data_2DO4
# 
_entry.id   2DO4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DO4         
RCSB  RCSB025642   
WWPDB D_1000025642 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DO4 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-27 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tanabe, W.'                                             1 
'Suzuki, S.'                                             2 
'Muto, Y.'                                               3 
'Inoue, M.'                                              4 
'Kigawa, T.'                                             5 
'Terada, T.'                                             6 
'Shirouzu, M.'                                           7 
'Yokoyama, S.'                                           8 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the RNA binding domain of squamous cell carcinoma antigen recognized by T cells 3' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Suzuki, S.'   1 
primary 'Muto, Y.'     2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Terada, T.'   5 
primary 'Shirouzu, M.' 6 
primary 'Yokoyama, S.' 7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Squamous cell carcinoma antigen recognized by T-cells 3' 
_entity.formula_weight             10772.243 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RNA recognition motif' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SART-3, hSART-3, Tat-interacting protein of 110 kDa, Tip110' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDG
MTIKENIIKVAISNSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDG
MTIKENIIKVAISNSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   VAL n 
1 9   PHE n 
1 10  ARG n 
1 11  TYR n 
1 12  SER n 
1 13  THR n 
1 14  SER n 
1 15  LEU n 
1 16  GLU n 
1 17  LYS n 
1 18  HIS n 
1 19  LYS n 
1 20  LEU n 
1 21  PHE n 
1 22  ILE n 
1 23  SER n 
1 24  GLY n 
1 25  LEU n 
1 26  PRO n 
1 27  PHE n 
1 28  SER n 
1 29  CYS n 
1 30  THR n 
1 31  LYS n 
1 32  GLU n 
1 33  GLU n 
1 34  LEU n 
1 35  GLU n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  LYS n 
1 40  ALA n 
1 41  HIS n 
1 42  GLY n 
1 43  THR n 
1 44  VAL n 
1 45  LYS n 
1 46  ASP n 
1 47  LEU n 
1 48  ARG n 
1 49  LEU n 
1 50  VAL n 
1 51  THR n 
1 52  ASN n 
1 53  ARG n 
1 54  ALA n 
1 55  GLY n 
1 56  LYS n 
1 57  PRO n 
1 58  LYS n 
1 59  GLY n 
1 60  LEU n 
1 61  ALA n 
1 62  TYR n 
1 63  VAL n 
1 64  GLU n 
1 65  TYR n 
1 66  GLU n 
1 67  ASN n 
1 68  GLU n 
1 69  SER n 
1 70  GLN n 
1 71  ALA n 
1 72  SER n 
1 73  GLN n 
1 74  ALA n 
1 75  VAL n 
1 76  MET n 
1 77  LYS n 
1 78  MET n 
1 79  ASP n 
1 80  GLY n 
1 81  MET n 
1 82  THR n 
1 83  ILE n 
1 84  LYS n 
1 85  GLU n 
1 86  ASN n 
1 87  ILE n 
1 88  ILE n 
1 89  LYS n 
1 90  VAL n 
1 91  ALA n 
1 92  ILE n 
1 93  SER n 
1 94  ASN n 
1 95  SER n 
1 96  GLY n 
1 97  PRO n 
1 98  SER n 
1 99  SER n 
1 100 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SART3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P051121-11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SART3_HUMAN 
_struct_ref.pdbx_db_accession          Q15020 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENI
IKVAISN
;
_struct_ref.pdbx_align_begin           791 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DO4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 94 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q15020 
_struct_ref_seq.db_align_beg                  791 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  877 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       791 
_struct_ref_seq.pdbx_auth_seq_align_end       877 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DO4 GLY A 1   ? UNP Q15020 ? ? 'CLONING ARTIFACT' 784 1  
1 2DO4 SER A 2   ? UNP Q15020 ? ? 'CLONING ARTIFACT' 785 2  
1 2DO4 SER A 3   ? UNP Q15020 ? ? 'CLONING ARTIFACT' 786 3  
1 2DO4 GLY A 4   ? UNP Q15020 ? ? 'CLONING ARTIFACT' 787 4  
1 2DO4 SER A 5   ? UNP Q15020 ? ? 'CLONING ARTIFACT' 788 5  
1 2DO4 SER A 6   ? UNP Q15020 ? ? 'CLONING ARTIFACT' 789 6  
1 2DO4 GLY A 7   ? UNP Q15020 ? ? 'CLONING ARTIFACT' 790 7  
1 2DO4 SER A 95  ? UNP Q15020 ? ? 'CLONING ARTIFACT' 878 8  
1 2DO4 GLY A 96  ? UNP Q15020 ? ? 'CLONING ARTIFACT' 879 9  
1 2DO4 PRO A 97  ? UNP Q15020 ? ? 'CLONING ARTIFACT' 880 10 
1 2DO4 SER A 98  ? UNP Q15020 ? ? 'CLONING ARTIFACT' 881 11 
1 2DO4 SER A 99  ? UNP Q15020 ? ? 'CLONING ARTIFACT' 882 12 
1 2DO4 GLY A 100 ? UNP Q15020 ? ? 'CLONING ARTIFACT' 883 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.1mM 13C/15N-PROTEIN; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DO4 
_pdbx_nmr_refine.method             'torsion angle dyanamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DO4 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DO4 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9742   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2DO4 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DO4 
_struct.title                     
'Solution structure of the RNA binding domain of squamous cell carcinoma antigen recognized by T cells 3' 
_struct.pdbx_descriptor           'Squamous cell carcinoma antigen recognized by T-cells 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DO4 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
;RRM domaim, RDB, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 31 ? ALA A 40 ? LYS A 814 ALA A 823 1 ? 10 
HELX_P HELX_P2 2 GLU A 68 ? MET A 78 ? GLU A 851 MET A 861 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 44 ? LEU A 49 ? VAL A 827 LEU A 832 
A 2 LEU A 60 ? TYR A 65 ? LEU A 843 TYR A 848 
A 3 LYS A 19 ? SER A 23 ? LYS A 802 SER A 806 
A 4 ILE A 87 ? ILE A 92 ? ILE A 870 ILE A 875 
A 5 MET A 81 ? THR A 82 ? MET A 864 THR A 865 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 48 ? N ARG A 831 O TYR A 62 ? O TYR A 845 
A 2 3 O ALA A 61 ? O ALA A 844 N ILE A 22 ? N ILE A 805 
A 3 4 N PHE A 21 ? N PHE A 804 O ALA A 91 ? O ALA A 874 
A 4 5 O ILE A 88 ? O ILE A 871 N MET A 81 ? N MET A 864 
# 
_database_PDB_matrix.entry_id          2DO4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DO4 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 16.785  -5.172  -11.051 1.00 0.00 ? 784 GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 17.527  -5.171  -12.298 1.00 0.00 ? 784 GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 17.422  -3.850  -13.034 1.00 0.00 ? 784 GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 16.655  -2.972  -12.640 1.00 0.00 ? 784 GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 17.266  -5.173  -10.197 1.00 0.00 ? 784 GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 18.567  -5.371  -12.086 1.00 0.00 ? 784 GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 17.142  -5.955  -12.934 1.00 0.00 ? 784 GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 18.196  -3.708  -14.106 1.00 0.00 ? 785 SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 18.190  -2.482  -14.896 1.00 0.00 ? 785 SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 16.847  -2.291  -15.593 1.00 0.00 ? 785 SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 15.984  -3.169  -15.554 1.00 0.00 ? 785 SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 19.315  -2.513  -15.932 1.00 0.00 ? 785 SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 19.113  -3.553  -16.873 1.00 0.00 ? 785 SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 18.786  -4.445  -14.370 1.00 0.00 ? 785 SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 18.355  -1.654  -14.223 1.00 0.00 ? 785 SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 19.344  -1.570  -16.456 1.00 0.00 ? 785 SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 20.258  -2.676  -15.431 1.00 0.00 ? 785 SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 18.171  -3.688  -17.005 1.00 0.00 ? 785 SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 16.677  -1.137  -16.230 1.00 0.00 ? 786 SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 15.437  -0.828  -16.933 1.00 0.00 ? 786 SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 15.726  -0.232  -18.307 1.00 0.00 ? 786 SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 16.084  0.939   -18.426 1.00 0.00 ? 786 SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 14.589  0.145   -16.111 1.00 0.00 ? 786 SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 13.908  -0.529  -15.067 1.00 0.00 ? 786 SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 17.402  -0.477  -16.225 1.00 0.00 ? 786 SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 14.890  -1.749  -17.061 1.00 0.00 ? 786 SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 15.228  0.900   -15.679 1.00 0.00 ? 786 SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 13.860  0.616   -16.755 1.00 0.00 ? 786 SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 13.777  -1.448  -15.311 1.00 0.00 ? 786 SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 15.568  -1.048  -19.345 1.00 0.00 ? 787 GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 15.816  -0.585  -20.698 1.00 0.00 ? 787 GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 14.600  0.075   -21.317 1.00 0.00 ? 787 GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 13.621  -0.595  -21.644 1.00 0.00 ? 787 GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 15.281  -1.972  -19.190 1.00 0.00 ? 787 GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 16.629  0.125   -20.680 1.00 0.00 ? 787 GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 16.103  -1.429  -21.308 1.00 0.00 ? 787 GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 14.662  1.393   -21.476 1.00 0.00 ? 788 SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 13.555  2.146   -22.055 1.00 0.00 ? 788 SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 13.357  1.778   -23.522 1.00 0.00 ? 788 SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 12.236  1.524   -23.964 1.00 0.00 ? 788 SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 13.808  3.649   -21.923 1.00 0.00 ? 788 SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 12.590  4.374   -21.937 1.00 0.00 ? 788 SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 15.470  1.872   -21.195 1.00 0.00 ? 788 SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 12.659  1.891   -21.508 1.00 0.00 ? 788 SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 14.319  3.845   -20.993 1.00 0.00 ? 788 SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 14.421  3.981   -22.748 1.00 0.00 ? 788 SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 12.354  4.622   -21.040 1.00 0.00 ? 788 SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 14.453  1.753   -24.273 1.00 0.00 ? 789 SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 14.401  1.420   -25.691 1.00 0.00 ? 789 SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 13.953  -0.024  -25.895 1.00 0.00 ? 789 SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 14.691  -0.962  -25.601 1.00 0.00 ? 789 SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 15.771  1.637   -26.338 1.00 0.00 ? 789 SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 15.929  2.981   -26.759 1.00 0.00 ? 789 SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 15.318  1.965   -23.862 1.00 0.00 ? 789 SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 13.684  2.077   -26.160 1.00 0.00 ? 789 SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 16.545  1.403   -25.623 1.00 0.00 ? 789 SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 15.866  0.989   -27.198 1.00 0.00 ? 789 SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 15.073  3.346   -26.993 1.00 0.00 ? 789 SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 12.735  -0.193  -26.402 1.00 0.00 ? 790 GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 12.208  -1.524  -26.637 1.00 0.00 ? 790 GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 11.832  -2.234  -25.351 1.00 0.00 ? 790 GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 12.457  -2.023  -24.312 1.00 0.00 ? 790 GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 12.191  0.593   -26.618 1.00 0.00 ? 790 GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 11.332  -1.447  -27.263 1.00 0.00 ? 790 GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 12.956  -2.109  -27.152 1.00 0.00 ? 790 GLY A HA3  1  
ATOM 66    N N    . VAL A 1 8   ? 10.806  -3.077  -25.420 1.00 0.00 ? 791 VAL A N    1  
ATOM 67    C CA   . VAL A 1 8   ? 10.347  -3.820  -24.253 1.00 0.00 ? 791 VAL A CA   1  
ATOM 68    C C    . VAL A 1 8   ? 10.095  -5.283  -24.597 1.00 0.00 ? 791 VAL A C    1  
ATOM 69    O O    . VAL A 1 8   ? 9.599   -5.602  -25.678 1.00 0.00 ? 791 VAL A O    1  
ATOM 70    C CB   . VAL A 1 8   ? 9.057   -3.211  -23.672 1.00 0.00 ? 791 VAL A CB   1  
ATOM 71    C CG1  . VAL A 1 8   ? 8.567   -4.029  -22.487 1.00 0.00 ? 791 VAL A CG1  1  
ATOM 72    C CG2  . VAL A 1 8   ? 9.286   -1.761  -23.271 1.00 0.00 ? 791 VAL A CG2  1  
ATOM 73    H H    . VAL A 1 8   ? 10.348  -3.203  -26.277 1.00 0.00 ? 791 VAL A H    1  
ATOM 74    H HA   . VAL A 1 8   ? 11.118  -3.765  -23.498 1.00 0.00 ? 791 VAL A HA   1  
ATOM 75    H HB   . VAL A 1 8   ? 8.296   -3.235  -24.437 1.00 0.00 ? 791 VAL A HB   1  
ATOM 76    H HG11 . VAL A 1 8   ? 7.605   -4.460  -22.721 1.00 0.00 ? 791 VAL A HG11 1  
ATOM 77    H HG12 . VAL A 1 8   ? 9.275   -4.817  -22.276 1.00 0.00 ? 791 VAL A HG12 1  
ATOM 78    H HG13 . VAL A 1 8   ? 8.473   -3.389  -21.622 1.00 0.00 ? 791 VAL A HG13 1  
ATOM 79    H HG21 . VAL A 1 8   ? 9.638   -1.722  -22.251 1.00 0.00 ? 791 VAL A HG21 1  
ATOM 80    H HG22 . VAL A 1 8   ? 10.026  -1.319  -23.924 1.00 0.00 ? 791 VAL A HG22 1  
ATOM 81    H HG23 . VAL A 1 8   ? 8.360   -1.214  -23.355 1.00 0.00 ? 791 VAL A HG23 1  
ATOM 82    N N    . PHE A 1 9   ? 10.440  -6.171  -23.670 1.00 0.00 ? 792 PHE A N    1  
ATOM 83    C CA   . PHE A 1 9   ? 10.251  -7.603  -23.875 1.00 0.00 ? 792 PHE A CA   1  
ATOM 84    C C    . PHE A 1 9   ? 9.626   -8.251  -22.644 1.00 0.00 ? 792 PHE A C    1  
ATOM 85    O O    . PHE A 1 9   ? 9.461   -7.608  -21.607 1.00 0.00 ? 792 PHE A O    1  
ATOM 86    C CB   . PHE A 1 9   ? 11.589  -8.274  -24.195 1.00 0.00 ? 792 PHE A CB   1  
ATOM 87    C CG   . PHE A 1 9   ? 11.923  -8.277  -25.659 1.00 0.00 ? 792 PHE A CG   1  
ATOM 88    C CD1  . PHE A 1 9   ? 12.268  -7.101  -26.307 1.00 0.00 ? 792 PHE A CD1  1  
ATOM 89    C CD2  . PHE A 1 9   ? 11.894  -9.455  -26.388 1.00 0.00 ? 792 PHE A CD2  1  
ATOM 90    C CE1  . PHE A 1 9   ? 12.575  -7.101  -27.654 1.00 0.00 ? 792 PHE A CE1  1  
ATOM 91    C CE2  . PHE A 1 9   ? 12.200  -9.461  -27.736 1.00 0.00 ? 792 PHE A CE2  1  
ATOM 92    C CZ   . PHE A 1 9   ? 12.543  -8.283  -28.369 1.00 0.00 ? 792 PHE A CZ   1  
ATOM 93    H H    . PHE A 1 9   ? 10.831  -5.856  -22.828 1.00 0.00 ? 792 PHE A H    1  
ATOM 94    H HA   . PHE A 1 9   ? 9.584   -7.732  -24.713 1.00 0.00 ? 792 PHE A HA   1  
ATOM 95    H HB2  . PHE A 1 9   ? 12.379  -7.752  -23.676 1.00 0.00 ? 792 PHE A HB2  1  
ATOM 96    H HB3  . PHE A 1 9   ? 11.558  -9.299  -23.858 1.00 0.00 ? 792 PHE A HB3  1  
ATOM 97    H HD1  . PHE A 1 9   ? 12.294  -6.177  -25.749 1.00 0.00 ? 792 PHE A HD1  1  
ATOM 98    H HD2  . PHE A 1 9   ? 11.626  -10.378 -25.892 1.00 0.00 ? 792 PHE A HD2  1  
ATOM 99    H HE1  . PHE A 1 9   ? 12.842  -6.179  -28.148 1.00 0.00 ? 792 PHE A HE1  1  
ATOM 100   H HE2  . PHE A 1 9   ? 12.174  -10.387 -28.291 1.00 0.00 ? 792 PHE A HE2  1  
ATOM 101   H HZ   . PHE A 1 9   ? 12.782  -8.285  -29.422 1.00 0.00 ? 792 PHE A HZ   1  
ATOM 102   N N    . ARG A 1 10  ? 9.279   -9.528  -22.766 1.00 0.00 ? 793 ARG A N    1  
ATOM 103   C CA   . ARG A 1 10  ? 8.669   -10.263 -21.665 1.00 0.00 ? 793 ARG A CA   1  
ATOM 104   C C    . ARG A 1 10  ? 9.694   -11.162 -20.979 1.00 0.00 ? 793 ARG A C    1  
ATOM 105   O O    . ARG A 1 10  ? 10.201  -12.111 -21.577 1.00 0.00 ? 793 ARG A O    1  
ATOM 106   C CB   . ARG A 1 10  ? 7.496   -11.103 -22.172 1.00 0.00 ? 793 ARG A CB   1  
ATOM 107   C CG   . ARG A 1 10  ? 6.324   -10.274 -22.671 1.00 0.00 ? 793 ARG A CG   1  
ATOM 108   C CD   . ARG A 1 10  ? 5.388   -9.893  -21.535 1.00 0.00 ? 793 ARG A CD   1  
ATOM 109   N NE   . ARG A 1 10  ? 4.350   -10.898 -21.319 1.00 0.00 ? 793 ARG A NE   1  
ATOM 110   C CZ   . ARG A 1 10  ? 3.514   -10.881 -20.287 1.00 0.00 ? 793 ARG A CZ   1  
ATOM 111   N NH1  . ARG A 1 10  ? 3.593   -9.916  -19.382 1.00 0.00 ? 793 ARG A NH1  1  
ATOM 112   N NH2  . ARG A 1 10  ? 2.597   -11.831 -20.160 1.00 0.00 ? 793 ARG A NH2  1  
ATOM 113   H H    . ARG A 1 10  ? 9.435   -9.986  -23.618 1.00 0.00 ? 793 ARG A H    1  
ATOM 114   H HA   . ARG A 1 10  ? 8.302   -9.544  -20.948 1.00 0.00 ? 793 ARG A HA   1  
ATOM 115   H HB2  . ARG A 1 10  ? 7.839   -11.727 -22.984 1.00 0.00 ? 793 ARG A HB2  1  
ATOM 116   H HB3  . ARG A 1 10  ? 7.147   -11.734 -21.368 1.00 0.00 ? 793 ARG A HB3  1  
ATOM 117   H HG2  . ARG A 1 10  ? 6.702   -9.372  -23.129 1.00 0.00 ? 793 ARG A HG2  1  
ATOM 118   H HG3  . ARG A 1 10  ? 5.774   -10.849 -23.402 1.00 0.00 ? 793 ARG A HG3  1  
ATOM 119   H HD2  . ARG A 1 10  ? 5.966   -9.787  -20.630 1.00 0.00 ? 793 ARG A HD2  1  
ATOM 120   H HD3  . ARG A 1 10  ? 4.919   -8.950  -21.775 1.00 0.00 ? 793 ARG A HD3  1  
ATOM 121   H HE   . ARG A 1 10  ? 4.275   -11.620 -21.977 1.00 0.00 ? 793 ARG A HE   1  
ATOM 122   H HH11 . ARG A 1 10  ? 4.282   -9.198  -19.476 1.00 0.00 ? 793 ARG A HH11 1  
ATOM 123   H HH12 . ARG A 1 10  ? 2.961   -9.905  -18.606 1.00 0.00 ? 793 ARG A HH12 1  
ATOM 124   H HH21 . ARG A 1 10  ? 2.534   -12.560 -20.841 1.00 0.00 ? 793 ARG A HH21 1  
ATOM 125   H HH22 . ARG A 1 10  ? 1.968   -11.818 -19.383 1.00 0.00 ? 793 ARG A HH22 1  
ATOM 126   N N    . TYR A 1 11  ? 9.993   -10.857 -19.721 1.00 0.00 ? 794 TYR A N    1  
ATOM 127   C CA   . TYR A 1 11  ? 10.959  -11.635 -18.955 1.00 0.00 ? 794 TYR A CA   1  
ATOM 128   C C    . TYR A 1 11  ? 10.331  -12.174 -17.674 1.00 0.00 ? 794 TYR A C    1  
ATOM 129   O O    . TYR A 1 11  ? 10.480  -13.351 -17.344 1.00 0.00 ? 794 TYR A O    1  
ATOM 130   C CB   . TYR A 1 11  ? 12.181  -10.779 -18.615 1.00 0.00 ? 794 TYR A CB   1  
ATOM 131   C CG   . TYR A 1 11  ? 13.256  -10.809 -19.678 1.00 0.00 ? 794 TYR A CG   1  
ATOM 132   C CD1  . TYR A 1 11  ? 14.046  -11.938 -19.863 1.00 0.00 ? 794 TYR A CD1  1  
ATOM 133   C CD2  . TYR A 1 11  ? 13.483  -9.710  -20.497 1.00 0.00 ? 794 TYR A CD2  1  
ATOM 134   C CE1  . TYR A 1 11  ? 15.030  -11.970 -20.832 1.00 0.00 ? 794 TYR A CE1  1  
ATOM 135   C CE2  . TYR A 1 11  ? 14.463  -9.734  -21.470 1.00 0.00 ? 794 TYR A CE2  1  
ATOM 136   C CZ   . TYR A 1 11  ? 15.234  -10.866 -21.633 1.00 0.00 ? 794 TYR A CZ   1  
ATOM 137   O OH   . TYR A 1 11  ? 16.213  -10.893 -22.600 1.00 0.00 ? 794 TYR A OH   1  
ATOM 138   H H    . TYR A 1 11  ? 9.556   -10.088 -19.299 1.00 0.00 ? 794 TYR A H    1  
ATOM 139   H HA   . TYR A 1 11  ? 11.274  -12.468 -19.567 1.00 0.00 ? 794 TYR A HA   1  
ATOM 140   H HB2  . TYR A 1 11  ? 11.870  -9.754  -18.489 1.00 0.00 ? 794 TYR A HB2  1  
ATOM 141   H HB3  . TYR A 1 11  ? 12.616  -11.135 -17.693 1.00 0.00 ? 794 TYR A HB3  1  
ATOM 142   H HD1  . TYR A 1 11  ? 13.883  -12.801 -19.234 1.00 0.00 ? 794 TYR A HD1  1  
ATOM 143   H HD2  . TYR A 1 11  ? 12.877  -8.825  -20.366 1.00 0.00 ? 794 TYR A HD2  1  
ATOM 144   H HE1  . TYR A 1 11  ? 15.633  -12.856 -20.961 1.00 0.00 ? 794 TYR A HE1  1  
ATOM 145   H HE2  . TYR A 1 11  ? 14.624  -8.869  -22.097 1.00 0.00 ? 794 TYR A HE2  1  
ATOM 146   H HH   . TYR A 1 11  ? 16.015  -10.238 -23.274 1.00 0.00 ? 794 TYR A HH   1  
ATOM 147   N N    . SER A 1 12  ? 9.626   -11.305 -16.957 1.00 0.00 ? 795 SER A N    1  
ATOM 148   C CA   . SER A 1 12  ? 8.976   -11.692 -15.710 1.00 0.00 ? 795 SER A CA   1  
ATOM 149   C C    . SER A 1 12  ? 7.500   -11.308 -15.725 1.00 0.00 ? 795 SER A C    1  
ATOM 150   O O    . SER A 1 12  ? 7.124   -10.258 -16.247 1.00 0.00 ? 795 SER A O    1  
ATOM 151   C CB   . SER A 1 12  ? 9.675   -11.031 -14.520 1.00 0.00 ? 795 SER A CB   1  
ATOM 152   O OG   . SER A 1 12  ? 9.284   -11.636 -13.299 1.00 0.00 ? 795 SER A OG   1  
ATOM 153   H H    . SER A 1 12  ? 9.544   -10.381 -17.272 1.00 0.00 ? 795 SER A H    1  
ATOM 154   H HA   . SER A 1 12  ? 9.056   -12.764 -15.613 1.00 0.00 ? 795 SER A HA   1  
ATOM 155   H HB2  . SER A 1 12  ? 10.743  -11.132 -14.631 1.00 0.00 ? 795 SER A HB2  1  
ATOM 156   H HB3  . SER A 1 12  ? 9.413   -9.983  -14.489 1.00 0.00 ? 795 SER A HB3  1  
ATOM 157   H HG   . SER A 1 12  ? 8.547   -11.149 -12.922 1.00 0.00 ? 795 SER A HG   1  
ATOM 158   N N    . THR A 1 13  ? 6.665   -12.168 -15.148 1.00 0.00 ? 796 THR A N    1  
ATOM 159   C CA   . THR A 1 13  ? 5.230   -11.921 -15.096 1.00 0.00 ? 796 THR A CA   1  
ATOM 160   C C    . THR A 1 13  ? 4.934   -10.443 -14.865 1.00 0.00 ? 796 THR A C    1  
ATOM 161   O O    . THR A 1 13  ? 5.760   -9.713  -14.318 1.00 0.00 ? 796 THR A O    1  
ATOM 162   C CB   . THR A 1 13  ? 4.559   -12.747 -13.982 1.00 0.00 ? 796 THR A CB   1  
ATOM 163   O OG1  . THR A 1 13  ? 3.173   -12.399 -13.882 1.00 0.00 ? 796 THR A OG1  1  
ATOM 164   C CG2  . THR A 1 13  ? 5.244   -12.510 -12.645 1.00 0.00 ? 796 THR A CG2  1  
ATOM 165   H H    . THR A 1 13  ? 7.025   -12.987 -14.750 1.00 0.00 ? 796 THR A H    1  
ATOM 166   H HA   . THR A 1 13  ? 4.805   -12.220 -16.043 1.00 0.00 ? 796 THR A HA   1  
ATOM 167   H HB   . THR A 1 13  ? 4.642   -13.795 -14.232 1.00 0.00 ? 796 THR A HB   1  
ATOM 168   H HG1  . THR A 1 13  ? 2.647   -13.036 -14.372 1.00 0.00 ? 796 THR A HG1  1  
ATOM 169   H HG21 . THR A 1 13  ? 6.009   -13.257 -12.495 1.00 0.00 ? 796 THR A HG21 1  
ATOM 170   H HG22 . THR A 1 13  ? 4.515   -12.577 -11.850 1.00 0.00 ? 796 THR A HG22 1  
ATOM 171   H HG23 . THR A 1 13  ? 5.693   -11.529 -12.640 1.00 0.00 ? 796 THR A HG23 1  
ATOM 172   N N    . SER A 1 14  ? 3.750   -10.009 -15.286 1.00 0.00 ? 797 SER A N    1  
ATOM 173   C CA   . SER A 1 14  ? 3.346   -8.617  -15.128 1.00 0.00 ? 797 SER A CA   1  
ATOM 174   C C    . SER A 1 14  ? 3.513   -8.164  -13.681 1.00 0.00 ? 797 SER A C    1  
ATOM 175   O O    . SER A 1 14  ? 3.075   -8.843  -12.751 1.00 0.00 ? 797 SER A O    1  
ATOM 176   C CB   . SER A 1 14  ? 1.893   -8.432  -15.568 1.00 0.00 ? 797 SER A CB   1  
ATOM 177   O OG   . SER A 1 14  ? 1.814   -8.114  -16.946 1.00 0.00 ? 797 SER A OG   1  
ATOM 178   H H    . SER A 1 14  ? 3.135   -10.640 -15.715 1.00 0.00 ? 797 SER A H    1  
ATOM 179   H HA   . SER A 1 14  ? 3.984   -8.014  -15.757 1.00 0.00 ? 797 SER A HA   1  
ATOM 180   H HB2  . SER A 1 14  ? 1.347   -9.346  -15.390 1.00 0.00 ? 797 SER A HB2  1  
ATOM 181   H HB3  . SER A 1 14  ? 1.447   -7.629  -14.999 1.00 0.00 ? 797 SER A HB3  1  
ATOM 182   H HG   . SER A 1 14  ? 1.024   -7.593  -17.110 1.00 0.00 ? 797 SER A HG   1  
ATOM 183   N N    . LEU A 1 15  ? 4.149   -7.012  -13.498 1.00 0.00 ? 798 LEU A N    1  
ATOM 184   C CA   . LEU A 1 15  ? 4.374   -6.466  -12.164 1.00 0.00 ? 798 LEU A CA   1  
ATOM 185   C C    . LEU A 1 15  ? 3.324   -5.415  -11.821 1.00 0.00 ? 798 LEU A C    1  
ATOM 186   O O    . LEU A 1 15  ? 2.818   -4.719  -12.701 1.00 0.00 ? 798 LEU A O    1  
ATOM 187   C CB   . LEU A 1 15  ? 5.774   -5.854  -12.071 1.00 0.00 ? 798 LEU A CB   1  
ATOM 188   C CG   . LEU A 1 15  ? 5.938   -4.459  -12.676 1.00 0.00 ? 798 LEU A CG   1  
ATOM 189   C CD1  . LEU A 1 15  ? 5.214   -3.423  -11.830 1.00 0.00 ? 798 LEU A CD1  1  
ATOM 190   C CD2  . LEU A 1 15  ? 7.412   -4.106  -12.810 1.00 0.00 ? 798 LEU A CD2  1  
ATOM 191   H H    . LEU A 1 15  ? 4.475   -6.516  -14.277 1.00 0.00 ? 798 LEU A H    1  
ATOM 192   H HA   . LEU A 1 15  ? 4.298   -7.278  -11.456 1.00 0.00 ? 798 LEU A HA   1  
ATOM 193   H HB2  . LEU A 1 15  ? 6.040   -5.795  -11.027 1.00 0.00 ? 798 LEU A HB2  1  
ATOM 194   H HB3  . LEU A 1 15  ? 6.458   -6.519  -12.579 1.00 0.00 ? 798 LEU A HB3  1  
ATOM 195   H HG   . LEU A 1 15  ? 5.498   -4.448  -13.664 1.00 0.00 ? 798 LEU A HG   1  
ATOM 196   H HD11 . LEU A 1 15  ? 4.891   -3.875  -10.905 1.00 0.00 ? 798 LEU A HD11 1  
ATOM 197   H HD12 . LEU A 1 15  ? 4.355   -3.053  -12.370 1.00 0.00 ? 798 LEU A HD12 1  
ATOM 198   H HD13 . LEU A 1 15  ? 5.884   -2.603  -11.616 1.00 0.00 ? 798 LEU A HD13 1  
ATOM 199   H HD21 . LEU A 1 15  ? 7.575   -3.596  -13.748 1.00 0.00 ? 798 LEU A HD21 1  
ATOM 200   H HD22 . LEU A 1 15  ? 8.002   -5.011  -12.786 1.00 0.00 ? 798 LEU A HD22 1  
ATOM 201   H HD23 . LEU A 1 15  ? 7.704   -3.463  -11.994 1.00 0.00 ? 798 LEU A HD23 1  
ATOM 202   N N    . GLU A 1 16  ? 3.002   -5.304  -10.536 1.00 0.00 ? 799 GLU A N    1  
ATOM 203   C CA   . GLU A 1 16  ? 2.013   -4.336  -10.077 1.00 0.00 ? 799 GLU A CA   1  
ATOM 204   C C    . GLU A 1 16  ? 2.690   -3.083  -9.529  1.00 0.00 ? 799 GLU A C    1  
ATOM 205   O O    . GLU A 1 16  ? 3.736   -3.161  -8.884  1.00 0.00 ? 799 GLU A O    1  
ATOM 206   C CB   . GLU A 1 16  ? 1.119   -4.957  -9.002  1.00 0.00 ? 799 GLU A CB   1  
ATOM 207   C CG   . GLU A 1 16  ? 1.869   -5.357  -7.743  1.00 0.00 ? 799 GLU A CG   1  
ATOM 208   C CD   . GLU A 1 16  ? 2.523   -6.720  -7.861  1.00 0.00 ? 799 GLU A CD   1  
ATOM 209   O OE1  . GLU A 1 16  ? 1.838   -7.671  -8.292  1.00 0.00 ? 799 GLU A OE1  1  
ATOM 210   O OE2  . GLU A 1 16  ? 3.719   -6.836  -7.523  1.00 0.00 ? 799 GLU A OE2  1  
ATOM 211   H H    . GLU A 1 16  ? 3.440   -5.887  -9.881  1.00 0.00 ? 799 GLU A H    1  
ATOM 212   H HA   . GLU A 1 16  ? 1.403   -4.059  -10.924 1.00 0.00 ? 799 GLU A HA   1  
ATOM 213   H HB2  . GLU A 1 16  ? 0.354   -4.245  -8.731  1.00 0.00 ? 799 GLU A HB2  1  
ATOM 214   H HB3  . GLU A 1 16  ? 0.647   -5.839  -9.410  1.00 0.00 ? 799 GLU A HB3  1  
ATOM 215   H HG2  . GLU A 1 16  ? 2.636   -4.622  -7.548  1.00 0.00 ? 799 GLU A HG2  1  
ATOM 216   H HG3  . GLU A 1 16  ? 1.174   -5.378  -6.916  1.00 0.00 ? 799 GLU A HG3  1  
ATOM 217   N N    . LYS A 1 17  ? 2.087   -1.929  -9.791  1.00 0.00 ? 800 LYS A N    1  
ATOM 218   C CA   . LYS A 1 17  ? 2.630   -0.658  -9.324  1.00 0.00 ? 800 LYS A CA   1  
ATOM 219   C C    . LYS A 1 17  ? 1.574   0.138   -8.564  1.00 0.00 ? 800 LYS A C    1  
ATOM 220   O O    . LYS A 1 17  ? 1.852   0.708   -7.508  1.00 0.00 ? 800 LYS A O    1  
ATOM 221   C CB   . LYS A 1 17  ? 3.150   0.162   -10.506 1.00 0.00 ? 800 LYS A CB   1  
ATOM 222   C CG   . LYS A 1 17  ? 4.603   -0.119  -10.850 1.00 0.00 ? 800 LYS A CG   1  
ATOM 223   C CD   . LYS A 1 17  ? 5.544   0.796   -10.085 1.00 0.00 ? 800 LYS A CD   1  
ATOM 224   C CE   . LYS A 1 17  ? 5.765   2.109   -10.820 1.00 0.00 ? 800 LYS A CE   1  
ATOM 225   N NZ   . LYS A 1 17  ? 6.920   2.033   -11.757 1.00 0.00 ? 800 LYS A NZ   1  
ATOM 226   H H    . LYS A 1 17  ? 1.255   -1.931  -10.310 1.00 0.00 ? 800 LYS A H    1  
ATOM 227   H HA   . LYS A 1 17  ? 3.451   -0.873  -8.657  1.00 0.00 ? 800 LYS A HA   1  
ATOM 228   H HB2  . LYS A 1 17  ? 2.547   -0.058  -11.375 1.00 0.00 ? 800 LYS A HB2  1  
ATOM 229   H HB3  . LYS A 1 17  ? 3.055   1.212   -10.269 1.00 0.00 ? 800 LYS A HB3  1  
ATOM 230   H HG2  . LYS A 1 17  ? 4.831   -1.144  -10.597 1.00 0.00 ? 800 LYS A HG2  1  
ATOM 231   H HG3  . LYS A 1 17  ? 4.749   0.034   -11.910 1.00 0.00 ? 800 LYS A HG3  1  
ATOM 232   H HD2  . LYS A 1 17  ? 5.119   1.007   -9.115  1.00 0.00 ? 800 LYS A HD2  1  
ATOM 233   H HD3  . LYS A 1 17  ? 6.496   0.298   -9.962  1.00 0.00 ? 800 LYS A HD3  1  
ATOM 234   H HE2  . LYS A 1 17  ? 4.874   2.347   -11.381 1.00 0.00 ? 800 LYS A HE2  1  
ATOM 235   H HE3  . LYS A 1 17  ? 5.951   2.886   -10.094 1.00 0.00 ? 800 LYS A HE3  1  
ATOM 236   H HZ1  . LYS A 1 17  ? 7.080   1.047   -12.047 1.00 0.00 ? 800 LYS A HZ1  1  
ATOM 237   H HZ2  . LYS A 1 17  ? 7.780   2.389   -11.293 1.00 0.00 ? 800 LYS A HZ2  1  
ATOM 238   H HZ3  . LYS A 1 17  ? 6.733   2.606   -12.604 1.00 0.00 ? 800 LYS A HZ3  1  
ATOM 239   N N    . HIS A 1 18  ? 0.361   0.173   -9.107  1.00 0.00 ? 801 HIS A N    1  
ATOM 240   C CA   . HIS A 1 18  ? -0.738  0.898   -8.479  1.00 0.00 ? 801 HIS A CA   1  
ATOM 241   C C    . HIS A 1 18  ? -0.843  0.548   -6.997  1.00 0.00 ? 801 HIS A C    1  
ATOM 242   O O    . HIS A 1 18  ? -1.016  1.426   -6.152  1.00 0.00 ? 801 HIS A O    1  
ATOM 243   C CB   . HIS A 1 18  ? -2.056  0.580   -9.184  1.00 0.00 ? 801 HIS A CB   1  
ATOM 244   C CG   . HIS A 1 18  ? -2.475  -0.852  -9.055  1.00 0.00 ? 801 HIS A CG   1  
ATOM 245   N ND1  . HIS A 1 18  ? -1.808  -1.890  -9.672  1.00 0.00 ? 801 HIS A ND1  1  
ATOM 246   C CD2  . HIS A 1 18  ? -3.499  -1.417  -8.373  1.00 0.00 ? 801 HIS A CD2  1  
ATOM 247   C CE1  . HIS A 1 18  ? -2.404  -3.031  -9.376  1.00 0.00 ? 801 HIS A CE1  1  
ATOM 248   N NE2  . HIS A 1 18  ? -3.433  -2.772  -8.589  1.00 0.00 ? 801 HIS A NE2  1  
ATOM 249   H H    . HIS A 1 18  ? 0.201   -0.301  -9.950  1.00 0.00 ? 801 HIS A H    1  
ATOM 250   H HA   . HIS A 1 18  ? -0.535  1.954   -8.573  1.00 0.00 ? 801 HIS A HA   1  
ATOM 251   H HB2  . HIS A 1 18  ? -2.839  1.193   -8.763  1.00 0.00 ? 801 HIS A HB2  1  
ATOM 252   H HB3  . HIS A 1 18  ? -1.957  0.804   -10.237 1.00 0.00 ? 801 HIS A HB3  1  
ATOM 253   H HD2  . HIS A 1 18  ? -4.232  -0.899  -7.771  1.00 0.00 ? 801 HIS A HD2  1  
ATOM 254   H HE1  . HIS A 1 18  ? -2.103  -4.009  -9.719  1.00 0.00 ? 801 HIS A HE1  1  
ATOM 255   H HE2  . HIS A 1 18  ? -4.096  -3.429  -8.292  1.00 0.00 ? 801 HIS A HE2  1  
ATOM 256   N N    . LYS A 1 19  ? -0.737  -0.740  -6.690  1.00 0.00 ? 802 LYS A N    1  
ATOM 257   C CA   . LYS A 1 19  ? -0.820  -1.208  -5.311  1.00 0.00 ? 802 LYS A CA   1  
ATOM 258   C C    . LYS A 1 19  ? 0.191   -0.481  -4.429  1.00 0.00 ? 802 LYS A C    1  
ATOM 259   O O    . LYS A 1 19  ? 1.264   -0.089  -4.890  1.00 0.00 ? 802 LYS A O    1  
ATOM 260   C CB   . LYS A 1 19  ? -0.576  -2.717  -5.247  1.00 0.00 ? 802 LYS A CB   1  
ATOM 261   C CG   . LYS A 1 19  ? -1.776  -3.546  -5.670  1.00 0.00 ? 802 LYS A CG   1  
ATOM 262   C CD   . LYS A 1 19  ? -1.398  -5.000  -5.898  1.00 0.00 ? 802 LYS A CD   1  
ATOM 263   C CE   . LYS A 1 19  ? -2.615  -5.910  -5.824  1.00 0.00 ? 802 LYS A CE   1  
ATOM 264   N NZ   . LYS A 1 19  ? -2.294  -7.300  -6.252  1.00 0.00 ? 802 LYS A NZ   1  
ATOM 265   H H    . LYS A 1 19  ? -0.600  -1.393  -7.408  1.00 0.00 ? 802 LYS A H    1  
ATOM 266   H HA   . LYS A 1 19  ? -1.814  -0.996  -4.948  1.00 0.00 ? 802 LYS A HA   1  
ATOM 267   H HB2  . LYS A 1 19  ? 0.252   -2.964  -5.895  1.00 0.00 ? 802 LYS A HB2  1  
ATOM 268   H HB3  . LYS A 1 19  ? -0.320  -2.985  -4.232  1.00 0.00 ? 802 LYS A HB3  1  
ATOM 269   H HG2  . LYS A 1 19  ? -2.527  -3.497  -4.896  1.00 0.00 ? 802 LYS A HG2  1  
ATOM 270   H HG3  . LYS A 1 19  ? -2.177  -3.139  -6.588  1.00 0.00 ? 802 LYS A HG3  1  
ATOM 271   H HD2  . LYS A 1 19  ? -0.949  -5.098  -6.875  1.00 0.00 ? 802 LYS A HD2  1  
ATOM 272   H HD3  . LYS A 1 19  ? -0.688  -5.300  -5.141  1.00 0.00 ? 802 LYS A HD3  1  
ATOM 273   H HE2  . LYS A 1 19  ? -2.972  -5.929  -4.806  1.00 0.00 ? 802 LYS A HE2  1  
ATOM 274   H HE3  . LYS A 1 19  ? -3.385  -5.512  -6.468  1.00 0.00 ? 802 LYS A HE3  1  
ATOM 275   H HZ1  . LYS A 1 19  ? -2.196  -7.916  -5.419  1.00 0.00 ? 802 LYS A HZ1  1  
ATOM 276   H HZ2  . LYS A 1 19  ? -1.402  -7.313  -6.785  1.00 0.00 ? 802 LYS A HZ2  1  
ATOM 277   H HZ3  . LYS A 1 19  ? -3.053  -7.671  -6.858  1.00 0.00 ? 802 LYS A HZ3  1  
ATOM 278   N N    . LEU A 1 20  ? -0.158  -0.305  -3.159  1.00 0.00 ? 803 LEU A N    1  
ATOM 279   C CA   . LEU A 1 20  ? 0.719   0.373   -2.212  1.00 0.00 ? 803 LEU A CA   1  
ATOM 280   C C    . LEU A 1 20  ? 0.935   -0.477  -0.964  1.00 0.00 ? 803 LEU A C    1  
ATOM 281   O O    . LEU A 1 20  ? 0.064   -1.254  -0.572  1.00 0.00 ? 803 LEU A O    1  
ATOM 282   C CB   . LEU A 1 20  ? 0.131   1.730   -1.823  1.00 0.00 ? 803 LEU A CB   1  
ATOM 283   C CG   . LEU A 1 20  ? -0.463  2.556   -2.964  1.00 0.00 ? 803 LEU A CG   1  
ATOM 284   C CD1  . LEU A 1 20  ? -1.420  3.606   -2.422  1.00 0.00 ? 803 LEU A CD1  1  
ATOM 285   C CD2  . LEU A 1 20  ? 0.643   3.211   -3.780  1.00 0.00 ? 803 LEU A CD2  1  
ATOM 286   H H    . LEU A 1 20  ? -1.026  -0.639  -2.851  1.00 0.00 ? 803 LEU A H    1  
ATOM 287   H HA   . LEU A 1 20  ? 1.672   0.528   -2.696  1.00 0.00 ? 803 LEU A HA   1  
ATOM 288   H HB2  . LEU A 1 20  ? -0.651  1.556   -1.100  1.00 0.00 ? 803 LEU A HB2  1  
ATOM 289   H HB3  . LEU A 1 20  ? 0.918   2.313   -1.366  1.00 0.00 ? 803 LEU A HB3  1  
ATOM 290   H HG   . LEU A 1 20  ? -1.022  1.903   -3.620  1.00 0.00 ? 803 LEU A HG   1  
ATOM 291   H HD11 . LEU A 1 20  ? -2.429  3.224   -2.453  1.00 0.00 ? 803 LEU A HD11 1  
ATOM 292   H HD12 . LEU A 1 20  ? -1.355  4.499   -3.026  1.00 0.00 ? 803 LEU A HD12 1  
ATOM 293   H HD13 . LEU A 1 20  ? -1.155  3.842   -1.401  1.00 0.00 ? 803 LEU A HD13 1  
ATOM 294   H HD21 . LEU A 1 20  ? 0.572   2.884   -4.807  1.00 0.00 ? 803 LEU A HD21 1  
ATOM 295   H HD22 . LEU A 1 20  ? 1.604   2.926   -3.377  1.00 0.00 ? 803 LEU A HD22 1  
ATOM 296   H HD23 . LEU A 1 20  ? 0.536   4.284   -3.735  1.00 0.00 ? 803 LEU A HD23 1  
ATOM 297   N N    . PHE A 1 21  ? 2.099   -0.323  -0.343  1.00 0.00 ? 804 PHE A N    1  
ATOM 298   C CA   . PHE A 1 21  ? 2.429   -1.076  0.862   1.00 0.00 ? 804 PHE A CA   1  
ATOM 299   C C    . PHE A 1 21  ? 2.788   -0.137  2.009   1.00 0.00 ? 804 PHE A C    1  
ATOM 300   O O    . PHE A 1 21  ? 3.633   0.747   1.860   1.00 0.00 ? 804 PHE A O    1  
ATOM 301   C CB   . PHE A 1 21  ? 3.591   -2.034  0.589   1.00 0.00 ? 804 PHE A CB   1  
ATOM 302   C CG   . PHE A 1 21  ? 4.179   -2.633  1.834   1.00 0.00 ? 804 PHE A CG   1  
ATOM 303   C CD1  . PHE A 1 21  ? 3.591   -3.735  2.433   1.00 0.00 ? 804 PHE A CD1  1  
ATOM 304   C CD2  . PHE A 1 21  ? 5.320   -2.093  2.406   1.00 0.00 ? 804 PHE A CD2  1  
ATOM 305   C CE1  . PHE A 1 21  ? 4.130   -4.289  3.579   1.00 0.00 ? 804 PHE A CE1  1  
ATOM 306   C CE2  . PHE A 1 21  ? 5.864   -2.643  3.551   1.00 0.00 ? 804 PHE A CE2  1  
ATOM 307   C CZ   . PHE A 1 21  ? 5.268   -3.742  4.139   1.00 0.00 ? 804 PHE A CZ   1  
ATOM 308   H H    . PHE A 1 21  ? 2.753   0.311   -0.704  1.00 0.00 ? 804 PHE A H    1  
ATOM 309   H HA   . PHE A 1 21  ? 1.559   -1.650  1.141   1.00 0.00 ? 804 PHE A HA   1  
ATOM 310   H HB2  . PHE A 1 21  ? 3.242   -2.843  -0.035  1.00 0.00 ? 804 PHE A HB2  1  
ATOM 311   H HB3  . PHE A 1 21  ? 4.374   -1.499  0.074   1.00 0.00 ? 804 PHE A HB3  1  
ATOM 312   H HD1  . PHE A 1 21  ? 2.701   -4.164  1.996   1.00 0.00 ? 804 PHE A HD1  1  
ATOM 313   H HD2  . PHE A 1 21  ? 5.787   -1.234  1.948   1.00 0.00 ? 804 PHE A HD2  1  
ATOM 314   H HE1  . PHE A 1 21  ? 3.661   -5.148  4.036   1.00 0.00 ? 804 PHE A HE1  1  
ATOM 315   H HE2  . PHE A 1 21  ? 6.753   -2.213  3.988   1.00 0.00 ? 804 PHE A HE2  1  
ATOM 316   H HZ   . PHE A 1 21  ? 5.691   -4.173  5.034   1.00 0.00 ? 804 PHE A HZ   1  
ATOM 317   N N    . ILE A 1 22  ? 2.141   -0.334  3.152   1.00 0.00 ? 805 ILE A N    1  
ATOM 318   C CA   . ILE A 1 22  ? 2.392   0.495   4.325   1.00 0.00 ? 805 ILE A CA   1  
ATOM 319   C C    . ILE A 1 22  ? 2.759   -0.359  5.534   1.00 0.00 ? 805 ILE A C    1  
ATOM 320   O O    . ILE A 1 22  ? 1.997   -1.236  5.941   1.00 0.00 ? 805 ILE A O    1  
ATOM 321   C CB   . ILE A 1 22  ? 1.168   1.361   4.675   1.00 0.00 ? 805 ILE A CB   1  
ATOM 322   C CG1  . ILE A 1 22  ? 0.563   1.965   3.406   1.00 0.00 ? 805 ILE A CG1  1  
ATOM 323   C CG2  . ILE A 1 22  ? 1.557   2.457   5.655   1.00 0.00 ? 805 ILE A CG2  1  
ATOM 324   C CD1  . ILE A 1 22  ? -0.505  3.001   3.679   1.00 0.00 ? 805 ILE A CD1  1  
ATOM 325   H H    . ILE A 1 22  ? 1.479   -1.054  3.209   1.00 0.00 ? 805 ILE A H    1  
ATOM 326   H HA   . ILE A 1 22  ? 3.220   1.152   4.097   1.00 0.00 ? 805 ILE A HA   1  
ATOM 327   H HB   . ILE A 1 22  ? 0.433   0.731   5.151   1.00 0.00 ? 805 ILE A HB   1  
ATOM 328   H HG12 . ILE A 1 22  ? 1.344   2.438   2.832   1.00 0.00 ? 805 ILE A HG12 1  
ATOM 329   H HG13 . ILE A 1 22  ? 0.118   1.175   2.818   1.00 0.00 ? 805 ILE A HG13 1  
ATOM 330   H HG21 . ILE A 1 22  ? 2.563   2.284   6.008   1.00 0.00 ? 805 ILE A HG21 1  
ATOM 331   H HG22 . ILE A 1 22  ? 1.511   3.416   5.160   1.00 0.00 ? 805 ILE A HG22 1  
ATOM 332   H HG23 . ILE A 1 22  ? 0.876   2.451   6.493   1.00 0.00 ? 805 ILE A HG23 1  
ATOM 333   H HD11 . ILE A 1 22  ? -0.038  3.934   3.959   1.00 0.00 ? 805 ILE A HD11 1  
ATOM 334   H HD12 . ILE A 1 22  ? -1.100  3.148   2.790   1.00 0.00 ? 805 ILE A HD12 1  
ATOM 335   H HD13 . ILE A 1 22  ? -1.139  2.660   4.484   1.00 0.00 ? 805 ILE A HD13 1  
ATOM 336   N N    . SER A 1 23  ? 3.930   -0.096  6.104   1.00 0.00 ? 806 SER A N    1  
ATOM 337   C CA   . SER A 1 23  ? 4.399   -0.842  7.266   1.00 0.00 ? 806 SER A CA   1  
ATOM 338   C C    . SER A 1 23  ? 4.602   0.084   8.461   1.00 0.00 ? 806 SER A C    1  
ATOM 339   O O    . SER A 1 23  ? 4.762   1.294   8.303   1.00 0.00 ? 806 SER A O    1  
ATOM 340   C CB   . SER A 1 23  ? 5.707   -1.566  6.939   1.00 0.00 ? 806 SER A CB   1  
ATOM 341   O OG   . SER A 1 23  ? 6.733   -0.644  6.614   1.00 0.00 ? 806 SER A OG   1  
ATOM 342   H H    . SER A 1 23  ? 4.493   0.615   5.733   1.00 0.00 ? 806 SER A H    1  
ATOM 343   H HA   . SER A 1 23  ? 3.646   -1.574  7.516   1.00 0.00 ? 806 SER A HA   1  
ATOM 344   H HB2  . SER A 1 23  ? 6.018   -2.145  7.795   1.00 0.00 ? 806 SER A HB2  1  
ATOM 345   H HB3  . SER A 1 23  ? 5.550   -2.224  6.097   1.00 0.00 ? 806 SER A HB3  1  
ATOM 346   H HG   . SER A 1 23  ? 7.460   -0.742  7.234   1.00 0.00 ? 806 SER A HG   1  
ATOM 347   N N    . GLY A 1 24  ? 4.595   -0.494  9.658   1.00 0.00 ? 807 GLY A N    1  
ATOM 348   C CA   . GLY A 1 24  ? 4.779   0.294   10.863  1.00 0.00 ? 807 GLY A CA   1  
ATOM 349   C C    . GLY A 1 24  ? 3.519   1.028   11.274  1.00 0.00 ? 807 GLY A C    1  
ATOM 350   O O    . GLY A 1 24  ? 3.546   2.235   11.519  1.00 0.00 ? 807 GLY A O    1  
ATOM 351   H H    . GLY A 1 24  ? 4.464   -1.463  9.724   1.00 0.00 ? 807 GLY A H    1  
ATOM 352   H HA2  . GLY A 1 24  ? 5.079   -0.363  11.666  1.00 0.00 ? 807 GLY A HA2  1  
ATOM 353   H HA3  . GLY A 1 24  ? 5.563   1.017   10.691  1.00 0.00 ? 807 GLY A HA3  1  
ATOM 354   N N    . LEU A 1 25  ? 2.409   0.301   11.347  1.00 0.00 ? 808 LEU A N    1  
ATOM 355   C CA   . LEU A 1 25  ? 1.131   0.891   11.730  1.00 0.00 ? 808 LEU A CA   1  
ATOM 356   C C    . LEU A 1 25  ? 0.689   0.390   13.101  1.00 0.00 ? 808 LEU A C    1  
ATOM 357   O O    . LEU A 1 25  ? 0.905   -0.765  13.467  1.00 0.00 ? 808 LEU A O    1  
ATOM 358   C CB   . LEU A 1 25  ? 0.063   0.563   10.685  1.00 0.00 ? 808 LEU A CB   1  
ATOM 359   C CG   . LEU A 1 25  ? 0.150   1.338   9.370   1.00 0.00 ? 808 LEU A CG   1  
ATOM 360   C CD1  . LEU A 1 25  ? -0.609  0.611   8.271   1.00 0.00 ? 808 LEU A CD1  1  
ATOM 361   C CD2  . LEU A 1 25  ? -0.386  2.751   9.547   1.00 0.00 ? 808 LEU A CD2  1  
ATOM 362   H H    . LEU A 1 25  ? 2.450   -0.656  11.140  1.00 0.00 ? 808 LEU A H    1  
ATOM 363   H HA   . LEU A 1 25  ? 1.262   1.962   11.776  1.00 0.00 ? 808 LEU A HA   1  
ATOM 364   H HB2  . LEU A 1 25  ? 0.138   -0.488  10.455  1.00 0.00 ? 808 LEU A HB2  1  
ATOM 365   H HB3  . LEU A 1 25  ? -0.903  0.766   11.126  1.00 0.00 ? 808 LEU A HB3  1  
ATOM 366   H HG   . LEU A 1 25  ? 1.187   1.408   9.069   1.00 0.00 ? 808 LEU A HG   1  
ATOM 367   H HD11 . LEU A 1 25  ? -1.564  0.282   8.651   1.00 0.00 ? 808 LEU A HD11 1  
ATOM 368   H HD12 . LEU A 1 25  ? -0.037  -0.244  7.943   1.00 0.00 ? 808 LEU A HD12 1  
ATOM 369   H HD13 . LEU A 1 25  ? -0.764  1.281   7.437   1.00 0.00 ? 808 LEU A HD13 1  
ATOM 370   H HD21 . LEU A 1 25  ? -0.194  3.085   10.556  1.00 0.00 ? 808 LEU A HD21 1  
ATOM 371   H HD22 . LEU A 1 25  ? -1.450  2.758   9.362   1.00 0.00 ? 808 LEU A HD22 1  
ATOM 372   H HD23 . LEU A 1 25  ? 0.106   3.413   8.849   1.00 0.00 ? 808 LEU A HD23 1  
ATOM 373   N N    . PRO A 1 26  ? 0.052   1.279   13.878  1.00 0.00 ? 809 PRO A N    1  
ATOM 374   C CA   . PRO A 1 26  ? -0.437  0.949   15.220  1.00 0.00 ? 809 PRO A CA   1  
ATOM 375   C C    . PRO A 1 26  ? -1.618  -0.015  15.186  1.00 0.00 ? 809 PRO A C    1  
ATOM 376   O O    . PRO A 1 26  ? -2.606  0.221   14.490  1.00 0.00 ? 809 PRO A O    1  
ATOM 377   C CB   . PRO A 1 26  ? -0.870  2.305   15.783  1.00 0.00 ? 809 PRO A CB   1  
ATOM 378   C CG   . PRO A 1 26  ? -1.186  3.130   14.583  1.00 0.00 ? 809 PRO A CG   1  
ATOM 379   C CD   . PRO A 1 26  ? -0.240  2.673   13.507  1.00 0.00 ? 809 PRO A CD   1  
ATOM 380   H HA   . PRO A 1 26  ? 0.346   0.535   15.837  1.00 0.00 ? 809 PRO A HA   1  
ATOM 381   H HB2  . PRO A 1 26  ? -1.739  2.175   16.414  1.00 0.00 ? 809 PRO A HB2  1  
ATOM 382   H HB3  . PRO A 1 26  ? -0.063  2.735   16.357  1.00 0.00 ? 809 PRO A HB3  1  
ATOM 383   H HG2  . PRO A 1 26  ? -2.208  2.962   14.281  1.00 0.00 ? 809 PRO A HG2  1  
ATOM 384   H HG3  . PRO A 1 26  ? -1.025  4.175   14.804  1.00 0.00 ? 809 PRO A HG3  1  
ATOM 385   H HD2  . PRO A 1 26  ? -0.718  2.723   12.540  1.00 0.00 ? 809 PRO A HD2  1  
ATOM 386   H HD3  . PRO A 1 26  ? 0.660   3.271   13.517  1.00 0.00 ? 809 PRO A HD3  1  
ATOM 387   N N    . PHE A 1 27  ? -1.511  -1.102  15.943  1.00 0.00 ? 810 PHE A N    1  
ATOM 388   C CA   . PHE A 1 27  ? -2.570  -2.103  15.998  1.00 0.00 ? 810 PHE A CA   1  
ATOM 389   C C    . PHE A 1 27  ? -3.940  -1.439  16.103  1.00 0.00 ? 810 PHE A C    1  
ATOM 390   O O    . PHE A 1 27  ? -4.915  -1.908  15.515  1.00 0.00 ? 810 PHE A O    1  
ATOM 391   C CB   . PHE A 1 27  ? -2.353  -3.040  17.188  1.00 0.00 ? 810 PHE A CB   1  
ATOM 392   C CG   . PHE A 1 27  ? -0.909  -3.373  17.434  1.00 0.00 ? 810 PHE A CG   1  
ATOM 393   C CD1  . PHE A 1 27  ? -0.235  -4.252  16.601  1.00 0.00 ? 810 PHE A CD1  1  
ATOM 394   C CD2  . PHE A 1 27  ? -0.226  -2.807  18.498  1.00 0.00 ? 810 PHE A CD2  1  
ATOM 395   C CE1  . PHE A 1 27  ? 1.094   -4.559  16.824  1.00 0.00 ? 810 PHE A CE1  1  
ATOM 396   C CE2  . PHE A 1 27  ? 1.103   -3.111  18.726  1.00 0.00 ? 810 PHE A CE2  1  
ATOM 397   C CZ   . PHE A 1 27  ? 1.763   -3.989  17.888  1.00 0.00 ? 810 PHE A CZ   1  
ATOM 398   H H    . PHE A 1 27  ? -0.699  -1.235  16.476  1.00 0.00 ? 810 PHE A H    1  
ATOM 399   H HA   . PHE A 1 27  ? -2.530  -2.678  15.086  1.00 0.00 ? 810 PHE A HA   1  
ATOM 400   H HB2  . PHE A 1 27  ? -2.742  -2.574  18.080  1.00 0.00 ? 810 PHE A HB2  1  
ATOM 401   H HB3  . PHE A 1 27  ? -2.882  -3.964  17.010  1.00 0.00 ? 810 PHE A HB3  1  
ATOM 402   H HD1  . PHE A 1 27  ? -0.759  -4.699  15.767  1.00 0.00 ? 810 PHE A HD1  1  
ATOM 403   H HD2  . PHE A 1 27  ? -0.741  -2.121  19.154  1.00 0.00 ? 810 PHE A HD2  1  
ATOM 404   H HE1  . PHE A 1 27  ? 1.606   -5.246  16.167  1.00 0.00 ? 810 PHE A HE1  1  
ATOM 405   H HE2  . PHE A 1 27  ? 1.625   -2.663  19.559  1.00 0.00 ? 810 PHE A HE2  1  
ATOM 406   H HZ   . PHE A 1 27  ? 2.802   -4.227  18.064  1.00 0.00 ? 810 PHE A HZ   1  
ATOM 407   N N    . SER A 1 28  ? -4.005  -0.346  16.856  1.00 0.00 ? 811 SER A N    1  
ATOM 408   C CA   . SER A 1 28  ? -5.256  0.381   17.041  1.00 0.00 ? 811 SER A CA   1  
ATOM 409   C C    . SER A 1 28  ? -5.874  0.751   15.697  1.00 0.00 ? 811 SER A C    1  
ATOM 410   O O    . SER A 1 28  ? -7.071  0.559   15.477  1.00 0.00 ? 811 SER A O    1  
ATOM 411   C CB   . SER A 1 28  ? -5.018  1.644   17.871  1.00 0.00 ? 811 SER A CB   1  
ATOM 412   O OG   . SER A 1 28  ? -6.244  2.262   18.222  1.00 0.00 ? 811 SER A OG   1  
ATOM 413   H H    . SER A 1 28  ? -3.193  -0.021  17.299  1.00 0.00 ? 811 SER A H    1  
ATOM 414   H HA   . SER A 1 28  ? -5.939  -0.265  17.573  1.00 0.00 ? 811 SER A HA   1  
ATOM 415   H HB2  . SER A 1 28  ? -4.489  1.383   18.775  1.00 0.00 ? 811 SER A HB2  1  
ATOM 416   H HB3  . SER A 1 28  ? -4.428  2.343   17.297  1.00 0.00 ? 811 SER A HB3  1  
ATOM 417   H HG   . SER A 1 28  ? -6.110  2.830   18.984  1.00 0.00 ? 811 SER A HG   1  
ATOM 418   N N    . CYS A 1 29  ? -5.050  1.282   14.800  1.00 0.00 ? 812 CYS A N    1  
ATOM 419   C CA   . CYS A 1 29  ? -5.515  1.681   13.476  1.00 0.00 ? 812 CYS A CA   1  
ATOM 420   C C    . CYS A 1 29  ? -6.548  0.694   12.943  1.00 0.00 ? 812 CYS A C    1  
ATOM 421   O O    . CYS A 1 29  ? -6.439  -0.514  13.158  1.00 0.00 ? 812 CYS A O    1  
ATOM 422   C CB   . CYS A 1 29  ? -4.336  1.778   12.507  1.00 0.00 ? 812 CYS A CB   1  
ATOM 423   S SG   . CYS A 1 29  ? -4.776  2.404   10.869  1.00 0.00 ? 812 CYS A SG   1  
ATOM 424   H H    . CYS A 1 29  ? -4.107  1.411   15.034  1.00 0.00 ? 812 CYS A H    1  
ATOM 425   H HA   . CYS A 1 29  ? -5.977  2.653   13.567  1.00 0.00 ? 812 CYS A HA   1  
ATOM 426   H HB2  . CYS A 1 29  ? -3.592  2.442   12.922  1.00 0.00 ? 812 CYS A HB2  1  
ATOM 427   H HB3  . CYS A 1 29  ? -3.902  0.797   12.380  1.00 0.00 ? 812 CYS A HB3  1  
ATOM 428   H HG   . CYS A 1 29  ? -5.420  3.550   11.029  1.00 0.00 ? 812 CYS A HG   1  
ATOM 429   N N    . THR A 1 30  ? -7.553  1.216   12.246  1.00 0.00 ? 813 THR A N    1  
ATOM 430   C CA   . THR A 1 30  ? -8.607  0.381   11.683  1.00 0.00 ? 813 THR A CA   1  
ATOM 431   C C    . THR A 1 30  ? -8.761  0.624   10.186  1.00 0.00 ? 813 THR A C    1  
ATOM 432   O O    . THR A 1 30  ? -8.415  1.692   9.681   1.00 0.00 ? 813 THR A O    1  
ATOM 433   C CB   . THR A 1 30  ? -9.958  0.642   12.375  1.00 0.00 ? 813 THR A CB   1  
ATOM 434   O OG1  . THR A 1 30  ? -10.940 -0.286  11.899  1.00 0.00 ? 813 THR A OG1  1  
ATOM 435   C CG2  . THR A 1 30  ? -10.432 2.065   12.120  1.00 0.00 ? 813 THR A CG2  1  
ATOM 436   H H    . THR A 1 30  ? -7.584  2.185   12.108  1.00 0.00 ? 813 THR A H    1  
ATOM 437   H HA   . THR A 1 30  ? -8.337  -0.652  11.845  1.00 0.00 ? 813 THR A HA   1  
ATOM 438   H HB   . THR A 1 30  ? -9.833  0.506   13.440  1.00 0.00 ? 813 THR A HB   1  
ATOM 439   H HG1  . THR A 1 30  ? -11.818 0.036   12.118  1.00 0.00 ? 813 THR A HG1  1  
ATOM 440   H HG21 . THR A 1 30  ? -10.485 2.600   13.056  1.00 0.00 ? 813 THR A HG21 1  
ATOM 441   H HG22 . THR A 1 30  ? -11.410 2.042   11.662  1.00 0.00 ? 813 THR A HG22 1  
ATOM 442   H HG23 . THR A 1 30  ? -9.737  2.562   11.460  1.00 0.00 ? 813 THR A HG23 1  
ATOM 443   N N    . LYS A 1 31  ? -9.282  -0.374  9.481   1.00 0.00 ? 814 LYS A N    1  
ATOM 444   C CA   . LYS A 1 31  ? -9.484  -0.269  8.040   1.00 0.00 ? 814 LYS A CA   1  
ATOM 445   C C    . LYS A 1 31  ? -10.144 1.057   7.678   1.00 0.00 ? 814 LYS A C    1  
ATOM 446   O O    . LYS A 1 31  ? -9.541  1.899   7.013   1.00 0.00 ? 814 LYS A O    1  
ATOM 447   C CB   . LYS A 1 31  ? -10.343 -1.432  7.539   1.00 0.00 ? 814 LYS A CB   1  
ATOM 448   C CG   . LYS A 1 31  ? -10.152 -1.738  6.063   1.00 0.00 ? 814 LYS A CG   1  
ATOM 449   C CD   . LYS A 1 31  ? -11.414 -2.318  5.446   1.00 0.00 ? 814 LYS A CD   1  
ATOM 450   C CE   . LYS A 1 31  ? -11.109 -3.075  4.163   1.00 0.00 ? 814 LYS A CE   1  
ATOM 451   N NZ   . LYS A 1 31  ? -10.467 -4.391  4.435   1.00 0.00 ? 814 LYS A NZ   1  
ATOM 452   H H    . LYS A 1 31  ? -9.538  -1.201  9.940   1.00 0.00 ? 814 LYS A H    1  
ATOM 453   H HA   . LYS A 1 31  ? -8.516  -0.317  7.565   1.00 0.00 ? 814 LYS A HA   1  
ATOM 454   H HB2  . LYS A 1 31  ? -10.093 -2.318  8.104   1.00 0.00 ? 814 LYS A HB2  1  
ATOM 455   H HB3  . LYS A 1 31  ? -11.383 -1.192  7.704   1.00 0.00 ? 814 LYS A HB3  1  
ATOM 456   H HG2  . LYS A 1 31  ? -9.898  -0.824  5.546   1.00 0.00 ? 814 LYS A HG2  1  
ATOM 457   H HG3  . LYS A 1 31  ? -9.348  -2.451  5.954   1.00 0.00 ? 814 LYS A HG3  1  
ATOM 458   H HD2  . LYS A 1 31  ? -11.870 -2.996  6.152   1.00 0.00 ? 814 LYS A HD2  1  
ATOM 459   H HD3  . LYS A 1 31  ? -12.099 -1.512  5.225   1.00 0.00 ? 814 LYS A HD3  1  
ATOM 460   H HE2  . LYS A 1 31  ? -12.032 -3.238  3.629   1.00 0.00 ? 814 LYS A HE2  1  
ATOM 461   H HE3  . LYS A 1 31  ? -10.443 -2.478  3.558   1.00 0.00 ? 814 LYS A HE3  1  
ATOM 462   H HZ1  . LYS A 1 31  ? -9.862  -4.326  5.278   1.00 0.00 ? 814 LYS A HZ1  1  
ATOM 463   H HZ2  . LYS A 1 31  ? -9.883  -4.678  3.624   1.00 0.00 ? 814 LYS A HZ2  1  
ATOM 464   H HZ3  . LYS A 1 31  ? -11.194 -5.117  4.599   1.00 0.00 ? 814 LYS A HZ3  1  
ATOM 465   N N    . GLU A 1 32  ? -11.384 1.236   8.122   1.00 0.00 ? 815 GLU A N    1  
ATOM 466   C CA   . GLU A 1 32  ? -12.125 2.461   7.844   1.00 0.00 ? 815 GLU A CA   1  
ATOM 467   C C    . GLU A 1 32  ? -11.195 3.671   7.845   1.00 0.00 ? 815 GLU A C    1  
ATOM 468   O O    . GLU A 1 32  ? -11.100 4.394   6.853   1.00 0.00 ? 815 GLU A O    1  
ATOM 469   C CB   . GLU A 1 32  ? -13.235 2.658   8.879   1.00 0.00 ? 815 GLU A CB   1  
ATOM 470   C CG   . GLU A 1 32  ? -14.317 1.593   8.820   1.00 0.00 ? 815 GLU A CG   1  
ATOM 471   C CD   . GLU A 1 32  ? -15.564 1.985   9.589   1.00 0.00 ? 815 GLU A CD   1  
ATOM 472   O OE1  . GLU A 1 32  ? -15.592 1.775   10.820  1.00 0.00 ? 815 GLU A OE1  1  
ATOM 473   O OE2  . GLU A 1 32  ? -16.512 2.500   8.960   1.00 0.00 ? 815 GLU A OE2  1  
ATOM 474   H H    . GLU A 1 32  ? -11.811 0.528   8.647   1.00 0.00 ? 815 GLU A H    1  
ATOM 475   H HA   . GLU A 1 32  ? -12.570 2.365   6.866   1.00 0.00 ? 815 GLU A HA   1  
ATOM 476   H HB2  . GLU A 1 32  ? -12.798 2.644   9.866   1.00 0.00 ? 815 GLU A HB2  1  
ATOM 477   H HB3  . GLU A 1 32  ? -13.698 3.620   8.713   1.00 0.00 ? 815 GLU A HB3  1  
ATOM 478   H HG2  . GLU A 1 32  ? -14.586 1.427   7.788   1.00 0.00 ? 815 GLU A HG2  1  
ATOM 479   H HG3  . GLU A 1 32  ? -13.926 0.677   9.240   1.00 0.00 ? 815 GLU A HG3  1  
ATOM 480   N N    . GLU A 1 33  ? -10.511 3.884   8.964   1.00 0.00 ? 816 GLU A N    1  
ATOM 481   C CA   . GLU A 1 33  ? -9.589  5.007   9.094   1.00 0.00 ? 816 GLU A CA   1  
ATOM 482   C C    . GLU A 1 33  ? -8.737  5.159   7.837   1.00 0.00 ? 816 GLU A C    1  
ATOM 483   O O    . GLU A 1 33  ? -8.801  6.179   7.149   1.00 0.00 ? 816 GLU A O    1  
ATOM 484   C CB   . GLU A 1 33  ? -8.687  4.817   10.315  1.00 0.00 ? 816 GLU A CB   1  
ATOM 485   C CG   . GLU A 1 33  ? -9.324  5.269   11.619  1.00 0.00 ? 816 GLU A CG   1  
ATOM 486   C CD   . GLU A 1 33  ? -8.353  5.245   12.782  1.00 0.00 ? 816 GLU A CD   1  
ATOM 487   O OE1  . GLU A 1 33  ? -7.346  5.982   12.729  1.00 0.00 ? 816 GLU A OE1  1  
ATOM 488   O OE2  . GLU A 1 33  ? -8.598  4.489   13.745  1.00 0.00 ? 816 GLU A OE2  1  
ATOM 489   H H    . GLU A 1 33  ? -10.629 3.273   9.721   1.00 0.00 ? 816 GLU A H    1  
ATOM 490   H HA   . GLU A 1 33  ? -10.176 5.904   9.227   1.00 0.00 ? 816 GLU A HA   1  
ATOM 491   H HB2  . GLU A 1 33  ? -8.438  3.770   10.404  1.00 0.00 ? 816 GLU A HB2  1  
ATOM 492   H HB3  . GLU A 1 33  ? -7.779  5.383   10.168  1.00 0.00 ? 816 GLU A HB3  1  
ATOM 493   H HG2  . GLU A 1 33  ? -9.689  6.278   11.496  1.00 0.00 ? 816 GLU A HG2  1  
ATOM 494   H HG3  . GLU A 1 33  ? -10.152 4.614   11.846  1.00 0.00 ? 816 GLU A HG3  1  
ATOM 495   N N    . LEU A 1 34  ? -7.938  4.139   7.544   1.00 0.00 ? 817 LEU A N    1  
ATOM 496   C CA   . LEU A 1 34  ? -7.072  4.158   6.371   1.00 0.00 ? 817 LEU A CA   1  
ATOM 497   C C    . LEU A 1 34  ? -7.884  4.374   5.098   1.00 0.00 ? 817 LEU A C    1  
ATOM 498   O O    . LEU A 1 34  ? -7.435  5.049   4.172   1.00 0.00 ? 817 LEU A O    1  
ATOM 499   C CB   . LEU A 1 34  ? -6.286  2.850   6.272   1.00 0.00 ? 817 LEU A CB   1  
ATOM 500   C CG   . LEU A 1 34  ? -4.948  2.925   5.535   1.00 0.00 ? 817 LEU A CG   1  
ATOM 501   C CD1  . LEU A 1 34  ? -4.083  4.036   6.110   1.00 0.00 ? 817 LEU A CD1  1  
ATOM 502   C CD2  . LEU A 1 34  ? -4.222  1.589   5.610   1.00 0.00 ? 817 LEU A CD2  1  
ATOM 503   H H    . LEU A 1 34  ? -7.931  3.354   8.130   1.00 0.00 ? 817 LEU A H    1  
ATOM 504   H HA   . LEU A 1 34  ? -6.378  4.978   6.485   1.00 0.00 ? 817 LEU A HA   1  
ATOM 505   H HB2  . LEU A 1 34  ? -6.091  2.504   7.276   1.00 0.00 ? 817 LEU A HB2  1  
ATOM 506   H HB3  . LEU A 1 34  ? -6.907  2.129   5.759   1.00 0.00 ? 817 LEU A HB3  1  
ATOM 507   H HG   . LEU A 1 34  ? -5.130  3.149   4.493   1.00 0.00 ? 817 LEU A HG   1  
ATOM 508   H HD11 . LEU A 1 34  ? -4.469  4.993   5.792   1.00 0.00 ? 817 LEU A HD11 1  
ATOM 509   H HD12 . LEU A 1 34  ? -3.069  3.922   5.757   1.00 0.00 ? 817 LEU A HD12 1  
ATOM 510   H HD13 . LEU A 1 34  ? -4.097  3.981   7.189   1.00 0.00 ? 817 LEU A HD13 1  
ATOM 511   H HD21 . LEU A 1 34  ? -4.848  0.868   6.114   1.00 0.00 ? 817 LEU A HD21 1  
ATOM 512   H HD22 . LEU A 1 34  ? -3.300  1.711   6.159   1.00 0.00 ? 817 LEU A HD22 1  
ATOM 513   H HD23 . LEU A 1 34  ? -4.004  1.241   4.611   1.00 0.00 ? 817 LEU A HD23 1  
ATOM 514   N N    . GLU A 1 35  ? -9.081  3.798   5.061   1.00 0.00 ? 818 GLU A N    1  
ATOM 515   C CA   . GLU A 1 35  ? -9.956  3.930   3.901   1.00 0.00 ? 818 GLU A CA   1  
ATOM 516   C C    . GLU A 1 35  ? -10.282 5.395   3.629   1.00 0.00 ? 818 GLU A C    1  
ATOM 517   O O    . GLU A 1 35  ? -10.016 5.909   2.543   1.00 0.00 ? 818 GLU A O    1  
ATOM 518   C CB   . GLU A 1 35  ? -11.248 3.140   4.118   1.00 0.00 ? 818 GLU A CB   1  
ATOM 519   C CG   . GLU A 1 35  ? -12.146 3.095   2.893   1.00 0.00 ? 818 GLU A CG   1  
ATOM 520   C CD   . GLU A 1 35  ? -13.521 2.532   3.197   1.00 0.00 ? 818 GLU A CD   1  
ATOM 521   O OE1  . GLU A 1 35  ? -14.148 2.993   4.174   1.00 0.00 ? 818 GLU A OE1  1  
ATOM 522   O OE2  . GLU A 1 35  ? -13.969 1.630   2.459   1.00 0.00 ? 818 GLU A OE2  1  
ATOM 523   H H    . GLU A 1 35  ? -9.383  3.272   5.830   1.00 0.00 ? 818 GLU A H    1  
ATOM 524   H HA   . GLU A 1 35  ? -9.436  3.524   3.046   1.00 0.00 ? 818 GLU A HA   1  
ATOM 525   H HB2  . GLU A 1 35  ? -10.995 2.126   4.391   1.00 0.00 ? 818 GLU A HB2  1  
ATOM 526   H HB3  . GLU A 1 35  ? -11.802 3.593   4.927   1.00 0.00 ? 818 GLU A HB3  1  
ATOM 527   H HG2  . GLU A 1 35  ? -12.262 4.098   2.510   1.00 0.00 ? 818 GLU A HG2  1  
ATOM 528   H HG3  . GLU A 1 35  ? -11.678 2.476   2.142   1.00 0.00 ? 818 GLU A HG3  1  
ATOM 529   N N    . GLU A 1 36  ? -10.860 6.061   4.624   1.00 0.00 ? 819 GLU A N    1  
ATOM 530   C CA   . GLU A 1 36  ? -11.224 7.467   4.491   1.00 0.00 ? 819 GLU A CA   1  
ATOM 531   C C    . GLU A 1 36  ? -10.010 8.309   4.109   1.00 0.00 ? 819 GLU A C    1  
ATOM 532   O O    . GLU A 1 36  ? -10.115 9.245   3.315   1.00 0.00 ? 819 GLU A O    1  
ATOM 533   C CB   . GLU A 1 36  ? -11.827 7.986   5.798   1.00 0.00 ? 819 GLU A CB   1  
ATOM 534   C CG   . GLU A 1 36  ? -10.997 7.655   7.026   1.00 0.00 ? 819 GLU A CG   1  
ATOM 535   C CD   . GLU A 1 36  ? -11.546 8.289   8.290   1.00 0.00 ? 819 GLU A CD   1  
ATOM 536   O OE1  . GLU A 1 36  ? -12.783 8.314   8.452   1.00 0.00 ? 819 GLU A OE1  1  
ATOM 537   O OE2  . GLU A 1 36  ? -10.736 8.758   9.117   1.00 0.00 ? 819 GLU A OE2  1  
ATOM 538   H H    . GLU A 1 36  ? -11.047 5.597   5.466   1.00 0.00 ? 819 GLU A H    1  
ATOM 539   H HA   . GLU A 1 36  ? -11.962 7.546   3.708   1.00 0.00 ? 819 GLU A HA   1  
ATOM 540   H HB2  . GLU A 1 36  ? -11.925 9.060   5.734   1.00 0.00 ? 819 GLU A HB2  1  
ATOM 541   H HB3  . GLU A 1 36  ? -12.808 7.552   5.924   1.00 0.00 ? 819 GLU A HB3  1  
ATOM 542   H HG2  . GLU A 1 36  ? -10.982 6.583   7.157   1.00 0.00 ? 819 GLU A HG2  1  
ATOM 543   H HG3  . GLU A 1 36  ? -9.989  8.011   6.871   1.00 0.00 ? 819 GLU A HG3  1  
ATOM 544   N N    . ILE A 1 37  ? -8.859  7.971   4.680   1.00 0.00 ? 820 ILE A N    1  
ATOM 545   C CA   . ILE A 1 37  ? -7.625  8.695   4.400   1.00 0.00 ? 820 ILE A CA   1  
ATOM 546   C C    . ILE A 1 37  ? -7.118  8.392   2.994   1.00 0.00 ? 820 ILE A C    1  
ATOM 547   O O    . ILE A 1 37  ? -6.529  9.252   2.337   1.00 0.00 ? 820 ILE A O    1  
ATOM 548   C CB   . ILE A 1 37  ? -6.523  8.345   5.417   1.00 0.00 ? 820 ILE A CB   1  
ATOM 549   C CG1  . ILE A 1 37  ? -7.004  8.633   6.841   1.00 0.00 ? 820 ILE A CG1  1  
ATOM 550   C CG2  . ILE A 1 37  ? -5.254  9.127   5.113   1.00 0.00 ? 820 ILE A CG2  1  
ATOM 551   C CD1  . ILE A 1 37  ? -6.125  8.022   7.910   1.00 0.00 ? 820 ILE A CD1  1  
ATOM 552   H H    . ILE A 1 37  ? -8.839  7.216   5.305   1.00 0.00 ? 820 ILE A H    1  
ATOM 553   H HA   . ILE A 1 37  ? -7.835  9.752   4.476   1.00 0.00 ? 820 ILE A HA   1  
ATOM 554   H HB   . ILE A 1 37  ? -6.301  7.293   5.326   1.00 0.00 ? 820 ILE A HB   1  
ATOM 555   H HG12 . ILE A 1 37  ? -7.023  9.700   6.999   1.00 0.00 ? 820 ILE A HG12 1  
ATOM 556   H HG13 . ILE A 1 37  ? -8.001  8.237   6.963   1.00 0.00 ? 820 ILE A HG13 1  
ATOM 557   H HG21 . ILE A 1 37  ? -5.499  10.168  4.963   1.00 0.00 ? 820 ILE A HG21 1  
ATOM 558   H HG22 . ILE A 1 37  ? -4.568  9.035   5.941   1.00 0.00 ? 820 ILE A HG22 1  
ATOM 559   H HG23 . ILE A 1 37  ? -4.794  8.733   4.219   1.00 0.00 ? 820 ILE A HG23 1  
ATOM 560   H HD11 . ILE A 1 37  ? -6.707  7.860   8.806   1.00 0.00 ? 820 ILE A HD11 1  
ATOM 561   H HD12 . ILE A 1 37  ? -5.733  7.079   7.560   1.00 0.00 ? 820 ILE A HD12 1  
ATOM 562   H HD13 . ILE A 1 37  ? -5.307  8.692   8.130   1.00 0.00 ? 820 ILE A HD13 1  
ATOM 563   N N    . CYS A 1 38  ? -7.352  7.167   2.538   1.00 0.00 ? 821 CYS A N    1  
ATOM 564   C CA   . CYS A 1 38  ? -6.919  6.751   1.208   1.00 0.00 ? 821 CYS A CA   1  
ATOM 565   C C    . CYS A 1 38  ? -7.727  7.461   0.127   1.00 0.00 ? 821 CYS A C    1  
ATOM 566   O O    . CYS A 1 38  ? -7.165  8.046   -0.800  1.00 0.00 ? 821 CYS A O    1  
ATOM 567   C CB   . CYS A 1 38  ? -7.060  5.236   1.055   1.00 0.00 ? 821 CYS A CB   1  
ATOM 568   S SG   . CYS A 1 38  ? -5.827  4.283   1.973   1.00 0.00 ? 821 CYS A SG   1  
ATOM 569   H H    . CYS A 1 38  ? -7.826  6.526   3.108   1.00 0.00 ? 821 CYS A H    1  
ATOM 570   H HA   . CYS A 1 38  ? -5.880  7.020   1.099   1.00 0.00 ? 821 CYS A HA   1  
ATOM 571   H HB2  . CYS A 1 38  ? -8.036  4.934   1.407   1.00 0.00 ? 821 CYS A HB2  1  
ATOM 572   H HB3  . CYS A 1 38  ? -6.967  4.977   0.011   1.00 0.00 ? 821 CYS A HB3  1  
ATOM 573   H HG   . CYS A 1 38  ? -5.726  4.806   3.185   1.00 0.00 ? 821 CYS A HG   1  
ATOM 574   N N    . LYS A 1 39  ? -9.049  7.404   0.250   1.00 0.00 ? 822 LYS A N    1  
ATOM 575   C CA   . LYS A 1 39  ? -9.935  8.041   -0.717  1.00 0.00 ? 822 LYS A CA   1  
ATOM 576   C C    . LYS A 1 39  ? -9.709  9.549   -0.752  1.00 0.00 ? 822 LYS A C    1  
ATOM 577   O O    . LYS A 1 39  ? -10.220 10.242  -1.631  1.00 0.00 ? 822 LYS A O    1  
ATOM 578   C CB   . LYS A 1 39  ? -11.397 7.742   -0.374  1.00 0.00 ? 822 LYS A CB   1  
ATOM 579   C CG   . LYS A 1 39  ? -11.856 8.372   0.930   1.00 0.00 ? 822 LYS A CG   1  
ATOM 580   C CD   . LYS A 1 39  ? -13.355 8.619   0.932   1.00 0.00 ? 822 LYS A CD   1  
ATOM 581   C CE   . LYS A 1 39  ? -13.728 9.781   1.840   1.00 0.00 ? 822 LYS A CE   1  
ATOM 582   N NZ   . LYS A 1 39  ? -13.984 9.333   3.237   1.00 0.00 ? 822 LYS A NZ   1  
ATOM 583   H H    . LYS A 1 39  ? -9.438  6.922   1.010   1.00 0.00 ? 822 LYS A H    1  
ATOM 584   H HA   . LYS A 1 39  ? -9.713  7.632   -1.691  1.00 0.00 ? 822 LYS A HA   1  
ATOM 585   H HB2  . LYS A 1 39  ? -12.024 8.114   -1.170  1.00 0.00 ? 822 LYS A HB2  1  
ATOM 586   H HB3  . LYS A 1 39  ? -11.524 6.672   -0.296  1.00 0.00 ? 822 LYS A HB3  1  
ATOM 587   H HG2  . LYS A 1 39  ? -11.611 7.709   1.746   1.00 0.00 ? 822 LYS A HG2  1  
ATOM 588   H HG3  . LYS A 1 39  ? -11.345 9.315   1.063   1.00 0.00 ? 822 LYS A HG3  1  
ATOM 589   H HD2  . LYS A 1 39  ? -13.675 8.847   -0.074  1.00 0.00 ? 822 LYS A HD2  1  
ATOM 590   H HD3  . LYS A 1 39  ? -13.858 7.727   1.278   1.00 0.00 ? 822 LYS A HD3  1  
ATOM 591   H HE2  . LYS A 1 39  ? -12.917 10.493  1.842   1.00 0.00 ? 822 LYS A HE2  1  
ATOM 592   H HE3  . LYS A 1 39  ? -14.619 10.252  1.453   1.00 0.00 ? 822 LYS A HE3  1  
ATOM 593   H HZ1  . LYS A 1 39  ? -14.438 10.096  3.779   1.00 0.00 ? 822 LYS A HZ1  1  
ATOM 594   H HZ2  . LYS A 1 39  ? -13.089 9.080   3.701   1.00 0.00 ? 822 LYS A HZ2  1  
ATOM 595   H HZ3  . LYS A 1 39  ? -14.610 8.503   3.237   1.00 0.00 ? 822 LYS A HZ3  1  
ATOM 596   N N    . ALA A 1 40  ? -8.938  10.049  0.207   1.00 0.00 ? 823 ALA A N    1  
ATOM 597   C CA   . ALA A 1 40  ? -8.640  11.474  0.283   1.00 0.00 ? 823 ALA A CA   1  
ATOM 598   C C    . ALA A 1 40  ? -7.688  11.897  -0.830  1.00 0.00 ? 823 ALA A C    1  
ATOM 599   O O    . ALA A 1 40  ? -7.653  13.064  -1.222  1.00 0.00 ? 823 ALA A O    1  
ATOM 600   C CB   . ALA A 1 40  ? -8.051  11.819  1.643   1.00 0.00 ? 823 ALA A CB   1  
ATOM 601   H H    . ALA A 1 40  ? -8.558  9.446   0.880   1.00 0.00 ? 823 ALA A H    1  
ATOM 602   H HA   . ALA A 1 40  ? -9.569  12.015  0.173   1.00 0.00 ? 823 ALA A HA   1  
ATOM 603   H HB1  . ALA A 1 40  ? -6.973  11.795  1.584   1.00 0.00 ? 823 ALA A HB1  1  
ATOM 604   H HB2  . ALA A 1 40  ? -8.374  12.807  1.935   1.00 0.00 ? 823 ALA A HB2  1  
ATOM 605   H HB3  . ALA A 1 40  ? -8.388  11.099  2.374   1.00 0.00 ? 823 ALA A HB3  1  
ATOM 606   N N    . HIS A 1 41  ? -6.915  10.940  -1.336  1.00 0.00 ? 824 HIS A N    1  
ATOM 607   C CA   . HIS A 1 41  ? -5.961  11.214  -2.405  1.00 0.00 ? 824 HIS A CA   1  
ATOM 608   C C    . HIS A 1 41  ? -6.568  10.896  -3.769  1.00 0.00 ? 824 HIS A C    1  
ATOM 609   O O    . HIS A 1 41  ? -6.496  11.703  -4.694  1.00 0.00 ? 824 HIS A O    1  
ATOM 610   C CB   . HIS A 1 41  ? -4.685  10.398  -2.199  1.00 0.00 ? 824 HIS A CB   1  
ATOM 611   C CG   . HIS A 1 41  ? -4.001  10.675  -0.895  1.00 0.00 ? 824 HIS A CG   1  
ATOM 612   N ND1  . HIS A 1 41  ? -3.406  11.883  -0.599  1.00 0.00 ? 824 HIS A ND1  1  
ATOM 613   C CD2  . HIS A 1 41  ? -3.822  9.891   0.194   1.00 0.00 ? 824 HIS A CD2  1  
ATOM 614   C CE1  . HIS A 1 41  ? -2.889  11.830  0.615   1.00 0.00 ? 824 HIS A CE1  1  
ATOM 615   N NE2  . HIS A 1 41  ? -3.128  10.632  1.119   1.00 0.00 ? 824 HIS A NE2  1  
ATOM 616   H H    . HIS A 1 41  ? -6.989  10.030  -0.982  1.00 0.00 ? 824 HIS A H    1  
ATOM 617   H HA   . HIS A 1 41  ? -5.717  12.264  -2.370  1.00 0.00 ? 824 HIS A HA   1  
ATOM 618   H HB2  . HIS A 1 41  ? -4.929  9.347   -2.229  1.00 0.00 ? 824 HIS A HB2  1  
ATOM 619   H HB3  . HIS A 1 41  ? -3.989  10.624  -2.994  1.00 0.00 ? 824 HIS A HB3  1  
ATOM 620   H HD2  . HIS A 1 41  ? -4.161  8.872   0.314   1.00 0.00 ? 824 HIS A HD2  1  
ATOM 621   H HE1  . HIS A 1 41  ? -2.360  12.629  1.113   1.00 0.00 ? 824 HIS A HE1  1  
ATOM 622   H HE2  . HIS A 1 41  ? -2.779  10.299  1.971   1.00 0.00 ? 824 HIS A HE2  1  
ATOM 623   N N    . GLY A 1 42  ? -7.165  9.713   -3.885  1.00 0.00 ? 825 GLY A N    1  
ATOM 624   C CA   . GLY A 1 42  ? -7.774  9.310   -5.138  1.00 0.00 ? 825 GLY A CA   1  
ATOM 625   C C    . GLY A 1 42  ? -8.841  8.250   -4.950  1.00 0.00 ? 825 GLY A C    1  
ATOM 626   O O    . GLY A 1 42  ? -9.449  8.153   -3.883  1.00 0.00 ? 825 GLY A O    1  
ATOM 627   H H    . GLY A 1 42  ? -7.191  9.110   -3.112  1.00 0.00 ? 825 GLY A H    1  
ATOM 628   H HA2  . GLY A 1 42  ? -8.219  10.175  -5.605  1.00 0.00 ? 825 GLY A HA2  1  
ATOM 629   H HA3  . GLY A 1 42  ? -7.005  8.918   -5.789  1.00 0.00 ? 825 GLY A HA3  1  
ATOM 630   N N    . THR A 1 43  ? -9.072  7.453   -5.989  1.00 0.00 ? 826 THR A N    1  
ATOM 631   C CA   . THR A 1 43  ? -10.075 6.397   -5.934  1.00 0.00 ? 826 THR A CA   1  
ATOM 632   C C    . THR A 1 43  ? -9.503  5.126   -5.317  1.00 0.00 ? 826 THR A C    1  
ATOM 633   O O    . THR A 1 43  ? -8.492  4.599   -5.781  1.00 0.00 ? 826 THR A O    1  
ATOM 634   C CB   . THR A 1 43  ? -10.625 6.071   -7.335  1.00 0.00 ? 826 THR A CB   1  
ATOM 635   O OG1  . THR A 1 43  ? -11.241 7.233   -7.902  1.00 0.00 ? 826 THR A OG1  1  
ATOM 636   C CG2  . THR A 1 43  ? -11.635 4.936   -7.270  1.00 0.00 ? 826 THR A CG2  1  
ATOM 637   H H    . THR A 1 43  ? -8.555  7.580   -6.811  1.00 0.00 ? 826 THR A H    1  
ATOM 638   H HA   . THR A 1 43  ? -10.894 6.746   -5.321  1.00 0.00 ? 826 THR A HA   1  
ATOM 639   H HB   . THR A 1 43  ? -9.802  5.766   -7.966  1.00 0.00 ? 826 THR A HB   1  
ATOM 640   H HG1  . THR A 1 43  ? -11.439 7.071   -8.828  1.00 0.00 ? 826 THR A HG1  1  
ATOM 641   H HG21 . THR A 1 43  ? -11.685 4.557   -6.260  1.00 0.00 ? 826 THR A HG21 1  
ATOM 642   H HG22 . THR A 1 43  ? -11.329 4.143   -7.937  1.00 0.00 ? 826 THR A HG22 1  
ATOM 643   H HG23 . THR A 1 43  ? -12.606 5.301   -7.566  1.00 0.00 ? 826 THR A HG23 1  
ATOM 644   N N    . VAL A 1 44  ? -10.156 4.637   -4.267  1.00 0.00 ? 827 VAL A N    1  
ATOM 645   C CA   . VAL A 1 44  ? -9.712  3.426   -3.588  1.00 0.00 ? 827 VAL A CA   1  
ATOM 646   C C    . VAL A 1 44  ? -10.402 2.192   -4.158  1.00 0.00 ? 827 VAL A C    1  
ATOM 647   O O    . VAL A 1 44  ? -11.560 1.913   -3.846  1.00 0.00 ? 827 VAL A O    1  
ATOM 648   C CB   . VAL A 1 44  ? -9.987  3.500   -2.074  1.00 0.00 ? 827 VAL A CB   1  
ATOM 649   C CG1  . VAL A 1 44  ? -9.576  2.203   -1.393  1.00 0.00 ? 827 VAL A CG1  1  
ATOM 650   C CG2  . VAL A 1 44  ? -9.262  4.688   -1.459  1.00 0.00 ? 827 VAL A CG2  1  
ATOM 651   H H    . VAL A 1 44  ? -10.955 5.102   -3.943  1.00 0.00 ? 827 VAL A H    1  
ATOM 652   H HA   . VAL A 1 44  ? -8.646  3.332   -3.735  1.00 0.00 ? 827 VAL A HA   1  
ATOM 653   H HB   . VAL A 1 44  ? -11.048 3.637   -1.927  1.00 0.00 ? 827 VAL A HB   1  
ATOM 654   H HG11 . VAL A 1 44  ? -8.515  2.223   -1.191  1.00 0.00 ? 827 VAL A HG11 1  
ATOM 655   H HG12 . VAL A 1 44  ? -10.118 2.096   -0.465  1.00 0.00 ? 827 VAL A HG12 1  
ATOM 656   H HG13 . VAL A 1 44  ? -9.803  1.369   -2.041  1.00 0.00 ? 827 VAL A HG13 1  
ATOM 657   H HG21 . VAL A 1 44  ? -8.857  4.403   -0.499  1.00 0.00 ? 827 VAL A HG21 1  
ATOM 658   H HG22 . VAL A 1 44  ? -8.458  4.997   -2.111  1.00 0.00 ? 827 VAL A HG22 1  
ATOM 659   H HG23 . VAL A 1 44  ? -9.955  5.505   -1.330  1.00 0.00 ? 827 VAL A HG23 1  
ATOM 660   N N    . LYS A 1 45  ? -9.682  1.454   -4.996  1.00 0.00 ? 828 LYS A N    1  
ATOM 661   C CA   . LYS A 1 45  ? -10.222 0.247   -5.611  1.00 0.00 ? 828 LYS A CA   1  
ATOM 662   C C    . LYS A 1 45  ? -10.474 -0.832  -4.562  1.00 0.00 ? 828 LYS A C    1  
ATOM 663   O O    . LYS A 1 45  ? -11.539 -1.449  -4.536  1.00 0.00 ? 828 LYS A O    1  
ATOM 664   C CB   . LYS A 1 45  ? -9.262  -0.280  -6.680  1.00 0.00 ? 828 LYS A CB   1  
ATOM 665   C CG   . LYS A 1 45  ? -9.139  0.631   -7.889  1.00 0.00 ? 828 LYS A CG   1  
ATOM 666   C CD   . LYS A 1 45  ? -10.410 0.627   -8.721  1.00 0.00 ? 828 LYS A CD   1  
ATOM 667   C CE   . LYS A 1 45  ? -10.612 -0.706  -9.424  1.00 0.00 ? 828 LYS A CE   1  
ATOM 668   N NZ   . LYS A 1 45  ? -11.283 -1.702  -8.543  1.00 0.00 ? 828 LYS A NZ   1  
ATOM 669   H H    . LYS A 1 45  ? -8.764  1.727   -5.207  1.00 0.00 ? 828 LYS A H    1  
ATOM 670   H HA   . LYS A 1 45  ? -11.161 0.504   -6.078  1.00 0.00 ? 828 LYS A HA   1  
ATOM 671   H HB2  . LYS A 1 45  ? -8.282  -0.396  -6.240  1.00 0.00 ? 828 LYS A HB2  1  
ATOM 672   H HB3  . LYS A 1 45  ? -9.612  -1.245  -7.016  1.00 0.00 ? 828 LYS A HB3  1  
ATOM 673   H HG2  . LYS A 1 45  ? -8.945  1.638   -7.551  1.00 0.00 ? 828 LYS A HG2  1  
ATOM 674   H HG3  . LYS A 1 45  ? -8.316  0.290   -8.502  1.00 0.00 ? 828 LYS A HG3  1  
ATOM 675   H HD2  . LYS A 1 45  ? -11.254 0.812   -8.075  1.00 0.00 ? 828 LYS A HD2  1  
ATOM 676   H HD3  . LYS A 1 45  ? -10.345 1.410   -9.464  1.00 0.00 ? 828 LYS A HD3  1  
ATOM 677   H HE2  . LYS A 1 45  ? -11.220 -0.548  -10.302 1.00 0.00 ? 828 LYS A HE2  1  
ATOM 678   H HE3  . LYS A 1 45  ? -9.647  -1.092  -9.720  1.00 0.00 ? 828 LYS A HE3  1  
ATOM 679   H HZ1  . LYS A 1 45  ? -12.074 -2.150  -9.049  1.00 0.00 ? 828 LYS A HZ1  1  
ATOM 680   H HZ2  . LYS A 1 45  ? -11.652 -1.233  -7.691  1.00 0.00 ? 828 LYS A HZ2  1  
ATOM 681   H HZ3  . LYS A 1 45  ? -10.607 -2.438  -8.255  1.00 0.00 ? 828 LYS A HZ3  1  
ATOM 682   N N    . ASP A 1 46  ? -9.489  -1.052  -3.699  1.00 0.00 ? 829 ASP A N    1  
ATOM 683   C CA   . ASP A 1 46  ? -9.604  -2.055  -2.646  1.00 0.00 ? 829 ASP A CA   1  
ATOM 684   C C    . ASP A 1 46  ? -8.570  -1.814  -1.551  1.00 0.00 ? 829 ASP A C    1  
ATOM 685   O O    . ASP A 1 46  ? -7.508  -1.242  -1.799  1.00 0.00 ? 829 ASP A O    1  
ATOM 686   C CB   . ASP A 1 46  ? -9.432  -3.459  -3.228  1.00 0.00 ? 829 ASP A CB   1  
ATOM 687   C CG   . ASP A 1 46  ? -10.082 -4.525  -2.369  1.00 0.00 ? 829 ASP A CG   1  
ATOM 688   O OD1  . ASP A 1 46  ? -11.075 -4.209  -1.681  1.00 0.00 ? 829 ASP A OD1  1  
ATOM 689   O OD2  . ASP A 1 46  ? -9.598  -5.676  -2.385  1.00 0.00 ? 829 ASP A OD2  1  
ATOM 690   H H    . ASP A 1 46  ? -8.664  -0.528  -3.771  1.00 0.00 ? 829 ASP A H    1  
ATOM 691   H HA   . ASP A 1 46  ? -10.591 -1.972  -2.216  1.00 0.00 ? 829 ASP A HA   1  
ATOM 692   H HB2  . ASP A 1 46  ? -9.880  -3.492  -4.210  1.00 0.00 ? 829 ASP A HB2  1  
ATOM 693   H HB3  . ASP A 1 46  ? -8.378  -3.680  -3.310  1.00 0.00 ? 829 ASP A HB3  1  
ATOM 694   N N    . LEU A 1 47  ? -8.888  -2.254  -0.338  1.00 0.00 ? 830 LEU A N    1  
ATOM 695   C CA   . LEU A 1 47  ? -7.987  -2.085  0.797   1.00 0.00 ? 830 LEU A CA   1  
ATOM 696   C C    . LEU A 1 47  ? -7.974  -3.335  1.672   1.00 0.00 ? 830 LEU A C    1  
ATOM 697   O O    . LEU A 1 47  ? -9.026  -3.862  2.034   1.00 0.00 ? 830 LEU A O    1  
ATOM 698   C CB   . LEU A 1 47  ? -8.404  -0.871  1.629   1.00 0.00 ? 830 LEU A CB   1  
ATOM 699   C CG   . LEU A 1 47  ? -7.279  -0.148  2.371   1.00 0.00 ? 830 LEU A CG   1  
ATOM 700   C CD1  . LEU A 1 47  ? -7.734  1.234   2.815   1.00 0.00 ? 830 LEU A CD1  1  
ATOM 701   C CD2  . LEU A 1 47  ? -6.817  -0.968  3.567   1.00 0.00 ? 830 LEU A CD2  1  
ATOM 702   H H    . LEU A 1 47  ? -9.748  -2.702  -0.201  1.00 0.00 ? 830 LEU A H    1  
ATOM 703   H HA   . LEU A 1 47  ? -6.993  -1.922  0.409   1.00 0.00 ? 830 LEU A HA   1  
ATOM 704   H HB2  . LEU A 1 47  ? -8.871  -0.160  0.965   1.00 0.00 ? 830 LEU A HB2  1  
ATOM 705   H HB3  . LEU A 1 47  ? -9.125  -1.205  2.362   1.00 0.00 ? 830 LEU A HB3  1  
ATOM 706   H HG   . LEU A 1 47  ? -6.438  -0.024  1.704   1.00 0.00 ? 830 LEU A HG   1  
ATOM 707   H HD11 . LEU A 1 47  ? -8.455  1.137   3.613   1.00 0.00 ? 830 LEU A HD11 1  
ATOM 708   H HD12 . LEU A 1 47  ? -8.188  1.748   1.980   1.00 0.00 ? 830 LEU A HD12 1  
ATOM 709   H HD13 . LEU A 1 47  ? -6.882  1.798   3.164   1.00 0.00 ? 830 LEU A HD13 1  
ATOM 710   H HD21 . LEU A 1 47  ? -7.677  -1.363  4.087   1.00 0.00 ? 830 LEU A HD21 1  
ATOM 711   H HD22 . LEU A 1 47  ? -6.249  -0.339  4.237   1.00 0.00 ? 830 LEU A HD22 1  
ATOM 712   H HD23 . LEU A 1 47  ? -6.196  -1.783  3.226   1.00 0.00 ? 830 LEU A HD23 1  
ATOM 713   N N    . ARG A 1 48  ? -6.776  -3.802  2.009   1.00 0.00 ? 831 ARG A N    1  
ATOM 714   C CA   . ARG A 1 48  ? -6.627  -4.989  2.843   1.00 0.00 ? 831 ARG A CA   1  
ATOM 715   C C    . ARG A 1 48  ? -5.570  -4.766  3.921   1.00 0.00 ? 831 ARG A C    1  
ATOM 716   O O    . ARG A 1 48  ? -4.558  -4.104  3.687   1.00 0.00 ? 831 ARG A O    1  
ATOM 717   C CB   . ARG A 1 48  ? -6.247  -6.197  1.984   1.00 0.00 ? 831 ARG A CB   1  
ATOM 718   C CG   . ARG A 1 48  ? -6.206  -7.505  2.757   1.00 0.00 ? 831 ARG A CG   1  
ATOM 719   C CD   . ARG A 1 48  ? -7.599  -8.083  2.948   1.00 0.00 ? 831 ARG A CD   1  
ATOM 720   N NE   . ARG A 1 48  ? -7.982  -8.964  1.848   1.00 0.00 ? 831 ARG A NE   1  
ATOM 721   C CZ   . ARG A 1 48  ? -8.995  -9.822  1.912   1.00 0.00 ? 831 ARG A CZ   1  
ATOM 722   N NH1  . ARG A 1 48  ? -9.722  -9.913  3.017   1.00 0.00 ? 831 ARG A NH1  1  
ATOM 723   N NH2  . ARG A 1 48  ? -9.281  -10.590 0.869   1.00 0.00 ? 831 ARG A NH2  1  
ATOM 724   H H    . ARG A 1 48  ? -5.974  -3.338  1.690   1.00 0.00 ? 831 ARG A H    1  
ATOM 725   H HA   . ARG A 1 48  ? -7.576  -5.182  3.320   1.00 0.00 ? 831 ARG A HA   1  
ATOM 726   H HB2  . ARG A 1 48  ? -6.969  -6.298  1.187   1.00 0.00 ? 831 ARG A HB2  1  
ATOM 727   H HB3  . ARG A 1 48  ? -5.271  -6.026  1.556   1.00 0.00 ? 831 ARG A HB3  1  
ATOM 728   H HG2  . ARG A 1 48  ? -5.605  -8.217  2.210   1.00 0.00 ? 831 ARG A HG2  1  
ATOM 729   H HG3  . ARG A 1 48  ? -5.763  -7.326  3.725   1.00 0.00 ? 831 ARG A HG3  1  
ATOM 730   H HD2  . ARG A 1 48  ? -7.618  -8.645  3.870   1.00 0.00 ? 831 ARG A HD2  1  
ATOM 731   H HD3  . ARG A 1 48  ? -8.307  -7.269  3.008   1.00 0.00 ? 831 ARG A HD3  1  
ATOM 732   H HE   . ARG A 1 48  ? -7.458  -8.913  1.023   1.00 0.00 ? 831 ARG A HE   1  
ATOM 733   H HH11 . ARG A 1 48  ? -9.509  -9.334  3.804   1.00 0.00 ? 831 ARG A HH11 1  
ATOM 734   H HH12 . ARG A 1 48  ? -10.485 -10.559 3.062   1.00 0.00 ? 831 ARG A HH12 1  
ATOM 735   H HH21 . ARG A 1 48  ? -8.735  -10.524 0.035   1.00 0.00 ? 831 ARG A HH21 1  
ATOM 736   H HH22 . ARG A 1 48  ? -10.043 -11.235 0.918   1.00 0.00 ? 831 ARG A HH22 1  
ATOM 737   N N    . LEU A 1 49  ? -5.812  -5.323  5.103   1.00 0.00 ? 832 LEU A N    1  
ATOM 738   C CA   . LEU A 1 49  ? -4.882  -5.185  6.218   1.00 0.00 ? 832 LEU A CA   1  
ATOM 739   C C    . LEU A 1 49  ? -4.289  -6.537  6.603   1.00 0.00 ? 832 LEU A C    1  
ATOM 740   O O    . LEU A 1 49  ? -5.012  -7.459  6.979   1.00 0.00 ? 832 LEU A O    1  
ATOM 741   C CB   . LEU A 1 49  ? -5.589  -4.563  7.424   1.00 0.00 ? 832 LEU A CB   1  
ATOM 742   C CG   . LEU A 1 49  ? -6.372  -3.278  7.154   1.00 0.00 ? 832 LEU A CG   1  
ATOM 743   C CD1  . LEU A 1 49  ? -7.396  -3.036  8.252   1.00 0.00 ? 832 LEU A CD1  1  
ATOM 744   C CD2  . LEU A 1 49  ? -5.426  -2.093  7.033   1.00 0.00 ? 832 LEU A CD2  1  
ATOM 745   H H    . LEU A 1 49  ? -6.635  -5.839  5.229   1.00 0.00 ? 832 LEU A H    1  
ATOM 746   H HA   . LEU A 1 49  ? -4.082  -4.531  5.904   1.00 0.00 ? 832 LEU A HA   1  
ATOM 747   H HB2  . LEU A 1 49  ? -6.280  -5.295  7.815   1.00 0.00 ? 832 LEU A HB2  1  
ATOM 748   H HB3  . LEU A 1 49  ? -4.839  -4.344  8.170   1.00 0.00 ? 832 LEU A HB3  1  
ATOM 749   H HG   . LEU A 1 49  ? -6.905  -3.379  6.218   1.00 0.00 ? 832 LEU A HG   1  
ATOM 750   H HD11 . LEU A 1 49  ? -6.889  -2.744  9.159   1.00 0.00 ? 832 LEU A HD11 1  
ATOM 751   H HD12 . LEU A 1 49  ? -7.956  -3.942  8.428   1.00 0.00 ? 832 LEU A HD12 1  
ATOM 752   H HD13 . LEU A 1 49  ? -8.072  -2.250  7.947   1.00 0.00 ? 832 LEU A HD13 1  
ATOM 753   H HD21 . LEU A 1 49  ? -5.368  -1.782  6.000   1.00 0.00 ? 832 LEU A HD21 1  
ATOM 754   H HD22 . LEU A 1 49  ? -4.443  -2.380  7.378   1.00 0.00 ? 832 LEU A HD22 1  
ATOM 755   H HD23 . LEU A 1 49  ? -5.795  -1.275  7.635   1.00 0.00 ? 832 LEU A HD23 1  
ATOM 756   N N    . VAL A 1 50  ? -2.968  -6.646  6.508   1.00 0.00 ? 833 VAL A N    1  
ATOM 757   C CA   . VAL A 1 50  ? -2.277  -7.884  6.850   1.00 0.00 ? 833 VAL A CA   1  
ATOM 758   C C    . VAL A 1 50  ? -2.488  -8.245  8.316   1.00 0.00 ? 833 VAL A C    1  
ATOM 759   O O    . VAL A 1 50  ? -1.925  -7.613  9.210   1.00 0.00 ? 833 VAL A O    1  
ATOM 760   C CB   . VAL A 1 50  ? -0.766  -7.778  6.571   1.00 0.00 ? 833 VAL A CB   1  
ATOM 761   C CG1  . VAL A 1 50  ? -0.067  -9.086  6.910   1.00 0.00 ? 833 VAL A CG1  1  
ATOM 762   C CG2  . VAL A 1 50  ? -0.517  -7.391  5.121   1.00 0.00 ? 833 VAL A CG2  1  
ATOM 763   H H    . VAL A 1 50  ? -2.445  -5.876  6.202   1.00 0.00 ? 833 VAL A H    1  
ATOM 764   H HA   . VAL A 1 50  ? -2.681  -8.673  6.233   1.00 0.00 ? 833 VAL A HA   1  
ATOM 765   H HB   . VAL A 1 50  ? -0.357  -7.003  7.203   1.00 0.00 ? 833 VAL A HB   1  
ATOM 766   H HG11 . VAL A 1 50  ? -0.381  -9.418  7.889   1.00 0.00 ? 833 VAL A HG11 1  
ATOM 767   H HG12 . VAL A 1 50  ? -0.326  -9.834  6.174   1.00 0.00 ? 833 VAL A HG12 1  
ATOM 768   H HG13 . VAL A 1 50  ? 1.002   -8.934  6.908   1.00 0.00 ? 833 VAL A HG13 1  
ATOM 769   H HG21 . VAL A 1 50  ? -0.860  -8.185  4.474   1.00 0.00 ? 833 VAL A HG21 1  
ATOM 770   H HG22 . VAL A 1 50  ? -1.056  -6.483  4.893   1.00 0.00 ? 833 VAL A HG22 1  
ATOM 771   H HG23 . VAL A 1 50  ? 0.539   -7.231  4.967   1.00 0.00 ? 833 VAL A HG23 1  
ATOM 772   N N    . THR A 1 51  ? -3.304  -9.266  8.556   1.00 0.00 ? 834 THR A N    1  
ATOM 773   C CA   . THR A 1 51  ? -3.591  -9.712  9.914   1.00 0.00 ? 834 THR A CA   1  
ATOM 774   C C    . THR A 1 51  ? -2.837  -10.995 10.242  1.00 0.00 ? 834 THR A C    1  
ATOM 775   O O    . THR A 1 51  ? -2.246  -11.621 9.364   1.00 0.00 ? 834 THR A O    1  
ATOM 776   C CB   . THR A 1 51  ? -5.099  -9.949  10.121  1.00 0.00 ? 834 THR A CB   1  
ATOM 777   O OG1  . THR A 1 51  ? -5.612  -10.783 9.075   1.00 0.00 ? 834 THR A OG1  1  
ATOM 778   C CG2  . THR A 1 51  ? -5.857  -8.630  10.141  1.00 0.00 ? 834 THR A CG2  1  
ATOM 779   H H    . THR A 1 51  ? -3.723  -9.730  7.802   1.00 0.00 ? 834 THR A H    1  
ATOM 780   H HA   . THR A 1 51  ? -3.274  -8.935  10.594  1.00 0.00 ? 834 THR A HA   1  
ATOM 781   H HB   . THR A 1 51  ? -5.244  -10.445 11.070  1.00 0.00 ? 834 THR A HB   1  
ATOM 782   H HG1  . THR A 1 51  ? -5.475  -10.353 8.227   1.00 0.00 ? 834 THR A HG1  1  
ATOM 783   H HG21 . THR A 1 51  ? -5.153  -7.811  10.190  1.00 0.00 ? 834 THR A HG21 1  
ATOM 784   H HG22 . THR A 1 51  ? -6.504  -8.600  11.005  1.00 0.00 ? 834 THR A HG22 1  
ATOM 785   H HG23 . THR A 1 51  ? -6.449  -8.541  9.243   1.00 0.00 ? 834 THR A HG23 1  
ATOM 786   N N    . ASN A 1 52  ? -2.862  -11.382 11.514  1.00 0.00 ? 835 ASN A N    1  
ATOM 787   C CA   . ASN A 1 52  ? -2.180  -12.592 11.958  1.00 0.00 ? 835 ASN A CA   1  
ATOM 788   C C    . ASN A 1 52  ? -3.150  -13.768 12.028  1.00 0.00 ? 835 ASN A C    1  
ATOM 789   O O    . ASN A 1 52  ? -4.344  -13.617 11.771  1.00 0.00 ? 835 ASN A O    1  
ATOM 790   C CB   . ASN A 1 52  ? -1.535  -12.366 13.327  1.00 0.00 ? 835 ASN A CB   1  
ATOM 791   C CG   . ASN A 1 52  ? -0.428  -13.360 13.616  1.00 0.00 ? 835 ASN A CG   1  
ATOM 792   O OD1  . ASN A 1 52  ? 0.173   -13.921 12.699  1.00 0.00 ? 835 ASN A OD1  1  
ATOM 793   N ND2  . ASN A 1 52  ? -0.152  -13.584 14.896  1.00 0.00 ? 835 ASN A ND2  1  
ATOM 794   H H    . ASN A 1 52  ? -3.351  -10.841 12.169  1.00 0.00 ? 835 ASN A H    1  
ATOM 795   H HA   . ASN A 1 52  ? -1.408  -12.820 11.239  1.00 0.00 ? 835 ASN A HA   1  
ATOM 796   H HB2  . ASN A 1 52  ? -1.117  -11.370 13.361  1.00 0.00 ? 835 ASN A HB2  1  
ATOM 797   H HB3  . ASN A 1 52  ? -2.289  -12.461 14.094  1.00 0.00 ? 835 ASN A HB3  1  
ATOM 798   H HD21 . ASN A 1 52  ? -0.671  -13.101 15.572  1.00 0.00 ? 835 ASN A HD21 1  
ATOM 799   H HD22 . ASN A 1 52  ? 0.560   -14.222 15.111  1.00 0.00 ? 835 ASN A HD22 1  
ATOM 800   N N    . ARG A 1 53  ? -2.627  -14.939 12.379  1.00 0.00 ? 836 ARG A N    1  
ATOM 801   C CA   . ARG A 1 53  ? -3.445  -16.141 12.483  1.00 0.00 ? 836 ARG A CA   1  
ATOM 802   C C    . ARG A 1 53  ? -4.577  -15.943 13.487  1.00 0.00 ? 836 ARG A C    1  
ATOM 803   O O    . ARG A 1 53  ? -5.645  -16.541 13.360  1.00 0.00 ? 836 ARG A O    1  
ATOM 804   C CB   . ARG A 1 53  ? -2.585  -17.335 12.898  1.00 0.00 ? 836 ARG A CB   1  
ATOM 805   C CG   . ARG A 1 53  ? -1.423  -17.605 11.956  1.00 0.00 ? 836 ARG A CG   1  
ATOM 806   C CD   . ARG A 1 53  ? -0.467  -18.638 12.531  1.00 0.00 ? 836 ARG A CD   1  
ATOM 807   N NE   . ARG A 1 53  ? 0.264   -19.350 11.486  1.00 0.00 ? 836 ARG A NE   1  
ATOM 808   C CZ   . ARG A 1 53  ? -0.218  -20.408 10.843  1.00 0.00 ? 836 ARG A CZ   1  
ATOM 809   N NH1  . ARG A 1 53  ? -1.425  -20.874 11.137  1.00 0.00 ? 836 ARG A NH1  1  
ATOM 810   N NH2  . ARG A 1 53  ? 0.507   -21.002 9.904   1.00 0.00 ? 836 ARG A NH2  1  
ATOM 811   H H    . ARG A 1 53  ? -1.668  -14.996 12.572  1.00 0.00 ? 836 ARG A H    1  
ATOM 812   H HA   . ARG A 1 53  ? -3.873  -16.336 11.511  1.00 0.00 ? 836 ARG A HA   1  
ATOM 813   H HB2  . ARG A 1 53  ? -2.184  -17.151 13.884  1.00 0.00 ? 836 ARG A HB2  1  
ATOM 814   H HB3  . ARG A 1 53  ? -3.206  -18.217 12.929  1.00 0.00 ? 836 ARG A HB3  1  
ATOM 815   H HG2  . ARG A 1 53  ? -1.810  -17.973 11.017  1.00 0.00 ? 836 ARG A HG2  1  
ATOM 816   H HG3  . ARG A 1 53  ? -0.885  -16.683 11.789  1.00 0.00 ? 836 ARG A HG3  1  
ATOM 817   H HD2  . ARG A 1 53  ? 0.241   -18.136 13.173  1.00 0.00 ? 836 ARG A HD2  1  
ATOM 818   H HD3  . ARG A 1 53  ? -1.035  -19.351 13.111  1.00 0.00 ? 836 ARG A HD3  1  
ATOM 819   H HE   . ARG A 1 53  ? 1.157   -19.023 11.254  1.00 0.00 ? 836 ARG A HE   1  
ATOM 820   H HH11 . ARG A 1 53  ? -1.973  -20.427 11.843  1.00 0.00 ? 836 ARG A HH11 1  
ATOM 821   H HH12 . ARG A 1 53  ? -1.786  -21.670 10.650  1.00 0.00 ? 836 ARG A HH12 1  
ATOM 822   H HH21 . ARG A 1 53  ? 1.417   -20.654 9.680   1.00 0.00 ? 836 ARG A HH21 1  
ATOM 823   H HH22 . ARG A 1 53  ? 0.144   -21.798 9.421   1.00 0.00 ? 836 ARG A HH22 1  
ATOM 824   N N    . ALA A 1 54  ? -4.335  -15.099 14.485  1.00 0.00 ? 837 ALA A N    1  
ATOM 825   C CA   . ALA A 1 54  ? -5.334  -14.821 15.510  1.00 0.00 ? 837 ALA A CA   1  
ATOM 826   C C    . ALA A 1 54  ? -6.210  -13.637 15.115  1.00 0.00 ? 837 ALA A C    1  
ATOM 827   O O    . ALA A 1 54  ? -7.151  -13.285 15.825  1.00 0.00 ? 837 ALA A O    1  
ATOM 828   C CB   . ALA A 1 54  ? -4.658  -14.557 16.847  1.00 0.00 ? 837 ALA A CB   1  
ATOM 829   H H    . ALA A 1 54  ? -3.465  -14.652 14.532  1.00 0.00 ? 837 ALA A H    1  
ATOM 830   H HA   . ALA A 1 54  ? -5.957  -15.697 15.615  1.00 0.00 ? 837 ALA A HA   1  
ATOM 831   H HB1  . ALA A 1 54  ? -5.213  -13.804 17.387  1.00 0.00 ? 837 ALA A HB1  1  
ATOM 832   H HB2  . ALA A 1 54  ? -4.635  -15.470 17.424  1.00 0.00 ? 837 ALA A HB2  1  
ATOM 833   H HB3  . ALA A 1 54  ? -3.650  -14.211 16.679  1.00 0.00 ? 837 ALA A HB3  1  
ATOM 834   N N    . GLY A 1 55  ? -5.893  -13.025 13.978  1.00 0.00 ? 838 GLY A N    1  
ATOM 835   C CA   . GLY A 1 55  ? -6.661  -11.886 13.510  1.00 0.00 ? 838 GLY A CA   1  
ATOM 836   C C    . GLY A 1 55  ? -6.100  -10.566 14.002  1.00 0.00 ? 838 GLY A C    1  
ATOM 837   O O    . GLY A 1 55  ? -6.786  -9.544  13.980  1.00 0.00 ? 838 GLY A O    1  
ATOM 838   H H    . GLY A 1 55  ? -5.132  -13.349 13.453  1.00 0.00 ? 838 GLY A H    1  
ATOM 839   H HA2  . GLY A 1 55  ? -6.662  -11.885 12.430  1.00 0.00 ? 838 GLY A HA2  1  
ATOM 840   H HA3  . GLY A 1 55  ? -7.679  -11.984 13.860  1.00 0.00 ? 838 GLY A HA3  1  
ATOM 841   N N    . LYS A 1 56  ? -4.849  -10.587 14.447  1.00 0.00 ? 839 LYS A N    1  
ATOM 842   C CA   . LYS A 1 56  ? -4.194  -9.384  14.948  1.00 0.00 ? 839 LYS A CA   1  
ATOM 843   C C    . LYS A 1 56  ? -3.446  -8.666  13.829  1.00 0.00 ? 839 LYS A C    1  
ATOM 844   O O    . LYS A 1 56  ? -2.868  -9.288  12.937  1.00 0.00 ? 839 LYS A O    1  
ATOM 845   C CB   . LYS A 1 56  ? -3.225  -9.738  16.078  1.00 0.00 ? 839 LYS A CB   1  
ATOM 846   C CG   . LYS A 1 56  ? -3.843  -10.610 17.158  1.00 0.00 ? 839 LYS A CG   1  
ATOM 847   C CD   . LYS A 1 56  ? -4.572  -9.776  18.198  1.00 0.00 ? 839 LYS A CD   1  
ATOM 848   C CE   . LYS A 1 56  ? -3.601  -9.123  19.169  1.00 0.00 ? 839 LYS A CE   1  
ATOM 849   N NZ   . LYS A 1 56  ? -3.199  -10.052 20.261  1.00 0.00 ? 839 LYS A NZ   1  
ATOM 850   H H    . LYS A 1 56  ? -4.352  -11.433 14.439  1.00 0.00 ? 839 LYS A H    1  
ATOM 851   H HA   . LYS A 1 56  ? -4.959  -8.726  15.333  1.00 0.00 ? 839 LYS A HA   1  
ATOM 852   H HB2  . LYS A 1 56  ? -2.380  -10.264 15.660  1.00 0.00 ? 839 LYS A HB2  1  
ATOM 853   H HB3  . LYS A 1 56  ? -2.878  -8.824  16.538  1.00 0.00 ? 839 LYS A HB3  1  
ATOM 854   H HG2  . LYS A 1 56  ? -4.545  -11.290 16.700  1.00 0.00 ? 839 LYS A HG2  1  
ATOM 855   H HG3  . LYS A 1 56  ? -3.059  -11.172 17.645  1.00 0.00 ? 839 LYS A HG3  1  
ATOM 856   H HD2  . LYS A 1 56  ? -5.137  -9.004  17.697  1.00 0.00 ? 839 LYS A HD2  1  
ATOM 857   H HD3  . LYS A 1 56  ? -5.246  -10.416 18.751  1.00 0.00 ? 839 LYS A HD3  1  
ATOM 858   H HE2  . LYS A 1 56  ? -2.721  -8.816  18.626  1.00 0.00 ? 839 LYS A HE2  1  
ATOM 859   H HE3  . LYS A 1 56  ? -4.076  -8.255  19.603  1.00 0.00 ? 839 LYS A HE3  1  
ATOM 860   H HZ1  . LYS A 1 56  ? -3.451  -9.648  21.185  1.00 0.00 ? 839 LYS A HZ1  1  
ATOM 861   H HZ2  . LYS A 1 56  ? -2.171  -10.211 20.234  1.00 0.00 ? 839 LYS A HZ2  1  
ATOM 862   H HZ3  . LYS A 1 56  ? -3.683  -10.966 20.149  1.00 0.00 ? 839 LYS A HZ3  1  
ATOM 863   N N    . PRO A 1 57  ? -3.455  -7.326  13.874  1.00 0.00 ? 840 PRO A N    1  
ATOM 864   C CA   . PRO A 1 57  ? -2.780  -6.495  12.873  1.00 0.00 ? 840 PRO A CA   1  
ATOM 865   C C    . PRO A 1 57  ? -1.261  -6.586  12.973  1.00 0.00 ? 840 PRO A C    1  
ATOM 866   O O    . PRO A 1 57  ? -0.670  -6.195  13.979  1.00 0.00 ? 840 PRO A O    1  
ATOM 867   C CB   . PRO A 1 57  ? -3.254  -5.079  13.209  1.00 0.00 ? 840 PRO A CB   1  
ATOM 868   C CG   . PRO A 1 57  ? -3.604  -5.130  14.656  1.00 0.00 ? 840 PRO A CG   1  
ATOM 869   C CD   . PRO A 1 57  ? -4.124  -6.518  14.908  1.00 0.00 ? 840 PRO A CD   1  
ATOM 870   H HA   . PRO A 1 57  ? -3.090  -6.752  11.870  1.00 0.00 ? 840 PRO A HA   1  
ATOM 871   H HB2  . PRO A 1 57  ? -2.456  -4.375  13.019  1.00 0.00 ? 840 PRO A HB2  1  
ATOM 872   H HB3  . PRO A 1 57  ? -4.113  -4.830  12.604  1.00 0.00 ? 840 PRO A HB3  1  
ATOM 873   H HG2  . PRO A 1 57  ? -2.724  -4.945  15.253  1.00 0.00 ? 840 PRO A HG2  1  
ATOM 874   H HG3  . PRO A 1 57  ? -4.368  -4.398  14.875  1.00 0.00 ? 840 PRO A HG3  1  
ATOM 875   H HD2  . PRO A 1 57  ? -3.848  -6.851  15.897  1.00 0.00 ? 840 PRO A HD2  1  
ATOM 876   H HD3  . PRO A 1 57  ? -5.197  -6.547  14.784  1.00 0.00 ? 840 PRO A HD3  1  
ATOM 877   N N    . LYS A 1 58  ? -0.634  -7.103  11.922  1.00 0.00 ? 841 LYS A N    1  
ATOM 878   C CA   . LYS A 1 58  ? 0.817   -7.244  11.889  1.00 0.00 ? 841 LYS A CA   1  
ATOM 879   C C    . LYS A 1 58  ? 1.487   -5.905  11.601  1.00 0.00 ? 841 LYS A C    1  
ATOM 880   O O    . LYS A 1 58  ? 2.713   -5.800  11.605  1.00 0.00 ? 841 LYS A O    1  
ATOM 881   C CB   . LYS A 1 58  ? 1.227   -8.270  10.830  1.00 0.00 ? 841 LYS A CB   1  
ATOM 882   C CG   . LYS A 1 58  ? 0.908   -9.704  11.217  1.00 0.00 ? 841 LYS A CG   1  
ATOM 883   C CD   . LYS A 1 58  ? 1.250   -10.673 10.098  1.00 0.00 ? 841 LYS A CD   1  
ATOM 884   C CE   . LYS A 1 58  ? 2.745   -10.944 10.033  1.00 0.00 ? 841 LYS A CE   1  
ATOM 885   N NZ   . LYS A 1 58  ? 3.206   -11.785 11.173  1.00 0.00 ? 841 LYS A NZ   1  
ATOM 886   H H    . LYS A 1 58  ? -1.160  -7.397  11.148  1.00 0.00 ? 841 LYS A H    1  
ATOM 887   H HA   . LYS A 1 58  ? 1.138   -7.593  12.859  1.00 0.00 ? 841 LYS A HA   1  
ATOM 888   H HB2  . LYS A 1 58  ? 0.711   -8.045  9.909   1.00 0.00 ? 841 LYS A HB2  1  
ATOM 889   H HB3  . LYS A 1 58  ? 2.292   -8.193  10.665  1.00 0.00 ? 841 LYS A HB3  1  
ATOM 890   H HG2  . LYS A 1 58  ? 1.481   -9.967  12.094  1.00 0.00 ? 841 LYS A HG2  1  
ATOM 891   H HG3  . LYS A 1 58  ? -0.148  -9.782  11.438  1.00 0.00 ? 841 LYS A HG3  1  
ATOM 892   H HD2  . LYS A 1 58  ? 0.734   -11.606 10.270  1.00 0.00 ? 841 LYS A HD2  1  
ATOM 893   H HD3  . LYS A 1 58  ? 0.929   -10.250 9.156   1.00 0.00 ? 841 LYS A HD3  1  
ATOM 894   H HE2  . LYS A 1 58  ? 2.966   -11.455 9.108   1.00 0.00 ? 841 LYS A HE2  1  
ATOM 895   H HE3  . LYS A 1 58  ? 3.270   -10.001 10.057  1.00 0.00 ? 841 LYS A HE3  1  
ATOM 896   H HZ1  . LYS A 1 58  ? 2.582   -12.609 11.284  1.00 0.00 ? 841 LYS A HZ1  1  
ATOM 897   H HZ2  . LYS A 1 58  ? 3.191   -11.232 12.053  1.00 0.00 ? 841 LYS A HZ2  1  
ATOM 898   H HZ3  . LYS A 1 58  ? 4.176   -12.119 11.001  1.00 0.00 ? 841 LYS A HZ3  1  
ATOM 899   N N    . GLY A 1 59  ? 0.675   -4.883  11.352  1.00 0.00 ? 842 GLY A N    1  
ATOM 900   C CA   . GLY A 1 59  ? 1.208   -3.563  11.067  1.00 0.00 ? 842 GLY A CA   1  
ATOM 901   C C    . GLY A 1 59  ? 1.244   -3.261  9.582   1.00 0.00 ? 842 GLY A C    1  
ATOM 902   O O    . GLY A 1 59  ? 1.177   -2.101  9.175   1.00 0.00 ? 842 GLY A O    1  
ATOM 903   H H    . GLY A 1 59  ? -0.295  -5.025  11.362  1.00 0.00 ? 842 GLY A H    1  
ATOM 904   H HA2  . GLY A 1 59  ? 0.594   -2.825  11.559  1.00 0.00 ? 842 GLY A HA2  1  
ATOM 905   H HA3  . GLY A 1 59  ? 2.212   -3.501  11.459  1.00 0.00 ? 842 GLY A HA3  1  
ATOM 906   N N    . LEU A 1 60  ? 1.351   -4.307  8.769   1.00 0.00 ? 843 LEU A N    1  
ATOM 907   C CA   . LEU A 1 60  ? 1.397   -4.148  7.320   1.00 0.00 ? 843 LEU A CA   1  
ATOM 908   C C    . LEU A 1 60  ? -0.006  -3.988  6.744   1.00 0.00 ? 843 LEU A C    1  
ATOM 909   O O    . LEU A 1 60  ? -0.955  -4.617  7.212   1.00 0.00 ? 843 LEU A O    1  
ATOM 910   C CB   . LEU A 1 60  ? 2.090   -5.351  6.677   1.00 0.00 ? 843 LEU A CB   1  
ATOM 911   C CG   . LEU A 1 60  ? 3.399   -5.798  7.329   1.00 0.00 ? 843 LEU A CG   1  
ATOM 912   C CD1  . LEU A 1 60  ? 3.924   -7.060  6.661   1.00 0.00 ? 843 LEU A CD1  1  
ATOM 913   C CD2  . LEU A 1 60  ? 4.436   -4.686  7.261   1.00 0.00 ? 843 LEU A CD2  1  
ATOM 914   H H    . LEU A 1 60  ? 1.400   -5.207  9.152   1.00 0.00 ? 843 LEU A H    1  
ATOM 915   H HA   . LEU A 1 60  ? 1.966   -3.257  7.102   1.00 0.00 ? 843 LEU A HA   1  
ATOM 916   H HB2  . LEU A 1 60  ? 1.404   -6.184  6.709   1.00 0.00 ? 843 LEU A HB2  1  
ATOM 917   H HB3  . LEU A 1 60  ? 2.301   -5.099  5.648   1.00 0.00 ? 843 LEU A HB3  1  
ATOM 918   H HG   . LEU A 1 60  ? 3.217   -6.024  8.370   1.00 0.00 ? 843 LEU A HG   1  
ATOM 919   H HD11 . LEU A 1 60  ? 3.466   -7.925  7.115   1.00 0.00 ? 843 LEU A HD11 1  
ATOM 920   H HD12 . LEU A 1 60  ? 4.996   -7.113  6.784   1.00 0.00 ? 843 LEU A HD12 1  
ATOM 921   H HD13 . LEU A 1 60  ? 3.684   -7.036  5.608   1.00 0.00 ? 843 LEU A HD13 1  
ATOM 922   H HD21 . LEU A 1 60  ? 4.068   -3.889  6.631   1.00 0.00 ? 843 LEU A HD21 1  
ATOM 923   H HD22 . LEU A 1 60  ? 5.355   -5.076  6.848   1.00 0.00 ? 843 LEU A HD22 1  
ATOM 924   H HD23 . LEU A 1 60  ? 4.620   -4.305  8.254   1.00 0.00 ? 843 LEU A HD23 1  
ATOM 925   N N    . ALA A 1 61  ? -0.130  -3.144  5.726   1.00 0.00 ? 844 ALA A N    1  
ATOM 926   C CA   . ALA A 1 61  ? -1.416  -2.905  5.083   1.00 0.00 ? 844 ALA A CA   1  
ATOM 927   C C    . ALA A 1 61  ? -1.243  -2.632  3.593   1.00 0.00 ? 844 ALA A C    1  
ATOM 928   O O    . ALA A 1 61  ? -0.343  -1.896  3.187   1.00 0.00 ? 844 ALA A O    1  
ATOM 929   C CB   . ALA A 1 61  ? -2.133  -1.743  5.755   1.00 0.00 ? 844 ALA A CB   1  
ATOM 930   H H    . ALA A 1 61  ? 0.664   -2.672  5.397   1.00 0.00 ? 844 ALA A H    1  
ATOM 931   H HA   . ALA A 1 61  ? -2.022  -3.791  5.209   1.00 0.00 ? 844 ALA A HA   1  
ATOM 932   H HB1  . ALA A 1 61  ? -2.284  -1.970  6.800   1.00 0.00 ? 844 ALA A HB1  1  
ATOM 933   H HB2  . ALA A 1 61  ? -1.535  -0.849  5.663   1.00 0.00 ? 844 ALA A HB2  1  
ATOM 934   H HB3  . ALA A 1 61  ? -3.090  -1.587  5.279   1.00 0.00 ? 844 ALA A HB3  1  
ATOM 935   N N    . TYR A 1 62  ? -2.110  -3.229  2.783   1.00 0.00 ? 845 TYR A N    1  
ATOM 936   C CA   . TYR A 1 62  ? -2.051  -3.052  1.337   1.00 0.00 ? 845 TYR A CA   1  
ATOM 937   C C    . TYR A 1 62  ? -3.205  -2.183  0.846   1.00 0.00 ? 845 TYR A C    1  
ATOM 938   O O    . TYR A 1 62  ? -4.300  -2.210  1.408   1.00 0.00 ? 845 TYR A O    1  
ATOM 939   C CB   . TYR A 1 62  ? -2.087  -4.410  0.634   1.00 0.00 ? 845 TYR A CB   1  
ATOM 940   C CG   . TYR A 1 62  ? -0.747  -5.110  0.601   1.00 0.00 ? 845 TYR A CG   1  
ATOM 941   C CD1  . TYR A 1 62  ? -0.317  -5.882  1.674   1.00 0.00 ? 845 TYR A CD1  1  
ATOM 942   C CD2  . TYR A 1 62  ? 0.090   -5.000  -0.503  1.00 0.00 ? 845 TYR A CD2  1  
ATOM 943   C CE1  . TYR A 1 62  ? 0.906   -6.523  1.648   1.00 0.00 ? 845 TYR A CE1  1  
ATOM 944   C CE2  . TYR A 1 62  ? 1.315   -5.638  -0.538  1.00 0.00 ? 845 TYR A CE2  1  
ATOM 945   C CZ   . TYR A 1 62  ? 1.719   -6.398  0.540   1.00 0.00 ? 845 TYR A CZ   1  
ATOM 946   O OH   . TYR A 1 62  ? 2.938   -7.035  0.510   1.00 0.00 ? 845 TYR A OH   1  
ATOM 947   H H    . TYR A 1 62  ? -2.806  -3.803  3.166   1.00 0.00 ? 845 TYR A H    1  
ATOM 948   H HA   . TYR A 1 62  ? -1.119  -2.560  1.100   1.00 0.00 ? 845 TYR A HA   1  
ATOM 949   H HB2  . TYR A 1 62  ? -2.784  -5.055  1.146   1.00 0.00 ? 845 TYR A HB2  1  
ATOM 950   H HB3  . TYR A 1 62  ? -2.414  -4.272  -0.386  1.00 0.00 ? 845 TYR A HB3  1  
ATOM 951   H HD1  . TYR A 1 62  ? -0.956  -5.978  2.540   1.00 0.00 ? 845 TYR A HD1  1  
ATOM 952   H HD2  . TYR A 1 62  ? -0.229  -4.404  -1.346  1.00 0.00 ? 845 TYR A HD2  1  
ATOM 953   H HE1  . TYR A 1 62  ? 1.223   -7.118  2.492   1.00 0.00 ? 845 TYR A HE1  1  
ATOM 954   H HE2  . TYR A 1 62  ? 1.951   -5.540  -1.405  1.00 0.00 ? 845 TYR A HE2  1  
ATOM 955   H HH   . TYR A 1 62  ? 2.867   -7.837  -0.013  1.00 0.00 ? 845 TYR A HH   1  
ATOM 956   N N    . VAL A 1 63  ? -2.952  -1.413  -0.207  1.00 0.00 ? 846 VAL A N    1  
ATOM 957   C CA   . VAL A 1 63  ? -3.969  -0.537  -0.776  1.00 0.00 ? 846 VAL A CA   1  
ATOM 958   C C    . VAL A 1 63  ? -4.042  -0.691  -2.291  1.00 0.00 ? 846 VAL A C    1  
ATOM 959   O O    . VAL A 1 63  ? -3.048  -1.016  -2.940  1.00 0.00 ? 846 VAL A O    1  
ATOM 960   C CB   . VAL A 1 63  ? -3.693  0.939   -0.434  1.00 0.00 ? 846 VAL A CB   1  
ATOM 961   C CG1  . VAL A 1 63  ? -4.702  1.845   -1.123  1.00 0.00 ? 846 VAL A CG1  1  
ATOM 962   C CG2  . VAL A 1 63  ? -3.717  1.150   1.073   1.00 0.00 ? 846 VAL A CG2  1  
ATOM 963   H H    . VAL A 1 63  ? -2.060  -1.436  -0.612  1.00 0.00 ? 846 VAL A H    1  
ATOM 964   H HA   . VAL A 1 63  ? -4.923  -0.811  -0.350  1.00 0.00 ? 846 VAL A HA   1  
ATOM 965   H HB   . VAL A 1 63  ? -2.708  1.194   -0.796  1.00 0.00 ? 846 VAL A HB   1  
ATOM 966   H HG11 . VAL A 1 63  ? -4.814  2.757   -0.555  1.00 0.00 ? 846 VAL A HG11 1  
ATOM 967   H HG12 . VAL A 1 63  ? -4.354  2.080   -2.119  1.00 0.00 ? 846 VAL A HG12 1  
ATOM 968   H HG13 . VAL A 1 63  ? -5.655  1.341   -1.184  1.00 0.00 ? 846 VAL A HG13 1  
ATOM 969   H HG21 . VAL A 1 63  ? -2.734  1.442   1.410   1.00 0.00 ? 846 VAL A HG21 1  
ATOM 970   H HG22 . VAL A 1 63  ? -4.427  1.927   1.317   1.00 0.00 ? 846 VAL A HG22 1  
ATOM 971   H HG23 . VAL A 1 63  ? -4.008  0.231   1.560   1.00 0.00 ? 846 VAL A HG23 1  
ATOM 972   N N    . GLU A 1 64  ? -5.225  -0.454  -2.848  1.00 0.00 ? 847 GLU A N    1  
ATOM 973   C CA   . GLU A 1 64  ? -5.427  -0.567  -4.288  1.00 0.00 ? 847 GLU A CA   1  
ATOM 974   C C    . GLU A 1 64  ? -6.142  0.665   -4.835  1.00 0.00 ? 847 GLU A C    1  
ATOM 975   O O    . GLU A 1 64  ? -7.238  1.009   -4.391  1.00 0.00 ? 847 GLU A O    1  
ATOM 976   C CB   . GLU A 1 64  ? -6.234  -1.825  -4.615  1.00 0.00 ? 847 GLU A CB   1  
ATOM 977   C CG   . GLU A 1 64  ? -5.373  -3.055  -4.854  1.00 0.00 ? 847 GLU A CG   1  
ATOM 978   C CD   . GLU A 1 64  ? -5.109  -3.838  -3.583  1.00 0.00 ? 847 GLU A CD   1  
ATOM 979   O OE1  . GLU A 1 64  ? -6.026  -3.929  -2.740  1.00 0.00 ? 847 GLU A OE1  1  
ATOM 980   O OE2  . GLU A 1 64  ? -3.985  -4.360  -3.431  1.00 0.00 ? 847 GLU A OE2  1  
ATOM 981   H H    . GLU A 1 64  ? -5.980  -0.198  -2.278  1.00 0.00 ? 847 GLU A H    1  
ATOM 982   H HA   . GLU A 1 64  ? -4.456  -0.642  -4.754  1.00 0.00 ? 847 GLU A HA   1  
ATOM 983   H HB2  . GLU A 1 64  ? -6.903  -2.033  -3.794  1.00 0.00 ? 847 GLU A HB2  1  
ATOM 984   H HB3  . GLU A 1 64  ? -6.817  -1.642  -5.505  1.00 0.00 ? 847 GLU A HB3  1  
ATOM 985   H HG2  . GLU A 1 64  ? -5.877  -3.700  -5.558  1.00 0.00 ? 847 GLU A HG2  1  
ATOM 986   H HG3  . GLU A 1 64  ? -4.427  -2.741  -5.269  1.00 0.00 ? 847 GLU A HG3  1  
ATOM 987   N N    . TYR A 1 65  ? -5.514  1.326   -5.802  1.00 0.00 ? 848 TYR A N    1  
ATOM 988   C CA   . TYR A 1 65  ? -6.087  2.521   -6.408  1.00 0.00 ? 848 TYR A CA   1  
ATOM 989   C C    . TYR A 1 65  ? -6.546  2.241   -7.836  1.00 0.00 ? 848 TYR A C    1  
ATOM 990   O O    . TYR A 1 65  ? -6.291  1.168   -8.382  1.00 0.00 ? 848 TYR A O    1  
ATOM 991   C CB   . TYR A 1 65  ? -5.067  3.661   -6.403  1.00 0.00 ? 848 TYR A CB   1  
ATOM 992   C CG   . TYR A 1 65  ? -5.071  4.471   -5.126  1.00 0.00 ? 848 TYR A CG   1  
ATOM 993   C CD1  . TYR A 1 65  ? -4.482  3.981   -3.967  1.00 0.00 ? 848 TYR A CD1  1  
ATOM 994   C CD2  . TYR A 1 65  ? -5.665  5.726   -5.079  1.00 0.00 ? 848 TYR A CD2  1  
ATOM 995   C CE1  . TYR A 1 65  ? -4.484  4.717   -2.798  1.00 0.00 ? 848 TYR A CE1  1  
ATOM 996   C CE2  . TYR A 1 65  ? -5.670  6.470   -3.915  1.00 0.00 ? 848 TYR A CE2  1  
ATOM 997   C CZ   . TYR A 1 65  ? -5.078  5.962   -2.777  1.00 0.00 ? 848 TYR A CZ   1  
ATOM 998   O OH   . TYR A 1 65  ? -5.083  6.699   -1.616  1.00 0.00 ? 848 TYR A OH   1  
ATOM 999   H H    . TYR A 1 65  ? -4.643  1.003   -6.114  1.00 0.00 ? 848 TYR A H    1  
ATOM 1000  H HA   . TYR A 1 65  ? -6.943  2.815   -5.818  1.00 0.00 ? 848 TYR A HA   1  
ATOM 1001  H HB2  . TYR A 1 65  ? -4.077  3.250   -6.530  1.00 0.00 ? 848 TYR A HB2  1  
ATOM 1002  H HB3  . TYR A 1 65  ? -5.282  4.331   -7.222  1.00 0.00 ? 848 TYR A HB3  1  
ATOM 1003  H HD1  . TYR A 1 65  ? -4.017  3.006   -3.987  1.00 0.00 ? 848 TYR A HD1  1  
ATOM 1004  H HD2  . TYR A 1 65  ? -6.128  6.122   -5.971  1.00 0.00 ? 848 TYR A HD2  1  
ATOM 1005  H HE1  . TYR A 1 65  ? -4.020  4.320   -1.907  1.00 0.00 ? 848 TYR A HE1  1  
ATOM 1006  H HE2  . TYR A 1 65  ? -6.136  7.444   -3.898  1.00 0.00 ? 848 TYR A HE2  1  
ATOM 1007  H HH   . TYR A 1 65  ? -5.726  7.408   -1.689  1.00 0.00 ? 848 TYR A HH   1  
ATOM 1008  N N    . GLU A 1 66  ? -7.224  3.215   -8.434  1.00 0.00 ? 849 GLU A N    1  
ATOM 1009  C CA   . GLU A 1 66  ? -7.719  3.074   -9.799  1.00 0.00 ? 849 GLU A CA   1  
ATOM 1010  C C    . GLU A 1 66  ? -6.666  3.521   -10.809 1.00 0.00 ? 849 GLU A C    1  
ATOM 1011  O O    . GLU A 1 66  ? -6.467  2.879   -11.839 1.00 0.00 ? 849 GLU A O    1  
ATOM 1012  C CB   . GLU A 1 66  ? -9.000  3.889   -9.987  1.00 0.00 ? 849 GLU A CB   1  
ATOM 1013  C CG   . GLU A 1 66  ? -9.671  3.667   -11.332 1.00 0.00 ? 849 GLU A CG   1  
ATOM 1014  C CD   . GLU A 1 66  ? -11.176 3.845   -11.270 1.00 0.00 ? 849 GLU A CD   1  
ATOM 1015  O OE1  . GLU A 1 66  ? -11.638 5.004   -11.314 1.00 0.00 ? 849 GLU A OE1  1  
ATOM 1016  O OE2  . GLU A 1 66  ? -11.890 2.825   -11.178 1.00 0.00 ? 849 GLU A OE2  1  
ATOM 1017  H H    . GLU A 1 66  ? -7.396  4.048   -7.947  1.00 0.00 ? 849 GLU A H    1  
ATOM 1018  H HA   . GLU A 1 66  ? -7.940  2.031   -9.965  1.00 0.00 ? 849 GLU A HA   1  
ATOM 1019  H HB2  . GLU A 1 66  ? -9.700  3.622   -9.210  1.00 0.00 ? 849 GLU A HB2  1  
ATOM 1020  H HB3  . GLU A 1 66  ? -8.761  4.939   -9.897  1.00 0.00 ? 849 GLU A HB3  1  
ATOM 1021  H HG2  . GLU A 1 66  ? -9.269  4.374   -12.042 1.00 0.00 ? 849 GLU A HG2  1  
ATOM 1022  H HG3  . GLU A 1 66  ? -9.456  2.662   -11.665 1.00 0.00 ? 849 GLU A HG3  1  
ATOM 1023  N N    . ASN A 1 67  ? -5.995  4.628   -10.505 1.00 0.00 ? 850 ASN A N    1  
ATOM 1024  C CA   . ASN A 1 67  ? -4.963  5.162   -11.386 1.00 0.00 ? 850 ASN A CA   1  
ATOM 1025  C C    . ASN A 1 67  ? -3.583  5.029   -10.750 1.00 0.00 ? 850 ASN A C    1  
ATOM 1026  O O    . ASN A 1 67  ? -3.446  4.511   -9.642  1.00 0.00 ? 850 ASN A O    1  
ATOM 1027  C CB   . ASN A 1 67  ? -5.249  6.630   -11.709 1.00 0.00 ? 850 ASN A CB   1  
ATOM 1028  C CG   . ASN A 1 67  ? -6.430  6.796   -12.646 1.00 0.00 ? 850 ASN A CG   1  
ATOM 1029  O OD1  . ASN A 1 67  ? -6.917  5.826   -13.226 1.00 0.00 ? 850 ASN A OD1  1  
ATOM 1030  N ND2  . ASN A 1 67  ? -6.896  8.030   -12.797 1.00 0.00 ? 850 ASN A ND2  1  
ATOM 1031  H H    . ASN A 1 67  ? -6.199  5.096   -9.668  1.00 0.00 ? 850 ASN A H    1  
ATOM 1032  H HA   . ASN A 1 67  ? -4.981  4.591   -12.302 1.00 0.00 ? 850 ASN A HA   1  
ATOM 1033  H HB2  . ASN A 1 67  ? -5.465  7.159   -10.792 1.00 0.00 ? 850 ASN A HB2  1  
ATOM 1034  H HB3  . ASN A 1 67  ? -4.378  7.066   -12.175 1.00 0.00 ? 850 ASN A HB3  1  
ATOM 1035  H HD21 . ASN A 1 67  ? -6.457  8.755   -12.303 1.00 0.00 ? 850 ASN A HD21 1  
ATOM 1036  H HD22 . ASN A 1 67  ? -7.659  8.166   -13.396 1.00 0.00 ? 850 ASN A HD22 1  
ATOM 1037  N N    . GLU A 1 68  ? -2.562  5.502   -11.458 1.00 0.00 ? 851 GLU A N    1  
ATOM 1038  C CA   . GLU A 1 68  ? -1.193  5.436   -10.962 1.00 0.00 ? 851 GLU A CA   1  
ATOM 1039  C C    . GLU A 1 68  ? -0.800  6.740   -10.274 1.00 0.00 ? 851 GLU A C    1  
ATOM 1040  O O    . GLU A 1 68  ? -0.203  6.731   -9.197  1.00 0.00 ? 851 GLU A O    1  
ATOM 1041  C CB   . GLU A 1 68  ? -0.225  5.141   -12.110 1.00 0.00 ? 851 GLU A CB   1  
ATOM 1042  C CG   . GLU A 1 68  ? 1.021   4.387   -11.677 1.00 0.00 ? 851 GLU A CG   1  
ATOM 1043  C CD   . GLU A 1 68  ? 2.075   4.328   -12.766 1.00 0.00 ? 851 GLU A CD   1  
ATOM 1044  O OE1  . GLU A 1 68  ? 1.712   4.058   -13.930 1.00 0.00 ? 851 GLU A OE1  1  
ATOM 1045  O OE2  . GLU A 1 68  ? 3.264   4.551   -12.453 1.00 0.00 ? 851 GLU A OE2  1  
ATOM 1046  H H    . GLU A 1 68  ? -2.735  5.905   -12.335 1.00 0.00 ? 851 GLU A H    1  
ATOM 1047  H HA   . GLU A 1 68  ? -1.139  4.633   -10.243 1.00 0.00 ? 851 GLU A HA   1  
ATOM 1048  H HB2  . GLU A 1 68  ? -0.738  4.550   -12.855 1.00 0.00 ? 851 GLU A HB2  1  
ATOM 1049  H HB3  . GLU A 1 68  ? 0.082   6.076   -12.555 1.00 0.00 ? 851 GLU A HB3  1  
ATOM 1050  H HG2  . GLU A 1 68  ? 1.444   4.882   -10.815 1.00 0.00 ? 851 GLU A HG2  1  
ATOM 1051  H HG3  . GLU A 1 68  ? 0.742   3.379   -11.411 1.00 0.00 ? 851 GLU A HG3  1  
ATOM 1052  N N    . SER A 1 69  ? -1.139  7.861   -10.903 1.00 0.00 ? 852 SER A N    1  
ATOM 1053  C CA   . SER A 1 69  ? -0.818  9.173   -10.354 1.00 0.00 ? 852 SER A CA   1  
ATOM 1054  C C    . SER A 1 69  ? -1.395  9.331   -8.951  1.00 0.00 ? 852 SER A C    1  
ATOM 1055  O O    . SER A 1 69  ? -0.743  9.870   -8.058  1.00 0.00 ? 852 SER A O    1  
ATOM 1056  C CB   . SER A 1 69  ? -1.357  10.276  -11.267 1.00 0.00 ? 852 SER A CB   1  
ATOM 1057  O OG   . SER A 1 69  ? -1.234  11.549  -10.656 1.00 0.00 ? 852 SER A OG   1  
ATOM 1058  H H    . SER A 1 69  ? -1.614  7.803   -11.759 1.00 0.00 ? 852 SER A H    1  
ATOM 1059  H HA   . SER A 1 69  ? 0.257   9.256   -10.300 1.00 0.00 ? 852 SER A HA   1  
ATOM 1060  H HB2  . SER A 1 69  ? -0.800  10.279  -12.191 1.00 0.00 ? 852 SER A HB2  1  
ATOM 1061  H HB3  . SER A 1 69  ? -2.400  10.090  -11.475 1.00 0.00 ? 852 SER A HB3  1  
ATOM 1062  H HG   . SER A 1 69  ? -1.590  12.221  -11.241 1.00 0.00 ? 852 SER A HG   1  
ATOM 1063  N N    . GLN A 1 70  ? -2.623  8.856   -8.766  1.00 0.00 ? 853 GLN A N    1  
ATOM 1064  C CA   . GLN A 1 70  ? -3.289  8.945   -7.472  1.00 0.00 ? 853 GLN A CA   1  
ATOM 1065  C C    . GLN A 1 70  ? -2.467  8.255   -6.388  1.00 0.00 ? 853 GLN A C    1  
ATOM 1066  O O    . GLN A 1 70  ? -2.151  8.854   -5.361  1.00 0.00 ? 853 GLN A O    1  
ATOM 1067  C CB   . GLN A 1 70  ? -4.683  8.318   -7.548  1.00 0.00 ? 853 GLN A CB   1  
ATOM 1068  C CG   . GLN A 1 70  ? -5.713  9.206   -8.228  1.00 0.00 ? 853 GLN A CG   1  
ATOM 1069  C CD   . GLN A 1 70  ? -7.093  8.580   -8.258  1.00 0.00 ? 853 GLN A CD   1  
ATOM 1070  O OE1  . GLN A 1 70  ? -8.094  9.242   -7.981  1.00 0.00 ? 853 GLN A OE1  1  
ATOM 1071  N NE2  . GLN A 1 70  ? -7.155  7.297   -8.596  1.00 0.00 ? 853 GLN A NE2  1  
ATOM 1072  H H    . GLN A 1 70  ? -3.091  8.437   -9.517  1.00 0.00 ? 853 GLN A H    1  
ATOM 1073  H HA   . GLN A 1 70  ? -3.388  9.990   -7.222  1.00 0.00 ? 853 GLN A HA   1  
ATOM 1074  H HB2  . GLN A 1 70  ? -4.618  7.391   -8.099  1.00 0.00 ? 853 GLN A HB2  1  
ATOM 1075  H HB3  . GLN A 1 70  ? -5.025  8.109   -6.546  1.00 0.00 ? 853 GLN A HB3  1  
ATOM 1076  H HG2  . GLN A 1 70  ? -5.771  10.142  -7.694  1.00 0.00 ? 853 GLN A HG2  1  
ATOM 1077  H HG3  . GLN A 1 70  ? -5.395  9.391   -9.243  1.00 0.00 ? 853 GLN A HG3  1  
ATOM 1078  H HE21 . GLN A 1 70  ? -6.316  6.833   -8.803  1.00 0.00 ? 853 GLN A HE21 1  
ATOM 1079  H HE22 . GLN A 1 70  ? -8.034  6.867   -8.623  1.00 0.00 ? 853 GLN A HE22 1  
ATOM 1080  N N    . ALA A 1 71  ? -2.125  6.993   -6.625  1.00 0.00 ? 854 ALA A N    1  
ATOM 1081  C CA   . ALA A 1 71  ? -1.338  6.223   -5.670  1.00 0.00 ? 854 ALA A CA   1  
ATOM 1082  C C    . ALA A 1 71  ? -0.037  6.940   -5.325  1.00 0.00 ? 854 ALA A C    1  
ATOM 1083  O O    . ALA A 1 71  ? 0.337   7.041   -4.156  1.00 0.00 ? 854 ALA A O    1  
ATOM 1084  C CB   . ALA A 1 71  ? -1.047  4.836   -6.222  1.00 0.00 ? 854 ALA A CB   1  
ATOM 1085  H H    . ALA A 1 71  ? -2.406  6.571   -7.463  1.00 0.00 ? 854 ALA A H    1  
ATOM 1086  H HA   . ALA A 1 71  ? -1.924  6.109   -4.769  1.00 0.00 ? 854 ALA A HA   1  
ATOM 1087  H HB1  . ALA A 1 71  ? -1.600  4.100   -5.656  1.00 0.00 ? 854 ALA A HB1  1  
ATOM 1088  H HB2  . ALA A 1 71  ? -1.346  4.791   -7.259  1.00 0.00 ? 854 ALA A HB2  1  
ATOM 1089  H HB3  . ALA A 1 71  ? 0.010   4.631   -6.143  1.00 0.00 ? 854 ALA A HB3  1  
ATOM 1090  N N    . SER A 1 72  ? 0.649   7.437   -6.349  1.00 0.00 ? 855 SER A N    1  
ATOM 1091  C CA   . SER A 1 72  ? 1.911   8.142   -6.154  1.00 0.00 ? 855 SER A CA   1  
ATOM 1092  C C    . SER A 1 72  ? 1.762   9.245   -5.111  1.00 0.00 ? 855 SER A C    1  
ATOM 1093  O O    . SER A 1 72  ? 2.518   9.302   -4.141  1.00 0.00 ? 855 SER A O    1  
ATOM 1094  C CB   . SER A 1 72  ? 2.396   8.738   -7.477  1.00 0.00 ? 855 SER A CB   1  
ATOM 1095  O OG   . SER A 1 72  ? 3.775   9.059   -7.417  1.00 0.00 ? 855 SER A OG   1  
ATOM 1096  H H    . SER A 1 72  ? 0.299   7.325   -7.258  1.00 0.00 ? 855 SER A H    1  
ATOM 1097  H HA   . SER A 1 72  ? 2.639   7.426   -5.803  1.00 0.00 ? 855 SER A HA   1  
ATOM 1098  H HB2  . SER A 1 72  ? 2.240   8.023   -8.270  1.00 0.00 ? 855 SER A HB2  1  
ATOM 1099  H HB3  . SER A 1 72  ? 1.837   9.638   -7.689  1.00 0.00 ? 855 SER A HB3  1  
ATOM 1100  H HG   . SER A 1 72  ? 3.877   9.999   -7.250  1.00 0.00 ? 855 SER A HG   1  
ATOM 1101  N N    . GLN A 1 73  ? 0.781   10.118  -5.318  1.00 0.00 ? 856 GLN A N    1  
ATOM 1102  C CA   . GLN A 1 73  ? 0.533   11.220  -4.395  1.00 0.00 ? 856 GLN A CA   1  
ATOM 1103  C C    . GLN A 1 73  ? 0.355   10.707  -2.970  1.00 0.00 ? 856 GLN A C    1  
ATOM 1104  O O    . GLN A 1 73  ? 1.009   11.184  -2.043  1.00 0.00 ? 856 GLN A O    1  
ATOM 1105  C CB   . GLN A 1 73  ? -0.707  12.004  -4.827  1.00 0.00 ? 856 GLN A CB   1  
ATOM 1106  C CG   . GLN A 1 73  ? -0.760  13.415  -4.264  1.00 0.00 ? 856 GLN A CG   1  
ATOM 1107  C CD   . GLN A 1 73  ? -1.525  14.372  -5.158  1.00 0.00 ? 856 GLN A CD   1  
ATOM 1108  O OE1  . GLN A 1 73  ? -2.729  14.219  -5.363  1.00 0.00 ? 856 GLN A OE1  1  
ATOM 1109  N NE2  . GLN A 1 73  ? -0.827  15.365  -5.697  1.00 0.00 ? 856 GLN A NE2  1  
ATOM 1110  H H    . GLN A 1 73  ? 0.213   10.019  -6.109  1.00 0.00 ? 856 GLN A H    1  
ATOM 1111  H HA   . GLN A 1 73  ? 1.390   11.875  -4.424  1.00 0.00 ? 856 GLN A HA   1  
ATOM 1112  H HB2  . GLN A 1 73  ? -0.721  12.068  -5.904  1.00 0.00 ? 856 GLN A HB2  1  
ATOM 1113  H HB3  . GLN A 1 73  ? -1.587  11.474  -4.494  1.00 0.00 ? 856 GLN A HB3  1  
ATOM 1114  H HG2  . GLN A 1 73  ? -1.243  13.387  -3.299  1.00 0.00 ? 856 GLN A HG2  1  
ATOM 1115  H HG3  . GLN A 1 73  ? 0.249   13.782  -4.150  1.00 0.00 ? 856 GLN A HG3  1  
ATOM 1116  H HE21 . GLN A 1 73  ? 0.130   15.423  -5.490  1.00 0.00 ? 856 GLN A HE21 1  
ATOM 1117  H HE22 . GLN A 1 73  ? -1.296  15.997  -6.280  1.00 0.00 ? 856 GLN A HE22 1  
ATOM 1118  N N    . ALA A 1 74  ? -0.533  9.733   -2.804  1.00 0.00 ? 857 ALA A N    1  
ATOM 1119  C CA   . ALA A 1 74  ? -0.796  9.155   -1.492  1.00 0.00 ? 857 ALA A CA   1  
ATOM 1120  C C    . ALA A 1 74  ? 0.484   8.611   -0.865  1.00 0.00 ? 857 ALA A C    1  
ATOM 1121  O O    . ALA A 1 74  ? 0.657   8.653   0.353   1.00 0.00 ? 857 ALA A O    1  
ATOM 1122  C CB   . ALA A 1 74  ? -1.842  8.055   -1.600  1.00 0.00 ? 857 ALA A CB   1  
ATOM 1123  H H    . ALA A 1 74  ? -1.023  9.395   -3.582  1.00 0.00 ? 857 ALA A H    1  
ATOM 1124  H HA   . ALA A 1 74  ? -1.193  9.934   -0.857  1.00 0.00 ? 857 ALA A HA   1  
ATOM 1125  H HB1  . ALA A 1 74  ? -2.185  7.787   -0.611  1.00 0.00 ? 857 ALA A HB1  1  
ATOM 1126  H HB2  . ALA A 1 74  ? -2.676  8.408   -2.187  1.00 0.00 ? 857 ALA A HB2  1  
ATOM 1127  H HB3  . ALA A 1 74  ? -1.406  7.190   -2.076  1.00 0.00 ? 857 ALA A HB3  1  
ATOM 1128  N N    . VAL A 1 75  ? 1.377   8.099   -1.706  1.00 0.00 ? 858 VAL A N    1  
ATOM 1129  C CA   . VAL A 1 75  ? 2.642   7.547   -1.234  1.00 0.00 ? 858 VAL A CA   1  
ATOM 1130  C C    . VAL A 1 75  ? 3.585   8.652   -0.772  1.00 0.00 ? 858 VAL A C    1  
ATOM 1131  O O    . VAL A 1 75  ? 4.300   8.497   0.218   1.00 0.00 ? 858 VAL A O    1  
ATOM 1132  C CB   . VAL A 1 75  ? 3.337   6.719   -2.331  1.00 0.00 ? 858 VAL A CB   1  
ATOM 1133  C CG1  . VAL A 1 75  ? 4.697   6.234   -1.854  1.00 0.00 ? 858 VAL A CG1  1  
ATOM 1134  C CG2  . VAL A 1 75  ? 2.461   5.548   -2.750  1.00 0.00 ? 858 VAL A CG2  1  
ATOM 1135  H H    . VAL A 1 75  ? 1.182   8.094   -2.666  1.00 0.00 ? 858 VAL A H    1  
ATOM 1136  H HA   . VAL A 1 75  ? 2.431   6.895   -0.400  1.00 0.00 ? 858 VAL A HA   1  
ATOM 1137  H HB   . VAL A 1 75  ? 3.488   7.355   -3.192  1.00 0.00 ? 858 VAL A HB   1  
ATOM 1138  H HG11 . VAL A 1 75  ? 4.728   6.258   -0.774  1.00 0.00 ? 858 VAL A HG11 1  
ATOM 1139  H HG12 . VAL A 1 75  ? 4.861   5.224   -2.198  1.00 0.00 ? 858 VAL A HG12 1  
ATOM 1140  H HG13 . VAL A 1 75  ? 5.468   6.879   -2.249  1.00 0.00 ? 858 VAL A HG13 1  
ATOM 1141  H HG21 . VAL A 1 75  ? 1.500   5.627   -2.264  1.00 0.00 ? 858 VAL A HG21 1  
ATOM 1142  H HG22 . VAL A 1 75  ? 2.325   5.565   -3.822  1.00 0.00 ? 858 VAL A HG22 1  
ATOM 1143  H HG23 . VAL A 1 75  ? 2.935   4.622   -2.462  1.00 0.00 ? 858 VAL A HG23 1  
ATOM 1144  N N    . MET A 1 76  ? 3.581   9.767   -1.495  1.00 0.00 ? 859 MET A N    1  
ATOM 1145  C CA   . MET A 1 76  ? 4.436   10.899  -1.157  1.00 0.00 ? 859 MET A CA   1  
ATOM 1146  C C    . MET A 1 76  ? 3.996   11.541  0.155   1.00 0.00 ? 859 MET A C    1  
ATOM 1147  O O    . MET A 1 76  ? 4.809   12.112  0.882   1.00 0.00 ? 859 MET A O    1  
ATOM 1148  C CB   . MET A 1 76  ? 4.410   11.938  -2.280  1.00 0.00 ? 859 MET A CB   1  
ATOM 1149  C CG   . MET A 1 76  ? 5.470   11.708  -3.345  1.00 0.00 ? 859 MET A CG   1  
ATOM 1150  S SD   . MET A 1 76  ? 5.902   13.217  -4.233  1.00 0.00 ? 859 MET A SD   1  
ATOM 1151  C CE   . MET A 1 76  ? 7.633   13.380  -3.800  1.00 0.00 ? 859 MET A CE   1  
ATOM 1152  H H    . MET A 1 76  ? 2.989   9.831   -2.273  1.00 0.00 ? 859 MET A H    1  
ATOM 1153  H HA   . MET A 1 76  ? 5.444   10.530  -1.044  1.00 0.00 ? 859 MET A HA   1  
ATOM 1154  H HB2  . MET A 1 76  ? 3.441   11.912  -2.756  1.00 0.00 ? 859 MET A HB2  1  
ATOM 1155  H HB3  . MET A 1 76  ? 4.567   12.917  -1.853  1.00 0.00 ? 859 MET A HB3  1  
ATOM 1156  H HG2  . MET A 1 76  ? 6.359   11.319  -2.872  1.00 0.00 ? 859 MET A HG2  1  
ATOM 1157  H HG3  . MET A 1 76  ? 5.096   10.984  -4.054  1.00 0.00 ? 859 MET A HG3  1  
ATOM 1158  H HE1  . MET A 1 76  ? 8.018   14.306  -4.200  1.00 0.00 ? 859 MET A HE1  1  
ATOM 1159  H HE2  . MET A 1 76  ? 7.736   13.382  -2.725  1.00 0.00 ? 859 MET A HE2  1  
ATOM 1160  H HE3  . MET A 1 76  ? 8.187   12.550  -4.214  1.00 0.00 ? 859 MET A HE3  1  
ATOM 1161  N N    . LYS A 1 77  ? 2.705   11.443  0.452   1.00 0.00 ? 860 LYS A N    1  
ATOM 1162  C CA   . LYS A 1 77  ? 2.156   12.013  1.677   1.00 0.00 ? 860 LYS A CA   1  
ATOM 1163  C C    . LYS A 1 77  ? 2.214   11.004  2.820   1.00 0.00 ? 860 LYS A C    1  
ATOM 1164  O O    . LYS A 1 77  ? 2.819   11.265  3.859   1.00 0.00 ? 860 LYS A O    1  
ATOM 1165  C CB   . LYS A 1 77  ? 0.710   12.461  1.452   1.00 0.00 ? 860 LYS A CB   1  
ATOM 1166  C CG   . LYS A 1 77  ? 0.589   13.733  0.629   1.00 0.00 ? 860 LYS A CG   1  
ATOM 1167  C CD   . LYS A 1 77  ? 0.636   14.972  1.507   1.00 0.00 ? 860 LYS A CD   1  
ATOM 1168  C CE   . LYS A 1 77  ? 0.008   16.171  0.814   1.00 0.00 ? 860 LYS A CE   1  
ATOM 1169  N NZ   . LYS A 1 77  ? -1.468  16.024  0.681   1.00 0.00 ? 860 LYS A NZ   1  
ATOM 1170  H H    . LYS A 1 77  ? 2.106   10.975  -0.168  1.00 0.00 ? 860 LYS A H    1  
ATOM 1171  H HA   . LYS A 1 77  ? 2.754   12.872  1.940   1.00 0.00 ? 860 LYS A HA   1  
ATOM 1172  H HB2  . LYS A 1 77  ? 0.177   11.674  0.940   1.00 0.00 ? 860 LYS A HB2  1  
ATOM 1173  H HB3  . LYS A 1 77  ? 0.246   12.634  2.412   1.00 0.00 ? 860 LYS A HB3  1  
ATOM 1174  H HG2  . LYS A 1 77  ? 1.405   13.773  -0.077  1.00 0.00 ? 860 LYS A HG2  1  
ATOM 1175  H HG3  . LYS A 1 77  ? -0.351  13.716  0.095   1.00 0.00 ? 860 LYS A HG3  1  
ATOM 1176  H HD2  . LYS A 1 77  ? 0.096   14.775  2.421   1.00 0.00 ? 860 LYS A HD2  1  
ATOM 1177  H HD3  . LYS A 1 77  ? 1.667   15.200  1.738   1.00 0.00 ? 860 LYS A HD3  1  
ATOM 1178  H HE2  . LYS A 1 77  ? 0.223   17.057  1.390   1.00 0.00 ? 860 LYS A HE2  1  
ATOM 1179  H HE3  . LYS A 1 77  ? 0.442   16.268  -0.171  1.00 0.00 ? 860 LYS A HE3  1  
ATOM 1180  H HZ1  . LYS A 1 77  ? -1.850  15.504  1.497   1.00 0.00 ? 860 LYS A HZ1  1  
ATOM 1181  H HZ2  . LYS A 1 77  ? -1.699  15.501  -0.188  1.00 0.00 ? 860 LYS A HZ2  1  
ATOM 1182  H HZ3  . LYS A 1 77  ? -1.918  16.961  0.639   1.00 0.00 ? 860 LYS A HZ3  1  
ATOM 1183  N N    . MET A 1 78  ? 1.583   9.852   2.619   1.00 0.00 ? 861 MET A N    1  
ATOM 1184  C CA   . MET A 1 78  ? 1.566   8.804   3.632   1.00 0.00 ? 861 MET A CA   1  
ATOM 1185  C C    . MET A 1 78  ? 2.984   8.421   4.042   1.00 0.00 ? 861 MET A C    1  
ATOM 1186  O O    . MET A 1 78  ? 3.243   8.116   5.207   1.00 0.00 ? 861 MET A O    1  
ATOM 1187  C CB   . MET A 1 78  ? 0.823   7.572   3.110   1.00 0.00 ? 861 MET A CB   1  
ATOM 1188  C CG   . MET A 1 78  ? -0.689  7.725   3.118   1.00 0.00 ? 861 MET A CG   1  
ATOM 1189  S SD   . MET A 1 78  ? -1.548  6.141   3.081   1.00 0.00 ? 861 MET A SD   1  
ATOM 1190  C CE   . MET A 1 78  ? -3.240  6.666   3.345   1.00 0.00 ? 861 MET A CE   1  
ATOM 1191  H H    . MET A 1 78  ? 1.118   9.702   1.769   1.00 0.00 ? 861 MET A H    1  
ATOM 1192  H HA   . MET A 1 78  ? 1.045   9.187   4.497   1.00 0.00 ? 861 MET A HA   1  
ATOM 1193  H HB2  . MET A 1 78  ? 1.139   7.379   2.096   1.00 0.00 ? 861 MET A HB2  1  
ATOM 1194  H HB3  . MET A 1 78  ? 1.080   6.723   3.726   1.00 0.00 ? 861 MET A HB3  1  
ATOM 1195  H HG2  . MET A 1 78  ? -0.980  8.255   4.013   1.00 0.00 ? 861 MET A HG2  1  
ATOM 1196  H HG3  . MET A 1 78  ? -0.983  8.299   2.252   1.00 0.00 ? 861 MET A HG3  1  
ATOM 1197  H HE1  . MET A 1 78  ? -3.521  7.374   2.579   1.00 0.00 ? 861 MET A HE1  1  
ATOM 1198  H HE2  . MET A 1 78  ? -3.894  5.808   3.300   1.00 0.00 ? 861 MET A HE2  1  
ATOM 1199  H HE3  . MET A 1 78  ? -3.324  7.134   4.315   1.00 0.00 ? 861 MET A HE3  1  
ATOM 1200  N N    . ASP A 1 79  ? 3.899   8.439   3.079   1.00 0.00 ? 862 ASP A N    1  
ATOM 1201  C CA   . ASP A 1 79  ? 5.291   8.094   3.341   1.00 0.00 ? 862 ASP A CA   1  
ATOM 1202  C C    . ASP A 1 79  ? 5.841   8.904   4.511   1.00 0.00 ? 862 ASP A C    1  
ATOM 1203  O O    . ASP A 1 79  ? 6.002   10.120  4.416   1.00 0.00 ? 862 ASP A O    1  
ATOM 1204  C CB   . ASP A 1 79  ? 6.142   8.336   2.093   1.00 0.00 ? 862 ASP A CB   1  
ATOM 1205  C CG   . ASP A 1 79  ? 7.627   8.351   2.398   1.00 0.00 ? 862 ASP A CG   1  
ATOM 1206  O OD1  . ASP A 1 79  ? 8.212   7.258   2.552   1.00 0.00 ? 862 ASP A OD1  1  
ATOM 1207  O OD2  . ASP A 1 79  ? 8.204   9.454   2.482   1.00 0.00 ? 862 ASP A OD2  1  
ATOM 1208  H H    . ASP A 1 79  ? 3.631   8.690   2.170   1.00 0.00 ? 862 ASP A H    1  
ATOM 1209  H HA   . ASP A 1 79  ? 5.332   7.046   3.594   1.00 0.00 ? 862 ASP A HA   1  
ATOM 1210  H HB2  . ASP A 1 79  ? 5.948   7.552   1.375   1.00 0.00 ? 862 ASP A HB2  1  
ATOM 1211  H HB3  . ASP A 1 79  ? 5.872   9.289   1.660   1.00 0.00 ? 862 ASP A HB3  1  
ATOM 1212  N N    . GLY A 1 80  ? 6.126   8.220   5.615   1.00 0.00 ? 863 GLY A N    1  
ATOM 1213  C CA   . GLY A 1 80  ? 6.653   8.892   6.788   1.00 0.00 ? 863 GLY A CA   1  
ATOM 1214  C C    . GLY A 1 80  ? 5.632   9.800   7.444   1.00 0.00 ? 863 GLY A C    1  
ATOM 1215  O O    . GLY A 1 80  ? 5.922   10.958  7.742   1.00 0.00 ? 863 GLY A O    1  
ATOM 1216  H H    . GLY A 1 80  ? 5.977   7.251   5.633   1.00 0.00 ? 863 GLY A H    1  
ATOM 1217  H HA2  . GLY A 1 80  ? 6.970   8.148   7.504   1.00 0.00 ? 863 GLY A HA2  1  
ATOM 1218  H HA3  . GLY A 1 80  ? 7.509   9.483   6.496   1.00 0.00 ? 863 GLY A HA3  1  
ATOM 1219  N N    . MET A 1 81  ? 4.432   9.274   7.668   1.00 0.00 ? 864 MET A N    1  
ATOM 1220  C CA   . MET A 1 81  ? 3.364   10.047  8.292   1.00 0.00 ? 864 MET A CA   1  
ATOM 1221  C C    . MET A 1 81  ? 3.066   9.527   9.695   1.00 0.00 ? 864 MET A C    1  
ATOM 1222  O O    . MET A 1 81  ? 3.222   8.338   9.974   1.00 0.00 ? 864 MET A O    1  
ATOM 1223  C CB   . MET A 1 81  ? 2.098   9.992   7.435   1.00 0.00 ? 864 MET A CB   1  
ATOM 1224  C CG   . MET A 1 81  ? 1.298   8.712   7.614   1.00 0.00 ? 864 MET A CG   1  
ATOM 1225  S SD   . MET A 1 81  ? -0.351  8.817   6.892   1.00 0.00 ? 864 MET A SD   1  
ATOM 1226  C CE   . MET A 1 81  ? -1.201  9.791   8.131   1.00 0.00 ? 864 MET A CE   1  
ATOM 1227  H H    . MET A 1 81  ? 4.260   8.345   7.409   1.00 0.00 ? 864 MET A H    1  
ATOM 1228  H HA   . MET A 1 81  ? 3.695   11.072  8.364   1.00 0.00 ? 864 MET A HA   1  
ATOM 1229  H HB2  . MET A 1 81  ? 1.464   10.826  7.697   1.00 0.00 ? 864 MET A HB2  1  
ATOM 1230  H HB3  . MET A 1 81  ? 2.377   10.074  6.395   1.00 0.00 ? 864 MET A HB3  1  
ATOM 1231  H HG2  . MET A 1 81  ? 1.831   7.901   7.140   1.00 0.00 ? 864 MET A HG2  1  
ATOM 1232  H HG3  . MET A 1 81  ? 1.202   8.509   8.670   1.00 0.00 ? 864 MET A HG3  1  
ATOM 1233  H HE1  . MET A 1 81  ? -1.966  9.190   8.599   1.00 0.00 ? 864 MET A HE1  1  
ATOM 1234  H HE2  . MET A 1 81  ? -0.494  10.120  8.878   1.00 0.00 ? 864 MET A HE2  1  
ATOM 1235  H HE3  . MET A 1 81  ? -1.656  10.652  7.662   1.00 0.00 ? 864 MET A HE3  1  
ATOM 1236  N N    . THR A 1 82  ? 2.635   10.425  10.575  1.00 0.00 ? 865 THR A N    1  
ATOM 1237  C CA   . THR A 1 82  ? 2.316   10.057  11.949  1.00 0.00 ? 865 THR A CA   1  
ATOM 1238  C C    . THR A 1 82  ? 0.851   9.662   12.086  1.00 0.00 ? 865 THR A C    1  
ATOM 1239  O O    . THR A 1 82  ? -0.042  10.393  11.657  1.00 0.00 ? 865 THR A O    1  
ATOM 1240  C CB   . THR A 1 82  ? 2.618   11.211  12.924  1.00 0.00 ? 865 THR A CB   1  
ATOM 1241  O OG1  . THR A 1 82  ? 3.840   11.860  12.552  1.00 0.00 ? 865 THR A OG1  1  
ATOM 1242  C CG2  . THR A 1 82  ? 2.725   10.699  14.352  1.00 0.00 ? 865 THR A CG2  1  
ATOM 1243  H H    . THR A 1 82  ? 2.531   11.358  10.293  1.00 0.00 ? 865 THR A H    1  
ATOM 1244  H HA   . THR A 1 82  ? 2.934   9.214   12.220  1.00 0.00 ? 865 THR A HA   1  
ATOM 1245  H HB   . THR A 1 82  ? 1.810   11.926  12.873  1.00 0.00 ? 865 THR A HB   1  
ATOM 1246  H HG1  . THR A 1 82  ? 3.972   11.774  11.605  1.00 0.00 ? 865 THR A HG1  1  
ATOM 1247  H HG21 . THR A 1 82  ? 3.561   11.173  14.844  1.00 0.00 ? 865 THR A HG21 1  
ATOM 1248  H HG22 . THR A 1 82  ? 2.873   9.629   14.341  1.00 0.00 ? 865 THR A HG22 1  
ATOM 1249  H HG23 . THR A 1 82  ? 1.815   10.930  14.886  1.00 0.00 ? 865 THR A HG23 1  
ATOM 1250  N N    . ILE A 1 83  ? 0.610   8.501   12.687  1.00 0.00 ? 866 ILE A N    1  
ATOM 1251  C CA   . ILE A 1 83  ? -0.749  8.010   12.882  1.00 0.00 ? 866 ILE A CA   1  
ATOM 1252  C C    . ILE A 1 83  ? -0.940  7.470   14.295  1.00 0.00 ? 866 ILE A C    1  
ATOM 1253  O O    . ILE A 1 83  ? -0.349  6.457   14.670  1.00 0.00 ? 866 ILE A O    1  
ATOM 1254  C CB   . ILE A 1 83  ? -1.098  6.904   11.869  1.00 0.00 ? 866 ILE A CB   1  
ATOM 1255  C CG1  . ILE A 1 83  ? -1.136  7.474   10.450  1.00 0.00 ? 866 ILE A CG1  1  
ATOM 1256  C CG2  . ILE A 1 83  ? -2.431  6.262   12.224  1.00 0.00 ? 866 ILE A CG2  1  
ATOM 1257  C CD1  . ILE A 1 83  ? -1.219  6.414   9.374   1.00 0.00 ? 866 ILE A CD1  1  
ATOM 1258  H H    . ILE A 1 83  ? 1.363   7.963   13.007  1.00 0.00 ? 866 ILE A H    1  
ATOM 1259  H HA   . ILE A 1 83  ? -1.427  8.837   12.729  1.00 0.00 ? 866 ILE A HA   1  
ATOM 1260  H HB   . ILE A 1 83  ? -0.334  6.143   11.923  1.00 0.00 ? 866 ILE A HB   1  
ATOM 1261  H HG12 . ILE A 1 83  ? -1.997  8.116   10.349  1.00 0.00 ? 866 ILE A HG12 1  
ATOM 1262  H HG13 . ILE A 1 83  ? -0.240  8.053   10.279  1.00 0.00 ? 866 ILE A HG13 1  
ATOM 1263  H HG21 . ILE A 1 83  ? -2.256  5.343   12.763  1.00 0.00 ? 866 ILE A HG21 1  
ATOM 1264  H HG22 . ILE A 1 83  ? -3.002  6.938   12.843  1.00 0.00 ? 866 ILE A HG22 1  
ATOM 1265  H HG23 . ILE A 1 83  ? -2.981  6.050   11.320  1.00 0.00 ? 866 ILE A HG23 1  
ATOM 1266  H HD11 . ILE A 1 83  ? -0.554  6.671   8.563   1.00 0.00 ? 866 ILE A HD11 1  
ATOM 1267  H HD12 . ILE A 1 83  ? -0.932  5.459   9.787   1.00 0.00 ? 866 ILE A HD12 1  
ATOM 1268  H HD13 . ILE A 1 83  ? -2.232  6.356   9.004   1.00 0.00 ? 866 ILE A HD13 1  
ATOM 1269  N N    . LYS A 1 84  ? -1.772  8.151   15.075  1.00 0.00 ? 867 LYS A N    1  
ATOM 1270  C CA   . LYS A 1 84  ? -2.046  7.739   16.447  1.00 0.00 ? 867 LYS A CA   1  
ATOM 1271  C C    . LYS A 1 84  ? -0.757  7.661   17.259  1.00 0.00 ? 867 LYS A C    1  
ATOM 1272  O O    . LYS A 1 84  ? -0.614  6.805   18.131  1.00 0.00 ? 867 LYS A O    1  
ATOM 1273  C CB   . LYS A 1 84  ? -2.754  6.382   16.462  1.00 0.00 ? 867 LYS A CB   1  
ATOM 1274  C CG   . LYS A 1 84  ? -4.103  6.392   15.764  1.00 0.00 ? 867 LYS A CG   1  
ATOM 1275  C CD   . LYS A 1 84  ? -5.220  6.786   16.717  1.00 0.00 ? 867 LYS A CD   1  
ATOM 1276  C CE   . LYS A 1 84  ? -6.543  6.954   15.985  1.00 0.00 ? 867 LYS A CE   1  
ATOM 1277  N NZ   . LYS A 1 84  ? -6.702  8.329   15.435  1.00 0.00 ? 867 LYS A NZ   1  
ATOM 1278  H H    . LYS A 1 84  ? -2.214  8.951   14.719  1.00 0.00 ? 867 LYS A H    1  
ATOM 1279  H HA   . LYS A 1 84  ? -2.694  8.479   16.892  1.00 0.00 ? 867 LYS A HA   1  
ATOM 1280  H HB2  . LYS A 1 84  ? -2.123  5.656   15.971  1.00 0.00 ? 867 LYS A HB2  1  
ATOM 1281  H HB3  . LYS A 1 84  ? -2.905  6.080   17.488  1.00 0.00 ? 867 LYS A HB3  1  
ATOM 1282  H HG2  . LYS A 1 84  ? -4.072  7.101   14.950  1.00 0.00 ? 867 LYS A HG2  1  
ATOM 1283  H HG3  . LYS A 1 84  ? -4.305  5.404   15.376  1.00 0.00 ? 867 LYS A HG3  1  
ATOM 1284  H HD2  . LYS A 1 84  ? -5.331  6.016   17.466  1.00 0.00 ? 867 LYS A HD2  1  
ATOM 1285  H HD3  . LYS A 1 84  ? -4.961  7.721   17.194  1.00 0.00 ? 867 LYS A HD3  1  
ATOM 1286  H HE2  . LYS A 1 84  ? -6.583  6.244   15.173  1.00 0.00 ? 867 LYS A HE2  1  
ATOM 1287  H HE3  . LYS A 1 84  ? -7.349  6.756   16.676  1.00 0.00 ? 867 LYS A HE3  1  
ATOM 1288  H HZ1  . LYS A 1 84  ? -6.827  8.288   14.403  1.00 0.00 ? 867 LYS A HZ1  1  
ATOM 1289  H HZ2  . LYS A 1 84  ? -5.859  8.899   15.649  1.00 0.00 ? 867 LYS A HZ2  1  
ATOM 1290  H HZ3  . LYS A 1 84  ? -7.534  8.788   15.857  1.00 0.00 ? 867 LYS A HZ3  1  
ATOM 1291  N N    . GLU A 1 85  ? 0.176   8.561   16.967  1.00 0.00 ? 868 GLU A N    1  
ATOM 1292  C CA   . GLU A 1 85  ? 1.453   8.593   17.672  1.00 0.00 ? 868 GLU A CA   1  
ATOM 1293  C C    . GLU A 1 85  ? 2.355   7.450   17.215  1.00 0.00 ? 868 GLU A C    1  
ATOM 1294  O O    . GLU A 1 85  ? 2.929   6.734   18.035  1.00 0.00 ? 868 GLU A O    1  
ATOM 1295  C CB   . GLU A 1 85  ? 1.228   8.509   19.183  1.00 0.00 ? 868 GLU A CB   1  
ATOM 1296  C CG   . GLU A 1 85  ? 2.343   9.140   20.000  1.00 0.00 ? 868 GLU A CG   1  
ATOM 1297  C CD   . GLU A 1 85  ? 2.639   10.566  19.579  1.00 0.00 ? 868 GLU A CD   1  
ATOM 1298  O OE1  . GLU A 1 85  ? 1.948   11.484  20.068  1.00 0.00 ? 868 GLU A OE1  1  
ATOM 1299  O OE2  . GLU A 1 85  ? 3.561   10.765  18.760  1.00 0.00 ? 868 GLU A OE2  1  
ATOM 1300  H H    . GLU A 1 85  ? 0.003   9.218   16.261  1.00 0.00 ? 868 GLU A H    1  
ATOM 1301  H HA   . GLU A 1 85  ? 1.935   9.531   17.441  1.00 0.00 ? 868 GLU A HA   1  
ATOM 1302  H HB2  . GLU A 1 85  ? 0.303   9.010   19.426  1.00 0.00 ? 868 GLU A HB2  1  
ATOM 1303  H HB3  . GLU A 1 85  ? 1.149   7.469   19.465  1.00 0.00 ? 868 GLU A HB3  1  
ATOM 1304  H HG2  . GLU A 1 85  ? 2.053   9.141   21.040  1.00 0.00 ? 868 GLU A HG2  1  
ATOM 1305  H HG3  . GLU A 1 85  ? 3.240   8.551   19.878  1.00 0.00 ? 868 GLU A HG3  1  
ATOM 1306  N N    . ASN A 1 86  ? 2.474   7.286   15.902  1.00 0.00 ? 869 ASN A N    1  
ATOM 1307  C CA   . ASN A 1 86  ? 3.305   6.230   15.336  1.00 0.00 ? 869 ASN A CA   1  
ATOM 1308  C C    . ASN A 1 86  ? 3.706   6.563   13.902  1.00 0.00 ? 869 ASN A C    1  
ATOM 1309  O O    . ASN A 1 86  ? 2.860   6.620   13.008  1.00 0.00 ? 869 ASN A O    1  
ATOM 1310  C CB   . ASN A 1 86  ? 2.562   4.893   15.373  1.00 0.00 ? 869 ASN A CB   1  
ATOM 1311  C CG   . ASN A 1 86  ? 3.500   3.707   15.255  1.00 0.00 ? 869 ASN A CG   1  
ATOM 1312  O OD1  . ASN A 1 86  ? 4.266   3.600   14.297  1.00 0.00 ? 869 ASN A OD1  1  
ATOM 1313  N ND2  . ASN A 1 86  ? 3.443   2.808   16.231  1.00 0.00 ? 869 ASN A ND2  1  
ATOM 1314  H H    . ASN A 1 86  ? 1.992   7.890   15.299  1.00 0.00 ? 869 ASN A H    1  
ATOM 1315  H HA   . ASN A 1 86  ? 4.198   6.152   15.938  1.00 0.00 ? 869 ASN A HA   1  
ATOM 1316  H HB2  . ASN A 1 86  ? 2.026   4.812   16.307  1.00 0.00 ? 869 ASN A HB2  1  
ATOM 1317  H HB3  . ASN A 1 86  ? 1.859   4.856   14.555  1.00 0.00 ? 869 ASN A HB3  1  
ATOM 1318  H HD21 . ASN A 1 86  ? 2.808   2.959   16.962  1.00 0.00 ? 869 ASN A HD21 1  
ATOM 1319  H HD22 . ASN A 1 86  ? 4.039   2.032   16.180  1.00 0.00 ? 869 ASN A HD22 1  
ATOM 1320  N N    . ILE A 1 87  ? 4.999   6.780   13.690  1.00 0.00 ? 870 ILE A N    1  
ATOM 1321  C CA   . ILE A 1 87  ? 5.511   7.105   12.364  1.00 0.00 ? 870 ILE A CA   1  
ATOM 1322  C C    . ILE A 1 87  ? 5.452   5.894   11.440  1.00 0.00 ? 870 ILE A C    1  
ATOM 1323  O O    . ILE A 1 87  ? 6.184   4.922   11.626  1.00 0.00 ? 870 ILE A O    1  
ATOM 1324  C CB   . ILE A 1 87  ? 6.963   7.615   12.432  1.00 0.00 ? 870 ILE A CB   1  
ATOM 1325  C CG1  . ILE A 1 87  ? 6.992   9.085   12.855  1.00 0.00 ? 870 ILE A CG1  1  
ATOM 1326  C CG2  . ILE A 1 87  ? 7.652   7.432   11.087  1.00 0.00 ? 870 ILE A CG2  1  
ATOM 1327  C CD1  . ILE A 1 87  ? 6.757   9.292   14.334  1.00 0.00 ? 870 ILE A CD1  1  
ATOM 1328  H H    . ILE A 1 87  ? 5.624   6.720   14.442  1.00 0.00 ? 870 ILE A H    1  
ATOM 1329  H HA   . ILE A 1 87  ? 4.894   7.890   11.952  1.00 0.00 ? 870 ILE A HA   1  
ATOM 1330  H HB   . ILE A 1 87  ? 7.494   7.026   13.164  1.00 0.00 ? 870 ILE A HB   1  
ATOM 1331  H HG12 . ILE A 1 87  ? 7.955   9.505   12.611  1.00 0.00 ? 870 ILE A HG12 1  
ATOM 1332  H HG13 . ILE A 1 87  ? 6.223   9.621   12.317  1.00 0.00 ? 870 ILE A HG13 1  
ATOM 1333  H HG21 . ILE A 1 87  ? 8.225   6.516   11.098  1.00 0.00 ? 870 ILE A HG21 1  
ATOM 1334  H HG22 . ILE A 1 87  ? 6.908   7.380   10.306  1.00 0.00 ? 870 ILE A HG22 1  
ATOM 1335  H HG23 . ILE A 1 87  ? 8.310   8.267   10.903  1.00 0.00 ? 870 ILE A HG23 1  
ATOM 1336  H HD11 . ILE A 1 87  ? 6.349   10.279  14.500  1.00 0.00 ? 870 ILE A HD11 1  
ATOM 1337  H HD12 . ILE A 1 87  ? 6.063   8.549   14.697  1.00 0.00 ? 870 ILE A HD12 1  
ATOM 1338  H HD13 . ILE A 1 87  ? 7.694   9.198   14.864  1.00 0.00 ? 870 ILE A HD13 1  
ATOM 1339  N N    . ILE A 1 88  ? 4.577   5.961   10.442  1.00 0.00 ? 871 ILE A N    1  
ATOM 1340  C CA   . ILE A 1 88  ? 4.424   4.871   9.487   1.00 0.00 ? 871 ILE A CA   1  
ATOM 1341  C C    . ILE A 1 88  ? 5.111   5.198   8.165   1.00 0.00 ? 871 ILE A C    1  
ATOM 1342  O O    . ILE A 1 88  ? 5.133   6.351   7.733   1.00 0.00 ? 871 ILE A O    1  
ATOM 1343  C CB   . ILE A 1 88  ? 2.939   4.562   9.218   1.00 0.00 ? 871 ILE A CB   1  
ATOM 1344  C CG1  . ILE A 1 88  ? 2.354   5.579   8.236   1.00 0.00 ? 871 ILE A CG1  1  
ATOM 1345  C CG2  . ILE A 1 88  ? 2.154   4.563   10.520  1.00 0.00 ? 871 ILE A CG2  1  
ATOM 1346  C CD1  . ILE A 1 88  ? 2.704   5.295   6.792   1.00 0.00 ? 871 ILE A CD1  1  
ATOM 1347  H H    . ILE A 1 88  ? 4.022   6.762   10.346  1.00 0.00 ? 871 ILE A H    1  
ATOM 1348  H HA   . ILE A 1 88  ? 4.883   3.990   9.910   1.00 0.00 ? 871 ILE A HA   1  
ATOM 1349  H HB   . ILE A 1 88  ? 2.873   3.575   8.786   1.00 0.00 ? 871 ILE A HB   1  
ATOM 1350  H HG12 . ILE A 1 88  ? 1.279   5.577   8.323   1.00 0.00 ? 871 ILE A HG12 1  
ATOM 1351  H HG13 . ILE A 1 88  ? 2.729   6.562   8.481   1.00 0.00 ? 871 ILE A HG13 1  
ATOM 1352  H HG21 . ILE A 1 88  ? 1.350   5.281   10.455  1.00 0.00 ? 871 ILE A HG21 1  
ATOM 1353  H HG22 . ILE A 1 88  ? 1.744   3.579   10.694  1.00 0.00 ? 871 ILE A HG22 1  
ATOM 1354  H HG23 . ILE A 1 88  ? 2.809   4.829   11.336  1.00 0.00 ? 871 ILE A HG23 1  
ATOM 1355  H HD11 . ILE A 1 88  ? 3.204   6.152   6.366   1.00 0.00 ? 871 ILE A HD11 1  
ATOM 1356  H HD12 . ILE A 1 88  ? 3.354   4.435   6.741   1.00 0.00 ? 871 ILE A HD12 1  
ATOM 1357  H HD13 . ILE A 1 88  ? 1.799   5.095   6.235   1.00 0.00 ? 871 ILE A HD13 1  
ATOM 1358  N N    . LYS A 1 89  ? 5.670   4.176   7.526   1.00 0.00 ? 872 LYS A N    1  
ATOM 1359  C CA   . LYS A 1 89  ? 6.356   4.352   6.252   1.00 0.00 ? 872 LYS A CA   1  
ATOM 1360  C C    . LYS A 1 89  ? 5.581   3.684   5.120   1.00 0.00 ? 872 LYS A C    1  
ATOM 1361  O O    . LYS A 1 89  ? 4.900   2.680   5.329   1.00 0.00 ? 872 LYS A O    1  
ATOM 1362  C CB   . LYS A 1 89  ? 7.771   3.774   6.326   1.00 0.00 ? 872 LYS A CB   1  
ATOM 1363  C CG   . LYS A 1 89  ? 8.567   3.950   5.045   1.00 0.00 ? 872 LYS A CG   1  
ATOM 1364  C CD   . LYS A 1 89  ? 9.683   2.924   4.937   1.00 0.00 ? 872 LYS A CD   1  
ATOM 1365  C CE   . LYS A 1 89  ? 10.263  2.877   3.532   1.00 0.00 ? 872 LYS A CE   1  
ATOM 1366  N NZ   . LYS A 1 89  ? 11.004  4.124   3.196   1.00 0.00 ? 872 LYS A NZ   1  
ATOM 1367  H H    . LYS A 1 89  ? 5.619   3.280   7.922   1.00 0.00 ? 872 LYS A H    1  
ATOM 1368  H HA   . LYS A 1 89  ? 6.419   5.411   6.052   1.00 0.00 ? 872 LYS A HA   1  
ATOM 1369  H HB2  . LYS A 1 89  ? 8.305   4.263   7.127   1.00 0.00 ? 872 LYS A HB2  1  
ATOM 1370  H HB3  . LYS A 1 89  ? 7.704   2.717   6.541   1.00 0.00 ? 872 LYS A HB3  1  
ATOM 1371  H HG2  . LYS A 1 89  ? 7.904   3.834   4.200   1.00 0.00 ? 872 LYS A HG2  1  
ATOM 1372  H HG3  . LYS A 1 89  ? 8.999   4.940   5.033   1.00 0.00 ? 872 LYS A HG3  1  
ATOM 1373  H HD2  . LYS A 1 89  ? 10.469  3.185   5.630   1.00 0.00 ? 872 LYS A HD2  1  
ATOM 1374  H HD3  . LYS A 1 89  ? 9.289   1.949   5.188   1.00 0.00 ? 872 LYS A HD3  1  
ATOM 1375  H HE2  . LYS A 1 89  ? 10.938  2.037   3.463   1.00 0.00 ? 872 LYS A HE2  1  
ATOM 1376  H HE3  . LYS A 1 89  ? 9.455   2.747   2.827   1.00 0.00 ? 872 LYS A HE3  1  
ATOM 1377  H HZ1  . LYS A 1 89  ? 12.029  3.950   3.227   1.00 0.00 ? 872 LYS A HZ1  1  
ATOM 1378  H HZ2  . LYS A 1 89  ? 10.771  4.873   3.878   1.00 0.00 ? 872 LYS A HZ2  1  
ATOM 1379  H HZ3  . LYS A 1 89  ? 10.747  4.446   2.241   1.00 0.00 ? 872 LYS A HZ3  1  
ATOM 1380  N N    . VAL A 1 90  ? 5.691   4.247   3.921   1.00 0.00 ? 873 VAL A N    1  
ATOM 1381  C CA   . VAL A 1 90  ? 5.003   3.704   2.756   1.00 0.00 ? 873 VAL A CA   1  
ATOM 1382  C C    . VAL A 1 90  ? 5.997   3.207   1.712   1.00 0.00 ? 873 VAL A C    1  
ATOM 1383  O O    . VAL A 1 90  ? 7.153   3.629   1.691   1.00 0.00 ? 873 VAL A O    1  
ATOM 1384  C CB   . VAL A 1 90  ? 4.079   4.754   2.110   1.00 0.00 ? 873 VAL A CB   1  
ATOM 1385  C CG1  . VAL A 1 90  ? 3.249   4.125   1.001   1.00 0.00 ? 873 VAL A CG1  1  
ATOM 1386  C CG2  . VAL A 1 90  ? 3.184   5.394   3.160   1.00 0.00 ? 873 VAL A CG2  1  
ATOM 1387  H H    . VAL A 1 90  ? 6.249   5.046   3.817   1.00 0.00 ? 873 VAL A H    1  
ATOM 1388  H HA   . VAL A 1 90  ? 4.395   2.874   3.084   1.00 0.00 ? 873 VAL A HA   1  
ATOM 1389  H HB   . VAL A 1 90  ? 4.696   5.526   1.673   1.00 0.00 ? 873 VAL A HB   1  
ATOM 1390  H HG11 . VAL A 1 90  ? 3.882   3.917   0.151   1.00 0.00 ? 873 VAL A HG11 1  
ATOM 1391  H HG12 . VAL A 1 90  ? 2.809   3.205   1.358   1.00 0.00 ? 873 VAL A HG12 1  
ATOM 1392  H HG13 . VAL A 1 90  ? 2.466   4.808   0.707   1.00 0.00 ? 873 VAL A HG13 1  
ATOM 1393  H HG21 . VAL A 1 90  ? 2.284   4.808   3.271   1.00 0.00 ? 873 VAL A HG21 1  
ATOM 1394  H HG22 . VAL A 1 90  ? 3.707   5.432   4.104   1.00 0.00 ? 873 VAL A HG22 1  
ATOM 1395  H HG23 . VAL A 1 90  ? 2.926   6.396   2.851   1.00 0.00 ? 873 VAL A HG23 1  
ATOM 1396  N N    . ALA A 1 91  ? 5.539   2.308   0.847   1.00 0.00 ? 874 ALA A N    1  
ATOM 1397  C CA   . ALA A 1 91  ? 6.387   1.755   -0.201  1.00 0.00 ? 874 ALA A CA   1  
ATOM 1398  C C    . ALA A 1 91  ? 5.550   1.157   -1.327  1.00 0.00 ? 874 ALA A C    1  
ATOM 1399  O O    . ALA A 1 91  ? 4.637   0.368   -1.082  1.00 0.00 ? 874 ALA A O    1  
ATOM 1400  C CB   . ALA A 1 91  ? 7.324   0.705   0.377   1.00 0.00 ? 874 ALA A CB   1  
ATOM 1401  H H    . ALA A 1 91  ? 4.608   2.011   0.915   1.00 0.00 ? 874 ALA A H    1  
ATOM 1402  H HA   . ALA A 1 91  ? 6.989   2.558   -0.601  1.00 0.00 ? 874 ALA A HA   1  
ATOM 1403  H HB1  . ALA A 1 91  ? 6.797   -0.233  0.474   1.00 0.00 ? 874 ALA A HB1  1  
ATOM 1404  H HB2  . ALA A 1 91  ? 8.171   0.577   -0.281  1.00 0.00 ? 874 ALA A HB2  1  
ATOM 1405  H HB3  . ALA A 1 91  ? 7.668   1.026   1.349   1.00 0.00 ? 874 ALA A HB3  1  
ATOM 1406  N N    . ILE A 1 92  ? 5.866   1.539   -2.559  1.00 0.00 ? 875 ILE A N    1  
ATOM 1407  C CA   . ILE A 1 92  ? 5.142   1.040   -3.722  1.00 0.00 ? 875 ILE A CA   1  
ATOM 1408  C C    . ILE A 1 92  ? 5.282   -0.474  -3.848  1.00 0.00 ? 875 ILE A C    1  
ATOM 1409  O O    . ILE A 1 92  ? 6.377   -0.990  -4.071  1.00 0.00 ? 875 ILE A O    1  
ATOM 1410  C CB   . ILE A 1 92  ? 5.640   1.700   -5.021  1.00 0.00 ? 875 ILE A CB   1  
ATOM 1411  C CG1  . ILE A 1 92  ? 5.431   3.215   -4.961  1.00 0.00 ? 875 ILE A CG1  1  
ATOM 1412  C CG2  . ILE A 1 92  ? 4.922   1.108   -6.225  1.00 0.00 ? 875 ILE A CG2  1  
ATOM 1413  C CD1  . ILE A 1 92  ? 3.976   3.626   -4.992  1.00 0.00 ? 875 ILE A CD1  1  
ATOM 1414  H H    . ILE A 1 92  ? 6.603   2.171   -2.690  1.00 0.00 ? 875 ILE A H    1  
ATOM 1415  H HA   . ILE A 1 92  ? 4.098   1.284   -3.595  1.00 0.00 ? 875 ILE A HA   1  
ATOM 1416  H HB   . ILE A 1 92  ? 6.694   1.493   -5.123  1.00 0.00 ? 875 ILE A HB   1  
ATOM 1417  H HG12 . ILE A 1 92  ? 5.864   3.596   -4.050  1.00 0.00 ? 875 ILE A HG12 1  
ATOM 1418  H HG13 . ILE A 1 92  ? 5.924   3.672   -5.808  1.00 0.00 ? 875 ILE A HG13 1  
ATOM 1419  H HG21 . ILE A 1 92  ? 5.035   1.769   -7.072  1.00 0.00 ? 875 ILE A HG21 1  
ATOM 1420  H HG22 . ILE A 1 92  ? 5.350   0.146   -6.461  1.00 0.00 ? 875 ILE A HG22 1  
ATOM 1421  H HG23 . ILE A 1 92  ? 3.873   0.991   -5.997  1.00 0.00 ? 875 ILE A HG23 1  
ATOM 1422  H HD11 . ILE A 1 92  ? 3.901   4.668   -5.264  1.00 0.00 ? 875 ILE A HD11 1  
ATOM 1423  H HD12 . ILE A 1 92  ? 3.446   3.025   -5.715  1.00 0.00 ? 875 ILE A HD12 1  
ATOM 1424  H HD13 . ILE A 1 92  ? 3.540   3.479   -4.014  1.00 0.00 ? 875 ILE A HD13 1  
ATOM 1425  N N    . SER A 1 93  ? 4.165   -1.180  -3.707  1.00 0.00 ? 876 SER A N    1  
ATOM 1426  C CA   . SER A 1 93  ? 4.163   -2.635  -3.803  1.00 0.00 ? 876 SER A CA   1  
ATOM 1427  C C    . SER A 1 93  ? 4.688   -3.090  -5.162  1.00 0.00 ? 876 SER A C    1  
ATOM 1428  O O    . SER A 1 93  ? 3.914   -3.359  -6.080  1.00 0.00 ? 876 SER A O    1  
ATOM 1429  C CB   . SER A 1 93  ? 2.750   -3.179  -3.581  1.00 0.00 ? 876 SER A CB   1  
ATOM 1430  O OG   . SER A 1 93  ? 2.498   -3.396  -2.204  1.00 0.00 ? 876 SER A OG   1  
ATOM 1431  H H    . SER A 1 93  ? 3.322   -0.710  -3.531  1.00 0.00 ? 876 SER A H    1  
ATOM 1432  H HA   . SER A 1 93  ? 4.813   -3.019  -3.032  1.00 0.00 ? 876 SER A HA   1  
ATOM 1433  H HB2  . SER A 1 93  ? 2.030   -2.470  -3.960  1.00 0.00 ? 876 SER A HB2  1  
ATOM 1434  H HB3  . SER A 1 93  ? 2.643   -4.117  -4.107  1.00 0.00 ? 876 SER A HB3  1  
ATOM 1435  H HG   . SER A 1 93  ? 1.926   -2.701  -1.870  1.00 0.00 ? 876 SER A HG   1  
ATOM 1436  N N    . ASN A 1 94  ? 6.009   -3.174  -5.280  1.00 0.00 ? 877 ASN A N    1  
ATOM 1437  C CA   . ASN A 1 94  ? 6.639   -3.596  -6.526  1.00 0.00 ? 877 ASN A CA   1  
ATOM 1438  C C    . ASN A 1 94  ? 7.063   -5.059  -6.452  1.00 0.00 ? 877 ASN A C    1  
ATOM 1439  O O    . ASN A 1 94  ? 6.730   -5.858  -7.328  1.00 0.00 ? 877 ASN A O    1  
ATOM 1440  C CB   . ASN A 1 94  ? 7.853   -2.716  -6.831  1.00 0.00 ? 877 ASN A CB   1  
ATOM 1441  C CG   . ASN A 1 94  ? 8.297   -2.825  -8.277  1.00 0.00 ? 877 ASN A CG   1  
ATOM 1442  O OD1  . ASN A 1 94  ? 7.550   -3.297  -9.134  1.00 0.00 ? 877 ASN A OD1  1  
ATOM 1443  N ND2  . ASN A 1 94  ? 9.521   -2.389  -8.555  1.00 0.00 ? 877 ASN A ND2  1  
ATOM 1444  H H    . ASN A 1 94  ? 6.574   -2.946  -4.513  1.00 0.00 ? 877 ASN A H    1  
ATOM 1445  H HA   . ASN A 1 94  ? 5.915   -3.482  -7.319  1.00 0.00 ? 877 ASN A HA   1  
ATOM 1446  H HB2  . ASN A 1 94  ? 7.602   -1.684  -6.629  1.00 0.00 ? 877 ASN A HB2  1  
ATOM 1447  H HB3  . ASN A 1 94  ? 8.675   -3.013  -6.197  1.00 0.00 ? 877 ASN A HB3  1  
ATOM 1448  H HD21 . ASN A 1 94  ? 10.061  -2.027  -7.821  1.00 0.00 ? 877 ASN A HD21 1  
ATOM 1449  H HD22 . ASN A 1 94  ? 9.833   -2.448  -9.481  1.00 0.00 ? 877 ASN A HD22 1  
ATOM 1450  N N    . SER A 1 95  ? 7.801   -5.404  -5.402  1.00 0.00 ? 878 SER A N    1  
ATOM 1451  C CA   . SER A 1 95  ? 8.274   -6.770  -5.215  1.00 0.00 ? 878 SER A CA   1  
ATOM 1452  C C    . SER A 1 95  ? 7.116   -7.705  -4.877  1.00 0.00 ? 878 SER A C    1  
ATOM 1453  O O    . SER A 1 95  ? 6.319   -7.427  -3.982  1.00 0.00 ? 878 SER A O    1  
ATOM 1454  C CB   . SER A 1 95  ? 9.325   -6.821  -4.104  1.00 0.00 ? 878 SER A CB   1  
ATOM 1455  O OG   . SER A 1 95  ? 10.534  -6.209  -4.518  1.00 0.00 ? 878 SER A OG   1  
ATOM 1456  H H    . SER A 1 95  ? 8.034   -4.722  -4.738  1.00 0.00 ? 878 SER A H    1  
ATOM 1457  H HA   . SER A 1 95  ? 8.724   -7.095  -6.141  1.00 0.00 ? 878 SER A HA   1  
ATOM 1458  H HB2  . SER A 1 95  ? 8.952   -6.302  -3.235  1.00 0.00 ? 878 SER A HB2  1  
ATOM 1459  H HB3  . SER A 1 95  ? 9.526   -7.852  -3.850  1.00 0.00 ? 878 SER A HB3  1  
ATOM 1460  H HG   . SER A 1 95  ? 11.096  -6.863  -4.940  1.00 0.00 ? 878 SER A HG   1  
ATOM 1461  N N    . GLY A 1 96  ? 7.029   -8.816  -5.603  1.00 0.00 ? 879 GLY A N    1  
ATOM 1462  C CA   . GLY A 1 96  ? 5.966   -9.775  -5.367  1.00 0.00 ? 879 GLY A CA   1  
ATOM 1463  C C    . GLY A 1 96  ? 6.384   -11.195 -5.691  1.00 0.00 ? 879 GLY A C    1  
ATOM 1464  O O    . GLY A 1 96  ? 6.893   -11.925 -4.840  1.00 0.00 ? 879 GLY A O    1  
ATOM 1465  H H    . GLY A 1 96  ? 7.692   -8.985  -6.304  1.00 0.00 ? 879 GLY A H    1  
ATOM 1466  H HA2  . GLY A 1 96  ? 5.674   -9.724  -4.328  1.00 0.00 ? 879 GLY A HA2  1  
ATOM 1467  H HA3  . GLY A 1 96  ? 5.117   -9.513  -5.981  1.00 0.00 ? 879 GLY A HA3  1  
ATOM 1468  N N    . PRO A 1 97  ? 6.166   -11.608 -6.949  1.00 0.00 ? 880 PRO A N    1  
ATOM 1469  C CA   . PRO A 1 97  ? 6.516   -12.954 -7.412  1.00 0.00 ? 880 PRO A CA   1  
ATOM 1470  C C    . PRO A 1 97  ? 8.024   -13.163 -7.500  1.00 0.00 ? 880 PRO A C    1  
ATOM 1471  O O    . PRO A 1 97  ? 8.669   -12.709 -8.444  1.00 0.00 ? 880 PRO A O    1  
ATOM 1472  C CB   . PRO A 1 97  ? 5.884   -13.025 -8.805  1.00 0.00 ? 880 PRO A CB   1  
ATOM 1473  C CG   . PRO A 1 97  ? 5.802   -11.607 -9.256  1.00 0.00 ? 880 PRO A CG   1  
ATOM 1474  C CD   . PRO A 1 97  ? 5.563   -10.791 -8.016  1.00 0.00 ? 880 PRO A CD   1  
ATOM 1475  H HA   . PRO A 1 97  ? 6.084   -13.716 -6.780  1.00 0.00 ? 880 PRO A HA   1  
ATOM 1476  H HB2  . PRO A 1 97  ? 6.513   -13.613 -9.458  1.00 0.00 ? 880 PRO A HB2  1  
ATOM 1477  H HB3  . PRO A 1 97  ? 4.905   -13.475 -8.737  1.00 0.00 ? 880 PRO A HB3  1  
ATOM 1478  H HG2  . PRO A 1 97  ? 6.730   -11.316 -9.724  1.00 0.00 ? 880 PRO A HG2  1  
ATOM 1479  H HG3  . PRO A 1 97  ? 4.979   -11.490 -9.946  1.00 0.00 ? 880 PRO A HG3  1  
ATOM 1480  H HD2  . PRO A 1 97  ? 6.056   -9.833  -8.094  1.00 0.00 ? 880 PRO A HD2  1  
ATOM 1481  H HD3  . PRO A 1 97  ? 4.504   -10.660 -7.848  1.00 0.00 ? 880 PRO A HD3  1  
ATOM 1482  N N    . SER A 1 98  ? 8.579   -13.854 -6.510  1.00 0.00 ? 881 SER A N    1  
ATOM 1483  C CA   . SER A 1 98  ? 10.012  -14.121 -6.474  1.00 0.00 ? 881 SER A CA   1  
ATOM 1484  C C    . SER A 1 98  ? 10.427  -15.017 -7.637  1.00 0.00 ? 881 SER A C    1  
ATOM 1485  O O    . SER A 1 98  ? 10.090  -16.201 -7.674  1.00 0.00 ? 881 SER A O    1  
ATOM 1486  C CB   . SER A 1 98  ? 10.397  -14.778 -5.147  1.00 0.00 ? 881 SER A CB   1  
ATOM 1487  O OG   . SER A 1 98  ? 11.775  -15.110 -5.122  1.00 0.00 ? 881 SER A OG   1  
ATOM 1488  H H    . SER A 1 98  ? 8.011   -14.191 -5.785  1.00 0.00 ? 881 SER A H    1  
ATOM 1489  H HA   . SER A 1 98  ? 10.528  -13.176 -6.561  1.00 0.00 ? 881 SER A HA   1  
ATOM 1490  H HB2  . SER A 1 98  ? 10.190  -14.095 -4.337  1.00 0.00 ? 881 SER A HB2  1  
ATOM 1491  H HB3  . SER A 1 98  ? 9.819   -15.681 -5.014  1.00 0.00 ? 881 SER A HB3  1  
ATOM 1492  H HG   . SER A 1 98  ? 12.202  -14.653 -4.394  1.00 0.00 ? 881 SER A HG   1  
ATOM 1493  N N    . SER A 1 99  ? 11.161  -14.444 -8.585  1.00 0.00 ? 882 SER A N    1  
ATOM 1494  C CA   . SER A 1 99  ? 11.620  -15.188 -9.752  1.00 0.00 ? 882 SER A CA   1  
ATOM 1495  C C    . SER A 1 99  ? 12.790  -16.099 -9.390  1.00 0.00 ? 882 SER A C    1  
ATOM 1496  O O    . SER A 1 99  ? 12.708  -17.318 -9.530  1.00 0.00 ? 882 SER A O    1  
ATOM 1497  C CB   . SER A 1 99  ? 12.034  -14.226 -10.867 1.00 0.00 ? 882 SER A CB   1  
ATOM 1498  O OG   . SER A 1 99  ? 12.753  -14.902 -11.883 1.00 0.00 ? 882 SER A OG   1  
ATOM 1499  H H    . SER A 1 99  ? 11.398  -13.496 -8.498  1.00 0.00 ? 882 SER A H    1  
ATOM 1500  H HA   . SER A 1 99  ? 10.799  -15.797 -10.100 1.00 0.00 ? 882 SER A HA   1  
ATOM 1501  H HB2  . SER A 1 99  ? 11.151  -13.782 -11.302 1.00 0.00 ? 882 SER A HB2  1  
ATOM 1502  H HB3  . SER A 1 99  ? 12.661  -13.449 -10.453 1.00 0.00 ? 882 SER A HB3  1  
ATOM 1503  H HG   . SER A 1 99  ? 12.294  -14.803 -12.720 1.00 0.00 ? 882 SER A HG   1  
ATOM 1504  N N    . GLY A 1 100 ? 13.879  -15.495 -8.924  1.00 0.00 ? 883 GLY A N    1  
ATOM 1505  C CA   . GLY A 1 100 ? 15.050  -16.265 -8.549  1.00 0.00 ? 883 GLY A CA   1  
ATOM 1506  C C    . GLY A 1 100 ? 16.341  -15.503 -8.774  1.00 0.00 ? 883 GLY A C    1  
ATOM 1507  O O    . GLY A 1 100 ? 17.164  -15.383 -7.866  1.00 0.00 ? 883 GLY A O    1  
ATOM 1508  H H    . GLY A 1 100 ? 13.887  -14.519 -8.833  1.00 0.00 ? 883 GLY A H    1  
ATOM 1509  H HA2  . GLY A 1 100 ? 14.976  -16.528 -7.504  1.00 0.00 ? 883 GLY A HA2  1  
ATOM 1510  H HA3  . GLY A 1 100 ? 15.074  -17.172 -9.136  1.00 0.00 ? 883 GLY A HA3  1  
ATOM 1511  N N    . GLY A 1 1   ? 1.684   24.302  -16.834 1.00 0.00 ? 784 GLY A N    2  
ATOM 1512  C CA   . GLY A 1 1   ? 2.387   23.037  -16.733 1.00 0.00 ? 784 GLY A CA   2  
ATOM 1513  C C    . GLY A 1 1   ? 3.165   22.703  -17.991 1.00 0.00 ? 784 GLY A C    2  
ATOM 1514  O O    . GLY A 1 1   ? 2.735   21.875  -18.793 1.00 0.00 ? 784 GLY A O    2  
ATOM 1515  H H1   . GLY A 1 1   ? 2.130   25.132  -16.562 1.00 0.00 ? 784 GLY A H1   2  
ATOM 1516  H HA2  . GLY A 1 1   ? 3.072   23.084  -15.900 1.00 0.00 ? 784 GLY A HA2  2  
ATOM 1517  H HA3  . GLY A 1 1   ? 1.667   22.252  -16.550 1.00 0.00 ? 784 GLY A HA3  2  
ATOM 1518  N N    . SER A 1 2   ? 4.312   23.351  -18.164 1.00 0.00 ? 785 SER A N    2  
ATOM 1519  C CA   . SER A 1 2   ? 5.150   23.123  -19.336 1.00 0.00 ? 785 SER A CA   2  
ATOM 1520  C C    . SER A 1 2   ? 6.300   22.177  -19.006 1.00 0.00 ? 785 SER A C    2  
ATOM 1521  O O    . SER A 1 2   ? 7.412   22.615  -18.709 1.00 0.00 ? 785 SER A O    2  
ATOM 1522  C CB   . SER A 1 2   ? 5.700   24.450  -19.862 1.00 0.00 ? 785 SER A CB   2  
ATOM 1523  O OG   . SER A 1 2   ? 6.356   25.173  -18.835 1.00 0.00 ? 785 SER A OG   2  
ATOM 1524  H H    . SER A 1 2   ? 4.602   24.000  -17.488 1.00 0.00 ? 785 SER A H    2  
ATOM 1525  H HA   . SER A 1 2   ? 4.535   22.670  -20.099 1.00 0.00 ? 785 SER A HA   2  
ATOM 1526  H HB2  . SER A 1 2   ? 6.405   24.255  -20.656 1.00 0.00 ? 785 SER A HB2  2  
ATOM 1527  H HB3  . SER A 1 2   ? 4.885   25.048  -20.244 1.00 0.00 ? 785 SER A HB3  2  
ATOM 1528  H HG   . SER A 1 2   ? 7.050   25.714  -19.218 1.00 0.00 ? 785 SER A HG   2  
ATOM 1529  N N    . SER A 1 3   ? 6.025   20.878  -19.059 1.00 0.00 ? 786 SER A N    2  
ATOM 1530  C CA   . SER A 1 3   ? 7.035   19.869  -18.762 1.00 0.00 ? 786 SER A CA   2  
ATOM 1531  C C    . SER A 1 3   ? 6.939   18.701  -19.739 1.00 0.00 ? 786 SER A C    2  
ATOM 1532  O O    . SER A 1 3   ? 5.911   18.030  -19.823 1.00 0.00 ? 786 SER A O    2  
ATOM 1533  C CB   . SER A 1 3   ? 6.875   19.364  -17.327 1.00 0.00 ? 786 SER A CB   2  
ATOM 1534  O OG   . SER A 1 3   ? 7.228   20.368  -16.391 1.00 0.00 ? 786 SER A OG   2  
ATOM 1535  H H    . SER A 1 3   ? 5.119   20.592  -19.302 1.00 0.00 ? 786 SER A H    2  
ATOM 1536  H HA   . SER A 1 3   ? 8.005   20.331  -18.866 1.00 0.00 ? 786 SER A HA   2  
ATOM 1537  H HB2  . SER A 1 3   ? 5.847   19.079  -17.161 1.00 0.00 ? 786 SER A HB2  2  
ATOM 1538  H HB3  . SER A 1 3   ? 7.515   18.507  -17.177 1.00 0.00 ? 786 SER A HB3  2  
ATOM 1539  H HG   . SER A 1 3   ? 7.009   21.231  -16.749 1.00 0.00 ? 786 SER A HG   2  
ATOM 1540  N N    . GLY A 1 4   ? 8.020   18.463  -20.475 1.00 0.00 ? 787 GLY A N    2  
ATOM 1541  C CA   . GLY A 1 4   ? 8.039   17.376  -21.436 1.00 0.00 ? 787 GLY A CA   2  
ATOM 1542  C C    . GLY A 1 4   ? 9.410   17.164  -22.046 1.00 0.00 ? 787 GLY A C    2  
ATOM 1543  O O    . GLY A 1 4   ? 9.998   18.090  -22.606 1.00 0.00 ? 787 GLY A O    2  
ATOM 1544  H H    . GLY A 1 4   ? 8.812   19.031  -20.365 1.00 0.00 ? 787 GLY A H    2  
ATOM 1545  H HA2  . GLY A 1 4   ? 7.732   16.467  -20.941 1.00 0.00 ? 787 GLY A HA2  2  
ATOM 1546  H HA3  . GLY A 1 4   ? 7.336   17.597  -22.227 1.00 0.00 ? 787 GLY A HA3  2  
ATOM 1547  N N    . SER A 1 5   ? 9.922   15.943  -21.937 1.00 0.00 ? 788 SER A N    2  
ATOM 1548  C CA   . SER A 1 5   ? 11.236  15.614  -22.478 1.00 0.00 ? 788 SER A CA   2  
ATOM 1549  C C    . SER A 1 5   ? 11.120  14.588  -23.601 1.00 0.00 ? 788 SER A C    2  
ATOM 1550  O O    . SER A 1 5   ? 10.496  13.540  -23.438 1.00 0.00 ? 788 SER A O    2  
ATOM 1551  C CB   . SER A 1 5   ? 12.146  15.075  -21.372 1.00 0.00 ? 788 SER A CB   2  
ATOM 1552  O OG   . SER A 1 5   ? 13.508  15.343  -21.656 1.00 0.00 ? 788 SER A OG   2  
ATOM 1553  H H    . SER A 1 5   ? 9.405   15.247  -21.480 1.00 0.00 ? 788 SER A H    2  
ATOM 1554  H HA   . SER A 1 5   ? 11.667  16.520  -22.877 1.00 0.00 ? 788 SER A HA   2  
ATOM 1555  H HB2  . SER A 1 5   ? 11.887  15.545  -20.436 1.00 0.00 ? 788 SER A HB2  2  
ATOM 1556  H HB3  . SER A 1 5   ? 12.011  14.006  -21.288 1.00 0.00 ? 788 SER A HB3  2  
ATOM 1557  H HG   . SER A 1 5   ? 13.596  16.239  -21.989 1.00 0.00 ? 788 SER A HG   2  
ATOM 1558  N N    . SER A 1 6   ? 11.726  14.899  -24.743 1.00 0.00 ? 789 SER A N    2  
ATOM 1559  C CA   . SER A 1 6   ? 11.689  14.007  -25.896 1.00 0.00 ? 789 SER A CA   2  
ATOM 1560  C C    . SER A 1 6   ? 12.070  12.585  -25.495 1.00 0.00 ? 789 SER A C    2  
ATOM 1561  O O    . SER A 1 6   ? 13.116  12.358  -24.889 1.00 0.00 ? 789 SER A O    2  
ATOM 1562  C CB   . SER A 1 6   ? 12.632  14.511  -26.989 1.00 0.00 ? 789 SER A CB   2  
ATOM 1563  O OG   . SER A 1 6   ? 12.423  13.815  -28.205 1.00 0.00 ? 789 SER A OG   2  
ATOM 1564  H H    . SER A 1 6   ? 12.208  15.749  -24.811 1.00 0.00 ? 789 SER A H    2  
ATOM 1565  H HA   . SER A 1 6   ? 10.679  14.002  -26.278 1.00 0.00 ? 789 SER A HA   2  
ATOM 1566  H HB2  . SER A 1 6   ? 12.456  15.563  -27.156 1.00 0.00 ? 789 SER A HB2  2  
ATOM 1567  H HB3  . SER A 1 6   ? 13.655  14.363  -26.674 1.00 0.00 ? 789 SER A HB3  2  
ATOM 1568  H HG   . SER A 1 6   ? 11.753  14.267  -28.722 1.00 0.00 ? 789 SER A HG   2  
ATOM 1569  N N    . GLY A 1 7   ? 11.212  11.629  -25.840 1.00 0.00 ? 790 GLY A N    2  
ATOM 1570  C CA   . GLY A 1 7   ? 11.476  10.241  -25.508 1.00 0.00 ? 790 GLY A CA   2  
ATOM 1571  C C    . GLY A 1 7   ? 10.410  9.647   -24.609 1.00 0.00 ? 790 GLY A C    2  
ATOM 1572  O O    . GLY A 1 7   ? 10.531  9.681   -23.384 1.00 0.00 ? 790 GLY A O    2  
ATOM 1573  H H    . GLY A 1 7   ? 10.394  11.868  -26.323 1.00 0.00 ? 790 GLY A H    2  
ATOM 1574  H HA2  . GLY A 1 7   ? 11.523  9.667   -26.422 1.00 0.00 ? 790 GLY A HA2  2  
ATOM 1575  H HA3  . GLY A 1 7   ? 12.430  10.178  -25.006 1.00 0.00 ? 790 GLY A HA3  2  
ATOM 1576  N N    . VAL A 1 8   ? 9.361   9.102   -25.217 1.00 0.00 ? 791 VAL A N    2  
ATOM 1577  C CA   . VAL A 1 8   ? 8.269   8.498   -24.463 1.00 0.00 ? 791 VAL A CA   2  
ATOM 1578  C C    . VAL A 1 8   ? 8.568   7.039   -24.135 1.00 0.00 ? 791 VAL A C    2  
ATOM 1579  O O    . VAL A 1 8   ? 8.753   6.215   -25.031 1.00 0.00 ? 791 VAL A O    2  
ATOM 1580  C CB   . VAL A 1 8   ? 6.941   8.576   -25.239 1.00 0.00 ? 791 VAL A CB   2  
ATOM 1581  C CG1  . VAL A 1 8   ? 5.830   7.881   -24.467 1.00 0.00 ? 791 VAL A CG1  2  
ATOM 1582  C CG2  . VAL A 1 8   ? 6.577   10.025  -25.526 1.00 0.00 ? 791 VAL A CG2  2  
ATOM 1583  H H    . VAL A 1 8   ? 9.322   9.105   -26.196 1.00 0.00 ? 791 VAL A H    2  
ATOM 1584  H HA   . VAL A 1 8   ? 8.156   9.049   -23.541 1.00 0.00 ? 791 VAL A HA   2  
ATOM 1585  H HB   . VAL A 1 8   ? 7.068   8.066   -26.182 1.00 0.00 ? 791 VAL A HB   2  
ATOM 1586  H HG11 . VAL A 1 8   ? 5.768   8.297   -23.473 1.00 0.00 ? 791 VAL A HG11 2  
ATOM 1587  H HG12 . VAL A 1 8   ? 4.890   8.027   -24.979 1.00 0.00 ? 791 VAL A HG12 2  
ATOM 1588  H HG13 . VAL A 1 8   ? 6.044   6.824   -24.402 1.00 0.00 ? 791 VAL A HG13 2  
ATOM 1589  H HG21 . VAL A 1 8   ? 6.227   10.113  -26.543 1.00 0.00 ? 791 VAL A HG21 2  
ATOM 1590  H HG22 . VAL A 1 8   ? 5.796   10.341  -24.849 1.00 0.00 ? 791 VAL A HG22 2  
ATOM 1591  H HG23 . VAL A 1 8   ? 7.447   10.650  -25.388 1.00 0.00 ? 791 VAL A HG23 2  
ATOM 1592  N N    . PHE A 1 9   ? 8.614   6.727   -22.844 1.00 0.00 ? 792 PHE A N    2  
ATOM 1593  C CA   . PHE A 1 9   ? 8.891   5.367   -22.397 1.00 0.00 ? 792 PHE A CA   2  
ATOM 1594  C C    . PHE A 1 9   ? 7.630   4.510   -22.446 1.00 0.00 ? 792 PHE A C    2  
ATOM 1595  O O    . PHE A 1 9   ? 6.619   4.837   -21.823 1.00 0.00 ? 792 PHE A O    2  
ATOM 1596  C CB   . PHE A 1 9   ? 9.457   5.380   -20.975 1.00 0.00 ? 792 PHE A CB   2  
ATOM 1597  C CG   . PHE A 1 9   ? 10.854  5.924   -20.891 1.00 0.00 ? 792 PHE A CG   2  
ATOM 1598  C CD1  . PHE A 1 9   ? 11.123  7.238   -21.239 1.00 0.00 ? 792 PHE A CD1  2  
ATOM 1599  C CD2  . PHE A 1 9   ? 11.900  5.121   -20.464 1.00 0.00 ? 792 PHE A CD2  2  
ATOM 1600  C CE1  . PHE A 1 9   ? 12.408  7.740   -21.163 1.00 0.00 ? 792 PHE A CE1  2  
ATOM 1601  C CE2  . PHE A 1 9   ? 13.187  5.618   -20.385 1.00 0.00 ? 792 PHE A CE2  2  
ATOM 1602  C CZ   . PHE A 1 9   ? 13.441  6.930   -20.735 1.00 0.00 ? 792 PHE A CZ   2  
ATOM 1603  H H    . PHE A 1 9   ? 8.459   7.427   -22.177 1.00 0.00 ? 792 PHE A H    2  
ATOM 1604  H HA   . PHE A 1 9   ? 9.626   4.943   -23.063 1.00 0.00 ? 792 PHE A HA   2  
ATOM 1605  H HB2  . PHE A 1 9   ? 8.825   5.993   -20.350 1.00 0.00 ? 792 PHE A HB2  2  
ATOM 1606  H HB3  . PHE A 1 9   ? 9.468   4.372   -20.590 1.00 0.00 ? 792 PHE A HB3  2  
ATOM 1607  H HD1  . PHE A 1 9   ? 10.316  7.873   -21.573 1.00 0.00 ? 792 PHE A HD1  2  
ATOM 1608  H HD2  . PHE A 1 9   ? 11.702  4.094   -20.190 1.00 0.00 ? 792 PHE A HD2  2  
ATOM 1609  H HE1  . PHE A 1 9   ? 12.604  8.766   -21.436 1.00 0.00 ? 792 PHE A HE1  2  
ATOM 1610  H HE2  . PHE A 1 9   ? 13.992  4.981   -20.050 1.00 0.00 ? 792 PHE A HE2  2  
ATOM 1611  H HZ   . PHE A 1 9   ? 14.446  7.320   -20.675 1.00 0.00 ? 792 PHE A HZ   2  
ATOM 1612  N N    . ARG A 1 10  ? 7.696   3.412   -23.192 1.00 0.00 ? 793 ARG A N    2  
ATOM 1613  C CA   . ARG A 1 10  ? 6.559   2.509   -23.325 1.00 0.00 ? 793 ARG A CA   2  
ATOM 1614  C C    . ARG A 1 10  ? 6.990   1.059   -23.121 1.00 0.00 ? 793 ARG A C    2  
ATOM 1615  O O    . ARG A 1 10  ? 7.321   0.359   -24.078 1.00 0.00 ? 793 ARG A O    2  
ATOM 1616  C CB   . ARG A 1 10  ? 5.910   2.671   -24.701 1.00 0.00 ? 793 ARG A CB   2  
ATOM 1617  C CG   . ARG A 1 10  ? 5.244   4.022   -24.905 1.00 0.00 ? 793 ARG A CG   2  
ATOM 1618  C CD   . ARG A 1 10  ? 4.284   3.997   -26.084 1.00 0.00 ? 793 ARG A CD   2  
ATOM 1619  N NE   . ARG A 1 10  ? 3.489   5.219   -26.168 1.00 0.00 ? 793 ARG A NE   2  
ATOM 1620  C CZ   . ARG A 1 10  ? 2.828   5.592   -27.258 1.00 0.00 ? 793 ARG A CZ   2  
ATOM 1621  N NH1  . ARG A 1 10  ? 2.867   4.842   -28.351 1.00 0.00 ? 793 ARG A NH1  2  
ATOM 1622  N NH2  . ARG A 1 10  ? 2.126   6.718   -27.257 1.00 0.00 ? 793 ARG A NH2  2  
ATOM 1623  H H    . ARG A 1 10  ? 8.529   3.205   -23.665 1.00 0.00 ? 793 ARG A H    2  
ATOM 1624  H HA   . ARG A 1 10  ? 5.838   2.768   -22.564 1.00 0.00 ? 793 ARG A HA   2  
ATOM 1625  H HB2  . ARG A 1 10  ? 6.669   2.550   -25.460 1.00 0.00 ? 793 ARG A HB2  2  
ATOM 1626  H HB3  . ARG A 1 10  ? 5.162   1.902   -24.825 1.00 0.00 ? 793 ARG A HB3  2  
ATOM 1627  H HG2  . ARG A 1 10  ? 4.693   4.280   -24.012 1.00 0.00 ? 793 ARG A HG2  2  
ATOM 1628  H HG3  . ARG A 1 10  ? 6.006   4.764   -25.087 1.00 0.00 ? 793 ARG A HG3  2  
ATOM 1629  H HD2  . ARG A 1 10  ? 4.855   3.887   -26.994 1.00 0.00 ? 793 ARG A HD2  2  
ATOM 1630  H HD3  . ARG A 1 10  ? 3.620   3.153   -25.972 1.00 0.00 ? 793 ARG A HD3  2  
ATOM 1631  H HE   . ARG A 1 10  ? 3.446   5.788   -25.372 1.00 0.00 ? 793 ARG A HE   2  
ATOM 1632  H HH11 . ARG A 1 10  ? 3.395   3.992   -28.354 1.00 0.00 ? 793 ARG A HH11 2  
ATOM 1633  H HH12 . ARG A 1 10  ? 2.368   5.125   -29.170 1.00 0.00 ? 793 ARG A HH12 2  
ATOM 1634  H HH21 . ARG A 1 10  ? 2.094   7.287   -26.436 1.00 0.00 ? 793 ARG A HH21 2  
ATOM 1635  H HH22 . ARG A 1 10  ? 1.630   6.999   -28.078 1.00 0.00 ? 793 ARG A HH22 2  
ATOM 1636  N N    . TYR A 1 11  ? 6.983   0.616   -21.869 1.00 0.00 ? 794 TYR A N    2  
ATOM 1637  C CA   . TYR A 1 11  ? 7.375   -0.749  -21.539 1.00 0.00 ? 794 TYR A CA   2  
ATOM 1638  C C    . TYR A 1 11  ? 6.210   -1.517  -20.923 1.00 0.00 ? 794 TYR A C    2  
ATOM 1639  O O    . TYR A 1 11  ? 5.477   -0.989  -20.087 1.00 0.00 ? 794 TYR A O    2  
ATOM 1640  C CB   . TYR A 1 11  ? 8.562   -0.741  -20.574 1.00 0.00 ? 794 TYR A CB   2  
ATOM 1641  C CG   . TYR A 1 11  ? 9.896   -0.542  -21.258 1.00 0.00 ? 794 TYR A CG   2  
ATOM 1642  C CD1  . TYR A 1 11  ? 10.501  -1.578  -21.960 1.00 0.00 ? 794 TYR A CD1  2  
ATOM 1643  C CD2  . TYR A 1 11  ? 10.553  0.681   -21.200 1.00 0.00 ? 794 TYR A CD2  2  
ATOM 1644  C CE1  . TYR A 1 11  ? 11.720  -1.401  -22.585 1.00 0.00 ? 794 TYR A CE1  2  
ATOM 1645  C CE2  . TYR A 1 11  ? 11.772  0.867   -21.824 1.00 0.00 ? 794 TYR A CE2  2  
ATOM 1646  C CZ   . TYR A 1 11  ? 12.351  -0.177  -22.515 1.00 0.00 ? 794 TYR A CZ   2  
ATOM 1647  O OH   . TYR A 1 11  ? 13.566  0.004   -23.136 1.00 0.00 ? 794 TYR A OH   2  
ATOM 1648  H H    . TYR A 1 11  ? 6.709   1.222   -21.149 1.00 0.00 ? 794 TYR A H    2  
ATOM 1649  H HA   . TYR A 1 11  ? 7.671   -1.239  -22.455 1.00 0.00 ? 794 TYR A HA   2  
ATOM 1650  H HB2  . TYR A 1 11  ? 8.433   0.058   -19.861 1.00 0.00 ? 794 TYR A HB2  2  
ATOM 1651  H HB3  . TYR A 1 11  ? 8.596   -1.684  -20.049 1.00 0.00 ? 794 TYR A HB3  2  
ATOM 1652  H HD1  . TYR A 1 11  ? 10.004  -2.536  -22.013 1.00 0.00 ? 794 TYR A HD1  2  
ATOM 1653  H HD2  . TYR A 1 11  ? 10.097  1.496   -20.658 1.00 0.00 ? 794 TYR A HD2  2  
ATOM 1654  H HE1  . TYR A 1 11  ? 12.174  -2.218  -23.126 1.00 0.00 ? 794 TYR A HE1  2  
ATOM 1655  H HE2  . TYR A 1 11  ? 12.267  1.825   -21.768 1.00 0.00 ? 794 TYR A HE2  2  
ATOM 1656  H HH   . TYR A 1 11  ? 13.500  0.729   -23.761 1.00 0.00 ? 794 TYR A HH   2  
ATOM 1657  N N    . SER A 1 12  ? 6.046   -2.768  -21.343 1.00 0.00 ? 795 SER A N    2  
ATOM 1658  C CA   . SER A 1 12  ? 4.969   -3.609  -20.836 1.00 0.00 ? 795 SER A CA   2  
ATOM 1659  C C    . SER A 1 12  ? 5.374   -4.280  -19.527 1.00 0.00 ? 795 SER A C    2  
ATOM 1660  O O    . SER A 1 12  ? 6.113   -5.265  -19.522 1.00 0.00 ? 795 SER A O    2  
ATOM 1661  C CB   . SER A 1 12  ? 4.592   -4.671  -21.871 1.00 0.00 ? 795 SER A CB   2  
ATOM 1662  O OG   . SER A 1 12  ? 5.724   -5.433  -22.255 1.00 0.00 ? 795 SER A OG   2  
ATOM 1663  H H    . SER A 1 12  ? 6.664   -3.132  -22.011 1.00 0.00 ? 795 SER A H    2  
ATOM 1664  H HA   . SER A 1 12  ? 4.113   -2.977  -20.653 1.00 0.00 ? 795 SER A HA   2  
ATOM 1665  H HB2  . SER A 1 12  ? 3.853   -5.334  -21.450 1.00 0.00 ? 795 SER A HB2  2  
ATOM 1666  H HB3  . SER A 1 12  ? 4.185   -4.187  -22.747 1.00 0.00 ? 795 SER A HB3  2  
ATOM 1667  H HG   . SER A 1 12  ? 6.370   -5.427  -21.545 1.00 0.00 ? 795 SER A HG   2  
ATOM 1668  N N    . THR A 1 13  ? 4.884   -3.739  -18.415 1.00 0.00 ? 796 THR A N    2  
ATOM 1669  C CA   . THR A 1 13  ? 5.195   -4.283  -17.099 1.00 0.00 ? 796 THR A CA   2  
ATOM 1670  C C    . THR A 1 13  ? 4.175   -5.338  -16.686 1.00 0.00 ? 796 THR A C    2  
ATOM 1671  O O    . THR A 1 13  ? 3.104   -5.448  -17.283 1.00 0.00 ? 796 THR A O    2  
ATOM 1672  C CB   . THR A 1 13  ? 5.234   -3.176  -16.029 1.00 0.00 ? 796 THR A CB   2  
ATOM 1673  O OG1  . THR A 1 13  ? 4.051   -2.373  -16.112 1.00 0.00 ? 796 THR A OG1  2  
ATOM 1674  C CG2  . THR A 1 13  ? 6.463   -2.298  -16.203 1.00 0.00 ? 796 THR A CG2  2  
ATOM 1675  H H    . THR A 1 13  ? 4.300   -2.955  -18.484 1.00 0.00 ? 796 THR A H    2  
ATOM 1676  H HA   . THR A 1 13  ? 6.172   -4.741  -17.150 1.00 0.00 ? 796 THR A HA   2  
ATOM 1677  H HB   . THR A 1 13  ? 5.277   -3.641  -15.054 1.00 0.00 ? 796 THR A HB   2  
ATOM 1678  H HG1  . THR A 1 13  ? 4.200   -1.646  -16.722 1.00 0.00 ? 796 THR A HG1  2  
ATOM 1679  H HG21 . THR A 1 13  ? 7.070   -2.683  -17.010 1.00 0.00 ? 796 THR A HG21 2  
ATOM 1680  H HG22 . THR A 1 13  ? 7.038   -2.298  -15.289 1.00 0.00 ? 796 THR A HG22 2  
ATOM 1681  H HG23 . THR A 1 13  ? 6.155   -1.290  -16.436 1.00 0.00 ? 796 THR A HG23 2  
ATOM 1682  N N    . SER A 1 14  ? 4.514   -6.113  -15.660 1.00 0.00 ? 797 SER A N    2  
ATOM 1683  C CA   . SER A 1 14  ? 3.629   -7.162  -15.169 1.00 0.00 ? 797 SER A CA   2  
ATOM 1684  C C    . SER A 1 14  ? 3.547   -7.134  -13.645 1.00 0.00 ? 797 SER A C    2  
ATOM 1685  O O    . SER A 1 14  ? 3.610   -8.175  -12.989 1.00 0.00 ? 797 SER A O    2  
ATOM 1686  C CB   . SER A 1 14  ? 4.117   -8.533  -15.640 1.00 0.00 ? 797 SER A CB   2  
ATOM 1687  O OG   . SER A 1 14  ? 5.286   -8.925  -14.941 1.00 0.00 ? 797 SER A OG   2  
ATOM 1688  H H    . SER A 1 14  ? 5.382   -5.976  -15.225 1.00 0.00 ? 797 SER A H    2  
ATOM 1689  H HA   . SER A 1 14  ? 2.644   -6.981  -15.574 1.00 0.00 ? 797 SER A HA   2  
ATOM 1690  H HB2  . SER A 1 14  ? 3.345   -9.267  -15.466 1.00 0.00 ? 797 SER A HB2  2  
ATOM 1691  H HB3  . SER A 1 14  ? 4.341   -8.489  -16.696 1.00 0.00 ? 797 SER A HB3  2  
ATOM 1692  H HG   . SER A 1 14  ? 5.885   -9.372  -15.544 1.00 0.00 ? 797 SER A HG   2  
ATOM 1693  N N    . LEU A 1 15  ? 3.405   -5.936  -13.089 1.00 0.00 ? 798 LEU A N    2  
ATOM 1694  C CA   . LEU A 1 15  ? 3.314   -5.771  -11.642 1.00 0.00 ? 798 LEU A CA   2  
ATOM 1695  C C    . LEU A 1 15  ? 2.124   -4.893  -11.269 1.00 0.00 ? 798 LEU A C    2  
ATOM 1696  O O    . LEU A 1 15  ? 1.547   -4.219  -12.121 1.00 0.00 ? 798 LEU A O    2  
ATOM 1697  C CB   . LEU A 1 15  ? 4.606   -5.159  -11.097 1.00 0.00 ? 798 LEU A CB   2  
ATOM 1698  C CG   . LEU A 1 15  ? 5.896   -5.913  -11.422 1.00 0.00 ? 798 LEU A CG   2  
ATOM 1699  C CD1  . LEU A 1 15  ? 7.069   -4.950  -11.510 1.00 0.00 ? 798 LEU A CD1  2  
ATOM 1700  C CD2  . LEU A 1 15  ? 6.163   -6.988  -10.379 1.00 0.00 ? 798 LEU A CD2  2  
ATOM 1701  H H    . LEU A 1 15  ? 3.361   -5.144  -13.663 1.00 0.00 ? 798 LEU A H    2  
ATOM 1702  H HA   . LEU A 1 15  ? 3.176   -6.748  -11.205 1.00 0.00 ? 798 LEU A HA   2  
ATOM 1703  H HB2  . LEU A 1 15  ? 4.695   -4.162  -11.500 1.00 0.00 ? 798 LEU A HB2  2  
ATOM 1704  H HB3  . LEU A 1 15  ? 4.516   -5.103  -10.021 1.00 0.00 ? 798 LEU A HB3  2  
ATOM 1705  H HG   . LEU A 1 15  ? 5.789   -6.397  -12.383 1.00 0.00 ? 798 LEU A HG   2  
ATOM 1706  H HD11 . LEU A 1 15  ? 7.687   -5.211  -12.356 1.00 0.00 ? 798 LEU A HD11 2  
ATOM 1707  H HD12 . LEU A 1 15  ? 7.654   -5.011  -10.605 1.00 0.00 ? 798 LEU A HD12 2  
ATOM 1708  H HD13 . LEU A 1 15  ? 6.699   -3.942  -11.631 1.00 0.00 ? 798 LEU A HD13 2  
ATOM 1709  H HD21 . LEU A 1 15  ? 7.188   -6.920  -10.047 1.00 0.00 ? 798 LEU A HD21 2  
ATOM 1710  H HD22 . LEU A 1 15  ? 5.989   -7.962  -10.813 1.00 0.00 ? 798 LEU A HD22 2  
ATOM 1711  H HD23 . LEU A 1 15  ? 5.502   -6.845  -9.537  1.00 0.00 ? 798 LEU A HD23 2  
ATOM 1712  N N    . GLU A 1 16  ? 1.766   -4.904  -9.988  1.00 0.00 ? 799 GLU A N    2  
ATOM 1713  C CA   . GLU A 1 16  ? 0.645   -4.108  -9.502  1.00 0.00 ? 799 GLU A CA   2  
ATOM 1714  C C    . GLU A 1 16  ? 1.138   -2.824  -8.839  1.00 0.00 ? 799 GLU A C    2  
ATOM 1715  O O    . GLU A 1 16  ? 0.768   -2.516  -7.706  1.00 0.00 ? 799 GLU A O    2  
ATOM 1716  C CB   . GLU A 1 16  ? -0.193  -4.917  -8.512  1.00 0.00 ? 799 GLU A CB   2  
ATOM 1717  C CG   . GLU A 1 16  ? -0.644  -6.264  -9.053  1.00 0.00 ? 799 GLU A CG   2  
ATOM 1718  C CD   . GLU A 1 16  ? -0.828  -7.300  -7.961  1.00 0.00 ? 799 GLU A CD   2  
ATOM 1719  O OE1  . GLU A 1 16  ? 0.042   -7.380  -7.068  1.00 0.00 ? 799 GLU A OE1  2  
ATOM 1720  O OE2  . GLU A 1 16  ? -1.840  -8.030  -8.000  1.00 0.00 ? 799 GLU A OE2  2  
ATOM 1721  H H    . GLU A 1 16  ? 2.266   -5.462  -9.357  1.00 0.00 ? 799 GLU A H    2  
ATOM 1722  H HA   . GLU A 1 16  ? 0.031   -3.847  -10.351 1.00 0.00 ? 799 GLU A HA   2  
ATOM 1723  H HB2  . GLU A 1 16  ? 0.391   -5.088  -7.619  1.00 0.00 ? 799 GLU A HB2  2  
ATOM 1724  H HB3  . GLU A 1 16  ? -1.072  -4.346  -8.252  1.00 0.00 ? 799 GLU A HB3  2  
ATOM 1725  H HG2  . GLU A 1 16  ? -1.584  -6.134  -9.567  1.00 0.00 ? 799 GLU A HG2  2  
ATOM 1726  H HG3  . GLU A 1 16  ? 0.099   -6.624  -9.750  1.00 0.00 ? 799 GLU A HG3  2  
ATOM 1727  N N    . LYS A 1 17  ? 1.975   -2.080  -9.554  1.00 0.00 ? 800 LYS A N    2  
ATOM 1728  C CA   . LYS A 1 17  ? 2.519   -0.829  -9.037  1.00 0.00 ? 800 LYS A CA   2  
ATOM 1729  C C    . LYS A 1 17  ? 1.437   -0.015  -8.334  1.00 0.00 ? 800 LYS A C    2  
ATOM 1730  O O    . LYS A 1 17  ? 1.594   0.375   -7.176  1.00 0.00 ? 800 LYS A O    2  
ATOM 1731  C CB   . LYS A 1 17  ? 3.132   -0.008  -10.173 1.00 0.00 ? 800 LYS A CB   2  
ATOM 1732  C CG   . LYS A 1 17  ? 4.297   0.862   -9.735  1.00 0.00 ? 800 LYS A CG   2  
ATOM 1733  C CD   . LYS A 1 17  ? 4.542   2.000   -10.711 1.00 0.00 ? 800 LYS A CD   2  
ATOM 1734  C CE   . LYS A 1 17  ? 5.983   2.482   -10.656 1.00 0.00 ? 800 LYS A CE   2  
ATOM 1735  N NZ   . LYS A 1 17  ? 6.285   3.455   -11.742 1.00 0.00 ? 800 LYS A NZ   2  
ATOM 1736  H H    . LYS A 1 17  ? 2.233   -2.378  -10.452 1.00 0.00 ? 800 LYS A H    2  
ATOM 1737  H HA   . LYS A 1 17  ? 3.291   -1.073  -8.323  1.00 0.00 ? 800 LYS A HA   2  
ATOM 1738  H HB2  . LYS A 1 17  ? 3.483   -0.683  -10.940 1.00 0.00 ? 800 LYS A HB2  2  
ATOM 1739  H HB3  . LYS A 1 17  ? 2.369   0.632   -10.591 1.00 0.00 ? 800 LYS A HB3  2  
ATOM 1740  H HG2  . LYS A 1 17  ? 4.078   1.278   -8.762  1.00 0.00 ? 800 LYS A HG2  2  
ATOM 1741  H HG3  . LYS A 1 17  ? 5.188   0.253   -9.675  1.00 0.00 ? 800 LYS A HG3  2  
ATOM 1742  H HD2  . LYS A 1 17  ? 4.328   1.656   -11.712 1.00 0.00 ? 800 LYS A HD2  2  
ATOM 1743  H HD3  . LYS A 1 17  ? 3.886   2.823   -10.464 1.00 0.00 ? 800 LYS A HD3  2  
ATOM 1744  H HE2  . LYS A 1 17  ? 6.154   2.957   -9.702  1.00 0.00 ? 800 LYS A HE2  2  
ATOM 1745  H HE3  . LYS A 1 17  ? 6.638   1.629   -10.755 1.00 0.00 ? 800 LYS A HE3  2  
ATOM 1746  H HZ1  . LYS A 1 17  ? 6.332   2.964   -12.658 1.00 0.00 ? 800 LYS A HZ1  2  
ATOM 1747  H HZ2  . LYS A 1 17  ? 7.199   3.918   -11.563 1.00 0.00 ? 800 LYS A HZ2  2  
ATOM 1748  H HZ3  . LYS A 1 17  ? 5.543   4.182   -11.788 1.00 0.00 ? 800 LYS A HZ3  2  
ATOM 1749  N N    . HIS A 1 18  ? 0.340   0.237   -9.039  1.00 0.00 ? 801 HIS A N    2  
ATOM 1750  C CA   . HIS A 1 18  ? -0.769  1.003   -8.481  1.00 0.00 ? 801 HIS A CA   2  
ATOM 1751  C C    . HIS A 1 18  ? -0.955  0.689   -7.000  1.00 0.00 ? 801 HIS A C    2  
ATOM 1752  O O    . HIS A 1 18  ? -1.210  1.583   -6.192  1.00 0.00 ? 801 HIS A O    2  
ATOM 1753  C CB   . HIS A 1 18  ? -2.060  0.702   -9.244  1.00 0.00 ? 801 HIS A CB   2  
ATOM 1754  C CG   . HIS A 1 18  ? -2.581  -0.684  -9.017  1.00 0.00 ? 801 HIS A CG   2  
ATOM 1755  N ND1  . HIS A 1 18  ? -2.053  -1.797  -9.636  1.00 0.00 ? 801 HIS A ND1  2  
ATOM 1756  C CD2  . HIS A 1 18  ? -3.587  -1.133  -8.231  1.00 0.00 ? 801 HIS A CD2  2  
ATOM 1757  C CE1  . HIS A 1 18  ? -2.713  -2.871  -9.243  1.00 0.00 ? 801 HIS A CE1  2  
ATOM 1758  N NE2  . HIS A 1 18  ? -3.649  -2.496  -8.390  1.00 0.00 ? 801 HIS A NE2  2  
ATOM 1759  H H    . HIS A 1 18  ? 0.273   -0.101  -9.957  1.00 0.00 ? 801 HIS A H    2  
ATOM 1760  H HA   . HIS A 1 18  ? -0.534  2.051   -8.588  1.00 0.00 ? 801 HIS A HA   2  
ATOM 1761  H HB2  . HIS A 1 18  ? -2.824  1.399   -8.933  1.00 0.00 ? 801 HIS A HB2  2  
ATOM 1762  H HB3  . HIS A 1 18  ? -1.880  0.821   -10.303 1.00 0.00 ? 801 HIS A HB3  2  
ATOM 1763  H HD2  . HIS A 1 18  ? -4.224  -0.532  -7.597  1.00 0.00 ? 801 HIS A HD2  2  
ATOM 1764  H HE1  . HIS A 1 18  ? -2.521  -3.884  -9.563  1.00 0.00 ? 801 HIS A HE1  2  
ATOM 1765  H HE2  . HIS A 1 18  ? -4.336  -3.083  -8.011  1.00 0.00 ? 801 HIS A HE2  2  
ATOM 1766  N N    . LYS A 1 19  ? -0.825  -0.586  -6.649  1.00 0.00 ? 802 LYS A N    2  
ATOM 1767  C CA   . LYS A 1 19  ? -0.978  -1.019  -5.265  1.00 0.00 ? 802 LYS A CA   2  
ATOM 1768  C C    . LYS A 1 19  ? 0.072   -0.367  -4.372  1.00 0.00 ? 802 LYS A C    2  
ATOM 1769  O O    . LYS A 1 19  ? 1.175   -0.052  -4.821  1.00 0.00 ? 802 LYS A O    2  
ATOM 1770  C CB   . LYS A 1 19  ? -0.868  -2.542  -5.171  1.00 0.00 ? 802 LYS A CB   2  
ATOM 1771  C CG   . LYS A 1 19  ? -2.011  -3.278  -5.850  1.00 0.00 ? 802 LYS A CG   2  
ATOM 1772  C CD   . LYS A 1 19  ? -1.948  -4.773  -5.584  1.00 0.00 ? 802 LYS A CD   2  
ATOM 1773  C CE   . LYS A 1 19  ? -3.299  -5.435  -5.807  1.00 0.00 ? 802 LYS A CE   2  
ATOM 1774  N NZ   . LYS A 1 19  ? -3.472  -5.880  -7.218  1.00 0.00 ? 802 LYS A NZ   2  
ATOM 1775  H H    . LYS A 1 19  ? -0.621  -1.253  -7.339  1.00 0.00 ? 802 LYS A H    2  
ATOM 1776  H HA   . LYS A 1 19  ? -1.958  -0.715  -4.929  1.00 0.00 ? 802 LYS A HA   2  
ATOM 1777  H HB2  . LYS A 1 19  ? 0.057   -2.854  -5.632  1.00 0.00 ? 802 LYS A HB2  2  
ATOM 1778  H HB3  . LYS A 1 19  ? -0.855  -2.826  -4.128  1.00 0.00 ? 802 LYS A HB3  2  
ATOM 1779  H HG2  . LYS A 1 19  ? -2.948  -2.895  -5.473  1.00 0.00 ? 802 LYS A HG2  2  
ATOM 1780  H HG3  . LYS A 1 19  ? -1.953  -3.108  -6.916  1.00 0.00 ? 802 LYS A HG3  2  
ATOM 1781  H HD2  . LYS A 1 19  ? -1.226  -5.218  -6.252  1.00 0.00 ? 802 LYS A HD2  2  
ATOM 1782  H HD3  . LYS A 1 19  ? -1.642  -4.935  -4.560  1.00 0.00 ? 802 LYS A HD3  2  
ATOM 1783  H HE2  . LYS A 1 19  ? -3.376  -6.293  -5.157  1.00 0.00 ? 802 LYS A HE2  2  
ATOM 1784  H HE3  . LYS A 1 19  ? -4.077  -4.727  -5.563  1.00 0.00 ? 802 LYS A HE3  2  
ATOM 1785  H HZ1  . LYS A 1 19  ? -3.597  -6.912  -7.254  1.00 0.00 ? 802 LYS A HZ1  2  
ATOM 1786  H HZ2  . LYS A 1 19  ? -2.635  -5.624  -7.779  1.00 0.00 ? 802 LYS A HZ2  2  
ATOM 1787  H HZ3  . LYS A 1 19  ? -4.309  -5.425  -7.636  1.00 0.00 ? 802 LYS A HZ3  2  
ATOM 1788  N N    . LEU A 1 20  ? -0.276  -0.168  -3.106  1.00 0.00 ? 803 LEU A N    2  
ATOM 1789  C CA   . LEU A 1 20  ? 0.638   0.446   -2.148  1.00 0.00 ? 803 LEU A CA   2  
ATOM 1790  C C    . LEU A 1 20  ? 0.879   -0.477  -0.958  1.00 0.00 ? 803 LEU A C    2  
ATOM 1791  O O    . LEU A 1 20  ? 0.004   -1.251  -0.571  1.00 0.00 ? 803 LEU A O    2  
ATOM 1792  C CB   . LEU A 1 20  ? 0.078   1.785   -1.665  1.00 0.00 ? 803 LEU A CB   2  
ATOM 1793  C CG   . LEU A 1 20  ? -0.585  2.658   -2.730  1.00 0.00 ? 803 LEU A CG   2  
ATOM 1794  C CD1  . LEU A 1 20  ? -1.472  3.710   -2.082  1.00 0.00 ? 803 LEU A CD1  2  
ATOM 1795  C CD2  . LEU A 1 20  ? 0.467   3.315   -3.612  1.00 0.00 ? 803 LEU A CD2  2  
ATOM 1796  H H    . LEU A 1 20  ? -1.168  -0.440  -2.806  1.00 0.00 ? 803 LEU A H    2  
ATOM 1797  H HA   . LEU A 1 20  ? 1.578   0.618   -2.651  1.00 0.00 ? 803 LEU A HA   2  
ATOM 1798  H HB2  . LEU A 1 20  ? -0.656  1.580   -0.902  1.00 0.00 ? 803 LEU A HB2  2  
ATOM 1799  H HB3  . LEU A 1 20  ? 0.895   2.348   -1.235  1.00 0.00 ? 803 LEU A HB3  2  
ATOM 1800  H HG   . LEU A 1 20  ? -1.209  2.038   -3.358  1.00 0.00 ? 803 LEU A HG   2  
ATOM 1801  H HD11 . LEU A 1 20  ? -1.043  4.009   -1.137  1.00 0.00 ? 803 LEU A HD11 2  
ATOM 1802  H HD12 . LEU A 1 20  ? -2.456  3.298   -1.917  1.00 0.00 ? 803 LEU A HD12 2  
ATOM 1803  H HD13 . LEU A 1 20  ? -1.546  4.569   -2.732  1.00 0.00 ? 803 LEU A HD13 2  
ATOM 1804  H HD21 . LEU A 1 20  ? 1.442   3.188   -3.165  1.00 0.00 ? 803 LEU A HD21 2  
ATOM 1805  H HD22 . LEU A 1 20  ? 0.249   4.369   -3.708  1.00 0.00 ? 803 LEU A HD22 2  
ATOM 1806  H HD23 . LEU A 1 20  ? 0.456   2.855   -4.589  1.00 0.00 ? 803 LEU A HD23 2  
ATOM 1807  N N    . PHE A 1 21  ? 2.072   -0.387  -0.378  1.00 0.00 ? 804 PHE A N    2  
ATOM 1808  C CA   . PHE A 1 21  ? 2.428   -1.213  0.769   1.00 0.00 ? 804 PHE A CA   2  
ATOM 1809  C C    . PHE A 1 21  ? 2.862   -0.347  1.949   1.00 0.00 ? 804 PHE A C    2  
ATOM 1810  O O    . PHE A 1 21  ? 3.844   0.392   1.861   1.00 0.00 ? 804 PHE A O    2  
ATOM 1811  C CB   . PHE A 1 21  ? 3.549   -2.186  0.397   1.00 0.00 ? 804 PHE A CB   2  
ATOM 1812  C CG   . PHE A 1 21  ? 4.252   -2.775  1.586   1.00 0.00 ? 804 PHE A CG   2  
ATOM 1813  C CD1  . PHE A 1 21  ? 3.687   -3.827  2.290   1.00 0.00 ? 804 PHE A CD1  2  
ATOM 1814  C CD2  . PHE A 1 21  ? 5.477   -2.278  2.001   1.00 0.00 ? 804 PHE A CD2  2  
ATOM 1815  C CE1  . PHE A 1 21  ? 4.330   -4.372  3.385   1.00 0.00 ? 804 PHE A CE1  2  
ATOM 1816  C CE2  . PHE A 1 21  ? 6.125   -2.819  3.095   1.00 0.00 ? 804 PHE A CE2  2  
ATOM 1817  C CZ   . PHE A 1 21  ? 5.551   -3.867  3.788   1.00 0.00 ? 804 PHE A CZ   2  
ATOM 1818  H H    . PHE A 1 21  ? 2.729   0.249   -0.732  1.00 0.00 ? 804 PHE A H    2  
ATOM 1819  H HA   . PHE A 1 21  ? 1.554   -1.777  1.055   1.00 0.00 ? 804 PHE A HA   2  
ATOM 1820  H HB2  . PHE A 1 21  ? 3.134   -2.999  -0.179  1.00 0.00 ? 804 PHE A HB2  2  
ATOM 1821  H HB3  . PHE A 1 21  ? 4.284   -1.665  -0.200  1.00 0.00 ? 804 PHE A HB3  2  
ATOM 1822  H HD1  . PHE A 1 21  ? 2.731   -4.222  1.975   1.00 0.00 ? 804 PHE A HD1  2  
ATOM 1823  H HD2  . PHE A 1 21  ? 5.926   -1.458  1.460   1.00 0.00 ? 804 PHE A HD2  2  
ATOM 1824  H HE1  . PHE A 1 21  ? 3.878   -5.191  3.925   1.00 0.00 ? 804 PHE A HE1  2  
ATOM 1825  H HE2  . PHE A 1 21  ? 7.079   -2.422  3.408   1.00 0.00 ? 804 PHE A HE2  2  
ATOM 1826  H HZ   . PHE A 1 21  ? 6.056   -4.292  4.643   1.00 0.00 ? 804 PHE A HZ   2  
ATOM 1827  N N    . ILE A 1 22  ? 2.124   -0.444  3.049   1.00 0.00 ? 805 ILE A N    2  
ATOM 1828  C CA   . ILE A 1 22  ? 2.432   0.330   4.245   1.00 0.00 ? 805 ILE A CA   2  
ATOM 1829  C C    . ILE A 1 22  ? 2.870   -0.578  5.389   1.00 0.00 ? 805 ILE A C    2  
ATOM 1830  O O    . ILE A 1 22  ? 2.466   -1.738  5.465   1.00 0.00 ? 805 ILE A O    2  
ATOM 1831  C CB   . ILE A 1 22  ? 1.222   1.165   4.703   1.00 0.00 ? 805 ILE A CB   2  
ATOM 1832  C CG1  . ILE A 1 22  ? 0.502   1.765   3.493   1.00 0.00 ? 805 ILE A CG1  2  
ATOM 1833  C CG2  . ILE A 1 22  ? 1.667   2.263   5.658   1.00 0.00 ? 805 ILE A CG2  2  
ATOM 1834  C CD1  . ILE A 1 22  ? -0.500  2.838   3.857   1.00 0.00 ? 805 ILE A CD1  2  
ATOM 1835  H H    . ILE A 1 22  ? 1.355   -1.050  3.057   1.00 0.00 ? 805 ILE A H    2  
ATOM 1836  H HA   . ILE A 1 22  ? 3.241   1.005   4.006   1.00 0.00 ? 805 ILE A HA   2  
ATOM 1837  H HB   . ILE A 1 22  ? 0.543   0.515   5.231   1.00 0.00 ? 805 ILE A HB   2  
ATOM 1838  H HG12 . ILE A 1 22  ? 1.230   2.203   2.829   1.00 0.00 ? 805 ILE A HG12 2  
ATOM 1839  H HG13 . ILE A 1 22  ? -0.027  0.979   2.973   1.00 0.00 ? 805 ILE A HG13 2  
ATOM 1840  H HG21 . ILE A 1 22  ? 2.098   1.817   6.543   1.00 0.00 ? 805 ILE A HG21 2  
ATOM 1841  H HG22 . ILE A 1 22  ? 2.405   2.884   5.174   1.00 0.00 ? 805 ILE A HG22 2  
ATOM 1842  H HG23 . ILE A 1 22  ? 0.816   2.865   5.937   1.00 0.00 ? 805 ILE A HG23 2  
ATOM 1843  H HD11 . ILE A 1 22  ? -1.157  3.016   3.019   1.00 0.00 ? 805 ILE A HD11 2  
ATOM 1844  H HD12 . ILE A 1 22  ? -1.079  2.517   4.709   1.00 0.00 ? 805 ILE A HD12 2  
ATOM 1845  H HD13 . ILE A 1 22  ? 0.025   3.751   4.102   1.00 0.00 ? 805 ILE A HD13 2  
ATOM 1846  N N    . SER A 1 23  ? 3.699   -0.042  6.280   1.00 0.00 ? 806 SER A N    2  
ATOM 1847  C CA   . SER A 1 23  ? 4.194   -0.804  7.420   1.00 0.00 ? 806 SER A CA   2  
ATOM 1848  C C    . SER A 1 23  ? 4.429   0.106   8.621   1.00 0.00 ? 806 SER A C    2  
ATOM 1849  O O    . SER A 1 23  ? 4.671   1.303   8.470   1.00 0.00 ? 806 SER A O    2  
ATOM 1850  C CB   . SER A 1 23  ? 5.491   -1.528  7.052   1.00 0.00 ? 806 SER A CB   2  
ATOM 1851  O OG   . SER A 1 23  ? 6.428   -0.634  6.478   1.00 0.00 ? 806 SER A OG   2  
ATOM 1852  H H    . SER A 1 23  ? 3.986   0.888   6.165   1.00 0.00 ? 806 SER A H    2  
ATOM 1853  H HA   . SER A 1 23  ? 3.444   -1.537  7.679   1.00 0.00 ? 806 SER A HA   2  
ATOM 1854  H HB2  . SER A 1 23  ? 5.923   -1.961  7.941   1.00 0.00 ? 806 SER A HB2  2  
ATOM 1855  H HB3  . SER A 1 23  ? 5.273   -2.310  6.339   1.00 0.00 ? 806 SER A HB3  2  
ATOM 1856  H HG   . SER A 1 23  ? 7.227   -1.113  6.245   1.00 0.00 ? 806 SER A HG   2  
ATOM 1857  N N    . GLY A 1 24  ? 4.356   -0.471  9.817   1.00 0.00 ? 807 GLY A N    2  
ATOM 1858  C CA   . GLY A 1 24  ? 4.563   0.302   11.028  1.00 0.00 ? 807 GLY A CA   2  
ATOM 1859  C C    . GLY A 1 24  ? 3.298   0.993   11.498  1.00 0.00 ? 807 GLY A C    2  
ATOM 1860  O O    . GLY A 1 24  ? 3.351   1.910   12.318  1.00 0.00 ? 807 GLY A O    2  
ATOM 1861  H H    . GLY A 1 24  ? 4.159   -1.430  9.877   1.00 0.00 ? 807 GLY A H    2  
ATOM 1862  H HA2  . GLY A 1 24  ? 4.911   -0.359  11.808  1.00 0.00 ? 807 GLY A HA2  2  
ATOM 1863  H HA3  . GLY A 1 24  ? 5.319   1.049   10.839  1.00 0.00 ? 807 GLY A HA3  2  
ATOM 1864  N N    . LEU A 1 25  ? 2.158   0.554   10.977  1.00 0.00 ? 808 LEU A N    2  
ATOM 1865  C CA   . LEU A 1 25  ? 0.873   1.138   11.346  1.00 0.00 ? 808 LEU A CA   2  
ATOM 1866  C C    . LEU A 1 25  ? 0.451   0.687   12.741  1.00 0.00 ? 808 LEU A C    2  
ATOM 1867  O O    . LEU A 1 25  ? 0.671   -0.455  13.144  1.00 0.00 ? 808 LEU A O    2  
ATOM 1868  C CB   . LEU A 1 25  ? -0.199  0.750   10.326  1.00 0.00 ? 808 LEU A CB   2  
ATOM 1869  C CG   . LEU A 1 25  ? -0.105  1.432   8.961   1.00 0.00 ? 808 LEU A CG   2  
ATOM 1870  C CD1  . LEU A 1 25  ? -0.874  0.641   7.915   1.00 0.00 ? 808 LEU A CD1  2  
ATOM 1871  C CD2  . LEU A 1 25  ? -0.625  2.860   9.042   1.00 0.00 ? 808 LEU A CD2  2  
ATOM 1872  H H    . LEU A 1 25  ? 2.179   -0.180  10.328  1.00 0.00 ? 808 LEU A H    2  
ATOM 1873  H HA   . LEU A 1 25  ? 0.985   2.212   11.347  1.00 0.00 ? 808 LEU A HA   2  
ATOM 1874  H HB2  . LEU A 1 25  ? -0.134  -0.316  10.168  1.00 0.00 ? 808 LEU A HB2  2  
ATOM 1875  H HB3  . LEU A 1 25  ? -1.162  0.990   10.752  1.00 0.00 ? 808 LEU A HB3  2  
ATOM 1876  H HG   . LEU A 1 25  ? 0.931   1.470   8.655   1.00 0.00 ? 808 LEU A HG   2  
ATOM 1877  H HD11 . LEU A 1 25  ? -1.933  0.713   8.116   1.00 0.00 ? 808 LEU A HD11 2  
ATOM 1878  H HD12 . LEU A 1 25  ? -0.570  -0.394  7.951   1.00 0.00 ? 808 LEU A HD12 2  
ATOM 1879  H HD13 . LEU A 1 25  ? -0.666  1.044   6.934   1.00 0.00 ? 808 LEU A HD13 2  
ATOM 1880  H HD21 . LEU A 1 25  ? 0.208   3.541   9.143   1.00 0.00 ? 808 LEU A HD21 2  
ATOM 1881  H HD22 . LEU A 1 25  ? -1.275  2.958   9.899   1.00 0.00 ? 808 LEU A HD22 2  
ATOM 1882  H HD23 . LEU A 1 25  ? -1.175  3.094   8.143   1.00 0.00 ? 808 LEU A HD23 2  
ATOM 1883  N N    . PRO A 1 26  ? -0.172  1.603   13.496  1.00 0.00 ? 809 PRO A N    2  
ATOM 1884  C CA   . PRO A 1 26  ? -0.641  1.322   14.856  1.00 0.00 ? 809 PRO A CA   2  
ATOM 1885  C C    . PRO A 1 26  ? -1.824  0.360   14.875  1.00 0.00 ? 809 PRO A C    2  
ATOM 1886  O O    . PRO A 1 26  ? -2.804  0.552   14.155  1.00 0.00 ? 809 PRO A O    2  
ATOM 1887  C CB   . PRO A 1 26  ? -1.063  2.698   15.378  1.00 0.00 ? 809 PRO A CB   2  
ATOM 1888  C CG   . PRO A 1 26  ? -1.395  3.481   14.155  1.00 0.00 ? 809 PRO A CG   2  
ATOM 1889  C CD   . PRO A 1 26  ? -0.468  2.985   13.081  1.00 0.00 ? 809 PRO A CD   2  
ATOM 1890  H HA   . PRO A 1 26  ? 0.152   0.928   15.476  1.00 0.00 ? 809 PRO A HA   2  
ATOM 1891  H HB2  . PRO A 1 26  ? -1.921  2.593   16.026  1.00 0.00 ? 809 PRO A HB2  2  
ATOM 1892  H HB3  . PRO A 1 26  ? -0.246  3.146   15.923  1.00 0.00 ? 809 PRO A HB3  2  
ATOM 1893  H HG2  . PRO A 1 26  ? -2.423  3.305   13.874  1.00 0.00 ? 809 PRO A HG2  2  
ATOM 1894  H HG3  . PRO A 1 26  ? -1.230  4.533   14.336  1.00 0.00 ? 809 PRO A HG3  2  
ATOM 1895  H HD2  . PRO A 1 26  ? -0.960  3.001   12.120  1.00 0.00 ? 809 PRO A HD2  2  
ATOM 1896  H HD3  . PRO A 1 26  ? 0.433   3.580   13.055  1.00 0.00 ? 809 PRO A HD3  2  
ATOM 1897  N N    . PHE A 1 27  ? -1.726  -0.675  15.702  1.00 0.00 ? 810 PHE A N    2  
ATOM 1898  C CA   . PHE A 1 27  ? -2.788  -1.668  15.814  1.00 0.00 ? 810 PHE A CA   2  
ATOM 1899  C C    . PHE A 1 27  ? -4.152  -0.994  15.931  1.00 0.00 ? 810 PHE A C    2  
ATOM 1900  O O    . PHE A 1 27  ? -5.117  -1.404  15.285  1.00 0.00 ? 810 PHE A O    2  
ATOM 1901  C CB   . PHE A 1 27  ? -2.547  -2.570  17.025  1.00 0.00 ? 810 PHE A CB   2  
ATOM 1902  C CG   . PHE A 1 27  ? -1.104  -2.940  17.220  1.00 0.00 ? 810 PHE A CG   2  
ATOM 1903  C CD1  . PHE A 1 27  ? -0.357  -3.444  16.167  1.00 0.00 ? 810 PHE A CD1  2  
ATOM 1904  C CD2  . PHE A 1 27  ? -0.495  -2.784  18.454  1.00 0.00 ? 810 PHE A CD2  2  
ATOM 1905  C CE1  . PHE A 1 27  ? 0.971   -3.785  16.343  1.00 0.00 ? 810 PHE A CE1  2  
ATOM 1906  C CE2  . PHE A 1 27  ? 0.832   -3.123  18.635  1.00 0.00 ? 810 PHE A CE2  2  
ATOM 1907  C CZ   . PHE A 1 27  ? 1.566   -3.625  17.578  1.00 0.00 ? 810 PHE A CZ   2  
ATOM 1908  H H    . PHE A 1 27  ? -0.919  -0.774  16.251  1.00 0.00 ? 810 PHE A H    2  
ATOM 1909  H HA   . PHE A 1 27  ? -2.773  -2.270  14.918  1.00 0.00 ? 810 PHE A HA   2  
ATOM 1910  H HB2  . PHE A 1 27  ? -2.881  -2.061  17.917  1.00 0.00 ? 810 PHE A HB2  2  
ATOM 1911  H HB3  . PHE A 1 27  ? -3.111  -3.482  16.904  1.00 0.00 ? 810 PHE A HB3  2  
ATOM 1912  H HD1  . PHE A 1 27  ? -0.822  -3.570  15.200  1.00 0.00 ? 810 PHE A HD1  2  
ATOM 1913  H HD2  . PHE A 1 27  ? -1.068  -2.392  19.282  1.00 0.00 ? 810 PHE A HD2  2  
ATOM 1914  H HE1  . PHE A 1 27  ? 1.542   -4.178  15.514  1.00 0.00 ? 810 PHE A HE1  2  
ATOM 1915  H HE2  . PHE A 1 27  ? 1.295   -2.997  19.603  1.00 0.00 ? 810 PHE A HE2  2  
ATOM 1916  H HZ   . PHE A 1 27  ? 2.604   -3.890  17.717  1.00 0.00 ? 810 PHE A HZ   2  
ATOM 1917  N N    . SER A 1 28  ? -4.225  0.042   16.761  1.00 0.00 ? 811 SER A N    2  
ATOM 1918  C CA   . SER A 1 28  ? -5.471  0.770   16.967  1.00 0.00 ? 811 SER A CA   2  
ATOM 1919  C C    . SER A 1 28  ? -6.177  1.026   15.639  1.00 0.00 ? 811 SER A C    2  
ATOM 1920  O O    . SER A 1 28  ? -7.360  0.719   15.483  1.00 0.00 ? 811 SER A O    2  
ATOM 1921  C CB   . SER A 1 28  ? -5.198  2.098   17.676  1.00 0.00 ? 811 SER A CB   2  
ATOM 1922  O OG   . SER A 1 28  ? -6.392  2.648   18.206  1.00 0.00 ? 811 SER A OG   2  
ATOM 1923  H H    . SER A 1 28  ? -3.421  0.321   17.248  1.00 0.00 ? 811 SER A H    2  
ATOM 1924  H HA   . SER A 1 28  ? -6.110  0.164   17.591  1.00 0.00 ? 811 SER A HA   2  
ATOM 1925  H HB2  . SER A 1 28  ? -4.502  1.936   18.485  1.00 0.00 ? 811 SER A HB2  2  
ATOM 1926  H HB3  . SER A 1 28  ? -4.775  2.799   16.972  1.00 0.00 ? 811 SER A HB3  2  
ATOM 1927  H HG   . SER A 1 28  ? -6.241  2.929   19.111  1.00 0.00 ? 811 SER A HG   2  
ATOM 1928  N N    . CYS A 1 29  ? -5.444  1.589   14.685  1.00 0.00 ? 812 CYS A N    2  
ATOM 1929  C CA   . CYS A 1 29  ? -5.999  1.887   13.370  1.00 0.00 ? 812 CYS A CA   2  
ATOM 1930  C C    . CYS A 1 29  ? -6.635  0.645   12.754  1.00 0.00 ? 812 CYS A C    2  
ATOM 1931  O O    . CYS A 1 29  ? -6.265  -0.483  13.081  1.00 0.00 ? 812 CYS A O    2  
ATOM 1932  C CB   . CYS A 1 29  ? -4.909  2.429   12.444  1.00 0.00 ? 812 CYS A CB   2  
ATOM 1933  S SG   . CYS A 1 29  ? -5.528  3.488   11.115  1.00 0.00 ? 812 CYS A SG   2  
ATOM 1934  H H    . CYS A 1 29  ? -4.507  1.810   14.869  1.00 0.00 ? 812 CYS A H    2  
ATOM 1935  H HA   . CYS A 1 29  ? -6.761  2.641   13.496  1.00 0.00 ? 812 CYS A HA   2  
ATOM 1936  H HB2  . CYS A 1 29  ? -4.209  3.010   13.027  1.00 0.00 ? 812 CYS A HB2  2  
ATOM 1937  H HB3  . CYS A 1 29  ? -4.388  1.600   11.990  1.00 0.00 ? 812 CYS A HB3  2  
ATOM 1938  H HG   . CYS A 1 29  ? -6.341  4.385   11.653  1.00 0.00 ? 812 CYS A HG   2  
ATOM 1939  N N    . THR A 1 30  ? -7.595  0.859   11.859  1.00 0.00 ? 813 THR A N    2  
ATOM 1940  C CA   . THR A 1 30  ? -8.284  -0.242  11.199  1.00 0.00 ? 813 THR A CA   2  
ATOM 1941  C C    . THR A 1 30  ? -8.561  0.081   9.736   1.00 0.00 ? 813 THR A C    2  
ATOM 1942  O O    . THR A 1 30  ? -8.196  1.150   9.245   1.00 0.00 ? 813 THR A O    2  
ATOM 1943  C CB   . THR A 1 30  ? -9.615  -0.573  11.901  1.00 0.00 ? 813 THR A CB   2  
ATOM 1944  O OG1  . THR A 1 30  ? -10.182 -1.762  11.340  1.00 0.00 ? 813 THR A OG1  2  
ATOM 1945  C CG2  . THR A 1 30  ? -10.600 0.578   11.764  1.00 0.00 ? 813 THR A CG2  2  
ATOM 1946  H H    . THR A 1 30  ? -7.845  1.781   11.640  1.00 0.00 ? 813 THR A H    2  
ATOM 1947  H HA   . THR A 1 30  ? -7.647  -1.113  11.251  1.00 0.00 ? 813 THR A HA   2  
ATOM 1948  H HB   . THR A 1 30  ? -9.419  -0.737  12.951  1.00 0.00 ? 813 THR A HB   2  
ATOM 1949  H HG1  . THR A 1 30  ? -10.479 -2.340  12.047  1.00 0.00 ? 813 THR A HG1  2  
ATOM 1950  H HG21 . THR A 1 30  ? -10.367 1.340   12.494  1.00 0.00 ? 813 THR A HG21 2  
ATOM 1951  H HG22 . THR A 1 30  ? -11.603 0.215   11.930  1.00 0.00 ? 813 THR A HG22 2  
ATOM 1952  H HG23 . THR A 1 30  ? -10.528 0.997   10.772  1.00 0.00 ? 813 THR A HG23 2  
ATOM 1953  N N    . LYS A 1 31  ? -9.210  -0.848  9.042   1.00 0.00 ? 814 LYS A N    2  
ATOM 1954  C CA   . LYS A 1 31  ? -9.538  -0.662  7.634   1.00 0.00 ? 814 LYS A CA   2  
ATOM 1955  C C    . LYS A 1 31  ? -10.320 0.630   7.424   1.00 0.00 ? 814 LYS A C    2  
ATOM 1956  O O    . LYS A 1 31  ? -10.008 1.417   6.530   1.00 0.00 ? 814 LYS A O    2  
ATOM 1957  C CB   . LYS A 1 31  ? -10.351 -1.852  7.117   1.00 0.00 ? 814 LYS A CB   2  
ATOM 1958  C CG   . LYS A 1 31  ? -10.145 -2.133  5.638   1.00 0.00 ? 814 LYS A CG   2  
ATOM 1959  C CD   . LYS A 1 31  ? -11.038 -3.264  5.156   1.00 0.00 ? 814 LYS A CD   2  
ATOM 1960  C CE   . LYS A 1 31  ? -10.416 -4.623  5.436   1.00 0.00 ? 814 LYS A CE   2  
ATOM 1961  N NZ   . LYS A 1 31  ? -9.319  -4.939  4.480   1.00 0.00 ? 814 LYS A NZ   2  
ATOM 1962  H H    . LYS A 1 31  ? -9.475  -1.680  9.489   1.00 0.00 ? 814 LYS A H    2  
ATOM 1963  H HA   . LYS A 1 31  ? -8.613  -0.603  7.082   1.00 0.00 ? 814 LYS A HA   2  
ATOM 1964  H HB2  . LYS A 1 31  ? -10.068 -2.734  7.673   1.00 0.00 ? 814 LYS A HB2  2  
ATOM 1965  H HB3  . LYS A 1 31  ? -11.400 -1.654  7.281   1.00 0.00 ? 814 LYS A HB3  2  
ATOM 1966  H HG2  . LYS A 1 31  ? -10.377 -1.241  5.076   1.00 0.00 ? 814 LYS A HG2  2  
ATOM 1967  H HG3  . LYS A 1 31  ? -9.112  -2.406  5.474   1.00 0.00 ? 814 LYS A HG3  2  
ATOM 1968  H HD2  . LYS A 1 31  ? -11.988 -3.204  5.666   1.00 0.00 ? 814 LYS A HD2  2  
ATOM 1969  H HD3  . LYS A 1 31  ? -11.191 -3.160  4.091   1.00 0.00 ? 814 LYS A HD3  2  
ATOM 1970  H HE2  . LYS A 1 31  ? -10.018 -4.623  6.439   1.00 0.00 ? 814 LYS A HE2  2  
ATOM 1971  H HE3  . LYS A 1 31  ? -11.183 -5.379  5.354   1.00 0.00 ? 814 LYS A HE3  2  
ATOM 1972  H HZ1  . LYS A 1 31  ? -8.538  -4.262  4.596   1.00 0.00 ? 814 LYS A HZ1  2  
ATOM 1973  H HZ2  . LYS A 1 31  ? -9.669  -4.882  3.503   1.00 0.00 ? 814 LYS A HZ2  2  
ATOM 1974  H HZ3  . LYS A 1 31  ? -8.959  -5.899  4.652   1.00 0.00 ? 814 LYS A HZ3  2  
ATOM 1975  N N    . GLU A 1 32  ? -11.337 0.843   8.253   1.00 0.00 ? 815 GLU A N    2  
ATOM 1976  C CA   . GLU A 1 32  ? -12.162 2.042   8.157   1.00 0.00 ? 815 GLU A CA   2  
ATOM 1977  C C    . GLU A 1 32  ? -11.297 3.299   8.148   1.00 0.00 ? 815 GLU A C    2  
ATOM 1978  O O    . GLU A 1 32  ? -11.322 4.074   7.192   1.00 0.00 ? 815 GLU A O    2  
ATOM 1979  C CB   . GLU A 1 32  ? -13.153 2.100   9.322   1.00 0.00 ? 815 GLU A CB   2  
ATOM 1980  C CG   . GLU A 1 32  ? -14.316 1.133   9.180   1.00 0.00 ? 815 GLU A CG   2  
ATOM 1981  C CD   . GLU A 1 32  ? -15.565 1.613   9.894   1.00 0.00 ? 815 GLU A CD   2  
ATOM 1982  O OE1  . GLU A 1 32  ? -15.435 2.175   11.002  1.00 0.00 ? 815 GLU A OE1  2  
ATOM 1983  O OE2  . GLU A 1 32  ? -16.671 1.428   9.345   1.00 0.00 ? 815 GLU A OE2  2  
ATOM 1984  H H    . GLU A 1 32  ? -11.537 0.179   8.945   1.00 0.00 ? 815 GLU A H    2  
ATOM 1985  H HA   . GLU A 1 32  ? -12.713 1.992   7.230   1.00 0.00 ? 815 GLU A HA   2  
ATOM 1986  H HB2  . GLU A 1 32  ? -12.629 1.869   10.237  1.00 0.00 ? 815 GLU A HB2  2  
ATOM 1987  H HB3  . GLU A 1 32  ? -13.552 3.102   9.389   1.00 0.00 ? 815 GLU A HB3  2  
ATOM 1988  H HG2  . GLU A 1 32  ? -14.543 1.013   8.131   1.00 0.00 ? 815 GLU A HG2  2  
ATOM 1989  H HG3  . GLU A 1 32  ? -14.027 0.178   9.596   1.00 0.00 ? 815 GLU A HG3  2  
ATOM 1990  N N    . GLU A 1 33  ? -10.533 3.493   9.218   1.00 0.00 ? 816 GLU A N    2  
ATOM 1991  C CA   . GLU A 1 33  ? -9.662  4.656   9.334   1.00 0.00 ? 816 GLU A CA   2  
ATOM 1992  C C    . GLU A 1 33  ? -8.781  4.800   8.096   1.00 0.00 ? 816 GLU A C    2  
ATOM 1993  O O    . GLU A 1 33  ? -8.929  5.746   7.321   1.00 0.00 ? 816 GLU A O    2  
ATOM 1994  C CB   . GLU A 1 33  ? -8.789  4.544   10.585  1.00 0.00 ? 816 GLU A CB   2  
ATOM 1995  C CG   . GLU A 1 33  ? -9.562  4.703   11.883  1.00 0.00 ? 816 GLU A CG   2  
ATOM 1996  C CD   . GLU A 1 33  ? -9.915  6.148   12.179  1.00 0.00 ? 816 GLU A CD   2  
ATOM 1997  O OE1  . GLU A 1 33  ? -9.063  6.864   12.744  1.00 0.00 ? 816 GLU A OE1  2  
ATOM 1998  O OE2  . GLU A 1 33  ? -11.045 6.562   11.844  1.00 0.00 ? 816 GLU A OE2  2  
ATOM 1999  H H    . GLU A 1 33  ? -10.557 2.838   9.948   1.00 0.00 ? 816 GLU A H    2  
ATOM 2000  H HA   . GLU A 1 33  ? -10.287 5.531   9.419   1.00 0.00 ? 816 GLU A HA   2  
ATOM 2001  H HB2  . GLU A 1 33  ? -8.310  3.576   10.591  1.00 0.00 ? 816 GLU A HB2  2  
ATOM 2002  H HB3  . GLU A 1 33  ? -8.028  5.311   10.548  1.00 0.00 ? 816 GLU A HB3  2  
ATOM 2003  H HG2  . GLU A 1 33  ? -10.476 4.132   11.815  1.00 0.00 ? 816 GLU A HG2  2  
ATOM 2004  H HG3  . GLU A 1 33  ? -8.960  4.322   12.695  1.00 0.00 ? 816 GLU A HG3  2  
ATOM 2005  N N    . LEU A 1 34  ? -7.863  3.856   7.917   1.00 0.00 ? 817 LEU A N    2  
ATOM 2006  C CA   . LEU A 1 34  ? -6.956  3.877   6.775   1.00 0.00 ? 817 LEU A CA   2  
ATOM 2007  C C    . LEU A 1 34  ? -7.710  4.194   5.487   1.00 0.00 ? 817 LEU A C    2  
ATOM 2008  O O    . LEU A 1 34  ? -7.479  5.227   4.860   1.00 0.00 ? 817 LEU A O    2  
ATOM 2009  C CB   . LEU A 1 34  ? -6.241  2.532   6.642   1.00 0.00 ? 817 LEU A CB   2  
ATOM 2010  C CG   . LEU A 1 34  ? -4.929  2.545   5.856   1.00 0.00 ? 817 LEU A CG   2  
ATOM 2011  C CD1  . LEU A 1 34  ? -3.944  3.523   6.477   1.00 0.00 ? 817 LEU A CD1  2  
ATOM 2012  C CD2  . LEU A 1 34  ? -4.329  1.147   5.797   1.00 0.00 ? 817 LEU A CD2  2  
ATOM 2013  H H    . LEU A 1 34  ? -7.793  3.128   8.569   1.00 0.00 ? 817 LEU A H    2  
ATOM 2014  H HA   . LEU A 1 34  ? -6.223  4.651   6.948   1.00 0.00 ? 817 LEU A HA   2  
ATOM 2015  H HB2  . LEU A 1 34  ? -6.027  2.172   7.636   1.00 0.00 ? 817 LEU A HB2  2  
ATOM 2016  H HB3  . LEU A 1 34  ? -6.916  1.846   6.150   1.00 0.00 ? 817 LEU A HB3  2  
ATOM 2017  H HG   . LEU A 1 34  ? -5.126  2.868   4.843   1.00 0.00 ? 817 LEU A HG   2  
ATOM 2018  H HD11 . LEU A 1 34  ? -3.860  3.327   7.535   1.00 0.00 ? 817 LEU A HD11 2  
ATOM 2019  H HD12 . LEU A 1 34  ? -4.296  4.533   6.325   1.00 0.00 ? 817 LEU A HD12 2  
ATOM 2020  H HD13 . LEU A 1 34  ? -2.977  3.406   6.010   1.00 0.00 ? 817 LEU A HD13 2  
ATOM 2021  H HD21 . LEU A 1 34  ? -5.101  0.417   5.990   1.00 0.00 ? 817 LEU A HD21 2  
ATOM 2022  H HD22 . LEU A 1 34  ? -3.553  1.057   6.544   1.00 0.00 ? 817 LEU A HD22 2  
ATOM 2023  H HD23 . LEU A 1 34  ? -3.909  0.977   4.818   1.00 0.00 ? 817 LEU A HD23 2  
ATOM 2024  N N    . GLU A 1 35  ? -8.614  3.299   5.101   1.00 0.00 ? 818 GLU A N    2  
ATOM 2025  C CA   . GLU A 1 35  ? -9.403  3.485   3.889   1.00 0.00 ? 818 GLU A CA   2  
ATOM 2026  C C    . GLU A 1 35  ? -9.740  4.959   3.679   1.00 0.00 ? 818 GLU A C    2  
ATOM 2027  O O    . GLU A 1 35  ? -9.413  5.539   2.645   1.00 0.00 ? 818 GLU A O    2  
ATOM 2028  C CB   . GLU A 1 35  ? -10.691 2.662   3.960   1.00 0.00 ? 818 GLU A CB   2  
ATOM 2029  C CG   . GLU A 1 35  ? -11.490 2.669   2.668   1.00 0.00 ? 818 GLU A CG   2  
ATOM 2030  C CD   . GLU A 1 35  ? -12.809 1.932   2.794   1.00 0.00 ? 818 GLU A CD   2  
ATOM 2031  O OE1  . GLU A 1 35  ? -13.732 2.473   3.438   1.00 0.00 ? 818 GLU A OE1  2  
ATOM 2032  O OE2  . GLU A 1 35  ? -12.919 0.814   2.248   1.00 0.00 ? 818 GLU A OE2  2  
ATOM 2033  H H    . GLU A 1 35  ? -8.753  2.495   5.643   1.00 0.00 ? 818 GLU A H    2  
ATOM 2034  H HA   . GLU A 1 35  ? -8.813  3.141   3.053   1.00 0.00 ? 818 GLU A HA   2  
ATOM 2035  H HB2  . GLU A 1 35  ? -10.437 1.639   4.197   1.00 0.00 ? 818 GLU A HB2  2  
ATOM 2036  H HB3  . GLU A 1 35  ? -11.314 3.060   4.747   1.00 0.00 ? 818 GLU A HB3  2  
ATOM 2037  H HG2  . GLU A 1 35  ? -11.692 3.692   2.390   1.00 0.00 ? 818 GLU A HG2  2  
ATOM 2038  H HG3  . GLU A 1 35  ? -10.903 2.196   1.894   1.00 0.00 ? 818 GLU A HG3  2  
ATOM 2039  N N    . GLU A 1 36  ? -10.396 5.556   4.669   1.00 0.00 ? 819 GLU A N    2  
ATOM 2040  C CA   . GLU A 1 36  ? -10.778 6.961   4.593   1.00 0.00 ? 819 GLU A CA   2  
ATOM 2041  C C    . GLU A 1 36  ? -9.595  7.824   4.162   1.00 0.00 ? 819 GLU A C    2  
ATOM 2042  O O    . GLU A 1 36  ? -9.653  8.510   3.141   1.00 0.00 ? 819 GLU A O    2  
ATOM 2043  C CB   . GLU A 1 36  ? -11.309 7.443   5.945   1.00 0.00 ? 819 GLU A CB   2  
ATOM 2044  C CG   . GLU A 1 36  ? -12.751 7.045   6.209   1.00 0.00 ? 819 GLU A CG   2  
ATOM 2045  C CD   . GLU A 1 36  ? -13.123 7.139   7.676   1.00 0.00 ? 819 GLU A CD   2  
ATOM 2046  O OE1  . GLU A 1 36  ? -12.674 8.095   8.342   1.00 0.00 ? 819 GLU A OE1  2  
ATOM 2047  O OE2  . GLU A 1 36  ? -13.865 6.257   8.157   1.00 0.00 ? 819 GLU A OE2  2  
ATOM 2048  H H    . GLU A 1 36  ? -10.628 5.040   5.469   1.00 0.00 ? 819 GLU A H    2  
ATOM 2049  H HA   . GLU A 1 36  ? -11.561 7.052   3.856   1.00 0.00 ? 819 GLU A HA   2  
ATOM 2050  H HB2  . GLU A 1 36  ? -10.693 7.027   6.729   1.00 0.00 ? 819 GLU A HB2  2  
ATOM 2051  H HB3  . GLU A 1 36  ? -11.242 8.520   5.981   1.00 0.00 ? 819 GLU A HB3  2  
ATOM 2052  H HG2  . GLU A 1 36  ? -13.400 7.699   5.646   1.00 0.00 ? 819 GLU A HG2  2  
ATOM 2053  H HG3  . GLU A 1 36  ? -12.896 6.026   5.881   1.00 0.00 ? 819 GLU A HG3  2  
ATOM 2054  N N    . ILE A 1 37  ? -8.524  7.785   4.948   1.00 0.00 ? 820 ILE A N    2  
ATOM 2055  C CA   . ILE A 1 37  ? -7.328  8.562   4.648   1.00 0.00 ? 820 ILE A CA   2  
ATOM 2056  C C    . ILE A 1 37  ? -6.913  8.391   3.191   1.00 0.00 ? 820 ILE A C    2  
ATOM 2057  O O    . ILE A 1 37  ? -6.439  9.334   2.555   1.00 0.00 ? 820 ILE A O    2  
ATOM 2058  C CB   . ILE A 1 37  ? -6.152  8.158   5.556   1.00 0.00 ? 820 ILE A CB   2  
ATOM 2059  C CG1  . ILE A 1 37  ? -6.481  8.462   7.019   1.00 0.00 ? 820 ILE A CG1  2  
ATOM 2060  C CG2  . ILE A 1 37  ? -4.882  8.881   5.132   1.00 0.00 ? 820 ILE A CG2  2  
ATOM 2061  C CD1  . ILE A 1 37  ? -5.467  7.906   7.995   1.00 0.00 ? 820 ILE A CD1  2  
ATOM 2062  H H    . ILE A 1 37  ? -8.539  7.219   5.748   1.00 0.00 ? 820 ILE A H    2  
ATOM 2063  H HA   . ILE A 1 37  ? -7.554  9.603   4.827   1.00 0.00 ? 820 ILE A HA   2  
ATOM 2064  H HB   . ILE A 1 37  ? -5.988  7.097   5.444   1.00 0.00 ? 820 ILE A HB   2  
ATOM 2065  H HG12 . ILE A 1 37  ? -6.522  9.530   7.158   1.00 0.00 ? 820 ILE A HG12 2  
ATOM 2066  H HG13 . ILE A 1 37  ? -7.443  8.034   7.260   1.00 0.00 ? 820 ILE A HG13 2  
ATOM 2067  H HG21 . ILE A 1 37  ? -5.114  9.584   4.345   1.00 0.00 ? 820 ILE A HG21 2  
ATOM 2068  H HG22 . ILE A 1 37  ? -4.471  9.411   5.977   1.00 0.00 ? 820 ILE A HG22 2  
ATOM 2069  H HG23 . ILE A 1 37  ? -4.162  8.162   4.771   1.00 0.00 ? 820 ILE A HG23 2  
ATOM 2070  H HD11 . ILE A 1 37  ? -5.873  7.027   8.474   1.00 0.00 ? 820 ILE A HD11 2  
ATOM 2071  H HD12 . ILE A 1 37  ? -4.564  7.643   7.465   1.00 0.00 ? 820 ILE A HD12 2  
ATOM 2072  H HD13 . ILE A 1 37  ? -5.241  8.651   8.743   1.00 0.00 ? 820 ILE A HD13 2  
ATOM 2073  N N    . CYS A 1 38  ? -7.095  7.184   2.667   1.00 0.00 ? 821 CYS A N    2  
ATOM 2074  C CA   . CYS A 1 38  ? -6.740  6.890   1.283   1.00 0.00 ? 821 CYS A CA   2  
ATOM 2075  C C    . CYS A 1 38  ? -7.703  7.573   0.318   1.00 0.00 ? 821 CYS A C    2  
ATOM 2076  O O    . CYS A 1 38  ? -7.304  8.036   -0.751  1.00 0.00 ? 821 CYS A O    2  
ATOM 2077  C CB   . CYS A 1 38  ? -6.745  5.379   1.044   1.00 0.00 ? 821 CYS A CB   2  
ATOM 2078  S SG   . CYS A 1 38  ? -5.477  4.481   1.968   1.00 0.00 ? 821 CYS A SG   2  
ATOM 2079  H H    . CYS A 1 38  ? -7.477  6.474   3.224   1.00 0.00 ? 821 CYS A H    2  
ATOM 2080  H HA   . CYS A 1 38  ? -5.745  7.270   1.109   1.00 0.00 ? 821 CYS A HA   2  
ATOM 2081  H HB2  . CYS A 1 38  ? -7.706  4.980   1.334   1.00 0.00 ? 821 CYS A HB2  2  
ATOM 2082  H HB3  . CYS A 1 38  ? -6.586  5.189   -0.007  1.00 0.00 ? 821 CYS A HB3  2  
ATOM 2083  H HG   . CYS A 1 38  ? -5.419  4.994   3.187   1.00 0.00 ? 821 CYS A HG   2  
ATOM 2084  N N    . LYS A 1 39  ? -8.974  7.633   0.701   1.00 0.00 ? 822 LYS A N    2  
ATOM 2085  C CA   . LYS A 1 39  ? -9.995  8.259   -0.130  1.00 0.00 ? 822 LYS A CA   2  
ATOM 2086  C C    . LYS A 1 39  ? -9.682  9.734   -0.358  1.00 0.00 ? 822 LYS A C    2  
ATOM 2087  O O    . LYS A 1 39  ? -10.169 10.342  -1.311  1.00 0.00 ? 822 LYS A O    2  
ATOM 2088  C CB   . LYS A 1 39  ? -11.372 8.115   0.523   1.00 0.00 ? 822 LYS A CB   2  
ATOM 2089  C CG   . LYS A 1 39  ? -11.808 6.672   0.708   1.00 0.00 ? 822 LYS A CG   2  
ATOM 2090  C CD   . LYS A 1 39  ? -13.323 6.546   0.731   1.00 0.00 ? 822 LYS A CD   2  
ATOM 2091  C CE   . LYS A 1 39  ? -13.766 5.276   1.443   1.00 0.00 ? 822 LYS A CE   2  
ATOM 2092  N NZ   . LYS A 1 39  ? -13.744 5.434   2.923   1.00 0.00 ? 822 LYS A NZ   2  
ATOM 2093  H H    . LYS A 1 39  ? -9.231  7.246   1.565   1.00 0.00 ? 822 LYS A H    2  
ATOM 2094  H HA   . LYS A 1 39  ? -10.003 7.753   -1.084  1.00 0.00 ? 822 LYS A HA   2  
ATOM 2095  H HB2  . LYS A 1 39  ? -11.349 8.590   1.492   1.00 0.00 ? 822 LYS A HB2  2  
ATOM 2096  H HB3  . LYS A 1 39  ? -12.104 8.613   -0.096  1.00 0.00 ? 822 LYS A HB3  2  
ATOM 2097  H HG2  . LYS A 1 39  ? -11.421 6.080   -0.107  1.00 0.00 ? 822 LYS A HG2  2  
ATOM 2098  H HG3  . LYS A 1 39  ? -11.411 6.303   1.644   1.00 0.00 ? 822 LYS A HG3  2  
ATOM 2099  H HD2  . LYS A 1 39  ? -13.739 7.398   1.247   1.00 0.00 ? 822 LYS A HD2  2  
ATOM 2100  H HD3  . LYS A 1 39  ? -13.688 6.524   -0.286  1.00 0.00 ? 822 LYS A HD3  2  
ATOM 2101  H HE2  . LYS A 1 39  ? -14.770 5.036   1.130   1.00 0.00 ? 822 LYS A HE2  2  
ATOM 2102  H HE3  . LYS A 1 39  ? -13.100 4.473   1.165   1.00 0.00 ? 822 LYS A HE3  2  
ATOM 2103  H HZ1  . LYS A 1 39  ? -13.020 4.813   3.338   1.00 0.00 ? 822 LYS A HZ1  2  
ATOM 2104  H HZ2  . LYS A 1 39  ? -14.670 5.183   3.323   1.00 0.00 ? 822 LYS A HZ2  2  
ATOM 2105  H HZ3  . LYS A 1 39  ? -13.526 6.420   3.175   1.00 0.00 ? 822 LYS A HZ3  2  
ATOM 2106  N N    . ALA A 1 40  ? -8.864  10.304  0.521   1.00 0.00 ? 823 ALA A N    2  
ATOM 2107  C CA   . ALA A 1 40  ? -8.483  11.706  0.413   1.00 0.00 ? 823 ALA A CA   2  
ATOM 2108  C C    . ALA A 1 40  ? -7.506  11.923  -0.738  1.00 0.00 ? 823 ALA A C    2  
ATOM 2109  O O    . ALA A 1 40  ? -7.617  12.894  -1.486  1.00 0.00 ? 823 ALA A O    2  
ATOM 2110  C CB   . ALA A 1 40  ? -7.876  12.191  1.721   1.00 0.00 ? 823 ALA A CB   2  
ATOM 2111  H H    . ALA A 1 40  ? -8.508  9.767   1.259   1.00 0.00 ? 823 ALA A H    2  
ATOM 2112  H HA   . ALA A 1 40  ? -9.378  12.282  0.224   1.00 0.00 ? 823 ALA A HA   2  
ATOM 2113  H HB1  . ALA A 1 40  ? -7.599  13.231  1.625   1.00 0.00 ? 823 ALA A HB1  2  
ATOM 2114  H HB2  . ALA A 1 40  ? -8.599  12.082  2.515   1.00 0.00 ? 823 ALA A HB2  2  
ATOM 2115  H HB3  . ALA A 1 40  ? -6.999  11.605  1.949   1.00 0.00 ? 823 ALA A HB3  2  
ATOM 2116  N N    . HIS A 1 41  ? -6.547  11.011  -0.874  1.00 0.00 ? 824 HIS A N    2  
ATOM 2117  C CA   . HIS A 1 41  ? -5.550  11.103  -1.934  1.00 0.00 ? 824 HIS A CA   2  
ATOM 2118  C C    . HIS A 1 41  ? -6.179  10.830  -3.297  1.00 0.00 ? 824 HIS A C    2  
ATOM 2119  O O    . HIS A 1 41  ? -5.847  11.481  -4.286  1.00 0.00 ? 824 HIS A O    2  
ATOM 2120  C CB   . HIS A 1 41  ? -4.411  10.116  -1.678  1.00 0.00 ? 824 HIS A CB   2  
ATOM 2121  C CG   . HIS A 1 41  ? -3.760  10.286  -0.340  1.00 0.00 ? 824 HIS A CG   2  
ATOM 2122  N ND1  . HIS A 1 41  ? -3.128  11.449  0.048   1.00 0.00 ? 824 HIS A ND1  2  
ATOM 2123  C CD2  . HIS A 1 41  ? -3.647  9.432   0.705   1.00 0.00 ? 824 HIS A CD2  2  
ATOM 2124  C CE1  . HIS A 1 41  ? -2.654  11.302  1.272   1.00 0.00 ? 824 HIS A CE1  2  
ATOM 2125  N NE2  . HIS A 1 41  ? -2.955  10.088  1.693   1.00 0.00 ? 824 HIS A NE2  2  
ATOM 2126  H H    . HIS A 1 41  ? -6.511  10.260  -0.246  1.00 0.00 ? 824 HIS A H    2  
ATOM 2127  H HA   . HIS A 1 41  ? -5.153  12.106  -1.930  1.00 0.00 ? 824 HIS A HA   2  
ATOM 2128  H HB2  . HIS A 1 41  ? -4.797  9.109   -1.733  1.00 0.00 ? 824 HIS A HB2  2  
ATOM 2129  H HB3  . HIS A 1 41  ? -3.652  10.247  -2.436  1.00 0.00 ? 824 HIS A HB3  2  
ATOM 2130  H HD2  . HIS A 1 41  ? -4.029  8.422   0.752   1.00 0.00 ? 824 HIS A HD2  2  
ATOM 2131  H HE1  . HIS A 1 41  ? -2.111  12.049  1.833   1.00 0.00 ? 824 HIS A HE1  2  
ATOM 2132  H HE2  . HIS A 1 41  ? -2.648  9.690   2.534   1.00 0.00 ? 824 HIS A HE2  2  
ATOM 2133  N N    . GLY A 1 42  ? -7.089  9.861   -3.340  1.00 0.00 ? 825 GLY A N    2  
ATOM 2134  C CA   . GLY A 1 42  ? -7.749  9.518   -4.586  1.00 0.00 ? 825 GLY A CA   2  
ATOM 2135  C C    . GLY A 1 42  ? -8.862  8.508   -4.394  1.00 0.00 ? 825 GLY A C    2  
ATOM 2136  O O    . GLY A 1 42  ? -9.486  8.453   -3.333  1.00 0.00 ? 825 GLY A O    2  
ATOM 2137  H H    . GLY A 1 42  ? -7.314  9.375   -2.519  1.00 0.00 ? 825 GLY A H    2  
ATOM 2138  H HA2  . GLY A 1 42  ? -8.163  10.416  -5.020  1.00 0.00 ? 825 GLY A HA2  2  
ATOM 2139  H HA3  . GLY A 1 42  ? -7.018  9.106   -5.266  1.00 0.00 ? 825 GLY A HA3  2  
ATOM 2140  N N    . THR A 1 43  ? -9.115  7.705   -5.423  1.00 0.00 ? 826 THR A N    2  
ATOM 2141  C CA   . THR A 1 43  ? -10.163 6.693   -5.363  1.00 0.00 ? 826 THR A CA   2  
ATOM 2142  C C    . THR A 1 43  ? -9.601  5.345   -4.929  1.00 0.00 ? 826 THR A C    2  
ATOM 2143  O O    . THR A 1 43  ? -8.650  4.836   -5.524  1.00 0.00 ? 826 THR A O    2  
ATOM 2144  C CB   . THR A 1 43  ? -10.864 6.530   -6.725  1.00 0.00 ? 826 THR A CB   2  
ATOM 2145  O OG1  . THR A 1 43  ? -11.347 7.799   -7.183  1.00 0.00 ? 826 THR A OG1  2  
ATOM 2146  C CG2  . THR A 1 43  ? -12.021 5.548   -6.624  1.00 0.00 ? 826 THR A CG2  2  
ATOM 2147  H H    . THR A 1 43  ? -8.584  7.797   -6.241  1.00 0.00 ? 826 THR A H    2  
ATOM 2148  H HA   . THR A 1 43  ? -10.898 7.016   -4.640  1.00 0.00 ? 826 THR A HA   2  
ATOM 2149  H HB   . THR A 1 43  ? -10.148 6.148   -7.438  1.00 0.00 ? 826 THR A HB   2  
ATOM 2150  H HG1  . THR A 1 43  ? -10.685 8.209   -7.744  1.00 0.00 ? 826 THR A HG1  2  
ATOM 2151  H HG21 . THR A 1 43  ? -11.663 4.548   -6.820  1.00 0.00 ? 826 THR A HG21 2  
ATOM 2152  H HG22 . THR A 1 43  ? -12.779 5.808   -7.348  1.00 0.00 ? 826 THR A HG22 2  
ATOM 2153  H HG23 . THR A 1 43  ? -12.443 5.591   -5.631  1.00 0.00 ? 826 THR A HG23 2  
ATOM 2154  N N    . VAL A 1 44  ? -10.195 4.768   -3.889  1.00 0.00 ? 827 VAL A N    2  
ATOM 2155  C CA   . VAL A 1 44  ? -9.755  3.477   -3.376  1.00 0.00 ? 827 VAL A CA   2  
ATOM 2156  C C    . VAL A 1 44  ? -10.601 2.342   -3.944  1.00 0.00 ? 827 VAL A C    2  
ATOM 2157  O O    . VAL A 1 44  ? -11.758 2.165   -3.563  1.00 0.00 ? 827 VAL A O    2  
ATOM 2158  C CB   . VAL A 1 44  ? -9.821  3.431   -1.838  1.00 0.00 ? 827 VAL A CB   2  
ATOM 2159  C CG1  . VAL A 1 44  ? -9.438  2.051   -1.327  1.00 0.00 ? 827 VAL A CG1  2  
ATOM 2160  C CG2  . VAL A 1 44  ? -8.922  4.500   -1.235  1.00 0.00 ? 827 VAL A CG2  2  
ATOM 2161  H H    . VAL A 1 44  ? -10.948 5.222   -3.457  1.00 0.00 ? 827 VAL A H    2  
ATOM 2162  H HA   . VAL A 1 44  ? -8.727  3.331   -3.676  1.00 0.00 ? 827 VAL A HA   2  
ATOM 2163  H HB   . VAL A 1 44  ? -10.838 3.633   -1.535  1.00 0.00 ? 827 VAL A HB   2  
ATOM 2164  H HG11 . VAL A 1 44  ? -8.542  2.125   -0.728  1.00 0.00 ? 827 VAL A HG11 2  
ATOM 2165  H HG12 . VAL A 1 44  ? -10.242 1.652   -0.727  1.00 0.00 ? 827 VAL A HG12 2  
ATOM 2166  H HG13 . VAL A 1 44  ? -9.255  1.395   -2.166  1.00 0.00 ? 827 VAL A HG13 2  
ATOM 2167  H HG21 . VAL A 1 44  ? -8.168  4.783   -1.954  1.00 0.00 ? 827 VAL A HG21 2  
ATOM 2168  H HG22 . VAL A 1 44  ? -9.515  5.365   -0.976  1.00 0.00 ? 827 VAL A HG22 2  
ATOM 2169  H HG23 . VAL A 1 44  ? -8.445  4.112   -0.347  1.00 0.00 ? 827 VAL A HG23 2  
ATOM 2170  N N    . LYS A 1 45  ? -10.016 1.576   -4.858  1.00 0.00 ? 828 LYS A N    2  
ATOM 2171  C CA   . LYS A 1 45  ? -10.714 0.456   -5.478  1.00 0.00 ? 828 LYS A CA   2  
ATOM 2172  C C    . LYS A 1 45  ? -10.872 -0.699  -4.495  1.00 0.00 ? 828 LYS A C    2  
ATOM 2173  O O    . LYS A 1 45  ? -11.963 -1.250  -4.341  1.00 0.00 ? 828 LYS A O    2  
ATOM 2174  C CB   . LYS A 1 45  ? -9.956  -0.019  -6.721  1.00 0.00 ? 828 LYS A CB   2  
ATOM 2175  C CG   . LYS A 1 45  ? -9.857  1.034   -7.812  1.00 0.00 ? 828 LYS A CG   2  
ATOM 2176  C CD   . LYS A 1 45  ? -11.207 1.296   -8.457  1.00 0.00 ? 828 LYS A CD   2  
ATOM 2177  C CE   . LYS A 1 45  ? -11.569 0.208   -9.456  1.00 0.00 ? 828 LYS A CE   2  
ATOM 2178  N NZ   . LYS A 1 45  ? -12.069 -1.021  -8.780  1.00 0.00 ? 828 LYS A NZ   2  
ATOM 2179  H H    . LYS A 1 45  ? -9.090  1.767   -5.121  1.00 0.00 ? 828 LYS A H    2  
ATOM 2180  H HA   . LYS A 1 45  ? -11.694 0.799   -5.774  1.00 0.00 ? 828 LYS A HA   2  
ATOM 2181  H HB2  . LYS A 1 45  ? -8.955  -0.302  -6.431  1.00 0.00 ? 828 LYS A HB2  2  
ATOM 2182  H HB3  . LYS A 1 45  ? -10.462 -0.882  -7.128  1.00 0.00 ? 828 LYS A HB3  2  
ATOM 2183  H HG2  . LYS A 1 45  ? -9.491  1.953   -7.380  1.00 0.00 ? 828 LYS A HG2  2  
ATOM 2184  H HG3  . LYS A 1 45  ? -9.167  0.690   -8.569  1.00 0.00 ? 828 LYS A HG3  2  
ATOM 2185  H HD2  . LYS A 1 45  ? -11.964 1.329   -7.688  1.00 0.00 ? 828 LYS A HD2  2  
ATOM 2186  H HD3  . LYS A 1 45  ? -11.172 2.247   -8.971  1.00 0.00 ? 828 LYS A HD3  2  
ATOM 2187  H HE2  . LYS A 1 45  ? -12.336 0.583   -10.116 1.00 0.00 ? 828 LYS A HE2  2  
ATOM 2188  H HE3  . LYS A 1 45  ? -10.689 -0.041  -10.031 1.00 0.00 ? 828 LYS A HE3  2  
ATOM 2189  H HZ1  . LYS A 1 45  ? -12.941 -1.352  -9.242  1.00 0.00 ? 828 LYS A HZ1  2  
ATOM 2190  H HZ2  . LYS A 1 45  ? -12.275 -0.820  -7.781  1.00 0.00 ? 828 LYS A HZ2  2  
ATOM 2191  H HZ3  . LYS A 1 45  ? -11.354 -1.774  -8.832  1.00 0.00 ? 828 LYS A HZ3  2  
ATOM 2192  N N    . ASP A 1 46  ? -9.780  -1.059  -3.831  1.00 0.00 ? 829 ASP A N    2  
ATOM 2193  C CA   . ASP A 1 46  ? -9.798  -2.147  -2.860  1.00 0.00 ? 829 ASP A CA   2  
ATOM 2194  C C    . ASP A 1 46  ? -8.766  -1.913  -1.762  1.00 0.00 ? 829 ASP A C    2  
ATOM 2195  O O    . ASP A 1 46  ? -7.791  -1.186  -1.956  1.00 0.00 ? 829 ASP A O    2  
ATOM 2196  C CB   . ASP A 1 46  ? -9.530  -3.483  -3.554  1.00 0.00 ? 829 ASP A CB   2  
ATOM 2197  C CG   . ASP A 1 46  ? -9.736  -4.667  -2.630  1.00 0.00 ? 829 ASP A CG   2  
ATOM 2198  O OD1  . ASP A 1 46  ? -10.902 -4.961  -2.292  1.00 0.00 ? 829 ASP A OD1  2  
ATOM 2199  O OD2  . ASP A 1 46  ? -8.731  -5.300  -2.244  1.00 0.00 ? 829 ASP A OD2  2  
ATOM 2200  H H    . ASP A 1 46  ? -8.940  -0.581  -3.998  1.00 0.00 ? 829 ASP A H    2  
ATOM 2201  H HA   . ASP A 1 46  ? -10.780 -2.175  -2.413  1.00 0.00 ? 829 ASP A HA   2  
ATOM 2202  H HB2  . ASP A 1 46  ? -10.200 -3.586  -4.395  1.00 0.00 ? 829 ASP A HB2  2  
ATOM 2203  H HB3  . ASP A 1 46  ? -8.510  -3.499  -3.908  1.00 0.00 ? 829 ASP A HB3  2  
ATOM 2204  N N    . LEU A 1 47  ? -8.986  -2.533  -0.608  1.00 0.00 ? 830 LEU A N    2  
ATOM 2205  C CA   . LEU A 1 47  ? -8.075  -2.392  0.523   1.00 0.00 ? 830 LEU A CA   2  
ATOM 2206  C C    . LEU A 1 47  ? -7.990  -3.690  1.319   1.00 0.00 ? 830 LEU A C    2  
ATOM 2207  O O    . LEU A 1 47  ? -9.010  -4.263  1.702   1.00 0.00 ? 830 LEU A O    2  
ATOM 2208  C CB   . LEU A 1 47  ? -8.533  -1.251  1.433   1.00 0.00 ? 830 LEU A CB   2  
ATOM 2209  C CG   . LEU A 1 47  ? -7.454  -0.619  2.312   1.00 0.00 ? 830 LEU A CG   2  
ATOM 2210  C CD1  . LEU A 1 47  ? -7.886  0.763   2.778   1.00 0.00 ? 830 LEU A CD1  2  
ATOM 2211  C CD2  . LEU A 1 47  ? -7.145  -1.513  3.504   1.00 0.00 ? 830 LEU A CD2  2  
ATOM 2212  H H    . LEU A 1 47  ? -9.780  -3.099  -0.513  1.00 0.00 ? 830 LEU A H    2  
ATOM 2213  H HA   . LEU A 1 47  ? -7.096  -2.159  0.132   1.00 0.00 ? 830 LEU A HA   2  
ATOM 2214  H HB2  . LEU A 1 47  ? -8.946  -0.475  0.808   1.00 0.00 ? 830 LEU A HB2  2  
ATOM 2215  H HB3  . LEU A 1 47  ? -9.306  -1.637  2.082   1.00 0.00 ? 830 LEU A HB3  2  
ATOM 2216  H HG   . LEU A 1 47  ? -6.547  -0.507  1.733   1.00 0.00 ? 830 LEU A HG   2  
ATOM 2217  H HD11 . LEU A 1 47  ? -8.472  0.671   3.680   1.00 0.00 ? 830 LEU A HD11 2  
ATOM 2218  H HD12 . LEU A 1 47  ? -8.480  1.233   2.008   1.00 0.00 ? 830 LEU A HD12 2  
ATOM 2219  H HD13 . LEU A 1 47  ? -7.012  1.366   2.976   1.00 0.00 ? 830 LEU A HD13 2  
ATOM 2220  H HD21 . LEU A 1 47  ? -7.492  -1.038  4.409   1.00 0.00 ? 830 LEU A HD21 2  
ATOM 2221  H HD22 . LEU A 1 47  ? -6.078  -1.672  3.568   1.00 0.00 ? 830 LEU A HD22 2  
ATOM 2222  H HD23 . LEU A 1 47  ? -7.644  -2.463  3.380   1.00 0.00 ? 830 LEU A HD23 2  
ATOM 2223  N N    . ARG A 1 48  ? -6.767  -4.147  1.566   1.00 0.00 ? 831 ARG A N    2  
ATOM 2224  C CA   . ARG A 1 48  ? -6.549  -5.377  2.318   1.00 0.00 ? 831 ARG A CA   2  
ATOM 2225  C C    . ARG A 1 48  ? -5.486  -5.176  3.394   1.00 0.00 ? 831 ARG A C    2  
ATOM 2226  O O    . ARG A 1 48  ? -4.481  -4.499  3.170   1.00 0.00 ? 831 ARG A O    2  
ATOM 2227  C CB   . ARG A 1 48  ? -6.129  -6.508  1.377   1.00 0.00 ? 831 ARG A CB   2  
ATOM 2228  C CG   . ARG A 1 48  ? -5.934  -7.843  2.077   1.00 0.00 ? 831 ARG A CG   2  
ATOM 2229  C CD   . ARG A 1 48  ? -6.154  -9.009  1.126   1.00 0.00 ? 831 ARG A CD   2  
ATOM 2230  N NE   . ARG A 1 48  ? -6.523  -10.231 1.834   1.00 0.00 ? 831 ARG A NE   2  
ATOM 2231  C CZ   . ARG A 1 48  ? -7.044  -11.297 1.237   1.00 0.00 ? 831 ARG A CZ   2  
ATOM 2232  N NH1  . ARG A 1 48  ? -7.255  -11.291 -0.072  1.00 0.00 ? 831 ARG A NH1  2  
ATOM 2233  N NH2  . ARG A 1 48  ? -7.354  -12.373 1.950   1.00 0.00 ? 831 ARG A NH2  2  
ATOM 2234  H H    . ARG A 1 48  ? -5.993  -3.646  1.235   1.00 0.00 ? 831 ARG A H    2  
ATOM 2235  H HA   . ARG A 1 48  ? -7.480  -5.645  2.795   1.00 0.00 ? 831 ARG A HA   2  
ATOM 2236  H HB2  . ARG A 1 48  ? -6.890  -6.632  0.620   1.00 0.00 ? 831 ARG A HB2  2  
ATOM 2237  H HB3  . ARG A 1 48  ? -5.200  -6.237  0.900   1.00 0.00 ? 831 ARG A HB3  2  
ATOM 2238  H HG2  . ARG A 1 48  ? -4.926  -7.892  2.463   1.00 0.00 ? 831 ARG A HG2  2  
ATOM 2239  H HG3  . ARG A 1 48  ? -6.638  -7.917  2.893   1.00 0.00 ? 831 ARG A HG3  2  
ATOM 2240  H HD2  . ARG A 1 48  ? -6.944  -8.750  0.437   1.00 0.00 ? 831 ARG A HD2  2  
ATOM 2241  H HD3  . ARG A 1 48  ? -5.241  -9.184  0.576   1.00 0.00 ? 831 ARG A HD3  2  
ATOM 2242  H HE   . ARG A 1 48  ? -6.376  -10.257 2.802   1.00 0.00 ? 831 ARG A HE   2  
ATOM 2243  H HH11 . ARG A 1 48  ? -7.021  -10.483 -0.611  1.00 0.00 ? 831 ARG A HH11 2  
ATOM 2244  H HH12 . ARG A 1 48  ? -7.646  -12.096 -0.519  1.00 0.00 ? 831 ARG A HH12 2  
ATOM 2245  H HH21 . ARG A 1 48  ? -7.197  -12.381 2.937   1.00 0.00 ? 831 ARG A HH21 2  
ATOM 2246  H HH22 . ARG A 1 48  ? -7.746  -13.174 1.500   1.00 0.00 ? 831 ARG A HH22 2  
ATOM 2247  N N    . LEU A 1 49  ? -5.714  -5.766  4.562   1.00 0.00 ? 832 LEU A N    2  
ATOM 2248  C CA   . LEU A 1 49  ? -4.776  -5.651  5.673   1.00 0.00 ? 832 LEU A CA   2  
ATOM 2249  C C    . LEU A 1 49  ? -4.183  -7.011  6.028   1.00 0.00 ? 832 LEU A C    2  
ATOM 2250  O O    . LEU A 1 49  ? -4.892  -8.016  6.076   1.00 0.00 ? 832 LEU A O    2  
ATOM 2251  C CB   . LEU A 1 49  ? -5.474  -5.052  6.895   1.00 0.00 ? 832 LEU A CB   2  
ATOM 2252  C CG   . LEU A 1 49  ? -6.205  -3.728  6.669   1.00 0.00 ? 832 LEU A CG   2  
ATOM 2253  C CD1  . LEU A 1 49  ? -7.213  -3.478  7.780   1.00 0.00 ? 832 LEU A CD1  2  
ATOM 2254  C CD2  . LEU A 1 49  ? -5.212  -2.579  6.579   1.00 0.00 ? 832 LEU A CD2  2  
ATOM 2255  H H    . LEU A 1 49  ? -6.532  -6.292  4.680   1.00 0.00 ? 832 LEU A H    2  
ATOM 2256  H HA   . LEU A 1 49  ? -3.977  -4.993  5.366   1.00 0.00 ? 832 LEU A HA   2  
ATOM 2257  H HB2  . LEU A 1 49  ? -6.196  -5.772  7.250   1.00 0.00 ? 832 LEU A HB2  2  
ATOM 2258  H HB3  . LEU A 1 49  ? -4.725  -4.892  7.657   1.00 0.00 ? 832 LEU A HB3  2  
ATOM 2259  H HG   . LEU A 1 49  ? -6.746  -3.778  5.734   1.00 0.00 ? 832 LEU A HG   2  
ATOM 2260  H HD11 . LEU A 1 49  ? -7.426  -4.407  8.288   1.00 0.00 ? 832 LEU A HD11 2  
ATOM 2261  H HD12 . LEU A 1 49  ? -8.124  -3.083  7.357   1.00 0.00 ? 832 LEU A HD12 2  
ATOM 2262  H HD13 . LEU A 1 49  ? -6.805  -2.767  8.483   1.00 0.00 ? 832 LEU A HD13 2  
ATOM 2263  H HD21 . LEU A 1 49  ? -4.241  -2.916  6.913   1.00 0.00 ? 832 LEU A HD21 2  
ATOM 2264  H HD22 . LEU A 1 49  ? -5.546  -1.765  7.206   1.00 0.00 ? 832 LEU A HD22 2  
ATOM 2265  H HD23 . LEU A 1 49  ? -5.143  -2.242  5.556   1.00 0.00 ? 832 LEU A HD23 2  
ATOM 2266  N N    . VAL A 1 50  ? -2.878  -7.035  6.277   1.00 0.00 ? 833 VAL A N    2  
ATOM 2267  C CA   . VAL A 1 50  ? -2.189  -8.271  6.631   1.00 0.00 ? 833 VAL A CA   2  
ATOM 2268  C C    . VAL A 1 50  ? -2.272  -8.536  8.130   1.00 0.00 ? 833 VAL A C    2  
ATOM 2269  O O    . VAL A 1 50  ? -1.460  -8.031  8.907   1.00 0.00 ? 833 VAL A O    2  
ATOM 2270  C CB   . VAL A 1 50  ? -0.708  -8.229  6.209   1.00 0.00 ? 833 VAL A CB   2  
ATOM 2271  C CG1  . VAL A 1 50  ? -0.109  -9.627  6.223   1.00 0.00 ? 833 VAL A CG1  2  
ATOM 2272  C CG2  . VAL A 1 50  ? -0.564  -7.592  4.835   1.00 0.00 ? 833 VAL A CG2  2  
ATOM 2273  H H    . VAL A 1 50  ? -2.365  -6.201  6.223   1.00 0.00 ? 833 VAL A H    2  
ATOM 2274  H HA   . VAL A 1 50  ? -2.669  -9.083  6.105   1.00 0.00 ? 833 VAL A HA   2  
ATOM 2275  H HB   . VAL A 1 50  ? -0.169  -7.623  6.922   1.00 0.00 ? 833 VAL A HB   2  
ATOM 2276  H HG11 . VAL A 1 50  ? 0.968   -9.556  6.208   1.00 0.00 ? 833 VAL A HG11 2  
ATOM 2277  H HG12 . VAL A 1 50  ? -0.424  -10.145 7.117   1.00 0.00 ? 833 VAL A HG12 2  
ATOM 2278  H HG13 . VAL A 1 50  ? -0.446  -10.172 5.354   1.00 0.00 ? 833 VAL A HG13 2  
ATOM 2279  H HG21 . VAL A 1 50  ? -1.275  -8.039  4.156   1.00 0.00 ? 833 VAL A HG21 2  
ATOM 2280  H HG22 . VAL A 1 50  ? -0.755  -6.531  4.908   1.00 0.00 ? 833 VAL A HG22 2  
ATOM 2281  H HG23 . VAL A 1 50  ? 0.438   -7.753  4.466   1.00 0.00 ? 833 VAL A HG23 2  
ATOM 2282  N N    . THR A 1 51  ? -3.258  -9.332  8.532   1.00 0.00 ? 834 THR A N    2  
ATOM 2283  C CA   . THR A 1 51  ? -3.448  -9.664  9.938   1.00 0.00 ? 834 THR A CA   2  
ATOM 2284  C C    . THR A 1 51  ? -2.772  -10.986 10.287  1.00 0.00 ? 834 THR A C    2  
ATOM 2285  O O    . THR A 1 51  ? -2.217  -11.658 9.418   1.00 0.00 ? 834 THR A O    2  
ATOM 2286  C CB   . THR A 1 51  ? -4.943  -9.755  10.297  1.00 0.00 ? 834 THR A CB   2  
ATOM 2287  O OG1  . THR A 1 51  ? -5.678  -10.306 9.199   1.00 0.00 ? 834 THR A OG1  2  
ATOM 2288  C CG2  . THR A 1 51  ? -5.499  -8.383  10.648  1.00 0.00 ? 834 THR A CG2  2  
ATOM 2289  H H    . THR A 1 51  ? -3.872  -9.703  7.865   1.00 0.00 ? 834 THR A H    2  
ATOM 2290  H HA   . THR A 1 51  ? -3.004  -8.877  10.530  1.00 0.00 ? 834 THR A HA   2  
ATOM 2291  H HB   . THR A 1 51  ? -5.053  -10.402 11.155  1.00 0.00 ? 834 THR A HB   2  
ATOM 2292  H HG1  . THR A 1 51  ? -5.130  -10.944 8.735   1.00 0.00 ? 834 THR A HG1  2  
ATOM 2293  H HG21 . THR A 1 51  ? -4.698  -7.749  10.999  1.00 0.00 ? 834 THR A HG21 2  
ATOM 2294  H HG22 . THR A 1 51  ? -6.244  -8.485  11.423  1.00 0.00 ? 834 THR A HG22 2  
ATOM 2295  H HG23 . THR A 1 51  ? -5.949  -7.942  9.772   1.00 0.00 ? 834 THR A HG23 2  
ATOM 2296  N N    . ASN A 1 52  ? -2.824  -11.353 11.563  1.00 0.00 ? 835 ASN A N    2  
ATOM 2297  C CA   . ASN A 1 52  ? -2.216  -12.595 12.026  1.00 0.00 ? 835 ASN A CA   2  
ATOM 2298  C C    . ASN A 1 52  ? -3.212  -13.748 11.952  1.00 0.00 ? 835 ASN A C    2  
ATOM 2299  O O    . ASN A 1 52  ? -4.392  -13.545 11.664  1.00 0.00 ? 835 ASN A O    2  
ATOM 2300  C CB   . ASN A 1 52  ? -1.710  -12.435 13.461  1.00 0.00 ? 835 ASN A CB   2  
ATOM 2301  C CG   . ASN A 1 52  ? -0.353  -11.761 13.524  1.00 0.00 ? 835 ASN A CG   2  
ATOM 2302  O OD1  . ASN A 1 52  ? 0.629   -12.265 12.980  1.00 0.00 ? 835 ASN A OD1  2  
ATOM 2303  N ND2  . ASN A 1 52  ? -0.293  -10.613 14.190  1.00 0.00 ? 835 ASN A ND2  2  
ATOM 2304  H H    . ASN A 1 52  ? -3.281  -10.774 12.209  1.00 0.00 ? 835 ASN A H    2  
ATOM 2305  H HA   . ASN A 1 52  ? -1.379  -12.815 11.381  1.00 0.00 ? 835 ASN A HA   2  
ATOM 2306  H HB2  . ASN A 1 52  ? -2.414  -11.836 14.020  1.00 0.00 ? 835 ASN A HB2  2  
ATOM 2307  H HB3  . ASN A 1 52  ? -1.629  -13.409 13.919  1.00 0.00 ? 835 ASN A HB3  2  
ATOM 2308  H HD21 . ASN A 1 52  ? -1.116  -10.271 14.598  1.00 0.00 ? 835 ASN A HD21 2  
ATOM 2309  H HD22 . ASN A 1 52  ? 0.572   -10.155 14.245  1.00 0.00 ? 835 ASN A HD22 2  
ATOM 2310  N N    . ARG A 1 53  ? -2.729  -14.958 12.214  1.00 0.00 ? 836 ARG A N    2  
ATOM 2311  C CA   . ARG A 1 53  ? -3.576  -16.144 12.176  1.00 0.00 ? 836 ARG A CA   2  
ATOM 2312  C C    . ARG A 1 53  ? -4.771  -15.988 13.113  1.00 0.00 ? 836 ARG A C    2  
ATOM 2313  O O    . ARG A 1 53  ? -5.820  -16.596 12.903  1.00 0.00 ? 836 ARG A O    2  
ATOM 2314  C CB   . ARG A 1 53  ? -2.770  -17.385 12.563  1.00 0.00 ? 836 ARG A CB   2  
ATOM 2315  C CG   . ARG A 1 53  ? -3.617  -18.637 12.721  1.00 0.00 ? 836 ARG A CG   2  
ATOM 2316  C CD   . ARG A 1 53  ? -3.986  -19.234 11.371  1.00 0.00 ? 836 ARG A CD   2  
ATOM 2317  N NE   . ARG A 1 53  ? -5.102  -18.528 10.747  1.00 0.00 ? 836 ARG A NE   2  
ATOM 2318  C CZ   . ARG A 1 53  ? -5.492  -18.732 9.494   1.00 0.00 ? 836 ARG A CZ   2  
ATOM 2319  N NH1  . ARG A 1 53  ? -4.858  -19.615 8.735   1.00 0.00 ? 836 ARG A NH1  2  
ATOM 2320  N NH2  . ARG A 1 53  ? -6.517  -18.051 8.997   1.00 0.00 ? 836 ARG A NH2  2  
ATOM 2321  H H    . ARG A 1 53  ? -1.780  -15.056 12.437  1.00 0.00 ? 836 ARG A H    2  
ATOM 2322  H HA   . ARG A 1 53  ? -3.938  -16.261 11.166  1.00 0.00 ? 836 ARG A HA   2  
ATOM 2323  H HB2  . ARG A 1 53  ? -2.030  -17.572 11.799  1.00 0.00 ? 836 ARG A HB2  2  
ATOM 2324  H HB3  . ARG A 1 53  ? -2.268  -17.196 13.500  1.00 0.00 ? 836 ARG A HB3  2  
ATOM 2325  H HG2  . ARG A 1 53  ? -3.060  -19.370 13.285  1.00 0.00 ? 836 ARG A HG2  2  
ATOM 2326  H HG3  . ARG A 1 53  ? -4.522  -18.383 13.252  1.00 0.00 ? 836 ARG A HG3  2  
ATOM 2327  H HD2  . ARG A 1 53  ? -3.127  -19.175 10.720  1.00 0.00 ? 836 ARG A HD2  2  
ATOM 2328  H HD3  . ARG A 1 53  ? -4.260  -20.268 11.513  1.00 0.00 ? 836 ARG A HD3  2  
ATOM 2329  H HE   . ARG A 1 53  ? -5.584  -17.871 11.291  1.00 0.00 ? 836 ARG A HE   2  
ATOM 2330  H HH11 . ARG A 1 53  ? -4.086  -20.130 9.106   1.00 0.00 ? 836 ARG A HH11 2  
ATOM 2331  H HH12 . ARG A 1 53  ? -5.154  -19.767 7.791   1.00 0.00 ? 836 ARG A HH12 2  
ATOM 2332  H HH21 . ARG A 1 53  ? -6.997  -17.384 9.567   1.00 0.00 ? 836 ARG A HH21 2  
ATOM 2333  H HH22 . ARG A 1 53  ? -6.809  -18.205 8.054   1.00 0.00 ? 836 ARG A HH22 2  
ATOM 2334  N N    . ALA A 1 54  ? -4.604  -15.170 14.146  1.00 0.00 ? 837 ALA A N    2  
ATOM 2335  C CA   . ALA A 1 54  ? -5.668  -14.934 15.114  1.00 0.00 ? 837 ALA A CA   2  
ATOM 2336  C C    . ALA A 1 54  ? -6.503  -13.718 14.725  1.00 0.00 ? 837 ALA A C    2  
ATOM 2337  O O    . ALA A 1 54  ? -7.590  -13.503 15.259  1.00 0.00 ? 837 ALA A O    2  
ATOM 2338  C CB   . ALA A 1 54  ? -5.084  -14.751 16.507  1.00 0.00 ? 837 ALA A CB   2  
ATOM 2339  H H    . ALA A 1 54  ? -3.744  -14.714 14.260  1.00 0.00 ? 837 ALA A H    2  
ATOM 2340  H HA   . ALA A 1 54  ? -6.305  -15.806 15.129  1.00 0.00 ? 837 ALA A HA   2  
ATOM 2341  H HB1  . ALA A 1 54  ? -5.252  -13.736 16.837  1.00 0.00 ? 837 ALA A HB1  2  
ATOM 2342  H HB2  . ALA A 1 54  ? -5.563  -15.436 17.190  1.00 0.00 ? 837 ALA A HB2  2  
ATOM 2343  H HB3  . ALA A 1 54  ? -4.023  -14.950 16.481  1.00 0.00 ? 837 ALA A HB3  2  
ATOM 2344  N N    . GLY A 1 55  ? -5.987  -12.926 13.790  1.00 0.00 ? 838 GLY A N    2  
ATOM 2345  C CA   . GLY A 1 55  ? -6.698  -11.741 13.346  1.00 0.00 ? 838 GLY A CA   2  
ATOM 2346  C C    . GLY A 1 55  ? -6.084  -10.462 13.880  1.00 0.00 ? 838 GLY A C    2  
ATOM 2347  O O    . GLY A 1 55  ? -6.621  -9.373  13.673  1.00 0.00 ? 838 GLY A O    2  
ATOM 2348  H H    . GLY A 1 55  ? -5.116  -13.147 13.399  1.00 0.00 ? 838 GLY A H    2  
ATOM 2349  H HA2  . GLY A 1 55  ? -6.687  -11.711 12.267  1.00 0.00 ? 838 GLY A HA2  2  
ATOM 2350  H HA3  . GLY A 1 55  ? -7.723  -11.803 13.684  1.00 0.00 ? 838 GLY A HA3  2  
ATOM 2351  N N    . LYS A 1 56  ? -4.956  -10.593 14.570  1.00 0.00 ? 839 LYS A N    2  
ATOM 2352  C CA   . LYS A 1 56  ? -4.267  -9.439  15.135  1.00 0.00 ? 839 LYS A CA   2  
ATOM 2353  C C    . LYS A 1 56  ? -3.502  -8.679  14.057  1.00 0.00 ? 839 LYS A C    2  
ATOM 2354  O O    . LYS A 1 56  ? -2.942  -9.265  13.130  1.00 0.00 ? 839 LYS A O    2  
ATOM 2355  C CB   . LYS A 1 56  ? -3.306  -9.884  16.240  1.00 0.00 ? 839 LYS A CB   2  
ATOM 2356  C CG   . LYS A 1 56  ? -4.007  -10.418 17.477  1.00 0.00 ? 839 LYS A CG   2  
ATOM 2357  C CD   . LYS A 1 56  ? -4.309  -9.309  18.470  1.00 0.00 ? 839 LYS A CD   2  
ATOM 2358  C CE   . LYS A 1 56  ? -3.055  -8.860  19.203  1.00 0.00 ? 839 LYS A CE   2  
ATOM 2359  N NZ   . LYS A 1 56  ? -3.369  -8.297  20.546  1.00 0.00 ? 839 LYS A NZ   2  
ATOM 2360  H H    . LYS A 1 56  ? -4.577  -11.487 14.701  1.00 0.00 ? 839 LYS A H    2  
ATOM 2361  H HA   . LYS A 1 56  ? -5.012  -8.783  15.561  1.00 0.00 ? 839 LYS A HA   2  
ATOM 2362  H HB2  . LYS A 1 56  ? -2.665  -10.661 15.851  1.00 0.00 ? 839 LYS A HB2  2  
ATOM 2363  H HB3  . LYS A 1 56  ? -2.698  -9.040  16.533  1.00 0.00 ? 839 LYS A HB3  2  
ATOM 2364  H HG2  . LYS A 1 56  ? -4.935  -10.885 17.181  1.00 0.00 ? 839 LYS A HG2  2  
ATOM 2365  H HG3  . LYS A 1 56  ? -3.370  -11.151 17.952  1.00 0.00 ? 839 LYS A HG3  2  
ATOM 2366  H HD2  . LYS A 1 56  ? -4.723  -8.465  17.938  1.00 0.00 ? 839 LYS A HD2  2  
ATOM 2367  H HD3  . LYS A 1 56  ? -5.028  -9.670  19.192  1.00 0.00 ? 839 LYS A HD3  2  
ATOM 2368  H HE2  . LYS A 1 56  ? -2.400  -9.709  19.323  1.00 0.00 ? 839 LYS A HE2  2  
ATOM 2369  H HE3  . LYS A 1 56  ? -2.559  -8.104  18.612  1.00 0.00 ? 839 LYS A HE3  2  
ATOM 2370  H HZ1  . LYS A 1 56  ? -3.177  -7.275  20.558  1.00 0.00 ? 839 LYS A HZ1  2  
ATOM 2371  H HZ2  . LYS A 1 56  ? -2.784  -8.757  21.272  1.00 0.00 ? 839 LYS A HZ2  2  
ATOM 2372  H HZ3  . LYS A 1 56  ? -4.371  -8.453  20.774  1.00 0.00 ? 839 LYS A HZ3  2  
ATOM 2373  N N    . PRO A 1 57  ? -3.474  -7.344  14.179  1.00 0.00 ? 840 PRO A N    2  
ATOM 2374  C CA   . PRO A 1 57  ? -2.778  -6.476  13.224  1.00 0.00 ? 840 PRO A CA   2  
ATOM 2375  C C    . PRO A 1 57  ? -1.262  -6.613  13.313  1.00 0.00 ? 840 PRO A C    2  
ATOM 2376  O O    . PRO A 1 57  ? -0.696  -6.660  14.405  1.00 0.00 ? 840 PRO A O    2  
ATOM 2377  C CB   . PRO A 1 57  ? -3.213  -5.069  13.641  1.00 0.00 ? 840 PRO A CB   2  
ATOM 2378  C CG   . PRO A 1 57  ? -3.561  -5.192  15.085  1.00 0.00 ? 840 PRO A CG   2  
ATOM 2379  C CD   . PRO A 1 57  ? -4.119  -6.578  15.258  1.00 0.00 ? 840 PRO A CD   2  
ATOM 2380  H HA   . PRO A 1 57  ? -3.097  -6.666  12.209  1.00 0.00 ? 840 PRO A HA   2  
ATOM 2381  H HB2  . PRO A 1 57  ? -2.397  -4.377  13.489  1.00 0.00 ? 840 PRO A HB2  2  
ATOM 2382  H HB3  . PRO A 1 57  ? -4.066  -4.762  13.055  1.00 0.00 ? 840 PRO A HB3  2  
ATOM 2383  H HG2  . PRO A 1 57  ? -2.676  -5.066  15.688  1.00 0.00 ? 840 PRO A HG2  2  
ATOM 2384  H HG3  . PRO A 1 57  ? -4.305  -4.454  15.347  1.00 0.00 ? 840 PRO A HG3  2  
ATOM 2385  H HD2  . PRO A 1 57  ? -3.850  -6.974  16.226  1.00 0.00 ? 840 PRO A HD2  2  
ATOM 2386  H HD3  . PRO A 1 57  ? -5.193  -6.571  15.137  1.00 0.00 ? 840 PRO A HD3  2  
ATOM 2387  N N    . LYS A 1 58  ? -0.610  -6.677  12.158  1.00 0.00 ? 841 LYS A N    2  
ATOM 2388  C CA   . LYS A 1 58  ? 0.842   -6.808  12.104  1.00 0.00 ? 841 LYS A CA   2  
ATOM 2389  C C    . LYS A 1 58  ? 1.492   -5.490  11.694  1.00 0.00 ? 841 LYS A C    2  
ATOM 2390  O O    . LYS A 1 58  ? 2.701   -5.312  11.837  1.00 0.00 ? 841 LYS A O    2  
ATOM 2391  C CB   . LYS A 1 58  ? 1.239   -7.912  11.123  1.00 0.00 ? 841 LYS A CB   2  
ATOM 2392  C CG   . LYS A 1 58  ? 0.646   -9.269  11.461  1.00 0.00 ? 841 LYS A CG   2  
ATOM 2393  C CD   . LYS A 1 58  ? 0.493   -10.135 10.221  1.00 0.00 ? 841 LYS A CD   2  
ATOM 2394  C CE   . LYS A 1 58  ? 1.836   -10.665 9.742   1.00 0.00 ? 841 LYS A CE   2  
ATOM 2395  N NZ   . LYS A 1 58  ? 2.659   -9.598  9.108   1.00 0.00 ? 841 LYS A NZ   2  
ATOM 2396  H H    . LYS A 1 58  ? -1.117  -6.635  11.319  1.00 0.00 ? 841 LYS A H    2  
ATOM 2397  H HA   . LYS A 1 58  ? 1.187   -7.074  13.092  1.00 0.00 ? 841 LYS A HA   2  
ATOM 2398  H HB2  . LYS A 1 58  ? 0.908   -7.634  10.133  1.00 0.00 ? 841 LYS A HB2  2  
ATOM 2399  H HB3  . LYS A 1 58  ? 2.316   -8.004  11.120  1.00 0.00 ? 841 LYS A HB3  2  
ATOM 2400  H HG2  . LYS A 1 58  ? 1.297   -9.772  12.160  1.00 0.00 ? 841 LYS A HG2  2  
ATOM 2401  H HG3  . LYS A 1 58  ? -0.326  -9.125  11.910  1.00 0.00 ? 841 LYS A HG3  2  
ATOM 2402  H HD2  . LYS A 1 58  ? -0.149  -10.972 10.454  1.00 0.00 ? 841 LYS A HD2  2  
ATOM 2403  H HD3  . LYS A 1 58  ? 0.047   -9.545  9.433   1.00 0.00 ? 841 LYS A HD3  2  
ATOM 2404  H HE2  . LYS A 1 58  ? 2.372   -11.066 10.589  1.00 0.00 ? 841 LYS A HE2  2  
ATOM 2405  H HE3  . LYS A 1 58  ? 1.662   -11.450 9.022   1.00 0.00 ? 841 LYS A HE3  2  
ATOM 2406  H HZ1  . LYS A 1 58  ? 3.319   -10.017 8.422   1.00 0.00 ? 841 LYS A HZ1  2  
ATOM 2407  H HZ2  . LYS A 1 58  ? 3.206   -9.091  9.832   1.00 0.00 ? 841 LYS A HZ2  2  
ATOM 2408  H HZ3  . LYS A 1 58  ? 2.046   -8.920  8.613   1.00 0.00 ? 841 LYS A HZ3  2  
ATOM 2409  N N    . GLY A 1 59  ? 0.680   -4.568  11.186  1.00 0.00 ? 842 GLY A N    2  
ATOM 2410  C CA   . GLY A 1 59  ? 1.195   -3.278  10.764  1.00 0.00 ? 842 GLY A CA   2  
ATOM 2411  C C    . GLY A 1 59  ? 1.254   -3.142  9.256   1.00 0.00 ? 842 GLY A C    2  
ATOM 2412  O O    . GLY A 1 59  ? 1.234   -2.031  8.724   1.00 0.00 ? 842 GLY A O    2  
ATOM 2413  H H    . GLY A 1 59  ? -0.276  -4.765  11.096  1.00 0.00 ? 842 GLY A H    2  
ATOM 2414  H HA2  . GLY A 1 59  ? 0.557   -2.502  11.161  1.00 0.00 ? 842 GLY A HA2  2  
ATOM 2415  H HA3  . GLY A 1 59  ? 2.190   -3.152  11.165  1.00 0.00 ? 842 GLY A HA3  2  
ATOM 2416  N N    . LEU A 1 60  ? 1.329   -4.273  8.564   1.00 0.00 ? 843 LEU A N    2  
ATOM 2417  C CA   . LEU A 1 60  ? 1.393   -4.276  7.107   1.00 0.00 ? 843 LEU A CA   2  
ATOM 2418  C C    . LEU A 1 60  ? -0.002  -4.170  6.500   1.00 0.00 ? 843 LEU A C    2  
ATOM 2419  O O    . LEU A 1 60  ? -0.894  -4.951  6.830   1.00 0.00 ? 843 LEU A O    2  
ATOM 2420  C CB   . LEU A 1 60  ? 2.082   -5.548  6.609   1.00 0.00 ? 843 LEU A CB   2  
ATOM 2421  C CG   . LEU A 1 60  ? 3.354   -5.958  7.354   1.00 0.00 ? 843 LEU A CG   2  
ATOM 2422  C CD1  . LEU A 1 60  ? 3.937   -7.228  6.756   1.00 0.00 ? 843 LEU A CD1  2  
ATOM 2423  C CD2  . LEU A 1 60  ? 4.377   -4.832  7.321   1.00 0.00 ? 843 LEU A CD2  2  
ATOM 2424  H H    . LEU A 1 60  ? 1.341   -5.128  9.043   1.00 0.00 ? 843 LEU A H    2  
ATOM 2425  H HA   . LEU A 1 60  ? 1.973   -3.419  6.799   1.00 0.00 ? 843 LEU A HA   2  
ATOM 2426  H HB2  . LEU A 1 60  ? 1.376   -6.360  6.690   1.00 0.00 ? 843 LEU A HB2  2  
ATOM 2427  H HB3  . LEU A 1 60  ? 2.340   -5.399  5.570   1.00 0.00 ? 843 LEU A HB3  2  
ATOM 2428  H HG   . LEU A 1 60  ? 3.109   -6.158  8.388   1.00 0.00 ? 843 LEU A HG   2  
ATOM 2429  H HD11 . LEU A 1 60  ? 3.955   -8.004  7.506   1.00 0.00 ? 843 LEU A HD11 2  
ATOM 2430  H HD12 . LEU A 1 60  ? 4.943   -7.036  6.413   1.00 0.00 ? 843 LEU A HD12 2  
ATOM 2431  H HD13 . LEU A 1 60  ? 3.328   -7.546  5.922   1.00 0.00 ? 843 LEU A HD13 2  
ATOM 2432  H HD21 . LEU A 1 60  ? 3.961   -3.954  7.794   1.00 0.00 ? 843 LEU A HD21 2  
ATOM 2433  H HD22 . LEU A 1 60  ? 4.628   -4.603  6.295   1.00 0.00 ? 843 LEU A HD22 2  
ATOM 2434  H HD23 . LEU A 1 60  ? 5.267   -5.139  7.851   1.00 0.00 ? 843 LEU A HD23 2  
ATOM 2435  N N    . ALA A 1 61  ? -0.182  -3.200  5.609   1.00 0.00 ? 844 ALA A N    2  
ATOM 2436  C CA   . ALA A 1 61  ? -1.468  -2.995  4.953   1.00 0.00 ? 844 ALA A CA   2  
ATOM 2437  C C    . ALA A 1 61  ? -1.283  -2.671  3.474   1.00 0.00 ? 844 ALA A C    2  
ATOM 2438  O O    . ALA A 1 61  ? -0.403  -1.895  3.104   1.00 0.00 ? 844 ALA A O    2  
ATOM 2439  C CB   . ALA A 1 61  ? -2.243  -1.884  5.646   1.00 0.00 ? 844 ALA A CB   2  
ATOM 2440  H H    . ALA A 1 61  ? 0.567   -2.610  5.387   1.00 0.00 ? 844 ALA A H    2  
ATOM 2441  H HA   . ALA A 1 61  ? -2.038  -3.909  5.043   1.00 0.00 ? 844 ALA A HA   2  
ATOM 2442  H HB1  . ALA A 1 61  ? -1.711  -0.951  5.532   1.00 0.00 ? 844 ALA A HB1  2  
ATOM 2443  H HB2  . ALA A 1 61  ? -3.222  -1.797  5.201   1.00 0.00 ? 844 ALA A HB2  2  
ATOM 2444  H HB3  . ALA A 1 61  ? -2.343  -2.116  6.696   1.00 0.00 ? 844 ALA A HB3  2  
ATOM 2445  N N    . TYR A 1 62  ? -2.118  -3.272  2.633   1.00 0.00 ? 845 TYR A N    2  
ATOM 2446  C CA   . TYR A 1 62  ? -2.045  -3.049  1.194   1.00 0.00 ? 845 TYR A CA   2  
ATOM 2447  C C    . TYR A 1 62  ? -3.227  -2.215  0.711   1.00 0.00 ? 845 TYR A C    2  
ATOM 2448  O O    . TYR A 1 62  ? -4.349  -2.366  1.196   1.00 0.00 ? 845 TYR A O    2  
ATOM 2449  C CB   . TYR A 1 62  ? -2.013  -4.386  0.452   1.00 0.00 ? 845 TYR A CB   2  
ATOM 2450  C CG   . TYR A 1 62  ? -0.617  -4.925  0.235   1.00 0.00 ? 845 TYR A CG   2  
ATOM 2451  C CD1  . TYR A 1 62  ? 0.088   -5.520  1.274   1.00 0.00 ? 845 TYR A CD1  2  
ATOM 2452  C CD2  . TYR A 1 62  ? -0.004  -4.841  -1.009  1.00 0.00 ? 845 TYR A CD2  2  
ATOM 2453  C CE1  . TYR A 1 62  ? 1.364   -6.013  1.080   1.00 0.00 ? 845 TYR A CE1  2  
ATOM 2454  C CE2  . TYR A 1 62  ? 1.271   -5.333  -1.212  1.00 0.00 ? 845 TYR A CE2  2  
ATOM 2455  C CZ   . TYR A 1 62  ? 1.951   -5.917  -0.164  1.00 0.00 ? 845 TYR A CZ   2  
ATOM 2456  O OH   . TYR A 1 62  ? 3.221   -6.408  -0.361  1.00 0.00 ? 845 TYR A OH   2  
ATOM 2457  H H    . TYR A 1 62  ? -2.799  -3.880  2.989   1.00 0.00 ? 845 TYR A H    2  
ATOM 2458  H HA   . TYR A 1 62  ? -1.131  -2.512  0.988   1.00 0.00 ? 845 TYR A HA   2  
ATOM 2459  H HB2  . TYR A 1 62  ? -2.567  -5.119  1.019   1.00 0.00 ? 845 TYR A HB2  2  
ATOM 2460  H HB3  . TYR A 1 62  ? -2.476  -4.263  -0.517  1.00 0.00 ? 845 TYR A HB3  2  
ATOM 2461  H HD1  . TYR A 1 62  ? -0.375  -5.594  2.247   1.00 0.00 ? 845 TYR A HD1  2  
ATOM 2462  H HD2  . TYR A 1 62  ? -0.540  -4.382  -1.828  1.00 0.00 ? 845 TYR A HD2  2  
ATOM 2463  H HE1  . TYR A 1 62  ? 1.897   -6.471  1.901   1.00 0.00 ? 845 TYR A HE1  2  
ATOM 2464  H HE2  . TYR A 1 62  ? 1.731   -5.258  -2.186  1.00 0.00 ? 845 TYR A HE2  2  
ATOM 2465  H HH   . TYR A 1 62  ? 3.835   -5.677  -0.461  1.00 0.00 ? 845 TYR A HH   2  
ATOM 2466  N N    . VAL A 1 63  ? -2.967  -1.333  -0.249  1.00 0.00 ? 846 VAL A N    2  
ATOM 2467  C CA   . VAL A 1 63  ? -4.009  -0.474  -0.801  1.00 0.00 ? 846 VAL A CA   2  
ATOM 2468  C C    . VAL A 1 63  ? -4.108  -0.634  -2.313  1.00 0.00 ? 846 VAL A C    2  
ATOM 2469  O O    . VAL A 1 63  ? -3.122  -0.946  -2.980  1.00 0.00 ? 846 VAL A O    2  
ATOM 2470  C CB   . VAL A 1 63  ? -3.750  1.007   -0.467  1.00 0.00 ? 846 VAL A CB   2  
ATOM 2471  C CG1  . VAL A 1 63  ? -4.905  1.872   -0.946  1.00 0.00 ? 846 VAL A CG1  2  
ATOM 2472  C CG2  . VAL A 1 63  ? -3.523  1.185   1.026   1.00 0.00 ? 846 VAL A CG2  2  
ATOM 2473  H H    . VAL A 1 63  ? -2.054  -1.259  -0.595  1.00 0.00 ? 846 VAL A H    2  
ATOM 2474  H HA   . VAL A 1 63  ? -4.950  -0.762  -0.355  1.00 0.00 ? 846 VAL A HA   2  
ATOM 2475  H HB   . VAL A 1 63  ? -2.855  1.321   -0.986  1.00 0.00 ? 846 VAL A HB   2  
ATOM 2476  H HG11 . VAL A 1 63  ? -5.834  1.337   -0.813  1.00 0.00 ? 846 VAL A HG11 2  
ATOM 2477  H HG12 . VAL A 1 63  ? -4.931  2.788   -0.375  1.00 0.00 ? 846 VAL A HG12 2  
ATOM 2478  H HG13 . VAL A 1 63  ? -4.771  2.104   -1.993  1.00 0.00 ? 846 VAL A HG13 2  
ATOM 2479  H HG21 . VAL A 1 63  ? -4.020  0.390   1.562   1.00 0.00 ? 846 VAL A HG21 2  
ATOM 2480  H HG22 . VAL A 1 63  ? -2.464  1.153   1.237   1.00 0.00 ? 846 VAL A HG22 2  
ATOM 2481  H HG23 . VAL A 1 63  ? -3.923  2.137   1.341   1.00 0.00 ? 846 VAL A HG23 2  
ATOM 2482  N N    . GLU A 1 64  ? -5.306  -0.416  -2.849  1.00 0.00 ? 847 GLU A N    2  
ATOM 2483  C CA   . GLU A 1 64  ? -5.533  -0.537  -4.284  1.00 0.00 ? 847 GLU A CA   2  
ATOM 2484  C C    . GLU A 1 64  ? -6.325  0.657   -4.811  1.00 0.00 ? 847 GLU A C    2  
ATOM 2485  O O    . GLU A 1 64  ? -7.514  0.802   -4.525  1.00 0.00 ? 847 GLU A O    2  
ATOM 2486  C CB   . GLU A 1 64  ? -6.278  -1.836  -4.598  1.00 0.00 ? 847 GLU A CB   2  
ATOM 2487  C CG   . GLU A 1 64  ? -6.044  -2.346  -6.009  1.00 0.00 ? 847 GLU A CG   2  
ATOM 2488  C CD   . GLU A 1 64  ? -7.128  -3.300  -6.472  1.00 0.00 ? 847 GLU A CD   2  
ATOM 2489  O OE1  . GLU A 1 64  ? -7.060  -4.494  -6.114  1.00 0.00 ? 847 GLU A OE1  2  
ATOM 2490  O OE2  . GLU A 1 64  ? -8.044  -2.852  -7.193  1.00 0.00 ? 847 GLU A OE2  2  
ATOM 2491  H H    . GLU A 1 64  ? -6.053  -0.170  -2.265  1.00 0.00 ? 847 GLU A H    2  
ATOM 2492  H HA   . GLU A 1 64  ? -4.571  -0.558  -4.772  1.00 0.00 ? 847 GLU A HA   2  
ATOM 2493  H HB2  . GLU A 1 64  ? -5.957  -2.598  -3.903  1.00 0.00 ? 847 GLU A HB2  2  
ATOM 2494  H HB3  . GLU A 1 64  ? -7.338  -1.668  -4.469  1.00 0.00 ? 847 GLU A HB3  2  
ATOM 2495  H HG2  . GLU A 1 64  ? -6.015  -1.503  -6.683  1.00 0.00 ? 847 GLU A HG2  2  
ATOM 2496  H HG3  . GLU A 1 64  ? -5.095  -2.861  -6.039  1.00 0.00 ? 847 GLU A HG3  2  
ATOM 2497  N N    . TYR A 1 65  ? -5.658  1.508   -5.581  1.00 0.00 ? 848 TYR A N    2  
ATOM 2498  C CA   . TYR A 1 65  ? -6.297  2.691   -6.146  1.00 0.00 ? 848 TYR A CA   2  
ATOM 2499  C C    . TYR A 1 65  ? -6.766  2.427   -7.574  1.00 0.00 ? 848 TYR A C    2  
ATOM 2500  O O    . TYR A 1 65  ? -6.592  1.329   -8.102  1.00 0.00 ? 848 TYR A O    2  
ATOM 2501  C CB   . TYR A 1 65  ? -5.332  3.877   -6.126  1.00 0.00 ? 848 TYR A CB   2  
ATOM 2502  C CG   . TYR A 1 65  ? -5.315  4.621   -4.809  1.00 0.00 ? 848 TYR A CG   2  
ATOM 2503  C CD1  . TYR A 1 65  ? -4.668  4.093   -3.699  1.00 0.00 ? 848 TYR A CD1  2  
ATOM 2504  C CD2  . TYR A 1 65  ? -5.946  5.852   -4.676  1.00 0.00 ? 848 TYR A CD2  2  
ATOM 2505  C CE1  . TYR A 1 65  ? -4.651  4.769   -2.494  1.00 0.00 ? 848 TYR A CE1  2  
ATOM 2506  C CE2  . TYR A 1 65  ? -5.932  6.535   -3.476  1.00 0.00 ? 848 TYR A CE2  2  
ATOM 2507  C CZ   . TYR A 1 65  ? -5.284  5.990   -2.388  1.00 0.00 ? 848 TYR A CZ   2  
ATOM 2508  O OH   . TYR A 1 65  ? -5.269  6.667   -1.190  1.00 0.00 ? 848 TYR A OH   2  
ATOM 2509  H H    . TYR A 1 65  ? -4.712  1.339   -5.774  1.00 0.00 ? 848 TYR A H    2  
ATOM 2510  H HA   . TYR A 1 65  ? -7.156  2.927   -5.535  1.00 0.00 ? 848 TYR A HA   2  
ATOM 2511  H HB2  . TYR A 1 65  ? -4.331  3.522   -6.318  1.00 0.00 ? 848 TYR A HB2  2  
ATOM 2512  H HB3  . TYR A 1 65  ? -5.615  4.576   -6.899  1.00 0.00 ? 848 TYR A HB3  2  
ATOM 2513  H HD1  . TYR A 1 65  ? -4.173  3.136   -3.785  1.00 0.00 ? 848 TYR A HD1  2  
ATOM 2514  H HD2  . TYR A 1 65  ? -6.454  6.276   -5.530  1.00 0.00 ? 848 TYR A HD2  2  
ATOM 2515  H HE1  . TYR A 1 65  ? -4.143  4.342   -1.642  1.00 0.00 ? 848 TYR A HE1  2  
ATOM 2516  H HE2  . TYR A 1 65  ? -6.428  7.491   -3.392  1.00 0.00 ? 848 TYR A HE2  2  
ATOM 2517  H HH   . TYR A 1 65  ? -4.484  7.218   -1.144  1.00 0.00 ? 848 TYR A HH   2  
ATOM 2518  N N    . GLU A 1 66  ? -7.361  3.443   -8.192  1.00 0.00 ? 849 GLU A N    2  
ATOM 2519  C CA   . GLU A 1 66  ? -7.855  3.321   -9.558  1.00 0.00 ? 849 GLU A CA   2  
ATOM 2520  C C    . GLU A 1 66  ? -6.771  3.696   -10.564 1.00 0.00 ? 849 GLU A C    2  
ATOM 2521  O O    . GLU A 1 66  ? -6.529  2.974   -11.530 1.00 0.00 ? 849 GLU A O    2  
ATOM 2522  C CB   . GLU A 1 66  ? -9.084  4.210   -9.760  1.00 0.00 ? 849 GLU A CB   2  
ATOM 2523  C CG   . GLU A 1 66  ? -9.715  4.073   -11.136 1.00 0.00 ? 849 GLU A CG   2  
ATOM 2524  C CD   . GLU A 1 66  ? -8.825  4.606   -12.242 1.00 0.00 ? 849 GLU A CD   2  
ATOM 2525  O OE1  . GLU A 1 66  ? -8.311  5.735   -12.097 1.00 0.00 ? 849 GLU A OE1  2  
ATOM 2526  O OE2  . GLU A 1 66  ? -8.642  3.894   -13.252 1.00 0.00 ? 849 GLU A OE2  2  
ATOM 2527  H H    . GLU A 1 66  ? -7.470  4.293   -7.717  1.00 0.00 ? 849 GLU A H    2  
ATOM 2528  H HA   . GLU A 1 66  ? -8.137  2.292   -9.718  1.00 0.00 ? 849 GLU A HA   2  
ATOM 2529  H HB2  . GLU A 1 66  ? -9.826  3.952   -9.019  1.00 0.00 ? 849 GLU A HB2  2  
ATOM 2530  H HB3  . GLU A 1 66  ? -8.794  5.241   -9.622  1.00 0.00 ? 849 GLU A HB3  2  
ATOM 2531  H HG2  . GLU A 1 66  ? -9.911  3.028   -11.325 1.00 0.00 ? 849 GLU A HG2  2  
ATOM 2532  H HG3  . GLU A 1 66  ? -10.646 4.620   -11.147 1.00 0.00 ? 849 GLU A HG3  2  
ATOM 2533  N N    . ASN A 1 67  ? -6.122  4.832   -10.330 1.00 0.00 ? 850 ASN A N    2  
ATOM 2534  C CA   . ASN A 1 67  ? -5.064  5.305   -11.216 1.00 0.00 ? 850 ASN A CA   2  
ATOM 2535  C C    . ASN A 1 67  ? -3.698  5.179   -10.548 1.00 0.00 ? 850 ASN A C    2  
ATOM 2536  O O    . ASN A 1 67  ? -3.605  4.997   -9.334  1.00 0.00 ? 850 ASN A O    2  
ATOM 2537  C CB   . ASN A 1 67  ? -5.317  6.760   -11.615 1.00 0.00 ? 850 ASN A CB   2  
ATOM 2538  C CG   . ASN A 1 67  ? -4.506  7.177   -12.827 1.00 0.00 ? 850 ASN A CG   2  
ATOM 2539  O OD1  . ASN A 1 67  ? -4.003  6.335   -13.570 1.00 0.00 ? 850 ASN A OD1  2  
ATOM 2540  N ND2  . ASN A 1 67  ? -4.375  8.483   -13.030 1.00 0.00 ? 850 ASN A ND2  2  
ATOM 2541  H H    . ASN A 1 67  ? -6.360  5.366   -9.543  1.00 0.00 ? 850 ASN A H    2  
ATOM 2542  H HA   . ASN A 1 67  ? -5.076  4.691   -12.103 1.00 0.00 ? 850 ASN A HA   2  
ATOM 2543  H HB2  . ASN A 1 67  ? -6.365  6.887   -11.847 1.00 0.00 ? 850 ASN A HB2  2  
ATOM 2544  H HB3  . ASN A 1 67  ? -5.055  7.405   -10.789 1.00 0.00 ? 850 ASN A HB3  2  
ATOM 2545  H HD21 . ASN A 1 67  ? -4.804  9.096   -12.397 1.00 0.00 ? 850 ASN A HD21 2  
ATOM 2546  H HD22 . ASN A 1 67  ? -3.857  8.780   -13.807 1.00 0.00 ? 850 ASN A HD22 2  
ATOM 2547  N N    . GLU A 1 68  ? -2.642  5.279   -11.349 1.00 0.00 ? 851 GLU A N    2  
ATOM 2548  C CA   . GLU A 1 68  ? -1.282  5.176   -10.835 1.00 0.00 ? 851 GLU A CA   2  
ATOM 2549  C C    . GLU A 1 68  ? -0.856  6.476   -10.160 1.00 0.00 ? 851 GLU A C    2  
ATOM 2550  O O    . GLU A 1 68  ? -0.284  6.464   -9.070  1.00 0.00 ? 851 GLU A O    2  
ATOM 2551  C CB   . GLU A 1 68  ? -0.310  4.833   -11.966 1.00 0.00 ? 851 GLU A CB   2  
ATOM 2552  C CG   . GLU A 1 68  ? -0.595  3.497   -12.630 1.00 0.00 ? 851 GLU A CG   2  
ATOM 2553  C CD   . GLU A 1 68  ? 0.097   3.352   -13.971 1.00 0.00 ? 851 GLU A CD   2  
ATOM 2554  O OE1  . GLU A 1 68  ? -0.349  3.996   -14.943 1.00 0.00 ? 851 GLU A OE1  2  
ATOM 2555  O OE2  . GLU A 1 68  ? 1.087   2.593   -14.048 1.00 0.00 ? 851 GLU A OE2  2  
ATOM 2556  H H    . GLU A 1 68  ? -2.782  5.424   -12.308 1.00 0.00 ? 851 GLU A H    2  
ATOM 2557  H HA   . GLU A 1 68  ? -1.263  4.382   -10.104 1.00 0.00 ? 851 GLU A HA   2  
ATOM 2558  H HB2  . GLU A 1 68  ? -0.366  5.606   -12.719 1.00 0.00 ? 851 GLU A HB2  2  
ATOM 2559  H HB3  . GLU A 1 68  ? 0.693   4.806   -11.566 1.00 0.00 ? 851 GLU A HB3  2  
ATOM 2560  H HG2  . GLU A 1 68  ? -0.254  2.706   -11.979 1.00 0.00 ? 851 GLU A HG2  2  
ATOM 2561  H HG3  . GLU A 1 68  ? -1.661  3.404   -12.779 1.00 0.00 ? 851 GLU A HG3  2  
ATOM 2562  N N    . SER A 1 69  ? -1.138  7.597   -10.816 1.00 0.00 ? 852 SER A N    2  
ATOM 2563  C CA   . SER A 1 69  ? -0.780  8.906   -10.282 1.00 0.00 ? 852 SER A CA   2  
ATOM 2564  C C    . SER A 1 69  ? -1.295  9.070   -8.856  1.00 0.00 ? 852 SER A C    2  
ATOM 2565  O O    . SER A 1 69  ? -0.536  9.400   -7.945  1.00 0.00 ? 852 SER A O    2  
ATOM 2566  C CB   . SER A 1 69  ? -1.346  10.015  -11.172 1.00 0.00 ? 852 SER A CB   2  
ATOM 2567  O OG   . SER A 1 69  ? -1.070  11.295  -10.630 1.00 0.00 ? 852 SER A OG   2  
ATOM 2568  H H    . SER A 1 69  ? -1.595  7.542   -11.681 1.00 0.00 ? 852 SER A H    2  
ATOM 2569  H HA   . SER A 1 69  ? 0.297   8.978   -10.274 1.00 0.00 ? 852 SER A HA   2  
ATOM 2570  H HB2  . SER A 1 69  ? -0.901  9.949   -12.153 1.00 0.00 ? 852 SER A HB2  2  
ATOM 2571  H HB3  . SER A 1 69  ? -2.417  9.895   -11.254 1.00 0.00 ? 852 SER A HB3  2  
ATOM 2572  H HG   . SER A 1 69  ? -0.234  11.269  -10.158 1.00 0.00 ? 852 SER A HG   2  
ATOM 2573  N N    . GLN A 1 70  ? -2.591  8.838   -8.671  1.00 0.00 ? 853 GLN A N    2  
ATOM 2574  C CA   . GLN A 1 70  ? -3.208  8.961   -7.355  1.00 0.00 ? 853 GLN A CA   2  
ATOM 2575  C C    . GLN A 1 70  ? -2.414  8.189   -6.307  1.00 0.00 ? 853 GLN A C    2  
ATOM 2576  O O    . GLN A 1 70  ? -2.077  8.725   -5.251  1.00 0.00 ? 853 GLN A O    2  
ATOM 2577  C CB   . GLN A 1 70  ? -4.650  8.453   -7.396  1.00 0.00 ? 853 GLN A CB   2  
ATOM 2578  C CG   . GLN A 1 70  ? -5.615  9.411   -8.075  1.00 0.00 ? 853 GLN A CG   2  
ATOM 2579  C CD   . GLN A 1 70  ? -7.055  8.944   -7.996  1.00 0.00 ? 853 GLN A CD   2  
ATOM 2580  O OE1  . GLN A 1 70  ? -7.891  9.579   -7.353  1.00 0.00 ? 853 GLN A OE1  2  
ATOM 2581  N NE2  . GLN A 1 70  ? -7.352  7.829   -8.652  1.00 0.00 ? 853 GLN A NE2  2  
ATOM 2582  H H    . GLN A 1 70  ? -3.144  8.579   -9.436  1.00 0.00 ? 853 GLN A H    2  
ATOM 2583  H HA   . GLN A 1 70  ? -3.213  10.007  -7.088  1.00 0.00 ? 853 GLN A HA   2  
ATOM 2584  H HB2  . GLN A 1 70  ? -4.674  7.514   -7.929  1.00 0.00 ? 853 GLN A HB2  2  
ATOM 2585  H HB3  . GLN A 1 70  ? -4.991  8.291   -6.384  1.00 0.00 ? 853 GLN A HB3  2  
ATOM 2586  H HG2  . GLN A 1 70  ? -5.539  10.377  -7.597  1.00 0.00 ? 853 GLN A HG2  2  
ATOM 2587  H HG3  . GLN A 1 70  ? -5.338  9.503   -9.115  1.00 0.00 ? 853 GLN A HG3  2  
ATOM 2588  H HE21 . GLN A 1 70  ? -6.634  7.375   -9.142  1.00 0.00 ? 853 GLN A HE21 2  
ATOM 2589  H HE22 . GLN A 1 70  ? -8.275  7.503   -8.617  1.00 0.00 ? 853 GLN A HE22 2  
ATOM 2590  N N    . ALA A 1 71  ? -2.118  6.928   -6.605  1.00 0.00 ? 854 ALA A N    2  
ATOM 2591  C CA   . ALA A 1 71  ? -1.362  6.084   -5.689  1.00 0.00 ? 854 ALA A CA   2  
ATOM 2592  C C    . ALA A 1 71  ? -0.020  6.717   -5.340  1.00 0.00 ? 854 ALA A C    2  
ATOM 2593  O O    . ALA A 1 71  ? 0.339   6.827   -4.167  1.00 0.00 ? 854 ALA A O    2  
ATOM 2594  C CB   . ALA A 1 71  ? -1.155  4.703   -6.294  1.00 0.00 ? 854 ALA A CB   2  
ATOM 2595  H H    . ALA A 1 71  ? -2.415  6.558   -7.463  1.00 0.00 ? 854 ALA A H    2  
ATOM 2596  H HA   . ALA A 1 71  ? -1.942  5.970   -4.784  1.00 0.00 ? 854 ALA A HA   2  
ATOM 2597  H HB1  . ALA A 1 71  ? -2.067  4.382   -6.776  1.00 0.00 ? 854 ALA A HB1  2  
ATOM 2598  H HB2  . ALA A 1 71  ? -0.358  4.745   -7.021  1.00 0.00 ? 854 ALA A HB2  2  
ATOM 2599  H HB3  . ALA A 1 71  ? -0.895  4.004   -5.513  1.00 0.00 ? 854 ALA A HB3  2  
ATOM 2600  N N    . SER A 1 72  ? 0.718   7.132   -6.364  1.00 0.00 ? 855 SER A N    2  
ATOM 2601  C CA   . SER A 1 72  ? 2.024   7.751   -6.165  1.00 0.00 ? 855 SER A CA   2  
ATOM 2602  C C    . SER A 1 72  ? 1.945   8.861   -5.122  1.00 0.00 ? 855 SER A C    2  
ATOM 2603  O O    . SER A 1 72  ? 2.640   8.823   -4.107  1.00 0.00 ? 855 SER A O    2  
ATOM 2604  C CB   . SER A 1 72  ? 2.552   8.313   -7.486  1.00 0.00 ? 855 SER A CB   2  
ATOM 2605  O OG   . SER A 1 72  ? 3.890   8.761   -7.351  1.00 0.00 ? 855 SER A OG   2  
ATOM 2606  H H    . SER A 1 72  ? 0.377   7.017   -7.276  1.00 0.00 ? 855 SER A H    2  
ATOM 2607  H HA   . SER A 1 72  ? 2.702   6.988   -5.812  1.00 0.00 ? 855 SER A HA   2  
ATOM 2608  H HB2  . SER A 1 72  ? 2.517   7.544   -8.242  1.00 0.00 ? 855 SER A HB2  2  
ATOM 2609  H HB3  . SER A 1 72  ? 1.935   9.146   -7.792  1.00 0.00 ? 855 SER A HB3  2  
ATOM 2610  H HG   . SER A 1 72  ? 4.437   8.342   -8.020  1.00 0.00 ? 855 SER A HG   2  
ATOM 2611  N N    . GLN A 1 73  ? 1.094   9.849   -5.381  1.00 0.00 ? 856 GLN A N    2  
ATOM 2612  C CA   . GLN A 1 73  ? 0.925   10.970  -4.465  1.00 0.00 ? 856 GLN A CA   2  
ATOM 2613  C C    . GLN A 1 73  ? 0.732   10.480  -3.033  1.00 0.00 ? 856 GLN A C    2  
ATOM 2614  O O    . GLN A 1 73  ? 1.463   10.878  -2.127  1.00 0.00 ? 856 GLN A O    2  
ATOM 2615  C CB   . GLN A 1 73  ? -0.269  11.827  -4.888  1.00 0.00 ? 856 GLN A CB   2  
ATOM 2616  C CG   . GLN A 1 73  ? -0.221  13.247  -4.349  1.00 0.00 ? 856 GLN A CG   2  
ATOM 2617  C CD   . GLN A 1 73  ? 0.503   14.200  -5.279  1.00 0.00 ? 856 GLN A CD   2  
ATOM 2618  O OE1  . GLN A 1 73  ? 0.691   13.910  -6.461  1.00 0.00 ? 856 GLN A OE1  2  
ATOM 2619  N NE2  . GLN A 1 73  ? 0.915   15.346  -4.750  1.00 0.00 ? 856 GLN A NE2  2  
ATOM 2620  H H    . GLN A 1 73  ? 0.569   9.823   -6.207  1.00 0.00 ? 856 GLN A H    2  
ATOM 2621  H HA   . GLN A 1 73  ? 1.821   11.572  -4.508  1.00 0.00 ? 856 GLN A HA   2  
ATOM 2622  H HB2  . GLN A 1 73  ? -0.299  11.874  -5.967  1.00 0.00 ? 856 GLN A HB2  2  
ATOM 2623  H HB3  . GLN A 1 73  ? -1.176  11.360  -4.532  1.00 0.00 ? 856 GLN A HB3  2  
ATOM 2624  H HG2  . GLN A 1 73  ? -1.233  13.602  -4.213  1.00 0.00 ? 856 GLN A HG2  2  
ATOM 2625  H HG3  . GLN A 1 73  ? 0.287   13.240  -3.397  1.00 0.00 ? 856 GLN A HG3  2  
ATOM 2626  H HE21 . GLN A 1 73  ? 0.731   15.509  -3.800  1.00 0.00 ? 856 GLN A HE21 2  
ATOM 2627  H HE22 . GLN A 1 73  ? 1.386   15.980  -5.328  1.00 0.00 ? 856 GLN A HE22 2  
ATOM 2628  N N    . ALA A 1 74  ? -0.257  9.614   -2.838  1.00 0.00 ? 857 ALA A N    2  
ATOM 2629  C CA   . ALA A 1 74  ? -0.545  9.069   -1.517  1.00 0.00 ? 857 ALA A CA   2  
ATOM 2630  C C    . ALA A 1 74  ? 0.707   8.469   -0.887  1.00 0.00 ? 857 ALA A C    2  
ATOM 2631  O O    . ALA A 1 74  ? 0.862   8.472   0.335   1.00 0.00 ? 857 ALA A O    2  
ATOM 2632  C CB   . ALA A 1 74  ? -1.646  8.023   -1.607  1.00 0.00 ? 857 ALA A CB   2  
ATOM 2633  H H    . ALA A 1 74  ? -0.805  9.335   -3.601  1.00 0.00 ? 857 ALA A H    2  
ATOM 2634  H HA   . ALA A 1 74  ? -0.899  9.876   -0.893  1.00 0.00 ? 857 ALA A HA   2  
ATOM 2635  H HB1  . ALA A 1 74  ? -1.237  7.104   -2.003  1.00 0.00 ? 857 ALA A HB1  2  
ATOM 2636  H HB2  . ALA A 1 74  ? -2.052  7.842   -0.623  1.00 0.00 ? 857 ALA A HB2  2  
ATOM 2637  H HB3  . ALA A 1 74  ? -2.428  8.379   -2.260  1.00 0.00 ? 857 ALA A HB3  2  
ATOM 2638  N N    . VAL A 1 75  ? 1.598   7.953   -1.727  1.00 0.00 ? 858 VAL A N    2  
ATOM 2639  C CA   . VAL A 1 75  ? 2.837   7.349   -1.251  1.00 0.00 ? 858 VAL A CA   2  
ATOM 2640  C C    . VAL A 1 75  ? 3.828   8.414   -0.795  1.00 0.00 ? 858 VAL A C    2  
ATOM 2641  O O    . VAL A 1 75  ? 4.515   8.247   0.212   1.00 0.00 ? 858 VAL A O    2  
ATOM 2642  C CB   . VAL A 1 75  ? 3.496   6.485   -2.343  1.00 0.00 ? 858 VAL A CB   2  
ATOM 2643  C CG1  . VAL A 1 75  ? 4.811   5.905   -1.844  1.00 0.00 ? 858 VAL A CG1  2  
ATOM 2644  C CG2  . VAL A 1 75  ? 2.552   5.379   -2.789  1.00 0.00 ? 858 VAL A CG2  2  
ATOM 2645  H H    . VAL A 1 75  ? 1.419   7.979   -2.690  1.00 0.00 ? 858 VAL A H    2  
ATOM 2646  H HA   . VAL A 1 75  ? 2.598   6.711   -0.413  1.00 0.00 ? 858 VAL A HA   2  
ATOM 2647  H HB   . VAL A 1 75  ? 3.706   7.115   -3.195  1.00 0.00 ? 858 VAL A HB   2  
ATOM 2648  H HG11 . VAL A 1 75  ? 5.544   5.942   -2.637  1.00 0.00 ? 858 VAL A HG11 2  
ATOM 2649  H HG12 . VAL A 1 75  ? 5.162   6.482   -1.001  1.00 0.00 ? 858 VAL A HG12 2  
ATOM 2650  H HG13 . VAL A 1 75  ? 4.660   4.879   -1.542  1.00 0.00 ? 858 VAL A HG13 2  
ATOM 2651  H HG21 . VAL A 1 75  ? 1.532   5.678   -2.596  1.00 0.00 ? 858 VAL A HG21 2  
ATOM 2652  H HG22 . VAL A 1 75  ? 2.680   5.199   -3.846  1.00 0.00 ? 858 VAL A HG22 2  
ATOM 2653  H HG23 . VAL A 1 75  ? 2.771   4.475   -2.241  1.00 0.00 ? 858 VAL A HG23 2  
ATOM 2654  N N    . MET A 1 76  ? 3.896   9.510   -1.544  1.00 0.00 ? 859 MET A N    2  
ATOM 2655  C CA   . MET A 1 76  ? 4.802   10.605  -1.215  1.00 0.00 ? 859 MET A CA   2  
ATOM 2656  C C    . MET A 1 76  ? 4.343   11.330  0.046   1.00 0.00 ? 859 MET A C    2  
ATOM 2657  O O    . MET A 1 76  ? 5.159   11.852  0.806   1.00 0.00 ? 859 MET A O    2  
ATOM 2658  C CB   . MET A 1 76  ? 4.890   11.590  -2.382  1.00 0.00 ? 859 MET A CB   2  
ATOM 2659  C CG   . MET A 1 76  ? 5.933   11.211  -3.421  1.00 0.00 ? 859 MET A CG   2  
ATOM 2660  S SD   . MET A 1 76  ? 6.555   12.637  -4.332  1.00 0.00 ? 859 MET A SD   2  
ATOM 2661  C CE   . MET A 1 76  ? 8.271   12.173  -4.556  1.00 0.00 ? 859 MET A CE   2  
ATOM 2662  H H    . MET A 1 76  ? 3.324   9.586   -2.336  1.00 0.00 ? 859 MET A H    2  
ATOM 2663  H HA   . MET A 1 76  ? 5.780   10.183  -1.038  1.00 0.00 ? 859 MET A HA   2  
ATOM 2664  H HB2  . MET A 1 76  ? 3.928   11.639  -2.869  1.00 0.00 ? 859 MET A HB2  2  
ATOM 2665  H HB3  . MET A 1 76  ? 5.139   12.567  -1.994  1.00 0.00 ? 859 MET A HB3  2  
ATOM 2666  H HG2  . MET A 1 76  ? 6.761   10.731  -2.922  1.00 0.00 ? 859 MET A HG2  2  
ATOM 2667  H HG3  . MET A 1 76  ? 5.487   10.519  -4.120  1.00 0.00 ? 859 MET A HG3  2  
ATOM 2668  H HE1  . MET A 1 76  ? 8.548   12.306  -5.591  1.00 0.00 ? 859 MET A HE1  2  
ATOM 2669  H HE2  . MET A 1 76  ? 8.896   12.794  -3.932  1.00 0.00 ? 859 MET A HE2  2  
ATOM 2670  H HE3  . MET A 1 76  ? 8.402   11.136  -4.279  1.00 0.00 ? 859 MET A HE3  2  
ATOM 2671  N N    . LYS A 1 77  ? 3.033   11.360  0.262   1.00 0.00 ? 860 LYS A N    2  
ATOM 2672  C CA   . LYS A 1 77  ? 2.464   12.021  1.431   1.00 0.00 ? 860 LYS A CA   2  
ATOM 2673  C C    . LYS A 1 77  ? 2.479   11.092  2.641   1.00 0.00 ? 860 LYS A C    2  
ATOM 2674  O O    . LYS A 1 77  ? 3.031   11.431  3.688   1.00 0.00 ? 860 LYS A O    2  
ATOM 2675  C CB   . LYS A 1 77  ? 1.032   12.474  1.140   1.00 0.00 ? 860 LYS A CB   2  
ATOM 2676  C CG   . LYS A 1 77  ? 0.952   13.736  0.300   1.00 0.00 ? 860 LYS A CG   2  
ATOM 2677  C CD   . LYS A 1 77  ? 1.078   14.985  1.156   1.00 0.00 ? 860 LYS A CD   2  
ATOM 2678  C CE   . LYS A 1 77  ? 0.861   16.248  0.336   1.00 0.00 ? 860 LYS A CE   2  
ATOM 2679  N NZ   . LYS A 1 77  ? 1.866   16.379  -0.756  1.00 0.00 ? 860 LYS A NZ   2  
ATOM 2680  H H    . LYS A 1 77  ? 2.432   10.926  -0.380  1.00 0.00 ? 860 LYS A H    2  
ATOM 2681  H HA   . LYS A 1 77  ? 3.070   12.887  1.649   1.00 0.00 ? 860 LYS A HA   2  
ATOM 2682  H HB2  . LYS A 1 77  ? 0.517   11.683  0.615   1.00 0.00 ? 860 LYS A HB2  2  
ATOM 2683  H HB3  . LYS A 1 77  ? 0.528   12.659  2.078   1.00 0.00 ? 860 LYS A HB3  2  
ATOM 2684  H HG2  . LYS A 1 77  ? 1.753   13.727  -0.424  1.00 0.00 ? 860 LYS A HG2  2  
ATOM 2685  H HG3  . LYS A 1 77  ? 0.001   13.757  -0.213  1.00 0.00 ? 860 LYS A HG3  2  
ATOM 2686  H HD2  . LYS A 1 77  ? 0.338   14.949  1.942   1.00 0.00 ? 860 LYS A HD2  2  
ATOM 2687  H HD3  . LYS A 1 77  ? 2.067   15.014  1.591   1.00 0.00 ? 860 LYS A HD3  2  
ATOM 2688  H HE2  . LYS A 1 77  ? -0.126  16.214  -0.098  1.00 0.00 ? 860 LYS A HE2  2  
ATOM 2689  H HE3  . LYS A 1 77  ? 0.938   17.104  0.990   1.00 0.00 ? 860 LYS A HE3  2  
ATOM 2690  H HZ1  . LYS A 1 77  ? 2.818   16.176  -0.390  1.00 0.00 ? 860 LYS A HZ1  2  
ATOM 2691  H HZ2  . LYS A 1 77  ? 1.853   17.346  -1.138  1.00 0.00 ? 860 LYS A HZ2  2  
ATOM 2692  H HZ3  . LYS A 1 77  ? 1.650   15.711  -1.523  1.00 0.00 ? 860 LYS A HZ3  2  
ATOM 2693  N N    . MET A 1 78  ? 1.870   9.921   2.491   1.00 0.00 ? 861 MET A N    2  
ATOM 2694  C CA   . MET A 1 78  ? 1.817   8.943   3.571   1.00 0.00 ? 861 MET A CA   2  
ATOM 2695  C C    . MET A 1 78  ? 3.220   8.570   4.037   1.00 0.00 ? 861 MET A C    2  
ATOM 2696  O O    . MET A 1 78  ? 3.490   8.506   5.236   1.00 0.00 ? 861 MET A O    2  
ATOM 2697  C CB   . MET A 1 78  ? 1.067   7.689   3.117   1.00 0.00 ? 861 MET A CB   2  
ATOM 2698  C CG   . MET A 1 78  ? -0.371  7.958   2.702   1.00 0.00 ? 861 MET A CG   2  
ATOM 2699  S SD   . MET A 1 78  ? -1.518  7.894   4.092   1.00 0.00 ? 861 MET A SD   2  
ATOM 2700  C CE   . MET A 1 78  ? -2.525  6.485   3.635   1.00 0.00 ? 861 MET A CE   2  
ATOM 2701  H H    . MET A 1 78  ? 1.448   9.707   1.632   1.00 0.00 ? 861 MET A H    2  
ATOM 2702  H HA   . MET A 1 78  ? 1.284   9.391   4.396   1.00 0.00 ? 861 MET A HA   2  
ATOM 2703  H HB2  . MET A 1 78  ? 1.587   7.259   2.275   1.00 0.00 ? 861 MET A HB2  2  
ATOM 2704  H HB3  . MET A 1 78  ? 1.057   6.976   3.927   1.00 0.00 ? 861 MET A HB3  2  
ATOM 2705  H HG2  . MET A 1 78  ? -0.425  8.939   2.254   1.00 0.00 ? 861 MET A HG2  2  
ATOM 2706  H HG3  . MET A 1 78  ? -0.665  7.215   1.975   1.00 0.00 ? 861 MET A HG3  2  
ATOM 2707  H HE1  . MET A 1 78  ? -2.063  5.964   2.809   1.00 0.00 ? 861 MET A HE1  2  
ATOM 2708  H HE2  . MET A 1 78  ? -2.613  5.817   4.478   1.00 0.00 ? 861 MET A HE2  2  
ATOM 2709  H HE3  . MET A 1 78  ? -3.508  6.826   3.340   1.00 0.00 ? 861 MET A HE3  2  
ATOM 2710  N N    . ASP A 1 79  ? 4.110   8.324   3.081   1.00 0.00 ? 862 ASP A N    2  
ATOM 2711  C CA   . ASP A 1 79  ? 5.486   7.957   3.394   1.00 0.00 ? 862 ASP A CA   2  
ATOM 2712  C C    . ASP A 1 79  ? 6.025   8.800   4.545   1.00 0.00 ? 862 ASP A C    2  
ATOM 2713  O O    . ASP A 1 79  ? 6.268   9.996   4.392   1.00 0.00 ? 862 ASP A O    2  
ATOM 2714  C CB   . ASP A 1 79  ? 6.375   8.129   2.161   1.00 0.00 ? 862 ASP A CB   2  
ATOM 2715  C CG   . ASP A 1 79  ? 7.846   8.216   2.515   1.00 0.00 ? 862 ASP A CG   2  
ATOM 2716  O OD1  . ASP A 1 79  ? 8.258   9.247   3.087   1.00 0.00 ? 862 ASP A OD1  2  
ATOM 2717  O OD2  . ASP A 1 79  ? 8.586   7.254   2.219   1.00 0.00 ? 862 ASP A OD2  2  
ATOM 2718  H H    . ASP A 1 79  ? 3.834   8.391   2.143   1.00 0.00 ? 862 ASP A H    2  
ATOM 2719  H HA   . ASP A 1 79  ? 5.494   6.919   3.690   1.00 0.00 ? 862 ASP A HA   2  
ATOM 2720  H HB2  . ASP A 1 79  ? 6.232   7.285   1.502   1.00 0.00 ? 862 ASP A HB2  2  
ATOM 2721  H HB3  . ASP A 1 79  ? 6.092   9.035   1.645   1.00 0.00 ? 862 ASP A HB3  2  
ATOM 2722  N N    . GLY A 1 80  ? 6.208   8.167   5.700   1.00 0.00 ? 863 GLY A N    2  
ATOM 2723  C CA   . GLY A 1 80  ? 6.715   8.874   6.862   1.00 0.00 ? 863 GLY A CA   2  
ATOM 2724  C C    . GLY A 1 80  ? 5.705   9.849   7.434   1.00 0.00 ? 863 GLY A C    2  
ATOM 2725  O O    . GLY A 1 80  ? 6.036   10.999  7.722   1.00 0.00 ? 863 GLY A O    2  
ATOM 2726  H H    . GLY A 1 80  ? 5.996   7.212   5.765   1.00 0.00 ? 863 GLY A H    2  
ATOM 2727  H HA2  . GLY A 1 80  ? 6.976   8.154   7.623   1.00 0.00 ? 863 GLY A HA2  2  
ATOM 2728  H HA3  . GLY A 1 80  ? 7.603   9.420   6.577   1.00 0.00 ? 863 GLY A HA3  2  
ATOM 2729  N N    . MET A 1 81  ? 4.468   9.390   7.597   1.00 0.00 ? 864 MET A N    2  
ATOM 2730  C CA   . MET A 1 81  ? 3.406   10.230  8.138   1.00 0.00 ? 864 MET A CA   2  
ATOM 2731  C C    . MET A 1 81  ? 3.060   9.817   9.565   1.00 0.00 ? 864 MET A C    2  
ATOM 2732  O O    . MET A 1 81  ? 3.274   8.671   9.960   1.00 0.00 ? 864 MET A O    2  
ATOM 2733  C CB   . MET A 1 81  ? 2.160   10.147  7.254   1.00 0.00 ? 864 MET A CB   2  
ATOM 2734  C CG   . MET A 1 81  ? 1.416   8.828   7.376   1.00 0.00 ? 864 MET A CG   2  
ATOM 2735  S SD   . MET A 1 81  ? -0.324  8.968   6.922   1.00 0.00 ? 864 MET A SD   2  
ATOM 2736  C CE   . MET A 1 81  ? -0.831  10.347  7.946   1.00 0.00 ? 864 MET A CE   2  
ATOM 2737  H H    . MET A 1 81  ? 4.265   8.464   7.348   1.00 0.00 ? 864 MET A H    2  
ATOM 2738  H HA   . MET A 1 81  ? 3.763   11.249  8.147   1.00 0.00 ? 864 MET A HA   2  
ATOM 2739  H HB2  . MET A 1 81  ? 1.485   10.944  7.528   1.00 0.00 ? 864 MET A HB2  2  
ATOM 2740  H HB3  . MET A 1 81  ? 2.455   10.275  6.223   1.00 0.00 ? 864 MET A HB3  2  
ATOM 2741  H HG2  . MET A 1 81  ? 1.884   8.103   6.726   1.00 0.00 ? 864 MET A HG2  2  
ATOM 2742  H HG3  . MET A 1 81  ? 1.481   8.487   8.398   1.00 0.00 ? 864 MET A HG3  2  
ATOM 2743  H HE1  . MET A 1 81  ? -1.899  10.308  8.100   1.00 0.00 ? 864 MET A HE1  2  
ATOM 2744  H HE2  . MET A 1 81  ? -0.328  10.291  8.900   1.00 0.00 ? 864 MET A HE2  2  
ATOM 2745  H HE3  . MET A 1 81  ? -0.571  11.274  7.455   1.00 0.00 ? 864 MET A HE3  2  
ATOM 2746  N N    . THR A 1 82  ? 2.524   10.759  10.335  1.00 0.00 ? 865 THR A N    2  
ATOM 2747  C CA   . THR A 1 82  ? 2.150   10.493  11.718  1.00 0.00 ? 865 THR A CA   2  
ATOM 2748  C C    . THR A 1 82  ? 0.695   10.049  11.819  1.00 0.00 ? 865 THR A C    2  
ATOM 2749  O O    . THR A 1 82  ? -0.189  10.642  11.200  1.00 0.00 ? 865 THR A O    2  
ATOM 2750  C CB   . THR A 1 82  ? 2.357   11.736  12.605  1.00 0.00 ? 865 THR A CB   2  
ATOM 2751  O OG1  . THR A 1 82  ? 3.540   12.435  12.201  1.00 0.00 ? 865 THR A OG1  2  
ATOM 2752  C CG2  . THR A 1 82  ? 2.470   11.342  14.070  1.00 0.00 ? 865 THR A CG2  2  
ATOM 2753  H H    . THR A 1 82  ? 2.378   11.654  9.963   1.00 0.00 ? 865 THR A H    2  
ATOM 2754  H HA   . THR A 1 82  ? 2.785   9.702   12.090  1.00 0.00 ? 865 THR A HA   2  
ATOM 2755  H HB   . THR A 1 82  ? 1.504   12.389  12.488  1.00 0.00 ? 865 THR A HB   2  
ATOM 2756  H HG1  . THR A 1 82  ? 4.156   11.816  11.800  1.00 0.00 ? 865 THR A HG1  2  
ATOM 2757  H HG21 . THR A 1 82  ? 2.653   12.224  14.667  1.00 0.00 ? 865 THR A HG21 2  
ATOM 2758  H HG22 . THR A 1 82  ? 3.287   10.647  14.194  1.00 0.00 ? 865 THR A HG22 2  
ATOM 2759  H HG23 . THR A 1 82  ? 1.550   10.877  14.389  1.00 0.00 ? 865 THR A HG23 2  
ATOM 2760  N N    . ILE A 1 83  ? 0.454   9.002   12.601  1.00 0.00 ? 866 ILE A N    2  
ATOM 2761  C CA   . ILE A 1 83  ? -0.895  8.480   12.783  1.00 0.00 ? 866 ILE A CA   2  
ATOM 2762  C C    . ILE A 1 83  ? -1.069  7.879   14.174  1.00 0.00 ? 866 ILE A C    2  
ATOM 2763  O O    . ILE A 1 83  ? -0.533  6.811   14.473  1.00 0.00 ? 866 ILE A O    2  
ATOM 2764  C CB   . ILE A 1 83  ? -1.231  7.410   11.728  1.00 0.00 ? 866 ILE A CB   2  
ATOM 2765  C CG1  . ILE A 1 83  ? -1.429  8.059   10.357  1.00 0.00 ? 866 ILE A CG1  2  
ATOM 2766  C CG2  . ILE A 1 83  ? -2.474  6.634   12.137  1.00 0.00 ? 866 ILE A CG2  2  
ATOM 2767  C CD1  . ILE A 1 83  ? -1.489  7.062   9.220   1.00 0.00 ? 866 ILE A CD1  2  
ATOM 2768  H H    . ILE A 1 83  ? 1.200   8.572   13.068  1.00 0.00 ? 866 ILE A H    2  
ATOM 2769  H HA   . ILE A 1 83  ? -1.588  9.301   12.668  1.00 0.00 ? 866 ILE A HA   2  
ATOM 2770  H HB   . ILE A 1 83  ? -0.405  6.717   11.675  1.00 0.00 ? 866 ILE A HB   2  
ATOM 2771  H HG12 . ILE A 1 83  ? -2.353  8.615   10.358  1.00 0.00 ? 866 ILE A HG12 2  
ATOM 2772  H HG13 . ILE A 1 83  ? -0.608  8.734   10.164  1.00 0.00 ? 866 ILE A HG13 2  
ATOM 2773  H HG21 . ILE A 1 83  ? -3.314  7.309   12.202  1.00 0.00 ? 866 ILE A HG21 2  
ATOM 2774  H HG22 . ILE A 1 83  ? -2.682  5.872   11.401  1.00 0.00 ? 866 ILE A HG22 2  
ATOM 2775  H HG23 . ILE A 1 83  ? -2.310  6.171   13.099  1.00 0.00 ? 866 ILE A HG23 2  
ATOM 2776  H HD11 . ILE A 1 83  ? -2.275  7.344   8.535   1.00 0.00 ? 866 ILE A HD11 2  
ATOM 2777  H HD12 . ILE A 1 83  ? -0.543  7.052   8.699   1.00 0.00 ? 866 ILE A HD12 2  
ATOM 2778  H HD13 . ILE A 1 83  ? -1.692  6.077   9.615   1.00 0.00 ? 866 ILE A HD13 2  
ATOM 2779  N N    . LYS A 1 84  ? -1.823  8.571   15.021  1.00 0.00 ? 867 LYS A N    2  
ATOM 2780  C CA   . LYS A 1 84  ? -2.072  8.105   16.380  1.00 0.00 ? 867 LYS A CA   2  
ATOM 2781  C C    . LYS A 1 84  ? -0.773  8.037   17.178  1.00 0.00 ? 867 LYS A C    2  
ATOM 2782  O O    . LYS A 1 84  ? -0.608  7.172   18.037  1.00 0.00 ? 867 LYS A O    2  
ATOM 2783  C CB   . LYS A 1 84  ? -2.740  6.729   16.356  1.00 0.00 ? 867 LYS A CB   2  
ATOM 2784  C CG   . LYS A 1 84  ? -3.892  6.630   15.370  1.00 0.00 ? 867 LYS A CG   2  
ATOM 2785  C CD   . LYS A 1 84  ? -5.212  7.020   16.014  1.00 0.00 ? 867 LYS A CD   2  
ATOM 2786  C CE   . LYS A 1 84  ? -5.888  5.825   16.668  1.00 0.00 ? 867 LYS A CE   2  
ATOM 2787  N NZ   . LYS A 1 84  ? -7.229  6.176   17.212  1.00 0.00 ? 867 LYS A NZ   2  
ATOM 2788  H H    . LYS A 1 84  ? -2.223  9.415   14.724  1.00 0.00 ? 867 LYS A H    2  
ATOM 2789  H HA   . LYS A 1 84  ? -2.736  8.810   16.856  1.00 0.00 ? 867 LYS A HA   2  
ATOM 2790  H HB2  . LYS A 1 84  ? -2.002  5.987   16.090  1.00 0.00 ? 867 LYS A HB2  2  
ATOM 2791  H HB3  . LYS A 1 84  ? -3.120  6.509   17.343  1.00 0.00 ? 867 LYS A HB3  2  
ATOM 2792  H HG2  . LYS A 1 84  ? -3.700  7.291   14.538  1.00 0.00 ? 867 LYS A HG2  2  
ATOM 2793  H HG3  . LYS A 1 84  ? -3.963  5.612   15.014  1.00 0.00 ? 867 LYS A HG3  2  
ATOM 2794  H HD2  . LYS A 1 84  ? -5.027  7.772   16.767  1.00 0.00 ? 867 LYS A HD2  2  
ATOM 2795  H HD3  . LYS A 1 84  ? -5.867  7.423   15.254  1.00 0.00 ? 867 LYS A HD3  2  
ATOM 2796  H HE2  . LYS A 1 84  ? -6.001  5.044   15.932  1.00 0.00 ? 867 LYS A HE2  2  
ATOM 2797  H HE3  . LYS A 1 84  ? -5.263  5.472   17.475  1.00 0.00 ? 867 LYS A HE3  2  
ATOM 2798  H HZ1  . LYS A 1 84  ? -7.136  6.901   17.952  1.00 0.00 ? 867 LYS A HZ1  2  
ATOM 2799  H HZ2  . LYS A 1 84  ? -7.680  5.334   17.623  1.00 0.00 ? 867 LYS A HZ2  2  
ATOM 2800  H HZ3  . LYS A 1 84  ? -7.837  6.546   16.454  1.00 0.00 ? 867 LYS A HZ3  2  
ATOM 2801  N N    . GLU A 1 85  ? 0.143   8.955   16.888  1.00 0.00 ? 868 GLU A N    2  
ATOM 2802  C CA   . GLU A 1 85  ? 1.426   8.998   17.580  1.00 0.00 ? 868 GLU A CA   2  
ATOM 2803  C C    . GLU A 1 85  ? 2.321   7.843   17.139  1.00 0.00 ? 868 GLU A C    2  
ATOM 2804  O O    . GLU A 1 85  ? 2.920   7.158   17.967  1.00 0.00 ? 868 GLU A O    2  
ATOM 2805  C CB   . GLU A 1 85  ? 1.216   8.946   19.094  1.00 0.00 ? 868 GLU A CB   2  
ATOM 2806  C CG   . GLU A 1 85  ? 2.298   9.664   19.884  1.00 0.00 ? 868 GLU A CG   2  
ATOM 2807  C CD   . GLU A 1 85  ? 2.209   11.172  19.757  1.00 0.00 ? 868 GLU A CD   2  
ATOM 2808  O OE1  . GLU A 1 85  ? 1.173   11.741  20.160  1.00 0.00 ? 868 GLU A OE1  2  
ATOM 2809  O OE2  . GLU A 1 85  ? 3.175   11.783  19.256  1.00 0.00 ? 868 GLU A OE2  2  
ATOM 2810  H H    . GLU A 1 85  ? -0.048  9.618   16.192  1.00 0.00 ? 868 GLU A H    2  
ATOM 2811  H HA   . GLU A 1 85  ? 1.910   9.929   17.325  1.00 0.00 ? 868 GLU A HA   2  
ATOM 2812  H HB2  . GLU A 1 85  ? 0.265   9.401   19.330  1.00 0.00 ? 868 GLU A HB2  2  
ATOM 2813  H HB3  . GLU A 1 85  ? 1.197   7.912   19.407  1.00 0.00 ? 868 GLU A HB3  2  
ATOM 2814  H HG2  . GLU A 1 85  ? 2.200   9.399   20.926  1.00 0.00 ? 868 GLU A HG2  2  
ATOM 2815  H HG3  . GLU A 1 85  ? 3.263   9.342   19.521  1.00 0.00 ? 868 GLU A HG3  2  
ATOM 2816  N N    . ASN A 1 86  ? 2.404   7.632   15.830  1.00 0.00 ? 869 ASN A N    2  
ATOM 2817  C CA   . ASN A 1 86  ? 3.224   6.560   15.278  1.00 0.00 ? 869 ASN A CA   2  
ATOM 2818  C C    . ASN A 1 86  ? 3.570   6.835   13.818  1.00 0.00 ? 869 ASN A C    2  
ATOM 2819  O O    . ASN A 1 86  ? 2.709   6.766   12.942  1.00 0.00 ? 869 ASN A O    2  
ATOM 2820  C CB   . ASN A 1 86  ? 2.494   5.220   15.397  1.00 0.00 ? 869 ASN A CB   2  
ATOM 2821  C CG   . ASN A 1 86  ? 3.430   4.036   15.243  1.00 0.00 ? 869 ASN A CG   2  
ATOM 2822  O OD1  . ASN A 1 86  ? 4.186   3.951   14.275  1.00 0.00 ? 869 ASN A OD1  2  
ATOM 2823  N ND2  . ASN A 1 86  ? 3.382   3.116   16.199  1.00 0.00 ? 869 ASN A ND2  2  
ATOM 2824  H H    . ASN A 1 86  ? 1.902   8.212   15.219  1.00 0.00 ? 869 ASN A H    2  
ATOM 2825  H HA   . ASN A 1 86  ? 4.138   6.514   15.851  1.00 0.00 ? 869 ASN A HA   2  
ATOM 2826  H HB2  . ASN A 1 86  ? 2.024   5.158   16.367  1.00 0.00 ? 869 ASN A HB2  2  
ATOM 2827  H HB3  . ASN A 1 86  ? 1.737   5.160   14.630  1.00 0.00 ? 869 ASN A HB3  2  
ATOM 2828  H HD21 . ASN A 1 86  ? 2.755   3.250   16.940  1.00 0.00 ? 869 ASN A HD21 2  
ATOM 2829  H HD22 . ASN A 1 86  ? 3.977   2.341   16.124  1.00 0.00 ? 869 ASN A HD22 2  
ATOM 2830  N N    . ILE A 1 87  ? 4.837   7.147   13.566  1.00 0.00 ? 870 ILE A N    2  
ATOM 2831  C CA   . ILE A 1 87  ? 5.298   7.431   12.212  1.00 0.00 ? 870 ILE A CA   2  
ATOM 2832  C C    . ILE A 1 87  ? 5.221   6.188   11.333  1.00 0.00 ? 870 ILE A C    2  
ATOM 2833  O O    . ILE A 1 87  ? 6.010   5.255   11.489  1.00 0.00 ? 870 ILE A O    2  
ATOM 2834  C CB   . ILE A 1 87  ? 6.745   7.959   12.209  1.00 0.00 ? 870 ILE A CB   2  
ATOM 2835  C CG1  . ILE A 1 87  ? 6.770   9.444   12.581  1.00 0.00 ? 870 ILE A CG1  2  
ATOM 2836  C CG2  . ILE A 1 87  ? 7.387   7.737   10.848  1.00 0.00 ? 870 ILE A CG2  2  
ATOM 2837  C CD1  . ILE A 1 87  ? 6.345   9.717   14.007  1.00 0.00 ? 870 ILE A CD1  2  
ATOM 2838  H H    . ILE A 1 87  ? 5.477   7.186   14.307  1.00 0.00 ? 870 ILE A H    2  
ATOM 2839  H HA   . ILE A 1 87  ? 4.656   8.194   11.796  1.00 0.00 ? 870 ILE A HA   2  
ATOM 2840  H HB   . ILE A 1 87  ? 7.309   7.403   12.942  1.00 0.00 ? 870 ILE A HB   2  
ATOM 2841  H HG12 . ILE A 1 87  ? 7.771   9.823   12.455  1.00 0.00 ? 870 ILE A HG12 2  
ATOM 2842  H HG13 . ILE A 1 87  ? 6.100   9.982   11.925  1.00 0.00 ? 870 ILE A HG13 2  
ATOM 2843  H HG21 . ILE A 1 87  ? 8.014   8.582   10.604  1.00 0.00 ? 870 ILE A HG21 2  
ATOM 2844  H HG22 . ILE A 1 87  ? 7.987   6.840   10.876  1.00 0.00 ? 870 ILE A HG22 2  
ATOM 2845  H HG23 . ILE A 1 87  ? 6.616   7.633   10.099  1.00 0.00 ? 870 ILE A HG23 2  
ATOM 2846  H HD11 . ILE A 1 87  ? 6.969   10.492  14.426  1.00 0.00 ? 870 ILE A HD11 2  
ATOM 2847  H HD12 . ILE A 1 87  ? 5.314   10.036  14.021  1.00 0.00 ? 870 ILE A HD12 2  
ATOM 2848  H HD13 . ILE A 1 87  ? 6.451   8.815   14.593  1.00 0.00 ? 870 ILE A HD13 2  
ATOM 2849  N N    . ILE A 1 88  ? 4.267   6.182   10.408  1.00 0.00 ? 871 ILE A N    2  
ATOM 2850  C CA   . ILE A 1 88  ? 4.089   5.055   9.502   1.00 0.00 ? 871 ILE A CA   2  
ATOM 2851  C C    . ILE A 1 88  ? 4.854   5.270   8.200   1.00 0.00 ? 871 ILE A C    2  
ATOM 2852  O O    . ILE A 1 88  ? 4.888   6.377   7.662   1.00 0.00 ? 871 ILE A O    2  
ATOM 2853  C CB   . ILE A 1 88  ? 2.601   4.823   9.177   1.00 0.00 ? 871 ILE A CB   2  
ATOM 2854  C CG1  . ILE A 1 88  ? 2.126   5.819   8.117   1.00 0.00 ? 871 ILE A CG1  2  
ATOM 2855  C CG2  . ILE A 1 88  ? 1.759   4.942   10.439  1.00 0.00 ? 871 ILE A CG2  2  
ATOM 2856  C CD1  . ILE A 1 88  ? 2.531   5.443   6.710   1.00 0.00 ? 871 ILE A CD1  2  
ATOM 2857  H H    . ILE A 1 88  ? 3.669   6.955   10.333  1.00 0.00 ? 871 ILE A H    2  
ATOM 2858  H HA   . ILE A 1 88  ? 4.472   4.171   9.991   1.00 0.00 ? 871 ILE A HA   2  
ATOM 2859  H HB   . ILE A 1 88  ? 2.491   3.820   8.793   1.00 0.00 ? 871 ILE A HB   2  
ATOM 2860  H HG12 . ILE A 1 88  ? 1.050   5.881   8.147   1.00 0.00 ? 871 ILE A HG12 2  
ATOM 2861  H HG13 . ILE A 1 88  ? 2.545   6.791   8.335   1.00 0.00 ? 871 ILE A HG13 2  
ATOM 2862  H HG21 . ILE A 1 88  ? 2.154   5.730   11.062  1.00 0.00 ? 871 ILE A HG21 2  
ATOM 2863  H HG22 . ILE A 1 88  ? 0.739   5.174   10.170  1.00 0.00 ? 871 ILE A HG22 2  
ATOM 2864  H HG23 . ILE A 1 88  ? 1.786   4.007   10.979  1.00 0.00 ? 871 ILE A HG23 2  
ATOM 2865  H HD11 . ILE A 1 88  ? 3.168   6.213   6.300   1.00 0.00 ? 871 ILE A HD11 2  
ATOM 2866  H HD12 . ILE A 1 88  ? 3.064   4.504   6.726   1.00 0.00 ? 871 ILE A HD12 2  
ATOM 2867  H HD13 . ILE A 1 88  ? 1.648   5.344   6.095   1.00 0.00 ? 871 ILE A HD13 2  
ATOM 2868  N N    . LYS A 1 89  ? 5.466   4.203   7.698   1.00 0.00 ? 872 LYS A N    2  
ATOM 2869  C CA   . LYS A 1 89  ? 6.229   4.272   6.457   1.00 0.00 ? 872 LYS A CA   2  
ATOM 2870  C C    . LYS A 1 89  ? 5.450   3.647   5.304   1.00 0.00 ? 872 LYS A C    2  
ATOM 2871  O O    . LYS A 1 89  ? 4.768   2.637   5.477   1.00 0.00 ? 872 LYS A O    2  
ATOM 2872  C CB   . LYS A 1 89  ? 7.575   3.562   6.622   1.00 0.00 ? 872 LYS A CB   2  
ATOM 2873  C CG   . LYS A 1 89  ? 8.393   3.505   5.343   1.00 0.00 ? 872 LYS A CG   2  
ATOM 2874  C CD   . LYS A 1 89  ? 9.862   3.250   5.632   1.00 0.00 ? 872 LYS A CD   2  
ATOM 2875  C CE   . LYS A 1 89  ? 10.749  3.770   4.511   1.00 0.00 ? 872 LYS A CE   2  
ATOM 2876  N NZ   . LYS A 1 89  ? 10.871  5.254   4.544   1.00 0.00 ? 872 LYS A NZ   2  
ATOM 2877  H H    . LYS A 1 89  ? 5.402   3.347   8.172   1.00 0.00 ? 872 LYS A H    2  
ATOM 2878  H HA   . LYS A 1 89  ? 6.406   5.313   6.234   1.00 0.00 ? 872 LYS A HA   2  
ATOM 2879  H HB2  . LYS A 1 89  ? 8.153   4.081   7.371   1.00 0.00 ? 872 LYS A HB2  2  
ATOM 2880  H HB3  . LYS A 1 89  ? 7.395   2.550   6.955   1.00 0.00 ? 872 LYS A HB3  2  
ATOM 2881  H HG2  . LYS A 1 89  ? 8.016   2.707   4.720   1.00 0.00 ? 872 LYS A HG2  2  
ATOM 2882  H HG3  . LYS A 1 89  ? 8.296   4.447   4.822   1.00 0.00 ? 872 LYS A HG3  2  
ATOM 2883  H HD2  . LYS A 1 89  ? 10.132  3.750   6.550   1.00 0.00 ? 872 LYS A HD2  2  
ATOM 2884  H HD3  . LYS A 1 89  ? 10.020  2.186   5.740   1.00 0.00 ? 872 LYS A HD3  2  
ATOM 2885  H HE2  . LYS A 1 89  ? 11.731  3.335   4.615   1.00 0.00 ? 872 LYS A HE2  2  
ATOM 2886  H HE3  . LYS A 1 89  ? 10.322  3.473   3.565   1.00 0.00 ? 872 LYS A HE3  2  
ATOM 2887  H HZ1  . LYS A 1 89  ? 11.446  5.583   3.741   1.00 0.00 ? 872 LYS A HZ1  2  
ATOM 2888  H HZ2  . LYS A 1 89  ? 11.328  5.556   5.428   1.00 0.00 ? 872 LYS A HZ2  2  
ATOM 2889  H HZ3  . LYS A 1 89  ? 9.930   5.692   4.485   1.00 0.00 ? 872 LYS A HZ3  2  
ATOM 2890  N N    . VAL A 1 90  ? 5.558   4.253   4.126   1.00 0.00 ? 873 VAL A N    2  
ATOM 2891  C CA   . VAL A 1 90  ? 4.866   3.755   2.943   1.00 0.00 ? 873 VAL A CA   2  
ATOM 2892  C C    . VAL A 1 90  ? 5.854   3.382   1.844   1.00 0.00 ? 873 VAL A C    2  
ATOM 2893  O O    . VAL A 1 90  ? 6.976   3.887   1.806   1.00 0.00 ? 873 VAL A O    2  
ATOM 2894  C CB   . VAL A 1 90  ? 3.872   4.795   2.394   1.00 0.00 ? 873 VAL A CB   2  
ATOM 2895  C CG1  . VAL A 1 90  ? 3.149   4.250   1.172   1.00 0.00 ? 873 VAL A CG1  2  
ATOM 2896  C CG2  . VAL A 1 90  ? 2.880   5.206   3.472   1.00 0.00 ? 873 VAL A CG2  2  
ATOM 2897  H H    . VAL A 1 90  ? 6.117   5.055   4.050   1.00 0.00 ? 873 VAL A H    2  
ATOM 2898  H HA   . VAL A 1 90  ? 4.310   2.873   3.228   1.00 0.00 ? 873 VAL A HA   2  
ATOM 2899  H HB   . VAL A 1 90  ? 4.429   5.671   2.094   1.00 0.00 ? 873 VAL A HB   2  
ATOM 2900  H HG11 . VAL A 1 90  ? 2.734   3.280   1.403   1.00 0.00 ? 873 VAL A HG11 2  
ATOM 2901  H HG12 . VAL A 1 90  ? 2.354   4.926   0.892   1.00 0.00 ? 873 VAL A HG12 2  
ATOM 2902  H HG13 . VAL A 1 90  ? 3.847   4.156   0.353   1.00 0.00 ? 873 VAL A HG13 2  
ATOM 2903  H HG21 . VAL A 1 90  ? 2.945   6.271   3.632   1.00 0.00 ? 873 VAL A HG21 2  
ATOM 2904  H HG22 . VAL A 1 90  ? 1.879   4.949   3.157   1.00 0.00 ? 873 VAL A HG22 2  
ATOM 2905  H HG23 . VAL A 1 90  ? 3.112   4.688   4.390   1.00 0.00 ? 873 VAL A HG23 2  
ATOM 2906  N N    . ALA A 1 91  ? 5.430   2.495   0.950   1.00 0.00 ? 874 ALA A N    2  
ATOM 2907  C CA   . ALA A 1 91  ? 6.277   2.056   -0.152  1.00 0.00 ? 874 ALA A CA   2  
ATOM 2908  C C    . ALA A 1 91  ? 5.441   1.495   -1.297  1.00 0.00 ? 874 ALA A C    2  
ATOM 2909  O O    . ALA A 1 91  ? 4.356   0.956   -1.079  1.00 0.00 ? 874 ALA A O    2  
ATOM 2910  C CB   . ALA A 1 91  ? 7.277   1.016   0.333   1.00 0.00 ? 874 ALA A CB   2  
ATOM 2911  H H    . ALA A 1 91  ? 4.526   2.127   1.034   1.00 0.00 ? 874 ALA A H    2  
ATOM 2912  H HA   . ALA A 1 91  ? 6.830   2.913   -0.509  1.00 0.00 ? 874 ALA A HA   2  
ATOM 2913  H HB1  . ALA A 1 91  ? 6.861   0.483   1.175   1.00 0.00 ? 874 ALA A HB1  2  
ATOM 2914  H HB2  . ALA A 1 91  ? 7.488   0.321   -0.466  1.00 0.00 ? 874 ALA A HB2  2  
ATOM 2915  H HB3  . ALA A 1 91  ? 8.190   1.508   0.632   1.00 0.00 ? 874 ALA A HB3  2  
ATOM 2916  N N    . ILE A 1 92  ? 5.953   1.625   -2.516  1.00 0.00 ? 875 ILE A N    2  
ATOM 2917  C CA   . ILE A 1 92  ? 5.253   1.131   -3.695  1.00 0.00 ? 875 ILE A CA   2  
ATOM 2918  C C    . ILE A 1 92  ? 5.253   -0.393  -3.735  1.00 0.00 ? 875 ILE A C    2  
ATOM 2919  O O    . ILE A 1 92  ? 6.307   -1.022  -3.828  1.00 0.00 ? 875 ILE A O    2  
ATOM 2920  C CB   . ILE A 1 92  ? 5.886   1.668   -4.992  1.00 0.00 ? 875 ILE A CB   2  
ATOM 2921  C CG1  . ILE A 1 92  ? 5.970   3.195   -4.951  1.00 0.00 ? 875 ILE A CG1  2  
ATOM 2922  C CG2  . ILE A 1 92  ? 5.086   1.208   -6.202  1.00 0.00 ? 875 ILE A CG2  2  
ATOM 2923  C CD1  . ILE A 1 92  ? 4.637   3.867   -4.707  1.00 0.00 ? 875 ILE A CD1  2  
ATOM 2924  H H    . ILE A 1 92  ? 6.822   2.064   -2.625  1.00 0.00 ? 875 ILE A H    2  
ATOM 2925  H HA   . ILE A 1 92  ? 4.231   1.479   -3.646  1.00 0.00 ? 875 ILE A HA   2  
ATOM 2926  H HB   . ILE A 1 92  ? 6.882   1.262   -5.075  1.00 0.00 ? 875 ILE A HB   2  
ATOM 2927  H HG12 . ILE A 1 92  ? 6.640   3.491   -4.159  1.00 0.00 ? 875 ILE A HG12 2  
ATOM 2928  H HG13 . ILE A 1 92  ? 6.355   3.552   -5.895  1.00 0.00 ? 875 ILE A HG13 2  
ATOM 2929  H HG21 . ILE A 1 92  ? 5.347   1.814   -7.057  1.00 0.00 ? 875 ILE A HG21 2  
ATOM 2930  H HG22 . ILE A 1 92  ? 5.313   0.174   -6.412  1.00 0.00 ? 875 ILE A HG22 2  
ATOM 2931  H HG23 . ILE A 1 92  ? 4.031   1.311   -5.996  1.00 0.00 ? 875 ILE A HG23 2  
ATOM 2932  H HD11 . ILE A 1 92  ? 4.388   3.805   -3.658  1.00 0.00 ? 875 ILE A HD11 2  
ATOM 2933  H HD12 . ILE A 1 92  ? 4.696   4.903   -5.004  1.00 0.00 ? 875 ILE A HD12 2  
ATOM 2934  H HD13 . ILE A 1 92  ? 3.872   3.370   -5.287  1.00 0.00 ? 875 ILE A HD13 2  
ATOM 2935  N N    . SER A 1 93  ? 4.063   -0.982  -3.667  1.00 0.00 ? 876 SER A N    2  
ATOM 2936  C CA   . SER A 1 93  ? 3.926   -2.433  -3.694  1.00 0.00 ? 876 SER A CA   2  
ATOM 2937  C C    . SER A 1 93  ? 4.617   -3.022  -4.920  1.00 0.00 ? 876 SER A C    2  
ATOM 2938  O O    . SER A 1 93  ? 4.056   -3.037  -6.015  1.00 0.00 ? 876 SER A O    2  
ATOM 2939  C CB   . SER A 1 93  ? 2.447   -2.827  -3.690  1.00 0.00 ? 876 SER A CB   2  
ATOM 2940  O OG   . SER A 1 93  ? 1.958   -2.959  -2.366  1.00 0.00 ? 876 SER A OG   2  
ATOM 2941  H H    . SER A 1 93  ? 3.259   -0.426  -3.595  1.00 0.00 ? 876 SER A H    2  
ATOM 2942  H HA   . SER A 1 93  ? 4.397   -2.827  -2.806  1.00 0.00 ? 876 SER A HA   2  
ATOM 2943  H HB2  . SER A 1 93  ? 1.873   -2.067  -4.198  1.00 0.00 ? 876 SER A HB2  2  
ATOM 2944  H HB3  . SER A 1 93  ? 2.327   -3.771  -4.201  1.00 0.00 ? 876 SER A HB3  2  
ATOM 2945  H HG   . SER A 1 93  ? 2.254   -2.213  -1.840  1.00 0.00 ? 876 SER A HG   2  
ATOM 2946  N N    . ASN A 1 94  ? 5.839   -3.507  -4.727  1.00 0.00 ? 877 ASN A N    2  
ATOM 2947  C CA   . ASN A 1 94  ? 6.608   -4.097  -5.817  1.00 0.00 ? 877 ASN A CA   2  
ATOM 2948  C C    . ASN A 1 94  ? 7.740   -4.965  -5.275  1.00 0.00 ? 877 ASN A C    2  
ATOM 2949  O O    . ASN A 1 94  ? 8.546   -4.515  -4.460  1.00 0.00 ? 877 ASN A O    2  
ATOM 2950  C CB   . ASN A 1 94  ? 7.178   -3.000  -6.718  1.00 0.00 ? 877 ASN A CB   2  
ATOM 2951  C CG   . ASN A 1 94  ? 8.288   -3.509  -7.618  1.00 0.00 ? 877 ASN A CG   2  
ATOM 2952  O OD1  . ASN A 1 94  ? 8.071   -3.777  -8.799  1.00 0.00 ? 877 ASN A OD1  2  
ATOM 2953  N ND2  . ASN A 1 94  ? 9.485   -3.646  -7.060  1.00 0.00 ? 877 ASN A ND2  2  
ATOM 2954  H H    . ASN A 1 94  ? 6.233   -3.467  -3.831  1.00 0.00 ? 877 ASN A H    2  
ATOM 2955  H HA   . ASN A 1 94  ? 5.941   -4.716  -6.396  1.00 0.00 ? 877 ASN A HA   2  
ATOM 2956  H HB2  . ASN A 1 94  ? 6.388   -2.608  -7.342  1.00 0.00 ? 877 ASN A HB2  2  
ATOM 2957  H HB3  . ASN A 1 94  ? 7.573   -2.205  -6.103  1.00 0.00 ? 877 ASN A HB3  2  
ATOM 2958  H HD21 . ASN A 1 94  ? 9.584   -3.414  -6.113  1.00 0.00 ? 877 ASN A HD21 2  
ATOM 2959  H HD22 . ASN A 1 94  ? 10.221  -3.973  -7.619  1.00 0.00 ? 877 ASN A HD22 2  
ATOM 2960  N N    . SER A 1 95  ? 7.795   -6.211  -5.735  1.00 0.00 ? 878 SER A N    2  
ATOM 2961  C CA   . SER A 1 95  ? 8.826   -7.143  -5.295  1.00 0.00 ? 878 SER A CA   2  
ATOM 2962  C C    . SER A 1 95  ? 9.632   -7.661  -6.482  1.00 0.00 ? 878 SER A C    2  
ATOM 2963  O O    . SER A 1 95  ? 9.232   -8.612  -7.152  1.00 0.00 ? 878 SER A O    2  
ATOM 2964  C CB   . SER A 1 95  ? 8.195   -8.316  -4.542  1.00 0.00 ? 878 SER A CB   2  
ATOM 2965  O OG   . SER A 1 95  ? 9.189   -9.156  -3.980  1.00 0.00 ? 878 SER A OG   2  
ATOM 2966  H H    . SER A 1 95  ? 7.124   -6.510  -6.384  1.00 0.00 ? 878 SER A H    2  
ATOM 2967  H HA   . SER A 1 95  ? 9.489   -6.614  -4.628  1.00 0.00 ? 878 SER A HA   2  
ATOM 2968  H HB2  . SER A 1 95  ? 7.570   -7.937  -3.748  1.00 0.00 ? 878 SER A HB2  2  
ATOM 2969  H HB3  . SER A 1 95  ? 7.594   -8.898  -5.226  1.00 0.00 ? 878 SER A HB3  2  
ATOM 2970  H HG   . SER A 1 95  ? 8.804   -10.008 -3.766  1.00 0.00 ? 878 SER A HG   2  
ATOM 2971  N N    . GLY A 1 96  ? 10.773  -7.027  -6.737  1.00 0.00 ? 879 GLY A N    2  
ATOM 2972  C CA   . GLY A 1 96  ? 11.618  -7.436  -7.843  1.00 0.00 ? 879 GLY A CA   2  
ATOM 2973  C C    . GLY A 1 96  ? 13.082  -7.510  -7.458  1.00 0.00 ? 879 GLY A C    2  
ATOM 2974  O O    . GLY A 1 96  ? 13.431  -7.639  -6.284  1.00 0.00 ? 879 GLY A O    2  
ATOM 2975  H H    . GLY A 1 96  ? 11.042  -6.274  -6.170  1.00 0.00 ? 879 GLY A H    2  
ATOM 2976  H HA2  . GLY A 1 96  ? 11.297  -8.408  -8.187  1.00 0.00 ? 879 GLY A HA2  2  
ATOM 2977  H HA3  . GLY A 1 96  ? 11.506  -6.726  -8.649  1.00 0.00 ? 879 GLY A HA3  2  
ATOM 2978  N N    . PRO A 1 97  ? 13.968  -7.428  -8.462  1.00 0.00 ? 880 PRO A N    2  
ATOM 2979  C CA   . PRO A 1 97  ? 15.416  -7.486  -8.246  1.00 0.00 ? 880 PRO A CA   2  
ATOM 2980  C C    . PRO A 1 97  ? 15.948  -6.240  -7.546  1.00 0.00 ? 880 PRO A C    2  
ATOM 2981  O O    . PRO A 1 97  ? 15.820  -5.127  -8.056  1.00 0.00 ? 880 PRO A O    2  
ATOM 2982  C CB   . PRO A 1 97  ? 15.982  -7.584  -9.665  1.00 0.00 ? 880 PRO A CB   2  
ATOM 2983  C CG   . PRO A 1 97  ? 14.943  -6.960  -10.532 1.00 0.00 ? 880 PRO A CG   2  
ATOM 2984  C CD   . PRO A 1 97  ? 13.622  -7.273  -9.885  1.00 0.00 ? 880 PRO A CD   2  
ATOM 2985  H HA   . PRO A 1 97  ? 15.699  -8.362  -7.682  1.00 0.00 ? 880 PRO A HA   2  
ATOM 2986  H HB2  . PRO A 1 97  ? 16.919  -7.046  -9.720  1.00 0.00 ? 880 PRO A HB2  2  
ATOM 2987  H HB3  . PRO A 1 97  ? 16.140  -8.621  -9.922  1.00 0.00 ? 880 PRO A HB3  2  
ATOM 2988  H HG2  . PRO A 1 97  ? 15.095  -5.893  -10.577 1.00 0.00 ? 880 PRO A HG2  2  
ATOM 2989  H HG3  . PRO A 1 97  ? 14.986  -7.389  -11.522 1.00 0.00 ? 880 PRO A HG3  2  
ATOM 2990  H HD2  . PRO A 1 97  ? 12.930  -6.457  -10.027 1.00 0.00 ? 880 PRO A HD2  2  
ATOM 2991  H HD3  . PRO A 1 97  ? 13.215  -8.191  -10.284 1.00 0.00 ? 880 PRO A HD3  2  
ATOM 2992  N N    . SER A 1 98  ? 16.546  -6.434  -6.375  1.00 0.00 ? 881 SER A N    2  
ATOM 2993  C CA   . SER A 1 98  ? 17.094  -5.325  -5.603  1.00 0.00 ? 881 SER A CA   2  
ATOM 2994  C C    . SER A 1 98  ? 18.129  -5.822  -4.598  1.00 0.00 ? 881 SER A C    2  
ATOM 2995  O O    . SER A 1 98  ? 17.829  -6.651  -3.740  1.00 0.00 ? 881 SER A O    2  
ATOM 2996  C CB   . SER A 1 98  ? 15.974  -4.581  -4.873  1.00 0.00 ? 881 SER A CB   2  
ATOM 2997  O OG   . SER A 1 98  ? 16.495  -3.756  -3.846  1.00 0.00 ? 881 SER A OG   2  
ATOM 2998  H H    . SER A 1 98  ? 16.617  -7.345  -6.020  1.00 0.00 ? 881 SER A H    2  
ATOM 2999  H HA   . SER A 1 98  ? 17.575  -4.647  -6.292  1.00 0.00 ? 881 SER A HA   2  
ATOM 3000  H HB2  . SER A 1 98  ? 15.437  -3.964  -5.577  1.00 0.00 ? 881 SER A HB2  2  
ATOM 3001  H HB3  . SER A 1 98  ? 15.296  -5.299  -4.433  1.00 0.00 ? 881 SER A HB3  2  
ATOM 3002  H HG   . SER A 1 98  ? 16.575  -4.264  -3.035  1.00 0.00 ? 881 SER A HG   2  
ATOM 3003  N N    . SER A 1 99  ? 19.350  -5.308  -4.713  1.00 0.00 ? 882 SER A N    2  
ATOM 3004  C CA   . SER A 1 99  ? 20.432  -5.701  -3.818  1.00 0.00 ? 882 SER A CA   2  
ATOM 3005  C C    . SER A 1 99  ? 20.959  -4.498  -3.041  1.00 0.00 ? 882 SER A C    2  
ATOM 3006  O O    . SER A 1 99  ? 21.072  -4.537  -1.817  1.00 0.00 ? 882 SER A O    2  
ATOM 3007  C CB   . SER A 1 99  ? 21.568  -6.349  -4.611  1.00 0.00 ? 882 SER A CB   2  
ATOM 3008  O OG   . SER A 1 99  ? 22.004  -5.503  -5.661  1.00 0.00 ? 882 SER A OG   2  
ATOM 3009  H H    . SER A 1 99  ? 19.527  -4.650  -5.418  1.00 0.00 ? 882 SER A H    2  
ATOM 3010  H HA   . SER A 1 99  ? 20.037  -6.422  -3.117  1.00 0.00 ? 882 SER A HA   2  
ATOM 3011  H HB2  . SER A 1 99  ? 22.400  -6.541  -3.951  1.00 0.00 ? 882 SER A HB2  2  
ATOM 3012  H HB3  . SER A 1 99  ? 21.222  -7.280  -5.035  1.00 0.00 ? 882 SER A HB3  2  
ATOM 3013  H HG   . SER A 1 99  ? 21.605  -5.786  -6.487  1.00 0.00 ? 882 SER A HG   2  
ATOM 3014  N N    . GLY A 1 100 ? 21.281  -3.430  -3.765  1.00 0.00 ? 883 GLY A N    2  
ATOM 3015  C CA   . GLY A 1 100 ? 21.792  -2.230  -3.128  1.00 0.00 ? 883 GLY A CA   2  
ATOM 3016  C C    . GLY A 1 100 ? 22.731  -1.451  -4.029  1.00 0.00 ? 883 GLY A C    2  
ATOM 3017  O O    . GLY A 1 100 ? 23.914  -1.304  -3.724  1.00 0.00 ? 883 GLY A O    2  
ATOM 3018  H H    . GLY A 1 100 ? 21.170  -3.457  -4.738  1.00 0.00 ? 883 GLY A H    2  
ATOM 3019  H HA2  . GLY A 1 100 ? 20.961  -1.597  -2.858  1.00 0.00 ? 883 GLY A HA2  2  
ATOM 3020  H HA3  . GLY A 1 100 ? 22.325  -2.512  -2.231  1.00 0.00 ? 883 GLY A HA3  2  
ATOM 3021  N N    . GLY A 1 1   ? 18.388  6.551   -8.897  1.00 0.00 ? 784 GLY A N    3  
ATOM 3022  C CA   . GLY A 1 1   ? 17.724  6.836   -10.155 1.00 0.00 ? 784 GLY A CA   3  
ATOM 3023  C C    . GLY A 1 1   ? 16.246  7.124   -9.978  1.00 0.00 ? 784 GLY A C    3  
ATOM 3024  O O    . GLY A 1 1   ? 15.422  6.210   -9.997  1.00 0.00 ? 784 GLY A O    3  
ATOM 3025  H H1   . GLY A 1 1   ? 19.349  6.354   -8.886  1.00 0.00 ? 784 GLY A H1   3  
ATOM 3026  H HA2  . GLY A 1 1   ? 18.195  7.693   -10.613 1.00 0.00 ? 784 GLY A HA2  3  
ATOM 3027  H HA3  . GLY A 1 1   ? 17.837  5.984   -10.810 1.00 0.00 ? 784 GLY A HA3  3  
ATOM 3028  N N    . SER A 1 2   ? 15.910  8.398   -9.805  1.00 0.00 ? 785 SER A N    3  
ATOM 3029  C CA   . SER A 1 2   ? 14.522  8.804   -9.618  1.00 0.00 ? 785 SER A CA   3  
ATOM 3030  C C    . SER A 1 2   ? 13.634  8.221   -10.713 1.00 0.00 ? 785 SER A C    3  
ATOM 3031  O O    . SER A 1 2   ? 13.851  8.466   -11.900 1.00 0.00 ? 785 SER A O    3  
ATOM 3032  C CB   . SER A 1 2   ? 14.411  10.330  -9.614  1.00 0.00 ? 785 SER A CB   3  
ATOM 3033  O OG   . SER A 1 2   ? 14.787  10.872  -10.868 1.00 0.00 ? 785 SER A OG   3  
ATOM 3034  H H    . SER A 1 2   ? 16.613  9.081   -9.800  1.00 0.00 ? 785 SER A H    3  
ATOM 3035  H HA   . SER A 1 2   ? 14.192  8.425   -8.663  1.00 0.00 ? 785 SER A HA   3  
ATOM 3036  H HB2  . SER A 1 2   ? 13.391  10.614  -9.404  1.00 0.00 ? 785 SER A HB2  3  
ATOM 3037  H HB3  . SER A 1 2   ? 15.061  10.733  -8.851  1.00 0.00 ? 785 SER A HB3  3  
ATOM 3038  H HG   . SER A 1 2   ? 15.566  11.423  -10.759 1.00 0.00 ? 785 SER A HG   3  
ATOM 3039  N N    . SER A 1 3   ? 12.632  7.449   -10.305 1.00 0.00 ? 786 SER A N    3  
ATOM 3040  C CA   . SER A 1 3   ? 11.712  6.827   -11.250 1.00 0.00 ? 786 SER A CA   3  
ATOM 3041  C C    . SER A 1 3   ? 10.780  7.867   -11.865 1.00 0.00 ? 786 SER A C    3  
ATOM 3042  O O    . SER A 1 3   ? 10.483  8.891   -11.251 1.00 0.00 ? 786 SER A O    3  
ATOM 3043  C CB   . SER A 1 3   ? 10.892  5.738   -10.555 1.00 0.00 ? 786 SER A CB   3  
ATOM 3044  O OG   . SER A 1 3   ? 10.278  4.881   -11.501 1.00 0.00 ? 786 SER A OG   3  
ATOM 3045  H H    . SER A 1 3   ? 12.511  7.292   -9.345  1.00 0.00 ? 786 SER A H    3  
ATOM 3046  H HA   . SER A 1 3   ? 12.299  6.377   -12.037 1.00 0.00 ? 786 SER A HA   3  
ATOM 3047  H HB2  . SER A 1 3   ? 11.541  5.151   -9.923  1.00 0.00 ? 786 SER A HB2  3  
ATOM 3048  H HB3  . SER A 1 3   ? 10.124  6.200   -9.952  1.00 0.00 ? 786 SER A HB3  3  
ATOM 3049  H HG   . SER A 1 3   ? 9.570   4.390   -11.076 1.00 0.00 ? 786 SER A HG   3  
ATOM 3050  N N    . GLY A 1 4   ? 10.322  7.595   -13.083 1.00 0.00 ? 787 GLY A N    3  
ATOM 3051  C CA   . GLY A 1 4   ? 9.429   8.516   -13.762 1.00 0.00 ? 787 GLY A CA   3  
ATOM 3052  C C    . GLY A 1 4   ? 9.904   8.859   -15.161 1.00 0.00 ? 787 GLY A C    3  
ATOM 3053  O O    . GLY A 1 4   ? 9.829   10.013  -15.583 1.00 0.00 ? 787 GLY A O    3  
ATOM 3054  H H    . GLY A 1 4   ? 10.593  6.763   -13.525 1.00 0.00 ? 787 GLY A H    3  
ATOM 3055  H HA2  . GLY A 1 4   ? 8.449   8.068   -13.826 1.00 0.00 ? 787 GLY A HA2  3  
ATOM 3056  H HA3  . GLY A 1 4   ? 9.361   9.426   -13.184 1.00 0.00 ? 787 GLY A HA3  3  
ATOM 3057  N N    . SER A 1 5   ? 10.394  7.855   -15.880 1.00 0.00 ? 788 SER A N    3  
ATOM 3058  C CA   . SER A 1 5   ? 10.888  8.057   -17.238 1.00 0.00 ? 788 SER A CA   3  
ATOM 3059  C C    . SER A 1 5   ? 9.774   7.844   -18.258 1.00 0.00 ? 788 SER A C    3  
ATOM 3060  O O    . SER A 1 5   ? 9.164   6.776   -18.314 1.00 0.00 ? 788 SER A O    3  
ATOM 3061  C CB   . SER A 1 5   ? 12.050  7.105   -17.527 1.00 0.00 ? 788 SER A CB   3  
ATOM 3062  O OG   . SER A 1 5   ? 12.866  7.600   -18.574 1.00 0.00 ? 788 SER A OG   3  
ATOM 3063  H H    . SER A 1 5   ? 10.427  6.957   -15.488 1.00 0.00 ? 788 SER A H    3  
ATOM 3064  H HA   . SER A 1 5   ? 11.240  9.075   -17.314 1.00 0.00 ? 788 SER A HA   3  
ATOM 3065  H HB2  . SER A 1 5   ? 12.652  6.995   -16.638 1.00 0.00 ? 788 SER A HB2  3  
ATOM 3066  H HB3  . SER A 1 5   ? 11.658  6.141   -17.818 1.00 0.00 ? 788 SER A HB3  3  
ATOM 3067  H HG   . SER A 1 5   ? 12.875  8.560   -18.546 1.00 0.00 ? 788 SER A HG   3  
ATOM 3068  N N    . SER A 1 6   ? 9.515   8.868   -19.064 1.00 0.00 ? 789 SER A N    3  
ATOM 3069  C CA   . SER A 1 6   ? 8.472   8.796   -20.081 1.00 0.00 ? 789 SER A CA   3  
ATOM 3070  C C    . SER A 1 6   ? 9.005   8.159   -21.361 1.00 0.00 ? 789 SER A C    3  
ATOM 3071  O O    . SER A 1 6   ? 9.898   8.700   -22.012 1.00 0.00 ? 789 SER A O    3  
ATOM 3072  C CB   . SER A 1 6   ? 7.926   10.193  -20.383 1.00 0.00 ? 789 SER A CB   3  
ATOM 3073  O OG   . SER A 1 6   ? 6.993   10.157  -21.448 1.00 0.00 ? 789 SER A OG   3  
ATOM 3074  H H    . SER A 1 6   ? 10.035  9.693   -18.971 1.00 0.00 ? 789 SER A H    3  
ATOM 3075  H HA   . SER A 1 6   ? 7.673   8.182   -19.693 1.00 0.00 ? 789 SER A HA   3  
ATOM 3076  H HB2  . SER A 1 6   ? 7.436   10.582  -19.503 1.00 0.00 ? 789 SER A HB2  3  
ATOM 3077  H HB3  . SER A 1 6   ? 8.743   10.844  -20.657 1.00 0.00 ? 789 SER A HB3  3  
ATOM 3078  H HG   . SER A 1 6   ? 6.815   11.051  -21.749 1.00 0.00 ? 789 SER A HG   3  
ATOM 3079  N N    . GLY A 1 7   ? 8.450   7.004   -21.715 1.00 0.00 ? 790 GLY A N    3  
ATOM 3080  C CA   . GLY A 1 7   ? 8.881   6.311   -22.915 1.00 0.00 ? 790 GLY A CA   3  
ATOM 3081  C C    . GLY A 1 7   ? 8.008   5.114   -23.239 1.00 0.00 ? 790 GLY A C    3  
ATOM 3082  O O    . GLY A 1 7   ? 8.295   3.995   -22.816 1.00 0.00 ? 790 GLY A O    3  
ATOM 3083  H H    . GLY A 1 7   ? 7.742   6.619   -21.157 1.00 0.00 ? 790 GLY A H    3  
ATOM 3084  H HA2  . GLY A 1 7   ? 8.852   7.000   -23.746 1.00 0.00 ? 790 GLY A HA2  3  
ATOM 3085  H HA3  . GLY A 1 7   ? 9.897   5.973   -22.776 1.00 0.00 ? 790 GLY A HA3  3  
ATOM 3086  N N    . VAL A 1 8   ? 6.938   5.351   -23.992 1.00 0.00 ? 791 VAL A N    3  
ATOM 3087  C CA   . VAL A 1 8   ? 6.020   4.284   -24.372 1.00 0.00 ? 791 VAL A CA   3  
ATOM 3088  C C    . VAL A 1 8   ? 6.234   3.866   -25.822 1.00 0.00 ? 791 VAL A C    3  
ATOM 3089  O O    . VAL A 1 8   ? 5.277   3.610   -26.553 1.00 0.00 ? 791 VAL A O    3  
ATOM 3090  C CB   . VAL A 1 8   ? 4.553   4.713   -24.184 1.00 0.00 ? 791 VAL A CB   3  
ATOM 3091  C CG1  . VAL A 1 8   ? 4.274   5.038   -22.724 1.00 0.00 ? 791 VAL A CG1  3  
ATOM 3092  C CG2  . VAL A 1 8   ? 4.227   5.902   -25.075 1.00 0.00 ? 791 VAL A CG2  3  
ATOM 3093  H H    . VAL A 1 8   ? 6.763   6.265   -24.299 1.00 0.00 ? 791 VAL A H    3  
ATOM 3094  H HA   . VAL A 1 8   ? 6.210   3.436   -23.731 1.00 0.00 ? 791 VAL A HA   3  
ATOM 3095  H HB   . VAL A 1 8   ? 3.918   3.889   -24.473 1.00 0.00 ? 791 VAL A HB   3  
ATOM 3096  H HG11 . VAL A 1 8   ? 4.779   4.321   -22.093 1.00 0.00 ? 791 VAL A HG11 3  
ATOM 3097  H HG12 . VAL A 1 8   ? 4.633   6.032   -22.501 1.00 0.00 ? 791 VAL A HG12 3  
ATOM 3098  H HG13 . VAL A 1 8   ? 3.210   4.990   -22.542 1.00 0.00 ? 791 VAL A HG13 3  
ATOM 3099  H HG21 . VAL A 1 8   ? 4.777   5.819   -26.000 1.00 0.00 ? 791 VAL A HG21 3  
ATOM 3100  H HG22 . VAL A 1 8   ? 3.168   5.915   -25.286 1.00 0.00 ? 791 VAL A HG22 3  
ATOM 3101  H HG23 . VAL A 1 8   ? 4.504   6.816   -24.571 1.00 0.00 ? 791 VAL A HG23 3  
ATOM 3102  N N    . PHE A 1 9   ? 7.496   3.797   -26.233 1.00 0.00 ? 792 PHE A N    3  
ATOM 3103  C CA   . PHE A 1 9   ? 7.836   3.410   -27.597 1.00 0.00 ? 792 PHE A CA   3  
ATOM 3104  C C    . PHE A 1 9   ? 7.156   2.098   -27.975 1.00 0.00 ? 792 PHE A C    3  
ATOM 3105  O O    . PHE A 1 9   ? 6.534   1.991   -29.032 1.00 0.00 ? 792 PHE A O    3  
ATOM 3106  C CB   . PHE A 1 9   ? 9.353   3.274   -27.747 1.00 0.00 ? 792 PHE A CB   3  
ATOM 3107  C CG   . PHE A 1 9   ? 10.052  4.583   -27.978 1.00 0.00 ? 792 PHE A CG   3  
ATOM 3108  C CD1  . PHE A 1 9   ? 10.156  5.113   -29.254 1.00 0.00 ? 792 PHE A CD1  3  
ATOM 3109  C CD2  . PHE A 1 9   ? 10.607  5.283   -26.919 1.00 0.00 ? 792 PHE A CD2  3  
ATOM 3110  C CE1  . PHE A 1 9   ? 10.799  6.317   -29.469 1.00 0.00 ? 792 PHE A CE1  3  
ATOM 3111  C CE2  . PHE A 1 9   ? 11.250  6.488   -27.128 1.00 0.00 ? 792 PHE A CE2  3  
ATOM 3112  C CZ   . PHE A 1 9   ? 11.348  7.005   -28.405 1.00 0.00 ? 792 PHE A CZ   3  
ATOM 3113  H H    . PHE A 1 9   ? 8.216   4.013   -25.603 1.00 0.00 ? 792 PHE A H    3  
ATOM 3114  H HA   . PHE A 1 9   ? 7.486   4.187   -28.258 1.00 0.00 ? 792 PHE A HA   3  
ATOM 3115  H HB2  . PHE A 1 9   ? 9.759   2.835   -26.848 1.00 0.00 ? 792 PHE A HB2  3  
ATOM 3116  H HB3  . PHE A 1 9   ? 9.567   2.629   -28.586 1.00 0.00 ? 792 PHE A HB3  3  
ATOM 3117  H HD1  . PHE A 1 9   ? 9.727   4.575   -30.088 1.00 0.00 ? 792 PHE A HD1  3  
ATOM 3118  H HD2  . PHE A 1 9   ? 10.532  4.879   -25.919 1.00 0.00 ? 792 PHE A HD2  3  
ATOM 3119  H HE1  . PHE A 1 9   ? 10.873  6.718   -30.469 1.00 0.00 ? 792 PHE A HE1  3  
ATOM 3120  H HE2  . PHE A 1 9   ? 11.679  7.024   -26.294 1.00 0.00 ? 792 PHE A HE2  3  
ATOM 3121  H HZ   . PHE A 1 9   ? 11.849  7.947   -28.571 1.00 0.00 ? 792 PHE A HZ   3  
ATOM 3122  N N    . ARG A 1 10  ? 7.280   1.101   -27.104 1.00 0.00 ? 793 ARG A N    3  
ATOM 3123  C CA   . ARG A 1 10  ? 6.679   -0.205  -27.347 1.00 0.00 ? 793 ARG A CA   3  
ATOM 3124  C C    . ARG A 1 10  ? 5.852   -0.654  -26.147 1.00 0.00 ? 793 ARG A C    3  
ATOM 3125  O O    . ARG A 1 10  ? 6.112   -0.250  -25.014 1.00 0.00 ? 793 ARG A O    3  
ATOM 3126  C CB   . ARG A 1 10  ? 7.764   -1.240  -27.649 1.00 0.00 ? 793 ARG A CB   3  
ATOM 3127  C CG   . ARG A 1 10  ? 7.226   -2.649  -27.836 1.00 0.00 ? 793 ARG A CG   3  
ATOM 3128  C CD   . ARG A 1 10  ? 8.220   -3.532  -28.575 1.00 0.00 ? 793 ARG A CD   3  
ATOM 3129  N NE   . ARG A 1 10  ? 7.569   -4.671  -29.217 1.00 0.00 ? 793 ARG A NE   3  
ATOM 3130  C CZ   . ARG A 1 10  ? 8.212   -5.558  -29.967 1.00 0.00 ? 793 ARG A CZ   3  
ATOM 3131  N NH1  . ARG A 1 10  ? 9.517   -5.438  -30.169 1.00 0.00 ? 793 ARG A NH1  3  
ATOM 3132  N NH2  . ARG A 1 10  ? 7.551   -6.568  -30.518 1.00 0.00 ? 793 ARG A NH2  3  
ATOM 3133  H H    . ARG A 1 10  ? 7.788   1.248   -26.279 1.00 0.00 ? 793 ARG A H    3  
ATOM 3134  H HA   . ARG A 1 10  ? 6.029   -0.117  -28.205 1.00 0.00 ? 793 ARG A HA   3  
ATOM 3135  H HB2  . ARG A 1 10  ? 8.279   -0.952  -28.554 1.00 0.00 ? 793 ARG A HB2  3  
ATOM 3136  H HB3  . ARG A 1 10  ? 8.469   -1.254  -26.832 1.00 0.00 ? 793 ARG A HB3  3  
ATOM 3137  H HG2  . ARG A 1 10  ? 7.029   -3.082  -26.867 1.00 0.00 ? 793 ARG A HG2  3  
ATOM 3138  H HG3  . ARG A 1 10  ? 6.308   -2.601  -28.404 1.00 0.00 ? 793 ARG A HG3  3  
ATOM 3139  H HD2  . ARG A 1 10  ? 8.714   -2.940  -29.331 1.00 0.00 ? 793 ARG A HD2  3  
ATOM 3140  H HD3  . ARG A 1 10  ? 8.950   -3.897  -27.869 1.00 0.00 ? 793 ARG A HD3  3  
ATOM 3141  H HE   . ARG A 1 10  ? 6.605   -4.779  -29.081 1.00 0.00 ? 793 ARG A HE   3  
ATOM 3142  H HH11 . ARG A 1 10  ? 10.019  -4.679  -29.755 1.00 0.00 ? 793 ARG A HH11 3  
ATOM 3143  H HH12 . ARG A 1 10  ? 10.000  -6.108  -30.734 1.00 0.00 ? 793 ARG A HH12 3  
ATOM 3144  H HH21 . ARG A 1 10  ? 6.567   -6.662  -30.367 1.00 0.00 ? 793 ARG A HH21 3  
ATOM 3145  H HH22 . ARG A 1 10  ? 8.036   -7.235  -31.082 1.00 0.00 ? 793 ARG A HH22 3  
ATOM 3146  N N    . TYR A 1 11  ? 4.853   -1.492  -26.404 1.00 0.00 ? 794 TYR A N    3  
ATOM 3147  C CA   . TYR A 1 11  ? 3.985   -1.994  -25.345 1.00 0.00 ? 794 TYR A CA   3  
ATOM 3148  C C    . TYR A 1 11  ? 4.104   -3.510  -25.217 1.00 0.00 ? 794 TYR A C    3  
ATOM 3149  O O    . TYR A 1 11  ? 3.414   -4.259  -25.908 1.00 0.00 ? 794 TYR A O    3  
ATOM 3150  C CB   . TYR A 1 11  ? 2.532   -1.607  -25.622 1.00 0.00 ? 794 TYR A CB   3  
ATOM 3151  C CG   . TYR A 1 11  ? 1.684   -1.504  -24.374 1.00 0.00 ? 794 TYR A CG   3  
ATOM 3152  C CD1  . TYR A 1 11  ? 1.845   -0.448  -23.486 1.00 0.00 ? 794 TYR A CD1  3  
ATOM 3153  C CD2  . TYR A 1 11  ? 0.722   -2.464  -24.083 1.00 0.00 ? 794 TYR A CD2  3  
ATOM 3154  C CE1  . TYR A 1 11  ? 1.073   -0.351  -22.344 1.00 0.00 ? 794 TYR A CE1  3  
ATOM 3155  C CE2  . TYR A 1 11  ? -0.055  -2.374  -22.944 1.00 0.00 ? 794 TYR A CE2  3  
ATOM 3156  C CZ   . TYR A 1 11  ? 0.125   -1.316  -22.078 1.00 0.00 ? 794 TYR A CZ   3  
ATOM 3157  O OH   . TYR A 1 11  ? -0.647  -1.222  -20.943 1.00 0.00 ? 794 TYR A OH   3  
ATOM 3158  H H    . TYR A 1 11  ? 4.695   -1.779  -27.327 1.00 0.00 ? 794 TYR A H    3  
ATOM 3159  H HA   . TYR A 1 11  ? 4.298   -1.540  -24.416 1.00 0.00 ? 794 TYR A HA   3  
ATOM 3160  H HB2  . TYR A 1 11  ? 2.510   -0.648  -26.116 1.00 0.00 ? 794 TYR A HB2  3  
ATOM 3161  H HB3  . TYR A 1 11  ? 2.085   -2.349  -26.267 1.00 0.00 ? 794 TYR A HB3  3  
ATOM 3162  H HD1  . TYR A 1 11  ? 2.588   0.307   -23.698 1.00 0.00 ? 794 TYR A HD1  3  
ATOM 3163  H HD2  . TYR A 1 11  ? 0.584   -3.292  -24.764 1.00 0.00 ? 794 TYR A HD2  3  
ATOM 3164  H HE1  . TYR A 1 11  ? 1.213   0.478   -21.666 1.00 0.00 ? 794 TYR A HE1  3  
ATOM 3165  H HE2  . TYR A 1 11  ? -0.797  -3.130  -22.735 1.00 0.00 ? 794 TYR A HE2  3  
ATOM 3166  H HH   . TYR A 1 11  ? -0.103  -1.399  -20.171 1.00 0.00 ? 794 TYR A HH   3  
ATOM 3167  N N    . SER A 1 12  ? 4.984   -3.955  -24.325 1.00 0.00 ? 795 SER A N    3  
ATOM 3168  C CA   . SER A 1 12  ? 5.196   -5.381  -24.106 1.00 0.00 ? 795 SER A CA   3  
ATOM 3169  C C    . SER A 1 12  ? 4.278   -5.904  -23.006 1.00 0.00 ? 795 SER A C    3  
ATOM 3170  O O    . SER A 1 12  ? 3.394   -6.724  -23.256 1.00 0.00 ? 795 SER A O    3  
ATOM 3171  C CB   . SER A 1 12  ? 6.657   -5.650  -23.739 1.00 0.00 ? 795 SER A CB   3  
ATOM 3172  O OG   . SER A 1 12  ? 7.509   -5.446  -24.853 1.00 0.00 ? 795 SER A OG   3  
ATOM 3173  H H    . SER A 1 12  ? 5.504   -3.308  -23.804 1.00 0.00 ? 795 SER A H    3  
ATOM 3174  H HA   . SER A 1 12  ? 4.965   -5.895  -25.027 1.00 0.00 ? 795 SER A HA   3  
ATOM 3175  H HB2  . SER A 1 12  ? 6.955   -4.981  -22.946 1.00 0.00 ? 795 SER A HB2  3  
ATOM 3176  H HB3  . SER A 1 12  ? 6.758   -6.672  -23.405 1.00 0.00 ? 795 SER A HB3  3  
ATOM 3177  H HG   . SER A 1 12  ? 7.904   -6.282  -25.111 1.00 0.00 ? 795 SER A HG   3  
ATOM 3178  N N    . THR A 1 13  ? 4.495   -5.424  -21.785 1.00 0.00 ? 796 THR A N    3  
ATOM 3179  C CA   . THR A 1 13  ? 3.689   -5.844  -20.645 1.00 0.00 ? 796 THR A CA   3  
ATOM 3180  C C    . THR A 1 13  ? 3.203   -4.642  -19.844 1.00 0.00 ? 796 THR A C    3  
ATOM 3181  O O    . THR A 1 13  ? 3.894   -3.628  -19.747 1.00 0.00 ? 796 THR A O    3  
ATOM 3182  C CB   . THR A 1 13  ? 4.479   -6.782  -19.714 1.00 0.00 ? 796 THR A CB   3  
ATOM 3183  O OG1  . THR A 1 13  ? 3.655   -7.191  -18.617 1.00 0.00 ? 796 THR A OG1  3  
ATOM 3184  C CG2  . THR A 1 13  ? 5.729   -6.094  -19.186 1.00 0.00 ? 796 THR A CG2  3  
ATOM 3185  H H    . THR A 1 13  ? 5.214   -4.773  -21.650 1.00 0.00 ? 796 THR A H    3  
ATOM 3186  H HA   . THR A 1 13  ? 2.832   -6.383  -21.023 1.00 0.00 ? 796 THR A HA   3  
ATOM 3187  H HB   . THR A 1 13  ? 4.777   -7.655  -20.276 1.00 0.00 ? 796 THR A HB   3  
ATOM 3188  H HG1  . THR A 1 13  ? 3.049   -6.481  -18.389 1.00 0.00 ? 796 THR A HG1  3  
ATOM 3189  H HG21 . THR A 1 13  ? 6.083   -6.613  -18.308 1.00 0.00 ? 796 THR A HG21 3  
ATOM 3190  H HG22 . THR A 1 13  ? 5.496   -5.071  -18.931 1.00 0.00 ? 796 THR A HG22 3  
ATOM 3191  H HG23 . THR A 1 13  ? 6.496   -6.110  -19.946 1.00 0.00 ? 796 THR A HG23 3  
ATOM 3192  N N    . SER A 1 14  ? 2.010   -4.762  -19.270 1.00 0.00 ? 797 SER A N    3  
ATOM 3193  C CA   . SER A 1 14  ? 1.430   -3.683  -18.479 1.00 0.00 ? 797 SER A CA   3  
ATOM 3194  C C    . SER A 1 14  ? 2.078   -3.611  -17.100 1.00 0.00 ? 797 SER A C    3  
ATOM 3195  O O    . SER A 1 14  ? 2.251   -4.629  -16.429 1.00 0.00 ? 797 SER A O    3  
ATOM 3196  C CB   . SER A 1 14  ? -0.080  -3.883  -18.335 1.00 0.00 ? 797 SER A CB   3  
ATOM 3197  O OG   . SER A 1 14  ? -0.695  -4.054  -19.601 1.00 0.00 ? 797 SER A OG   3  
ATOM 3198  H H    . SER A 1 14  ? 1.507   -5.596  -19.384 1.00 0.00 ? 797 SER A H    3  
ATOM 3199  H HA   . SER A 1 14  ? 1.613   -2.755  -18.999 1.00 0.00 ? 797 SER A HA   3  
ATOM 3200  H HB2  . SER A 1 14  ? -0.269  -4.760  -17.735 1.00 0.00 ? 797 SER A HB2  3  
ATOM 3201  H HB3  . SER A 1 14  ? -0.511  -3.017  -17.853 1.00 0.00 ? 797 SER A HB3  3  
ATOM 3202  H HG   . SER A 1 14  ? -0.061  -4.427  -20.217 1.00 0.00 ? 797 SER A HG   3  
ATOM 3203  N N    . LEU A 1 15  ? 2.436   -2.402  -16.684 1.00 0.00 ? 798 LEU A N    3  
ATOM 3204  C CA   . LEU A 1 15  ? 3.066   -2.195  -15.385 1.00 0.00 ? 798 LEU A CA   3  
ATOM 3205  C C    . LEU A 1 15  ? 2.046   -2.324  -14.258 1.00 0.00 ? 798 LEU A C    3  
ATOM 3206  O O    . LEU A 1 15  ? 0.852   -2.108  -14.462 1.00 0.00 ? 798 LEU A O    3  
ATOM 3207  C CB   . LEU A 1 15  ? 3.729   -0.817  -15.331 1.00 0.00 ? 798 LEU A CB   3  
ATOM 3208  C CG   . LEU A 1 15  ? 5.106   -0.710  -15.988 1.00 0.00 ? 798 LEU A CG   3  
ATOM 3209  C CD1  . LEU A 1 15  ? 4.983   -0.792  -17.502 1.00 0.00 ? 798 LEU A CD1  3  
ATOM 3210  C CD2  . LEU A 1 15  ? 5.794   0.584   -15.577 1.00 0.00 ? 798 LEU A CD2  3  
ATOM 3211  H H    . LEU A 1 15  ? 2.272   -1.628  -17.263 1.00 0.00 ? 798 LEU A H    3  
ATOM 3212  H HA   . LEU A 1 15  ? 3.822   -2.955  -15.259 1.00 0.00 ? 798 LEU A HA   3  
ATOM 3213  H HB2  . LEU A 1 15  ? 3.073   -0.115  -15.822 1.00 0.00 ? 798 LEU A HB2  3  
ATOM 3214  H HB3  . LEU A 1 15  ? 3.835   -0.542  -14.291 1.00 0.00 ? 798 LEU A HB3  3  
ATOM 3215  H HG   . LEU A 1 15  ? 5.721   -1.536  -15.658 1.00 0.00 ? 798 LEU A HG   3  
ATOM 3216  H HD11 . LEU A 1 15  ? 5.822   -0.290  -17.959 1.00 0.00 ? 798 LEU A HD11 3  
ATOM 3217  H HD12 . LEU A 1 15  ? 4.065   -0.318  -17.815 1.00 0.00 ? 798 LEU A HD12 3  
ATOM 3218  H HD13 . LEU A 1 15  ? 4.974   -1.829  -17.806 1.00 0.00 ? 798 LEU A HD13 3  
ATOM 3219  H HD21 . LEU A 1 15  ? 5.246   1.425   -15.976 1.00 0.00 ? 798 LEU A HD21 3  
ATOM 3220  H HD22 . LEU A 1 15  ? 6.802   0.594   -15.964 1.00 0.00 ? 798 LEU A HD22 3  
ATOM 3221  H HD23 . LEU A 1 15  ? 5.821   0.650   -14.499 1.00 0.00 ? 798 LEU A HD23 3  
ATOM 3222  N N    . GLU A 1 16  ? 2.526   -2.676  -13.069 1.00 0.00 ? 799 GLU A N    3  
ATOM 3223  C CA   . GLU A 1 16  ? 1.655   -2.833  -11.910 1.00 0.00 ? 799 GLU A CA   3  
ATOM 3224  C C    . GLU A 1 16  ? 2.142   -1.977  -10.745 1.00 0.00 ? 799 GLU A C    3  
ATOM 3225  O O    . GLU A 1 16  ? 2.613   -2.496  -9.733  1.00 0.00 ? 799 GLU A O    3  
ATOM 3226  C CB   . GLU A 1 16  ? 1.591   -4.302  -11.487 1.00 0.00 ? 799 GLU A CB   3  
ATOM 3227  C CG   . GLU A 1 16  ? 1.041   -5.222  -12.564 1.00 0.00 ? 799 GLU A CG   3  
ATOM 3228  C CD   . GLU A 1 16  ? -0.470  -5.339  -12.515 1.00 0.00 ? 799 GLU A CD   3  
ATOM 3229  O OE1  . GLU A 1 16  ? -1.152  -4.474  -13.103 1.00 0.00 ? 799 GLU A OE1  3  
ATOM 3230  O OE2  . GLU A 1 16  ? -0.971  -6.296  -11.888 1.00 0.00 ? 799 GLU A OE2  3  
ATOM 3231  H H    . GLU A 1 16  ? 3.488   -2.835  -12.970 1.00 0.00 ? 799 GLU A H    3  
ATOM 3232  H HA   . GLU A 1 16  ? 0.665   -2.506  -12.192 1.00 0.00 ? 799 GLU A HA   3  
ATOM 3233  H HB2  . GLU A 1 16  ? 2.586   -4.634  -11.232 1.00 0.00 ? 799 GLU A HB2  3  
ATOM 3234  H HB3  . GLU A 1 16  ? 0.959   -4.385  -10.615 1.00 0.00 ? 799 GLU A HB3  3  
ATOM 3235  H HG2  . GLU A 1 16  ? 1.325   -4.835  -13.531 1.00 0.00 ? 799 GLU A HG2  3  
ATOM 3236  H HG3  . GLU A 1 16  ? 1.467   -6.205  -12.432 1.00 0.00 ? 799 GLU A HG3  3  
ATOM 3237  N N    . LYS A 1 17  ? 2.024   -0.662  -10.894 1.00 0.00 ? 800 LYS A N    3  
ATOM 3238  C CA   . LYS A 1 17  ? 2.451   0.268   -9.855  1.00 0.00 ? 800 LYS A CA   3  
ATOM 3239  C C    . LYS A 1 17  ? 1.260   1.034   -9.289  1.00 0.00 ? 800 LYS A C    3  
ATOM 3240  O O    . LYS A 1 17  ? 1.277   2.264   -9.218  1.00 0.00 ? 800 LYS A O    3  
ATOM 3241  C CB   . LYS A 1 17  ? 3.484   1.250   -10.414 1.00 0.00 ? 800 LYS A CB   3  
ATOM 3242  C CG   . LYS A 1 17  ? 4.835   0.616   -10.696 1.00 0.00 ? 800 LYS A CG   3  
ATOM 3243  C CD   . LYS A 1 17  ? 4.851   -0.087  -12.043 1.00 0.00 ? 800 LYS A CD   3  
ATOM 3244  C CE   . LYS A 1 17  ? 6.166   -0.815  -12.276 1.00 0.00 ? 800 LYS A CE   3  
ATOM 3245  N NZ   . LYS A 1 17  ? 7.301   0.133   -12.452 1.00 0.00 ? 800 LYS A NZ   3  
ATOM 3246  H H    . LYS A 1 17  ? 1.640   -0.308  -11.724 1.00 0.00 ? 800 LYS A H    3  
ATOM 3247  H HA   . LYS A 1 17  ? 2.905   -0.306  -9.062  1.00 0.00 ? 800 LYS A HA   3  
ATOM 3248  H HB2  . LYS A 1 17  ? 3.105   1.666   -11.335 1.00 0.00 ? 800 LYS A HB2  3  
ATOM 3249  H HB3  . LYS A 1 17  ? 3.626   2.048   -9.700  1.00 0.00 ? 800 LYS A HB3  3  
ATOM 3250  H HG2  . LYS A 1 17  ? 5.591   1.387   -10.696 1.00 0.00 ? 800 LYS A HG2  3  
ATOM 3251  H HG3  . LYS A 1 17  ? 5.053   -0.105  -9.921  1.00 0.00 ? 800 LYS A HG3  3  
ATOM 3252  H HD2  . LYS A 1 17  ? 4.045   -0.805  -12.074 1.00 0.00 ? 800 LYS A HD2  3  
ATOM 3253  H HD3  . LYS A 1 17  ? 4.712   0.647   -12.824 1.00 0.00 ? 800 LYS A HD3  3  
ATOM 3254  H HE2  . LYS A 1 17  ? 6.367   -1.450  -11.427 1.00 0.00 ? 800 LYS A HE2  3  
ATOM 3255  H HE3  . LYS A 1 17  ? 6.073   -1.422  -13.165 1.00 0.00 ? 800 LYS A HE3  3  
ATOM 3256  H HZ1  . LYS A 1 17  ? 7.971   0.037   -11.663 1.00 0.00 ? 800 LYS A HZ1  3  
ATOM 3257  H HZ2  . LYS A 1 17  ? 6.949   1.111   -12.476 1.00 0.00 ? 800 LYS A HZ2  3  
ATOM 3258  H HZ3  . LYS A 1 17  ? 7.799   -0.067  -13.343 1.00 0.00 ? 800 LYS A HZ3  3  
ATOM 3259  N N    . HIS A 1 18  ? 0.228   0.300   -8.885  1.00 0.00 ? 801 HIS A N    3  
ATOM 3260  C CA   . HIS A 1 18  ? -0.971  0.912   -8.322  1.00 0.00 ? 801 HIS A CA   3  
ATOM 3261  C C    . HIS A 1 18  ? -1.092  0.599   -6.834  1.00 0.00 ? 801 HIS A C    3  
ATOM 3262  O O    . HIS A 1 18  ? -1.378  1.481   -6.024  1.00 0.00 ? 801 HIS A O    3  
ATOM 3263  C CB   . HIS A 1 18  ? -2.215  0.420   -9.062  1.00 0.00 ? 801 HIS A CB   3  
ATOM 3264  C CG   . HIS A 1 18  ? -2.398  -1.066  -9.006  1.00 0.00 ? 801 HIS A CG   3  
ATOM 3265  N ND1  . HIS A 1 18  ? -1.463  -1.957  -9.488  1.00 0.00 ? 801 HIS A ND1  3  
ATOM 3266  C CD2  . HIS A 1 18  ? -3.414  -1.815  -8.518  1.00 0.00 ? 801 HIS A CD2  3  
ATOM 3267  C CE1  . HIS A 1 18  ? -1.897  -3.191  -9.301  1.00 0.00 ? 801 HIS A CE1  3  
ATOM 3268  N NE2  . HIS A 1 18  ? -3.079  -3.132  -8.714  1.00 0.00 ? 801 HIS A NE2  3  
ATOM 3269  H H    . HIS A 1 18  ? 0.274   -0.675  -8.967  1.00 0.00 ? 801 HIS A H    3  
ATOM 3270  H HA   . HIS A 1 18  ? -0.888  1.981   -8.446  1.00 0.00 ? 801 HIS A HA   3  
ATOM 3271  H HB2  . HIS A 1 18  ? -3.090  0.878   -8.625  1.00 0.00 ? 801 HIS A HB2  3  
ATOM 3272  H HB3  . HIS A 1 18  ? -2.145  0.708   -10.101 1.00 0.00 ? 801 HIS A HB3  3  
ATOM 3273  H HD2  . HIS A 1 18  ? -4.321  -1.446  -8.060  1.00 0.00 ? 801 HIS A HD2  3  
ATOM 3274  H HE1  . HIS A 1 18  ? -1.376  -4.094  -9.580  1.00 0.00 ? 801 HIS A HE1  3  
ATOM 3275  H HE2  . HIS A 1 18  ? -3.661  -3.900  -8.539  1.00 0.00 ? 801 HIS A HE2  3  
ATOM 3276  N N    . LYS A 1 19  ? -0.875  -0.663  -6.480  1.00 0.00 ? 802 LYS A N    3  
ATOM 3277  C CA   . LYS A 1 19  ? -0.960  -1.094  -5.089  1.00 0.00 ? 802 LYS A CA   3  
ATOM 3278  C C    . LYS A 1 19  ? 0.117   -0.420  -4.245  1.00 0.00 ? 802 LYS A C    3  
ATOM 3279  O O    . LYS A 1 19  ? 1.201   -0.106  -4.737  1.00 0.00 ? 802 LYS A O    3  
ATOM 3280  C CB   . LYS A 1 19  ? -0.819  -2.615  -4.995  1.00 0.00 ? 802 LYS A CB   3  
ATOM 3281  C CG   . LYS A 1 19  ? -2.063  -3.369  -5.433  1.00 0.00 ? 802 LYS A CG   3  
ATOM 3282  C CD   . LYS A 1 19  ? -1.946  -4.856  -5.141  1.00 0.00 ? 802 LYS A CD   3  
ATOM 3283  C CE   . LYS A 1 19  ? -3.287  -5.559  -5.281  1.00 0.00 ? 802 LYS A CE   3  
ATOM 3284  N NZ   . LYS A 1 19  ? -3.242  -6.950  -4.751  1.00 0.00 ? 802 LYS A NZ   3  
ATOM 3285  H H    . LYS A 1 19  ? -0.652  -1.322  -7.171  1.00 0.00 ? 802 LYS A H    3  
ATOM 3286  H HA   . LYS A 1 19  ? -1.930  -0.807  -4.711  1.00 0.00 ? 802 LYS A HA   3  
ATOM 3287  H HB2  . LYS A 1 19  ? 0.004   -2.927  -5.620  1.00 0.00 ? 802 LYS A HB2  3  
ATOM 3288  H HB3  . LYS A 1 19  ? -0.604  -2.882  -3.971  1.00 0.00 ? 802 LYS A HB3  3  
ATOM 3289  H HG2  . LYS A 1 19  ? -2.917  -2.975  -4.902  1.00 0.00 ? 802 LYS A HG2  3  
ATOM 3290  H HG3  . LYS A 1 19  ? -2.202  -3.230  -6.496  1.00 0.00 ? 802 LYS A HG3  3  
ATOM 3291  H HD2  . LYS A 1 19  ? -1.247  -5.296  -5.836  1.00 0.00 ? 802 LYS A HD2  3  
ATOM 3292  H HD3  . LYS A 1 19  ? -1.583  -4.987  -4.131  1.00 0.00 ? 802 LYS A HD3  3  
ATOM 3293  H HE2  . LYS A 1 19  ? -4.031  -4.999  -4.734  1.00 0.00 ? 802 LYS A HE2  3  
ATOM 3294  H HE3  . LYS A 1 19  ? -3.555  -5.589  -6.326  1.00 0.00 ? 802 LYS A HE3  3  
ATOM 3295  H HZ1  . LYS A 1 19  ? -2.257  -7.283  -4.707  1.00 0.00 ? 802 LYS A HZ1  3  
ATOM 3296  H HZ2  . LYS A 1 19  ? -3.783  -7.586  -5.371  1.00 0.00 ? 802 LYS A HZ2  3  
ATOM 3297  H HZ3  . LYS A 1 19  ? -3.652  -6.983  -3.796  1.00 0.00 ? 802 LYS A HZ3  3  
ATOM 3298  N N    . LEU A 1 20  ? -0.188  -0.202  -2.970  1.00 0.00 ? 803 LEU A N    3  
ATOM 3299  C CA   . LEU A 1 20  ? 0.754   0.433   -2.056  1.00 0.00 ? 803 LEU A CA   3  
ATOM 3300  C C    . LEU A 1 20  ? 0.975   -0.427  -0.816  1.00 0.00 ? 803 LEU A C    3  
ATOM 3301  O O    . LEU A 1 20  ? 0.124   -1.240  -0.452  1.00 0.00 ? 803 LEU A O    3  
ATOM 3302  C CB   . LEU A 1 20  ? 0.245   1.816   -1.646  1.00 0.00 ? 803 LEU A CB   3  
ATOM 3303  C CG   . LEU A 1 20  ? -0.410  2.645   -2.752  1.00 0.00 ? 803 LEU A CG   3  
ATOM 3304  C CD1  . LEU A 1 20  ? -1.265  3.752   -2.155  1.00 0.00 ? 803 LEU A CD1  3  
ATOM 3305  C CD2  . LEU A 1 20  ? 0.648   3.227   -3.679  1.00 0.00 ? 803 LEU A CD2  3  
ATOM 3306  H H    . LEU A 1 20  ? -1.068  -0.474  -2.635  1.00 0.00 ? 803 LEU A H    3  
ATOM 3307  H HA   . LEU A 1 20  ? 1.695   0.544   -2.574  1.00 0.00 ? 803 LEU A HA   3  
ATOM 3308  H HB2  . LEU A 1 20  ? -0.482  1.681   -0.861  1.00 0.00 ? 803 LEU A HB2  3  
ATOM 3309  H HB3  . LEU A 1 20  ? 1.086   2.378   -1.264  1.00 0.00 ? 803 LEU A HB3  3  
ATOM 3310  H HG   . LEU A 1 20  ? -1.054  2.005   -3.339  1.00 0.00 ? 803 LEU A HG   3  
ATOM 3311  H HD11 . LEU A 1 20  ? -1.229  4.620   -2.796  1.00 0.00 ? 803 LEU A HD11 3  
ATOM 3312  H HD12 . LEU A 1 20  ? -0.887  4.010   -1.177  1.00 0.00 ? 803 LEU A HD12 3  
ATOM 3313  H HD13 . LEU A 1 20  ? -2.286  3.410   -2.067  1.00 0.00 ? 803 LEU A HD13 3  
ATOM 3314  H HD21 . LEU A 1 20  ? 0.496   2.849   -4.680  1.00 0.00 ? 803 LEU A HD21 3  
ATOM 3315  H HD22 . LEU A 1 20  ? 1.629   2.939   -3.331  1.00 0.00 ? 803 LEU A HD22 3  
ATOM 3316  H HD23 . LEU A 1 20  ? 0.568   4.304   -3.685  1.00 0.00 ? 803 LEU A HD23 3  
ATOM 3317  N N    . PHE A 1 21  ? 2.121   -0.242  -0.170  1.00 0.00 ? 804 PHE A N    3  
ATOM 3318  C CA   . PHE A 1 21  ? 2.453   -1.001  1.031   1.00 0.00 ? 804 PHE A CA   3  
ATOM 3319  C C    . PHE A 1 21  ? 2.792   -0.067  2.188   1.00 0.00 ? 804 PHE A C    3  
ATOM 3320  O O    . PHE A 1 21  ? 3.662   0.796   2.069   1.00 0.00 ? 804 PHE A O    3  
ATOM 3321  C CB   . PHE A 1 21  ? 3.630   -1.940  0.757   1.00 0.00 ? 804 PHE A CB   3  
ATOM 3322  C CG   . PHE A 1 21  ? 4.099   -2.684  1.974   1.00 0.00 ? 804 PHE A CG   3  
ATOM 3323  C CD1  . PHE A 1 21  ? 3.448   -3.834  2.393   1.00 0.00 ? 804 PHE A CD1  3  
ATOM 3324  C CD2  . PHE A 1 21  ? 5.189   -2.234  2.700   1.00 0.00 ? 804 PHE A CD2  3  
ATOM 3325  C CE1  . PHE A 1 21  ? 3.877   -4.521  3.513   1.00 0.00 ? 804 PHE A CE1  3  
ATOM 3326  C CE2  . PHE A 1 21  ? 5.623   -2.918  3.821   1.00 0.00 ? 804 PHE A CE2  3  
ATOM 3327  C CZ   . PHE A 1 21  ? 4.965   -4.062  4.228   1.00 0.00 ? 804 PHE A CZ   3  
ATOM 3328  H H    . PHE A 1 21  ? 2.759   0.420   -0.509  1.00 0.00 ? 804 PHE A H    3  
ATOM 3329  H HA   . PHE A 1 21  ? 1.589   -1.589  1.299   1.00 0.00 ? 804 PHE A HA   3  
ATOM 3330  H HB2  . PHE A 1 21  ? 3.336   -2.668  0.016   1.00 0.00 ? 804 PHE A HB2  3  
ATOM 3331  H HB3  . PHE A 1 21  ? 4.460   -1.363  0.379   1.00 0.00 ? 804 PHE A HB3  3  
ATOM 3332  H HD1  . PHE A 1 21  ? 2.596   -4.194  1.834   1.00 0.00 ? 804 PHE A HD1  3  
ATOM 3333  H HD2  . PHE A 1 21  ? 5.704   -1.339  2.384   1.00 0.00 ? 804 PHE A HD2  3  
ATOM 3334  H HE1  . PHE A 1 21  ? 3.360   -5.415  3.828   1.00 0.00 ? 804 PHE A HE1  3  
ATOM 3335  H HE2  . PHE A 1 21  ? 6.474   -2.557  4.378   1.00 0.00 ? 804 PHE A HE2  3  
ATOM 3336  H HZ   . PHE A 1 21  ? 5.302   -4.598  5.103   1.00 0.00 ? 804 PHE A HZ   3  
ATOM 3337  N N    . ILE A 1 22  ? 2.098   -0.245  3.307   1.00 0.00 ? 805 ILE A N    3  
ATOM 3338  C CA   . ILE A 1 22  ? 2.325   0.581   4.486   1.00 0.00 ? 805 ILE A CA   3  
ATOM 3339  C C    . ILE A 1 22  ? 2.696   -0.274  5.694   1.00 0.00 ? 805 ILE A C    3  
ATOM 3340  O O    . ILE A 1 22  ? 2.042   -1.277  5.981   1.00 0.00 ? 805 ILE A O    3  
ATOM 3341  C CB   . ILE A 1 22  ? 1.083   1.424   4.831   1.00 0.00 ? 805 ILE A CB   3  
ATOM 3342  C CG1  . ILE A 1 22  ? 0.464   2.004   3.557   1.00 0.00 ? 805 ILE A CG1  3  
ATOM 3343  C CG2  . ILE A 1 22  ? 1.451   2.537   5.801   1.00 0.00 ? 805 ILE A CG2  3  
ATOM 3344  C CD1  . ILE A 1 22  ? -0.626  3.018   3.822   1.00 0.00 ? 805 ILE A CD1  3  
ATOM 3345  H H    . ILE A 1 22  ? 1.418   -0.950  3.341   1.00 0.00 ? 805 ILE A H    3  
ATOM 3346  H HA   . ILE A 1 22  ? 3.143   1.253   4.270   1.00 0.00 ? 805 ILE A HA   3  
ATOM 3347  H HB   . ILE A 1 22  ? 0.362   0.782   5.313   1.00 0.00 ? 805 ILE A HB   3  
ATOM 3348  H HG12 . ILE A 1 22  ? 1.235   2.489   2.979   1.00 0.00 ? 805 ILE A HG12 3  
ATOM 3349  H HG13 . ILE A 1 22  ? 0.036   1.200   2.976   1.00 0.00 ? 805 ILE A HG13 3  
ATOM 3350  H HG21 . ILE A 1 22  ? 2.230   2.192   6.465   1.00 0.00 ? 805 ILE A HG21 3  
ATOM 3351  H HG22 . ILE A 1 22  ? 1.804   3.394   5.248   1.00 0.00 ? 805 ILE A HG22 3  
ATOM 3352  H HG23 . ILE A 1 22  ? 0.582   2.813   6.378   1.00 0.00 ? 805 ILE A HG23 3  
ATOM 3353  H HD11 . ILE A 1 22  ? -0.333  3.656   4.643   1.00 0.00 ? 805 ILE A HD11 3  
ATOM 3354  H HD12 . ILE A 1 22  ? -0.785  3.617   2.938   1.00 0.00 ? 805 ILE A HD12 3  
ATOM 3355  H HD13 . ILE A 1 22  ? -1.541  2.504   4.077   1.00 0.00 ? 805 ILE A HD13 3  
ATOM 3356  N N    . SER A 1 23  ? 3.747   0.131   6.398   1.00 0.00 ? 806 SER A N    3  
ATOM 3357  C CA   . SER A 1 23  ? 4.207   -0.599  7.574   1.00 0.00 ? 806 SER A CA   3  
ATOM 3358  C C    . SER A 1 23  ? 4.332   0.332   8.777   1.00 0.00 ? 806 SER A C    3  
ATOM 3359  O O    . SER A 1 23  ? 4.291   1.553   8.637   1.00 0.00 ? 806 SER A O    3  
ATOM 3360  C CB   . SER A 1 23  ? 5.552   -1.269  7.291   1.00 0.00 ? 806 SER A CB   3  
ATOM 3361  O OG   . SER A 1 23  ? 6.230   -1.582  8.496   1.00 0.00 ? 806 SER A OG   3  
ATOM 3362  H H    . SER A 1 23  ? 4.227   0.939   6.119   1.00 0.00 ? 806 SER A H    3  
ATOM 3363  H HA   . SER A 1 23  ? 3.475   -1.361  7.798   1.00 0.00 ? 806 SER A HA   3  
ATOM 3364  H HB2  . SER A 1 23  ? 5.388   -2.181  6.737   1.00 0.00 ? 806 SER A HB2  3  
ATOM 3365  H HB3  . SER A 1 23  ? 6.169   -0.600  6.708   1.00 0.00 ? 806 SER A HB3  3  
ATOM 3366  H HG   . SER A 1 23  ? 6.519   -2.497  8.473   1.00 0.00 ? 806 SER A HG   3  
ATOM 3367  N N    . GLY A 1 24  ? 4.485   -0.257  9.959   1.00 0.00 ? 807 GLY A N    3  
ATOM 3368  C CA   . GLY A 1 24  ? 4.614   0.533   11.170  1.00 0.00 ? 807 GLY A CA   3  
ATOM 3369  C C    . GLY A 1 24  ? 3.321   1.227   11.549  1.00 0.00 ? 807 GLY A C    3  
ATOM 3370  O O    . GLY A 1 24  ? 3.329   2.383   11.975  1.00 0.00 ? 807 GLY A O    3  
ATOM 3371  H H    . GLY A 1 24  ? 4.510   -1.235  10.010  1.00 0.00 ? 807 GLY A H    3  
ATOM 3372  H HA2  . GLY A 1 24  ? 4.913   -0.115  11.979  1.00 0.00 ? 807 GLY A HA2  3  
ATOM 3373  H HA3  . GLY A 1 24  ? 5.378   1.281   11.018  1.00 0.00 ? 807 GLY A HA3  3  
ATOM 3374  N N    . LEU A 1 25  ? 2.205   0.522   11.395  1.00 0.00 ? 808 LEU A N    3  
ATOM 3375  C CA   . LEU A 1 25  ? 0.897   1.078   11.723  1.00 0.00 ? 808 LEU A CA   3  
ATOM 3376  C C    . LEU A 1 25  ? 0.457   0.647   13.119  1.00 0.00 ? 808 LEU A C    3  
ATOM 3377  O O    . LEU A 1 25  ? 0.691   -0.483  13.549  1.00 0.00 ? 808 LEU A O    3  
ATOM 3378  C CB   . LEU A 1 25  ? -0.140  0.637   10.690  1.00 0.00 ? 808 LEU A CB   3  
ATOM 3379  C CG   . LEU A 1 25  ? 0.070   1.152   9.266   1.00 0.00 ? 808 LEU A CG   3  
ATOM 3380  C CD1  . LEU A 1 25  ? -0.904  0.484   8.307   1.00 0.00 ? 808 LEU A CD1  3  
ATOM 3381  C CD2  . LEU A 1 25  ? -0.085  2.665   9.218   1.00 0.00 ? 808 LEU A CD2  3  
ATOM 3382  H H    . LEU A 1 25  ? 2.262   -0.394  11.052  1.00 0.00 ? 808 LEU A H    3  
ATOM 3383  H HA   . LEU A 1 25  ? 0.980   2.155   11.702  1.00 0.00 ? 808 LEU A HA   3  
ATOM 3384  H HB2  . LEU A 1 25  ? -0.135  -0.442  10.655  1.00 0.00 ? 808 LEU A HB2  3  
ATOM 3385  H HB3  . LEU A 1 25  ? -1.109  0.979   11.027  1.00 0.00 ? 808 LEU A HB3  3  
ATOM 3386  H HG   . LEU A 1 25  ? 1.073   0.907   8.945   1.00 0.00 ? 808 LEU A HG   3  
ATOM 3387  H HD11 . LEU A 1 25  ? -0.701  0.814   7.300   1.00 0.00 ? 808 LEU A HD11 3  
ATOM 3388  H HD12 . LEU A 1 25  ? -1.915  0.752   8.577   1.00 0.00 ? 808 LEU A HD12 3  
ATOM 3389  H HD13 . LEU A 1 25  ? -0.789  -0.588  8.366   1.00 0.00 ? 808 LEU A HD13 3  
ATOM 3390  H HD21 . LEU A 1 25  ? -0.981  2.917   8.670   1.00 0.00 ? 808 LEU A HD21 3  
ATOM 3391  H HD22 . LEU A 1 25  ? 0.772   3.099   8.724   1.00 0.00 ? 808 LEU A HD22 3  
ATOM 3392  H HD23 . LEU A 1 25  ? -0.156  3.052   10.223  1.00 0.00 ? 808 LEU A HD23 3  
ATOM 3393  N N    . PRO A 1 26  ? -0.198  1.566   13.843  1.00 0.00 ? 809 PRO A N    3  
ATOM 3394  C CA   . PRO A 1 26  ? -0.687  1.303   15.200  1.00 0.00 ? 809 PRO A CA   3  
ATOM 3395  C C    . PRO A 1 26  ? -1.852  0.319   15.215  1.00 0.00 ? 809 PRO A C    3  
ATOM 3396  O O    . PRO A 1 26  ? -2.895  0.566   14.610  1.00 0.00 ? 809 PRO A O    3  
ATOM 3397  C CB   . PRO A 1 26  ? -1.145  2.681   15.685  1.00 0.00 ? 809 PRO A CB   3  
ATOM 3398  C CG   . PRO A 1 26  ? -1.469  3.433   14.440  1.00 0.00 ? 809 PRO A CG   3  
ATOM 3399  C CD   . PRO A 1 26  ? -0.512  2.933   13.394  1.00 0.00 ? 809 PRO A CD   3  
ATOM 3400  H HA   . PRO A 1 26  ? 0.101   0.937   15.842  1.00 0.00 ? 809 PRO A HA   3  
ATOM 3401  H HB2  . PRO A 1 26  ? -2.014  2.572   16.319  1.00 0.00 ? 809 PRO A HB2  3  
ATOM 3402  H HB3  . PRO A 1 26  ? -0.348  3.156   16.236  1.00 0.00 ? 809 PRO A HB3  3  
ATOM 3403  H HG2  . PRO A 1 26  ? -2.487  3.231   14.144  1.00 0.00 ? 809 PRO A HG2  3  
ATOM 3404  H HG3  . PRO A 1 26  ? -1.327  4.491   14.603  1.00 0.00 ? 809 PRO A HG3  3  
ATOM 3405  H HD2  . PRO A 1 26  ? -0.986  2.921   12.424  1.00 0.00 ? 809 PRO A HD2  3  
ATOM 3406  H HD3  . PRO A 1 26  ? 0.378   3.545   13.373  1.00 0.00 ? 809 PRO A HD3  3  
ATOM 3407  N N    . PHE A 1 27  ? -1.667  -0.798  15.912  1.00 0.00 ? 810 PHE A N    3  
ATOM 3408  C CA   . PHE A 1 27  ? -2.703  -1.820  16.005  1.00 0.00 ? 810 PHE A CA   3  
ATOM 3409  C C    . PHE A 1 27  ? -4.087  -1.185  16.097  1.00 0.00 ? 810 PHE A C    3  
ATOM 3410  O O    . PHE A 1 27  ? -5.061  -1.713  15.559  1.00 0.00 ? 810 PHE A O    3  
ATOM 3411  C CB   . PHE A 1 27  ? -2.458  -2.714  17.223  1.00 0.00 ? 810 PHE A CB   3  
ATOM 3412  C CG   . PHE A 1 27  ? -1.009  -3.041  17.445  1.00 0.00 ? 810 PHE A CG   3  
ATOM 3413  C CD1  . PHE A 1 27  ? -0.287  -3.734  16.488  1.00 0.00 ? 810 PHE A CD1  3  
ATOM 3414  C CD2  . PHE A 1 27  ? -0.370  -2.654  18.612  1.00 0.00 ? 810 PHE A CD2  3  
ATOM 3415  C CE1  . PHE A 1 27  ? 1.047   -4.036  16.689  1.00 0.00 ? 810 PHE A CE1  3  
ATOM 3416  C CE2  . PHE A 1 27  ? 0.964   -2.953  18.819  1.00 0.00 ? 810 PHE A CE2  3  
ATOM 3417  C CZ   . PHE A 1 27  ? 1.673   -3.646  17.857  1.00 0.00 ? 810 PHE A CZ   3  
ATOM 3418  H H    . PHE A 1 27  ? -0.814  -0.938  16.373  1.00 0.00 ? 810 PHE A H    3  
ATOM 3419  H HA   . PHE A 1 27  ? -2.655  -2.423  15.112  1.00 0.00 ? 810 PHE A HA   3  
ATOM 3420  H HB2  . PHE A 1 27  ? -2.825  -2.214  18.107  1.00 0.00 ? 810 PHE A HB2  3  
ATOM 3421  H HB3  . PHE A 1 27  ? -2.993  -3.643  17.092  1.00 0.00 ? 810 PHE A HB3  3  
ATOM 3422  H HD1  . PHE A 1 27  ? -0.776  -4.041  15.574  1.00 0.00 ? 810 PHE A HD1  3  
ATOM 3423  H HD2  . PHE A 1 27  ? -0.923  -2.114  19.366  1.00 0.00 ? 810 PHE A HD2  3  
ATOM 3424  H HE1  . PHE A 1 27  ? 1.598   -4.578  15.935  1.00 0.00 ? 810 PHE A HE1  3  
ATOM 3425  H HE2  . PHE A 1 27  ? 1.451   -2.647  19.733  1.00 0.00 ? 810 PHE A HE2  3  
ATOM 3426  H HZ   . PHE A 1 27  ? 2.715   -3.880  18.016  1.00 0.00 ? 810 PHE A HZ   3  
ATOM 3427  N N    . SER A 1 28  ? -4.167  -0.049  16.782  1.00 0.00 ? 811 SER A N    3  
ATOM 3428  C CA   . SER A 1 28  ? -5.432  0.657   16.948  1.00 0.00 ? 811 SER A CA   3  
ATOM 3429  C C    . SER A 1 28  ? -6.093  0.912   15.597  1.00 0.00 ? 811 SER A C    3  
ATOM 3430  O O    . SER A 1 28  ? -7.262  0.580   15.393  1.00 0.00 ? 811 SER A O    3  
ATOM 3431  C CB   . SER A 1 28  ? -5.208  1.983   17.677  1.00 0.00 ? 811 SER A CB   3  
ATOM 3432  O OG   . SER A 1 28  ? -5.271  1.810   19.082  1.00 0.00 ? 811 SER A OG   3  
ATOM 3433  H H    . SER A 1 28  ? -3.355  0.322   17.187  1.00 0.00 ? 811 SER A H    3  
ATOM 3434  H HA   . SER A 1 28  ? -6.083  0.034   17.543  1.00 0.00 ? 811 SER A HA   3  
ATOM 3435  H HB2  . SER A 1 28  ? -4.236  2.374   17.418  1.00 0.00 ? 811 SER A HB2  3  
ATOM 3436  H HB3  . SER A 1 28  ? -5.971  2.688   17.379  1.00 0.00 ? 811 SER A HB3  3  
ATOM 3437  H HG   . SER A 1 28  ? -6.040  1.280   19.305  1.00 0.00 ? 811 SER A HG   3  
ATOM 3438  N N    . CYS A 1 29  ? -5.338  1.503   14.678  1.00 0.00 ? 812 CYS A N    3  
ATOM 3439  C CA   . CYS A 1 29  ? -5.850  1.803   13.345  1.00 0.00 ? 812 CYS A CA   3  
ATOM 3440  C C    . CYS A 1 29  ? -6.675  0.640   12.805  1.00 0.00 ? 812 CYS A C    3  
ATOM 3441  O O    . CYS A 1 29  ? -6.467  -0.513  13.184  1.00 0.00 ? 812 CYS A O    3  
ATOM 3442  C CB   . CYS A 1 29  ? -4.696  2.113   12.391  1.00 0.00 ? 812 CYS A CB   3  
ATOM 3443  S SG   . CYS A 1 29  ? -5.196  2.985   10.888  1.00 0.00 ? 812 CYS A SG   3  
ATOM 3444  H H    . CYS A 1 29  ? -4.414  1.743   14.900  1.00 0.00 ? 812 CYS A H    3  
ATOM 3445  H HA   . CYS A 1 29  ? -6.485  2.673   13.424  1.00 0.00 ? 812 CYS A HA   3  
ATOM 3446  H HB2  . CYS A 1 29  ? -3.972  2.730   12.902  1.00 0.00 ? 812 CYS A HB2  3  
ATOM 3447  H HB3  . CYS A 1 29  ? -4.226  1.187   12.094  1.00 0.00 ? 812 CYS A HB3  3  
ATOM 3448  H HG   . CYS A 1 29  ? -5.138  2.128   9.880   1.00 0.00 ? 812 CYS A HG   3  
ATOM 3449  N N    . THR A 1 30  ? -7.615  0.950   11.917  1.00 0.00 ? 813 THR A N    3  
ATOM 3450  C CA   . THR A 1 30  ? -8.474  -0.068  11.326  1.00 0.00 ? 813 THR A CA   3  
ATOM 3451  C C    . THR A 1 30  ? -8.689  0.189   9.839   1.00 0.00 ? 813 THR A C    3  
ATOM 3452  O O    . THR A 1 30  ? -8.411  1.280   9.340   1.00 0.00 ? 813 THR A O    3  
ATOM 3453  C CB   . THR A 1 30  ? -9.844  -0.125  12.029  1.00 0.00 ? 813 THR A CB   3  
ATOM 3454  O OG1  . THR A 1 30  ? -10.719 -1.013  11.325  1.00 0.00 ? 813 THR A OG1  3  
ATOM 3455  C CG2  . THR A 1 30  ? -10.470 1.259   12.106  1.00 0.00 ? 813 THR A CG2  3  
ATOM 3456  H H    . THR A 1 30  ? -7.733  1.887   11.655  1.00 0.00 ? 813 THR A H    3  
ATOM 3457  H HA   . THR A 1 30  ? -7.989  -1.026  11.449  1.00 0.00 ? 813 THR A HA   3  
ATOM 3458  H HB   . THR A 1 30  ? -9.700  -0.496  13.034  1.00 0.00 ? 813 THR A HB   3  
ATOM 3459  H HG1  . THR A 1 30  ? -11.127 -1.621  11.946  1.00 0.00 ? 813 THR A HG1  3  
ATOM 3460  H HG21 . THR A 1 30  ? -11.148 1.301   12.946  1.00 0.00 ? 813 THR A HG21 3  
ATOM 3461  H HG22 . THR A 1 30  ? -11.013 1.459   11.194  1.00 0.00 ? 813 THR A HG22 3  
ATOM 3462  H HG23 . THR A 1 30  ? -9.694  1.998   12.233  1.00 0.00 ? 813 THR A HG23 3  
ATOM 3463  N N    . LYS A 1 31  ? -9.188  -0.821  9.135   1.00 0.00 ? 814 LYS A N    3  
ATOM 3464  C CA   . LYS A 1 31  ? -9.443  -0.704  7.704   1.00 0.00 ? 814 LYS A CA   3  
ATOM 3465  C C    . LYS A 1 31  ? -10.170 0.598   7.385   1.00 0.00 ? 814 LYS A C    3  
ATOM 3466  O O    . LYS A 1 31  ? -9.706  1.395   6.570   1.00 0.00 ? 814 LYS A O    3  
ATOM 3467  C CB   . LYS A 1 31  ? -10.270 -1.895  7.213   1.00 0.00 ? 814 LYS A CB   3  
ATOM 3468  C CG   . LYS A 1 31  ? -10.222 -2.090  5.708   1.00 0.00 ? 814 LYS A CG   3  
ATOM 3469  C CD   . LYS A 1 31  ? -11.319 -1.306  5.008   1.00 0.00 ? 814 LYS A CD   3  
ATOM 3470  C CE   . LYS A 1 31  ? -11.673 -1.922  3.663   1.00 0.00 ? 814 LYS A CE   3  
ATOM 3471  N NZ   . LYS A 1 31  ? -12.294 -0.928  2.745   1.00 0.00 ? 814 LYS A NZ   3  
ATOM 3472  H H    . LYS A 1 31  ? -9.390  -1.666  9.589   1.00 0.00 ? 814 LYS A H    3  
ATOM 3473  H HA   . LYS A 1 31  ? -8.491  -0.705  7.196   1.00 0.00 ? 814 LYS A HA   3  
ATOM 3474  H HB2  . LYS A 1 31  ? -9.899  -2.793  7.684   1.00 0.00 ? 814 LYS A HB2  3  
ATOM 3475  H HB3  . LYS A 1 31  ? -11.300 -1.746  7.503   1.00 0.00 ? 814 LYS A HB3  3  
ATOM 3476  H HG2  . LYS A 1 31  ? -9.264  -1.754  5.341   1.00 0.00 ? 814 LYS A HG2  3  
ATOM 3477  H HG3  . LYS A 1 31  ? -10.345 -3.141  5.486   1.00 0.00 ? 814 LYS A HG3  3  
ATOM 3478  H HD2  . LYS A 1 31  ? -12.200 -1.302  5.632   1.00 0.00 ? 814 LYS A HD2  3  
ATOM 3479  H HD3  . LYS A 1 31  ? -10.981 -0.291  4.852   1.00 0.00 ? 814 LYS A HD3  3  
ATOM 3480  H HE2  . LYS A 1 31  ? -10.772 -2.305  3.209   1.00 0.00 ? 814 LYS A HE2  3  
ATOM 3481  H HE3  . LYS A 1 31  ? -12.367 -2.733  3.825   1.00 0.00 ? 814 LYS A HE3  3  
ATOM 3482  H HZ1  . LYS A 1 31  ? -12.449 -0.028  3.244   1.00 0.00 ? 814 LYS A HZ1  3  
ATOM 3483  H HZ2  . LYS A 1 31  ? -13.210 -1.282  2.401   1.00 0.00 ? 814 LYS A HZ2  3  
ATOM 3484  H HZ3  . LYS A 1 31  ? -11.673 -0.757  1.929   1.00 0.00 ? 814 LYS A HZ3  3  
ATOM 3485  N N    . GLU A 1 32  ? -11.311 0.809   8.035   1.00 0.00 ? 815 GLU A N    3  
ATOM 3486  C CA   . GLU A 1 32  ? -12.100 2.016   7.820   1.00 0.00 ? 815 GLU A CA   3  
ATOM 3487  C C    . GLU A 1 32  ? -11.213 3.257   7.842   1.00 0.00 ? 815 GLU A C    3  
ATOM 3488  O O    . GLU A 1 32  ? -11.175 4.022   6.879   1.00 0.00 ? 815 GLU A O    3  
ATOM 3489  C CB   . GLU A 1 32  ? -13.191 2.135   8.887   1.00 0.00 ? 815 GLU A CB   3  
ATOM 3490  C CG   . GLU A 1 32  ? -14.310 1.120   8.729   1.00 0.00 ? 815 GLU A CG   3  
ATOM 3491  C CD   . GLU A 1 32  ? -15.394 1.591   7.778   1.00 0.00 ? 815 GLU A CD   3  
ATOM 3492  O OE1  . GLU A 1 32  ? -15.258 1.357   6.559   1.00 0.00 ? 815 GLU A OE1  3  
ATOM 3493  O OE2  . GLU A 1 32  ? -16.380 2.193   8.255   1.00 0.00 ? 815 GLU A OE2  3  
ATOM 3494  H H    . GLU A 1 32  ? -11.629 0.136   8.672   1.00 0.00 ? 815 GLU A H    3  
ATOM 3495  H HA   . GLU A 1 32  ? -12.566 1.939   6.849   1.00 0.00 ? 815 GLU A HA   3  
ATOM 3496  H HB2  . GLU A 1 32  ? -12.742 1.998   9.859   1.00 0.00 ? 815 GLU A HB2  3  
ATOM 3497  H HB3  . GLU A 1 32  ? -13.621 3.125   8.835   1.00 0.00 ? 815 GLU A HB3  3  
ATOM 3498  H HG2  . GLU A 1 32  ? -13.894 0.200   8.347   1.00 0.00 ? 815 GLU A HG2  3  
ATOM 3499  H HG3  . GLU A 1 32  ? -14.754 0.939   9.697   1.00 0.00 ? 815 GLU A HG3  3  
ATOM 3500  N N    . GLU A 1 33  ? -10.502 3.449   8.949   1.00 0.00 ? 816 GLU A N    3  
ATOM 3501  C CA   . GLU A 1 33  ? -9.617  4.598   9.097   1.00 0.00 ? 816 GLU A CA   3  
ATOM 3502  C C    . GLU A 1 33  ? -8.737  4.770   7.863   1.00 0.00 ? 816 GLU A C    3  
ATOM 3503  O O    . GLU A 1 33  ? -8.773  5.808   7.200   1.00 0.00 ? 816 GLU A O    3  
ATOM 3504  C CB   . GLU A 1 33  ? -8.741  4.438   10.342  1.00 0.00 ? 816 GLU A CB   3  
ATOM 3505  C CG   . GLU A 1 33  ? -9.455  4.788   11.637  1.00 0.00 ? 816 GLU A CG   3  
ATOM 3506  C CD   . GLU A 1 33  ? -8.540  4.723   12.844  1.00 0.00 ? 816 GLU A CD   3  
ATOM 3507  O OE1  . GLU A 1 33  ? -7.759  5.677   13.048  1.00 0.00 ? 816 GLU A OE1  3  
ATOM 3508  O OE2  . GLU A 1 33  ? -8.603  3.720   13.584  1.00 0.00 ? 816 GLU A OE2  3  
ATOM 3509  H H    . GLU A 1 33  ? -10.575 2.804   9.683   1.00 0.00 ? 816 GLU A H    3  
ATOM 3510  H HA   . GLU A 1 33  ? -10.231 5.478   9.212   1.00 0.00 ? 816 GLU A HA   3  
ATOM 3511  H HB2  . GLU A 1 33  ? -8.408  3.413   10.404  1.00 0.00 ? 816 GLU A HB2  3  
ATOM 3512  H HB3  . GLU A 1 33  ? -7.879  5.082   10.246  1.00 0.00 ? 816 GLU A HB3  3  
ATOM 3513  H HG2  . GLU A 1 33  ? -9.849  5.790   11.557  1.00 0.00 ? 816 GLU A HG2  3  
ATOM 3514  H HG3  . GLU A 1 33  ? -10.269 4.094   11.784  1.00 0.00 ? 816 GLU A HG3  3  
ATOM 3515  N N    . LEU A 1 34  ? -7.947  3.746   7.559   1.00 0.00 ? 817 LEU A N    3  
ATOM 3516  C CA   . LEU A 1 34  ? -7.056  3.783   6.404   1.00 0.00 ? 817 LEU A CA   3  
ATOM 3517  C C    . LEU A 1 34  ? -7.830  4.106   5.130   1.00 0.00 ? 817 LEU A C    3  
ATOM 3518  O O    . LEU A 1 34  ? -7.344  4.834   4.266   1.00 0.00 ? 817 LEU A O    3  
ATOM 3519  C CB   . LEU A 1 34  ? -6.334  2.443   6.250   1.00 0.00 ? 817 LEU A CB   3  
ATOM 3520  C CG   . LEU A 1 34  ? -5.035  2.470   5.444   1.00 0.00 ? 817 LEU A CG   3  
ATOM 3521  C CD1  . LEU A 1 34  ? -4.054  3.465   6.046   1.00 0.00 ? 817 LEU A CD1  3  
ATOM 3522  C CD2  . LEU A 1 34  ? -4.417  1.081   5.380   1.00 0.00 ? 817 LEU A CD2  3  
ATOM 3523  H H    . LEU A 1 34  ? -7.962  2.946   8.125   1.00 0.00 ? 817 LEU A H    3  
ATOM 3524  H HA   . LEU A 1 34  ? -6.325  4.559   6.574   1.00 0.00 ? 817 LEU A HA   3  
ATOM 3525  H HB2  . LEU A 1 34  ? -6.102  2.077   7.238   1.00 0.00 ? 817 LEU A HB2  3  
ATOM 3526  H HB3  . LEU A 1 34  ? -7.012  1.757   5.764   1.00 0.00 ? 817 LEU A HB3  3  
ATOM 3527  H HG   . LEU A 1 34  ? -5.252  2.787   4.433   1.00 0.00 ? 817 LEU A HG   3  
ATOM 3528  H HD11 . LEU A 1 34  ? -4.399  4.470   5.858   1.00 0.00 ? 817 LEU A HD11 3  
ATOM 3529  H HD12 . LEU A 1 34  ? -3.081  3.328   5.596   1.00 0.00 ? 817 LEU A HD12 3  
ATOM 3530  H HD13 . LEU A 1 34  ? -3.983  3.300   7.111   1.00 0.00 ? 817 LEU A HD13 3  
ATOM 3531  H HD21 . LEU A 1 34  ? -3.353  1.168   5.216   1.00 0.00 ? 817 LEU A HD21 3  
ATOM 3532  H HD22 . LEU A 1 34  ? -4.863  0.526   4.567   1.00 0.00 ? 817 LEU A HD22 3  
ATOM 3533  H HD23 . LEU A 1 34  ? -4.597  0.564   6.311   1.00 0.00 ? 817 LEU A HD23 3  
ATOM 3534  N N    . GLU A 1 35  ? -9.037  3.561   5.023   1.00 0.00 ? 818 GLU A N    3  
ATOM 3535  C CA   . GLU A 1 35  ? -9.879  3.793   3.855   1.00 0.00 ? 818 GLU A CA   3  
ATOM 3536  C C    . GLU A 1 35  ? -10.163 5.281   3.676   1.00 0.00 ? 818 GLU A C    3  
ATOM 3537  O O    . GLU A 1 35  ? -9.819  5.871   2.652   1.00 0.00 ? 818 GLU A O    3  
ATOM 3538  C CB   . GLU A 1 35  ? -11.194 3.023   3.985   1.00 0.00 ? 818 GLU A CB   3  
ATOM 3539  C CG   . GLU A 1 35  ? -12.097 3.150   2.769   1.00 0.00 ? 818 GLU A CG   3  
ATOM 3540  C CD   . GLU A 1 35  ? -13.567 3.025   3.118   1.00 0.00 ? 818 GLU A CD   3  
ATOM 3541  O OE1  . GLU A 1 35  ? -13.957 1.978   3.675   1.00 0.00 ? 818 GLU A OE1  3  
ATOM 3542  O OE2  . GLU A 1 35  ? -14.327 3.975   2.835   1.00 0.00 ? 818 GLU A OE2  3  
ATOM 3543  H H    . GLU A 1 35  ? -9.370  2.989   5.746   1.00 0.00 ? 818 GLU A H    3  
ATOM 3544  H HA   . GLU A 1 35  ? -9.347  3.434   2.986   1.00 0.00 ? 818 GLU A HA   3  
ATOM 3545  H HB2  . GLU A 1 35  ? -10.972 1.976   4.135   1.00 0.00 ? 818 GLU A HB2  3  
ATOM 3546  H HB3  . GLU A 1 35  ? -11.731 3.394   4.845   1.00 0.00 ? 818 GLU A HB3  3  
ATOM 3547  H HG2  . GLU A 1 35  ? -11.931 4.114   2.313   1.00 0.00 ? 818 GLU A HG2  3  
ATOM 3548  H HG3  . GLU A 1 35  ? -11.842 2.371   2.064   1.00 0.00 ? 818 GLU A HG3  3  
ATOM 3549  N N    . GLU A 1 36  ? -10.794 5.882   4.681   1.00 0.00 ? 819 GLU A N    3  
ATOM 3550  C CA   . GLU A 1 36  ? -11.127 7.301   4.634   1.00 0.00 ? 819 GLU A CA   3  
ATOM 3551  C C    . GLU A 1 36  ? -9.891  8.139   4.320   1.00 0.00 ? 819 GLU A C    3  
ATOM 3552  O O    . GLU A 1 36  ? -9.963  9.114   3.572   1.00 0.00 ? 819 GLU A O    3  
ATOM 3553  C CB   . GLU A 1 36  ? -11.736 7.749   5.964   1.00 0.00 ? 819 GLU A CB   3  
ATOM 3554  C CG   . GLU A 1 36  ? -10.901 7.368   7.175   1.00 0.00 ? 819 GLU A CG   3  
ATOM 3555  C CD   . GLU A 1 36  ? -11.415 7.992   8.458   1.00 0.00 ? 819 GLU A CD   3  
ATOM 3556  O OE1  . GLU A 1 36  ? -12.648 8.016   8.655   1.00 0.00 ? 819 GLU A OE1  3  
ATOM 3557  O OE2  . GLU A 1 36  ? -10.583 8.458   9.265   1.00 0.00 ? 819 GLU A OE2  3  
ATOM 3558  H H    . GLU A 1 36  ? -11.043 5.358   5.471   1.00 0.00 ? 819 GLU A H    3  
ATOM 3559  H HA   . GLU A 1 36  ? -11.854 7.445   3.849   1.00 0.00 ? 819 GLU A HA   3  
ATOM 3560  H HB2  . GLU A 1 36  ? -11.847 8.823   5.952   1.00 0.00 ? 819 GLU A HB2  3  
ATOM 3561  H HB3  . GLU A 1 36  ? -12.711 7.296   6.069   1.00 0.00 ? 819 GLU A HB3  3  
ATOM 3562  H HG2  . GLU A 1 36  ? -10.917 6.294   7.284   1.00 0.00 ? 819 GLU A HG2  3  
ATOM 3563  H HG3  . GLU A 1 36  ? -9.885  7.697   7.013   1.00 0.00 ? 819 GLU A HG3  3  
ATOM 3564  N N    . ILE A 1 37  ? -8.758  7.751   4.897   1.00 0.00 ? 820 ILE A N    3  
ATOM 3565  C CA   . ILE A 1 37  ? -7.507  8.466   4.679   1.00 0.00 ? 820 ILE A CA   3  
ATOM 3566  C C    . ILE A 1 37  ? -6.989  8.248   3.262   1.00 0.00 ? 820 ILE A C    3  
ATOM 3567  O O    . ILE A 1 37  ? -6.431  9.158   2.647   1.00 0.00 ? 820 ILE A O    3  
ATOM 3568  C CB   . ILE A 1 37  ? -6.425  8.025   5.682   1.00 0.00 ? 820 ILE A CB   3  
ATOM 3569  C CG1  . ILE A 1 37  ? -6.882  8.306   7.115   1.00 0.00 ? 820 ILE A CG1  3  
ATOM 3570  C CG2  . ILE A 1 37  ? -5.111  8.735   5.391   1.00 0.00 ? 820 ILE A CG2  3  
ATOM 3571  C CD1  . ILE A 1 37  ? -6.033  7.622   8.165   1.00 0.00 ? 820 ILE A CD1  3  
ATOM 3572  H H    . ILE A 1 37  ? -8.765  6.966   5.483   1.00 0.00 ? 820 ILE A H    3  
ATOM 3573  H HA   . ILE A 1 37  ? -7.696  9.520   4.825   1.00 0.00 ? 820 ILE A HA   3  
ATOM 3574  H HB   . ILE A 1 37  ? -6.266  6.964   5.564   1.00 0.00 ? 820 ILE A HB   3  
ATOM 3575  H HG12 . ILE A 1 37  ? -6.841  9.368   7.298   1.00 0.00 ? 820 ILE A HG12 3  
ATOM 3576  H HG13 . ILE A 1 37  ? -7.899  7.962   7.234   1.00 0.00 ? 820 ILE A HG13 3  
ATOM 3577  H HG21 . ILE A 1 37  ? -4.299  8.193   5.853   1.00 0.00 ? 820 ILE A HG21 3  
ATOM 3578  H HG22 . ILE A 1 37  ? -4.954  8.776   4.323   1.00 0.00 ? 820 ILE A HG22 3  
ATOM 3579  H HG23 . ILE A 1 37  ? -5.148  9.738   5.789   1.00 0.00 ? 820 ILE A HG23 3  
ATOM 3580  H HD11 . ILE A 1 37  ? -5.551  8.367   8.780   1.00 0.00 ? 820 ILE A HD11 3  
ATOM 3581  H HD12 . ILE A 1 37  ? -6.659  6.994   8.781   1.00 0.00 ? 820 ILE A HD12 3  
ATOM 3582  H HD13 . ILE A 1 37  ? -5.282  7.015   7.681   1.00 0.00 ? 820 ILE A HD13 3  
ATOM 3583  N N    . CYS A 1 38  ? -7.180  7.038   2.748   1.00 0.00 ? 821 CYS A N    3  
ATOM 3584  C CA   . CYS A 1 38  ? -6.733  6.701   1.401   1.00 0.00 ? 821 CYS A CA   3  
ATOM 3585  C C    . CYS A 1 38  ? -7.545  7.456   0.353   1.00 0.00 ? 821 CYS A C    3  
ATOM 3586  O O    . CYS A 1 38  ? -6.989  8.157   -0.492  1.00 0.00 ? 821 CYS A O    3  
ATOM 3587  C CB   . CYS A 1 38  ? -6.849  5.194   1.165   1.00 0.00 ? 821 CYS A CB   3  
ATOM 3588  S SG   . CYS A 1 38  ? -5.618  4.211   2.054   1.00 0.00 ? 821 CYS A SG   3  
ATOM 3589  H H    . CYS A 1 38  ? -7.631  6.355   3.286   1.00 0.00 ? 821 CYS A H    3  
ATOM 3590  H HA   . CYS A 1 38  ? -5.697  6.992   1.313   1.00 0.00 ? 821 CYS A HA   3  
ATOM 3591  H HB2  . CYS A 1 38  ? -7.826  4.862   1.484   1.00 0.00 ? 821 CYS A HB2  3  
ATOM 3592  H HB3  . CYS A 1 38  ? -6.733  4.993   0.111   1.00 0.00 ? 821 CYS A HB3  3  
ATOM 3593  H HG   . CYS A 1 38  ? -5.501  4.711   3.275   1.00 0.00 ? 821 CYS A HG   3  
ATOM 3594  N N    . LYS A 1 39  ? -8.864  7.306   0.415   1.00 0.00 ? 822 LYS A N    3  
ATOM 3595  C CA   . LYS A 1 39  ? -9.755  7.973   -0.528  1.00 0.00 ? 822 LYS A CA   3  
ATOM 3596  C C    . LYS A 1 39  ? -9.556  9.485   -0.488  1.00 0.00 ? 822 LYS A C    3  
ATOM 3597  O O    . LYS A 1 39  ? -10.041 10.207  -1.359  1.00 0.00 ? 822 LYS A O    3  
ATOM 3598  C CB   . LYS A 1 39  ? -11.212 7.630   -0.213  1.00 0.00 ? 822 LYS A CB   3  
ATOM 3599  C CG   . LYS A 1 39  ? -11.680 8.143   1.138   1.00 0.00 ? 822 LYS A CG   3  
ATOM 3600  C CD   . LYS A 1 39  ? -13.188 8.325   1.174   1.00 0.00 ? 822 LYS A CD   3  
ATOM 3601  C CE   . LYS A 1 39  ? -13.594 9.418   2.151   1.00 0.00 ? 822 LYS A CE   3  
ATOM 3602  N NZ   . LYS A 1 39  ? -14.975 9.910   1.890   1.00 0.00 ? 822 LYS A NZ   3  
ATOM 3603  H H    . LYS A 1 39  ? -9.248  6.734   1.112   1.00 0.00 ? 822 LYS A H    3  
ATOM 3604  H HA   . LYS A 1 39  ? -9.516  7.616   -1.519  1.00 0.00 ? 822 LYS A HA   3  
ATOM 3605  H HB2  . LYS A 1 39  ? -11.844 8.061   -0.976  1.00 0.00 ? 822 LYS A HB2  3  
ATOM 3606  H HB3  . LYS A 1 39  ? -11.328 6.556   -0.226  1.00 0.00 ? 822 LYS A HB3  3  
ATOM 3607  H HG2  . LYS A 1 39  ? -11.395 7.434   1.900   1.00 0.00 ? 822 LYS A HG2  3  
ATOM 3608  H HG3  . LYS A 1 39  ? -11.206 9.095   1.335   1.00 0.00 ? 822 LYS A HG3  3  
ATOM 3609  H HD2  . LYS A 1 39  ? -13.533 8.594   0.187   1.00 0.00 ? 822 LYS A HD2  3  
ATOM 3610  H HD3  . LYS A 1 39  ? -13.647 7.395   1.477   1.00 0.00 ? 822 LYS A HD3  3  
ATOM 3611  H HE2  . LYS A 1 39  ? -13.545 9.023   3.154   1.00 0.00 ? 822 LYS A HE2  3  
ATOM 3612  H HE3  . LYS A 1 39  ? -12.903 10.243  2.056   1.00 0.00 ? 822 LYS A HE3  3  
ATOM 3613  H HZ1  . LYS A 1 39  ? -15.560 9.802   2.744   1.00 0.00 ? 822 LYS A HZ1  3  
ATOM 3614  H HZ2  . LYS A 1 39  ? -15.408 9.366   1.117   1.00 0.00 ? 822 LYS A HZ2  3  
ATOM 3615  H HZ3  . LYS A 1 39  ? -14.953 10.914  1.623   1.00 0.00 ? 822 LYS A HZ3  3  
ATOM 3616  N N    . ALA A 1 40  ? -8.840  9.956   0.527   1.00 0.00 ? 823 ALA A N    3  
ATOM 3617  C CA   . ALA A 1 40  ? -8.575  11.382  0.678   1.00 0.00 ? 823 ALA A CA   3  
ATOM 3618  C C    . ALA A 1 40  ? -7.649  11.887  -0.423  1.00 0.00 ? 823 ALA A C    3  
ATOM 3619  O O    . ALA A 1 40  ? -7.665  13.069  -0.768  1.00 0.00 ? 823 ALA A O    3  
ATOM 3620  C CB   . ALA A 1 40  ? -7.974  11.665  2.047   1.00 0.00 ? 823 ALA A CB   3  
ATOM 3621  H H    . ALA A 1 40  ? -8.480  9.330   1.190   1.00 0.00 ? 823 ALA A H    3  
ATOM 3622  H HA   . ALA A 1 40  ? -9.517  11.905  0.611   1.00 0.00 ? 823 ALA A HA   3  
ATOM 3623  H HB1  . ALA A 1 40  ? -6.901  11.758  1.956   1.00 0.00 ? 823 ALA A HB1  3  
ATOM 3624  H HB2  . ALA A 1 40  ? -8.384  12.584  2.437   1.00 0.00 ? 823 ALA A HB2  3  
ATOM 3625  H HB3  . ALA A 1 40  ? -8.208  10.852  2.718   1.00 0.00 ? 823 ALA A HB3  3  
ATOM 3626  N N    . HIS A 1 41  ? -6.841  10.985  -0.972  1.00 0.00 ? 824 HIS A N    3  
ATOM 3627  C CA   . HIS A 1 41  ? -5.908  11.341  -2.035  1.00 0.00 ? 824 HIS A CA   3  
ATOM 3628  C C    . HIS A 1 41  ? -6.522  11.080  -3.407  1.00 0.00 ? 824 HIS A C    3  
ATOM 3629  O O    . HIS A 1 41  ? -6.658  11.993  -4.220  1.00 0.00 ? 824 HIS A O    3  
ATOM 3630  C CB   . HIS A 1 41  ? -4.608  10.549  -1.887  1.00 0.00 ? 824 HIS A CB   3  
ATOM 3631  C CG   . HIS A 1 41  ? -3.879  10.829  -0.609  1.00 0.00 ? 824 HIS A CG   3  
ATOM 3632  N ND1  . HIS A 1 41  ? -3.389  12.075  -0.279  1.00 0.00 ? 824 HIS A ND1  3  
ATOM 3633  C CD2  . HIS A 1 41  ? -3.559  10.015  0.424   1.00 0.00 ? 824 HIS A CD2  3  
ATOM 3634  C CE1  . HIS A 1 41  ? -2.798  12.015  0.901   1.00 0.00 ? 824 HIS A CE1  3  
ATOM 3635  N NE2  . HIS A 1 41  ? -2.888  10.776  1.349   1.00 0.00 ? 824 HIS A NE2  3  
ATOM 3636  H H    . HIS A 1 41  ? -6.875  10.059  -0.655  1.00 0.00 ? 824 HIS A H    3  
ATOM 3637  H HA   . HIS A 1 41  ? -5.690  12.394  -1.946  1.00 0.00 ? 824 HIS A HA   3  
ATOM 3638  H HB2  . HIS A 1 41  ? -4.832  9.493   -1.916  1.00 0.00 ? 824 HIS A HB2  3  
ATOM 3639  H HB3  . HIS A 1 41  ? -3.949  10.795  -2.707  1.00 0.00 ? 824 HIS A HB3  3  
ATOM 3640  H HD2  . HIS A 1 41  ? -3.789  8.962   0.507   1.00 0.00 ? 824 HIS A HD2  3  
ATOM 3641  H HE1  . HIS A 1 41  ? -2.322  12.838  1.413   1.00 0.00 ? 824 HIS A HE1  3  
ATOM 3642  H HE2  . HIS A 1 41  ? -2.458  10.437  2.162   1.00 0.00 ? 824 HIS A HE2  3  
ATOM 3643  N N    . GLY A 1 42  ? -6.891  9.828   -3.657  1.00 0.00 ? 825 GLY A N    3  
ATOM 3644  C CA   . GLY A 1 42  ? -7.485  9.470   -4.932  1.00 0.00 ? 825 GLY A CA   3  
ATOM 3645  C C    . GLY A 1 42  ? -8.641  8.500   -4.781  1.00 0.00 ? 825 GLY A C    3  
ATOM 3646  O O    . GLY A 1 42  ? -9.404  8.575   -3.817  1.00 0.00 ? 825 GLY A O    3  
ATOM 3647  H H    . GLY A 1 42  ? -6.758  9.141   -2.971  1.00 0.00 ? 825 GLY A H    3  
ATOM 3648  H HA2  . GLY A 1 42  ? -7.843  10.367  -5.415  1.00 0.00 ? 825 GLY A HA2  3  
ATOM 3649  H HA3  . GLY A 1 42  ? -6.728  9.015   -5.554  1.00 0.00 ? 825 GLY A HA3  3  
ATOM 3650  N N    . THR A 1 43  ? -8.772  7.586   -5.737  1.00 0.00 ? 826 THR A N    3  
ATOM 3651  C CA   . THR A 1 43  ? -9.845  6.599   -5.708  1.00 0.00 ? 826 THR A CA   3  
ATOM 3652  C C    . THR A 1 43  ? -9.355  5.272   -5.140  1.00 0.00 ? 826 THR A C    3  
ATOM 3653  O O    . THR A 1 43  ? -8.394  4.687   -5.641  1.00 0.00 ? 826 THR A O    3  
ATOM 3654  C CB   . THR A 1 43  ? -10.425 6.359   -7.115  1.00 0.00 ? 826 THR A CB   3  
ATOM 3655  O OG1  . THR A 1 43  ? -10.802 7.607   -7.709  1.00 0.00 ? 826 THR A OG1  3  
ATOM 3656  C CG2  . THR A 1 43  ? -11.634 5.437   -7.051  1.00 0.00 ? 826 THR A CG2  3  
ATOM 3657  H H    . THR A 1 43  ? -8.133  7.576   -6.480  1.00 0.00 ? 826 THR A H    3  
ATOM 3658  H HA   . THR A 1 43  ? -10.633 6.981   -5.076  1.00 0.00 ? 826 THR A HA   3  
ATOM 3659  H HB   . THR A 1 43  ? -9.666  5.892   -7.726  1.00 0.00 ? 826 THR A HB   3  
ATOM 3660  H HG1  . THR A 1 43  ? -11.005 8.241   -7.018  1.00 0.00 ? 826 THR A HG1  3  
ATOM 3661  H HG21 . THR A 1 43  ? -11.803 4.998   -8.023  1.00 0.00 ? 826 THR A HG21 3  
ATOM 3662  H HG22 . THR A 1 43  ? -12.504 6.004   -6.755  1.00 0.00 ? 826 THR A HG22 3  
ATOM 3663  H HG23 . THR A 1 43  ? -11.451 4.654   -6.330  1.00 0.00 ? 826 THR A HG23 3  
ATOM 3664  N N    . VAL A 1 44  ? -10.022 4.800   -4.091  1.00 0.00 ? 827 VAL A N    3  
ATOM 3665  C CA   . VAL A 1 44  ? -9.655  3.540   -3.456  1.00 0.00 ? 827 VAL A CA   3  
ATOM 3666  C C    . VAL A 1 44  ? -10.454 2.379   -4.037  1.00 0.00 ? 827 VAL A C    3  
ATOM 3667  O O    . VAL A 1 44  ? -11.640 2.218   -3.745  1.00 0.00 ? 827 VAL A O    3  
ATOM 3668  C CB   . VAL A 1 44  ? -9.881  3.593   -1.933  1.00 0.00 ? 827 VAL A CB   3  
ATOM 3669  C CG1  . VAL A 1 44  ? -9.508  2.265   -1.292  1.00 0.00 ? 827 VAL A CG1  3  
ATOM 3670  C CG2  . VAL A 1 44  ? -9.086  4.734   -1.317  1.00 0.00 ? 827 VAL A CG2  3  
ATOM 3671  H H    . VAL A 1 44  ? -10.779 5.312   -3.737  1.00 0.00 ? 827 VAL A H    3  
ATOM 3672  H HA   . VAL A 1 44  ? -8.604  3.368   -3.637  1.00 0.00 ? 827 VAL A HA   3  
ATOM 3673  H HB   . VAL A 1 44  ? -10.930 3.774   -1.751  1.00 0.00 ? 827 VAL A HB   3  
ATOM 3674  H HG11 . VAL A 1 44  ? -8.437  2.134   -1.332  1.00 0.00 ? 827 VAL A HG11 3  
ATOM 3675  H HG12 . VAL A 1 44  ? -9.834  2.259   -0.262  1.00 0.00 ? 827 VAL A HG12 3  
ATOM 3676  H HG13 . VAL A 1 44  ? -9.989  1.460   -1.827  1.00 0.00 ? 827 VAL A HG13 3  
ATOM 3677  H HG21 . VAL A 1 44  ? -9.697  5.624   -1.289  1.00 0.00 ? 827 VAL A HG21 3  
ATOM 3678  H HG22 . VAL A 1 44  ? -8.793  4.468   -0.312  1.00 0.00 ? 827 VAL A HG22 3  
ATOM 3679  H HG23 . VAL A 1 44  ? -8.204  4.921   -1.911  1.00 0.00 ? 827 VAL A HG23 3  
ATOM 3680  N N    . LYS A 1 45  ? -9.797  1.570   -4.861  1.00 0.00 ? 828 LYS A N    3  
ATOM 3681  C CA   . LYS A 1 45  ? -10.445 0.421   -5.483  1.00 0.00 ? 828 LYS A CA   3  
ATOM 3682  C C    . LYS A 1 45  ? -10.630 -0.710  -4.476  1.00 0.00 ? 828 LYS A C    3  
ATOM 3683  O O    . LYS A 1 45  ? -11.724 -1.258  -4.338  1.00 0.00 ? 828 LYS A O    3  
ATOM 3684  C CB   . LYS A 1 45  ? -9.620  -0.072  -6.674  1.00 0.00 ? 828 LYS A CB   3  
ATOM 3685  C CG   . LYS A 1 45  ? -9.621  0.885   -7.853  1.00 0.00 ? 828 LYS A CG   3  
ATOM 3686  C CD   . LYS A 1 45  ? -10.969 0.906   -8.553  1.00 0.00 ? 828 LYS A CD   3  
ATOM 3687  C CE   . LYS A 1 45  ? -11.180 -0.344  -9.394  1.00 0.00 ? 828 LYS A CE   3  
ATOM 3688  N NZ   . LYS A 1 45  ? -10.418 -0.288  -10.672 1.00 0.00 ? 828 LYS A NZ   3  
ATOM 3689  H H    . LYS A 1 45  ? -8.853  1.749   -5.055  1.00 0.00 ? 828 LYS A H    3  
ATOM 3690  H HA   . LYS A 1 45  ? -11.415 0.736   -5.834  1.00 0.00 ? 828 LYS A HA   3  
ATOM 3691  H HB2  . LYS A 1 45  ? -8.598  -0.216  -6.354  1.00 0.00 ? 828 LYS A HB2  3  
ATOM 3692  H HB3  . LYS A 1 45  ? -10.020 -1.020  -7.006  1.00 0.00 ? 828 LYS A HB3  3  
ATOM 3693  H HG2  . LYS A 1 45  ? -9.397  1.880   -7.497  1.00 0.00 ? 828 LYS A HG2  3  
ATOM 3694  H HG3  . LYS A 1 45  ? -8.863  0.574   -8.558  1.00 0.00 ? 828 LYS A HG3  3  
ATOM 3695  H HD2  . LYS A 1 45  ? -11.750 0.962   -7.810  1.00 0.00 ? 828 LYS A HD2  3  
ATOM 3696  H HD3  . LYS A 1 45  ? -11.018 1.774   -9.196  1.00 0.00 ? 828 LYS A HD3  3  
ATOM 3697  H HE2  . LYS A 1 45  ? -10.852 -1.202  -8.827  1.00 0.00 ? 828 LYS A HE2  3  
ATOM 3698  H HE3  . LYS A 1 45  ? -12.232 -0.439  -9.615  1.00 0.00 ? 828 LYS A HE3  3  
ATOM 3699  H HZ1  . LYS A 1 45  ? -10.292 -1.247  -11.055 1.00 0.00 ? 828 LYS A HZ1  3  
ATOM 3700  H HZ2  . LYS A 1 45  ? -9.481  0.135   -10.512 1.00 0.00 ? 828 LYS A HZ2  3  
ATOM 3701  H HZ3  . LYS A 1 45  ? -10.931 0.288   -11.369 1.00 0.00 ? 828 LYS A HZ3  3  
ATOM 3702  N N    . ASP A 1 46  ? -9.555  -1.054  -3.775  1.00 0.00 ? 829 ASP A N    3  
ATOM 3703  C CA   . ASP A 1 46  ? -9.600  -2.118  -2.779  1.00 0.00 ? 829 ASP A CA   3  
ATOM 3704  C C    . ASP A 1 46  ? -8.614  -1.845  -1.647  1.00 0.00 ? 829 ASP A C    3  
ATOM 3705  O O    . ASP A 1 46  ? -7.595  -1.182  -1.844  1.00 0.00 ? 829 ASP A O    3  
ATOM 3706  C CB   . ASP A 1 46  ? -9.289  -3.467  -3.429  1.00 0.00 ? 829 ASP A CB   3  
ATOM 3707  C CG   . ASP A 1 46  ? -9.714  -4.638  -2.564  1.00 0.00 ? 829 ASP A CG   3  
ATOM 3708  O OD1  . ASP A 1 46  ? -8.905  -5.074  -1.719  1.00 0.00 ? 829 ASP A OD1  3  
ATOM 3709  O OD2  . ASP A 1 46  ? -10.854 -5.118  -2.732  1.00 0.00 ? 829 ASP A OD2  3  
ATOM 3710  H H    . ASP A 1 46  ? -8.711  -0.580  -3.931  1.00 0.00 ? 829 ASP A H    3  
ATOM 3711  H HA   . ASP A 1 46  ? -10.599 -2.147  -2.370  1.00 0.00 ? 829 ASP A HA   3  
ATOM 3712  H HB2  . ASP A 1 46  ? -9.811  -3.534  -4.372  1.00 0.00 ? 829 ASP A HB2  3  
ATOM 3713  H HB3  . ASP A 1 46  ? -8.226  -3.539  -3.604  1.00 0.00 ? 829 ASP A HB3  3  
ATOM 3714  N N    . LEU A 1 47  ? -8.925  -2.359  -0.462  1.00 0.00 ? 830 LEU A N    3  
ATOM 3715  C CA   . LEU A 1 47  ? -8.067  -2.170  0.702   1.00 0.00 ? 830 LEU A CA   3  
ATOM 3716  C C    . LEU A 1 47  ? -8.072  -3.411  1.589   1.00 0.00 ? 830 LEU A C    3  
ATOM 3717  O O    . LEU A 1 47  ? -9.129  -3.958  1.902   1.00 0.00 ? 830 LEU A O    3  
ATOM 3718  C CB   . LEU A 1 47  ? -8.526  -0.953  1.506   1.00 0.00 ? 830 LEU A CB   3  
ATOM 3719  C CG   . LEU A 1 47  ? -7.436  -0.209  2.279   1.00 0.00 ? 830 LEU A CG   3  
ATOM 3720  C CD1  . LEU A 1 47  ? -7.932  1.160   2.718   1.00 0.00 ? 830 LEU A CD1  3  
ATOM 3721  C CD2  . LEU A 1 47  ? -6.983  -1.024  3.481   1.00 0.00 ? 830 LEU A CD2  3  
ATOM 3722  H H    . LEU A 1 47  ? -9.750  -2.878  -0.367  1.00 0.00 ? 830 LEU A H    3  
ATOM 3723  H HA   . LEU A 1 47  ? -7.061  -1.999  0.348   1.00 0.00 ? 830 LEU A HA   3  
ATOM 3724  H HB2  . LEU A 1 47  ? -8.979  -0.255  0.820   1.00 0.00 ? 830 LEU A HB2  3  
ATOM 3725  H HB3  . LEU A 1 47  ? -9.267  -1.288  2.218   1.00 0.00 ? 830 LEU A HB3  3  
ATOM 3726  H HG   . LEU A 1 47  ? -6.582  -0.062  1.632   1.00 0.00 ? 830 LEU A HG   3  
ATOM 3727  H HD11 . LEU A 1 47  ? -9.008  1.197   2.633   1.00 0.00 ? 830 LEU A HD11 3  
ATOM 3728  H HD12 . LEU A 1 47  ? -7.495  1.920   2.087   1.00 0.00 ? 830 LEU A HD12 3  
ATOM 3729  H HD13 . LEU A 1 47  ? -7.645  1.335   3.744   1.00 0.00 ? 830 LEU A HD13 3  
ATOM 3730  H HD21 . LEU A 1 47  ? -7.330  -2.042  3.376   1.00 0.00 ? 830 LEU A HD21 3  
ATOM 3731  H HD22 . LEU A 1 47  ? -7.395  -0.595  4.383   1.00 0.00 ? 830 LEU A HD22 3  
ATOM 3732  H HD23 . LEU A 1 47  ? -5.905  -1.015  3.537   1.00 0.00 ? 830 LEU A HD23 3  
ATOM 3733  N N    . ARG A 1 48  ? -6.883  -3.848  1.993   1.00 0.00 ? 831 ARG A N    3  
ATOM 3734  C CA   . ARG A 1 48  ? -6.751  -5.024  2.845   1.00 0.00 ? 831 ARG A CA   3  
ATOM 3735  C C    . ARG A 1 48  ? -5.713  -4.789  3.938   1.00 0.00 ? 831 ARG A C    3  
ATOM 3736  O O    . ARG A 1 48  ? -4.809  -3.965  3.785   1.00 0.00 ? 831 ARG A O    3  
ATOM 3737  C CB   . ARG A 1 48  ? -6.359  -6.244  2.009   1.00 0.00 ? 831 ARG A CB   3  
ATOM 3738  C CG   . ARG A 1 48  ? -6.185  -7.512  2.828   1.00 0.00 ? 831 ARG A CG   3  
ATOM 3739  C CD   . ARG A 1 48  ? -6.308  -8.756  1.963   1.00 0.00 ? 831 ARG A CD   3  
ATOM 3740  N NE   . ARG A 1 48  ? -5.118  -8.975  1.145   1.00 0.00 ? 831 ARG A NE   3  
ATOM 3741  C CZ   . ARG A 1 48  ? -5.112  -9.708  0.037   1.00 0.00 ? 831 ARG A CZ   3  
ATOM 3742  N NH1  . ARG A 1 48  ? -6.227  -10.289 -0.383  1.00 0.00 ? 831 ARG A NH1  3  
ATOM 3743  N NH2  . ARG A 1 48  ? -3.989  -9.860  -0.653  1.00 0.00 ? 831 ARG A NH2  3  
ATOM 3744  H H    . ARG A 1 48  ? -6.076  -3.370  1.710   1.00 0.00 ? 831 ARG A H    3  
ATOM 3745  H HA   . ARG A 1 48  ? -7.709  -5.208  3.308   1.00 0.00 ? 831 ARG A HA   3  
ATOM 3746  H HB2  . ARG A 1 48  ? -7.128  -6.422  1.271   1.00 0.00 ? 831 ARG A HB2  3  
ATOM 3747  H HB3  . ARG A 1 48  ? -5.428  -6.036  1.505   1.00 0.00 ? 831 ARG A HB3  3  
ATOM 3748  H HG2  . ARG A 1 48  ? -5.206  -7.502  3.286   1.00 0.00 ? 831 ARG A HG2  3  
ATOM 3749  H HG3  . ARG A 1 48  ? -6.944  -7.541  3.596   1.00 0.00 ? 831 ARG A HG3  3  
ATOM 3750  H HD2  . ARG A 1 48  ? -6.455  -9.612  2.604   1.00 0.00 ? 831 ARG A HD2  3  
ATOM 3751  H HD3  . ARG A 1 48  ? -7.164  -8.643  1.314   1.00 0.00 ? 831 ARG A HD3  3  
ATOM 3752  H HE   . ARG A 1 48  ? -4.283  -8.554  1.437   1.00 0.00 ? 831 ARG A HE   3  
ATOM 3753  H HH11 . ARG A 1 48  ? -7.075  -10.176 0.134   1.00 0.00 ? 831 ARG A HH11 3  
ATOM 3754  H HH12 . ARG A 1 48  ? -6.220  -10.840 -1.218  1.00 0.00 ? 831 ARG A HH12 3  
ATOM 3755  H HH21 . ARG A 1 48  ? -3.147  -9.423  -0.339  1.00 0.00 ? 831 ARG A HH21 3  
ATOM 3756  H HH22 . ARG A 1 48  ? -3.985  -10.412 -1.486  1.00 0.00 ? 831 ARG A HH22 3  
ATOM 3757  N N    . LEU A 1 49  ? -5.848  -5.516  5.041   1.00 0.00 ? 832 LEU A N    3  
ATOM 3758  C CA   . LEU A 1 49  ? -4.922  -5.387  6.161   1.00 0.00 ? 832 LEU A CA   3  
ATOM 3759  C C    . LEU A 1 49  ? -4.243  -6.719  6.463   1.00 0.00 ? 832 LEU A C    3  
ATOM 3760  O O    . LEU A 1 49  ? -4.898  -7.757  6.548   1.00 0.00 ? 832 LEU A O    3  
ATOM 3761  C CB   . LEU A 1 49  ? -5.661  -4.885  7.404   1.00 0.00 ? 832 LEU A CB   3  
ATOM 3762  C CG   . LEU A 1 49  ? -6.667  -3.757  7.176   1.00 0.00 ? 832 LEU A CG   3  
ATOM 3763  C CD1  . LEU A 1 49  ? -7.456  -3.482  8.447   1.00 0.00 ? 832 LEU A CD1  3  
ATOM 3764  C CD2  . LEU A 1 49  ? -5.958  -2.497  6.703   1.00 0.00 ? 832 LEU A CD2  3  
ATOM 3765  H H    . LEU A 1 49  ? -6.587  -6.156  5.105   1.00 0.00 ? 832 LEU A H    3  
ATOM 3766  H HA   . LEU A 1 49  ? -4.167  -4.665  5.886   1.00 0.00 ? 832 LEU A HA   3  
ATOM 3767  H HB2  . LEU A 1 49  ? -6.192  -5.721  7.832   1.00 0.00 ? 832 LEU A HB2  3  
ATOM 3768  H HB3  . LEU A 1 49  ? -4.920  -4.533  8.108   1.00 0.00 ? 832 LEU A HB3  3  
ATOM 3769  H HG   . LEU A 1 49  ? -7.367  -4.057  6.408   1.00 0.00 ? 832 LEU A HG   3  
ATOM 3770  H HD11 . LEU A 1 49  ? -8.133  -4.301  8.636   1.00 0.00 ? 832 LEU A HD11 3  
ATOM 3771  H HD12 . LEU A 1 49  ? -8.021  -2.568  8.329   1.00 0.00 ? 832 LEU A HD12 3  
ATOM 3772  H HD13 . LEU A 1 49  ? -6.774  -3.378  9.279   1.00 0.00 ? 832 LEU A HD13 3  
ATOM 3773  H HD21 . LEU A 1 49  ? -6.496  -1.628  7.053   1.00 0.00 ? 832 LEU A HD21 3  
ATOM 3774  H HD22 . LEU A 1 49  ? -5.924  -2.488  5.623   1.00 0.00 ? 832 LEU A HD22 3  
ATOM 3775  H HD23 . LEU A 1 49  ? -4.953  -2.480  7.096   1.00 0.00 ? 832 LEU A HD23 3  
ATOM 3776  N N    . VAL A 1 50  ? -2.924  -6.681  6.626   1.00 0.00 ? 833 VAL A N    3  
ATOM 3777  C CA   . VAL A 1 50  ? -2.155  -7.884  6.921   1.00 0.00 ? 833 VAL A CA   3  
ATOM 3778  C C    . VAL A 1 50  ? -2.391  -8.348  8.354   1.00 0.00 ? 833 VAL A C    3  
ATOM 3779  O O    . VAL A 1 50  ? -1.903  -7.737  9.306   1.00 0.00 ? 833 VAL A O    3  
ATOM 3780  C CB   . VAL A 1 50  ? -0.647  -7.653  6.709   1.00 0.00 ? 833 VAL A CB   3  
ATOM 3781  C CG1  . VAL A 1 50  ? 0.126   -8.946  6.920   1.00 0.00 ? 833 VAL A CG1  3  
ATOM 3782  C CG2  . VAL A 1 50  ? -0.386  -7.085  5.323   1.00 0.00 ? 833 VAL A CG2  3  
ATOM 3783  H H    . VAL A 1 50  ? -2.457  -5.823  6.546   1.00 0.00 ? 833 VAL A H    3  
ATOM 3784  H HA   . VAL A 1 50  ? -2.478  -8.661  6.244   1.00 0.00 ? 833 VAL A HA   3  
ATOM 3785  H HB   . VAL A 1 50  ? -0.308  -6.934  7.440   1.00 0.00 ? 833 VAL A HB   3  
ATOM 3786  H HG11 . VAL A 1 50  ? -0.304  -9.491  7.747   1.00 0.00 ? 833 VAL A HG11 3  
ATOM 3787  H HG12 . VAL A 1 50  ? 0.073   -9.547  6.024   1.00 0.00 ? 833 VAL A HG12 3  
ATOM 3788  H HG13 . VAL A 1 50  ? 1.158   -8.716  7.139   1.00 0.00 ? 833 VAL A HG13 3  
ATOM 3789  H HG21 . VAL A 1 50  ? -0.707  -7.796  4.577   1.00 0.00 ? 833 VAL A HG21 3  
ATOM 3790  H HG22 . VAL A 1 50  ? -0.935  -6.163  5.201   1.00 0.00 ? 833 VAL A HG22 3  
ATOM 3791  H HG23 . VAL A 1 50  ? 0.670   -6.892  5.206   1.00 0.00 ? 833 VAL A HG23 3  
ATOM 3792  N N    . THR A 1 51  ? -3.142  -9.435  8.503   1.00 0.00 ? 834 THR A N    3  
ATOM 3793  C CA   . THR A 1 51  ? -3.444  -9.982  9.819   1.00 0.00 ? 834 THR A CA   3  
ATOM 3794  C C    . THR A 1 51  ? -2.779  -11.339 10.016  1.00 0.00 ? 834 THR A C    3  
ATOM 3795  O O    . THR A 1 51  ? -2.054  -11.818 9.145   1.00 0.00 ? 834 THR A O    3  
ATOM 3796  C CB   . THR A 1 51  ? -4.962  -10.131 10.032  1.00 0.00 ? 834 THR A CB   3  
ATOM 3797  O OG1  . THR A 1 51  ? -5.504  -11.042 9.069   1.00 0.00 ? 834 THR A OG1  3  
ATOM 3798  C CG2  . THR A 1 51  ? -5.660  -8.785  9.912   1.00 0.00 ? 834 THR A CG2  3  
ATOM 3799  H H    . THR A 1 51  ? -3.503  -9.878  7.706   1.00 0.00 ? 834 THR A H    3  
ATOM 3800  H HA   . THR A 1 51  ? -3.063  -9.295  10.561  1.00 0.00 ? 834 THR A HA   3  
ATOM 3801  H HB   . THR A 1 51  ? -5.134  -10.523 11.024  1.00 0.00 ? 834 THR A HB   3  
ATOM 3802  H HG1  . THR A 1 51  ? -5.690  -10.572 8.253   1.00 0.00 ? 834 THR A HG1  3  
ATOM 3803  H HG21 . THR A 1 51  ? -5.078  -8.031  10.423  1.00 0.00 ? 834 THR A HG21 3  
ATOM 3804  H HG22 . THR A 1 51  ? -6.641  -8.847  10.360  1.00 0.00 ? 834 THR A HG22 3  
ATOM 3805  H HG23 . THR A 1 51  ? -5.755  -8.521  8.870   1.00 0.00 ? 834 THR A HG23 3  
ATOM 3806  N N    . ASN A 1 52  ? -3.031  -11.956 11.167  1.00 0.00 ? 835 ASN A N    3  
ATOM 3807  C CA   . ASN A 1 52  ? -2.456  -13.259 11.477  1.00 0.00 ? 835 ASN A CA   3  
ATOM 3808  C C    . ASN A 1 52  ? -3.541  -14.330 11.548  1.00 0.00 ? 835 ASN A C    3  
ATOM 3809  O O    . ASN A 1 52  ? -4.724  -14.041 11.370  1.00 0.00 ? 835 ASN A O    3  
ATOM 3810  C CB   . ASN A 1 52  ? -1.695  -13.201 12.803  1.00 0.00 ? 835 ASN A CB   3  
ATOM 3811  C CG   . ASN A 1 52  ? -2.614  -12.974 13.988  1.00 0.00 ? 835 ASN A CG   3  
ATOM 3812  O OD1  . ASN A 1 52  ? -3.537  -12.163 13.925  1.00 0.00 ? 835 ASN A OD1  3  
ATOM 3813  N ND2  . ASN A 1 52  ? -2.363  -13.691 15.077  1.00 0.00 ? 835 ASN A ND2  3  
ATOM 3814  H H    . ASN A 1 52  ? -3.617  -11.523 11.822  1.00 0.00 ? 835 ASN A H    3  
ATOM 3815  H HA   . ASN A 1 52  ? -1.766  -13.514 10.687  1.00 0.00 ? 835 ASN A HA   3  
ATOM 3816  H HB2  . ASN A 1 52  ? -1.172  -14.135 12.952  1.00 0.00 ? 835 ASN A HB2  3  
ATOM 3817  H HB3  . ASN A 1 52  ? -0.979  -12.394 12.766  1.00 0.00 ? 835 ASN A HB3  3  
ATOM 3818  H HD21 . ASN A 1 52  ? -1.610  -14.318 15.056  1.00 0.00 ? 835 ASN A HD21 3  
ATOM 3819  H HD22 . ASN A 1 52  ? -2.942  -13.564 15.858  1.00 0.00 ? 835 ASN A HD22 3  
ATOM 3820  N N    . ARG A 1 53  ? -3.129  -15.566 11.809  1.00 0.00 ? 836 ARG A N    3  
ATOM 3821  C CA   . ARG A 1 53  ? -4.065  -16.680 11.902  1.00 0.00 ? 836 ARG A CA   3  
ATOM 3822  C C    . ARG A 1 53  ? -5.259  -16.314 12.779  1.00 0.00 ? 836 ARG A C    3  
ATOM 3823  O O    . ARG A 1 53  ? -6.337  -16.893 12.650  1.00 0.00 ? 836 ARG A O    3  
ATOM 3824  C CB   . ARG A 1 53  ? -3.365  -17.917 12.466  1.00 0.00 ? 836 ARG A CB   3  
ATOM 3825  C CG   . ARG A 1 53  ? -2.512  -18.652 11.445  1.00 0.00 ? 836 ARG A CG   3  
ATOM 3826  C CD   . ARG A 1 53  ? -1.796  -19.840 12.069  1.00 0.00 ? 836 ARG A CD   3  
ATOM 3827  N NE   . ARG A 1 53  ? -2.616  -21.048 12.046  1.00 0.00 ? 836 ARG A NE   3  
ATOM 3828  C CZ   . ARG A 1 53  ? -2.147  -22.260 12.318  1.00 0.00 ? 836 ARG A CZ   3  
ATOM 3829  N NH1  . ARG A 1 53  ? -0.870  -22.425 12.633  1.00 0.00 ? 836 ARG A NH1  3  
ATOM 3830  N NH2  . ARG A 1 53  ? -2.956  -23.311 12.275  1.00 0.00 ? 836 ARG A NH2  3  
ATOM 3831  H H    . ARG A 1 53  ? -2.172  -15.734 11.941  1.00 0.00 ? 836 ARG A H    3  
ATOM 3832  H HA   . ARG A 1 53  ? -4.419  -16.900 10.906  1.00 0.00 ? 836 ARG A HA   3  
ATOM 3833  H HB2  . ARG A 1 53  ? -2.727  -17.614 13.284  1.00 0.00 ? 836 ARG A HB2  3  
ATOM 3834  H HB3  . ARG A 1 53  ? -4.113  -18.601 12.837  1.00 0.00 ? 836 ARG A HB3  3  
ATOM 3835  H HG2  . ARG A 1 53  ? -3.147  -19.008 10.648  1.00 0.00 ? 836 ARG A HG2  3  
ATOM 3836  H HG3  . ARG A 1 53  ? -1.777  -17.969 11.046  1.00 0.00 ? 836 ARG A HG3  3  
ATOM 3837  H HD2  . ARG A 1 53  ? -0.885  -20.024 11.519  1.00 0.00 ? 836 ARG A HD2  3  
ATOM 3838  H HD3  . ARG A 1 53  ? -1.555  -19.599 13.094  1.00 0.00 ? 836 ARG A HD3  3  
ATOM 3839  H HE   . ARG A 1 53  ? -3.563  -20.949 11.815  1.00 0.00 ? 836 ARG A HE   3  
ATOM 3840  H HH11 . ARG A 1 53  ? -0.258  -21.635 12.667  1.00 0.00 ? 836 ARG A HH11 3  
ATOM 3841  H HH12 . ARG A 1 53  ? -0.519  -23.339 12.839  1.00 0.00 ? 836 ARG A HH12 3  
ATOM 3842  H HH21 . ARG A 1 53  ? -3.920  -23.191 12.038  1.00 0.00 ? 836 ARG A HH21 3  
ATOM 3843  H HH22 . ARG A 1 53  ? -2.602  -24.223 12.480  1.00 0.00 ? 836 ARG A HH22 3  
ATOM 3844  N N    . ALA A 1 54  ? -5.059  -15.349 13.671  1.00 0.00 ? 837 ALA A N    3  
ATOM 3845  C CA   . ALA A 1 54  ? -6.118  -14.905 14.567  1.00 0.00 ? 837 ALA A CA   3  
ATOM 3846  C C    . ALA A 1 54  ? -6.918  -13.763 13.950  1.00 0.00 ? 837 ALA A C    3  
ATOM 3847  O O    . ALA A 1 54  ? -8.147  -13.762 13.987  1.00 0.00 ? 837 ALA A O    3  
ATOM 3848  C CB   . ALA A 1 54  ? -5.533  -14.480 15.906  1.00 0.00 ? 837 ALA A CB   3  
ATOM 3849  H H    . ALA A 1 54  ? -4.177  -14.925 13.726  1.00 0.00 ? 837 ALA A H    3  
ATOM 3850  H HA   . ALA A 1 54  ? -6.781  -15.742 14.741  1.00 0.00 ? 837 ALA A HA   3  
ATOM 3851  H HB1  . ALA A 1 54  ? -4.971  -15.299 16.329  1.00 0.00 ? 837 ALA A HB1  3  
ATOM 3852  H HB2  . ALA A 1 54  ? -4.881  -13.632 15.760  1.00 0.00 ? 837 ALA A HB2  3  
ATOM 3853  H HB3  . ALA A 1 54  ? -6.333  -14.208 16.578  1.00 0.00 ? 837 ALA A HB3  3  
ATOM 3854  N N    . GLY A 1 55  ? -6.210  -12.790 13.383  1.00 0.00 ? 838 GLY A N    3  
ATOM 3855  C CA   . GLY A 1 55  ? -6.871  -11.655 12.766  1.00 0.00 ? 838 GLY A CA   3  
ATOM 3856  C C    . GLY A 1 55  ? -6.307  -10.329 13.238  1.00 0.00 ? 838 GLY A C    3  
ATOM 3857  O O    . GLY A 1 55  ? -6.671  -9.272  12.723  1.00 0.00 ? 838 GLY A O    3  
ATOM 3858  H H    . GLY A 1 55  ? -5.231  -12.845 13.383  1.00 0.00 ? 838 GLY A H    3  
ATOM 3859  H HA2  . GLY A 1 55  ? -6.754  -11.723 11.695  1.00 0.00 ? 838 GLY A HA2  3  
ATOM 3860  H HA3  . GLY A 1 55  ? -7.923  -11.691 13.007  1.00 0.00 ? 838 GLY A HA3  3  
ATOM 3861  N N    . LYS A 1 56  ? -5.416  -10.384 14.223  1.00 0.00 ? 839 LYS A N    3  
ATOM 3862  C CA   . LYS A 1 56  ? -4.801  -9.179  14.766  1.00 0.00 ? 839 LYS A CA   3  
ATOM 3863  C C    . LYS A 1 56  ? -3.929  -8.494  13.718  1.00 0.00 ? 839 LYS A C    3  
ATOM 3864  O O    . LYS A 1 56  ? -3.262  -9.142  12.911  1.00 0.00 ? 839 LYS A O    3  
ATOM 3865  C CB   . LYS A 1 56  ? -3.961  -9.522  15.998  1.00 0.00 ? 839 LYS A CB   3  
ATOM 3866  C CG   . LYS A 1 56  ? -4.774  -10.085 17.151  1.00 0.00 ? 839 LYS A CG   3  
ATOM 3867  C CD   . LYS A 1 56  ? -5.512  -8.988  17.901  1.00 0.00 ? 839 LYS A CD   3  
ATOM 3868  C CE   . LYS A 1 56  ? -6.143  -9.516  19.180  1.00 0.00 ? 839 LYS A CE   3  
ATOM 3869  N NZ   . LYS A 1 56  ? -6.564  -8.412  20.087  1.00 0.00 ? 839 LYS A NZ   3  
ATOM 3870  H H    . LYS A 1 56  ? -5.166  -11.257 14.592  1.00 0.00 ? 839 LYS A H    3  
ATOM 3871  H HA   . LYS A 1 56  ? -5.591  -8.504  15.056  1.00 0.00 ? 839 LYS A HA   3  
ATOM 3872  H HB2  . LYS A 1 56  ? -3.216  -10.253 15.720  1.00 0.00 ? 839 LYS A HB2  3  
ATOM 3873  H HB3  . LYS A 1 56  ? -3.463  -8.626  16.341  1.00 0.00 ? 839 LYS A HB3  3  
ATOM 3874  H HG2  . LYS A 1 56  ? -5.496  -10.788 16.761  1.00 0.00 ? 839 LYS A HG2  3  
ATOM 3875  H HG3  . LYS A 1 56  ? -4.109  -10.592 17.836  1.00 0.00 ? 839 LYS A HG3  3  
ATOM 3876  H HD2  . LYS A 1 56  ? -4.814  -8.205  18.154  1.00 0.00 ? 839 LYS A HD2  3  
ATOM 3877  H HD3  . LYS A 1 56  ? -6.289  -8.589  17.264  1.00 0.00 ? 839 LYS A HD3  3  
ATOM 3878  H HE2  . LYS A 1 56  ? -7.008  -10.107 18.922  1.00 0.00 ? 839 LYS A HE2  3  
ATOM 3879  H HE3  . LYS A 1 56  ? -5.423  -10.136 19.692  1.00 0.00 ? 839 LYS A HE3  3  
ATOM 3880  H HZ1  . LYS A 1 56  ? -7.356  -7.885  19.665  1.00 0.00 ? 839 LYS A HZ1  3  
ATOM 3881  H HZ2  . LYS A 1 56  ? -5.772  -7.757  20.244  1.00 0.00 ? 839 LYS A HZ2  3  
ATOM 3882  H HZ3  . LYS A 1 56  ? -6.868  -8.798  21.004  1.00 0.00 ? 839 LYS A HZ3  3  
ATOM 3883  N N    . PRO A 1 57  ? -3.931  -7.153  13.731  1.00 0.00 ? 840 PRO A N    3  
ATOM 3884  C CA   . PRO A 1 57  ? -3.143  -6.351  12.789  1.00 0.00 ? 840 PRO A CA   3  
ATOM 3885  C C    . PRO A 1 57  ? -1.645  -6.449  13.057  1.00 0.00 ? 840 PRO A C    3  
ATOM 3886  O O    . PRO A 1 57  ? -1.173  -6.100  14.139  1.00 0.00 ? 840 PRO A O    3  
ATOM 3887  C CB   . PRO A 1 57  ? -3.639  -4.924  13.038  1.00 0.00 ? 840 PRO A CB   3  
ATOM 3888  C CG   . PRO A 1 57  ? -4.145  -4.937  14.439  1.00 0.00 ? 840 PRO A CG   3  
ATOM 3889  C CD   . PRO A 1 57  ? -4.702  -6.316  14.665  1.00 0.00 ? 840 PRO A CD   3  
ATOM 3890  H HA   . PRO A 1 57  ? -3.344  -6.631  11.766  1.00 0.00 ? 840 PRO A HA   3  
ATOM 3891  H HB2  . PRO A 1 57  ? -2.819  -4.230  12.919  1.00 0.00 ? 840 PRO A HB2  3  
ATOM 3892  H HB3  . PRO A 1 57  ? -4.425  -4.685  12.337  1.00 0.00 ? 840 PRO A HB3  3  
ATOM 3893  H HG2  . PRO A 1 57  ? -3.334  -4.744  15.124  1.00 0.00 ? 840 PRO A HG2  3  
ATOM 3894  H HG3  . PRO A 1 57  ? -4.922  -4.196  14.555  1.00 0.00 ? 840 PRO A HG3  3  
ATOM 3895  H HD2  . PRO A 1 57  ? -4.538  -6.626  15.686  1.00 0.00 ? 840 PRO A HD2  3  
ATOM 3896  H HD3  . PRO A 1 57  ? -5.755  -6.341  14.426  1.00 0.00 ? 840 PRO A HD3  3  
ATOM 3897  N N    . LYS A 1 58  ? -0.902  -6.925  12.064  1.00 0.00 ? 841 LYS A N    3  
ATOM 3898  C CA   . LYS A 1 58  ? 0.544   -7.067  12.190  1.00 0.00 ? 841 LYS A CA   3  
ATOM 3899  C C    . LYS A 1 58  ? 1.245   -5.733  11.952  1.00 0.00 ? 841 LYS A C    3  
ATOM 3900  O O    . LYS A 1 58  ? 2.442   -5.597  12.200  1.00 0.00 ? 841 LYS A O    3  
ATOM 3901  C CB   . LYS A 1 58  ? 1.063   -8.112  11.200  1.00 0.00 ? 841 LYS A CB   3  
ATOM 3902  C CG   . LYS A 1 58  ? 0.497   -9.503  11.431  1.00 0.00 ? 841 LYS A CG   3  
ATOM 3903  C CD   . LYS A 1 58  ? 1.479   -10.582 11.006  1.00 0.00 ? 841 LYS A CD   3  
ATOM 3904  C CE   . LYS A 1 58  ? 1.738   -10.541 9.508   1.00 0.00 ? 841 LYS A CE   3  
ATOM 3905  N NZ   . LYS A 1 58  ? 2.616   -11.659 9.066   1.00 0.00 ? 841 LYS A NZ   3  
ATOM 3906  H H    . LYS A 1 58  ? -1.336  -7.186  11.224  1.00 0.00 ? 841 LYS A H    3  
ATOM 3907  H HA   . LYS A 1 58  ? 0.758   -7.398  13.195  1.00 0.00 ? 841 LYS A HA   3  
ATOM 3908  H HB2  . LYS A 1 58  ? 0.803   -7.802  10.199  1.00 0.00 ? 841 LYS A HB2  3  
ATOM 3909  H HB3  . LYS A 1 58  ? 2.139   -8.166  11.283  1.00 0.00 ? 841 LYS A HB3  3  
ATOM 3910  H HG2  . LYS A 1 58  ? 0.280   -9.623  12.482  1.00 0.00 ? 841 LYS A HG2  3  
ATOM 3911  H HG3  . LYS A 1 58  ? -0.413  -9.611  10.859  1.00 0.00 ? 841 LYS A HG3  3  
ATOM 3912  H HD2  . LYS A 1 58  ? 2.414   -10.431 11.525  1.00 0.00 ? 841 LYS A HD2  3  
ATOM 3913  H HD3  . LYS A 1 58  ? 1.072   -11.549 11.266  1.00 0.00 ? 841 LYS A HD3  3  
ATOM 3914  H HE2  . LYS A 1 58  ? 0.793   -10.610 8.991   1.00 0.00 ? 841 LYS A HE2  3  
ATOM 3915  H HE3  . LYS A 1 58  ? 2.213   -9.602  9.264   1.00 0.00 ? 841 LYS A HE3  3  
ATOM 3916  H HZ1  . LYS A 1 58  ? 3.599   -11.475 9.352   1.00 0.00 ? 841 LYS A HZ1  3  
ATOM 3917  H HZ2  . LYS A 1 58  ? 2.581   -11.754 8.031   1.00 0.00 ? 841 LYS A HZ2  3  
ATOM 3918  H HZ3  . LYS A 1 58  ? 2.302   -12.552 9.496   1.00 0.00 ? 841 LYS A HZ3  3  
ATOM 3919  N N    . GLY A 1 59  ? 0.490   -4.751  11.470  1.00 0.00 ? 842 GLY A N    3  
ATOM 3920  C CA   . GLY A 1 59  ? 1.056   -3.440  11.207  1.00 0.00 ? 842 GLY A CA   3  
ATOM 3921  C C    . GLY A 1 59  ? 1.159   -3.140  9.725   1.00 0.00 ? 842 GLY A C    3  
ATOM 3922  O O    . GLY A 1 59  ? 1.239   -1.978  9.324   1.00 0.00 ? 842 GLY A O    3  
ATOM 3923  H H    . GLY A 1 59  ? -0.460  -4.917  11.291  1.00 0.00 ? 842 GLY A H    3  
ATOM 3924  H HA2  . GLY A 1 59  ? 0.433   -2.692  11.674  1.00 0.00 ? 842 GLY A HA2  3  
ATOM 3925  H HA3  . GLY A 1 59  ? 2.044   -3.394  11.641  1.00 0.00 ? 842 GLY A HA3  3  
ATOM 3926  N N    . LEU A 1 60  ? 1.158   -4.188  8.909   1.00 0.00 ? 843 LEU A N    3  
ATOM 3927  C CA   . LEU A 1 60  ? 1.254   -4.031  7.462   1.00 0.00 ? 843 LEU A CA   3  
ATOM 3928  C C    . LEU A 1 60  ? -0.132  -3.952  6.830   1.00 0.00 ? 843 LEU A C    3  
ATOM 3929  O O    . LEU A 1 60  ? -1.028  -4.719  7.178   1.00 0.00 ? 843 LEU A O    3  
ATOM 3930  C CB   . LEU A 1 60  ? 2.039   -5.194  6.854   1.00 0.00 ? 843 LEU A CB   3  
ATOM 3931  C CG   . LEU A 1 60  ? 3.372   -5.528  7.524   1.00 0.00 ? 843 LEU A CG   3  
ATOM 3932  C CD1  . LEU A 1 60  ? 4.071   -6.661  6.788   1.00 0.00 ? 843 LEU A CD1  3  
ATOM 3933  C CD2  . LEU A 1 60  ? 4.264   -4.296  7.582   1.00 0.00 ? 843 LEU A CD2  3  
ATOM 3934  H H    . LEU A 1 60  ? 1.092   -5.089  9.287   1.00 0.00 ? 843 LEU A H    3  
ATOM 3935  H HA   . LEU A 1 60  ? 1.781   -3.109  7.263   1.00 0.00 ? 843 LEU A HA   3  
ATOM 3936  H HB2  . LEU A 1 60  ? 1.416   -6.074  6.901   1.00 0.00 ? 843 LEU A HB2  3  
ATOM 3937  H HB3  . LEU A 1 60  ? 2.239   -4.952  5.819   1.00 0.00 ? 843 LEU A HB3  3  
ATOM 3938  H HG   . LEU A 1 60  ? 3.186   -5.855  8.538   1.00 0.00 ? 843 LEU A HG   3  
ATOM 3939  H HD11 . LEU A 1 60  ? 3.349   -7.209  6.203   1.00 0.00 ? 843 LEU A HD11 3  
ATOM 3940  H HD12 . LEU A 1 60  ? 4.533   -7.324  7.504   1.00 0.00 ? 843 LEU A HD12 3  
ATOM 3941  H HD13 . LEU A 1 60  ? 4.829   -6.252  6.136   1.00 0.00 ? 843 LEU A HD13 3  
ATOM 3942  H HD21 . LEU A 1 60  ? 4.013   -3.633  6.767   1.00 0.00 ? 843 LEU A HD21 3  
ATOM 3943  H HD22 . LEU A 1 60  ? 5.298   -4.596  7.496   1.00 0.00 ? 843 LEU A HD22 3  
ATOM 3944  H HD23 . LEU A 1 60  ? 4.112   -3.786  8.521   1.00 0.00 ? 843 LEU A HD23 3  
ATOM 3945  N N    . ALA A 1 61  ? -0.299  -3.019  5.898   1.00 0.00 ? 844 ALA A N    3  
ATOM 3946  C CA   . ALA A 1 61  ? -1.574  -2.843  5.214   1.00 0.00 ? 844 ALA A CA   3  
ATOM 3947  C C    . ALA A 1 61  ? -1.370  -2.636  3.717   1.00 0.00 ? 844 ALA A C    3  
ATOM 3948  O O    . ALA A 1 61  ? -0.403  -2.001  3.294   1.00 0.00 ? 844 ALA A O    3  
ATOM 3949  C CB   . ALA A 1 61  ? -2.335  -1.669  5.812   1.00 0.00 ? 844 ALA A CB   3  
ATOM 3950  H H    . ALA A 1 61  ? 0.454   -2.437  5.663   1.00 0.00 ? 844 ALA A H    3  
ATOM 3951  H HA   . ALA A 1 61  ? -2.161  -3.737  5.367   1.00 0.00 ? 844 ALA A HA   3  
ATOM 3952  H HB1  . ALA A 1 61  ? -2.447  -1.818  6.876   1.00 0.00 ? 844 ALA A HB1  3  
ATOM 3953  H HB2  . ALA A 1 61  ? -1.788  -0.756  5.632   1.00 0.00 ? 844 ALA A HB2  3  
ATOM 3954  H HB3  . ALA A 1 61  ? -3.310  -1.602  5.353   1.00 0.00 ? 844 ALA A HB3  3  
ATOM 3955  N N    . TYR A 1 62  ? -2.285  -3.175  2.920   1.00 0.00 ? 845 TYR A N    3  
ATOM 3956  C CA   . TYR A 1 62  ? -2.204  -3.052  1.469   1.00 0.00 ? 845 TYR A CA   3  
ATOM 3957  C C    . TYR A 1 62  ? -3.313  -2.150  0.936   1.00 0.00 ? 845 TYR A C    3  
ATOM 3958  O O    . TYR A 1 62  ? -4.465  -2.248  1.358   1.00 0.00 ? 845 TYR A O    3  
ATOM 3959  C CB   . TYR A 1 62  ? -2.293  -4.431  0.813   1.00 0.00 ? 845 TYR A CB   3  
ATOM 3960  C CG   . TYR A 1 62  ? -0.977  -5.175  0.786   1.00 0.00 ? 845 TYR A CG   3  
ATOM 3961  C CD1  . TYR A 1 62  ? -0.535  -5.886  1.895   1.00 0.00 ? 845 TYR A CD1  3  
ATOM 3962  C CD2  . TYR A 1 62  ? -0.176  -5.168  -0.349  1.00 0.00 ? 845 TYR A CD2  3  
ATOM 3963  C CE1  . TYR A 1 62  ? 0.667   -6.566  1.875   1.00 0.00 ? 845 TYR A CE1  3  
ATOM 3964  C CE2  . TYR A 1 62  ? 1.027   -5.847  -0.379  1.00 0.00 ? 845 TYR A CE2  3  
ATOM 3965  C CZ   . TYR A 1 62  ? 1.445   -6.544  0.736   1.00 0.00 ? 845 TYR A CZ   3  
ATOM 3966  O OH   . TYR A 1 62  ? 2.642   -7.221  0.711   1.00 0.00 ? 845 TYR A OH   3  
ATOM 3967  H H    . TYR A 1 62  ? -3.033  -3.669  3.316   1.00 0.00 ? 845 TYR A H    3  
ATOM 3968  H HA   . TYR A 1 62  ? -1.248  -2.610  1.227   1.00 0.00 ? 845 TYR A HA   3  
ATOM 3969  H HB2  . TYR A 1 62  ? -3.003  -5.035  1.357   1.00 0.00 ? 845 TYR A HB2  3  
ATOM 3970  H HB3  . TYR A 1 62  ? -2.631  -4.316  -0.206  1.00 0.00 ? 845 TYR A HB3  3  
ATOM 3971  H HD1  . TYR A 1 62  ? -1.146  -5.902  2.786   1.00 0.00 ? 845 TYR A HD1  3  
ATOM 3972  H HD2  . TYR A 1 62  ? -0.505  -4.621  -1.221  1.00 0.00 ? 845 TYR A HD2  3  
ATOM 3973  H HE1  . TYR A 1 62  ? 0.994   -7.112  2.747   1.00 0.00 ? 845 TYR A HE1  3  
ATOM 3974  H HE2  . TYR A 1 62  ? 1.636   -5.829  -1.271  1.00 0.00 ? 845 TYR A HE2  3  
ATOM 3975  H HH   . TYR A 1 62  ? 2.478   -8.164  0.792   1.00 0.00 ? 845 TYR A HH   3  
ATOM 3976  N N    . VAL A 1 63  ? -2.956  -1.272  0.004   1.00 0.00 ? 846 VAL A N    3  
ATOM 3977  C CA   . VAL A 1 63  ? -3.919  -0.354  -0.591  1.00 0.00 ? 846 VAL A CA   3  
ATOM 3978  C C    . VAL A 1 63  ? -3.932  -0.478  -2.110  1.00 0.00 ? 846 VAL A C    3  
ATOM 3979  O O    . VAL A 1 63  ? -2.886  -0.638  -2.738  1.00 0.00 ? 846 VAL A O    3  
ATOM 3980  C CB   . VAL A 1 63  ? -3.612  1.106   -0.208  1.00 0.00 ? 846 VAL A CB   3  
ATOM 3981  C CG1  . VAL A 1 63  ? -4.509  2.061   -0.981  1.00 0.00 ? 846 VAL A CG1  3  
ATOM 3982  C CG2  . VAL A 1 63  ? -3.770  1.309   1.291   1.00 0.00 ? 846 VAL A CG2  3  
ATOM 3983  H H    . VAL A 1 63  ? -2.022  -1.243  -0.292  1.00 0.00 ? 846 VAL A H    3  
ATOM 3984  H HA   . VAL A 1 63  ? -4.899  -0.605  -0.210  1.00 0.00 ? 846 VAL A HA   3  
ATOM 3985  H HB   . VAL A 1 63  ? -2.586  1.318   -0.472  1.00 0.00 ? 846 VAL A HB   3  
ATOM 3986  H HG11 . VAL A 1 63  ? -5.526  1.696   -0.959  1.00 0.00 ? 846 VAL A HG11 3  
ATOM 3987  H HG12 . VAL A 1 63  ? -4.468  3.041   -0.528  1.00 0.00 ? 846 VAL A HG12 3  
ATOM 3988  H HG13 . VAL A 1 63  ? -4.171  2.123   -2.005  1.00 0.00 ? 846 VAL A HG13 3  
ATOM 3989  H HG21 . VAL A 1 63  ? -2.929  1.871   1.669   1.00 0.00 ? 846 VAL A HG21 3  
ATOM 3990  H HG22 . VAL A 1 63  ? -4.683  1.852   1.487   1.00 0.00 ? 846 VAL A HG22 3  
ATOM 3991  H HG23 . VAL A 1 63  ? -3.811  0.348   1.782   1.00 0.00 ? 846 VAL A HG23 3  
ATOM 3992  N N    . GLU A 1 64  ? -5.124  -0.401  -2.694  1.00 0.00 ? 847 GLU A N    3  
ATOM 3993  C CA   . GLU A 1 64  ? -5.272  -0.505  -4.141  1.00 0.00 ? 847 GLU A CA   3  
ATOM 3994  C C    . GLU A 1 64  ? -6.021  0.701   -4.699  1.00 0.00 ? 847 GLU A C    3  
ATOM 3995  O O    . GLU A 1 64  ? -7.180  0.940   -4.357  1.00 0.00 ? 847 GLU A O    3  
ATOM 3996  C CB   . GLU A 1 64  ? -6.012  -1.793  -4.509  1.00 0.00 ? 847 GLU A CB   3  
ATOM 3997  C CG   . GLU A 1 64  ? -5.769  -2.248  -5.938  1.00 0.00 ? 847 GLU A CG   3  
ATOM 3998  C CD   . GLU A 1 64  ? -6.840  -3.198  -6.438  1.00 0.00 ? 847 GLU A CD   3  
ATOM 3999  O OE1  . GLU A 1 64  ? -6.877  -4.352  -5.961  1.00 0.00 ? 847 GLU A OE1  3  
ATOM 4000  O OE2  . GLU A 1 64  ? -7.639  -2.789  -7.305  1.00 0.00 ? 847 GLU A OE2  3  
ATOM 4001  H H    . GLU A 1 64  ? -5.921  -0.273  -2.140  1.00 0.00 ? 847 GLU A H    3  
ATOM 4002  H HA   . GLU A 1 64  ? -4.284  -0.532  -4.575  1.00 0.00 ? 847 GLU A HA   3  
ATOM 4003  H HB2  . GLU A 1 64  ? -5.692  -2.581  -3.843  1.00 0.00 ? 847 GLU A HB2  3  
ATOM 4004  H HB3  . GLU A 1 64  ? -7.072  -1.634  -4.379  1.00 0.00 ? 847 GLU A HB3  3  
ATOM 4005  H HG2  . GLU A 1 64  ? -5.752  -1.380  -6.581  1.00 0.00 ? 847 GLU A HG2  3  
ATOM 4006  H HG3  . GLU A 1 64  ? -4.813  -2.748  -5.986  1.00 0.00 ? 847 GLU A HG3  3  
ATOM 4007  N N    . TYR A 1 65  ? -5.352  1.459   -5.561  1.00 0.00 ? 848 TYR A N    3  
ATOM 4008  C CA   . TYR A 1 65  ? -5.952  2.643   -6.164  1.00 0.00 ? 848 TYR A CA   3  
ATOM 4009  C C    . TYR A 1 65  ? -6.481  2.333   -7.561  1.00 0.00 ? 848 TYR A C    3  
ATOM 4010  O O    . TYR A 1 65  ? -6.371  1.206   -8.042  1.00 0.00 ? 848 TYR A O    3  
ATOM 4011  C CB   . TYR A 1 65  ? -4.930  3.779   -6.235  1.00 0.00 ? 848 TYR A CB   3  
ATOM 4012  C CG   . TYR A 1 65  ? -4.905  4.648   -4.998  1.00 0.00 ? 848 TYR A CG   3  
ATOM 4013  C CD1  . TYR A 1 65  ? -4.335  4.191   -3.816  1.00 0.00 ? 848 TYR A CD1  3  
ATOM 4014  C CD2  . TYR A 1 65  ? -5.451  5.925   -5.011  1.00 0.00 ? 848 TYR A CD2  3  
ATOM 4015  C CE1  . TYR A 1 65  ? -4.310  4.981   -2.683  1.00 0.00 ? 848 TYR A CE1  3  
ATOM 4016  C CE2  . TYR A 1 65  ? -5.429  6.723   -3.883  1.00 0.00 ? 848 TYR A CE2  3  
ATOM 4017  C CZ   . TYR A 1 65  ? -4.858  6.246   -2.721  1.00 0.00 ? 848 TYR A CZ   3  
ATOM 4018  O OH   . TYR A 1 65  ? -4.835  7.037   -1.596  1.00 0.00 ? 848 TYR A OH   3  
ATOM 4019  H H    . TYR A 1 65  ? -4.431  1.218   -5.795  1.00 0.00 ? 848 TYR A H    3  
ATOM 4020  H HA   . TYR A 1 65  ? -6.777  2.952   -5.539  1.00 0.00 ? 848 TYR A HA   3  
ATOM 4021  H HB2  . TYR A 1 65  ? -3.944  3.360   -6.365  1.00 0.00 ? 848 TYR A HB2  3  
ATOM 4022  H HB3  . TYR A 1 65  ? -5.162  4.411   -7.080  1.00 0.00 ? 848 TYR A HB3  3  
ATOM 4023  H HD1  . TYR A 1 65  ? -3.906  3.200   -3.788  1.00 0.00 ? 848 TYR A HD1  3  
ATOM 4024  H HD2  . TYR A 1 65  ? -5.898  6.295   -5.922  1.00 0.00 ? 848 TYR A HD2  3  
ATOM 4025  H HE1  . TYR A 1 65  ? -3.862  4.609   -1.773  1.00 0.00 ? 848 TYR A HE1  3  
ATOM 4026  H HE2  . TYR A 1 65  ? -5.859  7.713   -3.913  1.00 0.00 ? 848 TYR A HE2  3  
ATOM 4027  H HH   . TYR A 1 65  ? -5.640  7.559   -1.555  1.00 0.00 ? 848 TYR A HH   3  
ATOM 4028  N N    . GLU A 1 66  ? -7.056  3.343   -8.207  1.00 0.00 ? 849 GLU A N    3  
ATOM 4029  C CA   . GLU A 1 66  ? -7.603  3.179   -9.549  1.00 0.00 ? 849 GLU A CA   3  
ATOM 4030  C C    . GLU A 1 66  ? -6.561  3.530   -10.607 1.00 0.00 ? 849 GLU A C    3  
ATOM 4031  O O    . GLU A 1 66  ? -6.385  2.803   -11.584 1.00 0.00 ? 849 GLU A O    3  
ATOM 4032  C CB   . GLU A 1 66  ? -8.844  4.055   -9.728  1.00 0.00 ? 849 GLU A CB   3  
ATOM 4033  C CG   . GLU A 1 66  ? -9.572  3.818   -11.040 1.00 0.00 ? 849 GLU A CG   3  
ATOM 4034  C CD   . GLU A 1 66  ? -10.702 4.804   -11.268 1.00 0.00 ? 849 GLU A CD   3  
ATOM 4035  O OE1  . GLU A 1 66  ? -10.551 5.980   -10.878 1.00 0.00 ? 849 GLU A OE1  3  
ATOM 4036  O OE2  . GLU A 1 66  ? -11.737 4.398   -11.836 1.00 0.00 ? 849 GLU A OE2  3  
ATOM 4037  H H    . GLU A 1 66  ? -7.113  4.219   -7.771  1.00 0.00 ? 849 GLU A H    3  
ATOM 4038  H HA   . GLU A 1 66  ? -7.884  2.144   -9.667  1.00 0.00 ? 849 GLU A HA   3  
ATOM 4039  H HB2  . GLU A 1 66  ? -9.530  3.857   -8.918  1.00 0.00 ? 849 GLU A HB2  3  
ATOM 4040  H HB3  . GLU A 1 66  ? -8.546  5.093   -9.689  1.00 0.00 ? 849 GLU A HB3  3  
ATOM 4041  H HG2  . GLU A 1 66  ? -8.866  3.911   -11.852 1.00 0.00 ? 849 GLU A HG2  3  
ATOM 4042  H HG3  . GLU A 1 66  ? -9.982  2.818   -11.034 1.00 0.00 ? 849 GLU A HG3  3  
ATOM 4043  N N    . ASN A 1 67  ? -5.874  4.649   -10.405 1.00 0.00 ? 850 ASN A N    3  
ATOM 4044  C CA   . ASN A 1 67  ? -4.851  5.098   -11.342 1.00 0.00 ? 850 ASN A CA   3  
ATOM 4045  C C    . ASN A 1 67  ? -3.496  5.217   -10.652 1.00 0.00 ? 850 ASN A C    3  
ATOM 4046  O O    . ASN A 1 67  ? -3.416  5.264   -9.425  1.00 0.00 ? 850 ASN A O    3  
ATOM 4047  C CB   . ASN A 1 67  ? -5.245  6.445   -11.953 1.00 0.00 ? 850 ASN A CB   3  
ATOM 4048  C CG   . ASN A 1 67  ? -4.420  6.787   -13.179 1.00 0.00 ? 850 ASN A CG   3  
ATOM 4049  O OD1  . ASN A 1 67  ? -4.286  5.976   -14.096 1.00 0.00 ? 850 ASN A OD1  3  
ATOM 4050  N ND2  . ASN A 1 67  ? -3.864  7.992   -13.201 1.00 0.00 ? 850 ASN A ND2  3  
ATOM 4051  H H    . ASN A 1 67  ? -6.060  5.187   -9.607  1.00 0.00 ? 850 ASN A H    3  
ATOM 4052  H HA   . ASN A 1 67  ? -4.778  4.364   -12.130 1.00 0.00 ? 850 ASN A HA   3  
ATOM 4053  H HB2  . ASN A 1 67  ? -6.286  6.412   -12.241 1.00 0.00 ? 850 ASN A HB2  3  
ATOM 4054  H HB3  . ASN A 1 67  ? -5.103  7.222   -11.218 1.00 0.00 ? 850 ASN A HB3  3  
ATOM 4055  H HD21 . ASN A 1 67  ? -4.014  8.585   -12.435 1.00 0.00 ? 850 ASN A HD21 3  
ATOM 4056  H HD22 . ASN A 1 67  ? -3.326  8.239   -13.982 1.00 0.00 ? 850 ASN A HD22 3  
ATOM 4057  N N    . GLU A 1 68  ? -2.434  5.265   -11.450 1.00 0.00 ? 851 GLU A N    3  
ATOM 4058  C CA   . GLU A 1 68  ? -1.082  5.378   -10.916 1.00 0.00 ? 851 GLU A CA   3  
ATOM 4059  C C    . GLU A 1 68  ? -0.853  6.756   -10.301 1.00 0.00 ? 851 GLU A C    3  
ATOM 4060  O O    . GLU A 1 68  ? -0.461  6.872   -9.140  1.00 0.00 ? 851 GLU A O    3  
ATOM 4061  C CB   . GLU A 1 68  ? -0.051  5.121   -12.017 1.00 0.00 ? 851 GLU A CB   3  
ATOM 4062  C CG   . GLU A 1 68  ? 0.118   3.651   -12.363 1.00 0.00 ? 851 GLU A CG   3  
ATOM 4063  C CD   . GLU A 1 68  ? -1.148  3.037   -12.928 1.00 0.00 ? 851 GLU A CD   3  
ATOM 4064  O OE1  . GLU A 1 68  ? -1.818  3.704   -13.743 1.00 0.00 ? 851 GLU A OE1  3  
ATOM 4065  O OE2  . GLU A 1 68  ? -1.468  1.888   -12.556 1.00 0.00 ? 851 GLU A OE2  3  
ATOM 4066  H H    . GLU A 1 68  ? -2.562  5.223   -12.421 1.00 0.00 ? 851 GLU A H    3  
ATOM 4067  H HA   . GLU A 1 68  ? -0.966  4.630   -10.146 1.00 0.00 ? 851 GLU A HA   3  
ATOM 4068  H HB2  . GLU A 1 68  ? -0.356  5.648   -12.909 1.00 0.00 ? 851 GLU A HB2  3  
ATOM 4069  H HB3  . GLU A 1 68  ? 0.906   5.505   -11.694 1.00 0.00 ? 851 GLU A HB3  3  
ATOM 4070  H HG2  . GLU A 1 68  ? 0.905   3.555   -13.095 1.00 0.00 ? 851 GLU A HG2  3  
ATOM 4071  H HG3  . GLU A 1 68  ? 0.393   3.113   -11.467 1.00 0.00 ? 851 GLU A HG3  3  
ATOM 4072  N N    . SER A 1 69  ? -1.101  7.797   -11.088 1.00 0.00 ? 852 SER A N    3  
ATOM 4073  C CA   . SER A 1 69  ? -0.918  9.167   -10.624 1.00 0.00 ? 852 SER A CA   3  
ATOM 4074  C C    . SER A 1 69  ? -1.391  9.319   -9.181  1.00 0.00 ? 852 SER A C    3  
ATOM 4075  O O    . SER A 1 69  ? -0.610  9.663   -8.295  1.00 0.00 ? 852 SER A O    3  
ATOM 4076  C CB   . SER A 1 69  ? -1.679  10.140  -11.527 1.00 0.00 ? 852 SER A CB   3  
ATOM 4077  O OG   . SER A 1 69  ? -1.052  11.411  -11.550 1.00 0.00 ? 852 SER A OG   3  
ATOM 4078  H H    . SER A 1 69  ? -1.412  7.640   -12.005 1.00 0.00 ? 852 SER A H    3  
ATOM 4079  H HA   . SER A 1 69  ? 0.136   9.395   -10.671 1.00 0.00 ? 852 SER A HA   3  
ATOM 4080  H HB2  . SER A 1 69  ? -1.707  9.747   -12.532 1.00 0.00 ? 852 SER A HB2  3  
ATOM 4081  H HB3  . SER A 1 69  ? -2.688  10.256  -11.157 1.00 0.00 ? 852 SER A HB3  3  
ATOM 4082  H HG   . SER A 1 69  ? -0.156  11.320  -11.880 1.00 0.00 ? 852 SER A HG   3  
ATOM 4083  N N    . GLN A 1 70  ? -2.675  9.060   -8.955  1.00 0.00 ? 853 GLN A N    3  
ATOM 4084  C CA   . GLN A 1 70  ? -3.252  9.169   -7.621  1.00 0.00 ? 853 GLN A CA   3  
ATOM 4085  C C    . GLN A 1 70  ? -2.392  8.440   -6.594  1.00 0.00 ? 853 GLN A C    3  
ATOM 4086  O O    . GLN A 1 70  ? -1.872  9.050   -5.660  1.00 0.00 ? 853 GLN A O    3  
ATOM 4087  C CB   . GLN A 1 70  ? -4.672  8.601   -7.609  1.00 0.00 ? 853 GLN A CB   3  
ATOM 4088  C CG   . GLN A 1 70  ? -5.690  9.492   -8.303  1.00 0.00 ? 853 GLN A CG   3  
ATOM 4089  C CD   . GLN A 1 70  ? -7.062  8.853   -8.391  1.00 0.00 ? 853 GLN A CD   3  
ATOM 4090  O OE1  . GLN A 1 70  ? -8.011  9.304   -7.749  1.00 0.00 ? 853 GLN A OE1  3  
ATOM 4091  N NE2  . GLN A 1 70  ? -7.173  7.796   -9.187  1.00 0.00 ? 853 GLN A NE2  3  
ATOM 4092  H H    . GLN A 1 70  ? -3.247  8.791   -9.703  1.00 0.00 ? 853 GLN A H    3  
ATOM 4093  H HA   . GLN A 1 70  ? -3.291  10.216  -7.361  1.00 0.00 ? 853 GLN A HA   3  
ATOM 4094  H HB2  . GLN A 1 70  ? -4.668  7.642   -8.104  1.00 0.00 ? 853 GLN A HB2  3  
ATOM 4095  H HB3  . GLN A 1 70  ? -4.985  8.467   -6.584  1.00 0.00 ? 853 GLN A HB3  3  
ATOM 4096  H HG2  . GLN A 1 70  ? -5.775  10.417  -7.752  1.00 0.00 ? 853 GLN A HG2  3  
ATOM 4097  H HG3  . GLN A 1 70  ? -5.342  9.701   -9.304  1.00 0.00 ? 853 GLN A HG3  3  
ATOM 4098  H HE21 . GLN A 1 70  ? -6.374  7.492   -9.666  1.00 0.00 ? 853 GLN A HE21 3  
ATOM 4099  H HE22 . GLN A 1 70  ? -8.048  7.363   -9.261  1.00 0.00 ? 853 GLN A HE22 3  
ATOM 4100  N N    . ALA A 1 71  ? -2.245  7.131   -6.775  1.00 0.00 ? 854 ALA A N    3  
ATOM 4101  C CA   . ALA A 1 71  ? -1.446  6.319   -5.865  1.00 0.00 ? 854 ALA A CA   3  
ATOM 4102  C C    . ALA A 1 71  ? -0.121  7.001   -5.541  1.00 0.00 ? 854 ALA A C    3  
ATOM 4103  O O    . ALA A 1 71  ? 0.173   7.287   -4.380  1.00 0.00 ? 854 ALA A O    3  
ATOM 4104  C CB   . ALA A 1 71  ? -1.201  4.942   -6.464  1.00 0.00 ? 854 ALA A CB   3  
ATOM 4105  H H    . ALA A 1 71  ? -2.684  6.702   -7.538  1.00 0.00 ? 854 ALA A H    3  
ATOM 4106  H HA   . ALA A 1 71  ? -2.008  6.193   -4.950  1.00 0.00 ? 854 ALA A HA   3  
ATOM 4107  H HB1  . ALA A 1 71  ? -2.112  4.364   -6.418  1.00 0.00 ? 854 ALA A HB1  3  
ATOM 4108  H HB2  . ALA A 1 71  ? -0.892  5.048   -7.493  1.00 0.00 ? 854 ALA A HB2  3  
ATOM 4109  H HB3  . ALA A 1 71  ? -0.426  4.440   -5.904  1.00 0.00 ? 854 ALA A HB3  3  
ATOM 4110  N N    . SER A 1 72  ? 0.675   7.258   -6.573  1.00 0.00 ? 855 SER A N    3  
ATOM 4111  C CA   . SER A 1 72  ? 1.972   7.902   -6.397  1.00 0.00 ? 855 SER A CA   3  
ATOM 4112  C C    . SER A 1 72  ? 1.891   9.008   -5.350  1.00 0.00 ? 855 SER A C    3  
ATOM 4113  O O    . SER A 1 72  ? 2.636   9.005   -4.370  1.00 0.00 ? 855 SER A O    3  
ATOM 4114  C CB   . SER A 1 72  ? 2.463   8.478   -7.727  1.00 0.00 ? 855 SER A CB   3  
ATOM 4115  O OG   . SER A 1 72  ? 3.872   8.634   -7.725  1.00 0.00 ? 855 SER A OG   3  
ATOM 4116  H H    . SER A 1 72  ? 0.385   7.006   -7.475  1.00 0.00 ? 855 SER A H    3  
ATOM 4117  H HA   . SER A 1 72  ? 2.671   7.152   -6.059  1.00 0.00 ? 855 SER A HA   3  
ATOM 4118  H HB2  . SER A 1 72  ? 2.188   7.810   -8.529  1.00 0.00 ? 855 SER A HB2  3  
ATOM 4119  H HB3  . SER A 1 72  ? 2.006   9.443   -7.888  1.00 0.00 ? 855 SER A HB3  3  
ATOM 4120  H HG   . SER A 1 72  ? 4.169   8.849   -6.838  1.00 0.00 ? 855 SER A HG   3  
ATOM 4121  N N    . GLN A 1 73  ? 0.981   9.953   -5.565  1.00 0.00 ? 856 GLN A N    3  
ATOM 4122  C CA   . GLN A 1 73  ? 0.803   11.066  -4.640  1.00 0.00 ? 856 GLN A CA   3  
ATOM 4123  C C    . GLN A 1 73  ? 0.521   10.561  -3.229  1.00 0.00 ? 856 GLN A C    3  
ATOM 4124  O O    . GLN A 1 73  ? 1.182   10.963  -2.272  1.00 0.00 ? 856 GLN A O    3  
ATOM 4125  C CB   . GLN A 1 73  ? -0.340  11.968  -5.109  1.00 0.00 ? 856 GLN A CB   3  
ATOM 4126  C CG   . GLN A 1 73  ? -0.215  13.406  -4.631  1.00 0.00 ? 856 GLN A CG   3  
ATOM 4127  C CD   . GLN A 1 73  ? 0.995   14.111  -5.210  1.00 0.00 ? 856 GLN A CD   3  
ATOM 4128  O OE1  . GLN A 1 73  ? 0.963   14.596  -6.341  1.00 0.00 ? 856 GLN A OE1  3  
ATOM 4129  N NE2  . GLN A 1 73  ? 2.072   14.171  -4.435  1.00 0.00 ? 856 GLN A NE2  3  
ATOM 4130  H H    . GLN A 1 73  ? 0.417   9.900   -6.364  1.00 0.00 ? 856 GLN A H    3  
ATOM 4131  H HA   . GLN A 1 73  ? 1.719   11.637  -4.628  1.00 0.00 ? 856 GLN A HA   3  
ATOM 4132  H HB2  . GLN A 1 73  ? -0.361  11.971  -6.189  1.00 0.00 ? 856 GLN A HB2  3  
ATOM 4133  H HB3  . GLN A 1 73  ? -1.273  11.569  -4.740  1.00 0.00 ? 856 GLN A HB3  3  
ATOM 4134  H HG2  . GLN A 1 73  ? -1.102  13.948  -4.924  1.00 0.00 ? 856 GLN A HG2  3  
ATOM 4135  H HG3  . GLN A 1 73  ? -0.134  13.407  -3.554  1.00 0.00 ? 856 GLN A HG3  3  
ATOM 4136  H HE21 . GLN A 1 73  ? 2.026   13.761  -3.546  1.00 0.00 ? 856 GLN A HE21 3  
ATOM 4137  H HE22 . GLN A 1 73  ? 2.869   14.620  -4.785  1.00 0.00 ? 856 GLN A HE22 3  
ATOM 4138  N N    . ALA A 1 74  ? -0.465  9.678   -3.107  1.00 0.00 ? 857 ALA A N    3  
ATOM 4139  C CA   . ALA A 1 74  ? -0.833  9.118   -1.813  1.00 0.00 ? 857 ALA A CA   3  
ATOM 4140  C C    . ALA A 1 74  ? 0.389   8.565   -1.087  1.00 0.00 ? 857 ALA A C    3  
ATOM 4141  O O    . ALA A 1 74  ? 0.455   8.586   0.143   1.00 0.00 ? 857 ALA A O    3  
ATOM 4142  C CB   . ALA A 1 74  ? -1.882  8.030   -1.988  1.00 0.00 ? 857 ALA A CB   3  
ATOM 4143  H H    . ALA A 1 74  ? -0.956  9.396   -3.907  1.00 0.00 ? 857 ALA A H    3  
ATOM 4144  H HA   . ALA A 1 74  ? -1.266  9.909   -1.217  1.00 0.00 ? 857 ALA A HA   3  
ATOM 4145  H HB1  . ALA A 1 74  ? -1.652  7.447   -2.868  1.00 0.00 ? 857 ALA A HB1  3  
ATOM 4146  H HB2  . ALA A 1 74  ? -1.883  7.387   -1.120  1.00 0.00 ? 857 ALA A HB2  3  
ATOM 4147  H HB3  . ALA A 1 74  ? -2.855  8.484   -2.101  1.00 0.00 ? 857 ALA A HB3  3  
ATOM 4148  N N    . VAL A 1 75  ? 1.354   8.069   -1.855  1.00 0.00 ? 858 VAL A N    3  
ATOM 4149  C CA   . VAL A 1 75  ? 2.574   7.511   -1.284  1.00 0.00 ? 858 VAL A CA   3  
ATOM 4150  C C    . VAL A 1 75  ? 3.483   8.611   -0.746  1.00 0.00 ? 858 VAL A C    3  
ATOM 4151  O O    . VAL A 1 75  ? 3.883   8.585   0.417   1.00 0.00 ? 858 VAL A O    3  
ATOM 4152  C CB   . VAL A 1 75  ? 3.351   6.681   -2.323  1.00 0.00 ? 858 VAL A CB   3  
ATOM 4153  C CG1  . VAL A 1 75  ? 4.628   6.122   -1.715  1.00 0.00 ? 858 VAL A CG1  3  
ATOM 4154  C CG2  . VAL A 1 75  ? 2.478   5.562   -2.871  1.00 0.00 ? 858 VAL A CG2  3  
ATOM 4155  H H    . VAL A 1 75  ? 1.243   8.080   -2.828  1.00 0.00 ? 858 VAL A H    3  
ATOM 4156  H HA   . VAL A 1 75  ? 2.294   6.858   -0.470  1.00 0.00 ? 858 VAL A HA   3  
ATOM 4157  H HB   . VAL A 1 75  ? 3.623   7.330   -3.142  1.00 0.00 ? 858 VAL A HB   3  
ATOM 4158  H HG11 . VAL A 1 75  ? 4.750   6.513   -0.715  1.00 0.00 ? 858 VAL A HG11 3  
ATOM 4159  H HG12 . VAL A 1 75  ? 4.568   5.045   -1.677  1.00 0.00 ? 858 VAL A HG12 3  
ATOM 4160  H HG13 . VAL A 1 75  ? 5.473   6.415   -2.320  1.00 0.00 ? 858 VAL A HG13 3  
ATOM 4161  H HG21 . VAL A 1 75  ? 1.585   5.984   -3.308  1.00 0.00 ? 858 VAL A HG21 3  
ATOM 4162  H HG22 . VAL A 1 75  ? 3.024   5.015   -3.626  1.00 0.00 ? 858 VAL A HG22 3  
ATOM 4163  H HG23 . VAL A 1 75  ? 2.205   4.892   -2.069  1.00 0.00 ? 858 VAL A HG23 3  
ATOM 4164  N N    . MET A 1 76  ? 3.804   9.576   -1.601  1.00 0.00 ? 859 MET A N    3  
ATOM 4165  C CA   . MET A 1 76  ? 4.665   10.686  -1.211  1.00 0.00 ? 859 MET A CA   3  
ATOM 4166  C C    . MET A 1 76  ? 4.050   11.472  -0.057  1.00 0.00 ? 859 MET A C    3  
ATOM 4167  O O    . MET A 1 76  ? 4.747   12.185  0.664   1.00 0.00 ? 859 MET A O    3  
ATOM 4168  C CB   . MET A 1 76  ? 4.908   11.614  -2.403  1.00 0.00 ? 859 MET A CB   3  
ATOM 4169  C CG   . MET A 1 76  ? 6.067   11.180  -3.285  1.00 0.00 ? 859 MET A CG   3  
ATOM 4170  S SD   . MET A 1 76  ? 5.907   11.769  -4.982  1.00 0.00 ? 859 MET A SD   3  
ATOM 4171  C CE   . MET A 1 76  ? 6.919   10.575  -5.852  1.00 0.00 ? 859 MET A CE   3  
ATOM 4172  H H    . MET A 1 76  ? 3.455   9.541   -2.516  1.00 0.00 ? 859 MET A H    3  
ATOM 4173  H HA   . MET A 1 76  ? 5.610   10.276  -0.888  1.00 0.00 ? 859 MET A HA   3  
ATOM 4174  H HB2  . MET A 1 76  ? 4.014   11.645  -3.008  1.00 0.00 ? 859 MET A HB2  3  
ATOM 4175  H HB3  . MET A 1 76  ? 5.118   12.608  -2.034  1.00 0.00 ? 859 MET A HB3  3  
ATOM 4176  H HG2  . MET A 1 76  ? 6.984   11.569  -2.870  1.00 0.00 ? 859 MET A HG2  3  
ATOM 4177  H HG3  . MET A 1 76  ? 6.108   10.101  -3.296  1.00 0.00 ? 859 MET A HG3  3  
ATOM 4178  H HE1  . MET A 1 76  ? 7.525   10.031  -5.142  1.00 0.00 ? 859 MET A HE1  3  
ATOM 4179  H HE2  . MET A 1 76  ? 6.283   9.885   -6.386  1.00 0.00 ? 859 MET A HE2  3  
ATOM 4180  H HE3  . MET A 1 76  ? 7.561   11.090  -6.552  1.00 0.00 ? 859 MET A HE3  3  
ATOM 4181  N N    . LYS A 1 77  ? 2.739   11.337  0.112   1.00 0.00 ? 860 LYS A N    3  
ATOM 4182  C CA   . LYS A 1 77  ? 2.028   12.032  1.178   1.00 0.00 ? 860 LYS A CA   3  
ATOM 4183  C C    . LYS A 1 77  ? 1.938   11.164  2.429   1.00 0.00 ? 860 LYS A C    3  
ATOM 4184  O O    . LYS A 1 77  ? 2.089   11.653  3.548   1.00 0.00 ? 860 LYS A O    3  
ATOM 4185  C CB   . LYS A 1 77  ? 0.623   12.422  0.713   1.00 0.00 ? 860 LYS A CB   3  
ATOM 4186  C CG   . LYS A 1 77  ? 0.597   13.651  -0.180  1.00 0.00 ? 860 LYS A CG   3  
ATOM 4187  C CD   . LYS A 1 77  ? 0.706   14.931  0.631   1.00 0.00 ? 860 LYS A CD   3  
ATOM 4188  C CE   . LYS A 1 77  ? 0.585   16.163  -0.254  1.00 0.00 ? 860 LYS A CE   3  
ATOM 4189  N NZ   . LYS A 1 77  ? 0.430   17.408  0.548   1.00 0.00 ? 860 LYS A NZ   3  
ATOM 4190  H H    . LYS A 1 77  ? 2.236   10.753  -0.496  1.00 0.00 ? 860 LYS A H    3  
ATOM 4191  H HA   . LYS A 1 77  ? 2.581   12.928  1.416   1.00 0.00 ? 860 LYS A HA   3  
ATOM 4192  H HB2  . LYS A 1 77  ? 0.196   11.595  0.165   1.00 0.00 ? 860 LYS A HB2  3  
ATOM 4193  H HB3  . LYS A 1 77  ? 0.012   12.621  1.582   1.00 0.00 ? 860 LYS A HB3  3  
ATOM 4194  H HG2  . LYS A 1 77  ? 1.427   13.602  -0.868  1.00 0.00 ? 860 LYS A HG2  3  
ATOM 4195  H HG3  . LYS A 1 77  ? -0.332  13.663  -0.732  1.00 0.00 ? 860 LYS A HG3  3  
ATOM 4196  H HD2  . LYS A 1 77  ? -0.085  14.951  1.366   1.00 0.00 ? 860 LYS A HD2  3  
ATOM 4197  H HD3  . LYS A 1 77  ? 1.665   14.951  1.130   1.00 0.00 ? 860 LYS A HD3  3  
ATOM 4198  H HE2  . LYS A 1 77  ? 1.474   16.244  -0.860  1.00 0.00 ? 860 LYS A HE2  3  
ATOM 4199  H HE3  . LYS A 1 77  ? -0.278  16.046  -0.893  1.00 0.00 ? 860 LYS A HE3  3  
ATOM 4200  H HZ1  . LYS A 1 77  ? 1.044   17.372  1.387   1.00 0.00 ? 860 LYS A HZ1  3  
ATOM 4201  H HZ2  . LYS A 1 77  ? -0.557  17.512  0.859   1.00 0.00 ? 860 LYS A HZ2  3  
ATOM 4202  H HZ3  . LYS A 1 77  ? 0.691   18.236  -0.024  1.00 0.00 ? 860 LYS A HZ3  3  
ATOM 4203  N N    . MET A 1 78  ? 1.694   9.872   2.231   1.00 0.00 ? 861 MET A N    3  
ATOM 4204  C CA   . MET A 1 78  ? 1.587   8.936   3.343   1.00 0.00 ? 861 MET A CA   3  
ATOM 4205  C C    . MET A 1 78  ? 2.968   8.555   3.868   1.00 0.00 ? 861 MET A C    3  
ATOM 4206  O O    . MET A 1 78  ? 3.264   8.734   5.050   1.00 0.00 ? 861 MET A O    3  
ATOM 4207  C CB   . MET A 1 78  ? 0.830   7.679   2.909   1.00 0.00 ? 861 MET A CB   3  
ATOM 4208  C CG   . MET A 1 78  ? -0.676  7.872   2.837   1.00 0.00 ? 861 MET A CG   3  
ATOM 4209  S SD   . MET A 1 78  ? -1.587  6.348   3.150   1.00 0.00 ? 861 MET A SD   3  
ATOM 4210  C CE   . MET A 1 78  ? -2.985  6.974   4.078   1.00 0.00 ? 861 MET A CE   3  
ATOM 4211  H H    . MET A 1 78  ? 1.583   9.541   1.315   1.00 0.00 ? 861 MET A H    3  
ATOM 4212  H HA   . MET A 1 78  ? 1.036   9.422   4.134   1.00 0.00 ? 861 MET A HA   3  
ATOM 4213  H HB2  . MET A 1 78  ? 1.180   7.381   1.932   1.00 0.00 ? 861 MET A HB2  3  
ATOM 4214  H HB3  . MET A 1 78  ? 1.036   6.887   3.614   1.00 0.00 ? 861 MET A HB3  3  
ATOM 4215  H HG2  . MET A 1 78  ? -0.968  8.606   3.573   1.00 0.00 ? 861 MET A HG2  3  
ATOM 4216  H HG3  . MET A 1 78  ? -0.932  8.233   1.852   1.00 0.00 ? 861 MET A HG3  3  
ATOM 4217  H HE1  . MET A 1 78  ? -3.309  6.228   4.789   1.00 0.00 ? 861 MET A HE1  3  
ATOM 4218  H HE2  . MET A 1 78  ? -2.695  7.871   4.604   1.00 0.00 ? 861 MET A HE2  3  
ATOM 4219  H HE3  . MET A 1 78  ? -3.795  7.199   3.400   1.00 0.00 ? 861 MET A HE3  3  
ATOM 4220  N N    . ASP A 1 79  ? 3.809   8.031   2.983   1.00 0.00 ? 862 ASP A N    3  
ATOM 4221  C CA   . ASP A 1 79  ? 5.159   7.626   3.357   1.00 0.00 ? 862 ASP A CA   3  
ATOM 4222  C C    . ASP A 1 79  ? 5.749   8.588   4.384   1.00 0.00 ? 862 ASP A C    3  
ATOM 4223  O O    . ASP A 1 79  ? 5.934   9.772   4.107   1.00 0.00 ? 862 ASP A O    3  
ATOM 4224  C CB   . ASP A 1 79  ? 6.057   7.566   2.121   1.00 0.00 ? 862 ASP A CB   3  
ATOM 4225  C CG   . ASP A 1 79  ? 6.735   8.891   1.833   1.00 0.00 ? 862 ASP A CG   3  
ATOM 4226  O OD1  . ASP A 1 79  ? 6.041   9.827   1.385   1.00 0.00 ? 862 ASP A OD1  3  
ATOM 4227  O OD2  . ASP A 1 79  ? 7.960   8.992   2.054   1.00 0.00 ? 862 ASP A OD2  3  
ATOM 4228  H H    . ASP A 1 79  ? 3.514   7.914   2.055   1.00 0.00 ? 862 ASP A H    3  
ATOM 4229  H HA   . ASP A 1 79  ? 5.100   6.642   3.796   1.00 0.00 ? 862 ASP A HA   3  
ATOM 4230  H HB2  . ASP A 1 79  ? 6.822   6.818   2.275   1.00 0.00 ? 862 ASP A HB2  3  
ATOM 4231  H HB3  . ASP A 1 79  ? 5.460   7.293   1.263   1.00 0.00 ? 862 ASP A HB3  3  
ATOM 4232  N N    . GLY A 1 80  ? 6.043   8.069   5.573   1.00 0.00 ? 863 GLY A N    3  
ATOM 4233  C CA   . GLY A 1 80  ? 6.608   8.895   6.623   1.00 0.00 ? 863 GLY A CA   3  
ATOM 4234  C C    . GLY A 1 80  ? 5.580   9.811   7.257   1.00 0.00 ? 863 GLY A C    3  
ATOM 4235  O O    . GLY A 1 80  ? 5.856   10.984  7.510   1.00 0.00 ? 863 GLY A O    3  
ATOM 4236  H H    . GLY A 1 80  ? 5.875   7.118   5.737   1.00 0.00 ? 863 GLY A H    3  
ATOM 4237  H HA2  . GLY A 1 80  ? 7.023   8.254   7.387   1.00 0.00 ? 863 GLY A HA2  3  
ATOM 4238  H HA3  . GLY A 1 80  ? 7.400   9.498   6.204   1.00 0.00 ? 863 GLY A HA3  3  
ATOM 4239  N N    . MET A 1 81  ? 4.391   9.276   7.513   1.00 0.00 ? 864 MET A N    3  
ATOM 4240  C CA   . MET A 1 81  ? 3.318   10.054  8.120   1.00 0.00 ? 864 MET A CA   3  
ATOM 4241  C C    . MET A 1 81  ? 3.083   9.623   9.564   1.00 0.00 ? 864 MET A C    3  
ATOM 4242  O O    . MET A 1 81  ? 3.359   8.481   9.935   1.00 0.00 ? 864 MET A O    3  
ATOM 4243  C CB   . MET A 1 81  ? 2.027   9.900   7.314   1.00 0.00 ? 864 MET A CB   3  
ATOM 4244  C CG   . MET A 1 81  ? 1.511   8.471   7.261   1.00 0.00 ? 864 MET A CG   3  
ATOM 4245  S SD   . MET A 1 81  ? -0.006  8.315   6.299   1.00 0.00 ? 864 MET A SD   3  
ATOM 4246  C CE   . MET A 1 81  ? -1.063  9.491   7.142   1.00 0.00 ? 864 MET A CE   3  
ATOM 4247  H H    . MET A 1 81  ? 4.231   8.335   7.289   1.00 0.00 ? 864 MET A H    3  
ATOM 4248  H HA   . MET A 1 81  ? 3.615   11.092  8.111   1.00 0.00 ? 864 MET A HA   3  
ATOM 4249  H HB2  . MET A 1 81  ? 1.262   10.519  7.758   1.00 0.00 ? 864 MET A HB2  3  
ATOM 4250  H HB3  . MET A 1 81  ? 2.206   10.232  6.302   1.00 0.00 ? 864 MET A HB3  3  
ATOM 4251  H HG2  . MET A 1 81  ? 2.269   7.845   6.813   1.00 0.00 ? 864 MET A HG2  3  
ATOM 4252  H HG3  . MET A 1 81  ? 1.319   8.135   8.269   1.00 0.00 ? 864 MET A HG3  3  
ATOM 4253  H HE1  . MET A 1 81  ? -0.608  9.777   8.079   1.00 0.00 ? 864 MET A HE1  3  
ATOM 4254  H HE2  . MET A 1 81  ? -1.192  10.366  6.523   1.00 0.00 ? 864 MET A HE2  3  
ATOM 4255  H HE3  . MET A 1 81  ? -2.025  9.038   7.331   1.00 0.00 ? 864 MET A HE3  3  
ATOM 4256  N N    . THR A 1 82  ? 2.574   10.543  10.377  1.00 0.00 ? 865 THR A N    3  
ATOM 4257  C CA   . THR A 1 82  ? 2.304   10.258  11.781  1.00 0.00 ? 865 THR A CA   3  
ATOM 4258  C C    . THR A 1 82  ? 0.849   9.854   11.990  1.00 0.00 ? 865 THR A C    3  
ATOM 4259  O O    . THR A 1 82  ? -0.064  10.498  11.473  1.00 0.00 ? 865 THR A O    3  
ATOM 4260  C CB   . THR A 1 82  ? 2.621   11.474  12.672  1.00 0.00 ? 865 THR A CB   3  
ATOM 4261  O OG1  . THR A 1 82  ? 3.802   12.132  12.201  1.00 0.00 ? 865 THR A OG1  3  
ATOM 4262  C CG2  . THR A 1 82  ? 2.814   11.048  14.120  1.00 0.00 ? 865 THR A CG2  3  
ATOM 4263  H H    . THR A 1 82  ? 2.376   11.435  10.023  1.00 0.00 ? 865 THR A H    3  
ATOM 4264  H HA   . THR A 1 82  ? 2.942   9.440   12.084  1.00 0.00 ? 865 THR A HA   3  
ATOM 4265  H HB   . THR A 1 82  ? 1.790   12.163  12.623  1.00 0.00 ? 865 THR A HB   3  
ATOM 4266  H HG1  . THR A 1 82  ? 3.660   12.443  11.304  1.00 0.00 ? 865 THR A HG1  3  
ATOM 4267  H HG21 . THR A 1 82  ? 3.405   10.145  14.154  1.00 0.00 ? 865 THR A HG21 3  
ATOM 4268  H HG22 . THR A 1 82  ? 1.851   10.866  14.573  1.00 0.00 ? 865 THR A HG22 3  
ATOM 4269  H HG23 . THR A 1 82  ? 3.324   11.832  14.660  1.00 0.00 ? 865 THR A HG23 3  
ATOM 4270  N N    . ILE A 1 83  ? 0.640   8.785   12.752  1.00 0.00 ? 866 ILE A N    3  
ATOM 4271  C CA   . ILE A 1 83  ? -0.705  8.298   13.031  1.00 0.00 ? 866 ILE A CA   3  
ATOM 4272  C C    . ILE A 1 83  ? -0.790  7.688   14.426  1.00 0.00 ? 866 ILE A C    3  
ATOM 4273  O O    . ILE A 1 83  ? -0.167  6.665   14.708  1.00 0.00 ? 866 ILE A O    3  
ATOM 4274  C CB   . ILE A 1 83  ? -1.148  7.247   11.996  1.00 0.00 ? 866 ILE A CB   3  
ATOM 4275  C CG1  . ILE A 1 83  ? -1.232  7.875   10.603  1.00 0.00 ? 866 ILE A CG1  3  
ATOM 4276  C CG2  . ILE A 1 83  ? -2.488  6.645   12.393  1.00 0.00 ? 866 ILE A CG2  3  
ATOM 4277  C CD1  . ILE A 1 83  ? -1.349  6.859   9.488   1.00 0.00 ? 866 ILE A CD1  3  
ATOM 4278  H H    . ILE A 1 83  ? 1.409   8.315   13.136  1.00 0.00 ? 866 ILE A H    3  
ATOM 4279  H HA   . ILE A 1 83  ? -1.382  9.138   12.974  1.00 0.00 ? 866 ILE A HA   3  
ATOM 4280  H HB   . ILE A 1 83  ? -0.415  6.455   11.983  1.00 0.00 ? 866 ILE A HB   3  
ATOM 4281  H HG12 . ILE A 1 83  ? -2.096  8.518   10.556  1.00 0.00 ? 866 ILE A HG12 3  
ATOM 4282  H HG13 . ILE A 1 83  ? -0.341  8.461   10.427  1.00 0.00 ? 866 ILE A HG13 3  
ATOM 4283  H HG21 . ILE A 1 83  ? -2.322  5.775   13.012  1.00 0.00 ? 866 ILE A HG21 3  
ATOM 4284  H HG22 . ILE A 1 83  ? -3.060  7.375   12.945  1.00 0.00 ? 866 ILE A HG22 3  
ATOM 4285  H HG23 . ILE A 1 83  ? -3.031  6.357   11.505  1.00 0.00 ? 866 ILE A HG23 3  
ATOM 4286  H HD11 . ILE A 1 83  ? -1.020  5.894   9.844   1.00 0.00 ? 866 ILE A HD11 3  
ATOM 4287  H HD12 . ILE A 1 83  ? -2.378  6.793   9.167   1.00 0.00 ? 866 ILE A HD12 3  
ATOM 4288  H HD13 . ILE A 1 83  ? -0.731  7.164   8.656   1.00 0.00 ? 866 ILE A HD13 3  
ATOM 4289  N N    . LYS A 1 84  ? -1.567  8.324   15.296  1.00 0.00 ? 867 LYS A N    3  
ATOM 4290  C CA   . LYS A 1 84  ? -1.739  7.844   16.663  1.00 0.00 ? 867 LYS A CA   3  
ATOM 4291  C C    . LYS A 1 84  ? -0.395  7.748   17.378  1.00 0.00 ? 867 LYS A C    3  
ATOM 4292  O O    . LYS A 1 84  ? -0.168  6.835   18.171  1.00 0.00 ? 867 LYS A O    3  
ATOM 4293  C CB   . LYS A 1 84  ? -2.427  6.478   16.663  1.00 0.00 ? 867 LYS A CB   3  
ATOM 4294  C CG   . LYS A 1 84  ? -3.812  6.494   16.040  1.00 0.00 ? 867 LYS A CG   3  
ATOM 4295  C CD   . LYS A 1 84  ? -4.858  7.001   17.019  1.00 0.00 ? 867 LYS A CD   3  
ATOM 4296  C CE   . LYS A 1 84  ? -6.093  7.519   16.297  1.00 0.00 ? 867 LYS A CE   3  
ATOM 4297  N NZ   . LYS A 1 84  ? -7.310  7.436   17.151  1.00 0.00 ? 867 LYS A NZ   3  
ATOM 4298  H H    . LYS A 1 84  ? -2.038  9.136   15.012  1.00 0.00 ? 867 LYS A H    3  
ATOM 4299  H HA   . LYS A 1 84  ? -2.362  8.552   17.187  1.00 0.00 ? 867 LYS A HA   3  
ATOM 4300  H HB2  . LYS A 1 84  ? -1.815  5.780   16.110  1.00 0.00 ? 867 LYS A HB2  3  
ATOM 4301  H HB3  . LYS A 1 84  ? -2.519  6.134   17.683  1.00 0.00 ? 867 LYS A HB3  3  
ATOM 4302  H HG2  . LYS A 1 84  ? -3.801  7.142   15.175  1.00 0.00 ? 867 LYS A HG2  3  
ATOM 4303  H HG3  . LYS A 1 84  ? -4.073  5.490   15.736  1.00 0.00 ? 867 LYS A HG3  3  
ATOM 4304  H HD2  . LYS A 1 84  ? -5.150  6.192   17.672  1.00 0.00 ? 867 LYS A HD2  3  
ATOM 4305  H HD3  . LYS A 1 84  ? -4.431  7.803   17.605  1.00 0.00 ? 867 LYS A HD3  3  
ATOM 4306  H HE2  . LYS A 1 84  ? -5.927  8.549   16.021  1.00 0.00 ? 867 LYS A HE2  3  
ATOM 4307  H HE3  . LYS A 1 84  ? -6.247  6.928   15.407  1.00 0.00 ? 867 LYS A HE3  3  
ATOM 4308  H HZ1  . LYS A 1 84  ? -8.138  7.784   16.627  1.00 0.00 ? 867 LYS A HZ1  3  
ATOM 4309  H HZ2  . LYS A 1 84  ? -7.187  8.015   18.006  1.00 0.00 ? 867 LYS A HZ2  3  
ATOM 4310  H HZ3  . LYS A 1 84  ? -7.481  6.450   17.435  1.00 0.00 ? 867 LYS A HZ3  3  
ATOM 4311  N N    . GLU A 1 85  ? 0.492   8.697   17.092  1.00 0.00 ? 868 GLU A N    3  
ATOM 4312  C CA   . GLU A 1 85  ? 1.813   8.718   17.710  1.00 0.00 ? 868 GLU A CA   3  
ATOM 4313  C C    . GLU A 1 85  ? 2.663   7.551   17.215  1.00 0.00 ? 868 GLU A C    3  
ATOM 4314  O O    . GLU A 1 85  ? 3.285   6.843   18.006  1.00 0.00 ? 868 GLU A O    3  
ATOM 4315  C CB   . GLU A 1 85  ? 1.689   8.662   19.234  1.00 0.00 ? 868 GLU A CB   3  
ATOM 4316  C CG   . GLU A 1 85  ? 2.820   9.367   19.963  1.00 0.00 ? 868 GLU A CG   3  
ATOM 4317  C CD   . GLU A 1 85  ? 2.883   10.849  19.646  1.00 0.00 ? 868 GLU A CD   3  
ATOM 4318  O OE1  . GLU A 1 85  ? 2.150   11.625  20.294  1.00 0.00 ? 868 GLU A OE1  3  
ATOM 4319  O OE2  . GLU A 1 85  ? 3.665   11.232  18.752  1.00 0.00 ? 868 GLU A OE2  3  
ATOM 4320  H H    . GLU A 1 85  ? 0.253   9.398   16.451  1.00 0.00 ? 868 GLU A H    3  
ATOM 4321  H HA   . GLU A 1 85  ? 2.295   9.642   17.431  1.00 0.00 ? 868 GLU A HA   3  
ATOM 4322  H HB2  . GLU A 1 85  ? 0.757   9.124   19.524  1.00 0.00 ? 868 GLU A HB2  3  
ATOM 4323  H HB3  . GLU A 1 85  ? 1.679   7.627   19.544  1.00 0.00 ? 868 GLU A HB3  3  
ATOM 4324  H HG2  . GLU A 1 85  ? 2.675   9.248   21.026  1.00 0.00 ? 868 GLU A HG2  3  
ATOM 4325  H HG3  . GLU A 1 85  ? 3.756   8.912   19.675  1.00 0.00 ? 868 GLU A HG3  3  
ATOM 4326  N N    . ASN A 1 86  ? 2.685   7.358   15.900  1.00 0.00 ? 869 ASN A N    3  
ATOM 4327  C CA   . ASN A 1 86  ? 3.458   6.278   15.298  1.00 0.00 ? 869 ASN A CA   3  
ATOM 4328  C C    . ASN A 1 86  ? 3.788   6.591   13.842  1.00 0.00 ? 869 ASN A C    3  
ATOM 4329  O O    . ASN A 1 86  ? 2.905   6.608   12.985  1.00 0.00 ? 869 ASN A O    3  
ATOM 4330  C CB   . ASN A 1 86  ? 2.685   4.960   15.386  1.00 0.00 ? 869 ASN A CB   3  
ATOM 4331  C CG   . ASN A 1 86  ? 3.586   3.750   15.235  1.00 0.00 ? 869 ASN A CG   3  
ATOM 4332  O OD1  . ASN A 1 86  ? 4.324   3.630   14.256  1.00 0.00 ? 869 ASN A OD1  3  
ATOM 4333  N ND2  . ASN A 1 86  ? 3.530   2.846   16.205  1.00 0.00 ? 869 ASN A ND2  3  
ATOM 4334  H H    . ASN A 1 86  ? 2.168   7.956   15.320  1.00 0.00 ? 869 ASN A H    3  
ATOM 4335  H HA   . ASN A 1 86  ? 4.379   6.181   15.852  1.00 0.00 ? 869 ASN A HA   3  
ATOM 4336  H HB2  . ASN A 1 86  ? 2.194   4.901   16.346  1.00 0.00 ? 869 ASN A HB2  3  
ATOM 4337  H HB3  . ASN A 1 86  ? 1.941   4.933   14.603  1.00 0.00 ? 869 ASN A HB3  3  
ATOM 4338  H HD21 . ASN A 1 86  ? 2.919   3.007   16.954  1.00 0.00 ? 869 ASN A HD21 3  
ATOM 4339  H HD22 . ASN A 1 86  ? 4.103   2.054   16.133  1.00 0.00 ? 869 ASN A HD22 3  
ATOM 4340  N N    . ILE A 1 87  ? 5.066   6.837   13.571  1.00 0.00 ? 870 ILE A N    3  
ATOM 4341  C CA   . ILE A 1 87  ? 5.513   7.147   12.219  1.00 0.00 ? 870 ILE A CA   3  
ATOM 4342  C C    . ILE A 1 87  ? 5.403   5.927   11.310  1.00 0.00 ? 870 ILE A C    3  
ATOM 4343  O O    . ILE A 1 87  ? 6.116   4.940   11.491  1.00 0.00 ? 870 ILE A O    3  
ATOM 4344  C CB   . ILE A 1 87  ? 6.968   7.651   12.210  1.00 0.00 ? 870 ILE A CB   3  
ATOM 4345  C CG1  . ILE A 1 87  ? 7.023   9.125   12.616  1.00 0.00 ? 870 ILE A CG1  3  
ATOM 4346  C CG2  . ILE A 1 87  ? 7.589   7.452   10.835  1.00 0.00 ? 870 ILE A CG2  3  
ATOM 4347  C CD1  . ILE A 1 87  ? 6.949   9.342   14.111  1.00 0.00 ? 870 ILE A CD1  3  
ATOM 4348  H H    . ILE A 1 87  ? 5.723   6.808   14.297  1.00 0.00 ? 870 ILE A H    3  
ATOM 4349  H HA   . ILE A 1 87  ? 4.879   7.931   11.830  1.00 0.00 ? 870 ILE A HA   3  
ATOM 4350  H HB   . ILE A 1 87  ? 7.533   7.067   12.921  1.00 0.00 ? 870 ILE A HB   3  
ATOM 4351  H HG12 . ILE A 1 87  ? 7.948   9.555   12.265  1.00 0.00 ? 870 ILE A HG12 3  
ATOM 4352  H HG13 . ILE A 1 87  ? 6.193   9.647   12.163  1.00 0.00 ? 870 ILE A HG13 3  
ATOM 4353  H HG21 . ILE A 1 87  ? 7.969   6.444   10.754  1.00 0.00 ? 870 ILE A HG21 3  
ATOM 4354  H HG22 . ILE A 1 87  ? 6.839   7.614   10.075  1.00 0.00 ? 870 ILE A HG22 3  
ATOM 4355  H HG23 . ILE A 1 87  ? 8.397   8.154   10.699  1.00 0.00 ? 870 ILE A HG23 3  
ATOM 4356  H HD11 . ILE A 1 87  ? 6.541   10.322  14.313  1.00 0.00 ? 870 ILE A HD11 3  
ATOM 4357  H HD12 . ILE A 1 87  ? 6.316   8.589   14.554  1.00 0.00 ? 870 ILE A HD12 3  
ATOM 4358  H HD13 . ILE A 1 87  ? 7.941   9.272   14.535  1.00 0.00 ? 870 ILE A HD13 3  
ATOM 4359  N N    . ILE A 1 88  ? 4.507   6.004   10.332  1.00 0.00 ? 871 ILE A N    3  
ATOM 4360  C CA   . ILE A 1 88  ? 4.306   4.908   9.393   1.00 0.00 ? 871 ILE A CA   3  
ATOM 4361  C C    . ILE A 1 88  ? 5.012   5.181   8.070   1.00 0.00 ? 871 ILE A C    3  
ATOM 4362  O O    . ILE A 1 88  ? 5.062   6.319   7.603   1.00 0.00 ? 871 ILE A O    3  
ATOM 4363  C CB   . ILE A 1 88  ? 2.809   4.665   9.123   1.00 0.00 ? 871 ILE A CB   3  
ATOM 4364  C CG1  . ILE A 1 88  ? 2.274   5.700   8.131   1.00 0.00 ? 871 ILE A CG1  3  
ATOM 4365  C CG2  . ILE A 1 88  ? 2.022   4.712   10.424  1.00 0.00 ? 871 ILE A CG2  3  
ATOM 4366  C CD1  . ILE A 1 88  ? 2.628   5.398   6.692   1.00 0.00 ? 871 ILE A CD1  3  
ATOM 4367  H H    . ILE A 1 88  ? 3.969   6.817   10.240  1.00 0.00 ? 871 ILE A H    3  
ATOM 4368  H HA   . ILE A 1 88  ? 4.722   4.012   9.833   1.00 0.00 ? 871 ILE A HA   3  
ATOM 4369  H HB   . ILE A 1 88  ? 2.698   3.679   8.698   1.00 0.00 ? 871 ILE A HB   3  
ATOM 4370  H HG12 . ILE A 1 88  ? 1.198   5.738   8.206   1.00 0.00 ? 871 ILE A HG12 3  
ATOM 4371  H HG13 . ILE A 1 88  ? 2.682   6.669   8.378   1.00 0.00 ? 871 ILE A HG13 3  
ATOM 4372  H HG21 . ILE A 1 88  ? 1.675   3.720   10.671  1.00 0.00 ? 871 ILE A HG21 3  
ATOM 4373  H HG22 . ILE A 1 88  ? 2.657   5.078   11.216  1.00 0.00 ? 871 ILE A HG22 3  
ATOM 4374  H HG23 . ILE A 1 88  ? 1.174   5.371   10.308  1.00 0.00 ? 871 ILE A HG23 3  
ATOM 4375  H HD11 . ILE A 1 88  ? 3.134   4.445   6.638   1.00 0.00 ? 871 ILE A HD11 3  
ATOM 4376  H HD12 . ILE A 1 88  ? 1.727   5.364   6.098   1.00 0.00 ? 871 ILE A HD12 3  
ATOM 4377  H HD13 . ILE A 1 88  ? 3.280   6.172   6.312   1.00 0.00 ? 871 ILE A HD13 3  
ATOM 4378  N N    . LYS A 1 89  ? 5.557   4.129   7.468   1.00 0.00 ? 872 LYS A N    3  
ATOM 4379  C CA   . LYS A 1 89  ? 6.258   4.253   6.196   1.00 0.00 ? 872 LYS A CA   3  
ATOM 4380  C C    . LYS A 1 89  ? 5.418   3.690   5.054   1.00 0.00 ? 872 LYS A C    3  
ATOM 4381  O O    . LYS A 1 89  ? 4.572   2.820   5.263   1.00 0.00 ? 872 LYS A O    3  
ATOM 4382  C CB   . LYS A 1 89  ? 7.604   3.528   6.259   1.00 0.00 ? 872 LYS A CB   3  
ATOM 4383  C CG   . LYS A 1 89  ? 8.520   3.842   5.089   1.00 0.00 ? 872 LYS A CG   3  
ATOM 4384  C CD   . LYS A 1 89  ? 9.960   3.460   5.390   1.00 0.00 ? 872 LYS A CD   3  
ATOM 4385  C CE   . LYS A 1 89  ? 10.936  4.230   4.513   1.00 0.00 ? 872 LYS A CE   3  
ATOM 4386  N NZ   . LYS A 1 89  ? 10.919  3.744   3.106   1.00 0.00 ? 872 LYS A NZ   3  
ATOM 4387  H H    . LYS A 1 89  ? 5.484   3.247   7.889   1.00 0.00 ? 872 LYS A H    3  
ATOM 4388  H HA   . LYS A 1 89  ? 6.433   5.303   6.014   1.00 0.00 ? 872 LYS A HA   3  
ATOM 4389  H HB2  . LYS A 1 89  ? 8.109   3.810   7.171   1.00 0.00 ? 872 LYS A HB2  3  
ATOM 4390  H HB3  . LYS A 1 89  ? 7.425   2.462   6.272   1.00 0.00 ? 872 LYS A HB3  3  
ATOM 4391  H HG2  . LYS A 1 89  ? 8.186   3.291   4.223   1.00 0.00 ? 872 LYS A HG2  3  
ATOM 4392  H HG3  . LYS A 1 89  ? 8.475   4.902   4.883   1.00 0.00 ? 872 LYS A HG3  3  
ATOM 4393  H HD2  . LYS A 1 89  ? 10.173  3.680   6.425   1.00 0.00 ? 872 LYS A HD2  3  
ATOM 4394  H HD3  . LYS A 1 89  ? 10.087  2.401   5.211   1.00 0.00 ? 872 LYS A HD3  3  
ATOM 4395  H HE2  . LYS A 1 89  ? 10.666  5.274   4.528   1.00 0.00 ? 872 LYS A HE2  3  
ATOM 4396  H HE3  . LYS A 1 89  ? 11.931  4.110   4.915   1.00 0.00 ? 872 LYS A HE3  3  
ATOM 4397  H HZ1  . LYS A 1 89  ? 11.889  3.549   2.784   1.00 0.00 ? 872 LYS A HZ1  3  
ATOM 4398  H HZ2  . LYS A 1 89  ? 10.498  4.464   2.484   1.00 0.00 ? 872 LYS A HZ2  3  
ATOM 4399  H HZ3  . LYS A 1 89  ? 10.359  2.871   3.035   1.00 0.00 ? 872 LYS A HZ3  3  
ATOM 4400  N N    . VAL A 1 90  ? 5.659   4.189   3.846   1.00 0.00 ? 873 VAL A N    3  
ATOM 4401  C CA   . VAL A 1 90  ? 4.927   3.733   2.670   1.00 0.00 ? 873 VAL A CA   3  
ATOM 4402  C C    . VAL A 1 90  ? 5.859   3.553   1.477   1.00 0.00 ? 873 VAL A C    3  
ATOM 4403  O O    . VAL A 1 90  ? 6.831   4.291   1.320   1.00 0.00 ? 873 VAL A O    3  
ATOM 4404  C CB   . VAL A 1 90  ? 3.807   4.720   2.289   1.00 0.00 ? 873 VAL A CB   3  
ATOM 4405  C CG1  . VAL A 1 90  ? 2.988   4.176   1.128   1.00 0.00 ? 873 VAL A CG1  3  
ATOM 4406  C CG2  . VAL A 1 90  ? 2.920   5.008   3.490   1.00 0.00 ? 873 VAL A CG2  3  
ATOM 4407  H H    . VAL A 1 90  ? 6.346   4.880   3.742   1.00 0.00 ? 873 VAL A H    3  
ATOM 4408  H HA   . VAL A 1 90  ? 4.474   2.781   2.907   1.00 0.00 ? 873 VAL A HA   3  
ATOM 4409  H HB   . VAL A 1 90  ? 4.264   5.647   1.975   1.00 0.00 ? 873 VAL A HB   3  
ATOM 4410  H HG11 . VAL A 1 90  ? 3.301   4.655   0.212   1.00 0.00 ? 873 VAL A HG11 3  
ATOM 4411  H HG12 . VAL A 1 90  ? 3.140   3.109   1.048   1.00 0.00 ? 873 VAL A HG12 3  
ATOM 4412  H HG13 . VAL A 1 90  ? 1.941   4.379   1.300   1.00 0.00 ? 873 VAL A HG13 3  
ATOM 4413  H HG21 . VAL A 1 90  ? 2.863   6.074   3.647   1.00 0.00 ? 873 VAL A HG21 3  
ATOM 4414  H HG22 . VAL A 1 90  ? 1.928   4.618   3.307   1.00 0.00 ? 873 VAL A HG22 3  
ATOM 4415  H HG23 . VAL A 1 90  ? 3.336   4.536   4.367   1.00 0.00 ? 873 VAL A HG23 3  
ATOM 4416  N N    . ALA A 1 91  ? 5.555   2.567   0.639   1.00 0.00 ? 874 ALA A N    3  
ATOM 4417  C CA   . ALA A 1 91  ? 6.364   2.292   -0.542  1.00 0.00 ? 874 ALA A CA   3  
ATOM 4418  C C    . ALA A 1 91  ? 5.559   1.540   -1.596  1.00 0.00 ? 874 ALA A C    3  
ATOM 4419  O O    . ALA A 1 91  ? 4.580   0.865   -1.277  1.00 0.00 ? 874 ALA A O    3  
ATOM 4420  C CB   . ALA A 1 91  ? 7.605   1.499   -0.158  1.00 0.00 ? 874 ALA A CB   3  
ATOM 4421  H H    . ALA A 1 91  ? 4.767   2.014   0.818   1.00 0.00 ? 874 ALA A H    3  
ATOM 4422  H HA   . ALA A 1 91  ? 6.685   3.238   -0.955  1.00 0.00 ? 874 ALA A HA   3  
ATOM 4423  H HB1  . ALA A 1 91  ? 7.541   0.506   -0.579  1.00 0.00 ? 874 ALA A HB1  3  
ATOM 4424  H HB2  . ALA A 1 91  ? 8.483   1.998   -0.541  1.00 0.00 ? 874 ALA A HB2  3  
ATOM 4425  H HB3  . ALA A 1 91  ? 7.670   1.431   0.918   1.00 0.00 ? 874 ALA A HB3  3  
ATOM 4426  N N    . ILE A 1 92  ? 5.977   1.662   -2.851  1.00 0.00 ? 875 ILE A N    3  
ATOM 4427  C CA   . ILE A 1 92  ? 5.294   0.993   -3.951  1.00 0.00 ? 875 ILE A CA   3  
ATOM 4428  C C    . ILE A 1 92  ? 5.333   -0.522  -3.783  1.00 0.00 ? 875 ILE A C    3  
ATOM 4429  O O    . ILE A 1 92  ? 6.404   -1.129  -3.775  1.00 0.00 ? 875 ILE A O    3  
ATOM 4430  C CB   . ILE A 1 92  ? 5.918   1.363   -5.310  1.00 0.00 ? 875 ILE A CB   3  
ATOM 4431  C CG1  . ILE A 1 92  ? 5.871   2.878   -5.521  1.00 0.00 ? 875 ILE A CG1  3  
ATOM 4432  C CG2  . ILE A 1 92  ? 5.196   0.643   -6.439  1.00 0.00 ? 875 ILE A CG2  3  
ATOM 4433  C CD1  . ILE A 1 92  ? 4.473   3.416   -5.727  1.00 0.00 ? 875 ILE A CD1  3  
ATOM 4434  H H    . ILE A 1 92  ? 6.763   2.214   -3.042  1.00 0.00 ? 875 ILE A H    3  
ATOM 4435  H HA   . ILE A 1 92  ? 4.263   1.318   -3.951  1.00 0.00 ? 875 ILE A HA   3  
ATOM 4436  H HB   . ILE A 1 92  ? 6.948   1.039   -5.308  1.00 0.00 ? 875 ILE A HB   3  
ATOM 4437  H HG12 . ILE A 1 92  ? 6.292   3.369   -4.658  1.00 0.00 ? 875 ILE A HG12 3  
ATOM 4438  H HG13 . ILE A 1 92  ? 6.456   3.130   -6.394  1.00 0.00 ? 875 ILE A HG13 3  
ATOM 4439  H HG21 . ILE A 1 92  ? 5.907   0.059   -7.006  1.00 0.00 ? 875 ILE A HG21 3  
ATOM 4440  H HG22 . ILE A 1 92  ? 4.444   -0.012  -6.024  1.00 0.00 ? 875 ILE A HG22 3  
ATOM 4441  H HG23 . ILE A 1 92  ? 4.727   1.367   -7.086  1.00 0.00 ? 875 ILE A HG23 3  
ATOM 4442  H HD11 . ILE A 1 92  ? 4.409   3.896   -6.692  1.00 0.00 ? 875 ILE A HD11 3  
ATOM 4443  H HD12 . ILE A 1 92  ? 3.763   2.604   -5.680  1.00 0.00 ? 875 ILE A HD12 3  
ATOM 4444  H HD13 . ILE A 1 92  ? 4.247   4.136   -4.952  1.00 0.00 ? 875 ILE A HD13 3  
ATOM 4445  N N    . SER A 1 93  ? 4.157   -1.127  -3.650  1.00 0.00 ? 876 SER A N    3  
ATOM 4446  C CA   . SER A 1 93  ? 4.056   -2.572  -3.479  1.00 0.00 ? 876 SER A CA   3  
ATOM 4447  C C    . SER A 1 93  ? 5.138   -3.291  -4.280  1.00 0.00 ? 876 SER A C    3  
ATOM 4448  O O    . SER A 1 93  ? 5.448   -2.908  -5.407  1.00 0.00 ? 876 SER A O    3  
ATOM 4449  C CB   . SER A 1 93  ? 2.674   -3.063  -3.913  1.00 0.00 ? 876 SER A CB   3  
ATOM 4450  O OG   . SER A 1 93  ? 2.630   -3.293  -5.311  1.00 0.00 ? 876 SER A OG   3  
ATOM 4451  H H    . SER A 1 93  ? 3.338   -0.589  -3.664  1.00 0.00 ? 876 SER A H    3  
ATOM 4452  H HA   . SER A 1 93  ? 4.194   -2.793  -2.431  1.00 0.00 ? 876 SER A HA   3  
ATOM 4453  H HB2  . SER A 1 93  ? 2.445   -3.985  -3.402  1.00 0.00 ? 876 SER A HB2  3  
ATOM 4454  H HB3  . SER A 1 93  ? 1.934   -2.317  -3.660  1.00 0.00 ? 876 SER A HB3  3  
ATOM 4455  H HG   . SER A 1 93  ? 1.821   -3.759  -5.534  1.00 0.00 ? 876 SER A HG   3  
ATOM 4456  N N    . ASN A 1 94  ? 5.709   -4.335  -3.688  1.00 0.00 ? 877 ASN A N    3  
ATOM 4457  C CA   . ASN A 1 94  ? 6.757   -5.107  -4.344  1.00 0.00 ? 877 ASN A CA   3  
ATOM 4458  C C    . ASN A 1 94  ? 6.198   -6.409  -4.912  1.00 0.00 ? 877 ASN A C    3  
ATOM 4459  O O    . ASN A 1 94  ? 6.848   -7.453  -4.854  1.00 0.00 ? 877 ASN A O    3  
ATOM 4460  C CB   . ASN A 1 94  ? 7.888   -5.411  -3.360  1.00 0.00 ? 877 ASN A CB   3  
ATOM 4461  C CG   . ASN A 1 94  ? 8.103   -4.290  -2.362  1.00 0.00 ? 877 ASN A CG   3  
ATOM 4462  O OD1  . ASN A 1 94  ? 7.871   -4.457  -1.165  1.00 0.00 ? 877 ASN A OD1  3  
ATOM 4463  N ND2  . ASN A 1 94  ? 8.549   -3.139  -2.852  1.00 0.00 ? 877 ASN A ND2  3  
ATOM 4464  H H    . ASN A 1 94  ? 5.418   -4.591  -2.787  1.00 0.00 ? 877 ASN A H    3  
ATOM 4465  H HA   . ASN A 1 94  ? 7.148   -4.512  -5.156  1.00 0.00 ? 877 ASN A HA   3  
ATOM 4466  H HB2  . ASN A 1 94  ? 7.649   -6.312  -2.814  1.00 0.00 ? 877 ASN A HB2  3  
ATOM 4467  H HB3  . ASN A 1 94  ? 8.805   -5.561  -3.909  1.00 0.00 ? 877 ASN A HB3  3  
ATOM 4468  H HD21 . ASN A 1 94  ? 8.712   -3.079  -3.817  1.00 0.00 ? 877 ASN A HD21 3  
ATOM 4469  H HD22 . ASN A 1 94  ? 8.697   -2.398  -2.229  1.00 0.00 ? 877 ASN A HD22 3  
ATOM 4470  N N    . SER A 1 95  ? 4.990   -6.338  -5.463  1.00 0.00 ? 878 SER A N    3  
ATOM 4471  C CA   . SER A 1 95  ? 4.343   -7.510  -6.039  1.00 0.00 ? 878 SER A CA   3  
ATOM 4472  C C    . SER A 1 95  ? 5.352   -8.375  -6.789  1.00 0.00 ? 878 SER A C    3  
ATOM 4473  O O    . SER A 1 95  ? 5.986   -7.923  -7.741  1.00 0.00 ? 878 SER A O    3  
ATOM 4474  C CB   . SER A 1 95  ? 3.217   -7.085  -6.983  1.00 0.00 ? 878 SER A CB   3  
ATOM 4475  O OG   . SER A 1 95  ? 2.819   -8.158  -7.818  1.00 0.00 ? 878 SER A OG   3  
ATOM 4476  H H    . SER A 1 95  ? 4.523   -5.476  -5.479  1.00 0.00 ? 878 SER A H    3  
ATOM 4477  H HA   . SER A 1 95  ? 3.923   -8.088  -5.229  1.00 0.00 ? 878 SER A HA   3  
ATOM 4478  H HB2  . SER A 1 95  ? 2.366   -6.761  -6.403  1.00 0.00 ? 878 SER A HB2  3  
ATOM 4479  H HB3  . SER A 1 95  ? 3.560   -6.270  -7.604  1.00 0.00 ? 878 SER A HB3  3  
ATOM 4480  H HG   . SER A 1 95  ? 2.851   -8.979  -7.322  1.00 0.00 ? 878 SER A HG   3  
ATOM 4481  N N    . GLY A 1 96  ? 5.494   -9.622  -6.350  1.00 0.00 ? 879 GLY A N    3  
ATOM 4482  C CA   . GLY A 1 96  ? 6.427   -10.531 -6.990  1.00 0.00 ? 879 GLY A CA   3  
ATOM 4483  C C    . GLY A 1 96  ? 5.729   -11.683 -7.686  1.00 0.00 ? 879 GLY A C    3  
ATOM 4484  O O    . GLY A 1 96  ? 4.687   -12.165 -7.242  1.00 0.00 ? 879 GLY A O    3  
ATOM 4485  H H    . GLY A 1 96  ? 4.961   -9.927  -5.586  1.00 0.00 ? 879 GLY A H    3  
ATOM 4486  H HA2  . GLY A 1 96  ? 7.006   -9.982  -7.718  1.00 0.00 ? 879 GLY A HA2  3  
ATOM 4487  H HA3  . GLY A 1 96  ? 7.094   -10.930 -6.241  1.00 0.00 ? 879 GLY A HA3  3  
ATOM 4488  N N    . PRO A 1 97  ? 6.309   -12.141 -8.806  1.00 0.00 ? 880 PRO A N    3  
ATOM 4489  C CA   . PRO A 1 97  ? 5.752   -13.247 -9.590  1.00 0.00 ? 880 PRO A CA   3  
ATOM 4490  C C    . PRO A 1 97  ? 5.867   -14.585 -8.866  1.00 0.00 ? 880 PRO A C    3  
ATOM 4491  O O    . PRO A 1 97  ? 6.620   -14.717 -7.902  1.00 0.00 ? 880 PRO A O    3  
ATOM 4492  C CB   . PRO A 1 97  ? 6.609   -13.250 -10.858 1.00 0.00 ? 880 PRO A CB   3  
ATOM 4493  C CG   . PRO A 1 97  ? 7.899   -12.630 -10.445 1.00 0.00 ? 880 PRO A CG   3  
ATOM 4494  C CD   . PRO A 1 97  ? 7.552   -11.613 -9.393  1.00 0.00 ? 880 PRO A CD   3  
ATOM 4495  H HA   . PRO A 1 97  ? 4.719   -13.068 -9.851  1.00 0.00 ? 880 PRO A HA   3  
ATOM 4496  H HB2  . PRO A 1 97  ? 6.748   -14.267 -11.199 1.00 0.00 ? 880 PRO A HB2  3  
ATOM 4497  H HB3  . PRO A 1 97  ? 6.121   -12.671 -11.628 1.00 0.00 ? 880 PRO A HB3  3  
ATOM 4498  H HG2  . PRO A 1 97  ? 8.554   -13.384 -10.036 1.00 0.00 ? 880 PRO A HG2  3  
ATOM 4499  H HG3  . PRO A 1 97  ? 8.362   -12.149 -11.294 1.00 0.00 ? 880 PRO A HG3  3  
ATOM 4500  H HD2  . PRO A 1 97  ? 8.334   -11.556 -8.652  1.00 0.00 ? 880 PRO A HD2  3  
ATOM 4501  H HD3  . PRO A 1 97  ? 7.385   -10.646 -9.844  1.00 0.00 ? 880 PRO A HD3  3  
ATOM 4502  N N    . SER A 1 98  ? 5.115   -15.574 -9.339  1.00 0.00 ? 881 SER A N    3  
ATOM 4503  C CA   . SER A 1 98  ? 5.131   -16.901 -8.734  1.00 0.00 ? 881 SER A CA   3  
ATOM 4504  C C    . SER A 1 98  ? 5.913   -17.884 -9.601  1.00 0.00 ? 881 SER A C    3  
ATOM 4505  O O    . SER A 1 98  ? 6.870   -18.507 -9.143  1.00 0.00 ? 881 SER A O    3  
ATOM 4506  C CB   . SER A 1 98  ? 3.702   -17.409 -8.531  1.00 0.00 ? 881 SER A CB   3  
ATOM 4507  O OG   . SER A 1 98  ? 3.200   -17.024 -7.262  1.00 0.00 ? 881 SER A OG   3  
ATOM 4508  H H    . SER A 1 98  ? 4.535   -15.407 -10.111 1.00 0.00 ? 881 SER A H    3  
ATOM 4509  H HA   . SER A 1 98  ? 5.616   -16.822 -7.773  1.00 0.00 ? 881 SER A HA   3  
ATOM 4510  H HB2  . SER A 1 98  ? 3.063   -16.996 -9.297  1.00 0.00 ? 881 SER A HB2  3  
ATOM 4511  H HB3  . SER A 1 98  ? 3.693   -18.487 -8.596  1.00 0.00 ? 881 SER A HB3  3  
ATOM 4512  H HG   . SER A 1 98  ? 2.596   -17.696 -6.940  1.00 0.00 ? 881 SER A HG   3  
ATOM 4513  N N    . SER A 1 99  ? 5.497   -18.017 -10.856 1.00 0.00 ? 882 SER A N    3  
ATOM 4514  C CA   . SER A 1 99  ? 6.154   -18.926 -11.788 1.00 0.00 ? 882 SER A CA   3  
ATOM 4515  C C    . SER A 1 99  ? 6.258   -20.329 -11.196 1.00 0.00 ? 882 SER A C    3  
ATOM 4516  O O    . SER A 1 99  ? 7.281   -20.999 -11.333 1.00 0.00 ? 882 SER A O    3  
ATOM 4517  C CB   . SER A 1 99  ? 7.548   -18.406 -12.143 1.00 0.00 ? 882 SER A CB   3  
ATOM 4518  O OG   . SER A 1 99  ? 7.923   -18.802 -13.450 1.00 0.00 ? 882 SER A OG   3  
ATOM 4519  H H    . SER A 1 99  ? 4.727   -17.493 -11.163 1.00 0.00 ? 882 SER A H    3  
ATOM 4520  H HA   . SER A 1 99  ? 5.556   -18.971 -12.686 1.00 0.00 ? 882 SER A HA   3  
ATOM 4521  H HB2  . SER A 1 99  ? 7.551   -17.328 -12.092 1.00 0.00 ? 882 SER A HB2  3  
ATOM 4522  H HB3  . SER A 1 99  ? 8.267   -18.801 -11.439 1.00 0.00 ? 882 SER A HB3  3  
ATOM 4523  H HG   . SER A 1 99  ? 7.139   -18.883 -13.998 1.00 0.00 ? 882 SER A HG   3  
ATOM 4524  N N    . GLY A 1 100 ? 5.190   -20.766 -10.536 1.00 0.00 ? 883 GLY A N    3  
ATOM 4525  C CA   . GLY A 1 100 ? 5.180   -22.086 -9.932  1.00 0.00 ? 883 GLY A CA   3  
ATOM 4526  C C    . GLY A 1 100 ? 3.888   -22.377 -9.196  1.00 0.00 ? 883 GLY A C    3  
ATOM 4527  O O    . GLY A 1 100 ? 3.706   -21.952 -8.055  1.00 0.00 ? 883 GLY A O    3  
ATOM 4528  H H    . GLY A 1 100 ? 4.402   -20.188 -10.458 1.00 0.00 ? 883 GLY A H    3  
ATOM 4529  H HA2  . GLY A 1 100 ? 5.315   -22.825 -10.707 1.00 0.00 ? 883 GLY A HA2  3  
ATOM 4530  H HA3  . GLY A 1 100 ? 6.002   -22.156 -9.235  1.00 0.00 ? 883 GLY A HA3  3  
ATOM 4531  N N    . GLY A 1 1   ? 27.091  5.236   -26.090 1.00 0.00 ? 784 GLY A N    4  
ATOM 4532  C CA   . GLY A 1 1   ? 26.264  4.059   -25.902 1.00 0.00 ? 784 GLY A CA   4  
ATOM 4533  C C    . GLY A 1 1   ? 24.799  4.328   -26.187 1.00 0.00 ? 784 GLY A C    4  
ATOM 4534  O O    . GLY A 1 1   ? 24.463  5.254   -26.924 1.00 0.00 ? 784 GLY A O    4  
ATOM 4535  H H1   . GLY A 1 1   ? 27.671  5.546   -25.363 1.00 0.00 ? 784 GLY A H1   4  
ATOM 4536  H HA2  . GLY A 1 1   ? 26.611  3.279   -26.564 1.00 0.00 ? 784 GLY A HA2  4  
ATOM 4537  H HA3  . GLY A 1 1   ? 26.364  3.722   -24.881 1.00 0.00 ? 784 GLY A HA3  4  
ATOM 4538  N N    . SER A 1 2   ? 23.925  3.515   -25.601 1.00 0.00 ? 785 SER A N    4  
ATOM 4539  C CA   . SER A 1 2   ? 22.489  3.666   -25.800 1.00 0.00 ? 785 SER A CA   4  
ATOM 4540  C C    . SER A 1 2   ? 21.750  3.639   -24.465 1.00 0.00 ? 785 SER A C    4  
ATOM 4541  O O    . SER A 1 2   ? 21.932  2.725   -23.661 1.00 0.00 ? 785 SER A O    4  
ATOM 4542  C CB   . SER A 1 2   ? 21.959  2.558   -26.712 1.00 0.00 ? 785 SER A CB   4  
ATOM 4543  O OG   . SER A 1 2   ? 22.300  2.805   -28.065 1.00 0.00 ? 785 SER A OG   4  
ATOM 4544  H H    . SER A 1 2   ? 24.255  2.795   -25.024 1.00 0.00 ? 785 SER A H    4  
ATOM 4545  H HA   . SER A 1 2   ? 22.318  4.622   -26.273 1.00 0.00 ? 785 SER A HA   4  
ATOM 4546  H HB2  . SER A 1 2   ? 22.387  1.614   -26.412 1.00 0.00 ? 785 SER A HB2  4  
ATOM 4547  H HB3  . SER A 1 2   ? 20.883  2.510   -26.627 1.00 0.00 ? 785 SER A HB3  4  
ATOM 4548  H HG   . SER A 1 2   ? 23.170  3.207   -28.108 1.00 0.00 ? 785 SER A HG   4  
ATOM 4549  N N    . SER A 1 3   ? 20.916  4.649   -24.237 1.00 0.00 ? 786 SER A N    4  
ATOM 4550  C CA   . SER A 1 3   ? 20.152  4.744   -22.999 1.00 0.00 ? 786 SER A CA   4  
ATOM 4551  C C    . SER A 1 3   ? 19.438  3.429   -22.699 1.00 0.00 ? 786 SER A C    4  
ATOM 4552  O O    . SER A 1 3   ? 18.495  3.049   -23.392 1.00 0.00 ? 786 SER A O    4  
ATOM 4553  C CB   . SER A 1 3   ? 19.133  5.881   -23.089 1.00 0.00 ? 786 SER A CB   4  
ATOM 4554  O OG   . SER A 1 3   ? 18.455  6.058   -21.858 1.00 0.00 ? 786 SER A OG   4  
ATOM 4555  H H    . SER A 1 3   ? 20.814  5.347   -24.917 1.00 0.00 ? 786 SER A H    4  
ATOM 4556  H HA   . SER A 1 3   ? 20.844  4.955   -22.197 1.00 0.00 ? 786 SER A HA   4  
ATOM 4557  H HB2  . SER A 1 3   ? 19.643  6.799   -23.341 1.00 0.00 ? 786 SER A HB2  4  
ATOM 4558  H HB3  . SER A 1 3   ? 18.407  5.651   -23.856 1.00 0.00 ? 786 SER A HB3  4  
ATOM 4559  H HG   . SER A 1 3   ? 17.570  5.691   -21.923 1.00 0.00 ? 786 SER A HG   4  
ATOM 4560  N N    . GLY A 1 4   ? 19.895  2.738   -21.659 1.00 0.00 ? 787 GLY A N    4  
ATOM 4561  C CA   . GLY A 1 4   ? 19.290  1.473   -21.284 1.00 0.00 ? 787 GLY A CA   4  
ATOM 4562  C C    . GLY A 1 4   ? 20.206  0.293   -21.541 1.00 0.00 ? 787 GLY A C    4  
ATOM 4563  O O    . GLY A 1 4   ? 21.354  0.282   -21.097 1.00 0.00 ? 787 GLY A O    4  
ATOM 4564  H H    . GLY A 1 4   ? 20.650  3.090   -21.142 1.00 0.00 ? 787 GLY A H    4  
ATOM 4565  H HA2  . GLY A 1 4   ? 19.043  1.502   -20.234 1.00 0.00 ? 787 GLY A HA2  4  
ATOM 4566  H HA3  . GLY A 1 4   ? 18.381  1.340   -21.854 1.00 0.00 ? 787 GLY A HA3  4  
ATOM 4567  N N    . SER A 1 5   ? 19.697  -0.703  -22.259 1.00 0.00 ? 788 SER A N    4  
ATOM 4568  C CA   . SER A 1 5   ? 20.476  -1.896  -22.569 1.00 0.00 ? 788 SER A CA   4  
ATOM 4569  C C    . SER A 1 5   ? 20.268  -2.318  -24.021 1.00 0.00 ? 788 SER A C    4  
ATOM 4570  O O    . SER A 1 5   ? 19.161  -2.230  -24.551 1.00 0.00 ? 788 SER A O    4  
ATOM 4571  C CB   . SER A 1 5   ? 20.089  -3.042  -21.632 1.00 0.00 ? 788 SER A CB   4  
ATOM 4572  O OG   . SER A 1 5   ? 20.227  -2.660  -20.275 1.00 0.00 ? 788 SER A OG   4  
ATOM 4573  H H    . SER A 1 5   ? 18.775  -0.635  -22.585 1.00 0.00 ? 788 SER A H    4  
ATOM 4574  H HA   . SER A 1 5   ? 21.519  -1.659  -22.422 1.00 0.00 ? 788 SER A HA   4  
ATOM 4575  H HB2  . SER A 1 5   ? 19.061  -3.320  -21.813 1.00 0.00 ? 788 SER A HB2  4  
ATOM 4576  H HB3  . SER A 1 5   ? 20.730  -3.891  -21.823 1.00 0.00 ? 788 SER A HB3  4  
ATOM 4577  H HG   . SER A 1 5   ? 19.756  -3.283  -19.717 1.00 0.00 ? 788 SER A HG   4  
ATOM 4578  N N    . SER A 1 6   ? 21.341  -2.777  -24.657 1.00 0.00 ? 789 SER A N    4  
ATOM 4579  C CA   . SER A 1 6   ? 21.279  -3.209  -26.048 1.00 0.00 ? 789 SER A CA   4  
ATOM 4580  C C    . SER A 1 6   ? 20.129  -4.190  -26.261 1.00 0.00 ? 789 SER A C    4  
ATOM 4581  O O    . SER A 1 6   ? 20.031  -5.207  -25.576 1.00 0.00 ? 789 SER A O    4  
ATOM 4582  C CB   . SER A 1 6   ? 22.601  -3.858  -26.462 1.00 0.00 ? 789 SER A CB   4  
ATOM 4583  O OG   . SER A 1 6   ? 22.735  -3.886  -27.873 1.00 0.00 ? 789 SER A OG   4  
ATOM 4584  H H    . SER A 1 6   ? 22.196  -2.823  -24.179 1.00 0.00 ? 789 SER A H    4  
ATOM 4585  H HA   . SER A 1 6   ? 21.109  -2.336  -26.659 1.00 0.00 ? 789 SER A HA   4  
ATOM 4586  H HB2  . SER A 1 6   ? 23.422  -3.295  -26.046 1.00 0.00 ? 789 SER A HB2  4  
ATOM 4587  H HB3  . SER A 1 6   ? 22.633  -4.872  -26.089 1.00 0.00 ? 789 SER A HB3  4  
ATOM 4588  H HG   . SER A 1 6   ? 23.666  -3.880  -28.106 1.00 0.00 ? 789 SER A HG   4  
ATOM 4589  N N    . GLY A 1 7   ? 19.260  -3.875  -27.216 1.00 0.00 ? 790 GLY A N    4  
ATOM 4590  C CA   . GLY A 1 7   ? 18.128  -4.736  -27.503 1.00 0.00 ? 790 GLY A CA   4  
ATOM 4591  C C    . GLY A 1 7   ? 16.905  -4.380  -26.682 1.00 0.00 ? 790 GLY A C    4  
ATOM 4592  O O    . GLY A 1 7   ? 15.891  -3.941  -27.224 1.00 0.00 ? 790 GLY A O    4  
ATOM 4593  H H    . GLY A 1 7   ? 19.388  -3.050  -27.730 1.00 0.00 ? 790 GLY A H    4  
ATOM 4594  H HA2  . GLY A 1 7   ? 17.882  -4.652  -28.551 1.00 0.00 ? 790 GLY A HA2  4  
ATOM 4595  H HA3  . GLY A 1 7   ? 18.405  -5.758  -27.290 1.00 0.00 ? 790 GLY A HA3  4  
ATOM 4596  N N    . VAL A 1 8   ? 16.999  -4.571  -25.370 1.00 0.00 ? 791 VAL A N    4  
ATOM 4597  C CA   . VAL A 1 8   ? 15.892  -4.268  -24.472 1.00 0.00 ? 791 VAL A CA   4  
ATOM 4598  C C    . VAL A 1 8   ? 15.378  -2.849  -24.692 1.00 0.00 ? 791 VAL A C    4  
ATOM 4599  O O    . VAL A 1 8   ? 16.074  -1.874  -24.410 1.00 0.00 ? 791 VAL A O    4  
ATOM 4600  C CB   . VAL A 1 8   ? 16.305  -4.428  -22.997 1.00 0.00 ? 791 VAL A CB   4  
ATOM 4601  C CG1  . VAL A 1 8   ? 15.154  -4.054  -22.076 1.00 0.00 ? 791 VAL A CG1  4  
ATOM 4602  C CG2  . VAL A 1 8   ? 16.773  -5.850  -22.727 1.00 0.00 ? 791 VAL A CG2  4  
ATOM 4603  H H    . VAL A 1 8   ? 17.834  -4.924  -24.997 1.00 0.00 ? 791 VAL A H    4  
ATOM 4604  H HA   . VAL A 1 8   ? 15.093  -4.966  -24.678 1.00 0.00 ? 791 VAL A HA   4  
ATOM 4605  H HB   . VAL A 1 8   ? 17.128  -3.757  -22.799 1.00 0.00 ? 791 VAL A HB   4  
ATOM 4606  H HG11 . VAL A 1 8   ? 15.455  -4.194  -21.048 1.00 0.00 ? 791 VAL A HG11 4  
ATOM 4607  H HG12 . VAL A 1 8   ? 14.886  -3.019  -22.236 1.00 0.00 ? 791 VAL A HG12 4  
ATOM 4608  H HG13 . VAL A 1 8   ? 14.303  -4.683  -22.289 1.00 0.00 ? 791 VAL A HG13 4  
ATOM 4609  H HG21 . VAL A 1 8   ? 15.994  -6.394  -22.213 1.00 0.00 ? 791 VAL A HG21 4  
ATOM 4610  H HG22 . VAL A 1 8   ? 16.995  -6.341  -23.664 1.00 0.00 ? 791 VAL A HG22 4  
ATOM 4611  H HG23 . VAL A 1 8   ? 17.662  -5.827  -22.114 1.00 0.00 ? 791 VAL A HG23 4  
ATOM 4612  N N    . PHE A 1 9   ? 14.154  -2.742  -25.199 1.00 0.00 ? 792 PHE A N    4  
ATOM 4613  C CA   . PHE A 1 9   ? 13.546  -1.442  -25.459 1.00 0.00 ? 792 PHE A CA   4  
ATOM 4614  C C    . PHE A 1 9   ? 12.862  -0.902  -24.206 1.00 0.00 ? 792 PHE A C    4  
ATOM 4615  O O    . PHE A 1 9   ? 13.082  0.244   -23.811 1.00 0.00 ? 792 PHE A O    4  
ATOM 4616  C CB   . PHE A 1 9   ? 12.534  -1.548  -26.601 1.00 0.00 ? 792 PHE A CB   4  
ATOM 4617  C CG   . PHE A 1 9   ? 13.036  -2.338  -27.776 1.00 0.00 ? 792 PHE A CG   4  
ATOM 4618  C CD1  . PHE A 1 9   ? 13.785  -1.728  -28.768 1.00 0.00 ? 792 PHE A CD1  4  
ATOM 4619  C CD2  . PHE A 1 9   ? 12.757  -3.691  -27.887 1.00 0.00 ? 792 PHE A CD2  4  
ATOM 4620  C CE1  . PHE A 1 9   ? 14.249  -2.453  -29.850 1.00 0.00 ? 792 PHE A CE1  4  
ATOM 4621  C CE2  . PHE A 1 9   ? 13.218  -4.420  -28.967 1.00 0.00 ? 792 PHE A CE2  4  
ATOM 4622  C CZ   . PHE A 1 9   ? 13.964  -3.800  -29.950 1.00 0.00 ? 792 PHE A CZ   4  
ATOM 4623  H H    . PHE A 1 9   ? 13.648  -3.556  -25.404 1.00 0.00 ? 792 PHE A H    4  
ATOM 4624  H HA   . PHE A 1 9   ? 14.332  -0.761  -25.747 1.00 0.00 ? 792 PHE A HA   4  
ATOM 4625  H HB2  . PHE A 1 9   ? 11.639  -2.029  -26.236 1.00 0.00 ? 792 PHE A HB2  4  
ATOM 4626  H HB3  . PHE A 1 9   ? 12.288  -0.555  -26.948 1.00 0.00 ? 792 PHE A HB3  4  
ATOM 4627  H HD1  . PHE A 1 9   ? 14.009  -0.673  -28.691 1.00 0.00 ? 792 PHE A HD1  4  
ATOM 4628  H HD2  . PHE A 1 9   ? 12.173  -4.177  -27.120 1.00 0.00 ? 792 PHE A HD2  4  
ATOM 4629  H HE1  . PHE A 1 9   ? 14.832  -1.964  -30.617 1.00 0.00 ? 792 PHE A HE1  4  
ATOM 4630  H HE2  . PHE A 1 9   ? 12.994  -5.474  -29.042 1.00 0.00 ? 792 PHE A HE2  4  
ATOM 4631  H HZ   . PHE A 1 9   ? 14.326  -4.368  -30.794 1.00 0.00 ? 792 PHE A HZ   4  
ATOM 4632  N N    . ARG A 1 10  ? 12.031  -1.734  -23.587 1.00 0.00 ? 793 ARG A N    4  
ATOM 4633  C CA   . ARG A 1 10  ? 11.313  -1.340  -22.381 1.00 0.00 ? 793 ARG A CA   4  
ATOM 4634  C C    . ARG A 1 10  ? 12.187  -1.524  -21.144 1.00 0.00 ? 793 ARG A C    4  
ATOM 4635  O O    . ARG A 1 10  ? 12.948  -2.487  -21.045 1.00 0.00 ? 793 ARG A O    4  
ATOM 4636  C CB   . ARG A 1 10  ? 10.029  -2.158  -22.237 1.00 0.00 ? 793 ARG A CB   4  
ATOM 4637  C CG   . ARG A 1 10  ? 8.933   -1.748  -23.207 1.00 0.00 ? 793 ARG A CG   4  
ATOM 4638  C CD   . ARG A 1 10  ? 7.760   -2.715  -23.164 1.00 0.00 ? 793 ARG A CD   4  
ATOM 4639  N NE   . ARG A 1 10  ? 7.066   -2.791  -24.447 1.00 0.00 ? 793 ARG A NE   4  
ATOM 4640  C CZ   . ARG A 1 10  ? 7.593   -3.340  -25.536 1.00 0.00 ? 793 ARG A CZ   4  
ATOM 4641  N NH1  . ARG A 1 10  ? 8.812   -3.859  -25.497 1.00 0.00 ? 793 ARG A NH1  4  
ATOM 4642  N NH2  . ARG A 1 10  ? 6.898   -3.372  -26.666 1.00 0.00 ? 793 ARG A NH2  4  
ATOM 4643  H H    . ARG A 1 10  ? 11.898  -2.634  -23.950 1.00 0.00 ? 793 ARG A H    4  
ATOM 4644  H HA   . ARG A 1 10  ? 11.056  -0.296  -22.474 1.00 0.00 ? 793 ARG A HA   4  
ATOM 4645  H HB2  . ARG A 1 10  ? 10.258  -3.200  -22.406 1.00 0.00 ? 793 ARG A HB2  4  
ATOM 4646  H HB3  . ARG A 1 10  ? 9.652   -2.040  -21.232 1.00 0.00 ? 793 ARG A HB3  4  
ATOM 4647  H HG2  . ARG A 1 10  ? 8.582   -0.761  -22.944 1.00 0.00 ? 793 ARG A HG2  4  
ATOM 4648  H HG3  . ARG A 1 10  ? 9.339   -1.733  -24.208 1.00 0.00 ? 793 ARG A HG3  4  
ATOM 4649  H HD2  . ARG A 1 10  ? 8.129   -3.696  -22.906 1.00 0.00 ? 793 ARG A HD2  4  
ATOM 4650  H HD3  . ARG A 1 10  ? 7.065   -2.382  -22.408 1.00 0.00 ? 793 ARG A HD3  4  
ATOM 4651  H HE   . ARG A 1 10  ? 6.163   -2.414  -24.498 1.00 0.00 ? 793 ARG A HE   4  
ATOM 4652  H HH11 . ARG A 1 10  ? 9.337   -3.837  -24.646 1.00 0.00 ? 793 ARG A HH11 4  
ATOM 4653  H HH12 . ARG A 1 10  ? 9.206   -4.273  -26.318 1.00 0.00 ? 793 ARG A HH12 4  
ATOM 4654  H HH21 . ARG A 1 10  ? 5.979   -2.982  -26.699 1.00 0.00 ? 793 ARG A HH21 4  
ATOM 4655  H HH22 . ARG A 1 10  ? 7.296   -3.785  -27.485 1.00 0.00 ? 793 ARG A HH22 4  
ATOM 4656  N N    . TYR A 1 11  ? 12.074  -0.593  -20.203 1.00 0.00 ? 794 TYR A N    4  
ATOM 4657  C CA   . TYR A 1 11  ? 12.856  -0.650  -18.973 1.00 0.00 ? 794 TYR A CA   4  
ATOM 4658  C C    . TYR A 1 11  ? 12.419  -1.825  -18.104 1.00 0.00 ? 794 TYR A C    4  
ATOM 4659  O O    . TYR A 1 11  ? 13.247  -2.600  -17.626 1.00 0.00 ? 794 TYR A O    4  
ATOM 4660  C CB   . TYR A 1 11  ? 12.714  0.658   -18.193 1.00 0.00 ? 794 TYR A CB   4  
ATOM 4661  C CG   . TYR A 1 11  ? 13.516  0.688   -16.911 1.00 0.00 ? 794 TYR A CG   4  
ATOM 4662  C CD1  . TYR A 1 11  ? 14.905  0.706   -16.939 1.00 0.00 ? 794 TYR A CD1  4  
ATOM 4663  C CD2  . TYR A 1 11  ? 12.885  0.700   -15.674 1.00 0.00 ? 794 TYR A CD2  4  
ATOM 4664  C CE1  . TYR A 1 11  ? 15.642  0.734   -15.770 1.00 0.00 ? 794 TYR A CE1  4  
ATOM 4665  C CE2  . TYR A 1 11  ? 13.614  0.729   -14.500 1.00 0.00 ? 794 TYR A CE2  4  
ATOM 4666  C CZ   . TYR A 1 11  ? 14.992  0.745   -14.554 1.00 0.00 ? 794 TYR A CZ   4  
ATOM 4667  O OH   . TYR A 1 11  ? 15.722  0.774   -13.388 1.00 0.00 ? 794 TYR A OH   4  
ATOM 4668  H H    . TYR A 1 11  ? 11.451  0.151   -20.338 1.00 0.00 ? 794 TYR A H    4  
ATOM 4669  H HA   . TYR A 1 11  ? 13.893  -0.784  -19.245 1.00 0.00 ? 794 TYR A HA   4  
ATOM 4670  H HB2  . TYR A 1 11  ? 13.047  1.477   -18.811 1.00 0.00 ? 794 TYR A HB2  4  
ATOM 4671  H HB3  . TYR A 1 11  ? 11.674  0.805   -17.937 1.00 0.00 ? 794 TYR A HB3  4  
ATOM 4672  H HD1  . TYR A 1 11  ? 15.411  0.698   -17.893 1.00 0.00 ? 794 TYR A HD1  4  
ATOM 4673  H HD2  . TYR A 1 11  ? 11.805  0.688   -15.635 1.00 0.00 ? 794 TYR A HD2  4  
ATOM 4674  H HE1  . TYR A 1 11  ? 16.721  0.747   -15.812 1.00 0.00 ? 794 TYR A HE1  4  
ATOM 4675  H HE2  . TYR A 1 11  ? 13.105  0.738   -13.548 1.00 0.00 ? 794 TYR A HE2  4  
ATOM 4676  H HH   . TYR A 1 11  ? 16.244  -0.029  -13.318 1.00 0.00 ? 794 TYR A HH   4  
ATOM 4677  N N    . SER A 1 12  ? 11.110  -1.949  -17.903 1.00 0.00 ? 795 SER A N    4  
ATOM 4678  C CA   . SER A 1 12  ? 10.561  -3.027  -17.089 1.00 0.00 ? 795 SER A CA   4  
ATOM 4679  C C    . SER A 1 12  ? 9.326   -3.631  -17.749 1.00 0.00 ? 795 SER A C    4  
ATOM 4680  O O    . SER A 1 12  ? 8.470   -2.913  -18.268 1.00 0.00 ? 795 SER A O    4  
ATOM 4681  C CB   . SER A 1 12  ? 10.207  -2.510  -15.693 1.00 0.00 ? 795 SER A CB   4  
ATOM 4682  O OG   . SER A 1 12  ? 11.372  -2.154  -14.970 1.00 0.00 ? 795 SER A OG   4  
ATOM 4683  H H    . SER A 1 12  ? 10.501  -1.299  -18.311 1.00 0.00 ? 795 SER A H    4  
ATOM 4684  H HA   . SER A 1 12  ? 11.317  -3.793  -16.998 1.00 0.00 ? 795 SER A HA   4  
ATOM 4685  H HB2  . SER A 1 12  ? 9.574   -1.640  -15.784 1.00 0.00 ? 795 SER A HB2  4  
ATOM 4686  H HB3  . SER A 1 12  ? 9.682   -3.282  -15.149 1.00 0.00 ? 795 SER A HB3  4  
ATOM 4687  H HG   . SER A 1 12  ? 11.160  -1.458  -14.343 1.00 0.00 ? 795 SER A HG   4  
ATOM 4688  N N    . THR A 1 13  ? 9.238   -4.958  -17.725 1.00 0.00 ? 796 THR A N    4  
ATOM 4689  C CA   . THR A 1 13  ? 8.109   -5.660  -18.321 1.00 0.00 ? 796 THR A CA   4  
ATOM 4690  C C    . THR A 1 13  ? 6.866   -5.544  -17.447 1.00 0.00 ? 796 THR A C    4  
ATOM 4691  O O    . THR A 1 13  ? 5.804   -6.065  -17.789 1.00 0.00 ? 796 THR A O    4  
ATOM 4692  C CB   . THR A 1 13  ? 8.429   -7.150  -18.544 1.00 0.00 ? 796 THR A CB   4  
ATOM 4693  O OG1  . THR A 1 13  ? 7.263   -7.837  -19.011 1.00 0.00 ? 796 THR A OG1  4  
ATOM 4694  C CG2  . THR A 1 13  ? 8.924   -7.796  -17.258 1.00 0.00 ? 796 THR A CG2  4  
ATOM 4695  H H    . THR A 1 13  ? 9.952   -5.475  -17.296 1.00 0.00 ? 796 THR A H    4  
ATOM 4696  H HA   . THR A 1 13  ? 7.906   -5.210  -19.282 1.00 0.00 ? 796 THR A HA   4  
ATOM 4697  H HB   . THR A 1 13  ? 9.207   -7.228  -19.291 1.00 0.00 ? 796 THR A HB   4  
ATOM 4698  H HG1  . THR A 1 13  ? 7.429   -8.783  -19.017 1.00 0.00 ? 796 THR A HG1  4  
ATOM 4699  H HG21 . THR A 1 13  ? 9.935   -8.148  -17.398 1.00 0.00 ? 796 THR A HG21 4  
ATOM 4700  H HG22 . THR A 1 13  ? 8.284   -8.628  -17.005 1.00 0.00 ? 796 THR A HG22 4  
ATOM 4701  H HG23 . THR A 1 13  ? 8.903   -7.069  -16.460 1.00 0.00 ? 796 THR A HG23 4  
ATOM 4702  N N    . SER A 1 14  ? 7.004   -4.858  -16.317 1.00 0.00 ? 797 SER A N    4  
ATOM 4703  C CA   . SER A 1 14  ? 5.892   -4.677  -15.392 1.00 0.00 ? 797 SER A CA   4  
ATOM 4704  C C    . SER A 1 14  ? 5.737   -3.208  -15.009 1.00 0.00 ? 797 SER A C    4  
ATOM 4705  O O    . SER A 1 14  ? 6.710   -2.541  -14.655 1.00 0.00 ? 797 SER A O    4  
ATOM 4706  C CB   . SER A 1 14  ? 6.103   -5.523  -14.135 1.00 0.00 ? 797 SER A CB   4  
ATOM 4707  O OG   . SER A 1 14  ? 5.820   -6.889  -14.386 1.00 0.00 ? 797 SER A OG   4  
ATOM 4708  H H    . SER A 1 14  ? 7.876   -4.467  -16.099 1.00 0.00 ? 797 SER A H    4  
ATOM 4709  H HA   . SER A 1 14  ? 4.991   -5.004  -15.889 1.00 0.00 ? 797 SER A HA   4  
ATOM 4710  H HB2  . SER A 1 14  ? 7.129   -5.434  -13.812 1.00 0.00 ? 797 SER A HB2  4  
ATOM 4711  H HB3  . SER A 1 14  ? 5.448   -5.170  -13.352 1.00 0.00 ? 797 SER A HB3  4  
ATOM 4712  H HG   . SER A 1 14  ? 6.523   -7.269  -14.918 1.00 0.00 ? 797 SER A HG   4  
ATOM 4713  N N    . LEU A 1 15  ? 4.508   -2.710  -15.084 1.00 0.00 ? 798 LEU A N    4  
ATOM 4714  C CA   . LEU A 1 15  ? 4.224   -1.320  -14.746 1.00 0.00 ? 798 LEU A CA   4  
ATOM 4715  C C    . LEU A 1 15  ? 3.084   -1.227  -13.737 1.00 0.00 ? 798 LEU A C    4  
ATOM 4716  O O    . LEU A 1 15  ? 2.510   -0.158  -13.532 1.00 0.00 ? 798 LEU A O    4  
ATOM 4717  C CB   . LEU A 1 15  ? 3.869   -0.530  -16.007 1.00 0.00 ? 798 LEU A CB   4  
ATOM 4718  C CG   . LEU A 1 15  ? 3.148   -1.310  -17.107 1.00 0.00 ? 798 LEU A CG   4  
ATOM 4719  C CD1  . LEU A 1 15  ? 4.076   -2.345  -17.724 1.00 0.00 ? 798 LEU A CD1  4  
ATOM 4720  C CD2  . LEU A 1 15  ? 1.896   -1.976  -16.555 1.00 0.00 ? 798 LEU A CD2  4  
ATOM 4721  H H    . LEU A 1 15  ? 3.773   -3.290  -15.373 1.00 0.00 ? 798 LEU A H    4  
ATOM 4722  H HA   . LEU A 1 15  ? 5.114   -0.897  -14.305 1.00 0.00 ? 798 LEU A HA   4  
ATOM 4723  H HB2  . LEU A 1 15  ? 3.234   0.292   -15.715 1.00 0.00 ? 798 LEU A HB2  4  
ATOM 4724  H HB3  . LEU A 1 15  ? 4.788   -0.143  -16.423 1.00 0.00 ? 798 LEU A HB3  4  
ATOM 4725  H HG   . LEU A 1 15  ? 2.847   -0.625  -17.887 1.00 0.00 ? 798 LEU A HG   4  
ATOM 4726  H HD11 . LEU A 1 15  ? 5.075   -2.206  -17.341 1.00 0.00 ? 798 LEU A HD11 4  
ATOM 4727  H HD12 . LEU A 1 15  ? 4.082   -2.228  -18.798 1.00 0.00 ? 798 LEU A HD12 4  
ATOM 4728  H HD13 . LEU A 1 15  ? 3.728   -3.336  -17.473 1.00 0.00 ? 798 LEU A HD13 4  
ATOM 4729  H HD21 . LEU A 1 15  ? 1.613   -2.797  -17.196 1.00 0.00 ? 798 LEU A HD21 4  
ATOM 4730  H HD22 . LEU A 1 15  ? 1.091   -1.255  -16.518 1.00 0.00 ? 798 LEU A HD22 4  
ATOM 4731  H HD23 . LEU A 1 15  ? 2.094   -2.347  -15.560 1.00 0.00 ? 798 LEU A HD23 4  
ATOM 4732  N N    . GLU A 1 16  ? 2.764   -2.353  -13.108 1.00 0.00 ? 799 GLU A N    4  
ATOM 4733  C CA   . GLU A 1 16  ? 1.693   -2.398  -12.119 1.00 0.00 ? 799 GLU A CA   4  
ATOM 4734  C C    . GLU A 1 16  ? 2.142   -1.767  -10.803 1.00 0.00 ? 799 GLU A C    4  
ATOM 4735  O O    . GLU A 1 16  ? 2.378   -2.464  -9.816  1.00 0.00 ? 799 GLU A O    4  
ATOM 4736  C CB   . GLU A 1 16  ? 1.249   -3.842  -11.879 1.00 0.00 ? 799 GLU A CB   4  
ATOM 4737  C CG   . GLU A 1 16  ? 0.658   -4.509  -13.110 1.00 0.00 ? 799 GLU A CG   4  
ATOM 4738  C CD   . GLU A 1 16  ? 0.421   -5.993  -12.912 1.00 0.00 ? 799 GLU A CD   4  
ATOM 4739  O OE1  . GLU A 1 16  ? -0.211  -6.364  -11.901 1.00 0.00 ? 799 GLU A OE1  4  
ATOM 4740  O OE2  . GLU A 1 16  ? 0.867   -6.784  -13.770 1.00 0.00 ? 799 GLU A OE2  4  
ATOM 4741  H H    . GLU A 1 16  ? 3.259   -3.174  -13.314 1.00 0.00 ? 799 GLU A H    4  
ATOM 4742  H HA   . GLU A 1 16  ? 0.859   -1.834  -12.507 1.00 0.00 ? 799 GLU A HA   4  
ATOM 4743  H HB2  . GLU A 1 16  ? 2.103   -4.420  -11.557 1.00 0.00 ? 799 GLU A HB2  4  
ATOM 4744  H HB3  . GLU A 1 16  ? 0.504   -3.851  -11.098 1.00 0.00 ? 799 GLU A HB3  4  
ATOM 4745  H HG2  . GLU A 1 16  ? -0.286  -4.037  -13.341 1.00 0.00 ? 799 GLU A HG2  4  
ATOM 4746  H HG3  . GLU A 1 16  ? 1.338   -4.375  -13.938 1.00 0.00 ? 799 GLU A HG3  4  
ATOM 4747  N N    . LYS A 1 17  ? 2.258   -0.444  -10.797 1.00 0.00 ? 800 LYS A N    4  
ATOM 4748  C CA   . LYS A 1 17  ? 2.677   0.283   -9.605  1.00 0.00 ? 800 LYS A CA   4  
ATOM 4749  C C    . LYS A 1 17  ? 1.499   1.017   -8.973  1.00 0.00 ? 800 LYS A C    4  
ATOM 4750  O O    . LYS A 1 17  ? 1.676   2.034   -8.301  1.00 0.00 ? 800 LYS A O    4  
ATOM 4751  C CB   . LYS A 1 17  ? 3.786   1.279   -9.953  1.00 0.00 ? 800 LYS A CB   4  
ATOM 4752  C CG   . LYS A 1 17  ? 3.641   1.891   -11.335 1.00 0.00 ? 800 LYS A CG   4  
ATOM 4753  C CD   . LYS A 1 17  ? 4.472   3.155   -11.474 1.00 0.00 ? 800 LYS A CD   4  
ATOM 4754  C CE   . LYS A 1 17  ? 3.829   4.328   -10.751 1.00 0.00 ? 800 LYS A CE   4  
ATOM 4755  N NZ   . LYS A 1 17  ? 4.842   5.308   -10.271 1.00 0.00 ? 800 LYS A NZ   4  
ATOM 4756  H H    . LYS A 1 17  ? 2.055   0.057   -11.616 1.00 0.00 ? 800 LYS A H    4  
ATOM 4757  H HA   . LYS A 1 17  ? 3.060   -0.436  -8.896  1.00 0.00 ? 800 LYS A HA   4  
ATOM 4758  H HB2  . LYS A 1 17  ? 3.777   2.077   -9.225  1.00 0.00 ? 800 LYS A HB2  4  
ATOM 4759  H HB3  . LYS A 1 17  ? 4.738   0.770   -9.905  1.00 0.00 ? 800 LYS A HB3  4  
ATOM 4760  H HG2  . LYS A 1 17  ? 3.969   1.174   -12.073 1.00 0.00 ? 800 LYS A HG2  4  
ATOM 4761  H HG3  . LYS A 1 17  ? 2.601   2.134   -11.504 1.00 0.00 ? 800 LYS A HG3  4  
ATOM 4762  H HD2  . LYS A 1 17  ? 5.451   2.981   -11.053 1.00 0.00 ? 800 LYS A HD2  4  
ATOM 4763  H HD3  . LYS A 1 17  ? 4.568   3.399   -12.523 1.00 0.00 ? 800 LYS A HD3  4  
ATOM 4764  H HE2  . LYS A 1 17  ? 3.153   4.826   -11.429 1.00 0.00 ? 800 LYS A HE2  4  
ATOM 4765  H HE3  . LYS A 1 17  ? 3.275   3.952   -9.904  1.00 0.00 ? 800 LYS A HE3  4  
ATOM 4766  H HZ1  . LYS A 1 17  ? 5.755   4.832   -10.120 1.00 0.00 ? 800 LYS A HZ1  4  
ATOM 4767  H HZ2  . LYS A 1 17  ? 4.533   5.732   -9.374  1.00 0.00 ? 800 LYS A HZ2  4  
ATOM 4768  H HZ3  . LYS A 1 17  ? 4.970   6.064   -10.974 1.00 0.00 ? 800 LYS A HZ3  4  
ATOM 4769  N N    . HIS A 1 18  ? 0.296   0.495   -9.191  1.00 0.00 ? 801 HIS A N    4  
ATOM 4770  C CA   . HIS A 1 18  ? -0.911  1.101   -8.641  1.00 0.00 ? 801 HIS A CA   4  
ATOM 4771  C C    . HIS A 1 18  ? -1.067  0.757   -7.162  1.00 0.00 ? 801 HIS A C    4  
ATOM 4772  O O    . HIS A 1 18  ? -1.365  1.624   -6.340  1.00 0.00 ? 801 HIS A O    4  
ATOM 4773  C CB   . HIS A 1 18  ? -2.142  0.632   -9.417  1.00 0.00 ? 801 HIS A CB   4  
ATOM 4774  C CG   . HIS A 1 18  ? -2.348  -0.851  -9.375  1.00 0.00 ? 801 HIS A CG   4  
ATOM 4775  N ND1  . HIS A 1 18  ? -1.498  -1.746  -9.990  1.00 0.00 ? 801 HIS A ND1  4  
ATOM 4776  C CD2  . HIS A 1 18  ? -3.312  -1.595  -8.785  1.00 0.00 ? 801 HIS A CD2  4  
ATOM 4777  C CE1  . HIS A 1 18  ? -1.932  -2.976  -9.782  1.00 0.00 ? 801 HIS A CE1  4  
ATOM 4778  N NE2  . HIS A 1 18  ? -3.032  -2.912  -9.053  1.00 0.00 ? 801 HIS A NE2  4  
ATOM 4779  H H    . HIS A 1 18  ? 0.219   -0.316  -9.734  1.00 0.00 ? 801 HIS A H    4  
ATOM 4780  H HA   . HIS A 1 18  ? -0.820  2.172   -8.740  1.00 0.00 ? 801 HIS A HA   4  
ATOM 4781  H HB2  . HIS A 1 18  ? -3.022  1.100   -9.001  1.00 0.00 ? 801 HIS A HB2  4  
ATOM 4782  H HB3  . HIS A 1 18  ? -2.040  0.925   -10.452 1.00 0.00 ? 801 HIS A HB3  4  
ATOM 4783  H HD2  . HIS A 1 18  ? -4.149  -1.222  -8.210  1.00 0.00 ? 801 HIS A HD2  4  
ATOM 4784  H HE1  . HIS A 1 18  ? -1.468  -3.881  -10.145 1.00 0.00 ? 801 HIS A HE1  4  
ATOM 4785  H HE2  . HIS A 1 18  ? -3.604  -3.674  -8.827  1.00 0.00 ? 801 HIS A HE2  4  
ATOM 4786  N N    . LYS A 1 19  ? -0.863  -0.513  -6.831  1.00 0.00 ? 802 LYS A N    4  
ATOM 4787  C CA   . LYS A 1 19  ? -0.980  -0.973  -5.452  1.00 0.00 ? 802 LYS A CA   4  
ATOM 4788  C C    . LYS A 1 19  ? 0.041   -0.276  -4.558  1.00 0.00 ? 802 LYS A C    4  
ATOM 4789  O O    . LYS A 1 19  ? 1.022   0.289   -5.042  1.00 0.00 ? 802 LYS A O    4  
ATOM 4790  C CB   . LYS A 1 19  ? -0.784  -2.489  -5.380  1.00 0.00 ? 802 LYS A CB   4  
ATOM 4791  C CG   . LYS A 1 19  ? -1.853  -3.276  -6.119  1.00 0.00 ? 802 LYS A CG   4  
ATOM 4792  C CD   . LYS A 1 19  ? -1.921  -4.715  -5.636  1.00 0.00 ? 802 LYS A CD   4  
ATOM 4793  C CE   . LYS A 1 19  ? -2.953  -5.517  -6.414  1.00 0.00 ? 802 LYS A CE   4  
ATOM 4794  N NZ   . LYS A 1 19  ? -2.419  -5.985  -7.723  1.00 0.00 ? 802 LYS A NZ   4  
ATOM 4795  H H    . LYS A 1 19  ? -0.628  -1.158  -7.531  1.00 0.00 ? 802 LYS A H    4  
ATOM 4796  H HA   . LYS A 1 19  ? -1.972  -0.730  -5.104  1.00 0.00 ? 802 LYS A HA   4  
ATOM 4797  H HB2  . LYS A 1 19  ? 0.176   -2.737  -5.808  1.00 0.00 ? 802 LYS A HB2  4  
ATOM 4798  H HB3  . LYS A 1 19  ? -0.796  -2.793  -4.343  1.00 0.00 ? 802 LYS A HB3  4  
ATOM 4799  H HG2  . LYS A 1 19  ? -2.812  -2.807  -5.953  1.00 0.00 ? 802 LYS A HG2  4  
ATOM 4800  H HG3  . LYS A 1 19  ? -1.626  -3.271  -7.175  1.00 0.00 ? 802 LYS A HG3  4  
ATOM 4801  H HD2  . LYS A 1 19  ? -0.952  -5.175  -5.765  1.00 0.00 ? 802 LYS A HD2  4  
ATOM 4802  H HD3  . LYS A 1 19  ? -2.187  -4.722  -4.588  1.00 0.00 ? 802 LYS A HD3  4  
ATOM 4803  H HE2  . LYS A 1 19  ? -3.242  -6.373  -5.825  1.00 0.00 ? 802 LYS A HE2  4  
ATOM 4804  H HE3  . LYS A 1 19  ? -3.816  -4.892  -6.590  1.00 0.00 ? 802 LYS A HE3  4  
ATOM 4805  H HZ1  . LYS A 1 19  ? -1.400  -6.182  -7.643  1.00 0.00 ? 802 LYS A HZ1  4  
ATOM 4806  H HZ2  . LYS A 1 19  ? -2.564  -5.256  -8.450  1.00 0.00 ? 802 LYS A HZ2  4  
ATOM 4807  H HZ3  . LYS A 1 19  ? -2.907  -6.855  -8.017  1.00 0.00 ? 802 LYS A HZ3  4  
ATOM 4808  N N    . LEU A 1 20  ? -0.197  -0.319  -3.252  1.00 0.00 ? 803 LEU A N    4  
ATOM 4809  C CA   . LEU A 1 20  ? 0.703   0.307   -2.289  1.00 0.00 ? 803 LEU A CA   4  
ATOM 4810  C C    . LEU A 1 20  ? 0.936   -0.604  -1.089  1.00 0.00 ? 803 LEU A C    4  
ATOM 4811  O O    . LEU A 1 20  ? 0.160   -1.525  -0.835  1.00 0.00 ? 803 LEU A O    4  
ATOM 4812  C CB   . LEU A 1 20  ? 0.130   1.647   -1.824  1.00 0.00 ? 803 LEU A CB   4  
ATOM 4813  C CG   . LEU A 1 20  ? -0.437  2.551   -2.918  1.00 0.00 ? 803 LEU A CG   4  
ATOM 4814  C CD1  . LEU A 1 20  ? -1.385  3.581   -2.323  1.00 0.00 ? 803 LEU A CD1  4  
ATOM 4815  C CD2  . LEU A 1 20  ? 0.688   3.237   -3.680  1.00 0.00 ? 803 LEU A CD2  4  
ATOM 4816  H H    . LEU A 1 20  ? -0.995  -0.784  -2.926  1.00 0.00 ? 803 LEU A H    4  
ATOM 4817  H HA   . LEU A 1 20  ? 1.647   0.481   -2.783  1.00 0.00 ? 803 LEU A HA   4  
ATOM 4818  H HB2  . LEU A 1 20  ? -0.663  1.441   -1.121  1.00 0.00 ? 803 LEU A HB2  4  
ATOM 4819  H HB3  . LEU A 1 20  ? 0.921   2.188   -1.323  1.00 0.00 ? 803 LEU A HB3  4  
ATOM 4820  H HG   . LEU A 1 20  ? -0.998  1.949   -3.620  1.00 0.00 ? 803 LEU A HG   4  
ATOM 4821  H HD11 . LEU A 1 20  ? -2.342  3.120   -2.130  1.00 0.00 ? 803 LEU A HD11 4  
ATOM 4822  H HD12 . LEU A 1 20  ? -1.512  4.398   -3.017  1.00 0.00 ? 803 LEU A HD12 4  
ATOM 4823  H HD13 . LEU A 1 20  ? -0.973  3.956   -1.398  1.00 0.00 ? 803 LEU A HD13 4  
ATOM 4824  H HD21 . LEU A 1 20  ? 1.633   3.003   -3.213  1.00 0.00 ? 803 LEU A HD21 4  
ATOM 4825  H HD22 . LEU A 1 20  ? 0.534   4.307   -3.663  1.00 0.00 ? 803 LEU A HD22 4  
ATOM 4826  H HD23 . LEU A 1 20  ? 0.695   2.889   -4.702  1.00 0.00 ? 803 LEU A HD23 4  
ATOM 4827  N N    . PHE A 1 21  ? 2.009   -0.339  -0.351  1.00 0.00 ? 804 PHE A N    4  
ATOM 4828  C CA   . PHE A 1 21  ? 2.344   -1.134  0.825   1.00 0.00 ? 804 PHE A CA   4  
ATOM 4829  C C    . PHE A 1 21  ? 2.749   -0.237  1.991   1.00 0.00 ? 804 PHE A C    4  
ATOM 4830  O O    . PHE A 1 21  ? 3.560   0.675   1.833   1.00 0.00 ? 804 PHE A O    4  
ATOM 4831  C CB   . PHE A 1 21  ? 3.477   -2.110  0.500   1.00 0.00 ? 804 PHE A CB   4  
ATOM 4832  C CG   . PHE A 1 21  ? 4.183   -2.634  1.718   1.00 0.00 ? 804 PHE A CG   4  
ATOM 4833  C CD1  . PHE A 1 21  ? 3.659   -3.697  2.436   1.00 0.00 ? 804 PHE A CD1  4  
ATOM 4834  C CD2  . PHE A 1 21  ? 5.372   -2.064  2.145   1.00 0.00 ? 804 PHE A CD2  4  
ATOM 4835  C CE1  . PHE A 1 21  ? 4.307   -4.182  3.556   1.00 0.00 ? 804 PHE A CE1  4  
ATOM 4836  C CE2  . PHE A 1 21  ? 6.024   -2.545  3.264   1.00 0.00 ? 804 PHE A CE2  4  
ATOM 4837  C CZ   . PHE A 1 21  ? 5.491   -3.604  3.971   1.00 0.00 ? 804 PHE A CZ   4  
ATOM 4838  H H    . PHE A 1 21  ? 2.590   0.409   -0.603  1.00 0.00 ? 804 PHE A H    4  
ATOM 4839  H HA   . PHE A 1 21  ? 1.466   -1.695  1.105   1.00 0.00 ? 804 PHE A HA   4  
ATOM 4840  H HB2  . PHE A 1 21  ? 3.072   -2.955  -0.037  1.00 0.00 ? 804 PHE A HB2  4  
ATOM 4841  H HB3  . PHE A 1 21  ? 4.206   -1.611  -0.119  1.00 0.00 ? 804 PHE A HB3  4  
ATOM 4842  H HD1  . PHE A 1 21  ? 2.732   -4.150  2.112   1.00 0.00 ? 804 PHE A HD1  4  
ATOM 4843  H HD2  . PHE A 1 21  ? 5.790   -1.234  1.593   1.00 0.00 ? 804 PHE A HD2  4  
ATOM 4844  H HE1  . PHE A 1 21  ? 3.887   -5.011  4.107   1.00 0.00 ? 804 PHE A HE1  4  
ATOM 4845  H HE2  . PHE A 1 21  ? 6.949   -2.091  3.587   1.00 0.00 ? 804 PHE A HE2  4  
ATOM 4846  H HZ   . PHE A 1 21  ? 5.999   -3.982  4.846   1.00 0.00 ? 804 PHE A HZ   4  
ATOM 4847  N N    . ILE A 1 22  ? 2.177   -0.504  3.160   1.00 0.00 ? 805 ILE A N    4  
ATOM 4848  C CA   . ILE A 1 22  ? 2.478   0.278   4.353   1.00 0.00 ? 805 ILE A CA   4  
ATOM 4849  C C    . ILE A 1 22  ? 2.928   -0.620  5.500   1.00 0.00 ? 805 ILE A C    4  
ATOM 4850  O O    . ILE A 1 22  ? 2.511   -1.774  5.600   1.00 0.00 ? 805 ILE A O    4  
ATOM 4851  C CB   . ILE A 1 22  ? 1.259   1.102   4.809   1.00 0.00 ? 805 ILE A CB   4  
ATOM 4852  C CG1  . ILE A 1 22  ? 0.594   1.777   3.608   1.00 0.00 ? 805 ILE A CG1  4  
ATOM 4853  C CG2  . ILE A 1 22  ? 1.676   2.138   5.842   1.00 0.00 ? 805 ILE A CG2  4  
ATOM 4854  C CD1  . ILE A 1 22  ? -0.518  2.729   3.988   1.00 0.00 ? 805 ILE A CD1  4  
ATOM 4855  H H    . ILE A 1 22  ? 1.539   -1.244  3.223   1.00 0.00 ? 805 ILE A H    4  
ATOM 4856  H HA   . ILE A 1 22  ? 3.279   0.962   4.110   1.00 0.00 ? 805 ILE A HA   4  
ATOM 4857  H HB   . ILE A 1 22  ? 0.552   0.431   5.273   1.00 0.00 ? 805 ILE A HB   4  
ATOM 4858  H HG12 . ILE A 1 22  ? 1.336   2.336   3.061   1.00 0.00 ? 805 ILE A HG12 4  
ATOM 4859  H HG13 . ILE A 1 22  ? 0.175   1.017   2.964   1.00 0.00 ? 805 ILE A HG13 4  
ATOM 4860  H HG21 . ILE A 1 22  ? 2.079   1.638   6.711   1.00 0.00 ? 805 ILE A HG21 4  
ATOM 4861  H HG22 . ILE A 1 22  ? 2.430   2.785   5.418   1.00 0.00 ? 805 ILE A HG22 4  
ATOM 4862  H HG23 . ILE A 1 22  ? 0.818   2.725   6.130   1.00 0.00 ? 805 ILE A HG23 4  
ATOM 4863  H HD11 . ILE A 1 22  ? -1.037  2.349   4.856   1.00 0.00 ? 805 ILE A HD11 4  
ATOM 4864  H HD12 . ILE A 1 22  ? -0.100  3.699   4.214   1.00 0.00 ? 805 ILE A HD12 4  
ATOM 4865  H HD13 . ILE A 1 22  ? -1.212  2.818   3.165   1.00 0.00 ? 805 ILE A HD13 4  
ATOM 4866  N N    . SER A 1 23  ? 3.782   -0.083  6.366   1.00 0.00 ? 806 SER A N    4  
ATOM 4867  C CA   . SER A 1 23  ? 4.291   -0.836  7.506   1.00 0.00 ? 806 SER A CA   4  
ATOM 4868  C C    . SER A 1 23  ? 4.457   0.068   8.724   1.00 0.00 ? 806 SER A C    4  
ATOM 4869  O O    . SER A 1 23  ? 4.708   1.265   8.593   1.00 0.00 ? 806 SER A O    4  
ATOM 4870  C CB   . SER A 1 23  ? 5.628   -1.490  7.156   1.00 0.00 ? 806 SER A CB   4  
ATOM 4871  O OG   . SER A 1 23  ? 6.588   -0.518  6.779   1.00 0.00 ? 806 SER A OG   4  
ATOM 4872  H H    . SER A 1 23  ? 4.078   0.842   6.233   1.00 0.00 ? 806 SER A H    4  
ATOM 4873  H HA   . SER A 1 23  ? 3.573   -1.608  7.740   1.00 0.00 ? 806 SER A HA   4  
ATOM 4874  H HB2  . SER A 1 23  ? 5.998   -2.030  8.014   1.00 0.00 ? 806 SER A HB2  4  
ATOM 4875  H HB3  . SER A 1 23  ? 5.486   -2.176  6.333   1.00 0.00 ? 806 SER A HB3  4  
ATOM 4876  H HG   . SER A 1 23  ? 6.577   -0.409  5.825   1.00 0.00 ? 806 SER A HG   4  
ATOM 4877  N N    . GLY A 1 24  ? 4.315   -0.516  9.910   1.00 0.00 ? 807 GLY A N    4  
ATOM 4878  C CA   . GLY A 1 24  ? 4.452   0.250   11.135  1.00 0.00 ? 807 GLY A CA   4  
ATOM 4879  C C    . GLY A 1 24  ? 3.185   0.999   11.496  1.00 0.00 ? 807 GLY A C    4  
ATOM 4880  O O    . GLY A 1 24  ? 3.235   2.156   11.914  1.00 0.00 ? 807 GLY A O    4  
ATOM 4881  H H    . GLY A 1 24  ? 4.115   -1.474  9.954   1.00 0.00 ? 807 GLY A H    4  
ATOM 4882  H HA2  . GLY A 1 24  ? 4.703   -0.422  11.941  1.00 0.00 ? 807 GLY A HA2  4  
ATOM 4883  H HA3  . GLY A 1 24  ? 5.254   0.963   11.012  1.00 0.00 ? 807 GLY A HA3  4  
ATOM 4884  N N    . LEU A 1 25  ? 2.043   0.339   11.333  1.00 0.00 ? 808 LEU A N    4  
ATOM 4885  C CA   . LEU A 1 25  ? 0.755   0.949   11.644  1.00 0.00 ? 808 LEU A CA   4  
ATOM 4886  C C    . LEU A 1 25  ? 0.294   0.564   13.046  1.00 0.00 ? 808 LEU A C    4  
ATOM 4887  O O    . LEU A 1 25  ? 0.507   -0.556  13.511  1.00 0.00 ? 808 LEU A O    4  
ATOM 4888  C CB   . LEU A 1 25  ? -0.294  0.524   10.615  1.00 0.00 ? 808 LEU A CB   4  
ATOM 4889  C CG   . LEU A 1 25  ? -0.225  1.225   9.258   1.00 0.00 ? 808 LEU A CG   4  
ATOM 4890  C CD1  . LEU A 1 25  ? -1.065  0.482   8.230   1.00 0.00 ? 808 LEU A CD1  4  
ATOM 4891  C CD2  . LEU A 1 25  ? -0.685  2.671   9.381   1.00 0.00 ? 808 LEU A CD2  4  
ATOM 4892  H H    . LEU A 1 25  ? 2.066   -0.581  10.997  1.00 0.00 ? 808 LEU A H    4  
ATOM 4893  H HA   . LEU A 1 25  ? 0.878   2.021   11.600  1.00 0.00 ? 808 LEU A HA   4  
ATOM 4894  H HB2  . LEU A 1 25  ? -0.181  -0.535  10.446  1.00 0.00 ? 808 LEU A HB2  4  
ATOM 4895  H HB3  . LEU A 1 25  ? -1.269  0.717   11.040  1.00 0.00 ? 808 LEU A HB3  4  
ATOM 4896  H HG   . LEU A 1 25  ? 0.799   1.228   8.912   1.00 0.00 ? 808 LEU A HG   4  
ATOM 4897  H HD11 . LEU A 1 25  ? -1.979  0.141   8.691   1.00 0.00 ? 808 LEU A HD11 4  
ATOM 4898  H HD12 . LEU A 1 25  ? -0.511  -0.366  7.858   1.00 0.00 ? 808 LEU A HD12 4  
ATOM 4899  H HD13 . LEU A 1 25  ? -1.300  1.145   7.411   1.00 0.00 ? 808 LEU A HD13 4  
ATOM 4900  H HD21 . LEU A 1 25  ? -1.720  2.694   9.688   1.00 0.00 ? 808 LEU A HD21 4  
ATOM 4901  H HD22 . LEU A 1 25  ? -0.583  3.163   8.424   1.00 0.00 ? 808 LEU A HD22 4  
ATOM 4902  H HD23 . LEU A 1 25  ? -0.080  3.180   10.115  1.00 0.00 ? 808 LEU A HD23 4  
ATOM 4903  N N    . PRO A 1 26  ? -0.355  1.513   13.737  1.00 0.00 ? 809 PRO A N    4  
ATOM 4904  C CA   . PRO A 1 26  ? -0.863  1.296   15.095  1.00 0.00 ? 809 PRO A CA   4  
ATOM 4905  C C    . PRO A 1 26  ? -2.041  0.329   15.126  1.00 0.00 ? 809 PRO A C    4  
ATOM 4906  O O    . PRO A 1 26  ? -3.080  0.581   14.514  1.00 0.00 ? 809 PRO A O    4  
ATOM 4907  C CB   . PRO A 1 26  ? -1.306  2.693   15.536  1.00 0.00 ? 809 PRO A CB   4  
ATOM 4908  C CG   . PRO A 1 26  ? -1.605  3.413   14.267  1.00 0.00 ? 809 PRO A CG   4  
ATOM 4909  C CD   . PRO A 1 26  ? -0.644  2.871   13.246  1.00 0.00 ? 809 PRO A CD   4  
ATOM 4910  H HA   . PRO A 1 26  ? -0.087  0.937   15.756  1.00 0.00 ? 809 PRO A HA   4  
ATOM 4911  H HB2  . PRO A 1 26  ? -2.182  2.614   16.163  1.00 0.00 ? 809 PRO A HB2  4  
ATOM 4912  H HB3  . PRO A 1 26  ? -0.507  3.172   16.082  1.00 0.00 ? 809 PRO A HB3  4  
ATOM 4913  H HG2  . PRO A 1 26  ? -2.623  3.218   13.965  1.00 0.00 ? 809 PRO A HG2  4  
ATOM 4914  H HG3  . PRO A 1 26  ? -1.449  4.474   14.401  1.00 0.00 ? 809 PRO A HG3  4  
ATOM 4915  H HD2  . PRO A 1 26  ? -1.108  2.837   12.271  1.00 0.00 ? 809 PRO A HD2  4  
ATOM 4916  H HD3  . PRO A 1 26  ? 0.255   3.469   13.218  1.00 0.00 ? 809 PRO A HD3  4  
ATOM 4917  N N    . PHE A 1 27  ? -1.874  -0.778  15.841  1.00 0.00 ? 810 PHE A N    4  
ATOM 4918  C CA   . PHE A 1 27  ? -2.925  -1.783  15.951  1.00 0.00 ? 810 PHE A CA   4  
ATOM 4919  C C    . PHE A 1 27  ? -4.287  -1.127  16.157  1.00 0.00 ? 810 PHE A C    4  
ATOM 4920  O O    . PHE A 1 27  ? -5.307  -1.626  15.682  1.00 0.00 ? 810 PHE A O    4  
ATOM 4921  C CB   . PHE A 1 27  ? -2.627  -2.739  17.108  1.00 0.00 ? 810 PHE A CB   4  
ATOM 4922  C CG   . PHE A 1 27  ? -1.166  -3.050  17.268  1.00 0.00 ? 810 PHE A CG   4  
ATOM 4923  C CD1  . PHE A 1 27  ? -0.516  -3.872  16.361  1.00 0.00 ? 810 PHE A CD1  4  
ATOM 4924  C CD2  . PHE A 1 27  ? -0.443  -2.522  18.325  1.00 0.00 ? 810 PHE A CD2  4  
ATOM 4925  C CE1  . PHE A 1 27  ? 0.828   -4.160  16.504  1.00 0.00 ? 810 PHE A CE1  4  
ATOM 4926  C CE2  . PHE A 1 27  ? 0.901   -2.806  18.473  1.00 0.00 ? 810 PHE A CE2  4  
ATOM 4927  C CZ   . PHE A 1 27  ? 1.537   -3.627  17.563  1.00 0.00 ? 810 PHE A CZ   4  
ATOM 4928  H H    . PHE A 1 27  ? -1.024  -0.923  16.307  1.00 0.00 ? 810 PHE A H    4  
ATOM 4929  H HA   . PHE A 1 27  ? -2.945  -2.343  15.029  1.00 0.00 ? 810 PHE A HA   4  
ATOM 4930  H HB2  . PHE A 1 27  ? -2.974  -2.296  18.030  1.00 0.00 ? 810 PHE A HB2  4  
ATOM 4931  H HB3  . PHE A 1 27  ? -3.149  -3.669  16.941  1.00 0.00 ? 810 PHE A HB3  4  
ATOM 4932  H HD1  . PHE A 1 27  ? -1.071  -4.290  15.532  1.00 0.00 ? 810 PHE A HD1  4  
ATOM 4933  H HD2  . PHE A 1 27  ? -0.939  -1.880  19.039  1.00 0.00 ? 810 PHE A HD2  4  
ATOM 4934  H HE1  . PHE A 1 27  ? 1.322   -4.802  15.790  1.00 0.00 ? 810 PHE A HE1  4  
ATOM 4935  H HE2  . PHE A 1 27  ? 1.454   -2.388  19.302  1.00 0.00 ? 810 PHE A HE2  4  
ATOM 4936  H HZ   . PHE A 1 27  ? 2.588   -3.850  17.676  1.00 0.00 ? 810 PHE A HZ   4  
ATOM 4937  N N    . SER A 1 28  ? -4.294  -0.004  16.869  1.00 0.00 ? 811 SER A N    4  
ATOM 4938  C CA   . SER A 1 28  ? -5.530  0.719   17.143  1.00 0.00 ? 811 SER A CA   4  
ATOM 4939  C C    . SER A 1 28  ? -6.275  1.031   15.848  1.00 0.00 ? 811 SER A C    4  
ATOM 4940  O O    . SER A 1 28  ? -7.465  0.741   15.718  1.00 0.00 ? 811 SER A O    4  
ATOM 4941  C CB   . SER A 1 28  ? -5.231  2.016   17.897  1.00 0.00 ? 811 SER A CB   4  
ATOM 4942  O OG   . SER A 1 28  ? -4.544  1.754   19.109  1.00 0.00 ? 811 SER A OG   4  
ATOM 4943  H H    . SER A 1 28  ? -3.448  0.344   17.221  1.00 0.00 ? 811 SER A H    4  
ATOM 4944  H HA   . SER A 1 28  ? -6.154  0.090   17.760  1.00 0.00 ? 811 SER A HA   4  
ATOM 4945  H HB2  . SER A 1 28  ? -4.617  2.655   17.280  1.00 0.00 ? 811 SER A HB2  4  
ATOM 4946  H HB3  . SER A 1 28  ? -6.159  2.520   18.124  1.00 0.00 ? 811 SER A HB3  4  
ATOM 4947  H HG   . SER A 1 28  ? -3.614  1.606   18.924  1.00 0.00 ? 811 SER A HG   4  
ATOM 4948  N N    . CYS A 1 29  ? -5.566  1.624   14.894  1.00 0.00 ? 812 CYS A N    4  
ATOM 4949  C CA   . CYS A 1 29  ? -6.159  1.976   13.608  1.00 0.00 ? 812 CYS A CA   4  
ATOM 4950  C C    . CYS A 1 29  ? -7.015  0.833   13.072  1.00 0.00 ? 812 CYS A C    4  
ATOM 4951  O O    . CYS A 1 29  ? -6.884  -0.312  13.507  1.00 0.00 ? 812 CYS A O    4  
ATOM 4952  C CB   . CYS A 1 29  ? -5.066  2.328   12.599  1.00 0.00 ? 812 CYS A CB   4  
ATOM 4953  S SG   . CYS A 1 29  ? -5.686  3.044   11.058  1.00 0.00 ? 812 CYS A SG   4  
ATOM 4954  H H    . CYS A 1 29  ? -4.622  1.830   15.056  1.00 0.00 ? 812 CYS A H    4  
ATOM 4955  H HA   . CYS A 1 29  ? -6.788  2.840   13.760  1.00 0.00 ? 812 CYS A HA   4  
ATOM 4956  H HB2  . CYS A 1 29  ? -4.391  3.045   13.044  1.00 0.00 ? 812 CYS A HB2  4  
ATOM 4957  H HB3  . CYS A 1 29  ? -4.516  1.433   12.349  1.00 0.00 ? 812 CYS A HB3  4  
ATOM 4958  H HG   . CYS A 1 29  ? -5.657  4.362   11.180  1.00 0.00 ? 812 CYS A HG   4  
ATOM 4959  N N    . THR A 1 30  ? -7.892  1.151   12.125  1.00 0.00 ? 813 THR A N    4  
ATOM 4960  C CA   . THR A 1 30  ? -8.771  0.152   11.532  1.00 0.00 ? 813 THR A CA   4  
ATOM 4961  C C    . THR A 1 30  ? -8.929  0.379   10.033  1.00 0.00 ? 813 THR A C    4  
ATOM 4962  O O    . THR A 1 30  ? -8.770  1.498   9.543   1.00 0.00 ? 813 THR A O    4  
ATOM 4963  C CB   . THR A 1 30  ? -10.164 0.167   12.190  1.00 0.00 ? 813 THR A CB   4  
ATOM 4964  O OG1  . THR A 1 30  ? -10.946 -0.931  11.708  1.00 0.00 ? 813 THR A OG1  4  
ATOM 4965  C CG2  . THR A 1 30  ? -10.885 1.475   11.902  1.00 0.00 ? 813 THR A CG2  4  
ATOM 4966  H H    . THR A 1 30  ? -7.949  2.081   11.821  1.00 0.00 ? 813 THR A H    4  
ATOM 4967  H HA   . THR A 1 30  ? -8.329  -0.820  11.694  1.00 0.00 ? 813 THR A HA   4  
ATOM 4968  H HB   . THR A 1 30  ? -10.041 0.069   13.260  1.00 0.00 ? 813 THR A HB   4  
ATOM 4969  H HG1  . THR A 1 30  ? -11.453 -0.651  10.942  1.00 0.00 ? 813 THR A HG1  4  
ATOM 4970  H HG21 . THR A 1 30  ? -10.160 2.263   11.763  1.00 0.00 ? 813 THR A HG21 4  
ATOM 4971  H HG22 . THR A 1 30  ? -11.530 1.721   12.732  1.00 0.00 ? 813 THR A HG22 4  
ATOM 4972  H HG23 . THR A 1 30  ? -11.477 1.369   11.005  1.00 0.00 ? 813 THR A HG23 4  
ATOM 4973  N N    . LYS A 1 31  ? -9.242  -0.688  9.307   1.00 0.00 ? 814 LYS A N    4  
ATOM 4974  C CA   . LYS A 1 31  ? -9.423  -0.606  7.862   1.00 0.00 ? 814 LYS A CA   4  
ATOM 4975  C C    . LYS A 1 31  ? -10.200 0.650   7.482   1.00 0.00 ? 814 LYS A C    4  
ATOM 4976  O O    . LYS A 1 31  ? -9.719  1.477   6.708   1.00 0.00 ? 814 LYS A O    4  
ATOM 4977  C CB   . LYS A 1 31  ? -10.155 -1.847  7.348   1.00 0.00 ? 814 LYS A CB   4  
ATOM 4978  C CG   . LYS A 1 31  ? -9.810  -2.207  5.913   1.00 0.00 ? 814 LYS A CG   4  
ATOM 4979  C CD   . LYS A 1 31  ? -10.275 -3.610  5.562   1.00 0.00 ? 814 LYS A CD   4  
ATOM 4980  C CE   . LYS A 1 31  ? -11.703 -3.610  5.040   1.00 0.00 ? 814 LYS A CE   4  
ATOM 4981  N NZ   . LYS A 1 31  ? -12.146 -4.973  4.636   1.00 0.00 ? 814 LYS A NZ   4  
ATOM 4982  H H    . LYS A 1 31  ? -9.355  -1.554  9.754   1.00 0.00 ? 814 LYS A H    4  
ATOM 4983  H HA   . LYS A 1 31  ? -8.445  -0.561  7.407   1.00 0.00 ? 814 LYS A HA   4  
ATOM 4984  H HB2  . LYS A 1 31  ? -9.903  -2.687  7.978   1.00 0.00 ? 814 LYS A HB2  4  
ATOM 4985  H HB3  . LYS A 1 31  ? -11.220 -1.672  7.406   1.00 0.00 ? 814 LYS A HB3  4  
ATOM 4986  H HG2  . LYS A 1 31  ? -10.290 -1.503  5.249   1.00 0.00 ? 814 LYS A HG2  4  
ATOM 4987  H HG3  . LYS A 1 31  ? -8.738  -2.150  5.786   1.00 0.00 ? 814 LYS A HG3  4  
ATOM 4988  H HD2  . LYS A 1 31  ? -9.625  -4.015  4.800   1.00 0.00 ? 814 LYS A HD2  4  
ATOM 4989  H HD3  . LYS A 1 31  ? -10.224 -4.228  6.447   1.00 0.00 ? 814 LYS A HD3  4  
ATOM 4990  H HE2  . LYS A 1 31  ? -12.357 -3.244  5.818   1.00 0.00 ? 814 LYS A HE2  4  
ATOM 4991  H HE3  . LYS A 1 31  ? -11.760 -2.953  4.185   1.00 0.00 ? 814 LYS A HE3  4  
ATOM 4992  H HZ1  . LYS A 1 31  ? -11.555 -5.323  3.854   1.00 0.00 ? 814 LYS A HZ1  4  
ATOM 4993  H HZ2  . LYS A 1 31  ? -13.137 -4.948  4.321   1.00 0.00 ? 814 LYS A HZ2  4  
ATOM 4994  H HZ3  . LYS A 1 31  ? -12.065 -5.628  5.438   1.00 0.00 ? 814 LYS A HZ3  4  
ATOM 4995  N N    . GLU A 1 32  ? -11.402 0.786   8.033   1.00 0.00 ? 815 GLU A N    4  
ATOM 4996  C CA   . GLU A 1 32  ? -12.245 1.942   7.751   1.00 0.00 ? 815 GLU A CA   4  
ATOM 4997  C C    . GLU A 1 32  ? -11.428 3.231   7.785   1.00 0.00 ? 815 GLU A C    4  
ATOM 4998  O O    . GLU A 1 32  ? -11.231 3.880   6.758   1.00 0.00 ? 815 GLU A O    4  
ATOM 4999  C CB   . GLU A 1 32  ? -13.391 2.025   8.761   1.00 0.00 ? 815 GLU A CB   4  
ATOM 5000  C CG   . GLU A 1 32  ? -14.346 0.845   8.695   1.00 0.00 ? 815 GLU A CG   4  
ATOM 5001  C CD   . GLU A 1 32  ? -15.100 0.777   7.380   1.00 0.00 ? 815 GLU A CD   4  
ATOM 5002  O OE1  . GLU A 1 32  ? -14.548 0.222   6.407   1.00 0.00 ? 815 GLU A OE1  4  
ATOM 5003  O OE2  . GLU A 1 32  ? -16.242 1.280   7.325   1.00 0.00 ? 815 GLU A OE2  4  
ATOM 5004  H H    . GLU A 1 32  ? -11.731 0.093   8.642   1.00 0.00 ? 815 GLU A H    4  
ATOM 5005  H HA   . GLU A 1 32  ? -12.658 1.819   6.761   1.00 0.00 ? 815 GLU A HA   4  
ATOM 5006  H HB2  . GLU A 1 32  ? -12.975 2.070   9.756   1.00 0.00 ? 815 GLU A HB2  4  
ATOM 5007  H HB3  . GLU A 1 32  ? -13.954 2.928   8.574   1.00 0.00 ? 815 GLU A HB3  4  
ATOM 5008  H HG2  . GLU A 1 32  ? -13.781 -0.067  8.815   1.00 0.00 ? 815 GLU A HG2  4  
ATOM 5009  H HG3  . GLU A 1 32  ? -15.062 0.932   9.499   1.00 0.00 ? 815 GLU A HG3  4  
ATOM 5010  N N    . GLU A 1 33  ? -10.957 3.595   8.974   1.00 0.00 ? 816 GLU A N    4  
ATOM 5011  C CA   . GLU A 1 33  ? -10.164 4.807   9.142   1.00 0.00 ? 816 GLU A CA   4  
ATOM 5012  C C    . GLU A 1 33  ? -9.199  4.992   7.974   1.00 0.00 ? 816 GLU A C    4  
ATOM 5013  O O    . GLU A 1 33  ? -9.326  5.936   7.193   1.00 0.00 ? 816 GLU A O    4  
ATOM 5014  C CB   . GLU A 1 33  ? -9.385  4.755   10.458  1.00 0.00 ? 816 GLU A CB   4  
ATOM 5015  C CG   . GLU A 1 33  ? -10.220 5.120   11.674  1.00 0.00 ? 816 GLU A CG   4  
ATOM 5016  C CD   . GLU A 1 33  ? -10.489 6.609   11.771  1.00 0.00 ? 816 GLU A CD   4  
ATOM 5017  O OE1  . GLU A 1 33  ? -10.725 7.239   10.719  1.00 0.00 ? 816 GLU A OE1  4  
ATOM 5018  O OE2  . GLU A 1 33  ? -10.463 7.145   12.899  1.00 0.00 ? 816 GLU A OE2  4  
ATOM 5019  H H    . GLU A 1 33  ? -11.148 3.036   9.755   1.00 0.00 ? 816 GLU A H    4  
ATOM 5020  H HA   . GLU A 1 33  ? -10.842 5.646   9.169   1.00 0.00 ? 816 GLU A HA   4  
ATOM 5021  H HB2  . GLU A 1 33  ? -9.003  3.754   10.597  1.00 0.00 ? 816 GLU A HB2  4  
ATOM 5022  H HB3  . GLU A 1 33  ? -8.555  5.443   10.398  1.00 0.00 ? 816 GLU A HB3  4  
ATOM 5023  H HG2  . GLU A 1 33  ? -11.166 4.602   11.614  1.00 0.00 ? 816 GLU A HG2  4  
ATOM 5024  H HG3  . GLU A 1 33  ? -9.694  4.805   12.563  1.00 0.00 ? 816 GLU A HG3  4  
ATOM 5025  N N    . LEU A 1 34  ? -8.235  4.086   7.862   1.00 0.00 ? 817 LEU A N    4  
ATOM 5026  C CA   . LEU A 1 34  ? -7.247  4.148   6.791   1.00 0.00 ? 817 LEU A CA   4  
ATOM 5027  C C    . LEU A 1 34  ? -7.917  4.415   5.447   1.00 0.00 ? 817 LEU A C    4  
ATOM 5028  O O    . LEU A 1 34  ? -7.637  5.419   4.793   1.00 0.00 ? 817 LEU A O    4  
ATOM 5029  C CB   . LEU A 1 34  ? -6.452  2.842   6.726   1.00 0.00 ? 817 LEU A CB   4  
ATOM 5030  C CG   . LEU A 1 34  ? -5.094  2.916   6.028   1.00 0.00 ? 817 LEU A CG   4  
ATOM 5031  C CD1  . LEU A 1 34  ? -4.150  3.831   6.792   1.00 0.00 ? 817 LEU A CD1  4  
ATOM 5032  C CD2  . LEU A 1 34  ? -4.492  1.526   5.882   1.00 0.00 ? 817 LEU A CD2  4  
ATOM 5033  H H    . LEU A 1 34  ? -8.185  3.357   8.515   1.00 0.00 ? 817 LEU A H    4  
ATOM 5034  H HA   . LEU A 1 34  ? -6.571  4.961   7.010   1.00 0.00 ? 817 LEU A HA   4  
ATOM 5035  H HB2  . LEU A 1 34  ? -6.285  2.507   7.738   1.00 0.00 ? 817 LEU A HB2  4  
ATOM 5036  H HB3  . LEU A 1 34  ? -7.056  2.114   6.202   1.00 0.00 ? 817 LEU A HB3  4  
ATOM 5037  H HG   . LEU A 1 34  ? -5.228  3.329   5.037   1.00 0.00 ? 817 LEU A HG   4  
ATOM 5038  H HD11 . LEU A 1 34  ? -4.515  4.846   6.746   1.00 0.00 ? 817 LEU A HD11 4  
ATOM 5039  H HD12 . LEU A 1 34  ? -3.166  3.782   6.351   1.00 0.00 ? 817 LEU A HD12 4  
ATOM 5040  H HD13 . LEU A 1 34  ? -4.098  3.513   7.823   1.00 0.00 ? 817 LEU A HD13 4  
ATOM 5041  H HD21 . LEU A 1 34  ? -5.042  0.973   5.135   1.00 0.00 ? 817 LEU A HD21 4  
ATOM 5042  H HD22 . LEU A 1 34  ? -4.551  1.008   6.829   1.00 0.00 ? 817 LEU A HD22 4  
ATOM 5043  H HD23 . LEU A 1 34  ? -3.459  1.611   5.581   1.00 0.00 ? 817 LEU A HD23 4  
ATOM 5044  N N    . GLU A 1 35  ? -8.805  3.512   5.044   1.00 0.00 ? 818 GLU A N    4  
ATOM 5045  C CA   . GLU A 1 35  ? -9.516  3.652   3.778   1.00 0.00 ? 818 GLU A CA   4  
ATOM 5046  C C    . GLU A 1 35  ? -9.873  5.112   3.514   1.00 0.00 ? 818 GLU A C    4  
ATOM 5047  O O    . GLU A 1 35  ? -9.448  5.694   2.517   1.00 0.00 ? 818 GLU A O    4  
ATOM 5048  C CB   . GLU A 1 35  ? -10.785 2.798   3.784   1.00 0.00 ? 818 GLU A CB   4  
ATOM 5049  C CG   . GLU A 1 35  ? -11.502 2.765   2.445   1.00 0.00 ? 818 GLU A CG   4  
ATOM 5050  C CD   . GLU A 1 35  ? -12.360 1.526   2.272   1.00 0.00 ? 818 GLU A CD   4  
ATOM 5051  O OE1  . GLU A 1 35  ? -12.051 0.498   2.911   1.00 0.00 ? 818 GLU A OE1  4  
ATOM 5052  O OE2  . GLU A 1 35  ? -13.339 1.585   1.500   1.00 0.00 ? 818 GLU A OE2  4  
ATOM 5053  H H    . GLU A 1 35  ? -8.985  2.732   5.610   1.00 0.00 ? 818 GLU A H    4  
ATOM 5054  H HA   . GLU A 1 35  ? -8.863  3.306   2.991   1.00 0.00 ? 818 GLU A HA   4  
ATOM 5055  H HB2  . GLU A 1 35  ? -10.522 1.785   4.053   1.00 0.00 ? 818 GLU A HB2  4  
ATOM 5056  H HB3  . GLU A 1 35  ? -11.466 3.192   4.523   1.00 0.00 ? 818 GLU A HB3  4  
ATOM 5057  H HG2  . GLU A 1 35  ? -12.136 3.636   2.368   1.00 0.00 ? 818 GLU A HG2  4  
ATOM 5058  H HG3  . GLU A 1 35  ? -10.765 2.787   1.655   1.00 0.00 ? 818 GLU A HG3  4  
ATOM 5059  N N    . GLU A 1 36  ? -10.657 5.695   4.415   1.00 0.00 ? 819 GLU A N    4  
ATOM 5060  C CA   . GLU A 1 36  ? -11.073 7.086   4.278   1.00 0.00 ? 819 GLU A CA   4  
ATOM 5061  C C    . GLU A 1 36  ? -9.878  7.983   3.965   1.00 0.00 ? 819 GLU A C    4  
ATOM 5062  O O    . GLU A 1 36  ? -9.894  8.737   2.992   1.00 0.00 ? 819 GLU A O    4  
ATOM 5063  C CB   . GLU A 1 36  ? -11.761 7.564   5.559   1.00 0.00 ? 819 GLU A CB   4  
ATOM 5064  C CG   . GLU A 1 36  ? -13.151 6.983   5.756   1.00 0.00 ? 819 GLU A CG   4  
ATOM 5065  C CD   . GLU A 1 36  ? -14.056 7.896   6.560   1.00 0.00 ? 819 GLU A CD   4  
ATOM 5066  O OE1  . GLU A 1 36  ? -13.860 7.993   7.790   1.00 0.00 ? 819 GLU A OE1  4  
ATOM 5067  O OE2  . GLU A 1 36  ? -14.960 8.514   5.960   1.00 0.00 ? 819 GLU A OE2  4  
ATOM 5068  H H    . GLU A 1 36  ? -10.963 5.179   5.189   1.00 0.00 ? 819 GLU A H    4  
ATOM 5069  H HA   . GLU A 1 36  ? -11.775 7.144   3.461   1.00 0.00 ? 819 GLU A HA   4  
ATOM 5070  H HB2  . GLU A 1 36  ? -11.152 7.285   6.406   1.00 0.00 ? 819 GLU A HB2  4  
ATOM 5071  H HB3  . GLU A 1 36  ? -11.845 8.641   5.527   1.00 0.00 ? 819 GLU A HB3  4  
ATOM 5072  H HG2  . GLU A 1 36  ? -13.599 6.819   4.788   1.00 0.00 ? 819 GLU A HG2  4  
ATOM 5073  H HG3  . GLU A 1 36  ? -13.063 6.040   6.275   1.00 0.00 ? 819 GLU A HG3  4  
ATOM 5074  N N    . ILE A 1 37  ? -8.846  7.895   4.796   1.00 0.00 ? 820 ILE A N    4  
ATOM 5075  C CA   . ILE A 1 37  ? -7.643  8.697   4.608   1.00 0.00 ? 820 ILE A CA   4  
ATOM 5076  C C    . ILE A 1 37  ? -7.087  8.530   3.198   1.00 0.00 ? 820 ILE A C    4  
ATOM 5077  O O    . ILE A 1 37  ? -6.614  9.491   2.589   1.00 0.00 ? 820 ILE A O    4  
ATOM 5078  C CB   . ILE A 1 37  ? -6.551  8.322   5.626   1.00 0.00 ? 820 ILE A CB   4  
ATOM 5079  C CG1  . ILE A 1 37  ? -7.030  8.612   7.050   1.00 0.00 ? 820 ILE A CG1  4  
ATOM 5080  C CG2  . ILE A 1 37  ? -5.266  9.080   5.329   1.00 0.00 ? 820 ILE A CG2  4  
ATOM 5081  C CD1  . ILE A 1 37  ? -6.031  8.217   8.116   1.00 0.00 ? 820 ILE A CD1  4  
ATOM 5082  H H    . ILE A 1 37  ? -8.893  7.275   5.554   1.00 0.00 ? 820 ILE A H    4  
ATOM 5083  H HA   . ILE A 1 37  ? -7.908  9.734   4.759   1.00 0.00 ? 820 ILE A HA   4  
ATOM 5084  H HB   . ILE A 1 37  ? -6.348  7.266   5.530   1.00 0.00 ? 820 ILE A HB   4  
ATOM 5085  H HG12 . ILE A 1 37  ? -7.221  9.669   7.151   1.00 0.00 ? 820 ILE A HG12 4  
ATOM 5086  H HG13 . ILE A 1 37  ? -7.944  8.066   7.233   1.00 0.00 ? 820 ILE A HG13 4  
ATOM 5087  H HG21 . ILE A 1 37  ? -4.452  8.380   5.217   1.00 0.00 ? 820 ILE A HG21 4  
ATOM 5088  H HG22 . ILE A 1 37  ? -5.384  9.642   4.414   1.00 0.00 ? 820 ILE A HG22 4  
ATOM 5089  H HG23 . ILE A 1 37  ? -5.050  9.757   6.142   1.00 0.00 ? 820 ILE A HG23 4  
ATOM 5090  H HD11 . ILE A 1 37  ? -6.334  8.632   9.065   1.00 0.00 ? 820 ILE A HD11 4  
ATOM 5091  H HD12 . ILE A 1 37  ? -5.988  7.141   8.189   1.00 0.00 ? 820 ILE A HD12 4  
ATOM 5092  H HD13 . ILE A 1 37  ? -5.055  8.599   7.853   1.00 0.00 ? 820 ILE A HD13 4  
ATOM 5093  N N    . CYS A 1 38  ? -7.148  7.307   2.685   1.00 0.00 ? 821 CYS A N    4  
ATOM 5094  C CA   . CYS A 1 38  ? -6.651  7.014   1.345   1.00 0.00 ? 821 CYS A CA   4  
ATOM 5095  C C    . CYS A 1 38  ? -7.545  7.645   0.283   1.00 0.00 ? 821 CYS A C    4  
ATOM 5096  O O    . CYS A 1 38  ? -7.069  8.086   -0.763  1.00 0.00 ? 821 CYS A O    4  
ATOM 5097  C CB   . CYS A 1 38  ? -6.569  5.502   1.128   1.00 0.00 ? 821 CYS A CB   4  
ATOM 5098  S SG   . CYS A 1 38  ? -5.429  4.656   2.247   1.00 0.00 ? 821 CYS A SG   4  
ATOM 5099  H H    . CYS A 1 38  ? -7.536  6.582   3.219   1.00 0.00 ? 821 CYS A H    4  
ATOM 5100  H HA   . CYS A 1 38  ? -5.661  7.435   1.260   1.00 0.00 ? 821 CYS A HA   4  
ATOM 5101  H HB2  . CYS A 1 38  ? -7.550  5.072   1.272   1.00 0.00 ? 821 CYS A HB2  4  
ATOM 5102  H HB3  . CYS A 1 38  ? -6.245  5.308   0.116   1.00 0.00 ? 821 CYS A HB3  4  
ATOM 5103  H HG   . CYS A 1 38  ? -5.309  5.392   3.341   1.00 0.00 ? 821 CYS A HG   4  
ATOM 5104  N N    . LYS A 1 39  ? -8.845  7.683   0.558   1.00 0.00 ? 822 LYS A N    4  
ATOM 5105  C CA   . LYS A 1 39  ? -9.808  8.259   -0.373  1.00 0.00 ? 822 LYS A CA   4  
ATOM 5106  C C    . LYS A 1 39  ? -9.539  9.746   -0.583  1.00 0.00 ? 822 LYS A C    4  
ATOM 5107  O O    . LYS A 1 39  ? -9.927  10.318  -1.601  1.00 0.00 ? 822 LYS A O    4  
ATOM 5108  C CB   . LYS A 1 39  ? -11.233 8.056   0.145   1.00 0.00 ? 822 LYS A CB   4  
ATOM 5109  C CG   . LYS A 1 39  ? -11.634 6.596   0.268   1.00 0.00 ? 822 LYS A CG   4  
ATOM 5110  C CD   . LYS A 1 39  ? -13.060 6.449   0.769   1.00 0.00 ? 822 LYS A CD   4  
ATOM 5111  C CE   . LYS A 1 39  ? -14.060 6.485   -0.376  1.00 0.00 ? 822 LYS A CE   4  
ATOM 5112  N NZ   . LYS A 1 39  ? -15.466 6.458   0.114   1.00 0.00 ? 822 LYS A NZ   4  
ATOM 5113  H H    . LYS A 1 39  ? -9.164  7.314   1.409   1.00 0.00 ? 822 LYS A H    4  
ATOM 5114  H HA   . LYS A 1 39  ? -9.701  7.749   -1.319  1.00 0.00 ? 822 LYS A HA   4  
ATOM 5115  H HB2  . LYS A 1 39  ? -11.318 8.514   1.119   1.00 0.00 ? 822 LYS A HB2  4  
ATOM 5116  H HB3  . LYS A 1 39  ? -11.922 8.540   -0.532  1.00 0.00 ? 822 LYS A HB3  4  
ATOM 5117  H HG2  . LYS A 1 39  ? -11.554 6.127   -0.702  1.00 0.00 ? 822 LYS A HG2  4  
ATOM 5118  H HG3  . LYS A 1 39  ? -10.965 6.106   0.962   1.00 0.00 ? 822 LYS A HG3  4  
ATOM 5119  H HD2  . LYS A 1 39  ? -13.156 5.505   1.286   1.00 0.00 ? 822 LYS A HD2  4  
ATOM 5120  H HD3  . LYS A 1 39  ? -13.278 7.258   1.452   1.00 0.00 ? 822 LYS A HD3  4  
ATOM 5121  H HE2  . LYS A 1 39  ? -13.904 7.388   -0.945  1.00 0.00 ? 822 LYS A HE2  4  
ATOM 5122  H HE3  . LYS A 1 39  ? -13.893 5.627   -1.010  1.00 0.00 ? 822 LYS A HE3  4  
ATOM 5123  H HZ1  . LYS A 1 39  ? -15.482 6.351   1.148   1.00 0.00 ? 822 LYS A HZ1  4  
ATOM 5124  H HZ2  . LYS A 1 39  ? -15.979 5.661   -0.314  1.00 0.00 ? 822 LYS A HZ2  4  
ATOM 5125  H HZ3  . LYS A 1 39  ? -15.950 7.343   -0.139  1.00 0.00 ? 822 LYS A HZ3  4  
ATOM 5126  N N    . ALA A 1 40  ? -8.872  10.364  0.386   1.00 0.00 ? 823 ALA A N    4  
ATOM 5127  C CA   . ALA A 1 40  ? -8.549  11.783  0.305   1.00 0.00 ? 823 ALA A CA   4  
ATOM 5128  C C    . ALA A 1 40  ? -7.674  12.078  -0.909  1.00 0.00 ? 823 ALA A C    4  
ATOM 5129  O O    . ALA A 1 40  ? -7.932  13.021  -1.658  1.00 0.00 ? 823 ALA A O    4  
ATOM 5130  C CB   . ALA A 1 40  ? -7.857  12.241  1.581   1.00 0.00 ? 823 ALA A CB   4  
ATOM 5131  H H    . ALA A 1 40  ? -8.590  9.854   1.173   1.00 0.00 ? 823 ALA A H    4  
ATOM 5132  H HA   . ALA A 1 40  ? -9.475  12.332  0.210   1.00 0.00 ? 823 ALA A HA   4  
ATOM 5133  H HB1  . ALA A 1 40  ? -8.127  13.266  1.787   1.00 0.00 ? 823 ALA A HB1  4  
ATOM 5134  H HB2  . ALA A 1 40  ? -8.168  11.613  2.403   1.00 0.00 ? 823 ALA A HB2  4  
ATOM 5135  H HB3  . ALA A 1 40  ? -6.787  12.168  1.455   1.00 0.00 ? 823 ALA A HB3  4  
ATOM 5136  N N    . HIS A 1 41  ? -6.638  11.268  -1.096  1.00 0.00 ? 824 HIS A N    4  
ATOM 5137  C CA   . HIS A 1 41  ? -5.724  11.442  -2.220  1.00 0.00 ? 824 HIS A CA   4  
ATOM 5138  C C    . HIS A 1 41  ? -6.432  11.169  -3.544  1.00 0.00 ? 824 HIS A C    4  
ATOM 5139  O O    . HIS A 1 41  ? -6.538  12.050  -4.396  1.00 0.00 ? 824 HIS A O    4  
ATOM 5140  C CB   . HIS A 1 41  ? -4.517  10.515  -2.072  1.00 0.00 ? 824 HIS A CB   4  
ATOM 5141  C CG   . HIS A 1 41  ? -3.774  10.699  -0.785  1.00 0.00 ? 824 HIS A CG   4  
ATOM 5142  N ND1  . HIS A 1 41  ? -3.216  11.901  -0.404  1.00 0.00 ? 824 HIS A ND1  4  
ATOM 5143  C CD2  . HIS A 1 41  ? -3.499  9.826   0.211   1.00 0.00 ? 824 HIS A CD2  4  
ATOM 5144  C CE1  . HIS A 1 41  ? -2.629  11.759  0.771   1.00 0.00 ? 824 HIS A CE1  4  
ATOM 5145  N NE2  . HIS A 1 41  ? -2.787  10.508  1.167   1.00 0.00 ? 824 HIS A NE2  4  
ATOM 5146  H H    . HIS A 1 41  ? -6.484  10.534  -0.465  1.00 0.00 ? 824 HIS A H    4  
ATOM 5147  H HA   . HIS A 1 41  ? -5.383  12.466  -2.213  1.00 0.00 ? 824 HIS A HA   4  
ATOM 5148  H HB2  . HIS A 1 41  ? -4.852  9.489   -2.117  1.00 0.00 ? 824 HIS A HB2  4  
ATOM 5149  H HB3  . HIS A 1 41  ? -3.828  10.700  -2.884  1.00 0.00 ? 824 HIS A HB3  4  
ATOM 5150  H HD2  . HIS A 1 41  ? -3.786  8.784   0.249   1.00 0.00 ? 824 HIS A HD2  4  
ATOM 5151  H HE1  . HIS A 1 41  ? -2.110  12.532  1.316   1.00 0.00 ? 824 HIS A HE1  4  
ATOM 5152  H HE2  . HIS A 1 41  ? -2.376  10.112  1.963   1.00 0.00 ? 824 HIS A HE2  4  
ATOM 5153  N N    . GLY A 1 42  ? -6.914  9.941   -3.709  1.00 0.00 ? 825 GLY A N    4  
ATOM 5154  C CA   . GLY A 1 42  ? -7.604  9.574   -4.931  1.00 0.00 ? 825 GLY A CA   4  
ATOM 5155  C C    . GLY A 1 42  ? -8.747  8.609   -4.684  1.00 0.00 ? 825 GLY A C    4  
ATOM 5156  O O    . GLY A 1 42  ? -9.429  8.691   -3.662  1.00 0.00 ? 825 GLY A O    4  
ATOM 5157  H H    . GLY A 1 42  ? -6.799  9.279   -2.995  1.00 0.00 ? 825 GLY A H    4  
ATOM 5158  H HA2  . GLY A 1 42  ? -7.994  10.468  -5.394  1.00 0.00 ? 825 GLY A HA2  4  
ATOM 5159  H HA3  . GLY A 1 42  ? -6.898  9.111   -5.605  1.00 0.00 ? 825 GLY A HA3  4  
ATOM 5160  N N    . THR A 1 43  ? -8.961  7.693   -5.624  1.00 0.00 ? 826 THR A N    4  
ATOM 5161  C CA   . THR A 1 43  ? -10.031 6.711   -5.505  1.00 0.00 ? 826 THR A CA   4  
ATOM 5162  C C    . THR A 1 43  ? -9.494  5.369   -5.021  1.00 0.00 ? 826 THR A C    4  
ATOM 5163  O O    . THR A 1 43  ? -8.611  4.781   -5.645  1.00 0.00 ? 826 THR A O    4  
ATOM 5164  C CB   . THR A 1 43  ? -10.758 6.507   -6.848  1.00 0.00 ? 826 THR A CB   4  
ATOM 5165  O OG1  . THR A 1 43  ? -11.328 7.744   -7.289  1.00 0.00 ? 826 THR A OG1  4  
ATOM 5166  C CG2  . THR A 1 43  ? -11.850 5.457   -6.717  1.00 0.00 ? 826 THR A CG2  4  
ATOM 5167  H H    . THR A 1 43  ? -8.384  7.679   -6.416  1.00 0.00 ? 826 THR A H    4  
ATOM 5168  H HA   . THR A 1 43  ? -10.746 7.083   -4.785  1.00 0.00 ? 826 THR A HA   4  
ATOM 5169  H HB   . THR A 1 43  ? -10.039 6.169   -7.581  1.00 0.00 ? 826 THR A HB   4  
ATOM 5170  H HG1  . THR A 1 43  ? -12.018 7.567   -7.933  1.00 0.00 ? 826 THR A HG1  4  
ATOM 5171  H HG21 . THR A 1 43  ? -11.831 4.807   -7.580  1.00 0.00 ? 826 THR A HG21 4  
ATOM 5172  H HG22 . THR A 1 43  ? -12.812 5.944   -6.654  1.00 0.00 ? 826 THR A HG22 4  
ATOM 5173  H HG23 . THR A 1 43  ? -11.683 4.873   -5.824  1.00 0.00 ? 826 THR A HG23 4  
ATOM 5174  N N    . VAL A 1 44  ? -10.035 4.888   -3.906  1.00 0.00 ? 827 VAL A N    4  
ATOM 5175  C CA   . VAL A 1 44  ? -9.611  3.613   -3.339  1.00 0.00 ? 827 VAL A CA   4  
ATOM 5176  C C    . VAL A 1 44  ? -10.476 2.469   -3.854  1.00 0.00 ? 827 VAL A C    4  
ATOM 5177  O O    . VAL A 1 44  ? -11.652 2.359   -3.506  1.00 0.00 ? 827 VAL A O    4  
ATOM 5178  C CB   . VAL A 1 44  ? -9.671  3.636   -1.800  1.00 0.00 ? 827 VAL A CB   4  
ATOM 5179  C CG1  . VAL A 1 44  ? -9.368  2.257   -1.234  1.00 0.00 ? 827 VAL A CG1  4  
ATOM 5180  C CG2  . VAL A 1 44  ? -8.707  4.673   -1.245  1.00 0.00 ? 827 VAL A CG2  4  
ATOM 5181  H H    . VAL A 1 44  ? -10.735 5.403   -3.454  1.00 0.00 ? 827 VAL A H    4  
ATOM 5182  H HA   . VAL A 1 44  ? -8.587  3.440   -3.636  1.00 0.00 ? 827 VAL A HA   4  
ATOM 5183  H HB   . VAL A 1 44  ? -10.672 3.910   -1.503  1.00 0.00 ? 827 VAL A HB   4  
ATOM 5184  H HG11 . VAL A 1 44  ? -10.191 1.591   -1.448  1.00 0.00 ? 827 VAL A HG11 4  
ATOM 5185  H HG12 . VAL A 1 44  ? -8.465  1.872   -1.685  1.00 0.00 ? 827 VAL A HG12 4  
ATOM 5186  H HG13 . VAL A 1 44  ? -9.233  2.329   -0.164  1.00 0.00 ? 827 VAL A HG13 4  
ATOM 5187  H HG21 . VAL A 1 44  ? -8.037  4.201   -0.542  1.00 0.00 ? 827 VAL A HG21 4  
ATOM 5188  H HG22 . VAL A 1 44  ? -8.134  5.103   -2.054  1.00 0.00 ? 827 VAL A HG22 4  
ATOM 5189  H HG23 . VAL A 1 44  ? -9.263  5.452   -0.745  1.00 0.00 ? 827 VAL A HG23 4  
ATOM 5190  N N    . LYS A 1 45  ? -9.887  1.616   -4.685  1.00 0.00 ? 828 LYS A N    4  
ATOM 5191  C CA   . LYS A 1 45  ? -10.602 0.477   -5.248  1.00 0.00 ? 828 LYS A CA   4  
ATOM 5192  C C    . LYS A 1 45  ? -10.816 -0.605  -4.195  1.00 0.00 ? 828 LYS A C    4  
ATOM 5193  O O    . LYS A 1 45  ? -11.934 -1.086  -4.004  1.00 0.00 ? 828 LYS A O    4  
ATOM 5194  C CB   . LYS A 1 45  ? -9.829  -0.099  -6.437  1.00 0.00 ? 828 LYS A CB   4  
ATOM 5195  C CG   . LYS A 1 45  ? -9.867  0.784   -7.672  1.00 0.00 ? 828 LYS A CG   4  
ATOM 5196  C CD   . LYS A 1 45  ? -11.220 0.724   -8.360  1.00 0.00 ? 828 LYS A CD   4  
ATOM 5197  C CE   . LYS A 1 45  ? -11.288 -0.421  -9.359  1.00 0.00 ? 828 LYS A CE   4  
ATOM 5198  N NZ   . LYS A 1 45  ? -10.511 -0.125  -10.595 1.00 0.00 ? 828 LYS A NZ   4  
ATOM 5199  H H    . LYS A 1 45  ? -8.946  1.757   -4.926  1.00 0.00 ? 828 LYS A H    4  
ATOM 5200  H HA   . LYS A 1 45  ? -11.564 0.826   -5.590  1.00 0.00 ? 828 LYS A HA   4  
ATOM 5201  H HB2  . LYS A 1 45  ? -8.798  -0.236  -6.148  1.00 0.00 ? 828 LYS A HB2  4  
ATOM 5202  H HB3  . LYS A 1 45  ? -10.252 -1.060  -6.694  1.00 0.00 ? 828 LYS A HB3  4  
ATOM 5203  H HG2  . LYS A 1 45  ? -9.668  1.804   -7.381  1.00 0.00 ? 828 LYS A HG2  4  
ATOM 5204  H HG3  . LYS A 1 45  ? -9.106  0.450   -8.364  1.00 0.00 ? 828 LYS A HG3  4  
ATOM 5205  H HD2  . LYS A 1 45  ? -11.987 0.581   -7.614  1.00 0.00 ? 828 LYS A HD2  4  
ATOM 5206  H HD3  . LYS A 1 45  ? -11.391 1.656   -8.880  1.00 0.00 ? 828 LYS A HD3  4  
ATOM 5207  H HE2  . LYS A 1 45  ? -10.887 -1.309  -8.897  1.00 0.00 ? 828 LYS A HE2  4  
ATOM 5208  H HE3  . LYS A 1 45  ? -12.321 -0.589  -9.625  1.00 0.00 ? 828 LYS A HE3  4  
ATOM 5209  H HZ1  . LYS A 1 45  ? -9.617  0.346   -10.350 1.00 0.00 ? 828 LYS A HZ1  4  
ATOM 5210  H HZ2  . LYS A 1 45  ? -11.059 0.501   -11.220 1.00 0.00 ? 828 LYS A HZ2  4  
ATOM 5211  H HZ3  . LYS A 1 45  ? -10.299 -1.006  -11.104 1.00 0.00 ? 828 LYS A HZ3  4  
ATOM 5212  N N    . ASP A 1 46  ? -9.740  -0.982  -3.513  1.00 0.00 ? 829 ASP A N    4  
ATOM 5213  C CA   . ASP A 1 46  ? -9.812  -2.006  -2.477  1.00 0.00 ? 829 ASP A CA   4  
ATOM 5214  C C    . ASP A 1 46  ? -8.757  -1.765  -1.401  1.00 0.00 ? 829 ASP A C    4  
ATOM 5215  O O    . ASP A 1 46  ? -7.778  -1.052  -1.626  1.00 0.00 ? 829 ASP A O    4  
ATOM 5216  C CB   . ASP A 1 46  ? -9.625  -3.395  -3.089  1.00 0.00 ? 829 ASP A CB   4  
ATOM 5217  C CG   . ASP A 1 46  ? -10.295 -4.483  -2.272  1.00 0.00 ? 829 ASP A CG   4  
ATOM 5218  O OD1  . ASP A 1 46  ? -11.472 -4.302  -1.895  1.00 0.00 ? 829 ASP A OD1  4  
ATOM 5219  O OD2  . ASP A 1 46  ? -9.642  -5.514  -2.009  1.00 0.00 ? 829 ASP A OD2  4  
ATOM 5220  H H    . ASP A 1 46  ? -8.877  -0.562  -3.712  1.00 0.00 ? 829 ASP A H    4  
ATOM 5221  H HA   . ASP A 1 46  ? -10.790 -1.951  -2.023  1.00 0.00 ? 829 ASP A HA   4  
ATOM 5222  H HB2  . ASP A 1 46  ? -10.050 -3.404  -4.082  1.00 0.00 ? 829 ASP A HB2  4  
ATOM 5223  H HB3  . ASP A 1 46  ? -8.570  -3.615  -3.152  1.00 0.00 ? 829 ASP A HB3  4  
ATOM 5224  N N    . LEU A 1 47  ? -8.964  -2.362  -0.233  1.00 0.00 ? 830 LEU A N    4  
ATOM 5225  C CA   . LEU A 1 47  ? -8.032  -2.211  0.879   1.00 0.00 ? 830 LEU A CA   4  
ATOM 5226  C C    . LEU A 1 47  ? -7.963  -3.489  1.708   1.00 0.00 ? 830 LEU A C    4  
ATOM 5227  O O    . LEU A 1 47  ? -8.990  -4.050  2.091   1.00 0.00 ? 830 LEU A O    4  
ATOM 5228  C CB   . LEU A 1 47  ? -8.451  -1.037  1.766   1.00 0.00 ? 830 LEU A CB   4  
ATOM 5229  C CG   . LEU A 1 47  ? -7.329  -0.355  2.550   1.00 0.00 ? 830 LEU A CG   4  
ATOM 5230  C CD1  . LEU A 1 47  ? -7.777  1.013   3.041   1.00 0.00 ? 830 LEU A CD1  4  
ATOM 5231  C CD2  . LEU A 1 47  ? -6.889  -1.225  3.717   1.00 0.00 ? 830 LEU A CD2  4  
ATOM 5232  H H    . LEU A 1 47  ? -9.763  -2.917  -0.114  1.00 0.00 ? 830 LEU A H    4  
ATOM 5233  H HA   . LEU A 1 47  ? -7.055  -2.010  0.467   1.00 0.00 ? 830 LEU A HA   4  
ATOM 5234  H HB2  . LEU A 1 47  ? -8.911  -0.293  1.134   1.00 0.00 ? 830 LEU A HB2  4  
ATOM 5235  H HB3  . LEU A 1 47  ? -9.178  -1.403  2.477   1.00 0.00 ? 830 LEU A HB3  4  
ATOM 5236  H HG   . LEU A 1 47  ? -6.478  -0.212  1.898   1.00 0.00 ? 830 LEU A HG   4  
ATOM 5237  H HD11 . LEU A 1 47  ? -8.812  0.966   3.342   1.00 0.00 ? 830 LEU A HD11 4  
ATOM 5238  H HD12 . LEU A 1 47  ? -7.665  1.736   2.246   1.00 0.00 ? 830 LEU A HD12 4  
ATOM 5239  H HD13 . LEU A 1 47  ? -7.169  1.309   3.884   1.00 0.00 ? 830 LEU A HD13 4  
ATOM 5240  H HD21 . LEU A 1 47  ? -6.087  -1.875  3.399   1.00 0.00 ? 830 LEU A HD21 4  
ATOM 5241  H HD22 . LEU A 1 47  ? -7.723  -1.822  4.056   1.00 0.00 ? 830 LEU A HD22 4  
ATOM 5242  H HD23 . LEU A 1 47  ? -6.544  -0.597  4.525   1.00 0.00 ? 830 LEU A HD23 4  
ATOM 5243  N N    . ARG A 1 48  ? -6.745  -3.944  1.984   1.00 0.00 ? 831 ARG A N    4  
ATOM 5244  C CA   . ARG A 1 48  ? -6.541  -5.156  2.769   1.00 0.00 ? 831 ARG A CA   4  
ATOM 5245  C C    . ARG A 1 48  ? -5.523  -4.919  3.881   1.00 0.00 ? 831 ARG A C    4  
ATOM 5246  O O    . ARG A 1 48  ? -4.623  -4.088  3.746   1.00 0.00 ? 831 ARG A O    4  
ATOM 5247  C CB   . ARG A 1 48  ? -6.072  -6.300  1.868   1.00 0.00 ? 831 ARG A CB   4  
ATOM 5248  C CG   . ARG A 1 48  ? -5.876  -7.614  2.606   1.00 0.00 ? 831 ARG A CG   4  
ATOM 5249  C CD   . ARG A 1 48  ? -5.759  -8.783  1.640   1.00 0.00 ? 831 ARG A CD   4  
ATOM 5250  N NE   . ARG A 1 48  ? -4.519  -8.734  0.869   1.00 0.00 ? 831 ARG A NE   4  
ATOM 5251  C CZ   . ARG A 1 48  ? -4.290  -9.483  -0.204  1.00 0.00 ? 831 ARG A CZ   4  
ATOM 5252  N NH1  . ARG A 1 48  ? -5.213  -10.333 -0.631  1.00 0.00 ? 831 ARG A NH1  4  
ATOM 5253  N NH2  . ARG A 1 48  ? -3.137  -9.381  -0.851  1.00 0.00 ? 831 ARG A NH2  4  
ATOM 5254  H H    . ARG A 1 48  ? -5.964  -3.453  1.651   1.00 0.00 ? 831 ARG A H    4  
ATOM 5255  H HA   . ARG A 1 48  ? -7.487  -5.425  3.215   1.00 0.00 ? 831 ARG A HA   4  
ATOM 5256  H HB2  . ARG A 1 48  ? -6.806  -6.455  1.091   1.00 0.00 ? 831 ARG A HB2  4  
ATOM 5257  H HB3  . ARG A 1 48  ? -5.133  -6.022  1.415   1.00 0.00 ? 831 ARG A HB3  4  
ATOM 5258  H HG2  . ARG A 1 48  ? -4.972  -7.555  3.193   1.00 0.00 ? 831 ARG A HG2  4  
ATOM 5259  H HG3  . ARG A 1 48  ? -6.721  -7.780  3.257   1.00 0.00 ? 831 ARG A HG3  4  
ATOM 5260  H HD2  . ARG A 1 48  ? -5.784  -9.703  2.204   1.00 0.00 ? 831 ARG A HD2  4  
ATOM 5261  H HD3  . ARG A 1 48  ? -6.596  -8.755  0.959   1.00 0.00 ? 831 ARG A HD3  4  
ATOM 5262  H HE   . ARG A 1 48  ? -3.823  -8.112  1.168   1.00 0.00 ? 831 ARG A HE   4  
ATOM 5263  H HH11 . ARG A 1 48  ? -6.083  -10.411 -0.146  1.00 0.00 ? 831 ARG A HH11 4  
ATOM 5264  H HH12 . ARG A 1 48  ? -5.038  -10.895 -1.440  1.00 0.00 ? 831 ARG A HH12 4  
ATOM 5265  H HH21 . ARG A 1 48  ? -2.439  -8.741  -0.532  1.00 0.00 ? 831 ARG A HH21 4  
ATOM 5266  H HH22 . ARG A 1 48  ? -2.965  -9.945  -1.658  1.00 0.00 ? 831 ARG A HH22 4  
ATOM 5267  N N    . LEU A 1 49  ? -5.670  -5.653  4.977   1.00 0.00 ? 832 LEU A N    4  
ATOM 5268  C CA   . LEU A 1 49  ? -4.764  -5.523  6.113   1.00 0.00 ? 832 LEU A CA   4  
ATOM 5269  C C    . LEU A 1 49  ? -4.050  -6.842  6.394   1.00 0.00 ? 832 LEU A C    4  
ATOM 5270  O O    . LEU A 1 49  ? -4.682  -7.895  6.484   1.00 0.00 ? 832 LEU A O    4  
ATOM 5271  C CB   . LEU A 1 49  ? -5.533  -5.072  7.356   1.00 0.00 ? 832 LEU A CB   4  
ATOM 5272  C CG   . LEU A 1 49  ? -6.434  -3.849  7.180   1.00 0.00 ? 832 LEU A CG   4  
ATOM 5273  C CD1  . LEU A 1 49  ? -7.407  -3.732  8.342   1.00 0.00 ? 832 LEU A CD1  4  
ATOM 5274  C CD2  . LEU A 1 49  ? -5.598  -2.584  7.052   1.00 0.00 ? 832 LEU A CD2  4  
ATOM 5275  H H    . LEU A 1 49  ? -6.406  -6.299  5.026   1.00 0.00 ? 832 LEU A H    4  
ATOM 5276  H HA   . LEU A 1 49  ? -4.026  -4.775  5.864   1.00 0.00 ? 832 LEU A HA   4  
ATOM 5277  H HB2  . LEU A 1 49  ? -6.152  -5.895  7.679   1.00 0.00 ? 832 LEU A HB2  4  
ATOM 5278  H HB3  . LEU A 1 49  ? -4.810  -4.843  8.126   1.00 0.00 ? 832 LEU A HB3  4  
ATOM 5279  H HG   . LEU A 1 49  ? -7.011  -3.963  6.272   1.00 0.00 ? 832 LEU A HG   4  
ATOM 5280  H HD11 . LEU A 1 49  ? -7.459  -2.703  8.666   1.00 0.00 ? 832 LEU A HD11 4  
ATOM 5281  H HD12 . LEU A 1 49  ? -7.067  -4.350  9.160   1.00 0.00 ? 832 LEU A HD12 4  
ATOM 5282  H HD13 . LEU A 1 49  ? -8.387  -4.061  8.026   1.00 0.00 ? 832 LEU A HD13 4  
ATOM 5283  H HD21 . LEU A 1 49  ? -5.526  -2.102  8.016   1.00 0.00 ? 832 LEU A HD21 4  
ATOM 5284  H HD22 . LEU A 1 49  ? -6.066  -1.912  6.348   1.00 0.00 ? 832 LEU A HD22 4  
ATOM 5285  H HD23 . LEU A 1 49  ? -4.608  -2.840  6.703   1.00 0.00 ? 832 LEU A HD23 4  
ATOM 5286  N N    . VAL A 1 50  ? -2.730  -6.777  6.533   1.00 0.00 ? 833 VAL A N    4  
ATOM 5287  C CA   . VAL A 1 50  ? -1.930  -7.965  6.807   1.00 0.00 ? 833 VAL A CA   4  
ATOM 5288  C C    . VAL A 1 50  ? -2.159  -8.465  8.229   1.00 0.00 ? 833 VAL A C    4  
ATOM 5289  O O    . VAL A 1 50  ? -1.860  -7.769  9.200   1.00 0.00 ? 833 VAL A O    4  
ATOM 5290  C CB   . VAL A 1 50  ? -0.428  -7.689  6.608   1.00 0.00 ? 833 VAL A CB   4  
ATOM 5291  C CG1  . VAL A 1 50  ? 0.390   -8.932  6.921   1.00 0.00 ? 833 VAL A CG1  4  
ATOM 5292  C CG2  . VAL A 1 50  ? -0.159  -7.206  5.190   1.00 0.00 ? 833 VAL A CG2  4  
ATOM 5293  H H    . VAL A 1 50  ? -2.283  -5.909  6.450   1.00 0.00 ? 833 VAL A H    4  
ATOM 5294  H HA   . VAL A 1 50  ? -2.229  -8.736  6.112   1.00 0.00 ? 833 VAL A HA   4  
ATOM 5295  H HB   . VAL A 1 50  ? -0.132  -6.908  7.293   1.00 0.00 ? 833 VAL A HB   4  
ATOM 5296  H HG11 . VAL A 1 50  ? -0.035  -9.437  7.776   1.00 0.00 ? 833 VAL A HG11 4  
ATOM 5297  H HG12 . VAL A 1 50  ? 0.378   -9.595  6.068   1.00 0.00 ? 833 VAL A HG12 4  
ATOM 5298  H HG13 . VAL A 1 50  ? 1.408   -8.647  7.141   1.00 0.00 ? 833 VAL A HG13 4  
ATOM 5299  H HG21 . VAL A 1 50  ? -0.148  -8.052  4.519   1.00 0.00 ? 833 VAL A HG21 4  
ATOM 5300  H HG22 . VAL A 1 50  ? -0.937  -6.519  4.890   1.00 0.00 ? 833 VAL A HG22 4  
ATOM 5301  H HG23 . VAL A 1 50  ? 0.796   -6.706  5.155   1.00 0.00 ? 833 VAL A HG23 4  
ATOM 5302  N N    . THR A 1 51  ? -2.692  -9.678  8.345   1.00 0.00 ? 834 THR A N    4  
ATOM 5303  C CA   . THR A 1 51  ? -2.962  -10.272 9.648   1.00 0.00 ? 834 THR A CA   4  
ATOM 5304  C C    . THR A 1 51  ? -2.208  -11.586 9.820   1.00 0.00 ? 834 THR A C    4  
ATOM 5305  O O    . THR A 1 51  ? -1.481  -12.017 8.926   1.00 0.00 ? 834 THR A O    4  
ATOM 5306  C CB   . THR A 1 51  ? -4.468  -10.528 9.848   1.00 0.00 ? 834 THR A CB   4  
ATOM 5307  O OG1  . THR A 1 51  ? -4.909  -11.567 8.967   1.00 0.00 ? 834 THR A OG1  4  
ATOM 5308  C CG2  . THR A 1 51  ? -5.270  -9.262  9.590   1.00 0.00 ? 834 THR A CG2  4  
ATOM 5309  H H    . THR A 1 51  ? -2.908  -10.183 7.534   1.00 0.00 ? 834 THR A H    4  
ATOM 5310  H HA   . THR A 1 51  ? -2.632  -9.577  10.407  1.00 0.00 ? 834 THR A HA   4  
ATOM 5311  H HB   . THR A 1 51  ? -4.632  -10.838 10.870  1.00 0.00 ? 834 THR A HB   4  
ATOM 5312  H HG1  . THR A 1 51  ? -4.925  -11.237 8.065   1.00 0.00 ? 834 THR A HG1  4  
ATOM 5313  H HG21 . THR A 1 51  ? -4.740  -8.411  9.992   1.00 0.00 ? 834 THR A HG21 4  
ATOM 5314  H HG22 . THR A 1 51  ? -6.235  -9.343  10.067  1.00 0.00 ? 834 THR A HG22 4  
ATOM 5315  H HG23 . THR A 1 51  ? -5.405  -9.132  8.526   1.00 0.00 ? 834 THR A HG23 4  
ATOM 5316  N N    . ASN A 1 52  ? -2.386  -12.218 10.976  1.00 0.00 ? 835 ASN A N    4  
ATOM 5317  C CA   . ASN A 1 52  ? -1.722  -13.484 11.264  1.00 0.00 ? 835 ASN A CA   4  
ATOM 5318  C C    . ASN A 1 52  ? -2.741  -14.607 11.435  1.00 0.00 ? 835 ASN A C    4  
ATOM 5319  O O    . ASN A 1 52  ? -3.949  -14.381 11.349  1.00 0.00 ? 835 ASN A O    4  
ATOM 5320  C CB   . ASN A 1 52  ? -0.868  -13.360 12.528  1.00 0.00 ? 835 ASN A CB   4  
ATOM 5321  C CG   . ASN A 1 52  ? -1.707  -13.328 13.791  1.00 0.00 ? 835 ASN A CG   4  
ATOM 5322  O OD1  . ASN A 1 52  ? -1.779  -14.313 14.526  1.00 0.00 ? 835 ASN A OD1  4  
ATOM 5323  N ND2  . ASN A 1 52  ? -2.345  -12.192 14.049  1.00 0.00 ? 835 ASN A ND2  4  
ATOM 5324  H H    . ASN A 1 52  ? -2.978  -11.825 11.650  1.00 0.00 ? 835 ASN A H    4  
ATOM 5325  H HA   . ASN A 1 52  ? -1.081  -13.720 10.429  1.00 0.00 ? 835 ASN A HA   4  
ATOM 5326  H HB2  . ASN A 1 52  ? -0.197  -14.204 12.586  1.00 0.00 ? 835 ASN A HB2  4  
ATOM 5327  H HB3  . ASN A 1 52  ? -0.291  -12.448 12.477  1.00 0.00 ? 835 ASN A HB3  4  
ATOM 5328  H HD21 . ASN A 1 52  ? -2.241  -11.449 13.419  1.00 0.00 ? 835 ASN A HD21 4  
ATOM 5329  H HD22 . ASN A 1 52  ? -2.894  -12.144 14.860  1.00 0.00 ? 835 ASN A HD22 4  
ATOM 5330  N N    . ARG A 1 53  ? -2.246  -15.816 11.677  1.00 0.00 ? 836 ARG A N    4  
ATOM 5331  C CA   . ARG A 1 53  ? -3.113  -16.974 11.859  1.00 0.00 ? 836 ARG A CA   4  
ATOM 5332  C C    . ARG A 1 53  ? -4.235  -16.664 12.846  1.00 0.00 ? 836 ARG A C    4  
ATOM 5333  O O    . ARG A 1 53  ? -5.275  -17.321 12.845  1.00 0.00 ? 836 ARG A O    4  
ATOM 5334  C CB   . ARG A 1 53  ? -2.302  -18.173 12.353  1.00 0.00 ? 836 ARG A CB   4  
ATOM 5335  C CG   . ARG A 1 53  ? -2.964  -19.513 12.076  1.00 0.00 ? 836 ARG A CG   4  
ATOM 5336  C CD   . ARG A 1 53  ? -1.952  -20.647 12.084  1.00 0.00 ? 836 ARG A CD   4  
ATOM 5337  N NE   . ARG A 1 53  ? -0.950  -20.493 11.032  1.00 0.00 ? 836 ARG A NE   4  
ATOM 5338  C CZ   . ARG A 1 53  ? -1.134  -20.889 9.778   1.00 0.00 ? 836 ARG A CZ   4  
ATOM 5339  N NH1  . ARG A 1 53  ? -2.277  -21.459 9.420   1.00 0.00 ? 836 ARG A NH1  4  
ATOM 5340  N NH2  . ARG A 1 53  ? -0.175  -20.714 8.878   1.00 0.00 ? 836 ARG A NH2  4  
ATOM 5341  H H    . ARG A 1 53  ? -1.275  -15.933 11.735  1.00 0.00 ? 836 ARG A H    4  
ATOM 5342  H HA   . ARG A 1 53  ? -3.549  -17.216 10.902  1.00 0.00 ? 836 ARG A HA   4  
ATOM 5343  H HB2  . ARG A 1 53  ? -1.338  -18.166 11.866  1.00 0.00 ? 836 ARG A HB2  4  
ATOM 5344  H HB3  . ARG A 1 53  ? -2.158  -18.080 13.419  1.00 0.00 ? 836 ARG A HB3  4  
ATOM 5345  H HG2  . ARG A 1 53  ? -3.705  -19.702 12.839  1.00 0.00 ? 836 ARG A HG2  4  
ATOM 5346  H HG3  . ARG A 1 53  ? -3.442  -19.474 11.109  1.00 0.00 ? 836 ARG A HG3  4  
ATOM 5347  H HD2  . ARG A 1 53  ? -1.454  -20.662 13.042  1.00 0.00 ? 836 ARG A HD2  4  
ATOM 5348  H HD3  . ARG A 1 53  ? -2.475  -21.580 11.936  1.00 0.00 ? 836 ARG A HD3  4  
ATOM 5349  H HE   . ARG A 1 53  ? -0.098  -20.074 11.274  1.00 0.00 ? 836 ARG A HE   4  
ATOM 5350  H HH11 . ARG A 1 53  ? -3.002  -21.591 10.096  1.00 0.00 ? 836 ARG A HH11 4  
ATOM 5351  H HH12 . ARG A 1 53  ? -2.414  -21.755 8.475   1.00 0.00 ? 836 ARG A HH12 4  
ATOM 5352  H HH21 . ARG A 1 53  ? 0.687   -20.285 9.143   1.00 0.00 ? 836 ARG A HH21 4  
ATOM 5353  H HH22 . ARG A 1 53  ? -0.315  -21.013 7.934   1.00 0.00 ? 836 ARG A HH22 4  
ATOM 5354  N N    . ALA A 1 54  ? -4.015  -15.659 13.687  1.00 0.00 ? 837 ALA A N    4  
ATOM 5355  C CA   . ALA A 1 54  ? -5.007  -15.260 14.678  1.00 0.00 ? 837 ALA A CA   4  
ATOM 5356  C C    . ALA A 1 54  ? -5.950  -14.203 14.116  1.00 0.00 ? 837 ALA A C    4  
ATOM 5357  O O    . ALA A 1 54  ? -7.165  -14.284 14.292  1.00 0.00 ? 837 ALA A O    4  
ATOM 5358  C CB   . ALA A 1 54  ? -4.320  -14.744 15.934  1.00 0.00 ? 837 ALA A CB   4  
ATOM 5359  H H    . ALA A 1 54  ? -3.165  -15.173 13.639  1.00 0.00 ? 837 ALA A H    4  
ATOM 5360  H HA   . ALA A 1 54  ? -5.581  -16.136 14.946  1.00 0.00 ? 837 ALA A HA   4  
ATOM 5361  H HB1  . ALA A 1 54  ? -4.884  -15.051 16.803  1.00 0.00 ? 837 ALA A HB1  4  
ATOM 5362  H HB2  . ALA A 1 54  ? -3.321  -15.150 15.991  1.00 0.00 ? 837 ALA A HB2  4  
ATOM 5363  H HB3  . ALA A 1 54  ? -4.270  -13.666 15.900  1.00 0.00 ? 837 ALA A HB3  4  
ATOM 5364  N N    . GLY A 1 55  ? -5.382  -13.209 13.440  1.00 0.00 ? 838 GLY A N    4  
ATOM 5365  C CA   . GLY A 1 55  ? -6.188  -12.148 12.863  1.00 0.00 ? 838 GLY A CA   4  
ATOM 5366  C C    . GLY A 1 55  ? -5.711  -10.769 13.274  1.00 0.00 ? 838 GLY A C    4  
ATOM 5367  O O    . GLY A 1 55  ? -6.064  -9.770  12.647  1.00 0.00 ? 838 GLY A O    4  
ATOM 5368  H H    . GLY A 1 55  ? -4.408  -13.195 13.332  1.00 0.00 ? 838 GLY A H    4  
ATOM 5369  H HA2  . GLY A 1 55  ? -6.149  -12.226 11.787  1.00 0.00 ? 838 GLY A HA2  4  
ATOM 5370  H HA3  . GLY A 1 55  ? -7.211  -12.273 13.186  1.00 0.00 ? 838 GLY A HA3  4  
ATOM 5371  N N    . LYS A 1 56  ? -4.908  -10.713 14.331  1.00 0.00 ? 839 LYS A N    4  
ATOM 5372  C CA   . LYS A 1 56  ? -4.382  -9.447  14.826  1.00 0.00 ? 839 LYS A CA   4  
ATOM 5373  C C    . LYS A 1 56  ? -3.557  -8.743  13.753  1.00 0.00 ? 839 LYS A C    4  
ATOM 5374  O O    . LYS A 1 56  ? -2.844  -9.373  12.972  1.00 0.00 ? 839 LYS A O    4  
ATOM 5375  C CB   . LYS A 1 56  ? -3.524  -9.679  16.072  1.00 0.00 ? 839 LYS A CB   4  
ATOM 5376  C CG   . LYS A 1 56  ? -4.312  -10.194 17.265  1.00 0.00 ? 839 LYS A CG   4  
ATOM 5377  C CD   . LYS A 1 56  ? -4.905  -9.054  18.075  1.00 0.00 ? 839 LYS A CD   4  
ATOM 5378  C CE   . LYS A 1 56  ? -5.384  -9.529  19.438  1.00 0.00 ? 839 LYS A CE   4  
ATOM 5379  N NZ   . LYS A 1 56  ? -6.466  -10.545 19.323  1.00 0.00 ? 839 LYS A NZ   4  
ATOM 5380  H H    . LYS A 1 56  ? -4.663  -11.545 14.789  1.00 0.00 ? 839 LYS A H    4  
ATOM 5381  H HA   . LYS A 1 56  ? -5.220  -8.819  15.088  1.00 0.00 ? 839 LYS A HA   4  
ATOM 5382  H HB2  . LYS A 1 56  ? -2.756  -10.401 15.836  1.00 0.00 ? 839 LYS A HB2  4  
ATOM 5383  H HB3  . LYS A 1 56  ? -3.057  -8.746  16.352  1.00 0.00 ? 839 LYS A HB3  4  
ATOM 5384  H HG2  . LYS A 1 56  ? -5.114  -10.824 16.910  1.00 0.00 ? 839 LYS A HG2  4  
ATOM 5385  H HG3  . LYS A 1 56  ? -3.652  -10.769 17.899  1.00 0.00 ? 839 LYS A HG3  4  
ATOM 5386  H HD2  . LYS A 1 56  ? -4.151  -8.293  18.216  1.00 0.00 ? 839 LYS A HD2  4  
ATOM 5387  H HD3  . LYS A 1 56  ? -5.743  -8.637  17.534  1.00 0.00 ? 839 LYS A HD3  4  
ATOM 5388  H HE2  . LYS A 1 56  ? -4.549  -9.963  19.967  1.00 0.00 ? 839 LYS A HE2  4  
ATOM 5389  H HE3  . LYS A 1 56  ? -5.757  -8.679  19.991  1.00 0.00 ? 839 LYS A HE3  4  
ATOM 5390  H HZ1  . LYS A 1 56  ? -6.946  -10.661 20.238  1.00 0.00 ? 839 LYS A HZ1  4  
ATOM 5391  H HZ2  . LYS A 1 56  ? -6.067  -11.461 19.036  1.00 0.00 ? 839 LYS A HZ2  4  
ATOM 5392  H HZ3  . LYS A 1 56  ? -7.164  -10.245 18.613  1.00 0.00 ? 839 LYS A HZ3  4  
ATOM 5393  N N    . PRO A 1 57  ? -3.654  -7.406  13.712  1.00 0.00 ? 840 PRO A N    4  
ATOM 5394  C CA   . PRO A 1 57  ? -2.923  -6.588  12.740  1.00 0.00 ? 840 PRO A CA   4  
ATOM 5395  C C    . PRO A 1 57  ? -1.422  -6.569  13.012  1.00 0.00 ? 840 PRO A C    4  
ATOM 5396  O O    . PRO A 1 57  ? -0.977  -6.104  14.061  1.00 0.00 ? 840 PRO A O    4  
ATOM 5397  C CB   . PRO A 1 57  ? -3.519  -5.192  12.931  1.00 0.00 ? 840 PRO A CB   4  
ATOM 5398  C CG   . PRO A 1 57  ? -4.027  -5.185  14.332  1.00 0.00 ? 840 PRO A CG   4  
ATOM 5399  C CD   . PRO A 1 57  ? -4.486  -6.589  14.612  1.00 0.00 ? 840 PRO A CD   4  
ATOM 5400  H HA   . PRO A 1 57  ? -3.100  -6.922  11.728  1.00 0.00 ? 840 PRO A HA   4  
ATOM 5401  H HB2  . PRO A 1 57  ? -2.750  -4.446  12.786  1.00 0.00 ? 840 PRO A HB2  4  
ATOM 5402  H HB3  . PRO A 1 57  ? -4.317  -5.036  12.221  1.00 0.00 ? 840 PRO A HB3  4  
ATOM 5403  H HG2  . PRO A 1 57  ? -3.234  -4.907  15.009  1.00 0.00 ? 840 PRO A HG2  4  
ATOM 5404  H HG3  . PRO A 1 57  ? -4.855  -4.497  14.418  1.00 0.00 ? 840 PRO A HG3  4  
ATOM 5405  H HD2  . PRO A 1 57  ? -4.303  -6.847  15.645  1.00 0.00 ? 840 PRO A HD2  4  
ATOM 5406  H HD3  . PRO A 1 57  ? -5.534  -6.699  14.373  1.00 0.00 ? 840 PRO A HD3  4  
ATOM 5407  N N    . LYS A 1 58  ? -0.647  -7.076  12.059  1.00 0.00 ? 841 LYS A N    4  
ATOM 5408  C CA   . LYS A 1 58  ? 0.804   -7.116  12.194  1.00 0.00 ? 841 LYS A CA   4  
ATOM 5409  C C    . LYS A 1 58  ? 1.413   -5.741  11.935  1.00 0.00 ? 841 LYS A C    4  
ATOM 5410  O O    . LYS A 1 58  ? 2.602   -5.524  12.165  1.00 0.00 ? 841 LYS A O    4  
ATOM 5411  C CB   . LYS A 1 58  ? 1.400   -8.139  11.225  1.00 0.00 ? 841 LYS A CB   4  
ATOM 5412  C CG   . LYS A 1 58  ? 0.885   -9.552  11.440  1.00 0.00 ? 841 LYS A CG   4  
ATOM 5413  C CD   . LYS A 1 58  ? 1.918   -10.590 11.034  1.00 0.00 ? 841 LYS A CD   4  
ATOM 5414  C CE   . LYS A 1 58  ? 2.103   -10.632 9.525   1.00 0.00 ? 841 LYS A CE   4  
ATOM 5415  N NZ   . LYS A 1 58  ? 3.118   -9.645  9.063   1.00 0.00 ? 841 LYS A NZ   4  
ATOM 5416  H H    . LYS A 1 58  ? -1.061  -7.432  11.245  1.00 0.00 ? 841 LYS A H    4  
ATOM 5417  H HA   . LYS A 1 58  ? 1.036   -7.414  13.206  1.00 0.00 ? 841 LYS A HA   4  
ATOM 5418  H HB2  . LYS A 1 58  ? 1.160   -7.842  10.214  1.00 0.00 ? 841 LYS A HB2  4  
ATOM 5419  H HB3  . LYS A 1 58  ? 2.474   -8.148  11.344  1.00 0.00 ? 841 LYS A HB3  4  
ATOM 5420  H HG2  . LYS A 1 58  ? 0.650   -9.684  12.486  1.00 0.00 ? 841 LYS A HG2  4  
ATOM 5421  H HG3  . LYS A 1 58  ? -0.008  -9.695  10.848  1.00 0.00 ? 841 LYS A HG3  4  
ATOM 5422  H HD2  . LYS A 1 58  ? 2.863   -10.344 11.494  1.00 0.00 ? 841 LYS A HD2  4  
ATOM 5423  H HD3  . LYS A 1 58  ? 1.592   -11.562 11.375  1.00 0.00 ? 841 LYS A HD3  4  
ATOM 5424  H HE2  . LYS A 1 58  ? 2.421   -11.623 9.242   1.00 0.00 ? 841 LYS A HE2  4  
ATOM 5425  H HE3  . LYS A 1 58  ? 1.157   -10.409 9.054   1.00 0.00 ? 841 LYS A HE3  4  
ATOM 5426  H HZ1  . LYS A 1 58  ? 2.943   -8.719  9.503   1.00 0.00 ? 841 LYS A HZ1  4  
ATOM 5427  H HZ2  . LYS A 1 58  ? 3.069   -9.539  8.030   1.00 0.00 ? 841 LYS A HZ2  4  
ATOM 5428  H HZ3  . LYS A 1 58  ? 4.072   -9.966  9.323   1.00 0.00 ? 841 LYS A HZ3  4  
ATOM 5429  N N    . GLY A 1 59  ? 0.588   -4.814  11.456  1.00 0.00 ? 842 GLY A N    4  
ATOM 5430  C CA   . GLY A 1 59  ? 1.063   -3.472  11.176  1.00 0.00 ? 842 GLY A CA   4  
ATOM 5431  C C    . GLY A 1 59  ? 1.133   -3.181  9.690   1.00 0.00 ? 842 GLY A C    4  
ATOM 5432  O O    . GLY A 1 59  ? 0.971   -2.036  9.266   1.00 0.00 ? 842 GLY A O    4  
ATOM 5433  H H    . GLY A 1 59  ? -0.351  -5.044  11.292  1.00 0.00 ? 842 GLY A H    4  
ATOM 5434  H HA2  . GLY A 1 59  ? 0.396   -2.761  11.640  1.00 0.00 ? 842 GLY A HA2  4  
ATOM 5435  H HA3  . GLY A 1 59  ? 2.050   -3.356  11.601  1.00 0.00 ? 842 GLY A HA3  4  
ATOM 5436  N N    . LEU A 1 60  ? 1.378   -4.218  8.896   1.00 0.00 ? 843 LEU A N    4  
ATOM 5437  C CA   . LEU A 1 60  ? 1.471   -4.068  7.448   1.00 0.00 ? 843 LEU A CA   4  
ATOM 5438  C C    . LEU A 1 60  ? 0.084   -4.026  6.815   1.00 0.00 ? 843 LEU A C    4  
ATOM 5439  O O    . LEU A 1 60  ? -0.853  -4.652  7.308   1.00 0.00 ? 843 LEU A O    4  
ATOM 5440  C CB   . LEU A 1 60  ? 2.284   -5.216  6.848   1.00 0.00 ? 843 LEU A CB   4  
ATOM 5441  C CG   . LEU A 1 60  ? 3.623   -5.516  7.524   1.00 0.00 ? 843 LEU A CG   4  
ATOM 5442  C CD1  . LEU A 1 60  ? 4.226   -6.797  6.969   1.00 0.00 ? 843 LEU A CD1  4  
ATOM 5443  C CD2  . LEU A 1 60  ? 4.584   -4.350  7.342   1.00 0.00 ? 843 LEU A CD2  4  
ATOM 5444  H H    . LEU A 1 60  ? 1.498   -5.106  9.293   1.00 0.00 ? 843 LEU A H    4  
ATOM 5445  H HA   . LEU A 1 60  ? 1.976   -3.135  7.244   1.00 0.00 ? 843 LEU A HA   4  
ATOM 5446  H HB2  . LEU A 1 60  ? 1.681   -6.110  6.899   1.00 0.00 ? 843 LEU A HB2  4  
ATOM 5447  H HB3  . LEU A 1 60  ? 2.481   -4.975  5.813   1.00 0.00 ? 843 LEU A HB3  4  
ATOM 5448  H HG   . LEU A 1 60  ? 3.461   -5.655  8.584   1.00 0.00 ? 843 LEU A HG   4  
ATOM 5449  H HD11 . LEU A 1 60  ? 4.988   -6.553  6.245   1.00 0.00 ? 843 LEU A HD11 4  
ATOM 5450  H HD12 . LEU A 1 60  ? 3.452   -7.382  6.494   1.00 0.00 ? 843 LEU A HD12 4  
ATOM 5451  H HD13 . LEU A 1 60  ? 4.663   -7.367  7.776   1.00 0.00 ? 843 LEU A HD13 4  
ATOM 5452  H HD21 . LEU A 1 60  ? 4.851   -3.950  8.309   1.00 0.00 ? 843 LEU A HD21 4  
ATOM 5453  H HD22 . LEU A 1 60  ? 4.108   -3.579  6.753   1.00 0.00 ? 843 LEU A HD22 4  
ATOM 5454  H HD23 . LEU A 1 60  ? 5.474   -4.693  6.836   1.00 0.00 ? 843 LEU A HD23 4  
ATOM 5455  N N    . ALA A 1 61  ? -0.037  -3.285  5.718   1.00 0.00 ? 844 ALA A N    4  
ATOM 5456  C CA   . ALA A 1 61  ? -1.308  -3.165  5.014   1.00 0.00 ? 844 ALA A CA   4  
ATOM 5457  C C    . ALA A 1 61  ? -1.091  -2.825  3.543   1.00 0.00 ? 844 ALA A C    4  
ATOM 5458  O O    . ALA A 1 61  ? -0.092  -2.204  3.181   1.00 0.00 ? 844 ALA A O    4  
ATOM 5459  C CB   . ALA A 1 61  ? -2.181  -2.111  5.678   1.00 0.00 ? 844 ALA A CB   4  
ATOM 5460  H H    . ALA A 1 61  ? 0.747   -2.809  5.373   1.00 0.00 ? 844 ALA A H    4  
ATOM 5461  H HA   . ALA A 1 61  ? -1.818  -4.115  5.082   1.00 0.00 ? 844 ALA A HA   4  
ATOM 5462  H HB1  . ALA A 1 61  ? -3.138  -2.070  5.177   1.00 0.00 ? 844 ALA A HB1  4  
ATOM 5463  H HB2  . ALA A 1 61  ? -2.329  -2.368  6.717   1.00 0.00 ? 844 ALA A HB2  4  
ATOM 5464  H HB3  . ALA A 1 61  ? -1.698  -1.148  5.610   1.00 0.00 ? 844 ALA A HB3  4  
ATOM 5465  N N    . TYR A 1 62  ? -2.032  -3.238  2.701   1.00 0.00 ? 845 TYR A N    4  
ATOM 5466  C CA   . TYR A 1 62  ? -1.942  -2.979  1.269   1.00 0.00 ? 845 TYR A CA   4  
ATOM 5467  C C    . TYR A 1 62  ? -3.101  -2.105  0.799   1.00 0.00 ? 845 TYR A C    4  
ATOM 5468  O O    . TYR A 1 62  ? -4.205  -2.174  1.340   1.00 0.00 ? 845 TYR A O    4  
ATOM 5469  C CB   . TYR A 1 62  ? -1.934  -4.297  0.492   1.00 0.00 ? 845 TYR A CB   4  
ATOM 5470  C CG   . TYR A 1 62  ? -0.573  -4.953  0.426   1.00 0.00 ? 845 TYR A CG   4  
ATOM 5471  C CD1  . TYR A 1 62  ? -0.124  -5.771  1.455   1.00 0.00 ? 845 TYR A CD1  4  
ATOM 5472  C CD2  . TYR A 1 62  ? 0.262   -4.755  -0.667  1.00 0.00 ? 845 TYR A CD2  4  
ATOM 5473  C CE1  . TYR A 1 62  ? 1.118   -6.372  1.399   1.00 0.00 ? 845 TYR A CE1  4  
ATOM 5474  C CE2  . TYR A 1 62  ? 1.506   -5.353  -0.731  1.00 0.00 ? 845 TYR A CE2  4  
ATOM 5475  C CZ   . TYR A 1 62  ? 1.930   -6.160  0.304   1.00 0.00 ? 845 TYR A CZ   4  
ATOM 5476  O OH   . TYR A 1 62  ? 3.168   -6.758  0.244   1.00 0.00 ? 845 TYR A OH   4  
ATOM 5477  H H    . TYR A 1 62  ? -2.805  -3.729  3.050   1.00 0.00 ? 845 TYR A H    4  
ATOM 5478  H HA   . TYR A 1 62  ? -1.014  -2.458  1.084   1.00 0.00 ? 845 TYR A HA   4  
ATOM 5479  H HB2  . TYR A 1 62  ? -2.613  -4.990  0.964   1.00 0.00 ? 845 TYR A HB2  4  
ATOM 5480  H HB3  . TYR A 1 62  ? -2.263  -4.111  -0.521  1.00 0.00 ? 845 TYR A HB3  4  
ATOM 5481  H HD1  . TYR A 1 62  ? -0.763  -5.935  2.311   1.00 0.00 ? 845 TYR A HD1  4  
ATOM 5482  H HD2  . TYR A 1 62  ? -0.072  -4.123  -1.476  1.00 0.00 ? 845 TYR A HD2  4  
ATOM 5483  H HE1  . TYR A 1 62  ? 1.450   -7.004  2.209   1.00 0.00 ? 845 TYR A HE1  4  
ATOM 5484  H HE2  . TYR A 1 62  ? 2.142   -5.188  -1.589  1.00 0.00 ? 845 TYR A HE2  4  
ATOM 5485  H HH   . TYR A 1 62  ? 3.065   -7.711  0.287   1.00 0.00 ? 845 TYR A HH   4  
ATOM 5486  N N    . VAL A 1 63  ? -2.841  -1.284  -0.213  1.00 0.00 ? 846 VAL A N    4  
ATOM 5487  C CA   . VAL A 1 63  ? -3.861  -0.396  -0.759  1.00 0.00 ? 846 VAL A CA   4  
ATOM 5488  C C    . VAL A 1 63  ? -3.972  -0.551  -2.271  1.00 0.00 ? 846 VAL A C    4  
ATOM 5489  O O    . VAL A 1 63  ? -2.974  -0.774  -2.956  1.00 0.00 ? 846 VAL A O    4  
ATOM 5490  C CB   . VAL A 1 63  ? -3.561  1.077   -0.424  1.00 0.00 ? 846 VAL A CB   4  
ATOM 5491  C CG1  . VAL A 1 63  ? -4.710  1.970   -0.868  1.00 0.00 ? 846 VAL A CG1  4  
ATOM 5492  C CG2  . VAL A 1 63  ? -3.292  1.241   1.064   1.00 0.00 ? 846 VAL A CG2  4  
ATOM 5493  H H    . VAL A 1 63  ? -1.942  -1.274  -0.603  1.00 0.00 ? 846 VAL A H    4  
ATOM 5494  H HA   . VAL A 1 63  ? -4.808  -0.660  -0.310  1.00 0.00 ? 846 VAL A HA   4  
ATOM 5495  H HB   . VAL A 1 63  ? -2.674  1.374   -0.965  1.00 0.00 ? 846 VAL A HB   4  
ATOM 5496  H HG11 . VAL A 1 63  ? -5.646  1.454   -0.715  1.00 0.00 ? 846 VAL A HG11 4  
ATOM 5497  H HG12 . VAL A 1 63  ? -4.701  2.882   -0.290  1.00 0.00 ? 846 VAL A HG12 4  
ATOM 5498  H HG13 . VAL A 1 63  ? -4.598  2.206   -1.916  1.00 0.00 ? 846 VAL A HG13 4  
ATOM 5499  H HG21 . VAL A 1 63  ? -3.619  0.355   1.588   1.00 0.00 ? 846 VAL A HG21 4  
ATOM 5500  H HG22 . VAL A 1 63  ? -2.233  1.383   1.225   1.00 0.00 ? 846 VAL A HG22 4  
ATOM 5501  H HG23 . VAL A 1 63  ? -3.830  2.100   1.435   1.00 0.00 ? 846 VAL A HG23 4  
ATOM 5502  N N    . GLU A 1 64  ? -5.192  -0.429  -2.786  1.00 0.00 ? 847 GLU A N    4  
ATOM 5503  C CA   . GLU A 1 64  ? -5.432  -0.556  -4.218  1.00 0.00 ? 847 GLU A CA   4  
ATOM 5504  C C    . GLU A 1 64  ? -6.195  0.653   -4.751  1.00 0.00 ? 847 GLU A C    4  
ATOM 5505  O O    . GLU A 1 64  ? -7.371  0.845   -4.439  1.00 0.00 ? 847 GLU A O    4  
ATOM 5506  C CB   . GLU A 1 64  ? -6.213  -1.837  -4.516  1.00 0.00 ? 847 GLU A CB   4  
ATOM 5507  C CG   . GLU A 1 64  ? -5.911  -2.430  -5.882  1.00 0.00 ? 847 GLU A CG   4  
ATOM 5508  C CD   . GLU A 1 64  ? -6.823  -1.890  -6.967  1.00 0.00 ? 847 GLU A CD   4  
ATOM 5509  O OE1  . GLU A 1 64  ? -8.034  -2.192  -6.928  1.00 0.00 ? 847 GLU A OE1  4  
ATOM 5510  O OE2  . GLU A 1 64  ? -6.325  -1.165  -7.854  1.00 0.00 ? 847 GLU A OE2  4  
ATOM 5511  H H    . GLU A 1 64  ? -5.947  -0.251  -2.188  1.00 0.00 ? 847 GLU A H    4  
ATOM 5512  H HA   . GLU A 1 64  ? -4.473  -0.607  -4.712  1.00 0.00 ? 847 GLU A HA   4  
ATOM 5513  H HB2  . GLU A 1 64  ? -5.971  -2.575  -3.765  1.00 0.00 ? 847 GLU A HB2  4  
ATOM 5514  H HB3  . GLU A 1 64  ? -7.269  -1.620  -4.467  1.00 0.00 ? 847 GLU A HB3  4  
ATOM 5515  H HG2  . GLU A 1 64  ? -4.890  -2.199  -6.144  1.00 0.00 ? 847 GLU A HG2  4  
ATOM 5516  H HG3  . GLU A 1 64  ? -6.034  -3.502  -5.830  1.00 0.00 ? 847 GLU A HG3  4  
ATOM 5517  N N    . TYR A 1 65  ? -5.519  1.466   -5.555  1.00 0.00 ? 848 TYR A N    4  
ATOM 5518  C CA   . TYR A 1 65  ? -6.132  2.658   -6.129  1.00 0.00 ? 848 TYR A CA   4  
ATOM 5519  C C    . TYR A 1 65  ? -6.653  2.379   -7.535  1.00 0.00 ? 848 TYR A C    4  
ATOM 5520  O O    . TYR A 1 65  ? -6.450  1.295   -8.080  1.00 0.00 ? 848 TYR A O    4  
ATOM 5521  C CB   . TYR A 1 65  ? -5.124  3.808   -6.165  1.00 0.00 ? 848 TYR A CB   4  
ATOM 5522  C CG   . TYR A 1 65  ? -5.099  4.631   -4.897  1.00 0.00 ? 848 TYR A CG   4  
ATOM 5523  C CD1  . TYR A 1 65  ? -4.405  4.194   -3.776  1.00 0.00 ? 848 TYR A CD1  4  
ATOM 5524  C CD2  . TYR A 1 65  ? -5.769  5.845   -4.820  1.00 0.00 ? 848 TYR A CD2  4  
ATOM 5525  C CE1  . TYR A 1 65  ? -4.379  4.942   -2.615  1.00 0.00 ? 848 TYR A CE1  4  
ATOM 5526  C CE2  . TYR A 1 65  ? -5.748  6.601   -3.664  1.00 0.00 ? 848 TYR A CE2  4  
ATOM 5527  C CZ   . TYR A 1 65  ? -5.052  6.145   -2.564  1.00 0.00 ? 848 TYR A CZ   4  
ATOM 5528  O OH   . TYR A 1 65  ? -5.030  6.894   -1.410  1.00 0.00 ? 848 TYR A OH   4  
ATOM 5529  H H    . TYR A 1 65  ? -4.585  1.260   -5.767  1.00 0.00 ? 848 TYR A H    4  
ATOM 5530  H HA   . TYR A 1 65  ? -6.962  2.940   -5.499  1.00 0.00 ? 848 TYR A HA   4  
ATOM 5531  H HB2  . TYR A 1 65  ? -4.134  3.405   -6.318  1.00 0.00 ? 848 TYR A HB2  4  
ATOM 5532  H HB3  . TYR A 1 65  ? -5.370  4.467   -6.985  1.00 0.00 ? 848 TYR A HB3  4  
ATOM 5533  H HD1  . TYR A 1 65  ? -3.879  3.251   -3.818  1.00 0.00 ? 848 TYR A HD1  4  
ATOM 5534  H HD2  . TYR A 1 65  ? -6.313  6.199   -5.684  1.00 0.00 ? 848 TYR A HD2  4  
ATOM 5535  H HE1  . TYR A 1 65  ? -3.835  4.585   -1.753  1.00 0.00 ? 848 TYR A HE1  4  
ATOM 5536  H HE2  . TYR A 1 65  ? -6.275  7.543   -3.624  1.00 0.00 ? 848 TYR A HE2  4  
ATOM 5537  H HH   . TYR A 1 65  ? -4.286  7.501   -1.437  1.00 0.00 ? 848 TYR A HH   4  
ATOM 5538  N N    . GLU A 1 66  ? -7.326  3.368   -8.117  1.00 0.00 ? 849 GLU A N    4  
ATOM 5539  C CA   . GLU A 1 66  ? -7.877  3.229   -9.460  1.00 0.00 ? 849 GLU A CA   4  
ATOM 5540  C C    . GLU A 1 66  ? -6.866  3.678   -10.511 1.00 0.00 ? 849 GLU A C    4  
ATOM 5541  O O    . GLU A 1 66  ? -6.732  3.055   -11.564 1.00 0.00 ? 849 GLU A O    4  
ATOM 5542  C CB   . GLU A 1 66  ? -9.164  4.046   -9.593  1.00 0.00 ? 849 GLU A CB   4  
ATOM 5543  C CG   . GLU A 1 66  ? -9.741  4.046   -10.999 1.00 0.00 ? 849 GLU A CG   4  
ATOM 5544  C CD   . GLU A 1 66  ? -10.693 5.202   -11.238 1.00 0.00 ? 849 GLU A CD   4  
ATOM 5545  O OE1  . GLU A 1 66  ? -10.453 6.294   -10.682 1.00 0.00 ? 849 GLU A OE1  4  
ATOM 5546  O OE2  . GLU A 1 66  ? -11.678 5.014   -11.983 1.00 0.00 ? 849 GLU A OE2  4  
ATOM 5547  H H    . GLU A 1 66  ? -7.455  4.209   -7.631  1.00 0.00 ? 849 GLU A H    4  
ATOM 5548  H HA   . GLU A 1 66  ? -8.105  2.186   -9.619  1.00 0.00 ? 849 GLU A HA   4  
ATOM 5549  H HB2  . GLU A 1 66  ? -9.905  3.639   -8.922  1.00 0.00 ? 849 GLU A HB2  4  
ATOM 5550  H HB3  . GLU A 1 66  ? -8.958  5.068   -9.311  1.00 0.00 ? 849 GLU A HB3  4  
ATOM 5551  H HG2  . GLU A 1 66  ? -8.930  4.116   -11.708 1.00 0.00 ? 849 GLU A HG2  4  
ATOM 5552  H HG3  . GLU A 1 66  ? -10.276 3.120   -11.155 1.00 0.00 ? 849 GLU A HG3  4  
ATOM 5553  N N    . ASN A 1 67  ? -6.157  4.763   -10.218 1.00 0.00 ? 850 ASN A N    4  
ATOM 5554  C CA   . ASN A 1 67  ? -5.159  5.296   -11.138 1.00 0.00 ? 850 ASN A CA   4  
ATOM 5555  C C    . ASN A 1 67  ? -3.763  5.229   -10.525 1.00 0.00 ? 850 ASN A C    4  
ATOM 5556  O O    . ASN A 1 67  ? -3.609  4.928   -9.342  1.00 0.00 ? 850 ASN A O    4  
ATOM 5557  C CB   . ASN A 1 67  ? -5.497  6.742   -11.507 1.00 0.00 ? 850 ASN A CB   4  
ATOM 5558  C CG   . ASN A 1 67  ? -6.588  6.831   -12.557 1.00 0.00 ? 850 ASN A CG   4  
ATOM 5559  O OD1  . ASN A 1 67  ? -6.314  6.807   -13.757 1.00 0.00 ? 850 ASN A OD1  4  
ATOM 5560  N ND2  . ASN A 1 67  ? -7.833  6.933   -12.108 1.00 0.00 ? 850 ASN A ND2  4  
ATOM 5561  H H    . ASN A 1 67  ? -6.309  5.216   -9.362  1.00 0.00 ? 850 ASN A H    4  
ATOM 5562  H HA   . ASN A 1 67  ? -5.176  4.692   -12.032 1.00 0.00 ? 850 ASN A HA   4  
ATOM 5563  H HB2  . ASN A 1 67  ? -5.832  7.264   -10.623 1.00 0.00 ? 850 ASN A HB2  4  
ATOM 5564  H HB3  . ASN A 1 67  ? -4.611  7.225   -11.893 1.00 0.00 ? 850 ASN A HB3  4  
ATOM 5565  H HD21 . ASN A 1 67  ? -7.977  6.946   -11.139 1.00 0.00 ? 850 ASN A HD21 4  
ATOM 5566  H HD22 . ASN A 1 67  ? -8.558  6.992   -12.765 1.00 0.00 ? 850 ASN A HD22 4  
ATOM 5567  N N    . GLU A 1 68  ? -2.751  5.512   -11.339 1.00 0.00 ? 851 GLU A N    4  
ATOM 5568  C CA   . GLU A 1 68  ? -1.369  5.483   -10.876 1.00 0.00 ? 851 GLU A CA   4  
ATOM 5569  C C    . GLU A 1 68  ? -1.017  6.768   -10.132 1.00 0.00 ? 851 GLU A C    4  
ATOM 5570  O O    . GLU A 1 68  ? -0.536  6.730   -9.000  1.00 0.00 ? 851 GLU A O    4  
ATOM 5571  C CB   . GLU A 1 68  ? -0.416  5.289   -12.058 1.00 0.00 ? 851 GLU A CB   4  
ATOM 5572  C CG   . GLU A 1 68  ? -0.774  4.104   -12.940 1.00 0.00 ? 851 GLU A CG   4  
ATOM 5573  C CD   . GLU A 1 68  ? -1.048  2.844   -12.141 1.00 0.00 ? 851 GLU A CD   4  
ATOM 5574  O OE1  . GLU A 1 68  ? -0.162  2.428   -11.366 1.00 0.00 ? 851 GLU A OE1  4  
ATOM 5575  O OE2  . GLU A 1 68  ? -2.150  2.275   -12.292 1.00 0.00 ? 851 GLU A OE2  4  
ATOM 5576  H H    . GLU A 1 68  ? -2.939  5.745   -12.272 1.00 0.00 ? 851 GLU A H    4  
ATOM 5577  H HA   . GLU A 1 68  ? -1.263  4.649   -10.200 1.00 0.00 ? 851 GLU A HA   4  
ATOM 5578  H HB2  . GLU A 1 68  ? -0.429  6.181   -12.666 1.00 0.00 ? 851 GLU A HB2  4  
ATOM 5579  H HB3  . GLU A 1 68  ? 0.583   5.138   -11.678 1.00 0.00 ? 851 GLU A HB3  4  
ATOM 5580  H HG2  . GLU A 1 68  ? -1.657  4.350   -13.510 1.00 0.00 ? 851 GLU A HG2  4  
ATOM 5581  H HG3  . GLU A 1 68  ? 0.047   3.913   -13.615 1.00 0.00 ? 851 GLU A HG3  4  
ATOM 5582  N N    . SER A 1 69  ? -1.261  7.904   -10.777 1.00 0.00 ? 852 SER A N    4  
ATOM 5583  C CA   . SER A 1 69  ? -0.967  9.201   -10.178 1.00 0.00 ? 852 SER A CA   4  
ATOM 5584  C C    . SER A 1 69  ? -1.476  9.265   -8.741  1.00 0.00 ? 852 SER A C    4  
ATOM 5585  O O    . SER A 1 69  ? -0.787  9.757   -7.849  1.00 0.00 ? 852 SER A O    4  
ATOM 5586  C CB   . SER A 1 69  ? -1.598  10.323  -11.005 1.00 0.00 ? 852 SER A CB   4  
ATOM 5587  O OG   . SER A 1 69  ? -1.543  11.559  -10.314 1.00 0.00 ? 852 SER A OG   4  
ATOM 5588  H H    . SER A 1 69  ? -1.646  7.869   -11.677 1.00 0.00 ? 852 SER A H    4  
ATOM 5589  H HA   . SER A 1 69  ? 0.105   9.328   -10.173 1.00 0.00 ? 852 SER A HA   4  
ATOM 5590  H HB2  . SER A 1 69  ? -1.065  10.422  -11.938 1.00 0.00 ? 852 SER A HB2  4  
ATOM 5591  H HB3  . SER A 1 69  ? -2.632  10.081  -11.205 1.00 0.00 ? 852 SER A HB3  4  
ATOM 5592  H HG   . SER A 1 69  ? -2.299  12.098  -10.560 1.00 0.00 ? 852 SER A HG   4  
ATOM 5593  N N    . GLN A 1 70  ? -2.688  8.763   -8.527  1.00 0.00 ? 853 GLN A N    4  
ATOM 5594  C CA   . GLN A 1 70  ? -3.291  8.763   -7.200  1.00 0.00 ? 853 GLN A CA   4  
ATOM 5595  C C    . GLN A 1 70  ? -2.427  7.989   -6.209  1.00 0.00 ? 853 GLN A C    4  
ATOM 5596  O O    . GLN A 1 70  ? -2.007  8.526   -5.185  1.00 0.00 ? 853 GLN A O    4  
ATOM 5597  C CB   . GLN A 1 70  ? -4.694  8.157   -7.253  1.00 0.00 ? 853 GLN A CB   4  
ATOM 5598  C CG   . GLN A 1 70  ? -5.715  9.044   -7.947  1.00 0.00 ? 853 GLN A CG   4  
ATOM 5599  C CD   . GLN A 1 70  ? -6.993  8.306   -8.291  1.00 0.00 ? 853 GLN A CD   4  
ATOM 5600  O OE1  . GLN A 1 70  ? -7.162  7.137   -7.941  1.00 0.00 ? 853 GLN A OE1  4  
ATOM 5601  N NE2  . GLN A 1 70  ? -7.902  8.985   -8.980  1.00 0.00 ? 853 GLN A NE2  4  
ATOM 5602  H H    . GLN A 1 70  ? -3.189  8.385   -9.279  1.00 0.00 ? 853 GLN A H    4  
ATOM 5603  H HA   . GLN A 1 70  ? -3.364  9.788   -6.869  1.00 0.00 ? 853 GLN A HA   4  
ATOM 5604  H HB2  . GLN A 1 70  ? -4.647  7.217   -7.782  1.00 0.00 ? 853 GLN A HB2  4  
ATOM 5605  H HB3  . GLN A 1 70  ? -5.034  7.976   -6.244  1.00 0.00 ? 853 GLN A HB3  4  
ATOM 5606  H HG2  . GLN A 1 70  ? -5.959  9.869   -7.294  1.00 0.00 ? 853 GLN A HG2  4  
ATOM 5607  H HG3  . GLN A 1 70  ? -5.280  9.425   -8.860  1.00 0.00 ? 853 GLN A HG3  4  
ATOM 5608  H HE21 . GLN A 1 70  ? -7.699  9.912   -9.226  1.00 0.00 ? 853 GLN A HE21 4  
ATOM 5609  H HE22 . GLN A 1 70  ? -8.737  8.531   -9.217  1.00 0.00 ? 853 GLN A HE22 4  
ATOM 5610  N N    . ALA A 1 71  ? -2.166  6.724   -6.523  1.00 0.00 ? 854 ALA A N    4  
ATOM 5611  C CA   . ALA A 1 71  ? -1.351  5.877   -5.661  1.00 0.00 ? 854 ALA A CA   4  
ATOM 5612  C C    . ALA A 1 71  ? -0.042  6.567   -5.292  1.00 0.00 ? 854 ALA A C    4  
ATOM 5613  O O    . ALA A 1 71  ? 0.272   6.735   -4.114  1.00 0.00 ? 854 ALA A O    4  
ATOM 5614  C CB   . ALA A 1 71  ? -1.074  4.544   -6.341  1.00 0.00 ? 854 ALA A CB   4  
ATOM 5615  H H    . ALA A 1 71  ? -2.529  6.353   -7.353  1.00 0.00 ? 854 ALA A H    4  
ATOM 5616  H HA   . ALA A 1 71  ? -1.911  5.683   -4.758  1.00 0.00 ? 854 ALA A HA   4  
ATOM 5617  H HB1  . ALA A 1 71  ? -1.543  3.750   -5.779  1.00 0.00 ? 854 ALA A HB1  4  
ATOM 5618  H HB2  . ALA A 1 71  ? -1.474  4.562   -7.344  1.00 0.00 ? 854 ALA A HB2  4  
ATOM 5619  H HB3  . ALA A 1 71  ? -0.008  4.376   -6.382  1.00 0.00 ? 854 ALA A HB3  4  
ATOM 5620  N N    . SER A 1 72  ? 0.719   6.964   -6.307  1.00 0.00 ? 855 SER A N    4  
ATOM 5621  C CA   . SER A 1 72  ? 1.997   7.632   -6.089  1.00 0.00 ? 855 SER A CA   4  
ATOM 5622  C C    . SER A 1 72  ? 1.845   8.787   -5.104  1.00 0.00 ? 855 SER A C    4  
ATOM 5623  O O    . SER A 1 72  ? 2.455   8.789   -4.035  1.00 0.00 ? 855 SER A O    4  
ATOM 5624  C CB   . SER A 1 72  ? 2.560   8.148   -7.415  1.00 0.00 ? 855 SER A CB   4  
ATOM 5625  O OG   . SER A 1 72  ? 3.955   8.379   -7.321  1.00 0.00 ? 855 SER A OG   4  
ATOM 5626  H H    . SER A 1 72  ? 0.415   6.801   -7.225  1.00 0.00 ? 855 SER A H    4  
ATOM 5627  H HA   . SER A 1 72  ? 2.683   6.908   -5.674  1.00 0.00 ? 855 SER A HA   4  
ATOM 5628  H HB2  . SER A 1 72  ? 2.379   7.417   -8.188  1.00 0.00 ? 855 SER A HB2  4  
ATOM 5629  H HB3  . SER A 1 72  ? 2.070   9.075   -7.674  1.00 0.00 ? 855 SER A HB3  4  
ATOM 5630  H HG   . SER A 1 72  ? 4.112   9.284   -7.043  1.00 0.00 ? 855 SER A HG   4  
ATOM 5631  N N    . GLN A 1 73  ? 1.026   9.767   -5.473  1.00 0.00 ? 856 GLN A N    4  
ATOM 5632  C CA   . GLN A 1 73  ? 0.794   10.929  -4.623  1.00 0.00 ? 856 GLN A CA   4  
ATOM 5633  C C    . GLN A 1 73  ? 0.631   10.512  -3.165  1.00 0.00 ? 856 GLN A C    4  
ATOM 5634  O O    . GLN A 1 73  ? 1.325   11.018  -2.283  1.00 0.00 ? 856 GLN A O    4  
ATOM 5635  C CB   . GLN A 1 73  ? -0.447  11.690  -5.090  1.00 0.00 ? 856 GLN A CB   4  
ATOM 5636  C CG   . GLN A 1 73  ? -0.474  13.143  -4.645  1.00 0.00 ? 856 GLN A CG   4  
ATOM 5637  C CD   . GLN A 1 73  ? -1.300  14.020  -5.565  1.00 0.00 ? 856 GLN A CD   4  
ATOM 5638  O OE1  . GLN A 1 73  ? -2.525  13.908  -5.615  1.00 0.00 ? 856 GLN A OE1  4  
ATOM 5639  N NE2  . GLN A 1 73  ? -0.632  14.901  -6.301  1.00 0.00 ? 856 GLN A NE2  4  
ATOM 5640  H H    . GLN A 1 73  ? 0.569   9.708   -6.337  1.00 0.00 ? 856 GLN A H    4  
ATOM 5641  H HA   . GLN A 1 73  ? 1.654   11.576  -4.704  1.00 0.00 ? 856 GLN A HA   4  
ATOM 5642  H HB2  . GLN A 1 73  ? -0.485  11.665  -6.169  1.00 0.00 ? 856 GLN A HB2  4  
ATOM 5643  H HB3  . GLN A 1 73  ? -1.325  11.199  -4.696  1.00 0.00 ? 856 GLN A HB3  4  
ATOM 5644  H HG2  . GLN A 1 73  ? -0.895  13.194  -3.652  1.00 0.00 ? 856 GLN A HG2  4  
ATOM 5645  H HG3  . GLN A 1 73  ? 0.538   13.518  -4.626  1.00 0.00 ? 856 GLN A HG3  4  
ATOM 5646  H HE21 . GLN A 1 73  ? 0.344   14.934  -6.210  1.00 0.00 ? 856 GLN A HE21 4  
ATOM 5647  H HE22 . GLN A 1 73  ? -1.140  15.480  -6.905  1.00 0.00 ? 856 GLN A HE22 4  
ATOM 5648  N N    . ALA A 1 74  ? -0.292  9.588   -2.918  1.00 0.00 ? 857 ALA A N    4  
ATOM 5649  C CA   . ALA A 1 74  ? -0.545  9.102   -1.568  1.00 0.00 ? 857 ALA A CA   4  
ATOM 5650  C C    . ALA A 1 74  ? 0.722   8.527   -0.944  1.00 0.00 ? 857 ALA A C    4  
ATOM 5651  O O    . ALA A 1 74  ? 0.935   8.633   0.264   1.00 0.00 ? 857 ALA A O    4  
ATOM 5652  C CB   . ALA A 1 74  ? -1.650  8.056   -1.582  1.00 0.00 ? 857 ALA A CB   4  
ATOM 5653  H H    . ALA A 1 74  ? -0.813  9.222   -3.663  1.00 0.00 ? 857 ALA A H    4  
ATOM 5654  H HA   . ALA A 1 74  ? -0.881  9.937   -0.970  1.00 0.00 ? 857 ALA A HA   4  
ATOM 5655  H HB1  . ALA A 1 74  ? -2.602  8.542   -1.742  1.00 0.00 ? 857 ALA A HB1  4  
ATOM 5656  H HB2  . ALA A 1 74  ? -1.467  7.350   -2.377  1.00 0.00 ? 857 ALA A HB2  4  
ATOM 5657  H HB3  . ALA A 1 74  ? -1.666  7.537   -0.635  1.00 0.00 ? 857 ALA A HB3  4  
ATOM 5658  N N    . VAL A 1 75  ? 1.561   7.917   -1.776  1.00 0.00 ? 858 VAL A N    4  
ATOM 5659  C CA   . VAL A 1 75  ? 2.808   7.325   -1.306  1.00 0.00 ? 858 VAL A CA   4  
ATOM 5660  C C    . VAL A 1 75  ? 3.782   8.399   -0.834  1.00 0.00 ? 858 VAL A C    4  
ATOM 5661  O O    . VAL A 1 75  ? 4.462   8.233   0.178   1.00 0.00 ? 858 VAL A O    4  
ATOM 5662  C CB   . VAL A 1 75  ? 3.481   6.485   -2.407  1.00 0.00 ? 858 VAL A CB   4  
ATOM 5663  C CG1  . VAL A 1 75  ? 4.806   5.922   -1.916  1.00 0.00 ? 858 VAL A CG1  4  
ATOM 5664  C CG2  . VAL A 1 75  ? 2.555   5.368   -2.865  1.00 0.00 ? 858 VAL A CG2  4  
ATOM 5665  H H    . VAL A 1 75  ? 1.336   7.865   -2.728  1.00 0.00 ? 858 VAL A H    4  
ATOM 5666  H HA   . VAL A 1 75  ? 2.576   6.674   -0.476  1.00 0.00 ? 858 VAL A HA   4  
ATOM 5667  H HB   . VAL A 1 75  ? 3.679   7.128   -3.252  1.00 0.00 ? 858 VAL A HB   4  
ATOM 5668  H HG11 . VAL A 1 75  ? 5.441   5.706   -2.762  1.00 0.00 ? 858 VAL A HG11 4  
ATOM 5669  H HG12 . VAL A 1 75  ? 5.289   6.646   -1.276  1.00 0.00 ? 858 VAL A HG12 4  
ATOM 5670  H HG13 . VAL A 1 75  ? 4.626   5.013   -1.360  1.00 0.00 ? 858 VAL A HG13 4  
ATOM 5671  H HG21 . VAL A 1 75  ? 1.695   5.324   -2.213  1.00 0.00 ? 858 VAL A HG21 4  
ATOM 5672  H HG22 . VAL A 1 75  ? 2.229   5.562   -3.877  1.00 0.00 ? 858 VAL A HG22 4  
ATOM 5673  H HG23 . VAL A 1 75  ? 3.082   4.426   -2.831  1.00 0.00 ? 858 VAL A HG23 4  
ATOM 5674  N N    . MET A 1 76  ? 3.844   9.500   -1.575  1.00 0.00 ? 859 MET A N    4  
ATOM 5675  C CA   . MET A 1 76  ? 4.735   10.603  -1.232  1.00 0.00 ? 859 MET A CA   4  
ATOM 5676  C C    . MET A 1 76  ? 4.264   11.307  0.037   1.00 0.00 ? 859 MET A C    4  
ATOM 5677  O O    . MET A 1 76  ? 5.074   11.795  0.826   1.00 0.00 ? 859 MET A O    4  
ATOM 5678  C CB   . MET A 1 76  ? 4.811   11.604  -2.386  1.00 0.00 ? 859 MET A CB   4  
ATOM 5679  C CG   . MET A 1 76  ? 5.868   11.257  -3.423  1.00 0.00 ? 859 MET A CG   4  
ATOM 5680  S SD   . MET A 1 76  ? 7.539   11.286  -2.747  1.00 0.00 ? 859 MET A SD   4  
ATOM 5681  C CE   . MET A 1 76  ? 8.389   10.212  -3.901  1.00 0.00 ? 859 MET A CE   4  
ATOM 5682  H H    . MET A 1 76  ? 3.278   9.574   -2.371  1.00 0.00 ? 859 MET A H    4  
ATOM 5683  H HA   . MET A 1 76  ? 5.718   10.192  -1.058  1.00 0.00 ? 859 MET A HA   4  
ATOM 5684  H HB2  . MET A 1 76  ? 3.852   11.640  -2.880  1.00 0.00 ? 859 MET A HB2  4  
ATOM 5685  H HB3  . MET A 1 76  ? 5.038   12.581  -1.986  1.00 0.00 ? 859 MET A HB3  4  
ATOM 5686  H HG2  . MET A 1 76  ? 5.667   10.268  -3.805  1.00 0.00 ? 859 MET A HG2  4  
ATOM 5687  H HG3  . MET A 1 76  ? 5.808   11.972  -4.230  1.00 0.00 ? 859 MET A HG3  4  
ATOM 5688  H HE1  . MET A 1 76  ? 7.794   9.329   -4.078  1.00 0.00 ? 859 MET A HE1  4  
ATOM 5689  H HE2  . MET A 1 76  ? 8.542   10.736  -4.834  1.00 0.00 ? 859 MET A HE2  4  
ATOM 5690  H HE3  . MET A 1 76  ? 9.346   9.926   -3.488  1.00 0.00 ? 859 MET A HE3  4  
ATOM 5691  N N    . LYS A 1 77  ? 2.950   11.356  0.228   1.00 0.00 ? 860 LYS A N    4  
ATOM 5692  C CA   . LYS A 1 77  ? 2.371   11.999  1.401   1.00 0.00 ? 860 LYS A CA   4  
ATOM 5693  C C    . LYS A 1 77  ? 2.466   11.091  2.623   1.00 0.00 ? 860 LYS A C    4  
ATOM 5694  O O    . LYS A 1 77  ? 3.060   11.458  3.636   1.00 0.00 ? 860 LYS A O    4  
ATOM 5695  C CB   . LYS A 1 77  ? 0.909   12.366  1.138   1.00 0.00 ? 860 LYS A CB   4  
ATOM 5696  C CG   . LYS A 1 77  ? 0.736   13.658  0.359   1.00 0.00 ? 860 LYS A CG   4  
ATOM 5697  C CD   . LYS A 1 77  ? 0.743   14.868  1.277   1.00 0.00 ? 860 LYS A CD   4  
ATOM 5698  C CE   . LYS A 1 77  ? 2.154   15.224  1.720   1.00 0.00 ? 860 LYS A CE   4  
ATOM 5699  N NZ   . LYS A 1 77  ? 2.297   16.680  2.001   1.00 0.00 ? 860 LYS A NZ   4  
ATOM 5700  H H    . LYS A 1 77  ? 2.355   10.949  -0.436  1.00 0.00 ? 860 LYS A H    4  
ATOM 5701  H HA   . LYS A 1 77  ? 2.930   12.902  1.595   1.00 0.00 ? 860 LYS A HA   4  
ATOM 5702  H HB2  . LYS A 1 77  ? 0.446   11.567  0.577   1.00 0.00 ? 860 LYS A HB2  4  
ATOM 5703  H HB3  . LYS A 1 77  ? 0.400   12.471  2.085   1.00 0.00 ? 860 LYS A HB3  4  
ATOM 5704  H HG2  . LYS A 1 77  ? 1.547   13.752  -0.349  1.00 0.00 ? 860 LYS A HG2  4  
ATOM 5705  H HG3  . LYS A 1 77  ? -0.205  13.625  -0.171  1.00 0.00 ? 860 LYS A HG3  4  
ATOM 5706  H HD2  . LYS A 1 77  ? 0.320   15.711  0.752   1.00 0.00 ? 860 LYS A HD2  4  
ATOM 5707  H HD3  . LYS A 1 77  ? 0.146   14.649  2.151   1.00 0.00 ? 860 LYS A HD3  4  
ATOM 5708  H HE2  . LYS A 1 77  ? 2.388   14.669  2.615   1.00 0.00 ? 860 LYS A HE2  4  
ATOM 5709  H HE3  . LYS A 1 77  ? 2.843   14.949  0.935   1.00 0.00 ? 860 LYS A HE3  4  
ATOM 5710  H HZ1  . LYS A 1 77  ? 1.456   17.030  2.503   1.00 0.00 ? 860 LYS A HZ1  4  
ATOM 5711  H HZ2  . LYS A 1 77  ? 2.400   17.207  1.111   1.00 0.00 ? 860 LYS A HZ2  4  
ATOM 5712  H HZ3  . LYS A 1 77  ? 3.136   16.849  2.592   1.00 0.00 ? 860 LYS A HZ3  4  
ATOM 5713  N N    . MET A 1 78  ? 1.879   9.903   2.519   1.00 0.00 ? 861 MET A N    4  
ATOM 5714  C CA   . MET A 1 78  ? 1.900   8.942   3.615   1.00 0.00 ? 861 MET A CA   4  
ATOM 5715  C C    . MET A 1 78  ? 3.333   8.568   3.982   1.00 0.00 ? 861 MET A C    4  
ATOM 5716  O O    . MET A 1 78  ? 3.685   8.504   5.160   1.00 0.00 ? 861 MET A O    4  
ATOM 5717  C CB   . MET A 1 78  ? 1.115   7.685   3.234   1.00 0.00 ? 861 MET A CB   4  
ATOM 5718  C CG   . MET A 1 78  ? -0.373  7.931   3.048   1.00 0.00 ? 861 MET A CG   4  
ATOM 5719  S SD   . MET A 1 78  ? -1.362  6.447   3.319   1.00 0.00 ? 861 MET A SD   4  
ATOM 5720  C CE   . MET A 1 78  ? -3.012  7.085   3.042   1.00 0.00 ? 861 MET A CE   4  
ATOM 5721  H H    . MET A 1 78  ? 1.420   9.667   1.685   1.00 0.00 ? 861 MET A H    4  
ATOM 5722  H HA   . MET A 1 78  ? 1.430   9.404   4.470   1.00 0.00 ? 861 MET A HA   4  
ATOM 5723  H HB2  . MET A 1 78  ? 1.512   7.293   2.309   1.00 0.00 ? 861 MET A HB2  4  
ATOM 5724  H HB3  . MET A 1 78  ? 1.241   6.946   4.012   1.00 0.00 ? 861 MET A HB3  4  
ATOM 5725  H HG2  . MET A 1 78  ? -0.690  8.689   3.749   1.00 0.00 ? 861 MET A HG2  4  
ATOM 5726  H HG3  . MET A 1 78  ? -0.543  8.282   2.041   1.00 0.00 ? 861 MET A HG3  4  
ATOM 5727  H HE1  . MET A 1 78  ? -3.691  6.653   3.762   1.00 0.00 ? 861 MET A HE1  4  
ATOM 5728  H HE2  . MET A 1 78  ? -3.006  8.159   3.152   1.00 0.00 ? 861 MET A HE2  4  
ATOM 5729  H HE3  . MET A 1 78  ? -3.335  6.827   2.043   1.00 0.00 ? 861 MET A HE3  4  
ATOM 5730  N N    . ASP A 1 79  ? 4.155   8.324   2.968   1.00 0.00 ? 862 ASP A N    4  
ATOM 5731  C CA   . ASP A 1 79  ? 5.550   7.958   3.184   1.00 0.00 ? 862 ASP A CA   4  
ATOM 5732  C C    . ASP A 1 79  ? 6.119   8.682   4.400   1.00 0.00 ? 862 ASP A C    4  
ATOM 5733  O O    . ASP A 1 79  ? 6.443   9.867   4.334   1.00 0.00 ? 862 ASP A O    4  
ATOM 5734  C CB   . ASP A 1 79  ? 6.383   8.284   1.944   1.00 0.00 ? 862 ASP A CB   4  
ATOM 5735  C CG   . ASP A 1 79  ? 7.840   8.541   2.277   1.00 0.00 ? 862 ASP A CG   4  
ATOM 5736  O OD1  . ASP A 1 79  ? 8.602   7.560   2.402   1.00 0.00 ? 862 ASP A OD1  4  
ATOM 5737  O OD2  . ASP A 1 79  ? 8.218   9.723   2.412   1.00 0.00 ? 862 ASP A OD2  4  
ATOM 5738  H H    . ASP A 1 79  ? 3.815   8.392   2.050   1.00 0.00 ? 862 ASP A H    4  
ATOM 5739  H HA   . ASP A 1 79  ? 5.589   6.894   3.364   1.00 0.00 ? 862 ASP A HA   4  
ATOM 5740  H HB2  . ASP A 1 79  ? 6.332   7.454   1.255   1.00 0.00 ? 862 ASP A HB2  4  
ATOM 5741  H HB3  . ASP A 1 79  ? 5.980   9.166   1.469   1.00 0.00 ? 862 ASP A HB3  4  
ATOM 5742  N N    . GLY A 1 80  ? 6.236   7.961   5.511   1.00 0.00 ? 863 GLY A N    4  
ATOM 5743  C CA   . GLY A 1 80  ? 6.765   8.552   6.727   1.00 0.00 ? 863 GLY A CA   4  
ATOM 5744  C C    . GLY A 1 80  ? 5.820   9.569   7.336   1.00 0.00 ? 863 GLY A C    4  
ATOM 5745  O O    . GLY A 1 80  ? 6.231   10.674  7.690   1.00 0.00 ? 863 GLY A O    4  
ATOM 5746  H H    . GLY A 1 80  ? 5.962   7.021   5.506   1.00 0.00 ? 863 GLY A H    4  
ATOM 5747  H HA2  . GLY A 1 80  ? 6.946   7.768   7.446   1.00 0.00 ? 863 GLY A HA2  4  
ATOM 5748  H HA3  . GLY A 1 80  ? 7.701   9.040   6.498   1.00 0.00 ? 863 GLY A HA3  4  
ATOM 5749  N N    . MET A 1 81  ? 4.550   9.197   7.456   1.00 0.00 ? 864 MET A N    4  
ATOM 5750  C CA   . MET A 1 81  ? 3.544   10.086  8.026   1.00 0.00 ? 864 MET A CA   4  
ATOM 5751  C C    . MET A 1 81  ? 3.214   9.685   9.460   1.00 0.00 ? 864 MET A C    4  
ATOM 5752  O O    . MET A 1 81  ? 3.515   8.570   9.890   1.00 0.00 ? 864 MET A O    4  
ATOM 5753  C CB   . MET A 1 81  ? 2.274   10.066  7.174   1.00 0.00 ? 864 MET A CB   4  
ATOM 5754  C CG   . MET A 1 81  ? 1.485   8.771   7.288   1.00 0.00 ? 864 MET A CG   4  
ATOM 5755  S SD   . MET A 1 81  ? -0.172  8.903   6.588   1.00 0.00 ? 864 MET A SD   4  
ATOM 5756  C CE   . MET A 1 81  ? -0.892  10.148  7.656   1.00 0.00 ? 864 MET A CE   4  
ATOM 5757  H H    . MET A 1 81  ? 4.282   8.303   7.155   1.00 0.00 ? 864 MET A H    4  
ATOM 5758  H HA   . MET A 1 81  ? 3.950   11.086  8.028   1.00 0.00 ? 864 MET A HA   4  
ATOM 5759  H HB2  . MET A 1 81  ? 1.635   10.880  7.482   1.00 0.00 ? 864 MET A HB2  4  
ATOM 5760  H HB3  . MET A 1 81  ? 2.546   10.205  6.138   1.00 0.00 ? 864 MET A HB3  4  
ATOM 5761  H HG2  . MET A 1 81  ? 2.020   7.992   6.765   1.00 0.00 ? 864 MET A HG2  4  
ATOM 5762  H HG3  . MET A 1 81  ? 1.401   8.509   8.332   1.00 0.00 ? 864 MET A HG3  4  
ATOM 5763  H HE1  . MET A 1 81  ? -0.995  11.075  7.110   1.00 0.00 ? 864 MET A HE1  4  
ATOM 5764  H HE2  . MET A 1 81  ? -1.864  9.817   7.990   1.00 0.00 ? 864 MET A HE2  4  
ATOM 5765  H HE3  . MET A 1 81  ? -0.250  10.304  8.511   1.00 0.00 ? 864 MET A HE3  4  
ATOM 5766  N N    . THR A 1 82  ? 2.595   10.600  10.198  1.00 0.00 ? 865 THR A N    4  
ATOM 5767  C CA   . THR A 1 82  ? 2.226   10.343  11.585  1.00 0.00 ? 865 THR A CA   4  
ATOM 5768  C C    . THR A 1 82  ? 0.755   9.960   11.700  1.00 0.00 ? 865 THR A C    4  
ATOM 5769  O O    . THR A 1 82  ? -0.114  10.615  11.123  1.00 0.00 ? 865 THR A O    4  
ATOM 5770  C CB   . THR A 1 82  ? 2.496   11.570  12.475  1.00 0.00 ? 865 THR A CB   4  
ATOM 5771  O OG1  . THR A 1 82  ? 3.778   12.127  12.165  1.00 0.00 ? 865 THR A OG1  4  
ATOM 5772  C CG2  . THR A 1 82  ? 2.444   11.192  13.948  1.00 0.00 ? 865 THR A CG2  4  
ATOM 5773  H H    . THR A 1 82  ? 2.382   11.470  9.800   1.00 0.00 ? 865 THR A H    4  
ATOM 5774  H HA   . THR A 1 82  ? 2.831   9.523   11.944  1.00 0.00 ? 865 THR A HA   4  
ATOM 5775  H HB   . THR A 1 82  ? 1.733   12.311  12.282  1.00 0.00 ? 865 THR A HB   4  
ATOM 5776  H HG1  . THR A 1 82  ? 4.432   11.790  12.783  1.00 0.00 ? 865 THR A HG1  4  
ATOM 5777  H HG21 . THR A 1 82  ? 3.095   11.845  14.510  1.00 0.00 ? 865 THR A HG21 4  
ATOM 5778  H HG22 . THR A 1 82  ? 2.768   10.169  14.068  1.00 0.00 ? 865 THR A HG22 4  
ATOM 5779  H HG23 . THR A 1 82  ? 1.432   11.294  14.310  1.00 0.00 ? 865 THR A HG23 4  
ATOM 5780  N N    . ILE A 1 83  ? 0.482   8.896   12.448  1.00 0.00 ? 866 ILE A N    4  
ATOM 5781  C CA   . ILE A 1 83  ? -0.885  8.427   12.640  1.00 0.00 ? 866 ILE A CA   4  
ATOM 5782  C C    . ILE A 1 83  ? -1.085  7.879   14.049  1.00 0.00 ? 866 ILE A C    4  
ATOM 5783  O O    . ILE A 1 83  ? -0.589  6.804   14.386  1.00 0.00 ? 866 ILE A O    4  
ATOM 5784  C CB   . ILE A 1 83  ? -1.254  7.335   11.619  1.00 0.00 ? 866 ILE A CB   4  
ATOM 5785  C CG1  . ILE A 1 83  ? -1.164  7.886   10.194  1.00 0.00 ? 866 ILE A CG1  4  
ATOM 5786  C CG2  . ILE A 1 83  ? -2.650  6.799   11.899  1.00 0.00 ? 866 ILE A CG2  4  
ATOM 5787  C CD1  . ILE A 1 83  ? -1.092  6.810   9.134   1.00 0.00 ? 866 ILE A CD1  4  
ATOM 5788  H H    . ILE A 1 83  ? 1.217   8.415   12.882  1.00 0.00 ? 866 ILE A H    4  
ATOM 5789  H HA   . ILE A 1 83  ? -1.548  9.267   12.494  1.00 0.00 ? 866 ILE A HA   4  
ATOM 5790  H HB   . ILE A 1 83  ? -0.553  6.521   11.727  1.00 0.00 ? 866 ILE A HB   4  
ATOM 5791  H HG12 . ILE A 1 83  ? -2.035  8.491   9.994   1.00 0.00 ? 866 ILE A HG12 4  
ATOM 5792  H HG13 . ILE A 1 83  ? -0.278  8.498   10.109  1.00 0.00 ? 866 ILE A HG13 4  
ATOM 5793  H HG21 . ILE A 1 83  ? -2.585  5.967   12.584  1.00 0.00 ? 866 ILE A HG21 4  
ATOM 5794  H HG22 . ILE A 1 83  ? -3.254  7.579   12.337  1.00 0.00 ? 866 ILE A HG22 4  
ATOM 5795  H HG23 . ILE A 1 83  ? -3.101  6.469   10.975  1.00 0.00 ? 866 ILE A HG23 4  
ATOM 5796  H HD11 . ILE A 1 83  ? -0.298  7.042   8.439   1.00 0.00 ? 866 ILE A HD11 4  
ATOM 5797  H HD12 . ILE A 1 83  ? -0.896  5.856   9.600   1.00 0.00 ? 866 ILE A HD12 4  
ATOM 5798  H HD13 . ILE A 1 83  ? -2.032  6.765   8.602   1.00 0.00 ? 866 ILE A HD13 4  
ATOM 5799  N N    . LYS A 1 84  ? -1.819  8.625   14.868  1.00 0.00 ? 867 LYS A N    4  
ATOM 5800  C CA   . LYS A 1 84  ? -2.089  8.214   16.241  1.00 0.00 ? 867 LYS A CA   4  
ATOM 5801  C C    . LYS A 1 84  ? -0.792  8.065   17.030  1.00 0.00 ? 867 LYS A C    4  
ATOM 5802  O O    . LYS A 1 84  ? -0.664  7.171   17.866  1.00 0.00 ? 867 LYS A O    4  
ATOM 5803  C CB   . LYS A 1 84  ? -2.863  6.894   16.257  1.00 0.00 ? 867 LYS A CB   4  
ATOM 5804  C CG   . LYS A 1 84  ? -3.947  6.811   15.195  1.00 0.00 ? 867 LYS A CG   4  
ATOM 5805  C CD   . LYS A 1 84  ? -5.270  7.356   15.705  1.00 0.00 ? 867 LYS A CD   4  
ATOM 5806  C CE   . LYS A 1 84  ? -5.398  8.848   15.442  1.00 0.00 ? 867 LYS A CE   4  
ATOM 5807  N NZ   . LYS A 1 84  ? -5.975  9.126   14.097  1.00 0.00 ? 867 LYS A NZ   4  
ATOM 5808  H H    . LYS A 1 84  ? -2.188  9.473   14.542  1.00 0.00 ? 867 LYS A H    4  
ATOM 5809  H HA   . LYS A 1 84  ? -2.692  8.981   16.704  1.00 0.00 ? 867 LYS A HA   4  
ATOM 5810  H HB2  . LYS A 1 84  ? -2.169  6.082   16.098  1.00 0.00 ? 867 LYS A HB2  4  
ATOM 5811  H HB3  . LYS A 1 84  ? -3.328  6.775   17.225  1.00 0.00 ? 867 LYS A HB3  4  
ATOM 5812  H HG2  . LYS A 1 84  ? -3.640  7.388   14.335  1.00 0.00 ? 867 LYS A HG2  4  
ATOM 5813  H HG3  . LYS A 1 84  ? -4.079  5.778   14.909  1.00 0.00 ? 867 LYS A HG3  4  
ATOM 5814  H HD2  . LYS A 1 84  ? -6.078  6.843   15.205  1.00 0.00 ? 867 LYS A HD2  4  
ATOM 5815  H HD3  . LYS A 1 84  ? -5.335  7.180   16.770  1.00 0.00 ? 867 LYS A HD3  4  
ATOM 5816  H HE2  . LYS A 1 84  ? -6.038  9.280   16.195  1.00 0.00 ? 867 LYS A HE2  4  
ATOM 5817  H HE3  . LYS A 1 84  ? -4.417  9.296   15.503  1.00 0.00 ? 867 LYS A HE3  4  
ATOM 5818  H HZ1  . LYS A 1 84  ? -6.185  10.141  14.002  1.00 0.00 ? 867 LYS A HZ1  4  
ATOM 5819  H HZ2  . LYS A 1 84  ? -6.855  8.589   13.968  1.00 0.00 ? 867 LYS A HZ2  4  
ATOM 5820  H HZ3  . LYS A 1 84  ? -5.301  8.851   13.355  1.00 0.00 ? 867 LYS A HZ3  4  
ATOM 5821  N N    . GLU A 1 85  ? 0.165   8.946   16.759  1.00 0.00 ? 868 GLU A N    4  
ATOM 5822  C CA   . GLU A 1 85  ? 1.451   8.911   17.445  1.00 0.00 ? 868 GLU A CA   4  
ATOM 5823  C C    . GLU A 1 85  ? 2.281   7.716   16.984  1.00 0.00 ? 868 GLU A C    4  
ATOM 5824  O O    . GLU A 1 85  ? 2.837   6.982   17.799  1.00 0.00 ? 868 GLU A O    4  
ATOM 5825  C CB   . GLU A 1 85  ? 1.245   8.849   18.959  1.00 0.00 ? 868 GLU A CB   4  
ATOM 5826  C CG   . GLU A 1 85  ? 2.401   9.431   19.756  1.00 0.00 ? 868 GLU A CG   4  
ATOM 5827  C CD   . GLU A 1 85  ? 2.464   10.944  19.670  1.00 0.00 ? 868 GLU A CD   4  
ATOM 5828  O OE1  . GLU A 1 85  ? 1.458   11.600  20.012  1.00 0.00 ? 868 GLU A OE1  4  
ATOM 5829  O OE2  . GLU A 1 85  ? 3.520   11.472  19.262  1.00 0.00 ? 868 GLU A OE2  4  
ATOM 5830  H H    . GLU A 1 85  ? 0.003   9.635   16.081  1.00 0.00 ? 868 GLU A H    4  
ATOM 5831  H HA   . GLU A 1 85  ? 1.982   9.819   17.200  1.00 0.00 ? 868 GLU A HA   4  
ATOM 5832  H HB2  . GLU A 1 85  ? 0.349   9.396   19.212  1.00 0.00 ? 868 GLU A HB2  4  
ATOM 5833  H HB3  . GLU A 1 85  ? 1.119   7.816   19.251  1.00 0.00 ? 868 GLU A HB3  4  
ATOM 5834  H HG2  . GLU A 1 85  ? 2.286   9.149   20.792  1.00 0.00 ? 868 GLU A HG2  4  
ATOM 5835  H HG3  . GLU A 1 85  ? 3.326   9.024   19.374  1.00 0.00 ? 868 GLU A HG3  4  
ATOM 5836  N N    . ASN A 1 86  ? 2.360   7.529   15.670  1.00 0.00 ? 869 ASN A N    4  
ATOM 5837  C CA   . ASN A 1 86  ? 3.121   6.423   15.100  1.00 0.00 ? 869 ASN A CA   4  
ATOM 5838  C C    . ASN A 1 86  ? 3.541   6.735   13.667  1.00 0.00 ? 869 ASN A C    4  
ATOM 5839  O O    . ASN A 1 86  ? 2.710   6.770   12.759  1.00 0.00 ? 869 ASN A O    4  
ATOM 5840  C CB   . ASN A 1 86  ? 2.293   5.137   15.133  1.00 0.00 ? 869 ASN A CB   4  
ATOM 5841  C CG   . ASN A 1 86  ? 3.149   3.894   14.986  1.00 0.00 ? 869 ASN A CG   4  
ATOM 5842  O OD1  . ASN A 1 86  ? 3.672   3.611   13.908  1.00 0.00 ? 869 ASN A OD1  4  
ATOM 5843  N ND2  . ASN A 1 86  ? 3.296   3.145   16.072  1.00 0.00 ? 869 ASN A ND2  4  
ATOM 5844  H H    . ASN A 1 86  ? 1.895   8.149   15.070  1.00 0.00 ? 869 ASN A H    4  
ATOM 5845  H HA   . ASN A 1 86  ? 4.007   6.286   15.701  1.00 0.00 ? 869 ASN A HA   4  
ATOM 5846  H HB2  . ASN A 1 86  ? 1.767   5.079   16.074  1.00 0.00 ? 869 ASN A HB2  4  
ATOM 5847  H HB3  . ASN A 1 86  ? 1.576   5.156   14.325  1.00 0.00 ? 869 ASN A HB3  4  
ATOM 5848  H HD21 . ASN A 1 86  ? 2.850   3.432   16.897  1.00 0.00 ? 869 ASN A HD21 4  
ATOM 5849  H HD22 . ASN A 1 86  ? 3.846   2.337   16.006  1.00 0.00 ? 869 ASN A HD22 4  
ATOM 5850  N N    . ILE A 1 87  ? 4.836   6.958   13.471  1.00 0.00 ? 870 ILE A N    4  
ATOM 5851  C CA   . ILE A 1 87  ? 5.367   7.265   12.149  1.00 0.00 ? 870 ILE A CA   4  
ATOM 5852  C C    . ILE A 1 87  ? 5.321   6.040   11.241  1.00 0.00 ? 870 ILE A C    4  
ATOM 5853  O O    . ILE A 1 87  ? 6.152   5.139   11.354  1.00 0.00 ? 870 ILE A O    4  
ATOM 5854  C CB   . ILE A 1 87  ? 6.818   7.776   12.229  1.00 0.00 ? 870 ILE A CB   4  
ATOM 5855  C CG1  . ILE A 1 87  ? 6.840   9.251   12.632  1.00 0.00 ? 870 ILE A CG1  4  
ATOM 5856  C CG2  . ILE A 1 87  ? 7.524   7.574   10.897  1.00 0.00 ? 870 ILE A CG2  4  
ATOM 5857  C CD1  . ILE A 1 87  ? 6.373   9.498   14.050  1.00 0.00 ? 870 ILE A CD1  4  
ATOM 5858  H H    . ILE A 1 87  ? 5.449   6.916   14.234  1.00 0.00 ? 870 ILE A H    4  
ATOM 5859  H HA   . ILE A 1 87  ? 4.755   8.043   11.717  1.00 0.00 ? 870 ILE A HA   4  
ATOM 5860  H HB   . ILE A 1 87  ? 7.339   7.197   12.977  1.00 0.00 ? 870 ILE A HB   4  
ATOM 5861  H HG12 . ILE A 1 87  ? 7.847   9.627   12.546  1.00 0.00 ? 870 ILE A HG12 4  
ATOM 5862  H HG13 . ILE A 1 87  ? 6.195   9.808   11.968  1.00 0.00 ? 870 ILE A HG13 4  
ATOM 5863  H HG21 . ILE A 1 87  ? 8.319   8.299   10.798  1.00 0.00 ? 870 ILE A HG21 4  
ATOM 5864  H HG22 . ILE A 1 87  ? 7.940   6.578   10.857  1.00 0.00 ? 870 ILE A HG22 4  
ATOM 5865  H HG23 . ILE A 1 87  ? 6.818   7.702   10.091  1.00 0.00 ? 870 ILE A HG23 4  
ATOM 5866  H HD11 . ILE A 1 87  ? 5.390   9.072   14.184  1.00 0.00 ? 870 ILE A HD11 4  
ATOM 5867  H HD12 . ILE A 1 87  ? 7.063   9.039   14.741  1.00 0.00 ? 870 ILE A HD12 4  
ATOM 5868  H HD13 . ILE A 1 87  ? 6.332   10.562  14.235  1.00 0.00 ? 870 ILE A HD13 4  
ATOM 5869  N N    . ILE A 1 88  ? 4.345   6.016   10.339  1.00 0.00 ? 871 ILE A N    4  
ATOM 5870  C CA   . ILE A 1 88  ? 4.192   4.904   9.410   1.00 0.00 ? 871 ILE A CA   4  
ATOM 5871  C C    . ILE A 1 88  ? 4.959   5.159   8.116   1.00 0.00 ? 871 ILE A C    4  
ATOM 5872  O O    . ILE A 1 88  ? 5.033   6.291   7.639   1.00 0.00 ? 871 ILE A O    4  
ATOM 5873  C CB   . ILE A 1 88  ? 2.711   4.650   9.074   1.00 0.00 ? 871 ILE A CB   4  
ATOM 5874  C CG1  . ILE A 1 88  ? 2.226   5.649   8.021   1.00 0.00 ? 871 ILE A CG1  4  
ATOM 5875  C CG2  . ILE A 1 88  ? 1.859   4.742   10.331  1.00 0.00 ? 871 ILE A CG2  4  
ATOM 5876  C CD1  . ILE A 1 88  ? 2.635   5.287   6.610   1.00 0.00 ? 871 ILE A CD1  4  
ATOM 5877  H H    . ILE A 1 88  ? 3.713   6.764   10.298  1.00 0.00 ? 871 ILE A H    4  
ATOM 5878  H HA   . ILE A 1 88  ? 4.590   4.017   9.882   1.00 0.00 ? 871 ILE A HA   4  
ATOM 5879  H HB   . ILE A 1 88  ? 2.620   3.650   8.679   1.00 0.00 ? 871 ILE A HB   4  
ATOM 5880  H HG12 . ILE A 1 88  ? 1.149   5.699   8.050   1.00 0.00 ? 871 ILE A HG12 4  
ATOM 5881  H HG13 . ILE A 1 88  ? 2.634   6.624   8.246   1.00 0.00 ? 871 ILE A HG13 4  
ATOM 5882  H HG21 . ILE A 1 88  ? 0.838   4.964   10.058  1.00 0.00 ? 871 ILE A HG21 4  
ATOM 5883  H HG22 . ILE A 1 88  ? 1.893   3.801   10.858  1.00 0.00 ? 871 ILE A HG22 4  
ATOM 5884  H HG23 . ILE A 1 88  ? 2.240   5.526   10.968  1.00 0.00 ? 871 ILE A HG23 4  
ATOM 5885  H HD11 . ILE A 1 88  ? 3.229   6.086   6.191   1.00 0.00 ? 871 ILE A HD11 4  
ATOM 5886  H HD12 . ILE A 1 88  ? 3.215   4.377   6.626   1.00 0.00 ? 871 ILE A HD12 4  
ATOM 5887  H HD13 . ILE A 1 88  ? 1.752   5.140   6.006   1.00 0.00 ? 871 ILE A HD13 4  
ATOM 5888  N N    . LYS A 1 89  ? 5.526   4.098   7.552   1.00 0.00 ? 872 LYS A N    4  
ATOM 5889  C CA   . LYS A 1 89  ? 6.285   4.205   6.312   1.00 0.00 ? 872 LYS A CA   4  
ATOM 5890  C C    . LYS A 1 89  ? 5.495   3.632   5.140   1.00 0.00 ? 872 LYS A C    4  
ATOM 5891  O O    . LYS A 1 89  ? 4.775   2.644   5.287   1.00 0.00 ? 872 LYS A O    4  
ATOM 5892  C CB   . LYS A 1 89  ? 7.624   3.475   6.444   1.00 0.00 ? 872 LYS A CB   4  
ATOM 5893  C CG   . LYS A 1 89  ? 8.658   3.912   5.421   1.00 0.00 ? 872 LYS A CG   4  
ATOM 5894  C CD   . LYS A 1 89  ? 9.713   2.840   5.203   1.00 0.00 ? 872 LYS A CD   4  
ATOM 5895  C CE   . LYS A 1 89  ? 9.185   1.705   4.340   1.00 0.00 ? 872 LYS A CE   4  
ATOM 5896  N NZ   . LYS A 1 89  ? 10.254  0.728   3.993   1.00 0.00 ? 872 LYS A NZ   4  
ATOM 5897  H H    . LYS A 1 89  ? 5.432   3.221   7.981   1.00 0.00 ? 872 LYS A H    4  
ATOM 5898  H HA   . LYS A 1 89  ? 6.472   5.252   6.126   1.00 0.00 ? 872 LYS A HA   4  
ATOM 5899  H HB2  . LYS A 1 89  ? 8.024   3.658   7.431   1.00 0.00 ? 872 LYS A HB2  4  
ATOM 5900  H HB3  . LYS A 1 89  ? 7.455   2.415   6.324   1.00 0.00 ? 872 LYS A HB3  4  
ATOM 5901  H HG2  . LYS A 1 89  ? 8.162   4.109   4.482   1.00 0.00 ? 872 LYS A HG2  4  
ATOM 5902  H HG3  . LYS A 1 89  ? 9.140   4.813   5.772   1.00 0.00 ? 872 LYS A HG3  4  
ATOM 5903  H HD2  . LYS A 1 89  ? 10.568  3.283   4.713   1.00 0.00 ? 872 LYS A HD2  4  
ATOM 5904  H HD3  . LYS A 1 89  ? 10.013  2.442   6.163   1.00 0.00 ? 872 LYS A HD3  4  
ATOM 5905  H HE2  . LYS A 1 89  ? 8.403   1.193   4.879   1.00 0.00 ? 872 LYS A HE2  4  
ATOM 5906  H HE3  . LYS A 1 89  ? 8.781   2.122   3.429   1.00 0.00 ? 872 LYS A HE3  4  
ATOM 5907  H HZ1  . LYS A 1 89  ? 10.129  -0.147  4.541   1.00 0.00 ? 872 LYS A HZ1  4  
ATOM 5908  H HZ2  . LYS A 1 89  ? 11.189  1.129   4.211   1.00 0.00 ? 872 LYS A HZ2  4  
ATOM 5909  H HZ3  . LYS A 1 89  ? 10.215  0.499   2.980   1.00 0.00 ? 872 LYS A HZ3  4  
ATOM 5910  N N    . VAL A 1 90  ? 5.635   4.257   3.975   1.00 0.00 ? 873 VAL A N    4  
ATOM 5911  C CA   . VAL A 1 90  ? 4.937   3.807   2.777   1.00 0.00 ? 873 VAL A CA   4  
ATOM 5912  C C    . VAL A 1 90  ? 5.914   3.547   1.636   1.00 0.00 ? 873 VAL A C    4  
ATOM 5913  O O    . VAL A 1 90  ? 6.912   4.251   1.487   1.00 0.00 ? 873 VAL A O    4  
ATOM 5914  C CB   . VAL A 1 90  ? 3.890   4.839   2.316   1.00 0.00 ? 873 VAL A CB   4  
ATOM 5915  C CG1  . VAL A 1 90  ? 3.062   4.283   1.168   1.00 0.00 ? 873 VAL A CG1  4  
ATOM 5916  C CG2  . VAL A 1 90  ? 2.999   5.247   3.479   1.00 0.00 ? 873 VAL A CG2  4  
ATOM 5917  H H    . VAL A 1 90  ? 6.224   5.039   3.920   1.00 0.00 ? 873 VAL A H    4  
ATOM 5918  H HA   . VAL A 1 90  ? 4.424   2.886   3.015   1.00 0.00 ? 873 VAL A HA   4  
ATOM 5919  H HB   . VAL A 1 90  ? 4.411   5.717   1.963   1.00 0.00 ? 873 VAL A HB   4  
ATOM 5920  H HG11 . VAL A 1 90  ? 2.850   3.240   1.349   1.00 0.00 ? 873 VAL A HG11 4  
ATOM 5921  H HG12 . VAL A 1 90  ? 2.135   4.832   1.094   1.00 0.00 ? 873 VAL A HG12 4  
ATOM 5922  H HG13 . VAL A 1 90  ? 3.614   4.382   0.245   1.00 0.00 ? 873 VAL A HG13 4  
ATOM 5923  H HG21 . VAL A 1 90  ? 3.307   6.215   3.845   1.00 0.00 ? 873 VAL A HG21 4  
ATOM 5924  H HG22 . VAL A 1 90  ? 1.972   5.300   3.145   1.00 0.00 ? 873 VAL A HG22 4  
ATOM 5925  H HG23 . VAL A 1 90  ? 3.082   4.518   4.271   1.00 0.00 ? 873 VAL A HG23 4  
ATOM 5926  N N    . ALA A 1 91  ? 5.620   2.530   0.832   1.00 0.00 ? 874 ALA A N    4  
ATOM 5927  C CA   . ALA A 1 91  ? 6.471   2.178   -0.298  1.00 0.00 ? 874 ALA A CA   4  
ATOM 5928  C C    . ALA A 1 91  ? 5.652   1.580   -1.437  1.00 0.00 ? 874 ALA A C    4  
ATOM 5929  O O    . ALA A 1 91  ? 4.568   1.040   -1.217  1.00 0.00 ? 874 ALA A O    4  
ATOM 5930  C CB   . ALA A 1 91  ? 7.556   1.206   0.142   1.00 0.00 ? 874 ALA A CB   4  
ATOM 5931  H H    . ALA A 1 91  ? 4.810   2.005   1.002   1.00 0.00 ? 874 ALA A H    4  
ATOM 5932  H HA   . ALA A 1 91  ? 6.951   3.081   -0.648  1.00 0.00 ? 874 ALA A HA   4  
ATOM 5933  H HB1  . ALA A 1 91  ? 7.439   0.988   1.193   1.00 0.00 ? 874 ALA A HB1  4  
ATOM 5934  H HB2  . ALA A 1 91  ? 7.473   0.292   -0.427  1.00 0.00 ? 874 ALA A HB2  4  
ATOM 5935  H HB3  . ALA A 1 91  ? 8.526   1.649   -0.028  1.00 0.00 ? 874 ALA A HB3  4  
ATOM 5936  N N    . ILE A 1 92  ? 6.178   1.681   -2.653  1.00 0.00 ? 875 ILE A N    4  
ATOM 5937  C CA   . ILE A 1 92  ? 5.495   1.149   -3.826  1.00 0.00 ? 875 ILE A CA   4  
ATOM 5938  C C    . ILE A 1 92  ? 5.412   -0.373  -3.771  1.00 0.00 ? 875 ILE A C    4  
ATOM 5939  O O    . ILE A 1 92  ? 6.430   -1.063  -3.837  1.00 0.00 ? 875 ILE A O    4  
ATOM 5940  C CB   . ILE A 1 92  ? 6.204   1.567   -5.128  1.00 0.00 ? 875 ILE A CB   4  
ATOM 5941  C CG1  . ILE A 1 92  ? 6.509   3.066   -5.109  1.00 0.00 ? 875 ILE A CG1  4  
ATOM 5942  C CG2  . ILE A 1 92  ? 5.350   1.209   -6.334  1.00 0.00 ? 875 ILE A CG2  4  
ATOM 5943  C CD1  . ILE A 1 92  ? 5.309   3.923   -4.770  1.00 0.00 ? 875 ILE A CD1  4  
ATOM 5944  H H    . ILE A 1 92  ? 7.046   2.122   -2.764  1.00 0.00 ? 875 ILE A H    4  
ATOM 5945  H HA   . ILE A 1 92  ? 4.493   1.553   -3.839  1.00 0.00 ? 875 ILE A HA   4  
ATOM 5946  H HB   . ILE A 1 92  ? 7.131   1.019   -5.198  1.00 0.00 ? 875 ILE A HB   4  
ATOM 5947  H HG12 . ILE A 1 92  ? 7.274   3.263   -4.375  1.00 0.00 ? 875 ILE A HG12 4  
ATOM 5948  H HG13 . ILE A 1 92  ? 6.866   3.365   -6.084  1.00 0.00 ? 875 ILE A HG13 4  
ATOM 5949  H HG21 . ILE A 1 92  ? 4.838   2.092   -6.688  1.00 0.00 ? 875 ILE A HG21 4  
ATOM 5950  H HG22 . ILE A 1 92  ? 5.981   0.822   -7.120  1.00 0.00 ? 875 ILE A HG22 4  
ATOM 5951  H HG23 . ILE A 1 92  ? 4.624   0.461   -6.053  1.00 0.00 ? 875 ILE A HG23 4  
ATOM 5952  H HD11 . ILE A 1 92  ? 5.476   4.931   -5.119  1.00 0.00 ? 875 ILE A HD11 4  
ATOM 5953  H HD12 . ILE A 1 92  ? 4.430   3.517   -5.247  1.00 0.00 ? 875 ILE A HD12 4  
ATOM 5954  H HD13 . ILE A 1 92  ? 5.165   3.932   -3.699  1.00 0.00 ? 875 ILE A HD13 4  
ATOM 5955  N N    . SER A 1 93  ? 4.194   -0.890  -3.652  1.00 0.00 ? 876 SER A N    4  
ATOM 5956  C CA   . SER A 1 93  ? 3.978   -2.330  -3.587  1.00 0.00 ? 876 SER A CA   4  
ATOM 5957  C C    . SER A 1 93  ? 4.976   -3.070  -4.472  1.00 0.00 ? 876 SER A C    4  
ATOM 5958  O O    . SER A 1 93  ? 5.324   -2.605  -5.556  1.00 0.00 ? 876 SER A O    4  
ATOM 5959  C CB   . SER A 1 93  ? 2.549   -2.673  -4.013  1.00 0.00 ? 876 SER A CB   4  
ATOM 5960  O OG   . SER A 1 93  ? 2.416   -4.057  -4.286  1.00 0.00 ? 876 SER A OG   4  
ATOM 5961  H H    . SER A 1 93  ? 3.422   -0.287  -3.604  1.00 0.00 ? 876 SER A H    4  
ATOM 5962  H HA   . SER A 1 93  ? 4.123   -2.641  -2.563  1.00 0.00 ? 876 SER A HA   4  
ATOM 5963  H HB2  . SER A 1 93  ? 1.866   -2.407  -3.221  1.00 0.00 ? 876 SER A HB2  4  
ATOM 5964  H HB3  . SER A 1 93  ? 2.299   -2.117  -4.905  1.00 0.00 ? 876 SER A HB3  4  
ATOM 5965  H HG   . SER A 1 93  ? 2.442   -4.550  -3.462  1.00 0.00 ? 876 SER A HG   4  
ATOM 5966  N N    . ASN A 1 94  ? 5.432   -4.226  -4.000  1.00 0.00 ? 877 ASN A N    4  
ATOM 5967  C CA   . ASN A 1 94  ? 6.391   -5.031  -4.748  1.00 0.00 ? 877 ASN A CA   4  
ATOM 5968  C C    . ASN A 1 94  ? 5.691   -5.840  -5.836  1.00 0.00 ? 877 ASN A C    4  
ATOM 5969  O O    . ASN A 1 94  ? 4.474   -6.017  -5.806  1.00 0.00 ? 877 ASN A O    4  
ATOM 5970  C CB   . ASN A 1 94  ? 7.145   -5.971  -3.804  1.00 0.00 ? 877 ASN A CB   4  
ATOM 5971  C CG   . ASN A 1 94  ? 8.375   -5.320  -3.202  1.00 0.00 ? 877 ASN A CG   4  
ATOM 5972  O OD1  . ASN A 1 94  ? 8.413   -4.106  -3.000  1.00 0.00 ? 877 ASN A OD1  4  
ATOM 5973  N ND2  . ASN A 1 94  ? 9.389   -6.127  -2.912  1.00 0.00 ? 877 ASN A ND2  4  
ATOM 5974  H H    . ASN A 1 94  ? 5.117   -4.545  -3.129  1.00 0.00 ? 877 ASN A H    4  
ATOM 5975  H HA   . ASN A 1 94  ? 7.097   -4.359  -5.212  1.00 0.00 ? 877 ASN A HA   4  
ATOM 5976  H HB2  . ASN A 1 94  ? 6.488   -6.266  -3.000  1.00 0.00 ? 877 ASN A HB2  4  
ATOM 5977  H HB3  . ASN A 1 94  ? 7.455   -6.848  -4.351  1.00 0.00 ? 877 ASN A HB3  4  
ATOM 5978  H HD21 . ASN A 1 94  ? 9.288   -7.083  -3.100  1.00 0.00 ? 877 ASN A HD21 4  
ATOM 5979  H HD22 . ASN A 1 94  ? 10.197  -5.732  -2.520  1.00 0.00 ? 877 ASN A HD22 4  
ATOM 5980  N N    . SER A 1 95  ? 6.470   -6.328  -6.796  1.00 0.00 ? 878 SER A N    4  
ATOM 5981  C CA   . SER A 1 95  ? 5.925   -7.115  -7.896  1.00 0.00 ? 878 SER A CA   4  
ATOM 5982  C C    . SER A 1 95  ? 6.034   -8.608  -7.601  1.00 0.00 ? 878 SER A C    4  
ATOM 5983  O O    . SER A 1 95  ? 6.543   -9.011  -6.556  1.00 0.00 ? 878 SER A O    4  
ATOM 5984  C CB   . SER A 1 95  ? 6.658   -6.787  -9.198  1.00 0.00 ? 878 SER A CB   4  
ATOM 5985  O OG   . SER A 1 95  ? 5.939   -7.265  -10.322 1.00 0.00 ? 878 SER A OG   4  
ATOM 5986  H H    . SER A 1 95  ? 7.434   -6.153  -6.765  1.00 0.00 ? 878 SER A H    4  
ATOM 5987  H HA   . SER A 1 95  ? 4.883   -6.856  -8.004  1.00 0.00 ? 878 SER A HA   4  
ATOM 5988  H HB2  . SER A 1 95  ? 6.769   -5.716  -9.286  1.00 0.00 ? 878 SER A HB2  4  
ATOM 5989  H HB3  . SER A 1 95  ? 7.634   -7.250  -9.186  1.00 0.00 ? 878 SER A HB3  4  
ATOM 5990  H HG   . SER A 1 95  ? 6.422   -7.054  -11.124 1.00 0.00 ? 878 SER A HG   4  
ATOM 5991  N N    . GLY A 1 96  ? 5.549   -9.426  -8.532  1.00 0.00 ? 879 GLY A N    4  
ATOM 5992  C CA   . GLY A 1 96  ? 5.601   -10.865 -8.354  1.00 0.00 ? 879 GLY A CA   4  
ATOM 5993  C C    . GLY A 1 96  ? 5.803   -11.604 -9.662  1.00 0.00 ? 879 GLY A C    4  
ATOM 5994  O O    . GLY A 1 96  ? 4.868   -12.163 -10.235 1.00 0.00 ? 879 GLY A O    4  
ATOM 5995  H H    . GLY A 1 96  ? 5.154   -9.048  -9.345  1.00 0.00 ? 879 GLY A H    4  
ATOM 5996  H HA2  . GLY A 1 96  ? 6.414   -11.106 -7.687  1.00 0.00 ? 879 GLY A HA2  4  
ATOM 5997  H HA3  . GLY A 1 96  ? 4.673   -11.194 -7.909  1.00 0.00 ? 879 GLY A HA3  4  
ATOM 5998  N N    . PRO A 1 97  ? 7.051   -11.610 -10.156 1.00 0.00 ? 880 PRO A N    4  
ATOM 5999  C CA   . PRO A 1 97  ? 7.402   -12.281 -11.411 1.00 0.00 ? 880 PRO A CA   4  
ATOM 6000  C C    . PRO A 1 97  ? 7.335   -13.800 -11.295 1.00 0.00 ? 880 PRO A C    4  
ATOM 6001  O O    . PRO A 1 97  ? 6.883   -14.483 -12.214 1.00 0.00 ? 880 PRO A O    4  
ATOM 6002  C CB   . PRO A 1 97  ? 8.842   -11.827 -11.665 1.00 0.00 ? 880 PRO A CB   4  
ATOM 6003  C CG   . PRO A 1 97  ? 9.378   -11.496 -10.315 1.00 0.00 ? 880 PRO A CG   4  
ATOM 6004  C CD   . PRO A 1 97  ? 8.214   -10.964 -9.526  1.00 0.00 ? 880 PRO A CD   4  
ATOM 6005  H HA   . PRO A 1 97  ? 6.771   -11.955 -12.225 1.00 0.00 ? 880 PRO A HA   4  
ATOM 6006  H HB2  . PRO A 1 97  ? 9.399   -12.631 -12.126 1.00 0.00 ? 880 PRO A HB2  4  
ATOM 6007  H HB3  . PRO A 1 97  ? 8.842   -10.963 -12.312 1.00 0.00 ? 880 PRO A HB3  4  
ATOM 6008  H HG2  . PRO A 1 97  ? 9.772   -12.386 -9.848  1.00 0.00 ? 880 PRO A HG2  4  
ATOM 6009  H HG3  . PRO A 1 97  ? 10.148  -10.744 -10.400 1.00 0.00 ? 880 PRO A HG3  4  
ATOM 6010  H HD2  . PRO A 1 97  ? 8.299   -11.250 -8.488  1.00 0.00 ? 880 PRO A HD2  4  
ATOM 6011  H HD3  . PRO A 1 97  ? 8.155   -9.889  -9.619  1.00 0.00 ? 880 PRO A HD3  4  
ATOM 6012  N N    . SER A 1 98  ? 7.786   -14.323 -10.159 1.00 0.00 ? 881 SER A N    4  
ATOM 6013  C CA   . SER A 1 98  ? 7.780   -15.762 -9.924  1.00 0.00 ? 881 SER A CA   4  
ATOM 6014  C C    . SER A 1 98  ? 7.099   -16.094 -8.600  1.00 0.00 ? 881 SER A C    4  
ATOM 6015  O O    . SER A 1 98  ? 7.003   -15.249 -7.710  1.00 0.00 ? 881 SER A O    4  
ATOM 6016  C CB   . SER A 1 98  ? 9.210   -16.306 -9.926  1.00 0.00 ? 881 SER A CB   4  
ATOM 6017  O OG   . SER A 1 98  ? 9.684   -16.493 -11.248 1.00 0.00 ? 881 SER A OG   4  
ATOM 6018  H H    . SER A 1 98  ? 8.134   -13.726 -9.463  1.00 0.00 ? 881 SER A H    4  
ATOM 6019  H HA   . SER A 1 98  ? 7.227   -16.226 -10.727 1.00 0.00 ? 881 SER A HA   4  
ATOM 6020  H HB2  . SER A 1 98  ? 9.859   -15.608 -9.420  1.00 0.00 ? 881 SER A HB2  4  
ATOM 6021  H HB3  . SER A 1 98  ? 9.231   -17.256 -9.410  1.00 0.00 ? 881 SER A HB3  4  
ATOM 6022  H HG   . SER A 1 98  ? 9.560   -17.410 -11.506 1.00 0.00 ? 881 SER A HG   4  
ATOM 6023  N N    . SER A 1 99  ? 6.627   -17.330 -8.478  1.00 0.00 ? 882 SER A N    4  
ATOM 6024  C CA   . SER A 1 99  ? 5.951   -17.774 -7.265  1.00 0.00 ? 882 SER A CA   4  
ATOM 6025  C C    . SER A 1 99  ? 6.959   -18.081 -6.162  1.00 0.00 ? 882 SER A C    4  
ATOM 6026  O O    . SER A 1 99  ? 8.040   -18.609 -6.423  1.00 0.00 ? 882 SER A O    4  
ATOM 6027  C CB   . SER A 1 99  ? 5.101   -19.013 -7.554  1.00 0.00 ? 882 SER A CB   4  
ATOM 6028  O OG   . SER A 1 99  ? 4.261   -19.323 -6.455  1.00 0.00 ? 882 SER A OG   4  
ATOM 6029  H H    . SER A 1 99  ? 6.734   -17.958 -9.223  1.00 0.00 ? 882 SER A H    4  
ATOM 6030  H HA   . SER A 1 99  ? 5.305   -16.975 -6.934  1.00 0.00 ? 882 SER A HA   4  
ATOM 6031  H HB2  . SER A 1 99  ? 4.485   -18.830 -8.421  1.00 0.00 ? 882 SER A HB2  4  
ATOM 6032  H HB3  . SER A 1 99  ? 5.750   -19.855 -7.744  1.00 0.00 ? 882 SER A HB3  4  
ATOM 6033  H HG   . SER A 1 99  ? 4.692   -19.060 -5.639  1.00 0.00 ? 882 SER A HG   4  
ATOM 6034  N N    . GLY A 1 100 ? 6.597   -17.746 -4.927  1.00 0.00 ? 883 GLY A N    4  
ATOM 6035  C CA   . GLY A 1 100 ? 7.481   -17.993 -3.803  1.00 0.00 ? 883 GLY A CA   4  
ATOM 6036  C C    . GLY A 1 100 ? 7.027   -19.166 -2.956  1.00 0.00 ? 883 GLY A C    4  
ATOM 6037  O O    . GLY A 1 100 ? 7.632   -19.468 -1.927  1.00 0.00 ? 883 GLY A O    4  
ATOM 6038  H H    . GLY A 1 100 ? 5.723   -17.328 -4.779  1.00 0.00 ? 883 GLY A H    4  
ATOM 6039  H HA2  . GLY A 1 100 ? 8.473   -18.195 -4.176  1.00 0.00 ? 883 GLY A HA2  4  
ATOM 6040  H HA3  . GLY A 1 100 ? 7.512   -17.108 -3.184  1.00 0.00 ? 883 GLY A HA3  4  
ATOM 6041  N N    . GLY A 1 1   ? 28.773  6.835   -28.429 1.00 0.00 ? 784 GLY A N    5  
ATOM 6042  C CA   . GLY A 1 1   ? 28.617  5.513   -27.852 1.00 0.00 ? 784 GLY A CA   5  
ATOM 6043  C C    . GLY A 1 1   ? 29.427  5.336   -26.583 1.00 0.00 ? 784 GLY A C    5  
ATOM 6044  O O    . GLY A 1 1   ? 30.558  4.851   -26.622 1.00 0.00 ? 784 GLY A O    5  
ATOM 6045  H H1   . GLY A 1 1   ? 29.670  7.209   -28.558 1.00 0.00 ? 784 GLY A H1   5  
ATOM 6046  H HA2  . GLY A 1 1   ? 27.574  5.350   -27.627 1.00 0.00 ? 784 GLY A HA2  5  
ATOM 6047  H HA3  . GLY A 1 1   ? 28.938  4.777   -28.575 1.00 0.00 ? 784 GLY A HA3  5  
ATOM 6048  N N    . SER A 1 2   ? 28.848  5.731   -25.453 1.00 0.00 ? 785 SER A N    5  
ATOM 6049  C CA   . SER A 1 2   ? 29.525  5.619   -24.167 1.00 0.00 ? 785 SER A CA   5  
ATOM 6050  C C    . SER A 1 2   ? 28.601  5.010   -23.118 1.00 0.00 ? 785 SER A C    5  
ATOM 6051  O O    . SER A 1 2   ? 27.489  5.490   -22.900 1.00 0.00 ? 785 SER A O    5  
ATOM 6052  C CB   . SER A 1 2   ? 30.010  6.993   -23.700 1.00 0.00 ? 785 SER A CB   5  
ATOM 6053  O OG   . SER A 1 2   ? 31.032  6.869   -22.726 1.00 0.00 ? 785 SER A OG   5  
ATOM 6054  H H    . SER A 1 2   ? 27.945  6.110   -25.487 1.00 0.00 ? 785 SER A H    5  
ATOM 6055  H HA   . SER A 1 2   ? 30.379  4.971   -24.297 1.00 0.00 ? 785 SER A HA   5  
ATOM 6056  H HB2  . SER A 1 2   ? 30.399  7.541   -24.545 1.00 0.00 ? 785 SER A HB2  5  
ATOM 6057  H HB3  . SER A 1 2   ? 29.182  7.536   -23.269 1.00 0.00 ? 785 SER A HB3  5  
ATOM 6058  H HG   . SER A 1 2   ? 31.889  6.978   -23.145 1.00 0.00 ? 785 SER A HG   5  
ATOM 6059  N N    . SER A 1 3   ? 29.069  3.947   -22.470 1.00 0.00 ? 786 SER A N    5  
ATOM 6060  C CA   . SER A 1 3   ? 28.284  3.269   -21.446 1.00 0.00 ? 786 SER A CA   5  
ATOM 6061  C C    . SER A 1 3   ? 27.608  4.278   -20.522 1.00 0.00 ? 786 SER A C    5  
ATOM 6062  O O    . SER A 1 3   ? 28.106  5.385   -20.323 1.00 0.00 ? 786 SER A O    5  
ATOM 6063  C CB   . SER A 1 3   ? 29.174  2.330   -20.629 1.00 0.00 ? 786 SER A CB   5  
ATOM 6064  O OG   . SER A 1 3   ? 30.260  3.032   -20.050 1.00 0.00 ? 786 SER A OG   5  
ATOM 6065  H H    . SER A 1 3   ? 29.964  3.611   -22.689 1.00 0.00 ? 786 SER A H    5  
ATOM 6066  H HA   . SER A 1 3   ? 27.522  2.687   -21.943 1.00 0.00 ? 786 SER A HA   5  
ATOM 6067  H HB2  . SER A 1 3   ? 28.591  1.880   -19.841 1.00 0.00 ? 786 SER A HB2  5  
ATOM 6068  H HB3  . SER A 1 3   ? 29.564  1.556   -21.275 1.00 0.00 ? 786 SER A HB3  5  
ATOM 6069  H HG   . SER A 1 3   ? 31.075  2.550   -20.209 1.00 0.00 ? 786 SER A HG   5  
ATOM 6070  N N    . GLY A 1 4   ? 26.468  3.885   -19.961 1.00 0.00 ? 787 GLY A N    5  
ATOM 6071  C CA   . GLY A 1 4   ? 25.741  4.766   -19.066 1.00 0.00 ? 787 GLY A CA   5  
ATOM 6072  C C    . GLY A 1 4   ? 24.242  4.709   -19.287 1.00 0.00 ? 787 GLY A C    5  
ATOM 6073  O O    . GLY A 1 4   ? 23.750  5.086   -20.350 1.00 0.00 ? 787 GLY A O    5  
ATOM 6074  H H    . GLY A 1 4   ? 26.118  2.991   -20.157 1.00 0.00 ? 787 GLY A H    5  
ATOM 6075  H HA2  . GLY A 1 4   ? 25.955  4.481   -18.046 1.00 0.00 ? 787 GLY A HA2  5  
ATOM 6076  H HA3  . GLY A 1 4   ? 26.078  5.780   -19.224 1.00 0.00 ? 787 GLY A HA3  5  
ATOM 6077  N N    . SER A 1 5   ? 23.515  4.234   -18.280 1.00 0.00 ? 788 SER A N    5  
ATOM 6078  C CA   . SER A 1 5   ? 22.063  4.123   -18.372 1.00 0.00 ? 788 SER A CA   5  
ATOM 6079  C C    . SER A 1 5   ? 21.383  5.268   -17.627 1.00 0.00 ? 788 SER A C    5  
ATOM 6080  O O    . SER A 1 5   ? 21.050  5.145   -16.449 1.00 0.00 ? 788 SER A O    5  
ATOM 6081  C CB   . SER A 1 5   ? 21.596  2.782   -17.804 1.00 0.00 ? 788 SER A CB   5  
ATOM 6082  O OG   . SER A 1 5   ? 20.259  2.505   -18.183 1.00 0.00 ? 788 SER A OG   5  
ATOM 6083  H H    . SER A 1 5   ? 23.965  3.949   -17.458 1.00 0.00 ? 788 SER A H    5  
ATOM 6084  H HA   . SER A 1 5   ? 21.792  4.177   -19.416 1.00 0.00 ? 788 SER A HA   5  
ATOM 6085  H HB2  . SER A 1 5   ? 22.234  1.994   -18.177 1.00 0.00 ? 788 SER A HB2  5  
ATOM 6086  H HB3  . SER A 1 5   ? 21.654  2.811   -16.725 1.00 0.00 ? 788 SER A HB3  5  
ATOM 6087  H HG   . SER A 1 5   ? 19.785  3.330   -18.310 1.00 0.00 ? 788 SER A HG   5  
ATOM 6088  N N    . SER A 1 6   ? 21.181  6.382   -18.325 1.00 0.00 ? 789 SER A N    5  
ATOM 6089  C CA   . SER A 1 6   ? 20.545  7.551   -17.730 1.00 0.00 ? 789 SER A CA   5  
ATOM 6090  C C    . SER A 1 6   ? 19.564  8.192   -18.707 1.00 0.00 ? 789 SER A C    5  
ATOM 6091  O O    . SER A 1 6   ? 19.961  8.728   -19.740 1.00 0.00 ? 789 SER A O    5  
ATOM 6092  C CB   . SER A 1 6   ? 21.601  8.574   -17.307 1.00 0.00 ? 789 SER A CB   5  
ATOM 6093  O OG   . SER A 1 6   ? 22.398  8.075   -16.246 1.00 0.00 ? 789 SER A OG   5  
ATOM 6094  H H    . SER A 1 6   ? 21.470  6.418   -19.261 1.00 0.00 ? 789 SER A H    5  
ATOM 6095  H HA   . SER A 1 6   ? 20.002  7.224   -16.856 1.00 0.00 ? 789 SER A HA   5  
ATOM 6096  H HB2  . SER A 1 6   ? 22.241  8.795   -18.147 1.00 0.00 ? 789 SER A HB2  5  
ATOM 6097  H HB3  . SER A 1 6   ? 21.111  9.479   -16.978 1.00 0.00 ? 789 SER A HB3  5  
ATOM 6098  H HG   . SER A 1 6   ? 21.861  7.990   -15.455 1.00 0.00 ? 789 SER A HG   5  
ATOM 6099  N N    . GLY A 1 7   ? 18.279  8.130   -18.372 1.00 0.00 ? 790 GLY A N    5  
ATOM 6100  C CA   . GLY A 1 7   ? 17.260  8.707   -19.229 1.00 0.00 ? 790 GLY A CA   5  
ATOM 6101  C C    . GLY A 1 7   ? 16.901  7.803   -20.392 1.00 0.00 ? 790 GLY A C    5  
ATOM 6102  O O    . GLY A 1 7   ? 16.803  8.256   -21.532 1.00 0.00 ? 790 GLY A O    5  
ATOM 6103  H H    . GLY A 1 7   ? 18.020  7.689   -17.535 1.00 0.00 ? 790 GLY A H    5  
ATOM 6104  H HA2  . GLY A 1 7   ? 16.372  8.891   -18.642 1.00 0.00 ? 790 GLY A HA2  5  
ATOM 6105  H HA3  . GLY A 1 7   ? 17.623  9.647   -19.618 1.00 0.00 ? 790 GLY A HA3  5  
ATOM 6106  N N    . VAL A 1 8   ? 16.705  6.520   -20.104 1.00 0.00 ? 791 VAL A N    5  
ATOM 6107  C CA   . VAL A 1 8   ? 16.355  5.550   -21.135 1.00 0.00 ? 791 VAL A CA   5  
ATOM 6108  C C    . VAL A 1 8   ? 15.044  4.847   -20.805 1.00 0.00 ? 791 VAL A C    5  
ATOM 6109  O O    . VAL A 1 8   ? 14.806  4.457   -19.662 1.00 0.00 ? 791 VAL A O    5  
ATOM 6110  C CB   . VAL A 1 8   ? 17.462  4.494   -21.309 1.00 0.00 ? 791 VAL A CB   5  
ATOM 6111  C CG1  . VAL A 1 8   ? 17.044  3.446   -22.330 1.00 0.00 ? 791 VAL A CG1  5  
ATOM 6112  C CG2  . VAL A 1 8   ? 18.770  5.155   -21.717 1.00 0.00 ? 791 VAL A CG2  5  
ATOM 6113  H H    . VAL A 1 8   ? 16.797  6.219   -19.176 1.00 0.00 ? 791 VAL A H    5  
ATOM 6114  H HA   . VAL A 1 8   ? 16.243  6.081   -22.069 1.00 0.00 ? 791 VAL A HA   5  
ATOM 6115  H HB   . VAL A 1 8   ? 17.614  4.000   -20.361 1.00 0.00 ? 791 VAL A HB   5  
ATOM 6116  H HG11 . VAL A 1 8   ? 16.016  3.163   -22.154 1.00 0.00 ? 791 VAL A HG11 5  
ATOM 6117  H HG12 . VAL A 1 8   ? 17.142  3.853   -23.325 1.00 0.00 ? 791 VAL A HG12 5  
ATOM 6118  H HG13 . VAL A 1 8   ? 17.677  2.576   -22.232 1.00 0.00 ? 791 VAL A HG13 5  
ATOM 6119  H HG21 . VAL A 1 8   ? 18.894  6.075   -21.167 1.00 0.00 ? 791 VAL A HG21 5  
ATOM 6120  H HG22 . VAL A 1 8   ? 19.594  4.491   -21.498 1.00 0.00 ? 791 VAL A HG22 5  
ATOM 6121  H HG23 . VAL A 1 8   ? 18.752  5.368   -22.776 1.00 0.00 ? 791 VAL A HG23 5  
ATOM 6122  N N    . PHE A 1 9   ? 14.194  4.687   -21.814 1.00 0.00 ? 792 PHE A N    5  
ATOM 6123  C CA   . PHE A 1 9   ? 12.905  4.030   -21.632 1.00 0.00 ? 792 PHE A CA   5  
ATOM 6124  C C    . PHE A 1 9   ? 12.730  2.889   -22.630 1.00 0.00 ? 792 PHE A C    5  
ATOM 6125  O O    . PHE A 1 9   ? 13.237  2.947   -23.751 1.00 0.00 ? 792 PHE A O    5  
ATOM 6126  C CB   . PHE A 1 9   ? 11.767  5.041   -21.791 1.00 0.00 ? 792 PHE A CB   5  
ATOM 6127  C CG   . PHE A 1 9   ? 11.699  6.047   -20.678 1.00 0.00 ? 792 PHE A CG   5  
ATOM 6128  C CD1  . PHE A 1 9   ? 11.372  5.654   -19.390 1.00 0.00 ? 792 PHE A CD1  5  
ATOM 6129  C CD2  . PHE A 1 9   ? 11.962  7.386   -20.919 1.00 0.00 ? 792 PHE A CD2  5  
ATOM 6130  C CE1  . PHE A 1 9   ? 11.309  6.577   -18.363 1.00 0.00 ? 792 PHE A CE1  5  
ATOM 6131  C CE2  . PHE A 1 9   ? 11.901  8.313   -19.896 1.00 0.00 ? 792 PHE A CE2  5  
ATOM 6132  C CZ   . PHE A 1 9   ? 11.573  7.909   -18.617 1.00 0.00 ? 792 PHE A CZ   5  
ATOM 6133  H H    . PHE A 1 9   ? 14.440  5.020   -22.703 1.00 0.00 ? 792 PHE A H    5  
ATOM 6134  H HA   . PHE A 1 9   ? 12.879  3.625   -20.632 1.00 0.00 ? 792 PHE A HA   5  
ATOM 6135  H HB2  . PHE A 1 9   ? 11.900  5.580   -22.717 1.00 0.00 ? 792 PHE A HB2  5  
ATOM 6136  H HB3  . PHE A 1 9   ? 10.827  4.511   -21.819 1.00 0.00 ? 792 PHE A HB3  5  
ATOM 6137  H HD1  . PHE A 1 9   ? 11.165  4.612   -19.190 1.00 0.00 ? 792 PHE A HD1  5  
ATOM 6138  H HD2  . PHE A 1 9   ? 12.218  7.704   -21.919 1.00 0.00 ? 792 PHE A HD2  5  
ATOM 6139  H HE1  . PHE A 1 9   ? 11.052  6.257   -17.364 1.00 0.00 ? 792 PHE A HE1  5  
ATOM 6140  H HE2  . PHE A 1 9   ? 12.107  9.354   -20.098 1.00 0.00 ? 792 PHE A HE2  5  
ATOM 6141  H HZ   . PHE A 1 9   ? 11.525  8.632   -17.816 1.00 0.00 ? 792 PHE A HZ   5  
ATOM 6142  N N    . ARG A 1 10  ? 12.010  1.853   -22.214 1.00 0.00 ? 793 ARG A N    5  
ATOM 6143  C CA   . ARG A 1 10  ? 11.769  0.697   -23.070 1.00 0.00 ? 793 ARG A CA   5  
ATOM 6144  C C    . ARG A 1 10  ? 10.586  0.947   -24.001 1.00 0.00 ? 793 ARG A C    5  
ATOM 6145  O O    . ARG A 1 10  ? 9.676   1.709   -23.674 1.00 0.00 ? 793 ARG A O    5  
ATOM 6146  C CB   . ARG A 1 10  ? 11.509  -0.548  -22.220 1.00 0.00 ? 793 ARG A CB   5  
ATOM 6147  C CG   . ARG A 1 10  ? 12.749  -1.078  -21.520 1.00 0.00 ? 793 ARG A CG   5  
ATOM 6148  C CD   . ARG A 1 10  ? 13.737  -1.674  -22.511 1.00 0.00 ? 793 ARG A CD   5  
ATOM 6149  N NE   . ARG A 1 10  ? 14.557  -2.720  -21.905 1.00 0.00 ? 793 ARG A NE   5  
ATOM 6150  C CZ   . ARG A 1 10  ? 14.138  -3.967  -21.720 1.00 0.00 ? 793 ARG A CZ   5  
ATOM 6151  N NH1  . ARG A 1 10  ? 12.916  -4.322  -22.092 1.00 0.00 ? 793 ARG A NH1  5  
ATOM 6152  N NH2  . ARG A 1 10  ? 14.943  -4.862  -21.161 1.00 0.00 ? 793 ARG A NH2  5  
ATOM 6153  H H    . ARG A 1 10  ? 11.632  1.865   -21.310 1.00 0.00 ? 793 ARG A H    5  
ATOM 6154  H HA   . ARG A 1 10  ? 12.654  0.536   -23.667 1.00 0.00 ? 793 ARG A HA   5  
ATOM 6155  H HB2  . ARG A 1 10  ? 10.772  -0.309  -21.467 1.00 0.00 ? 793 ARG A HB2  5  
ATOM 6156  H HB3  . ARG A 1 10  ? 11.120  -1.328  -22.857 1.00 0.00 ? 793 ARG A HB3  5  
ATOM 6157  H HG2  . ARG A 1 10  ? 13.230  -0.265  -20.995 1.00 0.00 ? 793 ARG A HG2  5  
ATOM 6158  H HG3  . ARG A 1 10  ? 12.455  -1.840  -20.815 1.00 0.00 ? 793 ARG A HG3  5  
ATOM 6159  H HD2  . ARG A 1 10  ? 13.185  -2.096  -23.338 1.00 0.00 ? 793 ARG A HD2  5  
ATOM 6160  H HD3  . ARG A 1 10  ? 14.382  -0.888  -22.873 1.00 0.00 ? 793 ARG A HD3  5  
ATOM 6161  H HE   . ARG A 1 10  ? 15.463  -2.479  -21.623 1.00 0.00 ? 793 ARG A HE   5  
ATOM 6162  H HH11 . ARG A 1 10  ? 12.308  -3.650  -22.514 1.00 0.00 ? 793 ARG A HH11 5  
ATOM 6163  H HH12 . ARG A 1 10  ? 12.604  -5.262  -21.952 1.00 0.00 ? 793 ARG A HH12 5  
ATOM 6164  H HH21 . ARG A 1 10  ? 15.865  -4.598  -20.880 1.00 0.00 ? 793 ARG A HH21 5  
ATOM 6165  H HH22 . ARG A 1 10  ? 14.627  -5.800  -21.022 1.00 0.00 ? 793 ARG A HH22 5  
ATOM 6166  N N    . TYR A 1 11  ? 10.606  0.301   -25.161 1.00 0.00 ? 794 TYR A N    5  
ATOM 6167  C CA   . TYR A 1 11  ? 9.537   0.455   -26.141 1.00 0.00 ? 794 TYR A CA   5  
ATOM 6168  C C    . TYR A 1 11  ? 8.169   0.341   -25.476 1.00 0.00 ? 794 TYR A C    5  
ATOM 6169  O O    . TYR A 1 11  ? 7.362   1.269   -25.527 1.00 0.00 ? 794 TYR A O    5  
ATOM 6170  C CB   . TYR A 1 11  ? 9.671   -0.597  -27.243 1.00 0.00 ? 794 TYR A CB   5  
ATOM 6171  C CG   . TYR A 1 11  ? 8.500   -0.625  -28.199 1.00 0.00 ? 794 TYR A CG   5  
ATOM 6172  C CD1  . TYR A 1 11  ? 8.357   0.346   -29.182 1.00 0.00 ? 794 TYR A CD1  5  
ATOM 6173  C CD2  . TYR A 1 11  ? 7.537   -1.623  -28.119 1.00 0.00 ? 794 TYR A CD2  5  
ATOM 6174  C CE1  . TYR A 1 11  ? 7.288   0.325   -30.057 1.00 0.00 ? 794 TYR A CE1  5  
ATOM 6175  C CE2  . TYR A 1 11  ? 6.465   -1.653  -28.991 1.00 0.00 ? 794 TYR A CE2  5  
ATOM 6176  C CZ   . TYR A 1 11  ? 6.345   -0.677  -29.958 1.00 0.00 ? 794 TYR A CZ   5  
ATOM 6177  O OH   . TYR A 1 11  ? 5.280   -0.702  -30.828 1.00 0.00 ? 794 TYR A OH   5  
ATOM 6178  H H    . TYR A 1 11  ? 11.358  -0.293  -25.365 1.00 0.00 ? 794 TYR A H    5  
ATOM 6179  H HA   . TYR A 1 11  ? 9.630   1.437   -26.581 1.00 0.00 ? 794 TYR A HA   5  
ATOM 6180  H HB2  . TYR A 1 11  ? 10.562  -0.396  -27.817 1.00 0.00 ? 794 TYR A HB2  5  
ATOM 6181  H HB3  . TYR A 1 11  ? 9.753   -1.574  -26.790 1.00 0.00 ? 794 TYR A HB3  5  
ATOM 6182  H HD1  . TYR A 1 11  ? 9.098   1.129   -29.257 1.00 0.00 ? 794 TYR A HD1  5  
ATOM 6183  H HD2  . TYR A 1 11  ? 7.634   -2.387  -27.361 1.00 0.00 ? 794 TYR A HD2  5  
ATOM 6184  H HE1  . TYR A 1 11  ? 7.194   1.089   -30.814 1.00 0.00 ? 794 TYR A HE1  5  
ATOM 6185  H HE2  . TYR A 1 11  ? 5.727   -2.438  -28.913 1.00 0.00 ? 794 TYR A HE2  5  
ATOM 6186  H HH   . TYR A 1 11  ? 4.479   -0.457  -30.360 1.00 0.00 ? 794 TYR A HH   5  
ATOM 6187  N N    . SER A 1 12  ? 7.915   -0.806  -24.853 1.00 0.00 ? 795 SER A N    5  
ATOM 6188  C CA   . SER A 1 12  ? 6.643   -1.045  -24.180 1.00 0.00 ? 795 SER A CA   5  
ATOM 6189  C C    . SER A 1 12  ? 6.830   -1.094  -22.667 1.00 0.00 ? 795 SER A C    5  
ATOM 6190  O O    . SER A 1 12  ? 7.633   -1.874  -22.152 1.00 0.00 ? 795 SER A O    5  
ATOM 6191  C CB   . SER A 1 12  ? 6.021   -2.353  -24.671 1.00 0.00 ? 795 SER A CB   5  
ATOM 6192  O OG   . SER A 1 12  ? 6.743   -3.474  -24.191 1.00 0.00 ? 795 SER A OG   5  
ATOM 6193  H H    . SER A 1 12  ? 8.599   -1.508  -24.847 1.00 0.00 ? 795 SER A H    5  
ATOM 6194  H HA   . SER A 1 12  ? 5.981   -0.227  -24.423 1.00 0.00 ? 795 SER A HA   5  
ATOM 6195  H HB2  . SER A 1 12  ? 5.003   -2.419  -24.319 1.00 0.00 ? 795 SER A HB2  5  
ATOM 6196  H HB3  . SER A 1 12  ? 6.029   -2.369  -25.751 1.00 0.00 ? 795 SER A HB3  5  
ATOM 6197  H HG   . SER A 1 12  ? 7.097   -3.969  -24.934 1.00 0.00 ? 795 SER A HG   5  
ATOM 6198  N N    . THR A 1 13  ? 6.083   -0.254  -21.957 1.00 0.00 ? 796 THR A N    5  
ATOM 6199  C CA   . THR A 1 13  ? 6.166   -0.200  -20.503 1.00 0.00 ? 796 THR A CA   5  
ATOM 6200  C C    . THR A 1 13  ? 4.918   -0.793  -19.858 1.00 0.00 ? 796 THR A C    5  
ATOM 6201  O O    . THR A 1 13  ? 3.893   -0.124  -19.736 1.00 0.00 ? 796 THR A O    5  
ATOM 6202  C CB   . THR A 1 13  ? 6.349   1.246   -20.004 1.00 0.00 ? 796 THR A CB   5  
ATOM 6203  O OG1  . THR A 1 13  ? 7.513   1.827   -20.602 1.00 0.00 ? 796 THR A OG1  5  
ATOM 6204  C CG2  . THR A 1 13  ? 6.477   1.284   -18.489 1.00 0.00 ? 796 THR A CG2  5  
ATOM 6205  H H    . THR A 1 13  ? 5.462   0.343   -22.424 1.00 0.00 ? 796 THR A H    5  
ATOM 6206  H HA   . THR A 1 13  ? 7.027   -0.776  -20.196 1.00 0.00 ? 796 THR A HA   5  
ATOM 6207  H HB   . THR A 1 13  ? 5.481   1.823   -20.292 1.00 0.00 ? 796 THR A HB   5  
ATOM 6208  H HG1  . THR A 1 13  ? 7.250   2.398   -21.327 1.00 0.00 ? 796 THR A HG1  5  
ATOM 6209  H HG21 . THR A 1 13  ? 5.521   1.057   -18.041 1.00 0.00 ? 796 THR A HG21 5  
ATOM 6210  H HG22 . THR A 1 13  ? 6.795   2.269   -18.179 1.00 0.00 ? 796 THR A HG22 5  
ATOM 6211  H HG23 . THR A 1 13  ? 7.206   0.554   -18.172 1.00 0.00 ? 796 THR A HG23 5  
ATOM 6212  N N    . SER A 1 14  ? 5.013   -2.053  -19.447 1.00 0.00 ? 797 SER A N    5  
ATOM 6213  C CA   . SER A 1 14  ? 3.890   -2.738  -18.817 1.00 0.00 ? 797 SER A CA   5  
ATOM 6214  C C    . SER A 1 14  ? 4.208   -3.082  -17.365 1.00 0.00 ? 797 SER A C    5  
ATOM 6215  O O    . SER A 1 14  ? 4.317   -4.254  -17.001 1.00 0.00 ? 797 SER A O    5  
ATOM 6216  C CB   . SER A 1 14  ? 3.544   -4.012  -19.590 1.00 0.00 ? 797 SER A CB   5  
ATOM 6217  O OG   . SER A 1 14  ? 4.684   -4.840  -19.745 1.00 0.00 ? 797 SER A OG   5  
ATOM 6218  H H    . SER A 1 14  ? 5.858   -2.535  -19.572 1.00 0.00 ? 797 SER A H    5  
ATOM 6219  H HA   . SER A 1 14  ? 3.041   -2.072  -18.839 1.00 0.00 ? 797 SER A HA   5  
ATOM 6220  H HB2  . SER A 1 14  ? 2.786   -4.562  -19.053 1.00 0.00 ? 797 SER A HB2  5  
ATOM 6221  H HB3  . SER A 1 14  ? 3.171   -3.746  -20.569 1.00 0.00 ? 797 SER A HB3  5  
ATOM 6222  H HG   . SER A 1 14  ? 4.462   -5.589  -20.304 1.00 0.00 ? 797 SER A HG   5  
ATOM 6223  N N    . LEU A 1 15  ? 4.357   -2.052  -16.539 1.00 0.00 ? 798 LEU A N    5  
ATOM 6224  C CA   . LEU A 1 15  ? 4.663   -2.243  -15.126 1.00 0.00 ? 798 LEU A CA   5  
ATOM 6225  C C    . LEU A 1 15  ? 3.460   -1.892  -14.256 1.00 0.00 ? 798 LEU A C    5  
ATOM 6226  O O    . LEU A 1 15  ? 2.888   -0.810  -14.379 1.00 0.00 ? 798 LEU A O    5  
ATOM 6227  C CB   . LEU A 1 15  ? 5.864   -1.385  -14.723 1.00 0.00 ? 798 LEU A CB   5  
ATOM 6228  C CG   . LEU A 1 15  ? 7.239   -1.934  -15.107 1.00 0.00 ? 798 LEU A CG   5  
ATOM 6229  C CD1  . LEU A 1 15  ? 7.581   -1.561  -16.541 1.00 0.00 ? 798 LEU A CD1  5  
ATOM 6230  C CD2  . LEU A 1 15  ? 8.304   -1.418  -14.150 1.00 0.00 ? 798 LEU A CD2  5  
ATOM 6231  H H    . LEU A 1 15  ? 4.258   -1.141  -16.887 1.00 0.00 ? 798 LEU A H    5  
ATOM 6232  H HA   . LEU A 1 15  ? 4.908   -3.284  -14.977 1.00 0.00 ? 798 LEU A HA   5  
ATOM 6233  H HB2  . LEU A 1 15  ? 5.752   -0.419  -15.191 1.00 0.00 ? 798 LEU A HB2  5  
ATOM 6234  H HB3  . LEU A 1 15  ? 5.841   -1.268  -13.649 1.00 0.00 ? 798 LEU A HB3  5  
ATOM 6235  H HG   . LEU A 1 15  ? 7.220   -3.013  -15.038 1.00 0.00 ? 798 LEU A HG   5  
ATOM 6236  H HD11 . LEU A 1 15  ? 8.382   -2.192  -16.895 1.00 0.00 ? 798 LEU A HD11 5  
ATOM 6237  H HD12 . LEU A 1 15  ? 7.894   -0.528  -16.579 1.00 0.00 ? 798 LEU A HD12 5  
ATOM 6238  H HD13 . LEU A 1 15  ? 6.711   -1.697  -17.166 1.00 0.00 ? 798 LEU A HD13 5  
ATOM 6239  H HD21 . LEU A 1 15  ? 8.103   -0.384  -13.912 1.00 0.00 ? 798 LEU A HD21 5  
ATOM 6240  H HD22 . LEU A 1 15  ? 9.276   -1.498  -14.617 1.00 0.00 ? 798 LEU A HD22 5  
ATOM 6241  H HD23 . LEU A 1 15  ? 8.290   -2.006  -13.245 1.00 0.00 ? 798 LEU A HD23 5  
ATOM 6242  N N    . GLU A 1 16  ? 3.083   -2.815  -13.376 1.00 0.00 ? 799 GLU A N    5  
ATOM 6243  C CA   . GLU A 1 16  ? 1.948   -2.602  -12.485 1.00 0.00 ? 799 GLU A CA   5  
ATOM 6244  C C    . GLU A 1 16  ? 2.406   -2.019  -11.151 1.00 0.00 ? 799 GLU A C    5  
ATOM 6245  O O    . GLU A 1 16  ? 2.876   -2.743  -10.273 1.00 0.00 ? 799 GLU A O    5  
ATOM 6246  C CB   . GLU A 1 16  ? 1.202   -3.917  -12.251 1.00 0.00 ? 799 GLU A CB   5  
ATOM 6247  C CG   . GLU A 1 16  ? 2.052   -4.990  -11.590 1.00 0.00 ? 799 GLU A CG   5  
ATOM 6248  C CD   . GLU A 1 16  ? 1.613   -6.393  -11.963 1.00 0.00 ? 799 GLU A CD   5  
ATOM 6249  O OE1  . GLU A 1 16  ? 0.734   -6.943  -11.266 1.00 0.00 ? 799 GLU A OE1  5  
ATOM 6250  O OE2  . GLU A 1 16  ? 2.148   -6.941  -12.949 1.00 0.00 ? 799 GLU A OE2  5  
ATOM 6251  H H    . GLU A 1 16  ? 3.579   -3.659  -13.326 1.00 0.00 ? 799 GLU A H    5  
ATOM 6252  H HA   . GLU A 1 16  ? 1.281   -1.900  -12.961 1.00 0.00 ? 799 GLU A HA   5  
ATOM 6253  H HB2  . GLU A 1 16  ? 0.347   -3.724  -11.619 1.00 0.00 ? 799 GLU A HB2  5  
ATOM 6254  H HB3  . GLU A 1 16  ? 0.857   -4.296  -13.202 1.00 0.00 ? 799 GLU A HB3  5  
ATOM 6255  H HG2  . GLU A 1 16  ? 3.078   -4.857  -11.897 1.00 0.00 ? 799 GLU A HG2  5  
ATOM 6256  H HG3  . GLU A 1 16  ? 1.981   -4.879  -10.518 1.00 0.00 ? 799 GLU A HG3  5  
ATOM 6257  N N    . LYS A 1 17  ? 2.266   -0.706  -11.007 1.00 0.00 ? 800 LYS A N    5  
ATOM 6258  C CA   . LYS A 1 17  ? 2.664   -0.024  -9.782  1.00 0.00 ? 800 LYS A CA   5  
ATOM 6259  C C    . LYS A 1 17  ? 1.547   0.884   -9.277  1.00 0.00 ? 800 LYS A C    5  
ATOM 6260  O O    . LYS A 1 17  ? 1.692   2.106   -9.245  1.00 0.00 ? 800 LYS A O    5  
ATOM 6261  C CB   . LYS A 1 17  ? 3.934   0.797   -10.019 1.00 0.00 ? 800 LYS A CB   5  
ATOM 6262  C CG   . LYS A 1 17  ? 4.017   1.398   -11.412 1.00 0.00 ? 800 LYS A CG   5  
ATOM 6263  C CD   . LYS A 1 17  ? 5.029   2.530   -11.470 1.00 0.00 ? 800 LYS A CD   5  
ATOM 6264  C CE   . LYS A 1 17  ? 6.416   2.020   -11.830 1.00 0.00 ? 800 LYS A CE   5  
ATOM 6265  N NZ   . LYS A 1 17  ? 7.111   1.424   -10.655 1.00 0.00 ? 800 LYS A NZ   5  
ATOM 6266  H H    . LYS A 1 17  ? 1.885   -0.182  -11.744 1.00 0.00 ? 800 LYS A H    5  
ATOM 6267  H HA   . LYS A 1 17  ? 2.866   -0.776  -9.034  1.00 0.00 ? 800 LYS A HA   5  
ATOM 6268  H HB2  . LYS A 1 17  ? 3.968   1.602   -9.300  1.00 0.00 ? 800 LYS A HB2  5  
ATOM 6269  H HB3  . LYS A 1 17  ? 4.793   0.159   -9.874  1.00 0.00 ? 800 LYS A HB3  5  
ATOM 6270  H HG2  . LYS A 1 17  ? 4.313   0.629   -12.109 1.00 0.00 ? 800 LYS A HG2  5  
ATOM 6271  H HG3  . LYS A 1 17  ? 3.045   1.782   -11.687 1.00 0.00 ? 800 LYS A HG3  5  
ATOM 6272  H HD2  . LYS A 1 17  ? 4.716   3.244   -12.218 1.00 0.00 ? 800 LYS A HD2  5  
ATOM 6273  H HD3  . LYS A 1 17  ? 5.073   3.013   -10.504 1.00 0.00 ? 800 LYS A HD3  5  
ATOM 6274  H HE2  . LYS A 1 17  ? 6.321   1.269   -12.600 1.00 0.00 ? 800 LYS A HE2  5  
ATOM 6275  H HE3  . LYS A 1 17  ? 7.003   2.845   -12.205 1.00 0.00 ? 800 LYS A HE3  5  
ATOM 6276  H HZ1  . LYS A 1 17  ? 6.500   1.477   -9.815  1.00 0.00 ? 800 LYS A HZ1  5  
ATOM 6277  H HZ2  . LYS A 1 17  ? 7.992   1.941   -10.462 1.00 0.00 ? 800 LYS A HZ2  5  
ATOM 6278  H HZ3  . LYS A 1 17  ? 7.339   0.427   -10.842 1.00 0.00 ? 800 LYS A HZ3  5  
ATOM 6279  N N    . HIS A 1 18  ? 0.431   0.277   -8.882  1.00 0.00 ? 801 HIS A N    5  
ATOM 6280  C CA   . HIS A 1 18  ? -0.710  1.031   -8.376  1.00 0.00 ? 801 HIS A CA   5  
ATOM 6281  C C    . HIS A 1 18  ? -0.898  0.795   -6.880  1.00 0.00 ? 801 HIS A C    5  
ATOM 6282  O O    . HIS A 1 18  ? -0.976  1.741   -6.096  1.00 0.00 ? 801 HIS A O    5  
ATOM 6283  C CB   . HIS A 1 18  ? -1.981  0.639   -9.130  1.00 0.00 ? 801 HIS A CB   5  
ATOM 6284  C CG   . HIS A 1 18  ? -2.208  -0.840  -9.194  1.00 0.00 ? 801 HIS A CG   5  
ATOM 6285  N ND1  . HIS A 1 18  ? -1.357  -1.704  -9.850  1.00 0.00 ? 801 HIS A ND1  5  
ATOM 6286  C CD2  . HIS A 1 18  ? -3.195  -1.608  -8.677  1.00 0.00 ? 801 HIS A CD2  5  
ATOM 6287  C CE1  . HIS A 1 18  ? -1.812  -2.938  -9.736  1.00 0.00 ? 801 HIS A CE1  5  
ATOM 6288  N NE2  . HIS A 1 18  ? -2.927  -2.908  -9.028  1.00 0.00 ? 801 HIS A NE2  5  
ATOM 6289  H H    . HIS A 1 18  ? 0.376   -0.699  -8.931  1.00 0.00 ? 801 HIS A H    5  
ATOM 6290  H HA   . HIS A 1 18  ? -0.514  2.080   -8.540  1.00 0.00 ? 801 HIS A HA   5  
ATOM 6291  H HB2  . HIS A 1 18  ? -2.835  1.084   -8.639  1.00 0.00 ? 801 HIS A HB2  5  
ATOM 6292  H HB3  . HIS A 1 18  ? -1.921  1.011   -10.143 1.00 0.00 ? 801 HIS A HB3  5  
ATOM 6293  H HD2  . HIS A 1 18  ? -4.039  -1.262  -8.096  1.00 0.00 ? 801 HIS A HD2  5  
ATOM 6294  H HE1  . HIS A 1 18  ? -1.352  -3.823  -10.150 1.00 0.00 ? 801 HIS A HE1  5  
ATOM 6295  H HE2  . HIS A 1 18  ? -3.514  -3.675  -8.867  1.00 0.00 ? 801 HIS A HE2  5  
ATOM 6296  N N    . LYS A 1 19  ? -0.972  -0.474  -6.491  1.00 0.00 ? 802 LYS A N    5  
ATOM 6297  C CA   . LYS A 1 19  ? -1.150  -0.836  -5.090  1.00 0.00 ? 802 LYS A CA   5  
ATOM 6298  C C    . LYS A 1 19  ? -0.040  -0.242  -4.229  1.00 0.00 ? 802 LYS A C    5  
ATOM 6299  O O    . LYS A 1 19  ? 1.051   0.051   -4.720  1.00 0.00 ? 802 LYS A O    5  
ATOM 6300  C CB   . LYS A 1 19  ? -1.171  -2.358  -4.935  1.00 0.00 ? 802 LYS A CB   5  
ATOM 6301  C CG   . LYS A 1 19  ? -2.305  -3.031  -5.690  1.00 0.00 ? 802 LYS A CG   5  
ATOM 6302  C CD   . LYS A 1 19  ? -2.072  -4.526  -5.829  1.00 0.00 ? 802 LYS A CD   5  
ATOM 6303  C CE   . LYS A 1 19  ? -3.337  -5.249  -6.265  1.00 0.00 ? 802 LYS A CE   5  
ATOM 6304  N NZ   . LYS A 1 19  ? -3.261  -6.711  -5.994  1.00 0.00 ? 802 LYS A NZ   5  
ATOM 6305  H H    . LYS A 1 19  ? -0.903  -1.184  -7.164  1.00 0.00 ? 802 LYS A H    5  
ATOM 6306  H HA   . LYS A 1 19  ? -2.097  -0.435  -4.762  1.00 0.00 ? 802 LYS A HA   5  
ATOM 6307  H HB2  . LYS A 1 19  ? -0.237  -2.758  -5.298  1.00 0.00 ? 802 LYS A HB2  5  
ATOM 6308  H HB3  . LYS A 1 19  ? -1.273  -2.599  -3.886  1.00 0.00 ? 802 LYS A HB3  5  
ATOM 6309  H HG2  . LYS A 1 19  ? -3.228  -2.869  -5.154  1.00 0.00 ? 802 LYS A HG2  5  
ATOM 6310  H HG3  . LYS A 1 19  ? -2.377  -2.594  -6.676  1.00 0.00 ? 802 LYS A HG3  5  
ATOM 6311  H HD2  . LYS A 1 19  ? -1.302  -4.695  -6.567  1.00 0.00 ? 802 LYS A HD2  5  
ATOM 6312  H HD3  . LYS A 1 19  ? -1.752  -4.922  -4.875  1.00 0.00 ? 802 LYS A HD3  5  
ATOM 6313  H HE2  . LYS A 1 19  ? -4.176  -4.835  -5.728  1.00 0.00 ? 802 LYS A HE2  5  
ATOM 6314  H HE3  . LYS A 1 19  ? -3.477  -5.094  -7.325  1.00 0.00 ? 802 LYS A HE3  5  
ATOM 6315  H HZ1  . LYS A 1 19  ? -2.344  -7.086  -6.310  1.00 0.00 ? 802 LYS A HZ1  5  
ATOM 6316  H HZ2  . LYS A 1 19  ? -4.020  -7.208  -6.503  1.00 0.00 ? 802 LYS A HZ2  5  
ATOM 6317  H HZ3  . LYS A 1 19  ? -3.366  -6.892  -4.976  1.00 0.00 ? 802 LYS A HZ3  5  
ATOM 6318  N N    . LEU A 1 20  ? -0.324  -0.067  -2.944  1.00 0.00 ? 803 LEU A N    5  
ATOM 6319  C CA   . LEU A 1 20  ? 0.651   0.491   -2.013  1.00 0.00 ? 803 LEU A CA   5  
ATOM 6320  C C    . LEU A 1 20  ? 0.888   -0.455  -0.840  1.00 0.00 ? 803 LEU A C    5  
ATOM 6321  O O    . LEU A 1 20  ? 0.032   -1.276  -0.509  1.00 0.00 ? 803 LEU A O    5  
ATOM 6322  C CB   . LEU A 1 20  ? 0.175   1.850   -1.498  1.00 0.00 ? 803 LEU A CB   5  
ATOM 6323  C CG   . LEU A 1 20  ? -0.460  2.776   -2.537  1.00 0.00 ? 803 LEU A CG   5  
ATOM 6324  C CD1  . LEU A 1 20  ? -1.256  3.878   -1.854  1.00 0.00 ? 803 LEU A CD1  5  
ATOM 6325  C CD2  . LEU A 1 20  ? 0.607   3.371   -3.444  1.00 0.00 ? 803 LEU A CD2  5  
ATOM 6326  H H    . LEU A 1 20  ? -1.211  -0.319  -2.611  1.00 0.00 ? 803 LEU A H    5  
ATOM 6327  H HA   . LEU A 1 20  ? 1.580   0.623   -2.547  1.00 0.00 ? 803 LEU A HA   5  
ATOM 6328  H HB2  . LEU A 1 20  ? -0.555  1.673   -0.724  1.00 0.00 ? 803 LEU A HB2  5  
ATOM 6329  H HB3  . LEU A 1 20  ? 1.029   2.361   -1.076  1.00 0.00 ? 803 LEU A HB3  5  
ATOM 6330  H HG   . LEU A 1 20  ? -1.142  2.204   -3.151  1.00 0.00 ? 803 LEU A HG   5  
ATOM 6331  H HD11 . LEU A 1 20  ? -0.684  4.278   -1.031  1.00 0.00 ? 803 LEU A HD11 5  
ATOM 6332  H HD12 . LEU A 1 20  ? -2.186  3.473   -1.483  1.00 0.00 ? 803 LEU A HD12 5  
ATOM 6333  H HD13 . LEU A 1 20  ? -1.464  4.665   -2.564  1.00 0.00 ? 803 LEU A HD13 5  
ATOM 6334  H HD21 . LEU A 1 20  ? 0.429   4.430   -3.563  1.00 0.00 ? 803 LEU A HD21 5  
ATOM 6335  H HD22 . LEU A 1 20  ? 0.567   2.889   -4.410  1.00 0.00 ? 803 LEU A HD22 5  
ATOM 6336  H HD23 . LEU A 1 20  ? 1.581   3.216   -3.004  1.00 0.00 ? 803 LEU A HD23 5  
ATOM 6337  N N    . PHE A 1 21  ? 2.054   -0.333  -0.215  1.00 0.00 ? 804 PHE A N    5  
ATOM 6338  C CA   . PHE A 1 21  ? 2.403   -1.177  0.923   1.00 0.00 ? 804 PHE A CA   5  
ATOM 6339  C C    . PHE A 1 21  ? 2.864   -0.331  2.106   1.00 0.00 ? 804 PHE A C    5  
ATOM 6340  O O    . PHE A 1 21  ? 3.939   0.268   2.073   1.00 0.00 ? 804 PHE A O    5  
ATOM 6341  C CB   . PHE A 1 21  ? 3.501   -2.167  0.532   1.00 0.00 ? 804 PHE A CB   5  
ATOM 6342  C CG   . PHE A 1 21  ? 4.227   -2.754  1.709   1.00 0.00 ? 804 PHE A CG   5  
ATOM 6343  C CD1  . PHE A 1 21  ? 3.706   -3.843  2.388   1.00 0.00 ? 804 PHE A CD1  5  
ATOM 6344  C CD2  . PHE A 1 21  ? 5.429   -2.215  2.137   1.00 0.00 ? 804 PHE A CD2  5  
ATOM 6345  C CE1  . PHE A 1 21  ? 4.371   -4.386  3.471   1.00 0.00 ? 804 PHE A CE1  5  
ATOM 6346  C CE2  . PHE A 1 21  ? 6.099   -2.753  3.220   1.00 0.00 ? 804 PHE A CE2  5  
ATOM 6347  C CZ   . PHE A 1 21  ? 5.569   -3.839  3.888   1.00 0.00 ? 804 PHE A CZ   5  
ATOM 6348  H H    . PHE A 1 21  ? 2.695   0.340   -0.526  1.00 0.00 ? 804 PHE A H    5  
ATOM 6349  H HA   . PHE A 1 21  ? 1.520   -1.726  1.210   1.00 0.00 ? 804 PHE A HA   5  
ATOM 6350  H HB2  . PHE A 1 21  ? 3.061   -2.981  -0.025  1.00 0.00 ? 804 PHE A HB2  5  
ATOM 6351  H HB3  . PHE A 1 21  ? 4.227   -1.663  -0.089  1.00 0.00 ? 804 PHE A HB3  5  
ATOM 6352  H HD1  . PHE A 1 21  ? 2.768   -4.272  2.062   1.00 0.00 ? 804 PHE A HD1  5  
ATOM 6353  H HD2  . PHE A 1 21  ? 5.845   -1.365  1.616   1.00 0.00 ? 804 PHE A HD2  5  
ATOM 6354  H HE1  . PHE A 1 21  ? 3.953   -5.235  3.992   1.00 0.00 ? 804 PHE A HE1  5  
ATOM 6355  H HE2  . PHE A 1 21  ? 7.035   -2.324  3.544   1.00 0.00 ? 804 PHE A HE2  5  
ATOM 6356  H HZ   . PHE A 1 21  ? 6.090   -4.261  4.734   1.00 0.00 ? 804 PHE A HZ   5  
ATOM 6357  N N    . ILE A 1 22  ? 2.042   -0.286  3.149   1.00 0.00 ? 805 ILE A N    5  
ATOM 6358  C CA   . ILE A 1 22  ? 2.364   0.486   4.343   1.00 0.00 ? 805 ILE A CA   5  
ATOM 6359  C C    . ILE A 1 22  ? 2.761   -0.428  5.498   1.00 0.00 ? 805 ILE A C    5  
ATOM 6360  O O    . ILE A 1 22  ? 2.127   -1.456  5.735   1.00 0.00 ? 805 ILE A O    5  
ATOM 6361  C CB   . ILE A 1 22  ? 1.179   1.365   4.782   1.00 0.00 ? 805 ILE A CB   5  
ATOM 6362  C CG1  . ILE A 1 22  ? 0.502   1.994   3.563   1.00 0.00 ? 805 ILE A CG1  5  
ATOM 6363  C CG2  . ILE A 1 22  ? 1.647   2.442   5.749   1.00 0.00 ? 805 ILE A CG2  5  
ATOM 6364  C CD1  . ILE A 1 22  ? -0.501  3.070   3.916   1.00 0.00 ? 805 ILE A CD1  5  
ATOM 6365  H H    . ILE A 1 22  ? 1.199   -0.784  3.115   1.00 0.00 ? 805 ILE A H    5  
ATOM 6366  H HA   . ILE A 1 22  ? 3.197   1.132   4.106   1.00 0.00 ? 805 ILE A HA   5  
ATOM 6367  H HB   . ILE A 1 22  ? 0.466   0.738   5.297   1.00 0.00 ? 805 ILE A HB   5  
ATOM 6368  H HG12 . ILE A 1 22  ? 1.255   2.438   2.931   1.00 0.00 ? 805 ILE A HG12 5  
ATOM 6369  H HG13 . ILE A 1 22  ? -0.017  1.224   3.011   1.00 0.00 ? 805 ILE A HG13 5  
ATOM 6370  H HG21 . ILE A 1 22  ? 2.555   2.117   6.237   1.00 0.00 ? 805 ILE A HG21 5  
ATOM 6371  H HG22 . ILE A 1 22  ? 1.838   3.355   5.206   1.00 0.00 ? 805 ILE A HG22 5  
ATOM 6372  H HG23 . ILE A 1 22  ? 0.883   2.617   6.492   1.00 0.00 ? 805 ILE A HG23 5  
ATOM 6373  H HD11 . ILE A 1 22  ? -0.005  3.861   4.460   1.00 0.00 ? 805 ILE A HD11 5  
ATOM 6374  H HD12 . ILE A 1 22  ? -0.934  3.470   3.012   1.00 0.00 ? 805 ILE A HD12 5  
ATOM 6375  H HD13 . ILE A 1 22  ? -1.281  2.646   4.532   1.00 0.00 ? 805 ILE A HD13 5  
ATOM 6376  N N    . SER A 1 23  ? 3.813   -0.045  6.213   1.00 0.00 ? 806 SER A N    5  
ATOM 6377  C CA   . SER A 1 23  ? 4.297   -0.830  7.343   1.00 0.00 ? 806 SER A CA   5  
ATOM 6378  C C    . SER A 1 23  ? 4.516   0.055   8.566   1.00 0.00 ? 806 SER A C    5  
ATOM 6379  O O    . SER A 1 23  ? 4.812   1.242   8.442   1.00 0.00 ? 806 SER A O    5  
ATOM 6380  C CB   . SER A 1 23  ? 5.599   -1.543  6.975   1.00 0.00 ? 806 SER A CB   5  
ATOM 6381  O OG   . SER A 1 23  ? 6.627   -0.611  6.688   1.00 0.00 ? 806 SER A OG   5  
ATOM 6382  H H    . SER A 1 23  ? 4.277   0.785   5.974   1.00 0.00 ? 806 SER A H    5  
ATOM 6383  H HA   . SER A 1 23  ? 3.545   -1.570  7.578   1.00 0.00 ? 806 SER A HA   5  
ATOM 6384  H HB2  . SER A 1 23  ? 5.913   -2.163  7.801   1.00 0.00 ? 806 SER A HB2  5  
ATOM 6385  H HB3  . SER A 1 23  ? 5.435   -2.160  6.104   1.00 0.00 ? 806 SER A HB3  5  
ATOM 6386  H HG   . SER A 1 23  ? 7.399   -1.077  6.358   1.00 0.00 ? 806 SER A HG   5  
ATOM 6387  N N    . GLY A 1 24  ? 4.367   -0.534  9.749   1.00 0.00 ? 807 GLY A N    5  
ATOM 6388  C CA   . GLY A 1 24  ? 4.551   0.215   10.979  1.00 0.00 ? 807 GLY A CA   5  
ATOM 6389  C C    . GLY A 1 24  ? 3.306   0.977   11.386  1.00 0.00 ? 807 GLY A C    5  
ATOM 6390  O O    . GLY A 1 24  ? 3.374   2.162   11.713  1.00 0.00 ? 807 GLY A O    5  
ATOM 6391  H H    . GLY A 1 24  ? 4.129   -1.484  9.787   1.00 0.00 ? 807 GLY A H    5  
ATOM 6392  H HA2  . GLY A 1 24  ? 4.816   -0.472  11.769  1.00 0.00 ? 807 GLY A HA2  5  
ATOM 6393  H HA3  . GLY A 1 24  ? 5.360   0.917   10.841  1.00 0.00 ? 807 GLY A HA3  5  
ATOM 6394  N N    . LEU A 1 25  ? 2.165   0.296   11.366  1.00 0.00 ? 808 LEU A N    5  
ATOM 6395  C CA   . LEU A 1 25  ? 0.898   0.917   11.735  1.00 0.00 ? 808 LEU A CA   5  
ATOM 6396  C C    . LEU A 1 25  ? 0.514   0.563   13.168  1.00 0.00 ? 808 LEU A C    5  
ATOM 6397  O O    . LEU A 1 25  ? 0.746   -0.550  13.642  1.00 0.00 ? 808 LEU A O    5  
ATOM 6398  C CB   . LEU A 1 25  ? -0.208  0.474   10.775  1.00 0.00 ? 808 LEU A CB   5  
ATOM 6399  C CG   . LEU A 1 25  ? -0.177  1.101   9.380   1.00 0.00 ? 808 LEU A CG   5  
ATOM 6400  C CD1  . LEU A 1 25  ? -0.990  0.267   8.402   1.00 0.00 ? 808 LEU A CD1  5  
ATOM 6401  C CD2  . LEU A 1 25  ? -0.697  2.530   9.426   1.00 0.00 ? 808 LEU A CD2  5  
ATOM 6402  H H    . LEU A 1 25  ? 2.174   -0.646  11.097  1.00 0.00 ? 808 LEU A H    5  
ATOM 6403  H HA   . LEU A 1 25  ? 1.019   1.988   11.661  1.00 0.00 ? 808 LEU A HA   5  
ATOM 6404  H HB2  . LEU A 1 25  ? -0.135  -0.596  10.658  1.00 0.00 ? 808 LEU A HB2  5  
ATOM 6405  H HB3  . LEU A 1 25  ? -1.157  0.721   11.229  1.00 0.00 ? 808 LEU A HB3  5  
ATOM 6406  H HG   . LEU A 1 25  ? 0.845   1.127   9.027   1.00 0.00 ? 808 LEU A HG   5  
ATOM 6407  H HD11 . LEU A 1 25  ? -0.596  -0.738  8.372   1.00 0.00 ? 808 LEU A HD11 5  
ATOM 6408  H HD12 . LEU A 1 25  ? -0.930  0.707   7.418   1.00 0.00 ? 808 LEU A HD12 5  
ATOM 6409  H HD13 . LEU A 1 25  ? -2.021  0.240   8.722   1.00 0.00 ? 808 LEU A HD13 5  
ATOM 6410  H HD21 . LEU A 1 25  ? -0.418  2.984   10.365  1.00 0.00 ? 808 LEU A HD21 5  
ATOM 6411  H HD22 . LEU A 1 25  ? -1.774  2.524   9.335   1.00 0.00 ? 808 LEU A HD22 5  
ATOM 6412  H HD23 . LEU A 1 25  ? -0.269  3.095   8.611   1.00 0.00 ? 808 LEU A HD23 5  
ATOM 6413  N N    . PRO A 1 26  ? -0.088  1.529   13.876  1.00 0.00 ? 809 PRO A N    5  
ATOM 6414  C CA   . PRO A 1 26  ? -0.519  1.342   15.264  1.00 0.00 ? 809 PRO A CA   5  
ATOM 6415  C C    . PRO A 1 26  ? -1.701  0.385   15.381  1.00 0.00 ? 809 PRO A C    5  
ATOM 6416  O O    . PRO A 1 26  ? -2.710  0.543   14.694  1.00 0.00 ? 809 PRO A O    5  
ATOM 6417  C CB   . PRO A 1 26  ? -0.928  2.751   15.702  1.00 0.00 ? 809 PRO A CB   5  
ATOM 6418  C CG   . PRO A 1 26  ? -1.295  3.449   14.438  1.00 0.00 ? 809 PRO A CG   5  
ATOM 6419  C CD   . PRO A 1 26  ? -0.397  2.879   13.375  1.00 0.00 ? 809 PRO A CD   5  
ATOM 6420  H HA   . PRO A 1 26  ? 0.290   0.991   15.887  1.00 0.00 ? 809 PRO A HA   5  
ATOM 6421  H HB2  . PRO A 1 26  ? -1.768  2.691   16.379  1.00 0.00 ? 809 PRO A HB2  5  
ATOM 6422  H HB3  . PRO A 1 26  ? -0.097  3.235   16.193  1.00 0.00 ? 809 PRO A HB3  5  
ATOM 6423  H HG2  . PRO A 1 26  ? -2.329  3.255   14.198  1.00 0.00 ? 809 PRO A HG2  5  
ATOM 6424  H HG3  . PRO A 1 26  ? -1.125  4.510   14.542  1.00 0.00 ? 809 PRO A HG3  5  
ATOM 6425  H HD2  . PRO A 1 26  ? -0.915  2.831   12.429  1.00 0.00 ? 809 PRO A HD2  5  
ATOM 6426  H HD3  . PRO A 1 26  ? 0.503   3.471   13.284  1.00 0.00 ? 809 PRO A HD3  5  
ATOM 6427  N N    . PHE A 1 27  ? -1.568  -0.608  16.254  1.00 0.00 ? 810 PHE A N    5  
ATOM 6428  C CA   . PHE A 1 27  ? -2.624  -1.592  16.460  1.00 0.00 ? 810 PHE A CA   5  
ATOM 6429  C C    . PHE A 1 27  ? -3.990  -0.915  16.538  1.00 0.00 ? 810 PHE A C    5  
ATOM 6430  O O    . PHE A 1 27  ? -5.011  -1.513  16.201  1.00 0.00 ? 810 PHE A O    5  
ATOM 6431  C CB   . PHE A 1 27  ? -2.365  -2.391  17.738  1.00 0.00 ? 810 PHE A CB   5  
ATOM 6432  C CG   . PHE A 1 27  ? -0.964  -2.923  17.838  1.00 0.00 ? 810 PHE A CG   5  
ATOM 6433  C CD1  . PHE A 1 27  ? -0.387  -3.597  16.774  1.00 0.00 ? 810 PHE A CD1  5  
ATOM 6434  C CD2  . PHE A 1 27  ? -0.224  -2.751  18.997  1.00 0.00 ? 810 PHE A CD2  5  
ATOM 6435  C CE1  . PHE A 1 27  ? 0.902   -4.087  16.862  1.00 0.00 ? 810 PHE A CE1  5  
ATOM 6436  C CE2  . PHE A 1 27  ? 1.066   -3.239  19.091  1.00 0.00 ? 810 PHE A CE2  5  
ATOM 6437  C CZ   . PHE A 1 27  ? 1.629   -3.909  18.023  1.00 0.00 ? 810 PHE A CZ   5  
ATOM 6438  H H    . PHE A 1 27  ? -0.739  -0.681  16.772  1.00 0.00 ? 810 PHE A H    5  
ATOM 6439  H HA   . PHE A 1 27  ? -2.618  -2.265  15.617  1.00 0.00 ? 810 PHE A HA   5  
ATOM 6440  H HB2  . PHE A 1 27  ? -2.539  -1.755  18.593  1.00 0.00 ? 810 PHE A HB2  5  
ATOM 6441  H HB3  . PHE A 1 27  ? -3.043  -3.230  17.774  1.00 0.00 ? 810 PHE A HB3  5  
ATOM 6442  H HD1  . PHE A 1 27  ? -0.955  -3.737  15.865  1.00 0.00 ? 810 PHE A HD1  5  
ATOM 6443  H HD2  . PHE A 1 27  ? -0.663  -2.228  19.834  1.00 0.00 ? 810 PHE A HD2  5  
ATOM 6444  H HE1  . PHE A 1 27  ? 1.339   -4.611  16.025  1.00 0.00 ? 810 PHE A HE1  5  
ATOM 6445  H HE2  . PHE A 1 27  ? 1.632   -3.098  20.000  1.00 0.00 ? 810 PHE A HE2  5  
ATOM 6446  H HZ   . PHE A 1 27  ? 2.637   -4.291  18.093  1.00 0.00 ? 810 PHE A HZ   5  
ATOM 6447  N N    . SER A 1 28  ? -3.998  0.337   16.987  1.00 0.00 ? 811 SER A N    5  
ATOM 6448  C CA   . SER A 1 28  ? -5.238  1.094   17.114  1.00 0.00 ? 811 SER A CA   5  
ATOM 6449  C C    . SER A 1 28  ? -5.883  1.315   15.749  1.00 0.00 ? 811 SER A C    5  
ATOM 6450  O O    . SER A 1 28  ? -7.084  1.102   15.577  1.00 0.00 ? 811 SER A O    5  
ATOM 6451  C CB   . SER A 1 28  ? -4.969  2.442   17.787  1.00 0.00 ? 811 SER A CB   5  
ATOM 6452  O OG   . SER A 1 28  ? -4.721  2.279   19.173  1.00 0.00 ? 811 SER A OG   5  
ATOM 6453  H H    . SER A 1 28  ? -3.151  0.759   17.240  1.00 0.00 ? 811 SER A H    5  
ATOM 6454  H HA   . SER A 1 28  ? -5.914  0.522   17.731  1.00 0.00 ? 811 SER A HA   5  
ATOM 6455  H HB2  . SER A 1 28  ? -4.107  2.904   17.331  1.00 0.00 ? 811 SER A HB2  5  
ATOM 6456  H HB3  . SER A 1 28  ? -5.830  3.082   17.661  1.00 0.00 ? 811 SER A HB3  5  
ATOM 6457  H HG   . SER A 1 28  ? -5.141  2.992   19.660  1.00 0.00 ? 811 SER A HG   5  
ATOM 6458  N N    . CYS A 1 29  ? -5.077  1.741   14.783  1.00 0.00 ? 812 CYS A N    5  
ATOM 6459  C CA   . CYS A 1 29  ? -5.568  1.992   13.433  1.00 0.00 ? 812 CYS A CA   5  
ATOM 6460  C C    . CYS A 1 29  ? -6.511  0.880   12.982  1.00 0.00 ? 812 CYS A C    5  
ATOM 6461  O O    . CYS A 1 29  ? -6.370  -0.273  13.392  1.00 0.00 ? 812 CYS A O    5  
ATOM 6462  C CB   . CYS A 1 29  ? -4.398  2.111   12.456  1.00 0.00 ? 812 CYS A CB   5  
ATOM 6463  S SG   . CYS A 1 29  ? -4.884  2.549   10.771  1.00 0.00 ? 812 CYS A SG   5  
ATOM 6464  H H    . CYS A 1 29  ? -4.129  1.892   14.982  1.00 0.00 ? 812 CYS A H    5  
ATOM 6465  H HA   . CYS A 1 29  ? -6.112  2.924   13.446  1.00 0.00 ? 812 CYS A HA   5  
ATOM 6466  H HB2  . CYS A 1 29  ? -3.720  2.874   12.810  1.00 0.00 ? 812 CYS A HB2  5  
ATOM 6467  H HB3  . CYS A 1 29  ? -3.876  1.167   12.414  1.00 0.00 ? 812 CYS A HB3  5  
ATOM 6468  H HG   . CYS A 1 29  ? -4.646  1.505   9.992   1.00 0.00 ? 812 CYS A HG   5  
ATOM 6469  N N    . THR A 1 30  ? -7.474  1.234   12.137  1.00 0.00 ? 813 THR A N    5  
ATOM 6470  C CA   . THR A 1 30  ? -8.442  0.268   11.633  1.00 0.00 ? 813 THR A CA   5  
ATOM 6471  C C    . THR A 1 30  ? -8.716  0.487   10.150  1.00 0.00 ? 813 THR A C    5  
ATOM 6472  O O    . THR A 1 30  ? -8.512  1.582   9.625   1.00 0.00 ? 813 THR A O    5  
ATOM 6473  C CB   . THR A 1 30  ? -9.771  0.349   12.407  1.00 0.00 ? 813 THR A CB   5  
ATOM 6474  O OG1  . THR A 1 30  ? -10.731 -0.540  11.825  1.00 0.00 ? 813 THR A OG1  5  
ATOM 6475  C CG2  . THR A 1 30  ? -10.317 1.769   12.397  1.00 0.00 ? 813 THR A CG2  5  
ATOM 6476  H H    . THR A 1 30  ? -7.534  2.168   11.847  1.00 0.00 ? 813 THR A H    5  
ATOM 6477  H HA   . THR A 1 30  ? -8.029  -0.721  11.771  1.00 0.00 ? 813 THR A HA   5  
ATOM 6478  H HB   . THR A 1 30  ? -9.593  0.054   13.431  1.00 0.00 ? 813 THR A HB   5  
ATOM 6479  H HG1  . THR A 1 30  ? -11.615 -0.279  12.096  1.00 0.00 ? 813 THR A HG1  5  
ATOM 6480  H HG21 . THR A 1 30  ? -9.866  2.334   13.200  1.00 0.00 ? 813 THR A HG21 5  
ATOM 6481  H HG22 . THR A 1 30  ? -11.388 1.744   12.532  1.00 0.00 ? 813 THR A HG22 5  
ATOM 6482  H HG23 . THR A 1 30  ? -10.084 2.238   11.453  1.00 0.00 ? 813 THR A HG23 5  
ATOM 6483  N N    . LYS A 1 31  ? -9.179  -0.561  9.477   1.00 0.00 ? 814 LYS A N    5  
ATOM 6484  C CA   . LYS A 1 31  ? -9.484  -0.484  8.054   1.00 0.00 ? 814 LYS A CA   5  
ATOM 6485  C C    . LYS A 1 31  ? -10.203 0.819   7.721   1.00 0.00 ? 814 LYS A C    5  
ATOM 6486  O O    . LYS A 1 31  ? -9.720  1.618   6.920   1.00 0.00 ? 814 LYS A O    5  
ATOM 6487  C CB   . LYS A 1 31  ? -10.343 -1.676  7.629   1.00 0.00 ? 814 LYS A CB   5  
ATOM 6488  C CG   . LYS A 1 31  ? -10.424 -1.863  6.124   1.00 0.00 ? 814 LYS A CG   5  
ATOM 6489  C CD   . LYS A 1 31  ? -11.237 -3.094  5.758   1.00 0.00 ? 814 LYS A CD   5  
ATOM 6490  C CE   . LYS A 1 31  ? -10.447 -4.373  5.992   1.00 0.00 ? 814 LYS A CE   5  
ATOM 6491  N NZ   . LYS A 1 31  ? -10.973 -5.505  5.180   1.00 0.00 ? 814 LYS A NZ   5  
ATOM 6492  H H    . LYS A 1 31  ? -9.321  -1.408  9.951   1.00 0.00 ? 814 LYS A H    5  
ATOM 6493  H HA   . LYS A 1 31  ? -8.550  -0.513  7.513   1.00 0.00 ? 814 LYS A HA   5  
ATOM 6494  H HB2  . LYS A 1 31  ? -9.929  -2.575  8.061   1.00 0.00 ? 814 LYS A HB2  5  
ATOM 6495  H HB3  . LYS A 1 31  ? -11.346 -1.535  8.008   1.00 0.00 ? 814 LYS A HB3  5  
ATOM 6496  H HG2  . LYS A 1 31  ? -10.892 -0.993  5.687   1.00 0.00 ? 814 LYS A HG2  5  
ATOM 6497  H HG3  . LYS A 1 31  ? -9.424  -1.973  5.730   1.00 0.00 ? 814 LYS A HG3  5  
ATOM 6498  H HD2  . LYS A 1 31  ? -12.129 -3.119  6.365   1.00 0.00 ? 814 LYS A HD2  5  
ATOM 6499  H HD3  . LYS A 1 31  ? -11.510 -3.036  4.714   1.00 0.00 ? 814 LYS A HD3  5  
ATOM 6500  H HE2  . LYS A 1 31  ? -9.416  -4.198  5.725   1.00 0.00 ? 814 LYS A HE2  5  
ATOM 6501  H HE3  . LYS A 1 31  ? -10.509 -4.632  7.039   1.00 0.00 ? 814 LYS A HE3  5  
ATOM 6502  H HZ1  . LYS A 1 31  ? -10.390 -5.634  4.328   1.00 0.00 ? 814 LYS A HZ1  5  
ATOM 6503  H HZ2  . LYS A 1 31  ? -11.953 -5.313  4.891   1.00 0.00 ? 814 LYS A HZ2  5  
ATOM 6504  H HZ3  . LYS A 1 31  ? -10.953 -6.383  5.737   1.00 0.00 ? 814 LYS A HZ3  5  
ATOM 6505  N N    . GLU A 1 32  ? -11.360 1.027   8.343   1.00 0.00 ? 815 GLU A N    5  
ATOM 6506  C CA   . GLU A 1 32  ? -12.145 2.234   8.113   1.00 0.00 ? 815 GLU A CA   5  
ATOM 6507  C C    . GLU A 1 32  ? -11.243 3.463   8.035   1.00 0.00 ? 815 GLU A C    5  
ATOM 6508  O O    . GLU A 1 32  ? -11.059 4.043   6.966   1.00 0.00 ? 815 GLU A O    5  
ATOM 6509  C CB   . GLU A 1 32  ? -13.180 2.416   9.225   1.00 0.00 ? 815 GLU A CB   5  
ATOM 6510  C CG   . GLU A 1 32  ? -14.425 1.565   9.043   1.00 0.00 ? 815 GLU A CG   5  
ATOM 6511  C CD   . GLU A 1 32  ? -15.603 2.075   9.850   1.00 0.00 ? 815 GLU A CD   5  
ATOM 6512  O OE1  . GLU A 1 32  ? -15.715 1.702   11.036  1.00 0.00 ? 815 GLU A OE1  5  
ATOM 6513  O OE2  . GLU A 1 32  ? -16.413 2.847   9.296   1.00 0.00 ? 815 GLU A OE2  5  
ATOM 6514  H H    . GLU A 1 32  ? -11.693 0.352   8.971   1.00 0.00 ? 815 GLU A H    5  
ATOM 6515  H HA   . GLU A 1 32  ? -12.659 2.120   7.170   1.00 0.00 ? 815 GLU A HA   5  
ATOM 6516  H HB2  . GLU A 1 32  ? -12.725 2.156   10.169  1.00 0.00 ? 815 GLU A HB2  5  
ATOM 6517  H HB3  . GLU A 1 32  ? -13.479 3.454   9.254   1.00 0.00 ? 815 GLU A HB3  5  
ATOM 6518  H HG2  . GLU A 1 32  ? -14.697 1.567   7.998   1.00 0.00 ? 815 GLU A HG2  5  
ATOM 6519  H HG3  . GLU A 1 32  ? -14.204 0.555   9.355   1.00 0.00 ? 815 GLU A HG3  5  
ATOM 6520  N N    . GLU A 1 33  ? -10.685 3.853   9.177   1.00 0.00 ? 816 GLU A N    5  
ATOM 6521  C CA   . GLU A 1 33  ? -9.804  5.013   9.238   1.00 0.00 ? 816 GLU A CA   5  
ATOM 6522  C C    . GLU A 1 33  ? -8.919  5.090   7.998   1.00 0.00 ? 816 GLU A C    5  
ATOM 6523  O O    . GLU A 1 33  ? -9.010  6.036   7.214   1.00 0.00 ? 816 GLU A O    5  
ATOM 6524  C CB   . GLU A 1 33  ? -8.935  4.955   10.496  1.00 0.00 ? 816 GLU A CB   5  
ATOM 6525  C CG   . GLU A 1 33  ? -9.657  5.401   11.757  1.00 0.00 ? 816 GLU A CG   5  
ATOM 6526  C CD   . GLU A 1 33  ? -8.707  5.690   12.903  1.00 0.00 ? 816 GLU A CD   5  
ATOM 6527  O OE1  . GLU A 1 33  ? -7.555  5.211   12.854  1.00 0.00 ? 816 GLU A OE1  5  
ATOM 6528  O OE2  . GLU A 1 33  ? -9.117  6.395   13.848  1.00 0.00 ? 816 GLU A OE2  5  
ATOM 6529  H H    . GLU A 1 33  ? -10.870 3.349   9.997   1.00 0.00 ? 816 GLU A H    5  
ATOM 6530  H HA   . GLU A 1 33  ? -10.422 5.897   9.280   1.00 0.00 ? 816 GLU A HA   5  
ATOM 6531  H HB2  . GLU A 1 33  ? -8.597  3.939   10.640  1.00 0.00 ? 816 GLU A HB2  5  
ATOM 6532  H HB3  . GLU A 1 33  ? -8.076  5.594   10.355  1.00 0.00 ? 816 GLU A HB3  5  
ATOM 6533  H HG2  . GLU A 1 33  ? -10.216 6.299   11.538  1.00 0.00 ? 816 GLU A HG2  5  
ATOM 6534  H HG3  . GLU A 1 33  ? -10.339 4.620   12.061  1.00 0.00 ? 816 GLU A HG3  5  
ATOM 6535  N N    . LEU A 1 34  ? -8.062  4.090   7.827   1.00 0.00 ? 817 LEU A N    5  
ATOM 6536  C CA   . LEU A 1 34  ? -7.158  4.043   6.683   1.00 0.00 ? 817 LEU A CA   5  
ATOM 6537  C C    . LEU A 1 34  ? -7.900  4.367   5.390   1.00 0.00 ? 817 LEU A C    5  
ATOM 6538  O O    . LEU A 1 34  ? -7.496  5.252   4.637   1.00 0.00 ? 817 LEU A O    5  
ATOM 6539  C CB   . LEU A 1 34  ? -6.507  2.663   6.578   1.00 0.00 ? 817 LEU A CB   5  
ATOM 6540  C CG   . LEU A 1 34  ? -5.215  2.591   5.763   1.00 0.00 ? 817 LEU A CG   5  
ATOM 6541  C CD1  . LEU A 1 34  ? -4.106  3.374   6.449   1.00 0.00 ? 817 LEU A CD1  5  
ATOM 6542  C CD2  . LEU A 1 34  ? -4.796  1.143   5.555   1.00 0.00 ? 817 LEU A CD2  5  
ATOM 6543  H H    . LEU A 1 34  ? -8.035  3.365   8.485   1.00 0.00 ? 817 LEU A H    5  
ATOM 6544  H HA   . LEU A 1 34  ? -6.389  4.785   6.838   1.00 0.00 ? 817 LEU A HA   5  
ATOM 6545  H HB2  . LEU A 1 34  ? -6.285  2.326   7.579   1.00 0.00 ? 817 LEU A HB2  5  
ATOM 6546  H HB3  . LEU A 1 34  ? -7.223  1.993   6.124   1.00 0.00 ? 817 LEU A HB3  5  
ATOM 6547  H HG   . LEU A 1 34  ? -5.384  3.034   4.792   1.00 0.00 ? 817 LEU A HG   5  
ATOM 6548  H HD11 . LEU A 1 34  ? -4.349  4.426   6.438   1.00 0.00 ? 817 LEU A HD11 5  
ATOM 6549  H HD12 . LEU A 1 34  ? -3.175  3.214   5.926   1.00 0.00 ? 817 LEU A HD12 5  
ATOM 6550  H HD13 . LEU A 1 34  ? -4.007  3.038   7.471   1.00 0.00 ? 817 LEU A HD13 5  
ATOM 6551  H HD21 . LEU A 1 34  ? -4.956  0.587   6.467   1.00 0.00 ? 817 LEU A HD21 5  
ATOM 6552  H HD22 . LEU A 1 34  ? -3.749  1.105   5.289   1.00 0.00 ? 817 LEU A HD22 5  
ATOM 6553  H HD23 . LEU A 1 34  ? -5.385  0.709   4.761   1.00 0.00 ? 817 LEU A HD23 5  
ATOM 6554  N N    . GLU A 1 35  ? -8.989  3.645   5.141   1.00 0.00 ? 818 GLU A N    5  
ATOM 6555  C CA   . GLU A 1 35  ? -9.787  3.858   3.940   1.00 0.00 ? 818 GLU A CA   5  
ATOM 6556  C C    . GLU A 1 35  ? -10.074 5.342   3.733   1.00 0.00 ? 818 GLU A C    5  
ATOM 6557  O O    . GLU A 1 35  ? -9.732  5.911   2.697   1.00 0.00 ? 818 GLU A O    5  
ATOM 6558  C CB   . GLU A 1 35  ? -11.102 3.080   4.031   1.00 0.00 ? 818 GLU A CB   5  
ATOM 6559  C CG   . GLU A 1 35  ? -11.917 3.111   2.749   1.00 0.00 ? 818 GLU A CG   5  
ATOM 6560  C CD   . GLU A 1 35  ? -12.651 4.425   2.556   1.00 0.00 ? 818 GLU A CD   5  
ATOM 6561  O OE1  . GLU A 1 35  ? -13.091 5.012   3.566   1.00 0.00 ? 818 GLU A OE1  5  
ATOM 6562  O OE2  . GLU A 1 35  ? -12.785 4.864   1.395   1.00 0.00 ? 818 GLU A OE2  5  
ATOM 6563  H H    . GLU A 1 35  ? -9.260  2.954   5.780   1.00 0.00 ? 818 GLU A H    5  
ATOM 6564  H HA   . GLU A 1 35  ? -9.221  3.491   3.097   1.00 0.00 ? 818 GLU A HA   5  
ATOM 6565  H HB2  . GLU A 1 35  ? -10.882 2.050   4.269   1.00 0.00 ? 818 GLU A HB2  5  
ATOM 6566  H HB3  . GLU A 1 35  ? -11.702 3.503   4.824   1.00 0.00 ? 818 GLU A HB3  5  
ATOM 6567  H HG2  . GLU A 1 35  ? -11.253 2.961   1.911   1.00 0.00 ? 818 GLU A HG2  5  
ATOM 6568  H HG3  . GLU A 1 35  ? -12.643 2.312   2.780   1.00 0.00 ? 818 GLU A HG3  5  
ATOM 6569  N N    . GLU A 1 36  ? -10.706 5.961   4.725   1.00 0.00 ? 819 GLU A N    5  
ATOM 6570  C CA   . GLU A 1 36  ? -11.040 7.378   4.651   1.00 0.00 ? 819 GLU A CA   5  
ATOM 6571  C C    . GLU A 1 36  ? -9.800  8.215   4.348   1.00 0.00 ? 819 GLU A C    5  
ATOM 6572  O O    . GLU A 1 36  ? -9.867  9.199   3.612   1.00 0.00 ? 819 GLU A O    5  
ATOM 6573  C CB   . GLU A 1 36  ? -11.675 7.845   5.962   1.00 0.00 ? 819 GLU A CB   5  
ATOM 6574  C CG   . GLU A 1 36  ? -13.188 7.700   5.991   1.00 0.00 ? 819 GLU A CG   5  
ATOM 6575  C CD   . GLU A 1 36  ? -13.842 8.621   7.002   1.00 0.00 ? 819 GLU A CD   5  
ATOM 6576  O OE1  . GLU A 1 36  ? -13.400 8.629   8.170   1.00 0.00 ? 819 GLU A OE1  5  
ATOM 6577  O OE2  . GLU A 1 36  ? -14.796 9.334   6.627   1.00 0.00 ? 819 GLU A OE2  5  
ATOM 6578  H H    . GLU A 1 36  ? -10.953 5.452   5.526   1.00 0.00 ? 819 GLU A H    5  
ATOM 6579  H HA   . GLU A 1 36  ? -11.752 7.509   3.850   1.00 0.00 ? 819 GLU A HA   5  
ATOM 6580  H HB2  . GLU A 1 36  ? -11.263 7.264   6.775   1.00 0.00 ? 819 GLU A HB2  5  
ATOM 6581  H HB3  . GLU A 1 36  ? -11.431 8.885   6.116   1.00 0.00 ? 819 GLU A HB3  5  
ATOM 6582  H HG2  . GLU A 1 36  ? -13.577 7.932   5.011   1.00 0.00 ? 819 GLU A HG2  5  
ATOM 6583  H HG3  . GLU A 1 36  ? -13.434 6.680   6.243   1.00 0.00 ? 819 GLU A HG3  5  
ATOM 6584  N N    . ILE A 1 37  ? -8.670  7.815   4.922   1.00 0.00 ? 820 ILE A N    5  
ATOM 6585  C CA   . ILE A 1 37  ? -7.415  8.527   4.714   1.00 0.00 ? 820 ILE A CA   5  
ATOM 6586  C C    . ILE A 1 37  ? -6.889  8.310   3.299   1.00 0.00 ? 820 ILE A C    5  
ATOM 6587  O O    . ILE A 1 37  ? -6.257  9.194   2.718   1.00 0.00 ? 820 ILE A O    5  
ATOM 6588  C CB   . ILE A 1 37  ? -6.340  8.081   5.723   1.00 0.00 ? 820 ILE A CB   5  
ATOM 6589  C CG1  . ILE A 1 37  ? -6.836  8.292   7.155   1.00 0.00 ? 820 ILE A CG1  5  
ATOM 6590  C CG2  . ILE A 1 37  ? -5.045  8.843   5.488   1.00 0.00 ? 820 ILE A CG2  5  
ATOM 6591  C CD1  . ILE A 1 37  ? -6.020  7.552   8.192   1.00 0.00 ? 820 ILE A CD1  5  
ATOM 6592  H H    . ILE A 1 37  ? -8.680  7.023   5.498   1.00 0.00 ? 820 ILE A H    5  
ATOM 6593  H HA   . ILE A 1 37  ? -7.602  9.581   4.859   1.00 0.00 ? 820 ILE A HA   5  
ATOM 6594  H HB   . ILE A 1 37  ? -6.146  7.031   5.567   1.00 0.00 ? 820 ILE A HB   5  
ATOM 6595  H HG12 . ILE A 1 37  ? -6.798  9.343   7.392   1.00 0.00 ? 820 ILE A HG12 5  
ATOM 6596  H HG13 . ILE A 1 37  ? -7.858  7.947   7.228   1.00 0.00 ? 820 ILE A HG13 5  
ATOM 6597  H HG21 . ILE A 1 37  ? -5.166  9.867   5.808   1.00 0.00 ? 820 ILE A HG21 5  
ATOM 6598  H HG22 . ILE A 1 37  ? -4.249  8.382   6.054   1.00 0.00 ? 820 ILE A HG22 5  
ATOM 6599  H HG23 . ILE A 1 37  ? -4.799  8.820   4.437   1.00 0.00 ? 820 ILE A HG23 5  
ATOM 6600  H HD11 . ILE A 1 37  ? -6.499  7.638   9.156   1.00 0.00 ? 820 ILE A HD11 5  
ATOM 6601  H HD12 . ILE A 1 37  ? -5.945  6.511   7.916   1.00 0.00 ? 820 ILE A HD12 5  
ATOM 6602  H HD13 . ILE A 1 37  ? -5.030  7.983   8.244   1.00 0.00 ? 820 ILE A HD13 5  
ATOM 6603  N N    . CYS A 1 38  ? -7.154  7.131   2.749   1.00 0.00 ? 821 CYS A N    5  
ATOM 6604  C CA   . CYS A 1 38  ? -6.708  6.798   1.401   1.00 0.00 ? 821 CYS A CA   5  
ATOM 6605  C C    . CYS A 1 38  ? -7.562  7.507   0.355   1.00 0.00 ? 821 CYS A C    5  
ATOM 6606  O O    . CYS A 1 38  ? -7.056  8.293   -0.447  1.00 0.00 ? 821 CYS A O    5  
ATOM 6607  C CB   . CYS A 1 38  ? -6.764  5.285   1.182   1.00 0.00 ? 821 CYS A CB   5  
ATOM 6608  S SG   . CYS A 1 38  ? -5.555  4.353   2.151   1.00 0.00 ? 821 CYS A SG   5  
ATOM 6609  H H    . CYS A 1 38  ? -7.661  6.467   3.262   1.00 0.00 ? 821 CYS A H    5  
ATOM 6610  H HA   . CYS A 1 38  ? -5.686  7.130   1.299   1.00 0.00 ? 821 CYS A HA   5  
ATOM 6611  H HB2  . CYS A 1 38  ? -7.747  4.926   1.451   1.00 0.00 ? 821 CYS A HB2  5  
ATOM 6612  H HB3  . CYS A 1 38  ? -6.585  5.073   0.138   1.00 0.00 ? 821 CYS A HB3  5  
ATOM 6613  H HG   . CYS A 1 38  ? -5.630  4.769   3.406   1.00 0.00 ? 821 CYS A HG   5  
ATOM 6614  N N    . LYS A 1 39  ? -8.860  7.224   0.368   1.00 0.00 ? 822 LYS A N    5  
ATOM 6615  C CA   . LYS A 1 39  ? -9.786  7.834   -0.579  1.00 0.00 ? 822 LYS A CA   5  
ATOM 6616  C C    . LYS A 1 39  ? -9.624  9.351   -0.598  1.00 0.00 ? 822 LYS A C    5  
ATOM 6617  O O    . LYS A 1 39  ? -10.025 10.016  -1.553  1.00 0.00 ? 822 LYS A O    5  
ATOM 6618  C CB   . LYS A 1 39  ? -11.228 7.468   -0.222  1.00 0.00 ? 822 LYS A CB   5  
ATOM 6619  C CG   . LYS A 1 39  ? -11.635 7.896   1.177   1.00 0.00 ? 822 LYS A CG   5  
ATOM 6620  C CD   . LYS A 1 39  ? -12.128 9.333   1.201   1.00 0.00 ? 822 LYS A CD   5  
ATOM 6621  C CE   . LYS A 1 39  ? -13.165 9.548   2.293   1.00 0.00 ? 822 LYS A CE   5  
ATOM 6622  N NZ   . LYS A 1 39  ? -14.457 8.881   1.971   1.00 0.00 ? 822 LYS A NZ   5  
ATOM 6623  H H    . LYS A 1 39  ? -9.204  6.590   1.031   1.00 0.00 ? 822 LYS A H    5  
ATOM 6624  H HA   . LYS A 1 39  ? -9.558  7.448   -1.562  1.00 0.00 ? 822 LYS A HA   5  
ATOM 6625  H HB2  . LYS A 1 39  ? -11.893 7.943   -0.929  1.00 0.00 ? 822 LYS A HB2  5  
ATOM 6626  H HB3  . LYS A 1 39  ? -11.344 6.397   -0.297  1.00 0.00 ? 822 LYS A HB3  5  
ATOM 6627  H HG2  . LYS A 1 39  ? -12.427 7.249   1.526   1.00 0.00 ? 822 LYS A HG2  5  
ATOM 6628  H HG3  . LYS A 1 39  ? -10.781 7.807   1.834   1.00 0.00 ? 822 LYS A HG3  5  
ATOM 6629  H HD2  . LYS A 1 39  ? -11.290 9.989   1.381   1.00 0.00 ? 822 LYS A HD2  5  
ATOM 6630  H HD3  . LYS A 1 39  ? -12.572 9.567   0.244   1.00 0.00 ? 822 LYS A HD3  5  
ATOM 6631  H HE2  . LYS A 1 39  ? -12.783 9.146   3.218   1.00 0.00 ? 822 LYS A HE2  5  
ATOM 6632  H HE3  . LYS A 1 39  ? -13.335 10.609  2.405   1.00 0.00 ? 822 LYS A HE3  5  
ATOM 6633  H HZ1  . LYS A 1 39  ? -15.151 9.585   1.649   1.00 0.00 ? 822 LYS A HZ1  5  
ATOM 6634  H HZ2  . LYS A 1 39  ? -14.832 8.402   2.814   1.00 0.00 ? 822 LYS A HZ2  5  
ATOM 6635  H HZ3  . LYS A 1 39  ? -14.318 8.177   1.218   1.00 0.00 ? 822 LYS A HZ3  5  
ATOM 6636  N N    . ALA A 1 40  ? -9.035  9.892   0.464   1.00 0.00 ? 823 ALA A N    5  
ATOM 6637  C CA   . ALA A 1 40  ? -8.818  11.329  0.567   1.00 0.00 ? 823 ALA A CA   5  
ATOM 6638  C C    . ALA A 1 40  ? -7.912  11.830  -0.553  1.00 0.00 ? 823 ALA A C    5  
ATOM 6639  O O    . ALA A 1 40  ? -8.063  12.955  -1.031  1.00 0.00 ? 823 ALA A O    5  
ATOM 6640  C CB   . ALA A 1 40  ? -8.223  11.677  1.924   1.00 0.00 ? 823 ALA A CB   5  
ATOM 6641  H H    . ALA A 1 40  ? -8.738  9.310   1.193   1.00 0.00 ? 823 ALA A H    5  
ATOM 6642  H HA   . ALA A 1 40  ? -9.778  11.819  0.486   1.00 0.00 ? 823 ALA A HA   5  
ATOM 6643  H HB1  . ALA A 1 40  ? -8.315  12.740  2.095   1.00 0.00 ? 823 ALA A HB1  5  
ATOM 6644  H HB2  . ALA A 1 40  ? -8.753  11.140  2.697   1.00 0.00 ? 823 ALA A HB2  5  
ATOM 6645  H HB3  . ALA A 1 40  ? -7.180  11.399  1.941   1.00 0.00 ? 823 ALA A HB3  5  
ATOM 6646  N N    . HIS A 1 41  ? -6.971  10.988  -0.968  1.00 0.00 ? 824 HIS A N    5  
ATOM 6647  C CA   . HIS A 1 41  ? -6.040  11.346  -2.033  1.00 0.00 ? 824 HIS A CA   5  
ATOM 6648  C C    . HIS A 1 41  ? -6.630  11.020  -3.401  1.00 0.00 ? 824 HIS A C    5  
ATOM 6649  O O    . HIS A 1 41  ? -6.725  11.886  -4.270  1.00 0.00 ? 824 HIS A O    5  
ATOM 6650  C CB   . HIS A 1 41  ? -4.713  10.610  -1.847  1.00 0.00 ? 824 HIS A CB   5  
ATOM 6651  C CG   . HIS A 1 41  ? -4.005  10.963  -0.576  1.00 0.00 ? 824 HIS A CG   5  
ATOM 6652  N ND1  . HIS A 1 41  ? -3.669  12.256  -0.235  1.00 0.00 ? 824 HIS A ND1  5  
ATOM 6653  C CD2  . HIS A 1 41  ? -3.570  10.182  0.441   1.00 0.00 ? 824 HIS A CD2  5  
ATOM 6654  C CE1  . HIS A 1 41  ? -3.057  12.256  0.936   1.00 0.00 ? 824 HIS A CE1  5  
ATOM 6655  N NE2  . HIS A 1 41  ? -2.984  11.009  1.368   1.00 0.00 ? 824 HIS A NE2  5  
ATOM 6656  H H    . HIS A 1 41  ? -6.900  10.106  -0.548  1.00 0.00 ? 824 HIS A H    5  
ATOM 6657  H HA   . HIS A 1 41  ? -5.863  12.410  -1.975  1.00 0.00 ? 824 HIS A HA   5  
ATOM 6658  H HB2  . HIS A 1 41  ? -4.897  9.546   -1.840  1.00 0.00 ? 824 HIS A HB2  5  
ATOM 6659  H HB3  . HIS A 1 41  ? -4.057  10.852  -2.671  1.00 0.00 ? 824 HIS A HB3  5  
ATOM 6660  H HD2  . HIS A 1 41  ? -3.665  9.108   0.511   1.00 0.00 ? 824 HIS A HD2  5  
ATOM 6661  H HE1  . HIS A 1 41  ? -2.680  13.125  1.453   1.00 0.00 ? 824 HIS A HE1  5  
ATOM 6662  H HE2  . HIS A 1 41  ? -2.503  10.717  2.170   1.00 0.00 ? 824 HIS A HE2  5  
ATOM 6663  N N    . GLY A 1 42  ? -7.024  9.764   -3.587  1.00 0.00 ? 825 GLY A N    5  
ATOM 6664  C CA   . GLY A 1 42  ? -7.598  9.346   -4.852  1.00 0.00 ? 825 GLY A CA   5  
ATOM 6665  C C    . GLY A 1 42  ? -8.736  8.360   -4.675  1.00 0.00 ? 825 GLY A C    5  
ATOM 6666  O O    . GLY A 1 42  ? -9.439  8.386   -3.665  1.00 0.00 ? 825 GLY A O    5  
ATOM 6667  H H    . GLY A 1 42  ? -6.924  9.116   -2.858  1.00 0.00 ? 825 GLY A H    5  
ATOM 6668  H HA2  . GLY A 1 42  ? -7.968  10.216  -5.373  1.00 0.00 ? 825 GLY A HA2  5  
ATOM 6669  H HA3  . GLY A 1 42  ? -6.826  8.883   -5.449  1.00 0.00 ? 825 GLY A HA3  5  
ATOM 6670  N N    . THR A 1 43  ? -8.920  7.487   -5.661  1.00 0.00 ? 826 THR A N    5  
ATOM 6671  C CA   . THR A 1 43  ? -9.982  6.490   -5.611  1.00 0.00 ? 826 THR A CA   5  
ATOM 6672  C C    . THR A 1 43  ? -9.438  5.128   -5.198  1.00 0.00 ? 826 THR A C    5  
ATOM 6673  O O    . THR A 1 43  ? -8.608  4.542   -5.894  1.00 0.00 ? 826 THR A O    5  
ATOM 6674  C CB   . THR A 1 43  ? -10.691 6.356   -6.972  1.00 0.00 ? 826 THR A CB   5  
ATOM 6675  O OG1  . THR A 1 43  ? -11.299 7.602   -7.333  1.00 0.00 ? 826 THR A OG1  5  
ATOM 6676  C CG2  . THR A 1 43  ? -11.749 5.264   -6.926  1.00 0.00 ? 826 THR A CG2  5  
ATOM 6677  H H    . THR A 1 43  ? -8.327  7.516   -6.441  1.00 0.00 ? 826 THR A H    5  
ATOM 6678  H HA   . THR A 1 43  ? -10.709 6.814   -4.881  1.00 0.00 ? 826 THR A HA   5  
ATOM 6679  H HB   . THR A 1 43  ? -9.956  6.094   -7.720  1.00 0.00 ? 826 THR A HB   5  
ATOM 6680  H HG1  . THR A 1 43  ? -12.150 7.681   -6.894  1.00 0.00 ? 826 THR A HG1  5  
ATOM 6681  H HG21 . THR A 1 43  ? -11.936 4.902   -7.926  1.00 0.00 ? 826 THR A HG21 5  
ATOM 6682  H HG22 . THR A 1 43  ? -12.661 5.664   -6.511  1.00 0.00 ? 826 THR A HG22 5  
ATOM 6683  H HG23 . THR A 1 43  ? -11.398 4.450   -6.309  1.00 0.00 ? 826 THR A HG23 5  
ATOM 6684  N N    . VAL A 1 44  ? -9.911  4.627   -4.062  1.00 0.00 ? 827 VAL A N    5  
ATOM 6685  C CA   . VAL A 1 44  ? -9.473  3.331   -3.556  1.00 0.00 ? 827 VAL A CA   5  
ATOM 6686  C C    . VAL A 1 44  ? -10.318 2.202   -4.134  1.00 0.00 ? 827 VAL A C    5  
ATOM 6687  O O    . VAL A 1 44  ? -11.439 1.958   -3.686  1.00 0.00 ? 827 VAL A O    5  
ATOM 6688  C CB   . VAL A 1 44  ? -9.543  3.275   -2.019  1.00 0.00 ? 827 VAL A CB   5  
ATOM 6689  C CG1  . VAL A 1 44  ? -9.153  1.894   -1.516  1.00 0.00 ? 827 VAL A CG1  5  
ATOM 6690  C CG2  . VAL A 1 44  ? -8.653  4.346   -1.406  1.00 0.00 ? 827 VAL A CG2  5  
ATOM 6691  H H    . VAL A 1 44  ? -10.570 5.140   -3.551  1.00 0.00 ? 827 VAL A H    5  
ATOM 6692  H HA   . VAL A 1 44  ? -8.445  3.186   -3.854  1.00 0.00 ? 827 VAL A HA   5  
ATOM 6693  H HB   . VAL A 1 44  ? -10.562 3.468   -1.718  1.00 0.00 ? 827 VAL A HB   5  
ATOM 6694  H HG11 . VAL A 1 44  ? -8.984  1.933   -0.450  1.00 0.00 ? 827 VAL A HG11 5  
ATOM 6695  H HG12 . VAL A 1 44  ? -9.947  1.194   -1.731  1.00 0.00 ? 827 VAL A HG12 5  
ATOM 6696  H HG13 . VAL A 1 44  ? -8.247  1.573   -2.011  1.00 0.00 ? 827 VAL A HG13 5  
ATOM 6697  H HG21 . VAL A 1 44  ? -7.831  4.555   -2.074  1.00 0.00 ? 827 VAL A HG21 5  
ATOM 6698  H HG22 . VAL A 1 44  ? -9.228  5.247   -1.249  1.00 0.00 ? 827 VAL A HG22 5  
ATOM 6699  H HG23 . VAL A 1 44  ? -8.268  3.996   -0.460  1.00 0.00 ? 827 VAL A HG23 5  
ATOM 6700  N N    . LYS A 1 45  ? -9.774  1.514   -5.132  1.00 0.00 ? 828 LYS A N    5  
ATOM 6701  C CA   . LYS A 1 45  ? -10.477 0.408   -5.772  1.00 0.00 ? 828 LYS A CA   5  
ATOM 6702  C C    . LYS A 1 45  ? -10.697 -0.738  -4.790  1.00 0.00 ? 828 LYS A C    5  
ATOM 6703  O O    . LYS A 1 45  ? -11.785 -1.309  -4.721  1.00 0.00 ? 828 LYS A O    5  
ATOM 6704  C CB   . LYS A 1 45  ? -9.688  -0.091  -6.985  1.00 0.00 ? 828 LYS A CB   5  
ATOM 6705  C CG   . LYS A 1 45  ? -9.399  0.992   -8.009  1.00 0.00 ? 828 LYS A CG   5  
ATOM 6706  C CD   . LYS A 1 45  ? -10.541 1.143   -8.999  1.00 0.00 ? 828 LYS A CD   5  
ATOM 6707  C CE   . LYS A 1 45  ? -11.759 1.784   -8.351  1.00 0.00 ? 828 LYS A CE   5  
ATOM 6708  N NZ   . LYS A 1 45  ? -12.599 2.509   -9.345  1.00 0.00 ? 828 LYS A NZ   5  
ATOM 6709  H H    . LYS A 1 45  ? -8.877  1.755   -5.446  1.00 0.00 ? 828 LYS A H    5  
ATOM 6710  H HA   . LYS A 1 45  ? -11.438 0.772   -6.103  1.00 0.00 ? 828 LYS A HA   5  
ATOM 6711  H HB2  . LYS A 1 45  ? -8.747  -0.497  -6.645  1.00 0.00 ? 828 LYS A HB2  5  
ATOM 6712  H HB3  . LYS A 1 45  ? -10.254 -0.874  -7.470  1.00 0.00 ? 828 LYS A HB3  5  
ATOM 6713  H HG2  . LYS A 1 45  ? -9.255  1.932   -7.496  1.00 0.00 ? 828 LYS A HG2  5  
ATOM 6714  H HG3  . LYS A 1 45  ? -8.499  0.733   -8.549  1.00 0.00 ? 828 LYS A HG3  5  
ATOM 6715  H HD2  . LYS A 1 45  ? -10.216 1.765   -9.820  1.00 0.00 ? 828 LYS A HD2  5  
ATOM 6716  H HD3  . LYS A 1 45  ? -10.815 0.166   -9.372  1.00 0.00 ? 828 LYS A HD3  5  
ATOM 6717  H HE2  . LYS A 1 45  ? -12.352 1.011   -7.887  1.00 0.00 ? 828 LYS A HE2  5  
ATOM 6718  H HE3  . LYS A 1 45  ? -11.424 2.482   -7.598  1.00 0.00 ? 828 LYS A HE3  5  
ATOM 6719  H HZ1  . LYS A 1 45  ? -13.603 2.277   -9.200  1.00 0.00 ? 828 LYS A HZ1  5  
ATOM 6720  H HZ2  . LYS A 1 45  ? -12.328 2.234   -10.310 1.00 0.00 ? 828 LYS A HZ2  5  
ATOM 6721  H HZ3  . LYS A 1 45  ? -12.473 3.535   -9.239  1.00 0.00 ? 828 LYS A HZ3  5  
ATOM 6722  N N    . ASP A 1 46  ? -9.658  -1.068  -4.030  1.00 0.00 ? 829 ASP A N    5  
ATOM 6723  C CA   . ASP A 1 46  ? -9.739  -2.144  -3.049  1.00 0.00 ? 829 ASP A CA   5  
ATOM 6724  C C    . ASP A 1 46  ? -8.725  -1.935  -1.928  1.00 0.00 ? 829 ASP A C    5  
ATOM 6725  O O    . ASP A 1 46  ? -7.623  -1.435  -2.159  1.00 0.00 ? 829 ASP A O    5  
ATOM 6726  C CB   . ASP A 1 46  ? -9.501  -3.496  -3.723  1.00 0.00 ? 829 ASP A CB   5  
ATOM 6727  C CG   . ASP A 1 46  ? -10.216 -4.630  -3.015  1.00 0.00 ? 829 ASP A CG   5  
ATOM 6728  O OD1  . ASP A 1 46  ? -11.442 -4.520  -2.807  1.00 0.00 ? 829 ASP A OD1  5  
ATOM 6729  O OD2  . ASP A 1 46  ? -9.549  -5.628  -2.670  1.00 0.00 ? 829 ASP A OD2  5  
ATOM 6730  H H    . ASP A 1 46  ? -8.816  -0.575  -4.131  1.00 0.00 ? 829 ASP A H    5  
ATOM 6731  H HA   . ASP A 1 46  ? -10.732 -2.133  -2.626  1.00 0.00 ? 829 ASP A HA   5  
ATOM 6732  H HB2  . ASP A 1 46  ? -9.857  -3.451  -4.742  1.00 0.00 ? 829 ASP A HB2  5  
ATOM 6733  H HB3  . ASP A 1 46  ? -8.442  -3.708  -3.726  1.00 0.00 ? 829 ASP A HB3  5  
ATOM 6734  N N    . LEU A 1 47  ? -9.105  -2.320  -0.715  1.00 0.00 ? 830 LEU A N    5  
ATOM 6735  C CA   . LEU A 1 47  ? -8.230  -2.173  0.443   1.00 0.00 ? 830 LEU A CA   5  
ATOM 6736  C C    . LEU A 1 47  ? -8.238  -3.438  1.295   1.00 0.00 ? 830 LEU A C    5  
ATOM 6737  O O    . LEU A 1 47  ? -9.298  -3.928  1.687   1.00 0.00 ? 830 LEU A O    5  
ATOM 6738  C CB   . LEU A 1 47  ? -8.664  -0.974  1.287   1.00 0.00 ? 830 LEU A CB   5  
ATOM 6739  C CG   . LEU A 1 47  ? -7.557  -0.271  2.073   1.00 0.00 ? 830 LEU A CG   5  
ATOM 6740  C CD1  . LEU A 1 47  ? -8.009  1.115   2.509   1.00 0.00 ? 830 LEU A CD1  5  
ATOM 6741  C CD2  . LEU A 1 47  ? -7.148  -1.104  3.279   1.00 0.00 ? 830 LEU A CD2  5  
ATOM 6742  H H    . LEU A 1 47  ? -9.995  -2.711  -0.594  1.00 0.00 ? 830 LEU A H    5  
ATOM 6743  H HA   . LEU A 1 47  ? -7.227  -2.005  0.081   1.00 0.00 ? 830 LEU A HA   5  
ATOM 6744  H HB2  . LEU A 1 47  ? -9.110  -0.248  0.624   1.00 0.00 ? 830 LEU A HB2  5  
ATOM 6745  H HB3  . LEU A 1 47  ? -9.406  -1.318  1.993   1.00 0.00 ? 830 LEU A HB3  5  
ATOM 6746  H HG   . LEU A 1 47  ? -6.690  -0.154  1.437   1.00 0.00 ? 830 LEU A HG   5  
ATOM 6747  H HD11 . LEU A 1 47  ? -7.940  1.795   1.674   1.00 0.00 ? 830 LEU A HD11 5  
ATOM 6748  H HD12 . LEU A 1 47  ? -7.375  1.464   3.311   1.00 0.00 ? 830 LEU A HD12 5  
ATOM 6749  H HD13 . LEU A 1 47  ? -9.031  1.068   2.853   1.00 0.00 ? 830 LEU A HD13 5  
ATOM 6750  H HD21 . LEU A 1 47  ? -7.455  -0.601  4.184   1.00 0.00 ? 830 LEU A HD21 5  
ATOM 6751  H HD22 . LEU A 1 47  ? -6.075  -1.230  3.283   1.00 0.00 ? 830 LEU A HD22 5  
ATOM 6752  H HD23 . LEU A 1 47  ? -7.624  -2.072  3.226   1.00 0.00 ? 830 LEU A HD23 5  
ATOM 6753  N N    . ARG A 1 48  ? -7.050  -3.962  1.580   1.00 0.00 ? 831 ARG A N    5  
ATOM 6754  C CA   . ARG A 1 48  ? -6.921  -5.169  2.386   1.00 0.00 ? 831 ARG A CA   5  
ATOM 6755  C C    . ARG A 1 48  ? -5.897  -4.972  3.500   1.00 0.00 ? 831 ARG A C    5  
ATOM 6756  O O    . ARG A 1 48  ? -4.912  -4.252  3.332   1.00 0.00 ? 831 ARG A O    5  
ATOM 6757  C CB   . ARG A 1 48  ? -6.514  -6.354  1.508   1.00 0.00 ? 831 ARG A CB   5  
ATOM 6758  C CG   . ARG A 1 48  ? -5.024  -6.408  1.211   1.00 0.00 ? 831 ARG A CG   5  
ATOM 6759  C CD   . ARG A 1 48  ? -4.635  -7.721  0.550   1.00 0.00 ? 831 ARG A CD   5  
ATOM 6760  N NE   . ARG A 1 48  ? -5.452  -8.005  -0.626  1.00 0.00 ? 831 ARG A NE   5  
ATOM 6761  C CZ   . ARG A 1 48  ? -5.323  -7.366  -1.783  1.00 0.00 ? 831 ARG A CZ   5  
ATOM 6762  N NH1  . ARG A 1 48  ? -4.413  -6.411  -1.919  1.00 0.00 ? 831 ARG A NH1  5  
ATOM 6763  N NH2  . ARG A 1 48  ? -6.105  -7.682  -2.808  1.00 0.00 ? 831 ARG A NH2  5  
ATOM 6764  H H    . ARG A 1 48  ? -6.242  -3.526  1.238   1.00 0.00 ? 831 ARG A H    5  
ATOM 6765  H HA   . ARG A 1 48  ? -7.883  -5.376  2.831   1.00 0.00 ? 831 ARG A HA   5  
ATOM 6766  H HB2  . ARG A 1 48  ? -6.792  -7.270  2.008   1.00 0.00 ? 831 ARG A HB2  5  
ATOM 6767  H HB3  . ARG A 1 48  ? -7.044  -6.290  0.570   1.00 0.00 ? 831 ARG A HB3  5  
ATOM 6768  H HG2  . ARG A 1 48  ? -4.769  -5.594  0.548   1.00 0.00 ? 831 ARG A HG2  5  
ATOM 6769  H HG3  . ARG A 1 48  ? -4.478  -6.304  2.137   1.00 0.00 ? 831 ARG A HG3  5  
ATOM 6770  H HD2  . ARG A 1 48  ? -3.599  -7.665  0.251   1.00 0.00 ? 831 ARG A HD2  5  
ATOM 6771  H HD3  . ARG A 1 48  ? -4.760  -8.519  1.266   1.00 0.00 ? 831 ARG A HD3  5  
ATOM 6772  H HE   . ARG A 1 48  ? -6.131  -8.707  -0.547  1.00 0.00 ? 831 ARG A HE   5  
ATOM 6773  H HH11 . ARG A 1 48  ? -3.822  -6.172  -1.148  1.00 0.00 ? 831 ARG A HH11 5  
ATOM 6774  H HH12 . ARG A 1 48  ? -4.317  -5.932  -2.791  1.00 0.00 ? 831 ARG A HH12 5  
ATOM 6775  H HH21 . ARG A 1 48  ? -6.791  -8.401  -2.709  1.00 0.00 ? 831 ARG A HH21 5  
ATOM 6776  H HH22 . ARG A 1 48  ? -6.006  -7.200  -3.678  1.00 0.00 ? 831 ARG A HH22 5  
ATOM 6777  N N    . LEU A 1 49  ? -6.136  -5.616  4.637   1.00 0.00 ? 832 LEU A N    5  
ATOM 6778  C CA   . LEU A 1 49  ? -5.235  -5.511  5.780   1.00 0.00 ? 832 LEU A CA   5  
ATOM 6779  C C    . LEU A 1 49  ? -4.579  -6.855  6.081   1.00 0.00 ? 832 LEU A C    5  
ATOM 6780  O O    . LEU A 1 49  ? -5.261  -7.863  6.264   1.00 0.00 ? 832 LEU A O    5  
ATOM 6781  C CB   . LEU A 1 49  ? -5.996  -5.015  7.011   1.00 0.00 ? 832 LEU A CB   5  
ATOM 6782  C CG   . LEU A 1 49  ? -6.694  -3.662  6.868   1.00 0.00 ? 832 LEU A CG   5  
ATOM 6783  C CD1  . LEU A 1 49  ? -7.678  -3.447  8.008   1.00 0.00 ? 832 LEU A CD1  5  
ATOM 6784  C CD2  . LEU A 1 49  ? -5.672  -2.536  6.824   1.00 0.00 ? 832 LEU A CD2  5  
ATOM 6785  H H    . LEU A 1 49  ? -6.937  -6.175  4.712   1.00 0.00 ? 832 LEU A H    5  
ATOM 6786  H HA   . LEU A 1 49  ? -4.466  -4.796  5.530   1.00 0.00 ? 832 LEU A HA   5  
ATOM 6787  H HB2  . LEU A 1 49  ? -6.747  -5.751  7.253   1.00 0.00 ? 832 LEU A HB2  5  
ATOM 6788  H HB3  . LEU A 1 49  ? -5.291  -4.941  7.827   1.00 0.00 ? 832 LEU A HB3  5  
ATOM 6789  H HG   . LEU A 1 49  ? -7.250  -3.647  5.941   1.00 0.00 ? 832 LEU A HG   5  
ATOM 6790  H HD11 . LEU A 1 49  ? -8.571  -4.026  7.827   1.00 0.00 ? 832 LEU A HD11 5  
ATOM 6791  H HD12 . LEU A 1 49  ? -7.935  -2.399  8.068   1.00 0.00 ? 832 LEU A HD12 5  
ATOM 6792  H HD13 . LEU A 1 49  ? -7.226  -3.760  8.938   1.00 0.00 ? 832 LEU A HD13 5  
ATOM 6793  H HD21 . LEU A 1 49  ? -5.261  -2.463  5.828   1.00 0.00 ? 832 LEU A HD21 5  
ATOM 6794  H HD22 . LEU A 1 49  ? -4.877  -2.744  7.526   1.00 0.00 ? 832 LEU A HD22 5  
ATOM 6795  H HD23 . LEU A 1 49  ? -6.151  -1.605  7.086   1.00 0.00 ? 832 LEU A HD23 5  
ATOM 6796  N N    . VAL A 1 50  ? -3.251  -6.860  6.132   1.00 0.00 ? 833 VAL A N    5  
ATOM 6797  C CA   . VAL A 1 50  ? -2.502  -8.079  6.414   1.00 0.00 ? 833 VAL A CA   5  
ATOM 6798  C C    . VAL A 1 50  ? -2.611  -8.463  7.885   1.00 0.00 ? 833 VAL A C    5  
ATOM 6799  O O    . VAL A 1 50  ? -2.565  -7.606  8.768   1.00 0.00 ? 833 VAL A O    5  
ATOM 6800  C CB   . VAL A 1 50  ? -1.015  -7.922  6.045   1.00 0.00 ? 833 VAL A CB   5  
ATOM 6801  C CG1  . VAL A 1 50  ? -0.298  -9.261  6.133   1.00 0.00 ? 833 VAL A CG1  5  
ATOM 6802  C CG2  . VAL A 1 50  ? -0.871  -7.322  4.655   1.00 0.00 ? 833 VAL A CG2  5  
ATOM 6803  H H    . VAL A 1 50  ? -2.763  -6.025  5.977   1.00 0.00 ? 833 VAL A H    5  
ATOM 6804  H HA   . VAL A 1 50  ? -2.918  -8.874  5.812   1.00 0.00 ? 833 VAL A HA   5  
ATOM 6805  H HB   . VAL A 1 50  ? -0.558  -7.247  6.755   1.00 0.00 ? 833 VAL A HB   5  
ATOM 6806  H HG11 . VAL A 1 50  ? 0.755   -9.119  5.939   1.00 0.00 ? 833 VAL A HG11 5  
ATOM 6807  H HG12 . VAL A 1 50  ? -0.430  -9.676  7.122   1.00 0.00 ? 833 VAL A HG12 5  
ATOM 6808  H HG13 . VAL A 1 50  ? -0.711  -9.938  5.400   1.00 0.00 ? 833 VAL A HG13 5  
ATOM 6809  H HG21 . VAL A 1 50  ? 0.077   -6.811  4.580   1.00 0.00 ? 833 VAL A HG21 5  
ATOM 6810  H HG22 . VAL A 1 50  ? -0.916  -8.109  3.916   1.00 0.00 ? 833 VAL A HG22 5  
ATOM 6811  H HG23 . VAL A 1 50  ? -1.673  -6.620  4.481   1.00 0.00 ? 833 VAL A HG23 5  
ATOM 6812  N N    . THR A 1 51  ? -2.758  -9.759  8.144   1.00 0.00 ? 834 THR A N    5  
ATOM 6813  C CA   . THR A 1 51  ? -2.875  -10.258 9.508   1.00 0.00 ? 834 THR A CA   5  
ATOM 6814  C C    . THR A 1 51  ? -2.271  -11.652 9.638   1.00 0.00 ? 834 THR A C    5  
ATOM 6815  O O    . THR A 1 51  ? -1.701  -12.182 8.685   1.00 0.00 ? 834 THR A O    5  
ATOM 6816  C CB   . THR A 1 51  ? -4.345  -10.304 9.965   1.00 0.00 ? 834 THR A CB   5  
ATOM 6817  O OG1  . THR A 1 51  ? -5.125  -11.061 9.033   1.00 0.00 ? 834 THR A OG1  5  
ATOM 6818  C CG2  . THR A 1 51  ? -4.916  -8.899  10.090  1.00 0.00 ? 834 THR A CG2  5  
ATOM 6819  H H    . THR A 1 51  ? -2.788  -10.394 7.398   1.00 0.00 ? 834 THR A H    5  
ATOM 6820  H HA   . THR A 1 51  ? -2.338  -9.582  10.158  1.00 0.00 ? 834 THR A HA   5  
ATOM 6821  H HB   . THR A 1 51  ? -4.390  -10.782 10.933  1.00 0.00 ? 834 THR A HB   5  
ATOM 6822  H HG1  . THR A 1 51  ? -5.316  -10.520 8.263   1.00 0.00 ? 834 THR A HG1  5  
ATOM 6823  H HG21 . THR A 1 51  ? -4.240  -8.285  10.665  1.00 0.00 ? 834 THR A HG21 5  
ATOM 6824  H HG22 . THR A 1 51  ? -5.874  -8.943  10.587  1.00 0.00 ? 834 THR A HG22 5  
ATOM 6825  H HG23 . THR A 1 51  ? -5.041  -8.473  9.106   1.00 0.00 ? 834 THR A HG23 5  
ATOM 6826  N N    . ASN A 1 52  ? -2.399  -12.240 10.823  1.00 0.00 ? 835 ASN A N    5  
ATOM 6827  C CA   . ASN A 1 52  ? -1.866  -13.573 11.077  1.00 0.00 ? 835 ASN A CA   5  
ATOM 6828  C C    . ASN A 1 52  ? -2.992  -14.569 11.335  1.00 0.00 ? 835 ASN A C    5  
ATOM 6829  O O    . ASN A 1 52  ? -4.169  -14.210 11.316  1.00 0.00 ? 835 ASN A O    5  
ATOM 6830  C CB   . ASN A 1 52  ? -0.911  -13.544 12.272  1.00 0.00 ? 835 ASN A CB   5  
ATOM 6831  C CG   . ASN A 1 52  ? 0.523   -13.276 11.859  1.00 0.00 ? 835 ASN A CG   5  
ATOM 6832  O OD1  . ASN A 1 52  ? 0.873   -13.380 10.683  1.00 0.00 ? 835 ASN A OD1  5  
ATOM 6833  N ND2  . ASN A 1 52  ? 1.363   -12.928 12.828  1.00 0.00 ? 835 ASN A ND2  5  
ATOM 6834  H H    . ASN A 1 52  ? -2.864  -11.766 11.544  1.00 0.00 ? 835 ASN A H    5  
ATOM 6835  H HA   . ASN A 1 52  ? -1.320  -13.884 10.199  1.00 0.00 ? 835 ASN A HA   5  
ATOM 6836  H HB2  . ASN A 1 52  ? -1.221  -12.765 12.953  1.00 0.00 ? 835 ASN A HB2  5  
ATOM 6837  H HB3  . ASN A 1 52  ? -0.949  -14.496 12.779  1.00 0.00 ? 835 ASN A HB3  5  
ATOM 6838  H HD21 . ASN A 1 52  ? 1.014   -12.865 13.742  1.00 0.00 ? 835 ASN A HD21 5  
ATOM 6839  H HD22 . ASN A 1 52  ? 2.296   -12.748 12.589  1.00 0.00 ? 835 ASN A HD22 5  
ATOM 6840  N N    . ARG A 1 53  ? -2.622  -15.822 11.578  1.00 0.00 ? 836 ARG A N    5  
ATOM 6841  C CA   . ARG A 1 53  ? -3.600  -16.871 11.840  1.00 0.00 ? 836 ARG A CA   5  
ATOM 6842  C C    . ARG A 1 53  ? -4.609  -16.422 12.893  1.00 0.00 ? 836 ARG A C    5  
ATOM 6843  O O    . ARG A 1 53  ? -5.791  -16.756 12.816  1.00 0.00 ? 836 ARG A O    5  
ATOM 6844  C CB   . ARG A 1 53  ? -2.898  -18.149 12.304  1.00 0.00 ? 836 ARG A CB   5  
ATOM 6845  C CG   . ARG A 1 53  ? -3.754  -19.397 12.169  1.00 0.00 ? 836 ARG A CG   5  
ATOM 6846  C CD   . ARG A 1 53  ? -4.746  -19.519 13.315  1.00 0.00 ? 836 ARG A CD   5  
ATOM 6847  N NE   . ARG A 1 53  ? -5.131  -20.907 13.560  1.00 0.00 ? 836 ARG A NE   5  
ATOM 6848  C CZ   . ARG A 1 53  ? -5.908  -21.286 14.568  1.00 0.00 ? 836 ARG A CZ   5  
ATOM 6849  N NH1  . ARG A 1 53  ? -6.379  -20.388 15.421  1.00 0.00 ? 836 ARG A NH1  5  
ATOM 6850  N NH2  . ARG A 1 53  ? -6.214  -22.568 14.725  1.00 0.00 ? 836 ARG A NH2  5  
ATOM 6851  H H    . ARG A 1 53  ? -1.668  -16.047 11.580  1.00 0.00 ? 836 ARG A H    5  
ATOM 6852  H HA   . ARG A 1 53  ? -4.125  -17.073 10.919  1.00 0.00 ? 836 ARG A HA   5  
ATOM 6853  H HB2  . ARG A 1 53  ? -2.003  -18.288 11.715  1.00 0.00 ? 836 ARG A HB2  5  
ATOM 6854  H HB3  . ARG A 1 53  ? -2.623  -18.038 13.342  1.00 0.00 ? 836 ARG A HB3  5  
ATOM 6855  H HG2  . ARG A 1 53  ? -4.300  -19.349 11.238  1.00 0.00 ? 836 ARG A HG2  5  
ATOM 6856  H HG3  . ARG A 1 53  ? -3.111  -20.265 12.166  1.00 0.00 ? 836 ARG A HG3  5  
ATOM 6857  H HD2  . ARG A 1 53  ? -4.293  -19.119 14.209  1.00 0.00 ? 836 ARG A HD2  5  
ATOM 6858  H HD3  . ARG A 1 53  ? -5.629  -18.947 13.071  1.00 0.00 ? 836 ARG A HD3  5  
ATOM 6859  H HE   . ARG A 1 53  ? -4.794  -21.587 12.941  1.00 0.00 ? 836 ARG A HE   5  
ATOM 6860  H HH11 . ARG A 1 53  ? -6.151  -19.421 15.305  1.00 0.00 ? 836 ARG A HH11 5  
ATOM 6861  H HH12 . ARG A 1 53  ? -6.965  -20.676 16.179  1.00 0.00 ? 836 ARG A HH12 5  
ATOM 6862  H HH21 . ARG A 1 53  ? -5.861  -23.248 14.084  1.00 0.00 ? 836 ARG A HH21 5  
ATOM 6863  H HH22 . ARG A 1 53  ? -6.798  -22.853 15.484  1.00 0.00 ? 836 ARG A HH22 5  
ATOM 6864  N N    . ALA A 1 54  ? -4.134  -15.663 13.875  1.00 0.00 ? 837 ALA A N    5  
ATOM 6865  C CA   . ALA A 1 54  ? -4.995  -15.167 14.942  1.00 0.00 ? 837 ALA A CA   5  
ATOM 6866  C C    . ALA A 1 54  ? -5.598  -13.815 14.577  1.00 0.00 ? 837 ALA A C    5  
ATOM 6867  O O    . ALA A 1 54  ? -5.956  -13.028 15.452  1.00 0.00 ? 837 ALA A O    5  
ATOM 6868  C CB   . ALA A 1 54  ? -4.215  -15.066 16.245  1.00 0.00 ? 837 ALA A CB   5  
ATOM 6869  H H    . ALA A 1 54  ? -3.183  -15.430 13.881  1.00 0.00 ? 837 ALA A H    5  
ATOM 6870  H HA   . ALA A 1 54  ? -5.794  -15.880 15.084  1.00 0.00 ? 837 ALA A HA   5  
ATOM 6871  H HB1  . ALA A 1 54  ? -4.904  -15.071 17.077  1.00 0.00 ? 837 ALA A HB1  5  
ATOM 6872  H HB2  . ALA A 1 54  ? -3.542  -15.906 16.328  1.00 0.00 ? 837 ALA A HB2  5  
ATOM 6873  H HB3  . ALA A 1 54  ? -3.648  -14.147 16.253  1.00 0.00 ? 837 ALA A HB3  5  
ATOM 6874  N N    . GLY A 1 55  ? -5.706  -13.551 13.278  1.00 0.00 ? 838 GLY A N    5  
ATOM 6875  C CA   . GLY A 1 55  ? -6.266  -12.293 12.821  1.00 0.00 ? 838 GLY A CA   5  
ATOM 6876  C C    . GLY A 1 55  ? -5.675  -11.099 13.545  1.00 0.00 ? 838 GLY A C    5  
ATOM 6877  O O    . GLY A 1 55  ? -6.355  -10.096 13.762  1.00 0.00 ? 838 GLY A O    5  
ATOM 6878  H H    . GLY A 1 55  ? -5.404  -14.217 12.625  1.00 0.00 ? 838 GLY A H    5  
ATOM 6879  H HA2  . GLY A 1 55  ? -6.075  -12.190 11.763  1.00 0.00 ? 838 GLY A HA2  5  
ATOM 6880  H HA3  . GLY A 1 55  ? -7.333  -12.306 12.985  1.00 0.00 ? 838 GLY A HA3  5  
ATOM 6881  N N    . LYS A 1 56  ? -4.405  -11.206 13.921  1.00 0.00 ? 839 LYS A N    5  
ATOM 6882  C CA   . LYS A 1 56  ? -3.722  -10.127 14.624  1.00 0.00 ? 839 LYS A CA   5  
ATOM 6883  C C    . LYS A 1 56  ? -3.063  -9.166  13.640  1.00 0.00 ? 839 LYS A C    5  
ATOM 6884  O O    . LYS A 1 56  ? -2.503  -9.571  12.621  1.00 0.00 ? 839 LYS A O    5  
ATOM 6885  C CB   . LYS A 1 56  ? -2.669  -10.699 15.577  1.00 0.00 ? 839 LYS A CB   5  
ATOM 6886  C CG   . LYS A 1 56  ? -3.247  -11.613 16.644  1.00 0.00 ? 839 LYS A CG   5  
ATOM 6887  C CD   . LYS A 1 56  ? -3.635  -10.839 17.892  1.00 0.00 ? 839 LYS A CD   5  
ATOM 6888  C CE   . LYS A 1 56  ? -4.488  -11.681 18.828  1.00 0.00 ? 839 LYS A CE   5  
ATOM 6889  N NZ   . LYS A 1 56  ? -3.701  -12.774 19.463  1.00 0.00 ? 839 LYS A NZ   5  
ATOM 6890  H H    . LYS A 1 56  ? -3.915  -12.031 13.719  1.00 0.00 ? 839 LYS A H    5  
ATOM 6891  H HA   . LYS A 1 56  ? -4.459  -9.587  15.199  1.00 0.00 ? 839 LYS A HA   5  
ATOM 6892  H HB2  . LYS A 1 56  ? -1.948  -11.261 15.002  1.00 0.00 ? 839 LYS A HB2  5  
ATOM 6893  H HB3  . LYS A 1 56  ? -2.165  -9.880  16.070  1.00 0.00 ? 839 LYS A HB3  5  
ATOM 6894  H HG2  . LYS A 1 56  ? -4.125  -12.102 16.249  1.00 0.00 ? 839 LYS A HG2  5  
ATOM 6895  H HG3  . LYS A 1 56  ? -2.507  -12.356 16.907  1.00 0.00 ? 839 LYS A HG3  5  
ATOM 6896  H HD2  . LYS A 1 56  ? -2.738  -10.539 18.413  1.00 0.00 ? 839 LYS A HD2  5  
ATOM 6897  H HD3  . LYS A 1 56  ? -4.194  -9.961  17.601  1.00 0.00 ? 839 LYS A HD3  5  
ATOM 6898  H HE2  . LYS A 1 56  ? -4.889  -11.043 19.600  1.00 0.00 ? 839 LYS A HE2  5  
ATOM 6899  H HE3  . LYS A 1 56  ? -5.299  -12.115 18.262  1.00 0.00 ? 839 LYS A HE3  5  
ATOM 6900  H HZ1  . LYS A 1 56  ? -2.692  -12.666 19.235  1.00 0.00 ? 839 LYS A HZ1  5  
ATOM 6901  H HZ2  . LYS A 1 56  ? -4.026  -13.698 19.113  1.00 0.00 ? 839 LYS A HZ2  5  
ATOM 6902  H HZ3  . LYS A 1 56  ? -3.817  -12.746 20.496  1.00 0.00 ? 839 LYS A HZ3  5  
ATOM 6903  N N    . PRO A 1 57  ? -3.129  -7.863  13.950  1.00 0.00 ? 840 PRO A N    5  
ATOM 6904  C CA   . PRO A 1 57  ? -2.543  -6.818  13.105  1.00 0.00 ? 840 PRO A CA   5  
ATOM 6905  C C    . PRO A 1 57  ? -1.018  -6.846  13.124  1.00 0.00 ? 840 PRO A C    5  
ATOM 6906  O O    . PRO A 1 57  ? -0.395  -6.598  14.156  1.00 0.00 ? 840 PRO A O    5  
ATOM 6907  C CB   . PRO A 1 57  ? -3.062  -5.522  13.733  1.00 0.00 ? 840 PRO A CB   5  
ATOM 6908  C CG   . PRO A 1 57  ? -3.336  -5.873  15.155  1.00 0.00 ? 840 PRO A CG   5  
ATOM 6909  C CD   . PRO A 1 57  ? -3.781  -7.309  15.148  1.00 0.00 ? 840 PRO A CD   5  
ATOM 6910  H HA   . PRO A 1 57  ? -2.891  -6.890  12.085  1.00 0.00 ? 840 PRO A HA   5  
ATOM 6911  H HB2  . PRO A 1 57  ? -2.306  -4.753  13.654  1.00 0.00 ? 840 PRO A HB2  5  
ATOM 6912  H HB3  . PRO A 1 57  ? -3.960  -5.206  13.224  1.00 0.00 ? 840 PRO A HB3  5  
ATOM 6913  H HG2  . PRO A 1 57  ? -2.436  -5.762  15.740  1.00 0.00 ? 840 PRO A HG2  5  
ATOM 6914  H HG3  . PRO A 1 57  ? -4.120  -5.240  15.544  1.00 0.00 ? 840 PRO A HG3  5  
ATOM 6915  H HD2  . PRO A 1 57  ? -3.441  -7.814  16.040  1.00 0.00 ? 840 PRO A HD2  5  
ATOM 6916  H HD3  . PRO A 1 57  ? -4.856  -7.371  15.065  1.00 0.00 ? 840 PRO A HD3  5  
ATOM 6917  N N    . LYS A 1 58  ? -0.423  -7.147  11.975  1.00 0.00 ? 841 LYS A N    5  
ATOM 6918  C CA   . LYS A 1 58  ? 1.030   -7.206  11.858  1.00 0.00 ? 841 LYS A CA   5  
ATOM 6919  C C    . LYS A 1 58  ? 1.602   -5.838  11.499  1.00 0.00 ? 841 LYS A C    5  
ATOM 6920  O O    . LYS A 1 58  ? 2.765   -5.722  11.115  1.00 0.00 ? 841 LYS A O    5  
ATOM 6921  C CB   . LYS A 1 58  ? 1.436   -8.234  10.800  1.00 0.00 ? 841 LYS A CB   5  
ATOM 6922  C CG   . LYS A 1 58  ? 1.133   -9.668  11.198  1.00 0.00 ? 841 LYS A CG   5  
ATOM 6923  C CD   . LYS A 1 58  ? 2.124   -10.639 10.578  1.00 0.00 ? 841 LYS A CD   5  
ATOM 6924  C CE   . LYS A 1 58  ? 1.825   -10.878 9.106   1.00 0.00 ? 841 LYS A CE   5  
ATOM 6925  N NZ   . LYS A 1 58  ? 2.484   -9.866  8.235   1.00 0.00 ? 841 LYS A NZ   5  
ATOM 6926  H H    . LYS A 1 58  ? -0.974  -7.335  11.186  1.00 0.00 ? 841 LYS A H    5  
ATOM 6927  H HA   . LYS A 1 58  ? 1.428   -7.509  12.814  1.00 0.00 ? 841 LYS A HA   5  
ATOM 6928  H HB2  . LYS A 1 58  ? 0.907   -8.017  9.883   1.00 0.00 ? 841 LYS A HB2  5  
ATOM 6929  H HB3  . LYS A 1 58  ? 2.498   -8.148  10.621  1.00 0.00 ? 841 LYS A HB3  5  
ATOM 6930  H HG2  . LYS A 1 58  ? 1.187   -9.753  12.273  1.00 0.00 ? 841 LYS A HG2  5  
ATOM 6931  H HG3  . LYS A 1 58  ? 0.137   -9.922  10.864  1.00 0.00 ? 841 LYS A HG3  5  
ATOM 6932  H HD2  . LYS A 1 58  ? 3.120   -10.232 10.670  1.00 0.00 ? 841 LYS A HD2  5  
ATOM 6933  H HD3  . LYS A 1 58  ? 2.068   -11.582 11.105  1.00 0.00 ? 841 LYS A HD3  5  
ATOM 6934  H HE2  . LYS A 1 58  ? 2.180   -11.860 8.834   1.00 0.00 ? 841 LYS A HE2  5  
ATOM 6935  H HE3  . LYS A 1 58  ? 0.756   -10.827 8.957   1.00 0.00 ? 841 LYS A HE3  5  
ATOM 6936  H HZ1  . LYS A 1 58  ? 2.715   -9.015  8.788   1.00 0.00 ? 841 LYS A HZ1  5  
ATOM 6937  H HZ2  . LYS A 1 58  ? 1.850   -9.597  7.456   1.00 0.00 ? 841 LYS A HZ2  5  
ATOM 6938  H HZ3  . LYS A 1 58  ? 3.362   -10.255 7.836   1.00 0.00 ? 841 LYS A HZ3  5  
ATOM 6939  N N    . GLY A 1 59  ? 0.776   -4.804  11.627  1.00 0.00 ? 842 GLY A N    5  
ATOM 6940  C CA   . GLY A 1 59  ? 1.219   -3.458  11.314  1.00 0.00 ? 842 GLY A CA   5  
ATOM 6941  C C    . GLY A 1 59  ? 1.398   -3.238  9.825   1.00 0.00 ? 842 GLY A C    5  
ATOM 6942  O O    . GLY A 1 59  ? 1.910   -2.202  9.399   1.00 0.00 ? 842 GLY A O    5  
ATOM 6943  H H    . GLY A 1 59  ? -0.141  -4.956  11.938  1.00 0.00 ? 842 GLY A H    5  
ATOM 6944  H HA2  . GLY A 1 59  ? 0.489   -2.754  11.686  1.00 0.00 ? 842 GLY A HA2  5  
ATOM 6945  H HA3  . GLY A 1 59  ? 2.162   -3.277  11.808  1.00 0.00 ? 842 GLY A HA3  5  
ATOM 6946  N N    . LEU A 1 60  ? 0.979   -4.216  9.030   1.00 0.00 ? 843 LEU A N    5  
ATOM 6947  C CA   . LEU A 1 60  ? 1.097   -4.127  7.579   1.00 0.00 ? 843 LEU A CA   5  
ATOM 6948  C C    . LEU A 1 60  ? -0.278  -4.014  6.926   1.00 0.00 ? 843 LEU A C    5  
ATOM 6949  O O    . LEU A 1 60  ? -1.226  -4.683  7.335   1.00 0.00 ? 843 LEU A O    5  
ATOM 6950  C CB   . LEU A 1 60  ? 1.835   -5.349  7.031   1.00 0.00 ? 843 LEU A CB   5  
ATOM 6951  C CG   . LEU A 1 60  ? 3.292   -5.505  7.469   1.00 0.00 ? 843 LEU A CG   5  
ATOM 6952  C CD1  . LEU A 1 60  ? 3.766   -6.934  7.248   1.00 0.00 ? 843 LEU A CD1  5  
ATOM 6953  C CD2  . LEU A 1 60  ? 4.182   -4.524  6.720   1.00 0.00 ? 843 LEU A CD2  5  
ATOM 6954  H H    . LEU A 1 60  ? 0.580   -5.018  9.427   1.00 0.00 ? 843 LEU A H    5  
ATOM 6955  H HA   . LEU A 1 60  ? 1.666   -3.239  7.347   1.00 0.00 ? 843 LEU A HA   5  
ATOM 6956  H HB2  . LEU A 1 60  ? 1.298   -6.230  7.349   1.00 0.00 ? 843 LEU A HB2  5  
ATOM 6957  H HB3  . LEU A 1 60  ? 1.818   -5.289  5.952   1.00 0.00 ? 843 LEU A HB3  5  
ATOM 6958  H HG   . LEU A 1 60  ? 3.369   -5.288  8.526   1.00 0.00 ? 843 LEU A HG   5  
ATOM 6959  H HD11 . LEU A 1 60  ? 4.627   -6.931  6.597   1.00 0.00 ? 843 LEU A HD11 5  
ATOM 6960  H HD12 . LEU A 1 60  ? 2.973   -7.509  6.794   1.00 0.00 ? 843 LEU A HD12 5  
ATOM 6961  H HD13 . LEU A 1 60  ? 4.032   -7.375  8.197   1.00 0.00 ? 843 LEU A HD13 5  
ATOM 6962  H HD21 . LEU A 1 60  ? 3.589   -3.689  6.379   1.00 0.00 ? 843 LEU A HD21 5  
ATOM 6963  H HD22 . LEU A 1 60  ? 4.628   -5.020  5.869   1.00 0.00 ? 843 LEU A HD22 5  
ATOM 6964  H HD23 . LEU A 1 60  ? 4.960   -4.169  7.379   1.00 0.00 ? 843 LEU A HD23 5  
ATOM 6965  N N    . ALA A 1 61  ? -0.376  -3.165  5.909   1.00 0.00 ? 844 ALA A N    5  
ATOM 6966  C CA   . ALA A 1 61  ? -1.633  -2.968  5.197   1.00 0.00 ? 844 ALA A CA   5  
ATOM 6967  C C    . ALA A 1 61  ? -1.396  -2.807  3.699   1.00 0.00 ? 844 ALA A C    5  
ATOM 6968  O O    . ALA A 1 61  ? -0.334  -2.352  3.274   1.00 0.00 ? 844 ALA A O    5  
ATOM 6969  C CB   . ALA A 1 61  ? -2.368  -1.757  5.750   1.00 0.00 ? 844 ALA A CB   5  
ATOM 6970  H H    . ALA A 1 61  ? 0.416   -2.660  5.630   1.00 0.00 ? 844 ALA A H    5  
ATOM 6971  H HA   . ALA A 1 61  ? -2.250  -3.840  5.362   1.00 0.00 ? 844 ALA A HA   5  
ATOM 6972  H HB1  . ALA A 1 61  ? -1.783  -0.867  5.568   1.00 0.00 ? 844 ALA A HB1  5  
ATOM 6973  H HB2  . ALA A 1 61  ? -3.327  -1.664  5.262   1.00 0.00 ? 844 ALA A HB2  5  
ATOM 6974  H HB3  . ALA A 1 61  ? -2.516  -1.879  6.813   1.00 0.00 ? 844 ALA A HB3  5  
ATOM 6975  N N    . TYR A 1 62  ? -2.391  -3.185  2.904   1.00 0.00 ? 845 TYR A N    5  
ATOM 6976  C CA   . TYR A 1 62  ? -2.289  -3.085  1.453   1.00 0.00 ? 845 TYR A CA   5  
ATOM 6977  C C    . TYR A 1 62  ? -3.390  -2.191  0.890   1.00 0.00 ? 845 TYR A C    5  
ATOM 6978  O O    . TYR A 1 62  ? -4.541  -2.256  1.322   1.00 0.00 ? 845 TYR A O    5  
ATOM 6979  C CB   . TYR A 1 62  ? -2.371  -4.474  0.819   1.00 0.00 ? 845 TYR A CB   5  
ATOM 6980  C CG   . TYR A 1 62  ? -1.026  -5.146  0.656   1.00 0.00 ? 845 TYR A CG   5  
ATOM 6981  C CD1  . TYR A 1 62  ? -0.287  -5.543  1.763   1.00 0.00 ? 845 TYR A CD1  5  
ATOM 6982  C CD2  . TYR A 1 62  ? -0.495  -5.384  -0.606  1.00 0.00 ? 845 TYR A CD2  5  
ATOM 6983  C CE1  . TYR A 1 62  ? 0.943   -6.156  1.618   1.00 0.00 ? 845 TYR A CE1  5  
ATOM 6984  C CE2  . TYR A 1 62  ? 0.733   -5.997  -0.760  1.00 0.00 ? 845 TYR A CE2  5  
ATOM 6985  C CZ   . TYR A 1 62  ? 1.448   -6.381  0.355   1.00 0.00 ? 845 TYR A CZ   5  
ATOM 6986  O OH   . TYR A 1 62  ? 2.672   -6.992  0.207   1.00 0.00 ? 845 TYR A OH   5  
ATOM 6987  H H    . TYR A 1 62  ? -3.213  -3.540  3.302   1.00 0.00 ? 845 TYR A H    5  
ATOM 6988  H HA   . TYR A 1 62  ? -1.330  -2.648  1.217   1.00 0.00 ? 845 TYR A HA   5  
ATOM 6989  H HB2  . TYR A 1 62  ? -2.985  -5.110  1.438   1.00 0.00 ? 845 TYR A HB2  5  
ATOM 6990  H HB3  . TYR A 1 62  ? -2.821  -4.390  -0.160  1.00 0.00 ? 845 TYR A HB3  5  
ATOM 6991  H HD1  . TYR A 1 62  ? -0.686  -5.365  2.751   1.00 0.00 ? 845 TYR A HD1  5  
ATOM 6992  H HD2  . TYR A 1 62  ? -1.058  -5.082  -1.478  1.00 0.00 ? 845 TYR A HD2  5  
ATOM 6993  H HE1  . TYR A 1 62  ? 1.503   -6.456  2.492   1.00 0.00 ? 845 TYR A HE1  5  
ATOM 6994  H HE2  . TYR A 1 62  ? 1.129   -6.174  -1.749  1.00 0.00 ? 845 TYR A HE2  5  
ATOM 6995  H HH   . TYR A 1 62  ? 3.107   -7.048  1.061   1.00 0.00 ? 845 TYR A HH   5  
ATOM 6996  N N    . VAL A 1 63  ? -3.027  -1.355  -0.078  1.00 0.00 ? 846 VAL A N    5  
ATOM 6997  C CA   . VAL A 1 63  ? -3.982  -0.448  -0.703  1.00 0.00 ? 846 VAL A CA   5  
ATOM 6998  C C    . VAL A 1 63  ? -4.025  -0.651  -2.214  1.00 0.00 ? 846 VAL A C    5  
ATOM 6999  O O    . VAL A 1 63  ? -3.029  -1.036  -2.826  1.00 0.00 ? 846 VAL A O    5  
ATOM 7000  C CB   . VAL A 1 63  ? -3.639  1.023   -0.403  1.00 0.00 ? 846 VAL A CB   5  
ATOM 7001  C CG1  . VAL A 1 63  ? -4.639  1.952   -1.074  1.00 0.00 ? 846 VAL A CG1  5  
ATOM 7002  C CG2  . VAL A 1 63  ? -3.599  1.264   1.099   1.00 0.00 ? 846 VAL A CG2  5  
ATOM 7003  H H    . VAL A 1 63  ? -2.095  -1.349  -0.380  1.00 0.00 ? 846 VAL A H    5  
ATOM 7004  H HA   . VAL A 1 63  ? -4.960  -0.659  -0.294  1.00 0.00 ? 846 VAL A HA   5  
ATOM 7005  H HB   . VAL A 1 63  ? -2.659  1.232   -0.806  1.00 0.00 ? 846 VAL A HB   5  
ATOM 7006  H HG11 . VAL A 1 63  ? -4.652  1.759   -2.136  1.00 0.00 ? 846 VAL A HG11 5  
ATOM 7007  H HG12 . VAL A 1 63  ? -5.623  1.780   -0.663  1.00 0.00 ? 846 VAL A HG12 5  
ATOM 7008  H HG13 . VAL A 1 63  ? -4.350  2.978   -0.898  1.00 0.00 ? 846 VAL A HG13 5  
ATOM 7009  H HG21 . VAL A 1 63  ? -4.159  2.156   1.334   1.00 0.00 ? 846 VAL A HG21 5  
ATOM 7010  H HG22 . VAL A 1 63  ? -4.036  0.419   1.612   1.00 0.00 ? 846 VAL A HG22 5  
ATOM 7011  H HG23 . VAL A 1 63  ? -2.574  1.386   1.417   1.00 0.00 ? 846 VAL A HG23 5  
ATOM 7012  N N    . GLU A 1 64  ? -5.185  -0.388  -2.808  1.00 0.00 ? 847 GLU A N    5  
ATOM 7013  C CA   . GLU A 1 64  ? -5.356  -0.541  -4.248  1.00 0.00 ? 847 GLU A CA   5  
ATOM 7014  C C    . GLU A 1 64  ? -6.082  0.663   -4.841  1.00 0.00 ? 847 GLU A C    5  
ATOM 7015  O O    . GLU A 1 64  ? -7.255  0.899   -4.551  1.00 0.00 ? 847 GLU A O    5  
ATOM 7016  C CB   . GLU A 1 64  ? -6.133  -1.823  -4.558  1.00 0.00 ? 847 GLU A CB   5  
ATOM 7017  C CG   . GLU A 1 64  ? -5.916  -2.340  -5.970  1.00 0.00 ? 847 GLU A CG   5  
ATOM 7018  C CD   . GLU A 1 64  ? -7.118  -3.093  -6.506  1.00 0.00 ? 847 GLU A CD   5  
ATOM 7019  O OE1  . GLU A 1 64  ? -7.375  -4.217  -6.027  1.00 0.00 ? 847 GLU A OE1  5  
ATOM 7020  O OE2  . GLU A 1 64  ? -7.801  -2.558  -7.405  1.00 0.00 ? 847 GLU A OE2  5  
ATOM 7021  H H    . GLU A 1 64  ? -5.942  -0.084  -2.266  1.00 0.00 ? 847 GLU A H    5  
ATOM 7022  H HA   . GLU A 1 64  ? -4.375  -0.610  -4.693  1.00 0.00 ? 847 GLU A HA   5  
ATOM 7023  H HB2  . GLU A 1 64  ? -5.827  -2.591  -3.863  1.00 0.00 ? 847 GLU A HB2  5  
ATOM 7024  H HB3  . GLU A 1 64  ? -7.188  -1.630  -4.426  1.00 0.00 ? 847 GLU A HB3  5  
ATOM 7025  H HG2  . GLU A 1 64  ? -5.716  -1.502  -6.620  1.00 0.00 ? 847 GLU A HG2  5  
ATOM 7026  H HG3  . GLU A 1 64  ? -5.064  -3.004  -5.969  1.00 0.00 ? 847 GLU A HG3  5  
ATOM 7027  N N    . TYR A 1 65  ? -5.377  1.421   -5.673  1.00 0.00 ? 848 TYR A N    5  
ATOM 7028  C CA   . TYR A 1 65  ? -5.952  2.602   -6.304  1.00 0.00 ? 848 TYR A CA   5  
ATOM 7029  C C    . TYR A 1 65  ? -6.420  2.289   -7.722  1.00 0.00 ? 848 TYR A C    5  
ATOM 7030  O O    . TYR A 1 65  ? -6.269  1.166   -8.202  1.00 0.00 ? 848 TYR A O    5  
ATOM 7031  C CB   . TYR A 1 65  ? -4.930  3.740   -6.333  1.00 0.00 ? 848 TYR A CB   5  
ATOM 7032  C CG   . TYR A 1 65  ? -4.968  4.619   -5.103  1.00 0.00 ? 848 TYR A CG   5  
ATOM 7033  C CD1  . TYR A 1 65  ? -4.265  4.271   -3.956  1.00 0.00 ? 848 TYR A CD1  5  
ATOM 7034  C CD2  . TYR A 1 65  ? -5.706  5.795   -5.088  1.00 0.00 ? 848 TYR A CD2  5  
ATOM 7035  C CE1  . TYR A 1 65  ? -4.297  5.071   -2.829  1.00 0.00 ? 848 TYR A CE1  5  
ATOM 7036  C CE2  . TYR A 1 65  ? -5.743  6.601   -3.966  1.00 0.00 ? 848 TYR A CE2  5  
ATOM 7037  C CZ   . TYR A 1 65  ? -5.037  6.235   -2.839  1.00 0.00 ? 848 TYR A CZ   5  
ATOM 7038  O OH   . TYR A 1 65  ? -5.071  7.034   -1.720  1.00 0.00 ? 848 TYR A OH   5  
ATOM 7039  H H    . TYR A 1 65  ? -4.446  1.182   -5.865  1.00 0.00 ? 848 TYR A H    5  
ATOM 7040  H HA   . TYR A 1 65  ? -6.804  2.911   -5.716  1.00 0.00 ? 848 TYR A HA   5  
ATOM 7041  H HB2  . TYR A 1 65  ? -3.938  3.322   -6.411  1.00 0.00 ? 848 TYR A HB2  5  
ATOM 7042  H HB3  . TYR A 1 65  ? -5.121  4.365   -7.193  1.00 0.00 ? 848 TYR A HB3  5  
ATOM 7043  H HD1  . TYR A 1 65  ? -3.686  3.359   -3.950  1.00 0.00 ? 848 TYR A HD1  5  
ATOM 7044  H HD2  . TYR A 1 65  ? -6.259  6.079   -5.972  1.00 0.00 ? 848 TYR A HD2  5  
ATOM 7045  H HE1  . TYR A 1 65  ? -3.744  4.784   -1.947  1.00 0.00 ? 848 TYR A HE1  5  
ATOM 7046  H HE2  . TYR A 1 65  ? -6.322  7.512   -3.974  1.00 0.00 ? 848 TYR A HE2  5  
ATOM 7047  H HH   . TYR A 1 65  ? -5.818  7.634   -1.779  1.00 0.00 ? 848 TYR A HH   5  
ATOM 7048  N N    . GLU A 1 66  ? -6.988  3.290   -8.386  1.00 0.00 ? 849 GLU A N    5  
ATOM 7049  C CA   . GLU A 1 66  ? -7.478  3.122   -9.749  1.00 0.00 ? 849 GLU A CA   5  
ATOM 7050  C C    . GLU A 1 66  ? -6.354  3.324   -10.761 1.00 0.00 ? 849 GLU A C    5  
ATOM 7051  O O    . GLU A 1 66  ? -6.168  2.514   -11.667 1.00 0.00 ? 849 GLU A O    5  
ATOM 7052  C CB   . GLU A 1 66  ? -8.616  4.105   -10.031 1.00 0.00 ? 849 GLU A CB   5  
ATOM 7053  C CG   . GLU A 1 66  ? -9.387  3.796   -11.303 1.00 0.00 ? 849 GLU A CG   5  
ATOM 7054  C CD   . GLU A 1 66  ? -8.790  4.467   -12.525 1.00 0.00 ? 849 GLU A CD   5  
ATOM 7055  O OE1  . GLU A 1 66  ? -7.900  3.863   -13.159 1.00 0.00 ? 849 GLU A OE1  5  
ATOM 7056  O OE2  . GLU A 1 66  ? -9.213  5.597   -12.847 1.00 0.00 ? 849 GLU A OE2  5  
ATOM 7057  H H    . GLU A 1 66  ? -7.080  4.163   -7.950  1.00 0.00 ? 849 GLU A H    5  
ATOM 7058  H HA   . GLU A 1 66  ? -7.855  2.114   -9.844  1.00 0.00 ? 849 GLU A HA   5  
ATOM 7059  H HB2  . GLU A 1 66  ? -9.307  4.085   -9.201  1.00 0.00 ? 849 GLU A HB2  5  
ATOM 7060  H HB3  . GLU A 1 66  ? -8.202  5.099   -10.119 1.00 0.00 ? 849 GLU A HB3  5  
ATOM 7061  H HG2  . GLU A 1 66  ? -9.383  2.728   -11.461 1.00 0.00 ? 849 GLU A HG2  5  
ATOM 7062  H HG3  . GLU A 1 66  ? -10.405 4.138   -11.184 1.00 0.00 ? 849 GLU A HG3  5  
ATOM 7063  N N    . ASN A 1 67  ? -5.608  4.412   -10.598 1.00 0.00 ? 850 ASN A N    5  
ATOM 7064  C CA   . ASN A 1 67  ? -4.503  4.722   -11.497 1.00 0.00 ? 850 ASN A CA   5  
ATOM 7065  C C    . ASN A 1 67  ? -3.186  4.811   -10.731 1.00 0.00 ? 850 ASN A C    5  
ATOM 7066  O O    . ASN A 1 67  ? -3.152  4.625   -9.515  1.00 0.00 ? 850 ASN A O    5  
ATOM 7067  C CB   . ASN A 1 67  ? -4.769  6.038   -12.231 1.00 0.00 ? 850 ASN A CB   5  
ATOM 7068  C CG   . ASN A 1 67  ? -4.757  7.233   -11.297 1.00 0.00 ? 850 ASN A CG   5  
ATOM 7069  O OD1  . ASN A 1 67  ? -4.228  7.163   -10.188 1.00 0.00 ? 850 ASN A OD1  5  
ATOM 7070  N ND2  . ASN A 1 67  ? -5.342  8.339   -11.743 1.00 0.00 ? 850 ASN A ND2  5  
ATOM 7071  H H    . ASN A 1 67  ? -5.806  5.021   -9.856  1.00 0.00 ? 850 ASN A H    5  
ATOM 7072  H HA   . ASN A 1 67  ? -4.431  3.925   -12.222 1.00 0.00 ? 850 ASN A HA   5  
ATOM 7073  H HB2  . ASN A 1 67  ? -4.006  6.185   -12.982 1.00 0.00 ? 850 ASN A HB2  5  
ATOM 7074  H HB3  . ASN A 1 67  ? -5.735  5.988   -12.710 1.00 0.00 ? 850 ASN A HB3  5  
ATOM 7075  H HD21 . ASN A 1 67  ? -5.743  8.322   -12.637 1.00 0.00 ? 850 ASN A HD21 5  
ATOM 7076  H HD22 . ASN A 1 67  ? -5.348  9.126   -11.160 1.00 0.00 ? 850 ASN A HD22 5  
ATOM 7077  N N    . GLU A 1 68  ? -2.107  5.098   -11.451 1.00 0.00 ? 851 GLU A N    5  
ATOM 7078  C CA   . GLU A 1 68  ? -0.788  5.211   -10.839 1.00 0.00 ? 851 GLU A CA   5  
ATOM 7079  C C    . GLU A 1 68  ? -0.604  6.581   -10.193 1.00 0.00 ? 851 GLU A C    5  
ATOM 7080  O O    . GLU A 1 68  ? -0.250  6.684   -9.019  1.00 0.00 ? 851 GLU A O    5  
ATOM 7081  C CB   . GLU A 1 68  ? 0.306   4.976   -11.882 1.00 0.00 ? 851 GLU A CB   5  
ATOM 7082  C CG   . GLU A 1 68  ? 1.683   5.436   -11.435 1.00 0.00 ? 851 GLU A CG   5  
ATOM 7083  C CD   . GLU A 1 68  ? 1.934   6.902   -11.734 1.00 0.00 ? 851 GLU A CD   5  
ATOM 7084  O OE1  . GLU A 1 68  ? 1.708   7.319   -12.888 1.00 0.00 ? 851 GLU A OE1  5  
ATOM 7085  O OE2  . GLU A 1 68  ? 2.356   7.631   -10.812 1.00 0.00 ? 851 GLU A OE2  5  
ATOM 7086  H H    . GLU A 1 68  ? -2.198  5.236   -12.417 1.00 0.00 ? 851 GLU A H    5  
ATOM 7087  H HA   . GLU A 1 68  ? -0.712  4.453   -10.074 1.00 0.00 ? 851 GLU A HA   5  
ATOM 7088  H HB2  . GLU A 1 68  ? 0.355   3.920   -12.103 1.00 0.00 ? 851 GLU A HB2  5  
ATOM 7089  H HB3  . GLU A 1 68  ? 0.046   5.510   -12.784 1.00 0.00 ? 851 GLU A HB3  5  
ATOM 7090  H HG2  . GLU A 1 68  ? 1.772   5.282   -10.370 1.00 0.00 ? 851 GLU A HG2  5  
ATOM 7091  H HG3  . GLU A 1 68  ? 2.429   4.847   -11.946 1.00 0.00 ? 851 GLU A HG3  5  
ATOM 7092  N N    . SER A 1 69  ? -0.848  7.632   -10.969 1.00 0.00 ? 852 SER A N    5  
ATOM 7093  C CA   . SER A 1 69  ? -0.705  8.997   -10.476 1.00 0.00 ? 852 SER A CA   5  
ATOM 7094  C C    . SER A 1 69  ? -1.186  9.105   -9.032  1.00 0.00 ? 852 SER A C    5  
ATOM 7095  O O    . SER A 1 69  ? -0.432  9.504   -8.145  1.00 0.00 ? 852 SER A O    5  
ATOM 7096  C CB   . SER A 1 69  ? -1.491  9.967   -11.360 1.00 0.00 ? 852 SER A CB   5  
ATOM 7097  O OG   . SER A 1 69  ? -0.975  11.283  -11.258 1.00 0.00 ? 852 SER A OG   5  
ATOM 7098  H H    . SER A 1 69  ? -1.128  7.486   -11.897 1.00 0.00 ? 852 SER A H    5  
ATOM 7099  H HA   . SER A 1 69  ? 0.342   9.256   -10.515 1.00 0.00 ? 852 SER A HA   5  
ATOM 7100  H HB2  . SER A 1 69  ? -1.425  9.646   -12.389 1.00 0.00 ? 852 SER A HB2  5  
ATOM 7101  H HB3  . SER A 1 69  ? -2.526  9.974   -11.051 1.00 0.00 ? 852 SER A HB3  5  
ATOM 7102  H HG   . SER A 1 69  ? -0.539  11.391  -10.410 1.00 0.00 ? 852 SER A HG   5  
ATOM 7103  N N    . GLN A 1 70  ? -2.445  8.747   -8.805  1.00 0.00 ? 853 GLN A N    5  
ATOM 7104  C CA   . GLN A 1 70  ? -3.027  8.804   -7.469  1.00 0.00 ? 853 GLN A CA   5  
ATOM 7105  C C    . GLN A 1 70  ? -2.144  8.079   -6.459  1.00 0.00 ? 853 GLN A C    5  
ATOM 7106  O O    . GLN A 1 70  ? -1.598  8.693   -5.543  1.00 0.00 ? 853 GLN A O    5  
ATOM 7107  C CB   . GLN A 1 70  ? -4.428  8.190   -7.473  1.00 0.00 ? 853 GLN A CB   5  
ATOM 7108  C CG   . GLN A 1 70  ? -5.474  9.066   -8.144  1.00 0.00 ? 853 GLN A CG   5  
ATOM 7109  C CD   . GLN A 1 70  ? -6.854  8.439   -8.132  1.00 0.00 ? 853 GLN A CD   5  
ATOM 7110  O OE1  . GLN A 1 70  ? -7.848  9.103   -7.836  1.00 0.00 ? 853 GLN A OE1  5  
ATOM 7111  N NE2  . GLN A 1 70  ? -6.924  7.153   -8.456  1.00 0.00 ? 853 GLN A NE2  5  
ATOM 7112  H H    . GLN A 1 70  ? -2.996  8.437   -9.553  1.00 0.00 ? 853 GLN A H    5  
ATOM 7113  H HA   . GLN A 1 70  ? -3.100  9.843   -7.184  1.00 0.00 ? 853 GLN A HA   5  
ATOM 7114  H HB2  . GLN A 1 70  ? -4.392  7.245   -7.994  1.00 0.00 ? 853 GLN A HB2  5  
ATOM 7115  H HB3  . GLN A 1 70  ? -4.735  8.018   -6.452  1.00 0.00 ? 853 GLN A HB3  5  
ATOM 7116  H HG2  . GLN A 1 70  ? -5.521  10.011  -7.624  1.00 0.00 ? 853 GLN A HG2  5  
ATOM 7117  H HG3  . GLN A 1 70  ? -5.180  9.234   -9.169  1.00 0.00 ? 853 GLN A HG3  5  
ATOM 7118  H HE21 . GLN A 1 70  ? -6.090  6.687   -8.680  1.00 0.00 ? 853 GLN A HE21 5  
ATOM 7119  H HE22 . GLN A 1 70  ? -7.803  6.722   -8.456  1.00 0.00 ? 853 GLN A HE22 5  
ATOM 7120  N N    . ALA A 1 71  ? -2.008  6.768   -6.633  1.00 0.00 ? 854 ALA A N    5  
ATOM 7121  C CA   . ALA A 1 71  ? -1.190  5.959   -5.738  1.00 0.00 ? 854 ALA A CA   5  
ATOM 7122  C C    . ALA A 1 71  ? 0.092   6.691   -5.355  1.00 0.00 ? 854 ALA A C    5  
ATOM 7123  O O    . ALA A 1 71  ? 0.490   6.696   -4.190  1.00 0.00 ? 854 ALA A O    5  
ATOM 7124  C CB   . ALA A 1 71  ? -0.864  4.622   -6.386  1.00 0.00 ? 854 ALA A CB   5  
ATOM 7125  H H    . ALA A 1 71  ? -2.468  6.335   -7.382  1.00 0.00 ? 854 ALA A H    5  
ATOM 7126  H HA   . ALA A 1 71  ? -1.764  5.768   -4.843  1.00 0.00 ? 854 ALA A HA   5  
ATOM 7127  H HB1  . ALA A 1 71  ? -0.966  4.707   -7.458  1.00 0.00 ? 854 ALA A HB1  5  
ATOM 7128  H HB2  . ALA A 1 71  ? 0.150   4.342   -6.141  1.00 0.00 ? 854 ALA A HB2  5  
ATOM 7129  H HB3  . ALA A 1 71  ? -1.544  3.869   -6.018  1.00 0.00 ? 854 ALA A HB3  5  
ATOM 7130  N N    . SER A 1 72  ? 0.734   7.306   -6.343  1.00 0.00 ? 855 SER A N    5  
ATOM 7131  C CA   . SER A 1 72  ? 1.974   8.037   -6.110  1.00 0.00 ? 855 SER A CA   5  
ATOM 7132  C C    . SER A 1 72  ? 1.772   9.132   -5.067  1.00 0.00 ? 855 SER A C    5  
ATOM 7133  O O    . SER A 1 72  ? 2.443   9.154   -4.036  1.00 0.00 ? 855 SER A O    5  
ATOM 7134  C CB   . SER A 1 72  ? 2.484   8.649   -7.416  1.00 0.00 ? 855 SER A CB   5  
ATOM 7135  O OG   . SER A 1 72  ? 3.699   9.350   -7.211  1.00 0.00 ? 855 SER A OG   5  
ATOM 7136  H H    . SER A 1 72  ? 0.366   7.266   -7.250  1.00 0.00 ? 855 SER A H    5  
ATOM 7137  H HA   . SER A 1 72  ? 2.708   7.336   -5.740  1.00 0.00 ? 855 SER A HA   5  
ATOM 7138  H HB2  . SER A 1 72  ? 2.652   7.864   -8.137  1.00 0.00 ? 855 SER A HB2  5  
ATOM 7139  H HB3  . SER A 1 72  ? 1.745   9.338   -7.799  1.00 0.00 ? 855 SER A HB3  5  
ATOM 7140  H HG   . SER A 1 72  ? 3.507   10.254  -6.952  1.00 0.00 ? 855 SER A HG   5  
ATOM 7141  N N    . GLN A 1 73  ? 0.841   10.040  -5.344  1.00 0.00 ? 856 GLN A N    5  
ATOM 7142  C CA   . GLN A 1 73  ? 0.550   11.138  -4.430  1.00 0.00 ? 856 GLN A CA   5  
ATOM 7143  C C    . GLN A 1 73  ? 0.375   10.628  -3.004  1.00 0.00 ? 856 GLN A C    5  
ATOM 7144  O O    . GLN A 1 73  ? 1.043   11.095  -2.081  1.00 0.00 ? 856 GLN A O    5  
ATOM 7145  C CB   . GLN A 1 73  ? -0.711  11.880  -4.877  1.00 0.00 ? 856 GLN A CB   5  
ATOM 7146  C CG   . GLN A 1 73  ? -0.729  13.346  -4.475  1.00 0.00 ? 856 GLN A CG   5  
ATOM 7147  C CD   . GLN A 1 73  ? 0.016   14.229  -5.456  1.00 0.00 ? 856 GLN A CD   5  
ATOM 7148  O OE1  . GLN A 1 73  ? -0.104  14.066  -6.671  1.00 0.00 ? 856 GLN A OE1  5  
ATOM 7149  N NE2  . GLN A 1 73  ? 0.790   15.173  -4.934  1.00 0.00 ? 856 GLN A NE2  5  
ATOM 7150  H H    . GLN A 1 73  ? 0.339   9.969   -6.182  1.00 0.00 ? 856 GLN A H    5  
ATOM 7151  H HA   . GLN A 1 73  ? 1.386   11.821  -4.456  1.00 0.00 ? 856 GLN A HA   5  
ATOM 7152  H HB2  . GLN A 1 73  ? -0.786  11.823  -5.952  1.00 0.00 ? 856 GLN A HB2  5  
ATOM 7153  H HB3  . GLN A 1 73  ? -1.573  11.399  -4.438  1.00 0.00 ? 856 GLN A HB3  5  
ATOM 7154  H HG2  . GLN A 1 73  ? -1.755  13.679  -4.422  1.00 0.00 ? 856 GLN A HG2  5  
ATOM 7155  H HG3  . GLN A 1 73  ? -0.269  13.445  -3.503  1.00 0.00 ? 856 GLN A HG3  5  
ATOM 7156  H HE21 . GLN A 1 73  ? 0.838   15.244  -3.957  1.00 0.00 ? 856 GLN A HE21 5  
ATOM 7157  H HE22 . GLN A 1 73  ? 1.284   15.758  -5.545  1.00 0.00 ? 856 GLN A HE22 5  
ATOM 7158  N N    . ALA A 1 74  ? -0.527  9.668   -2.830  1.00 0.00 ? 857 ALA A N    5  
ATOM 7159  C CA   . ALA A 1 74  ? -0.788  9.094   -1.516  1.00 0.00 ? 857 ALA A CA   5  
ATOM 7160  C C    . ALA A 1 74  ? 0.506   8.638   -0.849  1.00 0.00 ? 857 ALA A C    5  
ATOM 7161  O O    . ALA A 1 74  ? 0.677   8.783   0.361   1.00 0.00 ? 857 ALA A O    5  
ATOM 7162  C CB   . ALA A 1 74  ? -1.762  7.931   -1.632  1.00 0.00 ? 857 ALA A CB   5  
ATOM 7163  H H    . ALA A 1 74  ? -1.028  9.338   -3.604  1.00 0.00 ? 857 ALA A H    5  
ATOM 7164  H HA   . ALA A 1 74  ? -1.247  9.857   -0.903  1.00 0.00 ? 857 ALA A HA   5  
ATOM 7165  H HB1  . ALA A 1 74  ? -2.559  8.197   -2.312  1.00 0.00 ? 857 ALA A HB1  5  
ATOM 7166  H HB2  . ALA A 1 74  ? -1.243  7.062   -2.007  1.00 0.00 ? 857 ALA A HB2  5  
ATOM 7167  H HB3  . ALA A 1 74  ? -2.178  7.712   -0.660  1.00 0.00 ? 857 ALA A HB3  5  
ATOM 7168  N N    . VAL A 1 75  ? 1.414   8.085   -1.647  1.00 0.00 ? 858 VAL A N    5  
ATOM 7169  C CA   . VAL A 1 75  ? 2.693   7.608   -1.134  1.00 0.00 ? 858 VAL A CA   5  
ATOM 7170  C C    . VAL A 1 75  ? 3.592   8.772   -0.731  1.00 0.00 ? 858 VAL A C    5  
ATOM 7171  O O    . VAL A 1 75  ? 4.247   8.731   0.310   1.00 0.00 ? 858 VAL A O    5  
ATOM 7172  C CB   . VAL A 1 75  ? 3.427   6.743   -2.175  1.00 0.00 ? 858 VAL A CB   5  
ATOM 7173  C CG1  . VAL A 1 75  ? 4.826   6.395   -1.690  1.00 0.00 ? 858 VAL A CG1  5  
ATOM 7174  C CG2  . VAL A 1 75  ? 2.630   5.483   -2.478  1.00 0.00 ? 858 VAL A CG2  5  
ATOM 7175  H H    . VAL A 1 75  ? 1.220   7.997   -2.603  1.00 0.00 ? 858 VAL A H    5  
ATOM 7176  H HA   . VAL A 1 75  ? 2.497   6.999   -0.264  1.00 0.00 ? 858 VAL A HA   5  
ATOM 7177  H HB   . VAL A 1 75  ? 3.519   7.313   -3.088  1.00 0.00 ? 858 VAL A HB   5  
ATOM 7178  H HG11 . VAL A 1 75  ? 5.264   5.661   -2.350  1.00 0.00 ? 858 VAL A HG11 5  
ATOM 7179  H HG12 . VAL A 1 75  ? 5.437   7.286   -1.683  1.00 0.00 ? 858 VAL A HG12 5  
ATOM 7180  H HG13 . VAL A 1 75  ? 4.769   5.990   -0.690  1.00 0.00 ? 858 VAL A HG13 5  
ATOM 7181  H HG21 . VAL A 1 75  ? 1.601   5.630   -2.187  1.00 0.00 ? 858 VAL A HG21 5  
ATOM 7182  H HG22 . VAL A 1 75  ? 2.678   5.271   -3.536  1.00 0.00 ? 858 VAL A HG22 5  
ATOM 7183  H HG23 . VAL A 1 75  ? 3.045   4.653   -1.926  1.00 0.00 ? 858 VAL A HG23 5  
ATOM 7184  N N    . MET A 1 76  ? 3.618   9.808   -1.563  1.00 0.00 ? 859 MET A N    5  
ATOM 7185  C CA   . MET A 1 76  ? 4.436   10.984  -1.292  1.00 0.00 ? 859 MET A CA   5  
ATOM 7186  C C    . MET A 1 76  ? 3.981   11.680  -0.013  1.00 0.00 ? 859 MET A C    5  
ATOM 7187  O O    . MET A 1 76  ? 4.754   12.393  0.627   1.00 0.00 ? 859 MET A O    5  
ATOM 7188  C CB   . MET A 1 76  ? 4.370   11.960  -2.469  1.00 0.00 ? 859 MET A CB   5  
ATOM 7189  C CG   . MET A 1 76  ? 5.396   11.674  -3.553  1.00 0.00 ? 859 MET A CG   5  
ATOM 7190  S SD   . MET A 1 76  ? 4.975   12.446  -5.128  1.00 0.00 ? 859 MET A SD   5  
ATOM 7191  C CE   . MET A 1 76  ? 6.419   13.471  -5.398  1.00 0.00 ? 859 MET A CE   5  
ATOM 7192  H H    . MET A 1 76  ? 3.074   9.782   -2.378  1.00 0.00 ? 859 MET A H    5  
ATOM 7193  H HA   . MET A 1 76  ? 5.457   10.656  -1.165  1.00 0.00 ? 859 MET A HA   5  
ATOM 7194  H HB2  . MET A 1 76  ? 3.386   11.906  -2.911  1.00 0.00 ? 859 MET A HB2  5  
ATOM 7195  H HB3  . MET A 1 76  ? 4.537   12.961  -2.101  1.00 0.00 ? 859 MET A HB3  5  
ATOM 7196  H HG2  . MET A 1 76  ? 6.356   12.049  -3.231  1.00 0.00 ? 859 MET A HG2  5  
ATOM 7197  H HG3  . MET A 1 76  ? 5.459   10.606  -3.697  1.00 0.00 ? 859 MET A HG3  5  
ATOM 7198  H HE1  . MET A 1 76  ? 6.107   14.462  -5.691  1.00 0.00 ? 859 MET A HE1  5  
ATOM 7199  H HE2  . MET A 1 76  ? 6.995   13.529  -4.487  1.00 0.00 ? 859 MET A HE2  5  
ATOM 7200  H HE3  . MET A 1 76  ? 7.026   13.038  -6.181  1.00 0.00 ? 859 MET A HE3  5  
ATOM 7201  N N    . LYS A 1 77  ? 2.721   11.470  0.353   1.00 0.00 ? 860 LYS A N    5  
ATOM 7202  C CA   . LYS A 1 77  ? 2.162   12.076  1.556   1.00 0.00 ? 860 LYS A CA   5  
ATOM 7203  C C    . LYS A 1 77  ? 2.287   11.133  2.749   1.00 0.00 ? 860 LYS A C    5  
ATOM 7204  O O    . LYS A 1 77  ? 2.916   11.467  3.752   1.00 0.00 ? 860 LYS A O    5  
ATOM 7205  C CB   . LYS A 1 77  ? 0.693   12.440  1.333   1.00 0.00 ? 860 LYS A CB   5  
ATOM 7206  C CG   . LYS A 1 77  ? 0.498   13.704  0.513   1.00 0.00 ? 860 LYS A CG   5  
ATOM 7207  C CD   . LYS A 1 77  ? 0.514   14.945  1.388   1.00 0.00 ? 860 LYS A CD   5  
ATOM 7208  C CE   . LYS A 1 77  ? -0.877  15.285  1.900   1.00 0.00 ? 860 LYS A CE   5  
ATOM 7209  N NZ   . LYS A 1 77  ? -0.839  16.337  2.953   1.00 0.00 ? 860 LYS A NZ   5  
ATOM 7210  H H    . LYS A 1 77  ? 2.153   10.891  -0.199  1.00 0.00 ? 860 LYS A H    5  
ATOM 7211  H HA   . LYS A 1 77  ? 2.720   12.976  1.764   1.00 0.00 ? 860 LYS A HA   5  
ATOM 7212  H HB2  . LYS A 1 77  ? 0.206   11.624  0.820   1.00 0.00 ? 860 LYS A HB2  5  
ATOM 7213  H HB3  . LYS A 1 77  ? 0.220   12.583  2.294   1.00 0.00 ? 860 LYS A HB3  5  
ATOM 7214  H HG2  . LYS A 1 77  ? 1.294   13.778  -0.213  1.00 0.00 ? 860 LYS A HG2  5  
ATOM 7215  H HG3  . LYS A 1 77  ? -0.453  13.647  0.002   1.00 0.00 ? 860 LYS A HG3  5  
ATOM 7216  H HD2  . LYS A 1 77  ? 1.163   14.771  2.233   1.00 0.00 ? 860 LYS A HD2  5  
ATOM 7217  H HD3  . LYS A 1 77  ? 0.889   15.778  0.810   1.00 0.00 ? 860 LYS A HD3  5  
ATOM 7218  H HE2  . LYS A 1 77  ? -1.475  15.636  1.074   1.00 0.00 ? 860 LYS A HE2  5  
ATOM 7219  H HE3  . LYS A 1 77  ? -1.323  14.391  2.313   1.00 0.00 ? 860 LYS A HE3  5  
ATOM 7220  H HZ1  . LYS A 1 77  ? -1.805  16.565  3.265   1.00 0.00 ? 860 LYS A HZ1  5  
ATOM 7221  H HZ2  . LYS A 1 77  ? -0.396  17.201  2.579   1.00 0.00 ? 860 LYS A HZ2  5  
ATOM 7222  H HZ3  . LYS A 1 77  ? -0.291  16.005  3.772   1.00 0.00 ? 860 LYS A HZ3  5  
ATOM 7223  N N    . MET A 1 78  ? 1.686   9.954   2.631   1.00 0.00 ? 861 MET A N    5  
ATOM 7224  C CA   . MET A 1 78  ? 1.733   8.962   3.699   1.00 0.00 ? 861 MET A CA   5  
ATOM 7225  C C    . MET A 1 78  ? 3.175   8.617   4.057   1.00 0.00 ? 861 MET A C    5  
ATOM 7226  O O    . MET A 1 78  ? 3.566   8.674   5.223   1.00 0.00 ? 861 MET A O    5  
ATOM 7227  C CB   . MET A 1 78  ? 0.982   7.696   3.282   1.00 0.00 ? 861 MET A CB   5  
ATOM 7228  C CG   . MET A 1 78  ? -0.513  7.908   3.103   1.00 0.00 ? 861 MET A CG   5  
ATOM 7229  S SD   . MET A 1 78  ? -1.463  6.395   3.349   1.00 0.00 ? 861 MET A SD   5  
ATOM 7230  C CE   . MET A 1 78  ? -3.103  7.065   3.613   1.00 0.00 ? 861 MET A CE   5  
ATOM 7231  H H    . MET A 1 78  ? 1.200   9.744   1.806   1.00 0.00 ? 861 MET A H    5  
ATOM 7232  H HA   . MET A 1 78  ? 1.251   9.387   4.566   1.00 0.00 ? 861 MET A HA   5  
ATOM 7233  H HB2  . MET A 1 78  ? 1.388   7.342   2.347   1.00 0.00 ? 861 MET A HB2  5  
ATOM 7234  H HB3  . MET A 1 78  ? 1.128   6.939   4.038   1.00 0.00 ? 861 MET A HB3  5  
ATOM 7235  H HG2  . MET A 1 78  ? -0.847  8.646   3.817   1.00 0.00 ? 861 MET A HG2  5  
ATOM 7236  H HG3  . MET A 1 78  ? -0.693  8.271   2.102   1.00 0.00 ? 861 MET A HG3  5  
ATOM 7237  H HE1  . MET A 1 78  ? -3.775  6.678   2.861   1.00 0.00 ? 861 MET A HE1  5  
ATOM 7238  H HE2  . MET A 1 78  ? -3.455  6.779   4.593   1.00 0.00 ? 861 MET A HE2  5  
ATOM 7239  H HE3  . MET A 1 78  ? -3.067  8.143   3.543   1.00 0.00 ? 861 MET A HE3  5  
ATOM 7240  N N    . ASP A 1 79  ? 3.961   8.258   3.047   1.00 0.00 ? 862 ASP A N    5  
ATOM 7241  C CA   . ASP A 1 79  ? 5.360   7.904   3.256   1.00 0.00 ? 862 ASP A CA   5  
ATOM 7242  C C    . ASP A 1 79  ? 5.979   8.761   4.356   1.00 0.00 ? 862 ASP A C    5  
ATOM 7243  O O    . ASP A 1 79  ? 6.342   9.914   4.128   1.00 0.00 ? 862 ASP A O    5  
ATOM 7244  C CB   . ASP A 1 79  ? 6.150   8.071   1.957   1.00 0.00 ? 862 ASP A CB   5  
ATOM 7245  C CG   . ASP A 1 79  ? 7.625   7.769   2.133   1.00 0.00 ? 862 ASP A CG   5  
ATOM 7246  O OD1  . ASP A 1 79  ? 8.261   8.405   2.999   1.00 0.00 ? 862 ASP A OD1  5  
ATOM 7247  O OD2  . ASP A 1 79  ? 8.144   6.898   1.404   1.00 0.00 ? 862 ASP A OD2  5  
ATOM 7248  H H    . ASP A 1 79  ? 3.591   8.231   2.140   1.00 0.00 ? 862 ASP A H    5  
ATOM 7249  H HA   . ASP A 1 79  ? 5.399   6.869   3.559   1.00 0.00 ? 862 ASP A HA   5  
ATOM 7250  H HB2  . ASP A 1 79  ? 5.751   7.399   1.211   1.00 0.00 ? 862 ASP A HB2  5  
ATOM 7251  H HB3  . ASP A 1 79  ? 6.048   9.089   1.609   1.00 0.00 ? 862 ASP A HB3  5  
ATOM 7252  N N    . GLY A 1 80  ? 6.097   8.188   5.550   1.00 0.00 ? 863 GLY A N    5  
ATOM 7253  C CA   . GLY A 1 80  ? 6.671   8.914   6.668   1.00 0.00 ? 863 GLY A CA   5  
ATOM 7254  C C    . GLY A 1 80  ? 5.678   9.858   7.317   1.00 0.00 ? 863 GLY A C    5  
ATOM 7255  O O    . GLY A 1 80  ? 5.994   11.019  7.574   1.00 0.00 ? 863 GLY A O    5  
ATOM 7256  H H    . GLY A 1 80  ? 5.790   7.265   5.673   1.00 0.00 ? 863 GLY A H    5  
ATOM 7257  H HA2  . GLY A 1 80  ? 7.013   8.204   7.406   1.00 0.00 ? 863 GLY A HA2  5  
ATOM 7258  H HA3  . GLY A 1 80  ? 7.516   9.487   6.314   1.00 0.00 ? 863 GLY A HA3  5  
ATOM 7259  N N    . MET A 1 81  ? 4.475   9.359   7.581   1.00 0.00 ? 864 MET A N    5  
ATOM 7260  C CA   . MET A 1 81  ? 3.433   10.167  8.204   1.00 0.00 ? 864 MET A CA   5  
ATOM 7261  C C    . MET A 1 81  ? 3.151   9.689   9.625   1.00 0.00 ? 864 MET A C    5  
ATOM 7262  O O    . MET A 1 81  ? 3.281   8.502   9.930   1.00 0.00 ? 864 MET A O    5  
ATOM 7263  C CB   . MET A 1 81  ? 2.151   10.115  7.372   1.00 0.00 ? 864 MET A CB   5  
ATOM 7264  C CG   . MET A 1 81  ? 1.379   8.814   7.526   1.00 0.00 ? 864 MET A CG   5  
ATOM 7265  S SD   . MET A 1 81  ? -0.236  8.866   6.726   1.00 0.00 ? 864 MET A SD   5  
ATOM 7266  C CE   . MET A 1 81  ? -1.123  9.969   7.824   1.00 0.00 ? 864 MET A CE   5  
ATOM 7267  H H    . MET A 1 81  ? 4.283   8.426   7.353   1.00 0.00 ? 864 MET A H    5  
ATOM 7268  H HA   . MET A 1 81  ? 3.785   11.187  8.244   1.00 0.00 ? 864 MET A HA   5  
ATOM 7269  H HB2  . MET A 1 81  ? 1.508   10.928  7.672   1.00 0.00 ? 864 MET A HB2  5  
ATOM 7270  H HB3  . MET A 1 81  ? 2.407   10.234  6.330   1.00 0.00 ? 864 MET A HB3  5  
ATOM 7271  H HG2  . MET A 1 81  ? 1.956   8.014   7.088   1.00 0.00 ? 864 MET A HG2  5  
ATOM 7272  H HG3  . MET A 1 81  ? 1.238   8.619   8.579   1.00 0.00 ? 864 MET A HG3  5  
ATOM 7273  H HE1  . MET A 1 81  ? -2.013  9.478   8.186   1.00 0.00 ? 864 MET A HE1  5  
ATOM 7274  H HE2  . MET A 1 81  ? -0.490  10.230  8.659   1.00 0.00 ? 864 MET A HE2  5  
ATOM 7275  H HE3  . MET A 1 81  ? -1.399  10.865  7.287   1.00 0.00 ? 864 MET A HE3  5  
ATOM 7276  N N    . THR A 1 82  ? 2.764   10.619  10.492  1.00 0.00 ? 865 THR A N    5  
ATOM 7277  C CA   . THR A 1 82  ? 2.465   10.292  11.881  1.00 0.00 ? 865 THR A CA   5  
ATOM 7278  C C    . THR A 1 82  ? 0.986   9.971   12.064  1.00 0.00 ? 865 THR A C    5  
ATOM 7279  O O    . THR A 1 82  ? 0.119   10.756  11.680  1.00 0.00 ? 865 THR A O    5  
ATOM 7280  C CB   . THR A 1 82  ? 2.848   11.448  12.825  1.00 0.00 ? 865 THR A CB   5  
ATOM 7281  O OG1  . THR A 1 82  ? 4.018   12.113  12.336  1.00 0.00 ? 865 THR A OG1  5  
ATOM 7282  C CG2  . THR A 1 82  ? 3.103   10.934  14.234  1.00 0.00 ? 865 THR A CG2  5  
ATOM 7283  H H    . THR A 1 82  ? 2.679   11.547  10.190  1.00 0.00 ? 865 THR A H    5  
ATOM 7284  H HA   . THR A 1 82  ? 3.049   9.425   12.153  1.00 0.00 ? 865 THR A HA   5  
ATOM 7285  H HB   . THR A 1 82  ? 2.029   12.152  12.857  1.00 0.00 ? 865 THR A HB   5  
ATOM 7286  H HG1  . THR A 1 82  ? 4.194   12.888  12.874  1.00 0.00 ? 865 THR A HG1  5  
ATOM 7287  H HG21 . THR A 1 82  ? 3.410   9.899   14.190  1.00 0.00 ? 865 THR A HG21 5  
ATOM 7288  H HG22 . THR A 1 82  ? 2.197   11.016  14.816  1.00 0.00 ? 865 THR A HG22 5  
ATOM 7289  H HG23 . THR A 1 82  ? 3.882   11.521  14.695  1.00 0.00 ? 865 THR A HG23 5  
ATOM 7290  N N    . ILE A 1 83  ? 0.706   8.813   12.652  1.00 0.00 ? 866 ILE A N    5  
ATOM 7291  C CA   . ILE A 1 83  ? -0.669  8.390   12.887  1.00 0.00 ? 866 ILE A CA   5  
ATOM 7292  C C    . ILE A 1 83  ? -0.841  7.838   14.298  1.00 0.00 ? 866 ILE A C    5  
ATOM 7293  O O    . ILE A 1 83  ? -0.376  6.741   14.609  1.00 0.00 ? 866 ILE A O    5  
ATOM 7294  C CB   . ILE A 1 83  ? -1.109  7.318   11.872  1.00 0.00 ? 866 ILE A CB   5  
ATOM 7295  C CG1  . ILE A 1 83  ? -1.121  7.899   10.457  1.00 0.00 ? 866 ILE A CG1  5  
ATOM 7296  C CG2  . ILE A 1 83  ? -2.482  6.774   12.238  1.00 0.00 ? 866 ILE A CG2  5  
ATOM 7297  C CD1  . ILE A 1 83  ? -1.222  6.848   9.373   1.00 0.00 ? 866 ILE A CD1  5  
ATOM 7298  H H    . ILE A 1 83  ? 1.440   8.230   12.936  1.00 0.00 ? 866 ILE A H    5  
ATOM 7299  H HA   . ILE A 1 83  ? -1.308  9.253   12.769  1.00 0.00 ? 866 ILE A HA   5  
ATOM 7300  H HB   . ILE A 1 83  ? -0.403  6.503   11.914  1.00 0.00 ? 866 ILE A HB   5  
ATOM 7301  H HG12 . ILE A 1 83  ? -1.964  8.563   10.354  1.00 0.00 ? 866 ILE A HG12 5  
ATOM 7302  H HG13 . ILE A 1 83  ? -0.208  8.455   10.297  1.00 0.00 ? 866 ILE A HG13 5  
ATOM 7303  H HG21 . ILE A 1 83  ? -3.089  6.699   11.348  1.00 0.00 ? 866 ILE A HG21 5  
ATOM 7304  H HG22 . ILE A 1 83  ? -2.375  5.796   12.682  1.00 0.00 ? 866 ILE A HG22 5  
ATOM 7305  H HG23 . ILE A 1 83  ? -2.958  7.440   12.943  1.00 0.00 ? 866 ILE A HG23 5  
ATOM 7306  H HD11 . ILE A 1 83  ? -1.055  5.871   9.802   1.00 0.00 ? 866 ILE A HD11 5  
ATOM 7307  H HD12 . ILE A 1 83  ? -2.205  6.883   8.928   1.00 0.00 ? 866 ILE A HD12 5  
ATOM 7308  H HD13 . ILE A 1 83  ? -0.476  7.040   8.615   1.00 0.00 ? 866 ILE A HD13 5  
ATOM 7309  N N    . LYS A 1 84  ? -1.513  8.605   15.150  1.00 0.00 ? 867 LYS A N    5  
ATOM 7310  C CA   . LYS A 1 84  ? -1.751  8.194   16.528  1.00 0.00 ? 867 LYS A CA   5  
ATOM 7311  C C    . LYS A 1 84  ? -0.433  7.967   17.263  1.00 0.00 ? 867 LYS A C    5  
ATOM 7312  O O    . LYS A 1 84  ? -0.250  6.947   17.925  1.00 0.00 ? 867 LYS A O    5  
ATOM 7313  C CB   . LYS A 1 84  ? -2.592  6.916   16.563  1.00 0.00 ? 867 LYS A CB   5  
ATOM 7314  C CG   . LYS A 1 84  ? -4.072  7.156   16.315  1.00 0.00 ? 867 LYS A CG   5  
ATOM 7315  C CD   . LYS A 1 84  ? -4.917  6.004   16.833  1.00 0.00 ? 867 LYS A CD   5  
ATOM 7316  C CE   . LYS A 1 84  ? -6.392  6.213   16.526  1.00 0.00 ? 867 LYS A CE   5  
ATOM 7317  N NZ   . LYS A 1 84  ? -7.014  7.208   17.444  1.00 0.00 ? 867 LYS A NZ   5  
ATOM 7318  H H    . LYS A 1 84  ? -1.859  9.470   14.843  1.00 0.00 ? 867 LYS A H    5  
ATOM 7319  H HA   . LYS A 1 84  ? -2.293  8.986   17.022  1.00 0.00 ? 867 LYS A HA   5  
ATOM 7320  H HB2  . LYS A 1 84  ? -2.227  6.238   15.806  1.00 0.00 ? 867 LYS A HB2  5  
ATOM 7321  H HB3  . LYS A 1 84  ? -2.481  6.453   17.533  1.00 0.00 ? 867 LYS A HB3  5  
ATOM 7322  H HG2  . LYS A 1 84  ? -4.370  8.062   16.820  1.00 0.00 ? 867 LYS A HG2  5  
ATOM 7323  H HG3  . LYS A 1 84  ? -4.237  7.262   15.253  1.00 0.00 ? 867 LYS A HG3  5  
ATOM 7324  H HD2  . LYS A 1 84  ? -4.590  5.089   16.363  1.00 0.00 ? 867 LYS A HD2  5  
ATOM 7325  H HD3  . LYS A 1 84  ? -4.788  5.927   17.904  1.00 0.00 ? 867 LYS A HD3  5  
ATOM 7326  H HE2  . LYS A 1 84  ? -6.488  6.565   15.510  1.00 0.00 ? 867 LYS A HE2  5  
ATOM 7327  H HE3  . LYS A 1 84  ? -6.905  5.269   16.631  1.00 0.00 ? 867 LYS A HE3  5  
ATOM 7328  H HZ1  . LYS A 1 84  ? -6.287  7.850   17.819  1.00 0.00 ? 867 LYS A HZ1  5  
ATOM 7329  H HZ2  . LYS A 1 84  ? -7.474  6.721   18.239  1.00 0.00 ? 867 LYS A HZ2  5  
ATOM 7330  H HZ3  . LYS A 1 84  ? -7.727  7.767   16.935  1.00 0.00 ? 867 LYS A HZ3  5  
ATOM 7331  N N    . GLU A 1 85  ? 0.480   8.926   17.141  1.00 0.00 ? 868 GLU A N    5  
ATOM 7332  C CA   . GLU A 1 85  ? 1.779   8.830   17.795  1.00 0.00 ? 868 GLU A CA   5  
ATOM 7333  C C    . GLU A 1 85  ? 2.571   7.640   17.260  1.00 0.00 ? 868 GLU A C    5  
ATOM 7334  O O    . GLU A 1 85  ? 3.258   6.950   18.012  1.00 0.00 ? 868 GLU A O    5  
ATOM 7335  C CB   . GLU A 1 85  ? 1.605   8.702   19.310  1.00 0.00 ? 868 GLU A CB   5  
ATOM 7336  C CG   . GLU A 1 85  ? 2.842   9.092   20.100  1.00 0.00 ? 868 GLU A CG   5  
ATOM 7337  C CD   . GLU A 1 85  ? 2.772   8.651   21.550  1.00 0.00 ? 868 GLU A CD   5  
ATOM 7338  O OE1  . GLU A 1 85  ? 1.791   9.011   22.233  1.00 0.00 ? 868 GLU A OE1  5  
ATOM 7339  O OE2  . GLU A 1 85  ? 3.699   7.946   22.000  1.00 0.00 ? 868 GLU A OE2  5  
ATOM 7340  H H    . GLU A 1 85  ? 0.274   9.716   16.599  1.00 0.00 ? 868 GLU A H    5  
ATOM 7341  H HA   . GLU A 1 85  ? 2.326   9.736   17.581  1.00 0.00 ? 868 GLU A HA   5  
ATOM 7342  H HB2  . GLU A 1 85  ? 0.788   9.336   19.621  1.00 0.00 ? 868 GLU A HB2  5  
ATOM 7343  H HB3  . GLU A 1 85  ? 1.362   7.676   19.546  1.00 0.00 ? 868 GLU A HB3  5  
ATOM 7344  H HG2  . GLU A 1 85  ? 3.706   8.634   19.643  1.00 0.00 ? 868 GLU A HG2  5  
ATOM 7345  H HG3  . GLU A 1 85  ? 2.948   10.167  20.071  1.00 0.00 ? 868 GLU A HG3  5  
ATOM 7346  N N    . ASN A 1 86  ? 2.467   7.406   15.956  1.00 0.00 ? 869 ASN A N    5  
ATOM 7347  C CA   . ASN A 1 86  ? 3.171   6.298   15.320  1.00 0.00 ? 869 ASN A CA   5  
ATOM 7348  C C    . ASN A 1 86  ? 3.498   6.625   13.866  1.00 0.00 ? 869 ASN A C    5  
ATOM 7349  O O    . ASN A 1 86  ? 2.603   6.724   13.026  1.00 0.00 ? 869 ASN A O    5  
ATOM 7350  C CB   . ASN A 1 86  ? 2.329   5.023   15.391  1.00 0.00 ? 869 ASN A CB   5  
ATOM 7351  C CG   . ASN A 1 86  ? 3.160   3.770   15.191  1.00 0.00 ? 869 ASN A CG   5  
ATOM 7352  O OD1  . ASN A 1 86  ? 3.740   3.560   14.125  1.00 0.00 ? 869 ASN A OD1  5  
ATOM 7353  N ND2  . ASN A 1 86  ? 3.221   2.930   16.218  1.00 0.00 ? 869 ASN A ND2  5  
ATOM 7354  H H    . ASN A 1 86  ? 1.903   7.991   15.409  1.00 0.00 ? 869 ASN A H    5  
ATOM 7355  H HA   . ASN A 1 86  ? 4.094   6.141   15.857  1.00 0.00 ? 869 ASN A HA   5  
ATOM 7356  H HB2  . ASN A 1 86  ? 1.855   4.966   16.360  1.00 0.00 ? 869 ASN A HB2  5  
ATOM 7357  H HB3  . ASN A 1 86  ? 1.570   5.056   14.625  1.00 0.00 ? 869 ASN A HB3  5  
ATOM 7358  H HD21 . ASN A 1 86  ? 2.734   3.163   17.036  1.00 0.00 ? 869 ASN A HD21 5  
ATOM 7359  H HD22 . ASN A 1 86  ? 3.752   2.113   16.116  1.00 0.00 ? 869 ASN A HD22 5  
ATOM 7360  N N    . ILE A 1 87  ? 4.784   6.791   13.577  1.00 0.00 ? 870 ILE A N    5  
ATOM 7361  C CA   . ILE A 1 87  ? 5.228   7.105   12.225  1.00 0.00 ? 870 ILE A CA   5  
ATOM 7362  C C    . ILE A 1 87  ? 5.150   5.878   11.322  1.00 0.00 ? 870 ILE A C    5  
ATOM 7363  O O    . ILE A 1 87  ? 5.807   4.867   11.574  1.00 0.00 ? 870 ILE A O    5  
ATOM 7364  C CB   . ILE A 1 87  ? 6.671   7.643   12.217  1.00 0.00 ? 870 ILE A CB   5  
ATOM 7365  C CG1  . ILE A 1 87  ? 6.690   9.120   12.617  1.00 0.00 ? 870 ILE A CG1  5  
ATOM 7366  C CG2  . ILE A 1 87  ? 7.300   7.452   10.845  1.00 0.00 ? 870 ILE A CG2  5  
ATOM 7367  C CD1  . ILE A 1 87  ? 7.944   9.847   12.186  1.00 0.00 ? 870 ILE A CD1  5  
ATOM 7368  H H    . ILE A 1 87  ? 5.450   6.700   14.290  1.00 0.00 ? 870 ILE A H    5  
ATOM 7369  H HA   . ILE A 1 87  ? 4.577   7.871   11.830  1.00 0.00 ? 870 ILE A HA   5  
ATOM 7370  H HB   . ILE A 1 87  ? 7.247   7.076   12.932  1.00 0.00 ? 870 ILE A HB   5  
ATOM 7371  H HG12 . ILE A 1 87  ? 5.847   9.619   12.166  1.00 0.00 ? 870 ILE A HG12 5  
ATOM 7372  H HG13 . ILE A 1 87  ? 6.614   9.195   13.692  1.00 0.00 ? 870 ILE A HG13 5  
ATOM 7373  H HG21 . ILE A 1 87  ? 8.292   7.880   10.841  1.00 0.00 ? 870 ILE A HG21 5  
ATOM 7374  H HG22 . ILE A 1 87  ? 7.364   6.398   10.622  1.00 0.00 ? 870 ILE A HG22 5  
ATOM 7375  H HG23 . ILE A 1 87  ? 6.693   7.942   10.099  1.00 0.00 ? 870 ILE A HG23 5  
ATOM 7376  H HD11 . ILE A 1 87  ? 8.812   9.290   12.509  1.00 0.00 ? 870 ILE A HD11 5  
ATOM 7377  H HD12 . ILE A 1 87  ? 7.956   9.941   11.111  1.00 0.00 ? 870 ILE A HD12 5  
ATOM 7378  H HD13 . ILE A 1 87  ? 7.962   10.830  12.633  1.00 0.00 ? 870 ILE A HD13 5  
ATOM 7379  N N    . ILE A 1 88  ? 4.345   5.975   10.270  1.00 0.00 ? 871 ILE A N    5  
ATOM 7380  C CA   . ILE A 1 88  ? 4.184   4.874   9.328   1.00 0.00 ? 871 ILE A CA   5  
ATOM 7381  C C    . ILE A 1 88  ? 4.871   5.180   8.002   1.00 0.00 ? 871 ILE A C    5  
ATOM 7382  O O    . ILE A 1 88  ? 4.929   6.332   7.570   1.00 0.00 ? 871 ILE A O    5  
ATOM 7383  C CB   . ILE A 1 88  ? 2.697   4.572   9.065   1.00 0.00 ? 871 ILE A CB   5  
ATOM 7384  C CG1  . ILE A 1 88  ? 2.100   5.618   8.121   1.00 0.00 ? 871 ILE A CG1  5  
ATOM 7385  C CG2  . ILE A 1 88  ? 1.925   4.530   10.375  1.00 0.00 ? 871 ILE A CG2  5  
ATOM 7386  C CD1  . ILE A 1 88  ? 2.440   5.384   6.666   1.00 0.00 ? 871 ILE A CD1  5  
ATOM 7387  H H    . ILE A 1 88  ? 3.848   6.806   10.123  1.00 0.00 ? 871 ILE A H    5  
ATOM 7388  H HA   . ILE A 1 88  ? 4.638   3.995   9.762   1.00 0.00 ? 871 ILE A HA   5  
ATOM 7389  H HB   . ILE A 1 88  ? 2.627   3.599   8.602   1.00 0.00 ? 871 ILE A HB   5  
ATOM 7390  H HG12 . ILE A 1 88  ? 1.026   5.609   8.216   1.00 0.00 ? 871 ILE A HG12 5  
ATOM 7391  H HG13 . ILE A 1 88  ? 2.473   6.594   8.397   1.00 0.00 ? 871 ILE A HG13 5  
ATOM 7392  H HG21 . ILE A 1 88  ? 2.594   4.745   11.194  1.00 0.00 ? 871 ILE A HG21 5  
ATOM 7393  H HG22 . ILE A 1 88  ? 1.137   5.268   10.351  1.00 0.00 ? 871 ILE A HG22 5  
ATOM 7394  H HG23 . ILE A 1 88  ? 1.496   3.548   10.509  1.00 0.00 ? 871 ILE A HG23 5  
ATOM 7395  H HD11 . ILE A 1 88  ? 3.091   4.527   6.582   1.00 0.00 ? 871 ILE A HD11 5  
ATOM 7396  H HD12 . ILE A 1 88  ? 1.533   5.205   6.109   1.00 0.00 ? 871 ILE A HD12 5  
ATOM 7397  H HD13 . ILE A 1 88  ? 2.940   6.255   6.269   1.00 0.00 ? 871 ILE A HD13 5  
ATOM 7398  N N    . LYS A 1 89  ? 5.391   4.141   7.357   1.00 0.00 ? 872 LYS A N    5  
ATOM 7399  C CA   . LYS A 1 89  ? 6.073   4.296   6.078   1.00 0.00 ? 872 LYS A CA   5  
ATOM 7400  C C    . LYS A 1 89  ? 5.229   3.732   4.940   1.00 0.00 ? 872 LYS A C    5  
ATOM 7401  O O    . LYS A 1 89  ? 4.433   2.814   5.139   1.00 0.00 ? 872 LYS A O    5  
ATOM 7402  C CB   . LYS A 1 89  ? 7.433   3.597   6.113   1.00 0.00 ? 872 LYS A CB   5  
ATOM 7403  C CG   . LYS A 1 89  ? 8.269   3.828   4.866   1.00 0.00 ? 872 LYS A CG   5  
ATOM 7404  C CD   . LYS A 1 89  ? 9.723   3.450   5.091   1.00 0.00 ? 872 LYS A CD   5  
ATOM 7405  C CE   . LYS A 1 89  ? 10.556  3.668   3.837   1.00 0.00 ? 872 LYS A CE   5  
ATOM 7406  N NZ   . LYS A 1 89  ? 10.799  5.114   3.577   1.00 0.00 ? 872 LYS A NZ   5  
ATOM 7407  H H    . LYS A 1 89  ? 5.314   3.247   7.752   1.00 0.00 ? 872 LYS A H    5  
ATOM 7408  H HA   . LYS A 1 89  ? 6.225   5.352   5.909   1.00 0.00 ? 872 LYS A HA   5  
ATOM 7409  H HB2  . LYS A 1 89  ? 7.989   3.959   6.966   1.00 0.00 ? 872 LYS A HB2  5  
ATOM 7410  H HB3  . LYS A 1 89  ? 7.275   2.533   6.223   1.00 0.00 ? 872 LYS A HB3  5  
ATOM 7411  H HG2  . LYS A 1 89  ? 7.872   3.227   4.061   1.00 0.00 ? 872 LYS A HG2  5  
ATOM 7412  H HG3  . LYS A 1 89  ? 8.215   4.873   4.597   1.00 0.00 ? 872 LYS A HG3  5  
ATOM 7413  H HD2  . LYS A 1 89  ? 10.126  4.059   5.887   1.00 0.00 ? 872 LYS A HD2  5  
ATOM 7414  H HD3  . LYS A 1 89  ? 9.776   2.408   5.371   1.00 0.00 ? 872 LYS A HD3  5  
ATOM 7415  H HE2  . LYS A 1 89  ? 11.505  3.169   3.960   1.00 0.00 ? 872 LYS A HE2  5  
ATOM 7416  H HE3  . LYS A 1 89  ? 10.032  3.242   2.994   1.00 0.00 ? 872 LYS A HE3  5  
ATOM 7417  H HZ1  . LYS A 1 89  ? 10.413  5.380   2.648   1.00 0.00 ? 872 LYS A HZ1  5  
ATOM 7418  H HZ2  . LYS A 1 89  ? 11.820  5.312   3.585   1.00 0.00 ? 872 LYS A HZ2  5  
ATOM 7419  H HZ3  . LYS A 1 89  ? 10.339  5.692   4.309   1.00 0.00 ? 872 LYS A HZ3  5  
ATOM 7420  N N    . VAL A 1 90  ? 5.407   4.287   3.745   1.00 0.00 ? 873 VAL A N    5  
ATOM 7421  C CA   . VAL A 1 90  ? 4.664   3.837   2.574   1.00 0.00 ? 873 VAL A CA   5  
ATOM 7422  C C    . VAL A 1 90  ? 5.591   3.626   1.382   1.00 0.00 ? 873 VAL A C    5  
ATOM 7423  O O    . VAL A 1 90  ? 6.513   4.408   1.154   1.00 0.00 ? 873 VAL A O    5  
ATOM 7424  C CB   . VAL A 1 90  ? 3.567   4.845   2.185   1.00 0.00 ? 873 VAL A CB   5  
ATOM 7425  C CG1  . VAL A 1 90  ? 2.643   4.250   1.133   1.00 0.00 ? 873 VAL A CG1  5  
ATOM 7426  C CG2  . VAL A 1 90  ? 2.781   5.278   3.413   1.00 0.00 ? 873 VAL A CG2  5  
ATOM 7427  H H    . VAL A 1 90  ? 6.056   5.015   3.648   1.00 0.00 ? 873 VAL A H    5  
ATOM 7428  H HA   . VAL A 1 90  ? 4.190   2.898   2.820   1.00 0.00 ? 873 VAL A HA   5  
ATOM 7429  H HB   . VAL A 1 90  ? 4.042   5.718   1.761   1.00 0.00 ? 873 VAL A HB   5  
ATOM 7430  H HG11 . VAL A 1 90  ? 1.657   4.680   1.235   1.00 0.00 ? 873 VAL A HG11 5  
ATOM 7431  H HG12 . VAL A 1 90  ? 3.031   4.465   0.149   1.00 0.00 ? 873 VAL A HG12 5  
ATOM 7432  H HG13 . VAL A 1 90  ? 2.584   3.180   1.271   1.00 0.00 ? 873 VAL A HG13 5  
ATOM 7433  H HG21 . VAL A 1 90  ? 1.724   5.184   3.215   1.00 0.00 ? 873 VAL A HG21 5  
ATOM 7434  H HG22 . VAL A 1 90  ? 3.047   4.650   4.251   1.00 0.00 ? 873 VAL A HG22 5  
ATOM 7435  H HG23 . VAL A 1 90  ? 3.014   6.306   3.646   1.00 0.00 ? 873 VAL A HG23 5  
ATOM 7436  N N    . ALA A 1 91  ? 5.339   2.563   0.625   1.00 0.00 ? 874 ALA A N    5  
ATOM 7437  C CA   . ALA A 1 91  ? 6.150   2.250   -0.545  1.00 0.00 ? 874 ALA A CA   5  
ATOM 7438  C C    . ALA A 1 91  ? 5.340   1.480   -1.584  1.00 0.00 ? 874 ALA A C    5  
ATOM 7439  O O    . ALA A 1 91  ? 4.480   0.670   -1.237  1.00 0.00 ? 874 ALA A O    5  
ATOM 7440  C CB   . ALA A 1 91  ? 7.380   1.454   -0.137  1.00 0.00 ? 874 ALA A CB   5  
ATOM 7441  H H    . ALA A 1 91  ? 4.590   1.976   0.859   1.00 0.00 ? 874 ALA A H    5  
ATOM 7442  H HA   . ALA A 1 91  ? 6.481   3.181   -0.981  1.00 0.00 ? 874 ALA A HA   5  
ATOM 7443  H HB1  . ALA A 1 91  ? 7.443   0.557   -0.736  1.00 0.00 ? 874 ALA A HB1  5  
ATOM 7444  H HB2  . ALA A 1 91  ? 8.265   2.053   -0.294  1.00 0.00 ? 874 ALA A HB2  5  
ATOM 7445  H HB3  . ALA A 1 91  ? 7.306   1.186   0.906   1.00 0.00 ? 874 ALA A HB3  5  
ATOM 7446  N N    . ILE A 1 92  ? 5.620   1.740   -2.856  1.00 0.00 ? 875 ILE A N    5  
ATOM 7447  C CA   . ILE A 1 92  ? 4.917   1.071   -3.944  1.00 0.00 ? 875 ILE A CA   5  
ATOM 7448  C C    . ILE A 1 92  ? 5.030   -0.445  -3.822  1.00 0.00 ? 875 ILE A C    5  
ATOM 7449  O O    . ILE A 1 92  ? 6.128   -1.000  -3.851  1.00 0.00 ? 875 ILE A O    5  
ATOM 7450  C CB   . ILE A 1 92  ? 5.462   1.506   -5.318  1.00 0.00 ? 875 ILE A CB   5  
ATOM 7451  C CG1  . ILE A 1 92  ? 5.389   3.027   -5.461  1.00 0.00 ? 875 ILE A CG1  5  
ATOM 7452  C CG2  . ILE A 1 92  ? 4.686   0.824   -6.435  1.00 0.00 ? 875 ILE A CG2  5  
ATOM 7453  C CD1  . ILE A 1 92  ? 3.980   3.551   -5.635  1.00 0.00 ? 875 ILE A CD1  5  
ATOM 7454  H H    . ILE A 1 92  ? 6.316   2.396   -3.069  1.00 0.00 ? 875 ILE A H    5  
ATOM 7455  H HA   . ILE A 1 92  ? 3.875   1.349   -3.888  1.00 0.00 ? 875 ILE A HA   5  
ATOM 7456  H HB   . ILE A 1 92  ? 6.493   1.194   -5.386  1.00 0.00 ? 875 ILE A HB   5  
ATOM 7457  H HG12 . ILE A 1 92  ? 5.806   3.486   -4.579  1.00 0.00 ? 875 ILE A HG12 5  
ATOM 7458  H HG13 . ILE A 1 92  ? 5.964   3.328   -6.325  1.00 0.00 ? 875 ILE A HG13 5  
ATOM 7459  H HG21 . ILE A 1 92  ? 3.687   1.234   -6.481  1.00 0.00 ? 875 ILE A HG21 5  
ATOM 7460  H HG22 . ILE A 1 92  ? 5.187   0.994   -7.376  1.00 0.00 ? 875 ILE A HG22 5  
ATOM 7461  H HG23 . ILE A 1 92  ? 4.631   -0.236  -6.241  1.00 0.00 ? 875 ILE A HG23 5  
ATOM 7462  H HD11 . ILE A 1 92  ? 3.713   3.526   -6.681  1.00 0.00 ? 875 ILE A HD11 5  
ATOM 7463  H HD12 . ILE A 1 92  ? 3.295   2.935   -5.073  1.00 0.00 ? 875 ILE A HD12 5  
ATOM 7464  H HD13 . ILE A 1 92  ? 3.928   4.568   -5.275  1.00 0.00 ? 875 ILE A HD13 5  
ATOM 7465  N N    . SER A 1 93  ? 3.887   -1.109  -3.685  1.00 0.00 ? 876 SER A N    5  
ATOM 7466  C CA   . SER A 1 93  ? 3.857   -2.561  -3.557  1.00 0.00 ? 876 SER A CA   5  
ATOM 7467  C C    . SER A 1 93  ? 4.885   -3.210  -4.478  1.00 0.00 ? 876 SER A C    5  
ATOM 7468  O O    . SER A 1 93  ? 4.970   -2.881  -5.661  1.00 0.00 ? 876 SER A O    5  
ATOM 7469  C CB   . SER A 1 93  ? 2.459   -3.094  -3.878  1.00 0.00 ? 876 SER A CB   5  
ATOM 7470  O OG   . SER A 1 93  ? 2.292   -3.277  -5.273  1.00 0.00 ? 876 SER A OG   5  
ATOM 7471  H H    . SER A 1 93  ? 3.043   -0.610  -3.669  1.00 0.00 ? 876 SER A H    5  
ATOM 7472  H HA   . SER A 1 93  ? 4.101   -2.808  -2.534  1.00 0.00 ? 876 SER A HA   5  
ATOM 7473  H HB2  . SER A 1 93  ? 2.316   -4.043  -3.384  1.00 0.00 ? 876 SER A HB2  5  
ATOM 7474  H HB3  . SER A 1 93  ? 1.719   -2.390  -3.528  1.00 0.00 ? 876 SER A HB3  5  
ATOM 7475  H HG   . SER A 1 93  ? 2.379   -2.432  -5.720  1.00 0.00 ? 876 SER A HG   5  
ATOM 7476  N N    . ASN A 1 94  ? 5.666   -4.133  -3.927  1.00 0.00 ? 877 ASN A N    5  
ATOM 7477  C CA   . ASN A 1 94  ? 6.690   -4.829  -4.698  1.00 0.00 ? 877 ASN A CA   5  
ATOM 7478  C C    . ASN A 1 94  ? 6.191   -6.196  -5.156  1.00 0.00 ? 877 ASN A C    5  
ATOM 7479  O O    . ASN A 1 94  ? 6.069   -7.124  -4.357  1.00 0.00 ? 877 ASN A O    5  
ATOM 7480  C CB   . ASN A 1 94  ? 7.963   -4.991  -3.865  1.00 0.00 ? 877 ASN A CB   5  
ATOM 7481  C CG   . ASN A 1 94  ? 9.167   -5.350  -4.713  1.00 0.00 ? 877 ASN A CG   5  
ATOM 7482  O OD1  . ASN A 1 94  ? 9.527   -4.623  -5.639  1.00 0.00 ? 877 ASN A OD1  5  
ATOM 7483  N ND2  . ASN A 1 94  ? 9.796   -6.477  -4.401  1.00 0.00 ? 877 ASN A ND2  5  
ATOM 7484  H H    . ASN A 1 94  ? 5.551   -4.353  -2.978  1.00 0.00 ? 877 ASN A H    5  
ATOM 7485  H HA   . ASN A 1 94  ? 6.913   -4.229  -5.568  1.00 0.00 ? 877 ASN A HA   5  
ATOM 7486  H HB2  . ASN A 1 94  ? 8.171   -4.063  -3.353  1.00 0.00 ? 877 ASN A HB2  5  
ATOM 7487  H HB3  . ASN A 1 94  ? 7.812   -5.773  -3.136  1.00 0.00 ? 877 ASN A HB3  5  
ATOM 7488  H HD21 . ASN A 1 94  ? 9.452   -7.007  -3.651  1.00 0.00 ? 877 ASN A HD21 5  
ATOM 7489  H HD22 . ASN A 1 94  ? 10.578  -6.733  -4.933  1.00 0.00 ? 877 ASN A HD22 5  
ATOM 7490  N N    . SER A 1 95  ? 5.904   -6.312  -6.449  1.00 0.00 ? 878 SER A N    5  
ATOM 7491  C CA   . SER A 1 95  ? 5.416   -7.564  -7.014  1.00 0.00 ? 878 SER A CA   5  
ATOM 7492  C C    . SER A 1 95  ? 6.554   -8.567  -7.176  1.00 0.00 ? 878 SER A C    5  
ATOM 7493  O O    . SER A 1 95  ? 6.475   -9.696  -6.693  1.00 0.00 ? 878 SER A O    5  
ATOM 7494  C CB   . SER A 1 95  ? 4.747   -7.311  -8.367  1.00 0.00 ? 878 SER A CB   5  
ATOM 7495  O OG   . SER A 1 95  ? 4.291   -8.522  -8.945  1.00 0.00 ? 878 SER A OG   5  
ATOM 7496  H H    . SER A 1 95  ? 6.022   -5.536  -7.036  1.00 0.00 ? 878 SER A H    5  
ATOM 7497  H HA   . SER A 1 95  ? 4.685   -7.973  -6.332  1.00 0.00 ? 878 SER A HA   5  
ATOM 7498  H HB2  . SER A 1 95  ? 3.904   -6.652  -8.231  1.00 0.00 ? 878 SER A HB2  5  
ATOM 7499  H HB3  . SER A 1 95  ? 5.459   -6.852  -9.037  1.00 0.00 ? 878 SER A HB3  5  
ATOM 7500  H HG   . SER A 1 95  ? 3.436   -8.379  -9.355  1.00 0.00 ? 878 SER A HG   5  
ATOM 7501  N N    . GLY A 1 96  ? 7.613   -8.146  -7.861  1.00 0.00 ? 879 GLY A N    5  
ATOM 7502  C CA   . GLY A 1 96  ? 8.752   -9.019  -8.076  1.00 0.00 ? 879 GLY A CA   5  
ATOM 7503  C C    . GLY A 1 96  ? 9.425   -8.775  -9.412  1.00 0.00 ? 879 GLY A C    5  
ATOM 7504  O O    . GLY A 1 96  ? 9.352   -9.596  -10.327 1.00 0.00 ? 879 GLY A O    5  
ATOM 7505  H H    . GLY A 1 96  ? 7.620   -7.236  -8.223  1.00 0.00 ? 879 GLY A H    5  
ATOM 7506  H HA2  . GLY A 1 96  ? 9.471   -8.855  -7.287  1.00 0.00 ? 879 GLY A HA2  5  
ATOM 7507  H HA3  . GLY A 1 96  ? 8.418   -10.045 -8.036  1.00 0.00 ? 879 GLY A HA3  5  
ATOM 7508  N N    . PRO A 1 97  ? 10.098  -7.622  -9.538  1.00 0.00 ? 880 PRO A N    5  
ATOM 7509  C CA   . PRO A 1 97  ? 10.799  -7.246  -10.770 1.00 0.00 ? 880 PRO A CA   5  
ATOM 7510  C C    . PRO A 1 97  ? 12.033  -8.106  -11.021 1.00 0.00 ? 880 PRO A C    5  
ATOM 7511  O O    . PRO A 1 97  ? 12.955  -8.140  -10.206 1.00 0.00 ? 880 PRO A O    5  
ATOM 7512  C CB   . PRO A 1 97  ? 11.205  -5.791  -10.516 1.00 0.00 ? 880 PRO A CB   5  
ATOM 7513  C CG   . PRO A 1 97  ? 11.281  -5.672  -9.033  1.00 0.00 ? 880 PRO A CG   5  
ATOM 7514  C CD   . PRO A 1 97  ? 10.227  -6.597  -8.489  1.00 0.00 ? 880 PRO A CD   5  
ATOM 7515  H HA   . PRO A 1 97  ? 10.146  -7.295  -11.629 1.00 0.00 ? 880 PRO A HA   5  
ATOM 7516  H HB2  . PRO A 1 97  ? 12.162  -5.596  -10.979 1.00 0.00 ? 880 PRO A HB2  5  
ATOM 7517  H HB3  . PRO A 1 97  ? 10.458  -5.129  -10.928 1.00 0.00 ? 880 PRO A HB3  5  
ATOM 7518  H HG2  . PRO A 1 97  ? 12.258  -5.974  -8.690  1.00 0.00 ? 880 PRO A HG2  5  
ATOM 7519  H HG3  . PRO A 1 97  ? 11.074  -4.654  -8.736  1.00 0.00 ? 880 PRO A HG3  5  
ATOM 7520  H HD2  . PRO A 1 97  ? 10.556  -7.037  -7.559  1.00 0.00 ? 880 PRO A HD2  5  
ATOM 7521  H HD3  . PRO A 1 97  ? 9.296   -6.069  -8.351  1.00 0.00 ? 880 PRO A HD3  5  
ATOM 7522  N N    . SER A 1 98  ? 12.043  -8.801  -12.154 1.00 0.00 ? 881 SER A N    5  
ATOM 7523  C CA   . SER A 1 98  ? 13.162  -9.665  -12.511 1.00 0.00 ? 881 SER A CA   5  
ATOM 7524  C C    . SER A 1 98  ? 14.248  -8.876  -13.236 1.00 0.00 ? 881 SER A C    5  
ATOM 7525  O O    . SER A 1 98  ? 13.988  -8.233  -14.254 1.00 0.00 ? 881 SER A O    5  
ATOM 7526  C CB   . SER A 1 98  ? 12.682  -10.820 -13.391 1.00 0.00 ? 881 SER A CB   5  
ATOM 7527  O OG   . SER A 1 98  ? 13.758  -11.669 -13.751 1.00 0.00 ? 881 SER A OG   5  
ATOM 7528  H H    . SER A 1 98  ? 11.278  -8.733  -12.763 1.00 0.00 ? 881 SER A H    5  
ATOM 7529  H HA   . SER A 1 98  ? 13.575  -10.067 -11.598 1.00 0.00 ? 881 SER A HA   5  
ATOM 7530  H HB2  . SER A 1 98  ? 11.948  -11.399 -12.851 1.00 0.00 ? 881 SER A HB2  5  
ATOM 7531  H HB3  . SER A 1 98  ? 12.235  -10.422 -14.291 1.00 0.00 ? 881 SER A HB3  5  
ATOM 7532  H HG   . SER A 1 98  ? 13.838  -11.696 -14.708 1.00 0.00 ? 881 SER A HG   5  
ATOM 7533  N N    . SER A 1 99  ? 15.465  -8.929  -12.705 1.00 0.00 ? 882 SER A N    5  
ATOM 7534  C CA   . SER A 1 99  ? 16.590  -8.217  -13.298 1.00 0.00 ? 882 SER A CA   5  
ATOM 7535  C C    . SER A 1 99  ? 16.912  -8.768  -14.684 1.00 0.00 ? 882 SER A C    5  
ATOM 7536  O O    . SER A 1 99  ? 16.920  -8.033  -15.670 1.00 0.00 ? 882 SER A O    5  
ATOM 7537  C CB   . SER A 1 99  ? 17.821  -8.323  -12.396 1.00 0.00 ? 882 SER A CB   5  
ATOM 7538  O OG   . SER A 1 99  ? 18.967  -7.783  -13.032 1.00 0.00 ? 882 SER A OG   5  
ATOM 7539  H H    . SER A 1 99  ? 15.608  -9.459  -11.893 1.00 0.00 ? 882 SER A H    5  
ATOM 7540  H HA   . SER A 1 99  ? 16.312  -7.178  -13.393 1.00 0.00 ? 882 SER A HA   5  
ATOM 7541  H HB2  . SER A 1 99  ? 17.642  -7.778  -11.482 1.00 0.00 ? 882 SER A HB2  5  
ATOM 7542  H HB3  . SER A 1 99  ? 18.007  -9.362  -12.166 1.00 0.00 ? 882 SER A HB3  5  
ATOM 7543  H HG   . SER A 1 99  ? 19.755  -8.215  -12.693 1.00 0.00 ? 882 SER A HG   5  
ATOM 7544  N N    . GLY A 1 100 ? 17.178  -10.069 -14.750 1.00 0.00 ? 883 GLY A N    5  
ATOM 7545  C CA   . GLY A 1 100 ? 17.497  -10.698 -16.018 1.00 0.00 ? 883 GLY A CA   5  
ATOM 7546  C C    . GLY A 1 100 ? 18.697  -10.065 -16.693 1.00 0.00 ? 883 GLY A C    5  
ATOM 7547  O O    . GLY A 1 100 ? 18.548  -9.272  -17.623 1.00 0.00 ? 883 GLY A O    5  
ATOM 7548  H H    . GLY A 1 100 ? 17.156  -10.606 -13.930 1.00 0.00 ? 883 GLY A H    5  
ATOM 7549  H HA2  . GLY A 1 100 ? 17.704  -11.744 -15.847 1.00 0.00 ? 883 GLY A HA2  5  
ATOM 7550  H HA3  . GLY A 1 100 ? 16.643  -10.613 -16.674 1.00 0.00 ? 883 GLY A HA3  5  
ATOM 7551  N N    . GLY A 1 1   ? 17.484  17.193  2.159   1.00 0.00 ? 784 GLY A N    6  
ATOM 7552  C CA   . GLY A 1 1   ? 17.903  16.002  1.443   1.00 0.00 ? 784 GLY A CA   6  
ATOM 7553  C C    . GLY A 1 1   ? 17.070  15.748  0.203   1.00 0.00 ? 784 GLY A C    6  
ATOM 7554  O O    . GLY A 1 1   ? 16.252  14.829  0.174   1.00 0.00 ? 784 GLY A O    6  
ATOM 7555  H H1   . GLY A 1 1   ? 17.019  17.108  3.018   1.00 0.00 ? 784 GLY A H1   6  
ATOM 7556  H HA2  . GLY A 1 1   ? 18.937  16.115  1.153   1.00 0.00 ? 784 GLY A HA2  6  
ATOM 7557  H HA3  . GLY A 1 1   ? 17.816  15.150  2.102   1.00 0.00 ? 784 GLY A HA3  6  
ATOM 7558  N N    . SER A 1 2   ? 17.278  16.566  -0.825  1.00 0.00 ? 785 SER A N    6  
ATOM 7559  C CA   . SER A 1 2   ? 16.535  16.429  -2.072  1.00 0.00 ? 785 SER A CA   6  
ATOM 7560  C C    . SER A 1 2   ? 16.710  15.031  -2.658  1.00 0.00 ? 785 SER A C    6  
ATOM 7561  O O    . SER A 1 2   ? 17.795  14.667  -3.111  1.00 0.00 ? 785 SER A O    6  
ATOM 7562  C CB   . SER A 1 2   ? 16.998  17.479  -3.084  1.00 0.00 ? 785 SER A CB   6  
ATOM 7563  O OG   . SER A 1 2   ? 16.639  18.784  -2.664  1.00 0.00 ? 785 SER A OG   6  
ATOM 7564  H H    . SER A 1 2   ? 17.944  17.279  -0.740  1.00 0.00 ? 785 SER A H    6  
ATOM 7565  H HA   . SER A 1 2   ? 15.489  16.587  -1.855  1.00 0.00 ? 785 SER A HA   6  
ATOM 7566  H HB2  . SER A 1 2   ? 18.071  17.429  -3.185  1.00 0.00 ? 785 SER A HB2  6  
ATOM 7567  H HB3  . SER A 1 2   ? 16.536  17.282  -4.040  1.00 0.00 ? 785 SER A HB3  6  
ATOM 7568  H HG   . SER A 1 2   ? 17.424  19.335  -2.622  1.00 0.00 ? 785 SER A HG   6  
ATOM 7569  N N    . SER A 1 3   ? 15.633  14.251  -2.645  1.00 0.00 ? 786 SER A N    6  
ATOM 7570  C CA   . SER A 1 3   ? 15.667  12.892  -3.170  1.00 0.00 ? 786 SER A CA   6  
ATOM 7571  C C    . SER A 1 3   ? 14.347  12.538  -3.848  1.00 0.00 ? 786 SER A C    6  
ATOM 7572  O O    . SER A 1 3   ? 13.316  13.157  -3.585  1.00 0.00 ? 786 SER A O    6  
ATOM 7573  C CB   . SER A 1 3   ? 15.960  11.895  -2.047  1.00 0.00 ? 786 SER A CB   6  
ATOM 7574  O OG   . SER A 1 3   ? 14.805  11.660  -1.260  1.00 0.00 ? 786 SER A OG   6  
ATOM 7575  H H    . SER A 1 3   ? 14.797  14.599  -2.270  1.00 0.00 ? 786 SER A H    6  
ATOM 7576  H HA   . SER A 1 3   ? 16.460  12.839  -3.902  1.00 0.00 ? 786 SER A HA   6  
ATOM 7577  H HB2  . SER A 1 3   ? 16.286  10.960  -2.475  1.00 0.00 ? 786 SER A HB2  6  
ATOM 7578  H HB3  . SER A 1 3   ? 16.740  12.291  -1.412  1.00 0.00 ? 786 SER A HB3  6  
ATOM 7579  H HG   . SER A 1 3   ? 14.436  12.498  -0.974  1.00 0.00 ? 786 SER A HG   6  
ATOM 7580  N N    . GLY A 1 4   ? 14.387  11.537  -4.723  1.00 0.00 ? 787 GLY A N    6  
ATOM 7581  C CA   . GLY A 1 4   ? 13.189  11.118  -5.425  1.00 0.00 ? 787 GLY A CA   6  
ATOM 7582  C C    . GLY A 1 4   ? 13.436  10.879  -6.901  1.00 0.00 ? 787 GLY A C    6  
ATOM 7583  O O    . GLY A 1 4   ? 14.382  11.418  -7.475  1.00 0.00 ? 787 GLY A O    6  
ATOM 7584  H H    . GLY A 1 4   ? 15.237  11.080  -4.892  1.00 0.00 ? 787 GLY A H    6  
ATOM 7585  H HA2  . GLY A 1 4   ? 12.824  10.204  -4.979  1.00 0.00 ? 787 GLY A HA2  6  
ATOM 7586  H HA3  . GLY A 1 4   ? 12.435  11.884  -5.317  1.00 0.00 ? 787 GLY A HA3  6  
ATOM 7587  N N    . SER A 1 5   ? 12.583  10.068  -7.519  1.00 0.00 ? 788 SER A N    6  
ATOM 7588  C CA   . SER A 1 5   ? 12.717  9.754   -8.937  1.00 0.00 ? 788 SER A CA   6  
ATOM 7589  C C    . SER A 1 5   ? 13.181  10.977  -9.722  1.00 0.00 ? 788 SER A C    6  
ATOM 7590  O O    . SER A 1 5   ? 12.747  12.099  -9.459  1.00 0.00 ? 788 SER A O    6  
ATOM 7591  C CB   . SER A 1 5   ? 11.385  9.250   -9.497  1.00 0.00 ? 788 SER A CB   6  
ATOM 7592  O OG   . SER A 1 5   ? 10.351  10.194  -9.282  1.00 0.00 ? 788 SER A OG   6  
ATOM 7593  H H    . SER A 1 5   ? 11.848  9.668   -7.008  1.00 0.00 ? 788 SER A H    6  
ATOM 7594  H HA   . SER A 1 5   ? 13.457  8.975   -9.036  1.00 0.00 ? 788 SER A HA   6  
ATOM 7595  H HB2  . SER A 1 5   ? 11.485  9.079   -10.558 1.00 0.00 ? 788 SER A HB2  6  
ATOM 7596  H HB3  . SER A 1 5   ? 11.120  8.324   -9.007  1.00 0.00 ? 788 SER A HB3  6  
ATOM 7597  H HG   . SER A 1 5   ? 10.733  11.067  -9.165  1.00 0.00 ? 788 SER A HG   6  
ATOM 7598  N N    . SER A 1 6   ? 14.066  10.751  -10.687 1.00 0.00 ? 789 SER A N    6  
ATOM 7599  C CA   . SER A 1 6   ? 14.594  11.834  -11.509 1.00 0.00 ? 789 SER A CA   6  
ATOM 7600  C C    . SER A 1 6   ? 14.595  11.446  -12.985 1.00 0.00 ? 789 SER A C    6  
ATOM 7601  O O    . SER A 1 6   ? 15.431  10.662  -13.431 1.00 0.00 ? 789 SER A O    6  
ATOM 7602  C CB   . SER A 1 6   ? 16.012  12.196  -11.065 1.00 0.00 ? 789 SER A CB   6  
ATOM 7603  O OG   . SER A 1 6   ? 16.350  13.514  -11.461 1.00 0.00 ? 789 SER A OG   6  
ATOM 7604  H H    . SER A 1 6   ? 14.374  9.835   -10.848 1.00 0.00 ? 789 SER A H    6  
ATOM 7605  H HA   . SER A 1 6   ? 13.954  12.694  -11.376 1.00 0.00 ? 789 SER A HA   6  
ATOM 7606  H HB2  . SER A 1 6   ? 16.078  12.129  -9.990  1.00 0.00 ? 789 SER A HB2  6  
ATOM 7607  H HB3  . SER A 1 6   ? 16.714  11.507  -11.513 1.00 0.00 ? 789 SER A HB3  6  
ATOM 7608  H HG   . SER A 1 6   ? 16.411  13.555  -12.419 1.00 0.00 ? 789 SER A HG   6  
ATOM 7609  N N    . GLY A 1 7   ? 13.649  12.000  -13.737 1.00 0.00 ? 790 GLY A N    6  
ATOM 7610  C CA   . GLY A 1 7   ? 13.557  11.700  -15.154 1.00 0.00 ? 790 GLY A CA   6  
ATOM 7611  C C    . GLY A 1 7   ? 12.154  11.310  -15.574 1.00 0.00 ? 790 GLY A C    6  
ATOM 7612  O O    . GLY A 1 7   ? 11.321  10.962  -14.737 1.00 0.00 ? 790 GLY A O    6  
ATOM 7613  H H    . GLY A 1 7   ? 13.008  12.618  -13.326 1.00 0.00 ? 790 GLY A H    6  
ATOM 7614  H HA2  . GLY A 1 7   ? 13.861  12.571  -15.716 1.00 0.00 ? 790 GLY A HA2  6  
ATOM 7615  H HA3  . GLY A 1 7   ? 14.228  10.885  -15.382 1.00 0.00 ? 790 GLY A HA3  6  
ATOM 7616  N N    . VAL A 1 8   ? 11.889  11.370  -16.876 1.00 0.00 ? 791 VAL A N    6  
ATOM 7617  C CA   . VAL A 1 8   ? 10.577  11.021  -17.406 1.00 0.00 ? 791 VAL A CA   6  
ATOM 7618  C C    . VAL A 1 8   ? 10.654  9.786   -18.296 1.00 0.00 ? 791 VAL A C    6  
ATOM 7619  O O    . VAL A 1 8   ? 10.793  9.893   -19.515 1.00 0.00 ? 791 VAL A O    6  
ATOM 7620  C CB   . VAL A 1 8   ? 9.970   12.184  -18.212 1.00 0.00 ? 791 VAL A CB   6  
ATOM 7621  C CG1  . VAL A 1 8   ? 8.625   11.783  -18.799 1.00 0.00 ? 791 VAL A CG1  6  
ATOM 7622  C CG2  . VAL A 1 8   ? 9.832   13.423  -17.340 1.00 0.00 ? 791 VAL A CG2  6  
ATOM 7623  H H    . VAL A 1 8   ? 12.594  11.655  -17.494 1.00 0.00 ? 791 VAL A H    6  
ATOM 7624  H HA   . VAL A 1 8   ? 9.924   10.811  -16.571 1.00 0.00 ? 791 VAL A HA   6  
ATOM 7625  H HB   . VAL A 1 8   ? 10.638  12.417  -19.028 1.00 0.00 ? 791 VAL A HB   6  
ATOM 7626  H HG11 . VAL A 1 8   ? 8.767   10.987  -19.514 1.00 0.00 ? 791 VAL A HG11 6  
ATOM 7627  H HG12 . VAL A 1 8   ? 7.973   11.445  -18.007 1.00 0.00 ? 791 VAL A HG12 6  
ATOM 7628  H HG13 . VAL A 1 8   ? 8.180   12.634  -19.293 1.00 0.00 ? 791 VAL A HG13 6  
ATOM 7629  H HG21 . VAL A 1 8   ? 10.744  13.999  -17.387 1.00 0.00 ? 791 VAL A HG21 6  
ATOM 7630  H HG22 . VAL A 1 8   ? 9.008   14.024  -17.695 1.00 0.00 ? 791 VAL A HG22 6  
ATOM 7631  H HG23 . VAL A 1 8   ? 9.646   13.125  -16.318 1.00 0.00 ? 791 VAL A HG23 6  
ATOM 7632  N N    . PHE A 1 9   ? 10.564  8.612   -17.679 1.00 0.00 ? 792 PHE A N    6  
ATOM 7633  C CA   . PHE A 1 9   ? 10.625  7.355   -18.416 1.00 0.00 ? 792 PHE A CA   6  
ATOM 7634  C C    . PHE A 1 9   ? 9.317   6.580   -18.277 1.00 0.00 ? 792 PHE A C    6  
ATOM 7635  O O    . PHE A 1 9   ? 8.710   6.554   -17.207 1.00 0.00 ? 792 PHE A O    6  
ATOM 7636  C CB   . PHE A 1 9   ? 11.792  6.502   -17.915 1.00 0.00 ? 792 PHE A CB   6  
ATOM 7637  C CG   . PHE A 1 9   ? 13.104  7.234   -17.895 1.00 0.00 ? 792 PHE A CG   6  
ATOM 7638  C CD1  . PHE A 1 9   ? 13.825  7.422   -19.062 1.00 0.00 ? 792 PHE A CD1  6  
ATOM 7639  C CD2  . PHE A 1 9   ? 13.615  7.732   -16.707 1.00 0.00 ? 792 PHE A CD2  6  
ATOM 7640  C CE1  . PHE A 1 9   ? 15.032  8.096   -19.047 1.00 0.00 ? 792 PHE A CE1  6  
ATOM 7641  C CE2  . PHE A 1 9   ? 14.821  8.406   -16.686 1.00 0.00 ? 792 PHE A CE2  6  
ATOM 7642  C CZ   . PHE A 1 9   ? 15.531  8.587   -17.857 1.00 0.00 ? 792 PHE A CZ   6  
ATOM 7643  H H    . PHE A 1 9   ? 10.455  8.591   -16.705 1.00 0.00 ? 792 PHE A H    6  
ATOM 7644  H HA   . PHE A 1 9   ? 10.782  7.589   -19.457 1.00 0.00 ? 792 PHE A HA   6  
ATOM 7645  H HB2  . PHE A 1 9   ? 11.581  6.171   -16.909 1.00 0.00 ? 792 PHE A HB2  6  
ATOM 7646  H HB3  . PHE A 1 9   ? 11.901  5.641   -18.558 1.00 0.00 ? 792 PHE A HB3  6  
ATOM 7647  H HD1  . PHE A 1 9   ? 13.435  7.038   -19.994 1.00 0.00 ? 792 PHE A HD1  6  
ATOM 7648  H HD2  . PHE A 1 9   ? 13.062  7.590   -15.790 1.00 0.00 ? 792 PHE A HD2  6  
ATOM 7649  H HE1  . PHE A 1 9   ? 15.585  8.235   -19.964 1.00 0.00 ? 792 PHE A HE1  6  
ATOM 7650  H HE2  . PHE A 1 9   ? 15.210  8.789   -15.754 1.00 0.00 ? 792 PHE A HE2  6  
ATOM 7651  H HZ   . PHE A 1 9   ? 16.474  9.114   -17.842 1.00 0.00 ? 792 PHE A HZ   6  
ATOM 7652  N N    . ARG A 1 10  ? 8.891   5.951   -19.367 1.00 0.00 ? 793 ARG A N    6  
ATOM 7653  C CA   . ARG A 1 10  ? 7.656   5.177   -19.369 1.00 0.00 ? 793 ARG A CA   6  
ATOM 7654  C C    . ARG A 1 10  ? 7.933   3.711   -19.687 1.00 0.00 ? 793 ARG A C    6  
ATOM 7655  O O    . ARG A 1 10  ? 7.660   3.243   -20.793 1.00 0.00 ? 793 ARG A O    6  
ATOM 7656  C CB   . ARG A 1 10  ? 6.669   5.753   -20.386 1.00 0.00 ? 793 ARG A CB   6  
ATOM 7657  C CG   . ARG A 1 10  ? 5.280   5.141   -20.302 1.00 0.00 ? 793 ARG A CG   6  
ATOM 7658  C CD   . ARG A 1 10  ? 4.305   5.841   -21.236 1.00 0.00 ? 793 ARG A CD   6  
ATOM 7659  N NE   . ARG A 1 10  ? 4.315   5.258   -22.575 1.00 0.00 ? 793 ARG A NE   6  
ATOM 7660  C CZ   . ARG A 1 10  ? 3.431   5.567   -23.517 1.00 0.00 ? 793 ARG A CZ   6  
ATOM 7661  N NH1  . ARG A 1 10  ? 2.472   6.448   -23.268 1.00 0.00 ? 793 ARG A NH1  6  
ATOM 7662  N NH2  . ARG A 1 10  ? 3.505   4.993   -24.711 1.00 0.00 ? 793 ARG A NH2  6  
ATOM 7663  H H    . ARG A 1 10  ? 9.419   6.010   -20.191 1.00 0.00 ? 793 ARG A H    6  
ATOM 7664  H HA   . ARG A 1 10  ? 7.221   5.243   -18.383 1.00 0.00 ? 793 ARG A HA   6  
ATOM 7665  H HB2  . ARG A 1 10  ? 6.580   6.817   -20.222 1.00 0.00 ? 793 ARG A HB2  6  
ATOM 7666  H HB3  . ARG A 1 10  ? 7.055   5.582   -21.380 1.00 0.00 ? 793 ARG A HB3  6  
ATOM 7667  H HG2  . ARG A 1 10  ? 5.339   4.098   -20.578 1.00 0.00 ? 793 ARG A HG2  6  
ATOM 7668  H HG3  . ARG A 1 10  ? 4.920   5.227   -19.288 1.00 0.00 ? 793 ARG A HG3  6  
ATOM 7669  H HD2  . ARG A 1 10  ? 3.311   5.758   -20.824 1.00 0.00 ? 793 ARG A HD2  6  
ATOM 7670  H HD3  . ARG A 1 10  ? 4.580   6.883   -21.305 1.00 0.00 ? 793 ARG A HD3  6  
ATOM 7671  H HE   . ARG A 1 10  ? 5.015   4.604   -22.780 1.00 0.00 ? 793 ARG A HE   6  
ATOM 7672  H HH11 . ARG A 1 10  ? 2.415   6.883   -22.370 1.00 0.00 ? 793 ARG A HH11 6  
ATOM 7673  H HH12 . ARG A 1 10  ? 1.809   6.680   -23.980 1.00 0.00 ? 793 ARG A HH12 6  
ATOM 7674  H HH21 . ARG A 1 10  ? 4.226   4.328   -24.903 1.00 0.00 ? 793 ARG A HH21 6  
ATOM 7675  H HH22 . ARG A 1 10  ? 2.839   5.226   -25.420 1.00 0.00 ? 793 ARG A HH22 6  
ATOM 7676  N N    . TYR A 1 11  ? 8.477   2.992   -18.712 1.00 0.00 ? 794 TYR A N    6  
ATOM 7677  C CA   . TYR A 1 11  ? 8.794   1.580   -18.888 1.00 0.00 ? 794 TYR A CA   6  
ATOM 7678  C C    . TYR A 1 11  ? 7.522   0.745   -18.995 1.00 0.00 ? 794 TYR A C    6  
ATOM 7679  O O    . TYR A 1 11  ? 6.473   1.122   -18.473 1.00 0.00 ? 794 TYR A O    6  
ATOM 7680  C CB   . TYR A 1 11  ? 9.650   1.078   -17.724 1.00 0.00 ? 794 TYR A CB   6  
ATOM 7681  C CG   . TYR A 1 11  ? 11.040  1.674   -17.694 1.00 0.00 ? 794 TYR A CG   6  
ATOM 7682  C CD1  . TYR A 1 11  ? 11.967  1.375   -18.685 1.00 0.00 ? 794 TYR A CD1  6  
ATOM 7683  C CD2  . TYR A 1 11  ? 11.426  2.534   -16.674 1.00 0.00 ? 794 TYR A CD2  6  
ATOM 7684  C CE1  . TYR A 1 11  ? 13.238  1.916   -18.661 1.00 0.00 ? 794 TYR A CE1  6  
ATOM 7685  C CE2  . TYR A 1 11  ? 12.695  3.081   -16.643 1.00 0.00 ? 794 TYR A CE2  6  
ATOM 7686  C CZ   . TYR A 1 11  ? 13.597  2.769   -17.639 1.00 0.00 ? 794 TYR A CZ   6  
ATOM 7687  O OH   . TYR A 1 11  ? 14.861  3.310   -17.611 1.00 0.00 ? 794 TYR A OH   6  
ATOM 7688  H H    . TYR A 1 11  ? 8.671   3.421   -17.852 1.00 0.00 ? 794 TYR A H    6  
ATOM 7689  H HA   . TYR A 1 11  ? 9.356   1.478   -19.805 1.00 0.00 ? 794 TYR A HA   6  
ATOM 7690  H HB2  . TYR A 1 11  ? 9.163   1.328   -16.794 1.00 0.00 ? 794 TYR A HB2  6  
ATOM 7691  H HB3  . TYR A 1 11  ? 9.751   0.005   -17.796 1.00 0.00 ? 794 TYR A HB3  6  
ATOM 7692  H HD1  . TYR A 1 11  ? 11.683  0.706   -19.485 1.00 0.00 ? 794 TYR A HD1  6  
ATOM 7693  H HD2  . TYR A 1 11  ? 10.717  2.777   -15.896 1.00 0.00 ? 794 TYR A HD2  6  
ATOM 7694  H HE1  . TYR A 1 11  ? 13.944  1.672   -19.441 1.00 0.00 ? 794 TYR A HE1  6  
ATOM 7695  H HE2  . TYR A 1 11  ? 12.976  3.749   -15.842 1.00 0.00 ? 794 TYR A HE2  6  
ATOM 7696  H HH   . TYR A 1 11  ? 15.214  3.252   -16.720 1.00 0.00 ? 794 TYR A HH   6  
ATOM 7697  N N    . SER A 1 12  ? 7.624   -0.392  -19.676 1.00 0.00 ? 795 SER A N    6  
ATOM 7698  C CA   . SER A 1 12  ? 6.481   -1.281  -19.855 1.00 0.00 ? 795 SER A CA   6  
ATOM 7699  C C    . SER A 1 12  ? 6.756   -2.650  -19.240 1.00 0.00 ? 795 SER A C    6  
ATOM 7700  O O    . SER A 1 12  ? 7.223   -3.566  -19.917 1.00 0.00 ? 795 SER A O    6  
ATOM 7701  C CB   . SER A 1 12  ? 6.156   -1.434  -21.342 1.00 0.00 ? 795 SER A CB   6  
ATOM 7702  O OG   . SER A 1 12  ? 5.781   -0.192  -21.913 1.00 0.00 ? 795 SER A OG   6  
ATOM 7703  H H    . SER A 1 12  ? 8.487   -0.638  -20.069 1.00 0.00 ? 795 SER A H    6  
ATOM 7704  H HA   . SER A 1 12  ? 5.634   -0.837  -19.354 1.00 0.00 ? 795 SER A HA   6  
ATOM 7705  H HB2  . SER A 1 12  ? 7.025   -1.807  -21.862 1.00 0.00 ? 795 SER A HB2  6  
ATOM 7706  H HB3  . SER A 1 12  ? 5.339   -2.131  -21.459 1.00 0.00 ? 795 SER A HB3  6  
ATOM 7707  H HG   . SER A 1 12  ? 5.145   -0.341  -22.616 1.00 0.00 ? 795 SER A HG   6  
ATOM 7708  N N    . THR A 1 13  ? 6.462   -2.781  -17.950 1.00 0.00 ? 796 THR A N    6  
ATOM 7709  C CA   . THR A 1 13  ? 6.678   -4.036  -17.241 1.00 0.00 ? 796 THR A CA   6  
ATOM 7710  C C    . THR A 1 13  ? 5.433   -4.450  -16.465 1.00 0.00 ? 796 THR A C    6  
ATOM 7711  O O    . THR A 1 13  ? 4.644   -3.606  -16.041 1.00 0.00 ? 796 THR A O    6  
ATOM 7712  C CB   . THR A 1 13  ? 7.866   -3.934  -16.267 1.00 0.00 ? 796 THR A CB   6  
ATOM 7713  O OG1  . THR A 1 13  ? 9.038   -3.503  -16.967 1.00 0.00 ? 796 THR A OG1  6  
ATOM 7714  C CG2  . THR A 1 13  ? 8.133   -5.273  -15.596 1.00 0.00 ? 796 THR A CG2  6  
ATOM 7715  H H    . THR A 1 13  ? 6.092   -2.015  -17.465 1.00 0.00 ? 796 THR A H    6  
ATOM 7716  H HA   . THR A 1 13  ? 6.904   -4.798  -17.973 1.00 0.00 ? 796 THR A HA   6  
ATOM 7717  H HB   . THR A 1 13  ? 7.624   -3.208  -15.503 1.00 0.00 ? 796 THR A HB   6  
ATOM 7718  H HG1  . THR A 1 13  ? 9.108   -2.547  -16.916 1.00 0.00 ? 796 THR A HG1  6  
ATOM 7719  H HG21 . THR A 1 13  ? 8.439   -5.994  -16.340 1.00 0.00 ? 796 THR A HG21 6  
ATOM 7720  H HG22 . THR A 1 13  ? 7.232   -5.618  -15.110 1.00 0.00 ? 796 THR A HG22 6  
ATOM 7721  H HG23 . THR A 1 13  ? 8.917   -5.159  -14.863 1.00 0.00 ? 796 THR A HG23 6  
ATOM 7722  N N    . SER A 1 14  ? 5.262   -5.756  -16.283 1.00 0.00 ? 797 SER A N    6  
ATOM 7723  C CA   . SER A 1 14  ? 4.110   -6.282  -15.560 1.00 0.00 ? 797 SER A CA   6  
ATOM 7724  C C    . SER A 1 14  ? 4.307   -6.150  -14.053 1.00 0.00 ? 797 SER A C    6  
ATOM 7725  O O    . SER A 1 14  ? 4.802   -7.068  -13.397 1.00 0.00 ? 797 SER A O    6  
ATOM 7726  C CB   . SER A 1 14  ? 3.876   -7.749  -15.929 1.00 0.00 ? 797 SER A CB   6  
ATOM 7727  O OG   . SER A 1 14  ? 3.835   -7.921  -17.335 1.00 0.00 ? 797 SER A OG   6  
ATOM 7728  H H    . SER A 1 14  ? 5.925   -6.380  -16.646 1.00 0.00 ? 797 SER A H    6  
ATOM 7729  H HA   . SER A 1 14  ? 3.244   -5.705  -15.850 1.00 0.00 ? 797 SER A HA   6  
ATOM 7730  H HB2  . SER A 1 14  ? 4.678   -8.350  -15.528 1.00 0.00 ? 797 SER A HB2  6  
ATOM 7731  H HB3  . SER A 1 14  ? 2.936   -8.077  -15.509 1.00 0.00 ? 797 SER A HB3  6  
ATOM 7732  H HG   . SER A 1 14  ? 4.362   -7.239  -17.757 1.00 0.00 ? 797 SER A HG   6  
ATOM 7733  N N    . LEU A 1 15  ? 3.918   -5.002  -13.510 1.00 0.00 ? 798 LEU A N    6  
ATOM 7734  C CA   . LEU A 1 15  ? 4.052   -4.748  -12.080 1.00 0.00 ? 798 LEU A CA   6  
ATOM 7735  C C    . LEU A 1 15  ? 2.767   -4.153  -11.510 1.00 0.00 ? 798 LEU A C    6  
ATOM 7736  O O    . LEU A 1 15  ? 1.976   -3.553  -12.236 1.00 0.00 ? 798 LEU A O    6  
ATOM 7737  C CB   . LEU A 1 15  ? 5.225   -3.802  -11.818 1.00 0.00 ? 798 LEU A CB   6  
ATOM 7738  C CG   . LEU A 1 15  ? 6.620   -4.385  -12.042 1.00 0.00 ? 798 LEU A CG   6  
ATOM 7739  C CD1  . LEU A 1 15  ? 7.638   -3.272  -12.242 1.00 0.00 ? 798 LEU A CD1  6  
ATOM 7740  C CD2  . LEU A 1 15  ? 7.021   -5.274  -10.874 1.00 0.00 ? 798 LEU A CD2  6  
ATOM 7741  H H    . LEU A 1 15  ? 3.531   -4.308  -14.084 1.00 0.00 ? 798 LEU A H    6  
ATOM 7742  H HA   . LEU A 1 15  ? 4.245   -5.691  -11.592 1.00 0.00 ? 798 LEU A HA   6  
ATOM 7743  H HB2  . LEU A 1 15  ? 5.114   -2.949  -12.470 1.00 0.00 ? 798 LEU A HB2  6  
ATOM 7744  H HB3  . LEU A 1 15  ? 5.163   -3.477  -10.789 1.00 0.00 ? 798 LEU A HB3  6  
ATOM 7745  H HG   . LEU A 1 15  ? 6.610   -4.992  -12.937 1.00 0.00 ? 798 LEU A HG   6  
ATOM 7746  H HD11 . LEU A 1 15  ? 7.849   -2.804  -11.293 1.00 0.00 ? 798 LEU A HD11 6  
ATOM 7747  H HD12 . LEU A 1 15  ? 7.239   -2.538  -12.925 1.00 0.00 ? 798 LEU A HD12 6  
ATOM 7748  H HD13 . LEU A 1 15  ? 8.548   -3.687  -12.650 1.00 0.00 ? 798 LEU A HD13 6  
ATOM 7749  H HD21 . LEU A 1 15  ? 7.330   -6.239  -11.247 1.00 0.00 ? 798 LEU A HD21 6  
ATOM 7750  H HD22 . LEU A 1 15  ? 6.178   -5.398  -10.210 1.00 0.00 ? 798 LEU A HD22 6  
ATOM 7751  H HD23 . LEU A 1 15  ? 7.839   -4.816  -10.338 1.00 0.00 ? 798 LEU A HD23 6  
ATOM 7752  N N    . GLU A 1 16  ? 2.570   -4.324  -10.207 1.00 0.00 ? 799 GLU A N    6  
ATOM 7753  C CA   . GLU A 1 16  ? 1.382   -3.803  -9.540  1.00 0.00 ? 799 GLU A CA   6  
ATOM 7754  C C    . GLU A 1 16  ? 1.688   -2.485  -8.836  1.00 0.00 ? 799 GLU A C    6  
ATOM 7755  O O    . GLU A 1 16  ? 1.377   -2.310  -7.657  1.00 0.00 ? 799 GLU A O    6  
ATOM 7756  C CB   . GLU A 1 16  ? 0.848   -4.822  -8.531  1.00 0.00 ? 799 GLU A CB   6  
ATOM 7757  C CG   . GLU A 1 16  ? 0.488   -6.162  -9.151  1.00 0.00 ? 799 GLU A CG   6  
ATOM 7758  C CD   . GLU A 1 16  ? 0.081   -7.192  -8.116  1.00 0.00 ? 799 GLU A CD   6  
ATOM 7759  O OE1  . GLU A 1 16  ? 0.471   -7.037  -6.939  1.00 0.00 ? 799 GLU A OE1  6  
ATOM 7760  O OE2  . GLU A 1 16  ? -0.627  -8.154  -8.482  1.00 0.00 ? 799 GLU A OE2  6  
ATOM 7761  H H    . GLU A 1 16  ? 3.238   -4.812  -9.682  1.00 0.00 ? 799 GLU A H    6  
ATOM 7762  H HA   . GLU A 1 16  ? 0.629   -3.629  -10.294 1.00 0.00 ? 799 GLU A HA   6  
ATOM 7763  H HB2  . GLU A 1 16  ? 1.601   -4.989  -7.774  1.00 0.00 ? 799 GLU A HB2  6  
ATOM 7764  H HB3  . GLU A 1 16  ? -0.036  -4.416  -8.063  1.00 0.00 ? 799 GLU A HB3  6  
ATOM 7765  H HG2  . GLU A 1 16  ? -0.334  -6.018  -9.836  1.00 0.00 ? 799 GLU A HG2  6  
ATOM 7766  H HG3  . GLU A 1 16  ? 1.345   -6.535  -9.692  1.00 0.00 ? 799 GLU A HG3  6  
ATOM 7767  N N    . LYS A 1 17  ? 2.300   -1.559  -9.566  1.00 0.00 ? 800 LYS A N    6  
ATOM 7768  C CA   . LYS A 1 17  ? 2.649   -0.255  -9.013  1.00 0.00 ? 800 LYS A CA   6  
ATOM 7769  C C    . LYS A 1 17  ? 1.428   0.416   -8.391  1.00 0.00 ? 800 LYS A C    6  
ATOM 7770  O O    . LYS A 1 17  ? 1.535   1.099   -7.372  1.00 0.00 ? 800 LYS A O    6  
ATOM 7771  C CB   . LYS A 1 17  ? 3.237   0.643   -10.104 1.00 0.00 ? 800 LYS A CB   6  
ATOM 7772  C CG   . LYS A 1 17  ? 4.694   0.347   -10.415 1.00 0.00 ? 800 LYS A CG   6  
ATOM 7773  C CD   . LYS A 1 17  ? 5.350   1.498   -11.159 1.00 0.00 ? 800 LYS A CD   6  
ATOM 7774  C CE   . LYS A 1 17  ? 5.186   1.353   -12.665 1.00 0.00 ? 800 LYS A CE   6  
ATOM 7775  N NZ   . LYS A 1 17  ? 3.940   2.007   -13.152 1.00 0.00 ? 800 LYS A NZ   6  
ATOM 7776  H H    . LYS A 1 17  ? 2.523   -1.757  -10.500 1.00 0.00 ? 800 LYS A H    6  
ATOM 7777  H HA   . LYS A 1 17  ? 3.391   -0.408  -8.245  1.00 0.00 ? 800 LYS A HA   6  
ATOM 7778  H HB2  . LYS A 1 17  ? 2.664   0.512   -11.009 1.00 0.00 ? 800 LYS A HB2  6  
ATOM 7779  H HB3  . LYS A 1 17  ? 3.161   1.673   -9.785  1.00 0.00 ? 800 LYS A HB3  6  
ATOM 7780  H HG2  . LYS A 1 17  ? 5.225   0.183   -9.489  1.00 0.00 ? 800 LYS A HG2  6  
ATOM 7781  H HG3  . LYS A 1 17  ? 4.749   -0.543  -11.026 1.00 0.00 ? 800 LYS A HG3  6  
ATOM 7782  H HD2  . LYS A 1 17  ? 4.893   2.425   -10.846 1.00 0.00 ? 800 LYS A HD2  6  
ATOM 7783  H HD3  . LYS A 1 17  ? 6.404   1.515   -10.921 1.00 0.00 ? 800 LYS A HD3  6  
ATOM 7784  H HE2  . LYS A 1 17  ? 6.035   1.808   -13.151 1.00 0.00 ? 800 LYS A HE2  6  
ATOM 7785  H HE3  . LYS A 1 17  ? 5.151   0.302   -12.910 1.00 0.00 ? 800 LYS A HE3  6  
ATOM 7786  H HZ1  . LYS A 1 17  ? 3.967   3.026   -12.943 1.00 0.00 ? 800 LYS A HZ1  6  
ATOM 7787  H HZ2  . LYS A 1 17  ? 3.111   1.590   -12.683 1.00 0.00 ? 800 LYS A HZ2  6  
ATOM 7788  H HZ3  . LYS A 1 17  ? 3.846   1.877   -14.179 1.00 0.00 ? 800 LYS A HZ3  6  
ATOM 7789  N N    . HIS A 1 18  ? 0.269   0.216   -9.009  1.00 0.00 ? 801 HIS A N    6  
ATOM 7790  C CA   . HIS A 1 18  ? -0.972  0.801   -8.514  1.00 0.00 ? 801 HIS A CA   6  
ATOM 7791  C C    . HIS A 1 18  ? -1.173  0.479   -7.036  1.00 0.00 ? 801 HIS A C    6  
ATOM 7792  O O    . HIS A 1 18  ? -1.667  1.307   -6.271  1.00 0.00 ? 801 HIS A O    6  
ATOM 7793  C CB   . HIS A 1 18  ? -2.162  0.287   -9.326  1.00 0.00 ? 801 HIS A CB   6  
ATOM 7794  C CG   . HIS A 1 18  ? -2.350  -1.197  -9.240  1.00 0.00 ? 801 HIS A CG   6  
ATOM 7795  N ND1  . HIS A 1 18  ? -1.405  -2.101  -9.675  1.00 0.00 ? 801 HIS A ND1  6  
ATOM 7796  C CD2  . HIS A 1 18  ? -3.381  -1.932  -8.763  1.00 0.00 ? 801 HIS A CD2  6  
ATOM 7797  C CE1  . HIS A 1 18  ? -1.848  -3.329  -9.472  1.00 0.00 ? 801 HIS A CE1  6  
ATOM 7798  N NE2  . HIS A 1 18  ? -3.045  -3.254  -8.919  1.00 0.00 ? 801 HIS A NE2  6  
ATOM 7799  H H    . HIS A 1 18  ? 0.248   -0.338  -9.817  1.00 0.00 ? 801 HIS A H    6  
ATOM 7800  H HA   . HIS A 1 18  ? -0.904  1.871   -8.630  1.00 0.00 ? 801 HIS A HA   6  
ATOM 7801  H HB2  . HIS A 1 18  ? -3.065  0.757   -8.965  1.00 0.00 ? 801 HIS A HB2  6  
ATOM 7802  H HB3  . HIS A 1 18  ? -2.019  0.544   -10.365 1.00 0.00 ? 801 HIS A HB3  6  
ATOM 7803  H HD2  . HIS A 1 18  ? -4.300  -1.551  -8.340  1.00 0.00 ? 801 HIS A HD2  6  
ATOM 7804  H HE1  . HIS A 1 18  ? -1.321  -4.240  -9.715  1.00 0.00 ? 801 HIS A HE1  6  
ATOM 7805  H HE2  . HIS A 1 18  ? -3.634  -4.017  -8.743  1.00 0.00 ? 801 HIS A HE2  6  
ATOM 7806  N N    . LYS A 1 19  ? -0.787  -0.730  -6.641  1.00 0.00 ? 802 LYS A N    6  
ATOM 7807  C CA   . LYS A 1 19  ? -0.923  -1.162  -5.255  1.00 0.00 ? 802 LYS A CA   6  
ATOM 7808  C C    . LYS A 1 19  ? 0.088   -0.451  -4.362  1.00 0.00 ? 802 LYS A C    6  
ATOM 7809  O O    . LYS A 1 19  ? 1.143   -0.016  -4.825  1.00 0.00 ? 802 LYS A O    6  
ATOM 7810  C CB   . LYS A 1 19  ? -0.734  -2.677  -5.151  1.00 0.00 ? 802 LYS A CB   6  
ATOM 7811  C CG   . LYS A 1 19  ? -1.882  -3.475  -5.746  1.00 0.00 ? 802 LYS A CG   6  
ATOM 7812  C CD   . LYS A 1 19  ? -1.874  -4.913  -5.255  1.00 0.00 ? 802 LYS A CD   6  
ATOM 7813  C CE   . LYS A 1 19  ? -3.260  -5.535  -5.330  1.00 0.00 ? 802 LYS A CE   6  
ATOM 7814  N NZ   . LYS A 1 19  ? -4.076  -5.220  -4.125  1.00 0.00 ? 802 LYS A NZ   6  
ATOM 7815  H H    . LYS A 1 19  ? -0.400  -1.346  -7.298  1.00 0.00 ? 802 LYS A H    6  
ATOM 7816  H HA   . LYS A 1 19  ? -1.919  -0.908  -4.925  1.00 0.00 ? 802 LYS A HA   6  
ATOM 7817  H HB2  . LYS A 1 19  ? 0.173   -2.951  -5.669  1.00 0.00 ? 802 LYS A HB2  6  
ATOM 7818  H HB3  . LYS A 1 19  ? -0.639  -2.945  -4.109  1.00 0.00 ? 802 LYS A HB3  6  
ATOM 7819  H HG2  . LYS A 1 19  ? -2.816  -3.014  -5.460  1.00 0.00 ? 802 LYS A HG2  6  
ATOM 7820  H HG3  . LYS A 1 19  ? -1.791  -3.471  -6.823  1.00 0.00 ? 802 LYS A HG3  6  
ATOM 7821  H HD2  . LYS A 1 19  ? -1.199  -5.491  -5.869  1.00 0.00 ? 802 LYS A HD2  6  
ATOM 7822  H HD3  . LYS A 1 19  ? -1.536  -4.932  -4.228  1.00 0.00 ? 802 LYS A HD3  6  
ATOM 7823  H HE2  . LYS A 1 19  ? -3.764  -5.154  -6.205  1.00 0.00 ? 802 LYS A HE2  6  
ATOM 7824  H HE3  . LYS A 1 19  ? -3.155  -6.607  -5.413  1.00 0.00 ? 802 LYS A HE3  6  
ATOM 7825  H HZ1  . LYS A 1 19  ? -5.009  -4.857  -4.410  1.00 0.00 ? 802 LYS A HZ1  6  
ATOM 7826  H HZ2  . LYS A 1 19  ? -3.599  -4.498  -3.549  1.00 0.00 ? 802 LYS A HZ2  6  
ATOM 7827  H HZ3  . LYS A 1 19  ? -4.210  -6.075  -3.550  1.00 0.00 ? 802 LYS A HZ3  6  
ATOM 7828  N N    . LEU A 1 20  ? -0.240  -0.337  -3.080  1.00 0.00 ? 803 LEU A N    6  
ATOM 7829  C CA   . LEU A 1 20  ? 0.641   0.321   -2.120  1.00 0.00 ? 803 LEU A CA   6  
ATOM 7830  C C    . LEU A 1 20  ? 0.917   -0.586  -0.925  1.00 0.00 ? 803 LEU A C    6  
ATOM 7831  O O    . LEU A 1 20  ? 0.059   -1.367  -0.513  1.00 0.00 ? 803 LEU A O    6  
ATOM 7832  C CB   . LEU A 1 20  ? 0.019   1.635   -1.645  1.00 0.00 ? 803 LEU A CB   6  
ATOM 7833  C CG   . LEU A 1 20  ? -0.531  2.551   -2.738  1.00 0.00 ? 803 LEU A CG   6  
ATOM 7834  C CD1  . LEU A 1 20  ? -1.444  3.610   -2.139  1.00 0.00 ? 803 LEU A CD1  6  
ATOM 7835  C CD2  . LEU A 1 20  ? 0.607   3.202   -3.511  1.00 0.00 ? 803 LEU A CD2  6  
ATOM 7836  H H    . LEU A 1 20  ? -1.094  -0.703  -2.770  1.00 0.00 ? 803 LEU A H    6  
ATOM 7837  H HA   . LEU A 1 20  ? 1.574   0.533   -2.619  1.00 0.00 ? 803 LEU A HA   6  
ATOM 7838  H HB2  . LEU A 1 20  ? -0.793  1.394   -0.976  1.00 0.00 ? 803 LEU A HB2  6  
ATOM 7839  H HB3  . LEU A 1 20  ? 0.778   2.182   -1.104  1.00 0.00 ? 803 LEU A HB3  6  
ATOM 7840  H HG   . LEU A 1 20  ? -1.115  1.963   -3.433  1.00 0.00 ? 803 LEU A HG   6  
ATOM 7841  H HD11 . LEU A 1 20  ? -1.068  3.902   -1.170  1.00 0.00 ? 803 LEU A HD11 6  
ATOM 7842  H HD12 . LEU A 1 20  ? -2.440  3.207   -2.032  1.00 0.00 ? 803 LEU A HD12 6  
ATOM 7843  H HD13 . LEU A 1 20  ? -1.472  4.471   -2.790  1.00 0.00 ? 803 LEU A HD13 6  
ATOM 7844  H HD21 . LEU A 1 20  ? 0.316   4.199   -3.807  1.00 0.00 ? 803 LEU A HD21 6  
ATOM 7845  H HD22 . LEU A 1 20  ? 0.826   2.615   -4.392  1.00 0.00 ? 803 LEU A HD22 6  
ATOM 7846  H HD23 . LEU A 1 20  ? 1.485   3.253   -2.885  1.00 0.00 ? 803 LEU A HD23 6  
ATOM 7847  N N    . PHE A 1 21  ? 2.120   -0.475  -0.371  1.00 0.00 ? 804 PHE A N    6  
ATOM 7848  C CA   . PHE A 1 21  ? 2.510   -1.284  0.778   1.00 0.00 ? 804 PHE A CA   6  
ATOM 7849  C C    . PHE A 1 21  ? 2.870   -0.400  1.969   1.00 0.00 ? 804 PHE A C    6  
ATOM 7850  O O    . PHE A 1 21  ? 3.875   0.311   1.946   1.00 0.00 ? 804 PHE A O    6  
ATOM 7851  C CB   . PHE A 1 21  ? 3.695   -2.182  0.418   1.00 0.00 ? 804 PHE A CB   6  
ATOM 7852  C CG   . PHE A 1 21  ? 4.290   -2.892  1.601   1.00 0.00 ? 804 PHE A CG   6  
ATOM 7853  C CD1  . PHE A 1 21  ? 3.819   -4.135  1.989   1.00 0.00 ? 804 PHE A CD1  6  
ATOM 7854  C CD2  . PHE A 1 21  ? 5.321   -2.314  2.325   1.00 0.00 ? 804 PHE A CD2  6  
ATOM 7855  C CE1  . PHE A 1 21  ? 4.365   -4.791  3.076   1.00 0.00 ? 804 PHE A CE1  6  
ATOM 7856  C CE2  . PHE A 1 21  ? 5.871   -2.966  3.413   1.00 0.00 ? 804 PHE A CE2  6  
ATOM 7857  C CZ   . PHE A 1 21  ? 5.391   -4.205  3.790   1.00 0.00 ? 804 PHE A CZ   6  
ATOM 7858  H H    . PHE A 1 21  ? 2.761   0.165   -0.745  1.00 0.00 ? 804 PHE A H    6  
ATOM 7859  H HA   . PHE A 1 21  ? 1.668   -1.904  1.047   1.00 0.00 ? 804 PHE A HA   6  
ATOM 7860  H HB2  . PHE A 1 21  ? 3.369   -2.931  -0.288  1.00 0.00 ? 804 PHE A HB2  6  
ATOM 7861  H HB3  . PHE A 1 21  ? 4.469   -1.580  -0.033  1.00 0.00 ? 804 PHE A HB3  6  
ATOM 7862  H HD1  . PHE A 1 21  ? 3.015   -4.595  1.431   1.00 0.00 ? 804 PHE A HD1  6  
ATOM 7863  H HD2  . PHE A 1 21  ? 5.696   -1.345  2.033   1.00 0.00 ? 804 PHE A HD2  6  
ATOM 7864  H HE1  . PHE A 1 21  ? 3.987   -5.760  3.368   1.00 0.00 ? 804 PHE A HE1  6  
ATOM 7865  H HE2  . PHE A 1 21  ? 6.673   -2.505  3.970   1.00 0.00 ? 804 PHE A HE2  6  
ATOM 7866  H HZ   . PHE A 1 21  ? 5.819   -4.716  4.639   1.00 0.00 ? 804 PHE A HZ   6  
ATOM 7867  N N    . ILE A 1 22  ? 2.041   -0.449  3.006   1.00 0.00 ? 805 ILE A N    6  
ATOM 7868  C CA   . ILE A 1 22  ? 2.272   0.346   4.206   1.00 0.00 ? 805 ILE A CA   6  
ATOM 7869  C C    . ILE A 1 22  ? 2.677   -0.536  5.381   1.00 0.00 ? 805 ILE A C    6  
ATOM 7870  O O    . ILE A 1 22  ? 2.194   -1.660  5.523   1.00 0.00 ? 805 ILE A O    6  
ATOM 7871  C CB   . ILE A 1 22  ? 1.020   1.156   4.594   1.00 0.00 ? 805 ILE A CB   6  
ATOM 7872  C CG1  . ILE A 1 22  ? 0.402   1.806   3.354   1.00 0.00 ? 805 ILE A CG1  6  
ATOM 7873  C CG2  . ILE A 1 22  ? 1.373   2.211   5.632   1.00 0.00 ? 805 ILE A CG2  6  
ATOM 7874  C CD1  . ILE A 1 22  ? -0.601  2.890   3.677   1.00 0.00 ? 805 ILE A CD1  6  
ATOM 7875  H H    . ILE A 1 22  ? 1.257   -1.035  2.965   1.00 0.00 ? 805 ILE A H    6  
ATOM 7876  H HA   . ILE A 1 22  ? 3.074   1.039   3.996   1.00 0.00 ? 805 ILE A HA   6  
ATOM 7877  H HB   . ILE A 1 22  ? 0.303   0.479   5.032   1.00 0.00 ? 805 ILE A HB   6  
ATOM 7878  H HG12 . ILE A 1 22  ? 1.186   2.247   2.758   1.00 0.00 ? 805 ILE A HG12 6  
ATOM 7879  H HG13 . ILE A 1 22  ? -0.103  1.048   2.773   1.00 0.00 ? 805 ILE A HG13 6  
ATOM 7880  H HG21 . ILE A 1 22  ? 2.155   1.836   6.275   1.00 0.00 ? 805 ILE A HG21 6  
ATOM 7881  H HG22 . ILE A 1 22  ? 1.716   3.105   5.133   1.00 0.00 ? 805 ILE A HG22 6  
ATOM 7882  H HG23 . ILE A 1 22  ? 0.500   2.440   6.223   1.00 0.00 ? 805 ILE A HG23 6  
ATOM 7883  H HD11 . ILE A 1 22  ? -1.119  2.641   4.592   1.00 0.00 ? 805 ILE A HD11 6  
ATOM 7884  H HD12 . ILE A 1 22  ? -0.088  3.832   3.798   1.00 0.00 ? 805 ILE A HD12 6  
ATOM 7885  H HD13 . ILE A 1 22  ? -1.316  2.971   2.871   1.00 0.00 ? 805 ILE A HD13 6  
ATOM 7886  N N    . SER A 1 23  ? 3.566   -0.020  6.223   1.00 0.00 ? 806 SER A N    6  
ATOM 7887  C CA   . SER A 1 23  ? 4.038   -0.762  7.387   1.00 0.00 ? 806 SER A CA   6  
ATOM 7888  C C    . SER A 1 23  ? 4.331   0.181   8.550   1.00 0.00 ? 806 SER A C    6  
ATOM 7889  O O    . SER A 1 23  ? 4.625   1.359   8.350   1.00 0.00 ? 806 SER A O    6  
ATOM 7890  C CB   . SER A 1 23  ? 5.295   -1.560  7.033   1.00 0.00 ? 806 SER A CB   6  
ATOM 7891  O OG   . SER A 1 23  ? 6.383   -0.698  6.748   1.00 0.00 ? 806 SER A OG   6  
ATOM 7892  H H    . SER A 1 23  ? 3.915   0.881   6.057   1.00 0.00 ? 806 SER A H    6  
ATOM 7893  H HA   . SER A 1 23  ? 3.258   -1.447  7.682   1.00 0.00 ? 806 SER A HA   6  
ATOM 7894  H HB2  . SER A 1 23  ? 5.562   -2.193  7.865   1.00 0.00 ? 806 SER A HB2  6  
ATOM 7895  H HB3  . SER A 1 23  ? 5.097   -2.171  6.164   1.00 0.00 ? 806 SER A HB3  6  
ATOM 7896  H HG   . SER A 1 23  ? 6.684   -0.282  7.559   1.00 0.00 ? 806 SER A HG   6  
ATOM 7897  N N    . GLY A 1 24  ? 4.249   -0.348  9.767   1.00 0.00 ? 807 GLY A N    6  
ATOM 7898  C CA   . GLY A 1 24  ? 4.508   0.459   10.945  1.00 0.00 ? 807 GLY A CA   6  
ATOM 7899  C C    . GLY A 1 24  ? 3.254   1.123   11.480  1.00 0.00 ? 807 GLY A C    6  
ATOM 7900  O O    . GLY A 1 24  ? 3.330   2.072   12.261  1.00 0.00 ? 807 GLY A O    6  
ATOM 7901  H H    . GLY A 1 24  ? 4.011   -1.293  9.866   1.00 0.00 ? 807 GLY A H    6  
ATOM 7902  H HA2  . GLY A 1 24  ? 4.926   -0.171  11.716  1.00 0.00 ? 807 GLY A HA2  6  
ATOM 7903  H HA3  . GLY A 1 24  ? 5.226   1.225   10.692  1.00 0.00 ? 807 GLY A HA3  6  
ATOM 7904  N N    . LEU A 1 25  ? 2.097   0.624   11.059  1.00 0.00 ? 808 LEU A N    6  
ATOM 7905  C CA   . LEU A 1 25  ? 0.821   1.175   11.500  1.00 0.00 ? 808 LEU A CA   6  
ATOM 7906  C C    . LEU A 1 25  ? 0.450   0.652   12.884  1.00 0.00 ? 808 LEU A C    6  
ATOM 7907  O O    . LEU A 1 25  ? 0.692   -0.507  13.221  1.00 0.00 ? 808 LEU A O    6  
ATOM 7908  C CB   . LEU A 1 25  ? -0.281  0.827   10.498  1.00 0.00 ? 808 LEU A CB   6  
ATOM 7909  C CG   . LEU A 1 25  ? -0.249  1.589   9.173   1.00 0.00 ? 808 LEU A CG   6  
ATOM 7910  C CD1  . LEU A 1 25  ? -1.095  0.878   8.128   1.00 0.00 ? 808 LEU A CD1  6  
ATOM 7911  C CD2  . LEU A 1 25  ? -0.730  3.019   9.369   1.00 0.00 ? 808 LEU A CD2  6  
ATOM 7912  H H    . LEU A 1 25  ? 2.101   -0.133  10.438  1.00 0.00 ? 808 LEU A H    6  
ATOM 7913  H HA   . LEU A 1 25  ? 0.924   2.249   11.550  1.00 0.00 ? 808 LEU A HA   6  
ATOM 7914  H HB2  . LEU A 1 25  ? -0.204  -0.226  10.275  1.00 0.00 ? 808 LEU A HB2  6  
ATOM 7915  H HB3  . LEU A 1 25  ? -1.232  1.024   10.972  1.00 0.00 ? 808 LEU A HB3  6  
ATOM 7916  H HG   . LEU A 1 25  ? 0.769   1.624   8.809   1.00 0.00 ? 808 LEU A HG   6  
ATOM 7917  H HD11 . LEU A 1 25  ? -2.098  0.747   8.505   1.00 0.00 ? 808 LEU A HD11 6  
ATOM 7918  H HD12 . LEU A 1 25  ? -0.663  -0.087  7.910   1.00 0.00 ? 808 LEU A HD12 6  
ATOM 7919  H HD13 . LEU A 1 25  ? -1.125  1.471   7.225   1.00 0.00 ? 808 LEU A HD13 6  
ATOM 7920  H HD21 . LEU A 1 25  ? -0.484  3.348   10.368  1.00 0.00 ? 808 LEU A HD21 6  
ATOM 7921  H HD22 . LEU A 1 25  ? -1.801  3.061   9.230   1.00 0.00 ? 808 LEU A HD22 6  
ATOM 7922  H HD23 . LEU A 1 25  ? -0.247  3.663   8.648   1.00 0.00 ? 808 LEU A HD23 6  
ATOM 7923  N N    . PRO A 1 26  ? -0.154  1.524   13.704  1.00 0.00 ? 809 PRO A N    6  
ATOM 7924  C CA   . PRO A 1 26  ? -0.574  1.171   15.064  1.00 0.00 ? 809 PRO A CA   6  
ATOM 7925  C C    . PRO A 1 26  ? -1.748  0.198   15.074  1.00 0.00 ? 809 PRO A C    6  
ATOM 7926  O O    . PRO A 1 26  ? -2.638  0.275   14.226  1.00 0.00 ? 809 PRO A O    6  
ATOM 7927  C CB   . PRO A 1 26  ? -0.989  2.515   15.667  1.00 0.00 ? 809 PRO A CB   6  
ATOM 7928  C CG   . PRO A 1 26  ? -1.369  3.355   14.497  1.00 0.00 ? 809 PRO A CG   6  
ATOM 7929  C CD   . PRO A 1 26  ? -0.474  2.921   13.368  1.00 0.00 ? 809 PRO A CD   6  
ATOM 7930  H HA   . PRO A 1 26  ? 0.242   0.754   15.636  1.00 0.00 ? 809 PRO A HA   6  
ATOM 7931  H HB2  . PRO A 1 26  ? -1.824  2.370   16.338  1.00 0.00 ? 809 PRO A HB2  6  
ATOM 7932  H HB3  . PRO A 1 26  ? -0.157  2.944   16.207  1.00 0.00 ? 809 PRO A HB3  6  
ATOM 7933  H HG2  . PRO A 1 26  ? -2.403  3.184   14.242  1.00 0.00 ? 809 PRO A HG2  6  
ATOM 7934  H HG3  . PRO A 1 26  ? -1.204  4.398   14.725  1.00 0.00 ? 809 PRO A HG3  6  
ATOM 7935  H HD2  . PRO A 1 26  ? -0.999  2.981   12.426  1.00 0.00 ? 809 PRO A HD2  6  
ATOM 7936  H HD3  . PRO A 1 26  ? 0.421   3.526   13.343  1.00 0.00 ? 809 PRO A HD3  6  
ATOM 7937  N N    . PHE A 1 27  ? -1.745  -0.716  16.038  1.00 0.00 ? 810 PHE A N    6  
ATOM 7938  C CA   . PHE A 1 27  ? -2.810  -1.705  16.157  1.00 0.00 ? 810 PHE A CA   6  
ATOM 7939  C C    . PHE A 1 27  ? -4.181  -1.036  16.108  1.00 0.00 ? 810 PHE A C    6  
ATOM 7940  O O    . PHE A 1 27  ? -5.120  -1.564  15.513  1.00 0.00 ? 810 PHE A O    6  
ATOM 7941  C CB   . PHE A 1 27  ? -2.661  -2.492  17.461  1.00 0.00 ? 810 PHE A CB   6  
ATOM 7942  C CG   . PHE A 1 27  ? -1.240  -2.861  17.779  1.00 0.00 ? 810 PHE A CG   6  
ATOM 7943  C CD1  . PHE A 1 27  ? -0.394  -3.330  16.787  1.00 0.00 ? 810 PHE A CD1  6  
ATOM 7944  C CD2  . PHE A 1 27  ? -0.751  -2.739  19.070  1.00 0.00 ? 810 PHE A CD2  6  
ATOM 7945  C CE1  . PHE A 1 27  ? 0.915   -3.670  17.076  1.00 0.00 ? 810 PHE A CE1  6  
ATOM 7946  C CE2  . PHE A 1 27  ? 0.556   -3.078  19.364  1.00 0.00 ? 810 PHE A CE2  6  
ATOM 7947  C CZ   . PHE A 1 27  ? 1.390   -3.545  18.367  1.00 0.00 ? 810 PHE A CZ   6  
ATOM 7948  H H    . PHE A 1 27  ? -1.008  -0.727  16.684  1.00 0.00 ? 810 PHE A H    6  
ATOM 7949  H HA   . PHE A 1 27  ? -2.725  -2.385  15.324  1.00 0.00 ? 810 PHE A HA   6  
ATOM 7950  H HB2  . PHE A 1 27  ? -3.039  -1.896  18.278  1.00 0.00 ? 810 PHE A HB2  6  
ATOM 7951  H HB3  . PHE A 1 27  ? -3.234  -3.404  17.390  1.00 0.00 ? 810 PHE A HB3  6  
ATOM 7952  H HD1  . PHE A 1 27  ? -0.765  -3.429  15.777  1.00 0.00 ? 810 PHE A HD1  6  
ATOM 7953  H HD2  . PHE A 1 27  ? -1.402  -2.375  19.851  1.00 0.00 ? 810 PHE A HD2  6  
ATOM 7954  H HE1  . PHE A 1 27  ? 1.563   -4.035  16.294  1.00 0.00 ? 810 PHE A HE1  6  
ATOM 7955  H HE2  . PHE A 1 27  ? 0.925   -2.979  20.374  1.00 0.00 ? 810 PHE A HE2  6  
ATOM 7956  H HZ   . PHE A 1 27  ? 2.411   -3.809  18.595  1.00 0.00 ? 810 PHE A HZ   6  
ATOM 7957  N N    . SER A 1 28  ? -4.287  0.129   16.739  1.00 0.00 ? 811 SER A N    6  
ATOM 7958  C CA   . SER A 1 28  ? -5.544  0.869   16.772  1.00 0.00 ? 811 SER A CA   6  
ATOM 7959  C C    . SER A 1 28  ? -6.084  1.083   15.361  1.00 0.00 ? 811 SER A C    6  
ATOM 7960  O O    . SER A 1 28  ? -7.251  0.805   15.083  1.00 0.00 ? 811 SER A O    6  
ATOM 7961  C CB   . SER A 1 28  ? -5.347  2.218   17.466  1.00 0.00 ? 811 SER A CB   6  
ATOM 7962  O OG   . SER A 1 28  ? -4.791  2.050   18.758  1.00 0.00 ? 811 SER A OG   6  
ATOM 7963  H H    . SER A 1 28  ? -3.503  0.498   17.196  1.00 0.00 ? 811 SER A H    6  
ATOM 7964  H HA   . SER A 1 28  ? -6.258  0.285   17.333  1.00 0.00 ? 811 SER A HA   6  
ATOM 7965  H HB2  . SER A 1 28  ? -4.681  2.829   16.877  1.00 0.00 ? 811 SER A HB2  6  
ATOM 7966  H HB3  . SER A 1 28  ? -6.303  2.713   17.560  1.00 0.00 ? 811 SER A HB3  6  
ATOM 7967  H HG   . SER A 1 28  ? -3.834  2.108   18.705  1.00 0.00 ? 811 SER A HG   6  
ATOM 7968  N N    . CYS A 1 29  ? -5.228  1.581   14.476  1.00 0.00 ? 812 CYS A N    6  
ATOM 7969  C CA   . CYS A 1 29  ? -5.619  1.834   13.094  1.00 0.00 ? 812 CYS A CA   6  
ATOM 7970  C C    . CYS A 1 29  ? -6.308  0.615   12.491  1.00 0.00 ? 812 CYS A C    6  
ATOM 7971  O O    . CYS A 1 29  ? -6.049  -0.521  12.892  1.00 0.00 ? 812 CYS A O    6  
ATOM 7972  C CB   . CYS A 1 29  ? -4.395  2.209   12.257  1.00 0.00 ? 812 CYS A CB   6  
ATOM 7973  S SG   . CYS A 1 29  ? -4.793  3.002   10.681  1.00 0.00 ? 812 CYS A SG   6  
ATOM 7974  H H    . CYS A 1 29  ? -4.311  1.783   14.758  1.00 0.00 ? 812 CYS A H    6  
ATOM 7975  H HA   . CYS A 1 29  ? -6.312  2.662   13.093  1.00 0.00 ? 812 CYS A HA   6  
ATOM 7976  H HB2  . CYS A 1 29  ? -3.778  2.893   12.821  1.00 0.00 ? 812 CYS A HB2  6  
ATOM 7977  H HB3  . CYS A 1 29  ? -3.827  1.316   12.043  1.00 0.00 ? 812 CYS A HB3  6  
ATOM 7978  H HG   . CYS A 1 29  ? -4.320  2.237   9.708   1.00 0.00 ? 812 CYS A HG   6  
ATOM 7979  N N    . THR A 1 30  ? -7.189  0.856   11.525  1.00 0.00 ? 813 THR A N    6  
ATOM 7980  C CA   . THR A 1 30  ? -7.919  -0.221  10.869  1.00 0.00 ? 813 THR A CA   6  
ATOM 7981  C C    . THR A 1 30  ? -8.415  0.209   9.493   1.00 0.00 ? 813 THR A C    6  
ATOM 7982  O O    . THR A 1 30  ? -8.296  1.374   9.115   1.00 0.00 ? 813 THR A O    6  
ATOM 7983  C CB   . THR A 1 30  ? -9.121  -0.682  11.714  1.00 0.00 ? 813 THR A CB   6  
ATOM 7984  O OG1  . THR A 1 30  ? -9.636  -1.916  11.203  1.00 0.00 ? 813 THR A OG1  6  
ATOM 7985  C CG2  . THR A 1 30  ? -10.219 0.371   11.712  1.00 0.00 ? 813 THR A CG2  6  
ATOM 7986  H H    . THR A 1 30  ? -7.353  1.782   11.250  1.00 0.00 ? 813 THR A H    6  
ATOM 7987  H HA   . THR A 1 30  ? -7.245  -1.058  10.753  1.00 0.00 ? 813 THR A HA   6  
ATOM 7988  H HB   . THR A 1 30  ? -8.790  -0.833  12.732  1.00 0.00 ? 813 THR A HB   6  
ATOM 7989  H HG1  . THR A 1 30  ? -9.738  -2.544  11.922  1.00 0.00 ? 813 THR A HG1  6  
ATOM 7990  H HG21 . THR A 1 30  ? -11.143 -0.072  12.054  1.00 0.00 ? 813 THR A HG21 6  
ATOM 7991  H HG22 . THR A 1 30  ? -10.351 0.751   10.710  1.00 0.00 ? 813 THR A HG22 6  
ATOM 7992  H HG23 . THR A 1 30  ? -9.943  1.180   12.371  1.00 0.00 ? 813 THR A HG23 6  
ATOM 7993  N N    . LYS A 1 31  ? -8.972  -0.739  8.747   1.00 0.00 ? 814 LYS A N    6  
ATOM 7994  C CA   . LYS A 1 31  ? -9.488  -0.459  7.413   1.00 0.00 ? 814 LYS A CA   6  
ATOM 7995  C C    . LYS A 1 31  ? -10.228 0.874   7.385   1.00 0.00 ? 814 LYS A C    6  
ATOM 7996  O O    . LYS A 1 31  ? -9.873  1.775   6.625   1.00 0.00 ? 814 LYS A O    6  
ATOM 7997  C CB   . LYS A 1 31  ? -10.422 -1.583  6.959   1.00 0.00 ? 814 LYS A CB   6  
ATOM 7998  C CG   . LYS A 1 31  ? -10.709 -1.570  5.467   1.00 0.00 ? 814 LYS A CG   6  
ATOM 7999  C CD   . LYS A 1 31  ? -11.562 -2.757  5.053   1.00 0.00 ? 814 LYS A CD   6  
ATOM 8000  C CE   . LYS A 1 31  ? -11.559 -2.947  3.544   1.00 0.00 ? 814 LYS A CE   6  
ATOM 8001  N NZ   . LYS A 1 31  ? -12.414 -4.092  3.127   1.00 0.00 ? 814 LYS A NZ   6  
ATOM 8002  H H    . LYS A 1 31  ? -9.038  -1.651  9.104   1.00 0.00 ? 814 LYS A H    6  
ATOM 8003  H HA   . LYS A 1 31  ? -8.648  -0.405  6.737   1.00 0.00 ? 814 LYS A HA   6  
ATOM 8004  H HB2  . LYS A 1 31  ? -9.973  -2.532  7.210   1.00 0.00 ? 814 LYS A HB2  6  
ATOM 8005  H HB3  . LYS A 1 31  ? -11.361 -1.488  7.485   1.00 0.00 ? 814 LYS A HB3  6  
ATOM 8006  H HG2  . LYS A 1 31  ? -11.233 -0.660  5.218   1.00 0.00 ? 814 LYS A HG2  6  
ATOM 8007  H HG3  . LYS A 1 31  ? -9.772  -1.607  4.930   1.00 0.00 ? 814 LYS A HG3  6  
ATOM 8008  H HD2  . LYS A 1 31  ? -11.171 -3.650  5.517   1.00 0.00 ? 814 LYS A HD2  6  
ATOM 8009  H HD3  . LYS A 1 31  ? -12.578 -2.593  5.384   1.00 0.00 ? 814 LYS A HD3  6  
ATOM 8010  H HE2  . LYS A 1 31  ? -11.928 -2.045  3.080   1.00 0.00 ? 814 LYS A HE2  6  
ATOM 8011  H HE3  . LYS A 1 31  ? -10.545 -3.129  3.220   1.00 0.00 ? 814 LYS A HE3  6  
ATOM 8012  H HZ1  . LYS A 1 31  ? -11.831 -4.831  2.685   1.00 0.00 ? 814 LYS A HZ1  6  
ATOM 8013  H HZ2  . LYS A 1 31  ? -13.128 -3.774  2.441   1.00 0.00 ? 814 LYS A HZ2  6  
ATOM 8014  H HZ3  . LYS A 1 31  ? -12.899 -4.496  3.953   1.00 0.00 ? 814 LYS A HZ3  6  
ATOM 8015  N N    . GLU A 1 32  ? -11.257 0.993   8.218   1.00 0.00 ? 815 GLU A N    6  
ATOM 8016  C CA   . GLU A 1 32  ? -12.045 2.217   8.288   1.00 0.00 ? 815 GLU A CA   6  
ATOM 8017  C C    . GLU A 1 32  ? -11.151 3.448   8.166   1.00 0.00 ? 815 GLU A C    6  
ATOM 8018  O O    . GLU A 1 32  ? -11.277 4.227   7.222   1.00 0.00 ? 815 GLU A O    6  
ATOM 8019  C CB   . GLU A 1 32  ? -12.829 2.271   9.601   1.00 0.00 ? 815 GLU A CB   6  
ATOM 8020  C CG   . GLU A 1 32  ? -14.104 1.445   9.583   1.00 0.00 ? 815 GLU A CG   6  
ATOM 8021  C CD   . GLU A 1 32  ? -15.224 2.116   8.811   1.00 0.00 ? 815 GLU A CD   6  
ATOM 8022  O OE1  . GLU A 1 32  ? -15.890 3.003   9.384   1.00 0.00 ? 815 GLU A OE1  6  
ATOM 8023  O OE2  . GLU A 1 32  ? -15.433 1.754   7.634   1.00 0.00 ? 815 GLU A OE2  6  
ATOM 8024  H H    . GLU A 1 32  ? -11.491 0.239   8.799   1.00 0.00 ? 815 GLU A H    6  
ATOM 8025  H HA   . GLU A 1 32  ? -12.742 2.211   7.464   1.00 0.00 ? 815 GLU A HA   6  
ATOM 8026  H HB2  . GLU A 1 32  ? -12.199 1.906   10.398  1.00 0.00 ? 815 GLU A HB2  6  
ATOM 8027  H HB3  . GLU A 1 32  ? -13.094 3.298   9.806   1.00 0.00 ? 815 GLU A HB3  6  
ATOM 8028  H HG2  . GLU A 1 32  ? -13.893 0.491   9.124   1.00 0.00 ? 815 GLU A HG2  6  
ATOM 8029  H HG3  . GLU A 1 32  ? -14.432 1.289   10.601  1.00 0.00 ? 815 GLU A HG3  6  
ATOM 8030  N N    . GLU A 1 33  ? -10.250 3.615   9.129   1.00 0.00 ? 816 GLU A N    6  
ATOM 8031  C CA   . GLU A 1 33  ? -9.336  4.751   9.130   1.00 0.00 ? 816 GLU A CA   6  
ATOM 8032  C C    . GLU A 1 33  ? -8.554  4.822   7.821   1.00 0.00 ? 816 GLU A C    6  
ATOM 8033  O O    . GLU A 1 33  ? -8.759  5.726   7.010   1.00 0.00 ? 816 GLU A O    6  
ATOM 8034  C CB   . GLU A 1 33  ? -8.368  4.655   10.311  1.00 0.00 ? 816 GLU A CB   6  
ATOM 8035  C CG   . GLU A 1 33  ? -9.023  4.907   11.658  1.00 0.00 ? 816 GLU A CG   6  
ATOM 8036  C CD   . GLU A 1 33  ? -9.567  3.640   12.289  1.00 0.00 ? 816 GLU A CD   6  
ATOM 8037  O OE1  . GLU A 1 33  ? -10.686 3.226   11.920  1.00 0.00 ? 816 GLU A OE1  6  
ATOM 8038  O OE2  . GLU A 1 33  ? -8.872  3.062   13.151  1.00 0.00 ? 816 GLU A OE2  6  
ATOM 8039  H H    . GLU A 1 33  ? -10.198 2.959   9.855   1.00 0.00 ? 816 GLU A H    6  
ATOM 8040  H HA   . GLU A 1 33  ? -9.925  5.650   9.232   1.00 0.00 ? 816 GLU A HA   6  
ATOM 8041  H HB2  . GLU A 1 33  ? -7.933  3.666   10.324  1.00 0.00 ? 816 GLU A HB2  6  
ATOM 8042  H HB3  . GLU A 1 33  ? -7.581  5.382   10.175  1.00 0.00 ? 816 GLU A HB3  6  
ATOM 8043  H HG2  . GLU A 1 33  ? -8.292  5.338   12.325  1.00 0.00 ? 816 GLU A HG2  6  
ATOM 8044  H HG3  . GLU A 1 33  ? -9.838  5.603   11.522  1.00 0.00 ? 816 GLU A HG3  6  
ATOM 8045  N N    . LEU A 1 34  ? -7.657  3.862   7.623   1.00 0.00 ? 817 LEU A N    6  
ATOM 8046  C CA   . LEU A 1 34  ? -6.843  3.815   6.413   1.00 0.00 ? 817 LEU A CA   6  
ATOM 8047  C C    . LEU A 1 34  ? -7.650  4.256   5.196   1.00 0.00 ? 817 LEU A C    6  
ATOM 8048  O O    . LEU A 1 34  ? -7.328  5.256   4.556   1.00 0.00 ? 817 LEU A O    6  
ATOM 8049  C CB   . LEU A 1 34  ? -6.301  2.401   6.195   1.00 0.00 ? 817 LEU A CB   6  
ATOM 8050  C CG   . LEU A 1 34  ? -5.074  2.284   5.290   1.00 0.00 ? 817 LEU A CG   6  
ATOM 8051  C CD1  . LEU A 1 34  ? -3.999  3.271   5.719   1.00 0.00 ? 817 LEU A CD1  6  
ATOM 8052  C CD2  . LEU A 1 34  ? -4.533  0.862   5.305   1.00 0.00 ? 817 LEU A CD2  6  
ATOM 8053  H H    . LEU A 1 34  ? -7.539  3.169   8.305   1.00 0.00 ? 817 LEU A H    6  
ATOM 8054  H HA   . LEU A 1 34  ? -6.013  4.493   6.545   1.00 0.00 ? 817 LEU A HA   6  
ATOM 8055  H HB2  . LEU A 1 34  ? -6.040  1.994   7.160   1.00 0.00 ? 817 LEU A HB2  6  
ATOM 8056  H HB3  . LEU A 1 34  ? -7.093  1.808   5.759   1.00 0.00 ? 817 LEU A HB3  6  
ATOM 8057  H HG   . LEU A 1 34  ? -5.359  2.524   4.275   1.00 0.00 ? 817 LEU A HG   6  
ATOM 8058  H HD11 . LEU A 1 34  ? -3.847  3.196   6.785   1.00 0.00 ? 817 LEU A HD11 6  
ATOM 8059  H HD12 . LEU A 1 34  ? -4.310  4.274   5.469   1.00 0.00 ? 817 LEU A HD12 6  
ATOM 8060  H HD13 . LEU A 1 34  ? -3.076  3.042   5.206   1.00 0.00 ? 817 LEU A HD13 6  
ATOM 8061  H HD21 . LEU A 1 34  ? -4.705  0.402   4.344   1.00 0.00 ? 817 LEU A HD21 6  
ATOM 8062  H HD22 . LEU A 1 34  ? -5.038  0.293   6.072   1.00 0.00 ? 817 LEU A HD22 6  
ATOM 8063  H HD23 . LEU A 1 34  ? -3.473  0.883   5.511   1.00 0.00 ? 817 LEU A HD23 6  
ATOM 8064  N N    . GLU A 1 35  ? -8.700  3.503   4.884   1.00 0.00 ? 818 GLU A N    6  
ATOM 8065  C CA   . GLU A 1 35  ? -9.554  3.819   3.745   1.00 0.00 ? 818 GLU A CA   6  
ATOM 8066  C C    . GLU A 1 35  ? -9.860  5.313   3.691   1.00 0.00 ? 818 GLU A C    6  
ATOM 8067  O O    . GLU A 1 35  ? -9.594  5.975   2.688   1.00 0.00 ? 818 GLU A O    6  
ATOM 8068  C CB   . GLU A 1 35  ? -10.858 3.022   3.820   1.00 0.00 ? 818 GLU A CB   6  
ATOM 8069  C CG   . GLU A 1 35  ? -11.591 2.927   2.492   1.00 0.00 ? 818 GLU A CG   6  
ATOM 8070  C CD   . GLU A 1 35  ? -13.090 2.777   2.663   1.00 0.00 ? 818 GLU A CD   6  
ATOM 8071  O OE1  . GLU A 1 35  ? -13.519 1.787   3.293   1.00 0.00 ? 818 GLU A OE1  6  
ATOM 8072  O OE2  . GLU A 1 35  ? -13.834 3.648   2.166   1.00 0.00 ? 818 GLU A OE2  6  
ATOM 8073  H H    . GLU A 1 35  ? -8.906  2.718   5.433   1.00 0.00 ? 818 GLU A H    6  
ATOM 8074  H HA   . GLU A 1 35  ? -9.024  3.539   2.846   1.00 0.00 ? 818 GLU A HA   6  
ATOM 8075  H HB2  . GLU A 1 35  ? -10.635 2.021   4.158   1.00 0.00 ? 818 GLU A HB2  6  
ATOM 8076  H HB3  . GLU A 1 35  ? -11.514 3.496   4.536   1.00 0.00 ? 818 GLU A HB3  6  
ATOM 8077  H HG2  . GLU A 1 35  ? -11.397 3.824   1.923   1.00 0.00 ? 818 GLU A HG2  6  
ATOM 8078  H HG3  . GLU A 1 35  ? -11.217 2.070   1.950   1.00 0.00 ? 818 GLU A HG3  6  
ATOM 8079  N N    . GLU A 1 36  ? -10.421 5.835   4.777   1.00 0.00 ? 819 GLU A N    6  
ATOM 8080  C CA   . GLU A 1 36  ? -10.764 7.250   4.852   1.00 0.00 ? 819 GLU A CA   6  
ATOM 8081  C C    . GLU A 1 36  ? -9.540  8.122   4.589   1.00 0.00 ? 819 GLU A C    6  
ATOM 8082  O O    . GLU A 1 36  ? -9.656  9.230   4.064   1.00 0.00 ? 819 GLU A O    6  
ATOM 8083  C CB   . GLU A 1 36  ? -11.354 7.582   6.225   1.00 0.00 ? 819 GLU A CB   6  
ATOM 8084  C CG   . GLU A 1 36  ? -12.759 7.042   6.430   1.00 0.00 ? 819 GLU A CG   6  
ATOM 8085  C CD   . GLU A 1 36  ? -13.288 7.307   7.826   1.00 0.00 ? 819 GLU A CD   6  
ATOM 8086  O OE1  . GLU A 1 36  ? -12.781 8.237   8.486   1.00 0.00 ? 819 GLU A OE1  6  
ATOM 8087  O OE2  . GLU A 1 36  ? -14.211 6.584   8.258   1.00 0.00 ? 819 GLU A OE2  6  
ATOM 8088  H H    . GLU A 1 36  ? -10.608 5.256   5.544   1.00 0.00 ? 819 GLU A H    6  
ATOM 8089  H HA   . GLU A 1 36  ? -11.505 7.453   4.094   1.00 0.00 ? 819 GLU A HA   6  
ATOM 8090  H HB2  . GLU A 1 36  ? -10.715 7.165   6.989   1.00 0.00 ? 819 GLU A HB2  6  
ATOM 8091  H HB3  . GLU A 1 36  ? -11.384 8.656   6.340   1.00 0.00 ? 819 GLU A HB3  6  
ATOM 8092  H HG2  . GLU A 1 36  ? -13.420 7.511   5.716   1.00 0.00 ? 819 GLU A HG2  6  
ATOM 8093  H HG3  . GLU A 1 36  ? -12.749 5.975   6.262   1.00 0.00 ? 819 GLU A HG3  6  
ATOM 8094  N N    . ILE A 1 37  ? -8.369  7.614   4.956   1.00 0.00 ? 820 ILE A N    6  
ATOM 8095  C CA   . ILE A 1 37  ? -7.124  8.345   4.759   1.00 0.00 ? 820 ILE A CA   6  
ATOM 8096  C C    . ILE A 1 37  ? -6.598  8.163   3.339   1.00 0.00 ? 820 ILE A C    6  
ATOM 8097  O O    . ILE A 1 37  ? -5.868  9.010   2.823   1.00 0.00 ? 820 ILE A O    6  
ATOM 8098  C CB   . ILE A 1 37  ? -6.041  7.893   5.757   1.00 0.00 ? 820 ILE A CB   6  
ATOM 8099  C CG1  . ILE A 1 37  ? -6.544  8.050   7.194   1.00 0.00 ? 820 ILE A CG1  6  
ATOM 8100  C CG2  . ILE A 1 37  ? -4.762  8.690   5.548   1.00 0.00 ? 820 ILE A CG2  6  
ATOM 8101  C CD1  . ILE A 1 37  ? -5.720  7.289   8.209   1.00 0.00 ? 820 ILE A CD1  6  
ATOM 8102  H H    . ILE A 1 37  ? -8.341  6.726   5.369   1.00 0.00 ? 820 ILE A H    6  
ATOM 8103  H HA   . ILE A 1 37  ? -7.323  9.394   4.926   1.00 0.00 ? 820 ILE A HA   6  
ATOM 8104  H HB   . ILE A 1 37  ? -5.823  6.853   5.571   1.00 0.00 ? 820 ILE A HB   6  
ATOM 8105  H HG12 . ILE A 1 37  ? -6.521  9.094   7.465   1.00 0.00 ? 820 ILE A HG12 6  
ATOM 8106  H HG13 . ILE A 1 37  ? -7.561  7.689   7.253   1.00 0.00 ? 820 ILE A HG13 6  
ATOM 8107  H HG21 . ILE A 1 37  ? -4.489  9.181   6.470   1.00 0.00 ? 820 ILE A HG21 6  
ATOM 8108  H HG22 . ILE A 1 37  ? -3.968  8.023   5.248   1.00 0.00 ? 820 ILE A HG22 6  
ATOM 8109  H HG23 . ILE A 1 37  ? -4.920  9.431   4.779   1.00 0.00 ? 820 ILE A HG23 6  
ATOM 8110  H HD11 . ILE A 1 37  ? -6.060  6.265   8.253   1.00 0.00 ? 820 ILE A HD11 6  
ATOM 8111  H HD12 . ILE A 1 37  ? -4.680  7.312   7.920   1.00 0.00 ? 820 ILE A HD12 6  
ATOM 8112  H HD13 . ILE A 1 37  ? -5.834  7.747   9.181   1.00 0.00 ? 820 ILE A HD13 6  
ATOM 8113  N N    . CYS A 1 38  ? -6.975  7.054   2.713   1.00 0.00 ? 821 CYS A N    6  
ATOM 8114  C CA   . CYS A 1 38  ? -6.542  6.761   1.351   1.00 0.00 ? 821 CYS A CA   6  
ATOM 8115  C C    . CYS A 1 38  ? -7.407  7.499   0.335   1.00 0.00 ? 821 CYS A C    6  
ATOM 8116  O O    . CYS A 1 38  ? -6.899  8.237   -0.510  1.00 0.00 ? 821 CYS A O    6  
ATOM 8117  C CB   . CYS A 1 38  ? -6.599  5.255   1.089   1.00 0.00 ? 821 CYS A CB   6  
ATOM 8118  S SG   . CYS A 1 38  ? -5.469  4.284   2.114   1.00 0.00 ? 821 CYS A SG   6  
ATOM 8119  H H    . CYS A 1 38  ? -7.557  6.417   3.176   1.00 0.00 ? 821 CYS A H    6  
ATOM 8120  H HA   . CYS A 1 38  ? -5.521  7.097   1.249   1.00 0.00 ? 821 CYS A HA   6  
ATOM 8121  H HB2  . CYS A 1 38  ? -7.601  4.901   1.281   1.00 0.00 ? 821 CYS A HB2  6  
ATOM 8122  H HB3  . CYS A 1 38  ? -6.350  5.068   0.055   1.00 0.00 ? 821 CYS A HB3  6  
ATOM 8123  H HG   . CYS A 1 38  ? -5.330  4.909   3.274   1.00 0.00 ? 821 CYS A HG   6  
ATOM 8124  N N    . LYS A 1 39  ? -8.717  7.294   0.421   1.00 0.00 ? 822 LYS A N    6  
ATOM 8125  C CA   . LYS A 1 39  ? -9.654  7.940   -0.491  1.00 0.00 ? 822 LYS A CA   6  
ATOM 8126  C C    . LYS A 1 39  ? -9.475  9.454   -0.473  1.00 0.00 ? 822 LYS A C    6  
ATOM 8127  O O    . LYS A 1 39  ? -9.974  10.158  -1.351  1.00 0.00 ? 822 LYS A O    6  
ATOM 8128  C CB   . LYS A 1 39  ? -11.093 7.582   -0.113  1.00 0.00 ? 822 LYS A CB   6  
ATOM 8129  C CG   . LYS A 1 39  ? -11.536 8.163   1.219   1.00 0.00 ? 822 LYS A CG   6  
ATOM 8130  C CD   . LYS A 1 39  ? -12.147 9.544   1.048   1.00 0.00 ? 822 LYS A CD   6  
ATOM 8131  C CE   . LYS A 1 39  ? -13.646 9.462   0.800   1.00 0.00 ? 822 LYS A CE   6  
ATOM 8132  N NZ   . LYS A 1 39  ? -14.209 10.774  0.374   1.00 0.00 ? 822 LYS A NZ   6  
ATOM 8133  H H    . LYS A 1 39  ? -9.062  6.695   1.116   1.00 0.00 ? 822 LYS A H    6  
ATOM 8134  H HA   . LYS A 1 39  ? -9.451  7.577   -1.487  1.00 0.00 ? 822 LYS A HA   6  
ATOM 8135  H HB2  . LYS A 1 39  ? -11.757 7.950   -0.881  1.00 0.00 ? 822 LYS A HB2  6  
ATOM 8136  H HB3  . LYS A 1 39  ? -11.181 6.506   -0.059  1.00 0.00 ? 822 LYS A HB3  6  
ATOM 8137  H HG2  . LYS A 1 39  ? -12.271 7.508   1.661   1.00 0.00 ? 822 LYS A HG2  6  
ATOM 8138  H HG3  . LYS A 1 39  ? -10.677 8.238   1.871   1.00 0.00 ? 822 LYS A HG3  6  
ATOM 8139  H HD2  . LYS A 1 39  ? -11.974 10.119  1.946   1.00 0.00 ? 822 LYS A HD2  6  
ATOM 8140  H HD3  . LYS A 1 39  ? -11.678 10.035  0.207   1.00 0.00 ? 822 LYS A HD3  6  
ATOM 8141  H HE2  . LYS A 1 39  ? -13.830 8.733   0.026   1.00 0.00 ? 822 LYS A HE2  6  
ATOM 8142  H HE3  . LYS A 1 39  ? -14.132 9.150   1.712   1.00 0.00 ? 822 LYS A HE3  6  
ATOM 8143  H HZ1  . LYS A 1 39  ? -13.806 11.539  0.951   1.00 0.00 ? 822 LYS A HZ1  6  
ATOM 8144  H HZ2  . LYS A 1 39  ? -15.243 10.773  0.492   1.00 0.00 ? 822 LYS A HZ2  6  
ATOM 8145  H HZ3  . LYS A 1 39  ? -13.985 10.952  -0.626  1.00 0.00 ? 822 LYS A HZ3  6  
ATOM 8146  N N    . ALA A 1 40  ? -8.759  9.949   0.531   1.00 0.00 ? 823 ALA A N    6  
ATOM 8147  C CA   . ALA A 1 40  ? -8.511  11.380  0.660   1.00 0.00 ? 823 ALA A CA   6  
ATOM 8148  C C    . ALA A 1 40  ? -7.712  11.908  -0.527  1.00 0.00 ? 823 ALA A C    6  
ATOM 8149  O O    . ALA A 1 40  ? -7.953  13.017  -1.006  1.00 0.00 ? 823 ALA A O    6  
ATOM 8150  C CB   . ALA A 1 40  ? -7.781  11.674  1.963   1.00 0.00 ? 823 ALA A CB   6  
ATOM 8151  H H    . ALA A 1 40  ? -8.387  9.338   1.200   1.00 0.00 ? 823 ALA A H    6  
ATOM 8152  H HA   . ALA A 1 40  ? -9.467  11.883  0.690   1.00 0.00 ? 823 ALA A HA   6  
ATOM 8153  H HB1  . ALA A 1 40  ? -6.870  12.213  1.750   1.00 0.00 ? 823 ALA A HB1  6  
ATOM 8154  H HB2  . ALA A 1 40  ? -8.413  12.272  2.602   1.00 0.00 ? 823 ALA A HB2  6  
ATOM 8155  H HB3  . ALA A 1 40  ? -7.543  10.745  2.459   1.00 0.00 ? 823 ALA A HB3  6  
ATOM 8156  N N    . HIS A 1 41  ? -6.761  11.108  -0.997  1.00 0.00 ? 824 HIS A N    6  
ATOM 8157  C CA   . HIS A 1 41  ? -5.926  11.495  -2.128  1.00 0.00 ? 824 HIS A CA   6  
ATOM 8158  C C    . HIS A 1 41  ? -6.627  11.194  -3.449  1.00 0.00 ? 824 HIS A C    6  
ATOM 8159  O O    . HIS A 1 41  ? -6.699  12.045  -4.334  1.00 0.00 ? 824 HIS A O    6  
ATOM 8160  C CB   . HIS A 1 41  ? -4.583  10.766  -2.072  1.00 0.00 ? 824 HIS A CB   6  
ATOM 8161  C CG   . HIS A 1 41  ? -3.847  10.965  -0.783  1.00 0.00 ? 824 HIS A CG   6  
ATOM 8162  N ND1  . HIS A 1 41  ? -3.405  12.198  -0.351  1.00 0.00 ? 824 HIS A ND1  6  
ATOM 8163  C CD2  . HIS A 1 41  ? -3.477  10.079  0.171   1.00 0.00 ? 824 HIS A CD2  6  
ATOM 8164  C CE1  . HIS A 1 41  ? -2.794  12.061  0.812   1.00 0.00 ? 824 HIS A CE1  6  
ATOM 8165  N NE2  . HIS A 1 41  ? -2.824  10.785  1.151   1.00 0.00 ? 824 HIS A NE2  6  
ATOM 8166  H H    . HIS A 1 41  ? -6.617  10.236  -0.573  1.00 0.00 ? 824 HIS A H    6  
ATOM 8167  H HA   . HIS A 1 41  ? -5.751  12.558  -2.063  1.00 0.00 ? 824 HIS A HA   6  
ATOM 8168  H HB2  . HIS A 1 41  ? -4.751  9.706   -2.198  1.00 0.00 ? 824 HIS A HB2  6  
ATOM 8169  H HB3  . HIS A 1 41  ? -3.953  11.123  -2.874  1.00 0.00 ? 824 HIS A HB3  6  
ATOM 8170  H HD2  . HIS A 1 41  ? -3.660  9.013   0.163   1.00 0.00 ? 824 HIS A HD2  6  
ATOM 8171  H HE1  . HIS A 1 41  ? -2.346  12.857  1.388   1.00 0.00 ? 824 HIS A HE1  6  
ATOM 8172  H HE2  . HIS A 1 41  ? -2.367  10.396  1.926   1.00 0.00 ? 824 HIS A HE2  6  
ATOM 8173  N N    . GLY A 1 42  ? -7.143  9.975   -3.575  1.00 0.00 ? 825 GLY A N    6  
ATOM 8174  C CA   . GLY A 1 42  ? -7.831  9.582   -4.791  1.00 0.00 ? 825 GLY A CA   6  
ATOM 8175  C C    . GLY A 1 42  ? -8.984  8.634   -4.526  1.00 0.00 ? 825 GLY A C    6  
ATOM 8176  O O    . GLY A 1 42  ? -9.756  8.831   -3.587  1.00 0.00 ? 825 GLY A O    6  
ATOM 8177  H H    . GLY A 1 42  ? -7.056  9.337   -2.836  1.00 0.00 ? 825 GLY A H    6  
ATOM 8178  H HA2  . GLY A 1 42  ? -8.212  10.468  -5.278  1.00 0.00 ? 825 GLY A HA2  6  
ATOM 8179  H HA3  . GLY A 1 42  ? -7.126  9.097   -5.450  1.00 0.00 ? 825 GLY A HA3  6  
ATOM 8180  N N    . THR A 1 43  ? -9.102  7.602   -5.355  1.00 0.00 ? 826 THR A N    6  
ATOM 8181  C CA   . THR A 1 43  ? -10.170 6.621   -5.207  1.00 0.00 ? 826 THR A CA   6  
ATOM 8182  C C    . THR A 1 43  ? -9.618  5.268   -4.774  1.00 0.00 ? 826 THR A C    6  
ATOM 8183  O O    . THR A 1 43  ? -8.635  4.780   -5.332  1.00 0.00 ? 826 THR A O    6  
ATOM 8184  C CB   . THR A 1 43  ? -10.957 6.446   -6.519  1.00 0.00 ? 826 THR A CB   6  
ATOM 8185  O OG1  . THR A 1 43  ? -11.687 7.641   -6.817  1.00 0.00 ? 826 THR A OG1  6  
ATOM 8186  C CG2  . THR A 1 43  ? -11.918 5.271   -6.421  1.00 0.00 ? 826 THR A CG2  6  
ATOM 8187  H H    . THR A 1 43  ? -8.455  7.499   -6.084  1.00 0.00 ? 826 THR A H    6  
ATOM 8188  H HA   . THR A 1 43  ? -10.850 6.981   -4.449  1.00 0.00 ? 826 THR A HA   6  
ATOM 8189  H HB   . THR A 1 43  ? -10.256 6.252   -7.319  1.00 0.00 ? 826 THR A HB   6  
ATOM 8190  H HG1  . THR A 1 43  ? -12.311 7.820   -6.109  1.00 0.00 ? 826 THR A HG1  6  
ATOM 8191  H HG21 . THR A 1 43  ? -12.085 5.028   -5.381  1.00 0.00 ? 826 THR A HG21 6  
ATOM 8192  H HG22 . THR A 1 43  ? -11.495 4.416   -6.927  1.00 0.00 ? 826 THR A HG22 6  
ATOM 8193  H HG23 . THR A 1 43  ? -12.857 5.535   -6.883  1.00 0.00 ? 826 THR A HG23 6  
ATOM 8194  N N    . VAL A 1 44  ? -10.256 4.665   -3.776  1.00 0.00 ? 827 VAL A N    6  
ATOM 8195  C CA   . VAL A 1 44  ? -9.829  3.367   -3.269  1.00 0.00 ? 827 VAL A CA   6  
ATOM 8196  C C    . VAL A 1 44  ? -10.661 2.241   -3.872  1.00 0.00 ? 827 VAL A C    6  
ATOM 8197  O O    . VAL A 1 44  ? -11.817 2.038   -3.498  1.00 0.00 ? 827 VAL A O    6  
ATOM 8198  C CB   . VAL A 1 44  ? -9.933  3.301   -1.734  1.00 0.00 ? 827 VAL A CB   6  
ATOM 8199  C CG1  . VAL A 1 44  ? -9.519  1.928   -1.228  1.00 0.00 ? 827 VAL A CG1  6  
ATOM 8200  C CG2  . VAL A 1 44  ? -9.086  4.392   -1.096  1.00 0.00 ? 827 VAL A CG2  6  
ATOM 8201  H H    . VAL A 1 44  ? -11.033 5.105   -3.371  1.00 0.00 ? 827 VAL A H    6  
ATOM 8202  H HA   . VAL A 1 44  ? -8.794  3.224   -3.545  1.00 0.00 ? 827 VAL A HA   6  
ATOM 8203  H HB   . VAL A 1 44  ? -10.964 3.467   -1.456  1.00 0.00 ? 827 VAL A HB   6  
ATOM 8204  H HG11 . VAL A 1 44  ? -8.447  1.825   -1.305  1.00 0.00 ? 827 VAL A HG11 6  
ATOM 8205  H HG12 . VAL A 1 44  ? -9.819  1.818   -0.196  1.00 0.00 ? 827 VAL A HG12 6  
ATOM 8206  H HG13 . VAL A 1 44  ? -9.997  1.166   -1.825  1.00 0.00 ? 827 VAL A HG13 6  
ATOM 8207  H HG21 . VAL A 1 44  ? -8.795  4.085   -0.102  1.00 0.00 ? 827 VAL A HG21 6  
ATOM 8208  H HG22 . VAL A 1 44  ? -8.201  4.557   -1.694  1.00 0.00 ? 827 VAL A HG22 6  
ATOM 8209  H HG23 . VAL A 1 44  ? -9.657  5.306   -1.038  1.00 0.00 ? 827 VAL A HG23 6  
ATOM 8210  N N    . LYS A 1 45  ? -10.067 1.510   -4.809  1.00 0.00 ? 828 LYS A N    6  
ATOM 8211  C CA   . LYS A 1 45  ? -10.752 0.402   -5.464  1.00 0.00 ? 828 LYS A CA   6  
ATOM 8212  C C    . LYS A 1 45  ? -10.861 -0.800  -4.530  1.00 0.00 ? 828 LYS A C    6  
ATOM 8213  O O    . LYS A 1 45  ? -11.915 -1.428  -4.433  1.00 0.00 ? 828 LYS A O    6  
ATOM 8214  C CB   . LYS A 1 45  ? -10.011 0.002   -6.742  1.00 0.00 ? 828 LYS A CB   6  
ATOM 8215  C CG   . LYS A 1 45  ? -9.891  1.128   -7.754  1.00 0.00 ? 828 LYS A CG   6  
ATOM 8216  C CD   . LYS A 1 45  ? -11.065 1.138   -8.719  1.00 0.00 ? 828 LYS A CD   6  
ATOM 8217  C CE   . LYS A 1 45  ? -12.186 2.038   -8.224  1.00 0.00 ? 828 LYS A CE   6  
ATOM 8218  N NZ   . LYS A 1 45  ? -13.523 1.554   -8.668  1.00 0.00 ? 828 LYS A NZ   6  
ATOM 8219  H H    . LYS A 1 45  ? -9.144  1.720   -5.065  1.00 0.00 ? 828 LYS A H    6  
ATOM 8220  H HA   . LYS A 1 45  ? -11.746 0.733   -5.723  1.00 0.00 ? 828 LYS A HA   6  
ATOM 8221  H HB2  . LYS A 1 45  ? -9.015  -0.325  -6.479  1.00 0.00 ? 828 LYS A HB2  6  
ATOM 8222  H HB3  . LYS A 1 45  ? -10.538 -0.818  -7.208  1.00 0.00 ? 828 LYS A HB3  6  
ATOM 8223  H HG2  . LYS A 1 45  ? -9.864  2.071   -7.228  1.00 0.00 ? 828 LYS A HG2  6  
ATOM 8224  H HG3  . LYS A 1 45  ? -8.976  1.000   -8.315  1.00 0.00 ? 828 LYS A HG3  6  
ATOM 8225  H HD2  . LYS A 1 45  ? -10.727 1.498   -9.679  1.00 0.00 ? 828 LYS A HD2  6  
ATOM 8226  H HD3  . LYS A 1 45  ? -11.442 0.130   -8.823  1.00 0.00 ? 828 LYS A HD3  6  
ATOM 8227  H HE2  . LYS A 1 45  ? -12.162 2.061   -7.145  1.00 0.00 ? 828 LYS A HE2  6  
ATOM 8228  H HE3  . LYS A 1 45  ? -12.027 3.034   -8.609  1.00 0.00 ? 828 LYS A HE3  6  
ATOM 8229  H HZ1  . LYS A 1 45  ? -14.169 2.359   -8.798  1.00 0.00 ? 828 LYS A HZ1  6  
ATOM 8230  H HZ2  . LYS A 1 45  ? -13.926 0.913   -7.955  1.00 0.00 ? 828 LYS A HZ2  6  
ATOM 8231  H HZ3  . LYS A 1 45  ? -13.437 1.043   -9.569  1.00 0.00 ? 828 LYS A HZ3  6  
ATOM 8232  N N    . ASP A 1 46  ? -9.767  -1.111  -3.845  1.00 0.00 ? 829 ASP A N    6  
ATOM 8233  C CA   . ASP A 1 46  ? -9.741  -2.236  -2.916  1.00 0.00 ? 829 ASP A CA   6  
ATOM 8234  C C    . ASP A 1 46  ? -8.739  -1.989  -1.792  1.00 0.00 ? 829 ASP A C    6  
ATOM 8235  O O    . ASP A 1 46  ? -7.720  -1.326  -1.989  1.00 0.00 ? 829 ASP A O    6  
ATOM 8236  C CB   . ASP A 1 46  ? -9.388  -3.527  -3.656  1.00 0.00 ? 829 ASP A CB   6  
ATOM 8237  C CG   . ASP A 1 46  ? -9.959  -4.757  -2.978  1.00 0.00 ? 829 ASP A CG   6  
ATOM 8238  O OD1  . ASP A 1 46  ? -11.170 -4.757  -2.670  1.00 0.00 ? 829 ASP A OD1  6  
ATOM 8239  O OD2  . ASP A 1 46  ? -9.196  -5.720  -2.755  1.00 0.00 ? 829 ASP A OD2  6  
ATOM 8240  H H    . ASP A 1 46  ? -8.957  -0.572  -3.965  1.00 0.00 ? 829 ASP A H    6  
ATOM 8241  H HA   . ASP A 1 46  ? -10.726 -2.335  -2.488  1.00 0.00 ? 829 ASP A HA   6  
ATOM 8242  H HB2  . ASP A 1 46  ? -9.782  -3.478  -4.661  1.00 0.00 ? 829 ASP A HB2  6  
ATOM 8243  H HB3  . ASP A 1 46  ? -8.314  -3.628  -3.699  1.00 0.00 ? 829 ASP A HB3  6  
ATOM 8244  N N    . LEU A 1 47  ? -9.036  -2.526  -0.614  1.00 0.00 ? 830 LEU A N    6  
ATOM 8245  C CA   . LEU A 1 47  ? -8.162  -2.364  0.543   1.00 0.00 ? 830 LEU A CA   6  
ATOM 8246  C C    . LEU A 1 47  ? -8.115  -3.643  1.373   1.00 0.00 ? 830 LEU A C    6  
ATOM 8247  O O    . LEU A 1 47  ? -9.152  -4.228  1.689   1.00 0.00 ? 830 LEU A O    6  
ATOM 8248  C CB   . LEU A 1 47  ? -8.641  -1.197  1.408   1.00 0.00 ? 830 LEU A CB   6  
ATOM 8249  C CG   . LEU A 1 47  ? -7.580  -0.534  2.288   1.00 0.00 ? 830 LEU A CG   6  
ATOM 8250  C CD1  . LEU A 1 47  ? -8.081  0.801   2.814   1.00 0.00 ? 830 LEU A CD1  6  
ATOM 8251  C CD2  . LEU A 1 47  ? -7.191  -1.452  3.438   1.00 0.00 ? 830 LEU A CD2  6  
ATOM 8252  H H    . LEU A 1 47  ? -9.862  -3.044  -0.519  1.00 0.00 ? 830 LEU A H    6  
ATOM 8253  H HA   . LEU A 1 47  ? -7.168  -2.148  0.179   1.00 0.00 ? 830 LEU A HA   6  
ATOM 8254  H HB2  . LEU A 1 47  ? -9.044  -0.442  0.751   1.00 0.00 ? 830 LEU A HB2  6  
ATOM 8255  H HB3  . LEU A 1 47  ? -9.425  -1.566  2.055   1.00 0.00 ? 830 LEU A HB3  6  
ATOM 8256  H HG   . LEU A 1 47  ? -6.695  -0.348  1.694   1.00 0.00 ? 830 LEU A HG   6  
ATOM 8257  H HD11 . LEU A 1 47  ? -7.781  1.589   2.141   1.00 0.00 ? 830 LEU A HD11 6  
ATOM 8258  H HD12 . LEU A 1 47  ? -7.660  0.983   3.792   1.00 0.00 ? 830 LEU A HD12 6  
ATOM 8259  H HD13 . LEU A 1 47  ? -9.159  0.778   2.886   1.00 0.00 ? 830 LEU A HD13 6  
ATOM 8260  H HD21 . LEU A 1 47  ? -7.822  -2.328  3.427   1.00 0.00 ? 830 LEU A HD21 6  
ATOM 8261  H HD22 . LEU A 1 47  ? -7.319  -0.928  4.374   1.00 0.00 ? 830 LEU A HD22 6  
ATOM 8262  H HD23 . LEU A 1 47  ? -6.159  -1.749  3.328   1.00 0.00 ? 830 LEU A HD23 6  
ATOM 8263  N N    . ARG A 1 48  ? -6.907  -4.069  1.726   1.00 0.00 ? 831 ARG A N    6  
ATOM 8264  C CA   . ARG A 1 48  ? -6.725  -5.277  2.521   1.00 0.00 ? 831 ARG A CA   6  
ATOM 8265  C C    . ARG A 1 48  ? -5.694  -5.053  3.623   1.00 0.00 ? 831 ARG A C    6  
ATOM 8266  O O    . ARG A 1 48  ? -4.755  -4.274  3.460   1.00 0.00 ? 831 ARG A O    6  
ATOM 8267  C CB   . ARG A 1 48  ? -6.288  -6.440  1.628   1.00 0.00 ? 831 ARG A CB   6  
ATOM 8268  C CG   . ARG A 1 48  ? -5.852  -7.673  2.403   1.00 0.00 ? 831 ARG A CG   6  
ATOM 8269  C CD   . ARG A 1 48  ? -5.138  -8.671  1.506   1.00 0.00 ? 831 ARG A CD   6  
ATOM 8270  N NE   . ARG A 1 48  ? -5.088  -10.004 2.101   1.00 0.00 ? 831 ARG A NE   6  
ATOM 8271  C CZ   . ARG A 1 48  ? -6.142  -10.808 2.192   1.00 0.00 ? 831 ARG A CZ   6  
ATOM 8272  N NH1  . ARG A 1 48  ? -7.321  -10.416 1.730   1.00 0.00 ? 831 ARG A NH1  6  
ATOM 8273  N NH2  . ARG A 1 48  ? -6.017  -12.007 2.747   1.00 0.00 ? 831 ARG A NH2  6  
ATOM 8274  H H    . ARG A 1 48  ? -6.119  -3.559  1.444   1.00 0.00 ? 831 ARG A H    6  
ATOM 8275  H HA   . ARG A 1 48  ? -7.674  -5.521  2.976   1.00 0.00 ? 831 ARG A HA   6  
ATOM 8276  H HB2  . ARG A 1 48  ? -7.113  -6.718  0.988   1.00 0.00 ? 831 ARG A HB2  6  
ATOM 8277  H HB3  . ARG A 1 48  ? -5.461  -6.116  1.015   1.00 0.00 ? 831 ARG A HB3  6  
ATOM 8278  H HG2  . ARG A 1 48  ? -5.180  -7.371  3.193   1.00 0.00 ? 831 ARG A HG2  6  
ATOM 8279  H HG3  . ARG A 1 48  ? -6.724  -8.145  2.830   1.00 0.00 ? 831 ARG A HG3  6  
ATOM 8280  H HD2  . ARG A 1 48  ? -5.662  -8.728  0.563   1.00 0.00 ? 831 ARG A HD2  6  
ATOM 8281  H HD3  . ARG A 1 48  ? -4.129  -8.325  1.336   1.00 0.00 ? 831 ARG A HD3  6  
ATOM 8282  H HE   . ARG A 1 48  ? -4.226  -10.314 2.449   1.00 0.00 ? 831 ARG A HE   6  
ATOM 8283  H HH11 . ARG A 1 48  ? -7.417  -9.514  1.310   1.00 0.00 ? 831 ARG A HH11 6  
ATOM 8284  H HH12 . ARG A 1 48  ? -8.112  -11.024 1.799   1.00 0.00 ? 831 ARG A HH12 6  
ATOM 8285  H HH21 . ARG A 1 48  ? -5.129  -12.305 3.097   1.00 0.00 ? 831 ARG A HH21 6  
ATOM 8286  H HH22 . ARG A 1 48  ? -6.810  -12.611 2.816   1.00 0.00 ? 831 ARG A HH22 6  
ATOM 8287  N N    . LEU A 1 49  ? -5.877  -5.740  4.746   1.00 0.00 ? 832 LEU A N    6  
ATOM 8288  C CA   . LEU A 1 49  ? -4.963  -5.616  5.876   1.00 0.00 ? 832 LEU A CA   6  
ATOM 8289  C C    . LEU A 1 49  ? -4.285  -6.948  6.177   1.00 0.00 ? 832 LEU A C    6  
ATOM 8290  O O    . LEU A 1 49  ? -4.951  -7.965  6.376   1.00 0.00 ? 832 LEU A O    6  
ATOM 8291  C CB   . LEU A 1 49  ? -5.716  -5.122  7.113   1.00 0.00 ? 832 LEU A CB   6  
ATOM 8292  C CG   . LEU A 1 49  ? -6.566  -3.866  6.925   1.00 0.00 ? 832 LEU A CG   6  
ATOM 8293  C CD1  . LEU A 1 49  ? -7.553  -3.712  8.072   1.00 0.00 ? 832 LEU A CD1  6  
ATOM 8294  C CD2  . LEU A 1 49  ? -5.680  -2.634  6.813   1.00 0.00 ? 832 LEU A CD2  6  
ATOM 8295  H H    . LEU A 1 49  ? -6.644  -6.345  4.817   1.00 0.00 ? 832 LEU A H    6  
ATOM 8296  H HA   . LEU A 1 49  ? -4.207  -4.892  5.612   1.00 0.00 ? 832 LEU A HA   6  
ATOM 8297  H HB2  . LEU A 1 49  ? -6.368  -5.917  7.442   1.00 0.00 ? 832 LEU A HB2  6  
ATOM 8298  H HB3  . LEU A 1 49  ? -4.985  -4.917  7.883   1.00 0.00 ? 832 LEU A HB3  6  
ATOM 8299  H HG   . LEU A 1 49  ? -7.132  -3.956  6.008   1.00 0.00 ? 832 LEU A HG   6  
ATOM 8300  H HD11 . LEU A 1 49  ? -7.336  -4.446  8.834   1.00 0.00 ? 832 LEU A HD11 6  
ATOM 8301  H HD12 . LEU A 1 49  ? -8.557  -3.859  7.705   1.00 0.00 ? 832 LEU A HD12 6  
ATOM 8302  H HD13 . LEU A 1 49  ? -7.465  -2.720  8.491   1.00 0.00 ? 832 LEU A HD13 6  
ATOM 8303  H HD21 . LEU A 1 49  ? -4.961  -2.779  6.019   1.00 0.00 ? 832 LEU A HD21 6  
ATOM 8304  H HD22 . LEU A 1 49  ? -5.158  -2.479  7.746   1.00 0.00 ? 832 LEU A HD22 6  
ATOM 8305  H HD23 . LEU A 1 49  ? -6.290  -1.770  6.593   1.00 0.00 ? 832 LEU A HD23 6  
ATOM 8306  N N    . VAL A 1 50  ? -2.956  -6.936  6.211   1.00 0.00 ? 833 VAL A N    6  
ATOM 8307  C CA   . VAL A 1 50  ? -2.187  -8.143  6.492   1.00 0.00 ? 833 VAL A CA   6  
ATOM 8308  C C    . VAL A 1 50  ? -2.160  -8.442  7.986   1.00 0.00 ? 833 VAL A C    6  
ATOM 8309  O O    . VAL A 1 50  ? -1.278  -7.975  8.708   1.00 0.00 ? 833 VAL A O    6  
ATOM 8310  C CB   . VAL A 1 50  ? -0.741  -8.019  5.977   1.00 0.00 ? 833 VAL A CB   6  
ATOM 8311  C CG1  . VAL A 1 50  ? 0.031   -9.302  6.240   1.00 0.00 ? 833 VAL A CG1  6  
ATOM 8312  C CG2  . VAL A 1 50  ? -0.731  -7.674  4.495   1.00 0.00 ? 833 VAL A CG2  6  
ATOM 8313  H H    . VAL A 1 50  ? -2.482  -6.095  6.045   1.00 0.00 ? 833 VAL A H    6  
ATOM 8314  H HA   . VAL A 1 50  ? -2.661  -8.967  5.978   1.00 0.00 ? 833 VAL A HA   6  
ATOM 8315  H HB   . VAL A 1 50  ? -0.257  -7.217  6.515   1.00 0.00 ? 833 VAL A HB   6  
ATOM 8316  H HG11 . VAL A 1 50  ? 1.091   -9.107  6.160   1.00 0.00 ? 833 VAL A HG11 6  
ATOM 8317  H HG12 . VAL A 1 50  ? -0.196  -9.663  7.232   1.00 0.00 ? 833 VAL A HG12 6  
ATOM 8318  H HG13 . VAL A 1 50  ? -0.252  -10.048 5.511   1.00 0.00 ? 833 VAL A HG13 6  
ATOM 8319  H HG21 . VAL A 1 50  ? 0.161   -7.111  4.263   1.00 0.00 ? 833 VAL A HG21 6  
ATOM 8320  H HG22 . VAL A 1 50  ? -0.743  -8.585  3.913   1.00 0.00 ? 833 VAL A HG22 6  
ATOM 8321  H HG23 . VAL A 1 50  ? -1.603  -7.084  4.256   1.00 0.00 ? 833 VAL A HG23 6  
ATOM 8322  N N    . THR A 1 51  ? -3.131  -9.224  8.446   1.00 0.00 ? 834 THR A N    6  
ATOM 8323  C CA   . THR A 1 51  ? -3.219  -9.586  9.855   1.00 0.00 ? 834 THR A CA   6  
ATOM 8324  C C    . THR A 1 51  ? -2.752  -11.018 10.085  1.00 0.00 ? 834 THR A C    6  
ATOM 8325  O O    . THR A 1 51  ? -2.390  -11.722 9.143   1.00 0.00 ? 834 THR A O    6  
ATOM 8326  C CB   . THR A 1 51  ? -4.657  -9.435  10.385  1.00 0.00 ? 834 THR A CB   6  
ATOM 8327  O OG1  . THR A 1 51  ? -5.569  -10.136 9.532   1.00 0.00 ? 834 THR A OG1  6  
ATOM 8328  C CG2  . THR A 1 51  ? -5.054  -7.969  10.465  1.00 0.00 ? 834 THR A CG2  6  
ATOM 8329  H H    . THR A 1 51  ? -3.805  -9.565  7.821   1.00 0.00 ? 834 THR A H    6  
ATOM 8330  H HA   . THR A 1 51  ? -2.581  -8.915  10.412  1.00 0.00 ? 834 THR A HA   6  
ATOM 8331  H HB   . THR A 1 51  ? -4.706  -9.861  11.377  1.00 0.00 ? 834 THR A HB   6  
ATOM 8332  H HG1  . THR A 1 51  ? -5.312  -11.060 9.478   1.00 0.00 ? 834 THR A HG1  6  
ATOM 8333  H HG21 . THR A 1 51  ? -5.824  -7.764  9.735   1.00 0.00 ? 834 THR A HG21 6  
ATOM 8334  H HG22 . THR A 1 51  ? -4.192  -7.351  10.262  1.00 0.00 ? 834 THR A HG22 6  
ATOM 8335  H HG23 . THR A 1 51  ? -5.429  -7.751  11.453  1.00 0.00 ? 834 THR A HG23 6  
ATOM 8336  N N    . ASN A 1 52  ? -2.763  -11.445 11.344  1.00 0.00 ? 835 ASN A N    6  
ATOM 8337  C CA   . ASN A 1 52  ? -2.340  -12.795 11.698  1.00 0.00 ? 835 ASN A CA   6  
ATOM 8338  C C    . ASN A 1 52  ? -3.532  -13.747 11.729  1.00 0.00 ? 835 ASN A C    6  
ATOM 8339  O O    . ASN A 1 52  ? -4.659  -13.359 11.420  1.00 0.00 ? 835 ASN A O    6  
ATOM 8340  C CB   . ASN A 1 52  ? -1.640  -12.792 13.058  1.00 0.00 ? 835 ASN A CB   6  
ATOM 8341  C CG   . ASN A 1 52  ? -0.157  -12.497 12.944  1.00 0.00 ? 835 ASN A CG   6  
ATOM 8342  O OD1  . ASN A 1 52  ? 0.556   -13.131 12.167  1.00 0.00 ? 835 ASN A OD1  6  
ATOM 8343  N ND2  . ASN A 1 52  ? 0.315   -11.528 13.721  1.00 0.00 ? 835 ASN A ND2  6  
ATOM 8344  H H    . ASN A 1 52  ? -3.063  -10.837 12.052  1.00 0.00 ? 835 ASN A H    6  
ATOM 8345  H HA   . ASN A 1 52  ? -1.644  -13.132 10.945  1.00 0.00 ? 835 ASN A HA   6  
ATOM 8346  H HB2  . ASN A 1 52  ? -2.090  -12.038 13.687  1.00 0.00 ? 835 ASN A HB2  6  
ATOM 8347  H HB3  . ASN A 1 52  ? -1.761  -13.760 13.521  1.00 0.00 ? 835 ASN A HB3  6  
ATOM 8348  H HD21 . ASN A 1 52  ? -0.312  -11.066 14.316  1.00 0.00 ? 835 ASN A HD21 6  
ATOM 8349  H HD22 . ASN A 1 52  ? 1.270   -11.316 13.667  1.00 0.00 ? 835 ASN A HD22 6  
ATOM 8350  N N    . ARG A 1 53  ? -3.274  -14.996 12.103  1.00 0.00 ? 836 ARG A N    6  
ATOM 8351  C CA   . ARG A 1 53  ? -4.325  -16.005 12.173  1.00 0.00 ? 836 ARG A CA   6  
ATOM 8352  C C    . ARG A 1 53  ? -5.544  -15.468 12.917  1.00 0.00 ? 836 ARG A C    6  
ATOM 8353  O O    . ARG A 1 53  ? -6.683  -15.728 12.530  1.00 0.00 ? 836 ARG A O    6  
ATOM 8354  C CB   . ARG A 1 53  ? -3.805  -17.265 12.867  1.00 0.00 ? 836 ARG A CB   6  
ATOM 8355  C CG   . ARG A 1 53  ? -4.887  -18.294 13.151  1.00 0.00 ? 836 ARG A CG   6  
ATOM 8356  C CD   . ARG A 1 53  ? -5.365  -18.968 11.874  1.00 0.00 ? 836 ARG A CD   6  
ATOM 8357  N NE   . ARG A 1 53  ? -4.433  -19.995 11.416  1.00 0.00 ? 836 ARG A NE   6  
ATOM 8358  C CZ   . ARG A 1 53  ? -4.474  -20.535 10.203  1.00 0.00 ? 836 ARG A CZ   6  
ATOM 8359  N NH1  . ARG A 1 53  ? -5.395  -20.147 9.332   1.00 0.00 ? 836 ARG A NH1  6  
ATOM 8360  N NH2  . ARG A 1 53  ? -3.591  -21.464 9.860   1.00 0.00 ? 836 ARG A NH2  6  
ATOM 8361  H H    . ARG A 1 53  ? -2.356  -15.246 12.336  1.00 0.00 ? 836 ARG A H    6  
ATOM 8362  H HA   . ARG A 1 53  ? -4.614  -16.254 11.163  1.00 0.00 ? 836 ARG A HA   6  
ATOM 8363  H HB2  . ARG A 1 53  ? -3.058  -17.726 12.238  1.00 0.00 ? 836 ARG A HB2  6  
ATOM 8364  H HB3  . ARG A 1 53  ? -3.351  -16.984 13.805  1.00 0.00 ? 836 ARG A HB3  6  
ATOM 8365  H HG2  . ARG A 1 53  ? -4.490  -19.047 13.815  1.00 0.00 ? 836 ARG A HG2  6  
ATOM 8366  H HG3  . ARG A 1 53  ? -5.724  -17.801 13.623  1.00 0.00 ? 836 ARG A HG3  6  
ATOM 8367  H HD2  . ARG A 1 53  ? -6.325  -19.425 12.062  1.00 0.00 ? 836 ARG A HD2  6  
ATOM 8368  H HD3  . ARG A 1 53  ? -5.467  -18.218 11.105  1.00 0.00 ? 836 ARG A HD3  6  
ATOM 8369  H HE   . ARG A 1 53  ? -3.744  -20.295 12.044  1.00 0.00 ? 836 ARG A HE   6  
ATOM 8370  H HH11 . ARG A 1 53  ? -6.060  -19.447 9.587   1.00 0.00 ? 836 ARG A HH11 6  
ATOM 8371  H HH12 . ARG A 1 53  ? -5.422  -20.555 8.418   1.00 0.00 ? 836 ARG A HH12 6  
ATOM 8372  H HH21 . ARG A 1 53  ? -2.895  -21.759 10.514  1.00 0.00 ? 836 ARG A HH21 6  
ATOM 8373  H HH22 . ARG A 1 53  ? -3.622  -21.870 8.947   1.00 0.00 ? 836 ARG A HH22 6  
ATOM 8374  N N    . ALA A 1 54  ? -5.297  -14.719 13.986  1.00 0.00 ? 837 ALA A N    6  
ATOM 8375  C CA   . ALA A 1 54  ? -6.374  -14.145 14.783  1.00 0.00 ? 837 ALA A CA   6  
ATOM 8376  C C    . ALA A 1 54  ? -6.764  -12.764 14.266  1.00 0.00 ? 837 ALA A C    6  
ATOM 8377  O O    . ALA A 1 54  ? -7.139  -11.884 15.039  1.00 0.00 ? 837 ALA A O    6  
ATOM 8378  C CB   . ALA A 1 54  ? -5.965  -14.066 16.246  1.00 0.00 ? 837 ALA A CB   6  
ATOM 8379  H H    . ALA A 1 54  ? -4.368  -14.548 14.245  1.00 0.00 ? 837 ALA A H    6  
ATOM 8380  H HA   . ALA A 1 54  ? -7.230  -14.801 14.709  1.00 0.00 ? 837 ALA A HA   6  
ATOM 8381  H HB1  . ALA A 1 54  ? -6.845  -13.936 16.859  1.00 0.00 ? 837 ALA A HB1  6  
ATOM 8382  H HB2  . ALA A 1 54  ? -5.460  -14.979 16.528  1.00 0.00 ? 837 ALA A HB2  6  
ATOM 8383  H HB3  . ALA A 1 54  ? -5.299  -13.228 16.389  1.00 0.00 ? 837 ALA A HB3  6  
ATOM 8384  N N    . GLY A 1 55  ? -6.671  -12.582 12.952  1.00 0.00 ? 838 GLY A N    6  
ATOM 8385  C CA   . GLY A 1 55  ? -7.016  -11.305 12.354  1.00 0.00 ? 838 GLY A CA   6  
ATOM 8386  C C    . GLY A 1 55  ? -6.468  -10.130 13.140  1.00 0.00 ? 838 GLY A C    6  
ATOM 8387  O O    . GLY A 1 55  ? -7.107  -9.081  13.229  1.00 0.00 ? 838 GLY A O    6  
ATOM 8388  H H    . GLY A 1 55  ? -6.365  -13.320 12.384  1.00 0.00 ? 838 GLY A H    6  
ATOM 8389  H HA2  . GLY A 1 55  ? -6.619  -11.270 11.351  1.00 0.00 ? 838 GLY A HA2  6  
ATOM 8390  H HA3  . GLY A 1 55  ? -8.092  -11.222 12.308  1.00 0.00 ? 838 GLY A HA3  6  
ATOM 8391  N N    . LYS A 1 56  ? -5.282  -10.305 13.713  1.00 0.00 ? 839 LYS A N    6  
ATOM 8392  C CA   . LYS A 1 56  ? -4.648  -9.251  14.496  1.00 0.00 ? 839 LYS A CA   6  
ATOM 8393  C C    . LYS A 1 56  ? -3.821  -8.332  13.602  1.00 0.00 ? 839 LYS A C    6  
ATOM 8394  O O    . LYS A 1 56  ? -3.191  -8.766  12.638  1.00 0.00 ? 839 LYS A O    6  
ATOM 8395  C CB   . LYS A 1 56  ? -3.757  -9.860  15.581  1.00 0.00 ? 839 LYS A CB   6  
ATOM 8396  C CG   . LYS A 1 56  ? -4.532  -10.592 16.664  1.00 0.00 ? 839 LYS A CG   6  
ATOM 8397  C CD   . LYS A 1 56  ? -5.133  -9.624  17.670  1.00 0.00 ? 839 LYS A CD   6  
ATOM 8398  C CE   . LYS A 1 56  ? -4.086  -9.118  18.650  1.00 0.00 ? 839 LYS A CE   6  
ATOM 8399  N NZ   . LYS A 1 56  ? -4.701  -8.634  19.917  1.00 0.00 ? 839 LYS A NZ   6  
ATOM 8400  H H    . LYS A 1 56  ? -4.822  -11.164 13.605  1.00 0.00 ? 839 LYS A H    6  
ATOM 8401  H HA   . LYS A 1 56  ? -5.427  -8.671  14.965  1.00 0.00 ? 839 LYS A HA   6  
ATOM 8402  H HB2  . LYS A 1 56  ? -3.075  -10.560 15.120  1.00 0.00 ? 839 LYS A HB2  6  
ATOM 8403  H HB3  . LYS A 1 56  ? -3.187  -9.070  16.047  1.00 0.00 ? 839 LYS A HB3  6  
ATOM 8404  H HG2  . LYS A 1 56  ? -5.328  -11.157 16.204  1.00 0.00 ? 839 LYS A HG2  6  
ATOM 8405  H HG3  . LYS A 1 56  ? -3.862  -11.264 17.181  1.00 0.00 ? 839 LYS A HG3  6  
ATOM 8406  H HD2  . LYS A 1 56  ? -5.551  -8.781  17.140  1.00 0.00 ? 839 LYS A HD2  6  
ATOM 8407  H HD3  . LYS A 1 56  ? -5.914  -10.130 18.219  1.00 0.00 ? 839 LYS A HD3  6  
ATOM 8408  H HE2  . LYS A 1 56  ? -3.404  -9.924  18.876  1.00 0.00 ? 839 LYS A HE2  6  
ATOM 8409  H HE3  . LYS A 1 56  ? -3.543  -8.306  18.190  1.00 0.00 ? 839 LYS A HE3  6  
ATOM 8410  H HZ1  . LYS A 1 56  ? -4.919  -9.439  20.539  1.00 0.00 ? 839 LYS A HZ1  6  
ATOM 8411  H HZ2  . LYS A 1 56  ? -5.581  -8.120  19.713  1.00 0.00 ? 839 LYS A HZ2  6  
ATOM 8412  H HZ3  . LYS A 1 56  ? -4.045  -7.995  20.411  1.00 0.00 ? 839 LYS A HZ3  6  
ATOM 8413  N N    . PRO A 1 57  ? -3.821  -7.031  13.929  1.00 0.00 ? 840 PRO A N    6  
ATOM 8414  C CA   . PRO A 1 57  ? -3.075  -6.024  13.169  1.00 0.00 ? 840 PRO A CA   6  
ATOM 8415  C C    . PRO A 1 57  ? -1.566  -6.168  13.342  1.00 0.00 ? 840 PRO A C    6  
ATOM 8416  O O    . PRO A 1 57  ? -1.036  -5.982  14.437  1.00 0.00 ? 840 PRO A O    6  
ATOM 8417  C CB   . PRO A 1 57  ? -3.557  -4.699  13.765  1.00 0.00 ? 840 PRO A CB   6  
ATOM 8418  C CG   . PRO A 1 57  ? -4.002  -5.045  15.145  1.00 0.00 ? 840 PRO A CG   6  
ATOM 8419  C CD   . PRO A 1 57  ? -4.550  -6.443  15.065  1.00 0.00 ? 840 PRO A CD   6  
ATOM 8420  H HA   . PRO A 1 57  ? -3.320  -6.058  12.117  1.00 0.00 ? 840 PRO A HA   6  
ATOM 8421  H HB2  . PRO A 1 57  ? -2.743  -3.989  13.778  1.00 0.00 ? 840 PRO A HB2  6  
ATOM 8422  H HB3  . PRO A 1 57  ? -4.373  -4.310  13.174  1.00 0.00 ? 840 PRO A HB3  6  
ATOM 8423  H HG2  . PRO A 1 57  ? -3.162  -5.010  15.821  1.00 0.00 ? 840 PRO A HG2  6  
ATOM 8424  H HG3  . PRO A 1 57  ? -4.772  -4.359  15.464  1.00 0.00 ? 840 PRO A HG3  6  
ATOM 8425  H HD2  . PRO A 1 57  ? -4.342  -6.982  15.977  1.00 0.00 ? 840 PRO A HD2  6  
ATOM 8426  H HD3  . PRO A 1 57  ? -5.612  -6.421  14.871  1.00 0.00 ? 840 PRO A HD3  6  
ATOM 8427  N N    . LYS A 1 58  ? -0.880  -6.499  12.254  1.00 0.00 ? 841 LYS A N    6  
ATOM 8428  C CA   . LYS A 1 58  ? 0.568   -6.666  12.284  1.00 0.00 ? 841 LYS A CA   6  
ATOM 8429  C C    . LYS A 1 58  ? 1.274   -5.371  11.895  1.00 0.00 ? 841 LYS A C    6  
ATOM 8430  O O    . LYS A 1 58  ? 2.496   -5.267  11.986  1.00 0.00 ? 841 LYS A O    6  
ATOM 8431  C CB   . LYS A 1 58  ? 0.992   -7.794  11.340  1.00 0.00 ? 841 LYS A CB   6  
ATOM 8432  C CG   . LYS A 1 58  ? 0.414   -9.148  11.713  1.00 0.00 ? 841 LYS A CG   6  
ATOM 8433  C CD   . LYS A 1 58  ? 0.372   -10.085 10.517  1.00 0.00 ? 841 LYS A CD   6  
ATOM 8434  C CE   . LYS A 1 58  ? 1.729   -10.722 10.259  1.00 0.00 ? 841 LYS A CE   6  
ATOM 8435  N NZ   . LYS A 1 58  ? 1.609   -11.988 9.484   1.00 0.00 ? 841 LYS A NZ   6  
ATOM 8436  H H    . LYS A 1 58  ? -1.359  -6.634  11.409  1.00 0.00 ? 841 LYS A H    6  
ATOM 8437  H HA   . LYS A 1 58  ? 0.851   -6.927  13.292  1.00 0.00 ? 841 LYS A HA   6  
ATOM 8438  H HB2  . LYS A 1 58  ? 0.667   -7.550  10.339  1.00 0.00 ? 841 LYS A HB2  6  
ATOM 8439  H HB3  . LYS A 1 58  ? 2.070   -7.870  11.351  1.00 0.00 ? 841 LYS A HB3  6  
ATOM 8440  H HG2  . LYS A 1 58  ? 1.029   -9.592  12.482  1.00 0.00 ? 841 LYS A HG2  6  
ATOM 8441  H HG3  . LYS A 1 58  ? -0.590  -9.011  12.087  1.00 0.00 ? 841 LYS A HG3  6  
ATOM 8442  H HD2  . LYS A 1 58  ? -0.350  -10.866 10.707  1.00 0.00 ? 841 LYS A HD2  6  
ATOM 8443  H HD3  . LYS A 1 58  ? 0.075   -9.524  9.642   1.00 0.00 ? 841 LYS A HD3  6  
ATOM 8444  H HE2  . LYS A 1 58  ? 2.339   -10.026 9.704   1.00 0.00 ? 841 LYS A HE2  6  
ATOM 8445  H HE3  . LYS A 1 58  ? 2.198   -10.934 11.209  1.00 0.00 ? 841 LYS A HE3  6  
ATOM 8446  H HZ1  . LYS A 1 58  ? 2.084   -11.889 8.564   1.00 0.00 ? 841 LYS A HZ1  6  
ATOM 8447  H HZ2  . LYS A 1 58  ? 0.607   -12.214 9.321   1.00 0.00 ? 841 LYS A HZ2  6  
ATOM 8448  H HZ3  . LYS A 1 58  ? 2.049   -12.771 10.007  1.00 0.00 ? 841 LYS A HZ3  6  
ATOM 8449  N N    . GLY A 1 59  ? 0.494   -4.385  11.461  1.00 0.00 ? 842 GLY A N    6  
ATOM 8450  C CA   . GLY A 1 59  ? 1.063   -3.109  11.066  1.00 0.00 ? 842 GLY A CA   6  
ATOM 8451  C C    . GLY A 1 59  ? 1.153   -2.956  9.561   1.00 0.00 ? 842 GLY A C    6  
ATOM 8452  O O    . GLY A 1 59  ? 1.272   -1.842  9.048   1.00 0.00 ? 842 GLY A O    6  
ATOM 8453  H H    . GLY A 1 59  ? -0.474  -4.525  11.410  1.00 0.00 ? 842 GLY A H    6  
ATOM 8454  H HA2  . GLY A 1 59  ? 0.447   -2.315  11.462  1.00 0.00 ? 842 GLY A HA2  6  
ATOM 8455  H HA3  . GLY A 1 59  ? 2.055   -3.025  11.485  1.00 0.00 ? 842 GLY A HA3  6  
ATOM 8456  N N    . LEU A 1 60  ? 1.098   -4.077  8.850   1.00 0.00 ? 843 LEU A N    6  
ATOM 8457  C CA   . LEU A 1 60  ? 1.176   -4.063  7.393   1.00 0.00 ? 843 LEU A CA   6  
ATOM 8458  C C    . LEU A 1 60  ? -0.213  -3.947  6.774   1.00 0.00 ? 843 LEU A C    6  
ATOM 8459  O O    . LEU A 1 60  ? -1.197  -4.423  7.340   1.00 0.00 ? 843 LEU A O    6  
ATOM 8460  C CB   . LEU A 1 60  ? 1.868   -5.331  6.888   1.00 0.00 ? 843 LEU A CB   6  
ATOM 8461  C CG   . LEU A 1 60  ? 3.327   -5.513  7.308   1.00 0.00 ? 843 LEU A CG   6  
ATOM 8462  C CD1  . LEU A 1 60  ? 3.897   -6.793  6.718   1.00 0.00 ? 843 LEU A CD1  6  
ATOM 8463  C CD2  . LEU A 1 60  ? 4.158   -4.311  6.883   1.00 0.00 ? 843 LEU A CD2  6  
ATOM 8464  H H    . LEU A 1 60  ? 1.003   -4.934  9.314   1.00 0.00 ? 843 LEU A H    6  
ATOM 8465  H HA   . LEU A 1 60  ? 1.760   -3.203  7.101   1.00 0.00 ? 843 LEU A HA   6  
ATOM 8466  H HB2  . LEU A 1 60  ? 1.310   -6.179  7.253   1.00 0.00 ? 843 LEU A HB2  6  
ATOM 8467  H HB3  . LEU A 1 60  ? 1.833   -5.317  5.807   1.00 0.00 ? 843 LEU A HB3  6  
ATOM 8468  H HG   . LEU A 1 60  ? 3.377   -5.592  8.385   1.00 0.00 ? 843 LEU A HG   6  
ATOM 8469  H HD11 . LEU A 1 60  ? 4.829   -6.575  6.219   1.00 0.00 ? 843 LEU A HD11 6  
ATOM 8470  H HD12 . LEU A 1 60  ? 3.196   -7.204  6.006   1.00 0.00 ? 843 LEU A HD12 6  
ATOM 8471  H HD13 . LEU A 1 60  ? 4.068   -7.509  7.508   1.00 0.00 ? 843 LEU A HD13 6  
ATOM 8472  H HD21 . LEU A 1 60  ? 3.915   -3.466  7.511   1.00 0.00 ? 843 LEU A HD21 6  
ATOM 8473  H HD22 . LEU A 1 60  ? 3.940   -4.068  5.853   1.00 0.00 ? 843 LEU A HD22 6  
ATOM 8474  H HD23 . LEU A 1 60  ? 5.207   -4.545  6.984   1.00 0.00 ? 843 LEU A HD23 6  
ATOM 8475  N N    . ALA A 1 61  ? -0.285  -3.313  5.609   1.00 0.00 ? 844 ALA A N    6  
ATOM 8476  C CA   . ALA A 1 61  ? -1.553  -3.138  4.911   1.00 0.00 ? 844 ALA A CA   6  
ATOM 8477  C C    . ALA A 1 61  ? -1.331  -2.906  3.420   1.00 0.00 ? 844 ALA A C    6  
ATOM 8478  O O    . ALA A 1 61  ? -0.299  -2.375  3.011   1.00 0.00 ? 844 ALA A O    6  
ATOM 8479  C CB   . ALA A 1 61  ? -2.333  -1.981  5.517   1.00 0.00 ? 844 ALA A CB   6  
ATOM 8480  H H    . ALA A 1 61  ? 0.535   -2.955  5.208   1.00 0.00 ? 844 ALA A H    6  
ATOM 8481  H HA   . ALA A 1 61  ? -2.133  -4.040  5.043   1.00 0.00 ? 844 ALA A HA   6  
ATOM 8482  H HB1  . ALA A 1 61  ? -2.786  -2.300  6.444   1.00 0.00 ? 844 ALA A HB1  6  
ATOM 8483  H HB2  . ALA A 1 61  ? -1.664  -1.156  5.708   1.00 0.00 ? 844 ALA A HB2  6  
ATOM 8484  H HB3  . ALA A 1 61  ? -3.104  -1.668  4.829   1.00 0.00 ? 844 ALA A HB3  6  
ATOM 8485  N N    . TYR A 1 62  ? -2.306  -3.308  2.613   1.00 0.00 ? 845 TYR A N    6  
ATOM 8486  C CA   . TYR A 1 62  ? -2.216  -3.147  1.166   1.00 0.00 ? 845 TYR A CA   6  
ATOM 8487  C C    . TYR A 1 62  ? -3.375  -2.307  0.639   1.00 0.00 ? 845 TYR A C    6  
ATOM 8488  O O    . TYR A 1 62  ? -4.522  -2.482  1.050   1.00 0.00 ? 845 TYR A O    6  
ATOM 8489  C CB   . TYR A 1 62  ? -2.209  -4.514  0.479   1.00 0.00 ? 845 TYR A CB   6  
ATOM 8490  C CG   . TYR A 1 62  ? -0.837  -5.145  0.400   1.00 0.00 ? 845 TYR A CG   6  
ATOM 8491  C CD1  . TYR A 1 62  ? -0.322  -5.869  1.468   1.00 0.00 ? 845 TYR A CD1  6  
ATOM 8492  C CD2  . TYR A 1 62  ? -0.057  -5.016  -0.742  1.00 0.00 ? 845 TYR A CD2  6  
ATOM 8493  C CE1  . TYR A 1 62  ? 0.932   -6.447  1.400   1.00 0.00 ? 845 TYR A CE1  6  
ATOM 8494  C CE2  . TYR A 1 62  ? 1.197   -5.592  -0.819  1.00 0.00 ? 845 TYR A CE2  6  
ATOM 8495  C CZ   . TYR A 1 62  ? 1.687   -6.305  0.255   1.00 0.00 ? 845 TYR A CZ   6  
ATOM 8496  O OH   . TYR A 1 62  ? 2.935   -6.880  0.183   1.00 0.00 ? 845 TYR A OH   6  
ATOM 8497  H H    . TYR A 1 62  ? -3.105  -3.725  2.998   1.00 0.00 ? 845 TYR A H    6  
ATOM 8498  H HA   . TYR A 1 62  ? -1.289  -2.640  0.946   1.00 0.00 ? 845 TYR A HA   6  
ATOM 8499  H HB2  . TYR A 1 62  ? -2.852  -5.187  1.025   1.00 0.00 ? 845 TYR A HB2  6  
ATOM 8500  H HB3  . TYR A 1 62  ? -2.583  -4.404  -0.528  1.00 0.00 ? 845 TYR A HB3  6  
ATOM 8501  H HD1  . TYR A 1 62  ? -0.916  -5.979  2.363   1.00 0.00 ? 845 TYR A HD1  6  
ATOM 8502  H HD2  . TYR A 1 62  ? -0.443  -4.457  -1.582  1.00 0.00 ? 845 TYR A HD2  6  
ATOM 8503  H HE1  . TYR A 1 62  ? 1.315   -7.006  2.241   1.00 0.00 ? 845 TYR A HE1  6  
ATOM 8504  H HE2  . TYR A 1 62  ? 1.789   -5.481  -1.716  1.00 0.00 ? 845 TYR A HE2  6  
ATOM 8505  H HH   . TYR A 1 62  ? 3.313   -6.936  1.064   1.00 0.00 ? 845 TYR A HH   6  
ATOM 8506  N N    . VAL A 1 63  ? -3.066  -1.393  -0.276  1.00 0.00 ? 846 VAL A N    6  
ATOM 8507  C CA   . VAL A 1 63  ? -4.080  -0.525  -0.862  1.00 0.00 ? 846 VAL A CA   6  
ATOM 8508  C C    . VAL A 1 63  ? -4.142  -0.697  -2.376  1.00 0.00 ? 846 VAL A C    6  
ATOM 8509  O O    . VAL A 1 63  ? -3.143  -1.025  -3.014  1.00 0.00 ? 846 VAL A O    6  
ATOM 8510  C CB   . VAL A 1 63  ? -3.809  0.956   -0.536  1.00 0.00 ? 846 VAL A CB   6  
ATOM 8511  C CG1  . VAL A 1 63  ? -4.982  1.822   -0.970  1.00 0.00 ? 846 VAL A CG1  6  
ATOM 8512  C CG2  . VAL A 1 63  ? -3.527  1.131   0.949   1.00 0.00 ? 846 VAL A CG2  6  
ATOM 8513  H H    . VAL A 1 63  ? -2.134  -1.300  -0.563  1.00 0.00 ? 846 VAL A H    6  
ATOM 8514  H HA   . VAL A 1 63  ? -5.037  -0.796  -0.439  1.00 0.00 ? 846 VAL A HA   6  
ATOM 8515  H HB   . VAL A 1 63  ? -2.935  1.271   -1.086  1.00 0.00 ? 846 VAL A HB   6  
ATOM 8516  H HG11 . VAL A 1 63  ? -4.779  2.240   -1.945  1.00 0.00 ? 846 VAL A HG11 6  
ATOM 8517  H HG12 . VAL A 1 63  ? -5.878  1.220   -1.014  1.00 0.00 ? 846 VAL A HG12 6  
ATOM 8518  H HG13 . VAL A 1 63  ? -5.120  2.623   -0.258  1.00 0.00 ? 846 VAL A HG13 6  
ATOM 8519  H HG21 . VAL A 1 63  ? -2.460  1.121   1.115   1.00 0.00 ? 846 VAL A HG21 6  
ATOM 8520  H HG22 . VAL A 1 63  ? -3.935  2.073   1.285   1.00 0.00 ? 846 VAL A HG22 6  
ATOM 8521  H HG23 . VAL A 1 63  ? -3.986  0.324   1.500   1.00 0.00 ? 846 VAL A HG23 6  
ATOM 8522  N N    . GLU A 1 64  ? -5.323  -0.473  -2.944  1.00 0.00 ? 847 GLU A N    6  
ATOM 8523  C CA   . GLU A 1 64  ? -5.515  -0.604  -4.383  1.00 0.00 ? 847 GLU A CA   6  
ATOM 8524  C C    . GLU A 1 64  ? -6.293  0.586   -4.939  1.00 0.00 ? 847 GLU A C    6  
ATOM 8525  O O    . GLU A 1 64  ? -7.512  0.667   -4.792  1.00 0.00 ? 847 GLU A O    6  
ATOM 8526  C CB   . GLU A 1 64  ? -6.253  -1.905  -4.706  1.00 0.00 ? 847 GLU A CB   6  
ATOM 8527  C CG   . GLU A 1 64  ? -5.965  -2.438  -6.099  1.00 0.00 ? 847 GLU A CG   6  
ATOM 8528  C CD   . GLU A 1 64  ? -6.919  -1.889  -7.142  1.00 0.00 ? 847 GLU A CD   6  
ATOM 8529  O OE1  . GLU A 1 64  ? -8.117  -2.238  -7.093  1.00 0.00 ? 847 GLU A OE1  6  
ATOM 8530  O OE2  . GLU A 1 64  ? -6.467  -1.110  -8.007  1.00 0.00 ? 847 GLU A OE2  6  
ATOM 8531  H H    . GLU A 1 64  ? -6.083  -0.214  -2.382  1.00 0.00 ? 847 GLU A H    6  
ATOM 8532  H HA   . GLU A 1 64  ? -4.541  -0.629  -4.847  1.00 0.00 ? 847 GLU A HA   6  
ATOM 8533  H HB2  . GLU A 1 64  ? -5.963  -2.657  -3.987  1.00 0.00 ? 847 GLU A HB2  6  
ATOM 8534  H HB3  . GLU A 1 64  ? -7.316  -1.732  -4.622  1.00 0.00 ? 847 GLU A HB3  6  
ATOM 8535  H HG2  . GLU A 1 64  ? -4.958  -2.165  -6.375  1.00 0.00 ? 847 GLU A HG2  6  
ATOM 8536  H HG3  . GLU A 1 64  ? -6.054  -3.515  -6.084  1.00 0.00 ? 847 GLU A HG3  6  
ATOM 8537  N N    . TYR A 1 65  ? -5.578  1.506   -5.577  1.00 0.00 ? 848 TYR A N    6  
ATOM 8538  C CA   . TYR A 1 65  ? -6.199  2.693   -6.152  1.00 0.00 ? 848 TYR A CA   6  
ATOM 8539  C C    . TYR A 1 65  ? -6.716  2.410   -7.560  1.00 0.00 ? 848 TYR A C    6  
ATOM 8540  O O    . TYR A 1 65  ? -6.606  1.291   -8.059  1.00 0.00 ? 848 TYR A O    6  
ATOM 8541  C CB   . TYR A 1 65  ? -5.201  3.851   -6.187  1.00 0.00 ? 848 TYR A CB   6  
ATOM 8542  C CG   . TYR A 1 65  ? -5.163  4.657   -4.908  1.00 0.00 ? 848 TYR A CG   6  
ATOM 8543  C CD1  . TYR A 1 65  ? -4.477  4.193   -3.792  1.00 0.00 ? 848 TYR A CD1  6  
ATOM 8544  C CD2  . TYR A 1 65  ? -5.815  5.880   -4.814  1.00 0.00 ? 848 TYR A CD2  6  
ATOM 8545  C CE1  . TYR A 1 65  ? -4.440  4.926   -2.621  1.00 0.00 ? 848 TYR A CE1  6  
ATOM 8546  C CE2  . TYR A 1 65  ? -5.782  6.620   -3.648  1.00 0.00 ? 848 TYR A CE2  6  
ATOM 8547  C CZ   . TYR A 1 65  ? -5.094  6.138   -2.554  1.00 0.00 ? 848 TYR A CZ   6  
ATOM 8548  O OH   . TYR A 1 65  ? -5.060  6.871   -1.390  1.00 0.00 ? 848 TYR A OH   6  
ATOM 8549  H H    . TYR A 1 65  ? -4.609  1.386   -5.662  1.00 0.00 ? 848 TYR A H    6  
ATOM 8550  H HA   . TYR A 1 65  ? -7.033  2.969   -5.524  1.00 0.00 ? 848 TYR A HA   6  
ATOM 8551  H HB2  . TYR A 1 65  ? -4.211  3.459   -6.360  1.00 0.00 ? 848 TYR A HB2  6  
ATOM 8552  H HB3  . TYR A 1 65  ? -5.464  4.520   -6.993  1.00 0.00 ? 848 TYR A HB3  6  
ATOM 8553  H HD1  . TYR A 1 65  ? -3.965  3.243   -3.847  1.00 0.00 ? 848 TYR A HD1  6  
ATOM 8554  H HD2  . TYR A 1 65  ? -6.353  6.255   -5.673  1.00 0.00 ? 848 TYR A HD2  6  
ATOM 8555  H HE1  . TYR A 1 65  ? -3.901  4.549   -1.764  1.00 0.00 ? 848 TYR A HE1  6  
ATOM 8556  H HE2  . TYR A 1 65  ? -6.294  7.569   -3.595  1.00 0.00 ? 848 TYR A HE2  6  
ATOM 8557  H HH   . TYR A 1 65  ? -5.482  7.721   -1.535  1.00 0.00 ? 848 TYR A HH   6  
ATOM 8558  N N    . GLU A 1 66  ? -7.279  3.434   -8.193  1.00 0.00 ? 849 GLU A N    6  
ATOM 8559  C CA   . GLU A 1 66  ? -7.813  3.296   -9.543  1.00 0.00 ? 849 GLU A CA   6  
ATOM 8560  C C    . GLU A 1 66  ? -6.755  3.650   -10.585 1.00 0.00 ? 849 GLU A C    6  
ATOM 8561  O O    . GLU A 1 66  ? -6.653  3.002   -11.626 1.00 0.00 ? 849 GLU A O    6  
ATOM 8562  C CB   . GLU A 1 66  ? -9.042  4.189   -9.724  1.00 0.00 ? 849 GLU A CB   6  
ATOM 8563  C CG   . GLU A 1 66  ? -9.598  4.181   -11.138 1.00 0.00 ? 849 GLU A CG   6  
ATOM 8564  C CD   . GLU A 1 66  ? -10.175 2.835   -11.530 1.00 0.00 ? 849 GLU A CD   6  
ATOM 8565  O OE1  . GLU A 1 66  ? -9.385  1.899   -11.775 1.00 0.00 ? 849 GLU A OE1  6  
ATOM 8566  O OE2  . GLU A 1 66  ? -11.417 2.716   -11.591 1.00 0.00 ? 849 GLU A OE2  6  
ATOM 8567  H H    . GLU A 1 66  ? -7.337  4.302   -7.743  1.00 0.00 ? 849 GLU A H    6  
ATOM 8568  H HA   . GLU A 1 66  ? -8.105  2.265   -9.680  1.00 0.00 ? 849 GLU A HA   6  
ATOM 8569  H HB2  . GLU A 1 66  ? -9.817  3.854   -9.051  1.00 0.00 ? 849 GLU A HB2  6  
ATOM 8570  H HB3  . GLU A 1 66  ? -8.773  5.204   -9.471  1.00 0.00 ? 849 GLU A HB3  6  
ATOM 8571  H HG2  . GLU A 1 66  ? -10.378 4.924   -11.209 1.00 0.00 ? 849 GLU A HG2  6  
ATOM 8572  H HG3  . GLU A 1 66  ? -8.803  4.429   -11.825 1.00 0.00 ? 849 GLU A HG3  6  
ATOM 8573  N N    . ASN A 1 67  ? -5.972  4.683   -10.297 1.00 0.00 ? 850 ASN A N    6  
ATOM 8574  C CA   . ASN A 1 67  ? -4.923  5.125   -11.209 1.00 0.00 ? 850 ASN A CA   6  
ATOM 8575  C C    . ASN A 1 67  ? -3.569  5.158   -10.506 1.00 0.00 ? 850 ASN A C    6  
ATOM 8576  O O    . ASN A 1 67  ? -3.497  5.173   -9.277  1.00 0.00 ? 850 ASN A O    6  
ATOM 8577  C CB   . ASN A 1 67  ? -5.254  6.510   -11.767 1.00 0.00 ? 850 ASN A CB   6  
ATOM 8578  C CG   . ASN A 1 67  ? -5.464  7.540   -10.673 1.00 0.00 ? 850 ASN A CG   6  
ATOM 8579  O OD1  . ASN A 1 67  ? -4.783  7.519   -9.647  1.00 0.00 ? 850 ASN A OD1  6  
ATOM 8580  N ND2  . ASN A 1 67  ? -6.409  8.447   -10.888 1.00 0.00 ? 850 ASN A ND2  6  
ATOM 8581  H H    . ASN A 1 67  ? -6.101  5.161   -9.451  1.00 0.00 ? 850 ASN A H    6  
ATOM 8582  H HA   . ASN A 1 67  ? -4.874  4.420   -12.025 1.00 0.00 ? 850 ASN A HA   6  
ATOM 8583  H HB2  . ASN A 1 67  ? -4.440  6.843   -12.396 1.00 0.00 ? 850 ASN A HB2  6  
ATOM 8584  H HB3  . ASN A 1 67  ? -6.156  6.449   -12.356 1.00 0.00 ? 850 ASN A HB3  6  
ATOM 8585  H HD21 . ASN A 1 67  ? -6.912  8.402   -11.729 1.00 0.00 ? 850 ASN A HD21 6  
ATOM 8586  H HD22 . ASN A 1 67  ? -6.566  9.125   -10.198 1.00 0.00 ? 850 ASN A HD22 6  
ATOM 8587  N N    . GLU A 1 68  ? -2.499  5.170   -11.294 1.00 0.00 ? 851 GLU A N    6  
ATOM 8588  C CA   . GLU A 1 68  ? -1.148  5.201   -10.747 1.00 0.00 ? 851 GLU A CA   6  
ATOM 8589  C C    . GLU A 1 68  ? -0.860  6.545   -10.083 1.00 0.00 ? 851 GLU A C    6  
ATOM 8590  O O    . GLU A 1 68  ? -0.319  6.601   -8.979  1.00 0.00 ? 851 GLU A O    6  
ATOM 8591  C CB   . GLU A 1 68  ? -0.120  4.935   -11.849 1.00 0.00 ? 851 GLU A CB   6  
ATOM 8592  C CG   . GLU A 1 68  ? -0.207  5.911   -13.011 1.00 0.00 ? 851 GLU A CG   6  
ATOM 8593  C CD   . GLU A 1 68  ? 0.725   5.547   -14.149 1.00 0.00 ? 851 GLU A CD   6  
ATOM 8594  O OE1  . GLU A 1 68  ? 1.924   5.887   -14.068 1.00 0.00 ? 851 GLU A OE1  6  
ATOM 8595  O OE2  . GLU A 1 68  ? 0.256   4.921   -15.123 1.00 0.00 ? 851 GLU A OE2  6  
ATOM 8596  H H    . GLU A 1 68  ? -2.621  5.157   -12.266 1.00 0.00 ? 851 GLU A H    6  
ATOM 8597  H HA   . GLU A 1 68  ? -1.073  4.423   -10.003 1.00 0.00 ? 851 GLU A HA   6  
ATOM 8598  H HB2  . GLU A 1 68  ? 0.871   4.999   -11.425 1.00 0.00 ? 851 GLU A HB2  6  
ATOM 8599  H HB3  . GLU A 1 68  ? -0.273  3.937   -12.233 1.00 0.00 ? 851 GLU A HB3  6  
ATOM 8600  H HG2  . GLU A 1 68  ? -1.220  5.918   -13.384 1.00 0.00 ? 851 GLU A HG2  6  
ATOM 8601  H HG3  . GLU A 1 68  ? 0.051   6.898   -12.655 1.00 0.00 ? 851 GLU A HG3  6  
ATOM 8602  N N    . SER A 1 69  ? -1.227  7.626   -10.764 1.00 0.00 ? 852 SER A N    6  
ATOM 8603  C CA   . SER A 1 69  ? -1.005  8.969   -10.244 1.00 0.00 ? 852 SER A CA   6  
ATOM 8604  C C    . SER A 1 69  ? -1.353  9.041   -8.760  1.00 0.00 ? 852 SER A C    6  
ATOM 8605  O O    . SER A 1 69  ? -0.499  9.341   -7.926  1.00 0.00 ? 852 SER A O    6  
ATOM 8606  C CB   . SER A 1 69  ? -1.840  9.986   -11.025 1.00 0.00 ? 852 SER A CB   6  
ATOM 8607  O OG   . SER A 1 69  ? -1.268  11.280  -10.951 1.00 0.00 ? 852 SER A OG   6  
ATOM 8608  H H    . SER A 1 69  ? -1.654  7.516   -11.640 1.00 0.00 ? 852 SER A H    6  
ATOM 8609  H HA   . SER A 1 69  ? 0.041   9.205   -10.368 1.00 0.00 ? 852 SER A HA   6  
ATOM 8610  H HB2  . SER A 1 69  ? -1.891  9.687   -12.060 1.00 0.00 ? 852 SER A HB2  6  
ATOM 8611  H HB3  . SER A 1 69  ? -2.838  10.022  -10.611 1.00 0.00 ? 852 SER A HB3  6  
ATOM 8612  H HG   . SER A 1 69  ? -1.494  11.683  -10.109 1.00 0.00 ? 852 SER A HG   6  
ATOM 8613  N N    . GLN A 1 70  ? -2.613  8.764   -8.440  1.00 0.00 ? 853 GLN A N    6  
ATOM 8614  C CA   . GLN A 1 70  ? -3.074  8.798   -7.057  1.00 0.00 ? 853 GLN A CA   6  
ATOM 8615  C C    . GLN A 1 70  ? -2.134  8.012   -6.150  1.00 0.00 ? 853 GLN A C    6  
ATOM 8616  O O    . GLN A 1 70  ? -1.520  8.571   -5.242  1.00 0.00 ? 853 GLN A O    6  
ATOM 8617  C CB   . GLN A 1 70  ? -4.492  8.231   -6.956  1.00 0.00 ? 853 GLN A CB   6  
ATOM 8618  C CG   . GLN A 1 70  ? -5.549  9.119   -7.593  1.00 0.00 ? 853 GLN A CG   6  
ATOM 8619  C CD   . GLN A 1 70  ? -6.828  8.369   -7.909  1.00 0.00 ? 853 GLN A CD   6  
ATOM 8620  O OE1  . GLN A 1 70  ? -6.886  7.144   -7.798  1.00 0.00 ? 853 GLN A OE1  6  
ATOM 8621  N NE2  . GLN A 1 70  ? -7.862  9.102   -8.305  1.00 0.00 ? 853 GLN A NE2  6  
ATOM 8622  H H    . GLN A 1 70  ? -3.246  8.532   -9.150  1.00 0.00 ? 853 GLN A H    6  
ATOM 8623  H HA   . GLN A 1 70  ? -3.085  9.829   -6.737  1.00 0.00 ? 853 GLN A HA   6  
ATOM 8624  H HB2  . GLN A 1 70  ? -4.518  7.269   -7.446  1.00 0.00 ? 853 GLN A HB2  6  
ATOM 8625  H HB3  . GLN A 1 70  ? -4.741  8.102   -5.913  1.00 0.00 ? 853 GLN A HB3  6  
ATOM 8626  H HG2  . GLN A 1 70  ? -5.781  9.925   -6.912  1.00 0.00 ? 853 GLN A HG2  6  
ATOM 8627  H HG3  . GLN A 1 70  ? -5.152  9.528   -8.510  1.00 0.00 ? 853 GLN A HG3  6  
ATOM 8628  H HE21 . GLN A 1 70  ? -7.742  10.073  -8.371  1.00 0.00 ? 853 GLN A HE21 6  
ATOM 8629  H HE22 . GLN A 1 70  ? -8.700  8.643   -8.516  1.00 0.00 ? 853 GLN A HE22 6  
ATOM 8630  N N    . ALA A 1 71  ? -2.026  6.711   -6.402  1.00 0.00 ? 854 ALA A N    6  
ATOM 8631  C CA   . ALA A 1 71  ? -1.159  5.849   -5.609  1.00 0.00 ? 854 ALA A CA   6  
ATOM 8632  C C    . ALA A 1 71  ? 0.154   6.548   -5.275  1.00 0.00 ? 854 ALA A C    6  
ATOM 8633  O O    . ALA A 1 71  ? 0.594   6.547   -4.125  1.00 0.00 ? 854 ALA A O    6  
ATOM 8634  C CB   . ALA A 1 71  ? -0.892  4.546   -6.348  1.00 0.00 ? 854 ALA A CB   6  
ATOM 8635  H H    . ALA A 1 71  ? -2.541  6.324   -7.140  1.00 0.00 ? 854 ALA A H    6  
ATOM 8636  H HA   . ALA A 1 71  ? -1.674  5.613   -4.689  1.00 0.00 ? 854 ALA A HA   6  
ATOM 8637  H HB1  . ALA A 1 71  ? -1.771  4.266   -6.911  1.00 0.00 ? 854 ALA A HB1  6  
ATOM 8638  H HB2  . ALA A 1 71  ? -0.060  4.679   -7.023  1.00 0.00 ? 854 ALA A HB2  6  
ATOM 8639  H HB3  . ALA A 1 71  ? -0.658  3.770   -5.635  1.00 0.00 ? 854 ALA A HB3  6  
ATOM 8640  N N    . SER A 1 72  ? 0.776   7.145   -6.287  1.00 0.00 ? 855 SER A N    6  
ATOM 8641  C CA   . SER A 1 72  ? 2.042   7.845   -6.101  1.00 0.00 ? 855 SER A CA   6  
ATOM 8642  C C    . SER A 1 72  ? 1.895   8.971   -5.082  1.00 0.00 ? 855 SER A C    6  
ATOM 8643  O O    . SER A 1 72  ? 2.565   8.978   -4.049  1.00 0.00 ? 855 SER A O    6  
ATOM 8644  C CB   . SER A 1 72  ? 2.538   8.409   -7.433  1.00 0.00 ? 855 SER A CB   6  
ATOM 8645  O OG   . SER A 1 72  ? 3.930   8.668   -7.391  1.00 0.00 ? 855 SER A OG   6  
ATOM 8646  H H    . SER A 1 72  ? 0.374   7.111   -7.181  1.00 0.00 ? 855 SER A H    6  
ATOM 8647  H HA   . SER A 1 72  ? 2.763   7.132   -5.730  1.00 0.00 ? 855 SER A HA   6  
ATOM 8648  H HB2  . SER A 1 72  ? 2.340   7.695   -8.219  1.00 0.00 ? 855 SER A HB2  6  
ATOM 8649  H HB3  . SER A 1 72  ? 2.018   9.332   -7.646  1.00 0.00 ? 855 SER A HB3  6  
ATOM 8650  H HG   . SER A 1 72  ? 4.401   7.857   -7.182  1.00 0.00 ? 855 SER A HG   6  
ATOM 8651  N N    . GLN A 1 73  ? 1.015   9.920   -5.381  1.00 0.00 ? 856 GLN A N    6  
ATOM 8652  C CA   . GLN A 1 73  ? 0.781   11.052  -4.493  1.00 0.00 ? 856 GLN A CA   6  
ATOM 8653  C C    . GLN A 1 73  ? 0.518   10.579  -3.067  1.00 0.00 ? 856 GLN A C    6  
ATOM 8654  O O    . GLN A 1 73  ? 1.202   10.991  -2.130  1.00 0.00 ? 856 GLN A O    6  
ATOM 8655  C CB   . GLN A 1 73  ? -0.402  11.884  -4.992  1.00 0.00 ? 856 GLN A CB   6  
ATOM 8656  C CG   . GLN A 1 73  ? -0.324  13.350  -4.598  1.00 0.00 ? 856 GLN A CG   6  
ATOM 8657  C CD   . GLN A 1 73  ? 0.562   14.158  -5.525  1.00 0.00 ? 856 GLN A CD   6  
ATOM 8658  O OE1  . GLN A 1 73  ? 1.651   14.587  -5.145  1.00 0.00 ? 856 GLN A OE1  6  
ATOM 8659  N NE2  . GLN A 1 73  ? 0.098   14.370  -6.751  1.00 0.00 ? 856 GLN A NE2  6  
ATOM 8660  H H    . GLN A 1 73  ? 0.512   9.859   -6.220  1.00 0.00 ? 856 GLN A H    6  
ATOM 8661  H HA   . GLN A 1 73  ? 1.668   11.666  -4.497  1.00 0.00 ? 856 GLN A HA   6  
ATOM 8662  H HB2  . GLN A 1 73  ? -0.439  11.825  -6.070  1.00 0.00 ? 856 GLN A HB2  6  
ATOM 8663  H HB3  . GLN A 1 73  ? -1.314  11.472  -4.585  1.00 0.00 ? 856 GLN A HB3  6  
ATOM 8664  H HG2  . GLN A 1 73  ? -1.319  13.769  -4.620  1.00 0.00 ? 856 GLN A HG2  6  
ATOM 8665  H HG3  . GLN A 1 73  ? 0.071   13.419  -3.595  1.00 0.00 ? 856 GLN A HG3  6  
ATOM 8666  H HE21 . GLN A 1 73  ? -0.779  13.999  -6.984  1.00 0.00 ? 856 GLN A HE21 6  
ATOM 8667  H HE22 . GLN A 1 73  ? 0.649   14.890  -7.371  1.00 0.00 ? 856 GLN A HE22 6  
ATOM 8668  N N    . ALA A 1 74  ? -0.476  9.712   -2.910  1.00 0.00 ? 857 ALA A N    6  
ATOM 8669  C CA   . ALA A 1 74  ? -0.828  9.182   -1.598  1.00 0.00 ? 857 ALA A CA   6  
ATOM 8670  C C    . ALA A 1 74  ? 0.411   8.702   -0.850  1.00 0.00 ? 857 ALA A C    6  
ATOM 8671  O O    . ALA A 1 74  ? 0.538   8.908   0.357   1.00 0.00 ? 857 ALA A O    6  
ATOM 8672  C CB   . ALA A 1 74  ? -1.833  8.049   -1.739  1.00 0.00 ? 857 ALA A CB   6  
ATOM 8673  H H    . ALA A 1 74  ? -0.985  9.421   -3.695  1.00 0.00 ? 857 ALA A H    6  
ATOM 8674  H HA   . ALA A 1 74  ? -1.294  9.975   -1.031  1.00 0.00 ? 857 ALA A HA   6  
ATOM 8675  H HB1  . ALA A 1 74  ? -2.244  7.811   -0.769  1.00 0.00 ? 857 ALA A HB1  6  
ATOM 8676  H HB2  . ALA A 1 74  ? -2.629  8.354   -2.402  1.00 0.00 ? 857 ALA A HB2  6  
ATOM 8677  H HB3  . ALA A 1 74  ? -1.340  7.178   -2.145  1.00 0.00 ? 857 ALA A HB3  6  
ATOM 8678  N N    . VAL A 1 75  ? 1.323   8.061   -1.574  1.00 0.00 ? 858 VAL A N    6  
ATOM 8679  C CA   . VAL A 1 75  ? 2.552   7.552   -0.978  1.00 0.00 ? 858 VAL A CA   6  
ATOM 8680  C C    . VAL A 1 75  ? 3.507   8.689   -0.632  1.00 0.00 ? 858 VAL A C    6  
ATOM 8681  O O    . VAL A 1 75  ? 3.976   8.796   0.501   1.00 0.00 ? 858 VAL A O    6  
ATOM 8682  C CB   . VAL A 1 75  ? 3.267   6.566   -1.922  1.00 0.00 ? 858 VAL A CB   6  
ATOM 8683  C CG1  . VAL A 1 75  ? 4.682   6.291   -1.436  1.00 0.00 ? 858 VAL A CG1  6  
ATOM 8684  C CG2  . VAL A 1 75  ? 2.474   5.273   -2.041  1.00 0.00 ? 858 VAL A CG2  6  
ATOM 8685  H H    . VAL A 1 75  ? 1.165   7.927   -2.532  1.00 0.00 ? 858 VAL A H    6  
ATOM 8686  H HA   . VAL A 1 75  ? 2.291   7.025   -0.072  1.00 0.00 ? 858 VAL A HA   6  
ATOM 8687  H HB   . VAL A 1 75  ? 3.328   7.017   -2.902  1.00 0.00 ? 858 VAL A HB   6  
ATOM 8688  H HG11 . VAL A 1 75  ? 5.083   5.436   -1.960  1.00 0.00 ? 858 VAL A HG11 6  
ATOM 8689  H HG12 . VAL A 1 75  ? 5.302   7.155   -1.625  1.00 0.00 ? 858 VAL A HG12 6  
ATOM 8690  H HG13 . VAL A 1 75  ? 4.664   6.086   -0.375  1.00 0.00 ? 858 VAL A HG13 6  
ATOM 8691  H HG21 . VAL A 1 75  ? 1.622   5.313   -1.380  1.00 0.00 ? 858 VAL A HG21 6  
ATOM 8692  H HG22 . VAL A 1 75  ? 2.135   5.151   -3.059  1.00 0.00 ? 858 VAL A HG22 6  
ATOM 8693  H HG23 . VAL A 1 75  ? 3.103   4.439   -1.769  1.00 0.00 ? 858 VAL A HG23 6  
ATOM 8694  N N    . MET A 1 76  ? 3.790   9.537   -1.615  1.00 0.00 ? 859 MET A N    6  
ATOM 8695  C CA   . MET A 1 76  ? 4.688   10.668  -1.413  1.00 0.00 ? 859 MET A CA   6  
ATOM 8696  C C    . MET A 1 76  ? 4.210   11.542  -0.258  1.00 0.00 ? 859 MET A C    6  
ATOM 8697  O O    . MET A 1 76  ? 4.966   12.356  0.273   1.00 0.00 ? 859 MET A O    6  
ATOM 8698  C CB   . MET A 1 76  ? 4.787   11.503  -2.692  1.00 0.00 ? 859 MET A CB   6  
ATOM 8699  C CG   . MET A 1 76  ? 5.902   11.057  -3.623  1.00 0.00 ? 859 MET A CG   6  
ATOM 8700  S SD   . MET A 1 76  ? 7.537   11.232  -2.883  1.00 0.00 ? 859 MET A SD   6  
ATOM 8701  C CE   . MET A 1 76  ? 8.571   10.561  -4.183  1.00 0.00 ? 859 MET A CE   6  
ATOM 8702  H H    . MET A 1 76  ? 3.385   9.400   -2.497  1.00 0.00 ? 859 MET A H    6  
ATOM 8703  H HA   . MET A 1 76  ? 5.665   10.277  -1.173  1.00 0.00 ? 859 MET A HA   6  
ATOM 8704  H HB2  . MET A 1 76  ? 3.851   11.433  -3.226  1.00 0.00 ? 859 MET A HB2  6  
ATOM 8705  H HB3  . MET A 1 76  ? 4.963   12.533  -2.423  1.00 0.00 ? 859 MET A HB3  6  
ATOM 8706  H HG2  . MET A 1 76  ? 5.748   10.019  -3.878  1.00 0.00 ? 859 MET A HG2  6  
ATOM 8707  H HG3  . MET A 1 76  ? 5.863   11.655  -4.522  1.00 0.00 ? 859 MET A HG3  6  
ATOM 8708  H HE1  . MET A 1 76  ? 8.203   10.893  -5.143  1.00 0.00 ? 859 MET A HE1  6  
ATOM 8709  H HE2  . MET A 1 76  ? 9.586   10.904  -4.048  1.00 0.00 ? 859 MET A HE2  6  
ATOM 8710  H HE3  . MET A 1 76  ? 8.546   9.482   -4.141  1.00 0.00 ? 859 MET A HE3  6  
ATOM 8711  N N    . LYS A 1 77  ? 2.950   11.369  0.127   1.00 0.00 ? 860 LYS A N    6  
ATOM 8712  C CA   . LYS A 1 77  ? 2.371   12.141  1.221   1.00 0.00 ? 860 LYS A CA   6  
ATOM 8713  C C    . LYS A 1 77  ? 2.274   11.299  2.489   1.00 0.00 ? 860 LYS A C    6  
ATOM 8714  O O    . LYS A 1 77  ? 2.436   11.809  3.597   1.00 0.00 ? 860 LYS A O    6  
ATOM 8715  C CB   . LYS A 1 77  ? 0.983   12.654  0.830   1.00 0.00 ? 860 LYS A CB   6  
ATOM 8716  C CG   . LYS A 1 77  ? 1.019   13.862  -0.091  1.00 0.00 ? 860 LYS A CG   6  
ATOM 8717  C CD   . LYS A 1 77  ? 1.135   15.158  0.694   1.00 0.00 ? 860 LYS A CD   6  
ATOM 8718  C CE   . LYS A 1 77  ? 0.757   16.361  -0.158  1.00 0.00 ? 860 LYS A CE   6  
ATOM 8719  N NZ   . LYS A 1 77  ? 0.482   17.565  0.674   1.00 0.00 ? 860 LYS A NZ   6  
ATOM 8720  H H    . LYS A 1 77  ? 2.396   10.705  -0.335  1.00 0.00 ? 860 LYS A H    6  
ATOM 8721  H HA   . LYS A 1 77  ? 3.017   12.984  1.410   1.00 0.00 ? 860 LYS A HA   6  
ATOM 8722  H HB2  . LYS A 1 77  ? 0.447   11.862  0.329   1.00 0.00 ? 860 LYS A HB2  6  
ATOM 8723  H HB3  . LYS A 1 77  ? 0.448   12.928  1.728   1.00 0.00 ? 860 LYS A HB3  6  
ATOM 8724  H HG2  . LYS A 1 77  ? 1.869   13.776  -0.750  1.00 0.00 ? 860 LYS A HG2  6  
ATOM 8725  H HG3  . LYS A 1 77  ? 0.109   13.885  -0.674  1.00 0.00 ? 860 LYS A HG3  6  
ATOM 8726  H HD2  . LYS A 1 77  ? 0.474   15.113  1.546   1.00 0.00 ? 860 LYS A HD2  6  
ATOM 8727  H HD3  . LYS A 1 77  ? 2.155   15.274  1.032   1.00 0.00 ? 860 LYS A HD3  6  
ATOM 8728  H HE2  . LYS A 1 77  ? 1.571   16.578  -0.832  1.00 0.00 ? 860 LYS A HE2  6  
ATOM 8729  H HE3  . LYS A 1 77  ? -0.128  16.118  -0.728  1.00 0.00 ? 860 LYS A HE3  6  
ATOM 8730  H HZ1  . LYS A 1 77  ? 1.360   17.898  1.122   1.00 0.00 ? 860 LYS A HZ1  6  
ATOM 8731  H HZ2  . LYS A 1 77  ? -0.207  17.335  1.419   1.00 0.00 ? 860 LYS A HZ2  6  
ATOM 8732  H HZ3  . LYS A 1 77  ? 0.096   18.328  0.083   1.00 0.00 ? 860 LYS A HZ3  6  
ATOM 8733  N N    . MET A 1 78  ? 2.011   10.008  2.318   1.00 0.00 ? 861 MET A N    6  
ATOM 8734  C CA   . MET A 1 78  ? 1.896   9.096   3.451   1.00 0.00 ? 861 MET A CA   6  
ATOM 8735  C C    . MET A 1 78  ? 3.274   8.698   3.971   1.00 0.00 ? 861 MET A C    6  
ATOM 8736  O O    . MET A 1 78  ? 3.569   8.854   5.156   1.00 0.00 ? 861 MET A O    6  
ATOM 8737  C CB   . MET A 1 78  ? 1.110   7.846   3.048   1.00 0.00 ? 861 MET A CB   6  
ATOM 8738  C CG   . MET A 1 78  ? -0.369  8.108   2.812   1.00 0.00 ? 861 MET A CG   6  
ATOM 8739  S SD   . MET A 1 78  ? -1.138  6.857   1.766   1.00 0.00 ? 861 MET A SD   6  
ATOM 8740  C CE   . MET A 1 78  ? -2.435  6.262   2.848   1.00 0.00 ? 861 MET A CE   6  
ATOM 8741  H H    . MET A 1 78  ? 1.891   9.659   1.410   1.00 0.00 ? 861 MET A H    6  
ATOM 8742  H HA   . MET A 1 78  ? 1.362   9.609   4.236   1.00 0.00 ? 861 MET A HA   6  
ATOM 8743  H HB2  . MET A 1 78  ? 1.532   7.447   2.139   1.00 0.00 ? 861 MET A HB2  6  
ATOM 8744  H HB3  . MET A 1 78  ? 1.201   7.109   3.833   1.00 0.00 ? 861 MET A HB3  6  
ATOM 8745  H HG2  . MET A 1 78  ? -0.876  8.120   3.765   1.00 0.00 ? 861 MET A HG2  6  
ATOM 8746  H HG3  . MET A 1 78  ? -0.478  9.072   2.337   1.00 0.00 ? 861 MET A HG3  6  
ATOM 8747  H HE1  . MET A 1 78  ? -2.328  6.715   3.822   1.00 0.00 ? 861 MET A HE1  6  
ATOM 8748  H HE2  . MET A 1 78  ? -3.397  6.524   2.433   1.00 0.00 ? 861 MET A HE2  6  
ATOM 8749  H HE3  . MET A 1 78  ? -2.362  5.188   2.940   1.00 0.00 ? 861 MET A HE3  6  
ATOM 8750  N N    . ASP A 1 79  ? 4.112   8.184   3.078   1.00 0.00 ? 862 ASP A N    6  
ATOM 8751  C CA   . ASP A 1 79  ? 5.459   7.765   3.447   1.00 0.00 ? 862 ASP A CA   6  
ATOM 8752  C C    . ASP A 1 79  ? 6.040   8.683   4.518   1.00 0.00 ? 862 ASP A C    6  
ATOM 8753  O O    . ASP A 1 79  ? 6.407   9.824   4.241   1.00 0.00 ? 862 ASP A O    6  
ATOM 8754  C CB   . ASP A 1 79  ? 6.369   7.758   2.217   1.00 0.00 ? 862 ASP A CB   6  
ATOM 8755  C CG   . ASP A 1 79  ? 6.713   9.156   1.743   1.00 0.00 ? 862 ASP A CG   6  
ATOM 8756  O OD1  . ASP A 1 79  ? 5.784   9.977   1.596   1.00 0.00 ? 862 ASP A OD1  6  
ATOM 8757  O OD2  . ASP A 1 79  ? 7.911   9.429   1.519   1.00 0.00 ? 862 ASP A OD2  6  
ATOM 8758  H H    . ASP A 1 79  ? 3.818   8.085   2.148   1.00 0.00 ? 862 ASP A H    6  
ATOM 8759  H HA   . ASP A 1 79  ? 5.398   6.763   3.844   1.00 0.00 ? 862 ASP A HA   6  
ATOM 8760  H HB2  . ASP A 1 79  ? 7.288   7.244   2.460   1.00 0.00 ? 862 ASP A HB2  6  
ATOM 8761  H HB3  . ASP A 1 79  ? 5.872   7.236   1.413   1.00 0.00 ? 862 ASP A HB3  6  
ATOM 8762  N N    . GLY A 1 80  ? 6.118   8.176   5.745   1.00 0.00 ? 863 GLY A N    6  
ATOM 8763  C CA   . GLY A 1 80  ? 6.653   8.964   6.840   1.00 0.00 ? 863 GLY A CA   6  
ATOM 8764  C C    . GLY A 1 80  ? 5.621   9.899   7.440   1.00 0.00 ? 863 GLY A C    6  
ATOM 8765  O O    . GLY A 1 80  ? 5.916   11.061  7.720   1.00 0.00 ? 863 GLY A O    6  
ATOM 8766  H H    . GLY A 1 80  ? 5.810   7.260   5.908   1.00 0.00 ? 863 GLY A H    6  
ATOM 8767  H HA2  . GLY A 1 80  ? 7.008   8.296   7.610   1.00 0.00 ? 863 GLY A HA2  6  
ATOM 8768  H HA3  . GLY A 1 80  ? 7.483   9.550   6.475   1.00 0.00 ? 863 GLY A HA3  6  
ATOM 8769  N N    . MET A 1 81  ? 4.409   9.392   7.636   1.00 0.00 ? 864 MET A N    6  
ATOM 8770  C CA   . MET A 1 81  ? 3.330   10.191  8.206   1.00 0.00 ? 864 MET A CA   6  
ATOM 8771  C C    . MET A 1 81  ? 3.002   9.730   9.622   1.00 0.00 ? 864 MET A C    6  
ATOM 8772  O O    . MET A 1 81  ? 3.218   8.570   9.975   1.00 0.00 ? 864 MET A O    6  
ATOM 8773  C CB   . MET A 1 81  ? 2.081   10.103  7.326   1.00 0.00 ? 864 MET A CB   6  
ATOM 8774  C CG   . MET A 1 81  ? 1.420   8.734   7.345   1.00 0.00 ? 864 MET A CG   6  
ATOM 8775  S SD   . MET A 1 81  ? -0.207  8.738   6.567   1.00 0.00 ? 864 MET A SD   6  
ATOM 8776  C CE   . MET A 1 81  ? -1.072  9.920   7.597   1.00 0.00 ? 864 MET A CE   6  
ATOM 8777  H H    . MET A 1 81  ? 4.234   8.459   7.393   1.00 0.00 ? 864 MET A H    6  
ATOM 8778  H HA   . MET A 1 81  ? 3.662   11.218  8.242   1.00 0.00 ? 864 MET A HA   6  
ATOM 8779  H HB2  . MET A 1 81  ? 1.362   10.831  7.668   1.00 0.00 ? 864 MET A HB2  6  
ATOM 8780  H HB3  . MET A 1 81  ? 2.356   10.331  6.307   1.00 0.00 ? 864 MET A HB3  6  
ATOM 8781  H HG2  . MET A 1 81  ? 2.053   8.035   6.819   1.00 0.00 ? 864 MET A HG2  6  
ATOM 8782  H HG3  . MET A 1 81  ? 1.312   8.417   8.372   1.00 0.00 ? 864 MET A HG3  6  
ATOM 8783  H HE1  . MET A 1 81  ? -1.124  10.871  7.089   1.00 0.00 ? 864 MET A HE1  6  
ATOM 8784  H HE2  . MET A 1 81  ? -2.072  9.561   7.793   1.00 0.00 ? 864 MET A HE2  6  
ATOM 8785  H HE3  . MET A 1 81  ? -0.542  10.039  8.531   1.00 0.00 ? 864 MET A HE3  6  
ATOM 8786  N N    . THR A 1 82  ? 2.479   10.646  10.432  1.00 0.00 ? 865 THR A N    6  
ATOM 8787  C CA   . THR A 1 82  ? 2.122   10.333  11.810  1.00 0.00 ? 865 THR A CA   6  
ATOM 8788  C C    . THR A 1 82  ? 0.675   9.865   11.911  1.00 0.00 ? 865 THR A C    6  
ATOM 8789  O O    . THR A 1 82  ? -0.225  10.470  11.328  1.00 0.00 ? 865 THR A O    6  
ATOM 8790  C CB   . THR A 1 82  ? 2.321   11.551  12.732  1.00 0.00 ? 865 THR A CB   6  
ATOM 8791  O OG1  . THR A 1 82  ? 3.487   12.281  12.334  1.00 0.00 ? 865 THR A OG1  6  
ATOM 8792  C CG2  . THR A 1 82  ? 2.460   11.115  14.182  1.00 0.00 ? 865 THR A CG2  6  
ATOM 8793  H H    . THR A 1 82  ? 2.330   11.553  10.093  1.00 0.00 ? 865 THR A H    6  
ATOM 8794  H HA   . THR A 1 82  ? 2.772   9.540   12.151  1.00 0.00 ? 865 THR A HA   6  
ATOM 8795  H HB   . THR A 1 82  ? 1.456   12.193  12.646  1.00 0.00 ? 865 THR A HB   6  
ATOM 8796  H HG1  . THR A 1 82  ? 3.531   12.316  11.375  1.00 0.00 ? 865 THR A HG1  6  
ATOM 8797  H HG21 . THR A 1 82  ? 3.221   10.352  14.257  1.00 0.00 ? 865 THR A HG21 6  
ATOM 8798  H HG22 . THR A 1 82  ? 1.518   10.720  14.532  1.00 0.00 ? 865 THR A HG22 6  
ATOM 8799  H HG23 . THR A 1 82  ? 2.742   11.964  14.788  1.00 0.00 ? 865 THR A HG23 6  
ATOM 8800  N N    . ILE A 1 83  ? 0.458   8.785   12.654  1.00 0.00 ? 866 ILE A N    6  
ATOM 8801  C CA   . ILE A 1 83  ? -0.881  8.237   12.832  1.00 0.00 ? 866 ILE A CA   6  
ATOM 8802  C C    . ILE A 1 83  ? -1.047  7.630   14.222  1.00 0.00 ? 866 ILE A C    6  
ATOM 8803  O O    . ILE A 1 83  ? -0.526  6.552   14.506  1.00 0.00 ? 866 ILE A O    6  
ATOM 8804  C CB   . ILE A 1 83  ? -1.195  7.162   11.775  1.00 0.00 ? 866 ILE A CB   6  
ATOM 8805  C CG1  . ILE A 1 83  ? -1.380  7.808   10.400  1.00 0.00 ? 866 ILE A CG1  6  
ATOM 8806  C CG2  . ILE A 1 83  ? -2.438  6.378   12.169  1.00 0.00 ? 866 ILE A CG2  6  
ATOM 8807  C CD1  . ILE A 1 83  ? -1.416  6.810   9.264   1.00 0.00 ? 866 ILE A CD1  6  
ATOM 8808  H H    . ILE A 1 83  ? 1.216   8.346   13.094  1.00 0.00 ? 866 ILE A H    6  
ATOM 8809  H HA   . ILE A 1 83  ? -1.589  9.045   12.717  1.00 0.00 ? 866 ILE A HA   6  
ATOM 8810  H HB   . ILE A 1 83  ? -0.363  6.476   11.733  1.00 0.00 ? 866 ILE A HB   6  
ATOM 8811  H HG12 . ILE A 1 83  ? -2.309  8.356   10.388  1.00 0.00 ? 866 ILE A HG12 6  
ATOM 8812  H HG13 . ILE A 1 83  ? -0.562  8.490   10.218  1.00 0.00 ? 866 ILE A HG13 6  
ATOM 8813  H HG21 . ILE A 1 83  ? -3.268  7.057   12.290  1.00 0.00 ? 866 ILE A HG21 6  
ATOM 8814  H HG22 . ILE A 1 83  ? -2.670  5.661   11.396  1.00 0.00 ? 866 ILE A HG22 6  
ATOM 8815  H HG23 . ILE A 1 83  ? -2.257  5.861   13.099  1.00 0.00 ? 866 ILE A HG23 6  
ATOM 8816  H HD11 . ILE A 1 83  ? -1.441  5.807   9.665   1.00 0.00 ? 866 ILE A HD11 6  
ATOM 8817  H HD12 . ILE A 1 83  ? -2.296  6.980   8.662   1.00 0.00 ? 866 ILE A HD12 6  
ATOM 8818  H HD13 . ILE A 1 83  ? -0.533  6.929   8.652   1.00 0.00 ? 866 ILE A HD13 6  
ATOM 8819  N N    . LYS A 1 84  ? -1.776  8.331   15.084  1.00 0.00 ? 867 LYS A N    6  
ATOM 8820  C CA   . LYS A 1 84  ? -2.014  7.861   16.443  1.00 0.00 ? 867 LYS A CA   6  
ATOM 8821  C C    . LYS A 1 84  ? -0.718  7.842   17.247  1.00 0.00 ? 867 LYS A C    6  
ATOM 8822  O O    . LYS A 1 84  ? -0.505  6.958   18.076  1.00 0.00 ? 867 LYS A O    6  
ATOM 8823  C CB   . LYS A 1 84  ? -2.633  6.462   16.421  1.00 0.00 ? 867 LYS A CB   6  
ATOM 8824  C CG   . LYS A 1 84  ? -3.790  6.324   15.446  1.00 0.00 ? 867 LYS A CG   6  
ATOM 8825  C CD   . LYS A 1 84  ? -5.117  6.665   16.104  1.00 0.00 ? 867 LYS A CD   6  
ATOM 8826  C CE   . LYS A 1 84  ? -5.740  5.447   16.768  1.00 0.00 ? 867 LYS A CE   6  
ATOM 8827  N NZ   . LYS A 1 84  ? -7.123  5.722   17.246  1.00 0.00 ? 867 LYS A NZ   6  
ATOM 8828  H H    . LYS A 1 84  ? -2.165  9.184   14.798  1.00 0.00 ? 867 LYS A H    6  
ATOM 8829  H HA   . LYS A 1 84  ? -2.706  8.544   16.914  1.00 0.00 ? 867 LYS A HA   6  
ATOM 8830  H HB2  . LYS A 1 84  ? -1.870  5.748   16.144  1.00 0.00 ? 867 LYS A HB2  6  
ATOM 8831  H HB3  . LYS A 1 84  ? -2.994  6.224   17.411  1.00 0.00 ? 867 LYS A HB3  6  
ATOM 8832  H HG2  . LYS A 1 84  ? -3.630  6.993   14.615  1.00 0.00 ? 867 LYS A HG2  6  
ATOM 8833  H HG3  . LYS A 1 84  ? -3.828  5.305   15.088  1.00 0.00 ? 867 LYS A HG3  6  
ATOM 8834  H HD2  . LYS A 1 84  ? -4.952  7.424   16.854  1.00 0.00 ? 867 LYS A HD2  6  
ATOM 8835  H HD3  . LYS A 1 84  ? -5.795  7.042   15.352  1.00 0.00 ? 867 LYS A HD3  6  
ATOM 8836  H HE2  . LYS A 1 84  ? -5.770  4.639   16.052  1.00 0.00 ? 867 LYS A HE2  6  
ATOM 8837  H HE3  . LYS A 1 84  ? -5.127  5.159   17.609  1.00 0.00 ? 867 LYS A HE3  6  
ATOM 8838  H HZ1  . LYS A 1 84  ? -7.555  4.849   17.609  1.00 0.00 ? 867 LYS A HZ1  6  
ATOM 8839  H HZ2  . LYS A 1 84  ? -7.706  6.085   16.465  1.00 0.00 ? 867 LYS A HZ2  6  
ATOM 8840  H HZ3  . LYS A 1 84  ? -7.103  6.430   18.008  1.00 0.00 ? 867 LYS A HZ3  6  
ATOM 8841  N N    . GLU A 1 85  ? 0.142   8.824   16.997  1.00 0.00 ? 868 GLU A N    6  
ATOM 8842  C CA   . GLU A 1 85  ? 1.417   8.919   17.699  1.00 0.00 ? 868 GLU A CA   6  
ATOM 8843  C C    . GLU A 1 85  ? 2.369   7.814   17.251  1.00 0.00 ? 868 GLU A C    6  
ATOM 8844  O O    . GLU A 1 85  ? 3.054   7.201   18.068  1.00 0.00 ? 868 GLU A O    6  
ATOM 8845  C CB   . GLU A 1 85  ? 1.199   8.837   19.211  1.00 0.00 ? 868 GLU A CB   6  
ATOM 8846  C CG   . GLU A 1 85  ? 2.243   9.590   20.019  1.00 0.00 ? 868 GLU A CG   6  
ATOM 8847  C CD   . GLU A 1 85  ? 2.536   10.966  19.453  1.00 0.00 ? 868 GLU A CD   6  
ATOM 8848  O OE1  . GLU A 1 85  ? 1.620   11.570  18.856  1.00 0.00 ? 868 GLU A OE1  6  
ATOM 8849  O OE2  . GLU A 1 85  ? 3.681   11.440  19.607  1.00 0.00 ? 868 GLU A OE2  6  
ATOM 8850  H H    . GLU A 1 85  ? -0.085  9.500   16.324  1.00 0.00 ? 868 GLU A H    6  
ATOM 8851  H HA   . GLU A 1 85  ? 1.857   9.876   17.460  1.00 0.00 ? 868 GLU A HA   6  
ATOM 8852  H HB2  . GLU A 1 85  ? 0.227   9.247   19.446  1.00 0.00 ? 868 GLU A HB2  6  
ATOM 8853  H HB3  . GLU A 1 85  ? 1.223   7.799   19.510  1.00 0.00 ? 868 GLU A HB3  6  
ATOM 8854  H HG2  . GLU A 1 85  ? 1.884   9.703   21.031  1.00 0.00 ? 868 GLU A HG2  6  
ATOM 8855  H HG3  . GLU A 1 85  ? 3.158   9.017   20.024  1.00 0.00 ? 868 GLU A HG3  6  
ATOM 8856  N N    . ASN A 1 86  ? 2.405   7.566   15.945  1.00 0.00 ? 869 ASN A N    6  
ATOM 8857  C CA   . ASN A 1 86  ? 3.272   6.534   15.387  1.00 0.00 ? 869 ASN A CA   6  
ATOM 8858  C C    . ASN A 1 86  ? 3.603   6.833   13.928  1.00 0.00 ? 869 ASN A C    6  
ATOM 8859  O O    . ASN A 1 86  ? 2.725   6.813   13.065  1.00 0.00 ? 869 ASN A O    6  
ATOM 8860  C CB   . ASN A 1 86  ? 2.604   5.162   15.500  1.00 0.00 ? 869 ASN A CB   6  
ATOM 8861  C CG   . ASN A 1 86  ? 3.601   4.024   15.397  1.00 0.00 ? 869 ASN A CG   6  
ATOM 8862  O OD1  . ASN A 1 86  ? 4.424   3.986   14.482  1.00 0.00 ? 869 ASN A OD1  6  
ATOM 8863  N ND2  . ASN A 1 86  ? 3.530   3.089   16.338  1.00 0.00 ? 869 ASN A ND2  6  
ATOM 8864  H H    . ASN A 1 86  ? 1.836   8.089   15.343  1.00 0.00 ? 869 ASN A H    6  
ATOM 8865  H HA   . ASN A 1 86  ? 4.188   6.527   15.958  1.00 0.00 ? 869 ASN A HA   6  
ATOM 8866  H HB2  . ASN A 1 86  ? 2.102   5.090   16.454  1.00 0.00 ? 869 ASN A HB2  6  
ATOM 8867  H HB3  . ASN A 1 86  ? 1.879   5.055   14.707  1.00 0.00 ? 869 ASN A HB3  6  
ATOM 8868  H HD21 . ASN A 1 86  ? 2.848   3.185   17.035  1.00 0.00 ? 869 ASN A HD21 6  
ATOM 8869  H HD22 . ASN A 1 86  ? 4.163   2.342   16.295  1.00 0.00 ? 869 ASN A HD22 6  
ATOM 8870  N N    . ILE A 1 87  ? 4.875   7.108   13.661  1.00 0.00 ? 870 ILE A N    6  
ATOM 8871  C CA   . ILE A 1 87  ? 5.323   7.409   12.307  1.00 0.00 ? 870 ILE A CA   6  
ATOM 8872  C C    . ILE A 1 87  ? 5.295   6.162   11.429  1.00 0.00 ? 870 ILE A C    6  
ATOM 8873  O O    . ILE A 1 87  ? 6.092   5.242   11.615  1.00 0.00 ? 870 ILE A O    6  
ATOM 8874  C CB   . ILE A 1 87  ? 6.747   7.995   12.302  1.00 0.00 ? 870 ILE A CB   6  
ATOM 8875  C CG1  . ILE A 1 87  ? 6.712   9.480   12.671  1.00 0.00 ? 870 ILE A CG1  6  
ATOM 8876  C CG2  . ILE A 1 87  ? 7.396   7.798   10.940  1.00 0.00 ? 870 ILE A CG2  6  
ATOM 8877  C CD1  . ILE A 1 87  ? 5.855   10.313  11.744  1.00 0.00 ? 870 ILE A CD1  6  
ATOM 8878  H H    . ILE A 1 87  ? 5.528   7.108   14.391  1.00 0.00 ? 870 ILE A H    6  
ATOM 8879  H HA   . ILE A 1 87  ? 4.651   8.145   11.890  1.00 0.00 ? 870 ILE A HA   6  
ATOM 8880  H HB   . ILE A 1 87  ? 7.334   7.463   13.034  1.00 0.00 ? 870 ILE A HB   6  
ATOM 8881  H HG12 . ILE A 1 87  ? 6.320   9.587   13.670  1.00 0.00 ? 870 ILE A HG12 6  
ATOM 8882  H HG13 . ILE A 1 87  ? 7.718   9.874   12.639  1.00 0.00 ? 870 ILE A HG13 6  
ATOM 8883  H HG21 . ILE A 1 87  ? 6.712   8.113   10.166  1.00 0.00 ? 870 ILE A HG21 6  
ATOM 8884  H HG22 . ILE A 1 87  ? 8.299   8.387   10.883  1.00 0.00 ? 870 ILE A HG22 6  
ATOM 8885  H HG23 . ILE A 1 87  ? 7.637   6.754   10.804  1.00 0.00 ? 870 ILE A HG23 6  
ATOM 8886  H HD11 . ILE A 1 87  ? 6.269   11.308  11.668  1.00 0.00 ? 870 ILE A HD11 6  
ATOM 8887  H HD12 . ILE A 1 87  ? 5.832   9.856   10.766  1.00 0.00 ? 870 ILE A HD12 6  
ATOM 8888  H HD13 . ILE A 1 87  ? 4.851   10.371  12.138  1.00 0.00 ? 870 ILE A HD13 6  
ATOM 8889  N N    . ILE A 1 88  ? 4.374   6.140   10.471  1.00 0.00 ? 871 ILE A N    6  
ATOM 8890  C CA   . ILE A 1 88  ? 4.245   5.008   9.563   1.00 0.00 ? 871 ILE A CA   6  
ATOM 8891  C C    . ILE A 1 88  ? 4.949   5.283   8.238   1.00 0.00 ? 871 ILE A C    6  
ATOM 8892  O O    . ILE A 1 88  ? 4.957   6.413   7.749   1.00 0.00 ? 871 ILE A O    6  
ATOM 8893  C CB   . ILE A 1 88  ? 2.767   4.674   9.286   1.00 0.00 ? 871 ILE A CB   6  
ATOM 8894  C CG1  . ILE A 1 88  ? 2.193   5.629   8.238   1.00 0.00 ? 871 ILE A CG1  6  
ATOM 8895  C CG2  . ILE A 1 88  ? 1.959   4.743   10.573  1.00 0.00 ? 871 ILE A CG2  6  
ATOM 8896  C CD1  . ILE A 1 88  ? 2.582   5.273   6.820   1.00 0.00 ? 871 ILE A CD1  6  
ATOM 8897  H H    . ILE A 1 88  ? 3.768   6.904   10.373  1.00 0.00 ? 871 ILE A H    6  
ATOM 8898  H HA   . ILE A 1 88  ? 4.706   4.150   10.032  1.00 0.00 ? 871 ILE A HA   6  
ATOM 8899  H HB   . ILE A 1 88  ? 2.714   3.663   8.910   1.00 0.00 ? 871 ILE A HB   6  
ATOM 8900  H HG12 . ILE A 1 88  ? 1.116   5.616   8.299   1.00 0.00 ? 871 ILE A HG12 6  
ATOM 8901  H HG13 . ILE A 1 88  ? 2.549   6.629   8.440   1.00 0.00 ? 871 ILE A HG13 6  
ATOM 8902  H HG21 . ILE A 1 88  ? 2.082   3.823   11.125  1.00 0.00 ? 871 ILE A HG21 6  
ATOM 8903  H HG22 . ILE A 1 88  ? 2.308   5.570   11.173  1.00 0.00 ? 871 ILE A HG22 6  
ATOM 8904  H HG23 . ILE A 1 88  ? 0.915   4.884   10.336  1.00 0.00 ? 871 ILE A HG23 6  
ATOM 8905  H HD11 . ILE A 1 88  ? 1.690   5.118   6.230   1.00 0.00 ? 871 ILE A HD11 6  
ATOM 8906  H HD12 . ILE A 1 88  ? 3.162   6.077   6.393   1.00 0.00 ? 871 ILE A HD12 6  
ATOM 8907  H HD13 . ILE A 1 88  ? 3.171   4.368   6.824   1.00 0.00 ? 871 ILE A HD13 6  
ATOM 8908  N N    . LYS A 1 89  ? 5.538   4.242   7.660   1.00 0.00 ? 872 LYS A N    6  
ATOM 8909  C CA   . LYS A 1 89  ? 6.242   4.369   6.389   1.00 0.00 ? 872 LYS A CA   6  
ATOM 8910  C C    . LYS A 1 89  ? 5.420   3.775   5.250   1.00 0.00 ? 872 LYS A C    6  
ATOM 8911  O O    . LYS A 1 89  ? 4.594   2.887   5.464   1.00 0.00 ? 872 LYS A O    6  
ATOM 8912  C CB   . LYS A 1 89  ? 7.604   3.674   6.466   1.00 0.00 ? 872 LYS A CB   6  
ATOM 8913  C CG   . LYS A 1 89  ? 8.474   3.905   5.243   1.00 0.00 ? 872 LYS A CG   6  
ATOM 8914  C CD   . LYS A 1 89  ? 9.686   2.989   5.240   1.00 0.00 ? 872 LYS A CD   6  
ATOM 8915  C CE   . LYS A 1 89  ? 9.322   1.584   4.787   1.00 0.00 ? 872 LYS A CE   6  
ATOM 8916  N NZ   . LYS A 1 89  ? 9.298   1.468   3.303   1.00 0.00 ? 872 LYS A NZ   6  
ATOM 8917  H H    . LYS A 1 89  ? 5.497   3.366   8.098   1.00 0.00 ? 872 LYS A H    6  
ATOM 8918  H HA   . LYS A 1 89  ? 6.394   5.420   6.198   1.00 0.00 ? 872 LYS A HA   6  
ATOM 8919  H HB2  . LYS A 1 89  ? 8.133   4.041   7.333   1.00 0.00 ? 872 LYS A HB2  6  
ATOM 8920  H HB3  . LYS A 1 89  ? 7.446   2.611   6.574   1.00 0.00 ? 872 LYS A HB3  6  
ATOM 8921  H HG2  . LYS A 1 89  ? 7.890   3.714   4.355   1.00 0.00 ? 872 LYS A HG2  6  
ATOM 8922  H HG3  . LYS A 1 89  ? 8.810   4.932   5.240   1.00 0.00 ? 872 LYS A HG3  6  
ATOM 8923  H HD2  . LYS A 1 89  ? 10.429  3.391   4.567   1.00 0.00 ? 872 LYS A HD2  6  
ATOM 8924  H HD3  . LYS A 1 89  ? 10.093  2.942   6.240   1.00 0.00 ? 872 LYS A HD3  6  
ATOM 8925  H HE2  . LYS A 1 89  ? 10.051  0.892   5.181   1.00 0.00 ? 872 LYS A HE2  6  
ATOM 8926  H HE3  . LYS A 1 89  ? 8.345   1.337   5.175   1.00 0.00 ? 872 LYS A HE3  6  
ATOM 8927  H HZ1  . LYS A 1 89  ? 10.036  0.809   2.984   1.00 0.00 ? 872 LYS A HZ1  6  
ATOM 8928  H HZ2  . LYS A 1 89  ? 9.469   2.398   2.869   1.00 0.00 ? 872 LYS A HZ2  6  
ATOM 8929  H HZ3  . LYS A 1 89  ? 8.372   1.115   2.986   1.00 0.00 ? 872 LYS A HZ3  6  
ATOM 8930  N N    . VAL A 1 90  ? 5.653   4.269   4.038   1.00 0.00 ? 873 VAL A N    6  
ATOM 8931  C CA   . VAL A 1 90  ? 4.935   3.785   2.865   1.00 0.00 ? 873 VAL A CA   6  
ATOM 8932  C C    . VAL A 1 90  ? 5.889   3.539   1.701   1.00 0.00 ? 873 VAL A C    6  
ATOM 8933  O O    . VAL A 1 90  ? 6.916   4.205   1.575   1.00 0.00 ? 873 VAL A O    6  
ATOM 8934  C CB   . VAL A 1 90  ? 3.848   4.782   2.421   1.00 0.00 ? 873 VAL A CB   6  
ATOM 8935  C CG1  . VAL A 1 90  ? 3.003   4.188   1.304   1.00 0.00 ? 873 VAL A CG1  6  
ATOM 8936  C CG2  . VAL A 1 90  ? 2.979   5.182   3.603   1.00 0.00 ? 873 VAL A CG2  6  
ATOM 8937  H H    . VAL A 1 90  ? 6.323   4.976   3.931   1.00 0.00 ? 873 VAL A H    6  
ATOM 8938  H HA   . VAL A 1 90  ? 4.455   2.854   3.127   1.00 0.00 ? 873 VAL A HA   6  
ATOM 8939  H HB   . VAL A 1 90  ? 4.334   5.668   2.042   1.00 0.00 ? 873 VAL A HB   6  
ATOM 8940  H HG11 . VAL A 1 90  ? 2.268   4.913   0.985   1.00 0.00 ? 873 VAL A HG11 6  
ATOM 8941  H HG12 . VAL A 1 90  ? 3.639   3.927   0.471   1.00 0.00 ? 873 VAL A HG12 6  
ATOM 8942  H HG13 . VAL A 1 90  ? 2.500   3.302   1.666   1.00 0.00 ? 873 VAL A HG13 6  
ATOM 8943  H HG21 . VAL A 1 90  ? 1.961   4.870   3.423   1.00 0.00 ? 873 VAL A HG21 6  
ATOM 8944  H HG22 . VAL A 1 90  ? 3.348   4.706   4.500   1.00 0.00 ? 873 VAL A HG22 6  
ATOM 8945  H HG23 . VAL A 1 90  ? 3.010   6.254   3.727   1.00 0.00 ? 873 VAL A HG23 6  
ATOM 8946  N N    . ALA A 1 91  ? 5.541   2.578   0.852   1.00 0.00 ? 874 ALA A N    6  
ATOM 8947  C CA   . ALA A 1 91  ? 6.365   2.245   -0.304  1.00 0.00 ? 874 ALA A CA   6  
ATOM 8948  C C    . ALA A 1 91  ? 5.528   1.613   -1.411  1.00 0.00 ? 874 ALA A C    6  
ATOM 8949  O O    . ALA A 1 91  ? 4.443   1.088   -1.159  1.00 0.00 ? 874 ALA A O    6  
ATOM 8950  C CB   . ALA A 1 91  ? 7.495   1.311   0.104   1.00 0.00 ? 874 ALA A CB   6  
ATOM 8951  H H    . ALA A 1 91  ? 4.711   2.082   1.005   1.00 0.00 ? 874 ALA A H    6  
ATOM 8952  H HA   . ALA A 1 91  ? 6.804   3.160   -0.676  1.00 0.00 ? 874 ALA A HA   6  
ATOM 8953  H HB1  . ALA A 1 91  ? 8.215   1.857   0.697   1.00 0.00 ? 874 ALA A HB1  6  
ATOM 8954  H HB2  . ALA A 1 91  ? 7.094   0.494   0.686   1.00 0.00 ? 874 ALA A HB2  6  
ATOM 8955  H HB3  . ALA A 1 91  ? 7.977   0.922   -0.780  1.00 0.00 ? 874 ALA A HB3  6  
ATOM 8956  N N    . ILE A 1 92  ? 6.038   1.667   -2.637  1.00 0.00 ? 875 ILE A N    6  
ATOM 8957  C CA   . ILE A 1 92  ? 5.337   1.100   -3.781  1.00 0.00 ? 875 ILE A CA   6  
ATOM 8958  C C    . ILE A 1 92  ? 5.288   -0.422  -3.697  1.00 0.00 ? 875 ILE A C    6  
ATOM 8959  O O    . ILE A 1 92  ? 6.321   -1.090  -3.745  1.00 0.00 ? 875 ILE A O    6  
ATOM 8960  C CB   . ILE A 1 92  ? 6.003   1.508   -5.109  1.00 0.00 ? 875 ILE A CB   6  
ATOM 8961  C CG1  . ILE A 1 92  ? 6.125   3.030   -5.196  1.00 0.00 ? 875 ILE A CG1  6  
ATOM 8962  C CG2  . ILE A 1 92  ? 5.209   0.966   -6.288  1.00 0.00 ? 875 ILE A CG2  6  
ATOM 8963  C CD1  . ILE A 1 92  ? 4.819   3.725   -5.511  1.00 0.00 ? 875 ILE A CD1  6  
ATOM 8964  H H    . ILE A 1 92  ? 6.907   2.099   -2.774  1.00 0.00 ? 875 ILE A H    6  
ATOM 8965  H HA   . ILE A 1 92  ? 4.326   1.482   -3.776  1.00 0.00 ? 875 ILE A HA   6  
ATOM 8966  H HB   . ILE A 1 92  ? 6.990   1.072   -5.139  1.00 0.00 ? 875 ILE A HB   6  
ATOM 8967  H HG12 . ILE A 1 92  ? 6.484   3.411   -4.253  1.00 0.00 ? 875 ILE A HG12 6  
ATOM 8968  H HG13 . ILE A 1 92  ? 6.833   3.283   -5.973  1.00 0.00 ? 875 ILE A HG13 6  
ATOM 8969  H HG21 . ILE A 1 92  ? 4.925   1.783   -6.936  1.00 0.00 ? 875 ILE A HG21 6  
ATOM 8970  H HG22 . ILE A 1 92  ? 5.818   0.266   -6.840  1.00 0.00 ? 875 ILE A HG22 6  
ATOM 8971  H HG23 . ILE A 1 92  ? 4.323   0.467   -5.927  1.00 0.00 ? 875 ILE A HG23 6  
ATOM 8972  H HD11 . ILE A 1 92  ? 4.909   4.253   -6.449  1.00 0.00 ? 875 ILE A HD11 6  
ATOM 8973  H HD12 . ILE A 1 92  ? 4.030   2.992   -5.584  1.00 0.00 ? 875 ILE A HD12 6  
ATOM 8974  H HD13 . ILE A 1 92  ? 4.586   4.428   -4.724  1.00 0.00 ? 875 ILE A HD13 6  
ATOM 8975  N N    . SER A 1 93  ? 4.081   -0.964  -3.572  1.00 0.00 ? 876 SER A N    6  
ATOM 8976  C CA   . SER A 1 93  ? 3.897   -2.408  -3.479  1.00 0.00 ? 876 SER A CA   6  
ATOM 8977  C C    . SER A 1 93  ? 4.910   -3.142  -4.352  1.00 0.00 ? 876 SER A C    6  
ATOM 8978  O O    . SER A 1 93  ? 5.257   -2.683  -5.439  1.00 0.00 ? 876 SER A O    6  
ATOM 8979  C CB   . SER A 1 93  ? 2.476   -2.790  -3.897  1.00 0.00 ? 876 SER A CB   6  
ATOM 8980  O OG   . SER A 1 93  ? 2.405   -3.050  -5.288  1.00 0.00 ? 876 SER A OG   6  
ATOM 8981  H H    . SER A 1 93  ? 3.295   -0.379  -3.539  1.00 0.00 ? 876 SER A H    6  
ATOM 8982  H HA   . SER A 1 93  ? 4.050   -2.696  -2.450  1.00 0.00 ? 876 SER A HA   6  
ATOM 8983  H HB2  . SER A 1 93  ? 2.172   -3.677  -3.361  1.00 0.00 ? 876 SER A HB2  6  
ATOM 8984  H HB3  . SER A 1 93  ? 1.803   -1.978  -3.659  1.00 0.00 ? 876 SER A HB3  6  
ATOM 8985  H HG   . SER A 1 93  ? 2.554   -3.985  -5.447  1.00 0.00 ? 876 SER A HG   6  
ATOM 8986  N N    . ASN A 1 94  ? 5.381   -4.286  -3.866  1.00 0.00 ? 877 ASN A N    6  
ATOM 8987  C CA   . ASN A 1 94  ? 6.356   -5.085  -4.600  1.00 0.00 ? 877 ASN A CA   6  
ATOM 8988  C C    . ASN A 1 94  ? 6.383   -6.520  -4.083  1.00 0.00 ? 877 ASN A C    6  
ATOM 8989  O O    . ASN A 1 94  ? 6.037   -6.782  -2.932  1.00 0.00 ? 877 ASN A O    6  
ATOM 8990  C CB   . ASN A 1 94  ? 7.749   -4.462  -4.484  1.00 0.00 ? 877 ASN A CB   6  
ATOM 8991  C CG   . ASN A 1 94  ? 8.631   -4.791  -5.672  1.00 0.00 ? 877 ASN A CG   6  
ATOM 8992  O OD1  . ASN A 1 94  ? 8.925   -5.957  -5.937  1.00 0.00 ? 877 ASN A OD1  6  
ATOM 8993  N ND2  . ASN A 1 94  ? 9.057   -3.762  -6.396  1.00 0.00 ? 877 ASN A ND2  6  
ATOM 8994  H H    . ASN A 1 94  ? 5.067   -4.600  -2.993  1.00 0.00 ? 877 ASN A H    6  
ATOM 8995  H HA   . ASN A 1 94  ? 6.061   -5.094  -5.639  1.00 0.00 ? 877 ASN A HA   6  
ATOM 8996  H HB2  . ASN A 1 94  ? 7.652   -3.388  -4.419  1.00 0.00 ? 877 ASN A HB2  6  
ATOM 8997  H HB3  . ASN A 1 94  ? 8.228   -4.831  -3.589  1.00 0.00 ? 877 ASN A HB3  6  
ATOM 8998  H HD21 . ASN A 1 94  ? 8.782   -2.861  -6.126  1.00 0.00 ? 877 ASN A HD21 6  
ATOM 8999  H HD22 . ASN A 1 94  ? 9.628   -3.947  -7.171  1.00 0.00 ? 877 ASN A HD22 6  
ATOM 9000  N N    . SER A 1 95  ? 6.798   -7.445  -4.943  1.00 0.00 ? 878 SER A N    6  
ATOM 9001  C CA   . SER A 1 95  ? 6.868   -8.854  -4.574  1.00 0.00 ? 878 SER A CA   6  
ATOM 9002  C C    . SER A 1 95  ? 7.994   -9.557  -5.327  1.00 0.00 ? 878 SER A C    6  
ATOM 9003  O O    . SER A 1 95  ? 8.311   -9.206  -6.463  1.00 0.00 ? 878 SER A O    6  
ATOM 9004  C CB   . SER A 1 95  ? 5.535   -9.546  -4.866  1.00 0.00 ? 878 SER A CB   6  
ATOM 9005  O OG   . SER A 1 95  ? 4.544   -9.159  -3.930  1.00 0.00 ? 878 SER A OG   6  
ATOM 9006  H H    . SER A 1 95  ? 7.061   -7.173  -5.847  1.00 0.00 ? 878 SER A H    6  
ATOM 9007  H HA   . SER A 1 95  ? 7.069   -8.910  -3.515  1.00 0.00 ? 878 SER A HA   6  
ATOM 9008  H HB2  . SER A 1 95  ? 5.202   -9.277  -5.857  1.00 0.00 ? 878 SER A HB2  6  
ATOM 9009  H HB3  . SER A 1 95  ? 5.669   -10.617 -4.810  1.00 0.00 ? 878 SER A HB3  6  
ATOM 9010  H HG   . SER A 1 95  ? 4.742   -8.280  -3.599  1.00 0.00 ? 878 SER A HG   6  
ATOM 9011  N N    . GLY A 1 96  ? 8.596   -10.552 -4.683  1.00 0.00 ? 879 GLY A N    6  
ATOM 9012  C CA   . GLY A 1 96  ? 9.681   -11.289 -5.305  1.00 0.00 ? 879 GLY A CA   6  
ATOM 9013  C C    . GLY A 1 96  ? 10.169  -12.438 -4.445  1.00 0.00 ? 879 GLY A C    6  
ATOM 9014  O O    . GLY A 1 96  ? 11.169  -12.328 -3.735  1.00 0.00 ? 879 GLY A O    6  
ATOM 9015  H H    . GLY A 1 96  ? 8.302   -10.788 -3.778  1.00 0.00 ? 879 GLY A H    6  
ATOM 9016  H HA2  . GLY A 1 96  ? 9.339   -11.682 -6.251  1.00 0.00 ? 879 GLY A HA2  6  
ATOM 9017  H HA3  . GLY A 1 96  ? 10.504  -10.613 -5.483  1.00 0.00 ? 879 GLY A HA3  6  
ATOM 9018  N N    . PRO A 1 97  ? 9.453   -13.571 -4.501  1.00 0.00 ? 880 PRO A N    6  
ATOM 9019  C CA   . PRO A 1 97  ? 9.800   -14.766 -3.727  1.00 0.00 ? 880 PRO A CA   6  
ATOM 9020  C C    . PRO A 1 97  ? 11.077  -15.432 -4.229  1.00 0.00 ? 880 PRO A C    6  
ATOM 9021  O O    . PRO A 1 97  ? 11.287  -15.563 -5.435  1.00 0.00 ? 880 PRO A O    6  
ATOM 9022  C CB   . PRO A 1 97  ? 8.597   -15.688 -3.939  1.00 0.00 ? 880 PRO A CB   6  
ATOM 9023  C CG   . PRO A 1 97  ? 8.012   -15.254 -5.239  1.00 0.00 ? 880 PRO A CG   6  
ATOM 9024  C CD   . PRO A 1 97  ? 8.250   -13.772 -5.326  1.00 0.00 ? 880 PRO A CD   6  
ATOM 9025  H HA   . PRO A 1 97  ? 9.903   -14.541 -2.675  1.00 0.00 ? 880 PRO A HA   6  
ATOM 9026  H HB2  . PRO A 1 97  ? 8.930   -16.716 -3.977  1.00 0.00 ? 880 PRO A HB2  6  
ATOM 9027  H HB3  . PRO A 1 97  ? 7.895   -15.561 -3.128  1.00 0.00 ? 880 PRO A HB3  6  
ATOM 9028  H HG2  . PRO A 1 97  ? 8.508   -15.763 -6.052  1.00 0.00 ? 880 PRO A HG2  6  
ATOM 9029  H HG3  . PRO A 1 97  ? 6.953   -15.465 -5.252  1.00 0.00 ? 880 PRO A HG3  6  
ATOM 9030  H HD2  . PRO A 1 97  ? 8.431   -13.479 -6.350  1.00 0.00 ? 880 PRO A HD2  6  
ATOM 9031  H HD3  . PRO A 1 97  ? 7.409   -13.230 -4.919  1.00 0.00 ? 880 PRO A HD3  6  
ATOM 9032  N N    . SER A 1 98  ? 11.926  -15.852 -3.297  1.00 0.00 ? 881 SER A N    6  
ATOM 9033  C CA   . SER A 1 98  ? 13.184  -16.502 -3.646  1.00 0.00 ? 881 SER A CA   6  
ATOM 9034  C C    . SER A 1 98  ? 13.249  -17.909 -3.060  1.00 0.00 ? 881 SER A C    6  
ATOM 9035  O O    . SER A 1 98  ? 13.290  -18.086 -1.842  1.00 0.00 ? 881 SER A O    6  
ATOM 9036  C CB   . SER A 1 98  ? 14.367  -15.673 -3.143  1.00 0.00 ? 881 SER A CB   6  
ATOM 9037  O OG   . SER A 1 98  ? 14.258  -15.418 -1.753  1.00 0.00 ? 881 SER A OG   6  
ATOM 9038  H H    . SER A 1 98  ? 11.702  -15.719 -2.352  1.00 0.00 ? 881 SER A H    6  
ATOM 9039  H HA   . SER A 1 98  ? 13.234  -16.570 -4.722  1.00 0.00 ? 881 SER A HA   6  
ATOM 9040  H HB2  . SER A 1 98  ? 15.284  -16.212 -3.327  1.00 0.00 ? 881 SER A HB2  6  
ATOM 9041  H HB3  . SER A 1 98  ? 14.392  -14.730 -3.669  1.00 0.00 ? 881 SER A HB3  6  
ATOM 9042  H HG   . SER A 1 98  ? 13.794  -16.145 -1.330  1.00 0.00 ? 881 SER A HG   6  
ATOM 9043  N N    . SER A 1 99  ? 13.258  -18.909 -3.937  1.00 0.00 ? 882 SER A N    6  
ATOM 9044  C CA   . SER A 1 99  ? 13.314  -20.301 -3.508  1.00 0.00 ? 882 SER A CA   6  
ATOM 9045  C C    . SER A 1 99  ? 14.754  -20.805 -3.483  1.00 0.00 ? 882 SER A C    6  
ATOM 9046  O O    . SER A 1 99  ? 15.198  -21.403 -2.504  1.00 0.00 ? 882 SER A O    6  
ATOM 9047  C CB   . SER A 1 99  ? 12.471  -21.177 -4.437  1.00 0.00 ? 882 SER A CB   6  
ATOM 9048  O OG   . SER A 1 99  ? 11.091  -20.887 -4.298  1.00 0.00 ? 882 SER A OG   6  
ATOM 9049  H H    . SER A 1 99  ? 13.223  -18.704 -4.895  1.00 0.00 ? 882 SER A H    6  
ATOM 9050  H HA   . SER A 1 99  ? 12.908  -20.357 -2.509  1.00 0.00 ? 882 SER A HA   6  
ATOM 9051  H HB2  . SER A 1 99  ? 12.763  -20.997 -5.460  1.00 0.00 ? 882 SER A HB2  6  
ATOM 9052  H HB3  . SER A 1 99  ? 12.635  -22.217 -4.193  1.00 0.00 ? 882 SER A HB3  6  
ATOM 9053  H HG   . SER A 1 99  ? 10.982  -19.981 -4.001  1.00 0.00 ? 882 SER A HG   6  
ATOM 9054  N N    . GLY A 1 100 ? 15.479  -20.557 -4.570  1.00 0.00 ? 883 GLY A N    6  
ATOM 9055  C CA   . GLY A 1 100 ? 16.861  -20.992 -4.654  1.00 0.00 ? 883 GLY A CA   6  
ATOM 9056  C C    . GLY A 1 100 ? 17.233  -21.479 -6.041  1.00 0.00 ? 883 GLY A C    6  
ATOM 9057  O O    . GLY A 1 100 ? 18.380  -21.344 -6.467  1.00 0.00 ? 883 GLY A O    6  
ATOM 9058  H H    . GLY A 1 100 ? 15.072  -20.076 -5.321  1.00 0.00 ? 883 GLY A H    6  
ATOM 9059  H HA2  . GLY A 1 100 ? 17.504  -20.165 -4.390  1.00 0.00 ? 883 GLY A HA2  6  
ATOM 9060  H HA3  . GLY A 1 100 ? 17.017  -21.795 -3.949  1.00 0.00 ? 883 GLY A HA3  6  
ATOM 9061  N N    . GLY A 1 1   ? -2.979  17.467  -30.616 1.00 0.00 ? 784 GLY A N    7  
ATOM 9062  C CA   . GLY A 1 1   ? -4.059  18.116  -29.896 1.00 0.00 ? 784 GLY A CA   7  
ATOM 9063  C C    . GLY A 1 1   ? -5.424  17.755  -30.449 1.00 0.00 ? 784 GLY A C    7  
ATOM 9064  O O    . GLY A 1 1   ? -6.070  18.571  -31.107 1.00 0.00 ? 784 GLY A O    7  
ATOM 9065  H H1   . GLY A 1 1   ? -2.972  17.473  -31.596 1.00 0.00 ? 784 GLY A H1   7  
ATOM 9066  H HA2  . GLY A 1 1   ? -4.014  17.822  -28.858 1.00 0.00 ? 784 GLY A HA2  7  
ATOM 9067  H HA3  . GLY A 1 1   ? -3.929  19.187  -29.963 1.00 0.00 ? 784 GLY A HA3  7  
ATOM 9068  N N    . SER A 1 2   ? -5.862  16.529  -30.185 1.00 0.00 ? 785 SER A N    7  
ATOM 9069  C CA   . SER A 1 2   ? -7.156  16.059  -30.666 1.00 0.00 ? 785 SER A CA   7  
ATOM 9070  C C    . SER A 1 2   ? -8.054  15.653  -29.501 1.00 0.00 ? 785 SER A C    7  
ATOM 9071  O O    . SER A 1 2   ? -8.001  14.517  -29.029 1.00 0.00 ? 785 SER A O    7  
ATOM 9072  C CB   . SER A 1 2   ? -6.971  14.876  -31.618 1.00 0.00 ? 785 SER A CB   7  
ATOM 9073  O OG   . SER A 1 2   ? -8.221  14.392  -32.078 1.00 0.00 ? 785 SER A OG   7  
ATOM 9074  H H    . SER A 1 2   ? -5.300  15.924  -29.655 1.00 0.00 ? 785 SER A H    7  
ATOM 9075  H HA   . SER A 1 2   ? -7.625  16.871  -31.201 1.00 0.00 ? 785 SER A HA   7  
ATOM 9076  H HB2  . SER A 1 2   ? -6.385  15.190  -32.468 1.00 0.00 ? 785 SER A HB2  7  
ATOM 9077  H HB3  . SER A 1 2   ? -6.457  14.078  -31.101 1.00 0.00 ? 785 SER A HB3  7  
ATOM 9078  H HG   . SER A 1 2   ? -8.207  14.329  -33.036 1.00 0.00 ? 785 SER A HG   7  
ATOM 9079  N N    . SER A 1 3   ? -8.877  16.590  -29.042 1.00 0.00 ? 786 SER A N    7  
ATOM 9080  C CA   . SER A 1 3   ? -9.785  16.332  -27.930 1.00 0.00 ? 786 SER A CA   7  
ATOM 9081  C C    . SER A 1 3   ? -11.167 15.935  -28.438 1.00 0.00 ? 786 SER A C    7  
ATOM 9082  O O    . SER A 1 3   ? -11.814 16.688  -29.165 1.00 0.00 ? 786 SER A O    7  
ATOM 9083  C CB   . SER A 1 3   ? -9.893  17.569  -27.036 1.00 0.00 ? 786 SER A CB   7  
ATOM 9084  O OG   . SER A 1 3   ? -8.778  17.669  -26.166 1.00 0.00 ? 786 SER A OG   7  
ATOM 9085  H H    . SER A 1 3   ? -8.873  17.476  -29.460 1.00 0.00 ? 786 SER A H    7  
ATOM 9086  H HA   . SER A 1 3   ? -9.378  15.516  -27.353 1.00 0.00 ? 786 SER A HA   7  
ATOM 9087  H HB2  . SER A 1 3   ? -9.933  18.454  -27.652 1.00 0.00 ? 786 SER A HB2  7  
ATOM 9088  H HB3  . SER A 1 3   ? -10.793 17.502  -26.442 1.00 0.00 ? 786 SER A HB3  7  
ATOM 9089  H HG   . SER A 1 3   ? -8.911  18.400  -25.558 1.00 0.00 ? 786 SER A HG   7  
ATOM 9090  N N    . GLY A 1 4   ? -11.615 14.745  -28.047 1.00 0.00 ? 787 GLY A N    7  
ATOM 9091  C CA   . GLY A 1 4   ? -12.918 14.268  -28.472 1.00 0.00 ? 787 GLY A CA   7  
ATOM 9092  C C    . GLY A 1 4   ? -13.165 12.826  -28.074 1.00 0.00 ? 787 GLY A C    7  
ATOM 9093  O O    . GLY A 1 4   ? -12.802 11.903  -28.803 1.00 0.00 ? 787 GLY A O    7  
ATOM 9094  H H    . GLY A 1 4   ? -11.056 14.188  -27.467 1.00 0.00 ? 787 GLY A H    7  
ATOM 9095  H HA2  . GLY A 1 4   ? -13.680 14.889  -28.026 1.00 0.00 ? 787 GLY A HA2  7  
ATOM 9096  H HA3  . GLY A 1 4   ? -12.986 14.348  -29.547 1.00 0.00 ? 787 GLY A HA3  7  
ATOM 9097  N N    . SER A 1 5   ? -13.782 12.632  -26.913 1.00 0.00 ? 788 SER A N    7  
ATOM 9098  C CA   . SER A 1 5   ? -14.072 11.292  -26.416 1.00 0.00 ? 788 SER A CA   7  
ATOM 9099  C C    . SER A 1 5   ? -14.980 11.351  -25.191 1.00 0.00 ? 788 SER A C    7  
ATOM 9100  O O    . SER A 1 5   ? -14.654 11.994  -24.194 1.00 0.00 ? 788 SER A O    7  
ATOM 9101  C CB   . SER A 1 5   ? -12.773 10.562  -26.067 1.00 0.00 ? 788 SER A CB   7  
ATOM 9102  O OG   . SER A 1 5   ? -12.225 11.048  -24.854 1.00 0.00 ? 788 SER A OG   7  
ATOM 9103  H H    . SER A 1 5   ? -14.047 13.408  -26.377 1.00 0.00 ? 788 SER A H    7  
ATOM 9104  H HA   . SER A 1 5   ? -14.580 10.750  -27.200 1.00 0.00 ? 788 SER A HA   7  
ATOM 9105  H HB2  . SER A 1 5   ? -12.974 9.507   -25.961 1.00 0.00 ? 788 SER A HB2  7  
ATOM 9106  H HB3  . SER A 1 5   ? -12.055 10.714  -26.860 1.00 0.00 ? 788 SER A HB3  7  
ATOM 9107  H HG   . SER A 1 5   ? -12.609 10.570  -24.115 1.00 0.00 ? 788 SER A HG   7  
ATOM 9108  N N    . SER A 1 6   ? -16.121 10.675  -25.275 1.00 0.00 ? 789 SER A N    7  
ATOM 9109  C CA   . SER A 1 6   ? -17.079 10.653  -24.176 1.00 0.00 ? 789 SER A CA   7  
ATOM 9110  C C    . SER A 1 6   ? -16.910 9.392   -23.333 1.00 0.00 ? 789 SER A C    7  
ATOM 9111  O O    . SER A 1 6   ? -16.742 8.295   -23.864 1.00 0.00 ? 789 SER A O    7  
ATOM 9112  C CB   . SER A 1 6   ? -18.509 10.731  -24.716 1.00 0.00 ? 789 SER A CB   7  
ATOM 9113  O OG   . SER A 1 6   ? -19.410 11.165  -23.712 1.00 0.00 ? 789 SER A OG   7  
ATOM 9114  H H    . SER A 1 6   ? -16.325 10.181  -26.097 1.00 0.00 ? 789 SER A H    7  
ATOM 9115  H HA   . SER A 1 6   ? -16.890 11.515  -23.554 1.00 0.00 ? 789 SER A HA   7  
ATOM 9116  H HB2  . SER A 1 6   ? -18.542 11.429  -25.538 1.00 0.00 ? 789 SER A HB2  7  
ATOM 9117  H HB3  . SER A 1 6   ? -18.815 9.754   -25.060 1.00 0.00 ? 789 SER A HB3  7  
ATOM 9118  H HG   . SER A 1 6   ? -19.018 11.892  -23.222 1.00 0.00 ? 789 SER A HG   7  
ATOM 9119  N N    . GLY A 1 7   ? -16.956 9.559   -22.015 1.00 0.00 ? 790 GLY A N    7  
ATOM 9120  C CA   . GLY A 1 7   ? -16.807 8.427   -21.119 1.00 0.00 ? 790 GLY A CA   7  
ATOM 9121  C C    . GLY A 1 7   ? -15.589 7.586   -21.446 1.00 0.00 ? 790 GLY A C    7  
ATOM 9122  O O    . GLY A 1 7   ? -15.661 6.667   -22.262 1.00 0.00 ? 790 GLY A O    7  
ATOM 9123  H H    . GLY A 1 7   ? -17.093 10.457  -21.648 1.00 0.00 ? 790 GLY A H    7  
ATOM 9124  H HA2  . GLY A 1 7   ? -16.718 8.792   -20.107 1.00 0.00 ? 790 GLY A HA2  7  
ATOM 9125  H HA3  . GLY A 1 7   ? -17.688 7.806   -21.191 1.00 0.00 ? 790 GLY A HA3  7  
ATOM 9126  N N    . VAL A 1 8   ? -14.466 7.900   -20.808 1.00 0.00 ? 791 VAL A N    7  
ATOM 9127  C CA   . VAL A 1 8   ? -13.227 7.167   -21.035 1.00 0.00 ? 791 VAL A CA   7  
ATOM 9128  C C    . VAL A 1 8   ? -13.249 5.817   -20.327 1.00 0.00 ? 791 VAL A C    7  
ATOM 9129  O O    . VAL A 1 8   ? -13.770 5.693   -19.219 1.00 0.00 ? 791 VAL A O    7  
ATOM 9130  C CB   . VAL A 1 8   ? -12.003 7.968   -20.551 1.00 0.00 ? 791 VAL A CB   7  
ATOM 9131  C CG1  . VAL A 1 8   ? -12.137 8.305   -19.074 1.00 0.00 ? 791 VAL A CG1  7  
ATOM 9132  C CG2  . VAL A 1 8   ? -10.721 7.193   -20.815 1.00 0.00 ? 791 VAL A CG2  7  
ATOM 9133  H H    . VAL A 1 8   ? -14.471 8.642   -20.168 1.00 0.00 ? 791 VAL A H    7  
ATOM 9134  H HA   . VAL A 1 8   ? -13.126 7.003   -22.098 1.00 0.00 ? 791 VAL A HA   7  
ATOM 9135  H HB   . VAL A 1 8   ? -11.961 8.893   -21.106 1.00 0.00 ? 791 VAL A HB   7  
ATOM 9136  H HG11 . VAL A 1 8   ? -13.067 7.906   -18.696 1.00 0.00 ? 791 VAL A HG11 7  
ATOM 9137  H HG12 . VAL A 1 8   ? -11.310 7.872   -18.529 1.00 0.00 ? 791 VAL A HG12 7  
ATOM 9138  H HG13 . VAL A 1 8   ? -12.129 9.378   -18.948 1.00 0.00 ? 791 VAL A HG13 7  
ATOM 9139  H HG21 . VAL A 1 8   ? -10.877 6.150   -20.584 1.00 0.00 ? 791 VAL A HG21 7  
ATOM 9140  H HG22 . VAL A 1 8   ? -10.447 7.294   -21.856 1.00 0.00 ? 791 VAL A HG22 7  
ATOM 9141  H HG23 . VAL A 1 8   ? -9.929  7.585   -20.196 1.00 0.00 ? 791 VAL A HG23 7  
ATOM 9142  N N    . PHE A 1 9   ? -12.680 4.806   -20.975 1.00 0.00 ? 792 PHE A N    7  
ATOM 9143  C CA   . PHE A 1 9   ? -12.634 3.463   -20.408 1.00 0.00 ? 792 PHE A CA   7  
ATOM 9144  C C    . PHE A 1 9   ? -11.261 3.171   -19.810 1.00 0.00 ? 792 PHE A C    7  
ATOM 9145  O O    . PHE A 1 9   ? -10.234 3.370   -20.460 1.00 0.00 ? 792 PHE A O    7  
ATOM 9146  C CB   . PHE A 1 9   ? -12.968 2.422   -21.479 1.00 0.00 ? 792 PHE A CB   7  
ATOM 9147  C CG   . PHE A 1 9   ? -14.269 2.683   -22.183 1.00 0.00 ? 792 PHE A CG   7  
ATOM 9148  C CD1  . PHE A 1 9   ? -14.333 3.577   -23.240 1.00 0.00 ? 792 PHE A CD1  7  
ATOM 9149  C CD2  . PHE A 1 9   ? -15.428 2.034   -21.789 1.00 0.00 ? 792 PHE A CD2  7  
ATOM 9150  C CE1  . PHE A 1 9   ? -15.528 3.820   -23.889 1.00 0.00 ? 792 PHE A CE1  7  
ATOM 9151  C CE2  . PHE A 1 9   ? -16.626 2.272   -22.435 1.00 0.00 ? 792 PHE A CE2  7  
ATOM 9152  C CZ   . PHE A 1 9   ? -16.676 3.165   -23.487 1.00 0.00 ? 792 PHE A CZ   7  
ATOM 9153  H H    . PHE A 1 9   ? -12.281 4.966   -21.856 1.00 0.00 ? 792 PHE A H    7  
ATOM 9154  H HA   . PHE A 1 9   ? -13.374 3.410   -19.624 1.00 0.00 ? 792 PHE A HA   7  
ATOM 9155  H HB2  . PHE A 1 9   ? -12.185 2.417   -22.222 1.00 0.00 ? 792 PHE A HB2  7  
ATOM 9156  H HB3  . PHE A 1 9   ? -13.028 1.448   -21.018 1.00 0.00 ? 792 PHE A HB3  7  
ATOM 9157  H HD1  . PHE A 1 9   ? -13.436 4.089   -23.556 1.00 0.00 ? 792 PHE A HD1  7  
ATOM 9158  H HD2  . PHE A 1 9   ? -15.389 1.334   -20.966 1.00 0.00 ? 792 PHE A HD2  7  
ATOM 9159  H HE1  . PHE A 1 9   ? -15.565 4.519   -24.711 1.00 0.00 ? 792 PHE A HE1  7  
ATOM 9160  H HE2  . PHE A 1 9   ? -17.522 1.758   -22.118 1.00 0.00 ? 792 PHE A HE2  7  
ATOM 9161  H HZ   . PHE A 1 9   ? -17.612 3.353   -23.992 1.00 0.00 ? 792 PHE A HZ   7  
ATOM 9162  N N    . ARG A 1 10  ? -11.252 2.699   -18.568 1.00 0.00 ? 793 ARG A N    7  
ATOM 9163  C CA   . ARG A 1 10  ? -10.006 2.382   -17.881 1.00 0.00 ? 793 ARG A CA   7  
ATOM 9164  C C    . ARG A 1 10  ? -9.696  0.891   -17.978 1.00 0.00 ? 793 ARG A C    7  
ATOM 9165  O O    . ARG A 1 10  ? -10.602 0.063   -18.074 1.00 0.00 ? 793 ARG A O    7  
ATOM 9166  C CB   . ARG A 1 10  ? -10.087 2.802   -16.412 1.00 0.00 ? 793 ARG A CB   7  
ATOM 9167  C CG   . ARG A 1 10  ? -11.045 1.956   -15.589 1.00 0.00 ? 793 ARG A CG   7  
ATOM 9168  C CD   . ARG A 1 10  ? -12.453 2.531   -15.609 1.00 0.00 ? 793 ARG A CD   7  
ATOM 9169  N NE   . ARG A 1 10  ? -13.190 2.217   -14.388 1.00 0.00 ? 793 ARG A NE   7  
ATOM 9170  C CZ   . ARG A 1 10  ? -13.820 1.066   -14.185 1.00 0.00 ? 793 ARG A CZ   7  
ATOM 9171  N NH1  . ARG A 1 10  ? -13.803 0.123   -15.118 1.00 0.00 ? 793 ARG A NH1  7  
ATOM 9172  N NH2  . ARG A 1 10  ? -14.469 0.854   -13.047 1.00 0.00 ? 793 ARG A NH2  7  
ATOM 9173  H H    . ARG A 1 10  ? -12.103 2.562   -18.101 1.00 0.00 ? 793 ARG A H    7  
ATOM 9174  H HA   . ARG A 1 10  ? -9.212  2.934   -18.360 1.00 0.00 ? 793 ARG A HA   7  
ATOM 9175  H HB2  . ARG A 1 10  ? -9.103  2.723   -15.972 1.00 0.00 ? 793 ARG A HB2  7  
ATOM 9176  H HB3  . ARG A 1 10  ? -10.413 3.829   -16.362 1.00 0.00 ? 793 ARG A HB3  7  
ATOM 9177  H HG2  . ARG A 1 10  ? -11.070 0.957   -15.997 1.00 0.00 ? 793 ARG A HG2  7  
ATOM 9178  H HG3  . ARG A 1 10  ? -10.694 1.922   -14.568 1.00 0.00 ? 793 ARG A HG3  7  
ATOM 9179  H HD2  . ARG A 1 10  ? -12.388 3.604   -15.714 1.00 0.00 ? 793 ARG A HD2  7  
ATOM 9180  H HD3  . ARG A 1 10  ? -12.983 2.118   -16.455 1.00 0.00 ? 793 ARG A HD3  7  
ATOM 9181  H HE   . ARG A 1 10  ? -13.216 2.899   -13.686 1.00 0.00 ? 793 ARG A HE   7  
ATOM 9182  H HH11 . ARG A 1 10  ? -13.314 0.279   -15.976 1.00 0.00 ? 793 ARG A HH11 7  
ATOM 9183  H HH12 . ARG A 1 10  ? -14.277 -0.743  -14.962 1.00 0.00 ? 793 ARG A HH12 7  
ATOM 9184  H HH21 . ARG A 1 10  ? -14.484 1.562   -12.342 1.00 0.00 ? 793 ARG A HH21 7  
ATOM 9185  H HH22 . ARG A 1 10  ? -14.943 -0.012  -12.896 1.00 0.00 ? 793 ARG A HH22 7  
ATOM 9186  N N    . TYR A 1 11  ? -8.411  0.556   -17.953 1.00 0.00 ? 794 TYR A N    7  
ATOM 9187  C CA   . TYR A 1 11  ? -7.981  -0.834  -18.041 1.00 0.00 ? 794 TYR A CA   7  
ATOM 9188  C C    . TYR A 1 11  ? -7.112  -1.213  -16.846 1.00 0.00 ? 794 TYR A C    7  
ATOM 9189  O O    . TYR A 1 11  ? -6.818  -0.380  -15.989 1.00 0.00 ? 794 TYR A O    7  
ATOM 9190  C CB   . TYR A 1 11  ? -7.210  -1.070  -19.341 1.00 0.00 ? 794 TYR A CB   7  
ATOM 9191  C CG   . TYR A 1 11  ? -6.022  -0.152  -19.515 1.00 0.00 ? 794 TYR A CG   7  
ATOM 9192  C CD1  . TYR A 1 11  ? -6.160  1.085   -20.134 1.00 0.00 ? 794 TYR A CD1  7  
ATOM 9193  C CD2  . TYR A 1 11  ? -4.761  -0.520  -19.063 1.00 0.00 ? 794 TYR A CD2  7  
ATOM 9194  C CE1  . TYR A 1 11  ? -5.077  1.928   -20.296 1.00 0.00 ? 794 TYR A CE1  7  
ATOM 9195  C CE2  . TYR A 1 11  ? -3.673  0.316   -19.220 1.00 0.00 ? 794 TYR A CE2  7  
ATOM 9196  C CZ   . TYR A 1 11  ? -3.836  1.539   -19.837 1.00 0.00 ? 794 TYR A CZ   7  
ATOM 9197  O OH   . TYR A 1 11  ? -2.754  2.375   -19.996 1.00 0.00 ? 794 TYR A OH   7  
ATOM 9198  H H    . TYR A 1 11  ? -7.734  1.261   -17.875 1.00 0.00 ? 794 TYR A H    7  
ATOM 9199  H HA   . TYR A 1 11  ? -8.865  -1.455  -18.041 1.00 0.00 ? 794 TYR A HA   7  
ATOM 9200  H HB2  . TYR A 1 11  ? -6.847  -2.087  -19.357 1.00 0.00 ? 794 TYR A HB2  7  
ATOM 9201  H HB3  . TYR A 1 11  ? -7.874  -0.916  -20.179 1.00 0.00 ? 794 TYR A HB3  7  
ATOM 9202  H HD1  . TYR A 1 11  ? -7.134  1.387   -20.492 1.00 0.00 ? 794 TYR A HD1  7  
ATOM 9203  H HD2  . TYR A 1 11  ? -4.637  -1.479  -18.581 1.00 0.00 ? 794 TYR A HD2  7  
ATOM 9204  H HE1  . TYR A 1 11  ? -5.204  2.885   -20.779 1.00 0.00 ? 794 TYR A HE1  7  
ATOM 9205  H HE2  . TYR A 1 11  ? -2.701  0.012   -18.861 1.00 0.00 ? 794 TYR A HE2  7  
ATOM 9206  H HH   . TYR A 1 11  ? -2.463  2.350   -20.910 1.00 0.00 ? 794 TYR A HH   7  
ATOM 9207  N N    . SER A 1 12  ? -6.704  -2.477  -16.796 1.00 0.00 ? 795 SER A N    7  
ATOM 9208  C CA   . SER A 1 12  ? -5.872  -2.970  -15.705 1.00 0.00 ? 795 SER A CA   7  
ATOM 9209  C C    . SER A 1 12  ? -4.399  -2.976  -16.105 1.00 0.00 ? 795 SER A C    7  
ATOM 9210  O O    . SER A 1 12  ? -4.058  -3.241  -17.258 1.00 0.00 ? 795 SER A O    7  
ATOM 9211  C CB   . SER A 1 12  ? -6.308  -4.378  -15.298 1.00 0.00 ? 795 SER A CB   7  
ATOM 9212  O OG   . SER A 1 12  ? -6.115  -5.298  -16.358 1.00 0.00 ? 795 SER A OG   7  
ATOM 9213  H H    . SER A 1 12  ? -6.972  -3.094  -17.509 1.00 0.00 ? 795 SER A H    7  
ATOM 9214  H HA   . SER A 1 12  ? -6.001  -2.305  -14.863 1.00 0.00 ? 795 SER A HA   7  
ATOM 9215  H HB2  . SER A 1 12  ? -5.727  -4.701  -14.447 1.00 0.00 ? 795 SER A HB2  7  
ATOM 9216  H HB3  . SER A 1 12  ? -7.356  -4.366  -15.034 1.00 0.00 ? 795 SER A HB3  7  
ATOM 9217  H HG   . SER A 1 12  ? -5.669  -6.081  -16.026 1.00 0.00 ? 795 SER A HG   7  
ATOM 9218  N N    . THR A 1 13  ? -3.530  -2.683  -15.143 1.00 0.00 ? 796 THR A N    7  
ATOM 9219  C CA   . THR A 1 13  ? -2.094  -2.653  -15.394 1.00 0.00 ? 796 THR A CA   7  
ATOM 9220  C C    . THR A 1 13  ? -1.446  -3.986  -15.034 1.00 0.00 ? 796 THR A C    7  
ATOM 9221  O O    . THR A 1 13  ? -1.712  -4.550  -13.973 1.00 0.00 ? 796 THR A O    7  
ATOM 9222  C CB   . THR A 1 13  ? -1.408  -1.529  -14.595 1.00 0.00 ? 796 THR A CB   7  
ATOM 9223  O OG1  . THR A 1 13  ? -1.982  -0.263  -14.939 1.00 0.00 ? 796 THR A OG1  7  
ATOM 9224  C CG2  . THR A 1 13  ? 0.088   -1.505  -14.871 1.00 0.00 ? 796 THR A CG2  7  
ATOM 9225  H H    . THR A 1 13  ? -3.863  -2.481  -14.244 1.00 0.00 ? 796 THR A H    7  
ATOM 9226  H HA   . THR A 1 13  ? -1.943  -2.463  -16.446 1.00 0.00 ? 796 THR A HA   7  
ATOM 9227  H HB   . THR A 1 13  ? -1.561  -1.712  -13.541 1.00 0.00 ? 796 THR A HB   7  
ATOM 9228  H HG1  . THR A 1 13  ? -2.889  -0.391  -15.226 1.00 0.00 ? 796 THR A HG1  7  
ATOM 9229  H HG21 . THR A 1 13  ? 0.559   -2.344  -14.379 1.00 0.00 ? 796 THR A HG21 7  
ATOM 9230  H HG22 . THR A 1 13  ? 0.509   -0.585  -14.496 1.00 0.00 ? 796 THR A HG22 7  
ATOM 9231  H HG23 . THR A 1 13  ? 0.258   -1.572  -15.935 1.00 0.00 ? 796 THR A HG23 7  
ATOM 9232  N N    . SER A 1 14  ? -0.594  -4.483  -15.925 1.00 0.00 ? 797 SER A N    7  
ATOM 9233  C CA   . SER A 1 14  ? 0.090   -5.752  -15.702 1.00 0.00 ? 797 SER A CA   7  
ATOM 9234  C C    . SER A 1 14  ? 0.748   -5.780  -14.326 1.00 0.00 ? 797 SER A C    7  
ATOM 9235  O O    . SER A 1 14  ? 0.540   -6.709  -13.544 1.00 0.00 ? 797 SER A O    7  
ATOM 9236  C CB   . SER A 1 14  ? 1.142   -5.985  -16.788 1.00 0.00 ? 797 SER A CB   7  
ATOM 9237  O OG   . SER A 1 14  ? 2.024   -7.034  -16.427 1.00 0.00 ? 797 SER A OG   7  
ATOM 9238  H H    . SER A 1 14  ? -0.424  -3.986  -16.752 1.00 0.00 ? 797 SER A H    7  
ATOM 9239  H HA   . SER A 1 14  ? -0.647  -6.539  -15.752 1.00 0.00 ? 797 SER A HA   7  
ATOM 9240  H HB2  . SER A 1 14  ? 0.650   -6.247  -17.712 1.00 0.00 ? 797 SER A HB2  7  
ATOM 9241  H HB3  . SER A 1 14  ? 1.716   -5.081  -16.929 1.00 0.00 ? 797 SER A HB3  7  
ATOM 9242  H HG   . SER A 1 14  ? 2.854   -6.663  -16.118 1.00 0.00 ? 797 SER A HG   7  
ATOM 9243  N N    . LEU A 1 15  ? 1.543   -4.755  -14.036 1.00 0.00 ? 798 LEU A N    7  
ATOM 9244  C CA   . LEU A 1 15  ? 2.232   -4.661  -12.754 1.00 0.00 ? 798 LEU A CA   7  
ATOM 9245  C C    . LEU A 1 15  ? 1.275   -4.220  -11.652 1.00 0.00 ? 798 LEU A C    7  
ATOM 9246  O O    . LEU A 1 15  ? 0.341   -3.457  -11.897 1.00 0.00 ? 798 LEU A O    7  
ATOM 9247  C CB   . LEU A 1 15  ? 3.401   -3.679  -12.853 1.00 0.00 ? 798 LEU A CB   7  
ATOM 9248  C CG   . LEU A 1 15  ? 4.706   -4.243  -13.417 1.00 0.00 ? 798 LEU A CG   7  
ATOM 9249  C CD1  . LEU A 1 15  ? 5.228   -5.365  -12.533 1.00 0.00 ? 798 LEU A CD1  7  
ATOM 9250  C CD2  . LEU A 1 15  ? 4.502   -4.735  -14.842 1.00 0.00 ? 798 LEU A CD2  7  
ATOM 9251  H H    . LEU A 1 15  ? 1.669   -4.045  -14.699 1.00 0.00 ? 798 LEU A H    7  
ATOM 9252  H HA   . LEU A 1 15  ? 2.616   -5.641  -12.511 1.00 0.00 ? 798 LEU A HA   7  
ATOM 9253  H HB2  . LEU A 1 15  ? 3.094   -2.861  -13.487 1.00 0.00 ? 798 LEU A HB2  7  
ATOM 9254  H HB3  . LEU A 1 15  ? 3.603   -3.305  -11.859 1.00 0.00 ? 798 LEU A HB3  7  
ATOM 9255  H HG   . LEU A 1 15  ? 5.451   -3.459  -13.436 1.00 0.00 ? 798 LEU A HG   7  
ATOM 9256  H HD11 . LEU A 1 15  ? 5.355   -6.259  -13.124 1.00 0.00 ? 798 LEU A HD11 7  
ATOM 9257  H HD12 . LEU A 1 15  ? 4.522   -5.555  -11.738 1.00 0.00 ? 798 LEU A HD12 7  
ATOM 9258  H HD13 . LEU A 1 15  ? 6.179   -5.076  -12.108 1.00 0.00 ? 798 LEU A HD13 7  
ATOM 9259  H HD21 . LEU A 1 15  ? 5.380   -4.508  -15.430 1.00 0.00 ? 798 LEU A HD21 7  
ATOM 9260  H HD22 . LEU A 1 15  ? 3.643   -4.242  -15.274 1.00 0.00 ? 798 LEU A HD22 7  
ATOM 9261  H HD23 . LEU A 1 15  ? 4.340   -5.802  -14.835 1.00 0.00 ? 798 LEU A HD23 7  
ATOM 9262  N N    . GLU A 1 16  ? 1.516   -4.704  -10.437 1.00 0.00 ? 799 GLU A N    7  
ATOM 9263  C CA   . GLU A 1 16  ? 0.675   -4.358  -9.297  1.00 0.00 ? 799 GLU A CA   7  
ATOM 9264  C C    . GLU A 1 16  ? 1.262   -3.179  -8.526  1.00 0.00 ? 799 GLU A C    7  
ATOM 9265  O O    . GLU A 1 16  ? 1.283   -3.176  -7.295  1.00 0.00 ? 799 GLU A O    7  
ATOM 9266  C CB   . GLU A 1 16  ? 0.518   -5.563  -8.367  1.00 0.00 ? 799 GLU A CB   7  
ATOM 9267  C CG   . GLU A 1 16  ? -0.083  -6.782  -9.047  1.00 0.00 ? 799 GLU A CG   7  
ATOM 9268  C CD   . GLU A 1 16  ? 0.868   -7.425  -10.037 1.00 0.00 ? 799 GLU A CD   7  
ATOM 9269  O OE1  . GLU A 1 16  ? 1.916   -7.947  -9.601  1.00 0.00 ? 799 GLU A OE1  7  
ATOM 9270  O OE2  . GLU A 1 16  ? 0.564   -7.407  -11.248 1.00 0.00 ? 799 GLU A OE2  7  
ATOM 9271  H H    . GLU A 1 16  ? 2.276   -5.308  -10.305 1.00 0.00 ? 799 GLU A H    7  
ATOM 9272  H HA   . GLU A 1 16  ? -0.297  -4.077  -9.675  1.00 0.00 ? 799 GLU A HA   7  
ATOM 9273  H HB2  . GLU A 1 16  ? 1.489   -5.833  -7.980  1.00 0.00 ? 799 GLU A HB2  7  
ATOM 9274  H HB3  . GLU A 1 16  ? -0.123  -5.284  -7.543  1.00 0.00 ? 799 GLU A HB3  7  
ATOM 9275  H HG2  . GLU A 1 16  ? -0.338  -7.510  -8.291  1.00 0.00 ? 799 GLU A HG2  7  
ATOM 9276  H HG3  . GLU A 1 16  ? -0.977  -6.482  -9.572  1.00 0.00 ? 799 GLU A HG3  7  
ATOM 9277  N N    . LYS A 1 17  ? 1.738   -2.178  -9.259  1.00 0.00 ? 800 LYS A N    7  
ATOM 9278  C CA   . LYS A 1 17  ? 2.325   -0.992  -8.647  1.00 0.00 ? 800 LYS A CA   7  
ATOM 9279  C C    . LYS A 1 17  ? 1.242   -0.083  -8.075  1.00 0.00 ? 800 LYS A C    7  
ATOM 9280  O O    . LYS A 1 17  ? 1.388   0.460   -6.979  1.00 0.00 ? 800 LYS A O    7  
ATOM 9281  C CB   . LYS A 1 17  ? 3.161   -0.224  -9.673  1.00 0.00 ? 800 LYS A CB   7  
ATOM 9282  C CG   . LYS A 1 17  ? 4.527   -0.839  -9.926  1.00 0.00 ? 800 LYS A CG   7  
ATOM 9283  C CD   . LYS A 1 17  ? 5.020   -0.541  -11.332 1.00 0.00 ? 800 LYS A CD   7  
ATOM 9284  C CE   . LYS A 1 17  ? 6.534   -0.657  -11.429 1.00 0.00 ? 800 LYS A CE   7  
ATOM 9285  N NZ   . LYS A 1 17  ? 6.985   -2.076  -11.386 1.00 0.00 ? 800 LYS A NZ   7  
ATOM 9286  H H    . LYS A 1 17  ? 1.692   -2.238  -10.237 1.00 0.00 ? 800 LYS A H    7  
ATOM 9287  H HA   . LYS A 1 17  ? 2.967   -1.318  -7.842  1.00 0.00 ? 800 LYS A HA   7  
ATOM 9288  H HB2  . LYS A 1 17  ? 2.623   -0.195  -10.609 1.00 0.00 ? 800 LYS A HB2  7  
ATOM 9289  H HB3  . LYS A 1 17  ? 3.305   0.786   -9.318  1.00 0.00 ? 800 LYS A HB3  7  
ATOM 9290  H HG2  . LYS A 1 17  ? 5.232   -0.434  -9.216  1.00 0.00 ? 800 LYS A HG2  7  
ATOM 9291  H HG3  . LYS A 1 17  ? 4.459   -1.910  -9.798  1.00 0.00 ? 800 LYS A HG3  7  
ATOM 9292  H HD2  . LYS A 1 17  ? 4.572   -1.244  -12.019 1.00 0.00 ? 800 LYS A HD2  7  
ATOM 9293  H HD3  . LYS A 1 17  ? 4.727   0.464   -11.602 1.00 0.00 ? 800 LYS A HD3  7  
ATOM 9294  H HE2  . LYS A 1 17  ? 6.857   -0.213  -12.357 1.00 0.00 ? 800 LYS A HE2  7  
ATOM 9295  H HE3  . LYS A 1 17  ? 6.976   -0.123  -10.601 1.00 0.00 ? 800 LYS A HE3  7  
ATOM 9296  H HZ1  . LYS A 1 17  ? 6.521   -2.574  -10.600 1.00 0.00 ? 800 LYS A HZ1  7  
ATOM 9297  H HZ2  . LYS A 1 17  ? 8.015   -2.119  -11.249 1.00 0.00 ? 800 LYS A HZ2  7  
ATOM 9298  H HZ3  . LYS A 1 17  ? 6.744   -2.554  -12.277 1.00 0.00 ? 800 LYS A HZ3  7  
ATOM 9299  N N    . HIS A 1 18  ? 0.155   0.078   -8.823  1.00 0.00 ? 801 HIS A N    7  
ATOM 9300  C CA   . HIS A 1 18  ? -0.954  0.921   -8.389  1.00 0.00 ? 801 HIS A CA   7  
ATOM 9301  C C    . HIS A 1 18  ? -1.203  0.762   -6.892  1.00 0.00 ? 801 HIS A C    7  
ATOM 9302  O O    . HIS A 1 18  ? -1.428  1.742   -6.181  1.00 0.00 ? 801 HIS A O    7  
ATOM 9303  C CB   . HIS A 1 18  ? -2.222  0.573   -9.168  1.00 0.00 ? 801 HIS A CB   7  
ATOM 9304  C CG   . HIS A 1 18  ? -2.714  -0.820  -8.922  1.00 0.00 ? 801 HIS A CG   7  
ATOM 9305  N ND1  . HIS A 1 18  ? -1.913  -1.935  -9.051  1.00 0.00 ? 801 HIS A ND1  7  
ATOM 9306  C CD2  . HIS A 1 18  ? -3.933  -1.275  -8.549  1.00 0.00 ? 801 HIS A CD2  7  
ATOM 9307  C CE1  . HIS A 1 18  ? -2.619  -3.016  -8.771  1.00 0.00 ? 801 HIS A CE1  7  
ATOM 9308  N NE2  . HIS A 1 18  ? -3.848  -2.643  -8.463  1.00 0.00 ? 801 HIS A NE2  7  
ATOM 9309  H H    . HIS A 1 18  ? 0.097   -0.380  -9.687  1.00 0.00 ? 801 HIS A H    7  
ATOM 9310  H HA   . HIS A 1 18  ? -0.688  1.948   -8.589  1.00 0.00 ? 801 HIS A HA   7  
ATOM 9311  H HB2  . HIS A 1 18  ? -3.009  1.257   -8.886  1.00 0.00 ? 801 HIS A HB2  7  
ATOM 9312  H HB3  . HIS A 1 18  ? -2.026  0.674   -10.226 1.00 0.00 ? 801 HIS A HB3  7  
ATOM 9313  H HD2  . HIS A 1 18  ? -4.811  -0.675  -8.356  1.00 0.00 ? 801 HIS A HD2  7  
ATOM 9314  H HE1  . HIS A 1 18  ? -2.254  -4.032  -8.790  1.00 0.00 ? 801 HIS A HE1  7  
ATOM 9315  H HE2  . HIS A 1 18  ? -4.597  -3.252  -8.298  1.00 0.00 ? 801 HIS A HE2  7  
ATOM 9316  N N    . LYS A 1 19  ? -1.162  -0.479  -6.419  1.00 0.00 ? 802 LYS A N    7  
ATOM 9317  C CA   . LYS A 1 19  ? -1.383  -0.768  -5.007  1.00 0.00 ? 802 LYS A CA   7  
ATOM 9318  C C    . LYS A 1 19  ? -0.321  -0.096  -4.142  1.00 0.00 ? 802 LYS A C    7  
ATOM 9319  O O    . LYS A 1 19  ? 0.627   0.501   -4.655  1.00 0.00 ? 802 LYS A O    7  
ATOM 9320  C CB   . LYS A 1 19  ? -1.371  -2.279  -4.766  1.00 0.00 ? 802 LYS A CB   7  
ATOM 9321  C CG   . LYS A 1 19  ? -2.735  -2.930  -4.918  1.00 0.00 ? 802 LYS A CG   7  
ATOM 9322  C CD   . LYS A 1 19  ? -2.702  -4.394  -4.514  1.00 0.00 ? 802 LYS A CD   7  
ATOM 9323  C CE   . LYS A 1 19  ? -2.337  -5.289  -5.689  1.00 0.00 ? 802 LYS A CE   7  
ATOM 9324  N NZ   . LYS A 1 19  ? -1.626  -6.520  -5.248  1.00 0.00 ? 802 LYS A NZ   7  
ATOM 9325  H H    . LYS A 1 19  ? -0.978  -1.219  -7.035  1.00 0.00 ? 802 LYS A H    7  
ATOM 9326  H HA   . LYS A 1 19  ? -2.351  -0.376  -4.735  1.00 0.00 ? 802 LYS A HA   7  
ATOM 9327  H HB2  . LYS A 1 19  ? -0.695  -2.738  -5.472  1.00 0.00 ? 802 LYS A HB2  7  
ATOM 9328  H HB3  . LYS A 1 19  ? -1.015  -2.469  -3.763  1.00 0.00 ? 802 LYS A HB3  7  
ATOM 9329  H HG2  . LYS A 1 19  ? -3.444  -2.410  -4.291  1.00 0.00 ? 802 LYS A HG2  7  
ATOM 9330  H HG3  . LYS A 1 19  ? -3.045  -2.858  -5.951  1.00 0.00 ? 802 LYS A HG3  7  
ATOM 9331  H HD2  . LYS A 1 19  ? -1.968  -4.527  -3.733  1.00 0.00 ? 802 LYS A HD2  7  
ATOM 9332  H HD3  . LYS A 1 19  ? -3.677  -4.679  -4.145  1.00 0.00 ? 802 LYS A HD3  7  
ATOM 9333  H HE2  . LYS A 1 19  ? -3.242  -5.571  -6.204  1.00 0.00 ? 802 LYS A HE2  7  
ATOM 9334  H HE3  . LYS A 1 19  ? -1.698  -4.735  -6.361  1.00 0.00 ? 802 LYS A HE3  7  
ATOM 9335  H HZ1  . LYS A 1 19  ? -0.973  -6.296  -4.470  1.00 0.00 ? 802 LYS A HZ1  7  
ATOM 9336  H HZ2  . LYS A 1 19  ? -1.081  -6.920  -6.038  1.00 0.00 ? 802 LYS A HZ2  7  
ATOM 9337  H HZ3  . LYS A 1 19  ? -2.310  -7.230  -4.919  1.00 0.00 ? 802 LYS A HZ3  7  
ATOM 9338  N N    . LEU A 1 20  ? -0.484  -0.198  -2.827  1.00 0.00 ? 803 LEU A N    7  
ATOM 9339  C CA   . LEU A 1 20  ? 0.462   0.399   -1.890  1.00 0.00 ? 803 LEU A CA   7  
ATOM 9340  C C    . LEU A 1 20  ? 0.694   -0.518  -0.694  1.00 0.00 ? 803 LEU A C    7  
ATOM 9341  O O    . LEU A 1 20  ? -0.202  -1.252  -0.277  1.00 0.00 ? 803 LEU A O    7  
ATOM 9342  C CB   . LEU A 1 20  ? -0.052  1.759   -1.413  1.00 0.00 ? 803 LEU A CB   7  
ATOM 9343  C CG   . LEU A 1 20  ? -0.684  2.650   -2.483  1.00 0.00 ? 803 LEU A CG   7  
ATOM 9344  C CD1  . LEU A 1 20  ? -1.438  3.803   -1.839  1.00 0.00 ? 803 LEU A CD1  7  
ATOM 9345  C CD2  . LEU A 1 20  ? 0.379   3.173   -3.438  1.00 0.00 ? 803 LEU A CD2  7  
ATOM 9346  H H    . LEU A 1 20  ? -1.259  -0.685  -2.477  1.00 0.00 ? 803 LEU A H    7  
ATOM 9347  H HA   . LEU A 1 20  ? 1.398   0.538   -2.409  1.00 0.00 ? 803 LEU A HA   7  
ATOM 9348  H HB2  . LEU A 1 20  ? -0.793  1.583   -0.649  1.00 0.00 ? 803 LEU A HB2  7  
ATOM 9349  H HB3  . LEU A 1 20  ? 0.784   2.295   -0.986  1.00 0.00 ? 803 LEU A HB3  7  
ATOM 9350  H HG   . LEU A 1 20  ? -1.392  2.067   -3.055  1.00 0.00 ? 803 LEU A HG   7  
ATOM 9351  H HD11 . LEU A 1 20  ? -1.796  3.501   -0.866  1.00 0.00 ? 803 LEU A HD11 7  
ATOM 9352  H HD12 . LEU A 1 20  ? -2.277  4.077   -2.462  1.00 0.00 ? 803 LEU A HD12 7  
ATOM 9353  H HD13 . LEU A 1 20  ? -0.777  4.651   -1.733  1.00 0.00 ? 803 LEU A HD13 7  
ATOM 9354  H HD21 . LEU A 1 20  ? 0.250   4.237   -3.572  1.00 0.00 ? 803 LEU A HD21 7  
ATOM 9355  H HD22 . LEU A 1 20  ? 0.281   2.676   -4.392  1.00 0.00 ? 803 LEU A HD22 7  
ATOM 9356  H HD23 . LEU A 1 20  ? 1.359   2.977   -3.028  1.00 0.00 ? 803 LEU A HD23 7  
ATOM 9357  N N    . PHE A 1 21  ? 1.903   -0.469  -0.143  1.00 0.00 ? 804 PHE A N    7  
ATOM 9358  C CA   . PHE A 1 21  ? 2.253   -1.294  1.007   1.00 0.00 ? 804 PHE A CA   7  
ATOM 9359  C C    . PHE A 1 21  ? 2.717   -0.429  2.176   1.00 0.00 ? 804 PHE A C    7  
ATOM 9360  O O    . PHE A 1 21  ? 3.809   0.139   2.146   1.00 0.00 ? 804 PHE A O    7  
ATOM 9361  C CB   . PHE A 1 21  ? 3.350   -2.292  0.630   1.00 0.00 ? 804 PHE A CB   7  
ATOM 9362  C CG   . PHE A 1 21  ? 4.131   -2.798  1.809   1.00 0.00 ? 804 PHE A CG   7  
ATOM 9363  C CD1  . PHE A 1 21  ? 3.609   -3.782  2.632   1.00 0.00 ? 804 PHE A CD1  7  
ATOM 9364  C CD2  . PHE A 1 21  ? 5.388   -2.288  2.094   1.00 0.00 ? 804 PHE A CD2  7  
ATOM 9365  C CE1  . PHE A 1 21  ? 4.326   -4.250  3.718   1.00 0.00 ? 804 PHE A CE1  7  
ATOM 9366  C CE2  . PHE A 1 21  ? 6.109   -2.753  3.177   1.00 0.00 ? 804 PHE A CE2  7  
ATOM 9367  C CZ   . PHE A 1 21  ? 5.577   -3.733  3.991   1.00 0.00 ? 804 PHE A CZ   7  
ATOM 9368  H H    . PHE A 1 21  ? 2.575   0.137   -0.520  1.00 0.00 ? 804 PHE A H    7  
ATOM 9369  H HA   . PHE A 1 21  ? 1.370   -1.838  1.305   1.00 0.00 ? 804 PHE A HA   7  
ATOM 9370  H HB2  . PHE A 1 21  ? 2.899   -3.143  0.142   1.00 0.00 ? 804 PHE A HB2  7  
ATOM 9371  H HB3  . PHE A 1 21  ? 4.041   -1.817  -0.049  1.00 0.00 ? 804 PHE A HB3  7  
ATOM 9372  H HD1  . PHE A 1 21  ? 2.629   -4.187  2.420   1.00 0.00 ? 804 PHE A HD1  7  
ATOM 9373  H HD2  . PHE A 1 21  ? 5.805   -1.520  1.459   1.00 0.00 ? 804 PHE A HD2  7  
ATOM 9374  H HE1  . PHE A 1 21  ? 3.906   -5.017  4.352   1.00 0.00 ? 804 PHE A HE1  7  
ATOM 9375  H HE2  . PHE A 1 21  ? 7.087   -2.347  3.389   1.00 0.00 ? 804 PHE A HE2  7  
ATOM 9376  H HZ   . PHE A 1 21  ? 6.139   -4.098  4.838   1.00 0.00 ? 804 PHE A HZ   7  
ATOM 9377  N N    . ILE A 1 22  ? 1.880   -0.335  3.203   1.00 0.00 ? 805 ILE A N    7  
ATOM 9378  C CA   . ILE A 1 22  ? 2.203   0.460   4.381   1.00 0.00 ? 805 ILE A CA   7  
ATOM 9379  C C    . ILE A 1 22  ? 2.638   -0.430  5.541   1.00 0.00 ? 805 ILE A C    7  
ATOM 9380  O O    . ILE A 1 22  ? 2.080   -1.506  5.755   1.00 0.00 ? 805 ILE A O    7  
ATOM 9381  C CB   . ILE A 1 22  ? 1.005   1.318   4.828   1.00 0.00 ? 805 ILE A CB   7  
ATOM 9382  C CG1  . ILE A 1 22  ? 0.286   1.902   3.611   1.00 0.00 ? 805 ILE A CG1  7  
ATOM 9383  C CG2  . ILE A 1 22  ? 1.467   2.428   5.761   1.00 0.00 ? 805 ILE A CG2  7  
ATOM 9384  C CD1  . ILE A 1 22  ? -0.697  2.998   3.958   1.00 0.00 ? 805 ILE A CD1  7  
ATOM 9385  H H    . ILE A 1 22  ? 1.024   -0.811  3.168   1.00 0.00 ? 805 ILE A H    7  
ATOM 9386  H HA   . ILE A 1 22  ? 3.018   1.121   4.123   1.00 0.00 ? 805 ILE A HA   7  
ATOM 9387  H HB   . ILE A 1 22  ? 0.320   0.685   5.372   1.00 0.00 ? 805 ILE A HB   7  
ATOM 9388  H HG12 . ILE A 1 22  ? 1.017   2.316   2.933   1.00 0.00 ? 805 ILE A HG12 7  
ATOM 9389  H HG13 . ILE A 1 22  ? -0.257  1.114   3.110   1.00 0.00 ? 805 ILE A HG13 7  
ATOM 9390  H HG21 . ILE A 1 22  ? 1.846   3.254   5.177   1.00 0.00 ? 805 ILE A HG21 7  
ATOM 9391  H HG22 . ILE A 1 22  ? 0.634   2.764   6.360   1.00 0.00 ? 805 ILE A HG22 7  
ATOM 9392  H HG23 . ILE A 1 22  ? 2.248   2.054   6.406   1.00 0.00 ? 805 ILE A HG23 7  
ATOM 9393  H HD11 . ILE A 1 22  ? -0.180  3.798   4.467   1.00 0.00 ? 805 ILE A HD11 7  
ATOM 9394  H HD12 . ILE A 1 22  ? -1.148  3.378   3.054   1.00 0.00 ? 805 ILE A HD12 7  
ATOM 9395  H HD13 . ILE A 1 22  ? -1.466  2.600   4.604   1.00 0.00 ? 805 ILE A HD13 7  
ATOM 9396  N N    . SER A 1 23  ? 3.637   0.029   6.289   1.00 0.00 ? 806 SER A N    7  
ATOM 9397  C CA   . SER A 1 23  ? 4.148   -0.726  7.427   1.00 0.00 ? 806 SER A CA   7  
ATOM 9398  C C    . SER A 1 23  ? 4.406   0.193   8.617   1.00 0.00 ? 806 SER A C    7  
ATOM 9399  O O    . SER A 1 23  ? 4.465   1.414   8.472   1.00 0.00 ? 806 SER A O    7  
ATOM 9400  C CB   . SER A 1 23  ? 5.436   -1.457  7.044   1.00 0.00 ? 806 SER A CB   7  
ATOM 9401  O OG   . SER A 1 23  ? 5.901   -2.265  8.111   1.00 0.00 ? 806 SER A OG   7  
ATOM 9402  H H    . SER A 1 23  ? 4.041   0.894   6.068   1.00 0.00 ? 806 SER A H    7  
ATOM 9403  H HA   . SER A 1 23  ? 3.400   -1.454  7.705   1.00 0.00 ? 806 SER A HA   7  
ATOM 9404  H HB2  . SER A 1 23  ? 5.249   -2.086  6.187   1.00 0.00 ? 806 SER A HB2  7  
ATOM 9405  H HB3  . SER A 1 23  ? 6.199   -0.732  6.799   1.00 0.00 ? 806 SER A HB3  7  
ATOM 9406  H HG   . SER A 1 23  ? 6.808   -2.529  7.942   1.00 0.00 ? 806 SER A HG   7  
ATOM 9407  N N    . GLY A 1 24  ? 4.560   -0.403  9.796   1.00 0.00 ? 807 GLY A N    7  
ATOM 9408  C CA   . GLY A 1 24  ? 4.809   0.376   10.994  1.00 0.00 ? 807 GLY A CA   7  
ATOM 9409  C C    . GLY A 1 24  ? 3.579   1.124   11.466  1.00 0.00 ? 807 GLY A C    7  
ATOM 9410  O O    . GLY A 1 24  ? 3.656   2.301   11.822  1.00 0.00 ? 807 GLY A O    7  
ATOM 9411  H H    . GLY A 1 24  ? 4.503   -1.380  9.851   1.00 0.00 ? 807 GLY A H    7  
ATOM 9412  H HA2  . GLY A 1 24  ? 5.138   -0.288  11.780  1.00 0.00 ? 807 GLY A HA2  7  
ATOM 9413  H HA3  . GLY A 1 24  ? 5.593   1.090   10.789  1.00 0.00 ? 807 GLY A HA3  7  
ATOM 9414  N N    . LEU A 1 25  ? 2.439   0.442   11.469  1.00 0.00 ? 808 LEU A N    7  
ATOM 9415  C CA   . LEU A 1 25  ? 1.184   1.050   11.899  1.00 0.00 ? 808 LEU A CA   7  
ATOM 9416  C C    . LEU A 1 25  ? 0.762   0.518   13.265  1.00 0.00 ? 808 LEU A C    7  
ATOM 9417  O O    . LEU A 1 25  ? 0.931   -0.660  13.579  1.00 0.00 ? 808 LEU A O    7  
ATOM 9418  C CB   . LEU A 1 25  ? 0.084   0.779   10.872  1.00 0.00 ? 808 LEU A CB   7  
ATOM 9419  C CG   . LEU A 1 25  ? 0.113   1.648   9.613   1.00 0.00 ? 808 LEU A CG   7  
ATOM 9420  C CD1  . LEU A 1 25  ? -0.677  0.990   8.493   1.00 0.00 ? 808 LEU A CD1  7  
ATOM 9421  C CD2  . LEU A 1 25  ? -0.435  3.036   9.911   1.00 0.00 ? 808 LEU A CD2  7  
ATOM 9422  H H    . LEU A 1 25  ? 2.439   -0.492  11.174  1.00 0.00 ? 808 LEU A H    7  
ATOM 9423  H HA   . LEU A 1 25  ? 1.341   2.116   11.974  1.00 0.00 ? 808 LEU A HA   7  
ATOM 9424  H HB2  . LEU A 1 25  ? 0.166   -0.251  10.563  1.00 0.00 ? 808 LEU A HB2  7  
ATOM 9425  H HB3  . LEU A 1 25  ? -0.868  0.933   11.359  1.00 0.00 ? 808 LEU A HB3  7  
ATOM 9426  H HG   . LEU A 1 25  ? 1.136   1.756   9.281   1.00 0.00 ? 808 LEU A HG   7  
ATOM 9427  H HD11 . LEU A 1 25  ? -0.439  1.469   7.555   1.00 0.00 ? 808 LEU A HD11 7  
ATOM 9428  H HD12 . LEU A 1 25  ? -1.734  1.091   8.690   1.00 0.00 ? 808 LEU A HD12 7  
ATOM 9429  H HD13 . LEU A 1 25  ? -0.420  -0.058  8.438   1.00 0.00 ? 808 LEU A HD13 7  
ATOM 9430  H HD21 . LEU A 1 25  ? -0.099  3.726   9.152   1.00 0.00 ? 808 LEU A HD21 7  
ATOM 9431  H HD22 . LEU A 1 25  ? -0.080  3.364   10.878  1.00 0.00 ? 808 LEU A HD22 7  
ATOM 9432  H HD23 . LEU A 1 25  ? -1.515  3.004   9.916   1.00 0.00 ? 808 LEU A HD23 7  
ATOM 9433  N N    . PRO A 1 26  ? 0.197   1.406   14.097  1.00 0.00 ? 809 PRO A N    7  
ATOM 9434  C CA   . PRO A 1 26  ? -0.264  1.048   15.442  1.00 0.00 ? 809 PRO A CA   7  
ATOM 9435  C C    . PRO A 1 26  ? -1.493  0.146   15.413  1.00 0.00 ? 809 PRO A C    7  
ATOM 9436  O O    . PRO A 1 26  ? -2.492  0.462   14.767  1.00 0.00 ? 809 PRO A O    7  
ATOM 9437  C CB   . PRO A 1 26  ? -0.608  2.400   16.071  1.00 0.00 ? 809 PRO A CB   7  
ATOM 9438  C CG   . PRO A 1 26  ? -0.921  3.287   14.915  1.00 0.00 ? 809 PRO A CG   7  
ATOM 9439  C CD   . PRO A 1 26  ? -0.036  2.827   13.789  1.00 0.00 ? 809 PRO A CD   7  
ATOM 9440  H HA   . PRO A 1 26  ? 0.518   0.571   16.015  1.00 0.00 ? 809 PRO A HA   7  
ATOM 9441  H HB2  . PRO A 1 26  ? -1.461  2.289   16.726  1.00 0.00 ? 809 PRO A HB2  7  
ATOM 9442  H HB3  . PRO A 1 26  ? 0.238   2.767   16.631  1.00 0.00 ? 809 PRO A HB3  7  
ATOM 9443  H HG2  . PRO A 1 26  ? -1.960  3.182   14.642  1.00 0.00 ? 809 PRO A HG2  7  
ATOM 9444  H HG3  . PRO A 1 26  ? -0.700  4.313   15.169  1.00 0.00 ? 809 PRO A HG3  7  
ATOM 9445  H HD2  . PRO A 1 26  ? -0.542  2.938   12.842  1.00 0.00 ? 809 PRO A HD2  7  
ATOM 9446  H HD3  . PRO A 1 26  ? 0.893   3.378   13.790  1.00 0.00 ? 809 PRO A HD3  7  
ATOM 9447  N N    . PHE A 1 27  ? -1.413  -0.979  16.116  1.00 0.00 ? 810 PHE A N    7  
ATOM 9448  C CA   . PHE A 1 27  ? -2.519  -1.928  16.170  1.00 0.00 ? 810 PHE A CA   7  
ATOM 9449  C C    . PHE A 1 27  ? -3.855  -1.199  16.278  1.00 0.00 ? 810 PHE A C    7  
ATOM 9450  O O    . PHE A 1 27  ? -4.868  -1.656  15.749  1.00 0.00 ? 810 PHE A O    7  
ATOM 9451  C CB   . PHE A 1 27  ? -2.346  -2.879  17.356  1.00 0.00 ? 810 PHE A CB   7  
ATOM 9452  C CG   . PHE A 1 27  ? -0.918  -3.278  17.601  1.00 0.00 ? 810 PHE A CG   7  
ATOM 9453  C CD1  . PHE A 1 27  ? -0.174  -3.886  16.603  1.00 0.00 ? 810 PHE A CD1  7  
ATOM 9454  C CD2  . PHE A 1 27  ? -0.321  -3.045  18.830  1.00 0.00 ? 810 PHE A CD2  7  
ATOM 9455  C CE1  . PHE A 1 27  ? 1.140   -4.254  16.825  1.00 0.00 ? 810 PHE A CE1  7  
ATOM 9456  C CE2  . PHE A 1 27  ? 0.992   -3.411  19.057  1.00 0.00 ? 810 PHE A CE2  7  
ATOM 9457  C CZ   . PHE A 1 27  ? 1.723   -4.017  18.054  1.00 0.00 ? 810 PHE A CZ   7  
ATOM 9458  H H    . PHE A 1 27  ? -0.589  -1.176  16.610  1.00 0.00 ? 810 PHE A H    7  
ATOM 9459  H HA   . PHE A 1 27  ? -2.508  -2.500  15.256  1.00 0.00 ? 810 PHE A HA   7  
ATOM 9460  H HB2  . PHE A 1 27  ? -2.713  -2.398  18.250  1.00 0.00 ? 810 PHE A HB2  7  
ATOM 9461  H HB3  . PHE A 1 27  ? -2.916  -3.777  17.174  1.00 0.00 ? 810 PHE A HB3  7  
ATOM 9462  H HD1  . PHE A 1 27  ? -0.630  -4.072  15.641  1.00 0.00 ? 810 PHE A HD1  7  
ATOM 9463  H HD2  . PHE A 1 27  ? -0.892  -2.572  19.615  1.00 0.00 ? 810 PHE A HD2  7  
ATOM 9464  H HE1  . PHE A 1 27  ? 1.708   -4.728  16.039  1.00 0.00 ? 810 PHE A HE1  7  
ATOM 9465  H HE2  . PHE A 1 27  ? 1.445   -3.224  20.019  1.00 0.00 ? 810 PHE A HE2  7  
ATOM 9466  H HZ   . PHE A 1 27  ? 2.749   -4.303  18.230  1.00 0.00 ? 810 PHE A HZ   7  
ATOM 9467  N N    . SER A 1 28  ? -3.849  -0.064  16.970  1.00 0.00 ? 811 SER A N    7  
ATOM 9468  C CA   . SER A 1 28  ? -5.061  0.726   17.152  1.00 0.00 ? 811 SER A CA   7  
ATOM 9469  C C    . SER A 1 28  ? -5.724  1.022   15.811  1.00 0.00 ? 811 SER A C    7  
ATOM 9470  O O    . SER A 1 28  ? -6.906  0.736   15.614  1.00 0.00 ? 811 SER A O    7  
ATOM 9471  C CB   . SER A 1 28  ? -4.737  2.036   17.874  1.00 0.00 ? 811 SER A CB   7  
ATOM 9472  O OG   . SER A 1 28  ? -4.060  1.792   19.094  1.00 0.00 ? 811 SER A OG   7  
ATOM 9473  H H    . SER A 1 28  ? -3.010  0.248   17.369  1.00 0.00 ? 811 SER A H    7  
ATOM 9474  H HA   . SER A 1 28  ? -5.744  0.150   17.759  1.00 0.00 ? 811 SER A HA   7  
ATOM 9475  H HB2  . SER A 1 28  ? -4.109  2.646   17.243  1.00 0.00 ? 811 SER A HB2  7  
ATOM 9476  H HB3  . SER A 1 28  ? -5.656  2.564   18.085  1.00 0.00 ? 811 SER A HB3  7  
ATOM 9477  H HG   . SER A 1 28  ? -4.636  2.011   19.830  1.00 0.00 ? 811 SER A HG   7  
ATOM 9478  N N    . CYS A 1 29  ? -4.955  1.595   14.892  1.00 0.00 ? 812 CYS A N    7  
ATOM 9479  C CA   . CYS A 1 29  ? -5.467  1.931   13.568  1.00 0.00 ? 812 CYS A CA   7  
ATOM 9480  C C    . CYS A 1 29  ? -6.288  0.781   12.994  1.00 0.00 ? 812 CYS A C    7  
ATOM 9481  O O    . CYS A 1 29  ? -6.101  -0.378  13.368  1.00 0.00 ? 812 CYS A O    7  
ATOM 9482  C CB   . CYS A 1 29  ? -4.313  2.271   12.623  1.00 0.00 ? 812 CYS A CB   7  
ATOM 9483  S SG   . CYS A 1 29  ? -4.754  3.430   11.307  1.00 0.00 ? 812 CYS A SG   7  
ATOM 9484  H H    . CYS A 1 29  ? -4.021  1.799   15.108  1.00 0.00 ? 812 CYS A H    7  
ATOM 9485  H HA   . CYS A 1 29  ? -6.105  2.796   13.669  1.00 0.00 ? 812 CYS A HA   7  
ATOM 9486  H HB2  . CYS A 1 29  ? -3.509  2.712   13.193  1.00 0.00 ? 812 CYS A HB2  7  
ATOM 9487  H HB3  . CYS A 1 29  ? -3.960  1.363   12.158  1.00 0.00 ? 812 CYS A HB3  7  
ATOM 9488  H HG   . CYS A 1 29  ? -4.314  2.934   10.161  1.00 0.00 ? 812 CYS A HG   7  
ATOM 9489  N N    . THR A 1 30  ? -7.200  1.108   12.084  1.00 0.00 ? 813 THR A N    7  
ATOM 9490  C CA   . THR A 1 30  ? -8.052  0.103   11.461  1.00 0.00 ? 813 THR A CA   7  
ATOM 9491  C C    . THR A 1 30  ? -8.222  0.374   9.971   1.00 0.00 ? 813 THR A C    7  
ATOM 9492  O O    . THR A 1 30  ? -7.809  1.419   9.468   1.00 0.00 ? 813 THR A O    7  
ATOM 9493  C CB   . THR A 1 30  ? -9.442  0.055   12.124  1.00 0.00 ? 813 THR A CB   7  
ATOM 9494  O OG1  . THR A 1 30  ? -10.334 -0.740  11.335  1.00 0.00 ? 813 THR A OG1  7  
ATOM 9495  C CG2  . THR A 1 30  ? -10.012 1.456   12.287  1.00 0.00 ? 813 THR A CG2  7  
ATOM 9496  H H    . THR A 1 30  ? -7.302  2.048   11.828  1.00 0.00 ? 813 THR A H    7  
ATOM 9497  H HA   . THR A 1 30  ? -7.581  -0.861  11.591  1.00 0.00 ? 813 THR A HA   7  
ATOM 9498  H HB   . THR A 1 30  ? -9.342  -0.394  13.102  1.00 0.00 ? 813 THR A HB   7  
ATOM 9499  H HG1  . THR A 1 30  ? -10.253 -1.662  11.591  1.00 0.00 ? 813 THR A HG1  7  
ATOM 9500  H HG21 . THR A 1 30  ? -9.966  1.744   13.327  1.00 0.00 ? 813 THR A HG21 7  
ATOM 9501  H HG22 . THR A 1 30  ? -11.040 1.467   11.956  1.00 0.00 ? 813 THR A HG22 7  
ATOM 9502  H HG23 . THR A 1 30  ? -9.435  2.150   11.695  1.00 0.00 ? 813 THR A HG23 7  
ATOM 9503  N N    . LYS A 1 31  ? -8.834  -0.573  9.268   1.00 0.00 ? 814 LYS A N    7  
ATOM 9504  C CA   . LYS A 1 31  ? -9.061  -0.437  7.834   1.00 0.00 ? 814 LYS A CA   7  
ATOM 9505  C C    . LYS A 1 31  ? -9.838  0.839   7.525   1.00 0.00 ? 814 LYS A C    7  
ATOM 9506  O O    . LYS A 1 31  ? -9.398  1.666   6.727   1.00 0.00 ? 814 LYS A O    7  
ATOM 9507  C CB   . LYS A 1 31  ? -9.822  -1.652  7.299   1.00 0.00 ? 814 LYS A CB   7  
ATOM 9508  C CG   . LYS A 1 31  ? -9.761  -1.792  5.788   1.00 0.00 ? 814 LYS A CG   7  
ATOM 9509  C CD   . LYS A 1 31  ? -10.907 -1.058  5.113   1.00 0.00 ? 814 LYS A CD   7  
ATOM 9510  C CE   . LYS A 1 31  ? -12.201 -1.854  5.190   1.00 0.00 ? 814 LYS A CE   7  
ATOM 9511  N NZ   . LYS A 1 31  ? -13.355 -1.093  4.637   1.00 0.00 ? 814 LYS A NZ   7  
ATOM 9512  H H    . LYS A 1 31  ? -9.141  -1.385  9.725   1.00 0.00 ? 814 LYS A H    7  
ATOM 9513  H HA   . LYS A 1 31  ? -8.098  -0.384  7.349   1.00 0.00 ? 814 LYS A HA   7  
ATOM 9514  H HB2  . LYS A 1 31  ? -9.405  -2.546  7.740   1.00 0.00 ? 814 LYS A HB2  7  
ATOM 9515  H HB3  . LYS A 1 31  ? -10.859 -1.569  7.590   1.00 0.00 ? 814 LYS A HB3  7  
ATOM 9516  H HG2  . LYS A 1 31  ? -8.827  -1.380  5.435   1.00 0.00 ? 814 LYS A HG2  7  
ATOM 9517  H HG3  . LYS A 1 31  ? -9.814  -2.840  5.530   1.00 0.00 ? 814 LYS A HG3  7  
ATOM 9518  H HD2  . LYS A 1 31  ? -11.053 -0.107  5.604   1.00 0.00 ? 814 LYS A HD2  7  
ATOM 9519  H HD3  . LYS A 1 31  ? -10.657 -0.894  4.074   1.00 0.00 ? 814 LYS A HD3  7  
ATOM 9520  H HE2  . LYS A 1 31  ? -12.080 -2.767  4.628   1.00 0.00 ? 814 LYS A HE2  7  
ATOM 9521  H HE3  . LYS A 1 31  ? -12.400 -2.092  6.225   1.00 0.00 ? 814 LYS A HE3  7  
ATOM 9522  H HZ1  . LYS A 1 31  ? -14.035 -1.745  4.197   1.00 0.00 ? 814 LYS A HZ1  7  
ATOM 9523  H HZ2  . LYS A 1 31  ? -13.025 -0.417  3.918   1.00 0.00 ? 814 LYS A HZ2  7  
ATOM 9524  H HZ3  . LYS A 1 31  ? -13.835 -0.569  5.396   1.00 0.00 ? 814 LYS A HZ3  7  
ATOM 9525  N N    . GLU A 1 32  ? -10.994 0.992   8.164   1.00 0.00 ? 815 GLU A N    7  
ATOM 9526  C CA   . GLU A 1 32  ? -11.831 2.168   7.957   1.00 0.00 ? 815 GLU A CA   7  
ATOM 9527  C C    . GLU A 1 32  ? -10.986 3.438   7.928   1.00 0.00 ? 815 GLU A C    7  
ATOM 9528  O O    . GLU A 1 32  ? -10.873 4.097   6.895   1.00 0.00 ? 815 GLU A O    7  
ATOM 9529  C CB   . GLU A 1 32  ? -12.888 2.270   9.059   1.00 0.00 ? 815 GLU A CB   7  
ATOM 9530  C CG   . GLU A 1 32  ? -13.781 1.045   9.160   1.00 0.00 ? 815 GLU A CG   7  
ATOM 9531  C CD   . GLU A 1 32  ? -15.096 1.338   9.857   1.00 0.00 ? 815 GLU A CD   7  
ATOM 9532  O OE1  . GLU A 1 32  ? -16.002 1.897   9.206   1.00 0.00 ? 815 GLU A OE1  7  
ATOM 9533  O OE2  . GLU A 1 32  ? -15.217 1.008   11.056  1.00 0.00 ? 815 GLU A OE2  7  
ATOM 9534  H H    . GLU A 1 32  ? -11.291 0.297   8.788   1.00 0.00 ? 815 GLU A H    7  
ATOM 9535  H HA   . GLU A 1 32  ? -12.327 2.058   7.004   1.00 0.00 ? 815 GLU A HA   7  
ATOM 9536  H HB2  . GLU A 1 32  ? -12.389 2.406   10.007  1.00 0.00 ? 815 GLU A HB2  7  
ATOM 9537  H HB3  . GLU A 1 32  ? -13.511 3.129   8.863   1.00 0.00 ? 815 GLU A HB3  7  
ATOM 9538  H HG2  . GLU A 1 32  ? -13.993 0.686   8.164   1.00 0.00 ? 815 GLU A HG2  7  
ATOM 9539  H HG3  . GLU A 1 32  ? -13.260 0.279   9.714   1.00 0.00 ? 815 GLU A HG3  7  
ATOM 9540  N N    . GLU A 1 33  ? -10.396 3.775   9.070   1.00 0.00 ? 816 GLU A N    7  
ATOM 9541  C CA   . GLU A 1 33  ? -9.563  4.968   9.176   1.00 0.00 ? 816 GLU A CA   7  
ATOM 9542  C C    . GLU A 1 33  ? -8.654  5.106   7.958   1.00 0.00 ? 816 GLU A C    7  
ATOM 9543  O O    . GLU A 1 33  ? -8.705  6.107   7.242   1.00 0.00 ? 816 GLU A O    7  
ATOM 9544  C CB   . GLU A 1 33  ? -8.720  4.916   10.452  1.00 0.00 ? 816 GLU A CB   7  
ATOM 9545  C CG   . GLU A 1 33  ? -9.478  5.336   11.700  1.00 0.00 ? 816 GLU A CG   7  
ATOM 9546  C CD   . GLU A 1 33  ? -8.565  5.877   12.783  1.00 0.00 ? 816 GLU A CD   7  
ATOM 9547  O OE1  . GLU A 1 33  ? -8.021  6.987   12.600  1.00 0.00 ? 816 GLU A OE1  7  
ATOM 9548  O OE2  . GLU A 1 33  ? -8.393  5.192   13.812  1.00 0.00 ? 816 GLU A OE2  7  
ATOM 9549  H H    . GLU A 1 33  ? -10.524 3.210   9.860   1.00 0.00 ? 816 GLU A H    7  
ATOM 9550  H HA   . GLU A 1 33  ? -10.216 5.826   9.222   1.00 0.00 ? 816 GLU A HA   7  
ATOM 9551  H HB2  . GLU A 1 33  ? -8.365  3.906   10.594  1.00 0.00 ? 816 GLU A HB2  7  
ATOM 9552  H HB3  . GLU A 1 33  ? -7.870  5.573   10.334  1.00 0.00 ? 816 GLU A HB3  7  
ATOM 9553  H HG2  . GLU A 1 33  ? -10.188 6.105   11.433  1.00 0.00 ? 816 GLU A HG2  7  
ATOM 9554  H HG3  . GLU A 1 33  ? -10.007 4.479   12.090  1.00 0.00 ? 816 GLU A HG3  7  
ATOM 9555  N N    . LEU A 1 34  ? -7.822  4.095   7.730   1.00 0.00 ? 817 LEU A N    7  
ATOM 9556  C CA   . LEU A 1 34  ? -6.901  4.103   6.599   1.00 0.00 ? 817 LEU A CA   7  
ATOM 9557  C C    . LEU A 1 34  ? -7.628  4.458   5.306   1.00 0.00 ? 817 LEU A C    7  
ATOM 9558  O O    . LEU A 1 34  ? -7.336  5.474   4.678   1.00 0.00 ? 817 LEU A O    7  
ATOM 9559  C CB   . LEU A 1 34  ? -6.223  2.739   6.459   1.00 0.00 ? 817 LEU A CB   7  
ATOM 9560  C CG   . LEU A 1 34  ? -4.884  2.727   5.721   1.00 0.00 ? 817 LEU A CG   7  
ATOM 9561  C CD1  . LEU A 1 34  ? -3.879  3.626   6.425   1.00 0.00 ? 817 LEU A CD1  7  
ATOM 9562  C CD2  . LEU A 1 34  ? -4.347  1.308   5.612   1.00 0.00 ? 817 LEU A CD2  7  
ATOM 9563  H H    . LEU A 1 34  ? -7.828  3.325   8.335   1.00 0.00 ? 817 LEU A H    7  
ATOM 9564  H HA   . LEU A 1 34  ? -6.147  4.852   6.791   1.00 0.00 ? 817 LEU A HA   7  
ATOM 9565  H HB2  . LEU A 1 34  ? -6.057  2.349   7.451   1.00 0.00 ? 817 LEU A HB2  7  
ATOM 9566  H HB3  . LEU A 1 34  ? -6.901  2.087   5.927   1.00 0.00 ? 817 LEU A HB3  7  
ATOM 9567  H HG   . LEU A 1 34  ? -5.028  3.109   4.720   1.00 0.00 ? 817 LEU A HG   7  
ATOM 9568  H HD11 . LEU A 1 34  ? -3.806  3.341   7.463   1.00 0.00 ? 817 LEU A HD11 7  
ATOM 9569  H HD12 . LEU A 1 34  ? -4.205  4.653   6.356   1.00 0.00 ? 817 LEU A HD12 7  
ATOM 9570  H HD13 . LEU A 1 34  ? -2.912  3.523   5.954   1.00 0.00 ? 817 LEU A HD13 7  
ATOM 9571  H HD21 . LEU A 1 34  ? -4.986  0.638   6.169   1.00 0.00 ? 817 LEU A HD21 7  
ATOM 9572  H HD22 . LEU A 1 34  ? -3.346  1.269   6.016   1.00 0.00 ? 817 LEU A HD22 7  
ATOM 9573  H HD23 . LEU A 1 34  ? -4.330  1.009   4.574   1.00 0.00 ? 817 LEU A HD23 7  
ATOM 9574  N N    . GLU A 1 35  ? -8.578  3.613   4.917   1.00 0.00 ? 818 GLU A N    7  
ATOM 9575  C CA   . GLU A 1 35  ? -9.348  3.839   3.699   1.00 0.00 ? 818 GLU A CA   7  
ATOM 9576  C C    . GLU A 1 35  ? -9.713  5.313   3.552   1.00 0.00 ? 818 GLU A C    7  
ATOM 9577  O O    . GLU A 1 35  ? -9.338  5.960   2.575   1.00 0.00 ? 818 GLU A O    7  
ATOM 9578  C CB   . GLU A 1 35  ? -10.619 2.986   3.707   1.00 0.00 ? 818 GLU A CB   7  
ATOM 9579  C CG   . GLU A 1 35  ? -11.535 3.249   2.524   1.00 0.00 ? 818 GLU A CG   7  
ATOM 9580  C CD   . GLU A 1 35  ? -12.444 4.443   2.744   1.00 0.00 ? 818 GLU A CD   7  
ATOM 9581  O OE1  . GLU A 1 35  ? -12.757 4.741   3.916   1.00 0.00 ? 818 GLU A OE1  7  
ATOM 9582  O OE2  . GLU A 1 35  ? -12.842 5.077   1.746   1.00 0.00 ? 818 GLU A OE2  7  
ATOM 9583  H H    . GLU A 1 35  ? -8.765  2.819   5.460   1.00 0.00 ? 818 GLU A H    7  
ATOM 9584  H HA   . GLU A 1 35  ? -8.735  3.546   2.860   1.00 0.00 ? 818 GLU A HA   7  
ATOM 9585  H HB2  . GLU A 1 35  ? -10.338 1.943   3.695   1.00 0.00 ? 818 GLU A HB2  7  
ATOM 9586  H HB3  . GLU A 1 35  ? -11.169 3.191   4.614   1.00 0.00 ? 818 GLU A HB3  7  
ATOM 9587  H HG2  . GLU A 1 35  ? -10.929 3.433   1.650   1.00 0.00 ? 818 GLU A HG2  7  
ATOM 9588  H HG3  . GLU A 1 35  ? -12.147 2.374   2.358   1.00 0.00 ? 818 GLU A HG3  7  
ATOM 9589  N N    . GLU A 1 36  ? -10.446 5.836   4.530   1.00 0.00 ? 819 GLU A N    7  
ATOM 9590  C CA   . GLU A 1 36  ? -10.862 7.233   4.508   1.00 0.00 ? 819 GLU A CA   7  
ATOM 9591  C C    . GLU A 1 36  ? -9.690  8.145   4.157   1.00 0.00 ? 819 GLU A C    7  
ATOM 9592  O O    . GLU A 1 36  ? -9.848  9.123   3.426   1.00 0.00 ? 819 GLU A O    7  
ATOM 9593  C CB   . GLU A 1 36  ? -11.447 7.635   5.863   1.00 0.00 ? 819 GLU A CB   7  
ATOM 9594  C CG   . GLU A 1 36  ? -12.836 7.073   6.118   1.00 0.00 ? 819 GLU A CG   7  
ATOM 9595  C CD   . GLU A 1 36  ? -13.451 7.597   7.401   1.00 0.00 ? 819 GLU A CD   7  
ATOM 9596  O OE1  . GLU A 1 36  ? -12.805 7.472   8.462   1.00 0.00 ? 819 GLU A OE1  7  
ATOM 9597  O OE2  . GLU A 1 36  ? -14.578 8.131   7.344   1.00 0.00 ? 819 GLU A OE2  7  
ATOM 9598  H H    . GLU A 1 36  ? -10.713 5.269   5.283   1.00 0.00 ? 819 GLU A H    7  
ATOM 9599  H HA   . GLU A 1 36  ? -11.625 7.340   3.751   1.00 0.00 ? 819 GLU A HA   7  
ATOM 9600  H HB2  . GLU A 1 36  ? -10.790 7.284   6.645   1.00 0.00 ? 819 GLU A HB2  7  
ATOM 9601  H HB3  . GLU A 1 36  ? -11.504 8.713   5.911   1.00 0.00 ? 819 GLU A HB3  7  
ATOM 9602  H HG2  . GLU A 1 36  ? -13.477 7.343   5.293   1.00 0.00 ? 819 GLU A HG2  7  
ATOM 9603  H HG3  . GLU A 1 36  ? -12.768 5.997   6.182   1.00 0.00 ? 819 GLU A HG3  7  
ATOM 9604  N N    . ILE A 1 37  ? -8.515  7.817   4.684   1.00 0.00 ? 820 ILE A N    7  
ATOM 9605  C CA   . ILE A 1 37  ? -7.316  8.606   4.427   1.00 0.00 ? 820 ILE A CA   7  
ATOM 9606  C C    . ILE A 1 37  ? -6.795  8.368   3.013   1.00 0.00 ? 820 ILE A C    7  
ATOM 9607  O O    . ILE A 1 37  ? -6.172  9.246   2.415   1.00 0.00 ? 820 ILE A O    7  
ATOM 9608  C CB   . ILE A 1 37  ? -6.200  8.278   5.435   1.00 0.00 ? 820 ILE A CB   7  
ATOM 9609  C CG1  . ILE A 1 37  ? -6.699  8.483   6.867   1.00 0.00 ? 820 ILE A CG1  7  
ATOM 9610  C CG2  . ILE A 1 37  ? -4.974  9.139   5.168   1.00 0.00 ? 820 ILE A CG2  7  
ATOM 9611  C CD1  . ILE A 1 37  ? -5.833  7.813   7.911   1.00 0.00 ? 820 ILE A CD1  7  
ATOM 9612  H H    . ILE A 1 37  ? -8.453  7.027   5.259   1.00 0.00 ? 820 ILE A H    7  
ATOM 9613  H HA   . ILE A 1 37  ? -7.575  9.649   4.533   1.00 0.00 ? 820 ILE A HA   7  
ATOM 9614  H HB   . ILE A 1 37  ? -5.919  7.244   5.304   1.00 0.00 ? 820 ILE A HB   7  
ATOM 9615  H HG12 . ILE A 1 37  ? -6.724  9.539   7.085   1.00 0.00 ? 820 ILE A HG12 7  
ATOM 9616  H HG13 . ILE A 1 37  ? -7.697  8.078   6.953   1.00 0.00 ? 820 ILE A HG13 7  
ATOM 9617  H HG21 . ILE A 1 37  ? -4.778  9.763   6.027   1.00 0.00 ? 820 ILE A HG21 7  
ATOM 9618  H HG22 . ILE A 1 37  ? -4.121  8.504   4.983   1.00 0.00 ? 820 ILE A HG22 7  
ATOM 9619  H HG23 . ILE A 1 37  ? -5.154  9.762   4.304   1.00 0.00 ? 820 ILE A HG23 7  
ATOM 9620  H HD11 . ILE A 1 37  ? -6.442  7.531   8.757   1.00 0.00 ? 820 ILE A HD11 7  
ATOM 9621  H HD12 . ILE A 1 37  ? -5.373  6.934   7.487   1.00 0.00 ? 820 ILE A HD12 7  
ATOM 9622  H HD13 . ILE A 1 37  ? -5.065  8.500   8.236   1.00 0.00 ? 820 ILE A HD13 7  
ATOM 9623  N N    . CYS A 1 38  ? -7.056  7.178   2.485   1.00 0.00 ? 821 CYS A N    7  
ATOM 9624  C CA   . CYS A 1 38  ? -6.614  6.824   1.141   1.00 0.00 ? 821 CYS A CA   7  
ATOM 9625  C C    . CYS A 1 38  ? -7.469  7.520   0.087   1.00 0.00 ? 821 CYS A C    7  
ATOM 9626  O O    . CYS A 1 38  ? -6.954  8.230   -0.777  1.00 0.00 ? 821 CYS A O    7  
ATOM 9627  C CB   . CYS A 1 38  ? -6.673  5.309   0.944   1.00 0.00 ? 821 CYS A CB   7  
ATOM 9628  S SG   . CYS A 1 38  ? -5.353  4.403   1.784   1.00 0.00 ? 821 CYS A SG   7  
ATOM 9629  H H    . CYS A 1 38  ? -7.557  6.520   3.011   1.00 0.00 ? 821 CYS A H    7  
ATOM 9630  H HA   . CYS A 1 38  ? -5.592  7.153   1.031   1.00 0.00 ? 821 CYS A HA   7  
ATOM 9631  H HB2  . CYS A 1 38  ? -7.616  4.941   1.323   1.00 0.00 ? 821 CYS A HB2  7  
ATOM 9632  H HB3  . CYS A 1 38  ? -6.606  5.088   -0.111  1.00 0.00 ? 821 CYS A HB3  7  
ATOM 9633  H HG   . CYS A 1 38  ? -5.249  4.881   3.014   1.00 0.00 ? 821 CYS A HG   7  
ATOM 9634  N N    . LYS A 1 39  ? -8.779  7.311   0.163   1.00 0.00 ? 822 LYS A N    7  
ATOM 9635  C CA   . LYS A 1 39  ? -9.708  7.917   -0.784  1.00 0.00 ? 822 LYS A CA   7  
ATOM 9636  C C    . LYS A 1 39  ? -9.487  9.423   -0.873  1.00 0.00 ? 822 LYS A C    7  
ATOM 9637  O O    . LYS A 1 39  ? -9.709  10.032  -1.920  1.00 0.00 ? 822 LYS A O    7  
ATOM 9638  C CB   . LYS A 1 39  ? -11.152 7.626   -0.370  1.00 0.00 ? 822 LYS A CB   7  
ATOM 9639  C CG   . LYS A 1 39  ? -11.526 8.205   0.983   1.00 0.00 ? 822 LYS A CG   7  
ATOM 9640  C CD   . LYS A 1 39  ? -13.011 8.048   1.266   1.00 0.00 ? 822 LYS A CD   7  
ATOM 9641  C CE   . LYS A 1 39  ? -13.825 9.141   0.592   1.00 0.00 ? 822 LYS A CE   7  
ATOM 9642  N NZ   . LYS A 1 39  ? -15.061 9.464   1.357   1.00 0.00 ? 822 LYS A NZ   7  
ATOM 9643  H H    . LYS A 1 39  ? -9.131  6.735   0.875   1.00 0.00 ? 822 LYS A H    7  
ATOM 9644  H HA   . LYS A 1 39  ? -9.525  7.480   -1.754  1.00 0.00 ? 822 LYS A HA   7  
ATOM 9645  H HB2  . LYS A 1 39  ? -11.817 8.042   -1.112  1.00 0.00 ? 822 LYS A HB2  7  
ATOM 9646  H HB3  . LYS A 1 39  ? -11.294 6.555   -0.332  1.00 0.00 ? 822 LYS A HB3  7  
ATOM 9647  H HG2  . LYS A 1 39  ? -10.968 7.690   1.751   1.00 0.00 ? 822 LYS A HG2  7  
ATOM 9648  H HG3  . LYS A 1 39  ? -11.275 9.256   0.997   1.00 0.00 ? 822 LYS A HG3  7  
ATOM 9649  H HD2  . LYS A 1 39  ? -13.340 7.089   0.895   1.00 0.00 ? 822 LYS A HD2  7  
ATOM 9650  H HD3  . LYS A 1 39  ? -13.172 8.098   2.334   1.00 0.00 ? 822 LYS A HD3  7  
ATOM 9651  H HE2  . LYS A 1 39  ? -13.217 10.030  0.515   1.00 0.00 ? 822 LYS A HE2  7  
ATOM 9652  H HE3  . LYS A 1 39  ? -14.101 8.807   -0.398  1.00 0.00 ? 822 LYS A HE3  7  
ATOM 9653  H HZ1  . LYS A 1 39  ? -14.980 10.410  1.783   1.00 0.00 ? 822 LYS A HZ1  7  
ATOM 9654  H HZ2  . LYS A 1 39  ? -15.205 8.767   2.114   1.00 0.00 ? 822 LYS A HZ2  7  
ATOM 9655  H HZ3  . LYS A 1 39  ? -15.887 9.450   0.725   1.00 0.00 ? 822 LYS A HZ3  7  
ATOM 9656  N N    . ALA A 1 40  ? -9.048  10.019  0.230   1.00 0.00 ? 823 ALA A N    7  
ATOM 9657  C CA   . ALA A 1 40  ? -8.794  11.454  0.274   1.00 0.00 ? 823 ALA A CA   7  
ATOM 9658  C C    . ALA A 1 40  ? -7.825  11.874  -0.826  1.00 0.00 ? 823 ALA A C    7  
ATOM 9659  O O    . ALA A 1 40  ? -7.922  12.978  -1.364  1.00 0.00 ? 823 ALA A O    7  
ATOM 9660  C CB   . ALA A 1 40  ? -8.250  11.852  1.639   1.00 0.00 ? 823 ALA A CB   7  
ATOM 9661  H H    . ALA A 1 40  ? -8.889  9.481   1.033   1.00 0.00 ? 823 ALA A H    7  
ATOM 9662  H HA   . ALA A 1 40  ? -9.735  11.964  0.126   1.00 0.00 ? 823 ALA A HA   7  
ATOM 9663  H HB1  . ALA A 1 40  ? -7.233  12.200  1.532   1.00 0.00 ? 823 ALA A HB1  7  
ATOM 9664  H HB2  . ALA A 1 40  ? -8.860  12.641  2.053   1.00 0.00 ? 823 ALA A HB2  7  
ATOM 9665  H HB3  . ALA A 1 40  ? -8.271  10.997  2.297   1.00 0.00 ? 823 ALA A HB3  7  
ATOM 9666  N N    . HIS A 1 41  ? -6.892  10.988  -1.157  1.00 0.00 ? 824 HIS A N    7  
ATOM 9667  C CA   . HIS A 1 41  ? -5.905  11.267  -2.194  1.00 0.00 ? 824 HIS A CA   7  
ATOM 9668  C C    . HIS A 1 41  ? -6.467  10.954  -3.577  1.00 0.00 ? 824 HIS A C    7  
ATOM 9669  O O    . HIS A 1 41  ? -6.430  11.791  -4.478  1.00 0.00 ? 824 HIS A O    7  
ATOM 9670  C CB   . HIS A 1 41  ? -4.634  10.453  -1.951  1.00 0.00 ? 824 HIS A CB   7  
ATOM 9671  C CG   . HIS A 1 41  ? -3.992  10.727  -0.626  1.00 0.00 ? 824 HIS A CG   7  
ATOM 9672  N ND1  . HIS A 1 41  ? -3.431  11.943  -0.298  1.00 0.00 ? 824 HIS A ND1  7  
ATOM 9673  C CD2  . HIS A 1 41  ? -3.825  9.934   0.458   1.00 0.00 ? 824 HIS A CD2  7  
ATOM 9674  C CE1  . HIS A 1 41  ? -2.945  11.886  0.929   1.00 0.00 ? 824 HIS A CE1  7  
ATOM 9675  N NE2  . HIS A 1 41  ? -3.172  10.677  1.410   1.00 0.00 ? 824 HIS A NE2  7  
ATOM 9676  H H    . HIS A 1 41  ? -6.866  10.125  -0.693  1.00 0.00 ? 824 HIS A H    7  
ATOM 9677  H HA   . HIS A 1 41  ? -5.664  12.318  -2.147  1.00 0.00 ? 824 HIS A HA   7  
ATOM 9678  H HB2  . HIS A 1 41  ? -4.875  9.401   -1.991  1.00 0.00 ? 824 HIS A HB2  7  
ATOM 9679  H HB3  . HIS A 1 41  ? -3.914  10.683  -2.723  1.00 0.00 ? 824 HIS A HB3  7  
ATOM 9680  H HD2  . HIS A 1 41  ? -4.145  8.906   0.556   1.00 0.00 ? 824 HIS A HD2  7  
ATOM 9681  H HE1  . HIS A 1 41  ? -2.448  12.689  1.451   1.00 0.00 ? 824 HIS A HE1  7  
ATOM 9682  H HE2  . HIS A 1 41  ? -2.839  10.339  2.267   1.00 0.00 ? 824 HIS A HE2  7  
ATOM 9683  N N    . GLY A 1 42  ? -6.987  9.740   -3.739  1.00 0.00 ? 825 GLY A N    7  
ATOM 9684  C CA   . GLY A 1 42  ? -7.548  9.338   -5.015  1.00 0.00 ? 825 GLY A CA   7  
ATOM 9685  C C    . GLY A 1 42  ? -8.712  8.378   -4.860  1.00 0.00 ? 825 GLY A C    7  
ATOM 9686  O O    . GLY A 1 42  ? -9.455  8.444   -3.881  1.00 0.00 ? 825 GLY A O    7  
ATOM 9687  H H    . GLY A 1 42  ? -6.989  9.114   -2.985  1.00 0.00 ? 825 GLY A H    7  
ATOM 9688  H HA2  . GLY A 1 42  ? -7.888  10.218  -5.540  1.00 0.00 ? 825 GLY A HA2  7  
ATOM 9689  H HA3  . GLY A 1 42  ? -6.777  8.858   -5.599  1.00 0.00 ? 825 GLY A HA3  7  
ATOM 9690  N N    . THR A 1 43  ? -8.872  7.483   -5.830  1.00 0.00 ? 826 THR A N    7  
ATOM 9691  C CA   . THR A 1 43  ? -9.955  6.508   -5.799  1.00 0.00 ? 826 THR A CA   7  
ATOM 9692  C C    . THR A 1 43  ? -9.471  5.167   -5.258  1.00 0.00 ? 826 THR A C    7  
ATOM 9693  O O    . THR A 1 43  ? -8.540  4.568   -5.797  1.00 0.00 ? 826 THR A O    7  
ATOM 9694  C CB   . THR A 1 43  ? -10.560 6.296   -7.199  1.00 0.00 ? 826 THR A CB   7  
ATOM 9695  O OG1  . THR A 1 43  ? -11.140 7.517   -7.672  1.00 0.00 ? 826 THR A OG1  7  
ATOM 9696  C CG2  . THR A 1 43  ? -11.619 5.203   -7.171  1.00 0.00 ? 826 THR A CG2  7  
ATOM 9697  H H    . THR A 1 43  ? -8.247  7.481   -6.584  1.00 0.00 ? 826 THR A H    7  
ATOM 9698  H HA   . THR A 1 43  ? -10.728 6.890   -5.148  1.00 0.00 ? 826 THR A HA   7  
ATOM 9699  H HB   . THR A 1 43  ? -9.772  5.996   -7.874  1.00 0.00 ? 826 THR A HB   7  
ATOM 9700  H HG1  . THR A 1 43  ? -10.666 8.263   -7.297  1.00 0.00 ? 826 THR A HG1  7  
ATOM 9701  H HG21 . THR A 1 43  ? -12.577 5.623   -7.438  1.00 0.00 ? 826 THR A HG21 7  
ATOM 9702  H HG22 . THR A 1 43  ? -11.674 4.782   -6.178  1.00 0.00 ? 826 THR A HG22 7  
ATOM 9703  H HG23 . THR A 1 43  ? -11.355 4.430   -7.876  1.00 0.00 ? 826 THR A HG23 7  
ATOM 9704  N N    . VAL A 1 44  ? -10.110 4.700   -4.190  1.00 0.00 ? 827 VAL A N    7  
ATOM 9705  C CA   . VAL A 1 44  ? -9.746  3.428   -3.578  1.00 0.00 ? 827 VAL A CA   7  
ATOM 9706  C C    . VAL A 1 44  ? -10.504 2.271   -4.220  1.00 0.00 ? 827 VAL A C    7  
ATOM 9707  O O    . VAL A 1 44  ? -11.677 2.043   -3.925  1.00 0.00 ? 827 VAL A O    7  
ATOM 9708  C CB   . VAL A 1 44  ? -10.027 3.433   -2.063  1.00 0.00 ? 827 VAL A CB   7  
ATOM 9709  C CG1  . VAL A 1 44  ? -9.701  2.078   -1.454  1.00 0.00 ? 827 VAL A CG1  7  
ATOM 9710  C CG2  . VAL A 1 44  ? -9.237  4.538   -1.379  1.00 0.00 ? 827 VAL A CG2  7  
ATOM 9711  H H    . VAL A 1 44  ? -10.844 5.222   -3.806  1.00 0.00 ? 827 VAL A H    7  
ATOM 9712  H HA   . VAL A 1 44  ? -8.686  3.277   -3.725  1.00 0.00 ? 827 VAL A HA   7  
ATOM 9713  H HB   . VAL A 1 44  ? -11.079 3.626   -1.914  1.00 0.00 ? 827 VAL A HB   7  
ATOM 9714  H HG11 . VAL A 1 44  ? -9.675  1.330   -2.234  1.00 0.00 ? 827 VAL A HG11 7  
ATOM 9715  H HG12 . VAL A 1 44  ? -8.739  2.124   -0.966  1.00 0.00 ? 827 VAL A HG12 7  
ATOM 9716  H HG13 . VAL A 1 44  ? -10.460 1.816   -0.731  1.00 0.00 ? 827 VAL A HG13 7  
ATOM 9717  H HG21 . VAL A 1 44  ? -9.884  5.384   -1.201  1.00 0.00 ? 827 VAL A HG21 7  
ATOM 9718  H HG22 . VAL A 1 44  ? -8.852  4.175   -0.437  1.00 0.00 ? 827 VAL A HG22 7  
ATOM 9719  H HG23 . VAL A 1 44  ? -8.415  4.839   -2.012  1.00 0.00 ? 827 VAL A HG23 7  
ATOM 9720  N N    . LYS A 1 45  ? -9.826  1.543   -5.101  1.00 0.00 ? 828 LYS A N    7  
ATOM 9721  C CA   . LYS A 1 45  ? -10.433 0.408   -5.785  1.00 0.00 ? 828 LYS A CA   7  
ATOM 9722  C C    . LYS A 1 45  ? -10.693 -0.738  -4.813  1.00 0.00 ? 828 LYS A C    7  
ATOM 9723  O O    . LYS A 1 45  ? -11.752 -1.365  -4.847  1.00 0.00 ? 828 LYS A O    7  
ATOM 9724  C CB   . LYS A 1 45  ? -9.530  -0.070  -6.924  1.00 0.00 ? 828 LYS A CB   7  
ATOM 9725  C CG   . LYS A 1 45  ? -9.394  0.934   -8.055  1.00 0.00 ? 828 LYS A CG   7  
ATOM 9726  C CD   . LYS A 1 45  ? -10.435 0.700   -9.137  1.00 0.00 ? 828 LYS A CD   7  
ATOM 9727  C CE   . LYS A 1 45  ? -11.807 1.194   -8.706  1.00 0.00 ? 828 LYS A CE   7  
ATOM 9728  N NZ   . LYS A 1 45  ? -12.598 0.123   -8.038  1.00 0.00 ? 828 LYS A NZ   7  
ATOM 9729  H H    . LYS A 1 45  ? -8.893  1.775   -5.294  1.00 0.00 ? 828 LYS A H    7  
ATOM 9730  H HA   . LYS A 1 45  ? -11.376 0.735   -6.198  1.00 0.00 ? 828 LYS A HA   7  
ATOM 9731  H HB2  . LYS A 1 45  ? -8.545  -0.269  -6.527  1.00 0.00 ? 828 LYS A HB2  7  
ATOM 9732  H HB3  . LYS A 1 45  ? -9.936  -0.985  -7.330  1.00 0.00 ? 828 LYS A HB3  7  
ATOM 9733  H HG2  . LYS A 1 45  ? -9.521  1.930   -7.658  1.00 0.00 ? 828 LYS A HG2  7  
ATOM 9734  H HG3  . LYS A 1 45  ? -8.409  0.841   -8.490  1.00 0.00 ? 828 LYS A HG3  7  
ATOM 9735  H HD2  . LYS A 1 45  ? -10.139 1.229   -10.031 1.00 0.00 ? 828 LYS A HD2  7  
ATOM 9736  H HD3  . LYS A 1 45  ? -10.492 -0.359  -9.346  1.00 0.00 ? 828 LYS A HD3  7  
ATOM 9737  H HE2  . LYS A 1 45  ? -11.680 2.017   -8.019  1.00 0.00 ? 828 LYS A HE2  7  
ATOM 9738  H HE3  . LYS A 1 45  ? -12.343 1.534   -9.580  1.00 0.00 ? 828 LYS A HE3  7  
ATOM 9739  H HZ1  . LYS A 1 45  ? -13.010 0.483   -7.153  1.00 0.00 ? 828 LYS A HZ1  7  
ATOM 9740  H HZ2  . LYS A 1 45  ? -11.986 -0.688  -7.818  1.00 0.00 ? 828 LYS A HZ2  7  
ATOM 9741  H HZ3  . LYS A 1 45  ? -13.367 -0.195  -8.662  1.00 0.00 ? 828 LYS A HZ3  7  
ATOM 9742  N N    . ASP A 1 46  ? -9.722  -1.005  -3.947  1.00 0.00 ? 829 ASP A N    7  
ATOM 9743  C CA   . ASP A 1 46  ? -9.847  -2.074  -2.963  1.00 0.00 ? 829 ASP A CA   7  
ATOM 9744  C C    . ASP A 1 46  ? -8.807  -1.920  -1.858  1.00 0.00 ? 829 ASP A C    7  
ATOM 9745  O O    . ASP A 1 46  ? -7.703  -1.426  -2.094  1.00 0.00 ? 829 ASP A O    7  
ATOM 9746  C CB   . ASP A 1 46  ? -9.695  -3.438  -3.638  1.00 0.00 ? 829 ASP A CB   7  
ATOM 9747  C CG   . ASP A 1 46  ? -11.012 -3.976  -4.160  1.00 0.00 ? 829 ASP A CG   7  
ATOM 9748  O OD1  . ASP A 1 46  ? -11.856 -4.381  -3.334  1.00 0.00 ? 829 ASP A OD1  7  
ATOM 9749  O OD2  . ASP A 1 46  ? -11.199 -3.993  -5.395  1.00 0.00 ? 829 ASP A OD2  7  
ATOM 9750  H H    . ASP A 1 46  ? -8.901  -0.470  -3.970  1.00 0.00 ? 829 ASP A H    7  
ATOM 9751  H HA   . ASP A 1 46  ? -10.831 -2.008  -2.525  1.00 0.00 ? 829 ASP A HA   7  
ATOM 9752  H HB2  . ASP A 1 46  ? -9.010  -3.347  -4.469  1.00 0.00 ? 829 ASP A HB2  7  
ATOM 9753  H HB3  . ASP A 1 46  ? -9.295  -4.143  -2.924  1.00 0.00 ? 829 ASP A HB3  7  
ATOM 9754  N N    . LEU A 1 47  ? -9.165  -2.346  -0.652  1.00 0.00 ? 830 LEU A N    7  
ATOM 9755  C CA   . LEU A 1 47  ? -8.263  -2.255  0.491   1.00 0.00 ? 830 LEU A CA   7  
ATOM 9756  C C    . LEU A 1 47  ? -8.242  -3.564  1.274   1.00 0.00 ? 830 LEU A C    7  
ATOM 9757  O O    . LEU A 1 47  ? -9.290  -4.130  1.584   1.00 0.00 ? 830 LEU A O    7  
ATOM 9758  C CB   . LEU A 1 47  ? -8.684  -1.106  1.408   1.00 0.00 ? 830 LEU A CB   7  
ATOM 9759  C CG   . LEU A 1 47  ? -7.583  -0.510  2.286   1.00 0.00 ? 830 LEU A CG   7  
ATOM 9760  C CD1  . LEU A 1 47  ? -7.985  0.869   2.785   1.00 0.00 ? 830 LEU A CD1  7  
ATOM 9761  C CD2  . LEU A 1 47  ? -7.275  -1.434  3.456   1.00 0.00 ? 830 LEU A CD2  7  
ATOM 9762  H H    . LEU A 1 47  ? -10.057 -2.731  -0.526  1.00 0.00 ? 830 LEU A H    7  
ATOM 9763  H HA   . LEU A 1 47  ? -7.270  -2.060  0.114   1.00 0.00 ? 830 LEU A HA   7  
ATOM 9764  H HB2  . LEU A 1 47  ? -9.076  -0.315  0.787   1.00 0.00 ? 830 LEU A HB2  7  
ATOM 9765  H HB3  . LEU A 1 47  ? -9.465  -1.472  2.058   1.00 0.00 ? 830 LEU A HB3  7  
ATOM 9766  H HG   . LEU A 1 47  ? -6.681  -0.402  1.698   1.00 0.00 ? 830 LEU A HG   7  
ATOM 9767  H HD11 . LEU A 1 47  ? -8.867  1.200   2.257   1.00 0.00 ? 830 LEU A HD11 7  
ATOM 9768  H HD12 . LEU A 1 47  ? -7.178  1.565   2.610   1.00 0.00 ? 830 LEU A HD12 7  
ATOM 9769  H HD13 . LEU A 1 47  ? -8.196  0.821   3.843   1.00 0.00 ? 830 LEU A HD13 7  
ATOM 9770  H HD21 . LEU A 1 47  ? -6.374  -1.991  3.246   1.00 0.00 ? 830 LEU A HD21 7  
ATOM 9771  H HD22 . LEU A 1 47  ? -8.098  -2.120  3.598   1.00 0.00 ? 830 LEU A HD22 7  
ATOM 9772  H HD23 . LEU A 1 47  ? -7.136  -0.847  4.351   1.00 0.00 ? 830 LEU A HD23 7  
ATOM 9773  N N    . ARG A 1 48  ? -7.042  -4.039  1.591   1.00 0.00 ? 831 ARG A N    7  
ATOM 9774  C CA   . ARG A 1 48  ? -6.885  -5.280  2.339   1.00 0.00 ? 831 ARG A CA   7  
ATOM 9775  C C    . ARG A 1 48  ? -5.851  -5.119  3.450   1.00 0.00 ? 831 ARG A C    7  
ATOM 9776  O O    . ARG A 1 48  ? -4.901  -4.346  3.321   1.00 0.00 ? 831 ARG A O    7  
ATOM 9777  C CB   . ARG A 1 48  ? -6.469  -6.416  1.403   1.00 0.00 ? 831 ARG A CB   7  
ATOM 9778  C CG   . ARG A 1 48  ? -5.005  -6.366  0.997   1.00 0.00 ? 831 ARG A CG   7  
ATOM 9779  C CD   . ARG A 1 48  ? -4.688  -7.396  -0.075  1.00 0.00 ? 831 ARG A CD   7  
ATOM 9780  N NE   . ARG A 1 48  ? -4.521  -8.735  0.484   1.00 0.00 ? 831 ARG A NE   7  
ATOM 9781  C CZ   . ARG A 1 48  ? -5.532  -9.561  0.729   1.00 0.00 ? 831 ARG A CZ   7  
ATOM 9782  N NH1  . ARG A 1 48  ? -6.777  -9.187  0.464   1.00 0.00 ? 831 ARG A NH1  7  
ATOM 9783  N NH2  . ARG A 1 48  ? -5.300  -10.764 1.239   1.00 0.00 ? 831 ARG A NH2  7  
ATOM 9784  H H    . ARG A 1 48  ? -6.243  -3.543  1.316   1.00 0.00 ? 831 ARG A H    7  
ATOM 9785  H HA   . ARG A 1 48  ? -7.839  -5.523  2.784   1.00 0.00 ? 831 ARG A HA   7  
ATOM 9786  H HB2  . ARG A 1 48  ? -6.651  -7.359  1.896   1.00 0.00 ? 831 ARG A HB2  7  
ATOM 9787  H HB3  . ARG A 1 48  ? -7.070  -6.366  0.507   1.00 0.00 ? 831 ARG A HB3  7  
ATOM 9788  H HG2  . ARG A 1 48  ? -4.781  -5.382  0.612   1.00 0.00 ? 831 ARG A HG2  7  
ATOM 9789  H HG3  . ARG A 1 48  ? -4.394  -6.563  1.865   1.00 0.00 ? 831 ARG A HG3  7  
ATOM 9790  H HD2  . ARG A 1 48  ? -5.498  -7.414  -0.789  1.00 0.00 ? 831 ARG A HD2  7  
ATOM 9791  H HD3  . ARG A 1 48  ? -3.775  -7.108  -0.574  1.00 0.00 ? 831 ARG A HD3  7  
ATOM 9792  H HE   . ARG A 1 48  ? -3.610  -9.031  0.687   1.00 0.00 ? 831 ARG A HE   7  
ATOM 9793  H HH11 . ARG A 1 48  ? -6.955  -8.282  0.079   1.00 0.00 ? 831 ARG A HH11 7  
ATOM 9794  H HH12 . ARG A 1 48  ? -7.536  -9.812  0.648   1.00 0.00 ? 831 ARG A HH12 7  
ATOM 9795  H HH21 . ARG A 1 48  ? -4.363  -11.049 1.440   1.00 0.00 ? 831 ARG A HH21 7  
ATOM 9796  H HH22 . ARG A 1 48  ? -6.061  -11.384 1.423   1.00 0.00 ? 831 ARG A HH22 7  
ATOM 9797  N N    . LEU A 1 49  ? -6.044  -5.852  4.541   1.00 0.00 ? 832 LEU A N    7  
ATOM 9798  C CA   . LEU A 1 49  ? -5.129  -5.790  5.676   1.00 0.00 ? 832 LEU A CA   7  
ATOM 9799  C C    . LEU A 1 49  ? -4.311  -7.073  5.786   1.00 0.00 ? 832 LEU A C    7  
ATOM 9800  O O    . LEU A 1 49  ? -4.766  -8.148  5.394   1.00 0.00 ? 832 LEU A O    7  
ATOM 9801  C CB   . LEU A 1 49  ? -5.907  -5.555  6.971   1.00 0.00 ? 832 LEU A CB   7  
ATOM 9802  C CG   . LEU A 1 49  ? -6.663  -4.230  7.069   1.00 0.00 ? 832 LEU A CG   7  
ATOM 9803  C CD1  . LEU A 1 49  ? -7.604  -4.239  8.264   1.00 0.00 ? 832 LEU A CD1  7  
ATOM 9804  C CD2  . LEU A 1 49  ? -5.688  -3.065  7.165   1.00 0.00 ? 832 LEU A CD2  7  
ATOM 9805  H H    . LEU A 1 49  ? -6.819  -6.450  4.586   1.00 0.00 ? 832 LEU A H    7  
ATOM 9806  H HA   . LEU A 1 49  ? -4.456  -4.961  5.514   1.00 0.00 ? 832 LEU A HA   7  
ATOM 9807  H HB2  . LEU A 1 49  ? -6.625  -6.354  7.075   1.00 0.00 ? 832 LEU A HB2  7  
ATOM 9808  H HB3  . LEU A 1 49  ? -5.203  -5.597  7.791   1.00 0.00 ? 832 LEU A HB3  7  
ATOM 9809  H HG   . LEU A 1 49  ? -7.259  -4.096  6.177   1.00 0.00 ? 832 LEU A HG   7  
ATOM 9810  H HD11 . LEU A 1 49  ? -7.180  -4.843  9.051   1.00 0.00 ? 832 LEU A HD11 7  
ATOM 9811  H HD12 . LEU A 1 49  ? -8.558  -4.652  7.968   1.00 0.00 ? 832 LEU A HD12 7  
ATOM 9812  H HD13 . LEU A 1 49  ? -7.744  -3.229  8.619   1.00 0.00 ? 832 LEU A HD13 7  
ATOM 9813  H HD21 . LEU A 1 49  ? -4.830  -3.263  6.540   1.00 0.00 ? 832 LEU A HD21 7  
ATOM 9814  H HD22 . LEU A 1 49  ? -5.368  -2.948  8.190   1.00 0.00 ? 832 LEU A HD22 7  
ATOM 9815  H HD23 . LEU A 1 49  ? -6.175  -2.161  6.833   1.00 0.00 ? 832 LEU A HD23 7  
ATOM 9816  N N    . VAL A 1 50  ? -3.101  -6.953  6.324   1.00 0.00 ? 833 VAL A N    7  
ATOM 9817  C CA   . VAL A 1 50  ? -2.220  -8.103  6.489   1.00 0.00 ? 833 VAL A CA   7  
ATOM 9818  C C    . VAL A 1 50  ? -2.148  -8.535  7.949   1.00 0.00 ? 833 VAL A C    7  
ATOM 9819  O O    . VAL A 1 50  ? -1.241  -8.139  8.682   1.00 0.00 ? 833 VAL A O    7  
ATOM 9820  C CB   . VAL A 1 50  ? -0.797  -7.798  5.985   1.00 0.00 ? 833 VAL A CB   7  
ATOM 9821  C CG1  . VAL A 1 50  ? 0.027   -9.074  5.905   1.00 0.00 ? 833 VAL A CG1  7  
ATOM 9822  C CG2  . VAL A 1 50  ? -0.849  -7.101  4.634   1.00 0.00 ? 833 VAL A CG2  7  
ATOM 9823  H H    . VAL A 1 50  ? -2.794  -6.070  6.617   1.00 0.00 ? 833 VAL A H    7  
ATOM 9824  H HA   . VAL A 1 50  ? -2.620  -8.917  5.902   1.00 0.00 ? 833 VAL A HA   7  
ATOM 9825  H HB   . VAL A 1 50  ? -0.322  -7.133  6.691   1.00 0.00 ? 833 VAL A HB   7  
ATOM 9826  H HG11 . VAL A 1 50  ? -0.074  -9.505  4.919   1.00 0.00 ? 833 VAL A HG11 7  
ATOM 9827  H HG12 . VAL A 1 50  ? 1.065   -8.845  6.095   1.00 0.00 ? 833 VAL A HG12 7  
ATOM 9828  H HG13 . VAL A 1 50  ? -0.328  -9.778  6.643   1.00 0.00 ? 833 VAL A HG13 7  
ATOM 9829  H HG21 . VAL A 1 50  ? -1.222  -7.788  3.889   1.00 0.00 ? 833 VAL A HG21 7  
ATOM 9830  H HG22 . VAL A 1 50  ? -1.507  -6.245  4.694   1.00 0.00 ? 833 VAL A HG22 7  
ATOM 9831  H HG23 . VAL A 1 50  ? 0.142   -6.773  4.359   1.00 0.00 ? 833 VAL A HG23 7  
ATOM 9832  N N    . THR A 1 51  ? -3.111  -9.351  8.368   1.00 0.00 ? 834 THR A N    7  
ATOM 9833  C CA   . THR A 1 51  ? -3.158  -9.837  9.741   1.00 0.00 ? 834 THR A CA   7  
ATOM 9834  C C    . THR A 1 51  ? -2.623  -11.261 9.839   1.00 0.00 ? 834 THR A C    7  
ATOM 9835  O O    . THR A 1 51  ? -2.200  -11.845 8.842   1.00 0.00 ? 834 THR A O    7  
ATOM 9836  C CB   . THR A 1 51  ? -4.593  -9.801  10.301  1.00 0.00 ? 834 THR A CB   7  
ATOM 9837  O OG1  . THR A 1 51  ? -5.476  -10.520 9.432   1.00 0.00 ? 834 THR A OG1  7  
ATOM 9838  C CG2  . THR A 1 51  ? -5.078  -8.367  10.452  1.00 0.00 ? 834 THR A CG2  7  
ATOM 9839  H H    . THR A 1 51  ? -3.806  -9.632  7.736   1.00 0.00 ? 834 THR A H    7  
ATOM 9840  H HA   . THR A 1 51  ? -2.542  -9.188  10.346  1.00 0.00 ? 834 THR A HA   7  
ATOM 9841  H HB   . THR A 1 51  ? -4.595  -10.271 11.274  1.00 0.00 ? 834 THR A HB   7  
ATOM 9842  H HG1  . THR A 1 51  ? -6.375  -10.208 9.561   1.00 0.00 ? 834 THR A HG1  7  
ATOM 9843  H HG21 . THR A 1 51  ? -5.047  -7.873  9.492   1.00 0.00 ? 834 THR A HG21 7  
ATOM 9844  H HG22 . THR A 1 51  ? -4.441  -7.843  11.148  1.00 0.00 ? 834 THR A HG22 7  
ATOM 9845  H HG23 . THR A 1 51  ? -6.092  -8.368  10.823  1.00 0.00 ? 834 THR A HG23 7  
ATOM 9846  N N    . ASN A 1 52  ? -2.644  -11.814 11.047  1.00 0.00 ? 835 ASN A N    7  
ATOM 9847  C CA   . ASN A 1 52  ? -2.160  -13.171 11.275  1.00 0.00 ? 835 ASN A CA   7  
ATOM 9848  C C    . ASN A 1 52  ? -3.314  -14.169 11.268  1.00 0.00 ? 835 ASN A C    7  
ATOM 9849  O O    . ASN A 1 52  ? -4.463  -13.803 11.018  1.00 0.00 ? 835 ASN A O    7  
ATOM 9850  C CB   . ASN A 1 52  ? -1.411  -13.251 12.606  1.00 0.00 ? 835 ASN A CB   7  
ATOM 9851  C CG   . ASN A 1 52  ? -2.328  -13.583 13.767  1.00 0.00 ? 835 ASN A CG   7  
ATOM 9852  O OD1  . ASN A 1 52  ? -3.532  -13.330 13.714  1.00 0.00 ? 835 ASN A OD1  7  
ATOM 9853  N ND2  . ASN A 1 52  ? -1.762  -14.153 14.824  1.00 0.00 ? 835 ASN A ND2  7  
ATOM 9854  H H    . ASN A 1 52  ? -2.993  -11.298 11.804  1.00 0.00 ? 835 ASN A H    7  
ATOM 9855  H HA   . ASN A 1 52  ? -1.480  -13.419 10.474  1.00 0.00 ? 835 ASN A HA   7  
ATOM 9856  H HB2  . ASN A 1 52  ? -0.653  -14.018 12.541  1.00 0.00 ? 835 ASN A HB2  7  
ATOM 9857  H HB3  . ASN A 1 52  ? -0.939  -12.300 12.805  1.00 0.00 ? 835 ASN A HB3  7  
ATOM 9858  H HD21 . ASN A 1 52  ? -0.797  -14.326 14.797  1.00 0.00 ? 835 ASN A HD21 7  
ATOM 9859  H HD22 . ASN A 1 52  ? -2.332  -14.380 15.589  1.00 0.00 ? 835 ASN A HD22 7  
ATOM 9860  N N    . ARG A 1 53  ? -3.001  -15.430 11.544  1.00 0.00 ? 836 ARG A N    7  
ATOM 9861  C CA   . ARG A 1 53  ? -4.011  -16.481 11.569  1.00 0.00 ? 836 ARG A CA   7  
ATOM 9862  C C    . ARG A 1 53  ? -5.212  -16.060 12.411  1.00 0.00 ? 836 ARG A C    7  
ATOM 9863  O O    . ARG A 1 53  ? -6.357  -16.356 12.069  1.00 0.00 ? 836 ARG A O    7  
ATOM 9864  C CB   . ARG A 1 53  ? -3.416  -17.777 12.122  1.00 0.00 ? 836 ARG A CB   7  
ATOM 9865  C CG   . ARG A 1 53  ? -2.720  -18.625 11.070  1.00 0.00 ? 836 ARG A CG   7  
ATOM 9866  C CD   . ARG A 1 53  ? -3.722  -19.326 10.166  1.00 0.00 ? 836 ARG A CD   7  
ATOM 9867  N NE   . ARG A 1 53  ? -4.166  -20.599 10.726  1.00 0.00 ? 836 ARG A NE   7  
ATOM 9868  C CZ   . ARG A 1 53  ? -3.391  -21.675 10.811  1.00 0.00 ? 836 ARG A CZ   7  
ATOM 9869  N NH1  . ARG A 1 53  ? -2.140  -21.631 10.375  1.00 0.00 ? 836 ARG A NH1  7  
ATOM 9870  N NH2  . ARG A 1 53  ? -3.868  -22.798 11.334  1.00 0.00 ? 836 ARG A NH2  7  
ATOM 9871  H H    . ARG A 1 53  ? -2.067  -15.660 11.735  1.00 0.00 ? 836 ARG A H    7  
ATOM 9872  H HA   . ARG A 1 53  ? -4.339  -16.650 10.555  1.00 0.00 ? 836 ARG A HA   7  
ATOM 9873  H HB2  . ARG A 1 53  ? -2.696  -17.531 12.889  1.00 0.00 ? 836 ARG A HB2  7  
ATOM 9874  H HB3  . ARG A 1 53  ? -4.209  -18.365 12.559  1.00 0.00 ? 836 ARG A HB3  7  
ATOM 9875  H HG2  . ARG A 1 53  ? -2.091  -17.987 10.465  1.00 0.00 ? 836 ARG A HG2  7  
ATOM 9876  H HG3  . ARG A 1 53  ? -2.112  -19.368 11.565  1.00 0.00 ? 836 ARG A HG3  7  
ATOM 9877  H HD2  . ARG A 1 53  ? -4.579  -18.683 10.035  1.00 0.00 ? 836 ARG A HD2  7  
ATOM 9878  H HD3  . ARG A 1 53  ? -3.257  -19.507 9.209   1.00 0.00 ? 836 ARG A HD3  7  
ATOM 9879  H HE   . ARG A 1 53  ? -5.087  -20.654 11.055  1.00 0.00 ? 836 ARG A HE   7  
ATOM 9880  H HH11 . ARG A 1 53  ? -1.778  -20.786 9.982   1.00 0.00 ? 836 ARG A HH11 7  
ATOM 9881  H HH12 . ARG A 1 53  ? -1.558  -22.442 10.441  1.00 0.00 ? 836 ARG A HH12 7  
ATOM 9882  H HH21 . ARG A 1 53  ? -4.811  -22.835 11.664  1.00 0.00 ? 836 ARG A HH21 7  
ATOM 9883  H HH22 . ARG A 1 53  ? -3.284  -23.607 11.397  1.00 0.00 ? 836 ARG A HH22 7  
ATOM 9884  N N    . ALA A 1 54  ? -4.942  -15.369 13.514  1.00 0.00 ? 837 ALA A N    7  
ATOM 9885  C CA   . ALA A 1 54  ? -6.000  -14.906 14.404  1.00 0.00 ? 837 ALA A CA   7  
ATOM 9886  C C    . ALA A 1 54  ? -6.421  -13.481 14.062  1.00 0.00 ? 837 ALA A C    7  
ATOM 9887  O O    . ALA A 1 54  ? -6.767  -12.697 14.944  1.00 0.00 ? 837 ALA A O    7  
ATOM 9888  C CB   . ALA A 1 54  ? -5.545  -14.991 15.853  1.00 0.00 ? 837 ALA A CB   7  
ATOM 9889  H H    . ALA A 1 54  ? -4.010  -15.164 13.733  1.00 0.00 ? 837 ALA A H    7  
ATOM 9890  H HA   . ALA A 1 54  ? -6.850  -15.562 14.280  1.00 0.00 ? 837 ALA A HA   7  
ATOM 9891  H HB1  . ALA A 1 54  ? -6.406  -14.940 16.503  1.00 0.00 ? 837 ALA A HB1  7  
ATOM 9892  H HB2  . ALA A 1 54  ? -5.026  -15.924 16.013  1.00 0.00 ? 837 ALA A HB2  7  
ATOM 9893  H HB3  . ALA A 1 54  ? -4.881  -14.167 16.070  1.00 0.00 ? 837 ALA A HB3  7  
ATOM 9894  N N    . GLY A 1 55  ? -6.389  -13.152 12.774  1.00 0.00 ? 838 GLY A N    7  
ATOM 9895  C CA   . GLY A 1 55  ? -6.769  -11.821 12.338  1.00 0.00 ? 838 GLY A CA   7  
ATOM 9896  C C    . GLY A 1 55  ? -6.184  -10.734 13.218  1.00 0.00 ? 838 GLY A C    7  
ATOM 9897  O O    . GLY A 1 55  ? -6.866  -9.770  13.564  1.00 0.00 ? 838 GLY A O    7  
ATOM 9898  H H    . GLY A 1 55  ? -6.105  -13.819 12.114  1.00 0.00 ? 838 GLY A H    7  
ATOM 9899  H HA2  . GLY A 1 55  ? -6.426  -11.674 11.325  1.00 0.00 ? 838 GLY A HA2  7  
ATOM 9900  H HA3  . GLY A 1 55  ? -7.846  -11.742 12.358  1.00 0.00 ? 838 GLY A HA3  7  
ATOM 9901  N N    . LYS A 1 56  ? -4.916  -10.890 13.583  1.00 0.00 ? 839 LYS A N    7  
ATOM 9902  C CA   . LYS A 1 56  ? -4.237  -9.915  14.428  1.00 0.00 ? 839 LYS A CA   7  
ATOM 9903  C C    . LYS A 1 56  ? -3.459  -8.911  13.583  1.00 0.00 ? 839 LYS A C    7  
ATOM 9904  O O    . LYS A 1 56  ? -2.886  -9.247  12.546  1.00 0.00 ? 839 LYS A O    7  
ATOM 9905  C CB   . LYS A 1 56  ? -3.290  -10.622 15.399  1.00 0.00 ? 839 LYS A CB   7  
ATOM 9906  C CG   . LYS A 1 56  ? -3.996  -11.563 16.360  1.00 0.00 ? 839 LYS A CG   7  
ATOM 9907  C CD   . LYS A 1 56  ? -4.463  -10.836 17.610  1.00 0.00 ? 839 LYS A CD   7  
ATOM 9908  C CE   . LYS A 1 56  ? -4.513  -11.769 18.811  1.00 0.00 ? 839 LYS A CE   7  
ATOM 9909  N NZ   . LYS A 1 56  ? -3.151  -12.111 19.305  1.00 0.00 ? 839 LYS A NZ   7  
ATOM 9910  H H    . LYS A 1 56  ? -4.423  -11.680 13.275  1.00 0.00 ? 839 LYS A H    7  
ATOM 9911  H HA   . LYS A 1 56  ? -4.989  -9.385  14.993  1.00 0.00 ? 839 LYS A HA   7  
ATOM 9912  H HB2  . LYS A 1 56  ? -2.572  -11.195 14.831  1.00 0.00 ? 839 LYS A HB2  7  
ATOM 9913  H HB3  . LYS A 1 56  ? -2.765  -9.877  15.979  1.00 0.00 ? 839 LYS A HB3  7  
ATOM 9914  H HG2  . LYS A 1 56  ? -4.855  -11.992 15.865  1.00 0.00 ? 839 LYS A HG2  7  
ATOM 9915  H HG3  . LYS A 1 56  ? -3.313  -12.350 16.646  1.00 0.00 ? 839 LYS A HG3  7  
ATOM 9916  H HD2  . LYS A 1 56  ? -3.778  -10.029 17.824  1.00 0.00 ? 839 LYS A HD2  7  
ATOM 9917  H HD3  . LYS A 1 56  ? -5.452  -10.435 17.435  1.00 0.00 ? 839 LYS A HD3  7  
ATOM 9918  H HE2  . LYS A 1 56  ? -5.063  -11.284 19.604  1.00 0.00 ? 839 LYS A HE2  7  
ATOM 9919  H HE3  . LYS A 1 56  ? -5.021  -12.677 18.524  1.00 0.00 ? 839 LYS A HE3  7  
ATOM 9920  H HZ1  . LYS A 1 56  ? -2.944  -13.113 19.118  1.00 0.00 ? 839 LYS A HZ1  7  
ATOM 9921  H HZ2  . LYS A 1 56  ? -3.089  -11.941 20.329  1.00 0.00 ? 839 LYS A HZ2  7  
ATOM 9922  H HZ3  . LYS A 1 56  ? -2.438  -11.525 18.824  1.00 0.00 ? 839 LYS A HZ3  7  
ATOM 9923  N N    . PRO A 1 57  ? -3.434  -7.648  14.036  1.00 0.00 ? 840 PRO A N    7  
ATOM 9924  C CA   . PRO A 1 57  ? -2.727  -6.571  13.338  1.00 0.00 ? 840 PRO A CA   7  
ATOM 9925  C C    . PRO A 1 57  ? -1.212  -6.730  13.409  1.00 0.00 ? 840 PRO A C    7  
ATOM 9926  O O    . PRO A 1 57  ? -0.633  -6.773  14.495  1.00 0.00 ? 840 PRO A O    7  
ATOM 9927  C CB   . PRO A 1 57  ? -3.169  -5.312  14.088  1.00 0.00 ? 840 PRO A CB   7  
ATOM 9928  C CG   . PRO A 1 57  ? -3.536  -5.792  15.450  1.00 0.00 ? 840 PRO A CG   7  
ATOM 9929  C CD   . PRO A 1 57  ? -4.094  -7.176  15.265  1.00 0.00 ? 840 PRO A CD   7  
ATOM 9930  H HA   . PRO A 1 57  ? -3.032  -6.501  12.304  1.00 0.00 ? 840 PRO A HA   7  
ATOM 9931  H HB2  . PRO A 1 57  ? -2.351  -4.606  14.124  1.00 0.00 ? 840 PRO A HB2  7  
ATOM 9932  H HB3  . PRO A 1 57  ? -4.014  -4.867  13.586  1.00 0.00 ? 840 PRO A HB3  7  
ATOM 9933  H HG2  . PRO A 1 57  ? -2.658  -5.823  16.077  1.00 0.00 ? 840 PRO A HG2  7  
ATOM 9934  H HG3  . PRO A 1 57  ? -4.283  -5.141  15.879  1.00 0.00 ? 840 PRO A HG3  7  
ATOM 9935  H HD2  . PRO A 1 57  ? -3.837  -7.803  16.106  1.00 0.00 ? 840 PRO A HD2  7  
ATOM 9936  H HD3  . PRO A 1 57  ? -5.166  -7.136  15.135  1.00 0.00 ? 840 PRO A HD3  7  
ATOM 9937  N N    . LYS A 1 58  ? -0.575  -6.815  12.246  1.00 0.00 ? 841 LYS A N    7  
ATOM 9938  C CA   . LYS A 1 58  ? 0.873   -6.968  12.176  1.00 0.00 ? 841 LYS A CA   7  
ATOM 9939  C C    . LYS A 1 58  ? 1.534   -5.674  11.711  1.00 0.00 ? 841 LYS A C    7  
ATOM 9940  O O    . LYS A 1 58  ? 2.689   -5.674  11.286  1.00 0.00 ? 841 LYS A O    7  
ATOM 9941  C CB   . LYS A 1 58  ? 1.241   -8.111  11.227  1.00 0.00 ? 841 LYS A CB   7  
ATOM 9942  C CG   . LYS A 1 58  ? 0.694   -9.460  11.659  1.00 0.00 ? 841 LYS A CG   7  
ATOM 9943  C CD   . LYS A 1 58  ? 0.521   -10.397 10.476  1.00 0.00 ? 841 LYS A CD   7  
ATOM 9944  C CE   . LYS A 1 58  ? 1.859   -10.939 9.994   1.00 0.00 ? 841 LYS A CE   7  
ATOM 9945  N NZ   . LYS A 1 58  ? 1.722   -12.291 9.386   1.00 0.00 ? 841 LYS A NZ   7  
ATOM 9946  H H    . LYS A 1 58  ? -1.093  -6.775  11.414  1.00 0.00 ? 841 LYS A H    7  
ATOM 9947  H HA   . LYS A 1 58  ? 1.230   -7.205  13.167  1.00 0.00 ? 841 LYS A HA   7  
ATOM 9948  H HB2  . LYS A 1 58  ? 0.852   -7.886  10.245  1.00 0.00 ? 841 LYS A HB2  7  
ATOM 9949  H HB3  . LYS A 1 58  ? 2.318   -8.183  11.171  1.00 0.00 ? 841 LYS A HB3  7  
ATOM 9950  H HG2  . LYS A 1 58  ? 1.381   -9.908  12.362  1.00 0.00 ? 841 LYS A HG2  7  
ATOM 9951  H HG3  . LYS A 1 58  ? -0.266  -9.314  12.134  1.00 0.00 ? 841 LYS A HG3  7  
ATOM 9952  H HD2  . LYS A 1 58  ? -0.104  -11.226 10.772  1.00 0.00 ? 841 LYS A HD2  7  
ATOM 9953  H HD3  . LYS A 1 58  ? 0.049   -9.858  9.667   1.00 0.00 ? 841 LYS A HD3  7  
ATOM 9954  H HE2  . LYS A 1 58  ? 2.262   -10.261 9.257   1.00 0.00 ? 841 LYS A HE2  7  
ATOM 9955  H HE3  . LYS A 1 58  ? 2.532   -10.998 10.836  1.00 0.00 ? 841 LYS A HE3  7  
ATOM 9956  H HZ1  . LYS A 1 58  ? 2.352   -12.377 8.562   1.00 0.00 ? 841 LYS A HZ1  7  
ATOM 9957  H HZ2  . LYS A 1 58  ? 0.742   -12.446 9.076   1.00 0.00 ? 841 LYS A HZ2  7  
ATOM 9958  H HZ3  . LYS A 1 58  ? 1.975   -13.023 10.080  1.00 0.00 ? 841 LYS A HZ3  7  
ATOM 9959  N N    . GLY A 1 59  ? 0.794   -4.573  11.797  1.00 0.00 ? 842 GLY A N    7  
ATOM 9960  C CA   . GLY A 1 59  ? 1.327   -3.288  11.382  1.00 0.00 ? 842 GLY A CA   7  
ATOM 9961  C C    . GLY A 1 59  ? 1.545   -3.206  9.885   1.00 0.00 ? 842 GLY A C    7  
ATOM 9962  O O    . GLY A 1 59  ? 2.334   -2.389  9.408   1.00 0.00 ? 842 GLY A O    7  
ATOM 9963  H H    . GLY A 1 59  ? -0.120  -4.633  12.144  1.00 0.00 ? 842 GLY A H    7  
ATOM 9964  H HA2  . GLY A 1 59  ? 0.636   -2.512  11.678  1.00 0.00 ? 842 GLY A HA2  7  
ATOM 9965  H HA3  . GLY A 1 59  ? 2.270   -3.124  11.881  1.00 0.00 ? 842 GLY A HA3  7  
ATOM 9966  N N    . LEU A 1 60  ? 0.847   -4.056  9.139   1.00 0.00 ? 843 LEU A N    7  
ATOM 9967  C CA   . LEU A 1 60  ? 0.970   -4.078  7.686   1.00 0.00 ? 843 LEU A CA   7  
ATOM 9968  C C    . LEU A 1 60  ? -0.399  -3.969  7.022   1.00 0.00 ? 843 LEU A C    7  
ATOM 9969  O O    . LEU A 1 60  ? -1.361  -4.605  7.451   1.00 0.00 ? 843 LEU A O    7  
ATOM 9970  C CB   . LEU A 1 60  ? 1.667   -5.362  7.233   1.00 0.00 ? 843 LEU A CB   7  
ATOM 9971  C CG   . LEU A 1 60  ? 3.187   -5.395  7.400   1.00 0.00 ? 843 LEU A CG   7  
ATOM 9972  C CD1  . LEU A 1 60  ? 3.752   -6.709  6.883   1.00 0.00 ? 843 LEU A CD1  7  
ATOM 9973  C CD2  . LEU A 1 60  ? 3.828   -4.217  6.681   1.00 0.00 ? 843 LEU A CD2  7  
ATOM 9974  H H    . LEU A 1 60  ? 0.235   -4.684  9.576   1.00 0.00 ? 843 LEU A H    7  
ATOM 9975  H HA   . LEU A 1 60  ? 1.569   -3.230  7.391   1.00 0.00 ? 843 LEU A HA   7  
ATOM 9976  H HB2  . LEU A 1 60  ? 1.255   -6.181  7.802   1.00 0.00 ? 843 LEU A HB2  7  
ATOM 9977  H HB3  . LEU A 1 60  ? 1.445   -5.506  6.185   1.00 0.00 ? 843 LEU A HB3  7  
ATOM 9978  H HG   . LEU A 1 60  ? 3.429   -5.319  8.451   1.00 0.00 ? 843 LEU A HG   7  
ATOM 9979  H HD11 . LEU A 1 60  ? 4.403   -6.516  6.043   1.00 0.00 ? 843 LEU A HD11 7  
ATOM 9980  H HD12 . LEU A 1 60  ? 2.942   -7.351  6.571   1.00 0.00 ? 843 LEU A HD12 7  
ATOM 9981  H HD13 . LEU A 1 60  ? 4.313   -7.194  7.669   1.00 0.00 ? 843 LEU A HD13 7  
ATOM 9982  H HD21 . LEU A 1 60  ? 3.153   -3.848  5.923   1.00 0.00 ? 843 LEU A HD21 7  
ATOM 9983  H HD22 . LEU A 1 60  ? 4.750   -4.537  6.217   1.00 0.00 ? 843 LEU A HD22 7  
ATOM 9984  H HD23 . LEU A 1 60  ? 4.036   -3.432  7.392   1.00 0.00 ? 843 LEU A HD23 7  
ATOM 9985  N N    . ALA A 1 61  ? -0.478  -3.158  5.972   1.00 0.00 ? 844 ALA A N    7  
ATOM 9986  C CA   . ALA A 1 61  ? -1.728  -2.968  5.246   1.00 0.00 ? 844 ALA A CA   7  
ATOM 9987  C C    . ALA A 1 61  ? -1.478  -2.839  3.747   1.00 0.00 ? 844 ALA A C    7  
ATOM 9988  O O    . ALA A 1 61  ? -0.383  -2.474  3.320   1.00 0.00 ? 844 ALA A O    7  
ATOM 9989  C CB   . ALA A 1 61  ? -2.461  -1.741  5.769   1.00 0.00 ? 844 ALA A CB   7  
ATOM 9990  H H    . ALA A 1 61  ? 0.323   -2.677  5.678   1.00 0.00 ? 844 ALA A H    7  
ATOM 9991  H HA   . ALA A 1 61  ? -2.352  -3.832  5.424   1.00 0.00 ? 844 ALA A HA   7  
ATOM 9992  H HB1  . ALA A 1 61  ? -2.889  -1.963  6.735   1.00 0.00 ? 844 ALA A HB1  7  
ATOM 9993  H HB2  . ALA A 1 61  ? -1.766  -0.920  5.863   1.00 0.00 ? 844 ALA A HB2  7  
ATOM 9994  H HB3  . ALA A 1 61  ? -3.247  -1.471  5.080   1.00 0.00 ? 844 ALA A HB3  7  
ATOM 9995  N N    . TYR A 1 62  ? -2.500  -3.142  2.954   1.00 0.00 ? 845 TYR A N    7  
ATOM 9996  C CA   . TYR A 1 62  ? -2.390  -3.063  1.502   1.00 0.00 ? 845 TYR A CA   7  
ATOM 9997  C C    . TYR A 1 62  ? -3.526  -2.233  0.914   1.00 0.00 ? 845 TYR A C    7  
ATOM 9998  O O    . TYR A 1 62  ? -4.696  -2.442  1.237   1.00 0.00 ? 845 TYR A O    7  
ATOM 9999  C CB   . TYR A 1 62  ? -2.399  -4.466  0.892   1.00 0.00 ? 845 TYR A CB   7  
ATOM 10000 C CG   . TYR A 1 62  ? -1.024  -5.080  0.765   1.00 0.00 ? 845 TYR A CG   7  
ATOM 10001 C CD1  . TYR A 1 62  ? -0.285  -5.417  1.892   1.00 0.00 ? 845 TYR A CD1  7  
ATOM 10002 C CD2  . TYR A 1 62  ? -0.463  -5.323  -0.483  1.00 0.00 ? 845 TYR A CD2  7  
ATOM 10003 C CE1  . TYR A 1 62  ? 0.973   -5.978  1.780   1.00 0.00 ? 845 TYR A CE1  7  
ATOM 10004 C CE2  . TYR A 1 62  ? 0.793   -5.885  -0.605  1.00 0.00 ? 845 TYR A CE2  7  
ATOM 10005 C CZ   . TYR A 1 62  ? 1.507   -6.210  0.530   1.00 0.00 ? 845 TYR A CZ   7  
ATOM 10006 O OH   . TYR A 1 62  ? 2.759   -6.770  0.414   1.00 0.00 ? 845 TYR A OH   7  
ATOM 10007 H H    . TYR A 1 62  ? -3.348  -3.427  3.354   1.00 0.00 ? 845 TYR A H    7  
ATOM 10008 H HA   . TYR A 1 62  ? -1.450  -2.585  1.267   1.00 0.00 ? 845 TYR A HA   7  
ATOM 10009 H HB2  . TYR A 1 62  ? -2.996  -5.116  1.512   1.00 0.00 ? 845 TYR A HB2  7  
ATOM 10010 H HB3  . TYR A 1 62  ? -2.835  -4.418  -0.095  1.00 0.00 ? 845 TYR A HB3  7  
ATOM 10011 H HD1  . TYR A 1 62  ? -0.707  -5.235  2.870   1.00 0.00 ? 845 TYR A HD1  7  
ATOM 10012 H HD2  . TYR A 1 62  ? -1.025  -5.068  -1.370  1.00 0.00 ? 845 TYR A HD2  7  
ATOM 10013 H HE1  . TYR A 1 62  ? 1.532   -6.233  2.668   1.00 0.00 ? 845 TYR A HE1  7  
ATOM 10014 H HE2  . TYR A 1 62  ? 1.212   -6.067  -1.583  1.00 0.00 ? 845 TYR A HE2  7  
ATOM 10015 H HH   . TYR A 1 62  ? 3.419   -6.143  0.719   1.00 0.00 ? 845 TYR A HH   7  
ATOM 10016 N N    . VAL A 1 63  ? -3.174  -1.288  0.048   1.00 0.00 ? 846 VAL A N    7  
ATOM 10017 C CA   . VAL A 1 63  ? -4.163  -0.426  -0.588  1.00 0.00 ? 846 VAL A CA   7  
ATOM 10018 C C    . VAL A 1 63  ? -4.165  -0.614  -2.100  1.00 0.00 ? 846 VAL A C    7  
ATOM 10019 O O    . VAL A 1 63  ? -3.130  -0.904  -2.701  1.00 0.00 ? 846 VAL A O    7  
ATOM 10020 C CB   . VAL A 1 63  ? -3.903  1.058   -0.267  1.00 0.00 ? 846 VAL A CB   7  
ATOM 10021 C CG1  . VAL A 1 63  ? -4.991  1.933   -0.870  1.00 0.00 ? 846 VAL A CG1  7  
ATOM 10022 C CG2  . VAL A 1 63  ? -3.810  1.269   1.237   1.00 0.00 ? 846 VAL A CG2  7  
ATOM 10023 H H    . VAL A 1 63  ? -2.226  -1.169  -0.169  1.00 0.00 ? 846 VAL A H    7  
ATOM 10024 H HA   . VAL A 1 63  ? -5.136  -0.691  -0.200  1.00 0.00 ? 846 VAL A HA   7  
ATOM 10025 H HB   . VAL A 1 63  ? -2.958  1.341   -0.708  1.00 0.00 ? 846 VAL A HB   7  
ATOM 10026 H HG11 . VAL A 1 63  ? -5.953  1.465   -0.722  1.00 0.00 ? 846 VAL A HG11 7  
ATOM 10027 H HG12 . VAL A 1 63  ? -4.983  2.901   -0.390  1.00 0.00 ? 846 VAL A HG12 7  
ATOM 10028 H HG13 . VAL A 1 63  ? -4.810  2.055   -1.928  1.00 0.00 ? 846 VAL A HG13 7  
ATOM 10029 H HG21 . VAL A 1 63  ? -4.699  1.775   1.584   1.00 0.00 ? 846 VAL A HG21 7  
ATOM 10030 H HG22 . VAL A 1 63  ? -3.724  0.312   1.731   1.00 0.00 ? 846 VAL A HG22 7  
ATOM 10031 H HG23 . VAL A 1 63  ? -2.942  1.870   1.463   1.00 0.00 ? 846 VAL A HG23 7  
ATOM 10032 N N    . GLU A 1 64  ? -5.334  -0.448  -2.711  1.00 0.00 ? 847 GLU A N    7  
ATOM 10033 C CA   . GLU A 1 64  ? -5.470  -0.601  -4.154  1.00 0.00 ? 847 GLU A CA   7  
ATOM 10034 C C    . GLU A 1 64  ? -6.157  0.616   -4.768  1.00 0.00 ? 847 GLU A C    7  
ATOM 10035 O O    . GLU A 1 64  ? -7.294  0.940   -4.423  1.00 0.00 ? 847 GLU A O    7  
ATOM 10036 C CB   . GLU A 1 64  ? -6.263  -1.868  -4.483  1.00 0.00 ? 847 GLU A CB   7  
ATOM 10037 C CG   . GLU A 1 64  ? -6.070  -2.353  -5.910  1.00 0.00 ? 847 GLU A CG   7  
ATOM 10038 C CD   . GLU A 1 64  ? -7.069  -3.425  -6.302  1.00 0.00 ? 847 GLU A CD   7  
ATOM 10039 O OE1  . GLU A 1 64  ? -6.821  -4.608  -5.990  1.00 0.00 ? 847 GLU A OE1  7  
ATOM 10040 O OE2  . GLU A 1 64  ? -8.098  -3.080  -6.920  1.00 0.00 ? 847 GLU A OE2  7  
ATOM 10041 H H    . GLU A 1 64  ? -6.124  -0.218  -2.177  1.00 0.00 ? 847 GLU A H    7  
ATOM 10042 H HA   . GLU A 1 64  ? -4.479  -0.689  -4.573  1.00 0.00 ? 847 GLU A HA   7  
ATOM 10043 H HB2  . GLU A 1 64  ? -5.954  -2.655  -3.812  1.00 0.00 ? 847 GLU A HB2  7  
ATOM 10044 H HB3  . GLU A 1 64  ? -7.314  -1.669  -4.332  1.00 0.00 ? 847 GLU A HB3  7  
ATOM 10045 H HG2  . GLU A 1 64  ? -6.184  -1.514  -6.581  1.00 0.00 ? 847 GLU A HG2  7  
ATOM 10046 H HG3  . GLU A 1 64  ? -5.073  -2.757  -6.008  1.00 0.00 ? 847 GLU A HG3  7  
ATOM 10047 N N    . TYR A 1 65  ? -5.459  1.286   -5.678  1.00 0.00 ? 848 TYR A N    7  
ATOM 10048 C CA   . TYR A 1 65  ? -6.000  2.468   -6.338  1.00 0.00 ? 848 TYR A CA   7  
ATOM 10049 C C    . TYR A 1 65  ? -6.393  2.157   -7.778  1.00 0.00 ? 848 TYR A C    7  
ATOM 10050 O O    . TYR A 1 65  ? -6.181  1.046   -8.264  1.00 0.00 ? 848 TYR A O    7  
ATOM 10051 C CB   . TYR A 1 65  ? -4.977  3.605   -6.310  1.00 0.00 ? 848 TYR A CB   7  
ATOM 10052 C CG   . TYR A 1 65  ? -5.032  4.439   -5.050  1.00 0.00 ? 848 TYR A CG   7  
ATOM 10053 C CD1  . TYR A 1 65  ? -4.565  3.938   -3.841  1.00 0.00 ? 848 TYR A CD1  7  
ATOM 10054 C CD2  . TYR A 1 65  ? -5.552  5.728   -5.068  1.00 0.00 ? 848 TYR A CD2  7  
ATOM 10055 C CE1  . TYR A 1 65  ? -4.614  4.696   -2.687  1.00 0.00 ? 848 TYR A CE1  7  
ATOM 10056 C CE2  . TYR A 1 65  ? -5.603  6.493   -3.920  1.00 0.00 ? 848 TYR A CE2  7  
ATOM 10057 C CZ   . TYR A 1 65  ? -5.134  5.973   -2.732  1.00 0.00 ? 848 TYR A CZ   7  
ATOM 10058 O OH   . TYR A 1 65  ? -5.184  6.732   -1.585  1.00 0.00 ? 848 TYR A OH   7  
ATOM 10059 H H    . TYR A 1 65  ? -4.558  0.979   -5.911  1.00 0.00 ? 848 TYR A H    7  
ATOM 10060 H HA   . TYR A 1 65  ? -6.881  2.777   -5.795  1.00 0.00 ? 848 TYR A HA   7  
ATOM 10061 H HB2  . TYR A 1 65  ? -3.984  3.190   -6.389  1.00 0.00 ? 848 TYR A HB2  7  
ATOM 10062 H HB3  . TYR A 1 65  ? -5.155  4.261   -7.150  1.00 0.00 ? 848 TYR A HB3  7  
ATOM 10063 H HD1  . TYR A 1 65  ? -4.159  2.938   -3.810  1.00 0.00 ? 848 TYR A HD1  7  
ATOM 10064 H HD2  . TYR A 1 65  ? -5.920  6.132   -6.001  1.00 0.00 ? 848 TYR A HD2  7  
ATOM 10065 H HE1  . TYR A 1 65  ? -4.246  4.289   -1.757  1.00 0.00 ? 848 TYR A HE1  7  
ATOM 10066 H HE2  . TYR A 1 65  ? -6.011  7.493   -3.954  1.00 0.00 ? 848 TYR A HE2  7  
ATOM 10067 H HH   . TYR A 1 65  ? -4.363  7.220   -1.488  1.00 0.00 ? 848 TYR A HH   7  
ATOM 10068 N N    . GLU A 1 66  ? -6.965  3.147   -8.456  1.00 0.00 ? 849 GLU A N    7  
ATOM 10069 C CA   . GLU A 1 66  ? -7.387  2.979   -9.842  1.00 0.00 ? 849 GLU A CA   7  
ATOM 10070 C C    . GLU A 1 66  ? -6.271  3.376   -10.803 1.00 0.00 ? 849 GLU A C    7  
ATOM 10071 O O    . GLU A 1 66  ? -5.926  2.626   -11.715 1.00 0.00 ? 849 GLU A O    7  
ATOM 10072 C CB   . GLU A 1 66  ? -8.638  3.815   -10.122 1.00 0.00 ? 849 GLU A CB   7  
ATOM 10073 C CG   . GLU A 1 66  ? -9.058  3.812   -11.582 1.00 0.00 ? 849 GLU A CG   7  
ATOM 10074 C CD   . GLU A 1 66  ? -9.772  2.535   -11.981 1.00 0.00 ? 849 GLU A CD   7  
ATOM 10075 O OE1  . GLU A 1 66  ? -9.089  1.507   -12.167 1.00 0.00 ? 849 GLU A OE1  7  
ATOM 10076 O OE2  . GLU A 1 66  ? -11.014 2.565   -12.108 1.00 0.00 ? 849 GLU A OE2  7  
ATOM 10077 H H    . GLU A 1 66  ? -7.106  4.010   -8.014  1.00 0.00 ? 849 GLU A H    7  
ATOM 10078 H HA   . GLU A 1 66  ? -7.622  1.936   -9.993  1.00 0.00 ? 849 GLU A HA   7  
ATOM 10079 H HB2  . GLU A 1 66  ? -9.455  3.426   -9.532  1.00 0.00 ? 849 GLU A HB2  7  
ATOM 10080 H HB3  . GLU A 1 66  ? -8.447  4.836   -9.826  1.00 0.00 ? 849 GLU A HB3  7  
ATOM 10081 H HG2  . GLU A 1 66  ? -9.721  4.646   -11.754 1.00 0.00 ? 849 GLU A HG2  7  
ATOM 10082 H HG3  . GLU A 1 66  ? -8.176  3.921   -12.197 1.00 0.00 ? 849 GLU A HG3  7  
ATOM 10083 N N    . ASN A 1 67  ? -5.710  4.563   -10.591 1.00 0.00 ? 850 ASN A N    7  
ATOM 10084 C CA   . ASN A 1 67  ? -4.633  5.061   -11.439 1.00 0.00 ? 850 ASN A CA   7  
ATOM 10085 C C    . ASN A 1 67  ? -3.303  5.051   -10.692 1.00 0.00 ? 850 ASN A C    7  
ATOM 10086 O O    . ASN A 1 67  ? -3.252  4.743   -9.502  1.00 0.00 ? 850 ASN A O    7  
ATOM 10087 C CB   . ASN A 1 67  ? -4.950  6.479   -11.920 1.00 0.00 ? 850 ASN A CB   7  
ATOM 10088 C CG   . ASN A 1 67  ? -6.293  6.567   -12.619 1.00 0.00 ? 850 ASN A CG   7  
ATOM 10089 O OD1  . ASN A 1 67  ? -6.585  5.788   -13.526 1.00 0.00 ? 850 ASN A OD1  7  
ATOM 10090 N ND2  . ASN A 1 67  ? -7.118  7.518   -12.197 1.00 0.00 ? 850 ASN A ND2  7  
ATOM 10091 H H    . ASN A 1 67  ? -6.028  5.116   -9.848  1.00 0.00 ? 850 ASN A H    7  
ATOM 10092 H HA   . ASN A 1 67  ? -4.557  4.409   -12.296 1.00 0.00 ? 850 ASN A HA   7  
ATOM 10093 H HB2  . ASN A 1 67  ? -4.964  7.146   -11.070 1.00 0.00 ? 850 ASN A HB2  7  
ATOM 10094 H HB3  . ASN A 1 67  ? -4.184  6.798   -12.610 1.00 0.00 ? 850 ASN A HB3  7  
ATOM 10095 H HD21 . ASN A 1 67  ? -6.818  8.103   -11.470 1.00 0.00 ? 850 ASN A HD21 7  
ATOM 10096 H HD22 . ASN A 1 67  ? -7.993  7.597   -12.631 1.00 0.00 ? 850 ASN A HD22 7  
ATOM 10097 N N    . GLU A 1 68  ? -2.230  5.390   -11.400 1.00 0.00 ? 851 GLU A N    7  
ATOM 10098 C CA   . GLU A 1 68  ? -0.900  5.418   -10.803 1.00 0.00 ? 851 GLU A CA   7  
ATOM 10099 C C    . GLU A 1 68  ? -0.625  6.771   -10.153 1.00 0.00 ? 851 GLU A C    7  
ATOM 10100 O O    . GLU A 1 68  ? 0.005   6.848   -9.098  1.00 0.00 ? 851 GLU A O    7  
ATOM 10101 C CB   . GLU A 1 68  ? 0.165   5.123   -11.862 1.00 0.00 ? 851 GLU A CB   7  
ATOM 10102 C CG   . GLU A 1 68  ? 0.089   6.038   -13.073 1.00 0.00 ? 851 GLU A CG   7  
ATOM 10103 C CD   . GLU A 1 68  ? 1.214   5.794   -14.060 1.00 0.00 ? 851 GLU A CD   7  
ATOM 10104 O OE1  . GLU A 1 68  ? 1.434   4.621   -14.428 1.00 0.00 ? 851 GLU A OE1  7  
ATOM 10105 O OE2  . GLU A 1 68  ? 1.873   6.774   -14.464 1.00 0.00 ? 851 GLU A OE2  7  
ATOM 10106 H H    . GLU A 1 68  ? -2.336  5.625   -12.346 1.00 0.00 ? 851 GLU A H    7  
ATOM 10107 H HA   . GLU A 1 68  ? -0.861  4.653   -10.044 1.00 0.00 ? 851 GLU A HA   7  
ATOM 10108 H HB2  . GLU A 1 68  ? 1.141   5.233   -11.414 1.00 0.00 ? 851 GLU A HB2  7  
ATOM 10109 H HB3  . GLU A 1 68  ? 0.046   4.104   -12.200 1.00 0.00 ? 851 GLU A HB3  7  
ATOM 10110 H HG2  . GLU A 1 68  ? -0.852  5.873   -13.575 1.00 0.00 ? 851 GLU A HG2  7  
ATOM 10111 H HG3  . GLU A 1 68  ? 0.141   7.064   -12.737 1.00 0.00 ? 851 GLU A HG3  7  
ATOM 10112 N N    . SER A 1 69  ? -1.101  7.836   -10.791 1.00 0.00 ? 852 SER A N    7  
ATOM 10113 C CA   . SER A 1 69  ? -0.903  9.186   -10.277 1.00 0.00 ? 852 SER A CA   7  
ATOM 10114 C C    . SER A 1 69  ? -1.456  9.315   -8.861  1.00 0.00 ? 852 SER A C    7  
ATOM 10115 O O    . SER A 1 69  ? -0.780  9.815   -7.963  1.00 0.00 ? 852 SER A O    7  
ATOM 10116 C CB   . SER A 1 69  ? -1.577  10.207  -11.195 1.00 0.00 ? 852 SER A CB   7  
ATOM 10117 O OG   . SER A 1 69  ? -1.328  11.531  -10.756 1.00 0.00 ? 852 SER A OG   7  
ATOM 10118 H H    . SER A 1 69  ? -1.595  7.710   -11.628 1.00 0.00 ? 852 SER A H    7  
ATOM 10119 H HA   . SER A 1 69  ? 0.159   9.380   -10.255 1.00 0.00 ? 852 SER A HA   7  
ATOM 10120 H HB2  . SER A 1 69  ? -1.192  10.096  -12.198 1.00 0.00 ? 852 SER A HB2  7  
ATOM 10121 H HB3  . SER A 1 69  ? -2.644  10.036  -11.198 1.00 0.00 ? 852 SER A HB3  7  
ATOM 10122 H HG   . SER A 1 69  ? -1.463  11.584  -9.806  1.00 0.00 ? 852 SER A HG   7  
ATOM 10123 N N    . GLN A 1 70  ? -2.691  8.861   -8.671  1.00 0.00 ? 853 GLN A N    7  
ATOM 10124 C CA   . GLN A 1 70  ? -3.336  8.927   -7.365  1.00 0.00 ? 853 GLN A CA   7  
ATOM 10125 C C    . GLN A 1 70  ? -2.491  8.228   -6.305  1.00 0.00 ? 853 GLN A C    7  
ATOM 10126 O O    . GLN A 1 70  ? -2.146  8.819   -5.283  1.00 0.00 ? 853 GLN A O    7  
ATOM 10127 C CB   . GLN A 1 70  ? -4.726  8.292   -7.427  1.00 0.00 ? 853 GLN A CB   7  
ATOM 10128 C CG   . GLN A 1 70  ? -5.741  9.124   -8.193  1.00 0.00 ? 853 GLN A CG   7  
ATOM 10129 C CD   . GLN A 1 70  ? -7.025  8.367   -8.473  1.00 0.00 ? 853 GLN A CD   7  
ATOM 10130 O OE1  . GLN A 1 70  ? -7.135  7.177   -8.174  1.00 0.00 ? 853 GLN A OE1  7  
ATOM 10131 N NE2  . GLN A 1 70  ? -8.004  9.054   -9.049  1.00 0.00 ? 853 GLN A NE2  7  
ATOM 10132 H H    . GLN A 1 70  ? -3.179  8.474   -9.427  1.00 0.00 ? 853 GLN A H    7  
ATOM 10133 H HA   . GLN A 1 70  ? -3.437  9.968   -7.097  1.00 0.00 ? 853 GLN A HA   7  
ATOM 10134 H HB2  . GLN A 1 70  ? -4.647  7.327   -7.906  1.00 0.00 ? 853 GLN A HB2  7  
ATOM 10135 H HB3  . GLN A 1 70  ? -5.092  8.156   -6.420  1.00 0.00 ? 853 GLN A HB3  7  
ATOM 10136 H HG2  . GLN A 1 70  ? -5.980  10.003  -7.613  1.00 0.00 ? 853 GLN A HG2  7  
ATOM 10137 H HG3  . GLN A 1 70  ? -5.305  9.423   -9.135  1.00 0.00 ? 853 GLN A HG3  7  
ATOM 10138 H HE21 . GLN A 1 70  ? -7.845  9.998   -9.259  1.00 0.00 ? 853 GLN A HE21 7  
ATOM 10139 H HE22 . GLN A 1 70  ? -8.844  8.589   -9.241  1.00 0.00 ? 853 GLN A HE22 7  
ATOM 10140 N N    . ALA A 1 71  ? -2.162  6.965   -6.556  1.00 0.00 ? 854 ALA A N    7  
ATOM 10141 C CA   . ALA A 1 71  ? -1.356  6.185   -5.624  1.00 0.00 ? 854 ALA A CA   7  
ATOM 10142 C C    . ALA A 1 71  ? -0.077  6.927   -5.251  1.00 0.00 ? 854 ALA A C    7  
ATOM 10143 O O    . ALA A 1 71  ? 0.230   7.099   -4.072  1.00 0.00 ? 854 ALA A O    7  
ATOM 10144 C CB   . ALA A 1 71  ? -1.025  4.826   -6.222  1.00 0.00 ? 854 ALA A CB   7  
ATOM 10145 H H    . ALA A 1 71  ? -2.467  6.548   -7.389  1.00 0.00 ? 854 ALA A H    7  
ATOM 10146 H HA   . ALA A 1 71  ? -1.942  6.025   -4.730  1.00 0.00 ? 854 ALA A HA   7  
ATOM 10147 H HB1  . ALA A 1 71  ? -1.738  4.592   -7.000  1.00 0.00 ? 854 ALA A HB1  7  
ATOM 10148 H HB2  . ALA A 1 71  ? -0.030  4.850   -6.640  1.00 0.00 ? 854 ALA A HB2  7  
ATOM 10149 H HB3  . ALA A 1 71  ? -1.074  4.072   -5.450  1.00 0.00 ? 854 ALA A HB3  7  
ATOM 10150 N N    . SER A 1 72  ? 0.665   7.365   -6.264  1.00 0.00 ? 855 SER A N    7  
ATOM 10151 C CA   . SER A 1 72  ? 1.913   8.084   -6.041  1.00 0.00 ? 855 SER A CA   7  
ATOM 10152 C C    . SER A 1 72  ? 1.723   9.198   -5.016  1.00 0.00 ? 855 SER A C    7  
ATOM 10153 O O    . SER A 1 72  ? 2.366   9.206   -3.967  1.00 0.00 ? 855 SER A O    7  
ATOM 10154 C CB   . SER A 1 72  ? 2.430   8.669   -7.357  1.00 0.00 ? 855 SER A CB   7  
ATOM 10155 O OG   . SER A 1 72  ? 3.716   9.241   -7.190  1.00 0.00 ? 855 SER A OG   7  
ATOM 10156 H H    . SER A 1 72  ? 0.366   7.197   -7.182  1.00 0.00 ? 855 SER A H    7  
ATOM 10157 H HA   . SER A 1 72  ? 2.638   7.380   -5.660  1.00 0.00 ? 855 SER A HA   7  
ATOM 10158 H HB2  . SER A 1 72  ? 2.492   7.886   -8.097  1.00 0.00 ? 855 SER A HB2  7  
ATOM 10159 H HB3  . SER A 1 72  ? 1.750   9.436   -7.699  1.00 0.00 ? 855 SER A HB3  7  
ATOM 10160 H HG   . SER A 1 72  ? 4.281   8.627   -6.715  1.00 0.00 ? 855 SER A HG   7  
ATOM 10161 N N    . GLN A 1 73  ? 0.836   10.137  -5.329  1.00 0.00 ? 856 GLN A N    7  
ATOM 10162 C CA   . GLN A 1 73  ? 0.561   11.256  -4.436  1.00 0.00 ? 856 GLN A CA   7  
ATOM 10163 C C    . GLN A 1 73  ? 0.387   10.776  -2.999  1.00 0.00 ? 856 GLN A C    7  
ATOM 10164 O O    . GLN A 1 73  ? 1.072   11.243  -2.091  1.00 0.00 ? 856 GLN A O    7  
ATOM 10165 C CB   . GLN A 1 73  ? -0.692  12.005  -4.893  1.00 0.00 ? 856 GLN A CB   7  
ATOM 10166 C CG   . GLN A 1 73  ? -0.769  13.433  -4.379  1.00 0.00 ? 856 GLN A CG   7  
ATOM 10167 C CD   . GLN A 1 73  ? -1.606  14.330  -5.270  1.00 0.00 ? 856 GLN A CD   7  
ATOM 10168 O OE1  . GLN A 1 73  ? -2.220  13.869  -6.233  1.00 0.00 ? 856 GLN A OE1  7  
ATOM 10169 N NE2  . GLN A 1 73  ? -1.636  15.619  -4.953  1.00 0.00 ? 856 GLN A NE2  7  
ATOM 10170 H H    . GLN A 1 73  ? 0.355   10.076  -6.181  1.00 0.00 ? 856 GLN A H    7  
ATOM 10171 H HA   . GLN A 1 73  ? 1.405   11.928  -4.478  1.00 0.00 ? 856 GLN A HA   7  
ATOM 10172 H HB2  . GLN A 1 73  ? -0.709  12.031  -5.972  1.00 0.00 ? 856 GLN A HB2  7  
ATOM 10173 H HB3  . GLN A 1 73  ? -1.563  11.472  -4.540  1.00 0.00 ? 856 GLN A HB3  7  
ATOM 10174 H HG2  . GLN A 1 73  ? -1.205  13.425  -3.392  1.00 0.00 ? 856 GLN A HG2  7  
ATOM 10175 H HG3  . GLN A 1 73  ? 0.232   13.837  -4.326  1.00 0.00 ? 856 GLN A HG3  7  
ATOM 10176 H HE21 . GLN A 1 73  ? -1.121  15.915  -4.173  1.00 0.00 ? 856 GLN A HE21 7  
ATOM 10177 H HE22 . GLN A 1 73  ? -2.169  16.221  -5.512  1.00 0.00 ? 856 GLN A HE22 7  
ATOM 10178 N N    . ALA A 1 74  ? -0.536  9.840   -2.802  1.00 0.00 ? 857 ALA A N    7  
ATOM 10179 C CA   . ALA A 1 74  ? -0.800  9.296   -1.476  1.00 0.00 ? 857 ALA A CA   7  
ATOM 10180 C C    . ALA A 1 74  ? 0.456   8.668   -0.880  1.00 0.00 ? 857 ALA A C    7  
ATOM 10181 O O    . ALA A 1 74  ? 0.636   8.652   0.338   1.00 0.00 ? 857 ALA A O    7  
ATOM 10182 C CB   . ALA A 1 74  ? -1.924  8.273   -1.539  1.00 0.00 ? 857 ALA A CB   7  
ATOM 10183 H H    . ALA A 1 74  ? -1.051  9.508   -3.566  1.00 0.00 ? 857 ALA A H    7  
ATOM 10184 H HA   . ALA A 1 74  ? -1.121  10.108  -0.839  1.00 0.00 ? 857 ALA A HA   7  
ATOM 10185 H HB1  . ALA A 1 74  ? -1.551  7.356   -1.972  1.00 0.00 ? 857 ALA A HB1  7  
ATOM 10186 H HB2  . ALA A 1 74  ? -2.290  8.077   -0.542  1.00 0.00 ? 857 ALA A HB2  7  
ATOM 10187 H HB3  . ALA A 1 74  ? -2.727  8.658   -2.149  1.00 0.00 ? 857 ALA A HB3  7  
ATOM 10188 N N    . VAL A 1 75  ? 1.322   8.152   -1.746  1.00 0.00 ? 858 VAL A N    7  
ATOM 10189 C CA   . VAL A 1 75  ? 2.561   7.523   -1.306  1.00 0.00 ? 858 VAL A CA   7  
ATOM 10190 C C    . VAL A 1 75  ? 3.575   8.567   -0.850  1.00 0.00 ? 858 VAL A C    7  
ATOM 10191 O O    . VAL A 1 75  ? 4.306   8.356   0.117   1.00 0.00 ? 858 VAL A O    7  
ATOM 10192 C CB   . VAL A 1 75  ? 3.187   6.670   -2.425  1.00 0.00 ? 858 VAL A CB   7  
ATOM 10193 C CG1  . VAL A 1 75  ? 4.592   6.232   -2.041  1.00 0.00 ? 858 VAL A CG1  7  
ATOM 10194 C CG2  . VAL A 1 75  ? 2.309   5.466   -2.731  1.00 0.00 ? 858 VAL A CG2  7  
ATOM 10195 H H    . VAL A 1 75  ? 1.122   8.195   -2.705  1.00 0.00 ? 858 VAL A H    7  
ATOM 10196 H HA   . VAL A 1 75  ? 2.329   6.874   -0.474  1.00 0.00 ? 858 VAL A HA   7  
ATOM 10197 H HB   . VAL A 1 75  ? 3.254   7.276   -3.317  1.00 0.00 ? 858 VAL A HB   7  
ATOM 10198 H HG11 . VAL A 1 75  ? 5.299   6.996   -2.331  1.00 0.00 ? 858 VAL A HG11 7  
ATOM 10199 H HG12 . VAL A 1 75  ? 4.643   6.080   -0.973  1.00 0.00 ? 858 VAL A HG12 7  
ATOM 10200 H HG13 . VAL A 1 75  ? 4.833   5.310   -2.549  1.00 0.00 ? 858 VAL A HG13 7  
ATOM 10201 H HG21 . VAL A 1 75  ? 1.561   5.362   -1.959  1.00 0.00 ? 858 VAL A HG21 7  
ATOM 10202 H HG22 . VAL A 1 75  ? 1.823   5.607   -3.686  1.00 0.00 ? 858 VAL A HG22 7  
ATOM 10203 H HG23 . VAL A 1 75  ? 2.918   4.575   -2.765  1.00 0.00 ? 858 VAL A HG23 7  
ATOM 10204 N N    . MET A 1 76  ? 3.613   9.694   -1.554  1.00 0.00 ? 859 MET A N    7  
ATOM 10205 C CA   . MET A 1 76  ? 4.536   10.772  -1.221  1.00 0.00 ? 859 MET A CA   7  
ATOM 10206 C C    . MET A 1 76  ? 4.132   11.450  0.085   1.00 0.00 ? 859 MET A C    7  
ATOM 10207 O O    . MET A 1 76  ? 4.980   11.940  0.831   1.00 0.00 ? 859 MET A O    7  
ATOM 10208 C CB   . MET A 1 76  ? 4.581   11.802  -2.351  1.00 0.00 ? 859 MET A CB   7  
ATOM 10209 C CG   . MET A 1 76  ? 5.607   11.481  -3.425  1.00 0.00 ? 859 MET A CG   7  
ATOM 10210 S SD   . MET A 1 76  ? 5.062   10.170  -4.537  1.00 0.00 ? 859 MET A SD   7  
ATOM 10211 C CE   . MET A 1 76  ? 6.244   10.345  -5.871  1.00 0.00 ? 859 MET A CE   7  
ATOM 10212 H H    . MET A 1 76  ? 3.005   9.804   -2.315  1.00 0.00 ? 859 MET A H    7  
ATOM 10213 H HA   . MET A 1 76  ? 5.518   10.341  -1.100  1.00 0.00 ? 859 MET A HA   7  
ATOM 10214 H HB2  . MET A 1 76  ? 3.608   11.851  -2.816  1.00 0.00 ? 859 MET A HB2  7  
ATOM 10215 H HB3  . MET A 1 76  ? 4.820   12.768  -1.933  1.00 0.00 ? 859 MET A HB3  7  
ATOM 10216 H HG2  . MET A 1 76  ? 5.791   12.372  -4.007  1.00 0.00 ? 859 MET A HG2  7  
ATOM 10217 H HG3  . MET A 1 76  ? 6.524   11.171  -2.946  1.00 0.00 ? 859 MET A HG3  7  
ATOM 10218 H HE1  . MET A 1 76  ? 5.845   9.892   -6.767  1.00 0.00 ? 859 MET A HE1  7  
ATOM 10219 H HE2  . MET A 1 76  ? 6.432   11.393  -6.050  1.00 0.00 ? 859 MET A HE2  7  
ATOM 10220 H HE3  . MET A 1 76  ? 7.168   9.853   -5.600  1.00 0.00 ? 859 MET A HE3  7  
ATOM 10221 N N    . LYS A 1 77  ? 2.831   11.475  0.355   1.00 0.00 ? 860 LYS A N    7  
ATOM 10222 C CA   . LYS A 1 77  ? 2.314   12.092  1.571   1.00 0.00 ? 860 LYS A CA   7  
ATOM 10223 C C    . LYS A 1 77  ? 2.347   11.108  2.736   1.00 0.00 ? 860 LYS A C    7  
ATOM 10224 O O    . LYS A 1 77  ? 3.009   11.349  3.745   1.00 0.00 ? 860 LYS A O    7  
ATOM 10225 C CB   . LYS A 1 77  ? 0.883   12.586  1.347   1.00 0.00 ? 860 LYS A CB   7  
ATOM 10226 C CG   . LYS A 1 77  ? 0.801   13.858  0.521   1.00 0.00 ? 860 LYS A CG   7  
ATOM 10227 C CD   . LYS A 1 77  ? 1.030   15.094  1.375   1.00 0.00 ? 860 LYS A CD   7  
ATOM 10228 C CE   . LYS A 1 77  ? 1.010   16.362  0.536   1.00 0.00 ? 860 LYS A CE   7  
ATOM 10229 N NZ   . LYS A 1 77  ? 2.349   16.668  -0.040  1.00 0.00 ? 860 LYS A NZ   7  
ATOM 10230 H H    . LYS A 1 77  ? 2.204   11.068  -0.279  1.00 0.00 ? 860 LYS A H    7  
ATOM 10231 H HA   . LYS A 1 77  ? 2.944   12.935  1.810   1.00 0.00 ? 860 LYS A HA   7  
ATOM 10232 H HB2  . LYS A 1 77  ? 0.323   11.815  0.839   1.00 0.00 ? 860 LYS A HB2  7  
ATOM 10233 H HB3  . LYS A 1 77  ? 0.426   12.776  2.308   1.00 0.00 ? 860 LYS A HB3  7  
ATOM 10234 H HG2  . LYS A 1 77  ? 1.554   13.823  -0.252  1.00 0.00 ? 860 LYS A HG2  7  
ATOM 10235 H HG3  . LYS A 1 77  ? -0.179  13.920  0.069   1.00 0.00 ? 860 LYS A HG3  7  
ATOM 10236 H HD2  . LYS A 1 77  ? 0.250   15.156  2.119   1.00 0.00 ? 860 LYS A HD2  7  
ATOM 10237 H HD3  . LYS A 1 77  ? 1.990   15.010  1.863   1.00 0.00 ? 860 LYS A HD3  7  
ATOM 10238 H HE2  . LYS A 1 77  ? 0.302   16.235  -0.269  1.00 0.00 ? 860 LYS A HE2  7  
ATOM 10239 H HE3  . LYS A 1 77  ? 0.699   17.186  1.161   1.00 0.00 ? 860 LYS A HE3  7  
ATOM 10240 H HZ1  . LYS A 1 77  ? 2.897   15.791  -0.153  1.00 0.00 ? 860 LYS A HZ1  7  
ATOM 10241 H HZ2  . LYS A 1 77  ? 2.870   17.310  0.590   1.00 0.00 ? 860 LYS A HZ2  7  
ATOM 10242 H HZ3  . LYS A 1 77  ? 2.243   17.121  -0.970  1.00 0.00 ? 860 LYS A HZ3  7  
ATOM 10243 N N    . MET A 1 78  ? 1.629   9.999   2.589   1.00 0.00 ? 861 MET A N    7  
ATOM 10244 C CA   . MET A 1 78  ? 1.579   8.978   3.629   1.00 0.00 ? 861 MET A CA   7  
ATOM 10245 C C    . MET A 1 78  ? 2.984   8.544   4.034   1.00 0.00 ? 861 MET A C    7  
ATOM 10246 O O    . MET A 1 78  ? 3.279   8.388   5.219   1.00 0.00 ? 861 MET A O    7  
ATOM 10247 C CB   . MET A 1 78  ? 0.778   7.767   3.147   1.00 0.00 ? 861 MET A CB   7  
ATOM 10248 C CG   . MET A 1 78  ? -0.708  8.045   2.989   1.00 0.00 ? 861 MET A CG   7  
ATOM 10249 S SD   . MET A 1 78  ? -1.701  6.540   2.994   1.00 0.00 ? 861 MET A SD   7  
ATOM 10250 C CE   . MET A 1 78  ? -3.320  7.201   2.608   1.00 0.00 ? 861 MET A CE   7  
ATOM 10251 H H    . MET A 1 78  ? 1.122   9.863   1.762   1.00 0.00 ? 861 MET A H    7  
ATOM 10252 H HA   . MET A 1 78  ? 1.085   9.405   4.489   1.00 0.00 ? 861 MET A HA   7  
ATOM 10253 H HB2  . MET A 1 78  ? 1.167   7.451   2.191   1.00 0.00 ? 861 MET A HB2  7  
ATOM 10254 H HB3  . MET A 1 78  ? 0.898   6.964   3.859   1.00 0.00 ? 861 MET A HB3  7  
ATOM 10255 H HG2  . MET A 1 78  ? -1.032  8.675   3.804   1.00 0.00 ? 861 MET A HG2  7  
ATOM 10256 H HG3  . MET A 1 78  ? -0.866  8.561   2.054   1.00 0.00 ? 861 MET A HG3  7  
ATOM 10257 H HE1  . MET A 1 78  ? -3.258  8.275   2.515   1.00 0.00 ? 861 MET A HE1  7  
ATOM 10258 H HE2  . MET A 1 78  ? -3.668  6.779   1.677   1.00 0.00 ? 861 MET A HE2  7  
ATOM 10259 H HE3  . MET A 1 78  ? -4.010  6.947   3.400   1.00 0.00 ? 861 MET A HE3  7  
ATOM 10260 N N    . ASP A 1 79  ? 3.847   8.351   3.042   1.00 0.00 ? 862 ASP A N    7  
ATOM 10261 C CA   . ASP A 1 79  ? 5.222   7.936   3.295   1.00 0.00 ? 862 ASP A CA   7  
ATOM 10262 C C    . ASP A 1 79  ? 5.844   8.769   4.412   1.00 0.00 ? 862 ASP A C    7  
ATOM 10263 O O    . ASP A 1 79  ? 6.223   9.920   4.205   1.00 0.00 ? 862 ASP A O    7  
ATOM 10264 C CB   . ASP A 1 79  ? 6.059   8.064   2.021   1.00 0.00 ? 862 ASP A CB   7  
ATOM 10265 C CG   . ASP A 1 79  ? 7.548   7.993   2.296   1.00 0.00 ? 862 ASP A CG   7  
ATOM 10266 O OD1  . ASP A 1 79  ? 7.933   7.405   3.329   1.00 0.00 ? 862 ASP A OD1  7  
ATOM 10267 O OD2  . ASP A 1 79  ? 8.328   8.523   1.478   1.00 0.00 ? 862 ASP A OD2  7  
ATOM 10268 H H    . ASP A 1 79  ? 3.552   8.492   2.118   1.00 0.00 ? 862 ASP A H    7  
ATOM 10269 H HA   . ASP A 1 79  ? 5.205   6.901   3.601   1.00 0.00 ? 862 ASP A HA   7  
ATOM 10270 H HB2  . ASP A 1 79  ? 5.798   7.263   1.345   1.00 0.00 ? 862 ASP A HB2  7  
ATOM 10271 H HB3  . ASP A 1 79  ? 5.843   9.012   1.550   1.00 0.00 ? 862 ASP A HB3  7  
ATOM 10272 N N    . GLY A 1 80  ? 5.945   8.177   5.598   1.00 0.00 ? 863 GLY A N    7  
ATOM 10273 C CA   . GLY A 1 80  ? 6.521   8.878   6.731   1.00 0.00 ? 863 GLY A CA   7  
ATOM 10274 C C    . GLY A 1 80  ? 5.533   9.818   7.393   1.00 0.00 ? 863 GLY A C    7  
ATOM 10275 O O    . GLY A 1 80  ? 5.889   10.932  7.778   1.00 0.00 ? 863 GLY A O    7  
ATOM 10276 H H    . GLY A 1 80  ? 5.626   7.256   5.705   1.00 0.00 ? 863 GLY A H    7  
ATOM 10277 H HA2  . GLY A 1 80  ? 6.854   8.153   7.458   1.00 0.00 ? 863 GLY A HA2  7  
ATOM 10278 H HA3  . GLY A 1 80  ? 7.372   9.450   6.391   1.00 0.00 ? 863 GLY A HA3  7  
ATOM 10279 N N    . MET A 1 81  ? 4.289   9.370   7.525   1.00 0.00 ? 864 MET A N    7  
ATOM 10280 C CA   . MET A 1 81  ? 3.247   10.181  8.145   1.00 0.00 ? 864 MET A CA   7  
ATOM 10281 C C    . MET A 1 81  ? 2.964   9.707   9.567   1.00 0.00 ? 864 MET A C    7  
ATOM 10282 O O    . MET A 1 81  ? 3.009   8.511   9.855   1.00 0.00 ? 864 MET A O    7  
ATOM 10283 C CB   . MET A 1 81  ? 1.965   10.125  7.311   1.00 0.00 ? 864 MET A CB   7  
ATOM 10284 C CG   . MET A 1 81  ? 1.202   8.818   7.455   1.00 0.00 ? 864 MET A CG   7  
ATOM 10285 S SD   . MET A 1 81  ? -0.404  8.857   6.637   1.00 0.00 ? 864 MET A SD   7  
ATOM 10286 C CE   . MET A 1 81  ? -1.400  9.667   7.887   1.00 0.00 ? 864 MET A CE   7  
ATOM 10287 H H    . MET A 1 81  ? 4.066   8.473   7.198   1.00 0.00 ? 864 MET A H    7  
ATOM 10288 H HA   . MET A 1 81  ? 3.598   11.201  8.181   1.00 0.00 ? 864 MET A HA   7  
ATOM 10289 H HB2  . MET A 1 81  ? 1.315   10.932  7.618   1.00 0.00 ? 864 MET A HB2  7  
ATOM 10290 H HB3  . MET A 1 81  ? 2.220   10.255  6.270   1.00 0.00 ? 864 MET A HB3  7  
ATOM 10291 H HG2  . MET A 1 81  ? 1.791   8.024   7.022   1.00 0.00 ? 864 MET A HG2  7  
ATOM 10292 H HG3  . MET A 1 81  ? 1.052   8.620   8.506   1.00 0.00 ? 864 MET A HG3  7  
ATOM 10293 H HE1  . MET A 1 81  ? -1.994  10.443  7.427   1.00 0.00 ? 864 MET A HE1  7  
ATOM 10294 H HE2  . MET A 1 81  ? -2.053  8.942   8.351   1.00 0.00 ? 864 MET A HE2  7  
ATOM 10295 H HE3  . MET A 1 81  ? -0.755  10.102  8.635   1.00 0.00 ? 864 MET A HE3  7  
ATOM 10296 N N    . THR A 1 82  ? 2.671   10.653  10.454  1.00 0.00 ? 865 THR A N    7  
ATOM 10297 C CA   . THR A 1 82  ? 2.383   10.333  11.846  1.00 0.00 ? 865 THR A CA   7  
ATOM 10298 C C    . THR A 1 82  ? 0.920   9.946   12.029  1.00 0.00 ? 865 THR A C    7  
ATOM 10299 O O    . THR A 1 82  ? 0.018   10.684  11.630  1.00 0.00 ? 865 THR A O    7  
ATOM 10300 C CB   . THR A 1 82  ? 2.708   11.518  12.774  1.00 0.00 ? 865 THR A CB   7  
ATOM 10301 O OG1  . THR A 1 82  ? 3.980   12.077  12.428  1.00 0.00 ? 865 THR A OG1  7  
ATOM 10302 C CG2  . THR A 1 82  ? 2.721   11.077  14.230  1.00 0.00 ? 865 THR A CG2  7  
ATOM 10303 H H    . THR A 1 82  ? 2.651   11.589  10.163  1.00 0.00 ? 865 THR A H    7  
ATOM 10304 H HA   . THR A 1 82  ? 3.005   9.497   12.132  1.00 0.00 ? 865 THR A HA   7  
ATOM 10305 H HB   . THR A 1 82  ? 1.946   12.274  12.649  1.00 0.00 ? 865 THR A HB   7  
ATOM 10306 H HG1  . THR A 1 82  ? 4.631   11.374  12.360  1.00 0.00 ? 865 THR A HG1  7  
ATOM 10307 H HG21 . THR A 1 82  ? 1.735   11.199  14.652  1.00 0.00 ? 865 THR A HG21 7  
ATOM 10308 H HG22 . THR A 1 82  ? 3.426   11.681  14.783  1.00 0.00 ? 865 THR A HG22 7  
ATOM 10309 H HG23 . THR A 1 82  ? 3.012   10.040  14.289  1.00 0.00 ? 865 THR A HG23 7  
ATOM 10310 N N    . ILE A 1 83  ? 0.691   8.786   12.635  1.00 0.00 ? 866 ILE A N    7  
ATOM 10311 C CA   . ILE A 1 83  ? -0.664  8.302   12.872  1.00 0.00 ? 866 ILE A CA   7  
ATOM 10312 C C    . ILE A 1 83  ? -0.814  7.760   14.289  1.00 0.00 ? 866 ILE A C    7  
ATOM 10313 O O    . ILE A 1 83  ? -0.137  6.807   14.676  1.00 0.00 ? 866 ILE A O    7  
ATOM 10314 C CB   . ILE A 1 83  ? -1.052  7.200   11.869  1.00 0.00 ? 866 ILE A CB   7  
ATOM 10315 C CG1  . ILE A 1 83  ? -1.331  7.807   10.493  1.00 0.00 ? 866 ILE A CG1  7  
ATOM 10316 C CG2  . ILE A 1 83  ? -2.264  6.430   12.371  1.00 0.00 ? 866 ILE A CG2  7  
ATOM 10317 C CD1  . ILE A 1 83  ? -1.341  6.789   9.374   1.00 0.00 ? 866 ILE A CD1  7  
ATOM 10318 H H    . ILE A 1 83  ? 1.451   8.242   12.930  1.00 0.00 ? 866 ILE A H    7  
ATOM 10319 H HA   . ILE A 1 83  ? -1.342  9.134   12.742  1.00 0.00 ? 866 ILE A HA   7  
ATOM 10320 H HB   . ILE A 1 83  ? -0.226  6.510   11.789  1.00 0.00 ? 866 ILE A HB   7  
ATOM 10321 H HG12 . ILE A 1 83  ? -2.295  8.291   10.509  1.00 0.00 ? 866 ILE A HG12 7  
ATOM 10322 H HG13 . ILE A 1 83  ? -0.569  8.540   10.269  1.00 0.00 ? 866 ILE A HG13 7  
ATOM 10323 H HG21 . ILE A 1 83  ? -2.920  6.211   11.541  1.00 0.00 ? 866 ILE A HG21 7  
ATOM 10324 H HG22 . ILE A 1 83  ? -1.941  5.507   12.826  1.00 0.00 ? 866 ILE A HG22 7  
ATOM 10325 H HG23 . ILE A 1 83  ? -2.793  7.026   13.099  1.00 0.00 ? 866 ILE A HG23 7  
ATOM 10326 H HD11 . ILE A 1 83  ? -2.347  6.681   8.994   1.00 0.00 ? 866 ILE A HD11 7  
ATOM 10327 H HD12 . ILE A 1 83  ? -0.690  7.120   8.579   1.00 0.00 ? 866 ILE A HD12 7  
ATOM 10328 H HD13 . ILE A 1 83  ? -0.995  5.837   9.750   1.00 0.00 ? 866 ILE A HD13 7  
ATOM 10329 N N    . LYS A 1 84  ? -1.706  8.373   15.059  1.00 0.00 ? 867 LYS A N    7  
ATOM 10330 C CA   . LYS A 1 84  ? -1.949  7.951   16.434  1.00 0.00 ? 867 LYS A CA   7  
ATOM 10331 C C    . LYS A 1 84  ? -0.638  7.815   17.201  1.00 0.00 ? 867 LYS A C    7  
ATOM 10332 O O    . LYS A 1 84  ? -0.425  6.834   17.913  1.00 0.00 ? 867 LYS A O    7  
ATOM 10333 C CB   . LYS A 1 84  ? -2.706  6.621   16.455  1.00 0.00 ? 867 LYS A CB   7  
ATOM 10334 C CG   . LYS A 1 84  ? -4.190  6.761   16.163  1.00 0.00 ? 867 LYS A CG   7  
ATOM 10335 C CD   . LYS A 1 84  ? -4.981  5.591   16.723  1.00 0.00 ? 867 LYS A CD   7  
ATOM 10336 C CE   . LYS A 1 84  ? -6.467  5.730   16.428  1.00 0.00 ? 867 LYS A CE   7  
ATOM 10337 N NZ   . LYS A 1 84  ? -7.222  4.498   16.789  1.00 0.00 ? 867 LYS A NZ   7  
ATOM 10338 H H    . LYS A 1 84  ? -2.216  9.127   14.694  1.00 0.00 ? 867 LYS A H    7  
ATOM 10339 H HA   . LYS A 1 84  ? -2.554  8.707   16.911  1.00 0.00 ? 867 LYS A HA   7  
ATOM 10340 H HB2  . LYS A 1 84  ? -2.275  5.964   15.714  1.00 0.00 ? 867 LYS A HB2  7  
ATOM 10341 H HB3  . LYS A 1 84  ? -2.593  6.172   17.431  1.00 0.00 ? 867 LYS A HB3  7  
ATOM 10342 H HG2  . LYS A 1 84  ? -4.552  7.674   16.613  1.00 0.00 ? 867 LYS A HG2  7  
ATOM 10343 H HG3  . LYS A 1 84  ? -4.335  6.803   15.093  1.00 0.00 ? 867 LYS A HG3  7  
ATOM 10344 H HD2  . LYS A 1 84  ? -4.621  4.677   16.276  1.00 0.00 ? 867 LYS A HD2  7  
ATOM 10345 H HD3  . LYS A 1 84  ? -4.838  5.550   17.794  1.00 0.00 ? 867 LYS A HD3  7  
ATOM 10346 H HE2  . LYS A 1 84  ? -6.857  6.560   16.996  1.00 0.00 ? 867 LYS A HE2  7  
ATOM 10347 H HE3  . LYS A 1 84  ? -6.594  5.923   15.373  1.00 0.00 ? 867 LYS A HE3  7  
ATOM 10348 H HZ1  . LYS A 1 84  ? -7.280  4.406   17.823  1.00 0.00 ? 867 LYS A HZ1  7  
ATOM 10349 H HZ2  . LYS A 1 84  ? -6.742  3.659   16.404  1.00 0.00 ? 867 LYS A HZ2  7  
ATOM 10350 H HZ3  . LYS A 1 84  ? -8.185  4.542   16.400  1.00 0.00 ? 867 LYS A HZ3  7  
ATOM 10351 N N    . GLU A 1 85  ? 0.236   8.805   17.051  1.00 0.00 ? 868 GLU A N    7  
ATOM 10352 C CA   . GLU A 1 85  ? 1.526   8.793   17.731  1.00 0.00 ? 868 GLU A CA   7  
ATOM 10353 C C    . GLU A 1 85  ? 2.383   7.624   17.253  1.00 0.00 ? 868 GLU A C    7  
ATOM 10354 O O    . GLU A 1 85  ? 2.933   6.874   18.059  1.00 0.00 ? 868 GLU A O    7  
ATOM 10355 C CB   . GLU A 1 85  ? 1.328   8.709   19.246  1.00 0.00 ? 868 GLU A CB   7  
ATOM 10356 C CG   . GLU A 1 85  ? 2.437   9.376   20.042  1.00 0.00 ? 868 GLU A CG   7  
ATOM 10357 C CD   . GLU A 1 85  ? 2.137   9.430   21.528  1.00 0.00 ? 868 GLU A CD   7  
ATOM 10358 O OE1  . GLU A 1 85  ? 2.493   8.468   22.240  1.00 0.00 ? 868 GLU A OE1  7  
ATOM 10359 O OE2  . GLU A 1 85  ? 1.547   10.434  21.978  1.00 0.00 ? 868 GLU A OE2  7  
ATOM 10360 H H    . GLU A 1 85  ? 0.009   9.560   16.469  1.00 0.00 ? 868 GLU A H    7  
ATOM 10361 H HA   . GLU A 1 85  ? 2.034   9.716   17.494  1.00 0.00 ? 868 GLU A HA   7  
ATOM 10362 H HB2  . GLU A 1 85  ? 0.393   9.185   19.502  1.00 0.00 ? 868 GLU A HB2  7  
ATOM 10363 H HB3  . GLU A 1 85  ? 1.283   7.669   19.533  1.00 0.00 ? 868 GLU A HB3  7  
ATOM 10364 H HG2  . GLU A 1 85  ? 3.352   8.821   19.896  1.00 0.00 ? 868 GLU A HG2  7  
ATOM 10365 H HG3  . GLU A 1 85  ? 2.568   10.385  19.679  1.00 0.00 ? 868 GLU A HG3  7  
ATOM 10366 N N    . ASN A 1 86  ? 2.490   7.476   15.937  1.00 0.00 ? 869 ASN A N    7  
ATOM 10367 C CA   . ASN A 1 86  ? 3.278   6.398   15.351  1.00 0.00 ? 869 ASN A CA   7  
ATOM 10368 C C    . ASN A 1 86  ? 3.602   6.693   13.889  1.00 0.00 ? 869 ASN A C    7  
ATOM 10369 O O    . ASN A 1 86  ? 2.713   6.710   13.037  1.00 0.00 ? 869 ASN A O    7  
ATOM 10370 C CB   . ASN A 1 86  ? 2.526   5.070   15.460  1.00 0.00 ? 869 ASN A CB   7  
ATOM 10371 C CG   . ASN A 1 86  ? 3.434   3.873   15.260  1.00 0.00 ? 869 ASN A CG   7  
ATOM 10372 O OD1  . ASN A 1 86  ? 4.153   3.784   14.265  1.00 0.00 ? 869 ASN A OD1  7  
ATOM 10373 N ND2  . ASN A 1 86  ? 3.405   2.943   16.208  1.00 0.00 ? 869 ASN A ND2  7  
ATOM 10374 H H    . ASN A 1 86  ? 2.028   8.106   15.345  1.00 0.00 ? 869 ASN A H    7  
ATOM 10375 H HA   . ASN A 1 86  ? 4.202   6.324   15.904  1.00 0.00 ? 869 ASN A HA   7  
ATOM 10376 H HB2  . ASN A 1 86  ? 2.077   4.998   16.440  1.00 0.00 ? 869 ASN A HB2  7  
ATOM 10377 H HB3  . ASN A 1 86  ? 1.749   5.040   14.710  1.00 0.00 ? 869 ASN A HB3  7  
ATOM 10378 H HD21 . ASN A 1 86  ? 2.807   3.080   16.973  1.00 0.00 ? 869 ASN A HD21 7  
ATOM 10379 H HD22 . ASN A 1 86  ? 3.983   2.159   16.104  1.00 0.00 ? 869 ASN A HD22 7  
ATOM 10380 N N    . ILE A 1 87  ? 4.879   6.925   13.607  1.00 0.00 ? 870 ILE A N    7  
ATOM 10381 C CA   . ILE A 1 87  ? 5.320   7.218   12.249  1.00 0.00 ? 870 ILE A CA   7  
ATOM 10382 C C    . ILE A 1 87  ? 5.174   5.996   11.348  1.00 0.00 ? 870 ILE A C    7  
ATOM 10383 O O    . ILE A 1 87  ? 5.840   4.980   11.551  1.00 0.00 ? 870 ILE A O    7  
ATOM 10384 C CB   . ILE A 1 87  ? 6.786   7.689   12.222  1.00 0.00 ? 870 ILE A CB   7  
ATOM 10385 C CG1  . ILE A 1 87  ? 6.878   9.163   12.621  1.00 0.00 ? 870 ILE A CG1  7  
ATOM 10386 C CG2  . ILE A 1 87  ? 7.388   7.469   10.842  1.00 0.00 ? 870 ILE A CG2  7  
ATOM 10387 C CD1  . ILE A 1 87  ? 6.760   9.395   14.111  1.00 0.00 ? 870 ILE A CD1  7  
ATOM 10388 H H    . ILE A 1 87  ? 5.541   6.898   14.329  1.00 0.00 ? 870 ILE A H    7  
ATOM 10389 H HA   . ILE A 1 87  ? 4.700   8.013   11.862  1.00 0.00 ? 870 ILE A HA   7  
ATOM 10390 H HB   . ILE A 1 87  ? 7.344   7.096   12.931  1.00 0.00 ? 870 ILE A HB   7  
ATOM 10391 H HG12 . ILE A 1 87  ? 7.828   9.558   12.298  1.00 0.00 ? 870 ILE A HG12 7  
ATOM 10392 H HG13 . ILE A 1 87  ? 6.082   9.710   12.135  1.00 0.00 ? 870 ILE A HG13 7  
ATOM 10393 H HG21 . ILE A 1 87  ? 6.600   7.458   10.104  1.00 0.00 ? 870 ILE A HG21 7  
ATOM 10394 H HG22 . ILE A 1 87  ? 8.078   8.269   10.620  1.00 0.00 ? 870 ILE A HG22 7  
ATOM 10395 H HG23 . ILE A 1 87  ? 7.912   6.525   10.824  1.00 0.00 ? 870 ILE A HG23 7  
ATOM 10396 H HD11 . ILE A 1 87  ? 7.493   10.125  14.421  1.00 0.00 ? 870 ILE A HD11 7  
ATOM 10397 H HD12 . ILE A 1 87  ? 5.770   9.757   14.342  1.00 0.00 ? 870 ILE A HD12 7  
ATOM 10398 H HD13 . ILE A 1 87  ? 6.935   8.466   14.634  1.00 0.00 ? 870 ILE A HD13 7  
ATOM 10399 N N    . ILE A 1 88  ? 4.301   6.103   10.352  1.00 0.00 ? 871 ILE A N    7  
ATOM 10400 C CA   . ILE A 1 88  ? 4.071   5.007   9.419   1.00 0.00 ? 871 ILE A CA   7  
ATOM 10401 C C    . ILE A 1 88  ? 4.735   5.282   8.074   1.00 0.00 ? 871 ILE A C    7  
ATOM 10402 O O    . ILE A 1 88  ? 4.712   6.407   7.575   1.00 0.00 ? 871 ILE A O    7  
ATOM 10403 C CB   . ILE A 1 88  ? 2.566   4.766   9.195   1.00 0.00 ? 871 ILE A CB   7  
ATOM 10404 C CG1  . ILE A 1 88  ? 2.000   5.803   8.222   1.00 0.00 ? 871 ILE A CG1  7  
ATOM 10405 C CG2  . ILE A 1 88  ? 1.819   4.811   10.520  1.00 0.00 ? 871 ILE A CG2  7  
ATOM 10406 C CD1  . ILE A 1 88  ? 2.289   5.491   6.771   1.00 0.00 ? 871 ILE A CD1  7  
ATOM 10407 H H    . ILE A 1 88  ? 3.801   6.938   10.243  1.00 0.00 ? 871 ILE A H    7  
ATOM 10408 H HA   . ILE A 1 88  ? 4.499   4.111   9.844   1.00 0.00 ? 871 ILE A HA   7  
ATOM 10409 H HB   . ILE A 1 88  ? 2.441   3.781   8.772   1.00 0.00 ? 871 ILE A HB   7  
ATOM 10410 H HG12 . ILE A 1 88  ? 0.929   5.854   8.344   1.00 0.00 ? 871 ILE A HG12 7  
ATOM 10411 H HG13 . ILE A 1 88  ? 2.430   6.768   8.447   1.00 0.00 ? 871 ILE A HG13 7  
ATOM 10412 H HG21 . ILE A 1 88  ? 2.279   5.543   11.167  1.00 0.00 ? 871 ILE A HG21 7  
ATOM 10413 H HG22 . ILE A 1 88  ? 0.790   5.085   10.343  1.00 0.00 ? 871 ILE A HG22 7  
ATOM 10414 H HG23 . ILE A 1 88  ? 1.859   3.840   10.989  1.00 0.00 ? 871 ILE A HG23 7  
ATOM 10415 H HD11 . ILE A 1 88  ? 2.886   4.593   6.707   1.00 0.00 ? 871 ILE A HD11 7  
ATOM 10416 H HD12 . ILE A 1 88  ? 1.359   5.344   6.242   1.00 0.00 ? 871 ILE A HD12 7  
ATOM 10417 H HD13 . ILE A 1 88  ? 2.830   6.314   6.327   1.00 0.00 ? 871 ILE A HD13 7  
ATOM 10418 N N    . LYS A 1 89  ? 5.327   4.245   7.490   1.00 0.00 ? 872 LYS A N    7  
ATOM 10419 C CA   . LYS A 1 89  ? 5.996   4.372   6.201   1.00 0.00 ? 872 LYS A CA   7  
ATOM 10420 C C    . LYS A 1 89  ? 5.160   3.746   5.090   1.00 0.00 ? 872 LYS A C    7  
ATOM 10421 O O    . LYS A 1 89  ? 4.333   2.868   5.340   1.00 0.00 ? 872 LYS A O    7  
ATOM 10422 C CB   . LYS A 1 89  ? 7.375   3.710   6.252   1.00 0.00 ? 872 LYS A CB   7  
ATOM 10423 C CG   . LYS A 1 89  ? 8.371   4.303   5.271   1.00 0.00 ? 872 LYS A CG   7  
ATOM 10424 C CD   . LYS A 1 89  ? 9.719   3.606   5.355   1.00 0.00 ? 872 LYS A CD   7  
ATOM 10425 C CE   . LYS A 1 89  ? 9.680   2.236   4.694   1.00 0.00 ? 872 LYS A CE   7  
ATOM 10426 N NZ   . LYS A 1 89  ? 9.587   2.338   3.212   1.00 0.00 ? 872 LYS A NZ   7  
ATOM 10427 H H    . LYS A 1 89  ? 5.312   3.373   7.937   1.00 0.00 ? 872 LYS A H    7  
ATOM 10428 H HA   . LYS A 1 89  ? 6.119   5.424   5.993   1.00 0.00 ? 872 LYS A HA   7  
ATOM 10429 H HB2  . LYS A 1 89  ? 7.776   3.816   7.249   1.00 0.00 ? 872 LYS A HB2  7  
ATOM 10430 H HB3  . LYS A 1 89  ? 7.264   2.658   6.028   1.00 0.00 ? 872 LYS A HB3  7  
ATOM 10431 H HG2  . LYS A 1 89  ? 7.984   4.195   4.269   1.00 0.00 ? 872 LYS A HG2  7  
ATOM 10432 H HG3  . LYS A 1 89  ? 8.504   5.352   5.497   1.00 0.00 ? 872 LYS A HG3  7  
ATOM 10433 H HD2  . LYS A 1 89  ? 10.460  4.212   4.856   1.00 0.00 ? 872 LYS A HD2  7  
ATOM 10434 H HD3  . LYS A 1 89  ? 9.989   3.487   6.395   1.00 0.00 ? 872 LYS A HD3  7  
ATOM 10435 H HE2  . LYS A 1 89  ? 10.579  1.700   4.954   1.00 0.00 ? 872 LYS A HE2  7  
ATOM 10436 H HE3  . LYS A 1 89  ? 8.820   1.698   5.064   1.00 0.00 ? 872 LYS A HE3  7  
ATOM 10437 H HZ1  . LYS A 1 89  ? 10.070  3.199   2.882   1.00 0.00 ? 872 LYS A HZ1  7  
ATOM 10438 H HZ2  . LYS A 1 89  ? 8.591   2.379   2.917   1.00 0.00 ? 872 LYS A HZ2  7  
ATOM 10439 H HZ3  . LYS A 1 89  ? 10.036  1.511   2.768   1.00 0.00 ? 872 LYS A HZ3  7  
ATOM 10440 N N    . VAL A 1 90  ? 5.381   4.201   3.861   1.00 0.00 ? 873 VAL A N    7  
ATOM 10441 C CA   . VAL A 1 90  ? 4.650   3.683   2.710   1.00 0.00 ? 873 VAL A CA   7  
ATOM 10442 C C    . VAL A 1 90  ? 5.601   3.294   1.584   1.00 0.00 ? 873 VAL A C    7  
ATOM 10443 O O    . VAL A 1 90  ? 6.569   4.000   1.304   1.00 0.00 ? 873 VAL A O    7  
ATOM 10444 C CB   . VAL A 1 90  ? 3.637   4.714   2.179   1.00 0.00 ? 873 VAL A CB   7  
ATOM 10445 C CG1  . VAL A 1 90  ? 2.781   4.105   1.079   1.00 0.00 ? 873 VAL A CG1  7  
ATOM 10446 C CG2  . VAL A 1 90  ? 2.768   5.239   3.312   1.00 0.00 ? 873 VAL A CG2  7  
ATOM 10447 H H    . VAL A 1 90  ? 6.053   4.901   3.724   1.00 0.00 ? 873 VAL A H    7  
ATOM 10448 H HA   . VAL A 1 90  ? 4.106   2.806   3.028   1.00 0.00 ? 873 VAL A HA   7  
ATOM 10449 H HB   . VAL A 1 90  ? 4.185   5.545   1.759   1.00 0.00 ? 873 VAL A HB   7  
ATOM 10450 H HG11 . VAL A 1 90  ? 3.410   3.828   0.246   1.00 0.00 ? 873 VAL A HG11 7  
ATOM 10451 H HG12 . VAL A 1 90  ? 2.278   3.227   1.458   1.00 0.00 ? 873 VAL A HG12 7  
ATOM 10452 H HG13 . VAL A 1 90  ? 2.048   4.827   0.751   1.00 0.00 ? 873 VAL A HG13 7  
ATOM 10453 H HG21 . VAL A 1 90  ? 3.187   4.932   4.258   1.00 0.00 ? 873 VAL A HG21 7  
ATOM 10454 H HG22 . VAL A 1 90  ? 2.731   6.319   3.268   1.00 0.00 ? 873 VAL A HG22 7  
ATOM 10455 H HG23 . VAL A 1 90  ? 1.769   4.842   3.214   1.00 0.00 ? 873 VAL A HG23 7  
ATOM 10456 N N    . ALA A 1 91  ? 5.317   2.166   0.941   1.00 0.00 ? 874 ALA A N    7  
ATOM 10457 C CA   . ALA A 1 91  ? 6.146   1.685   -0.158  1.00 0.00 ? 874 ALA A CA   7  
ATOM 10458 C C    . ALA A 1 91  ? 5.288   1.134   -1.292  1.00 0.00 ? 874 ALA A C    7  
ATOM 10459 O O    . ALA A 1 91  ? 4.333   0.393   -1.057  1.00 0.00 ? 874 ALA A O    7  
ATOM 10460 C CB   . ALA A 1 91  ? 7.113   0.621   0.339   1.00 0.00 ? 874 ALA A CB   7  
ATOM 10461 H H    . ALA A 1 91  ? 4.531   1.647   1.210   1.00 0.00 ? 874 ALA A H    7  
ATOM 10462 H HA   . ALA A 1 91  ? 6.725   2.518   -0.529  1.00 0.00 ? 874 ALA A HA   7  
ATOM 10463 H HB1  . ALA A 1 91  ? 8.110   0.852   -0.008  1.00 0.00 ? 874 ALA A HB1  7  
ATOM 10464 H HB2  . ALA A 1 91  ? 7.103   0.601   1.419   1.00 0.00 ? 874 ALA A HB2  7  
ATOM 10465 H HB3  . ALA A 1 91  ? 6.814   -0.344  -0.042  1.00 0.00 ? 874 ALA A HB3  7  
ATOM 10466 N N    . ILE A 1 92  ? 5.634   1.502   -2.521  1.00 0.00 ? 875 ILE A N    7  
ATOM 10467 C CA   . ILE A 1 92  ? 4.895   1.044   -3.691  1.00 0.00 ? 875 ILE A CA   7  
ATOM 10468 C C    . ILE A 1 92  ? 4.852   -0.479  -3.753  1.00 0.00 ? 875 ILE A C    7  
ATOM 10469 O O    . ILE A 1 92  ? 5.890   -1.137  -3.832  1.00 0.00 ? 875 ILE A O    7  
ATOM 10470 C CB   . ILE A 1 92  ? 5.515   1.582   -4.994  1.00 0.00 ? 875 ILE A CB   7  
ATOM 10471 C CG1  . ILE A 1 92  ? 5.564   3.111   -4.968  1.00 0.00 ? 875 ILE A CG1  7  
ATOM 10472 C CG2  . ILE A 1 92  ? 4.725   1.092   -6.198  1.00 0.00 ? 875 ILE A CG2  7  
ATOM 10473 C CD1  . ILE A 1 92  ? 4.198   3.760   -5.024  1.00 0.00 ? 875 ILE A CD1  7  
ATOM 10474 H H    . ILE A 1 92  ? 6.405   2.094   -2.644  1.00 0.00 ? 875 ILE A H    7  
ATOM 10475 H HA   . ILE A 1 92  ? 3.885   1.419   -3.615  1.00 0.00 ? 875 ILE A HA   7  
ATOM 10476 H HB   . ILE A 1 92  ? 6.521   1.198   -5.074  1.00 0.00 ? 875 ILE A HB   7  
ATOM 10477 H HG12 . ILE A 1 92  ? 6.047   3.434   -4.060  1.00 0.00 ? 875 ILE A HG12 7  
ATOM 10478 H HG13 . ILE A 1 92  ? 6.133   3.460   -5.818  1.00 0.00 ? 875 ILE A HG13 7  
ATOM 10479 H HG21 . ILE A 1 92  ? 3.681   1.005   -5.933  1.00 0.00 ? 875 ILE A HG21 7  
ATOM 10480 H HG22 . ILE A 1 92  ? 4.831   1.797   -7.009  1.00 0.00 ? 875 ILE A HG22 7  
ATOM 10481 H HG23 . ILE A 1 92  ? 5.099   0.128   -6.508  1.00 0.00 ? 875 ILE A HG23 7  
ATOM 10482 H HD11 . ILE A 1 92  ? 3.767   3.608   -6.003  1.00 0.00 ? 875 ILE A HD11 7  
ATOM 10483 H HD12 . ILE A 1 92  ? 3.558   3.319   -4.275  1.00 0.00 ? 875 ILE A HD12 7  
ATOM 10484 H HD13 . ILE A 1 92  ? 4.296   4.819   -4.835  1.00 0.00 ? 875 ILE A HD13 7  
ATOM 10485 N N    . SER A 1 93  ? 3.645   -1.034  -3.718  1.00 0.00 ? 876 SER A N    7  
ATOM 10486 C CA   . SER A 1 93  ? 3.466   -2.480  -3.768  1.00 0.00 ? 876 SER A CA   7  
ATOM 10487 C C    . SER A 1 93  ? 3.988   -3.047  -5.085  1.00 0.00 ? 876 SER A C    7  
ATOM 10488 O O    . SER A 1 93  ? 3.370   -2.876  -6.135  1.00 0.00 ? 876 SER A O    7  
ATOM 10489 C CB   . SER A 1 93  ? 1.989   -2.839  -3.595  1.00 0.00 ? 876 SER A CB   7  
ATOM 10490 O OG   . SER A 1 93  ? 1.642   -2.926  -2.224  1.00 0.00 ? 876 SER A OG   7  
ATOM 10491 H H    . SER A 1 93  ? 2.855   -0.456  -3.655  1.00 0.00 ? 876 SER A H    7  
ATOM 10492 H HA   . SER A 1 93  ? 4.030   -2.912  -2.955  1.00 0.00 ? 876 SER A HA   7  
ATOM 10493 H HB2  . SER A 1 93  ? 1.380   -2.079  -4.061  1.00 0.00 ? 876 SER A HB2  7  
ATOM 10494 H HB3  . SER A 1 93  ? 1.796   -3.793  -4.065  1.00 0.00 ? 876 SER A HB3  7  
ATOM 10495 H HG   . SER A 1 93  ? 0.779   -3.338  -2.137  1.00 0.00 ? 876 SER A HG   7  
ATOM 10496 N N    . ASN A 1 94  ? 5.131   -3.722  -5.020  1.00 0.00 ? 877 ASN A N    7  
ATOM 10497 C CA   . ASN A 1 94  ? 5.738   -4.314  -6.207  1.00 0.00 ? 877 ASN A CA   7  
ATOM 10498 C C    . ASN A 1 94  ? 5.642   -5.836  -6.165  1.00 0.00 ? 877 ASN A C    7  
ATOM 10499 O O    . ASN A 1 94  ? 6.588   -6.538  -6.524  1.00 0.00 ? 877 ASN A O    7  
ATOM 10500 C CB   . ASN A 1 94  ? 7.202   -3.887  -6.323  1.00 0.00 ? 877 ASN A CB   7  
ATOM 10501 C CG   . ASN A 1 94  ? 8.055   -4.433  -5.195  1.00 0.00 ? 877 ASN A CG   7  
ATOM 10502 O OD1  . ASN A 1 94  ? 8.800   -5.396  -5.375  1.00 0.00 ? 877 ASN A OD1  7  
ATOM 10503 N ND2  . ASN A 1 94  ? 7.950   -3.818  -4.023  1.00 0.00 ? 877 ASN A ND2  7  
ATOM 10504 H H    . ASN A 1 94  ? 5.577   -3.825  -4.154  1.00 0.00 ? 877 ASN A H    7  
ATOM 10505 H HA   . ASN A 1 94  ? 5.197   -3.955  -7.069  1.00 0.00 ? 877 ASN A HA   7  
ATOM 10506 H HB2  . ASN A 1 94  ? 7.603   -4.249  -7.259  1.00 0.00 ? 877 ASN A HB2  7  
ATOM 10507 H HB3  . ASN A 1 94  ? 7.259   -2.809  -6.305  1.00 0.00 ? 877 ASN A HB3  7  
ATOM 10508 H HD21 . ASN A 1 94  ? 7.336   -3.058  -3.952  1.00 0.00 ? 877 ASN A HD21 7  
ATOM 10509 H HD22 . ASN A 1 94  ? 8.491   -4.150  -3.276  1.00 0.00 ? 877 ASN A HD22 7  
ATOM 10510 N N    . SER A 1 95  ? 4.494   -6.340  -5.724  1.00 0.00 ? 878 SER A N    7  
ATOM 10511 C CA   . SER A 1 95  ? 4.275   -7.779  -5.632  1.00 0.00 ? 878 SER A CA   7  
ATOM 10512 C C    . SER A 1 95  ? 5.515   -8.483  -5.089  1.00 0.00 ? 878 SER A C    7  
ATOM 10513 O O    . SER A 1 95  ? 5.886   -9.559  -5.556  1.00 0.00 ? 878 SER A O    7  
ATOM 10514 C CB   . SER A 1 95  ? 3.910   -8.349  -7.003  1.00 0.00 ? 878 SER A CB   7  
ATOM 10515 O OG   . SER A 1 95  ? 5.033   -8.358  -7.868  1.00 0.00 ? 878 SER A OG   7  
ATOM 10516 H H    . SER A 1 95  ? 3.777   -5.729  -5.452  1.00 0.00 ? 878 SER A H    7  
ATOM 10517 H HA   . SER A 1 95  ? 3.454   -7.946  -4.951  1.00 0.00 ? 878 SER A HA   7  
ATOM 10518 H HB2  . SER A 1 95  ? 3.553   -9.361  -6.886  1.00 0.00 ? 878 SER A HB2  7  
ATOM 10519 H HB3  . SER A 1 95  ? 3.133   -7.743  -7.447  1.00 0.00 ? 878 SER A HB3  7  
ATOM 10520 H HG   . SER A 1 95  ? 4.805   -8.809  -8.684  1.00 0.00 ? 878 SER A HG   7  
ATOM 10521 N N    . GLY A 1 96  ? 6.153   -7.866  -4.099  1.00 0.00 ? 879 GLY A N    7  
ATOM 10522 C CA   . GLY A 1 96  ? 7.345   -8.446  -3.509  1.00 0.00 ? 879 GLY A CA   7  
ATOM 10523 C C    . GLY A 1 96  ? 7.158   -8.791  -2.044  1.00 0.00 ? 879 GLY A C    7  
ATOM 10524 O O    . GLY A 1 96  ? 6.336   -8.197  -1.345  1.00 0.00 ? 879 GLY A O    7  
ATOM 10525 H H    . GLY A 1 96  ? 5.812   -7.009  -3.767  1.00 0.00 ? 879 GLY A H    7  
ATOM 10526 H HA2  . GLY A 1 96  ? 7.600   -9.345  -4.050  1.00 0.00 ? 879 GLY A HA2  7  
ATOM 10527 H HA3  . GLY A 1 96  ? 8.158   -7.741  -3.599  1.00 0.00 ? 879 GLY A HA3  7  
ATOM 10528 N N    . PRO A 1 97  ? 7.932   -9.773  -1.560  1.00 0.00 ? 880 PRO A N    7  
ATOM 10529 C CA   . PRO A 1 97  ? 7.865   -10.218 -0.165  1.00 0.00 ? 880 PRO A CA   7  
ATOM 10530 C C    . PRO A 1 97  ? 8.412   -9.175  0.804   1.00 0.00 ? 880 PRO A C    7  
ATOM 10531 O O    . PRO A 1 97  ? 8.901   -8.124  0.388   1.00 0.00 ? 880 PRO A O    7  
ATOM 10532 C CB   . PRO A 1 97  ? 8.742   -11.473 -0.151  1.00 0.00 ? 880 PRO A CB   7  
ATOM 10533 C CG   . PRO A 1 97  ? 9.690   -11.285 -1.283  1.00 0.00 ? 880 PRO A CG   7  
ATOM 10534 C CD   . PRO A 1 97  ? 8.933   -10.523 -2.336  1.00 0.00 ? 880 PRO A CD   7  
ATOM 10535 H HA   . PRO A 1 97  ? 6.856   -10.478 0.121   1.00 0.00 ? 880 PRO A HA   7  
ATOM 10536 H HB2  . PRO A 1 97  ? 9.262   -11.541 0.795   1.00 0.00 ? 880 PRO A HB2  7  
ATOM 10537 H HB3  . PRO A 1 97  ? 8.126   -12.348 -0.293  1.00 0.00 ? 880 PRO A HB3  7  
ATOM 10538 H HG2  . PRO A 1 97  ? 10.548  -10.718 -0.954  1.00 0.00 ? 880 PRO A HG2  7  
ATOM 10539 H HG3  . PRO A 1 97  ? 9.999   -12.246 -1.667  1.00 0.00 ? 880 PRO A HG3  7  
ATOM 10540 H HD2  . PRO A 1 97  ? 9.594   -9.852  -2.865  1.00 0.00 ? 880 PRO A HD2  7  
ATOM 10541 H HD3  . PRO A 1 97  ? 8.455   -11.205 -3.024  1.00 0.00 ? 880 PRO A HD3  7  
ATOM 10542 N N    . SER A 1 98  ? 8.328   -9.472  2.096   1.00 0.00 ? 881 SER A N    7  
ATOM 10543 C CA   . SER A 1 98  ? 8.812   -8.558  3.124   1.00 0.00 ? 881 SER A CA   7  
ATOM 10544 C C    . SER A 1 98  ? 10.331  -8.628  3.241   1.00 0.00 ? 881 SER A C    7  
ATOM 10545 O O    . SER A 1 98  ? 10.932  -9.685  3.048   1.00 0.00 ? 881 SER A O    7  
ATOM 10546 C CB   . SER A 1 98  ? 8.170   -8.888  4.473   1.00 0.00 ? 881 SER A CB   7  
ATOM 10547 O OG   . SER A 1 98  ? 8.698   -10.088 5.010   1.00 0.00 ? 881 SER A OG   7  
ATOM 10548 H H    . SER A 1 98  ? 7.928   -10.326 2.365   1.00 0.00 ? 881 SER A H    7  
ATOM 10549 H HA   . SER A 1 98  ? 8.530   -7.557  2.836   1.00 0.00 ? 881 SER A HA   7  
ATOM 10550 H HB2  . SER A 1 98  ? 8.360   -8.083  5.166   1.00 0.00 ? 881 SER A HB2  7  
ATOM 10551 H HB3  . SER A 1 98  ? 7.104   -9.005  4.342   1.00 0.00 ? 881 SER A HB3  7  
ATOM 10552 H HG   . SER A 1 98  ? 9.533   -9.903  5.447   1.00 0.00 ? 881 SER A HG   7  
ATOM 10553 N N    . SER A 1 99  ? 10.947  -7.494  3.559   1.00 0.00 ? 882 SER A N    7  
ATOM 10554 C CA   . SER A 1 99  ? 12.397  -7.423  3.699   1.00 0.00 ? 882 SER A CA   7  
ATOM 10555 C C    . SER A 1 99  ? 12.811  -7.598  5.157   1.00 0.00 ? 882 SER A C    7  
ATOM 10556 O O    . SER A 1 99  ? 12.280  -6.938  6.048   1.00 0.00 ? 882 SER A O    7  
ATOM 10557 C CB   . SER A 1 99  ? 12.917  -6.087  3.165   1.00 0.00 ? 882 SER A CB   7  
ATOM 10558 O OG   . SER A 1 99  ? 13.112  -6.139  1.763   1.00 0.00 ? 882 SER A OG   7  
ATOM 10559 H H    . SER A 1 99  ? 10.413  -6.684  3.701   1.00 0.00 ? 882 SER A H    7  
ATOM 10560 H HA   . SER A 1 99  ? 12.825  -8.225  3.116   1.00 0.00 ? 882 SER A HA   7  
ATOM 10561 H HB2  . SER A 1 99  ? 12.202  -5.310  3.388   1.00 0.00 ? 882 SER A HB2  7  
ATOM 10562 H HB3  . SER A 1 99  ? 13.860  -5.856  3.640   1.00 0.00 ? 882 SER A HB3  7  
ATOM 10563 H HG   . SER A 1 99  ? 13.919  -6.623  1.569   1.00 0.00 ? 882 SER A HG   7  
ATOM 10564 N N    . GLY A 1 100 ? 13.766  -8.494  5.391   1.00 0.00 ? 883 GLY A N    7  
ATOM 10565 C CA   . GLY A 1 100 ? 14.236  -8.741  6.741   1.00 0.00 ? 883 GLY A CA   7  
ATOM 10566 C C    . GLY A 1 100 ? 13.329  -9.682  7.508   1.00 0.00 ? 883 GLY A C    7  
ATOM 10567 O O    . GLY A 1 100 ? 13.187  -9.563  8.725   1.00 0.00 ? 883 GLY A O    7  
ATOM 10568 H H    . GLY A 1 100 ? 14.153  -8.991  4.640   1.00 0.00 ? 883 GLY A H    7  
ATOM 10569 H HA2  . GLY A 1 100 ? 15.226  -9.171  6.693   1.00 0.00 ? 883 GLY A HA2  7  
ATOM 10570 H HA3  . GLY A 1 100 ? 14.289  -7.800  7.269   1.00 0.00 ? 883 GLY A HA3  7  
ATOM 10571 N N    . GLY A 1 1   ? 16.810  11.045  -17.007 1.00 0.00 ? 784 GLY A N    8  
ATOM 10572 C CA   . GLY A 1 1   ? 16.588  12.473  -17.147 1.00 0.00 ? 784 GLY A CA   8  
ATOM 10573 C C    . GLY A 1 1   ? 15.173  12.799  -17.582 1.00 0.00 ? 784 GLY A C    8  
ATOM 10574 O O    . GLY A 1 1   ? 14.224  12.118  -17.194 1.00 0.00 ? 784 GLY A O    8  
ATOM 10575 H H1   . GLY A 1 1   ? 16.659  10.610  -16.142 1.00 0.00 ? 784 GLY A H1   8  
ATOM 10576 H HA2  . GLY A 1 1   ? 16.781  12.950  -16.198 1.00 0.00 ? 784 GLY A HA2  8  
ATOM 10577 H HA3  . GLY A 1 1   ? 17.277  12.862  -17.882 1.00 0.00 ? 784 GLY A HA3  8  
ATOM 10578 N N    . SER A 1 2   ? 15.031  13.846  -18.388 1.00 0.00 ? 785 SER A N    8  
ATOM 10579 C CA   . SER A 1 2   ? 13.721  14.266  -18.872 1.00 0.00 ? 785 SER A CA   8  
ATOM 10580 C C    . SER A 1 2   ? 13.498  13.803  -20.309 1.00 0.00 ? 785 SER A C    8  
ATOM 10581 O O    . SER A 1 2   ? 12.978  14.549  -21.139 1.00 0.00 ? 785 SER A O    8  
ATOM 10582 C CB   . SER A 1 2   ? 13.585  15.787  -18.787 1.00 0.00 ? 785 SER A CB   8  
ATOM 10583 O OG   . SER A 1 2   ? 14.550  16.431  -19.602 1.00 0.00 ? 785 SER A OG   8  
ATOM 10584 H H    . SER A 1 2   ? 15.826  14.350  -18.662 1.00 0.00 ? 785 SER A H    8  
ATOM 10585 H HA   . SER A 1 2   ? 12.973  13.811  -18.240 1.00 0.00 ? 785 SER A HA   8  
ATOM 10586 H HB2  . SER A 1 2   ? 12.600  16.078  -19.119 1.00 0.00 ? 785 SER A HB2  8  
ATOM 10587 H HB3  . SER A 1 2   ? 13.728  16.102  -17.763 1.00 0.00 ? 785 SER A HB3  8  
ATOM 10588 H HG   . SER A 1 2   ? 14.112  17.061  -20.179 1.00 0.00 ? 785 SER A HG   8  
ATOM 10589 N N    . SER A 1 3   ? 13.896  12.568  -20.594 1.00 0.00 ? 786 SER A N    8  
ATOM 10590 C CA   . SER A 1 3   ? 13.745  12.006  -21.931 1.00 0.00 ? 786 SER A CA   8  
ATOM 10591 C C    . SER A 1 3   ? 12.320  12.197  -22.443 1.00 0.00 ? 786 SER A C    8  
ATOM 10592 O O    . SER A 1 3   ? 11.358  12.103  -21.682 1.00 0.00 ? 786 SER A O    8  
ATOM 10593 C CB   . SER A 1 3   ? 14.102  10.518  -21.926 1.00 0.00 ? 786 SER A CB   8  
ATOM 10594 O OG   . SER A 1 3   ? 13.967  9.956   -23.220 1.00 0.00 ? 786 SER A OG   8  
ATOM 10595 H H    . SER A 1 3   ? 14.304  12.022  -19.889 1.00 0.00 ? 786 SER A H    8  
ATOM 10596 H HA   . SER A 1 3   ? 14.424  12.528  -22.589 1.00 0.00 ? 786 SER A HA   8  
ATOM 10597 H HB2  . SER A 1 3   ? 15.123  10.397  -21.598 1.00 0.00 ? 786 SER A HB2  8  
ATOM 10598 H HB3  . SER A 1 3   ? 13.442  9.995   -21.248 1.00 0.00 ? 786 SER A HB3  8  
ATOM 10599 H HG   . SER A 1 3   ? 13.471  9.136   -23.163 1.00 0.00 ? 786 SER A HG   8  
ATOM 10600 N N    . GLY A 1 4   ? 12.194  12.466  -23.739 1.00 0.00 ? 787 GLY A N    8  
ATOM 10601 C CA   . GLY A 1 4   ? 10.885  12.666  -24.331 1.00 0.00 ? 787 GLY A CA   8  
ATOM 10602 C C    . GLY A 1 4   ? 10.140  11.363  -24.545 1.00 0.00 ? 787 GLY A C    8  
ATOM 10603 O O    . GLY A 1 4   ? 9.934   10.596  -23.605 1.00 0.00 ? 787 GLY A O    8  
ATOM 10604 H H    . GLY A 1 4   ? 12.997  12.529  -24.297 1.00 0.00 ? 787 GLY A H    8  
ATOM 10605 H HA2  . GLY A 1 4   ? 10.301  13.300  -23.680 1.00 0.00 ? 787 GLY A HA2  8  
ATOM 10606 H HA3  . GLY A 1 4   ? 11.005  13.159  -25.284 1.00 0.00 ? 787 GLY A HA3  8  
ATOM 10607 N N    . SER A 1 5   ? 9.733   11.113  -25.786 1.00 0.00 ? 788 SER A N    8  
ATOM 10608 C CA   . SER A 1 5   ? 9.002   9.897   -26.120 1.00 0.00 ? 788 SER A CA   8  
ATOM 10609 C C    . SER A 1 5   ? 9.609   9.216   -27.343 1.00 0.00 ? 788 SER A C    8  
ATOM 10610 O O    . SER A 1 5   ? 10.423  9.805   -28.054 1.00 0.00 ? 788 SER A O    8  
ATOM 10611 C CB   . SER A 1 5   ? 7.528   10.217  -26.379 1.00 0.00 ? 788 SER A CB   8  
ATOM 10612 O OG   . SER A 1 5   ? 6.932   10.826  -25.246 1.00 0.00 ? 788 SER A OG   8  
ATOM 10613 H H    . SER A 1 5   ? 9.928   11.764  -26.493 1.00 0.00 ? 788 SER A H    8  
ATOM 10614 H HA   . SER A 1 5   ? 9.073   9.225   -25.277 1.00 0.00 ? 788 SER A HA   8  
ATOM 10615 H HB2  . SER A 1 5   ? 7.451   10.892  -27.217 1.00 0.00 ? 788 SER A HB2  8  
ATOM 10616 H HB3  . SER A 1 5   ? 6.998   9.302   -26.602 1.00 0.00 ? 788 SER A HB3  8  
ATOM 10617 H HG   . SER A 1 5   ? 7.024   11.779  -25.310 1.00 0.00 ? 788 SER A HG   8  
ATOM 10618 N N    . SER A 1 6   ? 9.206   7.972   -27.581 1.00 0.00 ? 789 SER A N    8  
ATOM 10619 C CA   . SER A 1 6   ? 9.712   7.209   -28.716 1.00 0.00 ? 789 SER A CA   8  
ATOM 10620 C C    . SER A 1 6   ? 8.638   7.051   -29.787 1.00 0.00 ? 789 SER A C    8  
ATOM 10621 O O    . SER A 1 6   ? 8.862   7.358   -30.957 1.00 0.00 ? 789 SER A O    8  
ATOM 10622 C CB   . SER A 1 6   ? 10.196  5.832   -28.256 1.00 0.00 ? 789 SER A CB   8  
ATOM 10623 O OG   . SER A 1 6   ? 10.604  5.041   -29.359 1.00 0.00 ? 789 SER A OG   8  
ATOM 10624 H H    . SER A 1 6   ? 8.555   7.557   -26.977 1.00 0.00 ? 789 SER A H    8  
ATOM 10625 H HA   . SER A 1 6   ? 10.546  7.752   -29.136 1.00 0.00 ? 789 SER A HA   8  
ATOM 10626 H HB2  . SER A 1 6   ? 11.034  5.953   -27.586 1.00 0.00 ? 789 SER A HB2  8  
ATOM 10627 H HB3  . SER A 1 6   ? 9.393   5.325   -27.741 1.00 0.00 ? 789 SER A HB3  8  
ATOM 10628 H HG   . SER A 1 6   ? 11.470  5.328   -29.657 1.00 0.00 ? 789 SER A HG   8  
ATOM 10629 N N    . GLY A 1 7   ? 7.468   6.570   -29.377 1.00 0.00 ? 790 GLY A N    8  
ATOM 10630 C CA   . GLY A 1 7   ? 6.375   6.379   -30.313 1.00 0.00 ? 790 GLY A CA   8  
ATOM 10631 C C    . GLY A 1 7   ? 5.050   6.870   -29.765 1.00 0.00 ? 790 GLY A C    8  
ATOM 10632 O O    . GLY A 1 7   ? 4.593   7.960   -30.109 1.00 0.00 ? 790 GLY A O    8  
ATOM 10633 H H    . GLY A 1 7   ? 7.346   6.343   -28.432 1.00 0.00 ? 790 GLY A H    8  
ATOM 10634 H HA2  . GLY A 1 7   ? 6.598   6.916   -31.223 1.00 0.00 ? 790 GLY A HA2  8  
ATOM 10635 H HA3  . GLY A 1 7   ? 6.290   5.327   -30.539 1.00 0.00 ? 790 GLY A HA3  8  
ATOM 10636 N N    . VAL A 1 8   ? 4.430   6.063   -28.910 1.00 0.00 ? 791 VAL A N    8  
ATOM 10637 C CA   . VAL A 1 8   ? 3.149   6.421   -28.313 1.00 0.00 ? 791 VAL A CA   8  
ATOM 10638 C C    . VAL A 1 8   ? 3.310   6.787   -26.842 1.00 0.00 ? 791 VAL A C    8  
ATOM 10639 O O    . VAL A 1 8   ? 4.083   6.161   -26.117 1.00 0.00 ? 791 VAL A O    8  
ATOM 10640 C CB   . VAL A 1 8   ? 2.132   5.271   -28.436 1.00 0.00 ? 791 VAL A CB   8  
ATOM 10641 C CG1  . VAL A 1 8   ? 1.868   4.944   -29.898 1.00 0.00 ? 791 VAL A CG1  8  
ATOM 10642 C CG2  . VAL A 1 8   ? 2.625   4.042   -27.687 1.00 0.00 ? 791 VAL A CG2  8  
ATOM 10643 H H    . VAL A 1 8   ? 4.844   5.207   -28.674 1.00 0.00 ? 791 VAL A H    8  
ATOM 10644 H HA   . VAL A 1 8   ? 2.759   7.276   -28.846 1.00 0.00 ? 791 VAL A HA   8  
ATOM 10645 H HB   . VAL A 1 8   ? 1.202   5.590   -27.988 1.00 0.00 ? 791 VAL A HB   8  
ATOM 10646 H HG11 . VAL A 1 8   ? 1.369   3.989   -29.968 1.00 0.00 ? 791 VAL A HG11 8  
ATOM 10647 H HG12 . VAL A 1 8   ? 1.245   5.711   -30.332 1.00 0.00 ? 791 VAL A HG12 8  
ATOM 10648 H HG13 . VAL A 1 8   ? 2.807   4.898   -30.431 1.00 0.00 ? 791 VAL A HG13 8  
ATOM 10649 H HG21 . VAL A 1 8   ? 3.438   3.590   -28.234 1.00 0.00 ? 791 VAL A HG21 8  
ATOM 10650 H HG22 . VAL A 1 8   ? 2.969   4.333   -26.704 1.00 0.00 ? 791 VAL A HG22 8  
ATOM 10651 H HG23 . VAL A 1 8   ? 1.818   3.332   -27.588 1.00 0.00 ? 791 VAL A HG23 8  
ATOM 10652 N N    . PHE A 1 9   ? 2.576   7.806   -26.407 1.00 0.00 ? 792 PHE A N    8  
ATOM 10653 C CA   . PHE A 1 9   ? 2.638   8.256   -25.022 1.00 0.00 ? 792 PHE A CA   8  
ATOM 10654 C C    . PHE A 1 9   ? 2.120   7.178   -24.075 1.00 0.00 ? 792 PHE A C    8  
ATOM 10655 O O    . PHE A 1 9   ? 2.744   6.880   -23.056 1.00 0.00 ? 792 PHE A O    8  
ATOM 10656 C CB   . PHE A 1 9   ? 1.825   9.540   -24.844 1.00 0.00 ? 792 PHE A CB   8  
ATOM 10657 C CG   . PHE A 1 9   ? 2.148   10.600  -25.858 1.00 0.00 ? 792 PHE A CG   8  
ATOM 10658 C CD1  . PHE A 1 9   ? 3.249   11.425  -25.691 1.00 0.00 ? 792 PHE A CD1  8  
ATOM 10659 C CD2  . PHE A 1 9   ? 1.351   10.772  -26.978 1.00 0.00 ? 792 PHE A CD2  8  
ATOM 10660 C CE1  . PHE A 1 9   ? 3.550   12.401  -26.622 1.00 0.00 ? 792 PHE A CE1  8  
ATOM 10661 C CE2  . PHE A 1 9   ? 1.647   11.746  -27.913 1.00 0.00 ? 792 PHE A CE2  8  
ATOM 10662 C CZ   . PHE A 1 9   ? 2.747   12.562  -27.734 1.00 0.00 ? 792 PHE A CZ   8  
ATOM 10663 H H    . PHE A 1 9   ? 1.979   8.266   -27.034 1.00 0.00 ? 792 PHE A H    8  
ATOM 10664 H HA   . PHE A 1 9   ? 3.671   8.459   -24.786 1.00 0.00 ? 792 PHE A HA   8  
ATOM 10665 H HB2  . PHE A 1 9   ? 0.774   9.307   -24.932 1.00 0.00 ? 792 PHE A HB2  8  
ATOM 10666 H HB3  . PHE A 1 9   ? 2.019   9.947   -23.863 1.00 0.00 ? 792 PHE A HB3  8  
ATOM 10667 H HD1  . PHE A 1 9   ? 3.878   11.299  -24.820 1.00 0.00 ? 792 PHE A HD1  8  
ATOM 10668 H HD2  . PHE A 1 9   ? 0.490   10.135  -27.119 1.00 0.00 ? 792 PHE A HD2  8  
ATOM 10669 H HE1  . PHE A 1 9   ? 4.410   13.037  -26.479 1.00 0.00 ? 792 PHE A HE1  8  
ATOM 10670 H HE2  . PHE A 1 9   ? 1.017   11.870  -28.781 1.00 0.00 ? 792 PHE A HE2  8  
ATOM 10671 H HZ   . PHE A 1 9   ? 2.980   13.324  -28.463 1.00 0.00 ? 792 PHE A HZ   8  
ATOM 10672 N N    . ARG A 1 10  ? 0.976   6.596   -24.420 1.00 0.00 ? 793 ARG A N    8  
ATOM 10673 C CA   . ARG A 1 10  ? 0.373   5.552   -23.601 1.00 0.00 ? 793 ARG A CA   8  
ATOM 10674 C C    . ARG A 1 10  ? 1.354   4.407   -23.369 1.00 0.00 ? 793 ARG A C    8  
ATOM 10675 O O    . ARG A 1 10  ? 1.998   3.929   -24.304 1.00 0.00 ? 793 ARG A O    8  
ATOM 10676 C CB   . ARG A 1 10  ? -0.898  5.022   -24.267 1.00 0.00 ? 793 ARG A CB   8  
ATOM 10677 C CG   . ARG A 1 10  ? -2.099  5.939   -24.105 1.00 0.00 ? 793 ARG A CG   8  
ATOM 10678 C CD   . ARG A 1 10  ? -3.378  5.273   -24.588 1.00 0.00 ? 793 ARG A CD   8  
ATOM 10679 N NE   . ARG A 1 10  ? -4.562  6.068   -24.273 1.00 0.00 ? 793 ARG A NE   8  
ATOM 10680 C CZ   . ARG A 1 10  ? -5.791  5.738   -24.654 1.00 0.00 ? 793 ARG A CZ   8  
ATOM 10681 N NH1  . ARG A 1 10  ? -5.997  4.635   -25.360 1.00 0.00 ? 793 ARG A NH1  8  
ATOM 10682 N NH2  . ARG A 1 10  ? -6.818  6.513   -24.328 1.00 0.00 ? 793 ARG A NH2  8  
ATOM 10683 H H    . ARG A 1 10  ? 0.526   6.877   -25.244 1.00 0.00 ? 793 ARG A H    8  
ATOM 10684 H HA   . ARG A 1 10  ? 0.113   5.987   -22.647 1.00 0.00 ? 793 ARG A HA   8  
ATOM 10685 H HB2  . ARG A 1 10  ? -0.710  4.894   -25.323 1.00 0.00 ? 793 ARG A HB2  8  
ATOM 10686 H HB3  . ARG A 1 10  ? -1.144  4.063   -23.835 1.00 0.00 ? 793 ARG A HB3  8  
ATOM 10687 H HG2  . ARG A 1 10  ? -2.210  6.191   -23.061 1.00 0.00 ? 793 ARG A HG2  8  
ATOM 10688 H HG3  . ARG A 1 10  ? -1.933  6.839   -24.679 1.00 0.00 ? 793 ARG A HG3  8  
ATOM 10689 H HD2  . ARG A 1 10  ? -3.318  5.143   -25.659 1.00 0.00 ? 793 ARG A HD2  8  
ATOM 10690 H HD3  . ARG A 1 10  ? -3.466  4.307   -24.113 1.00 0.00 ? 793 ARG A HD3  8  
ATOM 10691 H HE   . ARG A 1 10  ? -4.433  6.887   -23.752 1.00 0.00 ? 793 ARG A HE   8  
ATOM 10692 H HH11 . ARG A 1 10  ? -5.225  4.049   -25.606 1.00 0.00 ? 793 ARG A HH11 8  
ATOM 10693 H HH12 . ARG A 1 10  ? -6.923  4.388   -25.644 1.00 0.00 ? 793 ARG A HH12 8  
ATOM 10694 H HH21 . ARG A 1 10  ? -6.667  7.345   -23.795 1.00 0.00 ? 793 ARG A HH21 8  
ATOM 10695 H HH22 . ARG A 1 10  ? -7.742  6.264   -24.615 1.00 0.00 ? 793 ARG A HH22 8  
ATOM 10696 N N    . TYR A 1 11  ? 1.464   3.972   -22.119 1.00 0.00 ? 794 TYR A N    8  
ATOM 10697 C CA   . TYR A 1 11  ? 2.370   2.886   -21.764 1.00 0.00 ? 794 TYR A CA   8  
ATOM 10698 C C    . TYR A 1 11  ? 1.606   1.723   -21.137 1.00 0.00 ? 794 TYR A C    8  
ATOM 10699 O O    . TYR A 1 11  ? 0.510   1.901   -20.606 1.00 0.00 ? 794 TYR A O    8  
ATOM 10700 C CB   . TYR A 1 11  ? 3.445   3.385   -20.798 1.00 0.00 ? 794 TYR A CB   8  
ATOM 10701 C CG   . TYR A 1 11  ? 4.202   4.592   -21.304 1.00 0.00 ? 794 TYR A CG   8  
ATOM 10702 C CD1  . TYR A 1 11  ? 5.015   4.505   -22.428 1.00 0.00 ? 794 TYR A CD1  8  
ATOM 10703 C CD2  . TYR A 1 11  ? 4.105   5.819   -20.659 1.00 0.00 ? 794 TYR A CD2  8  
ATOM 10704 C CE1  . TYR A 1 11  ? 5.709   5.605   -22.894 1.00 0.00 ? 794 TYR A CE1  8  
ATOM 10705 C CE2  . TYR A 1 11  ? 4.794   6.924   -21.120 1.00 0.00 ? 794 TYR A CE2  8  
ATOM 10706 C CZ   . TYR A 1 11  ? 5.595   6.812   -22.237 1.00 0.00 ? 794 TYR A CZ   8  
ATOM 10707 O OH   . TYR A 1 11  ? 6.284   7.910   -22.698 1.00 0.00 ? 794 TYR A OH   8  
ATOM 10708 H H    . TYR A 1 11  ? 0.925   4.393   -21.417 1.00 0.00 ? 794 TYR A H    8  
ATOM 10709 H HA   . TYR A 1 11  ? 2.846   2.542   -22.671 1.00 0.00 ? 794 TYR A HA   8  
ATOM 10710 H HB2  . TYR A 1 11  ? 2.981   3.655   -19.861 1.00 0.00 ? 794 TYR A HB2  8  
ATOM 10711 H HB3  . TYR A 1 11  ? 4.159   2.594   -20.625 1.00 0.00 ? 794 TYR A HB3  8  
ATOM 10712 H HD1  . TYR A 1 11  ? 5.102   3.558   -22.940 1.00 0.00 ? 794 TYR A HD1  8  
ATOM 10713 H HD2  . TYR A 1 11  ? 3.477   5.903   -19.784 1.00 0.00 ? 794 TYR A HD2  8  
ATOM 10714 H HE1  . TYR A 1 11  ? 6.336   5.518   -23.769 1.00 0.00 ? 794 TYR A HE1  8  
ATOM 10715 H HE2  . TYR A 1 11  ? 4.705   7.869   -20.605 1.00 0.00 ? 794 TYR A HE2  8  
ATOM 10716 H HH   . TYR A 1 11  ? 6.228   7.944   -23.656 1.00 0.00 ? 794 TYR A HH   8  
ATOM 10717 N N    . SER A 1 12  ? 2.195   0.533   -21.203 1.00 0.00 ? 795 SER A N    8  
ATOM 10718 C CA   . SER A 1 12  ? 1.570   -0.660  -20.645 1.00 0.00 ? 795 SER A CA   8  
ATOM 10719 C C    . SER A 1 12  ? 2.470   -1.303  -19.594 1.00 0.00 ? 795 SER A C    8  
ATOM 10720 O O    . SER A 1 12  ? 3.506   -1.885  -19.918 1.00 0.00 ? 795 SER A O    8  
ATOM 10721 C CB   . SER A 1 12  ? 1.263   -1.667  -21.755 1.00 0.00 ? 795 SER A CB   8  
ATOM 10722 O OG   . SER A 1 12  ? 0.479   -1.076  -22.777 1.00 0.00 ? 795 SER A OG   8  
ATOM 10723 H H    . SER A 1 12  ? 3.069   0.456   -21.640 1.00 0.00 ? 795 SER A H    8  
ATOM 10724 H HA   . SER A 1 12  ? 0.645   -0.361  -20.175 1.00 0.00 ? 795 SER A HA   8  
ATOM 10725 H HB2  . SER A 1 12  ? 2.188   -2.018  -22.186 1.00 0.00 ? 795 SER A HB2  8  
ATOM 10726 H HB3  . SER A 1 12  ? 0.720   -2.503  -21.339 1.00 0.00 ? 795 SER A HB3  8  
ATOM 10727 H HG   . SER A 1 12  ? 0.323   -1.718  -23.473 1.00 0.00 ? 795 SER A HG   8  
ATOM 10728 N N    . THR A 1 13  ? 2.066   -1.195  -18.332 1.00 0.00 ? 796 THR A N    8  
ATOM 10729 C CA   . THR A 1 13  ? 2.835   -1.764  -17.232 1.00 0.00 ? 796 THR A CA   8  
ATOM 10730 C C    . THR A 1 13  ? 2.157   -3.012  -16.676 1.00 0.00 ? 796 THR A C    8  
ATOM 10731 O O    . THR A 1 13  ? 1.204   -2.920  -15.903 1.00 0.00 ? 796 THR A O    8  
ATOM 10732 C CB   . THR A 1 13  ? 3.024   -0.745  -16.093 1.00 0.00 ? 796 THR A CB   8  
ATOM 10733 O OG1  . THR A 1 13  ? 3.516   0.492   -16.619 1.00 0.00 ? 796 THR A OG1  8  
ATOM 10734 C CG2  . THR A 1 13  ? 3.990   -1.278  -15.046 1.00 0.00 ? 796 THR A CG2  8  
ATOM 10735 H H    . THR A 1 13  ? 1.231   -0.720  -18.137 1.00 0.00 ? 796 THR A H    8  
ATOM 10736 H HA   . THR A 1 13  ? 3.810   -2.034  -17.611 1.00 0.00 ? 796 THR A HA   8  
ATOM 10737 H HB   . THR A 1 13  ? 2.066   -0.572  -15.622 1.00 0.00 ? 796 THR A HB   8  
ATOM 10738 H HG1  . THR A 1 13  ? 3.123   0.653   -17.480 1.00 0.00 ? 796 THR A HG1  8  
ATOM 10739 H HG21 . THR A 1 13  ? 4.385   -2.229  -15.371 1.00 0.00 ? 796 THR A HG21 8  
ATOM 10740 H HG22 . THR A 1 13  ? 3.471   -1.405  -14.108 1.00 0.00 ? 796 THR A HG22 8  
ATOM 10741 H HG23 . THR A 1 13  ? 4.801   -0.577  -14.916 1.00 0.00 ? 796 THR A HG23 8  
ATOM 10742 N N    . SER A 1 14  ? 2.657   -4.178  -17.073 1.00 0.00 ? 797 SER A N    8  
ATOM 10743 C CA   . SER A 1 14  ? 2.098   -5.444  -16.616 1.00 0.00 ? 797 SER A CA   8  
ATOM 10744 C C    . SER A 1 14  ? 2.249   -5.591  -15.105 1.00 0.00 ? 797 SER A C    8  
ATOM 10745 O O    . SER A 1 14  ? 1.375   -6.141  -14.433 1.00 0.00 ? 797 SER A O    8  
ATOM 10746 C CB   . SER A 1 14  ? 2.783   -6.614  -17.325 1.00 0.00 ? 797 SER A CB   8  
ATOM 10747 O OG   . SER A 1 14  ? 1.965   -7.771  -17.310 1.00 0.00 ? 797 SER A OG   8  
ATOM 10748 H H    . SER A 1 14  ? 3.418   -4.186  -17.691 1.00 0.00 ? 797 SER A H    8  
ATOM 10749 H HA   . SER A 1 14  ? 1.047   -5.451  -16.864 1.00 0.00 ? 797 SER A HA   8  
ATOM 10750 H HB2  . SER A 1 14  ? 2.984   -6.343  -18.350 1.00 0.00 ? 797 SER A HB2  8  
ATOM 10751 H HB3  . SER A 1 14  ? 3.714   -6.839  -16.824 1.00 0.00 ? 797 SER A HB3  8  
ATOM 10752 H HG   . SER A 1 14  ? 1.042   -7.509  -17.267 1.00 0.00 ? 797 SER A HG   8  
ATOM 10753 N N    . LEU A 1 15  ? 3.363   -5.097  -14.578 1.00 0.00 ? 798 LEU A N    8  
ATOM 10754 C CA   . LEU A 1 15  ? 3.631   -5.172  -13.146 1.00 0.00 ? 798 LEU A CA   8  
ATOM 10755 C C    . LEU A 1 15  ? 2.605   -4.365  -12.357 1.00 0.00 ? 798 LEU A C    8  
ATOM 10756 O O    . LEU A 1 15  ? 2.081   -3.364  -12.845 1.00 0.00 ? 798 LEU A O    8  
ATOM 10757 C CB   . LEU A 1 15  ? 5.040   -4.661  -12.843 1.00 0.00 ? 798 LEU A CB   8  
ATOM 10758 C CG   . LEU A 1 15  ? 6.154   -5.709  -12.869 1.00 0.00 ? 798 LEU A CG   8  
ATOM 10759 C CD1  . LEU A 1 15  ? 6.332   -6.333  -11.494 1.00 0.00 ? 798 LEU A CD1  8  
ATOM 10760 C CD2  . LEU A 1 15  ? 5.855   -6.779  -13.909 1.00 0.00 ? 798 LEU A CD2  8  
ATOM 10761 H H    . LEU A 1 15  ? 4.022   -4.671  -15.164 1.00 0.00 ? 798 LEU A H    8  
ATOM 10762 H HA   . LEU A 1 15  ? 3.561   -6.208  -12.850 1.00 0.00 ? 798 LEU A HA   8  
ATOM 10763 H HB2  . LEU A 1 15  ? 5.281   -3.904  -13.573 1.00 0.00 ? 798 LEU A HB2  8  
ATOM 10764 H HB3  . LEU A 1 15  ? 5.026   -4.217  -11.857 1.00 0.00 ? 798 LEU A HB3  8  
ATOM 10765 H HG   . LEU A 1 15  ? 7.085   -5.229  -13.140 1.00 0.00 ? 798 LEU A HG   8  
ATOM 10766 H HD11 . LEU A 1 15  ? 6.891   -7.252  -11.586 1.00 0.00 ? 798 LEU A HD11 8  
ATOM 10767 H HD12 . LEU A 1 15  ? 5.363   -6.542  -11.066 1.00 0.00 ? 798 LEU A HD12 8  
ATOM 10768 H HD13 . LEU A 1 15  ? 6.868   -5.648  -10.854 1.00 0.00 ? 798 LEU A HD13 8  
ATOM 10769 H HD21 . LEU A 1 15  ? 5.472   -6.313  -14.805 1.00 0.00 ? 798 LEU A HD21 8  
ATOM 10770 H HD22 . LEU A 1 15  ? 5.118   -7.465  -13.517 1.00 0.00 ? 798 LEU A HD22 8  
ATOM 10771 H HD23 . LEU A 1 15  ? 6.761   -7.318  -14.142 1.00 0.00 ? 798 LEU A HD23 8  
ATOM 10772 N N    . GLU A 1 16  ? 2.324   -4.807  -11.135 1.00 0.00 ? 799 GLU A N    8  
ATOM 10773 C CA   . GLU A 1 16  ? 1.362   -4.124  -10.279 1.00 0.00 ? 799 GLU A CA   8  
ATOM 10774 C C    . GLU A 1 16  ? 2.032   -3.000  -9.495  1.00 0.00 ? 799 GLU A C    8  
ATOM 10775 O O    . GLU A 1 16  ? 2.627   -3.230  -8.442  1.00 0.00 ? 799 GLU A O    8  
ATOM 10776 C CB   . GLU A 1 16  ? 0.711   -5.117  -9.312  1.00 0.00 ? 799 GLU A CB   8  
ATOM 10777 C CG   . GLU A 1 16  ? 0.132   -6.343  -9.998  1.00 0.00 ? 799 GLU A CG   8  
ATOM 10778 C CD   . GLU A 1 16  ? -0.814  -7.119  -9.102  1.00 0.00 ? 799 GLU A CD   8  
ATOM 10779 O OE1  . GLU A 1 16  ? -1.733  -6.498  -8.529  1.00 0.00 ? 799 GLU A OE1  8  
ATOM 10780 O OE2  . GLU A 1 16  ? -0.635  -8.349  -8.975  1.00 0.00 ? 799 GLU A OE2  8  
ATOM 10781 H H    . GLU A 1 16  ? 2.775   -5.611  -10.802 1.00 0.00 ? 799 GLU A H    8  
ATOM 10782 H HA   . GLU A 1 16  ? 0.598   -3.699  -10.912 1.00 0.00 ? 799 GLU A HA   8  
ATOM 10783 H HB2  . GLU A 1 16  ? 1.453   -5.445  -8.599  1.00 0.00 ? 799 GLU A HB2  8  
ATOM 10784 H HB3  . GLU A 1 16  ? -0.086  -4.615  -8.784  1.00 0.00 ? 799 GLU A HB3  8  
ATOM 10785 H HG2  . GLU A 1 16  ? -0.408  -6.026  -10.877 1.00 0.00 ? 799 GLU A HG2  8  
ATOM 10786 H HG3  . GLU A 1 16  ? 0.943   -6.993  -10.290 1.00 0.00 ? 799 GLU A HG3  8  
ATOM 10787 N N    . LYS A 1 17  ? 1.933   -1.782  -10.016 1.00 0.00 ? 800 LYS A N    8  
ATOM 10788 C CA   . LYS A 1 17  ? 2.528   -0.620  -9.367  1.00 0.00 ? 800 LYS A CA   8  
ATOM 10789 C C    . LYS A 1 17  ? 1.476   0.170   -8.595  1.00 0.00 ? 800 LYS A C    8  
ATOM 10790 O O    . LYS A 1 17  ? 1.706   0.582   -7.457  1.00 0.00 ? 800 LYS A O    8  
ATOM 10791 C CB   . LYS A 1 17  ? 3.198   0.283   -10.406 1.00 0.00 ? 800 LYS A CB   8  
ATOM 10792 C CG   . LYS A 1 17  ? 3.237   1.747   -10.004 1.00 0.00 ? 800 LYS A CG   8  
ATOM 10793 C CD   . LYS A 1 17  ? 4.291   2.512   -10.787 1.00 0.00 ? 800 LYS A CD   8  
ATOM 10794 C CE   . LYS A 1 17  ? 5.681   2.297   -10.208 1.00 0.00 ? 800 LYS A CE   8  
ATOM 10795 N NZ   . LYS A 1 17  ? 6.363   1.125   -10.823 1.00 0.00 ? 800 LYS A NZ   8  
ATOM 10796 H H    . LYS A 1 17  ? 1.445   -1.661  -10.859 1.00 0.00 ? 800 LYS A H    8  
ATOM 10797 H HA   . LYS A 1 17  ? 3.276   -0.974  -8.675  1.00 0.00 ? 800 LYS A HA   8  
ATOM 10798 H HB2  . LYS A 1 17  ? 4.212   -0.055  -10.558 1.00 0.00 ? 800 LYS A HB2  8  
ATOM 10799 H HB3  . LYS A 1 17  ? 2.657   0.201   -11.338 1.00 0.00 ? 800 LYS A HB3  8  
ATOM 10800 H HG2  . LYS A 1 17  ? 2.271   2.190   -10.195 1.00 0.00 ? 800 LYS A HG2  8  
ATOM 10801 H HG3  . LYS A 1 17  ? 3.465   1.815   -8.950  1.00 0.00 ? 800 LYS A HG3  8  
ATOM 10802 H HD2  . LYS A 1 17  ? 4.284   2.171   -11.812 1.00 0.00 ? 800 LYS A HD2  8  
ATOM 10803 H HD3  . LYS A 1 17  ? 4.056   3.566   -10.755 1.00 0.00 ? 800 LYS A HD3  8  
ATOM 10804 H HE2  . LYS A 1 17  ? 6.272   3.182   -10.387 1.00 0.00 ? 800 LYS A HE2  8  
ATOM 10805 H HE3  . LYS A 1 17  ? 5.592   2.133   -9.144  1.00 0.00 ? 800 LYS A HE3  8  
ATOM 10806 H HZ1  . LYS A 1 17  ? 7.391   1.285   -10.853 1.00 0.00 ? 800 LYS A HZ1  8  
ATOM 10807 H HZ2  . LYS A 1 17  ? 6.019   0.979   -11.793 1.00 0.00 ? 800 LYS A HZ2  8  
ATOM 10808 H HZ3  . LYS A 1 17  ? 6.173   0.268   -10.267 1.00 0.00 ? 800 LYS A HZ3  8  
ATOM 10809 N N    . HIS A 1 18  ? 0.321   0.377   -9.219  1.00 0.00 ? 801 HIS A N    8  
ATOM 10810 C CA   . HIS A 1 18  ? -0.767  1.116   -8.589  1.00 0.00 ? 801 HIS A CA   8  
ATOM 10811 C C    . HIS A 1 18  ? -0.869  0.773   -7.106  1.00 0.00 ? 801 HIS A C    8  
ATOM 10812 O O    . HIS A 1 18  ? -0.868  1.659   -6.251  1.00 0.00 ? 801 HIS A O    8  
ATOM 10813 C CB   . HIS A 1 18  ? -2.092  0.810   -9.287  1.00 0.00 ? 801 HIS A CB   8  
ATOM 10814 C CG   . HIS A 1 18  ? -2.520  -0.620  -9.160  1.00 0.00 ? 801 HIS A CG   8  
ATOM 10815 N ND1  . HIS A 1 18  ? -1.897  -1.654  -9.827  1.00 0.00 ? 801 HIS A ND1  8  
ATOM 10816 C CD2  . HIS A 1 18  ? -3.513  -1.186  -8.435  1.00 0.00 ? 801 HIS A CD2  8  
ATOM 10817 C CE1  . HIS A 1 18  ? -2.491  -2.794  -9.519  1.00 0.00 ? 801 HIS A CE1  8  
ATOM 10818 N NE2  . HIS A 1 18  ? -3.474  -2.537  -8.676  1.00 0.00 ? 801 HIS A NE2  8  
ATOM 10819 H H    . HIS A 1 18  ? 0.198   0.024   -10.125 1.00 0.00 ? 801 HIS A H    8  
ATOM 10820 H HA   . HIS A 1 18  ? -0.553  2.170   -8.688  1.00 0.00 ? 801 HIS A HA   8  
ATOM 10821 H HB2  . HIS A 1 18  ? -2.868  1.427   -8.860  1.00 0.00 ? 801 HIS A HB2  8  
ATOM 10822 H HB3  . HIS A 1 18  ? -1.998  1.036   -10.340 1.00 0.00 ? 801 HIS A HB3  8  
ATOM 10823 H HD2  . HIS A 1 18  ? -4.209  -0.670  -7.788  1.00 0.00 ? 801 HIS A HD2  8  
ATOM 10824 H HE1  . HIS A 1 18  ? -2.218  -3.769  -9.893  1.00 0.00 ? 801 HIS A HE1  8  
ATOM 10825 H HE2  . HIS A 1 18  ? -4.128  -3.193  -8.356  1.00 0.00 ? 801 HIS A HE2  8  
ATOM 10826 N N    . LYS A 1 19  ? -0.958  -0.519  -6.807  1.00 0.00 ? 802 LYS A N    8  
ATOM 10827 C CA   . LYS A 1 19  ? -1.060  -0.980  -5.428  1.00 0.00 ? 802 LYS A CA   8  
ATOM 10828 C C    . LYS A 1 19  ? -0.037  -0.277  -4.541  1.00 0.00 ? 802 LYS A C    8  
ATOM 10829 O O    . LYS A 1 19  ? 0.958   0.259   -5.030  1.00 0.00 ? 802 LYS A O    8  
ATOM 10830 C CB   . LYS A 1 19  ? -0.855  -2.495  -5.359  1.00 0.00 ? 802 LYS A CB   8  
ATOM 10831 C CG   . LYS A 1 19  ? -1.973  -3.291  -6.009  1.00 0.00 ? 802 LYS A CG   8  
ATOM 10832 C CD   . LYS A 1 19  ? -1.868  -4.771  -5.682  1.00 0.00 ? 802 LYS A CD   8  
ATOM 10833 C CE   . LYS A 1 19  ? -3.217  -5.465  -5.795  1.00 0.00 ? 802 LYS A CE   8  
ATOM 10834 N NZ   . LYS A 1 19  ? -3.253  -6.738  -5.024  1.00 0.00 ? 802 LYS A NZ   8  
ATOM 10835 H H    . LYS A 1 19  ? -0.954  -1.178  -7.533  1.00 0.00 ? 802 LYS A H    8  
ATOM 10836 H HA   . LYS A 1 19  ? -2.051  -0.744  -5.071  1.00 0.00 ? 802 LYS A HA   8  
ATOM 10837 H HB2  . LYS A 1 19  ? 0.071   -2.744  -5.855  1.00 0.00 ? 802 LYS A HB2  8  
ATOM 10838 H HB3  . LYS A 1 19  ? -0.788  -2.791  -4.322  1.00 0.00 ? 802 LYS A HB3  8  
ATOM 10839 H HG2  . LYS A 1 19  ? -2.922  -2.921  -5.651  1.00 0.00 ? 802 LYS A HG2  8  
ATOM 10840 H HG3  . LYS A 1 19  ? -1.917  -3.164  -7.081  1.00 0.00 ? 802 LYS A HG3  8  
ATOM 10841 H HD2  . LYS A 1 19  ? -1.179  -5.235  -6.372  1.00 0.00 ? 802 LYS A HD2  8  
ATOM 10842 H HD3  . LYS A 1 19  ? -1.499  -4.882  -4.673  1.00 0.00 ? 802 LYS A HD3  8  
ATOM 10843 H HE2  . LYS A 1 19  ? -3.980  -4.802  -5.416  1.00 0.00 ? 802 LYS A HE2  8  
ATOM 10844 H HE3  . LYS A 1 19  ? -3.411  -5.679  -6.836  1.00 0.00 ? 802 LYS A HE3  8  
ATOM 10845 H HZ1  . LYS A 1 19  ? -2.321  -6.925  -4.601  1.00 0.00 ? 802 LYS A HZ1  8  
ATOM 10846 H HZ2  . LYS A 1 19  ? -3.501  -7.529  -5.651  1.00 0.00 ? 802 LYS A HZ2  8  
ATOM 10847 H HZ3  . LYS A 1 19  ? -3.960  -6.676  -4.264  1.00 0.00 ? 802 LYS A HZ3  8  
ATOM 10848 N N    . LEU A 1 20  ? -0.288  -0.284  -3.237  1.00 0.00 ? 803 LEU A N    8  
ATOM 10849 C CA   . LEU A 1 20  ? 0.612   0.352   -2.281  1.00 0.00 ? 803 LEU A CA   8  
ATOM 10850 C C    . LEU A 1 20  ? 0.788   -0.515  -1.039  1.00 0.00 ? 803 LEU A C    8  
ATOM 10851 O O    . LEU A 1 20  ? -0.056  -1.357  -0.732  1.00 0.00 ? 803 LEU A O    8  
ATOM 10852 C CB   . LEU A 1 20  ? 0.077   1.729   -1.885  1.00 0.00 ? 803 LEU A CB   8  
ATOM 10853 C CG   . LEU A 1 20  ? -0.534  2.562   -3.013  1.00 0.00 ? 803 LEU A CG   8  
ATOM 10854 C CD1  . LEU A 1 20  ? -1.414  3.664   -2.445  1.00 0.00 ? 803 LEU A CD1  8  
ATOM 10855 C CD2  . LEU A 1 20  ? 0.559   3.150   -3.894  1.00 0.00 ? 803 LEU A CD2  8  
ATOM 10856 H H    . LEU A 1 20  ? -1.097  -0.727  -2.907  1.00 0.00 ? 803 LEU A H    8  
ATOM 10857 H HA   . LEU A 1 20  ? 1.572   0.472   -2.761  1.00 0.00 ? 803 LEU A HA   8  
ATOM 10858 H HB2  . LEU A 1 20  ? -0.683  1.584   -1.132  1.00 0.00 ? 803 LEU A HB2  8  
ATOM 10859 H HB3  . LEU A 1 20  ? 0.897   2.293   -1.463  1.00 0.00 ? 803 LEU A HB3  8  
ATOM 10860 H HG   . LEU A 1 20  ? -1.153  1.924   -3.628  1.00 0.00 ? 803 LEU A HG   8  
ATOM 10861 H HD11 . LEU A 1 20  ? -2.395  3.267   -2.230  1.00 0.00 ? 803 LEU A HD11 8  
ATOM 10862 H HD12 . LEU A 1 20  ? -1.501  4.463   -3.167  1.00 0.00 ? 803 LEU A HD12 8  
ATOM 10863 H HD13 . LEU A 1 20  ? -0.972  4.047   -1.537  1.00 0.00 ? 803 LEU A HD13 8  
ATOM 10864 H HD21 . LEU A 1 20  ? 0.544   2.663   -4.858  1.00 0.00 ? 803 LEU A HD21 8  
ATOM 10865 H HD22 . LEU A 1 20  ? 1.521   2.994   -3.426  1.00 0.00 ? 803 LEU A HD22 8  
ATOM 10866 H HD23 . LEU A 1 20  ? 0.388   4.208   -4.021  1.00 0.00 ? 803 LEU A HD23 8  
ATOM 10867 N N    . PHE A 1 21  ? 1.889   -0.301  -0.325  1.00 0.00 ? 804 PHE A N    8  
ATOM 10868 C CA   . PHE A 1 21  ? 2.175   -1.062  0.885   1.00 0.00 ? 804 PHE A CA   8  
ATOM 10869 C C    . PHE A 1 21  ? 2.592   -0.135  2.024   1.00 0.00 ? 804 PHE A C    8  
ATOM 10870 O O    . PHE A 1 21  ? 3.387   0.785   1.830   1.00 0.00 ? 804 PHE A O    8  
ATOM 10871 C CB   . PHE A 1 21  ? 3.278   -2.089  0.619   1.00 0.00 ? 804 PHE A CB   8  
ATOM 10872 C CG   . PHE A 1 21  ? 3.940   -2.594  1.868   1.00 0.00 ? 804 PHE A CG   8  
ATOM 10873 C CD1  . PHE A 1 21  ? 4.821   -1.791  2.575   1.00 0.00 ? 804 PHE A CD1  8  
ATOM 10874 C CD2  . PHE A 1 21  ? 3.682   -3.872  2.336   1.00 0.00 ? 804 PHE A CD2  8  
ATOM 10875 C CE1  . PHE A 1 21  ? 5.433   -2.255  3.724   1.00 0.00 ? 804 PHE A CE1  8  
ATOM 10876 C CE2  . PHE A 1 21  ? 4.291   -4.341  3.486   1.00 0.00 ? 804 PHE A CE2  8  
ATOM 10877 C CZ   . PHE A 1 21  ? 5.166   -3.531  4.181   1.00 0.00 ? 804 PHE A CZ   8  
ATOM 10878 H H    . PHE A 1 21  ? 2.524   0.385   -0.621  1.00 0.00 ? 804 PHE A H    8  
ATOM 10879 H HA   . PHE A 1 21  ? 1.273   -1.581  1.171   1.00 0.00 ? 804 PHE A HA   8  
ATOM 10880 H HB2  . PHE A 1 21  ? 2.853   -2.936  0.103   1.00 0.00 ? 804 PHE A HB2  8  
ATOM 10881 H HB3  . PHE A 1 21  ? 4.037   -1.637  -0.002  1.00 0.00 ? 804 PHE A HB3  8  
ATOM 10882 H HD1  . PHE A 1 21  ? 5.030   -0.793  2.220   1.00 0.00 ? 804 PHE A HD1  8  
ATOM 10883 H HD2  . PHE A 1 21  ? 2.997   -4.508  1.793   1.00 0.00 ? 804 PHE A HD2  8  
ATOM 10884 H HE1  . PHE A 1 21  ? 6.117   -1.619  4.266   1.00 0.00 ? 804 PHE A HE1  8  
ATOM 10885 H HE2  . PHE A 1 21  ? 4.080   -5.339  3.840   1.00 0.00 ? 804 PHE A HE2  8  
ATOM 10886 H HZ   . PHE A 1 21  ? 5.643   -3.895  5.079   1.00 0.00 ? 804 PHE A HZ   8  
ATOM 10887 N N    . ILE A 1 22  ? 2.048   -0.385  3.210   1.00 0.00 ? 805 ILE A N    8  
ATOM 10888 C CA   . ILE A 1 22  ? 2.364   0.425   4.380   1.00 0.00 ? 805 ILE A CA   8  
ATOM 10889 C C    . ILE A 1 22  ? 2.746   -0.450  5.569   1.00 0.00 ? 805 ILE A C    8  
ATOM 10890 O O    . ILE A 1 22  ? 2.061   -1.424  5.882   1.00 0.00 ? 805 ILE A O    8  
ATOM 10891 C CB   . ILE A 1 22  ? 1.177   1.323   4.779   1.00 0.00 ? 805 ILE A CB   8  
ATOM 10892 C CG1  . ILE A 1 22  ? 0.577   1.992   3.541   1.00 0.00 ? 805 ILE A CG1  8  
ATOM 10893 C CG2  . ILE A 1 22  ? 1.622   2.370   5.790   1.00 0.00 ? 805 ILE A CG2  8  
ATOM 10894 C CD1  . ILE A 1 22  ? -0.451  3.053   3.866   1.00 0.00 ? 805 ILE A CD1  8  
ATOM 10895 H H    . ILE A 1 22  ? 1.422   -1.133  3.302   1.00 0.00 ? 805 ILE A H    8  
ATOM 10896 H HA   . ILE A 1 22  ? 3.201   1.060   4.130   1.00 0.00 ? 805 ILE A HA   8  
ATOM 10897 H HB   . ILE A 1 22  ? 0.427   0.704   5.245   1.00 0.00 ? 805 ILE A HB   8  
ATOM 10898 H HG12 . ILE A 1 22  ? 1.366   2.458   2.973   1.00 0.00 ? 805 ILE A HG12 8  
ATOM 10899 H HG13 . ILE A 1 22  ? 0.097   1.239   2.932   1.00 0.00 ? 805 ILE A HG13 8  
ATOM 10900 H HG21 . ILE A 1 22  ? 0.769   2.957   6.098   1.00 0.00 ? 805 ILE A HG21 8  
ATOM 10901 H HG22 . ILE A 1 22  ? 2.049   1.879   6.651   1.00 0.00 ? 805 ILE A HG22 8  
ATOM 10902 H HG23 . ILE A 1 22  ? 2.360   3.015   5.339   1.00 0.00 ? 805 ILE A HG23 8  
ATOM 10903 H HD11 . ILE A 1 22  ? -1.163  2.660   4.576   1.00 0.00 ? 805 ILE A HD11 8  
ATOM 10904 H HD12 . ILE A 1 22  ? 0.042   3.915   4.289   1.00 0.00 ? 805 ILE A HD12 8  
ATOM 10905 H HD13 . ILE A 1 22  ? -0.968  3.342   2.962   1.00 0.00 ? 805 ILE A HD13 8  
ATOM 10906 N N    . SER A 1 23  ? 3.844   -0.095  6.229   1.00 0.00 ? 806 SER A N    8  
ATOM 10907 C CA   . SER A 1 23  ? 4.320   -0.850  7.383   1.00 0.00 ? 806 SER A CA   8  
ATOM 10908 C C    . SER A 1 23  ? 4.566   0.074   8.571   1.00 0.00 ? 806 SER A C    8  
ATOM 10909 O O    . SER A 1 23  ? 4.875   1.253   8.402   1.00 0.00 ? 806 SER A O    8  
ATOM 10910 C CB   . SER A 1 23  ? 5.604   -1.603  7.032   1.00 0.00 ? 806 SER A CB   8  
ATOM 10911 O OG   . SER A 1 23  ? 6.656   -0.703  6.729   1.00 0.00 ? 806 SER A OG   8  
ATOM 10912 H H    . SER A 1 23  ? 4.347   0.691   5.931   1.00 0.00 ? 806 SER A H    8  
ATOM 10913 H HA   . SER A 1 23  ? 3.555   -1.564  7.649   1.00 0.00 ? 806 SER A HA   8  
ATOM 10914 H HB2  . SER A 1 23  ? 5.900   -2.214  7.871   1.00 0.00 ? 806 SER A HB2  8  
ATOM 10915 H HB3  . SER A 1 23  ? 5.426   -2.232  6.172   1.00 0.00 ? 806 SER A HB3  8  
ATOM 10916 H HG   . SER A 1 23  ? 6.549   0.100   7.244   1.00 0.00 ? 806 SER A HG   8  
ATOM 10917 N N    . GLY A 1 24  ? 4.427   -0.472  9.776   1.00 0.00 ? 807 GLY A N    8  
ATOM 10918 C CA   . GLY A 1 24  ? 4.638   0.317   10.976  1.00 0.00 ? 807 GLY A CA   8  
ATOM 10919 C C    . GLY A 1 24  ? 3.380   1.031   11.429  1.00 0.00 ? 807 GLY A C    8  
ATOM 10920 O O    . GLY A 1 24  ? 3.439   2.164   11.909  1.00 0.00 ? 807 GLY A O    8  
ATOM 10921 H H    . GLY A 1 24  ? 4.179   -1.417  9.850   1.00 0.00 ? 807 GLY A H    8  
ATOM 10922 H HA2  . GLY A 1 24  ? 4.973   -0.336  11.768  1.00 0.00 ? 807 GLY A HA2  8  
ATOM 10923 H HA3  . GLY A 1 24  ? 5.405   1.052   10.780  1.00 0.00 ? 807 GLY A HA3  8  
ATOM 10924 N N    . LEU A 1 25  ? 2.238   0.370   11.276  1.00 0.00 ? 808 LEU A N    8  
ATOM 10925 C CA   . LEU A 1 25  ? 0.959   0.950   11.671  1.00 0.00 ? 808 LEU A CA   8  
ATOM 10926 C C    . LEU A 1 25  ? 0.545   0.463   13.056  1.00 0.00 ? 808 LEU A C    8  
ATOM 10927 O O    . LEU A 1 25  ? 0.772   -0.688  13.429  1.00 0.00 ? 808 LEU A O    8  
ATOM 10928 C CB   . LEU A 1 25  ? -0.122  0.595   10.649  1.00 0.00 ? 808 LEU A CB   8  
ATOM 10929 C CG   . LEU A 1 25  ? -0.131  1.427   9.365   1.00 0.00 ? 808 LEU A CG   8  
ATOM 10930 C CD1  . LEU A 1 25  ? -0.947  0.733   8.286   1.00 0.00 ? 808 LEU A CD1  8  
ATOM 10931 C CD2  . LEU A 1 25  ? -0.678  2.820   9.637   1.00 0.00 ? 808 LEU A CD2  8  
ATOM 10932 H H    . LEU A 1 25  ? 2.254   -0.529  10.888  1.00 0.00 ? 808 LEU A H    8  
ATOM 10933 H HA   . LEU A 1 25  ? 1.077   2.023   11.700  1.00 0.00 ? 808 LEU A HA   8  
ATOM 10934 H HB2  . LEU A 1 25  ? 0.012   -0.439  10.371  1.00 0.00 ? 808 LEU A HB2  8  
ATOM 10935 H HB3  . LEU A 1 25  ? -1.082  0.715   11.129  1.00 0.00 ? 808 LEU A HB3  8  
ATOM 10936 H HG   . LEU A 1 25  ? 0.882   1.529   9.003   1.00 0.00 ? 808 LEU A HG   8  
ATOM 10937 H HD11 . LEU A 1 25  ? -0.785  1.226   7.339   1.00 0.00 ? 808 LEU A HD11 8  
ATOM 10938 H HD12 . LEU A 1 25  ? -1.995  0.779   8.541   1.00 0.00 ? 808 LEU A HD12 8  
ATOM 10939 H HD13 . LEU A 1 25  ? -0.641  -0.300  8.211   1.00 0.00 ? 808 LEU A HD13 8  
ATOM 10940 H HD21 . LEU A 1 25  ? -0.302  3.176   10.585  1.00 0.00 ? 808 LEU A HD21 8  
ATOM 10941 H HD22 . LEU A 1 25  ? -1.758  2.783   9.670   1.00 0.00 ? 808 LEU A HD22 8  
ATOM 10942 H HD23 . LEU A 1 25  ? -0.364  3.490   8.851   1.00 0.00 ? 808 LEU A HD23 8  
ATOM 10943 N N    . PRO A 1 26  ? -0.078  1.358   13.836  1.00 0.00 ? 809 PRO A N    8  
ATOM 10944 C CA   . PRO A 1 26  ? -0.540  1.041   15.191  1.00 0.00 ? 809 PRO A CA   8  
ATOM 10945 C C    . PRO A 1 26  ? -1.719  0.074   15.191  1.00 0.00 ? 809 PRO A C    8  
ATOM 10946 O O    . PRO A 1 26  ? -2.742  0.327   14.554  1.00 0.00 ? 809 PRO A O    8  
ATOM 10947 C CB   . PRO A 1 26  ? -0.965  2.402   15.748  1.00 0.00 ? 809 PRO A CB   8  
ATOM 10948 C CG   . PRO A 1 26  ? -1.306  3.213   14.546  1.00 0.00 ? 809 PRO A CG   8  
ATOM 10949 C CD   . PRO A 1 26  ? -0.381  2.748   13.456  1.00 0.00 ? 809 PRO A CD   8  
ATOM 10950 H HA   . PRO A 1 26  ? 0.257   0.635   15.797  1.00 0.00 ? 809 PRO A HA   8  
ATOM 10951 H HB2  . PRO A 1 26  ? -1.820  2.277   16.397  1.00 0.00 ? 809 PRO A HB2  8  
ATOM 10952 H HB3  . PRO A 1 26  ? -0.147  2.840   16.301  1.00 0.00 ? 809 PRO A HB3  8  
ATOM 10953 H HG2  . PRO A 1 26  ? -2.334  3.040   14.266  1.00 0.00 ? 809 PRO A HG2  8  
ATOM 10954 H HG3  . PRO A 1 26  ? -1.143  4.261   14.753  1.00 0.00 ? 809 PRO A HG3  8  
ATOM 10955 H HD2  . PRO A 1 26  ? -0.878  2.786   12.498  1.00 0.00 ? 809 PRO A HD2  8  
ATOM 10956 H HD3  . PRO A 1 26  ? 0.517   3.347   13.442  1.00 0.00 ? 809 PRO A HD3  8  
ATOM 10957 N N    . PHE A 1 27  ? -1.569  -1.034  15.908  1.00 0.00 ? 810 PHE A N    8  
ATOM 10958 C CA   . PHE A 1 27  ? -2.622  -2.040  15.990  1.00 0.00 ? 810 PHE A CA   8  
ATOM 10959 C C    . PHE A 1 27  ? -3.994  -1.383  16.111  1.00 0.00 ? 810 PHE A C    8  
ATOM 10960 O O    . PHE A 1 27  ? -4.986  -1.891  15.588  1.00 0.00 ? 810 PHE A O    8  
ATOM 10961 C CB   . PHE A 1 27  ? -2.381  -2.966  17.184  1.00 0.00 ? 810 PHE A CB   8  
ATOM 10962 C CG   . PHE A 1 27  ? -0.930  -3.274  17.420  1.00 0.00 ? 810 PHE A CG   8  
ATOM 10963 C CD1  . PHE A 1 27  ? -0.160  -3.852  16.423  1.00 0.00 ? 810 PHE A CD1  8  
ATOM 10964 C CD2  . PHE A 1 27  ? -0.335  -2.987  18.638  1.00 0.00 ? 810 PHE A CD2  8  
ATOM 10965 C CE1  . PHE A 1 27  ? 1.176   -4.137  16.636  1.00 0.00 ? 810 PHE A CE1  8  
ATOM 10966 C CE2  . PHE A 1 27  ? 1.000   -3.269  18.857  1.00 0.00 ? 810 PHE A CE2  8  
ATOM 10967 C CZ   . PHE A 1 27  ? 1.756   -3.846  17.855  1.00 0.00 ? 810 PHE A CZ   8  
ATOM 10968 H H    . PHE A 1 27  ? -0.730  -1.180  16.395  1.00 0.00 ? 810 PHE A H    8  
ATOM 10969 H HA   . PHE A 1 27  ? -2.594  -2.623  15.082  1.00 0.00 ? 810 PHE A HA   8  
ATOM 10970 H HB2  . PHE A 1 27  ? -2.769  -2.499  18.077  1.00 0.00 ? 810 PHE A HB2  8  
ATOM 10971 H HB3  . PHE A 1 27  ? -2.897  -3.899  17.017  1.00 0.00 ? 810 PHE A HB3  8  
ATOM 10972 H HD1  . PHE A 1 27  ? -0.613  -4.081  15.469  1.00 0.00 ? 810 PHE A HD1  8  
ATOM 10973 H HD2  . PHE A 1 27  ? -0.926  -2.536  19.423  1.00 0.00 ? 810 PHE A HD2  8  
ATOM 10974 H HE1  . PHE A 1 27  ? 1.764   -4.588  15.851  1.00 0.00 ? 810 PHE A HE1  8  
ATOM 10975 H HE2  . PHE A 1 27  ? 1.451   -3.040  19.811  1.00 0.00 ? 810 PHE A HE2  8  
ATOM 10976 H HZ   . PHE A 1 27  ? 2.799   -4.067  18.024  1.00 0.00 ? 810 PHE A HZ   8  
ATOM 10977 N N    . SER A 1 28  ? -4.042  -0.251  16.806  1.00 0.00 ? 811 SER A N    8  
ATOM 10978 C CA   . SER A 1 28  ? -5.292  0.475   17.000  1.00 0.00 ? 811 SER A CA   8  
ATOM 10979 C C    . SER A 1 28  ? -5.966  0.763   15.662  1.00 0.00 ? 811 SER A C    8  
ATOM 10980 O O    . SER A 1 28  ? -7.140  0.446   15.466  1.00 0.00 ? 811 SER A O    8  
ATOM 10981 C CB   . SER A 1 28  ? -5.035  1.785   17.747  1.00 0.00 ? 811 SER A CB   8  
ATOM 10982 O OG   . SER A 1 28  ? -4.613  1.539   19.078  1.00 0.00 ? 811 SER A OG   8  
ATOM 10983 H H    . SER A 1 28  ? -3.217  0.104   17.199  1.00 0.00 ? 811 SER A H    8  
ATOM 10984 H HA   . SER A 1 28  ? -5.946  -0.146  17.594  1.00 0.00 ? 811 SER A HA   8  
ATOM 10985 H HB2  . SER A 1 28  ? -4.265  2.343   17.236  1.00 0.00 ? 811 SER A HB2  8  
ATOM 10986 H HB3  . SER A 1 28  ? -5.945  2.366   17.772  1.00 0.00 ? 811 SER A HB3  8  
ATOM 10987 H HG   . SER A 1 28  ? -4.125  0.713   19.111  1.00 0.00 ? 811 SER A HG   8  
ATOM 10988 N N    . CYS A 1 29  ? -5.216  1.365   14.747  1.00 0.00 ? 812 CYS A N    8  
ATOM 10989 C CA   . CYS A 1 29  ? -5.741  1.698   13.427  1.00 0.00 ? 812 CYS A CA   8  
ATOM 10990 C C    . CYS A 1 29  ? -6.606  0.565   12.884  1.00 0.00 ? 812 CYS A C    8  
ATOM 10991 O O    . CYS A 1 29  ? -6.500  -0.579  13.328  1.00 0.00 ? 812 CYS A O    8  
ATOM 10992 C CB   . CYS A 1 29  ? -4.594  1.989   12.458  1.00 0.00 ? 812 CYS A CB   8  
ATOM 10993 S SG   . CYS A 1 29  ? -5.021  3.144   11.134  1.00 0.00 ? 812 CYS A SG   8  
ATOM 10994 H H    . CYS A 1 29  ? -4.288  1.593   14.962  1.00 0.00 ? 812 CYS A H    8  
ATOM 10995 H HA   . CYS A 1 29  ? -6.350  2.583   13.526  1.00 0.00 ? 812 CYS A HA   8  
ATOM 10996 H HB2  . CYS A 1 29  ? -3.766  2.412   13.008  1.00 0.00 ? 812 CYS A HB2  8  
ATOM 10997 H HB3  . CYS A 1 29  ? -4.277  1.064   11.999  1.00 0.00 ? 812 CYS A HB3  8  
ATOM 10998 H HG   . CYS A 1 29  ? -3.905  3.467   10.498  1.00 0.00 ? 812 CYS A HG   8  
ATOM 10999 N N    . THR A 1 30  ? -7.463  0.890   11.922  1.00 0.00 ? 813 THR A N    8  
ATOM 11000 C CA   . THR A 1 30  ? -8.349  -0.099  11.321  1.00 0.00 ? 813 THR A CA   8  
ATOM 11001 C C    . THR A 1 30  ? -8.617  0.222   9.855   1.00 0.00 ? 813 THR A C    8  
ATOM 11002 O O    . THR A 1 30  ? -8.333  1.326   9.388   1.00 0.00 ? 813 THR A O    8  
ATOM 11003 C CB   . THR A 1 30  ? -9.692  -0.179  12.071  1.00 0.00 ? 813 THR A CB   8  
ATOM 11004 O OG1  . THR A 1 30  ? -10.482 -1.253  11.547  1.00 0.00 ? 813 THR A OG1  8  
ATOM 11005 C CG2  . THR A 1 30  ? -10.460 1.128   11.948  1.00 0.00 ? 813 THR A CG2  8  
ATOM 11006 H H    . THR A 1 30  ? -7.501  1.819   11.611  1.00 0.00 ? 813 THR A H    8  
ATOM 11007 H HA   . THR A 1 30  ? -7.866  -1.063  11.386  1.00 0.00 ? 813 THR A HA   8  
ATOM 11008 H HB   . THR A 1 30  ? -9.493  -0.366  13.116  1.00 0.00 ? 813 THR A HB   8  
ATOM 11009 H HG1  . THR A 1 30  ? -10.923 -0.964  10.745  1.00 0.00 ? 813 THR A HG1  8  
ATOM 11010 H HG21 . THR A 1 30  ? -9.785  1.958   12.098  1.00 0.00 ? 813 THR A HG21 8  
ATOM 11011 H HG22 . THR A 1 30  ? -11.240 1.159   12.694  1.00 0.00 ? 813 THR A HG22 8  
ATOM 11012 H HG23 . THR A 1 30  ? -10.900 1.196   10.964  1.00 0.00 ? 813 THR A HG23 8  
ATOM 11013 N N    . LYS A 1 31  ? -9.166  -0.748  9.132   1.00 0.00 ? 814 LYS A N    8  
ATOM 11014 C CA   . LYS A 1 31  ? -9.474  -0.569  7.719   1.00 0.00 ? 814 LYS A CA   8  
ATOM 11015 C C    . LYS A 1 31  ? -10.196 0.754   7.482   1.00 0.00 ? 814 LYS A C    8  
ATOM 11016 O O    . LYS A 1 31  ? -9.774  1.562   6.656   1.00 0.00 ? 814 LYS A O    8  
ATOM 11017 C CB   . LYS A 1 31  ? -10.335 -1.729  7.213   1.00 0.00 ? 814 LYS A CB   8  
ATOM 11018 C CG   . LYS A 1 31  ? -10.233 -1.954  5.714   1.00 0.00 ? 814 LYS A CG   8  
ATOM 11019 C CD   . LYS A 1 31  ? -11.467 -2.655  5.170   1.00 0.00 ? 814 LYS A CD   8  
ATOM 11020 C CE   . LYS A 1 31  ? -11.339 -4.167  5.274   1.00 0.00 ? 814 LYS A CE   8  
ATOM 11021 N NZ   . LYS A 1 31  ? -11.735 -4.666  6.621   1.00 0.00 ? 814 LYS A NZ   8  
ATOM 11022 H H    . LYS A 1 31  ? -9.369  -1.607  9.561   1.00 0.00 ? 814 LYS A H    8  
ATOM 11023 H HA   . LYS A 1 31  ? -8.542  -0.560  7.174   1.00 0.00 ? 814 LYS A HA   8  
ATOM 11024 H HB2  . LYS A 1 31  ? -10.027 -2.635  7.713   1.00 0.00 ? 814 LYS A HB2  8  
ATOM 11025 H HB3  . LYS A 1 31  ? -11.369 -1.528  7.456   1.00 0.00 ? 814 LYS A HB3  8  
ATOM 11026 H HG2  . LYS A 1 31  ? -10.130 -0.998  5.222   1.00 0.00 ? 814 LYS A HG2  8  
ATOM 11027 H HG3  . LYS A 1 31  ? -9.364  -2.562  5.508   1.00 0.00 ? 814 LYS A HG3  8  
ATOM 11028 H HD2  . LYS A 1 31  ? -12.330 -2.338  5.736   1.00 0.00 ? 814 LYS A HD2  8  
ATOM 11029 H HD3  . LYS A 1 31  ? -11.595 -2.384  4.131   1.00 0.00 ? 814 LYS A HD3  8  
ATOM 11030 H HE2  . LYS A 1 31  ? -11.975 -4.621  4.530   1.00 0.00 ? 814 LYS A HE2  8  
ATOM 11031 H HE3  . LYS A 1 31  ? -10.312 -4.443  5.086   1.00 0.00 ? 814 LYS A HE3  8  
ATOM 11032 H HZ1  . LYS A 1 31  ? -11.060 -4.331  7.338   1.00 0.00 ? 814 LYS A HZ1  8  
ATOM 11033 H HZ2  . LYS A 1 31  ? -11.745 -5.705  6.628   1.00 0.00 ? 814 LYS A HZ2  8  
ATOM 11034 H HZ3  . LYS A 1 31  ? -12.685 -4.319  6.865   1.00 0.00 ? 814 LYS A HZ3  8  
ATOM 11035 N N    . GLU A 1 32  ? -11.285 0.968   8.214   1.00 0.00 ? 815 GLU A N    8  
ATOM 11036 C CA   . GLU A 1 32  ? -12.063 2.194   8.084   1.00 0.00 ? 815 GLU A CA   8  
ATOM 11037 C C    . GLU A 1 32  ? -11.151 3.417   8.053   1.00 0.00 ? 815 GLU A C    8  
ATOM 11038 O O    . GLU A 1 32  ? -11.077 4.123   7.048   1.00 0.00 ? 815 GLU A O    8  
ATOM 11039 C CB   . GLU A 1 32  ? -13.061 2.316   9.238   1.00 0.00 ? 815 GLU A CB   8  
ATOM 11040 C CG   . GLU A 1 32  ? -14.169 1.278   9.197   1.00 0.00 ? 815 GLU A CG   8  
ATOM 11041 C CD   . GLU A 1 32  ? -15.265 1.633   8.212   1.00 0.00 ? 815 GLU A CD   8  
ATOM 11042 O OE1  . GLU A 1 32  ? -15.840 2.734   8.336   1.00 0.00 ? 815 GLU A OE1  8  
ATOM 11043 O OE2  . GLU A 1 32  ? -15.549 0.809   7.317   1.00 0.00 ? 815 GLU A OE2  8  
ATOM 11044 H H    . GLU A 1 32  ? -11.571 0.285   8.857   1.00 0.00 ? 815 GLU A H    8  
ATOM 11045 H HA   . GLU A 1 32  ? -12.608 2.143   7.153   1.00 0.00 ? 815 GLU A HA   8  
ATOM 11046 H HB2  . GLU A 1 32  ? -12.528 2.209   10.171  1.00 0.00 ? 815 GLU A HB2  8  
ATOM 11047 H HB3  . GLU A 1 32  ? -13.513 3.296   9.203   1.00 0.00 ? 815 GLU A HB3  8  
ATOM 11048 H HG2  . GLU A 1 32  ? -13.744 0.327   8.912   1.00 0.00 ? 815 GLU A HG2  8  
ATOM 11049 H HG3  . GLU A 1 32  ? -14.604 1.195   10.182  1.00 0.00 ? 815 GLU A HG3  8  
ATOM 11050 N N    . GLU A 1 33  ? -10.460 3.660   9.162   1.00 0.00 ? 816 GLU A N    8  
ATOM 11051 C CA   . GLU A 1 33  ? -9.554  4.798   9.263   1.00 0.00 ? 816 GLU A CA   8  
ATOM 11052 C C    . GLU A 1 33  ? -8.697  4.924   8.006   1.00 0.00 ? 816 GLU A C    8  
ATOM 11053 O O    . GLU A 1 33  ? -8.841  5.874   7.235   1.00 0.00 ? 816 GLU A O    8  
ATOM 11054 C CB   . GLU A 1 33  ? -8.656  4.657   10.494  1.00 0.00 ? 816 GLU A CB   8  
ATOM 11055 C CG   . GLU A 1 33  ? -9.345  5.030   11.795  1.00 0.00 ? 816 GLU A CG   8  
ATOM 11056 C CD   . GLU A 1 33  ? -9.462  6.530   11.984  1.00 0.00 ? 816 GLU A CD   8  
ATOM 11057 O OE1  . GLU A 1 33  ? -8.424  7.220   11.913  1.00 0.00 ? 816 GLU A OE1  8  
ATOM 11058 O OE2  . GLU A 1 33  ? -10.593 7.013   12.203  1.00 0.00 ? 816 GLU A OE2  8  
ATOM 11059 H H    . GLU A 1 33  ? -10.562 3.060   9.931   1.00 0.00 ? 816 GLU A H    8  
ATOM 11060 H HA   . GLU A 1 33  ? -10.153 5.690   9.366   1.00 0.00 ? 816 GLU A HA   8  
ATOM 11061 H HB2  . GLU A 1 33  ? -8.324  3.631   10.566  1.00 0.00 ? 816 GLU A HB2  8  
ATOM 11062 H HB3  . GLU A 1 33  ? -7.795  5.296   10.371  1.00 0.00 ? 816 GLU A HB3  8  
ATOM 11063 H HG2  . GLU A 1 33  ? -10.337 4.604   11.798  1.00 0.00 ? 816 GLU A HG2  8  
ATOM 11064 H HG3  . GLU A 1 33  ? -8.777  4.621   12.618  1.00 0.00 ? 816 GLU A HG3  8  
ATOM 11065 N N    . LEU A 1 34  ? -7.805  3.960   7.807   1.00 0.00 ? 817 LEU A N    8  
ATOM 11066 C CA   . LEU A 1 34  ? -6.923  3.962   6.645   1.00 0.00 ? 817 LEU A CA   8  
ATOM 11067 C C    . LEU A 1 34  ? -7.691  4.332   5.380   1.00 0.00 ? 817 LEU A C    8  
ATOM 11068 O O    . LEU A 1 34  ? -7.404  5.345   4.743   1.00 0.00 ? 817 LEU A O    8  
ATOM 11069 C CB   . LEU A 1 34  ? -6.268  2.590   6.475   1.00 0.00 ? 817 LEU A CB   8  
ATOM 11070 C CG   . LEU A 1 34  ? -4.981  2.559   5.649   1.00 0.00 ? 817 LEU A CG   8  
ATOM 11071 C CD1  . LEU A 1 34  ? -3.987  3.584   6.171   1.00 0.00 ? 817 LEU A CD1  8  
ATOM 11072 C CD2  . LEU A 1 34  ? -4.371  1.165   5.665   1.00 0.00 ? 817 LEU A CD2  8  
ATOM 11073 H H    . LEU A 1 34  ? -7.737  3.230   8.456   1.00 0.00 ? 817 LEU A H    8  
ATOM 11074 H HA   . LEU A 1 34  ? -6.154  4.701   6.814   1.00 0.00 ? 817 LEU A HA   8  
ATOM 11075 H HB2  . LEU A 1 34  ? -6.039  2.209   7.458   1.00 0.00 ? 817 LEU A HB2  8  
ATOM 11076 H HB3  . LEU A 1 34  ? -6.986  1.939   5.996   1.00 0.00 ? 817 LEU A HB3  8  
ATOM 11077 H HG   . LEU A 1 34  ? -5.213  2.812   4.624   1.00 0.00 ? 817 LEU A HG   8  
ATOM 11078 H HD11 . LEU A 1 34  ? -3.906  3.493   7.244   1.00 0.00 ? 817 LEU A HD11 8  
ATOM 11079 H HD12 . LEU A 1 34  ? -4.327  4.577   5.919   1.00 0.00 ? 817 LEU A HD12 8  
ATOM 11080 H HD13 . LEU A 1 34  ? -3.020  3.410   5.721   1.00 0.00 ? 817 LEU A HD13 8  
ATOM 11081 H HD21 . LEU A 1 34  ? -4.192  0.839   4.651   1.00 0.00 ? 817 LEU A HD21 8  
ATOM 11082 H HD22 . LEU A 1 34  ? -5.053  0.479   6.148   1.00 0.00 ? 817 LEU A HD22 8  
ATOM 11083 H HD23 . LEU A 1 34  ? -3.438  1.187   6.207   1.00 0.00 ? 817 LEU A HD23 8  
ATOM 11084 N N    . GLU A 1 35  ? -8.669  3.505   5.024   1.00 0.00 ? 818 GLU A N    8  
ATOM 11085 C CA   . GLU A 1 35  ? -9.478  3.746   3.835   1.00 0.00 ? 818 GLU A CA   8  
ATOM 11086 C C    . GLU A 1 35  ? -9.878  5.216   3.739   1.00 0.00 ? 818 GLU A C    8  
ATOM 11087 O O    . GLU A 1 35  ? -9.656  5.864   2.716   1.00 0.00 ? 818 GLU A O    8  
ATOM 11088 C CB   . GLU A 1 35  ? -10.730 2.867   3.856   1.00 0.00 ? 818 GLU A CB   8  
ATOM 11089 C CG   . GLU A 1 35  ? -11.678 3.129   2.698   1.00 0.00 ? 818 GLU A CG   8  
ATOM 11090 C CD   . GLU A 1 35  ? -12.568 4.334   2.933   1.00 0.00 ? 818 GLU A CD   8  
ATOM 11091 O OE1  . GLU A 1 35  ? -13.323 4.327   3.928   1.00 0.00 ? 818 GLU A OE1  8  
ATOM 11092 O OE2  . GLU A 1 35  ? -12.510 5.283   2.124   1.00 0.00 ? 818 GLU A OE2  8  
ATOM 11093 H H    . GLU A 1 35  ? -8.849  2.713   5.572   1.00 0.00 ? 818 GLU A H    8  
ATOM 11094 H HA   . GLU A 1 35  ? -8.884  3.490   2.971   1.00 0.00 ? 818 GLU A HA   8  
ATOM 11095 H HB2  . GLU A 1 35  ? -10.428 1.830   3.820   1.00 0.00 ? 818 GLU A HB2  8  
ATOM 11096 H HB3  . GLU A 1 35  ? -11.264 3.044   4.778   1.00 0.00 ? 818 GLU A HB3  8  
ATOM 11097 H HG2  . GLU A 1 35  ? -11.096 3.300   1.805   1.00 0.00 ? 818 GLU A HG2  8  
ATOM 11098 H HG3  . GLU A 1 35  ? -12.303 2.260   2.557   1.00 0.00 ? 818 GLU A HG3  8  
ATOM 11099 N N    . GLU A 1 36  ? -10.469 5.734   4.811   1.00 0.00 ? 819 GLU A N    8  
ATOM 11100 C CA   . GLU A 1 36  ? -10.900 7.127   4.846   1.00 0.00 ? 819 GLU A CA   8  
ATOM 11101 C C    . GLU A 1 36  ? -9.760  8.060   4.451   1.00 0.00 ? 819 GLU A C    8  
ATOM 11102 O O    . GLU A 1 36  ? -9.968  9.048   3.745   1.00 0.00 ? 819 GLU A O    8  
ATOM 11103 C CB   . GLU A 1 36  ? -11.411 7.490   6.242   1.00 0.00 ? 819 GLU A CB   8  
ATOM 11104 C CG   . GLU A 1 36  ? -12.851 7.074   6.491   1.00 0.00 ? 819 GLU A CG   8  
ATOM 11105 C CD   . GLU A 1 36  ? -13.285 7.306   7.925   1.00 0.00 ? 819 GLU A CD   8  
ATOM 11106 O OE1  . GLU A 1 36  ? -12.953 6.467   8.789   1.00 0.00 ? 819 GLU A OE1  8  
ATOM 11107 O OE2  . GLU A 1 36  ? -13.958 8.326   8.184   1.00 0.00 ? 819 GLU A OE2  8  
ATOM 11108 H H    . GLU A 1 36  ? -10.618 5.167   5.596   1.00 0.00 ? 819 GLU A H    8  
ATOM 11109 H HA   . GLU A 1 36  ? -11.706 7.242   4.137   1.00 0.00 ? 819 GLU A HA   8  
ATOM 11110 H HB2  . GLU A 1 36  ? -10.785 7.007   6.978   1.00 0.00 ? 819 GLU A HB2  8  
ATOM 11111 H HB3  . GLU A 1 36  ? -11.341 8.560   6.370   1.00 0.00 ? 819 GLU A HB3  8  
ATOM 11112 H HG2  . GLU A 1 36  ? -13.495 7.644   5.839   1.00 0.00 ? 819 GLU A HG2  8  
ATOM 11113 H HG3  . GLU A 1 36  ? -12.952 6.022   6.266   1.00 0.00 ? 819 GLU A HG3  8  
ATOM 11114 N N    . ILE A 1 37  ? -8.555  7.740   4.911   1.00 0.00 ? 820 ILE A N    8  
ATOM 11115 C CA   . ILE A 1 37  ? -7.382  8.549   4.605   1.00 0.00 ? 820 ILE A CA   8  
ATOM 11116 C C    . ILE A 1 37  ? -6.908  8.312   3.176   1.00 0.00 ? 820 ILE A C    8  
ATOM 11117 O O    . ILE A 1 37  ? -6.337  9.202   2.544   1.00 0.00 ? 820 ILE A O    8  
ATOM 11118 C CB   . ILE A 1 37  ? -6.223  8.249   5.575   1.00 0.00 ? 820 ILE A CB   8  
ATOM 11119 C CG1  . ILE A 1 37  ? -6.683  8.424   7.023   1.00 0.00 ? 820 ILE A CG1  8  
ATOM 11120 C CG2  . ILE A 1 37  ? -5.036  9.153   5.277   1.00 0.00 ? 820 ILE A CG2  8  
ATOM 11121 C CD1  . ILE A 1 37  ? -5.779  7.748   8.030   1.00 0.00 ? 820 ILE A CD1  8  
ATOM 11122 H H    . ILE A 1 37  ? -8.453  6.941   5.469   1.00 0.00 ? 820 ILE A H    8  
ATOM 11123 H HA   . ILE A 1 37  ? -7.656  9.589   4.715   1.00 0.00 ? 820 ILE A HA   8  
ATOM 11124 H HB   . ILE A 1 37  ? -5.913  7.227   5.424   1.00 0.00 ? 820 ILE A HB   8  
ATOM 11125 H HG12 . ILE A 1 37  ? -6.713  9.476   7.260   1.00 0.00 ? 820 ILE A HG12 8  
ATOM 11126 H HG13 . ILE A 1 37  ? -7.673  8.006   7.132   1.00 0.00 ? 820 ILE A HG13 8  
ATOM 11127 H HG21 . ILE A 1 37  ? -5.319  10.183  5.437   1.00 0.00 ? 820 ILE A HG21 8  
ATOM 11128 H HG22 . ILE A 1 37  ? -4.217  8.899   5.934   1.00 0.00 ? 820 ILE A HG22 8  
ATOM 11129 H HG23 . ILE A 1 37  ? -4.729  9.019   4.251   1.00 0.00 ? 820 ILE A HG23 8  
ATOM 11130 H HD11 . ILE A 1 37  ? -6.262  7.734   8.996   1.00 0.00 ? 820 ILE A HD11 8  
ATOM 11131 H HD12 . ILE A 1 37  ? -5.579  6.736   7.712   1.00 0.00 ? 820 ILE A HD12 8  
ATOM 11132 H HD13 . ILE A 1 37  ? -4.849  8.293   8.102   1.00 0.00 ? 820 ILE A HD13 8  
ATOM 11133 N N    . CYS A 1 38  ? -7.149  7.108   2.670   1.00 0.00 ? 821 CYS A N    8  
ATOM 11134 C CA   . CYS A 1 38  ? -6.748  6.753   1.313   1.00 0.00 ? 821 CYS A CA   8  
ATOM 11135 C C    . CYS A 1 38  ? -7.599  7.490   0.285   1.00 0.00 ? 821 CYS A C    8  
ATOM 11136 O O    . CYS A 1 38  ? -7.075  8.140   -0.620  1.00 0.00 ? 821 CYS A O    8  
ATOM 11137 C CB   . CYS A 1 38  ? -6.866  5.243   1.103   1.00 0.00 ? 821 CYS A CB   8  
ATOM 11138 S SG   . CYS A 1 38  ? -5.578  4.280   1.928   1.00 0.00 ? 821 CYS A SG   8  
ATOM 11139 H H    . CYS A 1 38  ? -7.608  6.440   3.222   1.00 0.00 ? 821 CYS A H    8  
ATOM 11140 H HA   . CYS A 1 38  ? -5.717  7.046   1.186   1.00 0.00 ? 821 CYS A HA   8  
ATOM 11141 H HB2  . CYS A 1 38  ? -7.820  4.907   1.482   1.00 0.00 ? 821 CYS A HB2  8  
ATOM 11142 H HB3  . CYS A 1 38  ? -6.812  5.029   0.046   1.00 0.00 ? 821 CYS A HB3  8  
ATOM 11143 H HG   . CYS A 1 38  ? -5.598  4.589   3.216   1.00 0.00 ? 821 CYS A HG   8  
ATOM 11144 N N    . LYS A 1 39  ? -8.916  7.384   0.428   1.00 0.00 ? 822 LYS A N    8  
ATOM 11145 C CA   . LYS A 1 39  ? -9.841  8.039   -0.488  1.00 0.00 ? 822 LYS A CA   8  
ATOM 11146 C C    . LYS A 1 39  ? -9.603  9.546   -0.517  1.00 0.00 ? 822 LYS A C    8  
ATOM 11147 O O    . LYS A 1 39  ? -10.102 10.246  -1.398  1.00 0.00 ? 822 LYS A O    8  
ATOM 11148 C CB   . LYS A 1 39  ? -11.287 7.749   -0.080  1.00 0.00 ? 822 LYS A CB   8  
ATOM 11149 C CG   . LYS A 1 39  ? -11.640 8.254   1.309   1.00 0.00 ? 822 LYS A CG   8  
ATOM 11150 C CD   . LYS A 1 39  ? -13.137 8.464   1.462   1.00 0.00 ? 822 LYS A CD   8  
ATOM 11151 C CE   . LYS A 1 39  ? -13.464 9.242   2.727   1.00 0.00 ? 822 LYS A CE   8  
ATOM 11152 N NZ   . LYS A 1 39  ? -14.932 9.325   2.963   1.00 0.00 ? 822 LYS A NZ   8  
ATOM 11153 H H    . LYS A 1 39  ? -9.274  6.851   1.170   1.00 0.00 ? 822 LYS A H    8  
ATOM 11154 H HA   . LYS A 1 39  ? -9.668  7.641   -1.476  1.00 0.00 ? 822 LYS A HA   8  
ATOM 11155 H HB2  . LYS A 1 39  ? -11.951 8.219   -0.790  1.00 0.00 ? 822 LYS A HB2  8  
ATOM 11156 H HB3  . LYS A 1 39  ? -11.448 6.680   -0.103  1.00 0.00 ? 822 LYS A HB3  8  
ATOM 11157 H HG2  . LYS A 1 39  ? -11.313 7.529   2.040   1.00 0.00 ? 822 LYS A HG2  8  
ATOM 11158 H HG3  . LYS A 1 39  ? -11.134 9.193   1.480   1.00 0.00 ? 822 LYS A HG3  8  
ATOM 11159 H HD2  . LYS A 1 39  ? -13.504 9.016   0.609   1.00 0.00 ? 822 LYS A HD2  8  
ATOM 11160 H HD3  . LYS A 1 39  ? -13.625 7.501   1.505   1.00 0.00 ? 822 LYS A HD3  8  
ATOM 11161 H HE2  . LYS A 1 39  ? -13.001 8.748   3.568   1.00 0.00 ? 822 LYS A HE2  8  
ATOM 11162 H HE3  . LYS A 1 39  ? -13.066 10.241  2.633   1.00 0.00 ? 822 LYS A HE3  8  
ATOM 11163 H HZ1  . LYS A 1 39  ? -15.434 8.672   2.328   1.00 0.00 ? 822 LYS A HZ1  8  
ATOM 11164 H HZ2  . LYS A 1 39  ? -15.269 10.292  2.783   1.00 0.00 ? 822 LYS A HZ2  8  
ATOM 11165 H HZ3  . LYS A 1 39  ? -15.151 9.072   3.948   1.00 0.00 ? 822 LYS A HZ3  8  
ATOM 11166 N N    . ALA A 1 40  ? -8.837  10.038  0.451   1.00 0.00 ? 823 ALA A N    8  
ATOM 11167 C CA   . ALA A 1 40  ? -8.530  11.460  0.534   1.00 0.00 ? 823 ALA A CA   8  
ATOM 11168 C C    . ALA A 1 40  ? -7.556  11.876  -0.563  1.00 0.00 ? 823 ALA A C    8  
ATOM 11169 O O    . ALA A 1 40  ? -7.593  13.010  -1.043  1.00 0.00 ? 823 ALA A O    8  
ATOM 11170 C CB   . ALA A 1 40  ? -7.960  11.798  1.904   1.00 0.00 ? 823 ALA A CB   8  
ATOM 11171 H H    . ALA A 1 40  ? -8.468  9.429   1.125   1.00 0.00 ? 823 ALA A H    8  
ATOM 11172 H HA   . ALA A 1 40  ? -9.453  12.009  0.410   1.00 0.00 ? 823 ALA A HA   8  
ATOM 11173 H HB1  . ALA A 1 40  ? -6.886  11.889  1.834   1.00 0.00 ? 823 ALA A HB1  8  
ATOM 11174 H HB2  . ALA A 1 40  ? -8.380  12.732  2.248   1.00 0.00 ? 823 ALA A HB2  8  
ATOM 11175 H HB3  . ALA A 1 40  ? -8.210  11.012  2.601   1.00 0.00 ? 823 ALA A HB3  8  
ATOM 11176 N N    . HIS A 1 41  ? -6.684  10.953  -0.956  1.00 0.00 ? 824 HIS A N    8  
ATOM 11177 C CA   . HIS A 1 41  ? -5.700  11.225  -1.997  1.00 0.00 ? 824 HIS A CA   8  
ATOM 11178 C C    . HIS A 1 41  ? -6.301  11.011  -3.383  1.00 0.00 ? 824 HIS A C    8  
ATOM 11179 O O    . HIS A 1 41  ? -6.058  11.790  -4.303  1.00 0.00 ? 824 HIS A O    8  
ATOM 11180 C CB   . HIS A 1 41  ? -4.474  10.328  -1.816  1.00 0.00 ? 824 HIS A CB   8  
ATOM 11181 C CG   . HIS A 1 41  ? -3.732  10.579  -0.540  1.00 0.00 ? 824 HIS A CG   8  
ATOM 11182 N ND1  . HIS A 1 41  ? -3.234  11.816  -0.190  1.00 0.00 ? 824 HIS A ND1  8  
ATOM 11183 C CD2  . HIS A 1 41  ? -3.405  9.743   0.473   1.00 0.00 ? 824 HIS A CD2  8  
ATOM 11184 C CE1  . HIS A 1 41  ? -2.631  11.730  0.983   1.00 0.00 ? 824 HIS A CE1  8  
ATOM 11185 N NE2  . HIS A 1 41  ? -2.722  10.482  1.407   1.00 0.00 ? 824 HIS A NE2  8  
ATOM 11186 H H    . HIS A 1 41  ? -6.704  10.068  -0.536  1.00 0.00 ? 824 HIS A H    8  
ATOM 11187 H HA   . HIS A 1 41  ? -5.397  12.257  -1.906  1.00 0.00 ? 824 HIS A HA   8  
ATOM 11188 H HB2  . HIS A 1 41  ? -4.789  9.295   -1.819  1.00 0.00 ? 824 HIS A HB2  8  
ATOM 11189 H HB3  . HIS A 1 41  ? -3.791  10.494  -2.637  1.00 0.00 ? 824 HIS A HB3  8  
ATOM 11190 H HD2  . HIS A 1 41  ? -3.638  8.689   0.536   1.00 0.00 ? 824 HIS A HD2  8  
ATOM 11191 H HE1  . HIS A 1 41  ? -2.147  12.541  1.506   1.00 0.00 ? 824 HIS A HE1  8  
ATOM 11192 H HE2  . HIS A 1 41  ? -2.285  10.126  2.208   1.00 0.00 ? 824 HIS A HE2  8  
ATOM 11193 N N    . GLY A 1 42  ? -7.088  9.948   -3.524  1.00 0.00 ? 825 GLY A N    8  
ATOM 11194 C CA   . GLY A 1 42  ? -7.711  9.650   -4.800  1.00 0.00 ? 825 GLY A CA   8  
ATOM 11195 C C    . GLY A 1 42  ? -8.918  8.743   -4.659  1.00 0.00 ? 825 GLY A C    8  
ATOM 11196 O O    . GLY A 1 42  ? -9.771  8.961   -3.798  1.00 0.00 ? 825 GLY A O    8  
ATOM 11197 H H    . GLY A 1 42  ? -7.247  9.362   -2.755  1.00 0.00 ? 825 GLY A H    8  
ATOM 11198 H HA2  . GLY A 1 42  ? -8.022  10.576  -5.261  1.00 0.00 ? 825 GLY A HA2  8  
ATOM 11199 H HA3  . GLY A 1 42  ? -6.986  9.168   -5.438  1.00 0.00 ? 825 GLY A HA3  8  
ATOM 11200 N N    . THR A 1 43  ? -8.992  7.723   -5.507  1.00 0.00 ? 826 THR A N    8  
ATOM 11201 C CA   . THR A 1 43  ? -10.103 6.781   -5.476  1.00 0.00 ? 826 THR A CA   8  
ATOM 11202 C C    . THR A 1 43  ? -9.644  5.403   -5.013  1.00 0.00 ? 826 THR A C    8  
ATOM 11203 O O    . THR A 1 43  ? -8.865  4.737   -5.693  1.00 0.00 ? 826 THR A O    8  
ATOM 11204 C CB   . THR A 1 43  ? -10.768 6.650   -6.859  1.00 0.00 ? 826 THR A CB   8  
ATOM 11205 O OG1  . THR A 1 43  ? -11.179 7.939   -7.329  1.00 0.00 ? 826 THR A OG1  8  
ATOM 11206 C CG2  . THR A 1 43  ? -11.971 5.721   -6.795  1.00 0.00 ? 826 THR A CG2  8  
ATOM 11207 H H    . THR A 1 43  ? -8.281  7.602   -6.171  1.00 0.00 ? 826 THR A H    8  
ATOM 11208 H HA   . THR A 1 43  ? -10.839 7.157   -4.780  1.00 0.00 ? 826 THR A HA   8  
ATOM 11209 H HB   . THR A 1 43  ? -10.048 6.235   -7.550  1.00 0.00 ? 826 THR A HB   8  
ATOM 11210 H HG1  . THR A 1 43  ? -11.410 8.494   -6.581  1.00 0.00 ? 826 THR A HG1  8  
ATOM 11211 H HG21 . THR A 1 43  ? -11.728 4.784   -7.273  1.00 0.00 ? 826 THR A HG21 8  
ATOM 11212 H HG22 . THR A 1 43  ? -12.807 6.179   -7.304  1.00 0.00 ? 826 THR A HG22 8  
ATOM 11213 H HG23 . THR A 1 43  ? -12.233 5.542   -5.763  1.00 0.00 ? 826 THR A HG23 8  
ATOM 11214 N N    . VAL A 1 44  ? -10.133 4.981   -3.851  1.00 0.00 ? 827 VAL A N    8  
ATOM 11215 C CA   . VAL A 1 44  ? -9.774  3.681   -3.297  1.00 0.00 ? 827 VAL A CA   8  
ATOM 11216 C C    . VAL A 1 44  ? -10.566 2.562   -3.964  1.00 0.00 ? 827 VAL A C    8  
ATOM 11217 O O    . VAL A 1 44  ? -11.776 2.442   -3.769  1.00 0.00 ? 827 VAL A O    8  
ATOM 11218 C CB   . VAL A 1 44  ? -10.016 3.632   -1.777  1.00 0.00 ? 827 VAL A CB   8  
ATOM 11219 C CG1  . VAL A 1 44  ? -9.613  2.277   -1.216  1.00 0.00 ? 827 VAL A CG1  8  
ATOM 11220 C CG2  . VAL A 1 44  ? -9.259  4.753   -1.080  1.00 0.00 ? 827 VAL A CG2  8  
ATOM 11221 H H    . VAL A 1 44  ? -10.750 5.558   -3.354  1.00 0.00 ? 827 VAL A H    8  
ATOM 11222 H HA   . VAL A 1 44  ? -8.721  3.521   -3.478  1.00 0.00 ? 827 VAL A HA   8  
ATOM 11223 H HB   . VAL A 1 44  ? -11.072 3.772   -1.596  1.00 0.00 ? 827 VAL A HB   8  
ATOM 11224 H HG11 . VAL A 1 44  ? -10.467 1.817   -0.738  1.00 0.00 ? 827 VAL A HG11 8  
ATOM 11225 H HG12 . VAL A 1 44  ? -9.264  1.643   -2.018  1.00 0.00 ? 827 VAL A HG12 8  
ATOM 11226 H HG13 . VAL A 1 44  ? -8.824  2.408   -0.491  1.00 0.00 ? 827 VAL A HG13 8  
ATOM 11227 H HG21 . VAL A 1 44  ? -8.399  5.027   -1.673  1.00 0.00 ? 827 VAL A HG21 8  
ATOM 11228 H HG22 . VAL A 1 44  ? -9.907  5.610   -0.968  1.00 0.00 ? 827 VAL A HG22 8  
ATOM 11229 H HG23 . VAL A 1 44  ? -8.934  4.418   -0.107  1.00 0.00 ? 827 VAL A HG23 8  
ATOM 11230 N N    . LYS A 1 45  ? -9.876  1.744   -4.752  1.00 0.00 ? 828 LYS A N    8  
ATOM 11231 C CA   . LYS A 1 45  ? -10.514 0.633   -5.447  1.00 0.00 ? 828 LYS A CA   8  
ATOM 11232 C C    . LYS A 1 45  ? -10.697 -0.560  -4.514  1.00 0.00 ? 828 LYS A C    8  
ATOM 11233 O O    . LYS A 1 45  ? -11.764 -1.172  -4.475  1.00 0.00 ? 828 LYS A O    8  
ATOM 11234 C CB   . LYS A 1 45  ? -9.681  0.219   -6.662  1.00 0.00 ? 828 LYS A CB   8  
ATOM 11235 C CG   . LYS A 1 45  ? -9.758  1.204   -7.816  1.00 0.00 ? 828 LYS A CG   8  
ATOM 11236 C CD   . LYS A 1 45  ? -11.112 1.151   -8.504  1.00 0.00 ? 828 LYS A CD   8  
ATOM 11237 C CE   . LYS A 1 45  ? -11.263 -0.109  -9.342  1.00 0.00 ? 828 LYS A CE   8  
ATOM 11238 N NZ   . LYS A 1 45  ? -12.467 -0.053  -10.216 1.00 0.00 ? 828 LYS A NZ   8  
ATOM 11239 H H    . LYS A 1 45  ? -8.914  1.892   -4.868  1.00 0.00 ? 828 LYS A H    8  
ATOM 11240 H HA   . LYS A 1 45  ? -11.485 0.964   -5.783  1.00 0.00 ? 828 LYS A HA   8  
ATOM 11241 H HB2  . LYS A 1 45  ? -8.647  0.130   -6.362  1.00 0.00 ? 828 LYS A HB2  8  
ATOM 11242 H HB3  . LYS A 1 45  ? -10.029 -0.742  -7.013  1.00 0.00 ? 828 LYS A HB3  8  
ATOM 11243 H HG2  . LYS A 1 45  ? -9.598  2.202   -7.437  1.00 0.00 ? 828 LYS A HG2  8  
ATOM 11244 H HG3  . LYS A 1 45  ? -8.989  0.962   -8.536  1.00 0.00 ? 828 LYS A HG3  8  
ATOM 11245 H HD2  . LYS A 1 45  ? -11.888 1.166   -7.754  1.00 0.00 ? 828 LYS A HD2  8  
ATOM 11246 H HD3  . LYS A 1 45  ? -11.213 2.015   -9.146  1.00 0.00 ? 828 LYS A HD3  8  
ATOM 11247 H HE2  . LYS A 1 45  ? -10.385 -0.221  -9.961  1.00 0.00 ? 828 LYS A HE2  8  
ATOM 11248 H HE3  . LYS A 1 45  ? -11.347 -0.958  -8.680  1.00 0.00 ? 828 LYS A HE3  8  
ATOM 11249 H HZ1  . LYS A 1 45  ? -13.219 -0.658  -9.827  1.00 0.00 ? 828 LYS A HZ1  8  
ATOM 11250 H HZ2  . LYS A 1 45  ? -12.231 -0.386  -11.172 1.00 0.00 ? 828 LYS A HZ2  8  
ATOM 11251 H HZ3  . LYS A 1 45  ? -12.820 0.923   -10.278 1.00 0.00 ? 828 LYS A HZ3  8  
ATOM 11252 N N    . ASP A 1 46  ? -9.650  -0.883  -3.763  1.00 0.00 ? 829 ASP A N    8  
ATOM 11253 C CA   . ASP A 1 46  ? -9.697  -2.001  -2.827  1.00 0.00 ? 829 ASP A CA   8  
ATOM 11254 C C    . ASP A 1 46  ? -8.633  -1.848  -1.745  1.00 0.00 ? 829 ASP A C    8  
ATOM 11255 O O    . ASP A 1 46  ? -7.520  -1.391  -2.012  1.00 0.00 ? 829 ASP A O    8  
ATOM 11256 C CB   . ASP A 1 46  ? -9.500  -3.324  -3.570  1.00 0.00 ? 829 ASP A CB   8  
ATOM 11257 C CG   . ASP A 1 46  ? -10.769 -3.801  -4.248  1.00 0.00 ? 829 ASP A CG   8  
ATOM 11258 O OD1  . ASP A 1 46  ? -11.863 -3.566  -3.693  1.00 0.00 ? 829 ASP A OD1  8  
ATOM 11259 O OD2  . ASP A 1 46  ? -10.669 -4.410  -5.334  1.00 0.00 ? 829 ASP A OD2  8  
ATOM 11260 H H    . ASP A 1 46  ? -8.826  -0.357  -3.838  1.00 0.00 ? 829 ASP A H    8  
ATOM 11261 H HA   . ASP A 1 46  ? -10.670 -2.002  -2.360  1.00 0.00 ? 829 ASP A HA   8  
ATOM 11262 H HB2  . ASP A 1 46  ? -8.737  -3.196  -4.324  1.00 0.00 ? 829 ASP A HB2  8  
ATOM 11263 H HB3  . ASP A 1 46  ? -9.183  -4.080  -2.867  1.00 0.00 ? 829 ASP A HB3  8  
ATOM 11264 N N    . LEU A 1 47  ? -8.981  -2.232  -0.522  1.00 0.00 ? 830 LEU A N    8  
ATOM 11265 C CA   . LEU A 1 47  ? -8.056  -2.137  0.603   1.00 0.00 ? 830 LEU A CA   8  
ATOM 11266 C C    . LEU A 1 47  ? -8.108  -3.399  1.458   1.00 0.00 ? 830 LEU A C    8  
ATOM 11267 O O    . LEU A 1 47  ? -9.184  -3.926  1.741   1.00 0.00 ? 830 LEU A O    8  
ATOM 11268 C CB   . LEU A 1 47  ? -8.387  -0.914  1.459   1.00 0.00 ? 830 LEU A CB   8  
ATOM 11269 C CG   . LEU A 1 47  ? -7.252  -0.379  2.333   1.00 0.00 ? 830 LEU A CG   8  
ATOM 11270 C CD1  . LEU A 1 47  ? -7.607  0.991   2.890   1.00 0.00 ? 830 LEU A CD1  8  
ATOM 11271 C CD2  . LEU A 1 47  ? -6.945  -1.353  3.462   1.00 0.00 ? 830 LEU A CD2  8  
ATOM 11272 H H    . LEU A 1 47  ? -9.881  -2.588  -0.370  1.00 0.00 ? 830 LEU A H    8  
ATOM 11273 H HA   . LEU A 1 47  ? -7.059  -2.028  0.203   1.00 0.00 ? 830 LEU A HA   8  
ATOM 11274 H HB2  . LEU A 1 47  ? -8.695  -0.120  0.796   1.00 0.00 ? 830 LEU A HB2  8  
ATOM 11275 H HB3  . LEU A 1 47  ? -9.210  -1.178  2.108   1.00 0.00 ? 830 LEU A HB3  8  
ATOM 11276 H HG   . LEU A 1 47  ? -6.361  -0.273  1.730   1.00 0.00 ? 830 LEU A HG   8  
ATOM 11277 H HD11 . LEU A 1 47  ? -6.705  1.505   3.182   1.00 0.00 ? 830 LEU A HD11 8  
ATOM 11278 H HD12 . LEU A 1 47  ? -8.250  0.874   3.751   1.00 0.00 ? 830 LEU A HD12 8  
ATOM 11279 H HD13 . LEU A 1 47  ? -8.121  1.565   2.133   1.00 0.00 ? 830 LEU A HD13 8  
ATOM 11280 H HD21 . LEU A 1 47  ? -7.010  -0.837  4.409   1.00 0.00 ? 830 LEU A HD21 8  
ATOM 11281 H HD22 . LEU A 1 47  ? -5.948  -1.748  3.335   1.00 0.00 ? 830 LEU A HD22 8  
ATOM 11282 H HD23 . LEU A 1 47  ? -7.659  -2.163  3.443   1.00 0.00 ? 830 LEU A HD23 8  
ATOM 11283 N N    . ARG A 1 48  ? -6.938  -3.878  1.869   1.00 0.00 ? 831 ARG A N    8  
ATOM 11284 C CA   . ARG A 1 48  ? -6.849  -5.077  2.693   1.00 0.00 ? 831 ARG A CA   8  
ATOM 11285 C C    . ARG A 1 48  ? -5.811  -4.902  3.797   1.00 0.00 ? 831 ARG A C    8  
ATOM 11286 O O    . ARG A 1 48  ? -4.808  -4.210  3.618   1.00 0.00 ? 831 ARG A O    8  
ATOM 11287 C CB   . ARG A 1 48  ? -6.493  -6.289  1.830   1.00 0.00 ? 831 ARG A CB   8  
ATOM 11288 C CG   . ARG A 1 48  ? -5.035  -6.324  1.401   1.00 0.00 ? 831 ARG A CG   8  
ATOM 11289 C CD   . ARG A 1 48  ? -4.690  -7.631  0.706   1.00 0.00 ? 831 ARG A CD   8  
ATOM 11290 N NE   . ARG A 1 48  ? -5.061  -7.615  -0.707  1.00 0.00 ? 831 ARG A NE   8  
ATOM 11291 C CZ   . ARG A 1 48  ? -4.769  -8.595  -1.554  1.00 0.00 ? 831 ARG A CZ   8  
ATOM 11292 N NH1  . ARG A 1 48  ? -4.108  -9.665  -1.134  1.00 0.00 ? 831 ARG A NH1  8  
ATOM 11293 N NH2  . ARG A 1 48  ? -5.141  -8.508  -2.825  1.00 0.00 ? 831 ARG A NH2  8  
ATOM 11294 H H    . ARG A 1 48  ? -6.114  -3.413  1.611   1.00 0.00 ? 831 ARG A H    8  
ATOM 11295 H HA   . ARG A 1 48  ? -7.816  -5.240  3.146   1.00 0.00 ? 831 ARG A HA   8  
ATOM 11296 H HB2  . ARG A 1 48  ? -6.702  -7.189  2.390   1.00 0.00 ? 831 ARG A HB2  8  
ATOM 11297 H HB3  . ARG A 1 48  ? -7.107  -6.277  0.943   1.00 0.00 ? 831 ARG A HB3  8  
ATOM 11298 H HG2  . ARG A 1 48  ? -4.851  -5.507  0.718   1.00 0.00 ? 831 ARG A HG2  8  
ATOM 11299 H HG3  . ARG A 1 48  ? -4.410  -6.214  2.274   1.00 0.00 ? 831 ARG A HG3  8  
ATOM 11300 H HD2  . ARG A 1 48  ? -3.626  -7.797  0.787   1.00 0.00 ? 831 ARG A HD2  8  
ATOM 11301 H HD3  . ARG A 1 48  ? -5.218  -8.435  1.198   1.00 0.00 ? 831 ARG A HD3  8  
ATOM 11302 H HE   . ARG A 1 48  ? -5.550  -6.834  -1.039  1.00 0.00 ? 831 ARG A HE   8  
ATOM 11303 H HH11 . ARG A 1 48  ? -3.828  -9.734  -0.177  1.00 0.00 ? 831 ARG A HH11 8  
ATOM 11304 H HH12 . ARG A 1 48  ? -3.891  -10.402 -1.774  1.00 0.00 ? 831 ARG A HH12 8  
ATOM 11305 H HH21 . ARG A 1 48  ? -5.640  -7.703  -3.146  1.00 0.00 ? 831 ARG A HH21 8  
ATOM 11306 H HH22 . ARG A 1 48  ? -4.921  -9.246  -3.462  1.00 0.00 ? 831 ARG A HH22 8  
ATOM 11307 N N    . LEU A 1 49  ? -6.059  -5.533  4.940   1.00 0.00 ? 832 LEU A N    8  
ATOM 11308 C CA   . LEU A 1 49  ? -5.146  -5.448  6.075   1.00 0.00 ? 832 LEU A CA   8  
ATOM 11309 C C    . LEU A 1 49  ? -4.469  -6.790  6.331   1.00 0.00 ? 832 LEU A C    8  
ATOM 11310 O O    . LEU A 1 49  ? -5.079  -7.847  6.167   1.00 0.00 ? 832 LEU A O    8  
ATOM 11311 C CB   . LEU A 1 49  ? -5.899  -4.996  7.327   1.00 0.00 ? 832 LEU A CB   8  
ATOM 11312 C CG   . LEU A 1 49  ? -6.441  -3.566  7.306   1.00 0.00 ? 832 LEU A CG   8  
ATOM 11313 C CD1  . LEU A 1 49  ? -7.243  -3.280  8.566   1.00 0.00 ? 832 LEU A CD1  8  
ATOM 11314 C CD2  . LEU A 1 49  ? -5.302  -2.567  7.158   1.00 0.00 ? 832 LEU A CD2  8  
ATOM 11315 H H    . LEU A 1 49  ? -6.874  -6.069  5.023   1.00 0.00 ? 832 LEU A H    8  
ATOM 11316 H HA   . LEU A 1 49  ? -4.389  -4.716  5.836   1.00 0.00 ? 832 LEU A HA   8  
ATOM 11317 H HB2  . LEU A 1 49  ? -6.735  -5.664  7.469   1.00 0.00 ? 832 LEU A HB2  8  
ATOM 11318 H HB3  . LEU A 1 49  ? -5.225  -5.083  8.167   1.00 0.00 ? 832 LEU A HB3  8  
ATOM 11319 H HG   . LEU A 1 49  ? -7.101  -3.450  6.457   1.00 0.00 ? 832 LEU A HG   8  
ATOM 11320 H HD11 . LEU A 1 49  ? -8.100  -2.674  8.317   1.00 0.00 ? 832 LEU A HD11 8  
ATOM 11321 H HD12 . LEU A 1 49  ? -6.623  -2.753  9.275   1.00 0.00 ? 832 LEU A HD12 8  
ATOM 11322 H HD13 . LEU A 1 49  ? -7.574  -4.212  9.001   1.00 0.00 ? 832 LEU A HD13 8  
ATOM 11323 H HD21 . LEU A 1 49  ? -4.414  -2.962  7.629   1.00 0.00 ? 832 LEU A HD21 8  
ATOM 11324 H HD22 . LEU A 1 49  ? -5.577  -1.636  7.632   1.00 0.00 ? 832 LEU A HD22 8  
ATOM 11325 H HD23 . LEU A 1 49  ? -5.109  -2.395  6.110   1.00 0.00 ? 832 LEU A HD23 8  
ATOM 11326 N N    . VAL A 1 50  ? -3.204  -6.741  6.737   1.00 0.00 ? 833 VAL A N    8  
ATOM 11327 C CA   . VAL A 1 50  ? -2.444  -7.953  7.020   1.00 0.00 ? 833 VAL A CA   8  
ATOM 11328 C C    . VAL A 1 50  ? -2.584  -8.360  8.482   1.00 0.00 ? 833 VAL A C    8  
ATOM 11329 O O    . VAL A 1 50  ? -2.365  -7.555  9.387   1.00 0.00 ? 833 VAL A O    8  
ATOM 11330 C CB   . VAL A 1 50  ? -0.951  -7.769  6.690   1.00 0.00 ? 833 VAL A CB   8  
ATOM 11331 C CG1  . VAL A 1 50  ? -0.159  -9.004  7.092   1.00 0.00 ? 833 VAL A CG1  8  
ATOM 11332 C CG2  . VAL A 1 50  ? -0.766  -7.465  5.211   1.00 0.00 ? 833 VAL A CG2  8  
ATOM 11333 H H    . VAL A 1 50  ? -2.772  -5.869  6.850   1.00 0.00 ? 833 VAL A H    8  
ATOM 11334 H HA   . VAL A 1 50  ? -2.834  -8.744  6.397   1.00 0.00 ? 833 VAL A HA   8  
ATOM 11335 H HB   . VAL A 1 50  ? -0.579  -6.929  7.258   1.00 0.00 ? 833 VAL A HB   8  
ATOM 11336 H HG11 . VAL A 1 50  ? -0.760  -9.886  6.926   1.00 0.00 ? 833 VAL A HG11 8  
ATOM 11337 H HG12 . VAL A 1 50  ? 0.742   -9.063  6.499   1.00 0.00 ? 833 VAL A HG12 8  
ATOM 11338 H HG13 . VAL A 1 50  ? 0.102   -8.939  8.138   1.00 0.00 ? 833 VAL A HG13 8  
ATOM 11339 H HG21 . VAL A 1 50  ? -0.934  -8.363  4.636   1.00 0.00 ? 833 VAL A HG21 8  
ATOM 11340 H HG22 . VAL A 1 50  ? -1.473  -6.706  4.908   1.00 0.00 ? 833 VAL A HG22 8  
ATOM 11341 H HG23 . VAL A 1 50  ? 0.239   -7.109  5.040   1.00 0.00 ? 833 VAL A HG23 8  
ATOM 11342 N N    . THR A 1 51  ? -2.951  -9.618  8.708   1.00 0.00 ? 834 THR A N    8  
ATOM 11343 C CA   . THR A 1 51  ? -3.121  -10.134 10.061  1.00 0.00 ? 834 THR A CA   8  
ATOM 11344 C C    . THR A 1 51  ? -2.186  -11.310 10.322  1.00 0.00 ? 834 THR A C    8  
ATOM 11345 O O    . THR A 1 51  ? -1.412  -11.705 9.452   1.00 0.00 ? 834 THR A O    8  
ATOM 11346 C CB   . THR A 1 51  ? -4.573  -10.581 10.313  1.00 0.00 ? 834 THR A CB   8  
ATOM 11347 O OG1  . THR A 1 51  ? -4.870  -11.744 9.532   1.00 0.00 ? 834 THR A OG1  8  
ATOM 11348 C CG2  . THR A 1 51  ? -5.550  -9.467  9.966   1.00 0.00 ? 834 THR A CG2  8  
ATOM 11349 H H    . THR A 1 51  ? -3.111  -10.212 7.945   1.00 0.00 ? 834 THR A H    8  
ATOM 11350 H HA   . THR A 1 51  ? -2.886  -9.338  10.753  1.00 0.00 ? 834 THR A HA   8  
ATOM 11351 H HB   . THR A 1 51  ? -4.682  -10.822 11.361  1.00 0.00 ? 834 THR A HB   8  
ATOM 11352 H HG1  . THR A 1 51  ? -4.997  -12.497 10.114  1.00 0.00 ? 834 THR A HG1  8  
ATOM 11353 H HG21 . THR A 1 51  ? -5.875  -9.580  8.943   1.00 0.00 ? 834 THR A HG21 8  
ATOM 11354 H HG22 . THR A 1 51  ? -5.063  -8.511  10.087  1.00 0.00 ? 834 THR A HG22 8  
ATOM 11355 H HG23 . THR A 1 51  ? -6.405  -9.522  10.623  1.00 0.00 ? 834 THR A HG23 8  
ATOM 11356 N N    . ASN A 1 52  ? -2.265  -11.865 11.527  1.00 0.00 ? 835 ASN A N    8  
ATOM 11357 C CA   . ASN A 1 52  ? -1.425  -12.997 11.903  1.00 0.00 ? 835 ASN A CA   8  
ATOM 11358 C C    . ASN A 1 52  ? -2.276  -14.222 12.224  1.00 0.00 ? 835 ASN A C    8  
ATOM 11359 O O    . ASN A 1 52  ? -3.505  -14.160 12.202  1.00 0.00 ? 835 ASN A O    8  
ATOM 11360 C CB   . ASN A 1 52  ? -0.557  -12.635 13.110  1.00 0.00 ? 835 ASN A CB   8  
ATOM 11361 C CG   . ASN A 1 52  ? -1.358  -12.554 14.395  1.00 0.00 ? 835 ASN A CG   8  
ATOM 11362 O OD1  . ASN A 1 52  ? -1.239  -13.412 15.270  1.00 0.00 ? 835 ASN A OD1  8  
ATOM 11363 N ND2  . ASN A 1 52  ? -2.180  -11.518 14.515  1.00 0.00 ? 835 ASN A ND2  8  
ATOM 11364 H H    . ASN A 1 52  ? -2.902  -11.505 12.179  1.00 0.00 ? 835 ASN A H    8  
ATOM 11365 H HA   . ASN A 1 52  ? -0.784  -13.226 11.066  1.00 0.00 ? 835 ASN A HA   8  
ATOM 11366 H HB2  . ASN A 1 52  ? 0.209   -13.388 13.233  1.00 0.00 ? 835 ASN A HB2  8  
ATOM 11367 H HB3  . ASN A 1 52  ? -0.090  -11.678 12.937  1.00 0.00 ? 835 ASN A HB3  8  
ATOM 11368 H HD21 . ASN A 1 52  ? -2.223  -10.873 13.778  1.00 0.00 ? 835 ASN A HD21 8  
ATOM 11369 H HD22 . ASN A 1 52  ? -2.710  -11.440 15.336  1.00 0.00 ? 835 ASN A HD22 8  
ATOM 11370 N N    . ARG A 1 53  ? -1.612  -15.335 12.520  1.00 0.00 ? 836 ARG A N    8  
ATOM 11371 C CA   . ARG A 1 53  ? -2.307  -16.575 12.844  1.00 0.00 ? 836 ARG A CA   8  
ATOM 11372 C C    . ARG A 1 53  ? -3.368  -16.340 13.916  1.00 0.00 ? 836 ARG A C    8  
ATOM 11373 O O    . ARG A 1 53  ? -4.277  -17.150 14.091  1.00 0.00 ? 836 ARG A O    8  
ATOM 11374 C CB   . ARG A 1 53  ? -1.310  -17.633 13.322  1.00 0.00 ? 836 ARG A CB   8  
ATOM 11375 C CG   . ARG A 1 53  ? -1.930  -19.006 13.523  1.00 0.00 ? 836 ARG A CG   8  
ATOM 11376 C CD   . ARG A 1 53  ? -2.135  -19.724 12.198  1.00 0.00 ? 836 ARG A CD   8  
ATOM 11377 N NE   . ARG A 1 53  ? -2.875  -20.973 12.361  1.00 0.00 ? 836 ARG A NE   8  
ATOM 11378 C CZ   . ARG A 1 53  ? -3.262  -21.736 11.345  1.00 0.00 ? 836 ARG A CZ   8  
ATOM 11379 N NH1  . ARG A 1 53  ? -2.980  -21.380 10.099  1.00 0.00 ? 836 ARG A NH1  8  
ATOM 11380 N NH2  . ARG A 1 53  ? -3.932  -22.858 11.574  1.00 0.00 ? 836 ARG A NH2  8  
ATOM 11381 H H    . ARG A 1 53  ? -0.632  -15.322 12.521  1.00 0.00 ? 836 ARG A H    8  
ATOM 11382 H HA   . ARG A 1 53  ? -2.791  -16.929 11.947  1.00 0.00 ? 836 ARG A HA   8  
ATOM 11383 H HB2  . ARG A 1 53  ? -0.520  -17.723 12.590  1.00 0.00 ? 836 ARG A HB2  8  
ATOM 11384 H HB3  . ARG A 1 53  ? -0.886  -17.312 14.261  1.00 0.00 ? 836 ARG A HB3  8  
ATOM 11385 H HG2  . ARG A 1 53  ? -1.274  -19.600 14.143  1.00 0.00 ? 836 ARG A HG2  8  
ATOM 11386 H HG3  . ARG A 1 53  ? -2.885  -18.892 14.012  1.00 0.00 ? 836 ARG A HG3  8  
ATOM 11387 H HD2  . ARG A 1 53  ? -2.686  -19.075 11.534  1.00 0.00 ? 836 ARG A HD2  8  
ATOM 11388 H HD3  . ARG A 1 53  ? -1.169  -19.942 11.769  1.00 0.00 ? 836 ARG A HD3  8  
ATOM 11389 H HE   . ARG A 1 53  ? -3.094  -21.255 13.273  1.00 0.00 ? 836 ARG A HE   8  
ATOM 11390 H HH11 . ARG A 1 53  ? -2.474  -20.535 9.924   1.00 0.00 ? 836 ARG A HH11 8  
ATOM 11391 H HH12 . ARG A 1 53  ? -3.271  -21.957 9.336   1.00 0.00 ? 836 ARG A HH12 8  
ATOM 11392 H HH21 . ARG A 1 53  ? -4.146  -23.130 12.512  1.00 0.00 ? 836 ARG A HH21 8  
ATOM 11393 H HH22 . ARG A 1 53  ? -4.222  -23.432 10.809  1.00 0.00 ? 836 ARG A HH22 8  
ATOM 11394 N N    . ALA A 1 54  ? -3.244  -15.226 14.630  1.00 0.00 ? 837 ALA A N    8  
ATOM 11395 C CA   . ALA A 1 54  ? -4.192  -14.884 15.683  1.00 0.00 ? 837 ALA A CA   8  
ATOM 11396 C C    . ALA A 1 54  ? -5.349  -14.056 15.132  1.00 0.00 ? 837 ALA A C    8  
ATOM 11397 O O    . ALA A 1 54  ? -6.513  -14.330 15.420  1.00 0.00 ? 837 ALA A O    8  
ATOM 11398 C CB   . ALA A 1 54  ? -3.488  -14.131 16.802  1.00 0.00 ? 837 ALA A CB   8  
ATOM 11399 H H    . ALA A 1 54  ? -2.497  -14.619 14.443  1.00 0.00 ? 837 ALA A H    8  
ATOM 11400 H HA   . ALA A 1 54  ? -4.583  -15.804 16.091  1.00 0.00 ? 837 ALA A HA   8  
ATOM 11401 H HB1  . ALA A 1 54  ? -3.998  -14.319 17.736  1.00 0.00 ? 837 ALA A HB1  8  
ATOM 11402 H HB2  . ALA A 1 54  ? -2.466  -14.469 16.876  1.00 0.00 ? 837 ALA A HB2  8  
ATOM 11403 H HB3  . ALA A 1 54  ? -3.504  -13.073 16.590  1.00 0.00 ? 837 ALA A HB3  8  
ATOM 11404 N N    . GLY A 1 55  ? -5.019  -13.042 14.338  1.00 0.00 ? 838 GLY A N    8  
ATOM 11405 C CA   . GLY A 1 55  ? -6.042  -12.190 13.760  1.00 0.00 ? 838 GLY A CA   8  
ATOM 11406 C C    . GLY A 1 55  ? -5.709  -10.717 13.888  1.00 0.00 ? 838 GLY A C    8  
ATOM 11407 O O    . GLY A 1 55  ? -6.003  -9.926  12.991  1.00 0.00 ? 838 GLY A O    8  
ATOM 11408 H H    . GLY A 1 55  ? -4.074  -12.871 14.142  1.00 0.00 ? 838 GLY A H    8  
ATOM 11409 H HA2  . GLY A 1 55  ? -6.151  -12.435 12.714  1.00 0.00 ? 838 GLY A HA2  8  
ATOM 11410 H HA3  . GLY A 1 55  ? -6.979  -12.380 14.263  1.00 0.00 ? 838 GLY A HA3  8  
ATOM 11411 N N    . LYS A 1 56  ? -5.096  -10.345 15.006  1.00 0.00 ? 839 LYS A N    8  
ATOM 11412 C CA   . LYS A 1 56  ? -4.722  -8.957  15.249  1.00 0.00 ? 839 LYS A CA   8  
ATOM 11413 C C    . LYS A 1 56  ? -3.942  -8.388  14.069  1.00 0.00 ? 839 LYS A C    8  
ATOM 11414 O O    . LYS A 1 56  ? -3.356  -9.120  13.270  1.00 0.00 ? 839 LYS A O    8  
ATOM 11415 C CB   . LYS A 1 56  ? -3.886  -8.848  16.527  1.00 0.00 ? 839 LYS A CB   8  
ATOM 11416 C CG   . LYS A 1 56  ? -4.716  -8.859  17.799  1.00 0.00 ? 839 LYS A CG   8  
ATOM 11417 C CD   . LYS A 1 56  ? -4.068  -8.026  18.893  1.00 0.00 ? 839 LYS A CD   8  
ATOM 11418 C CE   . LYS A 1 56  ? -4.680  -8.322  20.254  1.00 0.00 ? 839 LYS A CE   8  
ATOM 11419 N NZ   . LYS A 1 56  ? -5.993  -7.641  20.431  1.00 0.00 ? 839 LYS A NZ   8  
ATOM 11420 H H    . LYS A 1 56  ? -4.888  -11.022 15.684  1.00 0.00 ? 839 LYS A H    8  
ATOM 11421 H HA   . LYS A 1 56  ? -5.630  -8.386  15.374  1.00 0.00 ? 839 LYS A HA   8  
ATOM 11422 H HB2  . LYS A 1 56  ? -3.198  -9.680  16.564  1.00 0.00 ? 839 LYS A HB2  8  
ATOM 11423 H HB3  . LYS A 1 56  ? -3.323  -7.927  16.496  1.00 0.00 ? 839 LYS A HB3  8  
ATOM 11424 H HG2  . LYS A 1 56  ? -5.693  -8.453  17.584  1.00 0.00 ? 839 LYS A HG2  8  
ATOM 11425 H HG3  . LYS A 1 56  ? -4.814  -9.878  18.145  1.00 0.00 ? 839 LYS A HG3  8  
ATOM 11426 H HD2  . LYS A 1 56  ? -3.013  -8.252  18.929  1.00 0.00 ? 839 LYS A HD2  8  
ATOM 11427 H HD3  . LYS A 1 56  ? -4.206  -6.979  18.666  1.00 0.00 ? 839 LYS A HD3  8  
ATOM 11428 H HE2  . LYS A 1 56  ? -4.822  -9.388  20.347  1.00 0.00 ? 839 LYS A HE2  8  
ATOM 11429 H HE3  . LYS A 1 56  ? -4.001  -7.980  21.021  1.00 0.00 ? 839 LYS A HE3  8  
ATOM 11430 H HZ1  . LYS A 1 56  ? -6.380  -7.366  19.506  1.00 0.00 ? 839 LYS A HZ1  8  
ATOM 11431 H HZ2  . LYS A 1 56  ? -5.878  -6.788  21.014  1.00 0.00 ? 839 LYS A HZ2  8  
ATOM 11432 H HZ3  . LYS A 1 56  ? -6.666  -8.280  20.901  1.00 0.00 ? 839 LYS A HZ3  8  
ATOM 11433 N N    . PRO A 1 57  ? -3.931  -7.052  13.954  1.00 0.00 ? 840 PRO A N    8  
ATOM 11434 C CA   . PRO A 1 57  ? -3.224  -6.356  12.875  1.00 0.00 ? 840 PRO A CA   8  
ATOM 11435 C C    . PRO A 1 57  ? -1.709  -6.454  13.016  1.00 0.00 ? 840 PRO A C    8  
ATOM 11436 O O    . PRO A 1 57  ? -1.134  -5.982  13.998  1.00 0.00 ? 840 PRO A O    8  
ATOM 11437 C CB   . PRO A 1 57  ? -3.682  -4.904  13.029  1.00 0.00 ? 840 PRO A CB   8  
ATOM 11438 C CG   . PRO A 1 57  ? -4.060  -4.776  14.465  1.00 0.00 ? 840 PRO A CG   8  
ATOM 11439 C CD   . PRO A 1 57  ? -4.607  -6.117  14.869  1.00 0.00 ? 840 PRO A CD   8  
ATOM 11440 H HA   . PRO A 1 57  ? -3.518  -6.727  11.904  1.00 0.00 ? 840 PRO A HA   8  
ATOM 11441 H HB2  . PRO A 1 57  ? -2.870  -4.238  12.773  1.00 0.00 ? 840 PRO A HB2  8  
ATOM 11442 H HB3  . PRO A 1 57  ? -4.525  -4.717  12.381  1.00 0.00 ? 840 PRO A HB3  8  
ATOM 11443 H HG2  . PRO A 1 57  ? -3.189  -4.534  15.054  1.00 0.00 ? 840 PRO A HG2  8  
ATOM 11444 H HG3  . PRO A 1 57  ? -4.816  -4.014  14.579  1.00 0.00 ? 840 PRO A HG3  8  
ATOM 11445 H HD2  . PRO A 1 57  ? -4.354  -6.334  15.897  1.00 0.00 ? 840 PRO A HD2  8  
ATOM 11446 H HD3  . PRO A 1 57  ? -5.677  -6.147  14.727  1.00 0.00 ? 840 PRO A HD3  8  
ATOM 11447 N N    . LYS A 1 58  ? -1.066  -7.070  12.030  1.00 0.00 ? 841 LYS A N    8  
ATOM 11448 C CA   . LYS A 1 58  ? 0.384   -7.229  12.043  1.00 0.00 ? 841 LYS A CA   8  
ATOM 11449 C C    . LYS A 1 58  ? 1.080   -5.901  11.762  1.00 0.00 ? 841 LYS A C    8  
ATOM 11450 O O    . LYS A 1 58  ? 2.291   -5.776  11.934  1.00 0.00 ? 841 LYS A O    8  
ATOM 11451 C CB   . LYS A 1 58  ? 0.812   -8.271  11.006  1.00 0.00 ? 841 LYS A CB   8  
ATOM 11452 C CG   . LYS A 1 58  ? 0.611   -9.704  11.466  1.00 0.00 ? 841 LYS A CG   8  
ATOM 11453 C CD   . LYS A 1 58  ? 1.246   -10.693 10.502  1.00 0.00 ? 841 LYS A CD   8  
ATOM 11454 C CE   . LYS A 1 58  ? 2.757   -10.739 10.665  1.00 0.00 ? 841 LYS A CE   8  
ATOM 11455 N NZ   . LYS A 1 58  ? 3.163   -11.539 11.854  1.00 0.00 ? 841 LYS A NZ   8  
ATOM 11456 H H    . LYS A 1 58  ? -1.579  -7.426  11.274  1.00 0.00 ? 841 LYS A H    8  
ATOM 11457 H HA   . LYS A 1 58  ? 0.671   -7.572  13.025  1.00 0.00 ? 841 LYS A HA   8  
ATOM 11458 H HB2  . LYS A 1 58  ? 0.238   -8.120  10.104  1.00 0.00 ? 841 LYS A HB2  8  
ATOM 11459 H HB3  . LYS A 1 58  ? 1.860   -8.130  10.784  1.00 0.00 ? 841 LYS A HB3  8  
ATOM 11460 H HG2  . LYS A 1 58  ? 1.062   -9.828  12.439  1.00 0.00 ? 841 LYS A HG2  8  
ATOM 11461 H HG3  . LYS A 1 58  ? -0.449  -9.907  11.529  1.00 0.00 ? 841 LYS A HG3  8  
ATOM 11462 H HD2  . LYS A 1 58  ? 0.845   -11.677 10.693  1.00 0.00 ? 841 LYS A HD2  8  
ATOM 11463 H HD3  . LYS A 1 58  ? 1.011   -10.397 9.489   1.00 0.00 ? 841 LYS A HD3  8  
ATOM 11464 H HE2  . LYS A 1 58  ? 3.189   -11.180 9.780   1.00 0.00 ? 841 LYS A HE2  8  
ATOM 11465 H HE3  . LYS A 1 58  ? 3.124   -9.729  10.779  1.00 0.00 ? 841 LYS A HE3  8  
ATOM 11466 H HZ1  . LYS A 1 58  ? 4.194   -11.495 11.979  1.00 0.00 ? 841 LYS A HZ1  8  
ATOM 11467 H HZ2  . LYS A 1 58  ? 2.882   -12.532 11.728  1.00 0.00 ? 841 LYS A HZ2  8  
ATOM 11468 H HZ3  . LYS A 1 58  ? 2.704   -11.166 12.710  1.00 0.00 ? 841 LYS A HZ3  8  
ATOM 11469 N N    . GLY A 1 59  ? 0.304   -4.912  11.330  1.00 0.00 ? 842 GLY A N    8  
ATOM 11470 C CA   . GLY A 1 59  ? 0.864   -3.606  11.034  1.00 0.00 ? 842 GLY A CA   8  
ATOM 11471 C C    . GLY A 1 59  ? 0.886   -3.308  9.548   1.00 0.00 ? 842 GLY A C    8  
ATOM 11472 O O    . GLY A 1 59  ? 0.630   -2.178  9.130   1.00 0.00 ? 842 GLY A O    8  
ATOM 11473 H H    . GLY A 1 59  ? -0.656  -5.069  11.211  1.00 0.00 ? 842 GLY A H    8  
ATOM 11474 H HA2  . GLY A 1 59  ? 0.273   -2.852  11.533  1.00 0.00 ? 842 GLY A HA2  8  
ATOM 11475 H HA3  . GLY A 1 59  ? 1.875   -3.566  11.413  1.00 0.00 ? 842 GLY A HA3  8  
ATOM 11476 N N    . LEU A 1 60  ? 1.194   -4.322  8.748   1.00 0.00 ? 843 LEU A N    8  
ATOM 11477 C CA   . LEU A 1 60  ? 1.251   -4.163  7.299   1.00 0.00 ? 843 LEU A CA   8  
ATOM 11478 C C    . LEU A 1 60  ? -0.145  -3.958  6.718   1.00 0.00 ? 843 LEU A C    8  
ATOM 11479 O O    . LEU A 1 60  ? -1.093  -4.644  7.098   1.00 0.00 ? 843 LEU A O    8  
ATOM 11480 C CB   . LEU A 1 60  ? 1.907   -5.387  6.657   1.00 0.00 ? 843 LEU A CB   8  
ATOM 11481 C CG   . LEU A 1 60  ? 3.245   -5.822  7.255   1.00 0.00 ? 843 LEU A CG   8  
ATOM 11482 C CD1  . LEU A 1 60  ? 3.667   -7.172  6.696   1.00 0.00 ? 843 LEU A CD1  8  
ATOM 11483 C CD2  . LEU A 1 60  ? 4.315   -4.774  6.987   1.00 0.00 ? 843 LEU A CD2  8  
ATOM 11484 H H    . LEU A 1 60  ? 1.388   -5.199  9.139   1.00 0.00 ? 843 LEU A H    8  
ATOM 11485 H HA   . LEU A 1 60  ? 1.849   -3.290  7.084   1.00 0.00 ? 843 LEU A HA   8  
ATOM 11486 H HB2  . LEU A 1 60  ? 1.221   -6.215  6.746   1.00 0.00 ? 843 LEU A HB2  8  
ATOM 11487 H HB3  . LEU A 1 60  ? 2.067   -5.165  5.611   1.00 0.00 ? 843 LEU A HB3  8  
ATOM 11488 H HG   . LEU A 1 60  ? 3.137   -5.924  8.326   1.00 0.00 ? 843 LEU A HG   8  
ATOM 11489 H HD11 . LEU A 1 60  ? 2.791   -7.724  6.391   1.00 0.00 ? 843 LEU A HD11 8  
ATOM 11490 H HD12 . LEU A 1 60  ? 4.197   -7.727  7.455   1.00 0.00 ? 843 LEU A HD12 8  
ATOM 11491 H HD13 . LEU A 1 60  ? 4.313   -7.022  5.843   1.00 0.00 ? 843 LEU A HD13 8  
ATOM 11492 H HD21 . LEU A 1 60  ? 5.162   -5.239  6.505   1.00 0.00 ? 843 LEU A HD21 8  
ATOM 11493 H HD22 . LEU A 1 60  ? 4.631   -4.334  7.922   1.00 0.00 ? 843 LEU A HD22 8  
ATOM 11494 H HD23 . LEU A 1 60  ? 3.913   -4.005  6.345   1.00 0.00 ? 843 LEU A HD23 8  
ATOM 11495 N N    . ALA A 1 61  ? -0.262  -3.010  5.794   1.00 0.00 ? 844 ALA A N    8  
ATOM 11496 C CA   . ALA A 1 61  ? -1.541  -2.717  5.158   1.00 0.00 ? 844 ALA A CA   8  
ATOM 11497 C C    . ALA A 1 61  ? -1.379  -2.551  3.651   1.00 0.00 ? 844 ALA A C    8  
ATOM 11498 O O    . ALA A 1 61  ? -0.424  -1.930  3.184   1.00 0.00 ? 844 ALA A O    8  
ATOM 11499 C CB   . ALA A 1 61  ? -2.158  -1.465  5.765   1.00 0.00 ? 844 ALA A CB   8  
ATOM 11500 H H    . ALA A 1 61  ? 0.530   -2.496  5.533   1.00 0.00 ? 844 ALA A H    8  
ATOM 11501 H HA   . ALA A 1 61  ? -2.206  -3.546  5.350   1.00 0.00 ? 844 ALA A HA   8  
ATOM 11502 H HB1  . ALA A 1 61  ? -2.251  -1.594  6.834   1.00 0.00 ? 844 ALA A HB1  8  
ATOM 11503 H HB2  . ALA A 1 61  ? -1.525  -0.615  5.558   1.00 0.00 ? 844 ALA A HB2  8  
ATOM 11504 H HB3  . ALA A 1 61  ? -3.134  -1.301  5.335   1.00 0.00 ? 844 ALA A HB3  8  
ATOM 11505 N N    . TYR A 1 62  ? -2.317  -3.110  2.895   1.00 0.00 ? 845 TYR A N    8  
ATOM 11506 C CA   . TYR A 1 62  ? -2.276  -3.027  1.440   1.00 0.00 ? 845 TYR A CA   8  
ATOM 11507 C C    . TYR A 1 62  ? -3.392  -2.129  0.914   1.00 0.00 ? 845 TYR A C    8  
ATOM 11508 O O    . TYR A 1 62  ? -4.511  -2.144  1.428   1.00 0.00 ? 845 TYR A O    8  
ATOM 11509 C CB   . TYR A 1 62  ? -2.397  -4.422  0.825   1.00 0.00 ? 845 TYR A CB   8  
ATOM 11510 C CG   . TYR A 1 62  ? -1.066  -5.108  0.614   1.00 0.00 ? 845 TYR A CG   8  
ATOM 11511 C CD1  . TYR A 1 62  ? -0.423  -5.758  1.660   1.00 0.00 ? 845 TYR A CD1  8  
ATOM 11512 C CD2  . TYR A 1 62  ? -0.451  -5.106  -0.633  1.00 0.00 ? 845 TYR A CD2  8  
ATOM 11513 C CE1  . TYR A 1 62  ? 0.793   -6.385  1.471   1.00 0.00 ? 845 TYR A CE1  8  
ATOM 11514 C CE2  . TYR A 1 62  ? 0.764   -5.732  -0.831  1.00 0.00 ? 845 TYR A CE2  8  
ATOM 11515 C CZ   . TYR A 1 62  ? 1.383   -6.370  0.224   1.00 0.00 ? 845 TYR A CZ   8  
ATOM 11516 O OH   . TYR A 1 62  ? 2.594   -6.994  0.032   1.00 0.00 ? 845 TYR A OH   8  
ATOM 11517 H H    . TYR A 1 62  ? -3.054  -3.592  3.326   1.00 0.00 ? 845 TYR A H    8  
ATOM 11518 H HA   . TYR A 1 62  ? -1.324  -2.601  1.159   1.00 0.00 ? 845 TYR A HA   8  
ATOM 11519 H HB2  . TYR A 1 62  ? -2.990  -5.045  1.476   1.00 0.00 ? 845 TYR A HB2  8  
ATOM 11520 H HB3  . TYR A 1 62  ? -2.886  -4.344  -0.135  1.00 0.00 ? 845 TYR A HB3  8  
ATOM 11521 H HD1  . TYR A 1 62  ? -0.888  -5.769  2.635   1.00 0.00 ? 845 TYR A HD1  8  
ATOM 11522 H HD2  . TYR A 1 62  ? -0.938  -4.606  -1.457  1.00 0.00 ? 845 TYR A HD2  8  
ATOM 11523 H HE1  . TYR A 1 62  ? 1.277   -6.885  2.297   1.00 0.00 ? 845 TYR A HE1  8  
ATOM 11524 H HE2  . TYR A 1 62  ? 1.227   -5.719  -1.807  1.00 0.00 ? 845 TYR A HE2  8  
ATOM 11525 H HH   . TYR A 1 62  ? 3.218   -6.694  0.697   1.00 0.00 ? 845 TYR A HH   8  
ATOM 11526 N N    . VAL A 1 63  ? -3.079  -1.348  -0.115  1.00 0.00 ? 846 VAL A N    8  
ATOM 11527 C CA   . VAL A 1 63  ? -4.054  -0.444  -0.713  1.00 0.00 ? 846 VAL A CA   8  
ATOM 11528 C C    . VAL A 1 63  ? -4.111  -0.621  -2.226  1.00 0.00 ? 846 VAL A C    8  
ATOM 11529 O O    . VAL A 1 63  ? -3.137  -1.043  -2.848  1.00 0.00 ? 846 VAL A O    8  
ATOM 11530 C CB   . VAL A 1 63  ? -3.727  1.026   -0.391  1.00 0.00 ? 846 VAL A CB   8  
ATOM 11531 C CG1  . VAL A 1 63  ? -4.749  1.953   -1.032  1.00 0.00 ? 846 VAL A CG1  8  
ATOM 11532 C CG2  . VAL A 1 63  ? -3.670  1.242   1.114   1.00 0.00 ? 846 VAL A CG2  8  
ATOM 11533 H H    . VAL A 1 63  ? -2.170  -1.381  -0.481  1.00 0.00 ? 846 VAL A H    8  
ATOM 11534 H HA   . VAL A 1 63  ? -5.023  -0.675  -0.296  1.00 0.00 ? 846 VAL A HA   8  
ATOM 11535 H HB   . VAL A 1 63  ? -2.756  1.257   -0.803  1.00 0.00 ? 846 VAL A HB   8  
ATOM 11536 H HG11 . VAL A 1 63  ? -5.743  1.565   -0.862  1.00 0.00 ? 846 VAL A HG11 8  
ATOM 11537 H HG12 . VAL A 1 63  ? -4.666  2.938   -0.595  1.00 0.00 ? 846 VAL A HG12 8  
ATOM 11538 H HG13 . VAL A 1 63  ? -4.563  2.013   -2.094  1.00 0.00 ? 846 VAL A HG13 8  
ATOM 11539 H HG21 . VAL A 1 63  ? -3.006  2.064   1.334   1.00 0.00 ? 846 VAL A HG21 8  
ATOM 11540 H HG22 . VAL A 1 63  ? -4.660  1.470   1.483   1.00 0.00 ? 846 VAL A HG22 8  
ATOM 11541 H HG23 . VAL A 1 63  ? -3.306  0.345   1.593   1.00 0.00 ? 846 VAL A HG23 8  
ATOM 11542 N N    . GLU A 1 64  ? -5.259  -0.294  -2.812  1.00 0.00 ? 847 GLU A N    8  
ATOM 11543 C CA   . GLU A 1 64  ? -5.443  -0.417  -4.253  1.00 0.00 ? 847 GLU A CA   8  
ATOM 11544 C C    . GLU A 1 64  ? -6.201  0.785   -4.809  1.00 0.00 ? 847 GLU A C    8  
ATOM 11545 O O    . GLU A 1 64  ? -7.401  0.936   -4.580  1.00 0.00 ? 847 GLU A O    8  
ATOM 11546 C CB   . GLU A 1 64  ? -6.196  -1.707  -