10077 O OG   . SER A 1 57  ? 10.939  10.823  1.972   1.00 0.00 ? 57  SER A OG   6  
ATOM 10078 H H    . SER A 1 57  ? 10.626  13.328  2.951   1.00 0.00 ? 57  SER A H    6  
ATOM 10079 H HA   . SER A 1 57  ? 13.368  13.125  1.892   1.00 0.00 ? 57  SER A HA   6  
ATOM 10080 H HB2  . SER A 1 57  ? 12.907  10.772  1.438   1.00 0.00 ? 57  SER A HB2  6  
ATOM 10081 H HB3  . SER A 1 57  ? 12.587  11.127  3.136   1.00 0.00 ? 57  SER A HB3  6  
ATOM 10082 H HG   . SER A 1 57  ? 10.745  10.703  1.039   1.00 0.00 ? 57  SER A HG   6  
ATOM 10083 N N    . ALA A 1 58  ? 12.514  12.507  -0.578  1.00 0.00 ? 58  ALA A N    6  
ATOM 10084 C CA   . ALA A 1 58  ? 12.133  12.688  -1.974  1.00 0.00 ? 58  ALA A CA   6  
ATOM 10085 C C    . ALA A 1 58  ? 10.736  12.136  -2.237  1.00 0.00 ? 58  ALA A C    6  
ATOM 10086 O O    . ALA A 1 58  ? 9.908   12.793  -2.867  1.00 0.00 ? 58  ALA A O    6  
ATOM 10087 C CB   . ALA A 1 58  ? 13.148  12.019  -2.889  1.00 0.00 ? 58  ALA A CB   6  
ATOM 10088 H H    . ALA A 1 58  ? 13.289  11.949  -0.363  1.00 0.00 ? 58  ALA A H    6  
ATOM 10089 H HA   . ALA A 1 58  ? 12.136  13.748  -2.186  1.00 0.00 ? 58  ALA A HA   6  
ATOM 10090 H HB1  . ALA A 1 58  ? 14.087  11.913  -2.366  1.00 0.00 ? 58  ALA A HB1  6  
ATOM 10091 H HB2  . ALA A 1 58  ? 12.784  11.045  -3.178  1.00 0.00 ? 58  ALA A HB2  6  
ATOM 10092 H HB3  . ALA A 1 58  ? 13.293  12.627  -3.770  1.00 0.00 ? 58  ALA A HB3  6  
ATOM 10093 N N    . ALA A 1 59  ? 10.482  10.925  -1.752  1.00 0.00 ? 59  ALA A N    6  
ATOM 10094 C CA   . ALA A 1 59  ? 9.184   10.286  -1.935  1.00 0.00 ? 59  ALA A CA   6  
ATOM 10095 C C    . ALA A 1 59  ? 8.065   11.137  -1.344  1.00 0.00 ? 59  ALA A C    6  
ATOM 10096 O O    . ALA A 1 59  ? 6.945   11.149  -1.856  1.00 0.00 ? 59  ALA A O    6  
ATOM 10097 C CB   . ALA A 1 59  ? 9.185   8.901   -1.305  1.00 0.00 ? 59  ALA A CB   6  
ATOM 10098 H H    . ALA A 1 59  ? 11.183  10.451  -1.258  1.00 0.00 ? 59  ALA A H    6  
ATOM 10099 H HA   . ALA A 1 59  ? 9.015   10.172  -2.996  1.00 0.00 ? 59  ALA A HA   6  
ATOM 10100 H HB1  . ALA A 1 59  ? 8.741   8.194   -1.990  1.00 0.00 ? 59  ALA A HB1  6  
ATOM 10101 H HB2  . ALA A 1 59  ? 10.201  8.604   -1.090  1.00 0.00 ? 59  ALA A HB2  6  
ATOM 10102 H HB3  . ALA A 1 59  ? 8.614   8.922   -0.389  1.00 0.00 ? 59  ALA A HB3  6  
ATOM 10103 N N    . TYR A 1 60  ? 8.375   11.847  -0.265  1.00 0.00 ? 60  TYR A N    6  
ATOM 10104 C CA   . TYR A 1 60  ? 7.394   12.699  0.396   1.00 0.00 ? 60  TYR A CA   6  
ATOM 10105 C C    . TYR A 1 60  ? 7.278   14.047  -0.309  1.00 0.00 ? 60  TYR A C    6  
ATOM 10106 O O    . TYR A 1 60  ? 6.292   14.765  -0.143  1.00 0.00 ? 60  TYR A O    6  
ATOM 10107 C CB   . TYR A 1 60  ? 7.776   12.910  1.862   1.00 0.00 ? 60  TYR A CB   6  
ATOM 10108 C CG   . TYR A 1 60  ? 6.984   14.002  2.544   1.00 0.00 ? 60  TYR A CG   6  
ATOM 10109 C CD1  . TYR A 1 60  ? 5.701   13.764  3.020   1.00 0.00 ? 60  TYR A CD1  6  
ATOM 10110 C CD2  . TYR A 1 60  ? 7.520   15.274  2.712   1.00 0.00 ? 60  TYR A CD2  6  
ATOM 10111 C CE1  . TYR A 1 60  ? 4.974   14.760  3.643   1.00 0.00 ? 60  TYR A CE1  6  
ATOM 10112 C CE2  . TYR A 1 60  ? 6.800   16.275  3.334   1.00 0.00 ? 60  TYR A CE2  6  
ATOM 10113 C CZ   . TYR A 1 60  ? 5.528   16.014  3.798   1.00 0.00 ? 60  TYR A CZ   6  
ATOM 10114 O OH   . TYR A 1 60  ? 4.807   17.008  4.419   1.00 0.00 ? 60  TYR A OH   6  
ATOM 10115 H H    . TYR A 1 60  ? 9.284   11.797  0.096   1.00 0.00 ? 60  TYR A H    6  
ATOM 10116 H HA   . TYR A 1 60  ? 6.437   12.199  0.352   1.00 0.00 ? 60  TYR A HA   6  
ATOM 10117 H HB2  . TYR A 1 60  ? 7.610   11.992  2.406   1.00 0.00 ? 60  TYR A HB2  6  
ATOM 10118 H HB3  . TYR A 1 60  ? 8.822   13.172  1.920   1.00 0.00 ? 60  TYR A HB3  6  
ATOM 10119 H HD1  . TYR A 1 60  ? 5.270   12.781  2.898   1.00 0.00 ? 60  TYR A HD1  6  
ATOM 10120 H HD2  . TYR A 1 60  ? 8.517   15.475  2.348   1.00 0.00 ? 60  TYR A HD2  6  
ATOM 10121 H HE1  . TYR A 1 60  ? 3.978   14.555  4.006   1.00 0.00 ? 60  TYR A HE1  6  
ATOM 10122 H HE2  . TYR A 1 60  ? 7.234   17.257  3.456   1.00 0.00 ? 60  TYR A HE2  6  
ATOM 10123 H HH   . TYR A 1 60  ? 5.409   17.609  4.863   1.00 0.00 ? 60  TYR A HH   6  
ATOM 10124 N N    . HIS A 1 61  ? 8.293   14.383  -1.099  1.00 0.00 ? 61  HIS A N    6  
ATOM 10125 C CA   . HIS A 1 61  ? 8.306   15.644  -1.832  1.00 0.00 ? 61  HIS A CA   6  
ATOM 10126 C C    . HIS A 1 61  ? 7.400   15.569  -3.058  1.00 0.00 ? 61  HIS A C    6  
ATOM 10127 O O    . HIS A 1 61  ? 6.611   16.477  -3.314  1.00 0.00 ? 61  HIS A O    6  
ATOM 10128 C CB   . HIS A 1 61  ? 9.732   15.996  -2.258  1.00 0.00 ? 61  HIS A CB   6  
ATOM 10129 C CG   . HIS A 1 61  ? 10.556  16.591  -1.158  1.00 0.00 ? 61  HIS A CG   6  
ATOM 10130 N ND1  . HIS A 1 61  ? 10.016  17.036  0.030   1.00 0.00 ? 61  HIS A ND1  6  
ATOM 10131 C CD2  . HIS A 1 61  ? 11.888  16.812  -1.071  1.00 0.00 ? 61  HIS A CD2  6  
ATOM 10132 C CE1  . HIS A 1 61  ? 10.980  17.507  0.800   1.00 0.00 ? 61  HIS A CE1  6  
ATOM 10133 N NE2  . HIS A 1 61  ? 12.126  17.382  0.156   1.00 0.00 ? 61  HIS A NE2  6  
ATOM 10134 H H    . HIS A 1 61  ? 9.050   13.768  -1.191  1.00 0.00 ? 61  HIS A H    6  
ATOM 10135 H HA   . HIS A 1 61  ? 7.936   16.414  -1.173  1.00 0.00 ? 61  HIS A HA   6  
ATOM 10136 H HB2  . HIS A 1 61  ? 10.230  15.100  -2.598  1.00 0.00 ? 61  HIS A HB2  6  
ATOM 10137 H HB3  . HIS A 1 61  ? 9.693   16.709  -3.068  1.00 0.00 ? 61  HIS A HB3  6  
ATOM 10138 H HD1  . HIS A 1 61  ? 9.067   17.012  0.272   1.00 0.00 ? 61  HIS A HD1  6  
ATOM 10139 H HD2  . HIS A 1 61  ? 12.628  16.583  -1.825  1.00 0.00 ? 61  HIS A HD2  6  
ATOM 10140 H HE1  . HIS A 1 61  ? 10.854  17.923  1.789   1.00 0.00 ? 61  HIS A HE1  6  
ATOM 10141 H HE2  . HIS A 1 61  ? 12.988  17.731  0.465   1.00 0.00 ? 61  HIS A HE2  6  
ATOM 10142 N N    . ASN A 1 62  ? 7.521   14.481  -3.811  1.00 0.00 ? 62  ASN A N    6  
ATOM 10143 C CA   . ASN A 1 62  ? 6.714   14.288  -5.011  1.00 0.00 ? 62  ASN A CA   6  
ATOM 10144 C C    . ASN A 1 62  ? 5.247   14.073  -4.651  1.00 0.00 ? 62  ASN A C    6  
ATOM 10145 O O    . ASN A 1 62  ? 4.351   14.585  -5.320  1.00 0.00 ? 62  ASN A O    6  
ATOM 10146 C CB   . ASN A 1 62  ? 7.234   13.095  -5.815  1.00 0.00 ? 62  ASN A CB   6  
ATOM 10147 C CG   . ASN A 1 62  ? 6.907   13.206  -7.291  1.00 0.00 ? 62  ASN A CG   6  
ATOM 10148 O OD1  . ASN A 1 62  ? 6.180   14.106  -7.711  1.00 0.00 ? 62  ASN A OD1  6  
ATOM 10149 N ND2  . ASN A 1 62  ? 7.445   12.289  -8.087  1.00 0.00 ? 62  ASN A ND2  6  
ATOM 10150 H H    . ASN A 1 62  ? 8.168   13.791  -3.555  1.00 0.00 ? 62  ASN A H    6  
ATOM 10151 H HA   . ASN A 1 62  ? 6.797   15.180  -5.613  1.00 0.00 ? 62  ASN A HA   6  
ATOM 10152 H HB2  . ASN A 1 62  ? 8.307   13.036  -5.707  1.00 0.00 ? 62  ASN A HB2  6  
ATOM 10153 H HB3  . ASN A 1 62  ? 6.788   12.189  -5.433  1.00 0.00 ? 62  ASN A HB3  6  
ATOM 10154 H HD21 . ASN A 1 62  ? 8.015   11.601  -7.682  1.00 0.00 ? 62  ASN A HD21 6  
ATOM 10155 H HD22 . ASN A 1 62  ? 7.251   12.337  -9.046  1.00 0.00 ? 62  ASN A HD22 6  
ATOM 10156 N N    . GLY A 1 63  ? 5.010   13.310  -3.587  1.00 0.00 ? 63  GLY A N    6  
ATOM 10157 C CA   . GLY A 1 63  ? 3.651   13.041  -3.156  1.00 0.00 ? 63  GLY A CA   6  
ATOM 10158 C C    . GLY A 1 63  ? 2.928   12.082  -4.082  1.00 0.00 ? 63  GLY A C    6  
ATOM 10159 O O    . GLY A 1 63  ? 1.699   12.010  -4.076  1.00 0.00 ? 63  GLY A O    6  
ATOM 10160 H H    . GLY A 1 63  ? 5.764   12.928  -3.092  1.00 0.00 ? 63  GLY A H    6  
ATOM 10161 H HA2  . GLY A 1 63  ? 3.677   12.615  -2.164  1.00 0.00 ? 63  GLY A HA2  6  
ATOM 10162 H HA3  . GLY A 1 63  ? 3.104   13.972  -3.123  1.00 0.00 ? 63  GLY A HA3  6  
ATOM 10163 N N    . HIS A 1 64  ? 3.692   11.345  -4.881  1.00 0.00 ? 64  HIS A N    6  
ATOM 10164 C CA   . HIS A 1 64  ? 3.117   10.386  -5.818  1.00 0.00 ? 64  HIS A CA   6  
ATOM 10165 C C    . HIS A 1 64  ? 3.327   8.956   -5.330  1.00 0.00 ? 64  HIS A C    6  
ATOM 10166 O O    . HIS A 1 64  ? 2.686   8.024   -5.815  1.00 0.00 ? 64  HIS A O    6  
ATOM 10167 C CB   . HIS A 1 64  ? 3.738   10.561  -7.204  1.00 0.00 ? 64  HIS A CB   6  
ATOM 10168 C CG   . HIS A 1 64  ? 3.007   11.541  -8.069  1.00 0.00 ? 64  HIS A CG   6  
ATOM 10169 N ND1  . HIS A 1 64  ? 1.900   11.204  -8.819  1.00 0.00 ? 64  HIS A ND1  6  
ATOM 10170 C CD2  . HIS A 1 64  ? 3.228   12.856  -8.299  1.00 0.00 ? 64  HIS A CD2  6  
ATOM 10171 C CE1  . HIS A 1 64  ? 1.474   12.269  -9.475  1.00 0.00 ? 64  HIS A CE1  6  
ATOM 10172 N NE2  . HIS A 1 64  ? 2.262   13.285  -9.175  1.00 0.00 ? 64  HIS A NE2  6  
ATOM 10173 H H    . HIS A 1 64  ? 4.666   11.447  -4.839  1.00 0.00 ? 64  HIS A H    6  
ATOM 10174 H HA   . HIS A 1 64  ? 2.057   10.579  -5.881  1.00 0.00 ? 64  HIS A HA   6  
ATOM 10175 H HB2  . HIS A 1 64  ? 4.754   10.909  -7.095  1.00 0.00 ? 64  HIS A HB2  6  
ATOM 10176 H HB3  . HIS A 1 64  ? 3.742   9.607   -7.713  1.00 0.00 ? 64  HIS A HB3  6  
ATOM 10177 H HD1  . HIS A 1 64  ? 1.490   10.316  -8.866  1.00 0.00 ? 64  HIS A HD1  6  
ATOM 10178 H HD2  . HIS A 1 64  ? 4.019   13.458  -7.872  1.00 0.00 ? 64  HIS A HD2  6  
ATOM 10179 H HE1  . HIS A 1 64  ? 0.625   12.303  -10.141 1.00 0.00 ? 64  HIS A HE1  6  
ATOM 10180 H HE2  . HIS A 1 64  ? 2.222   14.172  -9.590  1.00 0.00 ? 64  HIS A HE2  6  
ATOM 10181 N N    . ILE A 1 65  ? 4.230   8.791   -4.369  1.00 0.00 ? 65  ILE A N    6  
ATOM 10182 C CA   . ILE A 1 65  ? 4.524   7.474   -3.816  1.00 0.00 ? 65  ILE A CA   6  
ATOM 10183 C C    . ILE A 1 65  ? 4.290   7.447   -2.309  1.00 0.00 ? 65  ILE A C    6  
ATOM 10184 O O    . ILE A 1 65  ? 5.168   7.815   -1.529  1.00 0.00 ? 65  ILE A O    6  
ATOM 10185 C CB   . ILE A 1 65  ? 5.976   7.053   -4.107  1.00 0.00 ? 65  ILE A CB   6  
ATOM 10186 C CG1  . ILE A 1 65  ? 6.238   7.055   -5.614  1.00 0.00 ? 65  ILE A CG1  6  
ATOM 10187 C CG2  . ILE A 1 65  ? 6.257   5.679   -3.516  1.00 0.00 ? 65  ILE A CG2  6  
ATOM 10188 C CD1  . ILE A 1 65  ? 7.703   7.170   -5.972  1.00 0.00 ? 65  ILE A CD1  6  
ATOM 10189 H H    . ILE A 1 65  ? 4.708   9.572   -4.023  1.00 0.00 ? 65  ILE A H    6  
ATOM 10190 H HA   . ILE A 1 65  ? 3.862   6.761   -4.285  1.00 0.00 ? 65  ILE A HA   6  
ATOM 10191 H HB   . ILE A 1 65  ? 6.635   7.764   -3.633  1.00 0.00 ? 65  ILE A HB   6  
ATOM 10192 H HG12 . ILE A 1 65  ? 5.865   6.137   -6.039  1.00 0.00 ? 65  ILE A HG12 6  
ATOM 10193 H HG13 . ILE A 1 65  ? 5.720   7.891   -6.061  1.00 0.00 ? 65  ILE A HG13 6  
ATOM 10194 H HG21 . ILE A 1 65  ? 5.370   5.311   -3.023  1.00 0.00 ? 65  ILE A HG21 6  
ATOM 10195 H HG22 . ILE A 1 65  ? 6.537   4.999   -4.307  1.00 0.00 ? 65  ILE A HG22 6  
ATOM 10196 H HG23 . ILE A 1 65  ? 7.063   5.752   -2.802  1.00 0.00 ? 65  ILE A HG23 6  
ATOM 10197 H HD11 . ILE A 1 65  ? 7.884   6.672   -6.913  1.00 0.00 ? 65  ILE A HD11 6  
ATOM 10198 H HD12 . ILE A 1 65  ? 7.973   8.212   -6.058  1.00 0.00 ? 65  ILE A HD12 6  
ATOM 10199 H HD13 . ILE A 1 65  ? 8.300   6.706   -5.200  1.00 0.00 ? 65  ILE A HD13 6  
ATOM 10200 N N    . GLN A 1 66  ? 3.102   7.007   -1.907  1.00 0.00 ? 66  GLN A N    6  
ATOM 10201 C CA   . GLN A 1 66  ? 2.754   6.930   -0.494  1.00 0.00 ? 66  GLN A CA   6  
ATOM 10202 C C    . GLN A 1 66  ? 2.077   5.602   -0.171  1.00 0.00 ? 66  GLN A C    6  
ATOM 10203 O O    . GLN A 1 66  ? 1.854   4.776   -1.056  1.00 0.00 ? 66  GLN A O    6  
ATOM 10204 C CB   . GLN A 1 66  ? 1.836   8.091   -0.109  1.00 0.00 ? 66  GLN A CB   6  
ATOM 10205 C CG   . GLN A 1 66  ? 0.925   8.546   -1.238  1.00 0.00 ? 66  GLN A CG   6  
ATOM 10206 C CD   . GLN A 1 66  ? 1.620   9.480   -2.208  1.00 0.00 ? 66  GLN A CD   6  
ATOM 10207 O OE1  . GLN A 1 66  ? 2.559   10.188  -1.842  1.00 0.00 ? 66  GLN A OE1  6  
ATOM 10208 N NE2  . GLN A 1 66  ? 1.161   9.488   -3.454  1.00 0.00 ? 66  GLN A NE2  6  
ATOM 10209 H H    . GLN A 1 66  ? 2.445   6.728   -2.577  1.00 0.00 ? 66  GLN A H    6  
ATOM 10210 H HA   . GLN A 1 66  ? 3.668   7.001   0.077   1.00 0.00 ? 66  GLN A HA   6  
ATOM 10211 H HB2  . GLN A 1 66  ? 1.219   7.786   0.723   1.00 0.00 ? 66  GLN A HB2  6  
ATOM 10212 H HB3  . GLN A 1 66  ? 2.444   8.930   0.194   1.00 0.00 ? 66  GLN A HB3  6  
ATOM 10213 H HG2  . GLN A 1 66  ? 0.584   7.677   -1.781  1.00 0.00 ? 66  GLN A HG2  6  
ATOM 10214 H HG3  . GLN A 1 66  ? 0.075   9.059   -0.812  1.00 0.00 ? 66  GLN A HG3  6  
ATOM 10215 H HE21 . GLN A 1 66  ? 0.409   8.899   -3.674  1.00 0.00 ? 66  GLN A HE21 6  
ATOM 10216 H HE22 . GLN A 1 66  ? 1.591   10.083  -4.102  1.00 0.00 ? 66  GLN A HE22 6  
ATOM 10217 N N    . VAL A 1 67  ? 1.753   5.403   1.103   1.00 0.00 ? 67  VAL A N    6  
ATOM 10218 C CA   . VAL A 1 67  ? 1.100   4.175   1.542   1.00 0.00 ? 67  VAL A CA   6  
ATOM 10219 C C    . VAL A 1 67  ? -0.115  3.859   0.678   1.00 0.00 ? 67  VAL A C    6  
ATOM 10220 O O    . VAL A 1 67  ? -0.594  4.708   -0.072  1.00 0.00 ? 67  VAL A O    6  
ATOM 10221 C CB   . VAL A 1 67  ? 0.659   4.271   3.015   1.00 0.00 ? 67  VAL A CB   6  
ATOM 10222 C CG1  . VAL A 1 67  ? 1.836   4.645   3.902   1.00 0.00 ? 67  VAL A CG1  6  
ATOM 10223 C CG2  . VAL A 1 67  ? -0.475  5.274   3.167   1.00 0.00 ? 67  VAL A CG2  6  
ATOM 10224 H H    . VAL A 1 67  ? 1.956   6.098   1.762   1.00 0.00 ? 67  VAL A H    6  
ATOM 10225 H HA   . VAL A 1 67  ? 1.813   3.368   1.454   1.00 0.00 ? 67  VAL A HA   6  
ATOM 10226 H HB   . VAL A 1 67  ? 0.297   3.301   3.325   1.00 0.00 ? 67  VAL A HB   6  
ATOM 10227 H HG11 . VAL A 1 67  ? 2.271   3.749   4.319   1.00 0.00 ? 67  VAL A HG11 6  
ATOM 10228 H HG12 . VAL A 1 67  ? 2.577   5.168   3.316   1.00 0.00 ? 67  VAL A HG12 6  
ATOM 10229 H HG13 . VAL A 1 67  ? 1.493   5.284   4.703   1.00 0.00 ? 67  VAL A HG13 6  
ATOM 10230 H HG21 . VAL A 1 67  ? -0.792  5.304   4.198   1.00 0.00 ? 67  VAL A HG21 6  
ATOM 10231 H HG22 . VAL A 1 67  ? -0.131  6.254   2.867   1.00 0.00 ? 67  VAL A HG22 6  
ATOM 10232 H HG23 . VAL A 1 67  ? -1.305  4.977   2.543   1.00 0.00 ? 67  VAL A HG23 6  
ATOM 10233 N N    . ASN A 1 68  ? -0.610  2.630   0.789   1.00 0.00 ? 68  ASN A N    6  
ATOM 10234 C CA   . ASN A 1 68  ? -1.771  2.201   0.018   1.00 0.00 ? 68  ASN A CA   6  
ATOM 10235 C C    . ASN A 1 68  ? -1.457  2.188   -1.475  1.00 0.00 ? 68  ASN A C    6  
ATOM 10236 O O    . ASN A 1 68  ? -2.297  2.546   -2.300  1.00 0.00 ? 68  ASN A O    6  
ATOM 10237 C CB   . ASN A 1 68  ? -2.961  3.123   0.292   1.00 0.00 ? 68  ASN A CB   6  
ATOM 10238 C CG   . ASN A 1 68  ? -3.315  3.187   1.765   1.00 0.00 ? 68  ASN A CG   6  
ATOM 10239 O OD1  . ASN A 1 68  ? -2.797  2.417   2.573   1.00 0.00 ? 68  ASN A OD1  6  
ATOM 10240 N ND2  . ASN A 1 68  ? -4.203  4.109   2.120   1.00 0.00 ? 68  ASN A ND2  6  
ATOM 10241 H H    . ASN A 1 68  ? -0.184  1.997   1.404   1.00 0.00 ? 68  ASN A H    6  
ATOM 10242 H HA   . ASN A 1 68  ? -2.024  1.199   0.329   1.00 0.00 ? 68  ASN A HA   6  
ATOM 10243 H HB2  . ASN A 1 68  ? -2.720  4.121   -0.045  1.00 0.00 ? 68  ASN A HB2  6  
ATOM 10244 H HB3  . ASN A 1 68  ? -3.821  2.762   -0.252  1.00 0.00 ? 68  ASN A HB3  6  
ATOM 10245 H HD21 . ASN A 1 68  ? -4.574  4.688   1.422   1.00 0.00 ? 68  ASN A HD21 6  
ATOM 10246 H HD22 . ASN A 1 68  ? -4.449  4.173   3.066   1.00 0.00 ? 68  ASN A HD22 6  
ATOM 10247 N N    . ASP A 1 69  ? -0.242  1.771   -1.815  1.00 0.00 ? 69  ASP A N    6  
ATOM 10248 C CA   . ASP A 1 69  ? 0.184   1.709   -3.208  1.00 0.00 ? 69  ASP A CA   6  
ATOM 10249 C C    . ASP A 1 69  ? 0.812   0.356   -3.525  1.00 0.00 ? 69  ASP A C    6  
ATOM 10250 O O    . ASP A 1 69  ? 1.283   -0.347  -2.630  1.00 0.00 ? 69  ASP A O    6  
ATOM 10251 C CB   . ASP A 1 69  ? 1.179   2.831   -3.511  1.00 0.00 ? 69  ASP A CB   6  
ATOM 10252 C CG   . ASP A 1 69  ? 0.491   4.126   -3.896  1.00 0.00 ? 69  ASP A CG   6  
ATOM 10253 O OD1  . ASP A 1 69  ? -0.038  4.203   -5.024  1.00 0.00 ? 69  ASP A OD1  6  
ATOM 10254 O OD2  . ASP A 1 69  ? 0.484   5.063   -3.070  1.00 0.00 ? 69  ASP A OD2  6  
ATOM 10255 H H    . ASP A 1 69  ? 0.384   1.499   -1.111  1.00 0.00 ? 69  ASP A H    6  
ATOM 10256 H HA   . ASP A 1 69  ? -0.691  1.840   -3.828  1.00 0.00 ? 69  ASP A HA   6  
ATOM 10257 H HB2  . ASP A 1 69  ? 1.783   3.013   -2.634  1.00 0.00 ? 69  ASP A HB2  6  
ATOM 10258 H HB3  . ASP A 1 69  ? 1.818   2.526   -4.326  1.00 0.00 ? 69  ASP A HB3  6  
ATOM 10259 N N    . LYS A 1 70  ? 0.816   -0.004  -4.804  1.00 0.00 ? 70  LYS A N    6  
ATOM 10260 C CA   . LYS A 1 70  ? 1.387   -1.273  -5.240  1.00 0.00 ? 70  LYS A CA   6  
ATOM 10261 C C    . LYS A 1 70  ? 2.538   -1.046  -6.215  1.00 0.00 ? 70  LYS A C    6  
ATOM 10262 O O    . LYS A 1 70  ? 2.382   -0.358  -7.224  1.00 0.00 ? 70  LYS A O    6  
ATOM 10263 C CB   . LYS A 1 70  ? 0.311   -2.140  -5.898  1.00 0.00 ? 70  LYS A CB   6  
ATOM 10264 C CG   . LYS A 1 70  ? 0.577   -3.631  -5.784  1.00 0.00 ? 70  LYS A CG   6  
ATOM 10265 C CD   . LYS A 1 70  ? -0.219  -4.420  -6.810  1.00 0.00 ? 70  LYS A CD   6  
ATOM 10266 C CE   . LYS A 1 70  ? 0.553   -4.582  -8.111  1.00 0.00 ? 70  LYS A CE   6  
ATOM 10267 N NZ   . LYS A 1 70  ? -0.354  -4.812  -9.269  1.00 0.00 ? 70  LYS A NZ   6  
ATOM 10268 H H    . LYS A 1 70  ? 0.426   0.599   -5.471  1.00 0.00 ? 70  LYS A H    6  
ATOM 10269 H HA   . LYS A 1 70  ? 1.765   -1.784  -4.368  1.00 0.00 ? 70  LYS A HA   6  
ATOM 10270 H HB2  . LYS A 1 70  ? -0.640  -1.929  -5.432  1.00 0.00 ? 70  LYS A HB2  6  
ATOM 10271 H HB3  . LYS A 1 70  ? 0.252   -1.886  -6.947  1.00 0.00 ? 70  LYS A HB3  6  
ATOM 10272 H HG2  . LYS A 1 70  ? 1.630   -3.813  -5.944  1.00 0.00 ? 70  LYS A HG2  6  
ATOM 10273 H HG3  . LYS A 1 70  ? 0.299   -3.963  -4.794  1.00 0.00 ? 70  LYS A HG3  6  
ATOM 10274 H HD2  . LYS A 1 70  ? -0.436  -5.399  -6.410  1.00 0.00 ? 70  LYS A HD2  6  
ATOM 10275 H HD3  . LYS A 1 70  ? -1.144  -3.899  -7.013  1.00 0.00 ? 70  LYS A HD3  6  
ATOM 10276 H HE2  . LYS A 1 70  ? 1.127   -3.686  -8.287  1.00 0.00 ? 70  LYS A HE2  6  
ATOM 10277 H HE3  . LYS A 1 70  ? 1.221   -5.425  -8.015  1.00 0.00 ? 70  LYS A HE3  6  
ATOM 10278 H HZ1  . LYS A 1 70  ? 0.068   -4.422  -10.136 1.00 0.00 ? 70  LYS A HZ1  6  
ATOM 10279 H HZ2  . LYS A 1 70  ? -1.270  -4.347  -9.104  1.00 0.00 ? 70  LYS A HZ2  6  
ATOM 10280 H HZ3  . LYS A 1 70  ? -0.513  -5.831  -9.402  1.00 0.00 ? 70  LYS A HZ3  6  
ATOM 10281 N N    . ILE A 1 71  ? 3.691   -1.629  -5.907  1.00 0.00 ? 71  ILE A N    6  
ATOM 10282 C CA   . ILE A 1 71  ? 4.867   -1.491  -6.758  1.00 0.00 ? 71  ILE A CA   6  
ATOM 10283 C C    . ILE A 1 71  ? 4.977   -2.655  -7.736  1.00 0.00 ? 71  ILE A C    6  
ATOM 10284 O O    . ILE A 1 71  ? 5.007   -3.818  -7.333  1.00 0.00 ? 71  ILE A O    6  
ATOM 10285 C CB   . ILE A 1 71  ? 6.159   -1.412  -5.924  1.00 0.00 ? 71  ILE A CB   6  
ATOM 10286 C CG1  . ILE A 1 71  ? 6.036   -0.326  -4.853  1.00 0.00 ? 71  ILE A CG1  6  
ATOM 10287 C CG2  . ILE A 1 71  ? 7.355   -1.142  -6.824  1.00 0.00 ? 71  ILE A CG2  6  
ATOM 10288 C CD1  . ILE A 1 71  ? 7.096   -0.414  -3.778  1.00 0.00 ? 71  ILE A CD1  6  
ATOM 10289 H H    . ILE A 1 71  ? 3.753   -2.164  -5.089  1.00 0.00 ? 71  ILE A H    6  
ATOM 10290 H HA   . ILE A 1 71  ? 4.767   -0.572  -7.318  1.00 0.00 ? 71  ILE A HA   6  
ATOM 10291 H HB   . ILE A 1 71  ? 6.309   -2.367  -5.442  1.00 0.00 ? 71  ILE A HB   6  
ATOM 10292 H HG12 . ILE A 1 71  ? 6.118   0.642   -5.320  1.00 0.00 ? 71  ILE A HG12 6  
ATOM 10293 H HG13 . ILE A 1 71  ? 5.070   -0.410  -4.375  1.00 0.00 ? 71  ILE A HG13 6  
ATOM 10294 H HG21 . ILE A 1 71  ? 8.260   -1.153  -6.234  1.00 0.00 ? 71  ILE A HG21 6  
ATOM 10295 H HG22 . ILE A 1 71  ? 7.414   -1.908  -7.584  1.00 0.00 ? 71  ILE A HG22 6  
ATOM 10296 H HG23 . ILE A 1 71  ? 7.243   -0.177  -7.293  1.00 0.00 ? 71  ILE A HG23 6  
ATOM 10297 H HD11 . ILE A 1 71  ? 8.070   -0.493  -4.238  1.00 0.00 ? 71  ILE A HD11 6  
ATOM 10298 H HD12 . ILE A 1 71  ? 7.059   0.471   -3.162  1.00 0.00 ? 71  ILE A HD12 6  
ATOM 10299 H HD13 . ILE A 1 71  ? 6.917   -1.286  -3.166  1.00 0.00 ? 71  ILE A HD13 6  
ATOM 10300 N N    . VAL A 1 72  ? 5.038   -2.335  -9.025  1.00 0.00 ? 72  VAL A N    6  
ATOM 10301 C CA   . VAL A 1 72  ? 5.148   -3.354  -10.062 1.00 0.00 ? 72  VAL A CA   6  
ATOM 10302 C C    . VAL A 1 72  ? 6.574   -3.447  -10.591 1.00 0.00 ? 72  VAL A C    6  
ATOM 10303 O O    . VAL A 1 72  ? 7.045   -4.527  -10.947 1.00 0.00 ? 72  VAL A O    6  
ATOM 10304 C CB   . VAL A 1 72  ? 4.194   -3.065  -11.236 1.00 0.00 ? 72  VAL A CB   6  
ATOM 10305 C CG1  . VAL A 1 72  ? 2.770   -3.465  -10.879 1.00 0.00 ? 72  VAL A CG1  6  
ATOM 10306 C CG2  . VAL A 1 72  ? 4.261   -1.596  -11.627 1.00 0.00 ? 72  VAL A CG2  6  
ATOM 10307 H H    . VAL A 1 72  ? 5.009   -1.390  -9.284  1.00 0.00 ? 72  VAL A H    6  
ATOM 10308 H HA   . VAL A 1 72  ? 4.872   -4.304  -9.627  1.00 0.00 ? 72  VAL A HA   6  
ATOM 10309 H HB   . VAL A 1 72  ? 4.508   -3.656  -12.083 1.00 0.00 ? 72  VAL A HB   6  
ATOM 10310 H HG11 . VAL A 1 72  ? 2.759   -4.491  -10.541 1.00 0.00 ? 72  VAL A HG11 6  
ATOM 10311 H HG12 . VAL A 1 72  ? 2.402   -2.822  -10.093 1.00 0.00 ? 72  VAL A HG12 6  
ATOM 10312 H HG13 . VAL A 1 72  ? 2.140   -3.367  -11.750 1.00 0.00 ? 72  VAL A HG13 6  
ATOM 10313 H HG21 . VAL A 1 72  ? 4.091   -1.499  -12.689 1.00 0.00 ? 72  VAL A HG21 6  
ATOM 10314 H HG22 . VAL A 1 72  ? 3.503   -1.045  -11.090 1.00 0.00 ? 72  VAL A HG22 6  
ATOM 10315 H HG23 . VAL A 1 72  ? 5.235   -1.202  -11.381 1.00 0.00 ? 72  VAL A HG23 6  
ATOM 10316 N N    . ALA A 1 73  ? 7.257   -2.308  -10.640 1.00 0.00 ? 73  ALA A N    6  
ATOM 10317 C CA   . ALA A 1 73  ? 8.631   -2.262  -11.124 1.00 0.00 ? 73  ALA A CA   6  
ATOM 10318 C C    . ALA A 1 73  ? 9.409   -1.129  -10.462 1.00 0.00 ? 73  ALA A C    6  
ATOM 10319 O O    . ALA A 1 73  ? 8.838   -0.101  -10.098 1.00 0.00 ? 73  ALA A O    6  
ATOM 10320 C CB   . ALA A 1 73  ? 8.653   -2.105  -12.637 1.00 0.00 ? 73  ALA A CB   6  
ATOM 10321 H H    . ALA A 1 73  ? 6.827   -1.480  -10.343 1.00 0.00 ? 73  ALA A H    6  
ATOM 10322 H HA   . ALA A 1 73  ? 9.104   -3.201  -10.877 1.00 0.00 ? 73  ALA A HA   6  
ATOM 10323 H HB1  . ALA A 1 73  ? 7.735   -1.637  -12.963 1.00 0.00 ? 73  ALA A HB1  6  
ATOM 10324 H HB2  . ALA A 1 73  ? 9.493   -1.489  -12.923 1.00 0.00 ? 73  ALA A HB2  6  
ATOM 10325 H HB3  . ALA A 1 73  ? 8.745   -3.077  -13.098 1.00 0.00 ? 73  ALA A HB3  6  
ATOM 10326 N N    . VAL A 1 74  ? 10.714  -1.325  -10.307 1.00 0.00 ? 74  VAL A N    6  
ATOM 10327 C CA   . VAL A 1 74  ? 11.570  -0.319  -9.689  1.00 0.00 ? 74  VAL A CA   6  
ATOM 10328 C C    . VAL A 1 74  ? 12.828  -0.084  -10.516 1.00 0.00 ? 74  VAL A C    6  
ATOM 10329 O O    . VAL A 1 74  ? 13.705  -0.945  -10.590 1.00 0.00 ? 74  VAL A O    6  
ATOM 10330 C CB   . VAL A 1 74  ? 11.977  -0.730  -8.261  1.00 0.00 ? 74  VAL A CB   6  
ATOM 10331 C CG1  . VAL A 1 74  ? 12.812  0.361   -7.609  1.00 0.00 ? 74  VAL A CG1  6  
ATOM 10332 C CG2  . VAL A 1 74  ? 10.745  -1.042  -7.425  1.00 0.00 ? 74  VAL A CG2  6  
ATOM 10333 H H    . VAL A 1 74  ? 11.112  -2.165  -10.617 1.00 0.00 ? 74  VAL A H    6  
ATOM 10334 H HA   . VAL A 1 74  ? 11.012  0.604   -9.630  1.00 0.00 ? 74  VAL A HA   6  
ATOM 10335 H HB   . VAL A 1 74  ? 12.580  -1.625  -8.324  1.00 0.00 ? 74  VAL A HB   6  
ATOM 10336 H HG11 . VAL A 1 74  ? 13.509  -0.086  -6.915  1.00 0.00 ? 74  VAL A HG11 6  
ATOM 10337 H HG12 . VAL A 1 74  ? 13.356  0.902   -8.370  1.00 0.00 ? 74  VAL A HG12 6  
ATOM 10338 H HG13 . VAL A 1 74  ? 12.163  1.041   -7.077  1.00 0.00 ? 74  VAL A HG13 6  
ATOM 10339 H HG21 . VAL A 1 74  ? 10.886  -1.982  -6.914  1.00 0.00 ? 74  VAL A HG21 6  
ATOM 10340 H HG22 . VAL A 1 74  ? 10.595  -0.257  -6.698  1.00 0.00 ? 74  VAL A HG22 6  
ATOM 10341 H HG23 . VAL A 1 74  ? 9.880   -1.107  -8.068  1.00 0.00 ? 74  VAL A HG23 6  
ATOM 10342 N N    . ASP A 1 75  ? 12.911  1.087   -11.137 1.00 0.00 ? 75  ASP A N    6  
ATOM 10343 C CA   . ASP A 1 75  ? 14.063  1.437   -11.960 1.00 0.00 ? 75  ASP A CA   6  
ATOM 10344 C C    . ASP A 1 75  ? 14.199  0.481   -13.140 1.00 0.00 ? 75  ASP A C    6  
ATOM 10345 O O    . ASP A 1 75  ? 15.305  0.092   -13.514 1.00 0.00 ? 75  ASP A O    6  
ATOM 10346 C CB   . ASP A 1 75  ? 15.342  1.415   -11.120 1.00 0.00 ? 75  ASP A CB   6  
ATOM 10347 C CG   . ASP A 1 75  ? 15.617  2.747   -10.450 1.00 0.00 ? 75  ASP A CG   6  
ATOM 10348 O OD1  . ASP A 1 75  ? 14.816  3.152   -9.583  1.00 0.00 ? 75  ASP A OD1  6  
ATOM 10349 O OD2  . ASP A 1 75  ? 16.635  3.385   -10.794 1.00 0.00 ? 75  ASP A OD2  6  
ATOM 10350 H H    . ASP A 1 75  ? 12.179  1.732   -11.040 1.00 0.00 ? 75  ASP A H    6  
ATOM 10351 H HA   . ASP A 1 75  ? 13.910  2.436   -12.338 1.00 0.00 ? 75  ASP A HA   6  
ATOM 10352 H HB2  . ASP A 1 75  ? 15.247  0.660   -10.352 1.00 0.00 ? 75  ASP A HB2  6  
ATOM 10353 H HB3  . ASP A 1 75  ? 16.179  1.172   -11.757 1.00 0.00 ? 75  ASP A HB3  6  
ATOM 10354 N N    . GLY A 1 76  ? 13.065  0.104   -13.724 1.00 0.00 ? 76  GLY A N    6  
ATOM 10355 C CA   . GLY A 1 76  ? 13.080  -0.805  -14.855 1.00 0.00 ? 76  GLY A CA   6  
ATOM 10356 C C    . GLY A 1 76  ? 13.324  -2.242  -14.441 1.00 0.00 ? 76  GLY A C    6  
ATOM 10357 O O    . GLY A 1 76  ? 13.808  -3.051  -15.234 1.00 0.00 ? 76  GLY A O    6  
ATOM 10358 H H    . GLY A 1 76  ? 12.212  0.446   -13.383 1.00 0.00 ? 76  GLY A H    6  
ATOM 10359 H HA2  . GLY A 1 76  ? 12.129  -0.744  -15.364 1.00 0.00 ? 76  GLY A HA2  6  
ATOM 10360 H HA3  . GLY A 1 76  ? 13.861  -0.501  -15.536 1.00 0.00 ? 76  GLY A HA3  6  
ATOM 10361 N N    . VAL A 1 77  ? 12.991  -2.563  -13.195 1.00 0.00 ? 77  VAL A N    6  
ATOM 10362 C CA   . VAL A 1 77  ? 13.177  -3.912  -12.676 1.00 0.00 ? 77  VAL A CA   6  
ATOM 10363 C C    . VAL A 1 77  ? 11.848  -4.526  -12.251 1.00 0.00 ? 77  VAL A C    6  
ATOM 10364 O O    . VAL A 1 77  ? 11.264  -4.129  -11.243 1.00 0.00 ? 77  VAL A O    6  
ATOM 10365 C CB   . VAL A 1 77  ? 14.143  -3.924  -11.476 1.00 0.00 ? 77  VAL A CB   6  
ATOM 10366 C CG1  . VAL A 1 77  ? 14.204  -5.311  -10.854 1.00 0.00 ? 77  VAL A CG1  6  
ATOM 10367 C CG2  . VAL A 1 77  ? 15.528  -3.461  -11.903 1.00 0.00 ? 77  VAL A CG2  6  
ATOM 10368 H H    . VAL A 1 77  ? 12.609  -1.875  -12.610 1.00 0.00 ? 77  VAL A H    6  
ATOM 10369 H HA   . VAL A 1 77  ? 13.606  -4.516  -13.463 1.00 0.00 ? 77  VAL A HA   6  
ATOM 10370 H HB   . VAL A 1 77  ? 13.769  -3.236  -10.732 1.00 0.00 ? 77  VAL A HB   6  
ATOM 10371 H HG11 . VAL A 1 77  ? 13.490  -5.956  -11.343 1.00 0.00 ? 77  VAL A HG11 6  
ATOM 10372 H HG12 . VAL A 1 77  ? 15.199  -5.716  -10.973 1.00 0.00 ? 77  VAL A HG12 6  
ATOM 10373 H HG13 . VAL A 1 77  ? 13.966  -5.243  -9.802  1.00 0.00 ? 77  VAL A HG13 6  
ATOM 10374 H HG21 . VAL A 1 77  ? 15.447  -2.515  -12.419 1.00 0.00 ? 77  VAL A HG21 6  
ATOM 10375 H HG22 . VAL A 1 77  ? 16.153  -3.342  -11.030 1.00 0.00 ? 77  VAL A HG22 6  
ATOM 10376 H HG23 . VAL A 1 77  ? 15.966  -4.195  -12.562 1.00 0.00 ? 77  VAL A HG23 6  
ATOM 10377 N N    . ASN A 1 78  ? 11.376  -5.497  -13.025 1.00 0.00 ? 78  ASN A N    6  
ATOM 10378 C CA   . ASN A 1 78  ? 10.115  -6.167  -12.729 1.00 0.00 ? 78  ASN A CA   6  
ATOM 10379 C C    . ASN A 1 78  ? 10.199  -6.927  -11.409 1.00 0.00 ? 78  ASN A C    6  
ATOM 10380 O O    . ASN A 1 78  ? 10.633  -8.079  -11.371 1.00 0.00 ? 78  ASN A O    6  
ATOM 10381 C CB   . ASN A 1 78  ? 9.745   -7.128  -13.860 1.00 0.00 ? 78  ASN A CB   6  
ATOM 10382 C CG   . ASN A 1 78  ? 8.339   -7.677  -13.717 1.00 0.00 ? 78  ASN A CG   6  
ATOM 10383 O OD1  . ASN A 1 78  ? 8.134   -8.748  -13.146 1.00 0.00 ? 78  ASN A OD1  6  
ATOM 10384 N ND2  . ASN A 1 78  ? 7.361   -6.942  -14.236 1.00 0.00 ? 78  ASN A ND2  6  
ATOM 10385 H H    . ASN A 1 78  ? 11.887  -5.770  -13.816 1.00 0.00 ? 78  ASN A H    6  
ATOM 10386 H HA   . ASN A 1 78  ? 9.349   -5.410  -12.647 1.00 0.00 ? 78  ASN A HA   6  
ATOM 10387 H HB2  . ASN A 1 78  ? 9.812   -6.606  -14.804 1.00 0.00 ? 78  ASN A HB2  6  
ATOM 10388 H HB3  . ASN A 1 78  ? 10.437  -7.957  -13.862 1.00 0.00 ? 78  ASN A HB3  6  
ATOM 10389 H HD21 . ASN A 1 78  ? 7.599   -6.100  -14.676 1.00 0.00 ? 78  ASN A HD21 6  
ATOM 10390 H HD22 . ASN A 1 78  ? 6.442   -7.273  -14.156 1.00 0.00 ? 78  ASN A HD22 6  
ATOM 10391 N N    . ILE A 1 79  ? 9.783   -6.274  -10.329 1.00 0.00 ? 79  ILE A N    6  
ATOM 10392 C CA   . ILE A 1 79  ? 9.810   -6.889  -9.007  1.00 0.00 ? 79  ILE A CA   6  
ATOM 10393 C C    . ILE A 1 79  ? 8.519   -7.652  -8.729  1.00 0.00 ? 79  ILE A C    6  
ATOM 10394 O O    . ILE A 1 79  ? 8.274   -8.085  -7.604  1.00 0.00 ? 79  ILE A O    6  
ATOM 10395 C CB   . ILE A 1 79  ? 10.020  -5.837  -7.902  1.00 0.00 ? 79  ILE A CB   6  
ATOM 10396 C CG1  . ILE A 1 79  ? 8.804   -4.913  -7.809  1.00 0.00 ? 79  ILE A CG1  6  
ATOM 10397 C CG2  . ILE A 1 79  ? 11.284  -5.034  -8.168  1.00 0.00 ? 79  ILE A CG2  6  
ATOM 10398 C CD1  . ILE A 1 79  ? 8.574   -4.354  -6.423  1.00 0.00 ? 79  ILE A CD1  6  
ATOM 10399 H H    . ILE A 1 79  ? 9.448   -5.358  -10.423 1.00 0.00 ? 79  ILE A H    6  
ATOM 10400 H HA   . ILE A 1 79  ? 10.638  -7.582  -8.980  1.00 0.00 ? 79  ILE A HA   6  
ATOM 10401 H HB   . ILE A 1 79  ? 10.142  -6.355  -6.962  1.00 0.00 ? 79  ILE A HB   6  
ATOM 10402 H HG12 . ILE A 1 79  ? 8.940   -4.082  -8.483  1.00 0.00 ? 79  ILE A HG12 6  
ATOM 10403 H HG13 . ILE A 1 79  ? 7.920   -5.463  -8.097  1.00 0.00 ? 79  ILE A HG13 6  
ATOM 10404 H HG21 . ILE A 1 79  ? 11.141  -4.017  -7.836  1.00 0.00 ? 79  ILE A HG21 6  
ATOM 10405 H HG22 . ILE A 1 79  ? 12.110  -5.475  -7.629  1.00 0.00 ? 79  ILE A HG22 6  
ATOM 10406 H HG23 . ILE A 1 79  ? 11.499  -5.041  -9.226  1.00 0.00 ? 79  ILE A HG23 6  
ATOM 10407 H HD11 . ILE A 1 79  ? 7.612   -4.682  -6.057  1.00 0.00 ? 79  ILE A HD11 6  
ATOM 10408 H HD12 . ILE A 1 79  ? 9.350   -4.704  -5.760  1.00 0.00 ? 79  ILE A HD12 6  
ATOM 10409 H HD13 . ILE A 1 79  ? 8.594   -3.274  -6.462  1.00 0.00 ? 79  ILE A HD13 6  
ATOM 10410 N N    . GLN A 1 80  ? 7.699   -7.814  -9.763  1.00 0.00 ? 80  GLN A N    6  
ATOM 10411 C CA   . GLN A 1 80  ? 6.434   -8.526  -9.629  1.00 0.00 ? 80  GLN A CA   6  
ATOM 10412 C C    . GLN A 1 80  ? 6.661   -9.951  -9.136  1.00 0.00 ? 80  GLN A C    6  
ATOM 10413 O O    . GLN A 1 80  ? 6.632   -10.901 -9.917  1.00 0.00 ? 80  GLN A O    6  
ATOM 10414 C CB   . GLN A 1 80  ? 5.694   -8.548  -10.968 1.00 0.00 ? 80  GLN A CB   6  
ATOM 10415 C CG   . GLN A 1 80  ? 5.150   -7.192  -11.385 1.00 0.00 ? 80  GLN A CG   6  
ATOM 10416 C CD   . GLN A 1 80  ? 4.132   -7.290  -12.505 1.00 0.00 ? 80  GLN A CD   6  
ATOM 10417 O OE1  . GLN A 1 80  ? 4.011   -8.326  -13.159 1.00 0.00 ? 80  GLN A OE1  6  
ATOM 10418 N NE2  . GLN A 1 80  ? 3.395   -6.210  -12.732 1.00 0.00 ? 80  GLN A NE2  6  
ATOM 10419 H H    . GLN A 1 80  ? 7.951   -7.445  -10.635 1.00 0.00 ? 80  GLN A H    6  
ATOM 10420 H HA   . GLN A 1 80  ? 5.832   -7.999  -8.905  1.00 0.00 ? 80  GLN A HA   6  
ATOM 10421 H HB2  . GLN A 1 80  ? 6.371   -8.892  -11.735 1.00 0.00 ? 80  GLN A HB2  6  
ATOM 10422 H HB3  . GLN A 1 80  ? 4.865   -9.237  -10.896 1.00 0.00 ? 80  GLN A HB3  6  
ATOM 10423 H HG2  . GLN A 1 80  ? 4.677   -6.729  -10.531 1.00 0.00 ? 80  GLN A HG2  6  
ATOM 10424 H HG3  . GLN A 1 80  ? 5.972   -6.576  -11.718 1.00 0.00 ? 80  GLN A HG3  6  
ATOM 10425 H HE21 . GLN A 1 80  ? 3.548   -5.419  -12.172 1.00 0.00 ? 80  GLN A HE21 6  
ATOM 10426 H HE22 . GLN A 1 80  ? 2.730   -6.245  -13.450 1.00 0.00 ? 80  GLN A HE22 6  
ATOM 10427 N N    . GLY A 1 81  ? 6.887   -10.092 -7.833  1.00 0.00 ? 81  GLY A N    6  
ATOM 10428 C CA   . GLY A 1 81  ? 7.116   -11.405 -7.258  1.00 0.00 ? 81  GLY A CA   6  
ATOM 10429 C C    . GLY A 1 81  ? 8.443   -11.496 -6.532  1.00 0.00 ? 81  GLY A C    6  
ATOM 10430 O O    . GLY A 1 81  ? 8.943   -12.590 -6.271  1.00 0.00 ? 81  GLY A O    6  
ATOM 10431 H H    . GLY A 1 81  ? 6.899   -9.299  -7.258  1.00 0.00 ? 81  GLY A H    6  
ATOM 10432 H HA2  . GLY A 1 81  ? 6.321   -11.625 -6.563  1.00 0.00 ? 81  GLY A HA2  6  
ATOM 10433 H HA3  . GLY A 1 81  ? 7.102   -12.140 -8.050  1.00 0.00 ? 81  GLY A HA3  6  
ATOM 10434 N N    . PHE A 1 82  ? 9.017   -10.343 -6.205  1.00 0.00 ? 82  PHE A N    6  
ATOM 10435 C CA   . PHE A 1 82  ? 10.296  -10.296 -5.506  1.00 0.00 ? 82  PHE A CA   6  
ATOM 10436 C C    . PHE A 1 82  ? 10.092  -10.344 -3.994  1.00 0.00 ? 82  PHE A C    6  
ATOM 10437 O O    . PHE A 1 82  ? 9.083   -9.864  -3.478  1.00 0.00 ? 82  PHE A O    6  
ATOM 10438 C CB   . PHE A 1 82  ? 11.065  -9.030  -5.888  1.00 0.00 ? 82  PHE A CB   6  
ATOM 10439 C CG   . PHE A 1 82  ? 11.875  -9.177  -7.145  1.00 0.00 ? 82  PHE A CG   6  
ATOM 10440 C CD1  . PHE A 1 82  ? 11.570  -10.162 -8.070  1.00 0.00 ? 82  PHE A CD1  6  
ATOM 10441 C CD2  . PHE A 1 82  ? 12.942  -8.331  -7.400  1.00 0.00 ? 82  PHE A CD2  6  
ATOM 10442 C CE1  . PHE A 1 82  ? 12.313  -10.300 -9.228  1.00 0.00 ? 82  PHE A CE1  6  
ATOM 10443 C CE2  . PHE A 1 82  ? 13.688  -8.464  -8.556  1.00 0.00 ? 82  PHE A CE2  6  
ATOM 10444 C CZ   . PHE A 1 82  ? 13.374  -9.450  -9.470  1.00 0.00 ? 82  PHE A CZ   6  
ATOM 10445 H H    . PHE A 1 82  ? 8.570   -9.503  -6.440  1.00 0.00 ? 82  PHE A H    6  
ATOM 10446 H HA   . PHE A 1 82  ? 10.869  -11.160 -5.807  1.00 0.00 ? 82  PHE A HA   6  
ATOM 10447 H HB2  . PHE A 1 82  ? 10.364  -8.223  -6.039  1.00 0.00 ? 82  PHE A HB2  6  
ATOM 10448 H HB3  . PHE A 1 82  ? 11.739  -8.771  -5.086  1.00 0.00 ? 82  PHE A HB3  6  
ATOM 10449 H HD1  . PHE A 1 82  ? 10.739  -10.828 -7.881  1.00 0.00 ? 82  PHE A HD1  6  
ATOM 10450 H HD2  . PHE A 1 82  ? 13.190  -7.560  -6.686  1.00 0.00 ? 82  PHE A HD2  6  
ATOM 10451 H HE1  . PHE A 1 82  ? 12.064  -11.073 -9.940  1.00 0.00 ? 82  PHE A HE1  6  
ATOM 10452 H HE2  . PHE A 1 82  ? 14.518  -7.798  -8.743  1.00 0.00 ? 82  PHE A HE2  6  
ATOM 10453 H HZ   . PHE A 1 82  ? 13.955  -9.556  -10.374 1.00 0.00 ? 82  PHE A HZ   6  
ATOM 10454 N N    . ALA A 1 83  ? 11.058  -10.926 -3.291  1.00 0.00 ? 83  ALA A N    6  
ATOM 10455 C CA   . ALA A 1 83  ? 10.985  -11.036 -1.839  1.00 0.00 ? 83  ALA A CA   6  
ATOM 10456 C C    . ALA A 1 83  ? 11.237  -9.687  -1.174  1.00 0.00 ? 83  ALA A C    6  
ATOM 10457 O O    . ALA A 1 83  ? 12.028  -8.881  -1.663  1.00 0.00 ? 83  ALA A O    6  
ATOM 10458 C CB   . ALA A 1 83  ? 11.984  -12.068 -1.337  1.00 0.00 ? 83  ALA A CB   6  
ATOM 10459 H H    . ALA A 1 83  ? 11.837  -11.290 -3.759  1.00 0.00 ? 83  ALA A H    6  
ATOM 10460 H HA   . ALA A 1 83  ? 9.993   -11.375 -1.579  1.00 0.00 ? 83  ALA A HA   6  
ATOM 10461 H HB1  . ALA A 1 83  ? 12.672  -11.598 -0.650  1.00 0.00 ? 83  ALA A HB1  6  
ATOM 10462 H HB2  . ALA A 1 83  ? 11.456  -12.863 -0.831  1.00 0.00 ? 83  ALA A HB2  6  
ATOM 10463 H HB3  . ALA A 1 83  ? 12.532  -12.475 -2.174  1.00 0.00 ? 83  ALA A HB3  6  
ATOM 10464 N N    . ASN A 1 84  ? 10.558  -9.448  -0.056  1.00 0.00 ? 84  ASN A N    6  
ATOM 10465 C CA   . ASN A 1 84  ? 10.708  -8.195  0.675   1.00 0.00 ? 84  ASN A CA   6  
ATOM 10466 C C    . ASN A 1 84  ? 12.141  -7.680  0.584   1.00 0.00 ? 84  ASN A C    6  
ATOM 10467 O O    . ASN A 1 84  ? 12.389  -6.592  0.064   1.00 0.00 ? 84  ASN A O    6  
ATOM 10468 C CB   . ASN A 1 84  ? 10.314  -8.386  2.141   1.00 0.00 ? 84  ASN A CB   6  
ATOM 10469 C CG   . ASN A 1 84  ? 8.837   -8.143  2.380   1.00 0.00 ? 84  ASN A CG   6  
ATOM 10470 O OD1  . ASN A 1 84  ? 8.026   -9.067  2.316   1.00 0.00 ? 84  ASN A OD1  6  
ATOM 10471 N ND2  . ASN A 1 84  ? 8.481   -6.894  2.658   1.00 0.00 ? 84  ASN A ND2  6  
ATOM 10472 H H    . ASN A 1 84  ? 9.942   -10.129 0.284   1.00 0.00 ? 84  ASN A H    6  
ATOM 10473 H HA   . ASN A 1 84  ? 10.047  -7.468  0.227   1.00 0.00 ? 84  ASN A HA   6  
ATOM 10474 H HB2  . ASN A 1 84  ? 10.545  -9.399  2.440   1.00 0.00 ? 84  ASN A HB2  6  
ATOM 10475 H HB3  . ASN A 1 84  ? 10.878  -7.698  2.752   1.00 0.00 ? 84  ASN A HB3  6  
ATOM 10476 H HD21 . ASN A 1 84  ? 9.181   -6.209  2.692   1.00 0.00 ? 84  ASN A HD21 6  
ATOM 10477 H HD22 . ASN A 1 84  ? 7.532   -6.709  2.817   1.00 0.00 ? 84  ASN A HD22 6  
ATOM 10478 N N    . HIS A 1 85  ? 13.081  -8.469  1.094   1.00 0.00 ? 85  HIS A N    6  
ATOM 10479 C CA   . HIS A 1 85  ? 14.490  -8.093  1.070   1.00 0.00 ? 85  HIS A CA   6  
ATOM 10480 C C    . HIS A 1 85  ? 14.971  -7.882  -0.362  1.00 0.00 ? 85  HIS A C    6  
ATOM 10481 O O    . HIS A 1 85  ? 15.662  -6.906  -0.658  1.00 0.00 ? 85  HIS A O    6  
ATOM 10482 C CB   . HIS A 1 85  ? 15.338  -9.168  1.752   1.00 0.00 ? 85  HIS A CB   6  
ATOM 10483 C CG   . HIS A 1 85  ? 14.771  -10.548 1.625   1.00 0.00 ? 85  HIS A CG   6  
ATOM 10484 N ND1  . HIS A 1 85  ? 13.972  -11.125 2.590   1.00 0.00 ? 85  HIS A ND1  6  
ATOM 10485 C CD2  . HIS A 1 85  ? 14.890  -11.467 0.639   1.00 0.00 ? 85  HIS A CD2  6  
ATOM 10486 C CE1  . HIS A 1 85  ? 13.625  -12.339 2.203   1.00 0.00 ? 85  HIS A CE1  6  
ATOM 10487 N NE2  . HIS A 1 85  ? 14.169  -12.571 1.021   1.00 0.00 ? 85  HIS A NE2  6  
ATOM 10488 H H    . HIS A 1 85  ? 12.821  -9.324  1.496   1.00 0.00 ? 85  HIS A H    6  
ATOM 10489 H HA   . HIS A 1 85  ? 14.596  -7.166  1.612   1.00 0.00 ? 85  HIS A HA   6  
ATOM 10490 H HB2  . HIS A 1 85  ? 16.324  -9.173  1.311   1.00 0.00 ? 85  HIS A HB2  6  
ATOM 10491 H HB3  . HIS A 1 85  ? 15.421  -8.937  2.804   1.00 0.00 ? 85  HIS A HB3  6  
ATOM 10492 H HD1  . HIS A 1 85  ? 13.701  -10.707 3.434   1.00 0.00 ? 85  HIS A HD1  6  
ATOM 10493 H HD2  . HIS A 1 85  ? 15.448  -11.353 -0.280  1.00 0.00 ? 85  HIS A HD2  6  
ATOM 10494 H HE1  . HIS A 1 85  ? 13.003  -13.026 2.757   1.00 0.00 ? 85  HIS A HE1  6  
ATOM 10495 H HE2  . HIS A 1 85  ? 14.142  -13.427 0.546   1.00 0.00 ? 85  HIS A HE2  6  
ATOM 10496 N N    . ASP A 1 86  ? 14.603  -8.802  -1.247  1.00 0.00 ? 86  ASP A N    6  
ATOM 10497 C CA   . ASP A 1 86  ? 14.997  -8.717  -2.648  1.00 0.00 ? 86  ASP A CA   6  
ATOM 10498 C C    . ASP A 1 86  ? 14.634  -7.355  -3.232  1.00 0.00 ? 86  ASP A C    6  
ATOM 10499 O O    . ASP A 1 86  ? 15.296  -6.863  -4.147  1.00 0.00 ? 86  ASP A O    6  
ATOM 10500 C CB   . ASP A 1 86  ? 14.326  -9.828  -3.457  1.00 0.00 ? 86  ASP A CB   6  
ATOM 10501 C CG   . ASP A 1 86  ? 15.162  -11.091 -3.510  1.00 0.00 ? 86  ASP A CG   6  
ATOM 10502 O OD1  . ASP A 1 86  ? 15.805  -11.420 -2.491  1.00 0.00 ? 86  ASP A OD1  6  
ATOM 10503 O OD2  . ASP A 1 86  ? 15.173  -11.751 -4.570  1.00 0.00 ? 86  ASP A OD2  6  
ATOM 10504 H H    . ASP A 1 86  ? 14.052  -9.557  -0.950  1.00 0.00 ? 86  ASP A H    6  
ATOM 10505 H HA   . ASP A 1 86  ? 16.068  -8.843  -2.700  1.00 0.00 ? 86  ASP A HA   6  
ATOM 10506 H HB2  . ASP A 1 86  ? 13.374  -10.067 -3.007  1.00 0.00 ? 86  ASP A HB2  6  
ATOM 10507 H HB3  . ASP A 1 86  ? 14.165  -9.481  -4.467  1.00 0.00 ? 86  ASP A HB3  6  
ATOM 10508 N N    . VAL A 1 87  ? 13.577  -6.750  -2.699  1.00 0.00 ? 87  VAL A N    6  
ATOM 10509 C CA   . VAL A 1 87  ? 13.126  -5.445  -3.167  1.00 0.00 ? 87  VAL A CA   6  
ATOM 10510 C C    . VAL A 1 87  ? 13.915  -4.321  -2.506  1.00 0.00 ? 87  VAL A C    6  
ATOM 10511 O O    . VAL A 1 87  ? 14.193  -3.295  -3.126  1.00 0.00 ? 87  VAL A O    6  
ATOM 10512 C CB   . VAL A 1 87  ? 11.626  -5.237  -2.888  1.00 0.00 ? 87  VAL A CB   6  
ATOM 10513 C CG1  . VAL A 1 87  ? 11.191  -3.844  -3.318  1.00 0.00 ? 87  VAL A CG1  6  
ATOM 10514 C CG2  . VAL A 1 87  ? 10.800  -6.303  -3.593  1.00 0.00 ? 87  VAL A CG2  6  
ATOM 10515 H H    . VAL A 1 87  ? 13.090  -7.192  -1.973  1.00 0.00 ? 87  VAL A H    6  
ATOM 10516 H HA   . VAL A 1 87  ? 13.282  -5.402  -4.235  1.00 0.00 ? 87  VAL A HA   6  
ATOM 10517 H HB   . VAL A 1 87  ? 11.461  -5.329  -1.825  1.00 0.00 ? 87  VAL A HB   6  
ATOM 10518 H HG11 . VAL A 1 87  ? 11.992  -3.371  -3.866  1.00 0.00 ? 87  VAL A HG11 6  
ATOM 10519 H HG12 . VAL A 1 87  ? 10.316  -3.918  -3.948  1.00 0.00 ? 87  VAL A HG12 6  
ATOM 10520 H HG13 . VAL A 1 87  ? 10.956  -3.255  -2.444  1.00 0.00 ? 87  VAL A HG13 6  
ATOM 10521 H HG21 . VAL A 1 87  ? 9.867   -6.441  -3.067  1.00 0.00 ? 87  VAL A HG21 6  
ATOM 10522 H HG22 . VAL A 1 87  ? 10.599  -5.992  -4.608  1.00 0.00 ? 87  VAL A HG22 6  
ATOM 10523 H HG23 . VAL A 1 87  ? 11.348  -7.234  -3.604  1.00 0.00 ? 87  VAL A HG23 6  
ATOM 10524 N N    . VAL A 1 88  ? 14.275  -4.522  -1.242  1.00 0.00 ? 88  VAL A N    6  
ATOM 10525 C CA   . VAL A 1 88  ? 15.035  -3.526  -0.496  1.00 0.00 ? 88  VAL A CA   6  
ATOM 10526 C C    . VAL A 1 88  ? 16.382  -3.254  -1.156  1.00 0.00 ? 88  VAL A C    6  
ATOM 10527 O O    . VAL A 1 88  ? 16.818  -2.107  -1.250  1.00 0.00 ? 88  VAL A O    6  
ATOM 10528 C CB   . VAL A 1 88  ? 15.269  -3.973  0.959   1.00 0.00 ? 88  VAL A CB   6  
ATOM 10529 C CG1  . VAL A 1 88  ? 16.078  -2.930  1.715   1.00 0.00 ? 88  VAL A CG1  6  
ATOM 10530 C CG2  . VAL A 1 88  ? 13.943  -4.238  1.655   1.00 0.00 ? 88  VAL A CG2  6  
ATOM 10531 H H    . VAL A 1 88  ? 14.025  -5.361  -0.801  1.00 0.00 ? 88  VAL A H    6  
ATOM 10532 H HA   . VAL A 1 88  ? 14.461  -2.611  -0.481  1.00 0.00 ? 88  VAL A HA   6  
ATOM 10533 H HB   . VAL A 1 88  ? 15.834  -4.894  0.945   1.00 0.00 ? 88  VAL A HB   6  
ATOM 10534 H HG11 . VAL A 1 88  ? 15.461  -2.482  2.480   1.00 0.00 ? 88  VAL A HG11 6  
ATOM 10535 H HG12 . VAL A 1 88  ? 16.936  -3.401  2.172   1.00 0.00 ? 88  VAL A HG12 6  
ATOM 10536 H HG13 . VAL A 1 88  ? 16.411  -2.166  1.028   1.00 0.00 ? 88  VAL A HG13 6  
ATOM 10537 H HG21 . VAL A 1 88  ? 13.589  -5.224  1.391   1.00 0.00 ? 88  VAL A HG21 6  
ATOM 10538 H HG22 . VAL A 1 88  ? 14.079  -4.180  2.725   1.00 0.00 ? 88  VAL A HG22 6  
ATOM 10539 H HG23 . VAL A 1 88  ? 13.219  -3.500  1.344   1.00 0.00 ? 88  VAL A HG23 6  
ATOM 10540 N N    . GLU A 1 89  ? 17.036  -4.317  -1.613  1.00 0.00 ? 89  GLU A N    6  
ATOM 10541 C CA   . GLU A 1 89  ? 18.335  -4.193  -2.264  1.00 0.00 ? 89  GLU A CA   6  
ATOM 10542 C C    . GLU A 1 89  ? 18.202  -3.488  -3.612  1.00 0.00 ? 89  GLU A C    6  
ATOM 10543 O O    . GLU A 1 89  ? 19.112  -2.784  -4.049  1.00 0.00 ? 89  GLU A O    6  
ATOM 10544 C CB   . GLU A 1 89  ? 18.967  -5.572  -2.458  1.00 0.00 ? 89  GLU A CB   6  
ATOM 10545 C CG   . GLU A 1 89  ? 18.212  -6.457  -3.436  1.00 0.00 ? 89  GLU A CG   6  
ATOM 10546 C CD   . GLU A 1 89  ? 19.097  -7.509  -4.075  1.00 0.00 ? 89  GLU A CD   6  
ATOM 10547 O OE1  . GLU A 1 89  ? 20.313  -7.260  -4.210  1.00 0.00 ? 89  GLU A OE1  6  
ATOM 10548 O OE2  . GLU A 1 89  ? 18.573  -8.582  -4.440  1.00 0.00 ? 89  GLU A OE2  6  
ATOM 10549 H H    . GLU A 1 89  ? 16.636  -5.206  -1.509  1.00 0.00 ? 89  GLU A H    6  
ATOM 10550 H HA   . GLU A 1 89  ? 18.972  -3.602  -1.624  1.00 0.00 ? 89  GLU A HA   6  
ATOM 10551 H HB2  . GLU A 1 89  ? 19.975  -5.445  -2.824  1.00 0.00 ? 89  GLU A HB2  6  
ATOM 10552 H HB3  . GLU A 1 89  ? 19.002  -6.076  -1.503  1.00 0.00 ? 89  GLU A HB3  6  
ATOM 10553 H HG2  . GLU A 1 89  ? 17.412  -6.954  -2.908  1.00 0.00 ? 89  GLU A HG2  6  
ATOM 10554 H HG3  . GLU A 1 89  ? 17.796  -5.836  -4.215  1.00 0.00 ? 89  GLU A HG3  6  
ATOM 10555 N N    . VAL A 1 90  ? 17.061  -3.684  -4.266  1.00 0.00 ? 90  VAL A N    6  
ATOM 10556 C CA   . VAL A 1 90  ? 16.808  -3.068  -5.563  1.00 0.00 ? 90  VAL A CA   6  
ATOM 10557 C C    . VAL A 1 90  ? 16.725  -1.551  -5.443  1.00 0.00 ? 90  VAL A C    6  
ATOM 10558 O O    . VAL A 1 90  ? 17.321  -0.821  -6.237  1.00 0.00 ? 90  VAL A O    6  
ATOM 10559 C CB   . VAL A 1 90  ? 15.503  -3.595  -6.189  1.00 0.00 ? 90  VAL A CB   6  
ATOM 10560 C CG1  . VAL A 1 90  ? 15.202  -2.865  -7.489  1.00 0.00 ? 90  VAL A CG1  6  
ATOM 10561 C CG2  . VAL A 1 90  ? 15.592  -5.096  -6.420  1.00 0.00 ? 90  VAL A CG2  6  
ATOM 10562 H H    . VAL A 1 90  ? 16.374  -4.257  -3.866  1.00 0.00 ? 90  VAL A H    6  
ATOM 10563 H HA   . VAL A 1 90  ? 17.627  -3.324  -6.219  1.00 0.00 ? 90  VAL A HA   6  
ATOM 10564 H HB   . VAL A 1 90  ? 14.694  -3.405  -5.499  1.00 0.00 ? 90  VAL A HB   6  
ATOM 10565 H HG11 . VAL A 1 90  ? 14.412  -2.147  -7.323  1.00 0.00 ? 90  VAL A HG11 6  
ATOM 10566 H HG12 . VAL A 1 90  ? 16.090  -2.352  -7.828  1.00 0.00 ? 90  VAL A HG12 6  
ATOM 10567 H HG13 . VAL A 1 90  ? 14.888  -3.577  -8.237  1.00 0.00 ? 90  VAL A HG13 6  
ATOM 10568 H HG21 . VAL A 1 90  ? 15.611  -5.296  -7.481  1.00 0.00 ? 90  VAL A HG21 6  
ATOM 10569 H HG22 . VAL A 1 90  ? 16.495  -5.478  -5.966  1.00 0.00 ? 90  VAL A HG22 6  
ATOM 10570 H HG23 . VAL A 1 90  ? 14.734  -5.580  -5.977  1.00 0.00 ? 90  VAL A HG23 6  
ATOM 10571 N N    . LEU A 1 91  ? 15.983  -1.081  -4.446  1.00 0.00 ? 91  LEU A N    6  
ATOM 10572 C CA   . LEU A 1 91  ? 15.822  0.351   -4.222  1.00 0.00 ? 91  LEU A CA   6  
ATOM 10573 C C    . LEU A 1 91  ? 17.163  1.008   -3.909  1.00 0.00 ? 91  LEU A C    6  
ATOM 10574 O O    . LEU A 1 91  ? 17.467  2.090   -4.412  1.00 0.00 ? 91  LEU A O    6  
ATOM 10575 C CB   . LEU A 1 91  ? 14.840  0.600   -3.075  1.00 0.00 ? 91  LEU A CB   6  
ATOM 10576 C CG   . LEU A 1 91  ? 13.476  -0.080  -3.200  1.00 0.00 ? 91  LEU A CG   6  
ATOM 10577 C CD1  . LEU A 1 91  ? 12.796  -0.166  -1.842  1.00 0.00 ? 91  LEU A CD1  6  
ATOM 10578 C CD2  . LEU A 1 91  ? 12.597  0.665   -4.193  1.00 0.00 ? 91  LEU A CD2  6  
ATOM 10579 H H    . LEU A 1 91  ? 15.533  -1.711  -3.847  1.00 0.00 ? 91  LEU A H    6  
ATOM 10580 H HA   . LEU A 1 91  ? 15.424  0.786   -5.126  1.00 0.00 ? 91  LEU A HA   6  
ATOM 10581 H HB2  . LEU A 1 91  ? 15.301  0.252   -2.164  1.00 0.00 ? 91  LEU A HB2  6  
ATOM 10582 H HB3  . LEU A 1 91  ? 14.674  1.666   -3.009  1.00 0.00 ? 91  LEU A HB3  6  
ATOM 10583 H HG   . LEU A 1 91  ? 13.616  -1.088  -3.566  1.00 0.00 ? 91  LEU A HG   6  
ATOM 10584 H HD11 . LEU A 1 91  ? 12.504  0.823   -1.523  1.00 0.00 ? 91  LEU A HD11 6  
ATOM 10585 H HD12 . LEU A 1 91  ? 13.482  -0.588  -1.122  1.00 0.00 ? 91  LEU A HD12 6  
ATOM 10586 H HD13 . LEU A 1 91  ? 11.921  -0.794  -1.917  1.00 0.00 ? 91  LEU A HD13 6  
ATOM 10587 H HD21 . LEU A 1 91  ? 13.220  1.162   -4.922  1.00 0.00 ? 91  LEU A HD21 6  
ATOM 10588 H HD22 . LEU A 1 91  ? 12.003  1.400   -3.667  1.00 0.00 ? 91  LEU A HD22 6  
ATOM 10589 H HD23 . LEU A 1 91  ? 11.945  -0.035  -4.693  1.00 0.00 ? 91  LEU A HD23 6  
ATOM 10590 N N    . ARG A 1 92  ? 17.961  0.346   -3.078  1.00 0.00 ? 92  ARG A N    6  
ATOM 10591 C CA   . ARG A 1 92  ? 19.270  0.864   -2.700  1.00 0.00 ? 92  ARG A CA   6  
ATOM 10592 C C    . ARG A 1 92  ? 20.199  0.930   -3.909  1.00 0.00 ? 92  ARG A C    6  
ATOM 10593 O O    . ARG A 1 92  ? 20.988  1.863   -4.047  1.00 0.00 ? 92  ARG A O    6  
ATOM 10594 C CB   . ARG A 1 92  ? 19.893  -0.010  -1.611  1.00 0.00 ? 92  ARG A CB   6  
ATOM 10595 C CG   . ARG A 1 92  ? 19.097  -0.031  -0.316  1.00 0.00 ? 92  ARG A CG   6  
ATOM 10596 C CD   . ARG A 1 92  ? 19.694  -1.004  0.689   1.00 0.00 ? 92  ARG A CD   6  
ATOM 10597 N NE   . ARG A 1 92  ? 21.103  -0.724  0.952   1.00 0.00 ? 92  ARG A NE   6  
ATOM 10598 C CZ   . ARG A 1 92  ? 21.818  -1.355  1.877   1.00 0.00 ? 92  ARG A CZ   6  
ATOM 10599 N NH1  . ARG A 1 92  ? 21.258  -2.297  2.623   1.00 0.00 ? 92  ARG A NH1  6  
ATOM 10600 N NH2  . ARG A 1 92  ? 23.095  -1.044  2.056   1.00 0.00 ? 92  ARG A NH2  6  
ATOM 10601 H H    . ARG A 1 92  ? 17.662  -0.512  -2.710  1.00 0.00 ? 92  ARG A H    6  
ATOM 10602 H HA   . ARG A 1 92  ? 19.132  1.863   -2.312  1.00 0.00 ? 92  ARG A HA   6  
ATOM 10603 H HB2  . ARG A 1 92  ? 19.968  -1.024  -1.978  1.00 0.00 ? 92  ARG A HB2  6  
ATOM 10604 H HB3  . ARG A 1 92  ? 20.884  0.359   -1.393  1.00 0.00 ? 92  ARG A HB3  6  
ATOM 10605 H HG2  . ARG A 1 92  ? 19.100  0.960   0.113   1.00 0.00 ? 92  ARG A HG2  6  
ATOM 10606 H HG3  . ARG A 1 92  ? 18.082  -0.328  -0.533  1.00 0.00 ? 92  ARG A HG3  6  
ATOM 10607 H HD2  . ARG A 1 92  ? 19.143  -0.927  1.615   1.00 0.00 ? 92  ARG A HD2  6  
ATOM 10608 H HD3  . ARG A 1 92  ? 19.602  -2.006  0.298   1.00 0.00 ? 92  ARG A HD3  6  
ATOM 10609 H HE   . ARG A 1 92  ? 21.536  -0.031  0.412   1.00 0.00 ? 92  ARG A HE   6  
ATOM 10610 H HH11 . ARG A 1 92  ? 20.296  -2.534  2.490   1.00 0.00 ? 92  ARG A HH11 6  
ATOM 10611 H HH12 . ARG A 1 92  ? 21.799  -2.771  3.318   1.00 0.00 ? 92  ARG A HH12 6  
ATOM 10612 H HH21 . ARG A 1 92  ? 23.520  -0.334  1.495   1.00 0.00 ? 92  ARG A HH21 6  
ATOM 10613 H HH22 . ARG A 1 92  ? 23.632  -1.519  2.753   1.00 0.00 ? 92  ARG A HH22 6  
ATOM 10614 N N    . ASN A 1 93  ? 20.098  -0.068  -4.781  1.00 0.00 ? 93  ASN A N    6  
ATOM 10615 C CA   . ASN A 1 93  ? 20.930  -0.125  -5.977  1.00 0.00 ? 93  ASN A CA   6  
ATOM 10616 C C    . ASN A 1 93  ? 20.633  1.052   -6.902  1.00 0.00 ? 93  ASN A C    6  
ATOM 10617 O O    . ASN A 1 93  ? 21.520  1.550   -7.593  1.00 0.00 ? 93  ASN A O    6  
ATOM 10618 C CB   . ASN A 1 93  ? 20.702  -1.442  -6.720  1.00 0.00 ? 93  ASN A CB   6  
ATOM 10619 C CG   . ASN A 1 93  ? 21.557  -2.570  -6.174  1.00 0.00 ? 93  ASN A CG   6  
ATOM 10620 O OD1  . ASN A 1 93  ? 22.784  -2.535  -6.270  1.00 0.00 ? 93  ASN A OD1  6  
ATOM 10621 N ND2  . ASN A 1 93  ? 20.911  -3.576  -5.598  1.00 0.00 ? 93  ASN A ND2  6  
ATOM 10622 H H    . ASN A 1 93  ? 19.449  -0.784  -4.615  1.00 0.00 ? 93  ASN A H    6  
ATOM 10623 H HA   . ASN A 1 93  ? 21.962  -0.071  -5.666  1.00 0.00 ? 93  ASN A HA   6  
ATOM 10624 H HB2  . ASN A 1 93  ? 19.664  -1.726  -6.627  1.00 0.00 ? 93  ASN A HB2  6  
ATOM 10625 H HB3  . ASN A 1 93  ? 20.941  -1.306  -7.764  1.00 0.00 ? 93  ASN A HB3  6  
ATOM 10626 H HD21 . ASN A 1 93  ? 19.932  -3.536  -5.557  1.00 0.00 ? 93  ASN A HD21 6  
ATOM 10627 H HD22 . ASN A 1 93  ? 21.439  -4.318  -5.236  1.00 0.00 ? 93  ASN A HD22 6  
ATOM 10628 N N    . ALA A 1 94  ? 19.378  1.491   -6.908  1.00 0.00 ? 94  ALA A N    6  
ATOM 10629 C CA   . ALA A 1 94  ? 18.965  2.610   -7.745  1.00 0.00 ? 94  ALA A CA   6  
ATOM 10630 C C    . ALA A 1 94  ? 19.738  3.875   -7.392  1.00 0.00 ? 94  ALA A C    6  
ATOM 10631 O O    . ALA A 1 94  ? 20.121  4.079   -6.240  1.00 0.00 ? 94  ALA A O    6  
ATOM 10632 C CB   . ALA A 1 94  ? 17.468  2.847   -7.607  1.00 0.00 ? 94  ALA A CB   6  
ATOM 10633 H H    . ALA A 1 94  ? 18.716  1.052   -6.335  1.00 0.00 ? 94  ALA A H    6  
ATOM 10634 H HA   . ALA A 1 94  ? 19.170  2.350   -8.774  1.00 0.00 ? 94  ALA A HA   6  
ATOM 10635 H HB1  . ALA A 1 94  ? 17.290  3.563   -6.817  1.00 0.00 ? 94  ALA A HB1  6  
ATOM 10636 H HB2  . ALA A 1 94  ? 17.078  3.232   -8.537  1.00 0.00 ? 94  ALA A HB2  6  
ATOM 10637 H HB3  . ALA A 1 94  ? 16.977  1.916   -7.368  1.00 0.00 ? 94  ALA A HB3  6  
ATOM 10638 N N    . GLY A 1 95  ? 19.965  4.724   -8.390  1.00 0.00 ? 95  GLY A N    6  
ATOM 10639 C CA   . GLY A 1 95  ? 20.693  5.959   -8.164  1.00 0.00 ? 95  GLY A CA   6  
ATOM 10640 C C    . GLY A 1 95  ? 19.773  7.155   -8.016  1.00 0.00 ? 95  GLY A C    6  
ATOM 10641 O O    . GLY A 1 95  ? 18.594  7.003   -7.699  1.00 0.00 ? 95  GLY A O    6  
ATOM 10642 H H    . GLY A 1 95  ? 19.635  4.509   -9.288  1.00 0.00 ? 95  GLY A H    6  
ATOM 10643 H HA2  . GLY A 1 95  ? 21.281  5.857   -7.264  1.00 0.00 ? 95  GLY A HA2  6  
ATOM 10644 H HA3  . GLY A 1 95  ? 21.356  6.130   -8.999  1.00 0.00 ? 95  GLY A HA3  6  
ATOM 10645 N N    . GLN A 1 96  ? 20.314  8.347   -8.244  1.00 0.00 ? 96  GLN A N    6  
ATOM 10646 C CA   . GLN A 1 96  ? 19.534  9.574   -8.132  1.00 0.00 ? 96  GLN A CA   6  
ATOM 10647 C C    . GLN A 1 96  ? 18.166  9.411   -8.787  1.00 0.00 ? 96  GLN A C    6  
ATOM 10648 O O    . GLN A 1 96  ? 17.133  9.529   -8.128  1.00 0.00 ? 96  GLN A O    6  
ATOM 10649 C CB   . GLN A 1 96  ? 20.285  10.741  -8.775  1.00 0.00 ? 96  GLN A CB   6  
ATOM 10650 C CG   . GLN A 1 96  ? 19.909  12.097  -8.199  1.00 0.00 ? 96  GLN A CG   6  
ATOM 10651 C CD   . GLN A 1 96  ? 20.997  13.134  -8.391  1.00 0.00 ? 96  GLN A CD   6  
ATOM 10652 O OE1  . GLN A 1 96  ? 21.654  13.178  -9.432  1.00 0.00 ? 96  GLN A OE1  6  
ATOM 10653 N NE2  . GLN A 1 96  ? 21.195  13.977  -7.384  1.00 0.00 ? 96  GLN A NE2  6  
ATOM 10654 H H    . GLN A 1 96  ? 21.260  8.403   -8.493  1.00 0.00 ? 96  GLN A H    6  
ATOM 10655 H HA   . GLN A 1 96  ? 19.394  9.782   -7.082  1.00 0.00 ? 96  GLN A HA   6  
ATOM 10656 H HB2  . GLN A 1 96  ? 21.345  10.594  -8.632  1.00 0.00 ? 96  GLN A HB2  6  
ATOM 10657 H HB3  . GLN A 1 96  ? 20.070  10.752  -9.833  1.00 0.00 ? 96  GLN A HB3  6  
ATOM 10658 H HG2  . GLN A 1 96  ? 19.011  12.445  -8.689  1.00 0.00 ? 96  GLN A HG2  6  
ATOM 10659 H HG3  . GLN A 1 96  ? 19.720  11.985  -7.142  1.00 0.00 ? 96  GLN A HG3  6  
ATOM 10660 H HE21 . GLN A 1 96  ? 20.635  13.883  -6.585  1.00 0.00 ? 96  GLN A HE21 6  
ATOM 10661 H HE22 . GLN A 1 96  ? 21.893  14.658  -7.480  1.00 0.00 ? 96  GLN A HE22 6  
ATOM 10662 N N    . VAL A 1 97  ? 18.167  9.138   -10.088 1.00 0.00 ? 97  VAL A N    6  
ATOM 10663 C CA   . VAL A 1 97  ? 16.926  8.958   -10.832 1.00 0.00 ? 97  VAL A CA   6  
ATOM 10664 C C    . VAL A 1 97  ? 16.278  7.618   -10.503 1.00 0.00 ? 97  VAL A C    6  
ATOM 10665 O O    . VAL A 1 97  ? 16.634  6.587   -11.074 1.00 0.00 ? 97  VAL A O    6  
ATOM 10666 C CB   . VAL A 1 97  ? 17.166  9.041   -12.351 1.00 0.00 ? 97  VAL A CB   6  
ATOM 10667 C CG1  . VAL A 1 97  ? 15.884  8.739   -13.112 1.00 0.00 ? 97  VAL A CG1  6  
ATOM 10668 C CG2  . VAL A 1 97  ? 17.711  10.410  -12.730 1.00 0.00 ? 97  VAL A CG2  6  
ATOM 10669 H H    . VAL A 1 97  ? 19.023  9.056   -10.558 1.00 0.00 ? 97  VAL A H    6  
ATOM 10670 H HA   . VAL A 1 97  ? 16.251  9.753   -10.552 1.00 0.00 ? 97  VAL A HA   6  
ATOM 10671 H HB   . VAL A 1 97  ? 17.902  8.297   -12.620 1.00 0.00 ? 97  VAL A HB   6  
ATOM 10672 H HG11 . VAL A 1 97  ? 15.130  8.391   -12.421 1.00 0.00 ? 97  VAL A HG11 6  
ATOM 10673 H HG12 . VAL A 1 97  ? 15.537  9.636   -13.603 1.00 0.00 ? 97  VAL A HG12 6  
ATOM 10674 H HG13 . VAL A 1 97  ? 16.075  7.974   -13.850 1.00 0.00 ? 97  VAL A HG13 6  
ATOM 10675 H HG21 . VAL A 1 97  ? 18.788  10.363  -12.793 1.00 0.00 ? 97  VAL A HG21 6  
ATOM 10676 H HG22 . VAL A 1 97  ? 17.307  10.706  -13.688 1.00 0.00 ? 97  VAL A HG22 6  
ATOM 10677 H HG23 . VAL A 1 97  ? 17.424  11.132  -11.981 1.00 0.00 ? 97  VAL A HG23 6  
ATOM 10678 N N    . VAL A 1 98  ? 15.323  7.640   -9.578  1.00 0.00 ? 98  VAL A N    6  
ATOM 10679 C CA   . VAL A 1 98  ? 14.623  6.427   -9.174  1.00 0.00 ? 98  VAL A CA   6  
ATOM 10680 C C    . VAL A 1 98  ? 13.237  6.356   -9.806  1.00 0.00 ? 98  VAL A C    6  
ATOM 10681 O O    . VAL A 1 98  ? 12.282  6.949   -9.303  1.00 0.00 ? 98  VAL A O    6  
ATOM 10682 C CB   . VAL A 1 98  ? 14.481  6.345   -7.642  1.00 0.00 ? 98  VAL A CB   6  
ATOM 10683 C CG1  . VAL A 1 98  ? 13.558  5.201   -7.252  1.00 0.00 ? 98  VAL A CG1  6  
ATOM 10684 C CG2  . VAL A 1 98  ? 15.846  6.186   -6.989  1.00 0.00 ? 98  VAL A CG2  6  
ATOM 10685 H H    . VAL A 1 98  ? 15.084  8.493   -9.159  1.00 0.00 ? 98  VAL A H    6  
ATOM 10686 H HA   . VAL A 1 98  ? 15.204  5.579   -9.507  1.00 0.00 ? 98  VAL A HA   6  
ATOM 10687 H HB   . VAL A 1 98  ? 14.043  7.268   -7.292  1.00 0.00 ? 98  VAL A HB   6  
ATOM 10688 H HG11 . VAL A 1 98  ? 13.914  4.748   -6.338  1.00 0.00 ? 98  VAL A HG11 6  
ATOM 10689 H HG12 . VAL A 1 98  ? 12.558  5.580   -7.102  1.00 0.00 ? 98  VAL A HG12 6  
ATOM 10690 H HG13 . VAL A 1 98  ? 13.549  4.461   -8.039  1.00 0.00 ? 98  VAL A HG13 6  
ATOM 10691 H HG21 . VAL A 1 98  ? 16.398  5.408   -7.494  1.00 0.00 ? 98  VAL A HG21 6  
ATOM 10692 H HG22 . VAL A 1 98  ? 16.390  7.117   -7.061  1.00 0.00 ? 98  VAL A HG22 6  
ATOM 10693 H HG23 . VAL A 1 98  ? 15.720  5.923   -5.950  1.00 0.00 ? 98  VAL A HG23 6  
ATOM 10694 N N    . HIS A 1 99  ? 13.134  5.625   -10.912 1.00 0.00 ? 99  HIS A N    6  
ATOM 10695 C CA   . HIS A 1 99  ? 11.864  5.475   -11.613 1.00 0.00 ? 99  HIS A CA   6  
ATOM 10696 C C    . HIS A 1 99  ? 11.007  4.395   -10.959 1.00 0.00 ? 99  HIS A C    6  
ATOM 10697 O O    . HIS A 1 99  ? 11.149  3.209   -11.259 1.00 0.00 ? 99  HIS A O    6  
ATOM 10698 C CB   . HIS A 1 99  ? 12.106  5.130   -13.082 1.00 0.00 ? 99  HIS A CB   6  
ATOM 10699 C CG   . HIS A 1 99  ? 12.246  6.332   -13.965 1.00 0.00 ? 99  HIS A CG   6  
ATOM 10700 N ND1  . HIS A 1 99  ? 13.289  6.498   -14.851 1.00 0.00 ? 99  HIS A ND1  6  
ATOM 10701 C CD2  . HIS A 1 99  ? 11.465  7.430   -14.095 1.00 0.00 ? 99  HIS A CD2  6  
ATOM 10702 C CE1  . HIS A 1 99  ? 13.145  7.647   -15.487 1.00 0.00 ? 99  HIS A CE1  6  
ATOM 10703 N NE2  . HIS A 1 99  ? 12.045  8.232   -15.047 1.00 0.00 ? 99  HIS A NE2  6  
ATOM 10704 H H    . HIS A 1 99  ? 13.930  5.177   -11.264 1.00 0.00 ? 99  HIS A H    6  
ATOM 10705 H HA   . HIS A 1 99  ? 11.340  6.417   -11.555 1.00 0.00 ? 99  HIS A HA   6  
ATOM 10706 H HB2  . HIS A 1 99  ? 13.015  4.552   -13.165 1.00 0.00 ? 99  HIS A HB2  6  
ATOM 10707 H HB3  . HIS A 1 99  ? 11.277  4.543   -13.449 1.00 0.00 ? 99  HIS A HB3  6  
ATOM 10708 H HD1  . HIS A 1 99  ? 14.026  5.869   -14.992 1.00 0.00 ? 99  HIS A HD1  6  
ATOM 10709 H HD2  . HIS A 1 99  ? 10.554  7.638   -13.551 1.00 0.00 ? 99  HIS A HD2  6  
ATOM 10710 H HE1  . HIS A 1 99  ? 13.811  8.042   -16.239 1.00 0.00 ? 99  HIS A HE1  6  
ATOM 10711 H HE2  . HIS A 1 99  ? 11.750  9.134   -15.290 1.00 0.00 ? 99  HIS A HE2  6  
ATOM 10712 N N    . LEU A 1 100 ? 10.118  4.813   -10.065 1.00 0.00 ? 100 LEU A N    6  
ATOM 10713 C CA   . LEU A 1 100 ? 9.238   3.882   -9.368  1.00 0.00 ? 100 LEU A CA   6  
ATOM 10714 C C    . LEU A 1 100 ? 7.986   3.596   -10.190 1.00 0.00 ? 100 LEU A C    6  
ATOM 10715 O O    . LEU A 1 100 ? 7.271   4.515   -10.593 1.00 0.00 ? 100 LEU A O    6  
ATOM 10716 C CB   . LEU A 1 100 ? 8.846   4.445   -8.000  1.00 0.00 ? 100 LEU A CB   6  
ATOM 10717 C CG   . LEU A 1 100 ? 8.586   3.416   -6.900  1.00 0.00 ? 100 LEU A CG   6  
ATOM 10718 C CD1  . LEU A 1 100 ? 7.861   2.204   -7.463  1.00 0.00 ? 100 LEU A CD1  6  
ATOM 10719 C CD2  . LEU A 1 100 ? 9.892   3.000   -6.239  1.00 0.00 ? 100 LEU A CD2  6  
ATOM 10720 H H    . LEU A 1 100 ? 10.051  5.770   -9.868  1.00 0.00 ? 100 LEU A H    6  
ATOM 10721 H HA   . LEU A 1 100 ? 9.779   2.958   -9.225  1.00 0.00 ? 100 LEU A HA   6  
ATOM 10722 H HB2  . LEU A 1 100 ? 9.645   5.090   -7.668  1.00 0.00 ? 100 LEU A HB2  6  
ATOM 10723 H HB3  . LEU A 1 100 ? 7.945   5.028   -8.130  1.00 0.00 ? 100 LEU A HB3  6  
ATOM 10724 H HG   . LEU A 1 100 ? 7.954   3.860   -6.143  1.00 0.00 ? 100 LEU A HG   6  
ATOM 10725 H HD11 . LEU A 1 100 ? 8.582   1.505   -7.858  1.00 0.00 ? 100 LEU A HD11 6  
ATOM 10726 H HD12 . LEU A 1 100 ? 7.194   2.518   -8.253  1.00 0.00 ? 100 LEU A HD12 6  
ATOM 10727 H HD13 . LEU A 1 100 ? 7.290   1.729   -6.679  1.00 0.00 ? 100 LEU A HD13 6  
ATOM 10728 H HD21 . LEU A 1 100 ? 9.704   2.187   -5.553  1.00 0.00 ? 100 LEU A HD21 6  
ATOM 10729 H HD22 . LEU A 1 100 ? 10.305  3.839   -5.698  1.00 0.00 ? 100 LEU A HD22 6  
ATOM 10730 H HD23 . LEU A 1 100 ? 10.592  2.679   -6.996  1.00 0.00 ? 100 LEU A HD23 6  
ATOM 10731 N N    . THR A 1 101 ? 7.724   2.316   -10.435 1.00 0.00 ? 101 THR A N    6  
ATOM 10732 C CA   . THR A 1 101 ? 6.557   1.909   -11.209 1.00 0.00 ? 101 THR A CA   6  
ATOM 10733 C C    . THR A 1 101 ? 5.448   1.391   -10.300 1.00 0.00 ? 101 THR A C    6  
ATOM 10734 O O    . THR A 1 101 ? 5.612   0.378   -9.618  1.00 0.00 ? 101 THR A O    6  
ATOM 10735 C CB   . THR A 1 101 ? 6.917   0.817   -12.234 1.00 0.00 ? 101 THR A CB   6  
ATOM 10736 O OG1  . THR A 1 101 ? 8.137   1.156   -12.903 1.00 0.00 ? 101 THR A OG1  6  
ATOM 10737 C CG2  . THR A 1 101 ? 5.803   0.648   -13.256 1.00 0.00 ? 101 THR A CG2  6  
ATOM 10738 H H    . THR A 1 101 ? 8.331   1.630   -10.087 1.00 0.00 ? 101 THR A H    6  
ATOM 10739 H HA   . THR A 1 101 ? 6.195   2.773   -11.746 1.00 0.00 ? 101 THR A HA   6  
ATOM 10740 H HB   . THR A 1 101 ? 7.050   -0.118  -11.710 1.00 0.00 ? 101 THR A HB   6  
ATOM 10741 H HG1  . THR A 1 101 ? 8.117   2.082   -13.156 1.00 0.00 ? 101 THR A HG1  6  
ATOM 10742 H HG21 . THR A 1 101 ? 5.832   1.466   -13.960 1.00 0.00 ? 101 THR A HG21 6  
ATOM 10743 H HG22 . THR A 1 101 ? 4.849   0.641   -12.751 1.00 0.00 ? 101 THR A HG22 6  
ATOM 10744 H HG23 . THR A 1 101 ? 5.938   -0.285  -13.783 1.00 0.00 ? 101 THR A HG23 6  
ATOM 10745 N N    . LEU A 1 102 ? 4.319   2.091   -10.295 1.00 0.00 ? 102 LEU A N    6  
ATOM 10746 C CA   . LEU A 1 102 ? 3.181   1.701   -9.469  1.00 0.00 ? 102 LEU A CA   6  
ATOM 10747 C C    . LEU A 1 102 ? 1.880   1.788   -10.260 1.00 0.00 ? 102 LEU A C    6  
ATOM 10748 O O    . LEU A 1 102 ? 1.805   2.474   -11.280 1.00 0.00 ? 102 LEU A O    6  
ATOM 10749 C CB   . LEU A 1 102 ? 3.098   2.591   -8.228  1.00 0.00 ? 102 LEU A CB   6  
ATOM 10750 C CG   . LEU A 1 102 ? 4.433   3.040   -7.633  1.00 0.00 ? 102 LEU A CG   6  
ATOM 10751 C CD1  . LEU A 1 102 ? 4.992   4.222   -8.410  1.00 0.00 ? 102 LEU A CD1  6  
ATOM 10752 C CD2  . LEU A 1 102 ? 4.269   3.396   -6.163  1.00 0.00 ? 102 LEU A CD2  6  
ATOM 10753 H H    . LEU A 1 102 ? 4.248   2.889   -10.859 1.00 0.00 ? 102 LEU A H    6  
ATOM 10754 H HA   . LEU A 1 102 ? 3.332   0.678   -9.159  1.00 0.00 ? 102 LEU A HA   6  
ATOM 10755 H HB2  . LEU A 1 102 ? 2.539   3.475   -8.492  1.00 0.00 ? 102 LEU A HB2  6  
ATOM 10756 H HB3  . LEU A 1 102 ? 2.562   2.043   -7.465  1.00 0.00 ? 102 LEU A HB3  6  
ATOM 10757 H HG   . LEU A 1 102 ? 5.144   2.228   -7.705  1.00 0.00 ? 102 LEU A HG   6  
ATOM 10758 H HD11 . LEU A 1 102 ? 5.158   5.049   -7.737  1.00 0.00 ? 102 LEU A HD11 6  
ATOM 10759 H HD12 . LEU A 1 102 ? 4.288   4.516   -9.175  1.00 0.00 ? 102 LEU A HD12 6  
ATOM 10760 H HD13 . LEU A 1 102 ? 5.927   3.940   -8.872  1.00 0.00 ? 102 LEU A HD13 6  
ATOM 10761 H HD21 . LEU A 1 102 ? 5.190   3.186   -5.638  1.00 0.00 ? 102 LEU A HD21 6  
ATOM 10762 H HD22 . LEU A 1 102 ? 3.470   2.807   -5.737  1.00 0.00 ? 102 LEU A HD22 6  
ATOM 10763 H HD23 . LEU A 1 102 ? 4.032   4.445   -6.070  1.00 0.00 ? 102 LEU A HD23 6  
ATOM 10764 N N    . VAL A 1 103 ? 0.855   1.090   -9.781  1.00 0.00 ? 103 VAL A N    6  
ATOM 10765 C CA   . VAL A 1 103 ? -0.445  1.091   -10.441 1.00 0.00 ? 103 VAL A CA   6  
ATOM 10766 C C    . VAL A 1 103 ? -1.571  1.320   -9.438  1.00 0.00 ? 103 VAL A C    6  
ATOM 10767 O O    . VAL A 1 103 ? -1.734  0.555   -8.488  1.00 0.00 ? 103 VAL A O    6  
ATOM 10768 C CB   . VAL A 1 103 ? -0.698  -0.233  -11.186 1.00 0.00 ? 103 VAL A CB   6  
ATOM 10769 C CG1  . VAL A 1 103 ? -0.400  -1.419  -10.282 1.00 0.00 ? 103 VAL A CG1  6  
ATOM 10770 C CG2  . VAL A 1 103 ? -2.128  -0.290  -11.701 1.00 0.00 ? 103 VAL A CG2  6  
ATOM 10771 H H    . VAL A 1 103 ? 0.975   0.563   -8.964  1.00 0.00 ? 103 VAL A H    6  
ATOM 10772 H HA   . VAL A 1 103 ? -0.452  1.894   -11.165 1.00 0.00 ? 103 VAL A HA   6  
ATOM 10773 H HB   . VAL A 1 103 ? -0.031  -0.278  -12.034 1.00 0.00 ? 103 VAL A HB   6  
ATOM 10774 H HG11 . VAL A 1 103 ? 0.232   -2.121  -10.807 1.00 0.00 ? 103 VAL A HG11 6  
ATOM 10775 H HG12 . VAL A 1 103 ? 0.104   -1.076  -9.391  1.00 0.00 ? 103 VAL A HG12 6  
ATOM 10776 H HG13 . VAL A 1 103 ? -1.325  -1.905  -10.009 1.00 0.00 ? 103 VAL A HG13 6  
ATOM 10777 H HG21 . VAL A 1 103 ? -2.554  0.703   -11.690 1.00 0.00 ? 103 VAL A HG21 6  
ATOM 10778 H HG22 . VAL A 1 103 ? -2.133  -0.673  -12.711 1.00 0.00 ? 103 VAL A HG22 6  
ATOM 10779 H HG23 . VAL A 1 103 ? -2.714  -0.940  -11.067 1.00 0.00 ? 103 VAL A HG23 6  
ATOM 10780 N N    . ARG A 1 104 ? -2.344  2.379   -9.657  1.00 0.00 ? 104 ARG A N    6  
ATOM 10781 C CA   . ARG A 1 104 ? -3.454  2.709   -8.771  1.00 0.00 ? 104 ARG A CA   6  
ATOM 10782 C C    . ARG A 1 104 ? -4.792  2.421   -9.446  1.00 0.00 ? 104 ARG A C    6  
ATOM 10783 O O    . ARG A 1 104 ? -4.890  2.408   -10.673 1.00 0.00 ? 104 ARG A O    6  
ATOM 10784 C CB   . ARG A 1 104 ? -3.385  4.181   -8.359  1.00 0.00 ? 104 ARG A CB   6  
ATOM 10785 C CG   . ARG A 1 104 ? -2.135  4.534   -7.570  1.00 0.00 ? 104 ARG A CG   6  
ATOM 10786 C CD   . ARG A 1 104 ? -2.004  6.037   -7.378  1.00 0.00 ? 104 ARG A CD   6  
ATOM 10787 N NE   . ARG A 1 104 ? -1.829  6.738   -8.647  1.00 0.00 ? 104 ARG A NE   6  
ATOM 10788 C CZ   . ARG A 1 104 ? -1.361  7.977   -8.744  1.00 0.00 ? 104 ARG A CZ   6  
ATOM 10789 N NH1  . ARG A 1 104 ? -1.023  8.649   -7.651  1.00 0.00 ? 104 ARG A NH1  6  
ATOM 10790 N NH2  . ARG A 1 104 ? -1.230  8.547   -9.935  1.00 0.00 ? 104 ARG A NH2  6  
ATOM 10791 H H    . ARG A 1 104 ? -2.164  2.952   -10.431 1.00 0.00 ? 104 ARG A H    6  
ATOM 10792 H HA   . ARG A 1 104 ? -3.370  2.093   -7.889  1.00 0.00 ? 104 ARG A HA   6  
ATOM 10793 H HB2  . ARG A 1 104 ? -3.408  4.793   -9.248  1.00 0.00 ? 104 ARG A HB2  6  
ATOM 10794 H HB3  . ARG A 1 104 ? -4.246  4.412   -7.750  1.00 0.00 ? 104 ARG A HB3  6  
ATOM 10795 H HG2  . ARG A 1 104 ? -2.187  4.062   -6.600  1.00 0.00 ? 104 ARG A HG2  6  
ATOM 10796 H HG3  . ARG A 1 104 ? -1.269  4.171   -8.104  1.00 0.00 ? 104 ARG A HG3  6  
ATOM 10797 H HD2  . ARG A 1 104 ? -2.898  6.404   -6.895  1.00 0.00 ? 104 ARG A HD2  6  
ATOM 10798 H HD3  . ARG A 1 104 ? -1.149  6.232   -6.748  1.00 0.00 ? 104 ARG A HD3  6  
ATOM 10799 H HE   . ARG A 1 104 ? -2.073  6.260   -9.467  1.00 0.00 ? 104 ARG A HE   6  
ATOM 10800 H HH11 . ARG A 1 104 ? -1.119  8.221   -6.753  1.00 0.00 ? 104 ARG A HH11 6  
ATOM 10801 H HH12 . ARG A 1 104 ? -0.669  9.581   -7.727  1.00 0.00 ? 104 ARG A HH12 6  
ATOM 10802 H HH21 . ARG A 1 104 ? -1.484  8.044   -10.760 1.00 0.00 ? 104 ARG A HH21 6  
ATOM 10803 H HH22 . ARG A 1 104 ? -0.878  9.480   -10.006 1.00 0.00 ? 104 ARG A HH22 6  
ATOM 10804 N N    . ARG A 1 105 ? -5.820  2.190   -8.636  1.00 0.00 ? 105 ARG A N    6  
ATOM 10805 C CA   . ARG A 1 105 ? -7.152  1.901   -9.155  1.00 0.00 ? 105 ARG A CA   6  
ATOM 10806 C C    . ARG A 1 105 ? -7.850  3.180   -9.606  1.00 0.00 ? 105 ARG A C    6  
ATOM 10807 O O    . ARG A 1 105 ? -8.049  4.103   -8.816  1.00 0.00 ? 105 ARG A O    6  
ATOM 10808 C CB   . ARG A 1 105 ? -7.994  1.195   -8.091  1.00 0.00 ? 105 ARG A CB   6  
ATOM 10809 C CG   . ARG A 1 105 ? -9.362  0.756   -8.589  1.00 0.00 ? 105 ARG A CG   6  
ATOM 10810 C CD   . ARG A 1 105 ? -9.853  -0.479  -7.851  1.00 0.00 ? 105 ARG A CD   6  
ATOM 10811 N NE   . ARG A 1 105 ? -11.275 -0.722  -8.077  1.00 0.00 ? 105 ARG A NE   6  
ATOM 10812 C CZ   . ARG A 1 105 ? -11.927 -1.775  -7.595  1.00 0.00 ? 105 ARG A CZ   6  
ATOM 10813 N NH1  . ARG A 1 105 ? -11.287 -2.677  -6.864  1.00 0.00 ? 105 ARG A NH1  6  
ATOM 10814 N NH2  . ARG A 1 105 ? -13.221 -1.926  -7.843  1.00 0.00 ? 105 ARG A NH2  6  
ATOM 10815 H H    . ARG A 1 105 ? -5.680  2.214   -7.666  1.00 0.00 ? 105 ARG A H    6  
ATOM 10816 H HA   . ARG A 1 105 ? -7.041  1.246   -10.006 1.00 0.00 ? 105 ARG A HA   6  
ATOM 10817 H HB2  . ARG A 1 105 ? -7.462  0.320   -7.749  1.00 0.00 ? 105 ARG A HB2  6  
ATOM 10818 H HB3  . ARG A 1 105 ? -8.138  1.868   -7.258  1.00 0.00 ? 105 ARG A HB3  6  
ATOM 10819 H HG2  . ARG A 1 105 ? -10.066 1.559   -8.433  1.00 0.00 ? 105 ARG A HG2  6  
ATOM 10820 H HG3  . ARG A 1 105 ? -9.295  0.532   -9.643  1.00 0.00 ? 105 ARG A HG3  6  
ATOM 10821 H HD2  . ARG A 1 105 ? -9.293  -1.335  -8.196  1.00 0.00 ? 105 ARG A HD2  6  
ATOM 10822 H HD3  . ARG A 1 105 ? -9.684  -0.341  -6.793  1.00 0.00 ? 105 ARG A HD3  6  
ATOM 10823 H HE   . ARG A 1 105 ? -11.768 -0.068  -8.614  1.00 0.00 ? 105 ARG A HE   6  
ATOM 10824 H HH11 . ARG A 1 105 ? -10.312 -2.565  -6.674  1.00 0.00 ? 105 ARG A HH11 6  
ATOM 10825 H HH12 . ARG A 1 105 ? -11.780 -3.468  -6.501  1.00 0.00 ? 105 ARG A HH12 6  
ATOM 10826 H HH21 . ARG A 1 105 ? -13.707 -1.248  -8.393  1.00 0.00 ? 105 ARG A HH21 6  
ATOM 10827 H HH22 . ARG A 1 105 ? -13.711 -2.718  -7.480  1.00 0.00 ? 105 ARG A HH22 6  
ATOM 10828 N N    . LYS A 1 106 ? -8.219  3.229   -10.881 1.00 0.00 ? 106 LYS A N    6  
ATOM 10829 C CA   . LYS A 1 106 ? -8.895  4.394   -11.439 1.00 0.00 ? 106 LYS A CA   6  
ATOM 10830 C C    . LYS A 1 106 ? -10.143 4.737   -10.631 1.00 0.00 ? 106 LYS A C    6  
ATOM 10831 O O    . LYS A 1 106 ? -10.452 4.079   -9.637  1.00 0.00 ? 106 LYS A O    6  
ATOM 10832 C CB   . LYS A 1 106 ? -9.274  4.139   -12.899 1.00 0.00 ? 106 LYS A CB   6  
ATOM 10833 C CG   . LYS A 1 106 ? -8.092  3.771   -13.779 1.00 0.00 ? 106 LYS A CG   6  
ATOM 10834 C CD   . LYS A 1 106 ? -8.519  2.909   -14.956 1.00 0.00 ? 106 LYS A CD   6  
ATOM 10835 C CE   . LYS A 1 106 ? -7.638  3.150   -16.172 1.00 0.00 ? 106 LYS A CE   6  
ATOM 10836 N NZ   . LYS A 1 106 ? -8.173  4.237   -17.038 1.00 0.00 ? 106 LYS A NZ   6  
ATOM 10837 H H    . LYS A 1 106 ? -8.032  2.461   -11.462 1.00 0.00 ? 106 LYS A H    6  
ATOM 10838 H HA   . LYS A 1 106 ? -8.211  5.228   -11.394 1.00 0.00 ? 106 LYS A HA   6  
ATOM 10839 H HB2  . LYS A 1 106 ? -9.990  3.331   -12.937 1.00 0.00 ? 106 LYS A HB2  6  
ATOM 10840 H HB3  . LYS A 1 106 ? -9.731  5.032   -13.301 1.00 0.00 ? 106 LYS A HB3  6  
ATOM 10841 H HG2  . LYS A 1 106 ? -7.639  4.676   -14.156 1.00 0.00 ? 106 LYS A HG2  6  
ATOM 10842 H HG3  . LYS A 1 106 ? -7.371  3.225   -13.188 1.00 0.00 ? 106 LYS A HG3  6  
ATOM 10843 H HD2  . LYS A 1 106 ? -8.448  1.869   -14.674 1.00 0.00 ? 106 LYS A HD2  6  
ATOM 10844 H HD3  . LYS A 1 106 ? -9.543  3.146   -15.211 1.00 0.00 ? 106 LYS A HD3  6  
ATOM 10845 H HE2  . LYS A 1 106 ? -6.650  3.423   -15.836 1.00 0.00 ? 106 LYS A HE2  6  
ATOM 10846 H HE3  . LYS A 1 106 ? -7.584  2.237   -16.746 1.00 0.00 ? 106 LYS A HE3  6  
ATOM 10847 H HZ1  . LYS A 1 106 ? -8.032  5.160   -16.580 1.00 0.00 ? 106 LYS A HZ1  6  
ATOM 10848 H HZ2  . LYS A 1 106 ? -9.190  4.096   -17.201 1.00 0.00 ? 106 LYS A HZ2  6  
ATOM 10849 H HZ3  . LYS A 1 106 ? -7.682  4.237   -17.955 1.00 0.00 ? 106 LYS A HZ3  6  
ATOM 10850 N N    . THR A 1 107 ? -10.858 5.770   -11.065 1.00 0.00 ? 107 THR A N    6  
ATOM 10851 C CA   . THR A 1 107 ? -12.072 6.200   -10.383 1.00 0.00 ? 107 THR A CA   6  
ATOM 10852 C C    . THR A 1 107 ? -13.219 5.229   -10.637 1.00 0.00 ? 107 THR A C    6  
ATOM 10853 O O    . THR A 1 107 ? -13.063 4.245   -11.361 1.00 0.00 ? 107 THR A O    6  
ATOM 10854 C CB   . THR A 1 107 ? -12.499 7.610   -10.832 1.00 0.00 ? 107 THR A CB   6  
ATOM 10855 O OG1  . THR A 1 107 ? -12.603 7.659   -12.260 1.00 0.00 ? 107 THR A OG1  6  
ATOM 10856 C CG2  . THR A 1 107 ? -11.503 8.656   -10.355 1.00 0.00 ? 107 THR A CG2  6  
ATOM 10857 H H    . THR A 1 107 ? -10.560 6.255   -11.863 1.00 0.00 ? 107 THR A H    6  
ATOM 10858 H HA   . THR A 1 107 ? -11.866 6.230   -9.323  1.00 0.00 ? 107 THR A HA   6  
ATOM 10859 H HB   . THR A 1 107 ? -13.465 7.831   -10.401 1.00 0.00 ? 107 THR A HB   6  
ATOM 10860 H HG1  . THR A 1 107 ? -12.531 8.570   -12.555 1.00 0.00 ? 107 THR A HG1  6  
ATOM 10861 H HG21 . THR A 1 107 ? -10.591 8.572   -10.927 1.00 0.00 ? 107 THR A HG21 6  
ATOM 10862 H HG22 . THR A 1 107 ? -11.289 8.497   -9.308  1.00 0.00 ? 107 THR A HG22 6  
ATOM 10863 H HG23 . THR A 1 107 ? -11.923 9.641   -10.491 1.00 0.00 ? 107 THR A HG23 6  
ATOM 10864 N N    . SER A 1 108 ? -14.371 5.511   -10.037 1.00 0.00 ? 108 SER A N    6  
ATOM 10865 C CA   . SER A 1 108 ? -15.544 4.659   -10.196 1.00 0.00 ? 108 SER A CA   6  
ATOM 10866 C C    . SER A 1 108 ? -15.624 4.104   -11.615 1.00 0.00 ? 108 SER A C    6  
ATOM 10867 O O    . SER A 1 108 ? -15.369 4.816   -12.587 1.00 0.00 ? 108 SER A O    6  
ATOM 10868 C CB   . SER A 1 108 ? -16.817 5.442   -9.870  1.00 0.00 ? 108 SER A CB   6  
ATOM 10869 O OG   . SER A 1 108 ? -16.937 5.663   -8.475  1.00 0.00 ? 108 SER A OG   6  
ATOM 10870 H H    . SER A 1 108 ? -14.432 6.309   -9.472  1.00 0.00 ? 108 SER A H    6  
ATOM 10871 H HA   . SER A 1 108 ? -15.451 3.835   -9.505  1.00 0.00 ? 108 SER A HA   6  
ATOM 10872 H HB2  . SER A 1 108 ? -16.787 6.398   -10.372 1.00 0.00 ? 108 SER A HB2  6  
ATOM 10873 H HB3  . SER A 1 108 ? -17.677 4.884   -10.209 1.00 0.00 ? 108 SER A HB3  6  
ATOM 10874 H HG   . SER A 1 108 ? -17.715 6.197   -8.301  1.00 0.00 ? 108 SER A HG   6  
ATOM 10875 N N    . SER A 1 109 ? -15.980 2.829   -11.726 1.00 0.00 ? 109 SER A N    6  
ATOM 10876 C CA   . SER A 1 109 ? -16.091 2.176   -13.025 1.00 0.00 ? 109 SER A CA   6  
ATOM 10877 C C    . SER A 1 109 ? -17.525 1.728   -13.287 1.00 0.00 ? 109 SER A C    6  
ATOM 10878 O O    . SER A 1 109 ? -18.418 1.955   -12.470 1.00 0.00 ? 109 SER A O    6  
ATOM 10879 C CB   . SER A 1 109 ? -15.148 0.973   -13.097 1.00 0.00 ? 109 SER A CB   6  
ATOM 10880 O OG   . SER A 1 109 ? -15.531 -0.031  -12.174 1.00 0.00 ? 109 SER A OG   6  
ATOM 10881 H H    . SER A 1 109 ? -16.171 2.314   -10.913 1.00 0.00 ? 109 SER A H    6  
ATOM 10882 H HA   . SER A 1 109 ? -15.806 2.892   -13.781 1.00 0.00 ? 109 SER A HA   6  
ATOM 10883 H HB2  . SER A 1 109 ? -15.173 0.558   -14.093 1.00 0.00 ? 109 SER A HB2  6  
ATOM 10884 H HB3  . SER A 1 109 ? -14.142 1.294   -12.865 1.00 0.00 ? 109 SER A HB3  6  
ATOM 10885 H HG   . SER A 1 109 ? -15.114 -0.862  -12.413 1.00 0.00 ? 109 SER A HG   6  
ATOM 10886 N N    . SER A 1 110 ? -17.739 1.090   -14.434 1.00 0.00 ? 110 SER A N    6  
ATOM 10887 C CA   . SER A 1 110 ? -19.066 0.613   -14.808 1.00 0.00 ? 110 SER A CA   6  
ATOM 10888 C C    . SER A 1 110 ? -19.609 -0.355  -13.761 1.00 0.00 ? 110 SER A C    6  
ATOM 10889 O O    . SER A 1 110 ? -18.871 -0.841  -12.904 1.00 0.00 ? 110 SER A O    6  
ATOM 10890 C CB   . SER A 1 110 ? -19.018 -0.070  -16.175 1.00 0.00 ? 110 SER A CB   6  
ATOM 10891 O OG   . SER A 1 110 ? -18.801 0.873   -17.210 1.00 0.00 ? 110 SER A OG   6  
ATOM 10892 H H    . SER A 1 110 ? -16.987 0.940   -15.044 1.00 0.00 ? 110 SER A H    6  
ATOM 10893 H HA   . SER A 1 110 ? -19.722 1.469   -14.865 1.00 0.00 ? 110 SER A HA   6  
ATOM 10894 H HB2  . SER A 1 110 ? -18.215 -0.791  -16.187 1.00 0.00 ? 110 SER A HB2  6  
ATOM 10895 H HB3  . SER A 1 110 ? -19.957 -0.575  -16.355 1.00 0.00 ? 110 SER A HB3  6  
ATOM 10896 H HG   . SER A 1 110 ? -19.232 1.701   -16.984 1.00 0.00 ? 110 SER A HG   6  
ATOM 10897 N N    . THR A 1 111 ? -20.908 -0.631  -13.838 1.00 0.00 ? 111 THR A N    6  
ATOM 10898 C CA   . THR A 1 111 ? -21.552 -1.539  -12.898 1.00 0.00 ? 111 THR A CA   6  
ATOM 10899 C C    . THR A 1 111 ? -21.110 -1.255  -11.467 1.00 0.00 ? 111 THR A C    6  
ATOM 10900 O O    . THR A 1 111 ? -20.792 -2.173  -10.711 1.00 0.00 ? 111 THR A O    6  
ATOM 10901 C CB   . THR A 1 111 ? -21.243 -3.010  -13.236 1.00 0.00 ? 111 THR A CB   6  
ATOM 10902 O OG1  . THR A 1 111 ? -19.827 -3.218  -13.265 1.00 0.00 ? 111 THR A OG1  6  
ATOM 10903 C CG2  . THR A 1 111 ? -21.846 -3.395  -14.579 1.00 0.00 ? 111 THR A CG2  6  
ATOM 10904 H H    . THR A 1 111 ? -21.443 -0.212  -14.543 1.00 0.00 ? 111 THR A H    6  
ATOM 10905 H HA   . THR A 1 111 ? -22.620 -1.392  -12.971 1.00 0.00 ? 111 THR A HA   6  
ATOM 10906 H HB   . THR A 1 111 ? -21.676 -3.638  -12.470 1.00 0.00 ? 111 THR A HB   6  
ATOM 10907 H HG1  . THR A 1 111 ? -19.487 -2.985  -14.133 1.00 0.00 ? 111 THR A HG1  6  
ATOM 10908 H HG21 . THR A 1 111 ? -21.774 -2.559  -15.258 1.00 0.00 ? 111 THR A HG21 6  
ATOM 10909 H HG22 . THR A 1 111 ? -22.883 -3.663  -14.444 1.00 0.00 ? 111 THR A HG22 6  
ATOM 10910 H HG23 . THR A 1 111 ? -21.306 -4.237  -14.986 1.00 0.00 ? 111 THR A HG23 6  
ATOM 10911 N N    . SER A 1 112 ? -21.094 0.023   -11.101 1.00 0.00 ? 112 SER A N    6  
ATOM 10912 C CA   . SER A 1 112 ? -20.688 0.428   -9.760  1.00 0.00 ? 112 SER A CA   6  
ATOM 10913 C C    . SER A 1 112 ? -21.725 0.003   -8.726  1.00 0.00 ? 112 SER A C    6  
ATOM 10914 O O    . SER A 1 112 ? -22.930 0.003   -8.981  1.00 0.00 ? 112 SER A O    6  
ATOM 10915 C CB   . SER A 1 112 ? -20.485 1.944   -9.702  1.00 0.00 ? 112 SER A CB   6  
ATOM 10916 O OG   . SER A 1 112 ? -21.692 2.631   -9.983  1.00 0.00 ? 112 SER A OG   6  
ATOM 10917 H H    . SER A 1 112 ? -21.359 0.709   -11.748 1.00 0.00 ? 112 SER A H    6  
ATOM 10918 H HA   . SER A 1 112 ? -19.751 -0.060  -9.535  1.00 0.00 ? 112 SER A HA   6  
ATOM 10919 H HB2  . SER A 1 112 ? -20.148 2.222   -8.715  1.00 0.00 ? 112 SER A HB2  6  
ATOM 10920 H HB3  . SER A 1 112 ? -19.742 2.233   -10.431 1.00 0.00 ? 112 SER A HB3  6  
ATOM 10921 H HG   . SER A 1 112 ? -22.241 2.093   -10.559 1.00 0.00 ? 112 SER A HG   6  
ATOM 10922 N N    . PRO A 1 113 ? -21.248 -0.370  -7.529  1.00 0.00 ? 113 PRO A N    6  
ATOM 10923 C CA   . PRO A 1 113 ? -22.117 -0.805  -6.431  1.00 0.00 ? 113 PRO A CA   6  
ATOM 10924 C C    . PRO A 1 113 ? -22.941 0.342   -5.855  1.00 0.00 ? 113 PRO A C    6  
ATOM 10925 O O    . PRO A 1 113 ? -23.027 1.418   -6.448  1.00 0.00 ? 113 PRO A O    6  
ATOM 10926 C CB   . PRO A 1 113 ? -21.130 -1.332  -5.386  1.00 0.00 ? 113 PRO A CB   6  
ATOM 10927 C CG   . PRO A 1 113 ? -19.858 -0.609  -5.667  1.00 0.00 ? 113 PRO A CG   6  
ATOM 10928 C CD   . PRO A 1 113 ? -19.824 -0.395  -7.155  1.00 0.00 ? 113 PRO A CD   6  
ATOM 10929 H HA   . PRO A 1 113 ? -22.777 -1.602  -6.739  1.00 0.00 ? 113 PRO A HA   6  
ATOM 10930 H HB2  . PRO A 1 113 ? -21.500 -1.111  -4.394  1.00 0.00 ? 113 PRO A HB2  6  
ATOM 10931 H HB3  . PRO A 1 113 ? -21.012 -2.398  -5.503  1.00 0.00 ? 113 PRO A HB3  6  
ATOM 10932 H HG2  . PRO A 1 113 ? -19.853 0.339   -5.151  1.00 0.00 ? 113 PRO A HG2  6  
ATOM 10933 H HG3  . PRO A 1 113 ? -19.018 -1.212  -5.356  1.00 0.00 ? 113 PRO A HG3  6  
ATOM 10934 H HD2  . PRO A 1 113 ? -19.347 0.545   -7.390  1.00 0.00 ? 113 PRO A HD2  6  
ATOM 10935 H HD3  . PRO A 1 113 ? -19.313 -1.212  -7.642  1.00 0.00 ? 113 PRO A HD3  6  
ATOM 10936 N N    . LEU A 1 114 ? -23.546 0.106   -4.696  1.00 0.00 ? 114 LEU A N    6  
ATOM 10937 C CA   . LEU A 1 114 ? -24.364 1.119   -4.039  1.00 0.00 ? 114 LEU A CA   6  
ATOM 10938 C C    . LEU A 1 114 ? -23.621 1.736   -2.858  1.00 0.00 ? 114 LEU A C    6  
ATOM 10939 O O    . LEU A 1 114 ? -23.435 2.951   -2.796  1.00 0.00 ? 114 LEU A O    6  
ATOM 10940 C CB   . LEU A 1 114 ? -25.683 0.509   -3.564  1.00 0.00 ? 114 LEU A CB   6  
ATOM 10941 C CG   . LEU A 1 114 ? -26.765 0.337   -4.631  1.00 0.00 ? 114 LEU A CG   6  
ATOM 10942 C CD1  . LEU A 1 114 ? -27.977 -0.376  -4.052  1.00 0.00 ? 114 LEU A CD1  6  
ATOM 10943 C CD2  . LEU A 1 114 ? -27.165 1.687   -5.208  1.00 0.00 ? 114 LEU A CD2  6  
ATOM 10944 H H    . LEU A 1 114 ? -23.441 -0.771  -4.271  1.00 0.00 ? 114 LEU A H    6  
ATOM 10945 H HA   . LEU A 1 114 ? -24.574 1.894   -4.761  1.00 0.00 ? 114 LEU A HA   6  
ATOM 10946 H HB2  . LEU A 1 114 ? -25.468 -0.465  -3.152  1.00 0.00 ? 114 LEU A HB2  6  
ATOM 10947 H HB3  . LEU A 1 114 ? -26.081 1.147   -2.788  1.00 0.00 ? 114 LEU A HB3  6  
ATOM 10948 H HG   . LEU A 1 114 ? -26.375 -0.270  -5.436  1.00 0.00 ? 114 LEU A HG   6  
ATOM 10949 H HD11 . LEU A 1 114 ? -27.685 -1.354  -3.700  1.00 0.00 ? 114 LEU A HD11 6  
ATOM 10950 H HD12 . LEU A 1 114 ? -28.733 -0.480  -4.816  1.00 0.00 ? 114 LEU A HD12 6  
ATOM 10951 H HD13 . LEU A 1 114 ? -28.375 0.200   -3.229  1.00 0.00 ? 114 LEU A HD13 6  
ATOM 10952 H HD21 . LEU A 1 114 ? -26.730 1.801   -6.190  1.00 0.00 ? 114 LEU A HD21 6  
ATOM 10953 H HD22 . LEU A 1 114 ? -26.806 2.475   -4.562  1.00 0.00 ? 114 LEU A HD22 6  
ATOM 10954 H HD23 . LEU A 1 114 ? -28.241 1.743   -5.282  1.00 0.00 ? 114 LEU A HD23 6  
ATOM 10955 N N    . GLU A 1 115 ? -23.199 0.890   -1.924  1.00 0.00 ? 115 GLU A N    6  
ATOM 10956 C CA   . GLU A 1 115 ? -22.475 1.353   -0.745  1.00 0.00 ? 115 GLU A CA   6  
ATOM 10957 C C    . GLU A 1 115 ? -21.146 0.618   -0.600  1.00 0.00 ? 115 GLU A C    6  
ATOM 10958 O O    . GLU A 1 115 ? -20.947 -0.182  0.314   1.00 0.00 ? 115 GLU A O    6  
ATOM 10959 C CB   . GLU A 1 115 ? -23.323 1.151   0.513   1.00 0.00 ? 115 GLU A CB   6  
ATOM 10960 C CG   . GLU A 1 115 ? -23.839 -0.269  0.677   1.00 0.00 ? 115 GLU A CG   6  
ATOM 10961 C CD   . GLU A 1 115 ? -25.099 -0.338  1.518   1.00 0.00 ? 115 GLU A CD   6  
ATOM 10962 O OE1  . GLU A 1 115 ? -26.180 0.006   0.997   1.00 0.00 ? 115 GLU A OE1  6  
ATOM 10963 O OE2  . GLU A 1 115 ? -25.003 -0.737  2.698   1.00 0.00 ? 115 GLU A OE2  6  
ATOM 10964 H H    . GLU A 1 115 ? -23.378 -0.068  -2.029  1.00 0.00 ? 115 GLU A H    6  
ATOM 10965 H HA   . GLU A 1 115 ? -22.279 2.407   -0.870  1.00 0.00 ? 115 GLU A HA   6  
ATOM 10966 H HB2  . GLU A 1 115 ? -22.726 1.398   1.378   1.00 0.00 ? 115 GLU A HB2  6  
ATOM 10967 H HB3  . GLU A 1 115 ? -24.172 1.817   0.471   1.00 0.00 ? 115 GLU A HB3  6  
ATOM 10968 H HG2  . GLU A 1 115 ? -24.053 -0.676  -0.299  1.00 0.00 ? 115 GLU A HG2  6  
ATOM 10969 H HG3  . GLU A 1 115 ? -23.073 -0.864  1.153   1.00 0.00 ? 115 GLU A HG3  6  
ATOM 10970 N N    . PRO A 1 116 ? -20.213 0.896   -1.523  1.00 0.00 ? 116 PRO A N    6  
ATOM 10971 C CA   . PRO A 1 116 ? -18.886 0.273   -1.519  1.00 0.00 ? 116 PRO A CA   6  
ATOM 10972 C C    . PRO A 1 116 ? -18.022 0.755   -0.359  1.00 0.00 ? 116 PRO A C    6  
ATOM 10973 O O    . PRO A 1 116 ? -18.331 1.742   0.308   1.00 0.00 ? 116 PRO A O    6  
ATOM 10974 C CB   . PRO A 1 116 ? -18.283 0.715   -2.855  1.00 0.00 ? 116 PRO A CB   6  
ATOM 10975 C CG   . PRO A 1 116 ? -18.988 1.985   -3.187  1.00 0.00 ? 116 PRO A CG   6  
ATOM 10976 C CD   . PRO A 1 116 ? -20.381 1.840   -2.640  1.00 0.00 ? 116 PRO A CD   6  
ATOM 10977 H HA   . PRO A 1 116 ? -18.954 -0.805  -1.493  1.00 0.00 ? 116 PRO A HA   6  
ATOM 10978 H HB2  . PRO A 1 116 ? -17.220 0.871   -2.739  1.00 0.00 ? 116 PRO A HB2  6  
ATOM 10979 H HB3  . PRO A 1 116 ? -18.462 -0.043  -3.603  1.00 0.00 ? 116 PRO A HB3  6  
ATOM 10980 H HG2  . PRO A 1 116 ? -18.486 2.817   -2.718  1.00 0.00 ? 116 PRO A HG2  6  
ATOM 10981 H HG3  . PRO A 1 116 ? -19.018 2.118   -4.258  1.00 0.00 ? 116 PRO A HG3  6  
ATOM 10982 H HD2  . PRO A 1 116 ? -20.750 2.792   -2.288  1.00 0.00 ? 116 PRO A HD2  6  
ATOM 10983 H HD3  . PRO A 1 116 ? -21.041 1.432   -3.392  1.00 0.00 ? 116 PRO A HD3  6  
ATOM 10984 N N    . PRO A 1 117 ? -16.912 0.044   -0.111  1.00 0.00 ? 117 PRO A N    6  
ATOM 10985 C CA   . PRO A 1 117 ? -15.980 0.381   0.968   1.00 0.00 ? 117 PRO A CA   6  
ATOM 10986 C C    . PRO A 1 117 ? -15.211 1.668   0.689   1.00 0.00 ? 117 PRO A C    6  
ATOM 10987 O O    . PRO A 1 117 ? -14.809 1.928   -0.445  1.00 0.00 ? 117 PRO A O    6  
ATOM 10988 C CB   . PRO A 1 117 ? -15.026 -0.815  1.001   1.00 0.00 ? 117 PRO A CB   6  
ATOM 10989 C CG   . PRO A 1 117 ? -15.079 -1.380  -0.377  1.00 0.00 ? 117 PRO A CG   6  
ATOM 10990 C CD   . PRO A 1 117 ? -16.482 -1.145  -0.867  1.00 0.00 ? 117 PRO A CD   6  
ATOM 10991 H HA   . PRO A 1 117 ? -16.487 0.466   1.918   1.00 0.00 ? 117 PRO A HA   6  
ATOM 10992 H HB2  . PRO A 1 117 ? -14.030 -0.478  1.253   1.00 0.00 ? 117 PRO A HB2  6  
ATOM 10993 H HB3  . PRO A 1 117 ? -15.366 -1.531  1.734   1.00 0.00 ? 117 PRO A HB3  6  
ATOM 10994 H HG2  . PRO A 1 117 ? -14.370 -0.869  -1.010  1.00 0.00 ? 117 PRO A HG2  6  
ATOM 10995 H HG3  . PRO A 1 117 ? -14.865 -2.438  -0.348  1.00 0.00 ? 117 PRO A HG3  6  
ATOM 10996 H HD2  . PRO A 1 117 ? -16.482 -0.949  -1.928  1.00 0.00 ? 117 PRO A HD2  6  
ATOM 10997 H HD3  . PRO A 1 117 ? -17.108 -1.994  -0.638  1.00 0.00 ? 117 PRO A HD3  6  
ATOM 10998 N N    . SER A 1 118 ? -15.010 2.470   1.730   1.00 0.00 ? 118 SER A N    6  
ATOM 10999 C CA   . SER A 1 118 ? -14.291 3.732   1.595   1.00 0.00 ? 118 SER A CA   6  
ATOM 11000 C C    . SER A 1 118 ? -13.529 4.062   2.875   1.00 0.00 ? 118 SER A C    6  
ATOM 11001 O O    . SER A 1 118 ? -13.952 3.700   3.973   1.00 0.00 ? 118 SER A O    6  
ATOM 11002 C CB   . SER A 1 118 ? -15.265 4.864   1.260   1.00 0.00 ? 118 SER A CB   6  
ATOM 11003 O OG   . SER A 1 118 ? -15.993 4.578   0.079   1.00 0.00 ? 118 SER A OG   6  
ATOM 11004 H H    . SER A 1 118 ? -15.355 2.207   2.609   1.00 0.00 ? 118 SER A H    6  
ATOM 11005 H HA   . SER A 1 118 ? -13.584 3.626   0.786   1.00 0.00 ? 118 SER A HA   6  
ATOM 11006 H HB2  . SER A 1 118 ? -15.960 4.990   2.076   1.00 0.00 ? 118 SER A HB2  6  
ATOM 11007 H HB3  . SER A 1 118 ? -14.710 5.780   1.114   1.00 0.00 ? 118 SER A HB3  6  
ATOM 11008 H HG   . SER A 1 118 ? -16.451 3.740   0.180   1.00 0.00 ? 118 SER A HG   6  
ATOM 11009 N N    . ASP A 1 119 ? -12.404 4.752   2.724   1.00 0.00 ? 119 ASP A N    6  
ATOM 11010 C CA   . ASP A 1 119 ? -11.582 5.134   3.867   1.00 0.00 ? 119 ASP A CA   6  
ATOM 11011 C C    . ASP A 1 119 ? -12.151 6.370   4.556   1.00 0.00 ? 119 ASP A C    6  
ATOM 11012 O O    . ASP A 1 119 ? -12.710 7.254   3.907   1.00 0.00 ? 119 ASP A O    6  
ATOM 11013 C CB   . ASP A 1 119 ? -10.144 5.399   3.421   1.00 0.00 ? 119 ASP A CB   6  
ATOM 11014 C CG   . ASP A 1 119 ? -10.007 6.695   2.646   1.00 0.00 ? 119 ASP A CG   6  
ATOM 11015 O OD1  . ASP A 1 119 ? -10.578 6.788   1.539   1.00 0.00 ? 119 ASP A OD1  6  
ATOM 11016 O OD2  . ASP A 1 119 ? -9.331  7.617   3.147   1.00 0.00 ? 119 ASP A OD2  6  
ATOM 11017 H H    . ASP A 1 119 ? -12.120 5.012   1.822   1.00 0.00 ? 119 ASP A H    6  
ATOM 11018 H HA   . ASP A 1 119 ? -11.587 4.312   4.567   1.00 0.00 ? 119 ASP A HA   6  
ATOM 11019 H HB2  . ASP A 1 119 ? -9.508  5.455   4.293   1.00 0.00 ? 119 ASP A HB2  6  
ATOM 11020 H HB3  . ASP A 1 119 ? -9.813  4.587   2.791   1.00 0.00 ? 119 ASP A HB3  6  
ATOM 11021 N N    . ARG A 1 120 ? -12.005 6.424   5.876   1.00 0.00 ? 120 ARG A N    6  
ATOM 11022 C CA   . ARG A 1 120 ? -12.506 7.551   6.655   1.00 0.00 ? 120 ARG A CA   6  
ATOM 11023 C C    . ARG A 1 120 ? -11.396 8.160   7.506   1.00 0.00 ? 120 ARG A C    6  
ATOM 11024 O O    . ARG A 1 120 ? -10.548 7.447   8.041   1.00 0.00 ? 120 ARG A O    6  
ATOM 11025 C CB   . ARG A 1 120 ? -13.664 7.105   7.550   1.00 0.00 ? 120 ARG A CB   6  
ATOM 11026 C CG   . ARG A 1 120 ? -14.374 8.255   8.245   1.00 0.00 ? 120 ARG A CG   6  
ATOM 11027 C CD   . ARG A 1 120 ? -15.518 8.795   7.400   1.00 0.00 ? 120 ARG A CD   6  
ATOM 11028 N NE   . ARG A 1 120 ? -15.044 9.680   6.339   1.00 0.00 ? 120 ARG A NE   6  
ATOM 11029 C CZ   . ARG A 1 120 ? -15.836 10.204  5.411   1.00 0.00 ? 120 ARG A CZ   6  
ATOM 11030 N NH1  . ARG A 1 120 ? -17.134 9.936   5.414   1.00 0.00 ? 120 ARG A NH1  6  
ATOM 11031 N NH2  . ARG A 1 120 ? -15.330 11.000  4.478   1.00 0.00 ? 120 ARG A NH2  6  
ATOM 11032 H H    . ARG A 1 120 ? -11.551 5.689   6.338   1.00 0.00 ? 120 ARG A H    6  
ATOM 11033 H HA   . ARG A 1 120 ? -12.865 8.298   5.963   1.00 0.00 ? 120 ARG A HA   6  
ATOM 11034 H HB2  . ARG A 1 120 ? -14.388 6.576   6.946   1.00 0.00 ? 120 ARG A HB2  6  
ATOM 11035 H HB3  . ARG A 1 120 ? -13.281 6.437   8.306   1.00 0.00 ? 120 ARG A HB3  6  
ATOM 11036 H HG2  . ARG A 1 120 ? -14.772 7.904   9.186   1.00 0.00 ? 120 ARG A HG2  6  
ATOM 11037 H HG3  . ARG A 1 120 ? -13.664 9.048   8.424   1.00 0.00 ? 120 ARG A HG3  6  
ATOM 11038 H HD2  . ARG A 1 120 ? -16.043 7.964   6.955   1.00 0.00 ? 120 ARG A HD2  6  
ATOM 11039 H HD3  . ARG A 1 120 ? -16.191 9.345   8.040   1.00 0.00 ? 120 ARG A HD3  6  
ATOM 11040 H HE   . ARG A 1 120 ? -14.087 9.891   6.318   1.00 0.00 ? 120 ARG A HE   6  
ATOM 11041 H HH11 . ARG A 1 120 ? -17.519 9.337   6.117   1.00 0.00 ? 120 ARG A HH11 6  
ATOM 11042 H HH12 . ARG A 1 120 ? -17.729 10.333  4.715   1.00 0.00 ? 120 ARG A HH12 6  
ATOM 11043 H HH21 . ARG A 1 120 ? -14.352 11.205  4.472   1.00 0.00 ? 120 ARG A HH21 6  
ATOM 11044 H HH22 . ARG A 1 120 ? -15.927 11.395  3.780   1.00 0.00 ? 120 ARG A HH22 6  
ATOM 11045 N N    . GLY A 1 121 ? -11.409 9.484   7.627   1.00 0.00 ? 121 GLY A N    6  
ATOM 11046 C CA   . GLY A 1 121 ? -10.398 10.166  8.414   1.00 0.00 ? 121 GLY A CA   6  
ATOM 11047 C C    . GLY A 1 121 ? -10.683 10.105  9.901   1.00 0.00 ? 121 GLY A C    6  
ATOM 11048 O O    . GLY A 1 121 ? -11.699 9.553   10.326  1.00 0.00 ? 121 GLY A O    6  
ATOM 11049 H H    . GLY A 1 121 ? -12.110 10.001  7.178   1.00 0.00 ? 121 GLY A H    6  
ATOM 11050 H HA2  . GLY A 1 121 ? -9.439  9.710   8.222   1.00 0.00 ? 121 GLY A HA2  6  
ATOM 11051 H HA3  . GLY A 1 121 ? -10.360 11.202  8.109   1.00 0.00 ? 121 GLY A HA3  6  
ATOM 11052 N N    . THR A 1 122 ? -9.782  10.672  10.698  1.00 0.00 ? 122 THR A N    6  
ATOM 11053 C CA   . THR A 1 122 ? -9.940  10.677  12.147  1.00 0.00 ? 122 THR A CA   6  
ATOM 11054 C C    . THR A 1 122 ? -10.262 12.076  12.660  1.00 0.00 ? 122 THR A C    6  
ATOM 11055 O O    . THR A 1 122 ? -9.798  13.073  12.107  1.00 0.00 ? 122 THR A O    6  
ATOM 11056 C CB   . THR A 1 122 ? -8.670  10.164  12.852  1.00 0.00 ? 122 THR A CB   6  
ATOM 11057 O OG1  . THR A 1 122 ? -8.891  10.086  14.265  1.00 0.00 ? 122 THR A OG1  6  
ATOM 11058 C CG2  . THR A 1 122 ? -7.487  11.077  12.569  1.00 0.00 ? 122 THR A CG2  6  
ATOM 11059 H H    . THR A 1 122 ? -8.993  11.096  10.301  1.00 0.00 ? 122 THR A H    6  
ATOM 11060 H HA   . THR A 1 122 ? -10.757 10.016  12.396  1.00 0.00 ? 122 THR A HA   6  
ATOM 11061 H HB   . THR A 1 122 ? -8.442  9.177   12.476  1.00 0.00 ? 122 THR A HB   6  
ATOM 11062 H HG1  . THR A 1 122 ? -8.047  10.099  14.722  1.00 0.00 ? 122 THR A HG1  6  
ATOM 11063 H HG21 . THR A 1 122 ? -7.639  11.582  11.626  1.00 0.00 ? 122 THR A HG21 6  
ATOM 11064 H HG22 . THR A 1 122 ? -6.582  10.490  12.521  1.00 0.00 ? 122 THR A HG22 6  
ATOM 11065 H HG23 . THR A 1 122 ? -7.400  11.809  13.358  1.00 0.00 ? 122 THR A HG23 6  
ATOM 11066 N N    . VAL A 1 123 ? -11.059 12.143  13.722  1.00 0.00 ? 123 VAL A N    6  
ATOM 11067 C CA   . VAL A 1 123 ? -11.441 13.421  14.311  1.00 0.00 ? 123 VAL A CA   6  
ATOM 11068 C C    . VAL A 1 123 ? -11.561 13.313  15.827  1.00 0.00 ? 123 VAL A C    6  
ATOM 11069 O O    . VAL A 1 123 ? -12.435 12.617  16.344  1.00 0.00 ? 123 VAL A O    6  
ATOM 11070 C CB   . VAL A 1 123 ? -12.778 13.926  13.737  1.00 0.00 ? 123 VAL A CB   6  
ATOM 11071 C CG1  . VAL A 1 123 ? -13.186 15.232  14.402  1.00 0.00 ? 123 VAL A CG1  6  
ATOM 11072 C CG2  . VAL A 1 123 ? -12.679 14.095  12.228  1.00 0.00 ? 123 VAL A CG2  6  
ATOM 11073 H H    . VAL A 1 123 ? -11.397 11.314  14.119  1.00 0.00 ? 123 VAL A H    6  
ATOM 11074 H HA   . VAL A 1 123 ? -10.674 14.143  14.071  1.00 0.00 ? 123 VAL A HA   6  
ATOM 11075 H HB   . VAL A 1 123 ? -13.539 13.188  13.946  1.00 0.00 ? 123 VAL A HB   6  
ATOM 11076 H HG11 . VAL A 1 123 ? -13.986 15.044  15.103  1.00 0.00 ? 123 VAL A HG11 6  
ATOM 11077 H HG12 . VAL A 1 123 ? -12.338 15.650  14.925  1.00 0.00 ? 123 VAL A HG12 6  
ATOM 11078 H HG13 . VAL A 1 123 ? -13.524 15.929  13.649  1.00 0.00 ? 123 VAL A HG13 6  
ATOM 11079 H HG21 . VAL A 1 123 ? -13.664 14.272  11.821  1.00 0.00 ? 123 VAL A HG21 6  
ATOM 11080 H HG22 . VAL A 1 123 ? -12.040 14.935  12.000  1.00 0.00 ? 123 VAL A HG22 6  
ATOM 11081 H HG23 . VAL A 1 123 ? -12.265 13.199  11.792  1.00 0.00 ? 123 VAL A HG23 6  
ATOM 11082 N N    . SER A 1 124 ? -10.675 14.007  16.536  1.00 0.00 ? 124 SER A N    6  
ATOM 11083 C CA   . SER A 1 124 ? -10.679 13.987  17.994  1.00 0.00 ? 124 SER A CA   6  
ATOM 11084 C C    . SER A 1 124 ? -11.719 14.956  18.548  1.00 0.00 ? 124 SER A C    6  
ATOM 11085 O O    . SER A 1 124 ? -12.153 15.878  17.859  1.00 0.00 ? 124 SER A O    6  
ATOM 11086 C CB   . SER A 1 124 ? -9.293  14.345  18.533  1.00 0.00 ? 124 SER A CB   6  
ATOM 11087 O OG   . SER A 1 124 ? -9.225  14.148  19.935  1.00 0.00 ? 124 SER A OG   6  
ATOM 11088 H H    . SER A 1 124 ? -10.002 14.543  16.066  1.00 0.00 ? 124 SER A H    6  
ATOM 11089 H HA   . SER A 1 124 ? -10.932 12.986  18.311  1.00 0.00 ? 124 SER A HA   6  
ATOM 11090 H HB2  . SER A 1 124 ? -8.552  13.721  18.058  1.00 0.00 ? 124 SER A HB2  6  
ATOM 11091 H HB3  . SER A 1 124 ? -9.083  15.382  18.317  1.00 0.00 ? 124 SER A HB3  6  
ATOM 11092 H HG   . SER A 1 124 ? -9.930  14.639  20.362  1.00 0.00 ? 124 SER A HG   6  
ATOM 11093 N N    . GLY A 1 125 ? -12.114 14.739  19.799  1.00 0.00 ? 125 GLY A N    6  
ATOM 11094 C CA   . GLY A 1 125 ? -13.100 15.601  20.426  1.00 0.00 ? 125 GLY A CA   6  
ATOM 11095 C C    . GLY A 1 125 ? -12.486 16.536  21.448  1.00 0.00 ? 125 GLY A C    6  
ATOM 11096 O O    . GLY A 1 125 ? -11.315 16.414  21.808  1.00 0.00 ? 125 GLY A O    6  
ATOM 11097 H H    . GLY A 1 125 ? -11.733 13.988  20.300  1.00 0.00 ? 125 GLY A H    6  
ATOM 11098 H HA2  . GLY A 1 125 ? -13.586 16.188  19.661  1.00 0.00 ? 125 GLY A HA2  6  
ATOM 11099 H HA3  . GLY A 1 125 ? -13.839 14.985  20.917  1.00 0.00 ? 125 GLY A HA3  6  
ATOM 11100 N N    . PRO A 1 126 ? -13.286 17.498  21.931  1.00 0.00 ? 126 PRO A N    6  
ATOM 11101 C CA   . PRO A 1 126 ? -12.835 18.478  22.924  1.00 0.00 ? 126 PRO A CA   6  
ATOM 11102 C C    . PRO A 1 126 ? -12.599 17.849  24.293  1.00 0.00 ? 126 PRO A C    6  
ATOM 11103 O O    . PRO A 1 126 ? -12.792 16.648  24.477  1.00 0.00 ? 126 PRO A O    6  
ATOM 11104 C CB   . PRO A 1 126 ? -13.993 19.477  22.987  1.00 0.00 ? 126 PRO A CB   6  
ATOM 11105 C CG   . PRO A 1 126 ? -15.188 18.700  22.557  1.00 0.00 ? 126 PRO A CG   6  
ATOM 11106 C CD   . PRO A 1 126 ? -14.692 17.703  21.547  1.00 0.00 ? 126 PRO A CD   6  
ATOM 11107 H HA   . PRO A 1 126 ? -11.937 18.984  22.602  1.00 0.00 ? 126 PRO A HA   6  
ATOM 11108 H HB2  . PRO A 1 126 ? -14.101 19.844  23.998  1.00 0.00 ? 126 PRO A HB2  6  
ATOM 11109 H HB3  . PRO A 1 126 ? -13.797 20.302  22.318  1.00 0.00 ? 126 PRO A HB3  6  
ATOM 11110 H HG2  . PRO A 1 126 ? -15.620 18.191  23.405  1.00 0.00 ? 126 PRO A HG2  6  
ATOM 11111 H HG3  . PRO A 1 126 ? -15.913 19.361  22.105  1.00 0.00 ? 126 PRO A HG3  6  
ATOM 11112 H HD2  . PRO A 1 126 ? -15.250 16.781  21.621  1.00 0.00 ? 126 PRO A HD2  6  
ATOM 11113 H HD3  . PRO A 1 126 ? -14.763 18.109  20.548  1.00 0.00 ? 126 PRO A HD3  6  
ATOM 11114 N N    . SER A 1 127 ? -12.182 18.670  25.252  1.00 0.00 ? 127 SER A N    6  
ATOM 11115 C CA   . SER A 1 127 ? -11.917 18.193  26.604  1.00 0.00 ? 127 SER A CA   6  
ATOM 11116 C C    . SER A 1 127 ? -12.434 19.185  27.642  1.00 0.00 ? 127 SER A C    6  
ATOM 11117 O O    . SER A 1 127 ? -12.902 20.271  27.299  1.00 0.00 ? 127 SER A O    6  
ATOM 11118 C CB   . SER A 1 127 ? -10.417 17.966  26.803  1.00 0.00 ? 127 SER A CB   6  
ATOM 11119 O OG   . SER A 1 127 ? -9.889  17.129  25.788  1.00 0.00 ? 127 SER A OG   6  
ATOM 11120 H H    . SER A 1 127 ? -12.046 19.618  25.044  1.00 0.00 ? 127 SER A H    6  
ATOM 11121 H HA   . SER A 1 127 ? -12.434 17.254  26.732  1.00 0.00 ? 127 SER A HA   6  
ATOM 11122 H HB2  . SER A 1 127 ? -9.904  18.915  26.772  1.00 0.00 ? 127 SER A HB2  6  
ATOM 11123 H HB3  . SER A 1 127 ? -10.250 17.498  27.762  1.00 0.00 ? 127 SER A HB3  6  
ATOM 11124 H HG   . SER A 1 127 ? -10.508 16.419  25.605  1.00 0.00 ? 127 SER A HG   6  
ATOM 11125 N N    . SER A 1 128 ? -12.345 18.804  28.912  1.00 0.00 ? 128 SER A N    6  
ATOM 11126 C CA   . SER A 1 128 ? -12.807 19.658  30.000  1.00 0.00 ? 128 SER A CA   6  
ATOM 11127 C C    . SER A 1 128 ? -14.273 20.037  29.808  1.00 0.00 ? 128 SER A C    6  
ATOM 11128 O O    . SER A 1 128 ? -14.659 21.188  30.005  1.00 0.00 ? 128 SER A O    6  
ATOM 11129 C CB   . SER A 1 128 ? -11.949 20.922  30.085  1.00 0.00 ? 128 SER A CB   6  
ATOM 11130 O OG   . SER A 1 128 ? -10.570 20.599  30.136  1.00 0.00 ? 128 SER A OG   6  
ATOM 11131 H H    . SER A 1 128 ? -11.962 17.927  29.122  1.00 0.00 ? 128 SER A H    6  
ATOM 11132 H HA   . SER A 1 128 ? -12.709 19.103  30.921  1.00 0.00 ? 128 SER A HA   6  
ATOM 11133 H HB2  . SER A 1 128 ? -12.130 21.536  29.216  1.00 0.00 ? 128 SER A HB2  6  
ATOM 11134 H HB3  . SER A 1 128 ? -12.212 21.472  30.977  1.00 0.00 ? 128 SER A HB3  6  
ATOM 11135 H HG   . SER A 1 128 ? -10.466 19.674  30.372  1.00 0.00 ? 128 SER A HG   6  
ATOM 11136 N N    . GLY A 1 129 ? -15.085 19.057  29.423  1.00 0.00 ? 129 GLY A N    6  
ATOM 11137 C CA   . GLY A 1 129 ? -16.499 19.307  29.211  1.00 0.00 ? 129 GLY A CA   6  
ATOM 11138 C C    . GLY A 1 129 ? -17.379 18.283  29.902  1.00 0.00 ? 129 GLY A C    6  
ATOM 11139 O O    . GLY A 1 129 ? -18.497 18.593  30.313  1.00 0.00 ? 129 GLY A O    6  
ATOM 11140 H H    . GLY A 1 129 ? -14.722 18.158  29.282  1.00 0.00 ? 129 GLY A H    6  
ATOM 11141 H HA2  . GLY A 1 129 ? -16.741 20.289  29.590  1.00 0.00 ? 129 GLY A HA2  6  
ATOM 11142 H HA3  . GLY A 1 129 ? -16.702 19.281  28.150  1.00 0.00 ? 129 GLY A HA3  6  
ATOM 11143 N N    . GLY A 1 1   ? -9.841  6.291   -38.376 1.00 0.00 ? 1   GLY A N    7  
ATOM 11144 C CA   . GLY A 1 1   ? -10.405 4.954   -38.356 1.00 0.00 ? 1   GLY A CA   7  
ATOM 11145 C C    . GLY A 1 1   ? -10.434 4.358   -36.963 1.00 0.00 ? 1   GLY A C    7  
ATOM 11146 O O    . GLY A 1 1   ? -10.215 5.059   -35.975 1.00 0.00 ? 1   GLY A O    7  
ATOM 11147 H H1   . GLY A 1 1   ? -9.430  6.659   -37.566 1.00 0.00 ? 1   GLY A H1   7  
ATOM 11148 H HA2  . GLY A 1 1   ? -11.413 4.994   -38.741 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 11149 H HA3  . GLY A 1 1   ? -9.812  4.316   -38.995 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 11150 N N    . SER A 1 2   ? -10.707 3.059   -36.882 1.00 0.00 ? 2   SER A N    7  
ATOM 11151 C CA   . SER A 1 2   ? -10.770 2.370   -35.598 1.00 0.00 ? 2   SER A CA   7  
ATOM 11152 C C    . SER A 1 2   ? -11.931 2.893   -34.757 1.00 0.00 ? 2   SER A C    7  
ATOM 11153 O O    . SER A 1 2   ? -11.799 3.087   -33.549 1.00 0.00 ? 2   SER A O    7  
ATOM 11154 C CB   . SER A 1 2   ? -9.455  2.544   -34.837 1.00 0.00 ? 2   SER A CB   7  
ATOM 11155 O OG   . SER A 1 2   ? -8.347  2.188   -35.645 1.00 0.00 ? 2   SER A OG   7  
ATOM 11156 H H    . SER A 1 2   ? -10.873 2.554   -37.705 1.00 0.00 ? 2   SER A H    7  
ATOM 11157 H HA   . SER A 1 2   ? -10.927 1.320   -35.793 1.00 0.00 ? 2   SER A HA   7  
ATOM 11158 H HB2  . SER A 1 2   ? -9.350  3.576   -34.537 1.00 0.00 ? 2   SER A HB2  7  
ATOM 11159 H HB3  . SER A 1 2   ? -9.464  1.914   -33.959 1.00 0.00 ? 2   SER A HB3  7  
ATOM 11160 H HG   . SER A 1 2   ? -8.571  2.313   -36.570 1.00 0.00 ? 2   SER A HG   7  
ATOM 11161 N N    . SER A 1 3   ? -13.069 3.118   -35.406 1.00 0.00 ? 3   SER A N    7  
ATOM 11162 C CA   . SER A 1 3   ? -14.253 3.621   -34.720 1.00 0.00 ? 3   SER A CA   7  
ATOM 11163 C C    . SER A 1 3   ? -14.798 2.584   -33.743 1.00 0.00 ? 3   SER A C    7  
ATOM 11164 O O    . SER A 1 3   ? -15.076 2.891   -32.585 1.00 0.00 ? 3   SER A O    7  
ATOM 11165 C CB   . SER A 1 3   ? -15.334 3.999   -35.735 1.00 0.00 ? 3   SER A CB   7  
ATOM 11166 O OG   . SER A 1 3   ? -16.578 4.226   -35.094 1.00 0.00 ? 3   SER A OG   7  
ATOM 11167 H H    . SER A 1 3   ? -13.112 2.943   -36.370 1.00 0.00 ? 3   SER A H    7  
ATOM 11168 H HA   . SER A 1 3   ? -13.966 4.503   -34.168 1.00 0.00 ? 3   SER A HA   7  
ATOM 11169 H HB2  . SER A 1 3   ? -15.040 4.900   -36.252 1.00 0.00 ? 3   SER A HB2  7  
ATOM 11170 H HB3  . SER A 1 3   ? -15.451 3.196   -36.448 1.00 0.00 ? 3   SER A HB3  7  
ATOM 11171 H HG   . SER A 1 3   ? -17.266 4.326   -35.756 1.00 0.00 ? 3   SER A HG   7  
ATOM 11172 N N    . GLY A 1 4   ? -14.947 1.352   -34.220 1.00 0.00 ? 4   GLY A N    7  
ATOM 11173 C CA   . GLY A 1 4   ? -15.457 0.287   -33.377 1.00 0.00 ? 4   GLY A CA   7  
ATOM 11174 C C    . GLY A 1 4   ? -16.631 0.732   -32.527 1.00 0.00 ? 4   GLY A C    7  
ATOM 11175 O O    . GLY A 1 4   ? -17.759 0.819   -33.011 1.00 0.00 ? 4   GLY A O    7  
ATOM 11176 H H    . GLY A 1 4   ? -14.709 1.164   -35.152 1.00 0.00 ? 4   GLY A H    7  
ATOM 11177 H HA2  . GLY A 1 4   ? -15.771 -0.535  -34.003 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 11178 H HA3  . GLY A 1 4   ? -14.665 -0.053  -32.725 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 11179 N N    . SER A 1 5   ? -16.366 1.013   -31.255 1.00 0.00 ? 5   SER A N    7  
ATOM 11180 C CA   . SER A 1 5   ? -17.410 1.446   -30.334 1.00 0.00 ? 5   SER A CA   7  
ATOM 11181 C C    . SER A 1 5   ? -18.384 0.309   -30.042 1.00 0.00 ? 5   SER A C    7  
ATOM 11182 O O    . SER A 1 5   ? -19.594 0.517   -29.965 1.00 0.00 ? 5   SER A O    7  
ATOM 11183 C CB   . SER A 1 5   ? -18.166 2.644   -30.914 1.00 0.00 ? 5   SER A CB   7  
ATOM 11184 O OG   . SER A 1 5   ? -18.922 3.303   -29.913 1.00 0.00 ? 5   SER A OG   7  
ATOM 11185 H H    . SER A 1 5   ? -15.446 0.925   -30.928 1.00 0.00 ? 5   SER A H    7  
ATOM 11186 H HA   . SER A 1 5   ? -16.936 1.744   -29.411 1.00 0.00 ? 5   SER A HA   7  
ATOM 11187 H HB2  . SER A 1 5   ? -17.460 3.343   -31.333 1.00 0.00 ? 5   SER A HB2  7  
ATOM 11188 H HB3  . SER A 1 5   ? -18.837 2.301   -31.688 1.00 0.00 ? 5   SER A HB3  7  
ATOM 11189 H HG   . SER A 1 5   ? -18.898 4.250   -30.065 1.00 0.00 ? 5   SER A HG   7  
ATOM 11190 N N    . SER A 1 6   ? -17.845 -0.896  -29.881 1.00 0.00 ? 6   SER A N    7  
ATOM 11191 C CA   . SER A 1 6   ? -18.665 -2.069  -29.602 1.00 0.00 ? 6   SER A CA   7  
ATOM 11192 C C    . SER A 1 6   ? -17.981 -2.981  -28.588 1.00 0.00 ? 6   SER A C    7  
ATOM 11193 O O    . SER A 1 6   ? -16.755 -3.013  -28.493 1.00 0.00 ? 6   SER A O    7  
ATOM 11194 C CB   . SER A 1 6   ? -18.944 -2.842  -30.893 1.00 0.00 ? 6   SER A CB   7  
ATOM 11195 O OG   . SER A 1 6   ? -20.097 -3.655  -30.761 1.00 0.00 ? 6   SER A OG   7  
ATOM 11196 H H    . SER A 1 6   ? -16.873 -0.998  -29.955 1.00 0.00 ? 6   SER A H    7  
ATOM 11197 H HA   . SER A 1 6   ? -19.602 -1.727  -29.188 1.00 0.00 ? 6   SER A HA   7  
ATOM 11198 H HB2  . SER A 1 6   ? -19.101 -2.143  -31.701 1.00 0.00 ? 6   SER A HB2  7  
ATOM 11199 H HB3  . SER A 1 6   ? -18.097 -3.472  -31.122 1.00 0.00 ? 6   SER A HB3  7  
ATOM 11200 H HG   . SER A 1 6   ? -20.582 -3.659  -31.589 1.00 0.00 ? 6   SER A HG   7  
ATOM 11201 N N    . GLY A 1 7   ? -18.785 -3.720  -27.830 1.00 0.00 ? 7   GLY A N    7  
ATOM 11202 C CA   . GLY A 1 7   ? -18.241 -4.623  -26.832 1.00 0.00 ? 7   GLY A CA   7  
ATOM 11203 C C    . GLY A 1 7   ? -18.320 -4.052  -25.430 1.00 0.00 ? 7   GLY A C    7  
ATOM 11204 O O    . GLY A 1 7   ? -19.298 -3.396  -25.073 1.00 0.00 ? 7   GLY A O    7  
ATOM 11205 H H    . GLY A 1 7   ? -19.756 -3.653  -27.949 1.00 0.00 ? 7   GLY A H    7  
ATOM 11206 H HA2  . GLY A 1 7   ? -18.792 -5.551  -26.863 1.00 0.00 ? 7   GLY A HA2  7  
ATOM 11207 H HA3  . GLY A 1 7   ? -17.207 -4.822  -27.069 1.00 0.00 ? 7   GLY A HA3  7  
ATOM 11208 N N    . GLY A 1 8   ? -17.287 -4.304  -24.631 1.00 0.00 ? 8   GLY A N    7  
ATOM 11209 C CA   . GLY A 1 8   ? -17.264 -3.805  -23.269 1.00 0.00 ? 8   GLY A CA   7  
ATOM 11210 C C    . GLY A 1 8   ? -16.870 -4.872  -22.267 1.00 0.00 ? 8   GLY A C    7  
ATOM 11211 O O    . GLY A 1 8   ? -17.494 -5.930  -22.199 1.00 0.00 ? 8   GLY A O    7  
ATOM 11212 H H    . GLY A 1 8   ? -16.535 -4.833  -24.970 1.00 0.00 ? 8   GLY A H    7  
ATOM 11213 H HA2  . GLY A 1 8   ? -16.559 -2.989  -23.207 1.00 0.00 ? 8   GLY A HA2  7  
ATOM 11214 H HA3  . GLY A 1 8   ? -18.248 -3.437  -23.016 1.00 0.00 ? 8   GLY A HA3  7  
ATOM 11215 N N    . SER A 1 9   ? -15.829 -4.594  -21.488 1.00 0.00 ? 9   SER A N    7  
ATOM 11216 C CA   . SER A 1 9   ? -15.348 -5.541  -20.489 1.00 0.00 ? 9   SER A CA   7  
ATOM 11217 C C    . SER A 1 9   ? -14.367 -4.870  -19.533 1.00 0.00 ? 9   SER A C    7  
ATOM 11218 O O    . SER A 1 9   ? -13.717 -3.885  -19.883 1.00 0.00 ? 9   SER A O    7  
ATOM 11219 C CB   . SER A 1 9   ? -14.678 -6.737  -21.169 1.00 0.00 ? 9   SER A CB   7  
ATOM 11220 O OG   . SER A 1 9   ? -14.692 -7.876  -20.327 1.00 0.00 ? 9   SER A OG   7  
ATOM 11221 H H    . SER A 1 9   ? -15.372 -3.733  -21.590 1.00 0.00 ? 9   SER A H    7  
ATOM 11222 H HA   . SER A 1 9   ? -16.200 -5.889  -19.925 1.00 0.00 ? 9   SER A HA   7  
ATOM 11223 H HB2  . SER A 1 9   ? -15.206 -6.971  -22.081 1.00 0.00 ? 9   SER A HB2  7  
ATOM 11224 H HB3  . SER A 1 9   ? -13.652 -6.487  -21.400 1.00 0.00 ? 9   SER A HB3  7  
ATOM 11225 H HG   . SER A 1 9   ? -14.563 -7.603  -19.416 1.00 0.00 ? 9   SER A HG   7  
ATOM 11226 N N    . ASP A 1 10  ? -14.265 -5.411  -18.324 1.00 0.00 ? 10  ASP A N    7  
ATOM 11227 C CA   . ASP A 1 10  ? -13.363 -4.866  -17.316 1.00 0.00 ? 10  ASP A CA   7  
ATOM 11228 C C    . ASP A 1 10  ? -11.956 -5.434  -17.481 1.00 0.00 ? 10  ASP A C    7  
ATOM 11229 O O    . ASP A 1 10  ? -11.586 -6.404  -16.821 1.00 0.00 ? 10  ASP A O    7  
ATOM 11230 C CB   . ASP A 1 10  ? -13.887 -5.172  -15.912 1.00 0.00 ? 10  ASP A CB   7  
ATOM 11231 C CG   . ASP A 1 10  ? -15.401 -5.233  -15.860 1.00 0.00 ? 10  ASP A CG   7  
ATOM 11232 O OD1  . ASP A 1 10  ? -15.983 -6.106  -16.537 1.00 0.00 ? 10  ASP A OD1  7  
ATOM 11233 O OD2  . ASP A 1 10  ? -16.005 -4.407  -15.144 1.00 0.00 ? 10  ASP A OD2  7  
ATOM 11234 H H    . ASP A 1 10  ? -14.810 -6.195  -18.104 1.00 0.00 ? 10  ASP A H    7  
ATOM 11235 H HA   . ASP A 1 10  ? -13.323 -3.795  -17.450 1.00 0.00 ? 10  ASP A HA   7  
ATOM 11236 H HB2  . ASP A 1 10  ? -13.496 -6.125  -15.588 1.00 0.00 ? 10  ASP A HB2  7  
ATOM 11237 H HB3  . ASP A 1 10  ? -13.553 -4.401  -15.234 1.00 0.00 ? 10  ASP A HB3  7  
ATOM 11238 N N    . SER A 1 11  ? -11.178 -4.823  -18.369 1.00 0.00 ? 11  SER A N    7  
ATOM 11239 C CA   . SER A 1 11  ? -9.814  -5.270  -18.625 1.00 0.00 ? 11  SER A CA   7  
ATOM 11240 C C    . SER A 1 11  ? -8.815  -4.472  -17.793 1.00 0.00 ? 11  SER A C    7  
ATOM 11241 O O    . SER A 1 11  ? -8.272  -4.971  -16.808 1.00 0.00 ? 11  SER A O    7  
ATOM 11242 C CB   . SER A 1 11  ? -9.481  -5.134  -20.112 1.00 0.00 ? 11  SER A CB   7  
ATOM 11243 O OG   . SER A 1 11  ? -9.994  -6.228  -20.852 1.00 0.00 ? 11  SER A OG   7  
ATOM 11244 H H    . SER A 1 11  ? -11.530 -4.054  -18.864 1.00 0.00 ? 11  SER A H    7  
ATOM 11245 H HA   . SER A 1 11  ? -9.748  -6.311  -18.344 1.00 0.00 ? 11  SER A HA   7  
ATOM 11246 H HB2  . SER A 1 11  ? -9.915  -4.222  -20.493 1.00 0.00 ? 11  SER A HB2  7  
ATOM 11247 H HB3  . SER A 1 11  ? -8.408  -5.101  -20.236 1.00 0.00 ? 11  SER A HB3  7  
ATOM 11248 H HG   . SER A 1 11  ? -9.584  -7.041  -20.547 1.00 0.00 ? 11  SER A HG   7  
ATOM 11249 N N    . SER A 1 12  ? -8.577  -3.228  -18.198 1.00 0.00 ? 12  SER A N    7  
ATOM 11250 C CA   . SER A 1 12  ? -7.641  -2.361  -17.493 1.00 0.00 ? 12  SER A CA   7  
ATOM 11251 C C    . SER A 1 12  ? -8.347  -1.586  -16.385 1.00 0.00 ? 12  SER A C    7  
ATOM 11252 O O    . SER A 1 12  ? -8.745  -0.435  -16.572 1.00 0.00 ? 12  SER A O    7  
ATOM 11253 C CB   . SER A 1 12  ? -6.980  -1.387  -18.471 1.00 0.00 ? 12  SER A CB   7  
ATOM 11254 O OG   . SER A 1 12  ? -6.448  -2.072  -19.592 1.00 0.00 ? 12  SER A OG   7  
ATOM 11255 H H    . SER A 1 12  ? -9.041  -2.887  -18.991 1.00 0.00 ? 12  SER A H    7  
ATOM 11256 H HA   . SER A 1 12  ? -6.879  -2.986  -17.050 1.00 0.00 ? 12  SER A HA   7  
ATOM 11257 H HB2  . SER A 1 12  ? -7.713  -0.673  -18.815 1.00 0.00 ? 12  SER A HB2  7  
ATOM 11258 H HB3  . SER A 1 12  ? -6.178  -0.866  -17.968 1.00 0.00 ? 12  SER A HB3  7  
ATOM 11259 H HG   . SER A 1 12  ? -7.018  -2.812  -19.815 1.00 0.00 ? 12  SER A HG   7  
ATOM 11260 N N    . LEU A 1 13  ? -8.499  -2.224  -15.230 1.00 0.00 ? 13  LEU A N    7  
ATOM 11261 C CA   . LEU A 1 13  ? -9.157  -1.596  -14.090 1.00 0.00 ? 13  LEU A CA   7  
ATOM 11262 C C    . LEU A 1 13  ? -8.205  -0.650  -13.364 1.00 0.00 ? 13  LEU A C    7  
ATOM 11263 O O    . LEU A 1 13  ? -8.634  0.319   -12.737 1.00 0.00 ? 13  LEU A O    7  
ATOM 11264 C CB   . LEU A 1 13  ? -9.671  -2.662  -13.121 1.00 0.00 ? 13  LEU A CB   7  
ATOM 11265 C CG   . LEU A 1 13  ? -10.902 -3.447  -13.578 1.00 0.00 ? 13  LEU A CG   7  
ATOM 11266 C CD1  . LEU A 1 13  ? -12.063 -2.504  -13.853 1.00 0.00 ? 13  LEU A CD1  7  
ATOM 11267 C CD2  . LEU A 1 13  ? -10.579 -4.273  -14.814 1.00 0.00 ? 13  LEU A CD2  7  
ATOM 11268 H H    . LEU A 1 13  ? -8.161  -3.139  -15.141 1.00 0.00 ? 13  LEU A H    7  
ATOM 11269 H HA   . LEU A 1 13  ? -9.995  -1.026  -14.463 1.00 0.00 ? 13  LEU A HA   7  
ATOM 11270 H HB2  . LEU A 1 13  ? -8.873  -3.369  -12.953 1.00 0.00 ? 13  LEU A HB2  7  
ATOM 11271 H HB3  . LEU A 1 13  ? -9.917  -2.172  -12.190 1.00 0.00 ? 13  LEU A HB3  7  
ATOM 11272 H HG   . LEU A 1 13  ? -11.202 -4.124  -12.790 1.00 0.00 ? 13  LEU A HG   7  
ATOM 11273 H HD11 . LEU A 1 13  ? -11.950 -2.070  -14.835 1.00 0.00 ? 13  LEU A HD11 7  
ATOM 11274 H HD12 . LEU A 1 13  ? -12.074 -1.719  -13.111 1.00 0.00 ? 13  LEU A HD12 7  
ATOM 11275 H HD13 . LEU A 1 13  ? -12.992 -3.054  -13.807 1.00 0.00 ? 13  LEU A HD13 7  
ATOM 11276 H HD21 . LEU A 1 13  ? -11.107 -5.214  -14.765 1.00 0.00 ? 13  LEU A HD21 7  
ATOM 11277 H HD22 . LEU A 1 13  ? -9.516  -4.459  -14.855 1.00 0.00 ? 13  LEU A HD22 7  
ATOM 11278 H HD23 . LEU A 1 13  ? -10.886 -3.734  -15.698 1.00 0.00 ? 13  LEU A HD23 7  
ATOM 11279 N N    . PHE A 1 14  ? -6.911  -0.938  -13.456 1.00 0.00 ? 14  PHE A N    7  
ATOM 11280 C CA   . PHE A 1 14  ? -5.897  -0.112  -12.809 1.00 0.00 ? 14  PHE A CA   7  
ATOM 11281 C C    . PHE A 1 14  ? -5.052  0.623   -13.845 1.00 0.00 ? 14  PHE A C    7  
ATOM 11282 O O    . PHE A 1 14  ? -5.112  0.320   -15.037 1.00 0.00 ? 14  PHE A O    7  
ATOM 11283 C CB   . PHE A 1 14  ? -4.998  -0.974  -11.920 1.00 0.00 ? 14  PHE A CB   7  
ATOM 11284 C CG   . PHE A 1 14  ? -5.759  -1.919  -11.034 1.00 0.00 ? 14  PHE A CG   7  
ATOM 11285 C CD1  . PHE A 1 14  ? -6.309  -3.082  -11.549 1.00 0.00 ? 14  PHE A CD1  7  
ATOM 11286 C CD2  . PHE A 1 14  ? -5.926  -1.643  -9.687  1.00 0.00 ? 14  PHE A CD2  7  
ATOM 11287 C CE1  . PHE A 1 14  ? -7.010  -3.952  -10.737 1.00 0.00 ? 14  PHE A CE1  7  
ATOM 11288 C CE2  . PHE A 1 14  ? -6.626  -2.510  -8.869  1.00 0.00 ? 14  PHE A CE2  7  
ATOM 11289 C CZ   . PHE A 1 14  ? -7.168  -3.667  -9.394  1.00 0.00 ? 14  PHE A CZ   7  
ATOM 11290 H H    . PHE A 1 14  ? -6.631  -1.724  -13.970 1.00 0.00 ? 14  PHE A H    7  
ATOM 11291 H HA   . PHE A 1 14  ? -6.405  0.615   -12.195 1.00 0.00 ? 14  PHE A HA   7  
ATOM 11292 H HB2  . PHE A 1 14  ? -4.343  -1.562  -12.545 1.00 0.00 ? 14  PHE A HB2  7  
ATOM 11293 H HB3  . PHE A 1 14  ? -4.405  -0.330  -11.289 1.00 0.00 ? 14  PHE A HB3  7  
ATOM 11294 H HD1  . PHE A 1 14  ? -6.185  -3.307  -12.599 1.00 0.00 ? 14  PHE A HD1  7  
ATOM 11295 H HD2  . PHE A 1 14  ? -5.501  -0.739  -9.274  1.00 0.00 ? 14  PHE A HD2  7  
ATOM 11296 H HE1  . PHE A 1 14  ? -7.433  -4.856  -11.150 1.00 0.00 ? 14  PHE A HE1  7  
ATOM 11297 H HE2  . PHE A 1 14  ? -6.747  -2.284  -7.820  1.00 0.00 ? 14  PHE A HE2  7  
ATOM 11298 H HZ   . PHE A 1 14  ? -7.716  -4.345  -8.758  1.00 0.00 ? 14  PHE A HZ   7  
ATOM 11299 N N    . GLU A 1 15  ? -4.267  1.590   -13.382 1.00 0.00 ? 15  GLU A N    7  
ATOM 11300 C CA   . GLU A 1 15  ? -3.411  2.369   -14.269 1.00 0.00 ? 15  GLU A CA   7  
ATOM 11301 C C    . GLU A 1 15  ? -1.990  2.454   -13.718 1.00 0.00 ? 15  GLU A C    7  
ATOM 11302 O O    . GLU A 1 15  ? -1.769  2.941   -12.609 1.00 0.00 ? 15  GLU A O    7  
ATOM 11303 C CB   . GLU A 1 15  ? -3.981  3.776   -14.457 1.00 0.00 ? 15  GLU A CB   7  
ATOM 11304 C CG   . GLU A 1 15  ? -4.508  4.397   -13.174 1.00 0.00 ? 15  GLU A CG   7  
ATOM 11305 C CD   . GLU A 1 15  ? -4.664  5.902   -13.275 1.00 0.00 ? 15  GLU A CD   7  
ATOM 11306 O OE1  . GLU A 1 15  ? -3.645  6.591   -13.489 1.00 0.00 ? 15  GLU A OE1  7  
ATOM 11307 O OE2  . GLU A 1 15  ? -5.805  6.390   -13.140 1.00 0.00 ? 15  GLU A OE2  7  
ATOM 11308 H H    . GLU A 1 15  ? -4.263  1.784   -12.421 1.00 0.00 ? 15  GLU A H    7  
ATOM 11309 H HA   . GLU A 1 15  ? -3.384  1.871   -15.226 1.00 0.00 ? 15  GLU A HA   7  
ATOM 11310 H HB2  . GLU A 1 15  ? -3.205  4.417   -14.850 1.00 0.00 ? 15  GLU A HB2  7  
ATOM 11311 H HB3  . GLU A 1 15  ? -4.791  3.730   -15.170 1.00 0.00 ? 15  GLU A HB3  7  
ATOM 11312 H HG2  . GLU A 1 15  ? -5.472  3.965   -12.951 1.00 0.00 ? 15  GLU A HG2  7  
ATOM 11313 H HG3  . GLU A 1 15  ? -3.820  4.173   -12.372 1.00 0.00 ? 15  GLU A HG3  7  
ATOM 11314 N N    . THR A 1 16  ? -1.028  1.975   -14.501 1.00 0.00 ? 16  THR A N    7  
ATOM 11315 C CA   . THR A 1 16  ? 0.370   1.994   -14.093 1.00 0.00 ? 16  THR A CA   7  
ATOM 11316 C C    . THR A 1 16  ? 1.014   3.342   -14.396 1.00 0.00 ? 16  THR A C    7  
ATOM 11317 O O    . THR A 1 16  ? 0.941   3.836   -15.522 1.00 0.00 ? 16  THR A O    7  
ATOM 11318 C CB   . THR A 1 16  ? 1.176   0.884   -14.794 1.00 0.00 ? 16  THR A CB   7  
ATOM 11319 O OG1  . THR A 1 16  ? 0.612   -0.397  -14.491 1.00 0.00 ? 16  THR A OG1  7  
ATOM 11320 C CG2  . THR A 1 16  ? 2.634   0.918   -14.362 1.00 0.00 ? 16  THR A CG2  7  
ATOM 11321 H H    . THR A 1 16  ? -1.267  1.599   -15.374 1.00 0.00 ? 16  THR A H    7  
ATOM 11322 H HA   . THR A 1 16  ? 0.409   1.819   -13.027 1.00 0.00 ? 16  THR A HA   7  
ATOM 11323 H HB   . THR A 1 16  ? 1.128   1.046   -15.862 1.00 0.00 ? 16  THR A HB   7  
ATOM 11324 H HG1  . THR A 1 16  ? 0.988   -0.726  -13.671 1.00 0.00 ? 16  THR A HG1  7  
ATOM 11325 H HG21 . THR A 1 16  ? 2.984   1.939   -14.356 1.00 0.00 ? 16  THR A HG21 7  
ATOM 11326 H HG22 . THR A 1 16  ? 3.228   0.338   -15.053 1.00 0.00 ? 16  THR A HG22 7  
ATOM 11327 H HG23 . THR A 1 16  ? 2.725   0.501   -13.370 1.00 0.00 ? 16  THR A HG23 7  
ATOM 11328 N N    . TYR A 1 17  ? 1.643   3.933   -13.386 1.00 0.00 ? 17  TYR A N    7  
ATOM 11329 C CA   . TYR A 1 17  ? 2.298   5.226   -13.545 1.00 0.00 ? 17  TYR A CA   7  
ATOM 11330 C C    . TYR A 1 17  ? 3.716   5.190   -12.985 1.00 0.00 ? 17  TYR A C    7  
ATOM 11331 O O    . TYR A 1 17  ? 3.995   4.488   -12.014 1.00 0.00 ? 17  TYR A O    7  
ATOM 11332 C CB   . TYR A 1 17  ? 1.489   6.320   -12.847 1.00 0.00 ? 17  TYR A CB   7  
ATOM 11333 C CG   . TYR A 1 17  ? 1.289   6.075   -11.368 1.00 0.00 ? 17  TYR A CG   7  
ATOM 11334 C CD1  . TYR A 1 17  ? 0.353   5.153   -10.918 1.00 0.00 ? 17  TYR A CD1  7  
ATOM 11335 C CD2  . TYR A 1 17  ? 2.035   6.767   -10.422 1.00 0.00 ? 17  TYR A CD2  7  
ATOM 11336 C CE1  . TYR A 1 17  ? 0.166   4.926   -9.568  1.00 0.00 ? 17  TYR A CE1  7  
ATOM 11337 C CE2  . TYR A 1 17  ? 1.856   6.546   -9.071  1.00 0.00 ? 17  TYR A CE2  7  
ATOM 11338 C CZ   . TYR A 1 17  ? 0.921   5.624   -8.648  1.00 0.00 ? 17  TYR A CZ   7  
ATOM 11339 O OH   . TYR A 1 17  ? 0.739   5.402   -7.302  1.00 0.00 ? 17  TYR A OH   7  
ATOM 11340 H H    . TYR A 1 17  ? 1.667   3.489   -12.513 1.00 0.00 ? 17  TYR A H    7  
ATOM 11341 H HA   . TYR A 1 17  ? 2.346   5.446   -14.602 1.00 0.00 ? 17  TYR A HA   7  
ATOM 11342 H HB2  . TYR A 1 17  ? 2.000   7.264   -12.960 1.00 0.00 ? 17  TYR A HB2  7  
ATOM 11343 H HB3  . TYR A 1 17  ? 0.514   6.386   -13.307 1.00 0.00 ? 17  TYR A HB3  7  
ATOM 11344 H HD1  . TYR A 1 17  ? -0.237  4.607   -11.640 1.00 0.00 ? 17  TYR A HD1  7  
ATOM 11345 H HD2  . TYR A 1 17  ? 2.767   7.488   -10.757 1.00 0.00 ? 17  TYR A HD2  7  
ATOM 11346 H HE1  . TYR A 1 17  ? -0.566  4.205   -9.236  1.00 0.00 ? 17  TYR A HE1  7  
ATOM 11347 H HE2  . TYR A 1 17  ? 2.447   7.093   -8.351  1.00 0.00 ? 17  TYR A HE2  7  
ATOM 11348 H HH   . TYR A 1 17  ? 1.588   5.230   -6.889  1.00 0.00 ? 17  TYR A HH   7  
ATOM 11349 N N    . ASN A 1 18  ? 4.610   5.955   -13.605 1.00 0.00 ? 18  ASN A N    7  
ATOM 11350 C CA   . ASN A 1 18  ? 6.000   6.013   -13.169 1.00 0.00 ? 18  ASN A CA   7  
ATOM 11351 C C    . ASN A 1 18  ? 6.285   7.316   -12.429 1.00 0.00 ? 18  ASN A C    7  
ATOM 11352 O O    . ASN A 1 18  ? 5.765   8.373   -12.789 1.00 0.00 ? 18  ASN A O    7  
ATOM 11353 C CB   . ASN A 1 18  ? 6.939   5.879   -14.370 1.00 0.00 ? 18  ASN A CB   7  
ATOM 11354 C CG   . ASN A 1 18  ? 6.354   6.484   -15.631 1.00 0.00 ? 18  ASN A CG   7  
ATOM 11355 O OD1  . ASN A 1 18  ? 6.669   7.618   -15.993 1.00 0.00 ? 18  ASN A OD1  7  
ATOM 11356 N ND2  . ASN A 1 18  ? 5.496   5.728   -16.307 1.00 0.00 ? 18  ASN A ND2  7  
ATOM 11357 H H    . ASN A 1 18  ? 4.327   6.493   -14.373 1.00 0.00 ? 18  ASN A H    7  
ATOM 11358 H HA   . ASN A 1 18  ? 6.171   5.186   -12.496 1.00 0.00 ? 18  ASN A HA   7  
ATOM 11359 H HB2  . ASN A 1 18  ? 7.869   6.383   -14.150 1.00 0.00 ? 18  ASN A HB2  7  
ATOM 11360 H HB3  . ASN A 1 18  ? 7.135   4.833   -14.551 1.00 0.00 ? 18  ASN A HB3  7  
ATOM 11361 H HD21 . ASN A 1 18  ? 5.292   4.835   -15.959 1.00 0.00 ? 18  ASN A HD21 7  
ATOM 11362 H HD22 . ASN A 1 18  ? 5.103   6.095   -17.127 1.00 0.00 ? 18  ASN A HD22 7  
ATOM 11363 N N    . VAL A 1 19  ? 7.115   7.234   -11.394 1.00 0.00 ? 19  VAL A N    7  
ATOM 11364 C CA   . VAL A 1 19  ? 7.471   8.407   -10.604 1.00 0.00 ? 19  VAL A CA   7  
ATOM 11365 C C    . VAL A 1 19  ? 8.983   8.583   -10.533 1.00 0.00 ? 19  VAL A C    7  
ATOM 11366 O O    . VAL A 1 19  ? 9.678   7.805   -9.880  1.00 0.00 ? 19  VAL A O    7  
ATOM 11367 C CB   . VAL A 1 19  ? 6.908   8.312   -9.174  1.00 0.00 ? 19  VAL A CB   7  
ATOM 11368 C CG1  . VAL A 1 19  ? 6.625   9.700   -8.618  1.00 0.00 ? 19  VAL A CG1  7  
ATOM 11369 C CG2  . VAL A 1 19  ? 5.652   7.454   -9.151  1.00 0.00 ? 19  VAL A CG2  7  
ATOM 11370 H H    . VAL A 1 19  ? 7.497   6.364   -11.156 1.00 0.00 ? 19  VAL A H    7  
ATOM 11371 H HA   . VAL A 1 19  ? 7.039   9.275   -11.082 1.00 0.00 ? 19  VAL A HA   7  
ATOM 11372 H HB   . VAL A 1 19  ? 7.651   7.843   -8.547  1.00 0.00 ? 19  VAL A HB   7  
ATOM 11373 H HG11 . VAL A 1 19  ? 6.795   9.702   -7.552  1.00 0.00 ? 19  VAL A HG11 7  
ATOM 11374 H HG12 . VAL A 1 19  ? 7.280   10.417  -9.091  1.00 0.00 ? 19  VAL A HG12 7  
ATOM 11375 H HG13 . VAL A 1 19  ? 5.597   9.964   -8.818  1.00 0.00 ? 19  VAL A HG13 7  
ATOM 11376 H HG21 . VAL A 1 19  ? 5.214   7.433   -10.138 1.00 0.00 ? 19  VAL A HG21 7  
ATOM 11377 H HG22 . VAL A 1 19  ? 5.908   6.448   -8.850  1.00 0.00 ? 19  VAL A HG22 7  
ATOM 11378 H HG23 . VAL A 1 19  ? 4.944   7.870   -8.451  1.00 0.00 ? 19  VAL A HG23 7  
ATOM 11379 N N    . GLU A 1 20  ? 9.487   9.611   -11.209 1.00 0.00 ? 20  GLU A N    7  
ATOM 11380 C CA   . GLU A 1 20  ? 10.918  9.889   -11.222 1.00 0.00 ? 20  GLU A CA   7  
ATOM 11381 C C    . GLU A 1 20  ? 11.316  10.752  -10.027 1.00 0.00 ? 20  GLU A C    7  
ATOM 11382 O O    . GLU A 1 20  ? 11.284  11.982  -10.098 1.00 0.00 ? 20  GLU A O    7  
ATOM 11383 C CB   . GLU A 1 20  ? 11.313  10.588  -12.524 1.00 0.00 ? 20  GLU A CB   7  
ATOM 11384 C CG   . GLU A 1 20  ? 12.810  10.802  -12.671 1.00 0.00 ? 20  GLU A CG   7  
ATOM 11385 C CD   . GLU A 1 20  ? 13.154  11.775  -13.782 1.00 0.00 ? 20  GLU A CD   7  
ATOM 11386 O OE1  . GLU A 1 20  ? 12.891  11.450  -14.958 1.00 0.00 ? 20  GLU A OE1  7  
ATOM 11387 O OE2  . GLU A 1 20  ? 13.688  12.861  -13.473 1.00 0.00 ? 20  GLU A OE2  7  
ATOM 11388 H H    . GLU A 1 20  ? 8.881   10.196  -11.710 1.00 0.00 ? 20  GLU A H    7  
ATOM 11389 H HA   . GLU A 1 20  ? 11.439  8.946   -11.158 1.00 0.00 ? 20  GLU A HA   7  
ATOM 11390 H HB2  . GLU A 1 20  ? 10.972  9.991   -13.357 1.00 0.00 ? 20  GLU A HB2  7  
ATOM 11391 H HB3  . GLU A 1 20  ? 10.828  11.552  -12.562 1.00 0.00 ? 20  GLU A HB3  7  
ATOM 11392 H HG2  . GLU A 1 20  ? 13.198  11.189  -11.741 1.00 0.00 ? 20  GLU A HG2  7  
ATOM 11393 H HG3  . GLU A 1 20  ? 13.277  9.852   -12.886 1.00 0.00 ? 20  GLU A HG3  7  
ATOM 11394 N N    . LEU A 1 21  ? 11.689  10.100  -8.932  1.00 0.00 ? 21  LEU A N    7  
ATOM 11395 C CA   . LEU A 1 21  ? 12.093  10.807  -7.721  1.00 0.00 ? 21  LEU A CA   7  
ATOM 11396 C C    . LEU A 1 21  ? 13.524  11.319  -7.842  1.00 0.00 ? 21  LEU A C    7  
ATOM 11397 O O    . LEU A 1 21  ? 14.331  10.769  -8.591  1.00 0.00 ? 21  LEU A O    7  
ATOM 11398 C CB   . LEU A 1 21  ? 11.969  9.887   -6.505  1.00 0.00 ? 21  LEU A CB   7  
ATOM 11399 C CG   . LEU A 1 21  ? 10.592  9.264   -6.272  1.00 0.00 ? 21  LEU A CG   7  
ATOM 11400 C CD1  . LEU A 1 21  ? 10.655  8.231   -5.158  1.00 0.00 ? 21  LEU A CD1  7  
ATOM 11401 C CD2  . LEU A 1 21  ? 9.567   10.341  -5.947  1.00 0.00 ? 21  LEU A CD2  7  
ATOM 11402 H H    . LEU A 1 21  ? 11.694  9.121   -8.936  1.00 0.00 ? 21  LEU A H    7  
ATOM 11403 H HA   . LEU A 1 21  ? 11.431  11.650  -7.594  1.00 0.00 ? 21  LEU A HA   7  
ATOM 11404 H HB2  . LEU A 1 21  ? 12.679  9.084   -6.625  1.00 0.00 ? 21  LEU A HB2  7  
ATOM 11405 H HB3  . LEU A 1 21  ? 12.224  10.464  -5.628  1.00 0.00 ? 21  LEU A HB3  7  
ATOM 11406 H HG   . LEU A 1 21  ? 10.274  8.761   -7.175  1.00 0.00 ? 21  LEU A HG   7  
ATOM 11407 H HD11 . LEU A 1 21  ? 10.886  8.723   -4.225  1.00 0.00 ? 21  LEU A HD11 7  
ATOM 11408 H HD12 . LEU A 1 21  ? 11.422  7.506   -5.382  1.00 0.00 ? 21  LEU A HD12 7  
ATOM 11409 H HD13 . LEU A 1 21  ? 9.700   7.732   -5.076  1.00 0.00 ? 21  LEU A HD13 7  
ATOM 11410 H HD21 . LEU A 1 21  ? 8.625   10.093  -6.413  1.00 0.00 ? 21  LEU A HD21 7  
ATOM 11411 H HD22 . LEU A 1 21  ? 9.914   11.293  -6.322  1.00 0.00 ? 21  LEU A HD22 7  
ATOM 11412 H HD23 . LEU A 1 21  ? 9.435   10.401  -4.877  1.00 0.00 ? 21  LEU A HD23 7  
ATOM 11413 N N    . VAL A 1 22  ? 13.834  12.376  -7.096  1.00 0.00 ? 22  VAL A N    7  
ATOM 11414 C CA   . VAL A 1 22  ? 15.169  12.961  -7.117  1.00 0.00 ? 22  VAL A CA   7  
ATOM 11415 C C    . VAL A 1 22  ? 15.840  12.846  -5.753  1.00 0.00 ? 22  VAL A C    7  
ATOM 11416 O O    . VAL A 1 22  ? 15.260  13.213  -4.731  1.00 0.00 ? 22  VAL A O    7  
ATOM 11417 C CB   . VAL A 1 22  ? 15.126  14.443  -7.532  1.00 0.00 ? 22  VAL A CB   7  
ATOM 11418 C CG1  . VAL A 1 22  ? 14.557  15.296  -6.408  1.00 0.00 ? 22  VAL A CG1  7  
ATOM 11419 C CG2  . VAL A 1 22  ? 16.513  14.926  -7.929  1.00 0.00 ? 22  VAL A CG2  7  
ATOM 11420 H H    . VAL A 1 22  ? 13.148  12.770  -6.519  1.00 0.00 ? 22  VAL A H    7  
ATOM 11421 H HA   . VAL A 1 22  ? 15.759  12.422  -7.844  1.00 0.00 ? 22  VAL A HA   7  
ATOM 11422 H HB   . VAL A 1 22  ? 14.476  14.537  -8.390  1.00 0.00 ? 22  VAL A HB   7  
ATOM 11423 H HG11 . VAL A 1 22  ? 14.193  16.229  -6.814  1.00 0.00 ? 22  VAL A HG11 7  
ATOM 11424 H HG12 . VAL A 1 22  ? 13.745  14.768  -5.931  1.00 0.00 ? 22  VAL A HG12 7  
ATOM 11425 H HG13 . VAL A 1 22  ? 15.331  15.498  -5.683  1.00 0.00 ? 22  VAL A HG13 7  
ATOM 11426 H HG21 . VAL A 1 22  ? 17.181  14.829  -7.086  1.00 0.00 ? 22  VAL A HG21 7  
ATOM 11427 H HG22 . VAL A 1 22  ? 16.881  14.329  -8.751  1.00 0.00 ? 22  VAL A HG22 7  
ATOM 11428 H HG23 . VAL A 1 22  ? 16.462  15.961  -8.231  1.00 0.00 ? 22  VAL A HG23 7  
ATOM 11429 N N    . ARG A 1 23  ? 17.067  12.334  -5.744  1.00 0.00 ? 23  ARG A N    7  
ATOM 11430 C CA   . ARG A 1 23  ? 17.818  12.170  -4.506  1.00 0.00 ? 23  ARG A CA   7  
ATOM 11431 C C    . ARG A 1 23  ? 18.811  13.313  -4.316  1.00 0.00 ? 23  ARG A C    7  
ATOM 11432 O O    . ARG A 1 23  ? 19.853  13.359  -4.971  1.00 0.00 ? 23  ARG A O    7  
ATOM 11433 C CB   . ARG A 1 23  ? 18.558  10.831  -4.506  1.00 0.00 ? 23  ARG A CB   7  
ATOM 11434 C CG   . ARG A 1 23  ? 17.651  9.634   -4.743  1.00 0.00 ? 23  ARG A CG   7  
ATOM 11435 C CD   . ARG A 1 23  ? 18.206  8.378   -4.091  1.00 0.00 ? 23  ARG A CD   7  
ATOM 11436 N NE   . ARG A 1 23  ? 19.591  8.126   -4.478  1.00 0.00 ? 23  ARG A NE   7  
ATOM 11437 C CZ   . ARG A 1 23  ? 20.250  7.014   -4.171  1.00 0.00 ? 23  ARG A CZ   7  
ATOM 11438 N NH1  . ARG A 1 23  ? 19.652  6.056   -3.476  1.00 0.00 ? 23  ARG A NH1  7  
ATOM 11439 N NH2  . ARG A 1 23  ? 21.509  6.859   -4.559  1.00 0.00 ? 23  ARG A NH2  7  
ATOM 11440 H H    . ARG A 1 23  ? 17.477  12.060  -6.591  1.00 0.00 ? 23  ARG A H    7  
ATOM 11441 H HA   . ARG A 1 23  ? 17.114  12.182  -3.687  1.00 0.00 ? 23  ARG A HA   7  
ATOM 11442 H HB2  . ARG A 1 23  ? 19.306  10.847  -5.285  1.00 0.00 ? 23  ARG A HB2  7  
ATOM 11443 H HB3  . ARG A 1 23  ? 19.045  10.703  -3.552  1.00 0.00 ? 23  ARG A HB3  7  
ATOM 11444 H HG2  . ARG A 1 23  ? 16.677  9.844   -4.325  1.00 0.00 ? 23  ARG A HG2  7  
ATOM 11445 H HG3  . ARG A 1 23  ? 17.560  9.468   -5.806  1.00 0.00 ? 23  ARG A HG3  7  
ATOM 11446 H HD2  . ARG A 1 23  ? 18.157  8.493   -3.018  1.00 0.00 ? 23  ARG A HD2  7  
ATOM 11447 H HD3  . ARG A 1 23  ? 17.600  7.536   -4.390  1.00 0.00 ? 23  ARG A HD3  7  
ATOM 11448 H HE   . ARG A 1 23  ? 20.053  8.821   -4.991  1.00 0.00 ? 23  ARG A HE   7  
ATOM 11449 H HH11 . ARG A 1 23  ? 18.703  6.170   -3.184  1.00 0.00 ? 23  ARG A HH11 7  
ATOM 11450 H HH12 . ARG A 1 23  ? 20.150  5.219   -3.248  1.00 0.00 ? 23  ARG A HH12 7  
ATOM 11451 H HH21 . ARG A 1 23  ? 21.963  7.579   -5.082  1.00 0.00 ? 23  ARG A HH21 7  
ATOM 11452 H HH22 . ARG A 1 23  ? 22.004  6.022   -4.327  1.00 0.00 ? 23  ARG A HH22 7  
ATOM 11453 N N    . LYS A 1 24  ? 18.482  14.234  -3.417  1.00 0.00 ? 24  LYS A N    7  
ATOM 11454 C CA   . LYS A 1 24  ? 19.344  15.376  -3.140  1.00 0.00 ? 24  LYS A CA   7  
ATOM 11455 C C    . LYS A 1 24  ? 20.714  14.918  -2.650  1.00 0.00 ? 24  LYS A C    7  
ATOM 11456 O O    . LYS A 1 24  ? 20.973  13.720  -2.535  1.00 0.00 ? 24  LYS A O    7  
ATOM 11457 C CB   . LYS A 1 24  ? 18.696  16.289  -2.097  1.00 0.00 ? 24  LYS A CB   7  
ATOM 11458 C CG   . LYS A 1 24  ? 17.747  17.315  -2.691  1.00 0.00 ? 24  LYS A CG   7  
ATOM 11459 C CD   . LYS A 1 24  ? 17.507  18.472  -1.737  1.00 0.00 ? 24  LYS A CD   7  
ATOM 11460 C CE   . LYS A 1 24  ? 16.557  19.499  -2.333  1.00 0.00 ? 24  LYS A CE   7  
ATOM 11461 N NZ   . LYS A 1 24  ? 16.643  20.809  -1.630  1.00 0.00 ? 24  LYS A NZ   7  
ATOM 11462 H H    . LYS A 1 24  ? 17.637  14.142  -2.927  1.00 0.00 ? 24  LYS A H    7  
ATOM 11463 H HA   . LYS A 1 24  ? 19.470  15.927  -4.060  1.00 0.00 ? 24  LYS A HA   7  
ATOM 11464 H HB2  . LYS A 1 24  ? 18.144  15.680  -1.397  1.00 0.00 ? 24  LYS A HB2  7  
ATOM 11465 H HB3  . LYS A 1 24  ? 19.475  16.817  -1.565  1.00 0.00 ? 24  LYS A HB3  7  
ATOM 11466 H HG2  . LYS A 1 24  ? 18.173  17.699  -3.606  1.00 0.00 ? 24  LYS A HG2  7  
ATOM 11467 H HG3  . LYS A 1 24  ? 16.802  16.835  -2.906  1.00 0.00 ? 24  LYS A HG3  7  
ATOM 11468 H HD2  . LYS A 1 24  ? 17.079  18.091  -0.822  1.00 0.00 ? 24  LYS A HD2  7  
ATOM 11469 H HD3  . LYS A 1 24  ? 18.452  18.951  -1.521  1.00 0.00 ? 24  LYS A HD3  7  
ATOM 11470 H HE2  . LYS A 1 24  ? 16.808  19.642  -3.373  1.00 0.00 ? 24  LYS A HE2  7  
ATOM 11471 H HE3  . LYS A 1 24  ? 15.547  19.124  -2.255  1.00 0.00 ? 24  LYS A HE3  7  
ATOM 11472 H HZ1  . LYS A 1 24  ? 16.368  21.578  -2.274  1.00 0.00 ? 24  LYS A HZ1  7  
ATOM 11473 H HZ2  . LYS A 1 24  ? 17.616  20.976  -1.303  1.00 0.00 ? 24  LYS A HZ2  7  
ATOM 11474 H HZ3  . LYS A 1 24  ? 16.006  20.815  -0.808  1.00 0.00 ? 24  LYS A HZ3  7  
ATOM 11475 N N    . ASP A 1 25  ? 21.586  15.878  -2.362  1.00 0.00 ? 25  ASP A N    7  
ATOM 11476 C CA   . ASP A 1 25  ? 22.928  15.573  -1.882  1.00 0.00 ? 25  ASP A CA   7  
ATOM 11477 C C    . ASP A 1 25  ? 22.875  14.635  -0.680  1.00 0.00 ? 25  ASP A C    7  
ATOM 11478 O O    . ASP A 1 25  ? 22.810  15.080  0.465   1.00 0.00 ? 25  ASP A O    7  
ATOM 11479 C CB   . ASP A 1 25  ? 23.664  16.860  -1.508  1.00 0.00 ? 25  ASP A CB   7  
ATOM 11480 C CG   . ASP A 1 25  ? 23.975  17.721  -2.716  1.00 0.00 ? 25  ASP A CG   7  
ATOM 11481 O OD1  . ASP A 1 25  ? 23.108  18.533  -3.104  1.00 0.00 ? 25  ASP A OD1  7  
ATOM 11482 O OD2  . ASP A 1 25  ? 25.083  17.584  -3.275  1.00 0.00 ? 25  ASP A OD2  7  
ATOM 11483 H H    . ASP A 1 25  ? 21.320  16.815  -2.475  1.00 0.00 ? 25  ASP A H    7  
ATOM 11484 H HA   . ASP A 1 25  ? 23.463  15.082  -2.681  1.00 0.00 ? 25  ASP A HA   7  
ATOM 11485 H HB2  . ASP A 1 25  ? 23.051  17.434  -0.828  1.00 0.00 ? 25  ASP A HB2  7  
ATOM 11486 H HB3  . ASP A 1 25  ? 24.594  16.607  -1.020  1.00 0.00 ? 25  ASP A HB3  7  
ATOM 11487 N N    . GLY A 1 26  ? 22.902  13.333  -0.949  1.00 0.00 ? 26  GLY A N    7  
ATOM 11488 C CA   . GLY A 1 26  ? 22.854  12.353  0.121   1.00 0.00 ? 26  GLY A CA   7  
ATOM 11489 C C    . GLY A 1 26  ? 21.450  12.142  0.652   1.00 0.00 ? 26  GLY A C    7  
ATOM 11490 O O    . GLY A 1 26  ? 21.258  11.938  1.850   1.00 0.00 ? 26  GLY A O    7  
ATOM 11491 H H    . GLY A 1 26  ? 22.954  13.036  -1.881  1.00 0.00 ? 26  GLY A H    7  
ATOM 11492 H HA2  . GLY A 1 26  ? 23.233  11.413  -0.251  1.00 0.00 ? 26  GLY A HA2  7  
ATOM 11493 H HA3  . GLY A 1 26  ? 23.486  12.690  0.930   1.00 0.00 ? 26  GLY A HA3  7  
ATOM 11494 N N    . GLN A 1 27  ? 20.467  12.194  -0.241  1.00 0.00 ? 27  GLN A N    7  
ATOM 11495 C CA   . GLN A 1 27  ? 19.074  12.009  0.146   1.00 0.00 ? 27  GLN A CA   7  
ATOM 11496 C C    . GLN A 1 27  ? 18.583  10.616  -0.235  1.00 0.00 ? 27  GLN A C    7  
ATOM 11497 O O    . GLN A 1 27  ? 18.628  10.230  -1.402  1.00 0.00 ? 27  GLN A O    7  
ATOM 11498 C CB   . GLN A 1 27  ? 18.194  13.071  -0.515  1.00 0.00 ? 27  GLN A CB   7  
ATOM 11499 C CG   . GLN A 1 27  ? 16.757  13.066  -0.019  1.00 0.00 ? 27  GLN A CG   7  
ATOM 11500 C CD   . GLN A 1 27  ? 16.579  13.854  1.264   1.00 0.00 ? 27  GLN A CD   7  
ATOM 11501 O OE1  . GLN A 1 27  ? 17.459  13.869  2.124   1.00 0.00 ? 27  GLN A OE1  7  
ATOM 11502 N NE2  . GLN A 1 27  ? 15.435  14.516  1.398   1.00 0.00 ? 27  GLN A NE2  7  
ATOM 11503 H H    . GLN A 1 27  ? 20.684  12.360  -1.181  1.00 0.00 ? 27  GLN A H    7  
ATOM 11504 H HA   . GLN A 1 27  ? 19.011  12.119  1.218   1.00 0.00 ? 27  GLN A HA   7  
ATOM 11505 H HB2  . GLN A 1 27  ? 18.616  14.045  -0.318  1.00 0.00 ? 27  GLN A HB2  7  
ATOM 11506 H HB3  . GLN A 1 27  ? 18.184  12.901  -1.581  1.00 0.00 ? 27  GLN A HB3  7  
ATOM 11507 H HG2  . GLN A 1 27  ? 16.125  13.499  -0.780  1.00 0.00 ? 27  GLN A HG2  7  
ATOM 11508 H HG3  . GLN A 1 27  ? 16.455  12.044  0.159   1.00 0.00 ? 27  GLN A HG3  7  
ATOM 11509 H HE21 . GLN A 1 27  ? 14.779  14.458  0.672   1.00 0.00 ? 27  GLN A HE21 7  
ATOM 11510 H HE22 . GLN A 1 27  ? 15.293  15.033  2.217   1.00 0.00 ? 27  GLN A HE22 7  
ATOM 11511 N N    . SER A 1 28  ? 18.115  9.867   0.759   1.00 0.00 ? 28  SER A N    7  
ATOM 11512 C CA   . SER A 1 28  ? 17.620  8.515   0.528   1.00 0.00 ? 28  SER A CA   7  
ATOM 11513 C C    . SER A 1 28  ? 16.193  8.544   -0.012  1.00 0.00 ? 28  SER A C    7  
ATOM 11514 O O    . SER A 1 28  ? 15.535  9.585   -0.006  1.00 0.00 ? 28  SER A O    7  
ATOM 11515 C CB   . SER A 1 28  ? 17.670  7.703   1.824   1.00 0.00 ? 28  SER A CB   7  
ATOM 11516 O OG   . SER A 1 28  ? 18.943  7.104   2.001   1.00 0.00 ? 28  SER A OG   7  
ATOM 11517 H H    . SER A 1 28  ? 18.106  10.232  1.668   1.00 0.00 ? 28  SER A H    7  
ATOM 11518 H HA   . SER A 1 28  ? 18.260  8.048   -0.205  1.00 0.00 ? 28  SER A HA   7  
ATOM 11519 H HB2  . SER A 1 28  ? 17.472  8.354   2.662   1.00 0.00 ? 28  SER A HB2  7  
ATOM 11520 H HB3  . SER A 1 28  ? 16.921  6.925   1.787   1.00 0.00 ? 28  SER A HB3  7  
ATOM 11521 H HG   . SER A 1 28  ? 19.241  7.248   2.902   1.00 0.00 ? 28  SER A HG   7  
ATOM 11522 N N    . LEU A 1 29  ? 15.720  7.393   -0.478  1.00 0.00 ? 29  LEU A N    7  
ATOM 11523 C CA   . LEU A 1 29  ? 14.371  7.285   -1.022  1.00 0.00 ? 29  LEU A CA   7  
ATOM 11524 C C    . LEU A 1 29  ? 13.328  7.616   0.039   1.00 0.00 ? 29  LEU A C    7  
ATOM 11525 O O    . LEU A 1 29  ? 12.576  8.581   -0.094  1.00 0.00 ? 29  LEU A O    7  
ATOM 11526 C CB   . LEU A 1 29  ? 14.132  5.875   -1.567  1.00 0.00 ? 29  LEU A CB   7  
ATOM 11527 C CG   . LEU A 1 29  ? 13.130  5.762   -2.716  1.00 0.00 ? 29  LEU A CG   7  
ATOM 11528 C CD1  . LEU A 1 29  ? 13.560  6.631   -3.888  1.00 0.00 ? 29  LEU A CD1  7  
ATOM 11529 C CD2  . LEU A 1 29  ? 12.981  4.311   -3.152  1.00 0.00 ? 29  LEU A CD2  7  
ATOM 11530 H H    . LEU A 1 29  ? 16.291  6.597   -0.456  1.00 0.00 ? 29  LEU A H    7  
ATOM 11531 H HA   . LEU A 1 29  ? 14.282  7.995   -1.831  1.00 0.00 ? 29  LEU A HA   7  
ATOM 11532 H HB2  . LEU A 1 29  ? 15.078  5.490   -1.914  1.00 0.00 ? 29  LEU A HB2  7  
ATOM 11533 H HB3  . LEU A 1 29  ? 13.773  5.263   -0.752  1.00 0.00 ? 29  LEU A HB3  7  
ATOM 11534 H HG   . LEU A 1 29  ? 12.164  6.111   -2.379  1.00 0.00 ? 29  LEU A HG   7  
ATOM 11535 H HD11 . LEU A 1 29  ? 14.637  6.634   -3.957  1.00 0.00 ? 29  LEU A HD11 7  
ATOM 11536 H HD12 . LEU A 1 29  ? 13.206  7.640   -3.737  1.00 0.00 ? 29  LEU A HD12 7  
ATOM 11537 H HD13 . LEU A 1 29  ? 13.141  6.236   -4.802  1.00 0.00 ? 29  LEU A HD13 7  
ATOM 11538 H HD21 . LEU A 1 29  ? 13.900  3.978   -3.611  1.00 0.00 ? 29  LEU A HD21 7  
ATOM 11539 H HD22 . LEU A 1 29  ? 12.173  4.231   -3.865  1.00 0.00 ? 29  LEU A HD22 7  
ATOM 11540 H HD23 . LEU A 1 29  ? 12.765