data_2DOS
# 
_entry.id   2DOS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DOS         
RCSB  RCSB025665   
WWPDB D_1000025665 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DOS 
_pdbx_database_status.recvd_initial_deposition_date   2006-05-03 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Sumiyoshi, A.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Mode of substrate recognition by the Josephin domain of ataxin-3, which has an endo-type deubiquitinase activity.' 
_citation.journal_abbrev            'Febs Lett.' 
_citation.journal_volume            588 
_citation.page_first                4422 
_citation.page_last                 4430 
_citation.year                      2014 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25448680 
_citation.pdbx_database_id_DOI      10.1016/j.febslet.2014.10.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Satoh, T.'       1  
primary 'Sumiyoshi, A.'   2  
primary 'Yagi-Utsumi, M.' 3  
primary 'Sakata, E.'      4  
primary 'Sasakawa, H.'    5  
primary 'Kurimoto, E.'    6  
primary 'Yamaguchi, Y.'   7  
primary 'Li, W.'          8  
primary 'Joazeiro, C.A.'  9  
primary 'Hirokawa, T.'    10 
primary 'Kato, K.'        11 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Ataxin-3 
_entity.formula_weight             20162.674 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.4.22.- 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Josephin domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Machado-Joseph disease protein 1, Spinocerebellar ataxia type 3 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFF
SIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQL
QQEGYSIFVVKGDLPD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFF
SIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQL
QQEGYSIFVVKGDLPD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   GLU n 
1 8   SER n 
1 9   ILE n 
1 10  PHE n 
1 11  HIS n 
1 12  GLU n 
1 13  LYS n 
1 14  GLN n 
1 15  GLU n 
1 16  GLY n 
1 17  SER n 
1 18  LEU n 
1 19  CYS n 
1 20  ALA n 
1 21  GLN n 
1 22  HIS n 
1 23  CYS n 
1 24  LEU n 
1 25  ASN n 
1 26  ASN n 
1 27  LEU n 
1 28  LEU n 
1 29  GLN n 
1 30  GLY n 
1 31  GLU n 
1 32  TYR n 
1 33  PHE n 
1 34  SER n 
1 35  PRO n 
1 36  VAL n 
1 37  GLU n 
1 38  LEU n 
1 39  SER n 
1 40  SER n 
1 41  ILE n 
1 42  ALA n 
1 43  HIS n 
1 44  GLN n 
1 45  LEU n 
1 46  ASP n 
1 47  GLU n 
1 48  GLU n 
1 49  GLU n 
1 50  ARG n 
1 51  MET n 
1 52  ARG n 
1 53  MET n 
1 54  ALA n 
1 55  GLU n 
1 56  GLY n 
1 57  GLY n 
1 58  VAL n 
1 59  THR n 
1 60  SER n 
1 61  GLU n 
1 62  ASP n 
1 63  TYR n 
1 64  ARG n 
1 65  THR n 
1 66  PHE n 
1 67  LEU n 
1 68  GLN n 
1 69  GLN n 
1 70  PRO n 
1 71  SER n 
1 72  GLY n 
1 73  ASN n 
1 74  MET n 
1 75  ASP n 
1 76  ASP n 
1 77  SER n 
1 78  GLY n 
1 79  PHE n 
1 80  PHE n 
1 81  SER n 
1 82  ILE n 
1 83  GLN n 
1 84  VAL n 
1 85  ILE n 
1 86  SER n 
1 87  ASN n 
1 88  ALA n 
1 89  LEU n 
1 90  LYS n 
1 91  VAL n 
1 92  TRP n 
1 93  GLY n 
1 94  LEU n 
1 95  GLU n 
1 96  LEU n 
1 97  ILE n 
1 98  LEU n 
1 99  PHE n 
1 100 ASN n 
1 101 SER n 
1 102 PRO n 
1 103 GLU n 
1 104 TYR n 
1 105 GLN n 
1 106 ARG n 
1 107 LEU n 
1 108 ARG n 
1 109 ILE n 
1 110 ASP n 
1 111 PRO n 
1 112 ILE n 
1 113 ASN n 
1 114 GLU n 
1 115 ARG n 
1 116 SER n 
1 117 PHE n 
1 118 ILE n 
1 119 CYS n 
1 120 ASN n 
1 121 TYR n 
1 122 LYS n 
1 123 GLU n 
1 124 HIS n 
1 125 TRP n 
1 126 PHE n 
1 127 THR n 
1 128 VAL n 
1 129 ARG n 
1 130 LYS n 
1 131 LEU n 
1 132 GLY n 
1 133 LYS n 
1 134 GLN n 
1 135 TRP n 
1 136 PHE n 
1 137 ASN n 
1 138 LEU n 
1 139 ASN n 
1 140 SER n 
1 141 LEU n 
1 142 LEU n 
1 143 THR n 
1 144 GLY n 
1 145 PRO n 
1 146 GLU n 
1 147 LEU n 
1 148 ILE n 
1 149 SER n 
1 150 ASP n 
1 151 THR n 
1 152 TYR n 
1 153 LEU n 
1 154 ALA n 
1 155 LEU n 
1 156 PHE n 
1 157 LEU n 
1 158 ALA n 
1 159 GLN n 
1 160 LEU n 
1 161 GLN n 
1 162 GLN n 
1 163 GLU n 
1 164 GLY n 
1 165 TYR n 
1 166 SER n 
1 167 ILE n 
1 168 PHE n 
1 169 VAL n 
1 170 VAL n 
1 171 LYS n 
1 172 GLY n 
1 173 ASP n 
1 174 LEU n 
1 175 PRO n 
1 176 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ATX3_HUMAN 
_struct_ref.pdbx_db_accession          P54252 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVI
SNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGY
SIFVVKGDLPD
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DOS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 176 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P54252 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  171 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       171 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DOS GLY A 1 ? UNP P54252 ? ? 'CLONING ARTIFACT' -4 1 
1 2DOS PRO A 2 ? UNP P54252 ? ? 'CLONING ARTIFACT' -3 2 
1 2DOS LEU A 3 ? UNP P54252 ? ? 'CLONING ARTIFACT' -2 3 
1 2DOS GLY A 4 ? UNP P54252 ? ? 'CLONING ARTIFACT' -1 4 
1 2DOS SER A 5 ? UNP P54252 ? ? 'CLONING ARTIFACT' 0  5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
3 1 '2D NOESY'             2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '10mM Sodium phosphate buffer' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.2mM Josephin domain U-15N,13C; 10mM Sodium phosphate buffer; 90% H2O, 10% D2O' '90% H2O/10% D2O' 
2 '1.2mM Josephin domain U-15N,13C; 10mM Sodium phosphate buffer; 99% D2O'          '99% D2O'         
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 ECA    JEOL   920 ? 
2 Avance Bruker 600 ? 
3 DMX    Bruker 500 ? 
# 
_pdbx_nmr_refine.entry_id           2DOS 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DOS 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DOS 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6   ?        1 
processing           NMRPipe 2.3   Delaglio 2 
'structure solution' CYANA   2.1   Guntert  3 
collection           DELTA   4.3.3 ?        4 
refinement           CYANA   2.1   Guntert  5 
# 
_exptl.entry_id          2DOS 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DOS 
_struct.title                     
;Structural basis for the recognition of Lys48-linked polyubiquitin chain by the Josephin domain of ataxin-3, a putative deubiquitinating enzyme
;
_struct.pdbx_descriptor           'Ataxin-3 (E.C.3.4.22.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DOS 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Deubiquitinating enzyme, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 19  ? LEU A 28  ? CYS A 14  LEU A 23  1 ? 10 
HELX_P HELX_P2 2 SER A 34  ? GLU A 55  ? SER A 29  GLU A 50  1 ? 22 
HELX_P HELX_P3 3 THR A 59  ? GLN A 68  ? THR A 54  GLN A 63  1 ? 10 
HELX_P HELX_P4 4 SER A 81  ? VAL A 91  ? SER A 76  VAL A 86  1 ? 11 
HELX_P HELX_P5 5 SER A 101 ? ARG A 108 ? SER A 96  ARG A 103 1 ? 8  
HELX_P HELX_P6 6 SER A 149 ? GLY A 164 ? SER A 144 GLY A 159 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 95  ? LEU A 98  ? GLU A 90  LEU A 93  
A 2 SER A 166 ? LYS A 171 ? SER A 161 LYS A 166 
A 3 SER A 116 ? TYR A 121 ? SER A 111 TYR A 116 
A 4 HIS A 124 ? LEU A 131 ? HIS A 119 LEU A 126 
A 5 GLN A 134 ? LEU A 138 ? GLN A 129 LEU A 133 
A 6 GLU A 146 ? ILE A 148 ? GLU A 141 ILE A 143 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 95  ? N GLU A 90  O LYS A 171 ? O LYS A 166 
A 2 3 O PHE A 168 ? O PHE A 163 N ILE A 118 ? N ILE A 113 
A 3 4 N PHE A 117 ? N PHE A 112 O VAL A 128 ? O VAL A 123 
A 4 5 N ARG A 129 ? N ARG A 124 O PHE A 136 ? O PHE A 131 
A 5 6 N TRP A 135 ? N TRP A 130 O ILE A 148 ? O ILE A 143 
# 
_database_PDB_matrix.entry_id          2DOS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DOS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 6   ? -9.857  -24.123 6.209   1.00 0.00  ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 6   ? -8.704  -23.293 6.536   1.00 52.33 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 6   ? -7.404  -24.071 6.352   1.00 2.21  ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 6   ? -6.394  -23.769 6.986   1.00 71.32 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 6   ? -8.806  -22.783 7.975   1.00 15.44 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 6   ? -9.020  -23.888 8.997   1.00 14.21 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 6   ? -10.748 -24.063 9.481   1.00 61.42 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 6   ? -10.592 -25.112 10.924  1.00 44.34 ? 1   MET A CE   1  
ATOM 9     H H    . MET A 1 6   ? -10.320 -23.982 5.357   1.00 20.41 ? 1   MET A H    1  
ATOM 10    H HA   . MET A 1 6   ? -8.702  -22.448 5.865   1.00 2.35  ? 1   MET A HA   1  
ATOM 11    H HB3  . MET A 1 6   ? -9.635  -22.095 8.043   1.00 35.23 ? 1   MET A HB3  1  
ATOM 12    H HG3  . MET A 1 6   ? -8.435  -23.665 9.877   1.00 45.41 ? 1   MET A HG3  1  
ATOM 13    H HE1  . MET A 1 6   ? -9.564  -25.427 11.031  1.00 63.31 ? 1   MET A HE1  1  
ATOM 14    H HE2  . MET A 1 6   ? -10.893 -24.562 11.802  1.00 72.44 ? 1   MET A HE2  1  
ATOM 15    H HE3  . MET A 1 6   ? -11.224 -25.980 10.807  1.00 51.21 ? 1   MET A HE3  1  
ATOM 16    N N    . GLU A 1 7   ? -7.439  -25.074 5.479   1.00 25.12 ? 2   GLU A N    1  
ATOM 17    C CA   . GLU A 1 7   ? -6.263  -25.895 5.212   1.00 23.40 ? 2   GLU A CA   1  
ATOM 18    C C    . GLU A 1 7   ? -5.499  -25.373 4.000   1.00 42.35 ? 2   GLU A C    1  
ATOM 19    O O    . GLU A 1 7   ? -4.717  -26.099 3.385   1.00 35.34 ? 2   GLU A O    1  
ATOM 20    C CB   . GLU A 1 7   ? -6.673  -27.351 4.983   1.00 41.32 ? 2   GLU A CB   1  
ATOM 21    C CG   . GLU A 1 7   ? -7.668  -27.532 3.848   1.00 0.21  ? 2   GLU A CG   1  
ATOM 22    C CD   . GLU A 1 7   ? -8.038  -28.985 3.623   1.00 40.24 ? 2   GLU A CD   1  
ATOM 23    O OE1  . GLU A 1 7   ? -8.477  -29.642 4.591   1.00 24.43 ? 2   GLU A OE1  1  
ATOM 24    O OE2  . GLU A 1 7   ? -7.888  -29.466 2.481   1.00 33.13 ? 2   GLU A OE2  1  
ATOM 25    H H    . GLU A 1 7   ? -8.274  -25.265 5.003   1.00 52.41 ? 2   GLU A H    1  
ATOM 26    H HA   . GLU A 1 7   ? -5.621  -25.844 6.078   1.00 3.12  ? 2   GLU A HA   1  
ATOM 27    H HB3  . GLU A 1 7   ? -7.120  -27.734 5.889   1.00 45.35 ? 2   GLU A HB3  1  
ATOM 28    H HG3  . GLU A 1 7   ? -7.234  -27.142 2.939   1.00 51.04 ? 2   GLU A HG3  1  
ATOM 29    N N    . SER A 1 8   ? -5.730  -24.108 3.661   1.00 42.50 ? 3   SER A N    1  
ATOM 30    C CA   . SER A 1 8   ? -5.066  -23.489 2.519   1.00 52.02 ? 3   SER A CA   1  
ATOM 31    C C    . SER A 1 8   ? -4.170  -22.340 2.970   1.00 65.42 ? 3   SER A C    1  
ATOM 32    O O    . SER A 1 8   ? -3.283  -21.905 2.235   1.00 44.20 ? 3   SER A O    1  
ATOM 33    C CB   . SER A 1 8   ? -6.102  -22.980 1.515   1.00 51.41 ? 3   SER A CB   1  
ATOM 34    O OG   . SER A 1 8   ? -5.661  -23.178 0.183   1.00 60.25 ? 3   SER A OG   1  
ATOM 35    H H    . SER A 1 8   ? -6.363  -23.580 4.191   1.00 0.25  ? 3   SER A H    1  
ATOM 36    H HA   . SER A 1 8   ? -4.454  -24.241 2.043   1.00 34.41 ? 3   SER A HA   1  
ATOM 37    H HB3  . SER A 1 8   ? -6.265  -21.924 1.675   1.00 21.44 ? 3   SER A HB3  1  
ATOM 38    H HG   . SER A 1 8   ? -6.062  -22.519 -0.388  1.00 63.04 ? 3   SER A HG   1  
ATOM 39    N N    . ILE A 1 9   ? -4.409  -21.851 4.182   1.00 75.11 ? 4   ILE A N    1  
ATOM 40    C CA   . ILE A 1 9   ? -3.623  -20.754 4.732   1.00 24.53 ? 4   ILE A CA   1  
ATOM 41    C C    . ILE A 1 9   ? -2.267  -21.242 5.228   1.00 25.21 ? 4   ILE A C    1  
ATOM 42    O O    . ILE A 1 9   ? -2.181  -22.223 5.967   1.00 12.44 ? 4   ILE A O    1  
ATOM 43    C CB   . ILE A 1 9   ? -4.361  -20.058 5.891   1.00 10.15 ? 4   ILE A CB   1  
ATOM 44    C CG1  . ILE A 1 9   ? -5.816  -19.782 5.505   1.00 64.44 ? 4   ILE A CG1  1  
ATOM 45    C CG2  . ILE A 1 9   ? -3.654  -18.766 6.271   1.00 45.31 ? 4   ILE A CG2  1  
ATOM 46    C CD1  . ILE A 1 9   ? -6.614  -19.106 6.599   1.00 43.35 ? 4   ILE A CD1  1  
ATOM 47    H H    . ILE A 1 9   ? -5.130  -22.240 4.720   1.00 42.24 ? 4   ILE A H    1  
ATOM 48    H HA   . ILE A 1 9   ? -3.467  -20.029 3.945   1.00 73.40 ? 4   ILE A HA   1  
ATOM 49    H HB   . ILE A 1 9   ? -4.343  -20.715 6.746   1.00 55.33 ? 4   ILE A HB   1  
ATOM 50    H HG13 . ILE A 1 9   ? -6.302  -20.717 5.269   1.00 70.15 ? 4   ILE A HG13 1  
ATOM 51    H HG21 . ILE A 1 9   ? -2.643  -18.987 6.582   1.00 34.20 ? 4   ILE A HG21 1  
ATOM 52    H HG22 . ILE A 1 9   ? -3.630  -18.105 5.418   1.00 21.32 ? 4   ILE A HG22 1  
ATOM 53    H HG23 . ILE A 1 9   ? -4.184  -18.290 7.082   1.00 62.30 ? 4   ILE A HG23 1  
ATOM 54    H HD11 . ILE A 1 9   ? -6.625  -18.040 6.431   1.00 24.03 ? 4   ILE A HD11 1  
ATOM 55    H HD12 . ILE A 1 9   ? -7.625  -19.484 6.595   1.00 64.31 ? 4   ILE A HD12 1  
ATOM 56    H HD13 . ILE A 1 9   ? -6.156  -19.313 7.557   1.00 31.53 ? 4   ILE A HD13 1  
ATOM 57    N N    . PHE A 1 10  ? -1.209  -20.550 4.819   1.00 71.45 ? 5   PHE A N    1  
ATOM 58    C CA   . PHE A 1 10  ? 0.145   -20.913 5.223   1.00 22.42 ? 5   PHE A CA   1  
ATOM 59    C C    . PHE A 1 10  ? 0.346   -20.683 6.718   1.00 1.14  ? 5   PHE A C    1  
ATOM 60    O O    . PHE A 1 10  ? 0.373   -19.544 7.185   1.00 25.02 ? 5   PHE A O    1  
ATOM 61    C CB   . PHE A 1 10  ? 1.171   -20.103 4.428   1.00 64.42 ? 5   PHE A CB   1  
ATOM 62    C CG   . PHE A 1 10  ? 2.006   -20.938 3.500   1.00 33.43 ? 5   PHE A CG   1  
ATOM 63    C CD1  . PHE A 1 10  ? 1.409   -21.717 2.522   1.00 30.44 ? 5   PHE A CD1  1  
ATOM 64    C CD2  . PHE A 1 10  ? 3.387   -20.943 3.605   1.00 54.52 ? 5   PHE A CD2  1  
ATOM 65    C CE1  . PHE A 1 10  ? 2.175   -22.487 1.668   1.00 10.43 ? 5   PHE A CE1  1  
ATOM 66    C CE2  . PHE A 1 10  ? 4.158   -21.713 2.754   1.00 64.22 ? 5   PHE A CE2  1  
ATOM 67    C CZ   . PHE A 1 10  ? 3.551   -22.484 1.782   1.00 31.31 ? 5   PHE A CZ   1  
ATOM 68    H H    . PHE A 1 10  ? -1.342  -19.777 4.231   1.00 31.12 ? 5   PHE A H    1  
ATOM 69    H HA   . PHE A 1 10  ? 0.284   -21.961 5.010   1.00 21.34 ? 5   PHE A HA   1  
ATOM 70    H HB3  . PHE A 1 10  ? 1.835   -19.603 5.116   1.00 42.45 ? 5   PHE A HB3  1  
ATOM 71    H HD1  . PHE A 1 10  ? 0.332   -21.719 2.429   1.00 71.05 ? 5   PHE A HD1  1  
ATOM 72    H HD2  . PHE A 1 10  ? 3.863   -20.340 4.366   1.00 2.13  ? 5   PHE A HD2  1  
ATOM 73    H HE1  . PHE A 1 10  ? 1.698   -23.089 0.908   1.00 33.44 ? 5   PHE A HE1  1  
ATOM 74    H HE2  . PHE A 1 10  ? 5.234   -21.707 2.847   1.00 44.43 ? 5   PHE A HE2  1  
ATOM 75    H HZ   . PHE A 1 10  ? 4.151   -23.084 1.116   1.00 13.52 ? 5   PHE A HZ   1  
ATOM 76    N N    . HIS A 1 11  ? 0.488   -21.774 7.464   1.00 61.50 ? 6   HIS A N    1  
ATOM 77    C CA   . HIS A 1 11  ? 0.687   -21.692 8.907   1.00 11.42 ? 6   HIS A CA   1  
ATOM 78    C C    . HIS A 1 11  ? 2.162   -21.852 9.261   1.00 14.22 ? 6   HIS A C    1  
ATOM 79    O O    . HIS A 1 11  ? 2.824   -22.781 8.799   1.00 23.14 ? 6   HIS A O    1  
ATOM 80    C CB   . HIS A 1 11  ? -0.139  -22.765 9.618   1.00 23.30 ? 6   HIS A CB   1  
ATOM 81    C CG   . HIS A 1 11  ? 0.332   -24.160 9.350   1.00 40.13 ? 6   HIS A CG   1  
ATOM 82    N ND1  . HIS A 1 11  ? 0.935   -24.948 10.308  1.00 51.12 ? 6   HIS A ND1  1  
ATOM 83    C CD2  . HIS A 1 11  ? 0.285   -24.910 8.224   1.00 24.34 ? 6   HIS A CD2  1  
ATOM 84    C CE1  . HIS A 1 11  ? 1.239   -26.121 9.781   1.00 53.24 ? 6   HIS A CE1  1  
ATOM 85    N NE2  . HIS A 1 11  ? 0.855   -26.124 8.518   1.00 73.20 ? 6   HIS A NE2  1  
ATOM 86    H H    . HIS A 1 11  ? 0.457   -22.654 7.034   1.00 40.42 ? 6   HIS A H    1  
ATOM 87    H HA   . HIS A 1 11  ? 0.355   -20.719 9.232   1.00 74.04 ? 6   HIS A HA   1  
ATOM 88    H HB3  . HIS A 1 11  ? -1.167  -22.691 9.293   1.00 13.24 ? 6   HIS A HB3  1  
ATOM 89    H HD1  . HIS A 1 11  ? 1.114   -24.685 11.234  1.00 14.33 ? 6   HIS A HD1  1  
ATOM 90    H HD2  . HIS A 1 11  ? -0.126  -24.609 7.269   1.00 54.43 ? 6   HIS A HD2  1  
ATOM 91    H HE1  . HIS A 1 11  ? 1.720   -26.939 10.297  1.00 63.13 ? 6   HIS A HE1  1  
ATOM 92    N N    . GLU A 1 12  ? 2.671   -20.940 10.084  1.00 11.22 ? 7   GLU A N    1  
ATOM 93    C CA   . GLU A 1 12  ? 4.068   -20.980 10.498  1.00 15.12 ? 7   GLU A CA   1  
ATOM 94    C C    . GLU A 1 12  ? 4.341   -19.954 11.594  1.00 24.25 ? 7   GLU A C    1  
ATOM 95    O O    . GLU A 1 12  ? 3.731   -18.884 11.625  1.00 35.15 ? 7   GLU A O    1  
ATOM 96    C CB   . GLU A 1 12  ? 4.986   -20.721 9.301   1.00 72.54 ? 7   GLU A CB   1  
ATOM 97    C CG   . GLU A 1 12  ? 5.699   -21.965 8.800   1.00 24.15 ? 7   GLU A CG   1  
ATOM 98    C CD   . GLU A 1 12  ? 6.969   -21.642 8.036   1.00 61.34 ? 7   GLU A CD   1  
ATOM 99    O OE1  . GLU A 1 12  ? 7.416   -20.477 8.095   1.00 73.42 ? 7   GLU A OE1  1  
ATOM 100   O OE2  . GLU A 1 12  ? 7.515   -22.553 7.381   1.00 44.11 ? 7   GLU A OE2  1  
ATOM 101   H H    . GLU A 1 12  ? 2.093   -20.223 10.419  1.00 72.12 ? 7   GLU A H    1  
ATOM 102   H HA   . GLU A 1 12  ? 4.271   -21.966 10.887  1.00 14.02 ? 7   GLU A HA   1  
ATOM 103   H HB3  . GLU A 1 12  ? 5.732   -19.994 9.587   1.00 2.21  ? 7   GLU A HB3  1  
ATOM 104   H HG3  . GLU A 1 12  ? 5.032   -22.508 8.146   1.00 52.04 ? 7   GLU A HG3  1  
ATOM 105   N N    . LYS A 1 13  ? 5.261   -20.287 12.492  1.00 73.22 ? 8   LYS A N    1  
ATOM 106   C CA   . LYS A 1 13  ? 5.616   -19.396 13.590  1.00 73.13 ? 8   LYS A CA   1  
ATOM 107   C C    . LYS A 1 13  ? 7.130   -19.243 13.698  1.00 64.14 ? 8   LYS A C    1  
ATOM 108   O O    . LYS A 1 13  ? 7.852   -20.225 13.860  1.00 30.13 ? 8   LYS A O    1  
ATOM 109   C CB   . LYS A 1 13  ? 5.052   -19.929 14.910  1.00 63.52 ? 8   LYS A CB   1  
ATOM 110   C CG   . LYS A 1 13  ? 5.441   -21.368 15.201  1.00 63.23 ? 8   LYS A CG   1  
ATOM 111   C CD   . LYS A 1 13  ? 4.773   -21.881 16.466  1.00 22.04 ? 8   LYS A CD   1  
ATOM 112   C CE   . LYS A 1 13  ? 5.456   -21.344 17.714  1.00 52.51 ? 8   LYS A CE   1  
ATOM 113   N NZ   . LYS A 1 13  ? 5.333   -22.287 18.861  1.00 63.45 ? 8   LYS A NZ   1  
ATOM 114   H H    . LYS A 1 13  ? 5.712   -21.154 12.415  1.00 42.24 ? 8   LYS A H    1  
ATOM 115   H HA   . LYS A 1 13  ? 5.181   -18.429 13.387  1.00 45.43 ? 8   LYS A HA   1  
ATOM 116   H HB3  . LYS A 1 13  ? 3.973   -19.869 14.876  1.00 10.43 ? 8   LYS A HB3  1  
ATOM 117   H HG3  . LYS A 1 13  ? 6.514   -21.423 15.323  1.00 31.12 ? 8   LYS A HG3  1  
ATOM 118   H HD3  . LYS A 1 13  ? 4.821   -22.961 16.475  1.00 64.20 ? 8   LYS A HD3  1  
ATOM 119   H HE3  . LYS A 1 13  ? 4.999   -20.403 17.982  1.00 44.42 ? 8   LYS A HE3  1  
ATOM 120   H HZ1  . LYS A 1 13  ? 5.773   -21.875 19.709  1.00 44.53 ? 8   LYS A HZ1  1  
ATOM 121   H HZ2  . LYS A 1 13  ? 5.808   -23.184 18.638  1.00 73.05 ? 8   LYS A HZ2  1  
ATOM 122   H HZ3  . LYS A 1 13  ? 4.331   -22.477 19.062  1.00 12.42 ? 8   LYS A HZ3  1  
ATOM 123   N N    . GLN A 1 14  ? 7.602   -18.003 13.609  1.00 33.21 ? 9   GLN A N    1  
ATOM 124   C CA   . GLN A 1 14  ? 9.030   -17.722 13.697  1.00 23.23 ? 9   GLN A CA   1  
ATOM 125   C C    . GLN A 1 14  ? 9.286   -16.454 14.504  1.00 45.12 ? 9   GLN A C    1  
ATOM 126   O O    . GLN A 1 14  ? 8.424   -15.580 14.595  1.00 54.13 ? 9   GLN A O    1  
ATOM 127   C CB   . GLN A 1 14  ? 9.631   -17.580 12.298  1.00 23.22 ? 9   GLN A CB   1  
ATOM 128   C CG   . GLN A 1 14  ? 10.753  -18.565 12.015  1.00 11.40 ? 9   GLN A CG   1  
ATOM 129   C CD   . GLN A 1 14  ? 10.280  -20.005 12.017  1.00 51.12 ? 9   GLN A CD   1  
ATOM 130   O OE1  . GLN A 1 14  ? 10.720  -20.814 12.835  1.00 74.45 ? 9   GLN A OE1  1  
ATOM 131   N NE2  . GLN A 1 14  ? 9.379   -20.335 11.100  1.00 44.13 ? 9   GLN A NE2  1  
ATOM 132   H H    . GLN A 1 14  ? 6.976   -17.261 13.480  1.00 4.02  ? 9   GLN A H    1  
ATOM 133   H HA   . GLN A 1 14  ? 9.501   -18.554 14.198  1.00 63.31 ? 9   GLN A HA   1  
ATOM 134   H HB3  . GLN A 1 14  ? 10.023  -16.580 12.187  1.00 42.01 ? 9   GLN A HB3  1  
ATOM 135   H HG3  . GLN A 1 14  ? 11.515  -18.450 12.772  1.00 1.13  ? 9   GLN A HG3  1  
ATOM 136   H HE21 . GLN A 1 14  ? 9.075   -19.638 10.480  1.00 4.42  ? 9   GLN A HE21 1  
ATOM 137   H HE22 . GLN A 1 14  ? 9.057   -21.259 11.079  1.00 12.13 ? 9   GLN A HE22 1  
ATOM 138   N N    . GLU A 1 15  ? 10.478  -16.360 15.088  1.00 31.35 ? 10  GLU A N    1  
ATOM 139   C CA   . GLU A 1 15  ? 10.845  -15.197 15.888  1.00 54.43 ? 10  GLU A CA   1  
ATOM 140   C C    . GLU A 1 15  ? 11.526  -14.138 15.028  1.00 43.52 ? 10  GLU A C    1  
ATOM 141   O O    . GLU A 1 15  ? 12.529  -14.408 14.369  1.00 53.14 ? 10  GLU A O    1  
ATOM 142   C CB   . GLU A 1 15  ? 11.771  -15.612 17.034  1.00 1.43  ? 10  GLU A CB   1  
ATOM 143   C CG   . GLU A 1 15  ? 11.483  -14.893 18.341  1.00 4.33  ? 10  GLU A CG   1  
ATOM 144   C CD   . GLU A 1 15  ? 12.189  -13.554 18.437  1.00 50.35 ? 10  GLU A CD   1  
ATOM 145   O OE1  . GLU A 1 15  ? 13.407  -13.504 18.165  1.00 11.25 ? 10  GLU A OE1  1  
ATOM 146   O OE2  . GLU A 1 15  ? 11.523  -12.557 18.785  1.00 11.21 ? 10  GLU A OE2  1  
ATOM 147   H H    . GLU A 1 15  ? 11.122  -17.089 14.978  1.00 54.12 ? 10  GLU A H    1  
ATOM 148   H HA   . GLU A 1 15  ? 9.940   -14.781 16.303  1.00 21.22 ? 10  GLU A HA   1  
ATOM 149   H HB3  . GLU A 1 15  ? 12.792  -15.402 16.750  1.00 11.54 ? 10  GLU A HB3  1  
ATOM 150   H HG3  . GLU A 1 15  ? 11.811  -15.516 19.160  1.00 14.11 ? 10  GLU A HG3  1  
ATOM 151   N N    . GLY A 1 16  ? 10.972  -12.929 15.039  1.00 31.23 ? 11  GLY A N    1  
ATOM 152   C CA   . GLY A 1 16  ? 11.537  -11.846 14.256  1.00 43.41 ? 11  GLY A CA   1  
ATOM 153   C C    . GLY A 1 16  ? 10.668  -10.605 14.268  1.00 33.31 ? 11  GLY A C    1  
ATOM 154   O O    . GLY A 1 16  ? 9.801   -10.455 15.130  1.00 71.32 ? 11  GLY A O    1  
ATOM 155   H H    . GLY A 1 16  ? 10.172  -12.772 15.583  1.00 62.02 ? 11  GLY A H    1  
ATOM 156   H HA2  . GLY A 1 16  ? 12.508  -11.596 14.655  1.00 53.24 ? 11  GLY A HA2  1  
ATOM 157   H HA3  . GLY A 1 16  ? 11.655  -12.179 13.235  1.00 4.25  ? 11  GLY A HA3  1  
ATOM 158   N N    . SER A 1 17  ? 10.898  -9.712  13.310  1.00 53.44 ? 12  SER A N    1  
ATOM 159   C CA   . SER A 1 17  ? 10.132  -8.476  13.219  1.00 43.10 ? 12  SER A CA   1  
ATOM 160   C C    . SER A 1 17  ? 10.175  -7.914  11.800  1.00 41.53 ? 12  SER A C    1  
ATOM 161   O O    . SER A 1 17  ? 11.222  -7.470  11.328  1.00 43.32 ? 12  SER A O    1  
ATOM 162   C CB   . SER A 1 17  ? 10.674  -7.440  14.206  1.00 4.43  ? 12  SER A CB   1  
ATOM 163   O OG   . SER A 1 17  ? 10.769  -7.981  15.512  1.00 11.01 ? 12  SER A OG   1  
ATOM 164   H H    . SER A 1 17  ? 11.602  -9.890  12.652  1.00 63.41 ? 12  SER A H    1  
ATOM 165   H HA   . SER A 1 17  ? 9.107   -8.701  13.473  1.00 23.52 ? 12  SER A HA   1  
ATOM 166   H HB3  . SER A 1 17  ? 10.011  -6.588  14.229  1.00 23.21 ? 12  SER A HB3  1  
ATOM 167   H HG   . SER A 1 17  ? 10.899  -7.272  16.144  1.00 62.23 ? 12  SER A HG   1  
ATOM 168   N N    . LEU A 1 18  ? 9.030   -7.939  11.126  1.00 64.13 ? 13  LEU A N    1  
ATOM 169   C CA   . LEU A 1 18  ? 8.936   -7.432  9.761   1.00 14.43 ? 13  LEU A CA   1  
ATOM 170   C C    . LEU A 1 18  ? 9.885   -8.185  8.834   1.00 71.41 ? 13  LEU A C    1  
ATOM 171   O O    . LEU A 1 18  ? 11.090  -7.934  8.828   1.00 1.40  ? 13  LEU A O    1  
ATOM 172   C CB   . LEU A 1 18  ? 9.252   -5.936  9.728   1.00 5.11  ? 13  LEU A CB   1  
ATOM 173   C CG   . LEU A 1 18  ? 9.303   -5.291  8.342   1.00 13.01 ? 13  LEU A CG   1  
ATOM 174   C CD1  . LEU A 1 18  ? 10.721  -5.316  7.794   1.00 23.31 ? 13  LEU A CD1  1  
ATOM 175   C CD2  . LEU A 1 18  ? 8.348   -5.998  7.390   1.00 61.21 ? 13  LEU A CD2  1  
ATOM 176   H H    . LEU A 1 18  ? 8.230   -8.305  11.556  1.00 40.43 ? 13  LEU A H    1  
ATOM 177   H HA   . LEU A 1 18  ? 7.923   -7.586  9.421   1.00 24.21 ? 13  LEU A HA   1  
ATOM 178   H HB3  . LEU A 1 18  ? 10.215  -5.792  10.196  1.00 55.42 ? 13  LEU A HB3  1  
ATOM 179   H HG   . LEU A 1 18  ? 8.993   -4.258  8.422   1.00 44.22 ? 13  LEU A HG   1  
ATOM 180   H HD11 . LEU A 1 18  ? 11.009  -4.318  7.499   1.00 3.54  ? 13  LEU A HD11 1  
ATOM 181   H HD12 . LEU A 1 18  ? 10.764  -5.972  6.937   1.00 63.22 ? 13  LEU A HD12 1  
ATOM 182   H HD13 . LEU A 1 18  ? 11.395  -5.675  8.557   1.00 74.13 ? 13  LEU A HD13 1  
ATOM 183   H HD21 . LEU A 1 18  ? 7.473   -6.322  7.934   1.00 15.55 ? 13  LEU A HD21 1  
ATOM 184   H HD22 . LEU A 1 18  ? 8.841   -6.856  6.957   1.00 42.24 ? 13  LEU A HD22 1  
ATOM 185   H HD23 . LEU A 1 18  ? 8.053   -5.317  6.606   1.00 52.11 ? 13  LEU A HD23 1  
ATOM 186   N N    . CYS A 1 19  ? 9.333   -9.105  8.052   1.00 12.54 ? 14  CYS A N    1  
ATOM 187   C CA   . CYS A 1 19  ? 10.131  -9.895  7.120   1.00 23.44 ? 14  CYS A CA   1  
ATOM 188   C C    . CYS A 1 19  ? 9.731   -9.598  5.677   1.00 43.12 ? 14  CYS A C    1  
ATOM 189   O O    . CYS A 1 19  ? 8.547   -9.557  5.347   1.00 1.33  ? 14  CYS A O    1  
ATOM 190   C CB   . CYS A 1 19  ? 9.966   -11.387 7.410   1.00 24.35 ? 14  CYS A CB   1  
ATOM 191   S SG   . CYS A 1 19  ? 11.308  -12.102 8.388   1.00 3.03  ? 14  CYS A SG   1  
ATOM 192   H H    . CYS A 1 19  ? 8.366   -9.260  8.104   1.00 2.35  ? 14  CYS A H    1  
ATOM 193   H HA   . CYS A 1 19  ? 11.166  -9.622  7.257   1.00 33.10 ? 14  CYS A HA   1  
ATOM 194   H HB3  . CYS A 1 19  ? 9.916   -11.924 6.475   1.00 31.11 ? 14  CYS A HB3  1  
ATOM 195   H HG   . CYS A 1 19  ? 11.765  -11.162 9.202   1.00 73.51 ? 14  CYS A HG   1  
ATOM 196   N N    . ALA A 1 20  ? 10.729  -9.388  4.824   1.00 74.05 ? 15  ALA A N    1  
ATOM 197   C CA   . ALA A 1 20  ? 10.483  -9.095  3.418   1.00 12.23 ? 15  ALA A CA   1  
ATOM 198   C C    . ALA A 1 20  ? 10.000  -10.336 2.675   1.00 4.24  ? 15  ALA A C    1  
ATOM 199   O O    . ALA A 1 20  ? 8.999   -10.292 1.960   1.00 62.34 ? 15  ALA A O    1  
ATOM 200   C CB   . ALA A 1 20  ? 11.741  -8.543  2.765   1.00 40.01 ? 15  ALA A CB   1  
ATOM 201   H H    . ALA A 1 20  ? 11.652  -9.434  5.148   1.00 45.15 ? 15  ALA A H    1  
ATOM 202   H HA   . ALA A 1 20  ? 9.716   -8.335  3.365   1.00 33.23 ? 15  ALA A HA   1  
ATOM 203   H HB1  . ALA A 1 20  ? 12.020  -7.619  3.249   1.00 61.15 ? 15  ALA A HB1  1  
ATOM 204   H HB2  . ALA A 1 20  ? 12.543  -9.259  2.867   1.00 14.41 ? 15  ALA A HB2  1  
ATOM 205   H HB3  . ALA A 1 20  ? 11.552  -8.359  1.718   1.00 53.34 ? 15  ALA A HB3  1  
ATOM 206   N N    . GLN A 1 21  ? 10.719  -11.441 2.849   1.00 21.44 ? 16  GLN A N    1  
ATOM 207   C CA   . GLN A 1 21  ? 10.362  -12.694 2.192   1.00 61.04 ? 16  GLN A CA   1  
ATOM 208   C C    . GLN A 1 21  ? 9.033   -13.224 2.716   1.00 32.13 ? 16  GLN A C    1  
ATOM 209   O O    . GLN A 1 21  ? 8.186   -13.676 1.945   1.00 34.03 ? 16  GLN A O    1  
ATOM 210   C CB   . GLN A 1 21  ? 11.462  -13.736 2.407   1.00 15.10 ? 16  GLN A CB   1  
ATOM 211   C CG   . GLN A 1 21  ? 11.140  -15.092 1.802   1.00 34.01 ? 16  GLN A CG   1  
ATOM 212   C CD   . GLN A 1 21  ? 11.426  -16.239 2.752   1.00 11.15 ? 16  GLN A CD   1  
ATOM 213   O OE1  . GLN A 1 21  ? 12.217  -16.103 3.687   1.00 23.34 ? 16  GLN A OE1  1  
ATOM 214   N NE2  . GLN A 1 21  ? 10.783  -17.376 2.518   1.00 52.30 ? 16  GLN A NE2  1  
ATOM 215   H H    . GLN A 1 21  ? 11.505  -11.413 3.431   1.00 41.35 ? 16  GLN A H    1  
ATOM 216   H HA   . GLN A 1 21  ? 10.267  -12.498 1.135   1.00 52.22 ? 16  GLN A HA   1  
ATOM 217   H HB3  . GLN A 1 21  ? 11.614  -13.867 3.469   1.00 15.43 ? 16  GLN A HB3  1  
ATOM 218   H HG3  . GLN A 1 21  ? 11.736  -15.225 0.911   1.00 43.13 ? 16  GLN A HG3  1  
ATOM 219   H HE21 . GLN A 1 21  ? 10.169  -17.412 1.755   1.00 0.53  ? 16  GLN A HE21 1  
ATOM 220   H HE22 . GLN A 1 21  ? 10.949  -18.134 3.116   1.00 41.51 ? 16  GLN A HE22 1  
ATOM 221   N N    . HIS A 1 22  ? 8.854   -13.166 4.032   1.00 40.23 ? 17  HIS A N    1  
ATOM 222   C CA   . HIS A 1 22  ? 7.626   -13.641 4.660   1.00 4.15  ? 17  HIS A CA   1  
ATOM 223   C C    . HIS A 1 22  ? 6.424   -12.831 4.182   1.00 52.13 ? 17  HIS A C    1  
ATOM 224   O O    . HIS A 1 22  ? 5.342   -13.377 3.966   1.00 51.54 ? 17  HIS A O    1  
ATOM 225   C CB   . HIS A 1 22  ? 7.741   -13.556 6.182   1.00 33.42 ? 17  HIS A CB   1  
ATOM 226   C CG   . HIS A 1 22  ? 8.859   -14.378 6.745   1.00 71.22 ? 17  HIS A CG   1  
ATOM 227   N ND1  . HIS A 1 22  ? 9.087   -14.511 8.099   1.00 0.44  ? 17  HIS A ND1  1  
ATOM 228   C CD2  . HIS A 1 22  ? 9.815   -15.112 6.129   1.00 73.42 ? 17  HIS A CD2  1  
ATOM 229   C CE1  . HIS A 1 22  ? 10.136  -15.291 8.291   1.00 43.24 ? 17  HIS A CE1  1  
ATOM 230   N NE2  . HIS A 1 22  ? 10.596  -15.669 7.113   1.00 4.50  ? 17  HIS A NE2  1  
ATOM 231   H H    . HIS A 1 22  ? 9.566   -12.794 4.594   1.00 14.22 ? 17  HIS A H    1  
ATOM 232   H HA   . HIS A 1 22  ? 7.486   -14.673 4.375   1.00 22.12 ? 17  HIS A HA   1  
ATOM 233   H HB3  . HIS A 1 22  ? 6.817   -13.902 6.625   1.00 52.32 ? 17  HIS A HB3  1  
ATOM 234   H HD1  . HIS A 1 22  ? 8.560   -14.095 8.811   1.00 61.43 ? 17  HIS A HD1  1  
ATOM 235   H HD2  . HIS A 1 22  ? 9.941   -15.237 5.064   1.00 3.31  ? 17  HIS A HD2  1  
ATOM 236   H HE1  . HIS A 1 22  ? 10.548  -15.572 9.249   1.00 2.11  ? 17  HIS A HE1  1  
ATOM 237   N N    . CYS A 1 23  ? 6.622   -11.528 4.021   1.00 22.04 ? 18  CYS A N    1  
ATOM 238   C CA   . CYS A 1 23  ? 5.553   -10.643 3.570   1.00 43.14 ? 18  CYS A CA   1  
ATOM 239   C C    . CYS A 1 23  ? 5.183   -10.931 2.119   1.00 14.55 ? 18  CYS A C    1  
ATOM 240   O O    . CYS A 1 23  ? 4.007   -11.086 1.786   1.00 73.02 ? 18  CYS A O    1  
ATOM 241   C CB   . CYS A 1 23  ? 5.978   -9.180  3.719   1.00 12.03 ? 18  CYS A CB   1  
ATOM 242   S SG   . CYS A 1 23  ? 4.799   -7.996  3.027   1.00 3.41  ? 18  CYS A SG   1  
ATOM 243   H H    . CYS A 1 23  ? 7.507   -11.151 4.209   1.00 24.43 ? 18  CYS A H    1  
ATOM 244   H HA   . CYS A 1 23  ? 4.690   -10.823 4.192   1.00 15.44 ? 18  CYS A HA   1  
ATOM 245   H HB3  . CYS A 1 23  ? 6.923   -9.036  3.219   1.00 63.13 ? 18  CYS A HB3  1  
ATOM 246   H HG   . CYS A 1 23  ? 5.483   -6.950  2.588   1.00 34.04 ? 18  CYS A HG   1  
ATOM 247   N N    . LEU A 1 24  ? 6.193   -11.003 1.259   1.00 74.14 ? 19  LEU A N    1  
ATOM 248   C CA   . LEU A 1 24  ? 5.973   -11.273 -0.158  1.00 52.31 ? 19  LEU A CA   1  
ATOM 249   C C    . LEU A 1 24  ? 5.436   -12.685 -0.367  1.00 53.10 ? 19  LEU A C    1  
ATOM 250   O O    . LEU A 1 24  ? 4.501   -12.896 -1.137  1.00 75.41 ? 19  LEU A O    1  
ATOM 251   C CB   . LEU A 1 24  ? 7.276   -11.090 -0.940  1.00 35.20 ? 19  LEU A CB   1  
ATOM 252   C CG   . LEU A 1 24  ? 7.453   -9.744  -1.644  1.00 35.23 ? 19  LEU A CG   1  
ATOM 253   C CD1  . LEU A 1 24  ? 7.383   -8.603  -0.641  1.00 35.44 ? 19  LEU A CD1  1  
ATOM 254   C CD2  . LEU A 1 24  ? 8.770   -9.709  -2.403  1.00 23.13 ? 19  LEU A CD2  1  
ATOM 255   H H    . LEU A 1 24  ? 7.108   -10.872 1.583   1.00 72.13 ? 19  LEU A H    1  
ATOM 256   H HA   . LEU A 1 24  ? 5.243   -10.565 -0.520  1.00 34.11 ? 19  LEU A HA   1  
ATOM 257   H HB3  . LEU A 1 24  ? 7.322   -11.866 -1.690  1.00 24.02 ? 19  LEU A HB3  1  
ATOM 258   H HG   . LEU A 1 24  ? 6.650   -9.610  -2.356  1.00 1.41  ? 19  LEU A HG   1  
ATOM 259   H HD11 . LEU A 1 24  ? 7.832   -7.720  -1.068  1.00 43.23 ? 19  LEU A HD11 1  
ATOM 260   H HD12 . LEU A 1 24  ? 7.916   -8.881  0.257   1.00 60.52 ? 19  LEU A HD12 1  
ATOM 261   H HD13 . LEU A 1 24  ? 6.350   -8.400  -0.397  1.00 15.23 ? 19  LEU A HD13 1  
ATOM 262   H HD21 . LEU A 1 24  ? 8.585   -9.884  -3.453  1.00 21.35 ? 19  LEU A HD21 1  
ATOM 263   H HD22 . LEU A 1 24  ? 9.427   -10.477 -2.021  1.00 50.31 ? 19  LEU A HD22 1  
ATOM 264   H HD23 . LEU A 1 24  ? 9.233   -8.742  -2.276  1.00 24.40 ? 19  LEU A HD23 1  
ATOM 265   N N    . ASN A 1 25  ? 6.034   -13.649 0.327   1.00 44.21 ? 20  ASN A N    1  
ATOM 266   C CA   . ASN A 1 25  ? 5.614   -15.042 0.218   1.00 62.21 ? 20  ASN A CA   1  
ATOM 267   C C    . ASN A 1 25  ? 4.167   -15.210 0.672   1.00 74.04 ? 20  ASN A C    1  
ATOM 268   O O    . ASN A 1 25  ? 3.374   -15.880 0.013   1.00 54.01 ? 20  ASN A O    1  
ATOM 269   C CB   . ASN A 1 25  ? 6.530   -15.938 1.053   1.00 14.34 ? 20  ASN A CB   1  
ATOM 270   C CG   . ASN A 1 25  ? 7.833   -16.254 0.344   1.00 13.44 ? 20  ASN A CG   1  
ATOM 271   O OD1  . ASN A 1 25  ? 8.298   -17.394 0.357   1.00 41.33 ? 20  ASN A OD1  1  
ATOM 272   N ND2  . ASN A 1 25  ? 8.427   -15.243 -0.280  1.00 13.25 ? 20  ASN A ND2  1  
ATOM 273   H H    . ASN A 1 25  ? 6.775   -13.419 0.925   1.00 65.51 ? 20  ASN A H    1  
ATOM 274   H HA   . ASN A 1 25  ? 5.690   -15.331 -0.819  1.00 72.21 ? 20  ASN A HA   1  
ATOM 275   H HB3  . ASN A 1 25  ? 6.021   -16.867 1.264   1.00 12.14 ? 20  ASN A HB3  1  
ATOM 276   H HD21 . ASN A 1 25  ? 7.998   -14.363 -0.247  1.00 3.41  ? 20  ASN A HD21 1  
ATOM 277   H HD22 . ASN A 1 25  ? 9.270   -15.420 -0.747  1.00 2.02  ? 20  ASN A HD22 1  
ATOM 278   N N    . ASN A 1 26  ? 3.831   -14.596 1.803   1.00 43.43 ? 21  ASN A N    1  
ATOM 279   C CA   . ASN A 1 26  ? 2.481   -14.679 2.345   1.00 63.45 ? 21  ASN A CA   1  
ATOM 280   C C    . ASN A 1 26  ? 1.500   -13.889 1.483   1.00 14.32 ? 21  ASN A C    1  
ATOM 281   O O    . ASN A 1 26  ? 0.387   -14.345 1.215   1.00 34.43 ? 21  ASN A O    1  
ATOM 282   C CB   . ASN A 1 26  ? 2.453   -14.151 3.781   1.00 71.01 ? 21  ASN A CB   1  
ATOM 283   C CG   . ASN A 1 26  ? 2.938   -15.180 4.784   1.00 55.24 ? 21  ASN A CG   1  
ATOM 284   O OD1  . ASN A 1 26  ? 3.972   -14.995 5.428   1.00 12.40 ? 21  ASN A OD1  1  
ATOM 285   N ND2  . ASN A 1 26  ? 2.194   -16.271 4.921   1.00 11.13 ? 21  ASN A ND2  1  
ATOM 286   H H    . ASN A 1 26  ? 4.509   -14.076 2.283   1.00 53.30 ? 21  ASN A H    1  
ATOM 287   H HA   . ASN A 1 26  ? 2.187   -15.717 2.346   1.00 12.22 ? 21  ASN A HA   1  
ATOM 288   H HB3  . ASN A 1 26  ? 1.441   -13.875 4.038   1.00 42.50 ? 21  ASN A HB3  1  
ATOM 289   H HD21 . ASN A 1 26  ? 1.384   -16.350 4.375   1.00 34.45 ? 21  ASN A HD21 1  
ATOM 290   H HD22 . ASN A 1 26  ? 2.484   -16.951 5.562   1.00 74.11 ? 21  ASN A HD22 1  
ATOM 291   N N    . LEU A 1 27  ? 1.920   -12.706 1.050   1.00 14.23 ? 22  LEU A N    1  
ATOM 292   C CA   . LEU A 1 27  ? 1.079   -11.853 0.217   1.00 35.13 ? 22  LEU A CA   1  
ATOM 293   C C    . LEU A 1 27  ? 0.674   -12.574 -1.065  1.00 61.12 ? 22  LEU A C    1  
ATOM 294   O O    . LEU A 1 27  ? -0.478  -12.503 -1.492  1.00 31.54 ? 22  LEU A O    1  
ATOM 295   C CB   . LEU A 1 27  ? 1.814   -10.556 -0.124  1.00 14.20 ? 22  LEU A CB   1  
ATOM 296   C CG   . LEU A 1 27  ? 1.262   -9.764  -1.310  1.00 21.11 ? 22  LEU A CG   1  
ATOM 297   C CD1  . LEU A 1 27  ? -0.248  -9.621  -1.200  1.00 61.21 ? 22  LEU A CD1  1  
ATOM 298   C CD2  . LEU A 1 27  ? 1.925   -8.396  -1.392  1.00 74.10 ? 22  LEU A CD2  1  
ATOM 299   H H    . LEU A 1 27  ? 2.816   -12.398 1.296   1.00 4.33  ? 22  LEU A H    1  
ATOM 300   H HA   . LEU A 1 27  ? 0.188   -11.616 0.779   1.00 1.31  ? 22  LEU A HA   1  
ATOM 301   H HB3  . LEU A 1 27  ? 2.842   -10.807 -0.342  1.00 1.00  ? 22  LEU A HB3  1  
ATOM 302   H HG   . LEU A 1 27  ? 1.480   -10.297 -2.224  1.00 15.30 ? 22  LEU A HG   1  
ATOM 303   H HD11 . LEU A 1 27  ? -0.565  -9.900  -0.206  1.00 60.41 ? 22  LEU A HD11 1  
ATOM 304   H HD12 . LEU A 1 27  ? -0.725  -10.266 -1.924  1.00 65.54 ? 22  LEU A HD12 1  
ATOM 305   H HD13 . LEU A 1 27  ? -0.528  -8.595  -1.393  1.00 50.33 ? 22  LEU A HD13 1  
ATOM 306   H HD21 . LEU A 1 27  ? 2.304   -8.121  -0.419  1.00 11.30 ? 22  LEU A HD21 1  
ATOM 307   H HD22 . LEU A 1 27  ? 1.199   -7.664  -1.715  1.00 20.42 ? 22  LEU A HD22 1  
ATOM 308   H HD23 . LEU A 1 27  ? 2.740   -8.433  -2.100  1.00 35.12 ? 22  LEU A HD23 1  
ATOM 309   N N    . LEU A 1 28  ? 1.629   -13.268 -1.674  1.00 54.41 ? 23  LEU A N    1  
ATOM 310   C CA   . LEU A 1 28  ? 1.372   -14.005 -2.907  1.00 52.50 ? 23  LEU A CA   1  
ATOM 311   C C    . LEU A 1 28  ? 0.696   -15.340 -2.612  1.00 5.44  ? 23  LEU A C    1  
ATOM 312   O O    . LEU A 1 28  ? 0.366   -16.094 -3.527  1.00 2.52  ? 23  LEU A O    1  
ATOM 313   C CB   . LEU A 1 28  ? 2.679   -14.238 -3.667  1.00 33.02 ? 23  LEU A CB   1  
ATOM 314   C CG   . LEU A 1 28  ? 3.385   -12.986 -4.188  1.00 53.22 ? 23  LEU A CG   1  
ATOM 315   C CD1  . LEU A 1 28  ? 4.716   -13.351 -4.827  1.00 71.24 ? 23  LEU A CD1  1  
ATOM 316   C CD2  . LEU A 1 28  ? 2.498   -12.248 -5.181  1.00 40.31 ? 23  LEU A CD2  1  
ATOM 317   H H    . LEU A 1 28  ? 2.528   -13.288 -1.286  1.00 3.41  ? 23  LEU A H    1  
ATOM 318   H HA   . LEU A 1 28  ? 0.712   -13.408 -3.517  1.00 24.34 ? 23  LEU A HA   1  
ATOM 319   H HB3  . LEU A 1 28  ? 2.459   -14.872 -4.514  1.00 40.41 ? 23  LEU A HB3  1  
ATOM 320   H HG   . LEU A 1 28  ? 3.584   -12.322 -3.358  1.00 5.02  ? 23  LEU A HG   1  
ATOM 321   H HD11 . LEU A 1 28  ? 4.653   -14.342 -5.249  1.00 71.21 ? 23  LEU A HD11 1  
ATOM 322   H HD12 . LEU A 1 28  ? 5.493   -13.326 -4.078  1.00 52.15 ? 23  LEU A HD12 1  
ATOM 323   H HD13 . LEU A 1 28  ? 4.947   -12.641 -5.607  1.00 23.33 ? 23  LEU A HD13 1  
ATOM 324   H HD21 . LEU A 1 28  ? 2.946   -12.291 -6.163  1.00 13.32 ? 23  LEU A HD21 1  
ATOM 325   H HD22 . LEU A 1 28  ? 2.398   -11.217 -4.877  1.00 71.45 ? 23  LEU A HD22 1  
ATOM 326   H HD23 . LEU A 1 28  ? 1.524   -12.712 -5.208  1.00 53.20 ? 23  LEU A HD23 1  
ATOM 327   N N    . GLN A 1 29  ? 0.492   -15.625 -1.330  1.00 45.51 ? 24  GLN A N    1  
ATOM 328   C CA   . GLN A 1 29  ? -0.145  -16.869 -0.917  1.00 34.23 ? 24  GLN A CA   1  
ATOM 329   C C    . GLN A 1 29  ? 0.697   -18.074 -1.323  1.00 22.22 ? 24  GLN A C    1  
ATOM 330   O O    . GLN A 1 29  ? 0.166   -19.096 -1.755  1.00 51.40 ? 24  GLN A O    1  
ATOM 331   C CB   . GLN A 1 29  ? -1.543  -16.978 -1.529  1.00 53.20 ? 24  GLN A CB   1  
ATOM 332   C CG   . GLN A 1 29  ? -2.379  -15.720 -1.364  1.00 32.33 ? 24  GLN A CG   1  
ATOM 333   C CD   . GLN A 1 29  ? -3.860  -16.017 -1.229  1.00 22.52 ? 24  GLN A CD   1  
ATOM 334   O OE1  . GLN A 1 29  ? -4.274  -17.177 -1.219  1.00 61.54 ? 24  GLN A OE1  1  
ATOM 335   N NE2  . GLN A 1 29  ? -4.667  -14.967 -1.124  1.00 13.32 ? 24  GLN A NE2  1  
ATOM 336   H H    . GLN A 1 29  ? 0.778   -14.984 -0.647  1.00 43.12 ? 24  GLN A H    1  
ATOM 337   H HA   . GLN A 1 29  ? -0.234  -16.854 0.159   1.00 14.14 ? 24  GLN A HA   1  
ATOM 338   H HB3  . GLN A 1 29  ? -2.067  -17.797 -1.057  1.00 51.01 ? 24  GLN A HB3  1  
ATOM 339   H HG3  . GLN A 1 29  ? -2.231  -15.089 -2.228  1.00 51.32 ? 24  GLN A HG3  1  
ATOM 340   H HE21 . GLN A 1 29  ? -4.267  -14.072 -1.140  1.00 1.55  ? 24  GLN A HE21 1  
ATOM 341   H HE22 . GLN A 1 29  ? -5.629  -15.130 -1.036  1.00 71.54 ? 24  GLN A HE22 1  
ATOM 342   N N    . GLY A 1 30  ? 2.012   -17.946 -1.182  1.00 73.30 ? 25  GLY A N    1  
ATOM 343   C CA   . GLY A 1 30  ? 2.906   -19.032 -1.539  1.00 44.24 ? 25  GLY A CA   1  
ATOM 344   C C    . GLY A 1 30  ? 4.340   -18.570 -1.710  1.00 61.50 ? 25  GLY A C    1  
ATOM 345   O O    . GLY A 1 30  ? 4.601   -17.375 -1.847  1.00 3.20  ? 25  GLY A O    1  
ATOM 346   H H    . GLY A 1 30  ? 2.379   -17.106 -0.832  1.00 55.13 ? 25  GLY A H    1  
ATOM 347   H HA2  . GLY A 1 30  ? 2.870   -19.783 -0.765  1.00 72.12 ? 25  GLY A HA2  1  
ATOM 348   H HA3  . GLY A 1 30  ? 2.569   -19.469 -2.467  1.00 2.45  ? 25  GLY A HA3  1  
ATOM 349   N N    . GLU A 1 31  ? 5.271   -19.519 -1.699  1.00 71.34 ? 26  GLU A N    1  
ATOM 350   C CA   . GLU A 1 31  ? 6.686   -19.201 -1.851  1.00 31.11 ? 26  GLU A CA   1  
ATOM 351   C C    . GLU A 1 31  ? 6.995   -18.767 -3.280  1.00 43.10 ? 26  GLU A C    1  
ATOM 352   O O    . GLU A 1 31  ? 6.907   -19.562 -4.215  1.00 23.12 ? 26  GLU A O    1  
ATOM 353   C CB   . GLU A 1 31  ? 7.545   -20.410 -1.476  1.00 40.22 ? 26  GLU A CB   1  
ATOM 354   C CG   . GLU A 1 31  ? 7.166   -21.680 -2.218  1.00 13.55 ? 26  GLU A CG   1  
ATOM 355   C CD   . GLU A 1 31  ? 6.795   -22.814 -1.283  1.00 11.31 ? 26  GLU A CD   1  
ATOM 356   O OE1  . GLU A 1 31  ? 6.110   -22.549 -0.273  1.00 32.44 ? 26  GLU A OE1  1  
ATOM 357   O OE2  . GLU A 1 31  ? 7.189   -23.966 -1.560  1.00 52.42 ? 26  GLU A OE2  1  
ATOM 358   H H    . GLU A 1 31  ? 5.000   -20.453 -1.586  1.00 75.31 ? 26  GLU A H    1  
ATOM 359   H HA   . GLU A 1 31  ? 6.917   -18.386 -1.182  1.00 74.54 ? 26  GLU A HA   1  
ATOM 360   H HB3  . GLU A 1 31  ? 7.444   -20.594 -0.417  1.00 41.42 ? 26  GLU A HB3  1  
ATOM 361   H HG3  . GLU A 1 31  ? 8.005   -21.992 -2.824  1.00 14.33 ? 26  GLU A HG3  1  
ATOM 362   N N    . TYR A 1 32  ? 7.359   -17.499 -3.440  1.00 2.42  ? 27  TYR A N    1  
ATOM 363   C CA   . TYR A 1 32  ? 7.678   -16.956 -4.756  1.00 73.14 ? 27  TYR A CA   1  
ATOM 364   C C    . TYR A 1 32  ? 8.898   -16.042 -4.687  1.00 72.35 ? 27  TYR A C    1  
ATOM 365   O O    . TYR A 1 32  ? 9.212   -15.332 -5.642  1.00 15.51 ? 27  TYR A O    1  
ATOM 366   C CB   . TYR A 1 32  ? 6.481   -16.187 -5.318  1.00 42.35 ? 27  TYR A CB   1  
ATOM 367   C CG   . TYR A 1 32  ? 5.374   -17.081 -5.829  1.00 23.10 ? 27  TYR A CG   1  
ATOM 368   C CD1  . TYR A 1 32  ? 5.442   -17.648 -7.096  1.00 55.33 ? 27  TYR A CD1  1  
ATOM 369   C CD2  . TYR A 1 32  ? 4.260   -17.355 -5.047  1.00 14.43 ? 27  TYR A CD2  1  
ATOM 370   C CE1  . TYR A 1 32  ? 4.432   -18.465 -7.568  1.00 52.12 ? 27  TYR A CE1  1  
ATOM 371   C CE2  . TYR A 1 32  ? 3.246   -18.172 -5.509  1.00 20.05 ? 27  TYR A CE2  1  
ATOM 372   C CZ   . TYR A 1 32  ? 3.337   -18.724 -6.770  1.00 12.03 ? 27  TYR A CZ   1  
ATOM 373   O OH   . TYR A 1 32  ? 2.328   -19.536 -7.235  1.00 2.33  ? 27  TYR A OH   1  
ATOM 374   H H    . TYR A 1 32  ? 7.411   -16.913 -2.657  1.00 1.21  ? 27  TYR A H    1  
ATOM 375   H HA   . TYR A 1 32  ? 7.901   -17.785 -5.411  1.00 42.42 ? 27  TYR A HA   1  
ATOM 376   H HB3  . TYR A 1 32  ? 6.814   -15.568 -6.138  1.00 4.21  ? 27  TYR A HB3  1  
ATOM 377   H HD1  . TYR A 1 32  ? 6.302   -17.444 -7.718  1.00 20.42 ? 27  TYR A HD1  1  
ATOM 378   H HD2  . TYR A 1 32  ? 4.192   -16.921 -4.059  1.00 11.44 ? 27  TYR A HD2  1  
ATOM 379   H HE1  . TYR A 1 32  ? 4.503   -18.898 -8.555  1.00 34.45 ? 27  TYR A HE1  1  
ATOM 380   H HE2  . TYR A 1 32  ? 2.388   -18.375 -4.885  1.00 4.35  ? 27  TYR A HE2  1  
ATOM 381   H HH   . TYR A 1 32  ? 1.497   -19.056 -7.217  1.00 11.12 ? 27  TYR A HH   1  
ATOM 382   N N    . PHE A 1 33  ? 9.582   -16.064 -3.547  1.00 21.31 ? 28  PHE A N    1  
ATOM 383   C CA   . PHE A 1 33  ? 10.767  -15.238 -3.350  1.00 24.11 ? 28  PHE A CA   1  
ATOM 384   C C    . PHE A 1 33  ? 11.643  -15.801 -2.236  1.00 51.13 ? 28  PHE A C    1  
ATOM 385   O O    . PHE A 1 33  ? 11.159  -16.489 -1.337  1.00 22.50 ? 28  PHE A O    1  
ATOM 386   C CB   . PHE A 1 33  ? 10.362  -13.799 -3.018  1.00 55.01 ? 28  PHE A CB   1  
ATOM 387   C CG   . PHE A 1 33  ? 10.844  -12.794 -4.024  1.00 12.15 ? 28  PHE A CG   1  
ATOM 388   C CD1  . PHE A 1 33  ? 12.151  -12.336 -3.994  1.00 63.52 ? 28  PHE A CD1  1  
ATOM 389   C CD2  . PHE A 1 33  ? 9.990   -12.307 -5.001  1.00 75.33 ? 28  PHE A CD2  1  
ATOM 390   C CE1  . PHE A 1 33  ? 12.597  -11.410 -4.918  1.00 31.01 ? 28  PHE A CE1  1  
ATOM 391   C CE2  . PHE A 1 33  ? 10.430  -11.381 -5.928  1.00 41.20 ? 28  PHE A CE2  1  
ATOM 392   C CZ   . PHE A 1 33  ? 11.736  -10.933 -5.888  1.00 34.50 ? 28  PHE A CZ   1  
ATOM 393   H H    . PHE A 1 33  ? 9.282   -16.650 -2.820  1.00 14.35 ? 28  PHE A H    1  
ATOM 394   H HA   . PHE A 1 33  ? 11.329  -15.241 -4.271  1.00 21.32 ? 28  PHE A HA   1  
ATOM 395   H HB3  . PHE A 1 33  ? 10.771  -13.531 -2.056  1.00 43.52 ? 28  PHE A HB3  1  
ATOM 396   H HD1  . PHE A 1 33  ? 12.826  -12.709 -3.238  1.00 73.55 ? 28  PHE A HD1  1  
ATOM 397   H HD2  . PHE A 1 33  ? 8.968   -12.658 -5.034  1.00 72.31 ? 28  PHE A HD2  1  
ATOM 398   H HE1  . PHE A 1 33  ? 13.618  -11.060 -4.884  1.00 15.33 ? 28  PHE A HE1  1  
ATOM 399   H HE2  . PHE A 1 33  ? 9.754   -11.011 -6.684  1.00 34.14 ? 28  PHE A HE2  1  
ATOM 400   H HZ   . PHE A 1 33  ? 12.081  -10.209 -6.610  1.00 44.33 ? 28  PHE A HZ   1  
ATOM 401   N N    . SER A 1 34  ? 12.938  -15.504 -2.302  1.00 10.00 ? 29  SER A N    1  
ATOM 402   C CA   . SER A 1 34  ? 13.885  -15.985 -1.303  1.00 72.42 ? 29  SER A CA   1  
ATOM 403   C C    . SER A 1 34  ? 14.298  -14.857 -0.361  1.00 52.21 ? 29  SER A C    1  
ATOM 404   O O    . SER A 1 34  ? 14.283  -13.679 -0.717  1.00 45.42 ? 29  SER A O    1  
ATOM 405   C CB   . SER A 1 34  ? 15.120  -16.576 -1.983  1.00 54.34 ? 29  SER A CB   1  
ATOM 406   O OG   . SER A 1 34  ? 15.047  -17.990 -2.034  1.00 13.10 ? 29  SER A OG   1  
ATOM 407   H H    . SER A 1 34  ? 13.264  -14.952 -3.043  1.00 25.14 ? 29  SER A H    1  
ATOM 408   H HA   . SER A 1 34  ? 13.396  -16.757 -0.728  1.00 53.20 ? 29  SER A HA   1  
ATOM 409   H HB3  . SER A 1 34  ? 16.003  -16.294 -1.427  1.00 72.25 ? 29  SER A HB3  1  
ATOM 410   H HG   . SER A 1 34  ? 15.921  -18.362 -1.894  1.00 72.42 ? 29  SER A HG   1  
ATOM 411   N N    . PRO A 1 35  ? 14.676  -15.227 0.873   1.00 25.24 ? 30  PRO A N    1  
ATOM 412   C CA   . PRO A 1 35  ? 15.102  -14.263 1.892   1.00 4.34  ? 30  PRO A CA   1  
ATOM 413   C C    . PRO A 1 35  ? 16.449  -13.628 1.563   1.00 4.35  ? 30  PRO A C    1  
ATOM 414   O O    . PRO A 1 35  ? 16.653  -12.434 1.781   1.00 74.15 ? 30  PRO A O    1  
ATOM 415   C CB   . PRO A 1 35  ? 15.206  -15.112 3.161   1.00 43.30 ? 30  PRO A CB   1  
ATOM 416   C CG   . PRO A 1 35  ? 15.456  -16.496 2.671   1.00 44.41 ? 30  PRO A CG   1  
ATOM 417   C CD   . PRO A 1 35  ? 14.718  -16.613 1.366   1.00 34.24 ? 30  PRO A CD   1  
ATOM 418   H HA   . PRO A 1 35  ? 14.364  -13.486 2.035   1.00 54.15 ? 30  PRO A HA   1  
ATOM 419   H HB3  . PRO A 1 35  ? 14.283  -15.050 3.716   1.00 75.10 ? 30  PRO A HB3  1  
ATOM 420   H HG3  . PRO A 1 35  ? 15.073  -17.211 3.383   1.00 14.24 ? 30  PRO A HG3  1  
ATOM 421   H HD3  . PRO A 1 35  ? 13.720  -16.994 1.530   1.00 23.14 ? 30  PRO A HD3  1  
ATOM 422   N N    . VAL A 1 36  ? 17.364  -14.434 1.034   1.00 41.21 ? 31  VAL A N    1  
ATOM 423   C CA   . VAL A 1 36  ? 18.691  -13.949 0.673   1.00 15.20 ? 31  VAL A CA   1  
ATOM 424   C C    . VAL A 1 36  ? 18.621  -12.975 -0.496  1.00 65.11 ? 31  VAL A C    1  
ATOM 425   O O    . VAL A 1 36  ? 19.298  -11.947 -0.501  1.00 42.24 ? 31  VAL A O    1  
ATOM 426   C CB   . VAL A 1 36  ? 19.630  -15.113 0.301   1.00 42.55 ? 31  VAL A CB   1  
ATOM 427   C CG1  . VAL A 1 36  ? 19.036  -15.940 -0.828  1.00 3.31  ? 31  VAL A CG1  1  
ATOM 428   C CG2  . VAL A 1 36  ? 21.006  -14.585 -0.080  1.00 51.02 ? 31  VAL A CG2  1  
ATOM 429   H H    . VAL A 1 36  ? 17.141  -15.375 0.883   1.00 12.32 ? 31  VAL A H    1  
ATOM 430   H HA   . VAL A 1 36  ? 19.106  -13.440 1.531   1.00 10.30 ? 31  VAL A HA   1  
ATOM 431   H HB   . VAL A 1 36  ? 19.740  -15.751 1.166   1.00 74.12 ? 31  VAL A HB   1  
ATOM 432   H HG11 . VAL A 1 36  ? 19.410  -15.578 -1.775  1.00 70.52 ? 31  VAL A HG11 1  
ATOM 433   H HG12 . VAL A 1 36  ? 19.315  -16.976 -0.702  1.00 41.13 ? 31  VAL A HG12 1  
ATOM 434   H HG13 . VAL A 1 36  ? 17.960  -15.853 -0.810  1.00 60.21 ? 31  VAL A HG13 1  
ATOM 435   H HG21 . VAL A 1 36  ? 21.147  -13.606 0.353   1.00 41.21 ? 31  VAL A HG21 1  
ATOM 436   H HG22 . VAL A 1 36  ? 21.766  -15.256 0.293   1.00 12.53 ? 31  VAL A HG22 1  
ATOM 437   H HG23 . VAL A 1 36  ? 21.081  -14.519 -1.155  1.00 12.21 ? 31  VAL A HG23 1  
ATOM 438   N N    . GLU A 1 37  ? 17.797  -13.303 -1.486  1.00 14.22 ? 32  GLU A N    1  
ATOM 439   C CA   . GLU A 1 37  ? 17.639  -12.455 -2.662  1.00 62.34 ? 32  GLU A CA   1  
ATOM 440   C C    . GLU A 1 37  ? 17.052  -11.100 -2.280  1.00 1.22  ? 32  GLU A C    1  
ATOM 441   O O    . GLU A 1 37  ? 17.554  -10.053 -2.693  1.00 75.31 ? 32  GLU A O    1  
ATOM 442   C CB   . GLU A 1 37  ? 16.742  -13.139 -3.696  1.00 73.24 ? 32  GLU A CB   1  
ATOM 443   C CG   . GLU A 1 37  ? 17.290  -14.465 -4.195  1.00 50.45 ? 32  GLU A CG   1  
ATOM 444   C CD   . GLU A 1 37  ? 17.965  -14.345 -5.549  1.00 74.42 ? 32  GLU A CD   1  
ATOM 445   O OE1  . GLU A 1 37  ? 18.488  -13.254 -5.856  1.00 1.52  ? 32  GLU A OE1  1  
ATOM 446   O OE2  . GLU A 1 37  ? 17.967  -15.344 -6.299  1.00 24.40 ? 32  GLU A OE2  1  
ATOM 447   H H    . GLU A 1 37  ? 17.284  -14.136 -1.425  1.00 23.23 ? 32  GLU A H    1  
ATOM 448   H HA   . GLU A 1 37  ? 18.617  -12.301 -3.093  1.00 53.51 ? 32  GLU A HA   1  
ATOM 449   H HB3  . GLU A 1 37  ? 16.624  -12.481 -4.543  1.00 23.23 ? 32  GLU A HB3  1  
ATOM 450   H HG3  . GLU A 1 37  ? 16.476  -15.170 -4.276  1.00 12.41 ? 32  GLU A HG3  1  
ATOM 451   N N    . LEU A 1 38  ? 15.985  -11.126 -1.489  1.00 22.04 ? 33  LEU A N    1  
ATOM 452   C CA   . LEU A 1 38  ? 15.326  -9.901  -1.051  1.00 62.24 ? 33  LEU A CA   1  
ATOM 453   C C    . LEU A 1 38  ? 16.254  -9.069  -0.170  1.00 14.22 ? 33  LEU A C    1  
ATOM 454   O O    . LEU A 1 38  ? 16.271  -7.841  -0.253  1.00 3.44  ? 33  LEU A O    1  
ATOM 455   C CB   . LEU A 1 38  ? 14.042  -10.232 -0.289  1.00 64.45 ? 33  LEU A CB   1  
ATOM 456   C CG   . LEU A 1 38  ? 12.777  -10.374 -1.135  1.00 3.34  ? 33  LEU A CG   1  
ATOM 457   C CD1  . LEU A 1 38  ? 11.558  -10.566 -0.246  1.00 2.31  ? 33  LEU A CD1  1  
ATOM 458   C CD2  . LEU A 1 38  ? 12.597  -9.158  -2.034  1.00 15.42 ? 33  LEU A CD2  1  
ATOM 459   H H    . LEU A 1 38  ? 15.630  -11.990 -1.192  1.00 24.15 ? 33  LEU A H    1  
ATOM 460   H HA   . LEU A 1 38  ? 15.075  -9.326  -1.931  1.00 41.43 ? 33  LEU A HA   1  
ATOM 461   H HB3  . LEU A 1 38  ? 13.873  -9.444  0.431   1.00 74.32 ? 33  LEU A HB3  1  
ATOM 462   H HG   . LEU A 1 38  ? 12.870  -11.246 -1.767  1.00 52.03 ? 33  LEU A HG   1  
ATOM 463   H HD11 . LEU A 1 38  ? 10.827  -11.168 -0.764  1.00 52.11 ? 33  LEU A HD11 1  
ATOM 464   H HD12 . LEU A 1 38  ? 11.130  -9.603  -0.009  1.00 12.45 ? 33  LEU A HD12 1  
ATOM 465   H HD13 . LEU A 1 38  ? 11.854  -11.063 0.666   1.00 20.24 ? 33  LEU A HD13 1  
ATOM 466   H HD21 . LEU A 1 38  ? 13.325  -8.406  -1.770  1.00 61.00 ? 33  LEU A HD21 1  
ATOM 467   H HD22 . LEU A 1 38  ? 11.601  -8.758  -1.903  1.00 44.25 ? 33  LEU A HD22 1  
ATOM 468   H HD23 . LEU A 1 38  ? 12.736  -9.449  -3.065  1.00 31.40 ? 33  LEU A HD23 1  
ATOM 469   N N    . SER A 1 39  ? 17.026  -9.748  0.673   1.00 63.45 ? 34  SER A N    1  
ATOM 470   C CA   . SER A 1 39  ? 17.955  -9.072  1.571   1.00 52.42 ? 34  SER A CA   1  
ATOM 471   C C    . SER A 1 39  ? 19.011  -8.303  0.781   1.00 54.31 ? 34  SER A C    1  
ATOM 472   O O    . SER A 1 39  ? 19.335  -7.162  1.107   1.00 45.44 ? 34  SER A O    1  
ATOM 473   C CB   . SER A 1 39  ? 18.631  -10.086 2.496   1.00 1.33  ? 34  SER A CB   1  
ATOM 474   O OG   . SER A 1 39  ? 19.929  -9.653  2.865   1.00 72.01 ? 34  SER A OG   1  
ATOM 475   H H    . SER A 1 39  ? 16.967  -10.726 0.693   1.00 2.34  ? 34  SER A H    1  
ATOM 476   H HA   . SER A 1 39  ? 17.389  -8.373  2.169   1.00 45.43 ? 34  SER A HA   1  
ATOM 477   H HB3  . SER A 1 39  ? 18.713  -11.036 1.986   1.00 63.44 ? 34  SER A HB3  1  
ATOM 478   H HG   . SER A 1 39  ? 20.556  -9.898  2.181   1.00 13.52 ? 34  SER A HG   1  
ATOM 479   N N    . SER A 1 40  ? 19.543  -8.939  -0.258  1.00 15.10 ? 35  SER A N    1  
ATOM 480   C CA   . SER A 1 40  ? 20.565  -8.318  -1.092  1.00 21.21 ? 35  SER A CA   1  
ATOM 481   C C    . SER A 1 40  ? 19.995  -7.123  -1.851  1.00 71.34 ? 35  SER A C    1  
ATOM 482   O O    . SER A 1 40  ? 20.637  -6.077  -1.954  1.00 21.54 ? 35  SER A O    1  
ATOM 483   C CB   . SER A 1 40  ? 21.137  -9.338  -2.079  1.00 25.40 ? 35  SER A CB   1  
ATOM 484   O OG   . SER A 1 40  ? 20.619  -9.131  -3.382  1.00 32.24 ? 35  SER A OG   1  
ATOM 485   H H    . SER A 1 40  ? 19.243  -9.848  -0.467  1.00 34.43 ? 35  SER A H    1  
ATOM 486   H HA   . SER A 1 40  ? 21.357  -7.973  -0.444  1.00 51.24 ? 35  SER A HA   1  
ATOM 487   H HB3  . SER A 1 40  ? 20.876  -10.334 -1.753  1.00 5.54  ? 35  SER A HB3  1  
ATOM 488   H HG   . SER A 1 40  ? 20.363  -9.975  -3.762  1.00 4.05  ? 35  SER A HG   1  
ATOM 489   N N    . ILE A 1 41  ? 18.787  -7.287  -2.378  1.00 72.21 ? 36  ILE A N    1  
ATOM 490   C CA   . ILE A 1 41  ? 18.129  -6.222  -3.125  1.00 11.33 ? 36  ILE A CA   1  
ATOM 491   C C    . ILE A 1 41  ? 17.949  -4.977  -2.265  1.00 73.13 ? 36  ILE A C    1  
ATOM 492   O O    . ILE A 1 41  ? 18.209  -3.859  -2.710  1.00 51.54 ? 36  ILE A O    1  
ATOM 493   C CB   . ILE A 1 41  ? 16.754  -6.672  -3.653  1.00 33.30 ? 36  ILE A CB   1  
ATOM 494   C CG1  . ILE A 1 41  ? 16.911  -7.863  -4.601  1.00 22.33 ? 36  ILE A CG1  1  
ATOM 495   C CG2  . ILE A 1 41  ? 16.053  -5.518  -4.354  1.00 12.22 ? 36  ILE A CG2  1  
ATOM 496   C CD1  . ILE A 1 41  ? 15.726  -8.802  -4.594  1.00 31.12 ? 36  ILE A CD1  1  
ATOM 497   H H    . ILE A 1 41  ? 18.326  -8.144  -2.260  1.00 1.15  ? 36  ILE A H    1  
ATOM 498   H HA   . ILE A 1 41  ? 18.754  -5.975  -3.971  1.00 22.14 ? 36  ILE A HA   1  
ATOM 499   H HB   . ILE A 1 41  ? 16.149  -6.970  -2.810  1.00 43.41 ? 36  ILE A HB   1  
ATOM 500   H HG13 . ILE A 1 41  ? 17.786  -8.428  -4.315  1.00 30.35 ? 36  ILE A HG13 1  
ATOM 501   H HG21 . ILE A 1 41  ? 15.749  -4.784  -3.622  1.00 24.15 ? 36  ILE A HG21 1  
ATOM 502   H HG22 . ILE A 1 41  ? 16.729  -5.062  -5.061  1.00 51.24 ? 36  ILE A HG22 1  
ATOM 503   H HG23 . ILE A 1 41  ? 15.183  -5.888  -4.875  1.00 23.22 ? 36  ILE A HG23 1  
ATOM 504   H HD11 . ILE A 1 41  ? 15.054  -8.528  -3.793  1.00 74.14 ? 36  ILE A HD11 1  
ATOM 505   H HD12 . ILE A 1 41  ? 15.207  -8.736  -5.538  1.00 50.24 ? 36  ILE A HD12 1  
ATOM 506   H HD13 . ILE A 1 41  ? 16.071  -9.815  -4.443  1.00 74.13 ? 36  ILE A HD13 1  
ATOM 507   N N    . ALA A 1 42  ? 17.502  -5.178  -1.029  1.00 62.14 ? 37  ALA A N    1  
ATOM 508   C CA   . ALA A 1 42  ? 17.290  -4.071  -0.104  1.00 10.44 ? 37  ALA A CA   1  
ATOM 509   C C    . ALA A 1 42  ? 18.608  -3.386  0.243   1.00 1.00  ? 37  ALA A C    1  
ATOM 510   O O    . ALA A 1 42  ? 18.699  -2.157  0.243   1.00 14.14 ? 37  ALA A O    1  
ATOM 511   C CB   . ALA A 1 42  ? 16.601  -4.564  1.159   1.00 31.52 ? 37  ALA A CB   1  
ATOM 512   H H    . ALA A 1 42  ? 17.311  -6.091  -0.733  1.00 13.40 ? 37  ALA A H    1  
ATOM 513   H HA   . ALA A 1 42  ? 16.639  -3.355  -0.584  1.00 43.41 ? 37  ALA A HA   1  
ATOM 514   H HB1  . ALA A 1 42  ? 16.769  -3.857  1.959   1.00 11.11 ? 37  ALA A HB1  1  
ATOM 515   H HB2  . ALA A 1 42  ? 15.540  -4.657  0.977   1.00 54.43 ? 37  ALA A HB2  1  
ATOM 516   H HB3  . ALA A 1 42  ? 17.005  -5.525  1.438   1.00 1.32  ? 37  ALA A HB3  1  
ATOM 517   N N    . HIS A 1 43  ? 19.626  -4.187  0.538   1.00 40.22 ? 38  HIS A N    1  
ATOM 518   C CA   . HIS A 1 43  ? 20.940  -3.657  0.886   1.00 34.21 ? 38  HIS A CA   1  
ATOM 519   C C    . HIS A 1 43  ? 21.475  -2.757  -0.223  1.00 2.34  ? 38  HIS A C    1  
ATOM 520   O O    . HIS A 1 43  ? 22.043  -1.698  0.045   1.00 2.13  ? 38  HIS A O    1  
ATOM 521   C CB   . HIS A 1 43  ? 21.921  -4.800  1.150   1.00 3.03  ? 38  HIS A CB   1  
ATOM 522   C CG   . HIS A 1 43  ? 22.792  -4.578  2.348   1.00 32.23 ? 38  HIS A CG   1  
ATOM 523   N ND1  . HIS A 1 43  ? 23.839  -3.682  2.362   1.00 2.31  ? 38  HIS A ND1  1  
ATOM 524   C CD2  . HIS A 1 43  ? 22.764  -5.141  3.579   1.00 14.14 ? 38  HIS A CD2  1  
ATOM 525   C CE1  . HIS A 1 43  ? 24.419  -3.705  3.549   1.00 5.44  ? 38  HIS A CE1  1  
ATOM 526   N NE2  . HIS A 1 43  ? 23.785  -4.582  4.305   1.00 73.21 ? 38  HIS A NE2  1  
ATOM 527   H H    . HIS A 1 43  ? 19.492  -5.158  0.520   1.00 24.42 ? 38  HIS A H    1  
ATOM 528   H HA   . HIS A 1 43  ? 20.832  -3.072  1.787   1.00 45.44 ? 38  HIS A HA   1  
ATOM 529   H HB3  . HIS A 1 43  ? 22.564  -4.919  0.289   1.00 13.14 ? 38  HIS A HB3  1  
ATOM 530   H HD1  . HIS A 1 43  ? 24.117  -3.115  1.613   1.00 52.41 ? 38  HIS A HD1  1  
ATOM 531   H HD2  . HIS A 1 43  ? 22.067  -5.892  3.925   1.00 31.23 ? 38  HIS A HD2  1  
ATOM 532   H HE1  . HIS A 1 43  ? 25.268  -3.108  3.850   1.00 12.12 ? 38  HIS A HE1  1  
ATOM 533   N N    . GLN A 1 44  ? 21.290  -3.186  -1.467  1.00 30.44 ? 39  GLN A N    1  
ATOM 534   C CA   . GLN A 1 44  ? 21.754  -2.418  -2.617  1.00 42.44 ? 39  GLN A CA   1  
ATOM 535   C C    . GLN A 1 44  ? 20.967  -1.121  -2.760  1.00 64.22 ? 39  GLN A C    1  
ATOM 536   O O    . GLN A 1 44  ? 21.542  -0.055  -2.990  1.00 33.33 ? 39  GLN A O    1  
ATOM 537   C CB   . GLN A 1 44  ? 21.630  -3.248  -3.895  1.00 61.11 ? 39  GLN A CB   1  
ATOM 538   C CG   . GLN A 1 44  ? 22.687  -4.333  -4.022  1.00 10.13 ? 39  GLN A CG   1  
ATOM 539   C CD   . GLN A 1 44  ? 22.377  -5.324  -5.127  1.00 75.12 ? 39  GLN A CD   1  
ATOM 540   O OE1  . GLN A 1 44  ? 21.235  -5.755  -5.288  1.00 74.32 ? 39  GLN A OE1  1  
ATOM 541   N NE2  . GLN A 1 44  ? 23.396  -5.691  -5.895  1.00 33.25 ? 39  GLN A NE2  1  
ATOM 542   H H    . GLN A 1 44  ? 20.829  -4.037  -1.616  1.00 13.32 ? 39  GLN A H    1  
ATOM 543   H HA   . GLN A 1 44  ? 22.795  -2.177  -2.455  1.00 74.22 ? 39  GLN A HA   1  
ATOM 544   H HB3  . GLN A 1 44  ? 21.717  -2.590  -4.747  1.00 13.21 ? 39  GLN A HB3  1  
ATOM 545   H HG3  . GLN A 1 44  ? 22.750  -4.868  -3.085  1.00 24.34 ? 39  GLN A HG3  1  
ATOM 546   H HE21 . GLN A 1 44  ? 24.278  -5.308  -5.708  1.00 50.43 ? 39  GLN A HE21 1  
ATOM 547   H HE22 . GLN A 1 44  ? 23.224  -6.331  -6.617  1.00 60.21 ? 39  GLN A HE22 1  
ATOM 548   N N    . LEU A 1 45  ? 19.649  -1.216  -2.623  1.00 12.20 ? 40  LEU A N    1  
ATOM 549   C CA   . LEU A 1 45  ? 18.781  -0.049  -2.738  1.00 11.11 ? 40  LEU A CA   1  
ATOM 550   C C    . LEU A 1 45  ? 19.129  0.994   -1.681  1.00 53.23 ? 40  LEU A C    1  
ATOM 551   O O    . LEU A 1 45  ? 19.223  2.185   -1.977  1.00 25.50 ? 40  LEU A O    1  
ATOM 552   C CB   . LEU A 1 45  ? 17.315  -0.464  -2.598  1.00 23.32 ? 40  LEU A CB   1  
ATOM 553   C CG   . LEU A 1 45  ? 16.519  -0.565  -3.901  1.00 42.13 ? 40  LEU A CG   1  
ATOM 554   C CD1  . LEU A 1 45  ? 15.333  -1.499  -3.729  1.00 30.05 ? 40  LEU A CD1  1  
ATOM 555   C CD2  . LEU A 1 45  ? 16.056  0.813   -4.350  1.00 2.32  ? 40  LEU A CD2  1  
ATOM 556   H H    . LEU A 1 45  ? 19.249  -2.092  -2.441  1.00 60.24 ? 40  LEU A H    1  
ATOM 557   H HA   . LEU A 1 45  ? 18.933  0.382   -3.716  1.00 42.01 ? 40  LEU A HA   1  
ATOM 558   H HB3  . LEU A 1 45  ? 16.826  0.263   -1.966  1.00 31.33 ? 40  LEU A HB3  1  
ATOM 559   H HG   . LEU A 1 45  ? 17.156  -0.973  -4.674  1.00 71.14 ? 40  LEU A HG   1  
ATOM 560   H HD11 . LEU A 1 45  ? 14.904  -1.718  -4.696  1.00 1.43  ? 40  LEU A HD11 1  
ATOM 561   H HD12 . LEU A 1 45  ? 14.589  -1.026  -3.106  1.00 33.41 ? 40  LEU A HD12 1  
ATOM 562   H HD13 . LEU A 1 45  ? 15.661  -2.417  -3.265  1.00 54.04 ? 40  LEU A HD13 1  
ATOM 563   H HD21 . LEU A 1 45  ? 16.869  1.516   -4.249  1.00 63.23 ? 40  LEU A HD21 1  
ATOM 564   H HD22 . LEU A 1 45  ? 15.225  1.131   -3.737  1.00 42.44 ? 40  LEU A HD22 1  
ATOM 565   H HD23 . LEU A 1 45  ? 15.745  0.768   -5.384  1.00 52.12 ? 40  LEU A HD23 1  
ATOM 566   N N    . ASP A 1 46  ? 19.322  0.538   -0.448  1.00 35.35 ? 41  ASP A N    1  
ATOM 567   C CA   . ASP A 1 46  ? 19.662  1.431   0.654   1.00 5.33  ? 41  ASP A CA   1  
ATOM 568   C C    . ASP A 1 46  ? 21.028  2.073   0.429   1.00 0.02  ? 41  ASP A C    1  
ATOM 569   O O    . ASP A 1 46  ? 21.195  3.278   0.615   1.00 55.53 ? 41  ASP A O    1  
ATOM 570   C CB   . ASP A 1 46  ? 19.655  0.668   1.979   1.00 0.15  ? 41  ASP A CB   1  
ATOM 571   C CG   . ASP A 1 46  ? 18.390  -0.146  2.170   1.00 73.35 ? 41  ASP A CG   1  
ATOM 572   O OD1  . ASP A 1 46  ? 17.371  0.181   1.527   1.00 2.15  ? 41  ASP A OD1  1  
ATOM 573   O OD2  . ASP A 1 46  ? 18.419  -1.108  2.967   1.00 12.35 ? 41  ASP A OD2  1  
ATOM 574   H H    . ASP A 1 46  ? 19.231  -0.423  -0.274  1.00 43.43 ? 41  ASP A H    1  
ATOM 575   H HA   . ASP A 1 46  ? 18.915  2.209   0.693   1.00 32.22 ? 41  ASP A HA   1  
ATOM 576   H HB3  . ASP A 1 46  ? 19.736  1.373   2.793   1.00 14.25 ? 41  ASP A HB3  1  
ATOM 577   N N    . GLU A 1 47  ? 22.000  1.259   0.030   1.00 63.13 ? 42  GLU A N    1  
ATOM 578   C CA   . GLU A 1 47  ? 23.352  1.748   -0.217  1.00 24.24 ? 42  GLU A CA   1  
ATOM 579   C C    . GLU A 1 47  ? 23.366  2.748   -1.371  1.00 72.40 ? 42  GLU A C    1  
ATOM 580   O O    . GLU A 1 47  ? 23.946  3.828   -1.262  1.00 71.32 ? 42  GLU A O    1  
ATOM 581   C CB   . GLU A 1 47  ? 24.291  0.582   -0.527  1.00 41.34 ? 42  GLU A CB   1  
ATOM 582   C CG   . GLU A 1 47  ? 24.835  -0.107  0.713   1.00 10.54 ? 42  GLU A CG   1  
ATOM 583   C CD   . GLU A 1 47  ? 25.897  0.713   1.418   1.00 3.21  ? 42  GLU A CD   1  
ATOM 584   O OE1  . GLU A 1 47  ? 26.478  1.611   0.773   1.00 15.25 ? 42  GLU A OE1  1  
ATOM 585   O OE2  . GLU A 1 47  ? 26.149  0.457   2.614   1.00 4.02  ? 42  GLU A OE2  1  
ATOM 586   H H    . GLU A 1 47  ? 21.804  0.309   -0.101  1.00 13.32 ? 42  GLU A H    1  
ATOM 587   H HA   . GLU A 1 47  ? 23.693  2.245   0.678   1.00 43.12 ? 42  GLU A HA   1  
ATOM 588   H HB3  . GLU A 1 47  ? 25.126  0.952   -1.103  1.00 1.41  ? 42  GLU A HB3  1  
ATOM 589   H HG3  . GLU A 1 47  ? 25.266  -1.055  0.422   1.00 61.34 ? 42  GLU A HG3  1  
ATOM 590   N N    . GLU A 1 48  ? 22.724  2.378   -2.474  1.00 24.31 ? 43  GLU A N    1  
ATOM 591   C CA   . GLU A 1 48  ? 22.665  3.242   -3.648  1.00 31.43 ? 43  GLU A CA   1  
ATOM 592   C C    . GLU A 1 48  ? 21.979  4.565   -3.316  1.00 13.43 ? 43  GLU A C    1  
ATOM 593   O O    . GLU A 1 48  ? 22.405  5.626   -3.769  1.00 30.24 ? 43  GLU A O    1  
ATOM 594   C CB   . GLU A 1 48  ? 21.921  2.540   -4.787  1.00 63.23 ? 43  GLU A CB   1  
ATOM 595   C CG   . GLU A 1 48  ? 22.248  3.099   -6.162  1.00 72.41 ? 43  GLU A CG   1  
ATOM 596   C CD   . GLU A 1 48  ? 21.201  2.744   -7.199  1.00 0.22  ? 43  GLU A CD   1  
ATOM 597   O OE1  . GLU A 1 48  ? 20.198  3.480   -7.307  1.00 4.31  ? 43  GLU A OE1  1  
ATOM 598   O OE2  . GLU A 1 48  ? 21.386  1.730   -7.904  1.00 32.41 ? 43  GLU A OE2  1  
ATOM 599   H H    . GLU A 1 48  ? 22.281  1.505   -2.500  1.00 14.15 ? 43  GLU A H    1  
ATOM 600   H HA   . GLU A 1 48  ? 23.677  3.444   -3.962  1.00 23.01 ? 43  GLU A HA   1  
ATOM 601   H HB3  . GLU A 1 48  ? 20.858  2.643   -4.623  1.00 5.11  ? 43  GLU A HB3  1  
ATOM 602   H HG3  . GLU A 1 48  ? 23.200  2.702   -6.481  1.00 22.20 ? 43  GLU A HG3  1  
ATOM 603   N N    . GLU A 1 49  ? 20.914  4.489   -2.523  1.00 23.31 ? 44  GLU A N    1  
ATOM 604   C CA   . GLU A 1 49  ? 20.168  5.680   -2.133  1.00 43.24 ? 44  GLU A CA   1  
ATOM 605   C C    . GLU A 1 49  ? 20.978  6.535   -1.161  1.00 11.30 ? 44  GLU A C    1  
ATOM 606   O O    . GLU A 1 49  ? 20.876  7.761   -1.164  1.00 50.10 ? 44  GLU A O    1  
ATOM 607   C CB   . GLU A 1 49  ? 18.835  5.288   -1.494  1.00 73.05 ? 44  GLU A CB   1  
ATOM 608   C CG   . GLU A 1 49  ? 17.663  5.326   -2.460  1.00 74.40 ? 44  GLU A CG   1  
ATOM 609   C CD   . GLU A 1 49  ? 17.359  3.968   -3.063  1.00 71.52 ? 44  GLU A CD   1  
ATOM 610   O OE1  . GLU A 1 49  ? 17.994  3.615   -4.078  1.00 50.20 ? 44  GLU A OE1  1  
ATOM 611   O OE2  . GLU A 1 49  ? 16.486  3.259   -2.519  1.00 23.22 ? 44  GLU A OE2  1  
ATOM 612   H H    . GLU A 1 49  ? 20.623  3.613   -2.194  1.00 65.12 ? 44  GLU A H    1  
ATOM 613   H HA   . GLU A 1 49  ? 19.974  6.257   -3.024  1.00 61.01 ? 44  GLU A HA   1  
ATOM 614   H HB3  . GLU A 1 49  ? 18.626  5.966   -0.681  1.00 72.15 ? 44  GLU A HB3  1  
ATOM 615   H HG3  . GLU A 1 49  ? 17.894  6.015   -3.259  1.00 34.13 ? 44  GLU A HG3  1  
ATOM 616   N N    . ARG A 1 50  ? 21.781  5.876   -0.332  1.00 72.25 ? 45  ARG A N    1  
ATOM 617   C CA   . ARG A 1 50  ? 22.608  6.574   0.646   1.00 31.11 ? 45  ARG A CA   1  
ATOM 618   C C    . ARG A 1 50  ? 23.705  7.378   -0.044  1.00 64.23 ? 45  ARG A C    1  
ATOM 619   O O    . ARG A 1 50  ? 23.957  8.531   0.307   1.00 54.31 ? 45  ARG A O    1  
ATOM 620   C CB   . ARG A 1 50  ? 23.231  5.577   1.624   1.00 12.14 ? 45  ARG A CB   1  
ATOM 621   C CG   . ARG A 1 50  ? 22.267  5.091   2.696   1.00 2.50  ? 45  ARG A CG   1  
ATOM 622   C CD   . ARG A 1 50  ? 22.122  6.108   3.817   1.00 23.45 ? 45  ARG A CD   1  
ATOM 623   N NE   . ARG A 1 50  ? 22.844  5.705   5.020   1.00 13.44 ? 45  ARG A NE   1  
ATOM 624   C CZ   . ARG A 1 50  ? 23.044  6.504   6.061   1.00 22.13 ? 45  ARG A CZ   1  
ATOM 625   N NH1  . ARG A 1 50  ? 22.577  7.745   6.046   1.00 74.33 ? 45  ARG A NH1  1  
ATOM 626   N NH2  . ARG A 1 50  ? 23.711  6.063   7.120   1.00 34.01 ? 45  ARG A NH2  1  
ATOM 627   H H    . ARG A 1 50  ? 21.819  4.898   -0.378  1.00 61.12 ? 45  ARG A H    1  
ATOM 628   H HA   . ARG A 1 50  ? 21.971  7.252   1.194   1.00 64.34 ? 45  ARG A HA   1  
ATOM 629   H HB3  . ARG A 1 50  ? 24.070  6.047   2.113   1.00 12.41 ? 45  ARG A HB3  1  
ATOM 630   H HG3  . ARG A 1 50  ? 22.638  4.164   3.107   1.00 63.45 ? 45  ARG A HG3  1  
ATOM 631   H HD3  . ARG A 1 50  ? 21.074  6.214   4.055   1.00 20.11 ? 45  ARG A HD3  1  
ATOM 632   H HE   . ARG A 1 50  ? 23.197  4.791   5.052   1.00 44.21 ? 45  ARG A HE   1  
ATOM 633   H HH11 . ARG A 1 50  ? 22.074  8.080   5.250   1.00 34.31 ? 45  ARG A HH11 1  
ATOM 634   H HH12 . ARG A 1 50  ? 22.727  8.345   6.832   1.00 73.12 ? 45  ARG A HH12 1  
ATOM 635   H HH21 . ARG A 1 50  ? 24.064  5.128   7.134   1.00 35.32 ? 45  ARG A HH21 1  
ATOM 636   H HH22 . ARG A 1 50  ? 23.860  6.666   7.903   1.00 3.21  ? 45  ARG A HH22 1  
ATOM 637   N N    . MET A 1 51  ? 24.353  6.763   -1.027  1.00 44.31 ? 46  MET A N    1  
ATOM 638   C CA   . MET A 1 51  ? 25.424  7.423   -1.767  1.00 32.02 ? 46  MET A CA   1  
ATOM 639   C C    . MET A 1 51  ? 24.866  8.521   -2.665  1.00 5.11  ? 46  MET A C    1  
ATOM 640   O O    . MET A 1 51  ? 25.426  9.615   -2.746  1.00 13.34 ? 46  MET A O    1  
ATOM 641   C CB   . MET A 1 51  ? 26.195  6.403   -2.606  1.00 2.11  ? 46  MET A CB   1  
ATOM 642   C CG   . MET A 1 51  ? 25.321  5.634   -3.584  1.00 60.41 ? 46  MET A CG   1  
ATOM 643   S SD   . MET A 1 51  ? 26.236  4.371   -4.489  1.00 74.33 ? 46  MET A SD   1  
ATOM 644   C CE   . MET A 1 51  ? 26.550  3.183   -3.185  1.00 2.23  ? 46  MET A CE   1  
ATOM 645   H H    . MET A 1 51  ? 24.107  5.844   -1.261  1.00 43.12 ? 46  MET A H    1  
ATOM 646   H HA   . MET A 1 51  ? 26.097  7.867   -1.049  1.00 21.30 ? 46  MET A HA   1  
ATOM 647   H HB3  . MET A 1 51  ? 26.668  5.692   -1.945  1.00 64.42 ? 46  MET A HB3  1  
ATOM 648   H HG3  . MET A 1 51  ? 24.900  6.332   -4.293  1.00 53.42 ? 46  MET A HG3  1  
ATOM 649   H HE1  . MET A 1 51  ? 27.230  3.610   -2.464  1.00 4.32  ? 46  MET A HE1  1  
ATOM 650   H HE2  . MET A 1 51  ? 25.619  2.930   -2.698  1.00 42.53 ? 46  MET A HE2  1  
ATOM 651   H HE3  . MET A 1 51  ? 26.988  2.291   -3.610  1.00 43.12 ? 46  MET A HE3  1  
ATOM 652   N N    . ARG A 1 52  ? 23.760  8.223   -3.340  1.00 60.52 ? 47  ARG A N    1  
ATOM 653   C CA   . ARG A 1 52  ? 23.128  9.186   -4.235  1.00 33.32 ? 47  ARG A CA   1  
ATOM 654   C C    . ARG A 1 52  ? 22.565  10.368  -3.450  1.00 25.12 ? 47  ARG A C    1  
ATOM 655   O O    . ARG A 1 52  ? 22.557  11.500  -3.935  1.00 53.53 ? 47  ARG A O    1  
ATOM 656   C CB   . ARG A 1 52  ? 22.012  8.513   -5.035  1.00 2.04  ? 47  ARG A CB   1  
ATOM 657   C CG   . ARG A 1 52  ? 20.653  8.575   -4.357  1.00 15.32 ? 47  ARG A CG   1  
ATOM 658   C CD   . ARG A 1 52  ? 19.579  7.902   -5.198  1.00 30.22 ? 47  ARG A CD   1  
ATOM 659   N NE   . ARG A 1 52  ? 18.476  8.809   -5.505  1.00 41.22 ? 47  ARG A NE   1  
ATOM 660   C CZ   . ARG A 1 52  ? 18.504  9.688   -6.501  1.00 2.11  ? 47  ARG A CZ   1  
ATOM 661   N NH1  . ARG A 1 52  ? 19.572  9.778   -7.281  1.00 12.42 ? 47  ARG A NH1  1  
ATOM 662   N NH2  . ARG A 1 52  ? 17.461  10.479  -6.718  1.00 64.25 ? 47  ARG A NH2  1  
ATOM 663   H H    . ARG A 1 52  ? 23.360  7.335   -3.234  1.00 11.32 ? 47  ARG A H    1  
ATOM 664   H HA   . ARG A 1 52  ? 23.881  9.548   -4.918  1.00 22.11 ? 47  ARG A HA   1  
ATOM 665   H HB3  . ARG A 1 52  ? 22.268  7.475   -5.185  1.00 42.32 ? 47  ARG A HB3  1  
ATOM 666   H HG3  . ARG A 1 52  ? 20.384  9.609   -4.205  1.00 32.35 ? 47  ARG A HG3  1  
ATOM 667   H HD3  . ARG A 1 52  ? 19.194  7.053   -4.654  1.00 74.43 ? 47  ARG A HD3  1  
ATOM 668   H HE   . ARG A 1 52  ? 17.678  8.760   -4.941  1.00 74.12 ? 47  ARG A HE   1  
ATOM 669   H HH11 . ARG A 1 52  ? 20.359  9.182   -7.121  1.00 71.40 ? 47  ARG A HH11 1  
ATOM 670   H HH12 . ARG A 1 52  ? 19.589  10.439  -8.031  1.00 4.40  ? 47  ARG A HH12 1  
ATOM 671   H HH21 . ARG A 1 52  ? 16.654  10.414  -6.132  1.00 73.43 ? 47  ARG A HH21 1  
ATOM 672   H HH22 . ARG A 1 52  ? 17.483  11.141  -7.467  1.00 15.52 ? 47  ARG A HH22 1  
ATOM 673   N N    . MET A 1 53  ? 22.094  10.097  -2.237  1.00 3.34  ? 48  MET A N    1  
ATOM 674   C CA   . MET A 1 53  ? 21.531  11.138  -1.387  1.00 21.05 ? 48  MET A CA   1  
ATOM 675   C C    . MET A 1 53  ? 22.629  12.036  -0.825  1.00 25.23 ? 48  MET A C    1  
ATOM 676   O O    . MET A 1 53  ? 22.550  13.260  -0.918  1.00 31.44 ? 48  MET A O    1  
ATOM 677   C CB   . MET A 1 53  ? 20.731  10.514  -0.241  1.00 5.44  ? 48  MET A CB   1  
ATOM 678   C CG   . MET A 1 53  ? 19.313  10.129  -0.630  1.00 15.54 ? 48  MET A CG   1  
ATOM 679   S SD   . MET A 1 53  ? 18.528  9.051   0.583   1.00 54.14 ? 48  MET A SD   1  
ATOM 680   C CE   . MET A 1 53  ? 18.153  10.223  1.885   1.00 24.01 ? 48  MET A CE   1  
ATOM 681   H H    . MET A 1 53  ? 22.128  9.175   -1.906  1.00 3.43  ? 48  MET A H    1  
ATOM 682   H HA   . MET A 1 53  ? 20.867  11.738  -1.993  1.00 15.25 ? 48  MET A HA   1  
ATOM 683   H HB3  . MET A 1 53  ? 20.678  11.221  0.572   1.00 13.31 ? 48  MET A HB3  1  
ATOM 684   H HG3  . MET A 1 53  ? 19.342  9.617   -1.581  1.00 32.50 ? 48  MET A HG3  1  
ATOM 685   H HE1  . MET A 1 53  ? 18.920  10.177  2.643   1.00 72.43 ? 48  MET A HE1  1  
ATOM 686   H HE2  . MET A 1 53  ? 18.115  11.220  1.471   1.00 4.30  ? 48  MET A HE2  1  
ATOM 687   H HE3  . MET A 1 53  ? 17.197  9.979   2.324   1.00 32.25 ? 48  MET A HE3  1  
ATOM 688   N N    . ALA A 1 54  ? 23.651  11.419  -0.244  1.00 73.22 ? 49  ALA A N    1  
ATOM 689   C CA   . ALA A 1 54  ? 24.765  12.162  0.331   1.00 1.32  ? 49  ALA A CA   1  
ATOM 690   C C    . ALA A 1 54  ? 25.449  13.028  -0.722  1.00 53.40 ? 49  ALA A C    1  
ATOM 691   O O    . ALA A 1 54  ? 25.792  14.180  -0.463  1.00 51.11 ? 49  ALA A O    1  
ATOM 692   C CB   . ALA A 1 54  ? 25.767  11.207  0.963   1.00 73.50 ? 49  ALA A CB   1  
ATOM 693   H H    . ALA A 1 54  ? 23.657  10.439  -0.200  1.00 65.11 ? 49  ALA A H    1  
ATOM 694   H HA   . ALA A 1 54  ? 24.374  12.802  1.109   1.00 74.02 ? 49  ALA A HA   1  
ATOM 695   H HB1  . ALA A 1 54  ? 26.537  11.775  1.466   1.00 21.11 ? 49  ALA A HB1  1  
ATOM 696   H HB2  . ALA A 1 54  ? 25.261  10.576  1.678   1.00 34.43 ? 49  ALA A HB2  1  
ATOM 697   H HB3  . ALA A 1 54  ? 26.214  10.595  0.195   1.00 51.43 ? 49  ALA A HB3  1  
ATOM 698   N N    . GLU A 1 55  ? 25.645  12.462  -1.909  1.00 1.11  ? 50  GLU A N    1  
ATOM 699   C CA   . GLU A 1 55  ? 26.289  13.183  -3.000  1.00 4.53  ? 50  GLU A CA   1  
ATOM 700   C C    . GLU A 1 55  ? 25.330  14.188  -3.631  1.00 23.05 ? 50  GLU A C    1  
ATOM 701   O O    . GLU A 1 55  ? 25.712  14.966  -4.504  1.00 43.24 ? 50  GLU A O    1  
ATOM 702   C CB   . GLU A 1 55  ? 26.789  12.203  -4.064  1.00 45.40 ? 50  GLU A CB   1  
ATOM 703   C CG   . GLU A 1 55  ? 25.681  11.618  -4.923  1.00 63.33 ? 50  GLU A CG   1  
ATOM 704   C CD   . GLU A 1 55  ? 25.770  12.060  -6.371  1.00 42.44 ? 50  GLU A CD   1  
ATOM 705   O OE1  . GLU A 1 55  ? 26.248  13.188  -6.619  1.00 54.03 ? 50  GLU A OE1  1  
ATOM 706   O OE2  . GLU A 1 55  ? 25.364  11.279  -7.256  1.00 43.03 ? 50  GLU A OE2  1  
ATOM 707   H H    . GLU A 1 55  ? 25.349  11.540  -2.055  1.00 74.40 ? 50  GLU A H    1  
ATOM 708   H HA   . GLU A 1 55  ? 27.133  13.718  -2.592  1.00 62.12 ? 50  GLU A HA   1  
ATOM 709   H HB3  . GLU A 1 55  ? 27.302  11.389  -3.573  1.00 61.44 ? 50  GLU A HB3  1  
ATOM 710   H HG3  . GLU A 1 55  ? 24.728  11.936  -4.524  1.00 40.23 ? 50  GLU A HG3  1  
ATOM 711   N N    . GLY A 1 56  ? 24.078  14.165  -3.182  1.00 11.12 ? 51  GLY A N    1  
ATOM 712   C CA   . GLY A 1 56  ? 23.082  15.077  -3.713  1.00 42.14 ? 51  GLY A CA   1  
ATOM 713   C C    . GLY A 1 56  ? 22.605  14.675  -5.094  1.00 1.00  ? 51  GLY A C    1  
ATOM 714   O O    . GLY A 1 56  ? 23.094  13.703  -5.669  1.00 63.45 ? 51  GLY A O    1  
ATOM 715   H H    . GLY A 1 56  ? 23.830  13.524  -2.484  1.00 13.44 ? 51  GLY A H    1  
ATOM 716   H HA2  . GLY A 1 56  ? 22.236  15.098  -3.042  1.00 11.14 ? 51  GLY A HA2  1  
ATOM 717   H HA3  . GLY A 1 56  ? 23.510  16.068  -3.767  1.00 74.20 ? 51  GLY A HA3  1  
ATOM 718   N N    . GLY A 1 57  ? 21.644  15.423  -5.628  1.00 40.11 ? 52  GLY A N    1  
ATOM 719   C CA   . GLY A 1 57  ? 21.116  15.122  -6.946  1.00 12.41 ? 52  GLY A CA   1  
ATOM 720   C C    . GLY A 1 57  ? 20.308  16.268  -7.522  1.00 31.11 ? 52  GLY A C    1  
ATOM 721   O O    . GLY A 1 57  ? 19.773  17.093  -6.782  1.00 24.51 ? 52  GLY A O    1  
ATOM 722   H H    . GLY A 1 57  ? 21.292  16.186  -5.124  1.00 60.13 ? 52  GLY A H    1  
ATOM 723   H HA2  . GLY A 1 57  ? 21.938  14.905  -7.610  1.00 41.50 ? 52  GLY A HA2  1  
ATOM 724   H HA3  . GLY A 1 57  ? 20.483  14.250  -6.876  1.00 13.44 ? 52  GLY A HA3  1  
ATOM 725   N N    . VAL A 1 58  ? 20.220  16.321  -8.848  1.00 75.13 ? 53  VAL A N    1  
ATOM 726   C CA   . VAL A 1 58  ? 19.472  17.374  -9.523  1.00 61.43 ? 53  VAL A CA   1  
ATOM 727   C C    . VAL A 1 58  ? 18.457  16.788  -10.498 1.00 62.32 ? 53  VAL A C    1  
ATOM 728   O O    . VAL A 1 58  ? 18.696  16.737  -11.705 1.00 54.31 ? 53  VAL A O    1  
ATOM 729   C CB   . VAL A 1 58  ? 20.411  18.327  -10.287 1.00 22.11 ? 53  VAL A CB   1  
ATOM 730   C CG1  . VAL A 1 58  ? 21.123  19.262  -9.321  1.00 23.04 ? 53  VAL A CG1  1  
ATOM 731   C CG2  . VAL A 1 58  ? 21.414  17.536  -11.114 1.00 23.22 ? 53  VAL A CG2  1  
ATOM 732   H H    . VAL A 1 58  ? 20.669  15.634  -9.384  1.00 54.10 ? 53  VAL A H    1  
ATOM 733   H HA   . VAL A 1 58  ? 18.948  17.945  -8.771  1.00 33.33 ? 53  VAL A HA   1  
ATOM 734   H HB   . VAL A 1 58  ? 19.813  18.926  -10.959 1.00 51.22 ? 53  VAL A HB   1  
ATOM 735   H HG11 . VAL A 1 58  ? 21.266  18.762  -8.376  1.00 60.34 ? 53  VAL A HG11 1  
ATOM 736   H HG12 . VAL A 1 58  ? 22.083  19.541  -9.732  1.00 55.12 ? 53  VAL A HG12 1  
ATOM 737   H HG13 . VAL A 1 58  ? 20.525  20.149  -9.173  1.00 21.41 ? 53  VAL A HG13 1  
ATOM 738   H HG21 . VAL A 1 58  ? 21.459  17.948  -12.111 1.00 42.43 ? 53  VAL A HG21 1  
ATOM 739   H HG22 . VAL A 1 58  ? 22.389  17.599  -10.654 1.00 11.03 ? 53  VAL A HG22 1  
ATOM 740   H HG23 . VAL A 1 58  ? 21.105  16.504  -11.164 1.00 14.43 ? 53  VAL A HG23 1  
ATOM 741   N N    . THR A 1 59  ? 17.320  16.348  -9.966  1.00 1.40  ? 54  THR A N    1  
ATOM 742   C CA   . THR A 1 59  ? 16.268  15.766  -10.789 1.00 52.51 ? 54  THR A CA   1  
ATOM 743   C C    . THR A 1 59  ? 15.082  15.331  -9.936  1.00 20.24 ? 54  THR A C    1  
ATOM 744   O O    . THR A 1 59  ? 15.213  15.126  -8.730  1.00 43.35 ? 54  THR A O    1  
ATOM 745   C CB   . THR A 1 59  ? 16.783  14.553  -11.586 1.00 42.53 ? 54  THR A CB   1  
ATOM 746   O OG1  . THR A 1 59  ? 15.689  13.878  -12.215 1.00 63.21 ? 54  THR A OG1  1  
ATOM 747   C CG2  . THR A 1 59  ? 17.528  13.585  -10.678 1.00 31.13 ? 54  THR A CG2  1  
ATOM 748   H H    . THR A 1 59  ? 17.189  16.417  -8.998  1.00 32.22 ? 54  THR A H    1  
ATOM 749   H HA   . THR A 1 59  ? 15.938  16.517  -11.491 1.00 3.30  ? 54  THR A HA   1  
ATOM 750   H HB   . THR A 1 59  ? 17.466  14.905  -12.347 1.00 4.22  ? 54  THR A HB   1  
ATOM 751   H HG1  . THR A 1 59  ? 15.962  13.561  -13.080 1.00 62.23 ? 54  THR A HG1  1  
ATOM 752   H HG21 . THR A 1 59  ? 18.582  13.817  -10.691 1.00 62.45 ? 54  THR A HG21 1  
ATOM 753   H HG22 . THR A 1 59  ? 17.377  12.575  -11.028 1.00 61.04 ? 54  THR A HG22 1  
ATOM 754   H HG23 . THR A 1 59  ? 17.152  13.677  -9.670  1.00 1.33  ? 54  THR A HG23 1  
ATOM 755   N N    . SER A 1 60  ? 13.922  15.192  -10.572 1.00 74.12 ? 55  SER A N    1  
ATOM 756   C CA   . SER A 1 60  ? 12.710  14.785  -9.870  1.00 52.42 ? 55  SER A CA   1  
ATOM 757   C C    . SER A 1 60  ? 12.951  13.511  -9.064  1.00 5.23  ? 55  SER A C    1  
ATOM 758   O O    . SER A 1 60  ? 12.324  13.293  -8.028  1.00 44.12 ? 55  SER A O    1  
ATOM 759   C CB   . SER A 1 60  ? 11.569  14.565  -10.865 1.00 53.35 ? 55  SER A CB   1  
ATOM 760   O OG   . SER A 1 60  ? 12.048  13.997  -12.072 1.00 23.13 ? 55  SER A OG   1  
ATOM 761   H H    . SER A 1 60  ? 13.880  15.370  -11.535 1.00 41.23 ? 55  SER A H    1  
ATOM 762   H HA   . SER A 1 60  ? 12.436  15.579  -9.192  1.00 64.44 ? 55  SER A HA   1  
ATOM 763   H HB3  . SER A 1 60  ? 11.101  15.512  -11.086 1.00 4.15  ? 55  SER A HB3  1  
ATOM 764   H HG   . SER A 1 60  ? 11.305  13.695  -12.600 1.00 0.35  ? 55  SER A HG   1  
ATOM 765   N N    . GLU A 1 61  ? 13.864  12.675  -9.550  1.00 34.54 ? 56  GLU A N    1  
ATOM 766   C CA   . GLU A 1 61  ? 14.186  11.422  -8.876  1.00 24.51 ? 56  GLU A CA   1  
ATOM 767   C C    . GLU A 1 61  ? 14.553  11.670  -7.416  1.00 73.42 ? 56  GLU A C    1  
ATOM 768   O O    . GLU A 1 61  ? 14.155  10.915  -6.528  1.00 52.13 ? 56  GLU A O    1  
ATOM 769   C CB   . GLU A 1 61  ? 15.339  10.717  -9.590  1.00 40.45 ? 56  GLU A CB   1  
ATOM 770   C CG   . GLU A 1 61  ? 14.917  9.461   -10.336 1.00 63.22 ? 56  GLU A CG   1  
ATOM 771   C CD   . GLU A 1 61  ? 15.350  8.191   -9.631  1.00 14.03 ? 56  GLU A CD   1  
ATOM 772   O OE1  . GLU A 1 61  ? 16.533  8.102   -9.242  1.00 43.54 ? 56  GLU A OE1  1  
ATOM 773   O OE2  . GLU A 1 61  ? 14.506  7.285   -9.467  1.00 3.43  ? 56  GLU A OE2  1  
ATOM 774   H H    . GLU A 1 61  ? 14.329  12.905  -10.381 1.00 53.22 ? 56  GLU A H    1  
ATOM 775   H HA   . GLU A 1 61  ? 13.312  10.791  -8.913  1.00 72.30 ? 56  GLU A HA   1  
ATOM 776   H HB3  . GLU A 1 61  ? 16.085  10.441  -8.859  1.00 74.52 ? 56  GLU A HB3  1  
ATOM 777   H HG3  . GLU A 1 61  ? 15.359  9.478   -11.320 1.00 4.42  ? 56  GLU A HG3  1  
ATOM 778   N N    . ASP A 1 62  ? 15.312  12.733  -7.174  1.00 2.02  ? 57  ASP A N    1  
ATOM 779   C CA   . ASP A 1 62  ? 15.733  13.080  -5.821  1.00 24.23 ? 57  ASP A CA   1  
ATOM 780   C C    . ASP A 1 62  ? 14.527  13.396  -4.942  1.00 3.02  ? 57  ASP A C    1  
ATOM 781   O O    . ASP A 1 62  ? 14.487  13.023  -3.769  1.00 31.43 ? 57  ASP A O    1  
ATOM 782   C CB   . ASP A 1 62  ? 16.684  14.278  -5.853  1.00 64.24 ? 57  ASP A CB   1  
ATOM 783   C CG   . ASP A 1 62  ? 17.284  14.577  -4.493  1.00 34.53 ? 57  ASP A CG   1  
ATOM 784   O OD1  . ASP A 1 62  ? 17.701  13.622  -3.806  1.00 13.22 ? 57  ASP A OD1  1  
ATOM 785   O OD2  . ASP A 1 62  ? 17.333  15.767  -4.114  1.00 11.33 ? 57  ASP A OD2  1  
ATOM 786   H H    . ASP A 1 62  ? 15.597  13.297  -7.923  1.00 5.03  ? 57  ASP A H    1  
ATOM 787   H HA   . ASP A 1 62  ? 16.253  12.231  -5.406  1.00 4.14  ? 57  ASP A HA   1  
ATOM 788   H HB3  . ASP A 1 62  ? 16.143  15.151  -6.188  1.00 35.11 ? 57  ASP A HB3  1  
ATOM 789   N N    . TYR A 1 63  ? 13.547  14.086  -5.516  1.00 33.11 ? 58  TYR A N    1  
ATOM 790   C CA   . TYR A 1 63  ? 12.342  14.454  -4.782  1.00 3.14  ? 58  TYR A CA   1  
ATOM 791   C C    . TYR A 1 63  ? 11.533  13.216  -4.407  1.00 63.41 ? 58  TYR A C    1  
ATOM 792   O O    . TYR A 1 63  ? 11.174  13.025  -3.245  1.00 41.00 ? 58  TYR A O    1  
ATOM 793   C CB   . TYR A 1 63  ? 11.482  15.405  -5.619  1.00 73.31 ? 58  TYR A CB   1  
ATOM 794   C CG   . TYR A 1 63  ? 10.981  16.605  -4.847  1.00 53.41 ? 58  TYR A CG   1  
ATOM 795   C CD1  . TYR A 1 63  ? 11.859  17.419  -4.143  1.00 42.12 ? 58  TYR A CD1  1  
ATOM 796   C CD2  . TYR A 1 63  ? 9.629   16.923  -4.822  1.00 32.35 ? 58  TYR A CD2  1  
ATOM 797   C CE1  . TYR A 1 63  ? 11.405  18.515  -3.436  1.00 21.42 ? 58  TYR A CE1  1  
ATOM 798   C CE2  . TYR A 1 63  ? 9.165   18.019  -4.119  1.00 45.20 ? 58  TYR A CE2  1  
ATOM 799   C CZ   . TYR A 1 63  ? 10.057  18.812  -3.427  1.00 42.33 ? 58  TYR A CZ   1  
ATOM 800   O OH   . TYR A 1 63  ? 9.602   19.904  -2.726  1.00 74.42 ? 58  TYR A OH   1  
ATOM 801   H H    . TYR A 1 63  ? 13.637  14.354  -6.453  1.00 23.32 ? 58  TYR A H    1  
ATOM 802   H HA   . TYR A 1 63  ? 12.645  14.961  -3.878  1.00 4.23  ? 58  TYR A HA   1  
ATOM 803   H HB3  . TYR A 1 63  ? 10.622  14.867  -5.992  1.00 41.55 ? 58  TYR A HB3  1  
ATOM 804   H HD1  . TYR A 1 63  ? 12.913  17.185  -4.153  1.00 54.41 ? 58  TYR A HD1  1  
ATOM 805   H HD2  . TYR A 1 63  ? 8.932   16.300  -5.365  1.00 51.01 ? 58  TYR A HD2  1  
ATOM 806   H HE1  . TYR A 1 63  ? 12.102  19.137  -2.895  1.00 44.23 ? 58  TYR A HE1  1  
ATOM 807   H HE2  . TYR A 1 63  ? 8.111   18.251  -4.112  1.00 55.32 ? 58  TYR A HE2  1  
ATOM 808   H HH   . TYR A 1 63  ? 10.054  20.693  -3.032  1.00 3.03  ? 58  TYR A HH   1  
ATOM 809   N N    . ARG A 1 64  ? 11.249  12.379  -5.399  1.00 71.21 ? 59  ARG A N    1  
ATOM 810   C CA   . ARG A 1 64  ? 10.483  11.160  -5.174  1.00 30.33 ? 59  ARG A CA   1  
ATOM 811   C C    . ARG A 1 64  ? 11.231  10.211  -4.243  1.00 4.24  ? 59  ARG A C    1  
ATOM 812   O O    . ARG A 1 64  ? 10.657  9.664   -3.301  1.00 31.25 ? 59  ARG A O    1  
ATOM 813   C CB   . ARG A 1 64  ? 10.191  10.462  -6.504  1.00 22.42 ? 59  ARG A CB   1  
ATOM 814   C CG   . ARG A 1 64  ? 9.231   11.231  -7.398  1.00 64.32 ? 59  ARG A CG   1  
ATOM 815   C CD   . ARG A 1 64  ? 7.877   10.547  -7.480  1.00 32.34 ? 59  ARG A CD   1  
ATOM 816   N NE   . ARG A 1 64  ? 7.086   11.031  -8.609  1.00 54.44 ? 59  ARG A NE   1  
ATOM 817   C CZ   . ARG A 1 64  ? 7.301   10.663  -9.867  1.00 10.15 ? 59  ARG A CZ   1  
ATOM 818   N NH1  . ARG A 1 64  ? 8.276   9.812   -10.156 1.00 62.42 ? 59  ARG A NH1  1  
ATOM 819   N NH2  . ARG A 1 64  ? 6.540   11.147  -10.840 1.00 34.41 ? 59  ARG A NH2  1  
ATOM 820   H H    . ARG A 1 64  ? 11.562  12.587  -6.304  1.00 40.22 ? 59  ARG A H    1  
ATOM 821   H HA   . ARG A 1 64  ? 9.547   11.437  -4.710  1.00 5.35  ? 59  ARG A HA   1  
ATOM 822   H HB3  . ARG A 1 64  ? 9.762   9.494   -6.302  1.00 14.22 ? 59  ARG A HB3  1  
ATOM 823   H HG3  . ARG A 1 64  ? 9.652   11.298  -8.389  1.00 43.32 ? 59  ARG A HG3  1  
ATOM 824   H HD3  . ARG A 1 64  ? 7.336   10.738  -6.565  1.00 11.35 ? 59  ARG A HD3  1  
ATOM 825   H HE   . ARG A 1 64  ? 6.360   11.659  -8.418  1.00 61.43 ? 59  ARG A HE   1  
ATOM 826   H HH11 . ARG A 1 64  ? 8.852   9.446   -9.425  1.00 34.53 ? 59  ARG A HH11 1  
ATOM 827   H HH12 . ARG A 1 64  ? 8.435   9.537   -11.104 1.00 63.24 ? 59  ARG A HH12 1  
ATOM 828   H HH21 . ARG A 1 64  ? 5.803   11.789  -10.626 1.00 14.51 ? 59  ARG A HH21 1  
ATOM 829   H HH22 . ARG A 1 64  ? 6.702   10.870  -11.786 1.00 22.23 ? 59  ARG A HH22 1  
ATOM 830   N N    . THR A 1 65  ? 12.519  10.017  -4.514  1.00 71.41 ? 60  THR A N    1  
ATOM 831   C CA   . THR A 1 65  ? 13.346  9.134   -3.703  1.00 0.42  ? 60  THR A CA   1  
ATOM 832   C C    . THR A 1 65  ? 13.346  9.567   -2.241  1.00 24.55 ? 60  THR A C    1  
ATOM 833   O O    . THR A 1 65  ? 13.137  8.753   -1.342  1.00 23.31 ? 60  THR A O    1  
ATOM 834   C CB   . THR A 1 65  ? 14.798  9.097   -4.215  1.00 0.44  ? 60  THR A CB   1  
ATOM 835   O OG1  . THR A 1 65  ? 14.831  8.603   -5.559  1.00 13.22 ? 60  THR A OG1  1  
ATOM 836   C CG2  . THR A 1 65  ? 15.663  8.217   -3.325  1.00 50.32 ? 60  THR A CG2  1  
ATOM 837   H H    . THR A 1 65  ? 12.921  10.481  -5.279  1.00 34.54 ? 60  THR A H    1  
ATOM 838   H HA   . THR A 1 65  ? 12.936  8.137   -3.772  1.00 11.42 ? 60  THR A HA   1  
ATOM 839   H HB   . THR A 1 65  ? 15.196  10.101  -4.199  1.00 12.03 ? 60  THR A HB   1  
ATOM 840   H HG1  . THR A 1 65  ? 14.032  8.873   -6.019  1.00 3.11  ? 60  THR A HG1  1  
ATOM 841   H HG21 . THR A 1 65  ? 15.041  7.496   -2.816  1.00 25.42 ? 60  THR A HG21 1  
ATOM 842   H HG22 . THR A 1 65  ? 16.172  8.831   -2.597  1.00 5.11  ? 60  THR A HG22 1  
ATOM 843   H HG23 . THR A 1 65  ? 16.392  7.699   -3.930  1.00 1.14  ? 60  THR A HG23 1  
ATOM 844   N N    . PHE A 1 66  ? 13.581  10.855  -2.011  1.00 5.14  ? 61  PHE A N    1  
ATOM 845   C CA   . PHE A 1 66  ? 13.608  11.398  -0.659  1.00 70.25 ? 61  PHE A CA   1  
ATOM 846   C C    . PHE A 1 66  ? 12.234  11.293  -0.003  1.00 20.30 ? 61  PHE A C    1  
ATOM 847   O O    . PHE A 1 66  ? 12.117  10.922  1.166   1.00 13.53 ? 61  PHE A O    1  
ATOM 848   C CB   . PHE A 1 66  ? 14.065  12.858  -0.681  1.00 73.01 ? 61  PHE A CB   1  
ATOM 849   C CG   . PHE A 1 66  ? 14.707  13.304  0.602   1.00 71.03 ? 61  PHE A CG   1  
ATOM 850   C CD1  . PHE A 1 66  ? 13.950  13.458  1.753   1.00 44.25 ? 61  PHE A CD1  1  
ATOM 851   C CD2  . PHE A 1 66  ? 16.065  13.569  0.657   1.00 45.45 ? 61  PHE A CD2  1  
ATOM 852   C CE1  . PHE A 1 66  ? 14.539  13.869  2.935   1.00 25.50 ? 61  PHE A CE1  1  
ATOM 853   C CE2  . PHE A 1 66  ? 16.658  13.981  1.836   1.00 51.44 ? 61  PHE A CE2  1  
ATOM 854   C CZ   . PHE A 1 66  ? 15.894  14.131  2.976   1.00 51.13 ? 61  PHE A CZ   1  
ATOM 855   H H    . PHE A 1 66  ? 13.741  11.455  -2.771  1.00 13.23 ? 61  PHE A H    1  
ATOM 856   H HA   . PHE A 1 66  ? 14.313  10.817  -0.083  1.00 23.03 ? 61  PHE A HA   1  
ATOM 857   H HB3  . PHE A 1 66  ? 13.211  13.492  -0.864  1.00 24.12 ? 61  PHE A HB3  1  
ATOM 858   H HD1  . PHE A 1 66  ? 12.891  13.253  1.723   1.00 63.41 ? 61  PHE A HD1  1  
ATOM 859   H HD2  . PHE A 1 66  ? 16.665  13.453  -0.235  1.00 20.43 ? 61  PHE A HD2  1  
ATOM 860   H HE1  . PHE A 1 66  ? 13.939  13.985  3.825   1.00 20.50 ? 61  PHE A HE1  1  
ATOM 861   H HE2  . PHE A 1 66  ? 17.719  14.184  1.864   1.00 61.13 ? 61  PHE A HE2  1  
ATOM 862   H HZ   . PHE A 1 66  ? 16.356  14.452  3.897   1.00 71.23 ? 61  PHE A HZ   1  
ATOM 863   N N    . LEU A 1 67  ? 11.196  11.625  -0.763  1.00 41.02 ? 62  LEU A N    1  
ATOM 864   C CA   . LEU A 1 67  ? 9.829   11.569  -0.257  1.00 54.01 ? 62  LEU A CA   1  
ATOM 865   C C    . LEU A 1 67  ? 9.482   10.163  0.221   1.00 75.42 ? 62  LEU A C    1  
ATOM 866   O O    . LEU A 1 67  ? 8.803   9.992   1.233   1.00 31.34 ? 62  LEU A O    1  
ATOM 867   C CB   . LEU A 1 67  ? 8.844   12.009  -1.342  1.00 12.22 ? 62  LEU A CB   1  
ATOM 868   C CG   . LEU A 1 67  ? 8.619   13.515  -1.475  1.00 62.13 ? 62  LEU A CG   1  
ATOM 869   C CD1  . LEU A 1 67  ? 8.140   13.863  -2.875  1.00 10.52 ? 62  LEU A CD1  1  
ATOM 870   C CD2  . LEU A 1 67  ? 7.621   13.998  -0.432  1.00 44.24 ? 62  LEU A CD2  1  
ATOM 871   H H    . LEU A 1 67  ? 11.352  11.913  -1.686  1.00 61.32 ? 62  LEU A H    1  
ATOM 872   H HA   . LEU A 1 67  ? 9.756   12.249  0.579   1.00 44.44 ? 62  LEU A HA   1  
ATOM 873   H HB3  . LEU A 1 67  ? 7.890   11.548  -1.128  1.00 45.42 ? 62  LEU A HB3  1  
ATOM 874   H HG   . LEU A 1 67  ? 9.555   14.029  -1.305  1.00 43.11 ? 62  LEU A HG   1  
ATOM 875   H HD11 . LEU A 1 67  ? 8.273   14.920  -3.049  1.00 42.51 ? 62  LEU A HD11 1  
ATOM 876   H HD12 . LEU A 1 67  ? 7.095   13.611  -2.971  1.00 34.52 ? 62  LEU A HD12 1  
ATOM 877   H HD13 . LEU A 1 67  ? 8.713   13.302  -3.600  1.00 24.44 ? 62  LEU A HD13 1  
ATOM 878   H HD21 . LEU A 1 67  ? 7.396   15.041  -0.606  1.00 51.34 ? 62  LEU A HD21 1  
ATOM 879   H HD22 . LEU A 1 67  ? 8.046   13.882  0.554   1.00 72.11 ? 62  LEU A HD22 1  
ATOM 880   H HD23 . LEU A 1 67  ? 6.714   13.417  -0.506  1.00 44.12 ? 62  LEU A HD23 1  
ATOM 881   N N    . GLN A 1 68  ? 9.954   9.161   -0.512  1.00 0.43  ? 63  GLN A N    1  
ATOM 882   C CA   . GLN A 1 68  ? 9.695   7.769   -0.162  1.00 70.45 ? 63  GLN A CA   1  
ATOM 883   C C    . GLN A 1 68  ? 10.240  7.447   1.226   1.00 44.32 ? 63  GLN A C    1  
ATOM 884   O O    . GLN A 1 68  ? 9.812   6.484   1.863   1.00 23.43 ? 63  GLN A O    1  
ATOM 885   C CB   . GLN A 1 68  ? 10.321  6.835   -1.198  1.00 1.32  ? 63  GLN A CB   1  
ATOM 886   C CG   . GLN A 1 68  ? 9.301   6.149   -2.094  1.00 33.41 ? 63  GLN A CG   1  
ATOM 887   C CD   . GLN A 1 68  ? 9.497   6.479   -3.561  1.00 74.54 ? 63  GLN A CD   1  
ATOM 888   O OE1  . GLN A 1 68  ? 10.363  5.911   -4.225  1.00 4.54  ? 63  GLN A OE1  1  
ATOM 889   N NE2  . GLN A 1 68  ? 8.692   7.403   -4.073  1.00 61.25 ? 63  GLN A NE2  1  
ATOM 890   H H    . GLN A 1 68  ? 10.490  9.361   -1.308  1.00 31.25 ? 63  GLN A H    1  
ATOM 891   H HA   . GLN A 1 68  ? 8.626   7.622   -0.158  1.00 70.33 ? 63  GLN A HA   1  
ATOM 892   H HB3  . GLN A 1 68  ? 10.885  6.071   -0.683  1.00 72.40 ? 63  GLN A HB3  1  
ATOM 893   H HG3  . GLN A 1 68  ? 8.312   6.465   -1.798  1.00 34.32 ? 63  GLN A HG3  1  
ATOM 894   H HE21 . GLN A 1 68  ? 8.026   7.815   -3.482  1.00 51.04 ? 63  GLN A HE21 1  
ATOM 895   H HE22 . GLN A 1 68  ? 8.798   7.636   -5.017  1.00 31.21 ? 63  GLN A HE22 1  
ATOM 896   N N    . GLN A 1 69  ? 11.187  8.258   1.688   1.00 13.35 ? 64  GLN A N    1  
ATOM 897   C CA   . GLN A 1 69  ? 11.790  8.057   2.999   1.00 51.34 ? 64  GLN A CA   1  
ATOM 898   C C    . GLN A 1 69  ? 12.540  6.730   3.056   1.00 64.12 ? 64  GLN A C    1  
ATOM 899   O O    . GLN A 1 69  ? 12.094  5.763   3.673   1.00 71.03 ? 64  GLN A O    1  
ATOM 900   C CB   . GLN A 1 69  ? 10.719  8.098   4.089   1.00 60.21 ? 64  GLN A CB   1  
ATOM 901   C CG   . GLN A 1 69  ? 9.734   9.246   3.932   1.00 51.31 ? 64  GLN A CG   1  
ATOM 902   C CD   . GLN A 1 69  ? 9.164   9.712   5.257   1.00 50.21 ? 64  GLN A CD   1  
ATOM 903   O OE1  . GLN A 1 69  ? 9.008   8.924   6.191   1.00 12.35 ? 64  GLN A OE1  1  
ATOM 904   N NE2  . GLN A 1 69  ? 8.849   10.999  5.347   1.00 40.32 ? 64  GLN A NE2  1  
ATOM 905   H H    . GLN A 1 69  ? 11.486  9.008   1.132   1.00 75.12 ? 64  GLN A H    1  
ATOM 906   H HA   . GLN A 1 69  ? 12.493  8.860   3.167   1.00 22.40 ? 64  GLN A HA   1  
ATOM 907   H HB3  . GLN A 1 69  ? 11.203  8.197   5.050   1.00 22.41 ? 64  GLN A HB3  1  
ATOM 908   H HG3  . GLN A 1 69  ? 8.920   8.920   3.301   1.00 44.12 ? 64  GLN A HG3  1  
ATOM 909   H HE21 . GLN A 1 69  ? 9.000   11.567  4.562   1.00 22.11 ? 64  GLN A HE21 1  
ATOM 910   H HE22 . GLN A 1 69  ? 8.479   11.327  6.191   1.00 30.31 ? 64  GLN A HE22 1  
ATOM 911   N N    . PRO A 1 70  ? 13.708  6.681   2.398   1.00 41.31 ? 65  PRO A N    1  
ATOM 912   C CA   . PRO A 1 70  ? 14.545  5.478   2.359   1.00 31.14 ? 65  PRO A CA   1  
ATOM 913   C C    . PRO A 1 70  ? 15.182  5.170   3.710   1.00 32.32 ? 65  PRO A C    1  
ATOM 914   O O    . PRO A 1 70  ? 14.930  5.862   4.697   1.00 63.14 ? 65  PRO A O    1  
ATOM 915   C CB   . PRO A 1 70  ? 15.621  5.827   1.327   1.00 74.33 ? 65  PRO A CB   1  
ATOM 916   C CG   . PRO A 1 70  ? 15.696  7.315   1.348   1.00 54.40 ? 65  PRO A CG   1  
ATOM 917   C CD   . PRO A 1 70  ? 14.302  7.796   1.642   1.00 10.55 ? 65  PRO A CD   1  
ATOM 918   H HA   . PRO A 1 70  ? 13.986  4.617   2.021   1.00 33.22 ? 65  PRO A HA   1  
ATOM 919   H HB3  . PRO A 1 70  ? 15.326  5.461   0.356   1.00 11.34 ? 65  PRO A HB3  1  
ATOM 920   H HG3  . PRO A 1 70  ? 16.023  7.678   0.385   1.00 20.12 ? 65  PRO A HG3  1  
ATOM 921   H HD3  . PRO A 1 70  ? 13.760  7.968   0.722   1.00 45.13 ? 65  PRO A HD3  1  
ATOM 922   N N    . SER A 1 71  ? 16.007  4.129   3.747   1.00 11.24 ? 66  SER A N    1  
ATOM 923   C CA   . SER A 1 71  ? 16.677  3.728   4.978   1.00 63.02 ? 66  SER A CA   1  
ATOM 924   C C    . SER A 1 71  ? 15.673  3.563   6.114   1.00 34.11 ? 66  SER A C    1  
ATOM 925   O O    . SER A 1 71  ? 14.462  3.575   5.894   1.00 73.03 ? 66  SER A O    1  
ATOM 926   C CB   . SER A 1 71  ? 17.737  4.761   5.366   1.00 21.32 ? 66  SER A CB   1  
ATOM 927   O OG   . SER A 1 71  ? 19.008  4.154   5.521   1.00 31.24 ? 66  SER A OG   1  
ATOM 928   H H    . SER A 1 71  ? 16.165  3.617   2.927   1.00 44.50 ? 66  SER A H    1  
ATOM 929   H HA   . SER A 1 71  ? 17.159  2.779   4.799   1.00 40.30 ? 66  SER A HA   1  
ATOM 930   H HB3  . SER A 1 71  ? 17.456  5.227   6.300   1.00 53.25 ? 66  SER A HB3  1  
ATOM 931   H HG   . SER A 1 71  ? 19.424  4.057   4.661   1.00 61.12 ? 66  SER A HG   1  
ATOM 932   N N    . GLY A 1 72  ? 16.184  3.407   7.331   1.00 53.44 ? 67  GLY A N    1  
ATOM 933   C CA   . GLY A 1 72  ? 15.320  3.241   8.485   1.00 11.53 ? 67  GLY A CA   1  
ATOM 934   C C    . GLY A 1 72  ? 15.780  4.056   9.677   1.00 52.34 ? 67  GLY A C    1  
ATOM 935   O O    . GLY A 1 72  ? 16.105  5.234   9.543   1.00 74.11 ? 67  GLY A O    1  
ATOM 936   H H    . GLY A 1 72  ? 17.158  3.405   7.447   1.00 1.02  ? 67  GLY A H    1  
ATOM 937   H HA2  . GLY A 1 72  ? 14.319  3.546   8.218   1.00 10.51 ? 67  GLY A HA2  1  
ATOM 938   H HA3  . GLY A 1 72  ? 15.305  2.197   8.762   1.00 13.32 ? 67  GLY A HA3  1  
ATOM 939   N N    . ASN A 1 73  ? 15.807  3.426   10.848  1.00 3.11  ? 68  ASN A N    1  
ATOM 940   C CA   . ASN A 1 73  ? 16.229  4.101   12.069  1.00 65.33 ? 68  ASN A CA   1  
ATOM 941   C C    . ASN A 1 73  ? 16.711  3.095   13.109  1.00 72.24 ? 68  ASN A C    1  
ATOM 942   O O    . ASN A 1 73  ? 17.781  3.257   13.696  1.00 31.55 ? 68  ASN A O    1  
ATOM 943   C CB   . ASN A 1 73  ? 15.079  4.932   12.641  1.00 32.34 ? 68  ASN A CB   1  
ATOM 944   C CG   . ASN A 1 73  ? 15.367  6.420   12.608  1.00 20.34 ? 68  ASN A CG   1  
ATOM 945   O OD1  . ASN A 1 73  ? 14.632  7.192   11.991  1.00 43.21 ? 68  ASN A OD1  1  
ATOM 946   N ND2  . ASN A 1 73  ? 16.439  6.829   13.274  1.00 64.12 ? 68  ASN A ND2  1  
ATOM 947   H H    . ASN A 1 73  ? 15.536  2.485   10.891  1.00 45.02 ? 68  ASN A H    1  
ATOM 948   H HA   . ASN A 1 73  ? 17.046  4.761   11.817  1.00 54.03 ? 68  ASN A HA   1  
ATOM 949   H HB3  . ASN A 1 73  ? 14.906  4.639   13.667  1.00 23.55 ? 68  ASN A HB3  1  
ATOM 950   H HD21 . ASN A 1 73  ? 16.978  6.158   13.743  1.00 65.31 ? 68  ASN A HD21 1  
ATOM 951   H HD22 . ASN A 1 73  ? 16.649  7.787   13.269  1.00 62.25 ? 68  ASN A HD22 1  
ATOM 952   N N    . MET A 1 74  ? 15.914  2.055   13.331  1.00 13.11 ? 69  MET A N    1  
ATOM 953   C CA   . MET A 1 74  ? 16.259  1.020   14.299  1.00 52.34 ? 69  MET A CA   1  
ATOM 954   C C    . MET A 1 74  ? 16.510  -0.314  13.602  1.00 71.44 ? 69  MET A C    1  
ATOM 955   O O    . MET A 1 74  ? 16.593  -0.378  12.376  1.00 32.13 ? 69  MET A O    1  
ATOM 956   C CB   . MET A 1 74  ? 15.144  0.867   15.335  1.00 42.03 ? 69  MET A CB   1  
ATOM 957   C CG   . MET A 1 74  ? 15.635  0.938   16.772  1.00 2.13  ? 69  MET A CG   1  
ATOM 958   S SD   . MET A 1 74  ? 14.622  2.019   17.799  1.00 42.23 ? 69  MET A SD   1  
ATOM 959   C CE   . MET A 1 74  ? 14.442  1.016   19.272  1.00 14.22 ? 69  MET A CE   1  
ATOM 960   H H    . MET A 1 74  ? 15.073  1.980   12.832  1.00 62.34 ? 69  MET A H    1  
ATOM 961   H HA   . MET A 1 74  ? 17.165  1.327   14.801  1.00 14.20 ? 69  MET A HA   1  
ATOM 962   H HB3  . MET A 1 74  ? 14.662  -0.088  15.189  1.00 73.11 ? 69  MET A HB3  1  
ATOM 963   H HG3  . MET A 1 74  ? 16.649  1.309   16.772  1.00 54.03 ? 69  MET A HG3  1  
ATOM 964   H HE1  . MET A 1 74  ? 15.398  0.589   19.537  1.00 5.13  ? 69  MET A HE1  1  
ATOM 965   H HE2  . MET A 1 74  ? 14.084  1.630   20.084  1.00 61.33 ? 69  MET A HE2  1  
ATOM 966   H HE3  . MET A 1 74  ? 13.734  0.222   19.081  1.00 71.32 ? 69  MET A HE3  1  
ATOM 967   N N    . ASP A 1 75  ? 16.631  -1.375  14.393  1.00 13.22 ? 70  ASP A N    1  
ATOM 968   C CA   . ASP A 1 75  ? 16.871  -2.708  13.852  1.00 64.42 ? 70  ASP A CA   1  
ATOM 969   C C    . ASP A 1 75  ? 15.654  -3.605  14.058  1.00 50.10 ? 70  ASP A C    1  
ATOM 970   O O    . ASP A 1 75  ? 14.583  -3.136  14.443  1.00 54.11 ? 70  ASP A O    1  
ATOM 971   C CB   . ASP A 1 75  ? 18.100  -3.335  14.511  1.00 44.52 ? 70  ASP A CB   1  
ATOM 972   C CG   . ASP A 1 75  ? 19.189  -2.317  14.792  1.00 32.41 ? 70  ASP A CG   1  
ATOM 973   O OD1  . ASP A 1 75  ? 19.933  -1.970  13.853  1.00 45.24 ? 70  ASP A OD1  1  
ATOM 974   O OD2  . ASP A 1 75  ? 19.293  -1.868  15.952  1.00 53.21 ? 70  ASP A OD2  1  
ATOM 975   H H    . ASP A 1 75  ? 16.555  -1.259  15.364  1.00 1.43  ? 70  ASP A H    1  
ATOM 976   H HA   . ASP A 1 75  ? 17.052  -2.608  12.793  1.00 64.05 ? 70  ASP A HA   1  
ATOM 977   H HB3  . ASP A 1 75  ? 18.503  -4.094  13.857  1.00 3.14  ? 70  ASP A HB3  1  
ATOM 978   N N    . ASP A 1 76  ? 15.828  -4.897  13.799  1.00 2.01  ? 71  ASP A N    1  
ATOM 979   C CA   . ASP A 1 76  ? 14.744  -5.860  13.957  1.00 44.31 ? 71  ASP A CA   1  
ATOM 980   C C    . ASP A 1 76  ? 13.708  -5.697  12.850  1.00 32.14 ? 71  ASP A C    1  
ATOM 981   O O    . ASP A 1 76  ? 13.562  -6.565  11.989  1.00 21.34 ? 71  ASP A O    1  
ATOM 982   C CB   . ASP A 1 76  ? 14.081  -5.694  15.324  1.00 35.35 ? 71  ASP A CB   1  
ATOM 983   C CG   . ASP A 1 76  ? 13.370  -6.954  15.779  1.00 72.15 ? 71  ASP A CG   1  
ATOM 984   O OD1  . ASP A 1 76  ? 13.454  -7.973  15.064  1.00 52.14 ? 71  ASP A OD1  1  
ATOM 985   O OD2  . ASP A 1 76  ? 12.730  -6.920  16.851  1.00 52.33 ? 71  ASP A OD2  1  
ATOM 986   H H    . ASP A 1 76  ? 16.706  -5.210  13.496  1.00 5.13  ? 71  ASP A H    1  
ATOM 987   H HA   . ASP A 1 76  ? 15.169  -6.850  13.891  1.00 11.33 ? 71  ASP A HA   1  
ATOM 988   H HB3  . ASP A 1 76  ? 13.356  -4.894  15.271  1.00 43.51 ? 71  ASP A HB3  1  
ATOM 989   N N    . SER A 1 77  ? 12.988  -4.579  12.880  1.00 12.32 ? 72  SER A N    1  
ATOM 990   C CA   . SER A 1 77  ? 11.961  -4.305  11.883  1.00 24.42 ? 72  SER A CA   1  
ATOM 991   C C    . SER A 1 77  ? 12.459  -3.293  10.854  1.00 34.13 ? 72  SER A C    1  
ATOM 992   O O    . SER A 1 77  ? 12.017  -3.290  9.706   1.00 31.24 ? 72  SER A O    1  
ATOM 993   C CB   . SER A 1 77  ? 10.692  -3.779  12.558  1.00 21.23 ? 72  SER A CB   1  
ATOM 994   O OG   . SER A 1 77  ? 10.809  -3.826  13.969  1.00 23.14 ? 72  SER A OG   1  
ATOM 995   H H    . SER A 1 77  ? 13.151  -3.925  13.591  1.00 74.34 ? 72  SER A H    1  
ATOM 996   H HA   . SER A 1 77  ? 11.732  -5.231  11.377  1.00 74.05 ? 72  SER A HA   1  
ATOM 997   H HB3  . SER A 1 77  ? 9.851   -4.387  12.257  1.00 21.50 ? 72  SER A HB3  1  
ATOM 998   H HG   . SER A 1 77  ? 10.532  -2.986  14.341  1.00 71.52 ? 72  SER A HG   1  
ATOM 999   N N    . GLY A 1 78  ? 13.383  -2.436  11.275  1.00 73.00 ? 73  GLY A N    1  
ATOM 1000  C CA   . GLY A 1 78  ? 13.927  -1.432  10.380  1.00 22.33 ? 73  GLY A CA   1  
ATOM 1001  C C    . GLY A 1 78  ? 15.046  -1.973  9.513   1.00 52.41 ? 73  GLY A C    1  
ATOM 1002  O O    . GLY A 1 78  ? 16.144  -1.416  9.485   1.00 25.00 ? 73  GLY A O    1  
ATOM 1003  H H    . GLY A 1 78  ? 13.699  -2.486  12.202  1.00 50.31 ? 73  GLY A H    1  
ATOM 1004  H HA2  . GLY A 1 78  ? 13.135  -1.068  9.742   1.00 44.54 ? 73  GLY A HA2  1  
ATOM 1005  H HA3  . GLY A 1 78  ? 14.308  -0.610  10.968  1.00 32.23 ? 73  GLY A HA3  1  
ATOM 1006  N N    . PHE A 1 79  ? 14.771  -3.064  8.806   1.00 51.22 ? 74  PHE A N    1  
ATOM 1007  C CA   . PHE A 1 79  ? 15.765  -3.682  7.936   1.00 60.12 ? 74  PHE A CA   1  
ATOM 1008  C C    . PHE A 1 79  ? 15.462  -3.390  6.470   1.00 22.54 ? 74  PHE A C    1  
ATOM 1009  O O    . PHE A 1 79  ? 16.308  -2.873  5.741   1.00 5.30  ? 74  PHE A O    1  
ATOM 1010  C CB   . PHE A 1 79  ? 15.806  -5.194  8.168   1.00 71.12 ? 74  PHE A CB   1  
ATOM 1011  C CG   . PHE A 1 79  ? 16.945  -5.636  9.041   1.00 45.12 ? 74  PHE A CG   1  
ATOM 1012  C CD1  . PHE A 1 79  ? 17.205  -4.995  10.241  1.00 13.10 ? 74  PHE A CD1  1  
ATOM 1013  C CD2  . PHE A 1 79  ? 17.757  -6.693  8.660   1.00 63.43 ? 74  PHE A CD2  1  
ATOM 1014  C CE1  . PHE A 1 79  ? 18.252  -5.400  11.048  1.00 4.24  ? 74  PHE A CE1  1  
ATOM 1015  C CE2  . PHE A 1 79  ? 18.806  -7.101  9.462   1.00 14.21 ? 74  PHE A CE2  1  
ATOM 1016  C CZ   . PHE A 1 79  ? 19.054  -6.454  10.656  1.00 61.23 ? 74  PHE A CZ   1  
ATOM 1017  H H    . PHE A 1 79  ? 13.878  -3.462  8.871   1.00 35.12 ? 74  PHE A H    1  
ATOM 1018  H HA   . PHE A 1 79  ? 16.727  -3.263  8.184   1.00 3.20  ? 74  PHE A HA   1  
ATOM 1019  H HB3  . PHE A 1 79  ? 15.901  -5.694  7.216   1.00 44.33 ? 74  PHE A HB3  1  
ATOM 1020  H HD1  . PHE A 1 79  ? 16.577  -4.170  10.548  1.00 2.21  ? 74  PHE A HD1  1  
ATOM 1021  H HD2  . PHE A 1 79  ? 17.565  -7.199  7.726   1.00 12.02 ? 74  PHE A HD2  1  
ATOM 1022  H HE1  . PHE A 1 79  ? 18.443  -4.890  11.980  1.00 54.31 ? 74  PHE A HE1  1  
ATOM 1023  H HE2  . PHE A 1 79  ? 19.432  -7.926  9.154   1.00 42.15 ? 74  PHE A HE2  1  
ATOM 1024  H HZ   . PHE A 1 79  ? 19.873  -6.772  11.285  1.00 23.04 ? 74  PHE A HZ   1  
ATOM 1025  N N    . PHE A 1 80  ? 14.248  -3.723  6.044   1.00 40.00 ? 75  PHE A N    1  
ATOM 1026  C CA   . PHE A 1 80  ? 13.833  -3.498  4.664   1.00 72.11 ? 75  PHE A CA   1  
ATOM 1027  C C    . PHE A 1 80  ? 13.429  -2.043  4.449   1.00 25.50 ? 75  PHE A C    1  
ATOM 1028  O O    . PHE A 1 80  ? 13.662  -1.189  5.305   1.00 13.20 ? 75  PHE A O    1  
ATOM 1029  C CB   . PHE A 1 80  ? 12.668  -4.421  4.304   1.00 23.14 ? 75  PHE A CB   1  
ATOM 1030  C CG   . PHE A 1 80  ? 12.912  -5.239  3.067   1.00 32.23 ? 75  PHE A CG   1  
ATOM 1031  C CD1  . PHE A 1 80  ? 14.065  -5.994  2.937   1.00 11.44 ? 75  PHE A CD1  1  
ATOM 1032  C CD2  . PHE A 1 80  ? 11.987  -5.252  2.036   1.00 24.14 ? 75  PHE A CD2  1  
ATOM 1033  C CE1  . PHE A 1 80  ? 14.293  -6.749  1.801   1.00 72.12 ? 75  PHE A CE1  1  
ATOM 1034  C CE2  . PHE A 1 80  ? 12.209  -6.004  0.897   1.00 72.21 ? 75  PHE A CE2  1  
ATOM 1035  C CZ   . PHE A 1 80  ? 13.363  -6.752  0.779   1.00 74.34 ? 75  PHE A CZ   1  
ATOM 1036  H H    . PHE A 1 80  ? 13.616  -4.132  6.673   1.00 51.24 ? 75  PHE A H    1  
ATOM 1037  H HA   . PHE A 1 80  ? 14.672  -3.724  4.025   1.00 13.22 ? 75  PHE A HA   1  
ATOM 1038  H HB3  . PHE A 1 80  ? 11.783  -3.825  4.139   1.00 70.20 ? 75  PHE A HB3  1  
ATOM 1039  H HD1  . PHE A 1 80  ? 14.794  -5.993  3.736   1.00 71.40 ? 75  PHE A HD1  1  
ATOM 1040  H HD2  . PHE A 1 80  ? 11.084  -4.666  2.126   1.00 25.55 ? 75  PHE A HD2  1  
ATOM 1041  H HE1  . PHE A 1 80  ? 15.196  -7.333  1.713   1.00 43.23 ? 75  PHE A HE1  1  
ATOM 1042  H HE2  . PHE A 1 80  ? 11.480  -6.005  0.100   1.00 60.02 ? 75  PHE A HE2  1  
ATOM 1043  H HZ   . PHE A 1 80  ? 13.539  -7.341  -0.108  1.00 5.11  ? 75  PHE A HZ   1  
ATOM 1044  N N    . SER A 1 81  ? 12.822  -1.767  3.298   1.00 53.22 ? 76  SER A N    1  
ATOM 1045  C CA   . SER A 1 81  ? 12.390  -0.415  2.967   1.00 70.24 ? 76  SER A CA   1  
ATOM 1046  C C    . SER A 1 81  ? 11.199  -0.443  2.014   1.00 24.21 ? 76  SER A C    1  
ATOM 1047  O O    . SER A 1 81  ? 11.043  -1.377  1.227   1.00 13.33 ? 76  SER A O    1  
ATOM 1048  C CB   . SER A 1 81  ? 13.542  0.373   2.340   1.00 21.34 ? 76  SER A CB   1  
ATOM 1049  O OG   . SER A 1 81  ? 13.803  1.561   3.066   1.00 65.21 ? 76  SER A OG   1  
ATOM 1050  H H    . SER A 1 81  ? 12.665  -2.491  2.656   1.00 72.14 ? 76  SER A H    1  
ATOM 1051  H HA   . SER A 1 81  ? 12.091  0.072   3.883   1.00 75.44 ? 76  SER A HA   1  
ATOM 1052  H HB3  . SER A 1 81  ? 13.284  0.635   1.324   1.00 33.35 ? 76  SER A HB3  1  
ATOM 1053  H HG   . SER A 1 81  ? 13.015  2.110   3.077   1.00 41.40 ? 76  SER A HG   1  
ATOM 1054  N N    . ILE A 1 82  ? 10.363  0.587   2.091   1.00 15.32 ? 77  ILE A N    1  
ATOM 1055  C CA   . ILE A 1 82  ? 9.187   0.680   1.235   1.00 31.25 ? 77  ILE A CA   1  
ATOM 1056  C C    . ILE A 1 82  ? 9.572   0.610   -0.239  1.00 52.23 ? 77  ILE A C    1  
ATOM 1057  O O    . ILE A 1 82  ? 8.806   0.120   -1.067  1.00 30.44 ? 77  ILE A O    1  
ATOM 1058  C CB   . ILE A 1 82  ? 8.409   1.985   1.488   1.00 35.23 ? 77  ILE A CB   1  
ATOM 1059  C CG1  . ILE A 1 82  ? 7.575   1.867   2.766   1.00 70.23 ? 77  ILE A CG1  1  
ATOM 1060  C CG2  . ILE A 1 82  ? 7.519   2.311   0.298   1.00 51.04 ? 77  ILE A CG2  1  
ATOM 1061  C CD1  . ILE A 1 82  ? 6.391   0.934   2.632   1.00 61.25 ? 77  ILE A CD1  1  
ATOM 1062  H H    . ILE A 1 82  ? 10.540  1.299   2.739   1.00 44.55 ? 77  ILE A H    1  
ATOM 1063  H HA   . ILE A 1 82  ? 8.539   -0.153  1.466   1.00 74.24 ? 77  ILE A HA   1  
ATOM 1064  H HB   . ILE A 1 82  ? 9.122   2.786   1.605   1.00 73.41 ? 77  ILE A HB   1  
ATOM 1065  H HG13 . ILE A 1 82  ? 7.200   2.845   3.033   1.00 70.20 ? 77  ILE A HG13 1  
ATOM 1066  H HG21 . ILE A 1 82  ? 6.963   1.431   0.012   1.00 52.21 ? 77  ILE A HG21 1  
ATOM 1067  H HG22 . ILE A 1 82  ? 6.832   3.099   0.568   1.00 50.31 ? 77  ILE A HG22 1  
ATOM 1068  H HG23 . ILE A 1 82  ? 8.131   2.635   -0.531  1.00 13.52 ? 77  ILE A HG23 1  
ATOM 1069  H HD11 . ILE A 1 82  ? 6.638   0.137   1.947   1.00 12.14 ? 77  ILE A HD11 1  
ATOM 1070  H HD12 . ILE A 1 82  ? 6.149   0.519   3.599   1.00 5.44  ? 77  ILE A HD12 1  
ATOM 1071  H HD13 . ILE A 1 82  ? 5.542   1.484   2.253   1.00 73.03 ? 77  ILE A HD13 1  
ATOM 1072  N N    . GLN A 1 83  ? 10.766  1.100   -0.556  1.00 0.12  ? 78  GLN A N    1  
ATOM 1073  C CA   . GLN A 1 83  ? 11.254  1.092   -1.930  1.00 3.34  ? 78  GLN A CA   1  
ATOM 1074  C C    . GLN A 1 83  ? 11.360  -0.334  -2.461  1.00 14.11 ? 78  GLN A C    1  
ATOM 1075  O O    . GLN A 1 83  ? 10.961  -0.618  -3.591  1.00 22.23 ? 78  GLN A O    1  
ATOM 1076  C CB   . GLN A 1 83  ? 12.616  1.782   -2.014  1.00 52.41 ? 78  GLN A CB   1  
ATOM 1077  C CG   . GLN A 1 83  ? 12.607  3.212   -1.497  1.00 5.35  ? 78  GLN A CG   1  
ATOM 1078  C CD   . GLN A 1 83  ? 12.963  3.304   -0.027  1.00 44.52 ? 78  GLN A CD   1  
ATOM 1079  O OE1  . GLN A 1 83  ? 12.188  3.815   0.780   1.00 22.51 ? 78  GLN A OE1  1  
ATOM 1080  N NE2  . GLN A 1 83  ? 14.143  2.807   0.328   1.00 20.43 ? 78  GLN A NE2  1  
ATOM 1081  H H    . GLN A 1 83  ? 11.332  1.477   0.149   1.00 72.52 ? 78  GLN A H    1  
ATOM 1082  H HA   . GLN A 1 83  ? 10.547  1.637   -2.536  1.00 33.01 ? 78  GLN A HA   1  
ATOM 1083  H HB3  . GLN A 1 83  ? 12.936  1.797   -3.046  1.00 54.25 ? 78  GLN A HB3  1  
ATOM 1084  H HG3  . GLN A 1 83  ? 11.620  3.625   -1.641  1.00 24.23 ? 78  GLN A HG3  1  
ATOM 1085  H HE21 . GLN A 1 83  ? 14.709  2.416   -0.370  1.00 10.12 ? 78  GLN A HE21 1  
ATOM 1086  H HE22 . GLN A 1 83  ? 14.399  2.854   1.272   1.00 52.22 ? 78  GLN A HE22 1  
ATOM 1087  N N    . VAL A 1 84  ? 11.900  -1.229  -1.639  1.00 22.33 ? 79  VAL A N    1  
ATOM 1088  C CA   . VAL A 1 84  ? 12.057  -2.625  -2.026  1.00 51.30 ? 79  VAL A CA   1  
ATOM 1089  C C    . VAL A 1 84  ? 10.704  -3.319  -2.142  1.00 41.24 ? 79  VAL A C    1  
ATOM 1090  O O    . VAL A 1 84  ? 10.429  -4.001  -3.130  1.00 34.23 ? 79  VAL A O    1  
ATOM 1091  C CB   . VAL A 1 84  ? 12.930  -3.392  -1.015  1.00 44.32 ? 79  VAL A CB   1  
ATOM 1092  C CG1  . VAL A 1 84  ? 13.478  -4.666  -1.641  1.00 31.44 ? 79  VAL A CG1  1  
ATOM 1093  C CG2  . VAL A 1 84  ? 14.060  -2.509  -0.510  1.00 44.33 ? 79  VAL A CG2  1  
ATOM 1094  H H    . VAL A 1 84  ? 12.199  -0.941  -0.752  1.00 34.20 ? 79  VAL A H    1  
ATOM 1095  H HA   . VAL A 1 84  ? 12.549  -2.652  -2.988  1.00 1.13  ? 79  VAL A HA   1  
ATOM 1096  H HB   . VAL A 1 84  ? 12.313  -3.668  -0.174  1.00 70.44 ? 79  VAL A HB   1  
ATOM 1097  H HG11 . VAL A 1 84  ? 14.245  -5.080  -1.002  1.00 33.23 ? 79  VAL A HG11 1  
ATOM 1098  H HG12 . VAL A 1 84  ? 12.678  -5.383  -1.757  1.00 52.24 ? 79  VAL A HG12 1  
ATOM 1099  H HG13 . VAL A 1 84  ? 13.901  -4.439  -2.608  1.00 3.12  ? 79  VAL A HG13 1  
ATOM 1100  H HG21 . VAL A 1 84  ? 13.663  -1.770  0.169   1.00 22.25 ? 79  VAL A HG21 1  
ATOM 1101  H HG22 . VAL A 1 84  ? 14.789  -3.116  0.007   1.00 54.24 ? 79  VAL A HG22 1  
ATOM 1102  H HG23 . VAL A 1 84  ? 14.533  -2.014  -1.345  1.00 11.35 ? 79  VAL A HG23 1  
ATOM 1103  N N    . ILE A 1 85  ? 9.866   -3.141  -1.128  1.00 71.41 ? 80  ILE A N    1  
ATOM 1104  C CA   . ILE A 1 85  ? 8.541   -3.748  -1.117  1.00 0.24  ? 80  ILE A CA   1  
ATOM 1105  C C    . ILE A 1 85  ? 7.692   -3.238  -2.277  1.00 71.04 ? 80  ILE A C    1  
ATOM 1106  O O    . ILE A 1 85  ? 7.140   -4.023  -3.048  1.00 72.15 ? 80  ILE A O    1  
ATOM 1107  C CB   . ILE A 1 85  ? 7.804   -3.468  0.206   1.00 22.14 ? 80  ILE A CB   1  
ATOM 1108  C CG1  . ILE A 1 85  ? 8.606   -4.014  1.388   1.00 63.34 ? 80  ILE A CG1  1  
ATOM 1109  C CG2  . ILE A 1 85  ? 6.411   -4.080  0.176   1.00 33.11 ? 80  ILE A CG2  1  
ATOM 1110  C CD1  . ILE A 1 85  ? 8.743   -5.520  1.383   1.00 10.05 ? 80  ILE A CD1  1  
ATOM 1111  H H    . ILE A 1 85  ? 10.143  -2.587  -0.369  1.00 45.33 ? 80  ILE A H    1  
ATOM 1112  H HA   . ILE A 1 85  ? 8.664   -4.817  -1.218  1.00 44.11 ? 80  ILE A HA   1  
ATOM 1113  H HB   . ILE A 1 85  ? 7.698   -2.399  0.314   1.00 21.34 ? 80  ILE A HB   1  
ATOM 1114  H HG13 . ILE A 1 85  ? 8.117   -3.728  2.308   1.00 64.15 ? 80  ILE A HG13 1  
ATOM 1115  H HG21 . ILE A 1 85  ? 6.464   -5.075  -0.241  1.00 40.11 ? 80  ILE A HG21 1  
ATOM 1116  H HG22 . ILE A 1 85  ? 6.020   -4.133  1.181   1.00 2.02  ? 80  ILE A HG22 1  
ATOM 1117  H HG23 . ILE A 1 85  ? 5.761   -3.469  -0.432  1.00 51.12 ? 80  ILE A HG23 1  
ATOM 1118  H HD11 . ILE A 1 85  ? 9.361   -5.828  2.212   1.00 14.03 ? 80  ILE A HD11 1  
ATOM 1119  H HD12 . ILE A 1 85  ? 7.767   -5.971  1.471   1.00 72.31 ? 80  ILE A HD12 1  
ATOM 1120  H HD13 . ILE A 1 85  ? 9.202   -5.836  0.457   1.00 5.15  ? 80  ILE A HD13 1  
ATOM 1121  N N    . SER A 1 86  ? 7.595   -1.918  -2.396  1.00 3.31  ? 81  SER A N    1  
ATOM 1122  C CA   . SER A 1 86  ? 6.813   -1.302  -3.462  1.00 75.32 ? 81  SER A CA   1  
ATOM 1123  C C    . SER A 1 86  ? 7.302   -1.763  -4.831  1.00 10.23 ? 81  SER A C    1  
ATOM 1124  O O    . SER A 1 86  ? 6.506   -2.003  -5.738  1.00 73.43 ? 81  SER A O    1  
ATOM 1125  C CB   . SER A 1 86  ? 6.892   0.223   -3.365  1.00 1.31  ? 81  SER A CB   1  
ATOM 1126  O OG   . SER A 1 86  ? 6.382   0.835   -4.537  1.00 72.20 ? 81  SER A OG   1  
ATOM 1127  H H    . SER A 1 86  ? 8.059   -1.345  -1.750  1.00 21.45 ? 81  SER A H    1  
ATOM 1128  H HA   . SER A 1 86  ? 5.785   -1.609  -3.337  1.00 21.14 ? 81  SER A HA   1  
ATOM 1129  H HB3  . SER A 1 86  ? 7.924   0.519   -3.238  1.00 12.12 ? 81  SER A HB3  1  
ATOM 1130  H HG   . SER A 1 86  ? 5.468   1.092   -4.392  1.00 3.13  ? 81  SER A HG   1  
ATOM 1131  N N    . ASN A 1 87  ? 8.617   -1.884  -4.972  1.00 51.43 ? 82  ASN A N    1  
ATOM 1132  C CA   . ASN A 1 87  ? 9.215   -2.316  -6.230  1.00 25.33 ? 82  ASN A CA   1  
ATOM 1133  C C    . ASN A 1 87  ? 8.774   -3.734  -6.583  1.00 44.22 ? 82  ASN A C    1  
ATOM 1134  O O    . ASN A 1 87  ? 8.366   -4.005  -7.712  1.00 1.54  ? 82  ASN A O    1  
ATOM 1135  C CB   . ASN A 1 87  ? 10.741  -2.250  -6.144  1.00 3.24  ? 82  ASN A CB   1  
ATOM 1136  C CG   . ASN A 1 87  ? 11.410  -2.621  -7.454  1.00 51.23 ? 82  ASN A CG   1  
ATOM 1137  O OD1  . ASN A 1 87  ? 11.847  -1.752  -8.209  1.00 54.13 ? 82  ASN A OD1  1  
ATOM 1138  N ND2  . ASN A 1 87  ? 11.494  -3.918  -7.727  1.00 4.31  ? 82  ASN A ND2  1  
ATOM 1139  H H    . ASN A 1 87  ? 9.202   -1.678  -4.212  1.00 11.25 ? 82  ASN A H    1  
ATOM 1140  H HA   . ASN A 1 87  ? 8.878   -1.644  -7.005  1.00 30.53 ? 82  ASN A HA   1  
ATOM 1141  H HB3  . ASN A 1 87  ? 11.082  -2.931  -5.380  1.00 50.41 ? 82  ASN A HB3  1  
ATOM 1142  H HD21 . ASN A 1 87  ? 11.124  -4.553  -7.080  1.00 53.12 ? 82  ASN A HD21 1  
ATOM 1143  H HD22 . ASN A 1 87  ? 11.923  -4.186  -8.568  1.00 54.53 ? 82  ASN A HD22 1  
ATOM 1144  N N    . ALA A 1 88  ? 8.861   -4.634  -5.609  1.00 43.22 ? 83  ALA A N    1  
ATOM 1145  C CA   . ALA A 1 88  ? 8.469   -6.022  -5.816  1.00 43.53 ? 83  ALA A CA   1  
ATOM 1146  C C    . ALA A 1 88  ? 6.992   -6.128  -6.178  1.00 12.33 ? 83  ALA A C    1  
ATOM 1147  O O    . ALA A 1 88  ? 6.588   -7.023  -6.923  1.00 33.30 ? 83  ALA A O    1  
ATOM 1148  C CB   . ALA A 1 88  ? 8.770   -6.845  -4.572  1.00 53.41 ? 83  ALA A CB   1  
ATOM 1149  H H    . ALA A 1 88  ? 9.194   -4.356  -4.730  1.00 1.31  ? 83  ALA A H    1  
ATOM 1150  H HA   . ALA A 1 88  ? 9.059   -6.418  -6.631  1.00 71.40 ? 83  ALA A HA   1  
ATOM 1151  H HB1  . ALA A 1 88  ? 9.772   -6.630  -4.232  1.00 51.14 ? 83  ALA A HB1  1  
ATOM 1152  H HB2  . ALA A 1 88  ? 8.063   -6.594  -3.795  1.00 41.40 ? 83  ALA A HB2  1  
ATOM 1153  H HB3  . ALA A 1 88  ? 8.687   -7.896  -4.808  1.00 54.44 ? 83  ALA A HB3  1  
ATOM 1154  N N    . LEU A 1 89  ? 6.190   -5.211  -5.648  1.00 12.30 ? 84  LEU A N    1  
ATOM 1155  C CA   . LEU A 1 89  ? 4.756   -5.203  -5.916  1.00 72.32 ? 84  LEU A CA   1  
ATOM 1156  C C    . LEU A 1 89  ? 4.459   -4.560  -7.267  1.00 40.00 ? 84  LEU A C    1  
ATOM 1157  O O    . LEU A 1 89  ? 3.601   -5.030  -8.015  1.00 43.42 ? 84  LEU A O    1  
ATOM 1158  C CB   . LEU A 1 89  ? 4.015   -4.452  -4.807  1.00 1.31  ? 84  LEU A CB   1  
ATOM 1159  C CG   . LEU A 1 89  ? 3.888   -5.185  -3.471  1.00 23.23 ? 84  LEU A CG   1  
ATOM 1160  C CD1  . LEU A 1 89  ? 4.122   -4.227  -2.313  1.00 2.11  ? 84  LEU A CD1  1  
ATOM 1161  C CD2  . LEU A 1 89  ? 2.521   -5.844  -3.352  1.00 1.22  ? 84  LEU A CD2  1  
ATOM 1162  H H    . LEU A 1 89  ? 6.570   -4.525  -5.062  1.00 65.22 ? 84  LEU A H    1  
ATOM 1163  H HA   . LEU A 1 89  ? 4.416   -6.227  -5.935  1.00 0.41  ? 84  LEU A HA   1  
ATOM 1164  H HB3  . LEU A 1 89  ? 3.019   -4.237  -5.164  1.00 21.24 ? 84  LEU A HB3  1  
ATOM 1165  H HG   . LEU A 1 89  ? 4.640   -5.959  -3.419  1.00 15.44 ? 84  LEU A HG   1  
ATOM 1166  H HD11 . LEU A 1 89  ? 4.437   -4.783  -1.443  1.00 32.11 ? 84  LEU A HD11 1  
ATOM 1167  H HD12 . LEU A 1 89  ? 3.206   -3.700  -2.091  1.00 42.12 ? 84  LEU A HD12 1  
ATOM 1168  H HD13 . LEU A 1 89  ? 4.889   -3.516  -2.583  1.00 44.53 ? 84  LEU A HD13 1  
ATOM 1169  H HD21 . LEU A 1 89  ? 2.283   -5.991  -2.309  1.00 31.21 ? 84  LEU A HD21 1  
ATOM 1170  H HD22 . LEU A 1 89  ? 2.538   -6.799  -3.856  1.00 23.11 ? 84  LEU A HD22 1  
ATOM 1171  H HD23 . LEU A 1 89  ? 1.775   -5.209  -3.806  1.00 41.02 ? 84  LEU A HD23 1  
ATOM 1172  N N    . LYS A 1 90  ? 5.174   -3.483  -7.575  1.00 55.43 ? 85  LYS A N    1  
ATOM 1173  C CA   . LYS A 1 90  ? 4.990   -2.777  -8.837  1.00 1.00  ? 85  LYS A CA   1  
ATOM 1174  C C    . LYS A 1 90  ? 5.240   -3.705  -10.021 1.00 15.32 ? 85  LYS A C    1  
ATOM 1175  O O    . LYS A 1 90  ? 4.460   -3.736  -10.974 1.00 54.34 ? 85  LYS A O    1  
ATOM 1176  C CB   . LYS A 1 90  ? 5.931   -1.573  -8.913  1.00 31.32 ? 85  LYS A CB   1  
ATOM 1177  C CG   . LYS A 1 90  ? 5.752   -0.739  -10.169 1.00 33.33 ? 85  LYS A CG   1  
ATOM 1178  C CD   . LYS A 1 90  ? 6.270   0.677   -9.978  1.00 10.44 ? 85  LYS A CD   1  
ATOM 1179  C CE   . LYS A 1 90  ? 7.785   0.737   -10.104 1.00 20.23 ? 85  LYS A CE   1  
ATOM 1180  N NZ   . LYS A 1 90  ? 8.407   1.461   -8.961  1.00 43.22 ? 85  LYS A NZ   1  
ATOM 1181  H H    . LYS A 1 90  ? 5.843   -3.156  -6.937  1.00 11.11 ? 85  LYS A H    1  
ATOM 1182  H HA   . LYS A 1 90  ? 3.969   -2.429  -8.877  1.00 62.34 ? 85  LYS A HA   1  
ATOM 1183  H HB3  . LYS A 1 90  ? 6.952   -1.926  -8.884  1.00 51.21 ? 85  LYS A HB3  1  
ATOM 1184  H HG3  . LYS A 1 90  ? 4.700   -0.696  -10.414 1.00 0.15  ? 85  LYS A HG3  1  
ATOM 1185  H HD3  . LYS A 1 90  ? 5.985   1.026   -8.995  1.00 1.22  ? 85  LYS A HD3  1  
ATOM 1186  H HE3  . LYS A 1 90  ? 8.037   1.246   -11.022 1.00 21.34 ? 85  LYS A HE3  1  
ATOM 1187  H HZ1  . LYS A 1 90  ? 9.309   1.011   -8.702  1.00 51.11 ? 85  LYS A HZ1  1  
ATOM 1188  H HZ2  . LYS A 1 90  ? 7.774   1.441   -8.137  1.00 53.43 ? 85  LYS A HZ2  1  
ATOM 1189  H HZ3  . LYS A 1 90  ? 8.589   2.451   -9.222  1.00 61.52 ? 85  LYS A HZ3  1  
ATOM 1190  N N    . VAL A 1 91  ? 6.330   -4.463  -9.954  1.00 13.44 ? 86  VAL A N    1  
ATOM 1191  C CA   . VAL A 1 91  ? 6.680   -5.395  -11.019 1.00 2.52  ? 86  VAL A CA   1  
ATOM 1192  C C    . VAL A 1 91  ? 5.601   -6.457  -11.198 1.00 42.05 ? 86  VAL A C    1  
ATOM 1193  O O    . VAL A 1 91  ? 5.493   -7.075  -12.256 1.00 12.13 ? 86  VAL A O    1  
ATOM 1194  C CB   . VAL A 1 91  ? 8.026   -6.088  -10.738 1.00 4.52  ? 86  VAL A CB   1  
ATOM 1195  C CG1  . VAL A 1 91  ? 9.167   -5.083  -10.794 1.00 14.13 ? 86  VAL A CG1  1  
ATOM 1196  C CG2  . VAL A 1 91  ? 7.991   -6.794  -9.391  1.00 61.10 ? 86  VAL A CG2  1  
ATOM 1197  H H    . VAL A 1 91  ? 6.912   -4.394  -9.169  1.00 55.55 ? 86  VAL A H    1  
ATOM 1198  H HA   . VAL A 1 91  ? 6.773   -4.833  -11.937 1.00 40.11 ? 86  VAL A HA   1  
ATOM 1199  H HB   . VAL A 1 91  ? 8.193   -6.831  -11.505 1.00 22.34 ? 86  VAL A HB   1  
ATOM 1200  H HG11 . VAL A 1 91  ? 8.934   -4.240  -10.160 1.00 25.21 ? 86  VAL A HG11 1  
ATOM 1201  H HG12 . VAL A 1 91  ? 10.078  -5.552  -10.452 1.00 75.43 ? 86  VAL A HG12 1  
ATOM 1202  H HG13 . VAL A 1 91  ? 9.297   -4.743  -11.810 1.00 4.51  ? 86  VAL A HG13 1  
ATOM 1203  H HG21 . VAL A 1 91  ? 8.656   -7.644  -9.414  1.00 73.54 ? 86  VAL A HG21 1  
ATOM 1204  H HG22 . VAL A 1 91  ? 8.309   -6.109  -8.618  1.00 34.24 ? 86  VAL A HG22 1  
ATOM 1205  H HG23 . VAL A 1 91  ? 6.986   -7.127  -9.186  1.00 34.22 ? 86  VAL A HG23 1  
ATOM 1206  N N    . TRP A 1 92  ? 4.805   -6.664  -10.155 1.00 71.53 ? 87  TRP A N    1  
ATOM 1207  C CA   . TRP A 1 92  ? 3.733   -7.652  -10.196 1.00 24.25 ? 87  TRP A CA   1  
ATOM 1208  C C    . TRP A 1 92  ? 2.419   -7.012  -10.633 1.00 44.12 ? 87  TRP A C    1  
ATOM 1209  O O    . TRP A 1 92  ? 1.517   -7.693  -11.118 1.00 73.31 ? 87  TRP A O    1  
ATOM 1210  C CB   . TRP A 1 92  ? 3.563   -8.307  -8.825  1.00 52.30 ? 87  TRP A CB   1  
ATOM 1211  C CG   . TRP A 1 92  ? 4.783   -9.049  -8.366  1.00 24.43 ? 87  TRP A CG   1  
ATOM 1212  C CD1  . TRP A 1 92  ? 5.834   -9.454  -9.139  1.00 73.25 ? 87  TRP A CD1  1  
ATOM 1213  C CD2  . TRP A 1 92  ? 5.075   -9.474  -7.031  1.00 52.52 ? 87  TRP A CD2  1  
ATOM 1214  N NE1  . TRP A 1 92  ? 6.762   -10.106 -8.363  1.00 50.53 ? 87  TRP A NE1  1  
ATOM 1215  C CE2  . TRP A 1 92  ? 6.321   -10.131 -7.067  1.00 65.22 ? 87  TRP A CE2  1  
ATOM 1216  C CE3  . TRP A 1 92  ? 4.407   -9.363  -5.809  1.00 74.13 ? 87  TRP A CE3  1  
ATOM 1217  C CZ2  . TRP A 1 92  ? 6.909   -10.674 -5.928  1.00 74.55 ? 87  TRP A CZ2  1  
ATOM 1218  C CZ3  . TRP A 1 92  ? 4.992   -9.903  -4.679  1.00 31.41 ? 87  TRP A CZ3  1  
ATOM 1219  C CH2  . TRP A 1 92  ? 6.232   -10.550 -4.744  1.00 55.01 ? 87  TRP A CH2  1  
ATOM 1220  H H    . TRP A 1 92  ? 4.941   -6.139  -9.338  1.00 60.31 ? 87  TRP A H    1  
ATOM 1221  H HA   . TRP A 1 92  ? 4.008   -8.408  -10.916 1.00 23.24 ? 87  TRP A HA   1  
ATOM 1222  H HB3  . TRP A 1 92  ? 2.743   -9.010  -8.869  1.00 31.34 ? 87  TRP A HB3  1  
ATOM 1223  H HD1  . TRP A 1 92  ? 5.910   -9.282  -10.201 1.00 72.41 ? 87  TRP A HD1  1  
ATOM 1224  H HE1  . TRP A 1 92  ? 7.605   -10.489 -8.687  1.00 61.45 ? 87  TRP A HE1  1  
ATOM 1225  H HE3  . TRP A 1 92  ? 3.450   -8.868  -5.739  1.00 63.44 ? 87  TRP A HE3  1  
ATOM 1226  H HZ2  . TRP A 1 92  ? 7.864   -11.175 -5.960  1.00 43.21 ? 87  TRP A HZ2  1  
ATOM 1227  H HZ3  . TRP A 1 92  ? 4.490   -9.827  -3.725  1.00 21.43 ? 87  TRP A HZ3  1  
ATOM 1228  H HH2  . TRP A 1 92  ? 6.651   -10.957 -3.836  1.00 62.32 ? 87  TRP A HH2  1  
ATOM 1229  N N    . GLY A 1 93  ? 2.319   -5.697  -10.459 1.00 34.11 ? 88  GLY A N    1  
ATOM 1230  C CA   . GLY A 1 93  ? 1.112   -4.989  -10.841 1.00 64.32 ? 88  GLY A CA   1  
ATOM 1231  C C    . GLY A 1 93  ? 0.420   -4.342  -9.657  1.00 10.01 ? 88  GLY A C    1  
ATOM 1232  O O    . GLY A 1 93  ? -0.574  -3.633  -9.820  1.00 31.42 ? 88  GLY A O    1  
ATOM 1233  H H    . GLY A 1 93  ? 3.072   -5.205  -10.067 1.00 32.25 ? 88  GLY A H    1  
ATOM 1234  H HA2  . GLY A 1 93  ? 1.369   -4.221  -11.556 1.00 12.44 ? 88  GLY A HA2  1  
ATOM 1235  H HA3  . GLY A 1 93  ? 0.430   -5.686  -11.305 1.00 70.00 ? 88  GLY A HA3  1  
ATOM 1236  N N    . LEU A 1 94  ? 0.944   -4.589  -8.461  1.00 20.21 ? 89  LEU A N    1  
ATOM 1237  C CA   . LEU A 1 94  ? 0.369   -4.026  -7.244  1.00 13.12 ? 89  LEU A CA   1  
ATOM 1238  C C    . LEU A 1 94  ? 1.022   -2.693  -6.898  1.00 61.22 ? 89  LEU A C    1  
ATOM 1239  O O    . LEU A 1 94  ? 2.246   -2.562  -6.938  1.00 22.43 ? 89  LEU A O    1  
ATOM 1240  C CB   . LEU A 1 94  ? 0.533   -5.006  -6.080  1.00 71.31 ? 89  LEU A CB   1  
ATOM 1241  C CG   . LEU A 1 94  ? -0.281  -6.297  -6.169  1.00 24.43 ? 89  LEU A CG   1  
ATOM 1242  C CD1  . LEU A 1 94  ? -1.730  -5.992  -6.515  1.00 74.42 ? 89  LEU A CD1  1  
ATOM 1243  C CD2  . LEU A 1 94  ? 0.326   -7.240  -7.196  1.00 3.43  ? 89  LEU A CD2  1  
ATOM 1244  H H    . LEU A 1 94  ? 1.736   -5.161  -8.394  1.00 33.42 ? 89  LEU A H    1  
ATOM 1245  H HA   . LEU A 1 94  ? -0.684  -3.862  -7.420  1.00 53.22 ? 89  LEU A HA   1  
ATOM 1246  H HB3  . LEU A 1 94  ? 0.244   -4.492  -5.174  1.00 34.22 ? 89  LEU A HB3  1  
ATOM 1247  H HG   . LEU A 1 94  ? -0.266  -6.792  -5.208  1.00 50.24 ? 89  LEU A HG   1  
ATOM 1248  H HD11 . LEU A 1 94  ? -1.988  -5.008  -6.151  1.00 72.15 ? 89  LEU A HD11 1  
ATOM 1249  H HD12 . LEU A 1 94  ? -2.373  -6.726  -6.052  1.00 72.24 ? 89  LEU A HD12 1  
ATOM 1250  H HD13 . LEU A 1 94  ? -1.860  -6.025  -7.586  1.00 42.01 ? 89  LEU A HD13 1  
ATOM 1251  H HD21 . LEU A 1 94  ? -0.008  -8.248  -7.000  1.00 34.01 ? 89  LEU A HD21 1  
ATOM 1252  H HD22 . LEU A 1 94  ? 1.404   -7.200  -7.130  1.00 71.33 ? 89  LEU A HD22 1  
ATOM 1253  H HD23 . LEU A 1 94  ? 0.015   -6.943  -8.186  1.00 11.54 ? 89  LEU A HD23 1  
ATOM 1254  N N    . GLU A 1 95  ? 0.199   -1.707  -6.556  1.00 53.01 ? 90  GLU A N    1  
ATOM 1255  C CA   . GLU A 1 95  ? 0.699   -0.384  -6.201  1.00 64.14 ? 90  GLU A CA   1  
ATOM 1256  C C    . GLU A 1 95  ? 0.238   0.015   -4.802  1.00 13.11 ? 90  GLU A C    1  
ATOM 1257  O O    . GLU A 1 95  ? -0.903  -0.243  -4.414  1.00 45.40 ? 90  GLU A O    1  
ATOM 1258  C CB   . GLU A 1 95  ? 0.227   0.655   -7.221  1.00 74.32 ? 90  GLU A CB   1  
ATOM 1259  C CG   . GLU A 1 95  ? -1.282  0.841   -7.245  1.00 2.31  ? 90  GLU A CG   1  
ATOM 1260  C CD   . GLU A 1 95  ? -1.713  1.984   -8.143  1.00 0.02  ? 90  GLU A CD   1  
ATOM 1261  O OE1  . GLU A 1 95  ? -1.132  3.083   -8.024  1.00 41.41 ? 90  GLU A OE1  1  
ATOM 1262  O OE2  . GLU A 1 95  ? -2.633  1.781   -8.964  1.00 60.12 ? 90  GLU A OE2  1  
ATOM 1263  H H    . GLU A 1 95  ? -0.767  -1.873  -6.542  1.00 2.51  ? 90  GLU A H    1  
ATOM 1264  H HA   . GLU A 1 95  ? 1.778   -0.422  -6.214  1.00 33.43 ? 90  GLU A HA   1  
ATOM 1265  H HB3  . GLU A 1 95  ? 0.546   0.345   -8.205  1.00 21.21 ? 90  GLU A HB3  1  
ATOM 1266  H HG3  . GLU A 1 95  ? -1.623  1.042   -6.241  1.00 62.22 ? 90  GLU A HG3  1  
ATOM 1267  N N    . LEU A 1 96  ? 1.132   0.645   -4.048  1.00 52.33 ? 91  LEU A N    1  
ATOM 1268  C CA   . LEU A 1 96  ? 0.819   1.080   -2.692  1.00 74.11 ? 91  LEU A CA   1  
ATOM 1269  C C    . LEU A 1 96  ? 0.295   2.511   -2.686  1.00 62.34 ? 91  LEU A C    1  
ATOM 1270  O O    . LEU A 1 96  ? 0.853   3.389   -3.345  1.00 24.21 ? 91  LEU A O    1  
ATOM 1271  C CB   . LEU A 1 96  ? 2.059   0.974   -1.802  1.00 34.10 ? 91  LEU A CB   1  
ATOM 1272  C CG   . LEU A 1 96  ? 2.421   -0.431  -1.318  1.00 21.11 ? 91  LEU A CG   1  
ATOM 1273  C CD1  . LEU A 1 96  ? 3.931   -0.598  -1.248  1.00 31.12 ? 91  LEU A CD1  1  
ATOM 1274  C CD2  . LEU A 1 96  ? 1.788   -0.708  0.037   1.00 72.14 ? 91  LEU A CD2  1  
ATOM 1275  H H    . LEU A 1 96  ? 2.025   0.822   -4.411  1.00 2.33  ? 91  LEU A H    1  
ATOM 1276  H HA   . LEU A 1 96  ? 0.051   0.427   -2.303  1.00 0.22  ? 91  LEU A HA   1  
ATOM 1277  H HB3  . LEU A 1 96  ? 1.894   1.593   -0.931  1.00 14.34 ? 91  LEU A HB3  1  
ATOM 1278  H HG   . LEU A 1 96  ? 2.038   -1.156  -2.022  1.00 11.41 ? 91  LEU A HG   1  
ATOM 1279  H HD11 . LEU A 1 96  ? 4.377   0.312   -0.876  1.00 51.51 ? 91  LEU A HD11 1  
ATOM 1280  H HD12 . LEU A 1 96  ? 4.316   -0.812  -2.234  1.00 61.42 ? 91  LEU A HD12 1  
ATOM 1281  H HD13 . LEU A 1 96  ? 4.171   -1.415  -0.583  1.00 53.41 ? 91  LEU A HD13 1  
ATOM 1282  H HD21 . LEU A 1 96  ? 2.088   0.057   0.737   1.00 31.52 ? 91  LEU A HD21 1  
ATOM 1283  H HD22 . LEU A 1 96  ? 2.115   -1.673  0.397   1.00 72.11 ? 91  LEU A HD22 1  
ATOM 1284  H HD23 . LEU A 1 96  ? 0.712   -0.706  -0.061  1.00 62.34 ? 91  LEU A HD23 1  
ATOM 1285  N N    . ILE A 1 97  ? -0.777  2.741   -1.936  1.00 22.53 ? 92  ILE A N    1  
ATOM 1286  C CA   . ILE A 1 97  ? -1.374  4.068   -1.842  1.00 11.43 ? 92  ILE A CA   1  
ATOM 1287  C C    . ILE A 1 97  ? -1.520  4.503   -0.388  1.00 2.12  ? 92  ILE A C    1  
ATOM 1288  O O    . ILE A 1 97  ? -2.244  3.881   0.389   1.00 12.41 ? 92  ILE A O    1  
ATOM 1289  C CB   . ILE A 1 97  ? -2.757  4.113   -2.521  1.00 54.25 ? 92  ILE A CB   1  
ATOM 1290  C CG1  . ILE A 1 97  ? -2.771  3.213   -3.758  1.00 2.43  ? 92  ILE A CG1  1  
ATOM 1291  C CG2  . ILE A 1 97  ? -3.117  5.543   -2.894  1.00 1.32  ? 92  ILE A CG2  1  
ATOM 1292  C CD1  . ILE A 1 97  ? -1.718  3.577   -4.782  1.00 15.32 ? 92  ILE A CD1  1  
ATOM 1293  H H    . ILE A 1 97  ? -1.177  2.001   -1.434  1.00 13.23 ? 92  ILE A H    1  
ATOM 1294  H HA   . ILE A 1 97  ? -0.723  4.763   -2.352  1.00 1.53  ? 92  ILE A HA   1  
ATOM 1295  H HB   . ILE A 1 97  ? -3.491  3.755   -1.816  1.00 53.22 ? 92  ILE A HB   1  
ATOM 1296  H HG13 . ILE A 1 97  ? -3.737  3.286   -4.235  1.00 13.04 ? 92  ILE A HG13 1  
ATOM 1297  H HG21 . ILE A 1 97  ? -2.580  5.828   -3.786  1.00 42.31 ? 92  ILE A HG21 1  
ATOM 1298  H HG22 . ILE A 1 97  ? -4.179  5.610   -3.078  1.00 62.22 ? 92  ILE A HG22 1  
ATOM 1299  H HG23 . ILE A 1 97  ? -2.848  6.205   -2.085  1.00 12.12 ? 92  ILE A HG23 1  
ATOM 1300  H HD11 . ILE A 1 97  ? -0.967  2.801   -4.818  1.00 60.21 ? 92  ILE A HD11 1  
ATOM 1301  H HD12 . ILE A 1 97  ? -2.179  3.679   -5.753  1.00 13.04 ? 92  ILE A HD12 1  
ATOM 1302  H HD13 . ILE A 1 97  ? -1.254  4.513   -4.504  1.00 11.55 ? 92  ILE A HD13 1  
ATOM 1303  N N    . LEU A 1 98  ? -0.828  5.578   -0.027  1.00 63.12 ? 93  LEU A N    1  
ATOM 1304  C CA   . LEU A 1 98  ? -0.881  6.100   1.334   1.00 71.44 ? 93  LEU A CA   1  
ATOM 1305  C C    . LEU A 1 98  ? -2.240  6.730   1.623   1.00 64.23 ? 93  LEU A C    1  
ATOM 1306  O O    . LEU A 1 98  ? -2.682  7.633   0.912   1.00 51.42 ? 93  LEU A O    1  
ATOM 1307  C CB   . LEU A 1 98  ? 0.227   7.132   1.549   1.00 52.34 ? 93  LEU A CB   1  
ATOM 1308  C CG   . LEU A 1 98  ? 0.149   7.943   2.844   1.00 23.23 ? 93  LEU A CG   1  
ATOM 1309  C CD1  . LEU A 1 98  ? 0.036   7.019   4.046   1.00 21.23 ? 93  LEU A CD1  1  
ATOM 1310  C CD2  . LEU A 1 98  ? 1.361   8.852   2.978   1.00 73.01 ? 93  LEU A CD2  1  
ATOM 1311  H H    . LEU A 1 98  ? -0.269  6.033   -0.691  1.00 54.10 ? 93  LEU A H    1  
ATOM 1312  H HA   . LEU A 1 98  ? -0.729  5.274   2.013   1.00 3.35  ? 93  LEU A HA   1  
ATOM 1313  H HB3  . LEU A 1 98  ? 0.198   7.826   0.721   1.00 55.50 ? 93  LEU A HB3  1  
ATOM 1314  H HG   . LEU A 1 98  ? -0.736  8.565   2.817   1.00 11.52 ? 93  LEU A HG   1  
ATOM 1315  H HD11 . LEU A 1 98  ? -0.980  6.664   4.134   1.00 65.14 ? 93  LEU A HD11 1  
ATOM 1316  H HD12 . LEU A 1 98  ? 0.308   7.558   4.941   1.00 64.14 ? 93  LEU A HD12 1  
ATOM 1317  H HD13 . LEU A 1 98  ? 0.701   6.178   3.917   1.00 0.32  ? 93  LEU A HD13 1  
ATOM 1318  H HD21 . LEU A 1 98  ? 1.863   8.646   3.912   1.00 11.43 ? 93  LEU A HD21 1  
ATOM 1319  H HD22 . LEU A 1 98  ? 1.041   9.884   2.963   1.00 31.12 ? 93  LEU A HD22 1  
ATOM 1320  H HD23 . LEU A 1 98  ? 2.039   8.672   2.158   1.00 2.33  ? 93  LEU A HD23 1  
ATOM 1321  N N    . PHE A 1 99  ? -2.897  6.249   2.674   1.00 32.44 ? 94  PHE A N    1  
ATOM 1322  C CA   . PHE A 1 99  ? -4.205  6.766   3.059   1.00 22.23 ? 94  PHE A CA   1  
ATOM 1323  C C    . PHE A 1 99  ? -4.146  8.271   3.301   1.00 34.20 ? 94  PHE A C    1  
ATOM 1324  O O    . PHE A 1 99  ? -5.122  8.985   3.078   1.00 24.13 ? 94  PHE A O    1  
ATOM 1325  C CB   . PHE A 1 99  ? -4.708  6.054   4.316   1.00 64.31 ? 94  PHE A CB   1  
ATOM 1326  C CG   . PHE A 1 99  ? -4.244  6.694   5.593   1.00 51.12 ? 94  PHE A CG   1  
ATOM 1327  C CD1  . PHE A 1 99  ? -3.025  6.346   6.154   1.00 71.55 ? 94  PHE A CD1  1  
ATOM 1328  C CD2  . PHE A 1 99  ? -5.025  7.643   6.233   1.00 43.12 ? 94  PHE A CD2  1  
ATOM 1329  C CE1  . PHE A 1 99  ? -2.594  6.934   7.329   1.00 14.33 ? 94  PHE A CE1  1  
ATOM 1330  C CE2  . PHE A 1 99  ? -4.599  8.234   7.407   1.00 50.55 ? 94  PHE A CE2  1  
ATOM 1331  C CZ   . PHE A 1 99  ? -3.383  7.878   7.957   1.00 14.31 ? 94  PHE A CZ   1  
ATOM 1332  H H    . PHE A 1 99  ? -2.493  5.529   3.202   1.00 62.24 ? 94  PHE A H    1  
ATOM 1333  H HA   . PHE A 1 99  ? -4.889  6.571   2.247   1.00 30.13 ? 94  PHE A HA   1  
ATOM 1334  H HB3  . PHE A 1 99  ? -4.358  5.034   4.308   1.00 0.42  ? 94  PHE A HB3  1  
ATOM 1335  H HD1  . PHE A 1 99  ? -2.407  5.607   5.664   1.00 20.25 ? 94  PHE A HD1  1  
ATOM 1336  H HD2  . PHE A 1 99  ? -5.976  7.922   5.805   1.00 30.24 ? 94  PHE A HD2  1  
ATOM 1337  H HE1  . PHE A 1 99  ? -1.643  6.653   7.756   1.00 11.32 ? 94  PHE A HE1  1  
ATOM 1338  H HE2  . PHE A 1 99  ? -5.217  8.971   7.897   1.00 5.44  ? 94  PHE A HE2  1  
ATOM 1339  H HZ   . PHE A 1 99  ? -3.047  8.338   8.874   1.00 34.54 ? 94  PHE A HZ   1  
ATOM 1340  N N    . ASN A 1 100 ? -2.993  8.745   3.760   1.00 75.43 ? 95  ASN A N    1  
ATOM 1341  C CA   . ASN A 1 100 ? -2.805  10.165  4.036   1.00 33.45 ? 95  ASN A CA   1  
ATOM 1342  C C    . ASN A 1 100 ? -2.615  10.949  2.741   1.00 41.11 ? 95  ASN A C    1  
ATOM 1343  O O    . ASN A 1 100 ? -2.739  12.174  2.721   1.00 22.21 ? 95  ASN A O    1  
ATOM 1344  C CB   . ASN A 1 100 ? -1.599  10.374  4.954   1.00 2.11  ? 95  ASN A CB   1  
ATOM 1345  C CG   . ASN A 1 100 ? -1.326  11.840  5.227   1.00 25.05 ? 95  ASN A CG   1  
ATOM 1346  O OD1  . ASN A 1 100 ? -2.193  12.562  5.722   1.00 63.24 ? 95  ASN A OD1  1  
ATOM 1347  N ND2  . ASN A 1 100 ? -0.118  12.287  4.903   1.00 22.52 ? 95  ASN A ND2  1  
ATOM 1348  H H    . ASN A 1 100 ? -2.250  8.125   3.920   1.00 23.31 ? 95  ASN A H    1  
ATOM 1349  H HA   . ASN A 1 100 ? -3.692  10.526  4.535   1.00 32.25 ? 95  ASN A HA   1  
ATOM 1350  H HB3  . ASN A 1 100 ? -0.724  9.944   4.491   1.00 53.50 ? 95  ASN A HB3  1  
ATOM 1351  H HD21 . ASN A 1 100 ? 0.520   11.655  4.512   1.00 60.45 ? 95  ASN A HD21 1  
ATOM 1352  H HD22 . ASN A 1 100 ? 0.084   13.232  5.070   1.00 20.30 ? 95  ASN A HD22 1  
ATOM 1353  N N    . SER A 1 101 ? -2.314  10.235  1.662   1.00 52.43 ? 96  SER A N    1  
ATOM 1354  C CA   . SER A 1 101 ? -2.103  10.863  0.363   1.00 62.51 ? 96  SER A CA   1  
ATOM 1355  C C    . SER A 1 101 ? -3.429  11.064  -0.366  1.00 74.45 ? 96  SER A C    1  
ATOM 1356  O O    . SER A 1 101 ? -4.420  10.381  -0.103  1.00 2.11  ? 96  SER A O    1  
ATOM 1357  C CB   . SER A 1 101 ? -1.162  10.013  -0.493  1.00 74.32 ? 96  SER A CB   1  
ATOM 1358  O OG   . SER A 1 101 ? -1.580  9.995   -1.846  1.00 1.24  ? 96  SER A OG   1  
ATOM 1359  H H    . SER A 1 101 ? -2.228  9.261   1.742   1.00 65.52 ? 96  SER A H    1  
ATOM 1360  H HA   . SER A 1 101 ? -1.649  11.828  0.532   1.00 3.11  ? 96  SER A HA   1  
ATOM 1361  H HB3  . SER A 1 101 ? -1.155  9.000   -0.116  1.00 14.34 ? 96  SER A HB3  1  
ATOM 1362  H HG   . SER A 1 101 ? -0.809  9.973   -2.419  1.00 12.25 ? 96  SER A HG   1  
ATOM 1363  N N    . PRO A 1 102 ? -3.448  12.023  -1.303  1.00 35.20 ? 97  PRO A N    1  
ATOM 1364  C CA   . PRO A 1 102 ? -4.645  12.336  -2.089  1.00 32.25 ? 97  PRO A CA   1  
ATOM 1365  C C    . PRO A 1 102 ? -4.997  11.228  -3.075  1.00 33.44 ? 97  PRO A C    1  
ATOM 1366  O O    . PRO A 1 102 ? -6.077  11.231  -3.666  1.00 61.40 ? 97  PRO A O    1  
ATOM 1367  C CB   . PRO A 1 102 ? -4.255  13.613  -2.837  1.00 61.23 ? 97  PRO A CB   1  
ATOM 1368  C CG   . PRO A 1 102 ? -2.768  13.562  -2.922  1.00 21.30 ? 97  PRO A CG   1  
ATOM 1369  C CD   . PRO A 1 102 ? -2.304  12.875  -1.667  1.00 31.42 ? 97  PRO A CD   1  
ATOM 1370  H HA   . PRO A 1 102 ? -5.497  12.535  -1.454  1.00 71.11 ? 97  PRO A HA   1  
ATOM 1371  H HB3  . PRO A 1 102 ? -4.588  14.477  -2.281  1.00 33.53 ? 97  PRO A HB3  1  
ATOM 1372  H HG3  . PRO A 1 102 ? -2.369  14.564  -2.969  1.00 61.11 ? 97  PRO A HG3  1  
ATOM 1373  H HD3  . PRO A 1 102 ? -2.102  13.600  -0.893  1.00 73.11 ? 97  PRO A HD3  1  
ATOM 1374  N N    . GLU A 1 103 ? -4.080  10.282  -3.248  1.00 43.24 ? 98  GLU A N    1  
ATOM 1375  C CA   . GLU A 1 103 ? -4.295  9.167   -4.164  1.00 60.43 ? 98  GLU A CA   1  
ATOM 1376  C C    . GLU A 1 103 ? -5.369  8.225   -3.630  1.00 31.32 ? 98  GLU A C    1  
ATOM 1377  O O    . GLU A 1 103 ? -6.277  7.824   -4.359  1.00 4.42  ? 98  GLU A O    1  
ATOM 1378  C CB   . GLU A 1 103 ? -2.990  8.399   -4.383  1.00 71.33 ? 98  GLU A CB   1  
ATOM 1379  C CG   . GLU A 1 103 ? -2.011  9.112   -5.301  1.00 4.02  ? 98  GLU A CG   1  
ATOM 1380  C CD   . GLU A 1 103 ? -1.494  8.217   -6.410  1.00 53.11 ? 98  GLU A CD   1  
ATOM 1381  O OE1  . GLU A 1 103 ? -0.558  7.432   -6.152  1.00 54.34 ? 98  GLU A OE1  1  
ATOM 1382  O OE2  . GLU A 1 103 ? -2.025  8.301   -7.537  1.00 73.14 ? 98  GLU A OE2  1  
ATOM 1383  H H    . GLU A 1 103 ? -3.239  10.335  -2.748  1.00 53.31 ? 98  GLU A H    1  
ATOM 1384  H HA   . GLU A 1 103 ? -4.625  9.574   -5.107  1.00 13.15 ? 98  GLU A HA   1  
ATOM 1385  H HB3  . GLU A 1 103 ? -3.222  7.438   -4.816  1.00 4.11  ? 98  GLU A HB3  1  
ATOM 1386  H HG3  . GLU A 1 103 ? -1.172  9.456   -4.714  1.00 22.13 ? 98  GLU A HG3  1  
ATOM 1387  N N    . TYR A 1 104 ? -5.260  7.874   -2.354  1.00 11.41 ? 99  TYR A N    1  
ATOM 1388  C CA   . TYR A 1 104 ? -6.219  6.975   -1.722  1.00 4.14  ? 99  TYR A CA   1  
ATOM 1389  C C    . TYR A 1 104 ? -7.627  7.563   -1.768  1.00 71.55 ? 99  TYR A C    1  
ATOM 1390  O O    . TYR A 1 104 ? -8.587  6.876   -2.115  1.00 41.12 ? 99  TYR A O    1  
ATOM 1391  C CB   . TYR A 1 104 ? -5.815  6.700   -0.273  1.00 21.22 ? 99  TYR A CB   1  
ATOM 1392  C CG   . TYR A 1 104 ? -6.861  5.941   0.513   1.00 42.42 ? 99  TYR A CG   1  
ATOM 1393  C CD1  . TYR A 1 104 ? -7.286  4.683   0.106   1.00 64.00 ? 99  TYR A CD1  1  
ATOM 1394  C CD2  . TYR A 1 104 ? -7.421  6.483   1.663   1.00 54.43 ? 99  TYR A CD2  1  
ATOM 1395  C CE1  . TYR A 1 104 ? -8.241  3.986   0.821   1.00 50.41 ? 99  TYR A CE1  1  
ATOM 1396  C CE2  . TYR A 1 104 ? -8.375  5.792   2.385   1.00 25.41 ? 99  TYR A CE2  1  
ATOM 1397  C CZ   . TYR A 1 104 ? -8.783  4.545   1.960   1.00 3.32  ? 99  TYR A CZ   1  
ATOM 1398  O OH   . TYR A 1 104 ? -9.732  3.853   2.675   1.00 34.41 ? 99  TYR A OH   1  
ATOM 1399  H H    . TYR A 1 104 ? -4.514  8.226   -1.824  1.00 33.42 ? 99  TYR A H    1  
ATOM 1400  H HA   . TYR A 1 104 ? -6.213  6.044   -2.271  1.00 64.12 ? 99  TYR A HA   1  
ATOM 1401  H HB3  . TYR A 1 104 ? -5.640  7.640   0.229   1.00 24.40 ? 99  TYR A HB3  1  
ATOM 1402  H HD1  . TYR A 1 104 ? -6.859  4.248   -0.786  1.00 10.20 ? 99  TYR A HD1  1  
ATOM 1403  H HD2  . TYR A 1 104 ? -7.101  7.460   1.994   1.00 1.31  ? 99  TYR A HD2  1  
ATOM 1404  H HE1  . TYR A 1 104 ? -8.559  3.010   0.488   1.00 54.51 ? 99  TYR A HE1  1  
ATOM 1405  H HE2  . TYR A 1 104 ? -8.800  6.229   3.278   1.00 5.45  ? 99  TYR A HE2  1  
ATOM 1406  H HH   . TYR A 1 104 ? -10.510 4.404   2.790   1.00 61.23 ? 99  TYR A HH   1  
ATOM 1407  N N    . GLN A 1 105 ? -7.739  8.839   -1.414  1.00 64.10 ? 100 GLN A N    1  
ATOM 1408  C CA   . GLN A 1 105 ? -9.028  9.521   -1.414  1.00 14.45 ? 100 GLN A CA   1  
ATOM 1409  C C    . GLN A 1 105 ? -9.508  9.778   -2.839  1.00 35.33 ? 100 GLN A C    1  
ATOM 1410  O O    . GLN A 1 105 ? -10.709 9.758   -3.113  1.00 64.44 ? 100 GLN A O    1  
ATOM 1411  C CB   . GLN A 1 105 ? -8.931  10.842  -0.650  1.00 40.42 ? 100 GLN A CB   1  
ATOM 1412  C CG   . GLN A 1 105 ? -8.049  11.876  -1.333  1.00 34.21 ? 100 GLN A CG   1  
ATOM 1413  C CD   . GLN A 1 105 ? -7.719  13.047  -0.430  1.00 64.34 ? 100 GLN A CD   1  
ATOM 1414  O OE1  . GLN A 1 105 ? -8.190  14.164  -0.644  1.00 22.23 ? 100 GLN A OE1  1  
ATOM 1415  N NE2  . GLN A 1 105 ? -6.903  12.799  0.589   1.00 3.04  ? 100 GLN A NE2  1  
ATOM 1416  H H    . GLN A 1 105 ? -6.937  9.334   -1.148  1.00 73.30 ? 100 GLN A H    1  
ATOM 1417  H HA   . GLN A 1 105 ? -9.742  8.880   -0.918  1.00 71.14 ? 100 GLN A HA   1  
ATOM 1418  H HB3  . GLN A 1 105 ? -8.525  10.647  0.332   1.00 32.42 ? 100 GLN A HB3  1  
ATOM 1419  H HG3  . GLN A 1 105 ? -8.564  12.247  -2.206  1.00 51.12 ? 100 GLN A HG3  1  
ATOM 1420  H HE21 . GLN A 1 105 ? -6.564  11.885  0.697   1.00 33.31 ? 100 GLN A HE21 1  
ATOM 1421  H HE22 . GLN A 1 105 ? -6.672  13.538  1.188   1.00 4.54  ? 100 GLN A HE22 1  
ATOM 1422  N N    . ARG A 1 106 ? -8.565  10.018  -3.742  1.00 60.15 ? 101 ARG A N    1  
ATOM 1423  C CA   . ARG A 1 106 ? -8.892  10.281  -5.139  1.00 54.45 ? 101 ARG A CA   1  
ATOM 1424  C C    . ARG A 1 106 ? -9.789  9.182   -5.702  1.00 61.53 ? 101 ARG A C    1  
ATOM 1425  O O    . ARG A 1 106 ? -10.934 9.435   -6.079  1.00 14.54 ? 101 ARG A O    1  
ATOM 1426  C CB   . ARG A 1 106 ? -7.614  10.387  -5.972  1.00 65.25 ? 101 ARG A CB   1  
ATOM 1427  C CG   . ARG A 1 106 ? -7.203  11.819  -6.275  1.00 23.14 ? 101 ARG A CG   1  
ATOM 1428  C CD   . ARG A 1 106 ? -7.797  12.303  -7.589  1.00 71.13 ? 101 ARG A CD   1  
ATOM 1429  N NE   . ARG A 1 106 ? -7.639  13.745  -7.764  1.00 3.43  ? 101 ARG A NE   1  
ATOM 1430  C CZ   . ARG A 1 106 ? -7.723  14.355  -8.941  1.00 72.15 ? 101 ARG A CZ   1  
ATOM 1431  N NH1  . ARG A 1 106 ? -7.963  13.654  -10.040 1.00 41.22 ? 101 ARG A NH1  1  
ATOM 1432  N NH2  . ARG A 1 106 ? -7.567  15.671  -9.019  1.00 51.32 ? 101 ARG A NH2  1  
ATOM 1433  H H    . ARG A 1 106 ? -7.625  10.020  -3.463  1.00 33.10 ? 101 ARG A H    1  
ATOM 1434  H HA   . ARG A 1 106 ? -9.421  11.220  -5.185  1.00 74.23 ? 101 ARG A HA   1  
ATOM 1435  H HB3  . ARG A 1 106 ? -7.765  9.874   -6.909  1.00 30.42 ? 101 ARG A HB3  1  
ATOM 1436  H HG3  . ARG A 1 106 ? -6.126  11.870  -6.337  1.00 22.23 ? 101 ARG A HG3  1  
ATOM 1437  H HD3  . ARG A 1 106 ? -8.850  12.062  -7.603  1.00 14.41 ? 101 ARG A HD3  1  
ATOM 1438  H HE   . ARG A 1 106 ? -7.460  14.282  -6.965  1.00 13.41 ? 101 ARG A HE   1  
ATOM 1439  H HH11 . ARG A 1 106 ? -8.082  12.663  -9.984  1.00 72.52 ? 101 ARG A HH11 1  
ATOM 1440  H HH12 . ARG A 1 106 ? -8.027  14.117  -10.924 1.00 30.40 ? 101 ARG A HH12 1  
ATOM 1441  H HH21 . ARG A 1 106 ? -7.385  16.202  -8.192  1.00 23.32 ? 101 ARG A HH21 1  
ATOM 1442  H HH22 . ARG A 1 106 ? -7.630  16.130  -9.904  1.00 11.41 ? 101 ARG A HH22 1  
ATOM 1443  N N    . LEU A 1 107 ? -9.260  7.965   -5.757  1.00 35.42 ? 102 LEU A N    1  
ATOM 1444  C CA   . LEU A 1 107 ? -10.014 6.827   -6.275  1.00 44.11 ? 102 LEU A CA   1  
ATOM 1445  C C    . LEU A 1 107 ? -11.120 6.420   -5.307  1.00 3.44  ? 102 LEU A C    1  
ATOM 1446  O O    . LEU A 1 107 ? -12.088 5.766   -5.696  1.00 65.34 ? 102 LEU A O    1  
ATOM 1447  C CB   . LEU A 1 107 ? -9.078  5.643   -6.526  1.00 43.30 ? 102 LEU A CB   1  
ATOM 1448  C CG   . LEU A 1 107 ? -7.846  5.931   -7.385  1.00 23.32 ? 102 LEU A CG   1  
ATOM 1449  C CD1  . LEU A 1 107 ? -7.092  4.645   -7.685  1.00 13.13 ? 102 LEU A CD1  1  
ATOM 1450  C CD2  . LEU A 1 107 ? -8.248  6.629   -8.676  1.00 2.14  ? 102 LEU A CD2  1  
ATOM 1451  H H    . LEU A 1 107 ? -8.344  7.826   -5.442  1.00 34.03 ? 102 LEU A H    1  
ATOM 1452  H HA   . LEU A 1 107 ? -10.462 7.126   -7.211  1.00 61.11 ? 102 LEU A HA   1  
ATOM 1453  H HB3  . LEU A 1 107 ? -9.651  4.868   -7.015  1.00 2.25  ? 102 LEU A HB3  1  
ATOM 1454  H HG   . LEU A 1 107 ? -7.181  6.589   -6.841  1.00 13.32 ? 102 LEU A HG   1  
ATOM 1455  H HD11 . LEU A 1 107 ? -6.644  4.271   -6.777  1.00 33.03 ? 102 LEU A HD11 1  
ATOM 1456  H HD12 . LEU A 1 107 ? -6.319  4.842   -8.413  1.00 34.24 ? 102 LEU A HD12 1  
ATOM 1457  H HD13 . LEU A 1 107 ? -7.778  3.909   -8.078  1.00 61.30 ? 102 LEU A HD13 1  
ATOM 1458  H HD21 . LEU A 1 107 ? -8.588  7.630   -8.453  1.00 14.23 ? 102 LEU A HD21 1  
ATOM 1459  H HD22 . LEU A 1 107 ? -9.045  6.075   -9.151  1.00 22.33 ? 102 LEU A HD22 1  
ATOM 1460  H HD23 . LEU A 1 107 ? -7.397  6.676   -9.339  1.00 65.41 ? 102 LEU A HD23 1  
ATOM 1461  N N    . ARG A 1 108 ? -10.970 6.813   -4.047  1.00 13.22 ? 103 ARG A N    1  
ATOM 1462  C CA   . ARG A 1 108 ? -11.958 6.490   -3.024  1.00 52.33 ? 103 ARG A CA   1  
ATOM 1463  C C    . ARG A 1 108 ? -12.138 4.979   -2.899  1.00 43.41 ? 103 ARG A C    1  
ATOM 1464  O O    . ARG A 1 108 ? -13.262 4.478   -2.878  1.00 52.11 ? 103 ARG A O    1  
ATOM 1465  C CB   . ARG A 1 108 ? -13.299 7.148   -3.353  1.00 35.02 ? 103 ARG A CB   1  
ATOM 1466  C CG   . ARG A 1 108 ? -13.369 8.615   -2.962  1.00 10.34 ? 103 ARG A CG   1  
ATOM 1467  C CD   . ARG A 1 108 ? -14.769 9.005   -2.515  1.00 22.42 ? 103 ARG A CD   1  
ATOM 1468  N NE   . ARG A 1 108 ? -15.296 10.130  -3.284  1.00 61.34 ? 103 ARG A NE   1  
ATOM 1469  C CZ   . ARG A 1 108 ? -14.900 11.386  -3.114  1.00 61.44 ? 103 ARG A CZ   1  
ATOM 1470  N NH1  . ARG A 1 108 ? -13.979 11.678  -2.205  1.00 3.15  ? 103 ARG A NH1  1  
ATOM 1471  N NH2  . ARG A 1 108 ? -15.427 12.356  -3.852  1.00 12.42 ? 103 ARG A NH2  1  
ATOM 1472  H H    . ARG A 1 108 ? -10.177 7.332   -3.799  1.00 74.24 ? 103 ARG A H    1  
ATOM 1473  H HA   . ARG A 1 108 ? -11.599 6.876   -2.082  1.00 42.42 ? 103 ARG A HA   1  
ATOM 1474  H HB3  . ARG A 1 108 ? -14.083 6.621   -2.831  1.00 75.23 ? 103 ARG A HB3  1  
ATOM 1475  H HG3  . ARG A 1 108 ? -13.091 9.218   -3.813  1.00 2.22  ? 103 ARG A HG3  1  
ATOM 1476  H HD3  . ARG A 1 108 ? -14.735 9.280   -1.471  1.00 61.13 ? 103 ARG A HD3  1  
ATOM 1477  H HE   . ARG A 1 108 ? -15.978 9.938   -3.960  1.00 1.42  ? 103 ARG A HE   1  
ATOM 1478  H HH11 . ARG A 1 108 ? -13.580 10.949  -1.648  1.00 63.31 ? 103 ARG A HH11 1  
ATOM 1479  H HH12 . ARG A 1 108 ? -13.682 12.624  -2.080  1.00 65.31 ? 103 ARG A HH12 1  
ATOM 1480  H HH21 . ARG A 1 108 ? -16.121 12.139  -4.538  1.00 30.23 ? 103 ARG A HH21 1  
ATOM 1481  H HH22 . ARG A 1 108 ? -15.129 13.301  -3.723  1.00 51.30 ? 103 ARG A HH22 1  
ATOM 1482  N N    . ILE A 1 109 ? -11.023 4.261   -2.820  1.00 54.35 ? 104 ILE A N    1  
ATOM 1483  C CA   . ILE A 1 109 ? -11.057 2.808   -2.697  1.00 21.42 ? 104 ILE A CA   1  
ATOM 1484  C C    . ILE A 1 109 ? -11.454 2.385   -1.287  1.00 63.44 ? 104 ILE A C    1  
ATOM 1485  O O    . ILE A 1 109 ? -10.775 2.715   -0.314  1.00 53.23 ? 104 ILE A O    1  
ATOM 1486  C CB   . ILE A 1 109 ? -9.694  2.182   -3.044  1.00 22.21 ? 104 ILE A CB   1  
ATOM 1487  C CG1  . ILE A 1 109 ? -9.157  2.769   -4.351  1.00 52.23 ? 104 ILE A CG1  1  
ATOM 1488  C CG2  . ILE A 1 109 ? -9.818  0.669   -3.148  1.00 14.13 ? 104 ILE A CG2  1  
ATOM 1489  C CD1  . ILE A 1 109 ? -7.813  2.205   -4.760  1.00 71.44 ? 104 ILE A CD1  1  
ATOM 1490  H H    . ILE A 1 109 ? -10.156 4.718   -2.842  1.00 23.30 ? 104 ILE A H    1  
ATOM 1491  H HA   . ILE A 1 109 ? -11.791 2.433   -3.394  1.00 22.54 ? 104 ILE A HA   1  
ATOM 1492  H HB   . ILE A 1 109 ? -9.004  2.408   -2.245  1.00 23.40 ? 104 ILE A HB   1  
ATOM 1493  H HG13 . ILE A 1 109 ? -9.049  3.838   -4.239  1.00 52.45 ? 104 ILE A HG13 1  
ATOM 1494  H HG21 . ILE A 1 109 ? -10.372 0.414   -4.040  1.00 74.15 ? 104 ILE A HG21 1  
ATOM 1495  H HG22 . ILE A 1 109 ? -8.833  0.231   -3.200  1.00 52.22 ? 104 ILE A HG22 1  
ATOM 1496  H HG23 . ILE A 1 109 ? -10.337 0.289   -2.280  1.00 5.32  ? 104 ILE A HG23 1  
ATOM 1497  H HD11 . ILE A 1 109 ? -7.249  1.944   -3.876  1.00 41.31 ? 104 ILE A HD11 1  
ATOM 1498  H HD12 . ILE A 1 109 ? -7.961  1.325   -5.366  1.00 41.40 ? 104 ILE A HD12 1  
ATOM 1499  H HD13 . ILE A 1 109 ? -7.269  2.947   -5.326  1.00 32.15 ? 104 ILE A HD13 1  
ATOM 1500  N N    . ASP A 1 110 ? -12.556 1.652   -1.184  1.00 31.52 ? 105 ASP A N    1  
ATOM 1501  C CA   . ASP A 1 110 ? -13.043 1.180   0.108   1.00 63.22 ? 105 ASP A CA   1  
ATOM 1502  C C    . ASP A 1 110 ? -12.085 0.156   0.708   1.00 71.03 ? 105 ASP A C    1  
ATOM 1503  O O    . ASP A 1 110 ? -11.349 -0.531  0.001   1.00 3.42  ? 105 ASP A O    1  
ATOM 1504  C CB   . ASP A 1 110 ? -14.436 0.567   -0.042  1.00 71.44 ? 105 ASP A CB   1  
ATOM 1505  C CG   . ASP A 1 110 ? -15.538 1.526   0.369   1.00 2.31  ? 105 ASP A CG   1  
ATOM 1506  O OD1  . ASP A 1 110 ? -15.368 2.219   1.393   1.00 25.20 ? 105 ASP A OD1  1  
ATOM 1507  O OD2  . ASP A 1 110 ? -16.568 1.580   -0.334  1.00 23.20 ? 105 ASP A OD2  1  
ATOM 1508  H H    . ASP A 1 110 ? -13.055 1.422   -1.995  1.00 3.40  ? 105 ASP A H    1  
ATOM 1509  H HA   . ASP A 1 110 ? -13.103 2.030   0.770   1.00 62.34 ? 105 ASP A HA   1  
ATOM 1510  H HB3  . ASP A 1 110 ? -14.502 -0.315  0.578   1.00 74.44 ? 105 ASP A HB3  1  
ATOM 1511  N N    . PRO A 1 111 ? -12.092 0.052   2.046   1.00 11.32 ? 106 PRO A N    1  
ATOM 1512  C CA   . PRO A 1 111 ? -11.229 -0.885  2.771   1.00 11.43 ? 106 PRO A CA   1  
ATOM 1513  C C    . PRO A 1 111 ? -11.641 -2.338  2.558   1.00 64.50 ? 106 PRO A C    1  
ATOM 1514  O O    . PRO A 1 111 ? -10.814 -3.184  2.217   1.00 22.44 ? 106 PRO A O    1  
ATOM 1515  C CB   . PRO A 1 111 ? -11.422 -0.484  4.236   1.00 20.35 ? 106 PRO A CB   1  
ATOM 1516  C CG   . PRO A 1 111 ? -12.768 0.154   4.279   1.00 71.25 ? 106 PRO A CG   1  
ATOM 1517  C CD   . PRO A 1 111 ? -12.944 0.840   2.952   1.00 55.23 ? 106 PRO A CD   1  
ATOM 1518  H HA   . PRO A 1 111 ? -10.192 -0.763  2.496   1.00 71.33 ? 106 PRO A HA   1  
ATOM 1519  H HB3  . PRO A 1 111 ? -10.647 0.208   4.529   1.00 11.34 ? 106 PRO A HB3  1  
ATOM 1520  H HG3  . PRO A 1 111 ? -12.805 0.876   5.082   1.00 5.42  ? 106 PRO A HG3  1  
ATOM 1521  H HD3  . PRO A 1 111 ? -12.603 1.863   3.008   1.00 40.13 ? 106 PRO A HD3  1  
ATOM 1522  N N    . ILE A 1 112 ? -12.925 -2.619  2.759   1.00 44.51 ? 107 ILE A N    1  
ATOM 1523  C CA   . ILE A 1 112 ? -13.445 -3.969  2.586   1.00 33.24 ? 107 ILE A CA   1  
ATOM 1524  C C    . ILE A 1 112 ? -13.424 -4.384  1.119   1.00 42.11 ? 107 ILE A C    1  
ATOM 1525  O O    . ILE A 1 112 ? -13.403 -5.572  0.799   1.00 62.41 ? 107 ILE A O    1  
ATOM 1526  C CB   . ILE A 1 112 ? -14.885 -4.090  3.121   1.00 34.23 ? 107 ILE A CB   1  
ATOM 1527  C CG1  . ILE A 1 112 ? -15.845 -3.272  2.254   1.00 40.34 ? 107 ILE A CG1  1  
ATOM 1528  C CG2  . ILE A 1 112 ? -14.952 -3.632  4.571   1.00 3.21  ? 107 ILE A CG2  1  
ATOM 1529  C CD1  . ILE A 1 112 ? -17.282 -3.335  2.720   1.00 24.25 ? 107 ILE A CD1  1  
ATOM 1530  H H    . ILE A 1 112 ? -13.534 -1.902  3.029   1.00 13.02 ? 107 ILE A H    1  
ATOM 1531  H HA   . ILE A 1 112 ? -12.817 -4.644  3.149   1.00 41.15 ? 107 ILE A HA   1  
ATOM 1532  H HB   . ILE A 1 112 ? -15.173 -5.129  3.083   1.00 11.04 ? 107 ILE A HB   1  
ATOM 1533  H HG13 . ILE A 1 112 ? -15.807 -3.644  1.240   1.00 12.22 ? 107 ILE A HG13 1  
ATOM 1534  H HG21 . ILE A 1 112 ? -15.968 -3.714  4.928   1.00 11.34 ? 107 ILE A HG21 1  
ATOM 1535  H HG22 . ILE A 1 112 ? -14.307 -4.254  5.173   1.00 73.31 ? 107 ILE A HG22 1  
ATOM 1536  H HG23 . ILE A 1 112 ? -14.629 -2.604  4.639   1.00 61.13 ? 107 ILE A HG23 1  
ATOM 1537  H HD11 . ILE A 1 112 ? -17.596 -2.356  3.051   1.00 21.43 ? 107 ILE A HD11 1  
ATOM 1538  H HD12 . ILE A 1 112 ? -17.911 -3.659  1.904   1.00 72.21 ? 107 ILE A HD12 1  
ATOM 1539  H HD13 . ILE A 1 112 ? -17.365 -4.035  3.538   1.00 32.42 ? 107 ILE A HD13 1  
ATOM 1540  N N    . ASN A 1 113 ? -13.428 -3.395  0.231   1.00 52.41 ? 108 ASN A N    1  
ATOM 1541  C CA   . ASN A 1 113 ? -13.407 -3.657  -1.204  1.00 74.04 ? 108 ASN A CA   1  
ATOM 1542  C C    . ASN A 1 113 ? -11.973 -3.750  -1.719  1.00 21.44 ? 108 ASN A C    1  
ATOM 1543  O O    . ASN A 1 113 ? -11.744 -4.062  -2.887  1.00 51.23 ? 108 ASN A O    1  
ATOM 1544  C CB   . ASN A 1 113 ? -14.160 -2.558  -1.955  1.00 35.42 ? 108 ASN A CB   1  
ATOM 1545  C CG   . ASN A 1 113 ? -15.582 -2.962  -2.296  1.00 21.40 ? 108 ASN A CG   1  
ATOM 1546  O OD1  . ASN A 1 113 ? -15.810 -3.961  -2.978  1.00 72.03 ? 108 ASN A OD1  1  
ATOM 1547  N ND2  . ASN A 1 113 ? -16.548 -2.183  -1.821  1.00 24.41 ? 108 ASN A ND2  1  
ATOM 1548  H H    . ASN A 1 113 ? -13.445 -2.468  0.547   1.00 52.22 ? 108 ASN A H    1  
ATOM 1549  H HA   . ASN A 1 113 ? -13.900 -4.601  -1.375  1.00 12.13 ? 108 ASN A HA   1  
ATOM 1550  H HB3  . ASN A 1 113 ? -13.639 -2.334  -2.873  1.00 1.33  ? 108 ASN A HB3  1  
ATOM 1551  H HD21 . ASN A 1 113 ? -16.293 -1.402  -1.285  1.00 14.53 ? 108 ASN A HD21 1  
ATOM 1552  H HD22 . ASN A 1 113 ? -17.476 -2.420  -2.026  1.00 13.12 ? 108 ASN A HD22 1  
ATOM 1553  N N    . GLU A 1 114 ? -11.016 -3.477  -0.840  1.00 41.13 ? 109 GLU A N    1  
ATOM 1554  C CA   . GLU A 1 114 ? -9.606  -3.529  -1.207  1.00 52.33 ? 109 GLU A CA   1  
ATOM 1555  C C    . GLU A 1 114 ? -9.138  -4.974  -1.364  1.00 44.04 ? 109 GLU A C    1  
ATOM 1556  O O    . GLU A 1 114 ? -9.685  -5.885  -0.744  1.00 40.43 ? 109 GLU A O    1  
ATOM 1557  C CB   . GLU A 1 114 ? -8.755  -2.818  -0.153  1.00 40.44 ? 109 GLU A CB   1  
ATOM 1558  C CG   . GLU A 1 114 ? -7.854  -1.736  -0.725  1.00 33.45 ? 109 GLU A CG   1  
ATOM 1559  C CD   . GLU A 1 114 ? -6.935  -2.257  -1.813  1.00 35.33 ? 109 GLU A CD   1  
ATOM 1560  O OE1  . GLU A 1 114 ? -6.260  -3.280  -1.580  1.00 54.42 ? 109 GLU A OE1  1  
ATOM 1561  O OE2  . GLU A 1 114 ? -6.892  -1.640  -2.898  1.00 32.23 ? 109 GLU A OE2  1  
ATOM 1562  H H    . GLU A 1 114 ? -11.262 -3.235  0.077   1.00 65.31 ? 109 GLU A H    1  
ATOM 1563  H HA   . GLU A 1 114 ? -9.489  -3.021  -2.152  1.00 30.50 ? 109 GLU A HA   1  
ATOM 1564  H HB3  . GLU A 1 114 ? -8.132  -3.550  0.343   1.00 62.32 ? 109 GLU A HB3  1  
ATOM 1565  H HG3  . GLU A 1 114 ? -7.250  -1.329  0.072   1.00 13.33 ? 109 GLU A HG3  1  
ATOM 1566  N N    . ARG A 1 115 ? -8.122  -5.172  -2.199  1.00 54.52 ? 110 ARG A N    1  
ATOM 1567  C CA   . ARG A 1 115 ? -7.582  -6.505  -2.439  1.00 45.30 ? 110 ARG A CA   1  
ATOM 1568  C C    . ARG A 1 115 ? -6.451  -6.817  -1.464  1.00 72.02 ? 110 ARG A C    1  
ATOM 1569  O O    . ARG A 1 115 ? -6.459  -7.854  -0.800  1.00 63.33 ? 110 ARG A O    1  
ATOM 1570  C CB   . ARG A 1 115 ? -7.075  -6.620  -3.878  1.00 10.20 ? 110 ARG A CB   1  
ATOM 1571  C CG   . ARG A 1 115 ? -8.037  -7.342  -4.807  1.00 65.14 ? 110 ARG A CG   1  
ATOM 1572  C CD   . ARG A 1 115 ? -9.022  -6.376  -5.448  1.00 51.54 ? 110 ARG A CD   1  
ATOM 1573  N NE   . ARG A 1 115 ? -10.400 -6.659  -5.056  1.00 54.51 ? 110 ARG A NE   1  
ATOM 1574  C CZ   . ARG A 1 115 ? -11.444 -5.954  -5.477  1.00 45.32 ? 110 ARG A CZ   1  
ATOM 1575  N NH1  . ARG A 1 115 ? -11.266 -4.928  -6.299  1.00 0.15  ? 110 ARG A NH1  1  
ATOM 1576  N NH2  . ARG A 1 115 ? -12.668 -6.272  -5.077  1.00 55.54 ? 110 ARG A NH2  1  
ATOM 1577  H H    . ARG A 1 115 ? -7.727  -4.406  -2.663  1.00 24.22 ? 110 ARG A H    1  
ATOM 1578  H HA   . ARG A 1 115 ? -8.378  -7.218  -2.290  1.00 1.10  ? 110 ARG A HA   1  
ATOM 1579  H HB3  . ARG A 1 115 ? -6.139  -7.159  -3.876  1.00 54.24 ? 110 ARG A HB3  1  
ATOM 1580  H HG3  . ARG A 1 115 ? -8.585  -8.078  -4.240  1.00 35.51 ? 110 ARG A HG3  1  
ATOM 1581  H HD3  . ARG A 1 115 ? -8.938  -6.458  -6.521  1.00 24.23 ? 110 ARG A HD3  1  
ATOM 1582  H HE   . ARG A 1 115 ? -10.553 -7.413  -4.449  1.00 25.14 ? 110 ARG A HE   1  
ATOM 1583  H HH11 . ARG A 1 115 ? -10.346 -4.686  -6.604  1.00 3.43  ? 110 ARG A HH11 1  
ATOM 1584  H HH12 . ARG A 1 115 ? -12.054 -4.399  -6.616  1.00 51.22 ? 110 ARG A HH12 1  
ATOM 1585  H HH21 . ARG A 1 115 ? -12.805 -7.045  -4.457  1.00 74.24 ? 110 ARG A HH21 1  
ATOM 1586  H HH22 . ARG A 1 115 ? -13.452 -5.741  -5.394  1.00 73.05 ? 110 ARG A HH22 1  
ATOM 1587  N N    . SER A 1 116 ? -5.478  -5.914  -1.384  1.00 32.23 ? 111 SER A N    1  
ATOM 1588  C CA   . SER A 1 116 ? -4.339  -6.096  -0.493  1.00 61.43 ? 111 SER A CA   1  
ATOM 1589  C C    . SER A 1 116 ? -4.113  -4.852  0.362   1.00 21.43 ? 111 SER A C    1  
ATOM 1590  O O    . SER A 1 116 ? -4.170  -3.726  -0.133  1.00 0.03  ? 111 SER A O    1  
ATOM 1591  C CB   . SER A 1 116 ? -3.078  -6.407  -1.301  1.00 52.23 ? 111 SER A CB   1  
ATOM 1592  O OG   . SER A 1 116 ? -1.914  -6.270  -0.504  1.00 51.01 ? 111 SER A OG   1  
ATOM 1593  H H    . SER A 1 116 ? -5.529  -5.108  -1.939  1.00 61.52 ? 111 SER A H    1  
ATOM 1594  H HA   . SER A 1 116 ? -4.555  -6.929  0.158   1.00 12.52 ? 111 SER A HA   1  
ATOM 1595  H HB3  . SER A 1 116 ? -3.010  -5.725  -2.136  1.00 74.34 ? 111 SER A HB3  1  
ATOM 1596  H HG   . SER A 1 116 ? -1.699  -7.116  -0.102  1.00 23.12 ? 111 SER A HG   1  
ATOM 1597  N N    . PHE A 1 117 ? -3.859  -5.064  1.648   1.00 73.22 ? 112 PHE A N    1  
ATOM 1598  C CA   . PHE A 1 117 ? -3.627  -3.961  2.574   1.00 42.44 ? 112 PHE A CA   1  
ATOM 1599  C C    . PHE A 1 117 ? -2.308  -4.146  3.321   1.00 34.01 ? 112 PHE A C    1  
ATOM 1600  O O    . PHE A 1 117 ? -1.888  -5.273  3.588   1.00 63.42 ? 112 PHE A O    1  
ATOM 1601  C CB   . PHE A 1 117 ? -4.781  -3.852  3.572   1.00 54.54 ? 112 PHE A CB   1  
ATOM 1602  C CG   . PHE A 1 117 ? -5.374  -2.475  3.655   1.00 10.21 ? 112 PHE A CG   1  
ATOM 1603  C CD1  . PHE A 1 117 ? -5.791  -1.816  2.510   1.00 31.41 ? 112 PHE A CD1  1  
ATOM 1604  C CD2  . PHE A 1 117 ? -5.513  -1.839  4.878   1.00 50.34 ? 112 PHE A CD2  1  
ATOM 1605  C CE1  . PHE A 1 117 ? -6.338  -0.548  2.583   1.00 41.11 ? 112 PHE A CE1  1  
ATOM 1606  C CE2  . PHE A 1 117 ? -6.059  -0.572  4.958   1.00 21.41 ? 112 PHE A CE2  1  
ATOM 1607  C CZ   . PHE A 1 117 ? -6.470  0.075   3.809   1.00 33.44 ? 112 PHE A CZ   1  
ATOM 1608  H H    . PHE A 1 117 ? -3.826  -5.984  1.984   1.00 34.31 ? 112 PHE A H    1  
ATOM 1609  H HA   . PHE A 1 117 ? -3.574  -3.051  1.997   1.00 45.12 ? 112 PHE A HA   1  
ATOM 1610  H HB3  . PHE A 1 117 ? -4.424  -4.121  4.555   1.00 3.51  ? 112 PHE A HB3  1  
ATOM 1611  H HD1  . PHE A 1 117 ? -5.687  -2.302  1.551   1.00 4.42  ? 112 PHE A HD1  1  
ATOM 1612  H HD2  . PHE A 1 117 ? -5.191  -2.343  5.777   1.00 70.45 ? 112 PHE A HD2  1  
ATOM 1613  H HE1  . PHE A 1 117 ? -6.659  -0.046  1.683   1.00 44.22 ? 112 PHE A HE1  1  
ATOM 1614  H HE2  . PHE A 1 117 ? -6.162  -0.087  5.917   1.00 61.12 ? 112 PHE A HE2  1  
ATOM 1615  H HZ   . PHE A 1 117 ? -6.898  1.065   3.868   1.00 51.12 ? 112 PHE A HZ   1  
ATOM 1616  N N    . ILE A 1 118 ? -1.663  -3.034  3.655   1.00 12.32 ? 113 ILE A N    1  
ATOM 1617  C CA   . ILE A 1 118 ? -0.394  -3.073  4.371   1.00 32.42 ? 113 ILE A CA   1  
ATOM 1618  C C    . ILE A 1 118 ? -0.330  -1.983  5.436   1.00 14.31 ? 113 ILE A C    1  
ATOM 1619  O O    . ILE A 1 118 ? -0.457  -0.797  5.132   1.00 61.44 ? 113 ILE A O    1  
ATOM 1620  C CB   . ILE A 1 118 ? 0.799   -2.909  3.413   1.00 1.44  ? 113 ILE A CB   1  
ATOM 1621  C CG1  . ILE A 1 118 ? 0.810   -4.038  2.379   1.00 12.23 ? 113 ILE A CG1  1  
ATOM 1622  C CG2  . ILE A 1 118 ? 2.106   -2.884  4.192   1.00 31.24 ? 113 ILE A CG2  1  
ATOM 1623  C CD1  . ILE A 1 118 ? 1.225   -5.376  2.950   1.00 62.34 ? 113 ILE A CD1  1  
ATOM 1624  H H    . ILE A 1 118 ? -2.050  -2.166  3.415   1.00 1.33  ? 113 ILE A H    1  
ATOM 1625  H HA   . ILE A 1 118 ? -0.314  -4.037  4.853   1.00 70.23 ? 113 ILE A HA   1  
ATOM 1626  H HB   . ILE A 1 118 ? 0.694   -1.964  2.901   1.00 51.33 ? 113 ILE A HB   1  
ATOM 1627  H HG13 . ILE A 1 118 ? 1.501   -3.786  1.589   1.00 44.22 ? 113 ILE A HG13 1  
ATOM 1628  H HG21 . ILE A 1 118 ? 2.137   -2.001  4.813   1.00 60.01 ? 113 ILE A HG21 1  
ATOM 1629  H HG22 . ILE A 1 118 ? 2.170   -3.764  4.814   1.00 22.21 ? 113 ILE A HG22 1  
ATOM 1630  H HG23 . ILE A 1 118 ? 2.936   -2.870  3.503   1.00 25.24 ? 113 ILE A HG23 1  
ATOM 1631  H HD11 . ILE A 1 118 ? 0.545   -6.141  2.606   1.00 50.13 ? 113 ILE A HD11 1  
ATOM 1632  H HD12 . ILE A 1 118 ? 2.228   -5.611  2.627   1.00 21.30 ? 113 ILE A HD12 1  
ATOM 1633  H HD13 . ILE A 1 118 ? 1.197   -5.330  4.031   1.00 5.33  ? 113 ILE A HD13 1  
ATOM 1634  N N    . CYS A 1 119 ? -0.130  -2.394  6.684   1.00 21.54 ? 114 CYS A N    1  
ATOM 1635  C CA   . CYS A 1 119 ? -0.048  -1.452  7.794   1.00 22.35 ? 114 CYS A CA   1  
ATOM 1636  C C    . CYS A 1 119 ? 1.399   -1.252  8.231   1.00 72.12 ? 114 CYS A C    1  
ATOM 1637  O O    . CYS A 1 119 ? 2.198   -2.188  8.213   1.00 13.02 ? 114 CYS A O    1  
ATOM 1638  C CB   . CYS A 1 119 ? -0.886  -1.947  8.974   1.00 12.03 ? 114 CYS A CB   1  
ATOM 1639  S SG   . CYS A 1 119 ? -2.463  -1.086  9.173   1.00 4.34  ? 114 CYS A SG   1  
ATOM 1640  H H    . CYS A 1 119 ? -0.037  -3.353  6.862   1.00 72.32 ? 114 CYS A H    1  
ATOM 1641  H HA   . CYS A 1 119 ? -0.442  -0.506  7.455   1.00 74.33 ? 114 CYS A HA   1  
ATOM 1642  H HB3  . CYS A 1 119 ? -0.322  -1.819  9.885   1.00 72.31 ? 114 CYS A HB3  1  
ATOM 1643  H HG   . CYS A 1 119 ? -3.423  -1.997  9.223   1.00 24.25 ? 114 CYS A HG   1  
ATOM 1644  N N    . ASN A 1 120 ? 1.730   -0.025  8.622   1.00 15.51 ? 115 ASN A N    1  
ATOM 1645  C CA   . ASN A 1 120 ? 3.083   0.297   9.062   1.00 32.21 ? 115 ASN A CA   1  
ATOM 1646  C C    . ASN A 1 120 ? 3.062   0.990   10.422  1.00 22.24 ? 115 ASN A C    1  
ATOM 1647  O O    . ASN A 1 120 ? 2.547   2.100   10.556  1.00 40.23 ? 115 ASN A O    1  
ATOM 1648  C CB   . ASN A 1 120 ? 3.776   1.191   8.033   1.00 5.31  ? 115 ASN A CB   1  
ATOM 1649  C CG   . ASN A 1 120 ? 4.953   1.945   8.620   1.00 64.23 ? 115 ASN A CG   1  
ATOM 1650  O OD1  . ASN A 1 120 ? 4.779   2.948   9.312   1.00 34.30 ? 115 ASN A OD1  1  
ATOM 1651  N ND2  . ASN A 1 120 ? 6.160   1.464   8.346   1.00 43.35 ? 115 ASN A ND2  1  
ATOM 1652  H H    . ASN A 1 120 ? 1.049   0.679   8.615   1.00 11.43 ? 115 ASN A H    1  
ATOM 1653  H HA   . ASN A 1 120 ? 3.632   -0.628  9.151   1.00 23.11 ? 115 ASN A HA   1  
ATOM 1654  H HB3  . ASN A 1 120 ? 3.066   1.909   7.651   1.00 22.52 ? 115 ASN A HB3  1  
ATOM 1655  H HD21 . ASN A 1 120 ? 6.223   0.661   7.788   1.00 14.33 ? 115 ASN A HD21 1  
ATOM 1656  H HD22 . ASN A 1 120 ? 6.939   1.931   8.715   1.00 24.24 ? 115 ASN A HD22 1  
ATOM 1657  N N    . TYR A 1 121 ? 3.625   0.328   11.426  1.00 12.24 ? 116 TYR A N    1  
ATOM 1658  C CA   . TYR A 1 121 ? 3.670   0.878   12.775  1.00 24.24 ? 116 TYR A CA   1  
ATOM 1659  C C    . TYR A 1 121 ? 5.108   1.162   13.200  1.00 11.02 ? 116 TYR A C    1  
ATOM 1660  O O    . TYR A 1 121 ? 6.020   0.390   12.902  1.00 73.33 ? 116 TYR A O    1  
ATOM 1661  C CB   . TYR A 1 121 ? 3.015   -0.088  13.764  1.00 22.12 ? 116 TYR A CB   1  
ATOM 1662  C CG   . TYR A 1 121 ? 3.197   0.312   15.211  1.00 3.43  ? 116 TYR A CG   1  
ATOM 1663  C CD1  . TYR A 1 121 ? 2.902   1.600   15.639  1.00 23.22 ? 116 TYR A CD1  1  
ATOM 1664  C CD2  . TYR A 1 121 ? 3.664   -0.600  16.150  1.00 22.10 ? 116 TYR A CD2  1  
ATOM 1665  C CE1  . TYR A 1 121 ? 3.067   1.969   16.960  1.00 64.22 ? 116 TYR A CE1  1  
ATOM 1666  C CE2  . TYR A 1 121 ? 3.832   -0.239  17.473  1.00 73.10 ? 116 TYR A CE2  1  
ATOM 1667  C CZ   . TYR A 1 121 ? 3.533   1.047   17.873  1.00 15.35 ? 116 TYR A CZ   1  
ATOM 1668  O OH   . TYR A 1 121 ? 3.698   1.411   19.190  1.00 13.34 ? 116 TYR A OH   1  
ATOM 1669  H H    . TYR A 1 121 ? 4.019   -0.554  11.256  1.00 2.34  ? 116 TYR A H    1  
ATOM 1670  H HA   . TYR A 1 121 ? 3.117   1.806   12.773  1.00 33.30 ? 116 TYR A HA   1  
ATOM 1671  H HB3  . TYR A 1 121 ? 3.443   -1.070  13.634  1.00 51.44 ? 116 TYR A HB3  1  
ATOM 1672  H HD1  . TYR A 1 121 ? 2.537   2.321   14.921  1.00 12.42 ? 116 TYR A HD1  1  
ATOM 1673  H HD2  . TYR A 1 121 ? 3.898   -1.605  15.834  1.00 15.13 ? 116 TYR A HD2  1  
ATOM 1674  H HE1  . TYR A 1 121 ? 2.833   2.977   17.273  1.00 35.01 ? 116 TYR A HE1  1  
ATOM 1675  H HE2  . TYR A 1 121 ? 4.196   -0.962  18.189  1.00 23.51 ? 116 TYR A HE2  1  
ATOM 1676  H HH   . TYR A 1 121 ? 2.843   1.429   19.626  1.00 30.00 ? 116 TYR A HH   1  
ATOM 1677  N N    . LYS A 1 122 ? 5.302   2.275   13.899  1.00 64.22 ? 117 LYS A N    1  
ATOM 1678  C CA   . LYS A 1 122 ? 6.626   2.663   14.368  1.00 53.43 ? 117 LYS A CA   1  
ATOM 1679  C C    . LYS A 1 122 ? 7.400   1.450   14.877  1.00 5.31  ? 117 LYS A C    1  
ATOM 1680  O O    . LYS A 1 122 ? 7.112   0.926   15.951  1.00 52.11 ? 117 LYS A O    1  
ATOM 1681  C CB   . LYS A 1 122 ? 6.511   3.710   15.478  1.00 53.10 ? 117 LYS A CB   1  
ATOM 1682  C CG   . LYS A 1 122 ? 5.958   5.042   15.003  1.00 62.10 ? 117 LYS A CG   1  
ATOM 1683  C CD   . LYS A 1 122 ? 6.053   6.104   16.086  1.00 15.01 ? 117 LYS A CD   1  
ATOM 1684  C CE   . LYS A 1 122 ? 6.059   7.504   15.494  1.00 64.14 ? 117 LYS A CE   1  
ATOM 1685  N NZ   . LYS A 1 122 ? 4.839   7.769   14.682  1.00 55.21 ? 117 LYS A NZ   1  
ATOM 1686  H H    . LYS A 1 122 ? 4.534   2.850   14.104  1.00 62.43 ? 117 LYS A H    1  
ATOM 1687  H HA   . LYS A 1 122 ? 7.161   3.092   13.535  1.00 65.33 ? 117 LYS A HA   1  
ATOM 1688  H HB3  . LYS A 1 122 ? 7.491   3.880   15.899  1.00 53.03 ? 117 LYS A HB3  1  
ATOM 1689  H HG3  . LYS A 1 122 ? 4.921   4.913   14.728  1.00 22.14 ? 117 LYS A HG3  1  
ATOM 1690  H HD3  . LYS A 1 122 ? 6.966   5.954   16.645  1.00 52.22 ? 117 LYS A HD3  1  
ATOM 1691  H HE3  . LYS A 1 122 ? 6.930   7.611   14.865  1.00 60.34 ? 117 LYS A HE3  1  
ATOM 1692  H HZ1  . LYS A 1 122 ? 5.107   8.046   13.716  1.00 64.41 ? 117 LYS A HZ1  1  
ATOM 1693  H HZ2  . LYS A 1 122 ? 4.284   8.537   15.110  1.00 73.11 ? 117 LYS A HZ2  1  
ATOM 1694  H HZ3  . LYS A 1 122 ? 4.249   6.914   14.635  1.00 60.14 ? 117 LYS A HZ3  1  
ATOM 1695  N N    . GLU A 1 123 ? 8.384   1.013   14.097  1.00 12.12 ? 118 GLU A N    1  
ATOM 1696  C CA   . GLU A 1 123 ? 9.198   -0.139  14.470  1.00 65.44 ? 118 GLU A CA   1  
ATOM 1697  C C    . GLU A 1 123 ? 8.381   -1.425  14.413  1.00 3.44  ? 118 GLU A C    1  
ATOM 1698  O O    . GLU A 1 123 ? 8.433   -2.248  15.328  1.00 23.13 ? 118 GLU A O    1  
ATOM 1699  C CB   . GLU A 1 123 ? 9.774   0.051   15.875  1.00 71.22 ? 118 GLU A CB   1  
ATOM 1700  C CG   . GLU A 1 123 ? 11.180  -0.501  16.036  1.00 52.31 ? 118 GLU A CG   1  
ATOM 1701  C CD   . GLU A 1 123 ? 11.595  -0.626  17.489  1.00 54.12 ? 118 GLU A CD   1  
ATOM 1702  O OE1  . GLU A 1 123 ? 11.598  0.403   18.197  1.00 50.40 ? 118 GLU A OE1  1  
ATOM 1703  O OE2  . GLU A 1 123 ? 11.915  -1.755  17.919  1.00 41.33 ? 118 GLU A OE2  1  
ATOM 1704  H H    . GLU A 1 123 ? 8.566   1.473   13.252  1.00 13.25 ? 118 GLU A H    1  
ATOM 1705  H HA   . GLU A 1 123 ? 10.013  -0.211  13.765  1.00 24.03 ? 118 GLU A HA   1  
ATOM 1706  H HB3  . GLU A 1 123 ? 9.131   -0.449  16.585  1.00 3.35  ? 118 GLU A HB3  1  
ATOM 1707  H HG3  . GLU A 1 123 ? 11.872  0.160   15.536  1.00 53.42 ? 118 GLU A HG3  1  
ATOM 1708  N N    . HIS A 1 124 ? 7.627   -1.592  13.330  1.00 74.11 ? 119 HIS A N    1  
ATOM 1709  C CA   . HIS A 1 124 ? 6.798   -2.779  13.152  1.00 51.54 ? 119 HIS A CA   1  
ATOM 1710  C C    . HIS A 1 124 ? 6.027   -2.711  11.837  1.00 74.55 ? 119 HIS A C    1  
ATOM 1711  O O    . HIS A 1 124 ? 5.613   -1.635  11.406  1.00 34.25 ? 119 HIS A O    1  
ATOM 1712  C CB   . HIS A 1 124 ? 5.825   -2.928  14.322  1.00 21.41 ? 119 HIS A CB   1  
ATOM 1713  C CG   . HIS A 1 124 ? 4.757   -3.951  14.086  1.00 32.01 ? 119 HIS A CG   1  
ATOM 1714  N ND1  . HIS A 1 124 ? 5.028   -5.290  13.893  1.00 2.23  ? 119 HIS A ND1  1  
ATOM 1715  C CD2  . HIS A 1 124 ? 3.411   -3.827  14.016  1.00 51.43 ? 119 HIS A CD2  1  
ATOM 1716  C CE1  . HIS A 1 124 ? 3.895   -5.944  13.712  1.00 22.45 ? 119 HIS A CE1  1  
ATOM 1717  N NE2  . HIS A 1 124 ? 2.899   -5.080  13.782  1.00 71.41 ? 119 HIS A NE2  1  
ATOM 1718  H H    . HIS A 1 124 ? 7.629   -0.902  12.636  1.00 60.50 ? 119 HIS A H    1  
ATOM 1719  H HA   . HIS A 1 124 ? 7.451   -3.639  13.128  1.00 65.32 ? 119 HIS A HA   1  
ATOM 1720  H HB3  . HIS A 1 124 ? 5.340   -1.978  14.502  1.00 11.30 ? 119 HIS A HB3  1  
ATOM 1721  H HD1  . HIS A 1 124 ? 5.918   -5.698  13.886  1.00 34.01 ? 119 HIS A HD1  1  
ATOM 1722  H HD2  . HIS A 1 124 ? 2.844   -2.913  14.123  1.00 52.11 ? 119 HIS A HD2  1  
ATOM 1723  H HE1  . HIS A 1 124 ? 3.798   -7.006  13.536  1.00 24.42 ? 119 HIS A HE1  1  
ATOM 1724  N N    . TRP A 1 125 ? 5.838   -3.864  11.207  1.00 40.45 ? 120 TRP A N    1  
ATOM 1725  C CA   . TRP A 1 125 ? 5.117   -3.934  9.941   1.00 53.15 ? 120 TRP A CA   1  
ATOM 1726  C C    . TRP A 1 125 ? 3.969   -4.933  10.024  1.00 12.34 ? 120 TRP A C    1  
ATOM 1727  O O    . TRP A 1 125 ? 3.993   -5.855  10.840  1.00 15.14 ? 120 TRP A O    1  
ATOM 1728  C CB   . TRP A 1 125 ? 6.069   -4.325  8.810   1.00 40.42 ? 120 TRP A CB   1  
ATOM 1729  C CG   . TRP A 1 125 ? 6.627   -3.147  8.070   1.00 23.04 ? 120 TRP A CG   1  
ATOM 1730  C CD1  . TRP A 1 125 ? 7.260   -2.064  8.609   1.00 52.43 ? 120 TRP A CD1  1  
ATOM 1731  C CD2  . TRP A 1 125 ? 6.599   -2.933  6.654   1.00 20.15 ? 120 TRP A CD2  1  
ATOM 1732  N NE1  . TRP A 1 125 ? 7.628   -1.190  7.615   1.00 12.21 ? 120 TRP A NE1  1  
ATOM 1733  C CE2  . TRP A 1 125 ? 7.235   -1.701  6.406   1.00 21.11 ? 120 TRP A CE2  1  
ATOM 1734  C CE3  . TRP A 1 125 ? 6.101   -3.664  5.571   1.00 41.14 ? 120 TRP A CE3  1  
ATOM 1735  C CZ2  . TRP A 1 125 ? 7.382   -1.185  5.122   1.00 42.31 ? 120 TRP A CZ2  1  
ATOM 1736  C CZ3  . TRP A 1 125 ? 6.248   -3.150  4.297   1.00 51.13 ? 120 TRP A CZ3  1  
ATOM 1737  C CH2  . TRP A 1 125 ? 6.886   -1.921  4.080   1.00 72.40 ? 120 TRP A CH2  1  
ATOM 1738  H H    . TRP A 1 125 ? 6.193   -4.689  11.602  1.00 64.20 ? 120 TRP A H    1  
ATOM 1739  H HA   . TRP A 1 125 ? 4.712   -2.954  9.737   1.00 44.24 ? 120 TRP A HA   1  
ATOM 1740  H HB3  . TRP A 1 125 ? 5.539   -4.944  8.101   1.00 34.13 ? 120 TRP A HB3  1  
ATOM 1741  H HD1  . TRP A 1 125 ? 7.437   -1.928  9.665   1.00 52.44 ? 120 TRP A HD1  1  
ATOM 1742  H HE1  . TRP A 1 125 ? 8.097   -0.341  7.750   1.00 44.44 ? 120 TRP A HE1  1  
ATOM 1743  H HE3  . TRP A 1 125 ? 5.607   -4.614  5.718   1.00 63.14 ? 120 TRP A HE3  1  
ATOM 1744  H HZ2  . TRP A 1 125 ? 7.871   -0.239  4.938   1.00 52.11 ? 120 TRP A HZ2  1  
ATOM 1745  H HZ3  . TRP A 1 125 ? 5.869   -3.700  3.448   1.00 41.44 ? 120 TRP A HZ3  1  
ATOM 1746  H HH2  . TRP A 1 125 ? 6.978   -1.558  3.069   1.00 12.32 ? 120 TRP A HH2  1  
ATOM 1747  N N    . PHE A 1 126 ? 2.964   -4.745  9.175   1.00 61.42 ? 121 PHE A N    1  
ATOM 1748  C CA   . PHE A 1 126 ? 1.805   -5.630  9.153   1.00 31.40 ? 121 PHE A CA   1  
ATOM 1749  C C    . PHE A 1 126 ? 1.342   -5.884  7.722   1.00 14.24 ? 121 PHE A C    1  
ATOM 1750  O O    . PHE A 1 126 ? 1.199   -4.954  6.928   1.00 63.32 ? 121 PHE A O    1  
ATOM 1751  C CB   . PHE A 1 126 ? 0.661   -5.028  9.972   1.00 64.22 ? 121 PHE A CB   1  
ATOM 1752  C CG   . PHE A 1 126 ? 0.008   -6.010  10.902  1.00 10.12 ? 121 PHE A CG   1  
ATOM 1753  C CD1  . PHE A 1 126 ? -0.370  -7.264  10.453  1.00 5.34  ? 121 PHE A CD1  1  
ATOM 1754  C CD2  . PHE A 1 126 ? -0.227  -5.678  12.226  1.00 74.54 ? 121 PHE A CD2  1  
ATOM 1755  C CE1  . PHE A 1 126 ? -0.971  -8.170  11.306  1.00 52.21 ? 121 PHE A CE1  1  
ATOM 1756  C CE2  . PHE A 1 126 ? -0.828  -6.581  13.085  1.00 42.24 ? 121 PHE A CE2  1  
ATOM 1757  C CZ   . PHE A 1 126 ? -1.201  -7.828  12.623  1.00 74.54 ? 121 PHE A CZ   1  
ATOM 1758  H H    . PHE A 1 126 ? 3.002   -3.992  8.549   1.00 4.23  ? 121 PHE A H    1  
ATOM 1759  H HA   . PHE A 1 126 ? 2.098   -6.569  9.597   1.00 14.23 ? 121 PHE A HA   1  
ATOM 1760  H HB3  . PHE A 1 126 ? -0.095  -4.653  9.299   1.00 72.03 ? 121 PHE A HB3  1  
ATOM 1761  H HD1  . PHE A 1 126 ? -0.191  -7.533  9.420   1.00 34.21 ? 121 PHE A HD1  1  
ATOM 1762  H HD2  . PHE A 1 126 ? 0.063   -4.703  12.589  1.00 21.22 ? 121 PHE A HD2  1  
ATOM 1763  H HE1  . PHE A 1 126 ? -1.262  -9.145  10.941  1.00 63.04 ? 121 PHE A HE1  1  
ATOM 1764  H HE2  . PHE A 1 126 ? -1.005  -6.310  14.115  1.00 22.43 ? 121 PHE A HE2  1  
ATOM 1765  H HZ   . PHE A 1 126 ? -1.669  -8.534  13.293  1.00 3.13  ? 121 PHE A HZ   1  
ATOM 1766  N N    . THR A 1 127 ? 1.109   -7.153  7.399   1.00 25.04 ? 122 THR A N    1  
ATOM 1767  C CA   . THR A 1 127 ? 0.664   -7.531  6.063   1.00 1.11  ? 122 THR A CA   1  
ATOM 1768  C C    . THR A 1 127 ? -0.764  -8.064  6.089   1.00 60.33 ? 122 THR A C    1  
ATOM 1769  O O    . THR A 1 127 ? -1.056  -9.052  6.764   1.00 3.22  ? 122 THR A O    1  
ATOM 1770  C CB   . THR A 1 127 ? 1.587   -8.598  5.445   1.00 21.21 ? 122 THR A CB   1  
ATOM 1771  O OG1  . THR A 1 127 ? 2.949   -8.161  5.503   1.00 0.31  ? 122 THR A OG1  1  
ATOM 1772  C CG2  . THR A 1 127 ? 1.200   -8.876  4.000   1.00 12.42 ? 122 THR A CG2  1  
ATOM 1773  H H    . THR A 1 127 ? 1.241   -7.850  8.074   1.00 62.52 ? 122 THR A H    1  
ATOM 1774  H HA   . THR A 1 127 ? 0.697   -6.650  5.438   1.00 40.13 ? 122 THR A HA   1  
ATOM 1775  H HB   . THR A 1 127 ? 1.485   -9.512  6.012   1.00 11.41 ? 122 THR A HB   1  
ATOM 1776  H HG1  . THR A 1 127 ? 3.377   -8.550  6.270   1.00 64.10 ? 122 THR A HG1  1  
ATOM 1777  H HG21 . THR A 1 127 ? 0.558   -8.086  3.640   1.00 34.11 ? 122 THR A HG21 1  
ATOM 1778  H HG22 . THR A 1 127 ? 0.677   -9.820  3.943   1.00 60.23 ? 122 THR A HG22 1  
ATOM 1779  H HG23 . THR A 1 127 ? 2.091   -8.921  3.391   1.00 34.30 ? 122 THR A HG23 1  
ATOM 1780  N N    . VAL A 1 128 ? -1.651  -7.404  5.352   1.00 34.13 ? 123 VAL A N    1  
ATOM 1781  C CA   . VAL A 1 128 ? -3.049  -7.813  5.290   1.00 32.30 ? 123 VAL A CA   1  
ATOM 1782  C C    . VAL A 1 128 ? -3.454  -8.171  3.865   1.00 24.34 ? 123 VAL A C    1  
ATOM 1783  O O    . VAL A 1 128 ? -3.123  -7.458  2.917   1.00 11.23 ? 123 VAL A O    1  
ATOM 1784  C CB   . VAL A 1 128 ? -3.983  -6.705  5.814   1.00 60.04 ? 123 VAL A CB   1  
ATOM 1785  C CG1  . VAL A 1 128 ? -5.419  -6.974  5.394   1.00 61.42 ? 123 VAL A CG1  1  
ATOM 1786  C CG2  . VAL A 1 128 ? -3.874  -6.589  7.328   1.00 4.43  ? 123 VAL A CG2  1  
ATOM 1787  H H    . VAL A 1 128 ? -1.359  -6.623  4.837   1.00 55.21 ? 123 VAL A H    1  
ATOM 1788  H HA   . VAL A 1 128 ? -3.171  -8.684  5.918   1.00 60.20 ? 123 VAL A HA   1  
ATOM 1789  H HB   . VAL A 1 128 ? -3.673  -5.766  5.380   1.00 13.41 ? 123 VAL A HB   1  
ATOM 1790  H HG11 . VAL A 1 128 ? -5.684  -7.990  5.646   1.00 63.13 ? 123 VAL A HG11 1  
ATOM 1791  H HG12 . VAL A 1 128 ? -6.079  -6.290  5.908   1.00 61.12 ? 123 VAL A HG12 1  
ATOM 1792  H HG13 . VAL A 1 128 ? -5.514  -6.832  4.327   1.00 72.41 ? 123 VAL A HG13 1  
ATOM 1793  H HG21 . VAL A 1 128 ? -3.613  -7.551  7.743   1.00 74.43 ? 123 VAL A HG21 1  
ATOM 1794  H HG22 . VAL A 1 128 ? -3.109  -5.869  7.580   1.00 2.34  ? 123 VAL A HG22 1  
ATOM 1795  H HG23 . VAL A 1 128 ? -4.821  -6.266  7.733   1.00 42.12 ? 123 VAL A HG23 1  
ATOM 1796  N N    . ARG A 1 129 ? -4.174  -9.279  3.721   1.00 24.35 ? 124 ARG A N    1  
ATOM 1797  C CA   . ARG A 1 129 ? -4.624  -9.732  2.410   1.00 32.44 ? 124 ARG A CA   1  
ATOM 1798  C C    . ARG A 1 129 ? -6.098  -10.129 2.448   1.00 74.34 ? 124 ARG A C    1  
ATOM 1799  O O    . ARG A 1 129 ? -6.608  -10.563 3.481   1.00 21.35 ? 124 ARG A O    1  
ATOM 1800  C CB   . ARG A 1 129 ? -3.779  -10.917 1.938   1.00 60.30 ? 124 ARG A CB   1  
ATOM 1801  C CG   . ARG A 1 129 ? -4.135  -11.403 0.543   1.00 25.34 ? 124 ARG A CG   1  
ATOM 1802  C CD   . ARG A 1 129 ? -3.856  -10.337 -0.507  1.00 74.51 ? 124 ARG A CD   1  
ATOM 1803  N NE   . ARG A 1 129 ? -3.536  -10.920 -1.806  1.00 41.55 ? 124 ARG A NE   1  
ATOM 1804  C CZ   . ARG A 1 129 ? -4.416  -11.573 -2.556  1.00 42.23 ? 124 ARG A CZ   1  
ATOM 1805  N NH1  . ARG A 1 129 ? -5.664  -11.726 -2.138  1.00 61.24 ? 124 ARG A NH1  1  
ATOM 1806  N NH2  . ARG A 1 129 ? -4.048  -12.075 -3.728  1.00 55.34 ? 124 ARG A NH2  1  
ATOM 1807  H H    . ARG A 1 129 ? -4.407  -9.805  4.514   1.00 32.14 ? 124 ARG A H    1  
ATOM 1808  H HA   . ARG A 1 129 ? -4.502  -8.915  1.715   1.00 72.43 ? 124 ARG A HA   1  
ATOM 1809  H HB3  . ARG A 1 129 ? -3.914  -11.736 2.627   1.00 15.12 ? 124 ARG A HB3  1  
ATOM 1810  H HG3  . ARG A 1 129 ? -5.185  -11.654 0.517   1.00 11.20 ? 124 ARG A HG3  1  
ATOM 1811  H HD3  . ARG A 1 129 ? -3.023  -9.735  -0.175  1.00 1.20  ? 124 ARG A HD3  1  
ATOM 1812  H HE   . ARG A 1 129 ? -2.618  -10.819 -2.134  1.00 23.02 ? 124 ARG A HE   1  
ATOM 1813  H HH11 . ARG A 1 129 ? -5.945  -11.348 -1.255  1.00 12.12 ? 124 ARG A HH11 1  
ATOM 1814  H HH12 . ARG A 1 129 ? -6.326  -12.218 -2.705  1.00 41.51 ? 124 ARG A HH12 1  
ATOM 1815  H HH21 . ARG A 1 129 ? -3.107  -11.961 -4.047  1.00 10.53 ? 124 ARG A HH21 1  
ATOM 1816  H HH22 . ARG A 1 129 ? -4.711  -12.567 -4.291  1.00 45.42 ? 124 ARG A HH22 1  
ATOM 1817  N N    . LYS A 1 130 ? -6.776  -9.976  1.316   1.00 23.12 ? 125 LYS A N    1  
ATOM 1818  C CA   . LYS A 1 130 ? -8.190  -10.317 1.219   1.00 20.00 ? 125 LYS A CA   1  
ATOM 1819  C C    . LYS A 1 130 ? -8.370  -11.778 0.819   1.00 53.31 ? 125 LYS A C    1  
ATOM 1820  O O    . LYS A 1 130 ? -7.762  -12.249 -0.143  1.00 3.23  ? 125 LYS A O    1  
ATOM 1821  C CB   . LYS A 1 130 ? -8.886  -9.410  0.202   1.00 1.23  ? 125 LYS A CB   1  
ATOM 1822  C CG   . LYS A 1 130 ? -10.322 -9.810  -0.087  1.00 5.04  ? 125 LYS A CG   1  
ATOM 1823  C CD   . LYS A 1 130 ? -11.191 -8.598  -0.377  1.00 3.21  ? 125 LYS A CD   1  
ATOM 1824  C CE   . LYS A 1 130 ? -12.609 -8.791  0.140   1.00 45.45 ? 125 LYS A CE   1  
ATOM 1825  N NZ   . LYS A 1 130 ? -13.611 -8.105  -0.721  1.00 30.31 ? 125 LYS A NZ   1  
ATOM 1826  H H    . LYS A 1 130 ? -6.313  -9.624  0.526   1.00 53.01 ? 125 LYS A H    1  
ATOM 1827  H HA   . LYS A 1 130 ? -8.637  -10.164 2.190   1.00 45.43 ? 125 LYS A HA   1  
ATOM 1828  H HB3  . LYS A 1 130 ? -8.333  -9.440  -0.727  1.00 72.24 ? 125 LYS A HB3  1  
ATOM 1829  H HG3  . LYS A 1 130 ? -10.722 -10.330 0.773   1.00 42.43 ? 125 LYS A HG3  1  
ATOM 1830  H HD3  . LYS A 1 130 ? -11.226 -8.438  -1.446  1.00 54.24 ? 125 LYS A HD3  1  
ATOM 1831  H HE3  . LYS A 1 130 ? -12.670 -8.388  1.140   1.00 71.23 ? 125 LYS A HE3  1  
ATOM 1832  H HZ1  . LYS A 1 130 ? -13.526 -7.074  -0.616  1.00 24.23 ? 125 LYS A HZ1  1  
ATOM 1833  H HZ2  . LYS A 1 130 ? -14.573 -8.391  -0.447  1.00 63.24 ? 125 LYS A HZ2  1  
ATOM 1834  H HZ3  . LYS A 1 130 ? -13.458 -8.355  -1.719  1.00 73.44 ? 125 LYS A HZ3  1  
ATOM 1835  N N    . LEU A 1 131 ? -9.208  -12.491 1.563   1.00 22.54 ? 126 LEU A N    1  
ATOM 1836  C CA   . LEU A 1 131 ? -9.470  -13.899 1.286   1.00 13.15 ? 126 LEU A CA   1  
ATOM 1837  C C    . LEU A 1 131 ? -10.968 -14.162 1.167   1.00 32.31 ? 126 LEU A C    1  
ATOM 1838  O O    . LEU A 1 131 ? -11.664 -14.311 2.171   1.00 42.31 ? 126 LEU A O    1  
ATOM 1839  C CB   . LEU A 1 131 ? -8.873  -14.776 2.388   1.00 52.11 ? 126 LEU A CB   1  
ATOM 1840  C CG   . LEU A 1 131 ? -7.812  -15.783 1.942   1.00 53.32 ? 126 LEU A CG   1  
ATOM 1841  C CD1  . LEU A 1 131 ? -6.423  -15.304 2.335   1.00 62.51 ? 126 LEU A CD1  1  
ATOM 1842  C CD2  . LEU A 1 131 ? -8.094  -17.154 2.540   1.00 74.04 ? 126 LEU A CD2  1  
ATOM 1843  H H    . LEU A 1 131 ? -9.663  -12.062 2.317   1.00 25.55 ? 126 LEU A H    1  
ATOM 1844  H HA   . LEU A 1 131 ? -8.999  -14.145 0.346   1.00 72.03 ? 126 LEU A HA   1  
ATOM 1845  H HB3  . LEU A 1 131 ? -9.682  -15.326 2.846   1.00 52.41 ? 126 LEU A HB3  1  
ATOM 1846  H HG   . LEU A 1 131 ? -7.841  -15.875 0.866   1.00 64.20 ? 126 LEU A HG   1  
ATOM 1847  H HD11 . LEU A 1 131 ? -6.353  -14.238 2.180   1.00 1.11  ? 126 LEU A HD11 1  
ATOM 1848  H HD12 . LEU A 1 131 ? -5.684  -15.806 1.726   1.00 74.53 ? 126 LEU A HD12 1  
ATOM 1849  H HD13 . LEU A 1 131 ? -6.245  -15.530 3.376   1.00 21.14 ? 126 LEU A HD13 1  
ATOM 1850  H HD21 . LEU A 1 131 ? -8.036  -17.095 3.618   1.00 23.23 ? 126 LEU A HD21 1  
ATOM 1851  H HD22 . LEU A 1 131 ? -7.362  -17.862 2.179   1.00 61.41 ? 126 LEU A HD22 1  
ATOM 1852  H HD23 . LEU A 1 131 ? -9.082  -17.477 2.250   1.00 63.34 ? 126 LEU A HD23 1  
ATOM 1853  N N    . GLY A 1 132 ? -11.458 -14.218 -0.067  1.00 12.11 ? 127 GLY A N    1  
ATOM 1854  C CA   . GLY A 1 132 ? -12.870 -14.466 -0.294  1.00 62.31 ? 127 GLY A CA   1  
ATOM 1855  C C    . GLY A 1 132 ? -13.750 -13.375 0.285   1.00 65.24 ? 127 GLY A C    1  
ATOM 1856  O O    . GLY A 1 132 ? -13.878 -12.297 -0.295  1.00 62.35 ? 127 GLY A O    1  
ATOM 1857  H H    . GLY A 1 132 ? -10.857 -14.092 -0.830  1.00 63.13 ? 127 GLY A H    1  
ATOM 1858  H HA2  . GLY A 1 132 ? -13.047 -14.530 -1.357  1.00 61.01 ? 127 GLY A HA2  1  
ATOM 1859  H HA3  . GLY A 1 132 ? -13.137 -15.407 0.162   1.00 61.51 ? 127 GLY A HA3  1  
ATOM 1860  N N    . LYS A 1 133 ? -14.360 -13.656 1.431   1.00 21.42 ? 128 LYS A N    1  
ATOM 1861  C CA   . LYS A 1 133 ? -15.233 -12.692 2.090   1.00 64.32 ? 128 LYS A CA   1  
ATOM 1862  C C    . LYS A 1 133 ? -14.637 -12.236 3.418   1.00 24.41 ? 128 LYS A C    1  
ATOM 1863  O O    . LYS A 1 133 ? -15.147 -11.314 4.054   1.00 24.42 ? 128 LYS A O    1  
ATOM 1864  C CB   . LYS A 1 133 ? -16.617 -13.301 2.322   1.00 60.25 ? 128 LYS A CB   1  
ATOM 1865  C CG   . LYS A 1 133 ? -17.567 -13.119 1.151   1.00 43.31 ? 128 LYS A CG   1  
ATOM 1866  C CD   . LYS A 1 133 ? -18.970 -12.772 1.619   1.00 11.03 ? 128 LYS A CD   1  
ATOM 1867  C CE   . LYS A 1 133 ? -19.322 -11.326 1.304   1.00 11.24 ? 128 LYS A CE   1  
ATOM 1868  N NZ   . LYS A 1 133 ? -20.757 -11.172 0.940   1.00 74.20 ? 128 LYS A NZ   1  
ATOM 1869  H H    . LYS A 1 133 ? -14.219 -14.533 1.846   1.00 5.31  ? 128 LYS A H    1  
ATOM 1870  H HA   . LYS A 1 133 ? -15.331 -11.834 1.441   1.00 3.24  ? 128 LYS A HA   1  
ATOM 1871  H HB3  . LYS A 1 133 ? -17.060 -12.838 3.192   1.00 61.22 ? 128 LYS A HB3  1  
ATOM 1872  H HG3  . LYS A 1 133 ? -17.603 -14.038 0.583   1.00 61.12 ? 128 LYS A HG3  1  
ATOM 1873  H HD3  . LYS A 1 133 ? -19.032 -12.925 2.688   1.00 64.11 ? 128 LYS A HD3  1  
ATOM 1874  H HE3  . LYS A 1 133 ? -18.712 -10.993 0.477   1.00 52.44 ? 128 LYS A HE3  1  
ATOM 1875  H HZ1  . LYS A 1 133 ? -21.358 -11.353 1.770   1.00 1.54  ? 128 LYS A HZ1  1  
ATOM 1876  H HZ2  . LYS A 1 133 ? -21.011 -11.845 0.189   1.00 54.35 ? 128 LYS A HZ2  1  
ATOM 1877  H HZ3  . LYS A 1 133 ? -20.938 -10.206 0.600   1.00 12.22 ? 128 LYS A HZ3  1  
ATOM 1878  N N    . GLN A 1 134 ? -13.554 -12.887 3.830   1.00 1.40  ? 129 GLN A N    1  
ATOM 1879  C CA   . GLN A 1 134 ? -12.889 -12.547 5.082   1.00 42.20 ? 129 GLN A CA   1  
ATOM 1880  C C    . GLN A 1 134 ? -11.451 -12.105 4.833   1.00 2.23  ? 129 GLN A C    1  
ATOM 1881  O O    . GLN A 1 134 ? -10.808 -12.559 3.885   1.00 64.22 ? 129 GLN A O    1  
ATOM 1882  C CB   . GLN A 1 134 ? -12.909 -13.744 6.036   1.00 23.44 ? 129 GLN A CB   1  
ATOM 1883  C CG   . GLN A 1 134 ? -12.361 -15.021 5.421   1.00 51.42 ? 129 GLN A CG   1  
ATOM 1884  C CD   . GLN A 1 134 ? -11.888 -16.015 6.463   1.00 74.44 ? 129 GLN A CD   1  
ATOM 1885  O OE1  . GLN A 1 134 ? -10.705 -16.065 6.798   1.00 51.33 ? 129 GLN A OE1  1  
ATOM 1886  N NE2  . GLN A 1 134 ? -12.814 -16.812 6.983   1.00 50.14 ? 129 GLN A NE2  1  
ATOM 1887  H H    . GLN A 1 134 ? -13.194 -13.613 3.279   1.00 3.33  ? 129 GLN A H    1  
ATOM 1888  H HA   . GLN A 1 134 ? -13.430 -11.730 5.533   1.00 42.04 ? 129 GLN A HA   1  
ATOM 1889  H HB3  . GLN A 1 134 ? -13.928 -13.927 6.342   1.00 70.44 ? 129 GLN A HB3  1  
ATOM 1890  H HG3  . GLN A 1 134 ? -11.527 -14.768 4.782   1.00 3.43  ? 129 GLN A HG3  1  
ATOM 1891  H HE21 . GLN A 1 134 ? -13.737 -16.716 6.668   1.00 33.35 ? 129 GLN A HE21 1  
ATOM 1892  H HE22 . GLN A 1 134 ? -12.536 -17.464 7.659   1.00 12.14 ? 129 GLN A HE22 1  
ATOM 1893  N N    . TRP A 1 135 ? -10.953 -11.219 5.687   1.00 12.13 ? 130 TRP A N    1  
ATOM 1894  C CA   . TRP A 1 135 ? -9.590  -10.716 5.558   1.00 61.32 ? 130 TRP A CA   1  
ATOM 1895  C C    . TRP A 1 135 ? -8.611  -11.590 6.334   1.00 21.53 ? 130 TRP A C    1  
ATOM 1896  O O    . TRP A 1 135 ? -8.993  -12.274 7.284   1.00 70.22 ? 130 TRP A O    1  
ATOM 1897  C CB   . TRP A 1 135 ? -9.509  -9.272  6.056   1.00 61.11 ? 130 TRP A CB   1  
ATOM 1898  C CG   . TRP A 1 135 ? -10.001 -8.270  5.055   1.00 20.11 ? 130 TRP A CG   1  
ATOM 1899  C CD1  . TRP A 1 135 ? -11.261 -7.752  4.966   1.00 1.33  ? 130 TRP A CD1  1  
ATOM 1900  C CD2  . TRP A 1 135 ? -9.242  -7.667  4.002   1.00 40.23 ? 130 TRP A CD2  1  
ATOM 1901  N NE1  . TRP A 1 135 ? -11.332 -6.864  3.919   1.00 42.14 ? 130 TRP A NE1  1  
ATOM 1902  C CE2  . TRP A 1 135 ? -10.105 -6.793  3.313   1.00 22.43 ? 130 TRP A CE2  1  
ATOM 1903  C CE3  . TRP A 1 135 ? -7.915  -7.778  3.575   1.00 32.23 ? 130 TRP A CE3  1  
ATOM 1904  C CZ2  . TRP A 1 135 ? -9.684  -6.037  2.222   1.00 10.25 ? 130 TRP A CZ2  1  
ATOM 1905  C CZ3  . TRP A 1 135 ? -7.499  -7.028  2.492   1.00 24.52 ? 130 TRP A CZ3  1  
ATOM 1906  C CH2  . TRP A 1 135 ? -8.381  -6.167  1.825   1.00 71.51 ? 130 TRP A CH2  1  
ATOM 1907  H H    . TRP A 1 135 ? -11.515 -10.895 6.422   1.00 42.32 ? 130 TRP A H    1  
ATOM 1908  H HA   . TRP A 1 135 ? -9.326  -10.742 4.511   1.00 64.01 ? 130 TRP A HA   1  
ATOM 1909  H HB3  . TRP A 1 135 ? -8.480  -9.036  6.287   1.00 23.14 ? 130 TRP A HB3  1  
ATOM 1910  H HD1  . TRP A 1 135 ? -12.074 -8.015  5.625   1.00 71.40 ? 130 TRP A HD1  1  
ATOM 1911  H HE1  . TRP A 1 135 ? -12.130 -6.362  3.652   1.00 64.41 ? 130 TRP A HE1  1  
ATOM 1912  H HE3  . TRP A 1 135 ? -7.221  -8.436  4.075   1.00 51.24 ? 130 TRP A HE3  1  
ATOM 1913  H HZ2  . TRP A 1 135 ? -10.352 -5.368  1.698   1.00 53.31 ? 130 TRP A HZ2  1  
ATOM 1914  H HZ3  . TRP A 1 135 ? -6.478  -7.101  2.147   1.00 2.02  ? 130 TRP A HZ3  1  
ATOM 1915  H HH2  . TRP A 1 135 ? -8.012  -5.600  0.984   1.00 34.25 ? 130 TRP A HH2  1  
ATOM 1916  N N    . PHE A 1 136 ? -7.348  -11.563 5.924   1.00 4.41  ? 131 PHE A N    1  
ATOM 1917  C CA   . PHE A 1 136 ? -6.313  -12.354 6.582   1.00 5.14  ? 131 PHE A CA   1  
ATOM 1918  C C    . PHE A 1 136 ? -5.097  -11.494 6.909   1.00 45.31 ? 131 PHE A C    1  
ATOM 1919  O O    . PHE A 1 136 ? -4.535  -10.837 6.034   1.00 44.21 ? 131 PHE A O    1  
ATOM 1920  C CB   . PHE A 1 136 ? -5.898  -13.529 5.692   1.00 60.22 ? 131 PHE A CB   1  
ATOM 1921  C CG   . PHE A 1 136 ? -4.464  -13.938 5.872   1.00 24.12 ? 131 PHE A CG   1  
ATOM 1922  C CD1  . PHE A 1 136 ? -4.036  -14.510 7.058   1.00 22.13 ? 131 PHE A CD1  1  
ATOM 1923  C CD2  . PHE A 1 136 ? -3.544  -13.749 4.853   1.00 43.20 ? 131 PHE A CD2  1  
ATOM 1924  C CE1  . PHE A 1 136 ? -2.716  -14.888 7.225   1.00 34.33 ? 131 PHE A CE1  1  
ATOM 1925  C CE2  . PHE A 1 136 ? -2.224  -14.125 5.014   1.00 51.13 ? 131 PHE A CE2  1  
ATOM 1926  C CZ   . PHE A 1 136 ? -1.809  -14.694 6.202   1.00 74.30 ? 131 PHE A CZ   1  
ATOM 1927  H H    . PHE A 1 136 ? -7.104  -10.998 5.161   1.00 23.23 ? 131 PHE A H    1  
ATOM 1928  H HA   . PHE A 1 136 ? -6.726  -12.738 7.502   1.00 2.21  ? 131 PHE A HA   1  
ATOM 1929  H HB3  . PHE A 1 136 ? -6.041  -13.255 4.658   1.00 4.41  ? 131 PHE A HB3  1  
ATOM 1930  H HD1  . PHE A 1 136 ? -4.745  -14.662 7.860   1.00 15.24 ? 131 PHE A HD1  1  
ATOM 1931  H HD2  . PHE A 1 136 ? -3.866  -13.303 3.923   1.00 62.02 ? 131 PHE A HD2  1  
ATOM 1932  H HE1  . PHE A 1 136 ? -2.396  -15.333 8.156   1.00 64.52 ? 131 PHE A HE1  1  
ATOM 1933  H HE2  . PHE A 1 136 ? -1.517  -13.972 4.212   1.00 74.14 ? 131 PHE A HE2  1  
ATOM 1934  H HZ   . PHE A 1 136 ? -0.779  -14.990 6.330   1.00 60.45 ? 131 PHE A HZ   1  
ATOM 1935  N N    . ASN A 1 137 ? -4.695  -11.505 8.176   1.00 22.45 ? 132 ASN A N    1  
ATOM 1936  C CA   . ASN A 1 137 ? -3.546  -10.725 8.620   1.00 50.30 ? 132 ASN A CA   1  
ATOM 1937  C C    . ASN A 1 137 ? -2.393  -11.639 9.024   1.00 45.21 ? 132 ASN A C    1  
ATOM 1938  O O    . ASN A 1 137 ? -2.606  -12.739 9.534   1.00 32.04 ? 132 ASN A O    1  
ATOM 1939  C CB   . ASN A 1 137 ? -3.935  -9.828  9.796   1.00 32.42 ? 132 ASN A CB   1  
ATOM 1940  C CG   . ASN A 1 137 ? -4.978  -8.795  9.415   1.00 65.53 ? 132 ASN A CG   1  
ATOM 1941  O OD1  . ASN A 1 137 ? -5.859  -9.058  8.597   1.00 32.43 ? 132 ASN A OD1  1  
ATOM 1942  N ND2  . ASN A 1 137 ? -4.882  -7.610  10.008  1.00 5.54  ? 132 ASN A ND2  1  
ATOM 1943  H H    . ASN A 1 137 ? -5.184  -12.049 8.828   1.00 34.02 ? 132 ASN A H    1  
ATOM 1944  H HA   . ASN A 1 137 ? -3.227  -10.105 7.796   1.00 73.00 ? 132 ASN A HA   1  
ATOM 1945  H HB3  . ASN A 1 137 ? -3.058  -9.312  10.155  1.00 71.12 ? 132 ASN A HB3  1  
ATOM 1946  H HD21 . ASN A 1 137 ? -4.153  -7.471  10.649  1.00 33.34 ? 132 ASN A HD21 1  
ATOM 1947  H HD22 . ASN A 1 137 ? -5.543  -6.924  9.780   1.00 11.00 ? 132 ASN A HD22 1  
ATOM 1948  N N    . LEU A 1 138 ? -1.169  -11.174 8.791   1.00 53.31 ? 133 LEU A N    1  
ATOM 1949  C CA   . LEU A 1 138 ? 0.020   -11.949 9.131   1.00 21.42 ? 133 LEU A CA   1  
ATOM 1950  C C    . LEU A 1 138 ? 1.265   -11.069 9.118   1.00 44.25 ? 133 LEU A C    1  
ATOM 1951  O O    . LEU A 1 138 ? 1.312   -10.053 8.425   1.00 75.20 ? 133 LEU A O    1  
ATOM 1952  C CB   . LEU A 1 138 ? 0.192   -13.112 8.151   1.00 64.31 ? 133 LEU A CB   1  
ATOM 1953  C CG   . LEU A 1 138 ? 1.501   -13.895 8.263   1.00 75.24 ? 133 LEU A CG   1  
ATOM 1954  C CD1  . LEU A 1 138 ? 1.264   -15.371 7.983   1.00 73.14 ? 133 LEU A CD1  1  
ATOM 1955  C CD2  . LEU A 1 138 ? 2.544   -13.330 7.310   1.00 63.32 ? 133 LEU A CD2  1  
ATOM 1956  H H    . LEU A 1 138 ? -1.062  -10.291 8.383   1.00 3.25  ? 133 LEU A H    1  
ATOM 1957  H HA   . LEU A 1 138 ? -0.116  -12.345 10.126  1.00 75.41 ? 133 LEU A HA   1  
ATOM 1958  H HB3  . LEU A 1 138 ? 0.130   -12.710 7.149   1.00 64.13 ? 133 LEU A HB3  1  
ATOM 1959  H HG   . LEU A 1 138 ? 1.883   -13.804 9.271   1.00 30.54 ? 133 LEU A HG   1  
ATOM 1960  H HD11 . LEU A 1 138 ? 2.148   -15.933 8.244   1.00 45.21 ? 133 LEU A HD11 1  
ATOM 1961  H HD12 . LEU A 1 138 ? 1.047   -15.508 6.934   1.00 75.21 ? 133 LEU A HD12 1  
ATOM 1962  H HD13 . LEU A 1 138 ? 0.428   -15.719 8.572   1.00 54.35 ? 133 LEU A HD13 1  
ATOM 1963  H HD21 . LEU A 1 138 ? 2.165   -13.365 6.300   1.00 22.04 ? 133 LEU A HD21 1  
ATOM 1964  H HD22 . LEU A 1 138 ? 3.447   -13.918 7.376   1.00 41.44 ? 133 LEU A HD22 1  
ATOM 1965  H HD23 . LEU A 1 138 ? 2.760   -12.306 7.579   1.00 53.23 ? 133 LEU A HD23 1  
ATOM 1966  N N    . ASN A 1 139 ? 2.273   -11.468 9.887   1.00 24.50 ? 134 ASN A N    1  
ATOM 1967  C CA   . ASN A 1 139 ? 3.520   -10.715 9.962   1.00 61.15 ? 134 ASN A CA   1  
ATOM 1968  C C    . ASN A 1 139 ? 4.638   -11.572 10.551  1.00 4.13  ? 134 ASN A C    1  
ATOM 1969  O O    . ASN A 1 139 ? 4.381   -12.592 11.190  1.00 2.34  ? 134 ASN A O    1  
ATOM 1970  C CB   . ASN A 1 139 ? 3.330   -9.454  10.809  1.00 35.13 ? 134 ASN A CB   1  
ATOM 1971  C CG   . ASN A 1 139 ? 4.589   -8.613  10.885  1.00 34.24 ? 134 ASN A CG   1  
ATOM 1972  O OD1  . ASN A 1 139 ? 4.972   -8.144  11.957  1.00 2.21  ? 134 ASN A OD1  1  
ATOM 1973  N ND2  . ASN A 1 139 ? 5.239   -8.417  9.743   1.00 75.12 ? 134 ASN A ND2  1  
ATOM 1974  H H    . ASN A 1 139 ? 2.176   -12.286 10.416  1.00 72.12 ? 134 ASN A H    1  
ATOM 1975  H HA   . ASN A 1 139 ? 3.794   -10.426 8.959   1.00 64.05 ? 134 ASN A HA   1  
ATOM 1976  H HB3  . ASN A 1 139 ? 3.048   -9.740  11.811  1.00 52.45 ? 134 ASN A HB3  1  
ATOM 1977  H HD21 . ASN A 1 139 ? 4.876   -8.822  8.928   1.00 23.53 ? 134 ASN A HD21 1  
ATOM 1978  H HD22 . ASN A 1 139 ? 6.056   -7.878  9.763   1.00 52.15 ? 134 ASN A HD22 1  
ATOM 1979  N N    . SER A 1 140 ? 5.879   -11.149 10.331  1.00 3.04  ? 135 SER A N    1  
ATOM 1980  C CA   . SER A 1 140 ? 7.036   -11.878 10.835  1.00 35.14 ? 135 SER A CA   1  
ATOM 1981  C C    . SER A 1 140 ? 6.980   -11.999 12.355  1.00 1.42  ? 135 SER A C    1  
ATOM 1982  O O    . SER A 1 140 ? 7.466   -12.975 12.930  1.00 42.20 ? 135 SER A O    1  
ATOM 1983  C CB   . SER A 1 140 ? 8.329   -11.179 10.415  1.00 1.44  ? 135 SER A CB   1  
ATOM 1984  O OG   . SER A 1 140 ? 9.014   -10.653 11.538  1.00 31.43 ? 135 SER A OG   1  
ATOM 1985  H H    . SER A 1 140 ? 6.019   -10.328 9.813   1.00 33.33 ? 135 SER A H    1  
ATOM 1986  H HA   . SER A 1 140 ? 7.015   -12.869 10.406  1.00 1.51  ? 135 SER A HA   1  
ATOM 1987  H HB3  . SER A 1 140 ? 8.095   -10.369 9.739   1.00 32.33 ? 135 SER A HB3  1  
ATOM 1988  H HG   . SER A 1 140 ? 9.900   -11.020 11.575  1.00 32.11 ? 135 SER A HG   1  
ATOM 1989  N N    . LEU A 1 141 ? 6.386   -11.002 13.001  1.00 3.30  ? 136 LEU A N    1  
ATOM 1990  C CA   . LEU A 1 141 ? 6.267   -10.994 14.454  1.00 53.33 ? 136 LEU A CA   1  
ATOM 1991  C C    . LEU A 1 141 ? 5.120   -11.890 14.911  1.00 12.51 ? 136 LEU A C    1  
ATOM 1992  O O    . LEU A 1 141 ? 5.048   -12.278 16.078  1.00 41.42 ? 136 LEU A O    1  
ATOM 1993  C CB   . LEU A 1 141 ? 6.047   -9.568  14.960  1.00 32.23 ? 136 LEU A CB   1  
ATOM 1994  C CG   . LEU A 1 141 ? 6.707   -9.220  16.295  1.00 43.35 ? 136 LEU A CG   1  
ATOM 1995  C CD1  . LEU A 1 141 ? 6.829   -7.712  16.453  1.00 13.32 ? 136 LEU A CD1  1  
ATOM 1996  C CD2  . LEU A 1 141 ? 5.920   -9.818  17.452  1.00 63.21 ? 136 LEU A CD2  1  
ATOM 1997  H H    . LEU A 1 141 ? 6.019   -10.252 12.489  1.00 1.54  ? 136 LEU A H    1  
ATOM 1998  H HA   . LEU A 1 141 ? 7.190   -11.375 14.864  1.00 53.14 ? 136 LEU A HA   1  
ATOM 1999  H HB3  . LEU A 1 141 ? 4.983   -9.417  15.068  1.00 21.14 ? 136 LEU A HB3  1  
ATOM 2000  H HG   . LEU A 1 141 ? 7.704   -9.638  16.316  1.00 50.22 ? 136 LEU A HG   1  
ATOM 2001  H HD11 . LEU A 1 141 ? 6.679   -7.445  17.488  1.00 10.40 ? 136 LEU A HD11 1  
ATOM 2002  H HD12 . LEU A 1 141 ? 6.082   -7.225  15.844  1.00 41.41 ? 136 LEU A HD12 1  
ATOM 2003  H HD13 . LEU A 1 141 ? 7.813   -7.395  16.138  1.00 52.41 ? 136 LEU A HD13 1  
ATOM 2004  H HD21 . LEU A 1 141 ? 6.147   -9.275  18.358  1.00 13.13 ? 136 LEU A HD21 1  
ATOM 2005  H HD22 . LEU A 1 141 ? 6.194   -10.856 17.575  1.00 21.34 ? 136 LEU A HD22 1  
ATOM 2006  H HD23 . LEU A 1 141 ? 4.863   -9.746  17.243  1.00 65.31 ? 136 LEU A HD23 1  
ATOM 2007  N N    . LEU A 1 142 ? 4.227   -12.219 13.983  1.00 51.13 ? 137 LEU A N    1  
ATOM 2008  C CA   . LEU A 1 142 ? 3.085   -13.072 14.289  1.00 75.22 ? 137 LEU A CA   1  
ATOM 2009  C C    . LEU A 1 142 ? 3.475   -14.546 14.234  1.00 61.22 ? 137 LEU A C    1  
ATOM 2010  O O    . LEU A 1 142 ? 4.451   -14.918 13.581  1.00 63.03 ? 137 LEU A O    1  
ATOM 2011  C CB   . LEU A 1 142 ? 1.942   -12.798 13.311  1.00 51.21 ? 137 LEU A CB   1  
ATOM 2012  C CG   . LEU A 1 142 ? 0.760   -12.002 13.864  1.00 61.24 ? 137 LEU A CG   1  
ATOM 2013  C CD1  . LEU A 1 142 ? -0.004  -12.824 14.892  1.00 43.43 ? 137 LEU A CD1  1  
ATOM 2014  C CD2  . LEU A 1 142 ? 1.239   -10.693 14.476  1.00 13.02 ? 137 LEU A CD2  1  
ATOM 2015  H H    . LEU A 1 142 ? 4.338   -11.880 13.071  1.00 70.24 ? 137 LEU A H    1  
ATOM 2016  H HA   . LEU A 1 142 ? 2.754   -12.837 15.290  1.00 55.54 ? 137 LEU A HA   1  
ATOM 2017  H HB3  . LEU A 1 142 ? 1.567   -13.752 12.966  1.00 21.12 ? 137 LEU A HB3  1  
ATOM 2018  H HG   . LEU A 1 142 ? 0.082   -11.767 13.056  1.00 64.53 ? 137 LEU A HG   1  
ATOM 2019  H HD11 . LEU A 1 142 ? -1.047  -12.552 14.865  1.00 32.02 ? 137 LEU A HD11 1  
ATOM 2020  H HD12 . LEU A 1 142 ? 0.395   -12.629 15.876  1.00 13.42 ? 137 LEU A HD12 1  
ATOM 2021  H HD13 . LEU A 1 142 ? 0.102   -13.875 14.662  1.00 22.31 ? 137 LEU A HD13 1  
ATOM 2022  H HD21 . LEU A 1 142 ? 1.648   -10.882 15.457  1.00 14.22 ? 137 LEU A HD21 1  
ATOM 2023  H HD22 . LEU A 1 142 ? 0.407   -10.009 14.559  1.00 32.24 ? 137 LEU A HD22 1  
ATOM 2024  H HD23 . LEU A 1 142 ? 2.000   -10.259 13.845  1.00 54.23 ? 137 LEU A HD23 1  
ATOM 2025  N N    . THR A 1 143 ? 2.706   -15.383 14.923  1.00 55.20 ? 138 THR A N    1  
ATOM 2026  C CA   . THR A 1 143 ? 2.970   -16.816 14.951  1.00 53.31 ? 138 THR A CA   1  
ATOM 2027  C C    . THR A 1 143 ? 1.882   -17.591 14.215  1.00 50.14 ? 138 THR A C    1  
ATOM 2028  O O    . THR A 1 143 ? 2.016   -18.789 13.973  1.00 12.44 ? 138 THR A O    1  
ATOM 2029  C CB   . THR A 1 143 ? 3.069   -17.341 16.396  1.00 63.44 ? 138 THR A CB   1  
ATOM 2030  O OG1  . THR A 1 143 ? 1.888   -16.991 17.127  1.00 12.40 ? 138 THR A OG1  1  
ATOM 2031  C CG2  . THR A 1 143 ? 4.293   -16.768 17.096  1.00 13.12 ? 138 THR A CG2  1  
ATOM 2032  H H    . THR A 1 143 ? 1.942   -15.027 15.423  1.00 52.03 ? 138 THR A H    1  
ATOM 2033  H HA   . THR A 1 143 ? 3.917   -16.990 14.462  1.00 2.34  ? 138 THR A HA   1  
ATOM 2034  H HB   . THR A 1 143 ? 3.160   -18.417 16.367  1.00 32.33 ? 138 THR A HB   1  
ATOM 2035  H HG1  . THR A 1 143 ? 1.845   -17.510 17.933  1.00 44.13 ? 138 THR A HG1  1  
ATOM 2036  H HG21 . THR A 1 143 ? 5.182   -17.040 16.546  1.00 74.03 ? 138 THR A HG21 1  
ATOM 2037  H HG22 . THR A 1 143 ? 4.353   -17.167 18.098  1.00 61.23 ? 138 THR A HG22 1  
ATOM 2038  H HG23 . THR A 1 143 ? 4.212   -15.693 17.141  1.00 23.22 ? 138 THR A HG23 1  
ATOM 2039  N N    . GLY A 1 144 ? 0.805   -16.898 13.863  1.00 25.55 ? 139 GLY A N    1  
ATOM 2040  C CA   . GLY A 1 144 ? -0.291  -17.537 13.156  1.00 72.43 ? 139 GLY A CA   1  
ATOM 2041  C C    . GLY A 1 144 ? -1.145  -16.545 12.392  1.00 11.04 ? 139 GLY A C    1  
ATOM 2042  O O    . GLY A 1 144 ? -1.069  -15.335 12.602  1.00 62.23 ? 139 GLY A O    1  
ATOM 2043  H H    . GLY A 1 144 ? 0.752   -15.944 14.082  1.00 64.24 ? 139 GLY A H    1  
ATOM 2044  H HA2  . GLY A 1 144 ? 0.115   -18.257 12.463  1.00 33.13 ? 139 GLY A HA2  1  
ATOM 2045  H HA3  . GLY A 1 144 ? -0.914  -18.052 13.874  1.00 41.02 ? 139 GLY A HA3  1  
ATOM 2046  N N    . PRO A 1 145 ? -1.981  -17.060 11.478  1.00 30.33 ? 140 PRO A N    1  
ATOM 2047  C CA   . PRO A 1 145 ? -2.869  -16.229 10.659  1.00 43.03 ? 140 PRO A CA   1  
ATOM 2048  C C    . PRO A 1 145 ? -3.993  -15.602 11.477  1.00 63.24 ? 140 PRO A C    1  
ATOM 2049  O O    . PRO A 1 145 ? -4.610  -16.263 12.310  1.00 34.12 ? 140 PRO A O    1  
ATOM 2050  C CB   . PRO A 1 145 ? -3.438  -17.217 9.638   1.00 24.10 ? 140 PRO A CB   1  
ATOM 2051  C CG   . PRO A 1 145 ? -3.353  -18.545 10.308  1.00 12.32 ? 140 PRO A CG   1  
ATOM 2052  C CD   . PRO A 1 145 ? -2.125  -18.494 11.174  1.00 72.02 ? 140 PRO A CD   1  
ATOM 2053  H HA   . PRO A 1 145 ? -2.322  -15.452 10.145  1.00 52.12 ? 140 PRO A HA   1  
ATOM 2054  H HB3  . PRO A 1 145 ? -2.845  -17.191 8.737   1.00 43.34 ? 140 PRO A HB3  1  
ATOM 2055  H HG3  . PRO A 1 145 ? -3.256  -19.324 9.566   1.00 42.31 ? 140 PRO A HG3  1  
ATOM 2056  H HD3  . PRO A 1 145 ? -1.266  -18.860 10.632  1.00 74.03 ? 140 PRO A HD3  1  
ATOM 2057  N N    . GLU A 1 146 ? -4.252  -14.320 11.232  1.00 35.41 ? 141 GLU A N    1  
ATOM 2058  C CA   . GLU A 1 146 ? -5.302  -13.605 11.948  1.00 24.14 ? 141 GLU A CA   1  
ATOM 2059  C C    . GLU A 1 146 ? -6.491  -13.325 11.032  1.00 14.33 ? 141 GLU A C    1  
ATOM 2060  O O    . GLU A 1 146 ? -6.391  -12.541 10.087  1.00 34.00 ? 141 GLU A O    1  
ATOM 2061  C CB   . GLU A 1 146 ? -4.760  -12.291 12.513  1.00 25.10 ? 141 GLU A CB   1  
ATOM 2062  C CG   . GLU A 1 146 ? -4.917  -12.164 14.019  1.00 52.42 ? 141 GLU A CG   1  
ATOM 2063  C CD   . GLU A 1 146 ? -3.913  -11.208 14.633  1.00 44.33 ? 141 GLU A CD   1  
ATOM 2064  O OE1  . GLU A 1 146 ? -3.314  -10.412 13.879  1.00 14.12 ? 141 GLU A OE1  1  
ATOM 2065  O OE2  . GLU A 1 146 ? -3.727  -11.255 15.867  1.00 11.52 ? 141 GLU A OE2  1  
ATOM 2066  H H    . GLU A 1 146 ? -3.725  -13.847 10.556  1.00 64.44 ? 141 GLU A H    1  
ATOM 2067  H HA   . GLU A 1 146 ? -5.632  -14.228 12.765  1.00 50.05 ? 141 GLU A HA   1  
ATOM 2068  H HB3  . GLU A 1 146 ? -5.285  -11.470 12.048  1.00 24.30 ? 141 GLU A HB3  1  
ATOM 2069  H HG3  . GLU A 1 146 ? -4.783  -13.139 14.465  1.00 65.12 ? 141 GLU A HG3  1  
ATOM 2070  N N    . LEU A 1 147 ? -7.615  -13.972 11.319  1.00 51.31 ? 142 LEU A N    1  
ATOM 2071  C CA   . LEU A 1 147 ? -8.825  -13.796 10.522  1.00 43.44 ? 142 LEU A CA   1  
ATOM 2072  C C    . LEU A 1 147 ? -9.618  -12.585 11.000  1.00 61.51 ? 142 LEU A C    1  
ATOM 2073  O O    . LEU A 1 147 ? -9.880  -12.433 12.193  1.00 71.13 ? 142 LEU A O    1  
ATOM 2074  C CB   . LEU A 1 147 ? -9.695  -15.051 10.594  1.00 40.52 ? 142 LEU A CB   1  
ATOM 2075  C CG   . LEU A 1 147 ? -10.459 -15.265 11.901  1.00 24.33 ? 142 LEU A CG   1  
ATOM 2076  C CD1  . LEU A 1 147 ? -11.873 -14.717 11.787  1.00 21.32 ? 142 LEU A CD1  1  
ATOM 2077  C CD2  . LEU A 1 147 ? -10.485 -16.741 12.269  1.00 23.10 ? 142 LEU A CD2  1  
ATOM 2078  H H    . LEU A 1 147 ? -7.634  -14.584 12.084  1.00 1.53  ? 142 LEU A H    1  
ATOM 2079  H HA   . LEU A 1 147 ? -8.524  -13.633 9.497   1.00 33.31 ? 142 LEU A HA   1  
ATOM 2080  H HB3  . LEU A 1 147 ? -9.052  -15.908 10.442  1.00 65.13 ? 142 LEU A HB3  1  
ATOM 2081  H HG   . LEU A 1 147 ? -9.957  -14.729 12.695  1.00 50.23 ? 142 LEU A HG   1  
ATOM 2082  H HD11 . LEU A 1 147 ? -11.892 -13.916 11.064  1.00 52.23 ? 142 LEU A HD11 1  
ATOM 2083  H HD12 . LEU A 1 147 ? -12.192 -14.342 12.748  1.00 14.22 ? 142 LEU A HD12 1  
ATOM 2084  H HD13 . LEU A 1 147 ? -12.540 -15.505 11.470  1.00 42.51 ? 142 LEU A HD13 1  
ATOM 2085  H HD21 . LEU A 1 147 ? -9.723  -16.940 13.008  1.00 53.03 ? 142 LEU A HD21 1  
ATOM 2086  H HD22 . LEU A 1 147 ? -10.294 -17.334 11.387  1.00 15.50 ? 142 LEU A HD22 1  
ATOM 2087  H HD23 . LEU A 1 147 ? -11.453 -16.994 12.672  1.00 74.22 ? 142 LEU A HD23 1  
ATOM 2088  N N    . ILE A 1 148 ? -10.001 -11.726 10.061  1.00 4.43  ? 143 ILE A N    1  
ATOM 2089  C CA   . ILE A 1 148 ? -10.768 -10.531 10.386  1.00 23.14 ? 143 ILE A CA   1  
ATOM 2090  C C    . ILE A 1 148 ? -11.922 -10.335 9.407   1.00 60.43 ? 143 ILE A C    1  
ATOM 2091  O O    . ILE A 1 148 ? -11.806 -10.648 8.223   1.00 51.23 ? 143 ILE A O    1  
ATOM 2092  C CB   . ILE A 1 148 ? -9.882  -9.272  10.373  1.00 73.55 ? 143 ILE A CB   1  
ATOM 2093  C CG1  . ILE A 1 148 ? -8.721  -9.429  11.359  1.00 13.22 ? 143 ILE A CG1  1  
ATOM 2094  C CG2  . ILE A 1 148 ? -10.707 -8.039  10.713  1.00 22.10 ? 143 ILE A CG2  1  
ATOM 2095  C CD1  . ILE A 1 148 ? -7.580  -8.471  11.106  1.00 44.42 ? 143 ILE A CD1  1  
ATOM 2096  H H    . ILE A 1 148 ? -9.761  -11.902 9.127   1.00 33.44 ? 143 ILE A H    1  
ATOM 2097  H HA   . ILE A 1 148 ? -11.172 -10.654 11.381  1.00 42.32 ? 143 ILE A HA   1  
ATOM 2098  H HB   . ILE A 1 148 ? -9.486  -9.147  9.378   1.00 64.03 ? 143 ILE A HB   1  
ATOM 2099  H HG13 . ILE A 1 148 ? -8.333  -10.435 11.287  1.00 53.03 ? 143 ILE A HG13 1  
ATOM 2100  H HG21 . ILE A 1 148 ? -11.415 -7.850  9.919   1.00 55.43 ? 143 ILE A HG21 1  
ATOM 2101  H HG22 . ILE A 1 148 ? -11.241 -8.207  11.637  1.00 44.11 ? 143 ILE A HG22 1  
ATOM 2102  H HG23 . ILE A 1 148 ? -10.053 -7.188  10.824  1.00 24.52 ? 143 ILE A HG23 1  
ATOM 2103  H HD11 . ILE A 1 148 ? -7.520  -8.252  10.050  1.00 63.32 ? 143 ILE A HD11 1  
ATOM 2104  H HD12 . ILE A 1 148 ? -7.747  -7.557  11.656  1.00 3.23  ? 143 ILE A HD12 1  
ATOM 2105  H HD13 . ILE A 1 148 ? -6.652  -8.921  11.431  1.00 34.03 ? 143 ILE A HD13 1  
ATOM 2106  N N    . SER A 1 149 ? -13.036 -9.813  9.912   1.00 42.31 ? 144 SER A N    1  
ATOM 2107  C CA   . SER A 1 149 ? -14.212 -9.577  9.083   1.00 71.41 ? 144 SER A CA   1  
ATOM 2108  C C    . SER A 1 149 ? -14.131 -8.216  8.399   1.00 2.44  ? 144 SER A C    1  
ATOM 2109  O O    . SER A 1 149 ? -13.366 -7.344  8.815   1.00 13.33 ? 144 SER A O    1  
ATOM 2110  C CB   . SER A 1 149 ? -15.484 -9.660  9.930   1.00 60.44 ? 144 SER A CB   1  
ATOM 2111  O OG   . SER A 1 149 ? -16.092 -10.934 9.816   1.00 41.30 ? 144 SER A OG   1  
ATOM 2112  H H    . SER A 1 149 ? -13.068 -9.584  10.864  1.00 73.14 ? 144 SER A H    1  
ATOM 2113  H HA   . SER A 1 149 ? -14.244 -10.346 8.326   1.00 22.02 ? 144 SER A HA   1  
ATOM 2114  H HB3  . SER A 1 149 ? -16.185 -8.908  9.595   1.00 72.53 ? 144 SER A HB3  1  
ATOM 2115  H HG   . SER A 1 149 ? -16.659 -10.950 9.041   1.00 51.13 ? 144 SER A HG   1  
ATOM 2116  N N    . ASP A 1 150 ? -14.924 -8.041  7.347   1.00 50.41 ? 145 ASP A N    1  
ATOM 2117  C CA   . ASP A 1 150 ? -14.943 -6.786  6.605   1.00 21.43 ? 145 ASP A CA   1  
ATOM 2118  C C    . ASP A 1 150 ? -15.513 -5.658  7.459   1.00 23.54 ? 145 ASP A C    1  
ATOM 2119  O O    . ASP A 1 150 ? -14.993 -4.542  7.461   1.00 3.33  ? 145 ASP A O    1  
ATOM 2120  C CB   . ASP A 1 150 ? -15.766 -6.938  5.324   1.00 54.43 ? 145 ASP A CB   1  
ATOM 2121  C CG   . ASP A 1 150 ? -17.075 -7.666  5.562   1.00 25.13 ? 145 ASP A CG   1  
ATOM 2122  O OD1  . ASP A 1 150 ? -18.077 -6.994  5.888   1.00 43.42 ? 145 ASP A OD1  1  
ATOM 2123  O OD2  . ASP A 1 150 ? -17.098 -8.906  5.419   1.00 31.21 ? 145 ASP A OD2  1  
ATOM 2124  H H    . ASP A 1 150 ? -15.510 -8.774  7.065   1.00 24.44 ? 145 ASP A H    1  
ATOM 2125  H HA   . ASP A 1 150 ? -13.925 -6.541  6.340   1.00 32.12 ? 145 ASP A HA   1  
ATOM 2126  H HB3  . ASP A 1 150 ? -15.191 -7.496  4.600   1.00 10.13 ? 145 ASP A HB3  1  
ATOM 2127  N N    . THR A 1 151 ? -16.587 -5.956  8.183   1.00 72.14 ? 146 THR A N    1  
ATOM 2128  C CA   . THR A 1 151 ? -17.229 -4.967  9.040   1.00 1.11  ? 146 THR A CA   1  
ATOM 2129  C C    . THR A 1 151 ? -16.298 -4.523  10.162  1.00 43.34 ? 146 THR A C    1  
ATOM 2130  O O    . THR A 1 151 ? -16.398 -3.400  10.658  1.00 34.05 ? 146 THR A O    1  
ATOM 2131  C CB   . THR A 1 151 ? -18.529 -5.517  9.656   1.00 32.24 ? 146 THR A CB   1  
ATOM 2132  O OG1  . THR A 1 151 ? -19.159 -4.508  10.454  1.00 52.20 ? 146 THR A OG1  1  
ATOM 2133  C CG2  . THR A 1 151 ? -18.248 -6.744  10.509  1.00 74.40 ? 146 THR A CG2  1  
ATOM 2134  H H    . THR A 1 151 ? -16.955 -6.863  8.140   1.00 63.31 ? 146 THR A H    1  
ATOM 2135  H HA   . THR A 1 151 ? -17.479 -4.110  8.432   1.00 43.52 ? 146 THR A HA   1  
ATOM 2136  H HB   . THR A 1 151 ? -19.197 -5.800  8.855   1.00 24.45 ? 146 THR A HB   1  
ATOM 2137  H HG1  . THR A 1 151 ? -19.982 -4.239  10.039  1.00 74.01 ? 146 THR A HG1  1  
ATOM 2138  H HG21 . THR A 1 151 ? -19.182 -7.207  10.793  1.00 54.41 ? 146 THR A HG21 1  
ATOM 2139  H HG22 . THR A 1 151 ? -17.708 -6.449  11.397  1.00 30.32 ? 146 THR A HG22 1  
ATOM 2140  H HG23 . THR A 1 151 ? -17.655 -7.446  9.944   1.00 1.50  ? 146 THR A HG23 1  
ATOM 2141  N N    . TYR A 1 152 ? -15.391 -5.410  10.557  1.00 62.31 ? 147 TYR A N    1  
ATOM 2142  C CA   . TYR A 1 152 ? -14.442 -5.109  11.622  1.00 72.14 ? 147 TYR A CA   1  
ATOM 2143  C C    . TYR A 1 152 ? -13.155 -4.520  11.055  1.00 62.34 ? 147 TYR A C    1  
ATOM 2144  O O    . TYR A 1 152 ? -12.451 -3.767  11.731  1.00 23.22 ? 147 TYR A O    1  
ATOM 2145  C CB   . TYR A 1 152 ? -14.127 -6.373  12.425  1.00 72.11 ? 147 TYR A CB   1  
ATOM 2146  C CG   . TYR A 1 152 ? -13.239 -6.124  13.623  1.00 11.10 ? 147 TYR A CG   1  
ATOM 2147  C CD1  . TYR A 1 152 ? -11.855 -6.129  13.501  1.00 2.35  ? 147 TYR A CD1  1  
ATOM 2148  C CD2  . TYR A 1 152 ? -13.783 -5.884  14.878  1.00 33.32 ? 147 TYR A CD2  1  
ATOM 2149  C CE1  . TYR A 1 152 ? -11.040 -5.902  14.592  1.00 14.43 ? 147 TYR A CE1  1  
ATOM 2150  C CE2  . TYR A 1 152 ? -12.977 -5.655  15.976  1.00 41.23 ? 147 TYR A CE2  1  
ATOM 2151  C CZ   . TYR A 1 152 ? -11.605 -5.666  15.828  1.00 50.12 ? 147 TYR A CZ   1  
ATOM 2152  O OH   . TYR A 1 152 ? -10.798 -5.440  16.919  1.00 45.41 ? 147 TYR A OH   1  
ATOM 2153  H H    . TYR A 1 152 ? -15.360 -6.288  10.124  1.00 31.15 ? 147 TYR A H    1  
ATOM 2154  H HA   . TYR A 1 152 ? -14.899 -4.383  12.279  1.00 62.34 ? 147 TYR A HA   1  
ATOM 2155  H HB3  . TYR A 1 152 ? -13.627 -7.083  11.784  1.00 4.34  ? 147 TYR A HB3  1  
ATOM 2156  H HD1  . TYR A 1 152 ? -11.415 -6.316  12.531  1.00 44.21 ? 147 TYR A HD1  1  
ATOM 2157  H HD2  . TYR A 1 152 ? -14.858 -5.878  14.992  1.00 23.43 ? 147 TYR A HD2  1  
ATOM 2158  H HE1  . TYR A 1 152 ? -9.966  -5.911  14.476  1.00 70.13 ? 147 TYR A HE1  1  
ATOM 2159  H HE2  . TYR A 1 152 ? -13.419 -5.471  16.944  1.00 24.03 ? 147 TYR A HE2  1  
ATOM 2160  H HH   . TYR A 1 152 ? -11.318 -5.054  17.627  1.00 62.10 ? 147 TYR A HH   1  
ATOM 2161  N N    . LEU A 1 153 ? -12.852 -4.866  9.810   1.00 3.14  ? 148 LEU A N    1  
ATOM 2162  C CA   . LEU A 1 153 ? -11.650 -4.371  9.148   1.00 51.12 ? 148 LEU A CA   1  
ATOM 2163  C C    . LEU A 1 153 ? -11.715 -2.858  8.959   1.00 14.45 ? 148 LEU A C    1  
ATOM 2164  O O    . LEU A 1 153 ? -10.763 -2.143  9.265   1.00 42.22 ? 148 LEU A O    1  
ATOM 2165  C CB   . LEU A 1 153 ? -11.469 -5.059  7.793   1.00 14.01 ? 148 LEU A CB   1  
ATOM 2166  C CG   . LEU A 1 153 ? -10.344 -4.517  6.911   1.00 12.53 ? 148 LEU A CG   1  
ATOM 2167  C CD1  . LEU A 1 153 ? -9.144  -5.452  6.942   1.00 32.30 ? 148 LEU A CD1  1  
ATOM 2168  C CD2  . LEU A 1 153 ? -10.833 -4.322  5.483   1.00 13.20 ? 148 LEU A CD2  1  
ATOM 2169  H H    . LEU A 1 153 ? -13.451 -5.469  9.321   1.00 74.33 ? 148 LEU A H    1  
ATOM 2170  H HA   . LEU A 1 153 ? -10.804 -4.606  9.777   1.00 34.41 ? 148 LEU A HA   1  
ATOM 2171  H HB3  . LEU A 1 153 ? -12.396 -4.960  7.247   1.00 32.53 ? 148 LEU A HB3  1  
ATOM 2172  H HG   . LEU A 1 153 ? -10.027 -3.556  7.291   1.00 20.44 ? 148 LEU A HG   1  
ATOM 2173  H HD11 . LEU A 1 153 ? -8.450  -5.120  7.699   1.00 62.10 ? 148 LEU A HD11 1  
ATOM 2174  H HD12 . LEU A 1 153 ? -8.657  -5.445  5.978   1.00 51.10 ? 148 LEU A HD12 1  
ATOM 2175  H HD13 . LEU A 1 153 ? -9.475  -6.455  7.170   1.00 31.22 ? 148 LEU A HD13 1  
ATOM 2176  H HD21 . LEU A 1 153 ? -11.038 -3.276  5.312   1.00 44.04 ? 148 LEU A HD21 1  
ATOM 2177  H HD22 . LEU A 1 153 ? -11.738 -4.895  5.331   1.00 43.13 ? 148 LEU A HD22 1  
ATOM 2178  H HD23 . LEU A 1 153 ? -10.073 -4.659  4.793   1.00 34.42 ? 148 LEU A HD23 1  
ATOM 2179  N N    . ALA A 1 154 ? -12.848 -2.380  8.453   1.00 45.13 ? 149 ALA A N    1  
ATOM 2180  C CA   . ALA A 1 154 ? -13.039 -0.953  8.227   1.00 3.13  ? 149 ALA A CA   1  
ATOM 2181  C C    . ALA A 1 154 ? -12.769 -0.154  9.497   1.00 73.11 ? 149 ALA A C    1  
ATOM 2182  O O    . ALA A 1 154 ? -12.047 0.844   9.474   1.00 20.53 ? 149 ALA A O    1  
ATOM 2183  C CB   . ALA A 1 154 ? -14.449 -0.683  7.721   1.00 70.12 ? 149 ALA A CB   1  
ATOM 2184  H H    . ALA A 1 154 ? -13.572 -3.001  8.228   1.00 43.32 ? 149 ALA A H    1  
ATOM 2185  H HA   . ALA A 1 154 ? -12.344 -0.640  7.462   1.00 40.14 ? 149 ALA A HA   1  
ATOM 2186  H HB1  . ALA A 1 154 ? -14.913 0.074   8.336   1.00 60.24 ? 149 ALA A HB1  1  
ATOM 2187  H HB2  . ALA A 1 154 ? -14.405 -0.340  6.698   1.00 70.32 ? 149 ALA A HB2  1  
ATOM 2188  H HB3  . ALA A 1 154 ? -15.029 -1.593  7.772   1.00 2.14  ? 149 ALA A HB3  1  
ATOM 2189  N N    . LEU A 1 155 ? -13.352 -0.599  10.606  1.00 2.34  ? 150 LEU A N    1  
ATOM 2190  C CA   . LEU A 1 155 ? -13.175 0.075   11.887  1.00 0.42  ? 150 LEU A CA   1  
ATOM 2191  C C    . LEU A 1 155 ? -11.769 -0.152  12.431  1.00 51.33 ? 150 LEU A C    1  
ATOM 2192  O O    . LEU A 1 155 ? -11.165 0.748   13.015  1.00 52.25 ? 150 LEU A O    1  
ATOM 2193  C CB   . LEU A 1 155 ? -14.211 -0.424  12.895  1.00 14.14 ? 150 LEU A CB   1  
ATOM 2194  C CG   . LEU A 1 155 ? -15.663 -0.031  12.616  1.00 53.22 ? 150 LEU A CG   1  
ATOM 2195  C CD1  . LEU A 1 155 ? -16.617 -0.936  13.379  1.00 55.24 ? 150 LEU A CD1  1  
ATOM 2196  C CD2  . LEU A 1 155 ? -15.900 1.426   12.983  1.00 23.41 ? 150 LEU A CD2  1  
ATOM 2197  H H    . LEU A 1 155 ? -13.916 -1.399  10.561  1.00 41.34 ? 150 LEU A H    1  
ATOM 2198  H HA   . LEU A 1 155 ? -13.320 1.133   11.728  1.00 3.41  ? 150 LEU A HA   1  
ATOM 2199  H HB3  . LEU A 1 155 ? -13.942 -0.032  13.866  1.00 52.20 ? 150 LEU A HB3  1  
ATOM 2200  H HG   . LEU A 1 155 ? -15.864 -0.149  11.560  1.00 61.54 ? 150 LEU A HG   1  
ATOM 2201  H HD11 . LEU A 1 155 ? -16.610 -0.668  14.425  1.00 53.52 ? 150 LEU A HD11 1  
ATOM 2202  H HD12 . LEU A 1 155 ? -16.303 -1.964  13.269  1.00 33.42 ? 150 LEU A HD12 1  
ATOM 2203  H HD13 . LEU A 1 155 ? -17.616 -0.821  12.984  1.00 13.31 ? 150 LEU A HD13 1  
ATOM 2204  H HD21 . LEU A 1 155 ? -16.611 1.859   12.294  1.00 75.45 ? 150 LEU A HD21 1  
ATOM 2205  H HD22 . LEU A 1 155 ? -14.967 1.969   12.925  1.00 73.11 ? 150 LEU A HD22 1  
ATOM 2206  H HD23 . LEU A 1 155 ? -16.291 1.486   13.988  1.00 45.32 ? 150 LEU A HD23 1  
ATOM 2207  N N    . PHE A 1 156 ? -11.251 -1.360  12.234  1.00 52.04 ? 151 PHE A N    1  
ATOM 2208  C CA   . PHE A 1 156 ? -9.915  -1.706  12.704  1.00 43.13 ? 151 PHE A CA   1  
ATOM 2209  C C    . PHE A 1 156 ? -8.875  -0.737  12.148  1.00 44.01 ? 151 PHE A C    1  
ATOM 2210  O O    . PHE A 1 156 ? -8.107  -0.134  12.899  1.00 3.14  ? 151 PHE A O    1  
ATOM 2211  C CB   . PHE A 1 156 ? -9.563  -3.138  12.298  1.00 42.53 ? 151 PHE A CB   1  
ATOM 2212  C CG   . PHE A 1 156 ? -8.115  -3.321  11.939  1.00 12.11 ? 151 PHE A CG   1  
ATOM 2213  C CD1  . PHE A 1 156 ? -7.145  -3.382  12.926  1.00 13.40 ? 151 PHE A CD1  1  
ATOM 2214  C CD2  . PHE A 1 156 ? -7.725  -3.430  10.614  1.00 33.03 ? 151 PHE A CD2  1  
ATOM 2215  C CE1  . PHE A 1 156 ? -5.813  -3.550  12.599  1.00 54.34 ? 151 PHE A CE1  1  
ATOM 2216  C CE2  . PHE A 1 156 ? -6.395  -3.600  10.281  1.00 24.11 ? 151 PHE A CE2  1  
ATOM 2217  C CZ   . PHE A 1 156 ? -5.437  -3.658  11.275  1.00 10.13 ? 151 PHE A CZ   1  
ATOM 2218  H H    . PHE A 1 156 ? -11.781 -2.036  11.762  1.00 24.13 ? 151 PHE A H    1  
ATOM 2219  H HA   . PHE A 1 156 ? -9.914  -1.636  13.780  1.00 60.42 ? 151 PHE A HA   1  
ATOM 2220  H HB3  . PHE A 1 156 ? -10.156 -3.418  11.441  1.00 2.34  ? 151 PHE A HB3  1  
ATOM 2221  H HD1  . PHE A 1 156 ? -7.439  -3.298  13.962  1.00 75.25 ? 151 PHE A HD1  1  
ATOM 2222  H HD2  . PHE A 1 156 ? -8.473  -3.383  9.835   1.00 54.12 ? 151 PHE A HD2  1  
ATOM 2223  H HE1  . PHE A 1 156 ? -5.067  -3.597  13.379  1.00 64.20 ? 151 PHE A HE1  1  
ATOM 2224  H HE2  . PHE A 1 156 ? -6.103  -3.683  9.245   1.00 1.42  ? 151 PHE A HE2  1  
ATOM 2225  H HZ   . PHE A 1 156 ? -4.397  -3.790  11.017  1.00 51.31 ? 151 PHE A HZ   1  
ATOM 2226  N N    . LEU A 1 157 ? -8.857  -0.594  10.827  1.00 4.31  ? 152 LEU A N    1  
ATOM 2227  C CA   . LEU A 1 157 ? -7.911  0.301   10.168  1.00 21.53 ? 152 LEU A CA   1  
ATOM 2228  C C    . LEU A 1 157 ? -8.240  1.759   10.472  1.00 42.43 ? 152 LEU A C    1  
ATOM 2229  O O    . LEU A 1 157 ? -7.343  2.581   10.659  1.00 64.11 ? 152 LEU A O    1  
ATOM 2230  C CB   . LEU A 1 157 ? -7.927  0.068   8.656   1.00 40.34 ? 152 LEU A CB   1  
ATOM 2231  C CG   . LEU A 1 157 ? -9.297  0.137   7.980   1.00 64.34 ? 152 LEU A CG   1  
ATOM 2232  C CD1  . LEU A 1 157 ? -9.522  1.514   7.373   1.00 2.33  ? 152 LEU A CD1  1  
ATOM 2233  C CD2  . LEU A 1 157 ? -9.423  -0.943  6.917   1.00 55.22 ? 152 LEU A CD2  1  
ATOM 2234  H H    . LEU A 1 157 ? -9.493  -1.101  10.281  1.00 60.21 ? 152 LEU A H    1  
ATOM 2235  H HA   . LEU A 1 157 ? -6.925  0.080   10.548  1.00 12.13 ? 152 LEU A HA   1  
ATOM 2236  H HB3  . LEU A 1 157 ? -7.514  -0.914  8.470   1.00 33.24 ? 152 LEU A HB3  1  
ATOM 2237  H HG   . LEU A 1 157 ? -10.066 -0.029  8.721   1.00 61.14 ? 152 LEU A HG   1  
ATOM 2238  H HD11 . LEU A 1 157 ? -10.433 1.937   7.767   1.00 63.33 ? 152 LEU A HD11 1  
ATOM 2239  H HD12 . LEU A 1 157 ? -9.602  1.424   6.299   1.00 3.05  ? 152 LEU A HD12 1  
ATOM 2240  H HD13 . LEU A 1 157 ? -8.689  2.156   7.619   1.00 4.02  ? 152 LEU A HD13 1  
ATOM 2241  H HD21 . LEU A 1 157 ? -8.967  -1.854  7.276   1.00 54.40 ? 152 LEU A HD21 1  
ATOM 2242  H HD22 . LEU A 1 157 ? -8.923  -0.623  6.015   1.00 63.33 ? 152 LEU A HD22 1  
ATOM 2243  H HD23 . LEU A 1 157 ? -10.467 -1.122  6.708   1.00 4.34  ? 152 LEU A HD23 1  
ATOM 2244  N N    . ALA A 1 158 ? -9.530  2.072   10.522  1.00 22.35 ? 153 ALA A N    1  
ATOM 2245  C CA   . ALA A 1 158 ? -9.977  3.430   10.808  1.00 45.10 ? 153 ALA A CA   1  
ATOM 2246  C C    . ALA A 1 158 ? -9.423  3.921   12.142  1.00 2.55  ? 153 ALA A C    1  
ATOM 2247  O O    . ALA A 1 158 ? -9.103  5.099   12.294  1.00 41.25 ? 153 ALA A O    1  
ATOM 2248  C CB   . ALA A 1 158 ? -11.496 3.496   10.809  1.00 22.24 ? 153 ALA A CB   1  
ATOM 2249  H H    . ALA A 1 158 ? -10.198 1.373   10.364  1.00 41.42 ? 153 ALA A H    1  
ATOM 2250  H HA   . ALA A 1 158 ? -9.612  4.073   10.020  1.00 23.52 ? 153 ALA A HA   1  
ATOM 2251  H HB1  . ALA A 1 158 ? -11.891 2.686   11.404  1.00 43.31 ? 153 ALA A HB1  1  
ATOM 2252  H HB2  . ALA A 1 158 ? -11.815 4.440   11.227  1.00 20.34 ? 153 ALA A HB2  1  
ATOM 2253  H HB3  . ALA A 1 158 ? -11.860 3.410   9.796   1.00 21.51 ? 153 ALA A HB3  1  
ATOM 2254  N N    . GLN A 1 159 ? -9.314  3.009   13.103  1.00 64.01 ? 154 GLN A N    1  
ATOM 2255  C CA   . GLN A 1 159 ? -8.801  3.351   14.424  1.00 63.11 ? 154 GLN A CA   1  
ATOM 2256  C C    . GLN A 1 159 ? -7.315  3.694   14.358  1.00 73.41 ? 154 GLN A C    1  
ATOM 2257  O O    . GLN A 1 159 ? -6.831  4.545   15.105  1.00 0.33  ? 154 GLN A O    1  
ATOM 2258  C CB   . GLN A 1 159 ? -9.027  2.193   15.397  1.00 33.50 ? 154 GLN A CB   1  
ATOM 2259  C CG   . GLN A 1 159 ? -10.310 2.319   16.205  1.00 45.21 ? 154 GLN A CG   1  
ATOM 2260  C CD   . GLN A 1 159 ? -10.218 1.637   17.555  1.00 1.03  ? 154 GLN A CD   1  
ATOM 2261  O OE1  . GLN A 1 159 ? -10.421 0.427   17.668  1.00 24.43 ? 154 GLN A OE1  1  
ATOM 2262  N NE2  . GLN A 1 159 ? -9.912  2.410   18.590  1.00 63.32 ? 154 GLN A NE2  1  
ATOM 2263  H H    . GLN A 1 159 ? -9.587  2.087   12.920  1.00 42.51 ? 154 GLN A H    1  
ATOM 2264  H HA   . GLN A 1 159 ? -9.341  4.216   14.776  1.00 22.34 ? 154 GLN A HA   1  
ATOM 2265  H HB3  . GLN A 1 159 ? -8.197  2.151   16.087  1.00 40.23 ? 154 GLN A HB3  1  
ATOM 2266  H HG3  . GLN A 1 159 ? -11.117 1.870   15.644  1.00 63.23 ? 154 GLN A HG3  1  
ATOM 2267  H HE21 . GLN A 1 159 ? -9.765  3.366   18.426  1.00 43.31 ? 154 GLN A HE21 1  
ATOM 2268  H HE22 . GLN A 1 159 ? -9.847  1.996   19.474  1.00 51.33 ? 154 GLN A HE22 1  
ATOM 2269  N N    . LEU A 1 160 ? -6.598  3.025   13.463  1.00 33.55 ? 155 LEU A N    1  
ATOM 2270  C CA   . LEU A 1 160 ? -5.168  3.258   13.300  1.00 11.32 ? 155 LEU A CA   1  
ATOM 2271  C C    . LEU A 1 160 ? -4.907  4.616   12.655  1.00 71.03 ? 155 LEU A C    1  
ATOM 2272  O O    . LEU A 1 160 ? -4.085  5.394   13.138  1.00 41.21 ? 155 LEU A O    1  
ATOM 2273  C CB   . LEU A 1 160 ? -4.543  2.149   12.451  1.00 21.23 ? 155 LEU A CB   1  
ATOM 2274  C CG   . LEU A 1 160 ? -5.101  0.742   12.670  1.00 24.14 ? 155 LEU A CG   1  
ATOM 2275  C CD1  . LEU A 1 160 ? -4.253  -0.287  11.938  1.00 74.33 ? 155 LEU A CD1  1  
ATOM 2276  C CD2  . LEU A 1 160 ? -5.171  0.420   14.155  1.00 64.14 ? 155 LEU A CD2  1  
ATOM 2277  H H    . LEU A 1 160 ? -7.040  2.359   12.897  1.00 15.32 ? 155 LEU A H    1  
ATOM 2278  H HA   . LEU A 1 160 ? -4.717  3.246   14.281  1.00 51.44 ? 155 LEU A HA   1  
ATOM 2279  H HB3  . LEU A 1 160 ? -3.485  2.124   12.667  1.00 2.00  ? 155 LEU A HB3  1  
ATOM 2280  H HG   . LEU A 1 160 ? -6.104  0.693   12.268  1.00 24.20 ? 155 LEU A HG   1  
ATOM 2281  H HD11 . LEU A 1 160 ? -3.384  0.195   11.519  1.00 4.25  ? 155 LEU A HD11 1  
ATOM 2282  H HD12 . LEU A 1 160 ? -4.835  -0.736  11.147  1.00 3.13  ? 155 LEU A HD12 1  
ATOM 2283  H HD13 . LEU A 1 160 ? -3.940  -1.053  12.633  1.00 51.14 ? 155 LEU A HD13 1  
ATOM 2284  H HD21 . LEU A 1 160 ? -6.155  0.663   14.529  1.00 43.22 ? 155 LEU A HD21 1  
ATOM 2285  H HD22 . LEU A 1 160 ? -4.430  1.004   14.684  1.00 33.33 ? 155 LEU A HD22 1  
ATOM 2286  H HD23 . LEU A 1 160 ? -4.977  -0.630  14.305  1.00 34.14 ? 155 LEU A HD23 1  
ATOM 2287  N N    . GLN A 1 161 ? -5.614  4.893   11.564  1.00 40.13 ? 156 GLN A N    1  
ATOM 2288  C CA   . GLN A 1 161 ? -5.459  6.157   10.856  1.00 44.12 ? 156 GLN A CA   1  
ATOM 2289  C C    . GLN A 1 161 ? -5.852  7.332   11.745  1.00 52.55 ? 156 GLN A C    1  
ATOM 2290  O O    . GLN A 1 161 ? -5.165  8.353   11.779  1.00 2.32  ? 156 GLN A O    1  
ATOM 2291  C CB   . GLN A 1 161 ? -6.309  6.160   9.584   1.00 4.42  ? 156 GLN A CB   1  
ATOM 2292  C CG   . GLN A 1 161 ? -7.782  5.883   9.836   1.00 45.21 ? 156 GLN A CG   1  
ATOM 2293  C CD   . GLN A 1 161 ? -8.585  5.783   8.553   1.00 44.04 ? 156 GLN A CD   1  
ATOM 2294  O OE1  . GLN A 1 161 ? -8.637  4.728   7.921   1.00 23.15 ? 156 GLN A OE1  1  
ATOM 2295  N NE2  . GLN A 1 161 ? -9.216  6.883   8.162   1.00 65.02 ? 156 GLN A NE2  1  
ATOM 2296  H H    . GLN A 1 161 ? -6.254  4.231   11.229  1.00 43.40 ? 156 GLN A H    1  
ATOM 2297  H HA   . GLN A 1 161 ? -4.420  6.259   10.583  1.00 4.00  ? 156 GLN A HA   1  
ATOM 2298  H HB3  . GLN A 1 161 ? -5.932  5.402   8.911   1.00 70.42 ? 156 GLN A HB3  1  
ATOM 2299  H HG3  . GLN A 1 161 ? -8.188  6.683   10.435  1.00 65.42 ? 156 GLN A HG3  1  
ATOM 2300  H HE21 . GLN A 1 161 ? -9.128  7.689   8.715   1.00 2.13  ? 156 GLN A HE21 1  
ATOM 2301  H HE22 . GLN A 1 161 ? -9.741  6.848   7.336   1.00 40.13 ? 156 GLN A HE22 1  
ATOM 2302  N N    . GLN A 1 162 ? -6.959  7.179   12.464  1.00 45.21 ? 157 GLN A N    1  
ATOM 2303  C CA   . GLN A 1 162 ? -7.442  8.229   13.354  1.00 5.44  ? 157 GLN A CA   1  
ATOM 2304  C C    . GLN A 1 162 ? -6.536  8.370   14.572  1.00 22.21 ? 157 GLN A C    1  
ATOM 2305  O O    . GLN A 1 162 ? -6.548  9.397   15.250  1.00 11.20 ? 157 GLN A O    1  
ATOM 2306  C CB   . GLN A 1 162 ? -8.875  7.929   13.800  1.00 45.34 ? 157 GLN A CB   1  
ATOM 2307  C CG   . GLN A 1 162 ? -8.961  6.900   14.915  1.00 53.33 ? 157 GLN A CG   1  
ATOM 2308  C CD   . GLN A 1 162 ? -10.391 6.593   15.316  1.00 52.41 ? 157 GLN A CD   1  
ATOM 2309  O OE1  . GLN A 1 162 ? -11.335 6.957   14.616  1.00 31.13 ? 157 GLN A OE1  1  
ATOM 2310  N NE2  . GLN A 1 162 ? -10.556 5.919   16.449  1.00 64.12 ? 157 GLN A NE2  1  
ATOM 2311  H H    . GLN A 1 162 ? -7.463  6.343   12.394  1.00 23.14 ? 157 GLN A H    1  
ATOM 2312  H HA   . GLN A 1 162 ? -7.433  9.158   12.805  1.00 24.43 ? 157 GLN A HA   1  
ATOM 2313  H HB3  . GLN A 1 162 ? -9.432  7.557   12.953  1.00 70.31 ? 157 GLN A HB3  1  
ATOM 2314  H HG3  . GLN A 1 162 ? -8.433  7.279   15.778  1.00 21.14 ? 157 GLN A HG3  1  
ATOM 2315  H HE21 . GLN A 1 162 ? -9.757  5.664   16.956  1.00 1.45  ? 157 GLN A HE21 1  
ATOM 2316  H HE22 . GLN A 1 162 ? -11.469 5.709   16.732  1.00 71.14 ? 157 GLN A HE22 1  
ATOM 2317  N N    . GLU A 1 163 ? -5.752  7.331   14.844  1.00 75.51 ? 158 GLU A N    1  
ATOM 2318  C CA   . GLU A 1 163 ? -4.842  7.340   15.982  1.00 54.35 ? 158 GLU A CA   1  
ATOM 2319  C C    . GLU A 1 163 ? -3.499  7.955   15.600  1.00 64.34 ? 158 GLU A C    1  
ATOM 2320  O O    . GLU A 1 163 ? -3.146  9.039   16.064  1.00 64.12 ? 158 GLU A O    1  
ATOM 2321  C CB   . GLU A 1 163 ? -4.631  5.918   16.507  1.00 1.15  ? 158 GLU A CB   1  
ATOM 2322  C CG   . GLU A 1 163 ? -5.639  5.504   17.566  1.00 21.53 ? 158 GLU A CG   1  
ATOM 2323  C CD   . GLU A 1 163 ? -5.120  5.708   18.976  1.00 43.03 ? 158 GLU A CD   1  
ATOM 2324  O OE1  . GLU A 1 163 ? -4.493  6.757   19.231  1.00 45.54 ? 158 GLU A OE1  1  
ATOM 2325  O OE2  . GLU A 1 163 ? -5.341  4.819   19.825  1.00 61.03 ? 158 GLU A OE2  1  
ATOM 2326  H H    . GLU A 1 163 ? -5.789  6.540   14.267  1.00 21.02 ? 158 GLU A H    1  
ATOM 2327  H HA   . GLU A 1 163 ? -5.289  7.938   16.761  1.00 14.05 ? 158 GLU A HA   1  
ATOM 2328  H HB3  . GLU A 1 163 ? -3.642  5.847   16.935  1.00 25.33 ? 158 GLU A HB3  1  
ATOM 2329  H HG3  . GLU A 1 163 ? -5.876  4.459   17.432  1.00 43.05 ? 158 GLU A HG3  1  
ATOM 2330  N N    . GLY A 1 164 ? -2.754  7.256   14.749  1.00 52.25 ? 159 GLY A N    1  
ATOM 2331  C CA   . GLY A 1 164 ? -1.459  7.749   14.319  1.00 44.44 ? 159 GLY A CA   1  
ATOM 2332  C C    . GLY A 1 164 ? -0.600  6.661   13.706  1.00 43.44 ? 159 GLY A C    1  
ATOM 2333  O O    . GLY A 1 164 ? 0.575   6.522   14.046  1.00 41.13 ? 159 GLY A O    1  
ATOM 2334  H H    . GLY A 1 164 ? -3.086  6.398   14.412  1.00 61.54 ? 159 GLY A H    1  
ATOM 2335  H HA2  . GLY A 1 164 ? -1.607  8.531   13.590  1.00 13.23 ? 159 GLY A HA2  1  
ATOM 2336  H HA3  . GLY A 1 164 ? -0.941  8.161   15.173  1.00 51.43 ? 159 GLY A HA3  1  
ATOM 2337  N N    . TYR A 1 165 ? -1.185  5.888   12.799  1.00 33.14 ? 160 TYR A N    1  
ATOM 2338  C CA   . TYR A 1 165 ? -0.466  4.804   12.139  1.00 33.34 ? 160 TYR A CA   1  
ATOM 2339  C C    . TYR A 1 165 ? -0.371  5.050   10.637  1.00 3.55  ? 160 TYR A C    1  
ATOM 2340  O O    . TYR A 1 165 ? -0.969  5.988   10.110  1.00 52.25 ? 160 TYR A O    1  
ATOM 2341  C CB   . TYR A 1 165 ? -1.161  3.467   12.405  1.00 71.42 ? 160 TYR A CB   1  
ATOM 2342  C CG   . TYR A 1 165 ? -1.115  3.039   13.855  1.00 40.40 ? 160 TYR A CG   1  
ATOM 2343  C CD1  . TYR A 1 165 ? -1.848  3.713   14.823  1.00 61.01 ? 160 TYR A CD1  1  
ATOM 2344  C CD2  . TYR A 1 165 ? -0.337  1.960   14.255  1.00 75.25 ? 160 TYR A CD2  1  
ATOM 2345  C CE1  . TYR A 1 165 ? -1.808  3.325   16.149  1.00 25.54 ? 160 TYR A CE1  1  
ATOM 2346  C CE2  . TYR A 1 165 ? -0.292  1.564   15.578  1.00 35.31 ? 160 TYR A CE2  1  
ATOM 2347  C CZ   . TYR A 1 165 ? -1.029  2.250   16.521  1.00 74.22 ? 160 TYR A CZ   1  
ATOM 2348  O OH   . TYR A 1 165 ? -0.986  1.860   17.840  1.00 64.32 ? 160 TYR A OH   1  
ATOM 2349  H H    . TYR A 1 165 ? -2.124  6.047   12.569  1.00 21.04 ? 160 TYR A H    1  
ATOM 2350  H HA   . TYR A 1 165 ? 0.531   4.769   12.552  1.00 0.51  ? 160 TYR A HA   1  
ATOM 2351  H HB3  . TYR A 1 165 ? -0.685  2.698   11.816  1.00 41.43 ? 160 TYR A HB3  1  
ATOM 2352  H HD1  . TYR A 1 165 ? -2.457  4.555   14.528  1.00 20.41 ? 160 TYR A HD1  1  
ATOM 2353  H HD2  . TYR A 1 165 ? 0.240   1.424   13.515  1.00 32.20 ? 160 TYR A HD2  1  
ATOM 2354  H HE1  . TYR A 1 165 ? -2.385  3.863   16.886  1.00 72.04 ? 160 TYR A HE1  1  
ATOM 2355  H HE2  . TYR A 1 165 ? 0.318   0.722   15.871  1.00 71.21 ? 160 TYR A HE2  1  
ATOM 2356  H HH   . TYR A 1 165 ? -1.234  0.936   17.908  1.00 33.23 ? 160 TYR A HH   1  
ATOM 2357  N N    . SER A 1 166 ? 0.386   4.198   9.952   1.00 30.52 ? 161 SER A N    1  
ATOM 2358  C CA   . SER A 1 166 ? 0.565   4.323   8.510   1.00 22.42 ? 161 SER A CA   1  
ATOM 2359  C C    . SER A 1 166 ? -0.194  3.225   7.771   1.00 51.33 ? 161 SER A C    1  
ATOM 2360  O O    . SER A 1 166 ? 0.212   2.062   7.780   1.00 13.21 ? 161 SER A O    1  
ATOM 2361  C CB   . SER A 1 166 ? 2.050   4.263   8.151   1.00 54.43 ? 161 SER A CB   1  
ATOM 2362  O OG   . SER A 1 166 ? 2.689   5.500   8.411   1.00 52.25 ? 161 SER A OG   1  
ATOM 2363  H H    . SER A 1 166 ? 0.837   3.470   10.429  1.00 43.10 ? 161 SER A H    1  
ATOM 2364  H HA   . SER A 1 166 ? 0.169   5.282   8.209   1.00 41.13 ? 161 SER A HA   1  
ATOM 2365  H HB3  . SER A 1 166 ? 2.155   4.029   7.101   1.00 71.44 ? 161 SER A HB3  1  
ATOM 2366  H HG   . SER A 1 166 ? 2.469   5.794   9.298   1.00 53.30 ? 161 SER A HG   1  
ATOM 2367  N N    . ILE A 1 167 ? -1.297  3.602   7.134   1.00 54.10 ? 162 ILE A N    1  
ATOM 2368  C CA   . ILE A 1 167 ? -2.112  2.649   6.390   1.00 22.53 ? 162 ILE A CA   1  
ATOM 2369  C C    . ILE A 1 167 ? -1.850  2.755   4.891   1.00 74.12 ? 162 ILE A C    1  
ATOM 2370  O O    . ILE A 1 167 ? -2.072  3.803   4.283   1.00 33.04 ? 162 ILE A O    1  
ATOM 2371  C CB   . ILE A 1 167 ? -3.613  2.867   6.653   1.00 33.53 ? 162 ILE A CB   1  
ATOM 2372  C CG1  . ILE A 1 167 ? -3.968  2.455   8.084   1.00 43.12 ? 162 ILE A CG1  1  
ATOM 2373  C CG2  . ILE A 1 167 ? -4.447  2.084   5.650   1.00 3.24  ? 162 ILE A CG2  1  
ATOM 2374  C CD1  . ILE A 1 167 ? -4.051  3.620   9.045   1.00 31.50 ? 162 ILE A CD1  1  
ATOM 2375  H H    . ILE A 1 167 ? -1.569  4.542   7.164   1.00 73.04 ? 162 ILE A H    1  
ATOM 2376  H HA   . ILE A 1 167 ? -1.848  1.655   6.721   1.00 34.33 ? 162 ILE A HA   1  
ATOM 2377  H HB   . ILE A 1 167 ? -3.831  3.916   6.524   1.00 31.31 ? 162 ILE A HB   1  
ATOM 2378  H HG13 . ILE A 1 167 ? -3.213  1.774   8.451   1.00 74.23 ? 162 ILE A HG13 1  
ATOM 2379  H HG21 . ILE A 1 167 ? -4.670  2.712   4.799   1.00 62.15 ? 162 ILE A HG21 1  
ATOM 2380  H HG22 . ILE A 1 167 ? -3.893  1.218   5.320   1.00 74.05 ? 162 ILE A HG22 1  
ATOM 2381  H HG23 . ILE A 1 167 ? -5.368  1.768   6.115   1.00 21.13 ? 162 ILE A HG23 1  
ATOM 2382  H HD11 . ILE A 1 167 ? -4.897  3.484   9.703   1.00 51.22 ? 162 ILE A HD11 1  
ATOM 2383  H HD12 . ILE A 1 167 ? -3.145  3.672   9.628   1.00 64.32 ? 162 ILE A HD12 1  
ATOM 2384  H HD13 . ILE A 1 167 ? -4.175  4.538   8.488   1.00 1.42  ? 162 ILE A HD13 1  
ATOM 2385  N N    . PHE A 1 168 ? -1.378  1.662   4.300   1.00 21.12 ? 163 PHE A N    1  
ATOM 2386  C CA   . PHE A 1 168 ? -1.085  1.631   2.872   1.00 33.45 ? 163 PHE A CA   1  
ATOM 2387  C C    . PHE A 1 168 ? -2.081  0.741   2.133   1.00 64.12 ? 163 PHE A C    1  
ATOM 2388  O O    . PHE A 1 168 ? -2.399  -0.360  2.582   1.00 70.24 ? 163 PHE A O    1  
ATOM 2389  C CB   . PHE A 1 168 ? 0.340   1.131   2.632   1.00 13.41 ? 163 PHE A CB   1  
ATOM 2390  C CG   . PHE A 1 168 ? 1.398   2.121   3.029   1.00 12.54 ? 163 PHE A CG   1  
ATOM 2391  C CD1  . PHE A 1 168 ? 1.719   3.182   2.198   1.00 11.14 ? 163 PHE A CD1  1  
ATOM 2392  C CD2  . PHE A 1 168 ? 2.071   1.989   4.232   1.00 55.32 ? 163 PHE A CD2  1  
ATOM 2393  C CE1  . PHE A 1 168 ? 2.691   4.095   2.560   1.00 50.32 ? 163 PHE A CE1  1  
ATOM 2394  C CE2  . PHE A 1 168 ? 3.044   2.899   4.600   1.00 43.41 ? 163 PHE A CE2  1  
ATOM 2395  C CZ   . PHE A 1 168 ? 3.356   3.953   3.762   1.00 13.53 ? 163 PHE A CZ   1  
ATOM 2396  H H    . PHE A 1 168 ? -1.221  0.858   4.838   1.00 41.10 ? 163 PHE A H    1  
ATOM 2397  H HA   . PHE A 1 168 ? -1.173  2.639   2.495   1.00 11.11 ? 163 PHE A HA   1  
ATOM 2398  H HB3  . PHE A 1 168 ? 0.464   0.912   1.582   1.00 4.31  ? 163 PHE A HB3  1  
ATOM 2399  H HD1  . PHE A 1 168 ? 1.198   3.295   1.256   1.00 53.42 ? 163 PHE A HD1  1  
ATOM 2400  H HD2  . PHE A 1 168 ? 1.831   1.164   4.887   1.00 23.01 ? 163 PHE A HD2  1  
ATOM 2401  H HE1  . PHE A 1 168 ? 2.931   4.917   1.903   1.00 60.05 ? 163 PHE A HE1  1  
ATOM 2402  H HE2  . PHE A 1 168 ? 3.564   2.785   5.540   1.00 34.04 ? 163 PHE A HE2  1  
ATOM 2403  H HZ   . PHE A 1 168 ? 4.115   4.664   4.047   1.00 74.43 ? 163 PHE A HZ   1  
ATOM 2404  N N    . VAL A 1 169 ? -2.569  1.227   0.996   1.00 1.14  ? 164 VAL A N    1  
ATOM 2405  C CA   . VAL A 1 169 ? -3.528  0.477   0.193   1.00 54.21 ? 164 VAL A CA   1  
ATOM 2406  C C    . VAL A 1 169 ? -2.853  -0.159  -1.017  1.00 43.34 ? 164 VAL A C    1  
ATOM 2407  O O    . VAL A 1 169 ? -2.358  0.538   -1.903  1.00 22.35 ? 164 VAL A O    1  
ATOM 2408  C CB   . VAL A 1 169 ? -4.681  1.375   -0.290  1.00 74.23 ? 164 VAL A CB   1  
ATOM 2409  C CG1  . VAL A 1 169 ? -5.689  0.567   -1.093  1.00 54.15 ? 164 VAL A CG1  1  
ATOM 2410  C CG2  . VAL A 1 169 ? -5.354  2.059   0.891   1.00 41.24 ? 164 VAL A CG2  1  
ATOM 2411  H H    . VAL A 1 169 ? -2.278  2.111   0.689   1.00 52.52 ? 164 VAL A H    1  
ATOM 2412  H HA   . VAL A 1 169 ? -3.943  -0.305  0.813   1.00 64.21 ? 164 VAL A HA   1  
ATOM 2413  H HB   . VAL A 1 169 ? -4.270  2.139   -0.934  1.00 11.12 ? 164 VAL A HB   1  
ATOM 2414  H HG11 . VAL A 1 169 ? -5.820  1.018   -2.064  1.00 64.41 ? 164 VAL A HG11 1  
ATOM 2415  H HG12 . VAL A 1 169 ? -5.327  -0.445  -1.210  1.00 73.54 ? 164 VAL A HG12 1  
ATOM 2416  H HG13 . VAL A 1 169 ? -6.635  0.552   -0.572  1.00 62.53 ? 164 VAL A HG13 1  
ATOM 2417  H HG21 . VAL A 1 169 ? -6.426  1.994   0.782   1.00 42.32 ? 164 VAL A HG21 1  
ATOM 2418  H HG22 . VAL A 1 169 ? -5.056  1.570   1.808   1.00 62.25 ? 164 VAL A HG22 1  
ATOM 2419  H HG23 . VAL A 1 169 ? -5.056  3.097   0.924   1.00 15.12 ? 164 VAL A HG23 1  
ATOM 2420  N N    . VAL A 1 170 ? -2.835  -1.488  -1.048  1.00 2.32  ? 165 VAL A N    1  
ATOM 2421  C CA   . VAL A 1 170 ? -2.222  -2.219  -2.151  1.00 53.45 ? 165 VAL A CA   1  
ATOM 2422  C C    . VAL A 1 170 ? -3.271  -2.682  -3.155  1.00 74.41 ? 165 VAL A C    1  
ATOM 2423  O O    . VAL A 1 170 ? -4.056  -3.588  -2.876  1.00 33.02 ? 165 VAL A O    1  
ATOM 2424  C CB   . VAL A 1 170 ? -1.437  -3.443  -1.645  1.00 50.33 ? 165 VAL A CB   1  
ATOM 2425  C CG1  . VAL A 1 170 ? -0.925  -4.271  -2.814  1.00 62.13 ? 165 VAL A CG1  1  
ATOM 2426  C CG2  . VAL A 1 170 ? -0.289  -3.006  -0.747  1.00 55.31 ? 165 VAL A CG2  1  
ATOM 2427  H H    . VAL A 1 170 ? -3.245  -1.989  -0.312  1.00 1.43  ? 165 VAL A H    1  
ATOM 2428  H HA   . VAL A 1 170 ? -1.530  -1.555  -2.649  1.00 73.54 ? 165 VAL A HA   1  
ATOM 2429  H HB   . VAL A 1 170 ? -2.106  -4.060  -1.064  1.00 74.50 ? 165 VAL A HB   1  
ATOM 2430  H HG11 . VAL A 1 170 ? -0.327  -3.645  -3.461  1.00 11.53 ? 165 VAL A HG11 1  
ATOM 2431  H HG12 . VAL A 1 170 ? -0.322  -5.086  -2.443  1.00 72.04 ? 165 VAL A HG12 1  
ATOM 2432  H HG13 . VAL A 1 170 ? -1.762  -4.665  -3.369  1.00 1.54  ? 165 VAL A HG13 1  
ATOM 2433  H HG21 . VAL A 1 170 ? 0.509   -2.608  -1.354  1.00 65.35 ? 165 VAL A HG21 1  
ATOM 2434  H HG22 . VAL A 1 170 ? -0.636  -2.246  -0.063  1.00 24.12 ? 165 VAL A HG22 1  
ATOM 2435  H HG23 . VAL A 1 170 ? 0.073   -3.855  -0.187  1.00 40.03 ? 165 VAL A HG23 1  
ATOM 2436  N N    . LYS A 1 171 ? -3.281  -2.053  -4.326  1.00 73.33 ? 166 LYS A N    1  
ATOM 2437  C CA   . LYS A 1 171 ? -4.233  -2.400  -5.373  1.00 3.40  ? 166 LYS A CA   1  
ATOM 2438  C C    . LYS A 1 171 ? -3.509  -2.845  -6.640  1.00 61.32 ? 166 LYS A C    1  
ATOM 2439  O O    . LYS A 1 171 ? -2.433  -2.342  -6.962  1.00 34.35 ? 166 LYS A O    1  
ATOM 2440  C CB   . LYS A 1 171 ? -5.139  -1.206  -5.684  1.00 2.40  ? 166 LYS A CB   1  
ATOM 2441  C CG   . LYS A 1 171 ? -6.005  -1.403  -6.916  1.00 40.11 ? 166 LYS A CG   1  
ATOM 2442  C CD   . LYS A 1 171 ? -6.961  -2.572  -6.744  1.00 0.14  ? 166 LYS A CD   1  
ATOM 2443  C CE   . LYS A 1 171 ? -8.411  -2.110  -6.746  1.00 50.55 ? 166 LYS A CE   1  
ATOM 2444  N NZ   . LYS A 1 171 ? -8.819  -1.572  -8.073  1.00 72.21 ? 166 LYS A NZ   1  
ATOM 2445  H H    . LYS A 1 171 ? -2.629  -1.337  -4.488  1.00 34.25 ? 166 LYS A H    1  
ATOM 2446  H HA   . LYS A 1 171 ? -4.839  -3.217  -5.014  1.00 31.23 ? 166 LYS A HA   1  
ATOM 2447  H HB3  . LYS A 1 171 ? -4.522  -0.332  -5.839  1.00 43.01 ? 166 LYS A HB3  1  
ATOM 2448  H HG3  . LYS A 1 171 ? -5.365  -1.595  -7.767  1.00 31.43 ? 166 LYS A HG3  1  
ATOM 2449  H HD3  . LYS A 1 171 ? -6.749  -3.064  -5.805  1.00 22.25 ? 166 LYS A HD3  1  
ATOM 2450  H HE3  . LYS A 1 171 ? -8.529  -1.338  -6.001  1.00 51.14 ? 166 LYS A HE3  1  
ATOM 2451  H HZ1  . LYS A 1 171 ? -8.236  -0.746  -8.317  1.00 31.23 ? 166 LYS A HZ1  1  
ATOM 2452  H HZ2  . LYS A 1 171 ? -9.818  -1.282  -8.048  1.00 13.02 ? 166 LYS A HZ2  1  
ATOM 2453  H HZ3  . LYS A 1 171 ? -8.698  -2.299  -8.806  1.00 63.01 ? 166 LYS A HZ3  1  
ATOM 2454  N N    . GLY A 1 172 ? -4.108  -3.791  -7.357  1.00 73.21 ? 167 GLY A N    1  
ATOM 2455  C CA   . GLY A 1 172 ? -3.506  -4.287  -8.581  1.00 10.45 ? 167 GLY A CA   1  
ATOM 2456  C C    . GLY A 1 172 ? -3.951  -5.697  -8.916  1.00 54.43 ? 167 GLY A C    1  
ATOM 2457  O O    . GLY A 1 172 ? -5.038  -6.121  -8.526  1.00 1.54  ? 167 GLY A O    1  
ATOM 2458  H H    . GLY A 1 172 ? -4.965  -4.155  -7.052  1.00 14.40 ? 167 GLY A H    1  
ATOM 2459  H HA2  . GLY A 1 172 ? -3.779  -3.631  -9.394  1.00 12.34 ? 167 GLY A HA2  1  
ATOM 2460  H HA3  . GLY A 1 172 ? -2.432  -4.278  -8.470  1.00 45.22 ? 167 GLY A HA3  1  
ATOM 2461  N N    . ASP A 1 173 ? -3.108  -6.424  -9.642  1.00 72.05 ? 168 ASP A N    1  
ATOM 2462  C CA   . ASP A 1 173 ? -3.420  -7.795  -10.029 1.00 62.21 ? 168 ASP A CA   1  
ATOM 2463  C C    . ASP A 1 173 ? -2.471  -8.780  -9.353  1.00 0.30  ? 168 ASP A C    1  
ATOM 2464  O O    . ASP A 1 173 ? -1.259  -8.739  -9.568  1.00 2.13  ? 168 ASP A O    1  
ATOM 2465  C CB   . ASP A 1 173 ? -3.337  -7.949  -11.549 1.00 11.22 ? 168 ASP A CB   1  
ATOM 2466  C CG   . ASP A 1 173 ? -4.683  -8.258  -12.173 1.00 5.02  ? 168 ASP A CG   1  
ATOM 2467  O OD1  . ASP A 1 173 ? -5.703  -7.743  -11.669 1.00 31.11 ? 168 ASP A OD1  1  
ATOM 2468  O OD2  . ASP A 1 173 ? -4.716  -9.013  -13.167 1.00 33.02 ? 168 ASP A OD2  1  
ATOM 2469  H H    . ASP A 1 173 ? -2.255  -6.030  -9.922  1.00 3.12  ? 168 ASP A H    1  
ATOM 2470  H HA   . ASP A 1 173 ? -4.428  -8.009  -9.709  1.00 13.25 ? 168 ASP A HA   1  
ATOM 2471  H HB3  . ASP A 1 173 ? -2.656  -8.754  -11.786 1.00 30.31 ? 168 ASP A HB3  1  
ATOM 2472  N N    . LEU A 1 174 ? -3.030  -9.665  -8.534  1.00 24.23 ? 169 LEU A N    1  
ATOM 2473  C CA   . LEU A 1 174 ? -2.234  -10.660 -7.825  1.00 33.13 ? 169 LEU A CA   1  
ATOM 2474  C C    . LEU A 1 174 ? -2.364  -12.031 -8.482  1.00 23.42 ? 169 LEU A C    1  
ATOM 2475  O O    . LEU A 1 174 ? -3.314  -12.306 -9.216  1.00 11.45 ? 169 LEU A O    1  
ATOM 2476  C CB   . LEU A 1 174 ? -2.669  -10.741 -6.361  1.00 63.33 ? 169 LEU A CB   1  
ATOM 2477  C CG   . LEU A 1 174 ? -2.026  -9.727  -5.413  1.00 34.21 ? 169 LEU A CG   1  
ATOM 2478  C CD1  . LEU A 1 174 ? -3.072  -9.128  -4.485  1.00 42.51 ? 169 LEU A CD1  1  
ATOM 2479  C CD2  . LEU A 1 174 ? -0.909  -10.380 -4.611  1.00 24.24 ? 169 LEU A CD2  1  
ATOM 2480  H H    . LEU A 1 174 ? -4.001  -9.648  -8.403  1.00 51.05 ? 169 LEU A H    1  
ATOM 2481  H HA   . LEU A 1 174 ? -1.200  -10.351 -7.869  1.00 60.32 ? 169 LEU A HA   1  
ATOM 2482  H HB3  . LEU A 1 174 ? -2.430  -11.731 -6.000  1.00 45.05 ? 169 LEU A HB3  1  
ATOM 2483  H HG   . LEU A 1 174 ? -1.597  -8.922  -5.994  1.00 13.32 ? 169 LEU A HG   1  
ATOM 2484  H HD11 . LEU A 1 174 ? -3.981  -9.707  -4.545  1.00 44.43 ? 169 LEU A HD11 1  
ATOM 2485  H HD12 . LEU A 1 174 ? -3.273  -8.109  -4.780  1.00 71.25 ? 169 LEU A HD12 1  
ATOM 2486  H HD13 . LEU A 1 174 ? -2.702  -9.142  -3.470  1.00 55.20 ? 169 LEU A HD13 1  
ATOM 2487  H HD21 . LEU A 1 174 ? -0.548  -9.685  -3.867  1.00 25.15 ? 169 LEU A HD21 1  
ATOM 2488  H HD22 . LEU A 1 174 ? -0.101  -10.649 -5.275  1.00 51.34 ? 169 LEU A HD22 1  
ATOM 2489  H HD23 . LEU A 1 174 ? -1.287  -11.265 -4.123  1.00 13.34 ? 169 LEU A HD23 1  
ATOM 2490  N N    . PRO A 1 175 ? -1.390  -12.912 -8.213  1.00 30.42 ? 170 PRO A N    1  
ATOM 2491  C CA   . PRO A 1 175 ? -1.375  -14.269 -8.767  1.00 74.11 ? 170 PRO A CA   1  
ATOM 2492  C C    . PRO A 1 175 ? -2.470  -15.149 -8.172  1.00 53.50 ? 170 PRO A C    1  
ATOM 2493  O O    . PRO A 1 175 ? -3.194  -15.830 -8.898  1.00 0.21  ? 170 PRO A O    1  
ATOM 2494  C CB   . PRO A 1 175 ? 0.007   -14.797 -8.373  1.00 5.22  ? 170 PRO A CB   1  
ATOM 2495  C CG   . PRO A 1 175 ? 0.383   -14.013 -7.164  1.00 22.31 ? 170 PRO A CG   1  
ATOM 2496  C CD   . PRO A 1 175 ? -0.228  -12.651 -7.347  1.00 21.13 ? 170 PRO A CD   1  
ATOM 2497  H HA   . PRO A 1 175 ? -1.466  -14.259 -9.842  1.00 13.34 ? 170 PRO A HA   1  
ATOM 2498  H HB3  . PRO A 1 175 ? 0.703   -14.631 -9.183  1.00 70.53 ? 170 PRO A HB3  1  
ATOM 2499  H HG3  . PRO A 1 175 ? 1.457   -13.935 -7.096  1.00 3.53  ? 170 PRO A HG3  1  
ATOM 2500  H HD3  . PRO A 1 175 ? 0.472   -11.986 -7.831  1.00 23.22 ? 170 PRO A HD3  1  
ATOM 2501  N N    . ASP A 1 176 ? -2.584  -15.131 -6.849  1.00 41.32 ? 171 ASP A N    1  
ATOM 2502  C CA   . ASP A 1 176 ? -3.591  -15.926 -6.157  1.00 12.02 ? 171 ASP A CA   1  
ATOM 2503  C C    . ASP A 1 176 ? -4.976  -15.305 -6.315  1.00 55.22 ? 171 ASP A C    1  
ATOM 2504  O O    . ASP A 1 176 ? -5.105  -14.104 -6.557  1.00 73.22 ? 171 ASP A O    1  
ATOM 2505  C CB   . ASP A 1 176 ? -3.242  -16.054 -4.674  1.00 32.00 ? 171 ASP A CB   1  
ATOM 2506  C CG   . ASP A 1 176 ? -3.923  -17.239 -4.019  1.00 74.03 ? 171 ASP A CG   1  
ATOM 2507  O OD1  . ASP A 1 176 ? -5.134  -17.142 -3.729  1.00 42.41 ? 171 ASP A OD1  1  
ATOM 2508  O OD2  . ASP A 1 176 ? -3.245  -18.263 -3.793  1.00 13.22 ? 171 ASP A OD2  1  
ATOM 2509  H H    . ASP A 1 176 ? -1.977  -14.567 -6.325  1.00 52.53 ? 171 ASP A H    1  
ATOM 2510  H HA   . ASP A 1 176 ? -3.600  -16.910 -6.602  1.00 75.34 ? 171 ASP A HA   1  
ATOM 2511  H HB3  . ASP A 1 176 ? -3.549  -15.155 -4.160  1.00 15.41 ? 171 ASP A HB3  1  
ATOM 2512  N N    . MET A 1 6   ? -8.742  -22.482 6.759   1.00 34.14 ? 1   MET A N    2  
ATOM 2513  C CA   . MET A 1 6   ? -7.342  -22.096 6.880   1.00 62.22 ? 1   MET A CA   2  
ATOM 2514  C C    . MET A 1 6   ? -6.441  -23.326 6.926   1.00 44.41 ? 1   MET A C    2  
ATOM 2515  O O    . MET A 1 6   ? -5.358  -23.291 7.510   1.00 71.41 ? 1   MET A O    2  
ATOM 2516  C CB   . MET A 1 6   ? -7.130  -21.248 8.136   1.00 23.00 ? 1   MET A CB   2  
ATOM 2517  C CG   . MET A 1 6   ? -7.466  -21.978 9.426   1.00 4.11  ? 1   MET A CG   2  
ATOM 2518  S SD   . MET A 1 6   ? -6.005  -22.343 10.417  1.00 75.35 ? 1   MET A SD   2  
ATOM 2519  C CE   . MET A 1 6   ? -5.747  -20.768 11.232  1.00 51.31 ? 1   MET A CE   2  
ATOM 2520  H H    . MET A 1 6   ? -9.417  -21.789 6.603   1.00 25.55 ? 1   MET A H    2  
ATOM 2521  H HA   . MET A 1 6   ? -7.085  -21.507 6.012   1.00 42.10 ? 1   MET A HA   2  
ATOM 2522  H HB3  . MET A 1 6   ? -7.756  -20.369 8.072   1.00 41.04 ? 1   MET A HB3  2  
ATOM 2523  H HG3  . MET A 1 6   ? -7.959  -22.907 9.179   1.00 54.02 ? 1   MET A HG3  2  
ATOM 2524  H HE1  . MET A 1 6   ? -6.493  -20.063 10.896  1.00 42.13 ? 1   MET A HE1  2  
ATOM 2525  H HE2  . MET A 1 6   ? -5.829  -20.899 12.301  1.00 23.51 ? 1   MET A HE2  2  
ATOM 2526  H HE3  . MET A 1 6   ? -4.762  -20.395 10.988  1.00 75.10 ? 1   MET A HE3  2  
ATOM 2527  N N    . GLU A 1 7   ? -6.895  -24.410 6.305   1.00 60.43 ? 2   GLU A N    2  
ATOM 2528  C CA   . GLU A 1 7   ? -6.129  -25.651 6.277   1.00 44.12 ? 2   GLU A CA   2  
ATOM 2529  C C    . GLU A 1 7   ? -5.548  -25.900 4.888   1.00 31.21 ? 2   GLU A C    2  
ATOM 2530  O O    . GLU A 1 7   ? -5.314  -27.043 4.498   1.00 1.43  ? 2   GLU A O    2  
ATOM 2531  C CB   . GLU A 1 7   ? -7.011  -26.830 6.692   1.00 71.21 ? 2   GLU A CB   2  
ATOM 2532  C CG   . GLU A 1 7   ? -8.222  -27.029 5.796   1.00 15.12 ? 2   GLU A CG   2  
ATOM 2533  C CD   . GLU A 1 7   ? -8.438  -28.483 5.422   1.00 4.21  ? 2   GLU A CD   2  
ATOM 2534  O OE1  . GLU A 1 7   ? -7.960  -29.364 6.164   1.00 55.53 ? 2   GLU A OE1  2  
ATOM 2535  O OE2  . GLU A 1 7   ? -9.086  -28.737 4.386   1.00 2.45  ? 2   GLU A OE2  2  
ATOM 2536  H H    . GLU A 1 7   ? -7.766  -24.375 5.856   1.00 53.14 ? 2   GLU A H    2  
ATOM 2537  H HA   . GLU A 1 7   ? -5.317  -25.555 6.982   1.00 33.32 ? 2   GLU A HA   2  
ATOM 2538  H HB3  . GLU A 1 7   ? -7.359  -26.666 7.701   1.00 41.11 ? 2   GLU A HB3  2  
ATOM 2539  H HG3  . GLU A 1 7   ? -8.083  -26.456 4.891   1.00 62.14 ? 2   GLU A HG3  2  
ATOM 2540  N N    . SER A 1 8   ? -5.318  -24.820 4.147   1.00 51.34 ? 3   SER A N    2  
ATOM 2541  C CA   . SER A 1 8   ? -4.768  -24.921 2.800   1.00 22.44 ? 3   SER A CA   2  
ATOM 2542  C C    . SER A 1 8   ? -3.956  -23.678 2.451   1.00 41.13 ? 3   SER A C    2  
ATOM 2543  O O    . SER A 1 8   ? -3.802  -23.332 1.279   1.00 11.03 ? 3   SER A O    2  
ATOM 2544  C CB   . SER A 1 8   ? -5.893  -25.112 1.781   1.00 51.32 ? 3   SER A CB   2  
ATOM 2545  O OG   . SER A 1 8   ? -6.953  -25.878 2.328   1.00 62.22 ? 3   SER A OG   2  
ATOM 2546  H H    . SER A 1 8   ? -5.525  -23.936 4.515   1.00 21.24 ? 3   SER A H    2  
ATOM 2547  H HA   . SER A 1 8   ? -4.117  -25.782 2.771   1.00 15.33 ? 3   SER A HA   2  
ATOM 2548  H HB3  . SER A 1 8   ? -5.505  -25.624 0.912   1.00 52.43 ? 3   SER A HB3  2  
ATOM 2549  H HG   . SER A 1 8   ? -7.708  -25.848 1.736   1.00 3.41  ? 3   SER A HG   2  
ATOM 2550  N N    . ILE A 1 9   ? -3.436  -23.012 3.476   1.00 65.32 ? 4   ILE A N    2  
ATOM 2551  C CA   . ILE A 1 9   ? -2.638  -21.807 3.278   1.00 34.13 ? 4   ILE A CA   2  
ATOM 2552  C C    . ILE A 1 9   ? -1.152  -22.141 3.195   1.00 64.10 ? 4   ILE A C    2  
ATOM 2553  O O    . ILE A 1 9   ? -0.651  -22.986 3.938   1.00 31.25 ? 4   ILE A O    2  
ATOM 2554  C CB   . ILE A 1 9   ? -2.862  -20.791 4.413   1.00 74.02 ? 4   ILE A CB   2  
ATOM 2555  C CG1  . ILE A 1 9   ? -4.358  -20.611 4.679   1.00 14.23 ? 4   ILE A CG1  2  
ATOM 2556  C CG2  . ILE A 1 9   ? -2.217  -19.458 4.065   1.00 2.45  ? 4   ILE A CG2  2  
ATOM 2557  C CD1  . ILE A 1 9   ? -4.661  -19.633 5.791   1.00 65.34 ? 4   ILE A CD1  2  
ATOM 2558  H H    . ILE A 1 9   ? -3.593  -23.337 4.387   1.00 23.23 ? 4   ILE A H    2  
ATOM 2559  H HA   . ILE A 1 9   ? -2.946  -21.352 2.348   1.00 11.34 ? 4   ILE A HA   2  
ATOM 2560  H HB   . ILE A 1 9   ? -2.387  -21.170 5.305   1.00 32.32 ? 4   ILE A HB   2  
ATOM 2561  H HG13 . ILE A 1 9   ? -4.784  -21.567 4.951   1.00 71.33 ? 4   ILE A HG13 2  
ATOM 2562  H HG21 . ILE A 1 9   ? -1.738  -19.531 3.099   1.00 51.11 ? 4   ILE A HG21 2  
ATOM 2563  H HG22 . ILE A 1 9   ? -2.975  -18.689 4.032   1.00 34.12 ? 4   ILE A HG22 2  
ATOM 2564  H HG23 . ILE A 1 9   ? -1.481  -19.207 4.814   1.00 23.11 ? 4   ILE A HG23 2  
ATOM 2565  H HD11 . ILE A 1 9   ? -3.738  -19.220 6.169   1.00 72.14 ? 4   ILE A HD11 2  
ATOM 2566  H HD12 . ILE A 1 9   ? -5.283  -18.837 5.411   1.00 1.02  ? 4   ILE A HD12 2  
ATOM 2567  H HD13 . ILE A 1 9   ? -5.179  -20.144 6.590   1.00 11.45 ? 4   ILE A HD13 2  
ATOM 2568  N N    . PHE A 1 10  ? -0.451  -21.470 2.288   1.00 23.33 ? 5   PHE A N    2  
ATOM 2569  C CA   . PHE A 1 10  ? 0.979   -21.694 2.107   1.00 71.33 ? 5   PHE A CA   2  
ATOM 2570  C C    . PHE A 1 10  ? 1.792   -20.792 3.032   1.00 14.04 ? 5   PHE A C    2  
ATOM 2571  O O    . PHE A 1 10  ? 1.817   -19.573 2.864   1.00 25.52 ? 5   PHE A O    2  
ATOM 2572  C CB   . PHE A 1 10  ? 1.377   -21.441 0.652   1.00 14.14 ? 5   PHE A CB   2  
ATOM 2573  C CG   . PHE A 1 10  ? 2.206   -22.545 0.057   1.00 63.31 ? 5   PHE A CG   2  
ATOM 2574  C CD1  . PHE A 1 10  ? 3.266   -23.089 0.763   1.00 52.54 ? 5   PHE A CD1  2  
ATOM 2575  C CD2  . PHE A 1 10  ? 1.924   -23.036 -1.207  1.00 22.12 ? 5   PHE A CD2  2  
ATOM 2576  C CE1  . PHE A 1 10  ? 4.031   -24.104 0.218   1.00 64.31 ? 5   PHE A CE1  2  
ATOM 2577  C CE2  . PHE A 1 10  ? 2.684   -24.050 -1.757  1.00 43.55 ? 5   PHE A CE2  2  
ATOM 2578  C CZ   . PHE A 1 10  ? 3.739   -24.585 -1.044  1.00 52.04 ? 5   PHE A CZ   2  
ATOM 2579  H H    . PHE A 1 10  ? -0.906  -20.808 1.725   1.00 12.40 ? 5   PHE A H    2  
ATOM 2580  H HA   . PHE A 1 10  ? 1.186   -22.724 2.355   1.00 64.21 ? 5   PHE A HA   2  
ATOM 2581  H HB3  . PHE A 1 10  ? 1.948   -20.528 0.596   1.00 42.32 ? 5   PHE A HB3  2  
ATOM 2582  H HD1  . PHE A 1 10  ? 3.495   -22.714 1.750   1.00 61.41 ? 5   PHE A HD1  2  
ATOM 2583  H HD2  . PHE A 1 10  ? 1.099   -22.618 -1.767  1.00 52.12 ? 5   PHE A HD2  2  
ATOM 2584  H HE1  . PHE A 1 10  ? 4.854   -24.519 0.778   1.00 54.42 ? 5   PHE A HE1  2  
ATOM 2585  H HE2  . PHE A 1 10  ? 2.454   -24.425 -2.743  1.00 5.34  ? 5   PHE A HE2  2  
ATOM 2586  H HZ   . PHE A 1 10  ? 4.335   -25.377 -1.471  1.00 2.33  ? 5   PHE A HZ   2  
ATOM 2587  N N    . HIS A 1 11  ? 2.454   -21.401 4.010   1.00 74.30 ? 6   HIS A N    2  
ATOM 2588  C CA   . HIS A 1 11  ? 3.268   -20.654 4.963   1.00 43.41 ? 6   HIS A CA   2  
ATOM 2589  C C    . HIS A 1 11  ? 4.735   -21.063 4.863   1.00 14.13 ? 6   HIS A C    2  
ATOM 2590  O O    . HIS A 1 11  ? 5.052   -22.248 4.769   1.00 31.12 ? 6   HIS A O    2  
ATOM 2591  C CB   . HIS A 1 11  ? 2.759   -20.878 6.387   1.00 41.44 ? 6   HIS A CB   2  
ATOM 2592  C CG   . HIS A 1 11  ? 1.716   -19.892 6.813   1.00 22.44 ? 6   HIS A CG   2  
ATOM 2593  N ND1  . HIS A 1 11  ? 1.989   -18.809 7.621   1.00 53.13 ? 6   HIS A ND1  2  
ATOM 2594  C CD2  . HIS A 1 11  ? 0.392   -19.828 6.536   1.00 50.34 ? 6   HIS A CD2  2  
ATOM 2595  C CE1  . HIS A 1 11  ? 0.879   -18.123 7.826   1.00 43.50 ? 6   HIS A CE1  2  
ATOM 2596  N NE2  . HIS A 1 11  ? -0.105  -18.720 7.178   1.00 44.13 ? 6   HIS A NE2  2  
ATOM 2597  H H    . HIS A 1 11  ? 2.395   -22.375 4.093   1.00 73.44 ? 6   HIS A H    2  
ATOM 2598  H HA   . HIS A 1 11  ? 3.183   -19.605 4.721   1.00 1.20  ? 6   HIS A HA   2  
ATOM 2599  H HB3  . HIS A 1 11  ? 3.589   -20.803 7.074   1.00 75.32 ? 6   HIS A HB3  2  
ATOM 2600  H HD1  . HIS A 1 11  ? 2.867   -18.579 7.992   1.00 73.45 ? 6   HIS A HD1  2  
ATOM 2601  H HD2  . HIS A 1 11  ? -0.170  -20.520 5.925   1.00 72.13 ? 6   HIS A HD2  2  
ATOM 2602  H HE1  . HIS A 1 11  ? 0.790   -17.226 8.420   1.00 13.42 ? 6   HIS A HE1  2  
ATOM 2603  N N    . GLU A 1 12  ? 5.622   -20.075 4.883   1.00 63.34 ? 7   GLU A N    2  
ATOM 2604  C CA   . GLU A 1 12  ? 7.055   -20.334 4.794   1.00 64.32 ? 7   GLU A CA   2  
ATOM 2605  C C    . GLU A 1 12  ? 7.670   -20.474 6.183   1.00 40.33 ? 7   GLU A C    2  
ATOM 2606  O O    . GLU A 1 12  ? 8.774   -20.999 6.336   1.00 24.52 ? 7   GLU A O    2  
ATOM 2607  C CB   . GLU A 1 12  ? 7.752   -19.208 4.027   1.00 3.40  ? 7   GLU A CB   2  
ATOM 2608  C CG   . GLU A 1 12  ? 7.732   -19.396 2.518   1.00 74.45 ? 7   GLU A CG   2  
ATOM 2609  C CD   . GLU A 1 12  ? 9.123   -19.534 1.929   1.00 33.44 ? 7   GLU A CD   2  
ATOM 2610  O OE1  . GLU A 1 12  ? 9.888   -18.549 1.982   1.00 4.11  ? 7   GLU A OE1  2  
ATOM 2611  O OE2  . GLU A 1 12  ? 9.444   -20.626 1.415   1.00 62.50 ? 7   GLU A OE2  2  
ATOM 2612  H H    . GLU A 1 12  ? 5.307   -19.150 4.961   1.00 41.22 ? 7   GLU A H    2  
ATOM 2613  H HA   . GLU A 1 12  ? 7.192   -21.260 4.258   1.00 11.03 ? 7   GLU A HA   2  
ATOM 2614  H HB3  . GLU A 1 12  ? 8.782   -19.154 4.348   1.00 0.43  ? 7   GLU A HB3  2  
ATOM 2615  H HG3  . GLU A 1 12  ? 7.249   -18.542 2.068   1.00 71.42 ? 7   GLU A HG3  2  
ATOM 2616  N N    . LYS A 1 13  ? 6.950   -20.000 7.194   1.00 34.35 ? 8   LYS A N    2  
ATOM 2617  C CA   . LYS A 1 13  ? 7.422   -20.072 8.571   1.00 54.43 ? 8   LYS A CA   2  
ATOM 2618  C C    . LYS A 1 13  ? 8.735   -19.313 8.736   1.00 71.43 ? 8   LYS A C    2  
ATOM 2619  O O    . LYS A 1 13  ? 9.801   -19.815 8.382   1.00 12.51 ? 8   LYS A O    2  
ATOM 2620  C CB   . LYS A 1 13  ? 7.609   -21.531 8.993   1.00 15.24 ? 8   LYS A CB   2  
ATOM 2621  C CG   . LYS A 1 13  ? 6.504   -22.452 8.503   1.00 32.22 ? 8   LYS A CG   2  
ATOM 2622  C CD   . LYS A 1 13  ? 5.166   -22.102 9.134   1.00 44.10 ? 8   LYS A CD   2  
ATOM 2623  C CE   . LYS A 1 13  ? 4.793   -23.085 10.233  1.00 53.24 ? 8   LYS A CE   2  
ATOM 2624  N NZ   . LYS A 1 13  ? 3.336   -23.386 10.237  1.00 32.44 ? 8   LYS A NZ   2  
ATOM 2625  H H    . LYS A 1 13  ? 6.077   -19.593 7.008   1.00 63.54 ? 8   LYS A H    2  
ATOM 2626  H HA   . LYS A 1 13  ? 6.674   -19.616 9.202   1.00 55.35 ? 8   LYS A HA   2  
ATOM 2627  H HB3  . LYS A 1 13  ? 7.638   -21.581 10.071  1.00 71.42 ? 8   LYS A HB3  2  
ATOM 2628  H HG3  . LYS A 1 13  ? 6.757   -23.471 8.759   1.00 32.43 ? 8   LYS A HG3  2  
ATOM 2629  H HD3  . LYS A 1 13  ? 4.402   -22.122 8.371   1.00 24.01 ? 8   LYS A HD3  2  
ATOM 2630  H HE3  . LYS A 1 13  ? 5.067   -22.659 11.187  1.00 52.42 ? 8   LYS A HE3  2  
ATOM 2631  H HZ1  . LYS A 1 13  ? 2.845   -22.784 9.546   1.00 24.23 ? 8   LYS A HZ1  2  
ATOM 2632  H HZ2  . LYS A 1 13  ? 2.936   -23.207 11.180  1.00 41.20 ? 8   LYS A HZ2  2  
ATOM 2633  H HZ3  . LYS A 1 13  ? 3.176   -24.382 9.988   1.00 15.14 ? 8   LYS A HZ3  2  
ATOM 2634  N N    . GLN A 1 14  ? 8.649   -18.101 9.277   1.00 14.43 ? 9   GLN A N    2  
ATOM 2635  C CA   . GLN A 1 14  ? 9.831   -17.274 9.490   1.00 12.32 ? 9   GLN A CA   2  
ATOM 2636  C C    . GLN A 1 14  ? 9.727   -16.505 10.802  1.00 43.34 ? 9   GLN A C    2  
ATOM 2637  O O    . GLN A 1 14  ? 8.640   -16.348 11.356  1.00 62.32 ? 9   GLN A O    2  
ATOM 2638  C CB   . GLN A 1 14  ? 10.012  -16.299 8.325   1.00 74.34 ? 9   GLN A CB   2  
ATOM 2639  C CG   . GLN A 1 14  ? 10.472  -16.966 7.039   1.00 23.30 ? 9   GLN A CG   2  
ATOM 2640  C CD   . GLN A 1 14  ? 11.948  -17.309 7.055   1.00 52.24 ? 9   GLN A CD   2  
ATOM 2641  O OE1  . GLN A 1 14  ? 12.776  -16.570 6.524   1.00 25.33 ? 9   GLN A OE1  2  
ATOM 2642  N NE2  . GLN A 1 14  ? 12.287  -18.438 7.668   1.00 74.32 ? 9   GLN A NE2  2  
ATOM 2643  H H    . GLN A 1 14  ? 7.770   -17.757 9.539   1.00 64.10 ? 9   GLN A H    2  
ATOM 2644  H HA   . GLN A 1 14  ? 10.689  -17.929 9.536   1.00 23.45 ? 9   GLN A HA   2  
ATOM 2645  H HB3  . GLN A 1 14  ? 10.746  -15.558 8.604   1.00 65.22 ? 9   GLN A HB3  2  
ATOM 2646  H HG3  . GLN A 1 14  ? 10.282  -16.294 6.214   1.00 54.51 ? 9   GLN A HG3  2  
ATOM 2647  H HE21 . GLN A 1 14  ? 11.573  -18.978 8.070   1.00 5.55  ? 9   GLN A HE21 2  
ATOM 2648  H HE22 . GLN A 1 14  ? 13.233  -18.686 7.693   1.00 63.44 ? 9   GLN A HE22 2  
ATOM 2649  N N    . GLU A 1 15  ? 10.867  -16.029 11.294  1.00 14.21 ? 10  GLU A N    2  
ATOM 2650  C CA   . GLU A 1 15  ? 10.905  -15.278 12.544  1.00 24.45 ? 10  GLU A CA   2  
ATOM 2651  C C    . GLU A 1 15  ? 11.470  -13.878 12.320  1.00 4.30  ? 10  GLU A C    2  
ATOM 2652  O O    . GLU A 1 15  ? 12.252  -13.653 11.397  1.00 20.43 ? 10  GLU A O    2  
ATOM 2653  C CB   . GLU A 1 15  ? 11.745  -16.018 13.586  1.00 1.13  ? 10  GLU A CB   2  
ATOM 2654  C CG   . GLU A 1 15  ? 13.179  -16.264 13.148  1.00 61.43 ? 10  GLU A CG   2  
ATOM 2655  C CD   . GLU A 1 15  ? 13.806  -17.456 13.845  1.00 34.14 ? 10  GLU A CD   2  
ATOM 2656  O OE1  . GLU A 1 15  ? 13.570  -17.623 15.060  1.00 43.13 ? 10  GLU A OE1  2  
ATOM 2657  O OE2  . GLU A 1 15  ? 14.530  -18.221 13.176  1.00 52.41 ? 10  GLU A OE2  2  
ATOM 2658  H H    . GLU A 1 15  ? 11.702  -16.188 10.807  1.00 42.04 ? 10  GLU A H    2  
ATOM 2659  H HA   . GLU A 1 15  ? 9.892   -15.190 12.908  1.00 2.10  ? 10  GLU A HA   2  
ATOM 2660  H HB3  . GLU A 1 15  ? 11.284  -16.974 13.788  1.00 72.13 ? 10  GLU A HB3  2  
ATOM 2661  H HG3  . GLU A 1 15  ? 13.766  -15.385 13.374  1.00 4.32  ? 10  GLU A HG3  2  
ATOM 2662  N N    . GLY A 1 16  ? 11.067  -12.940 13.172  1.00 4.22  ? 11  GLY A N    2  
ATOM 2663  C CA   . GLY A 1 16  ? 11.543  -11.574 13.050  1.00 14.32 ? 11  GLY A CA   2  
ATOM 2664  C C    . GLY A 1 16  ? 10.590  -10.697 12.261  1.00 11.11 ? 11  GLY A C    2  
ATOM 2665  O O    . GLY A 1 16  ? 10.620  -10.687 11.031  1.00 23.23 ? 11  GLY A O    2  
ATOM 2666  H H    . GLY A 1 16  ? 10.443  -13.177 13.888  1.00 34.42 ? 11  GLY A H    2  
ATOM 2667  H HA2  . GLY A 1 16  ? 11.664  -11.157 14.038  1.00 55.23 ? 11  GLY A HA2  2  
ATOM 2668  H HA3  . GLY A 1 16  ? 12.502  -11.581 12.553  1.00 13.24 ? 11  GLY A HA3  2  
ATOM 2669  N N    . SER A 1 17  ? 9.742   -9.959  12.971  1.00 51.22 ? 12  SER A N    2  
ATOM 2670  C CA   . SER A 1 17  ? 8.773   -9.079  12.329  1.00 31.34 ? 12  SER A CA   2  
ATOM 2671  C C    . SER A 1 17  ? 9.456   -8.168  11.314  1.00 2.25  ? 12  SER A C    2  
ATOM 2672  O O    . SER A 1 17  ? 10.684  -8.101  11.250  1.00 64.44 ? 12  SER A O    2  
ATOM 2673  C CB   . SER A 1 17  ? 8.044   -8.237  13.379  1.00 5.33  ? 12  SER A CB   2  
ATOM 2674  O OG   . SER A 1 17  ? 8.871   -7.190  13.855  1.00 61.44 ? 12  SER A OG   2  
ATOM 2675  H H    . SER A 1 17  ? 9.768   -10.011 13.950  1.00 0.34  ? 12  SER A H    2  
ATOM 2676  H HA   . SER A 1 17  ? 8.053   -9.698  11.814  1.00 52.41 ? 12  SER A HA   2  
ATOM 2677  H HB3  . SER A 1 17  ? 7.765   -8.867  14.211  1.00 44.20 ? 12  SER A HB3  2  
ATOM 2678  H HG   . SER A 1 17  ? 8.926   -7.236  14.813  1.00 44.05 ? 12  SER A HG   2  
ATOM 2679  N N    . LEU A 1 18  ? 8.651   -7.469  10.521  1.00 33.32 ? 13  LEU A N    2  
ATOM 2680  C CA   . LEU A 1 18  ? 9.175   -6.561  9.507   1.00 1.32  ? 13  LEU A CA   2  
ATOM 2681  C C    . LEU A 1 18  ? 10.127  -7.289  8.564   1.00 1.30  ? 13  LEU A C    2  
ATOM 2682  O O    . LEU A 1 18  ? 11.310  -6.957  8.480   1.00 64.03 ? 13  LEU A O    2  
ATOM 2683  C CB   . LEU A 1 18  ? 9.896   -5.386  10.170  1.00 42.21 ? 13  LEU A CB   2  
ATOM 2684  C CG   . LEU A 1 18  ? 9.073   -4.570  11.166  1.00 73.53 ? 13  LEU A CG   2  
ATOM 2685  C CD1  . LEU A 1 18  ? 9.639   -4.712  12.571  1.00 4.21  ? 13  LEU A CD1  2  
ATOM 2686  C CD2  . LEU A 1 18  ? 9.033   -3.106  10.752  1.00 23.13 ? 13  LEU A CD2  2  
ATOM 2687  H H    . LEU A 1 18  ? 7.681   -7.565  10.619  1.00 2.20  ? 13  LEU A H    2  
ATOM 2688  H HA   . LEU A 1 18  ? 8.340   -6.184  8.936   1.00 11.45 ? 13  LEU A HA   2  
ATOM 2689  H HB3  . LEU A 1 18  ? 10.229  -4.719  9.387   1.00 32.43 ? 13  LEU A HB3  2  
ATOM 2690  H HG   . LEU A 1 18  ? 8.058   -4.943  11.178  1.00 3.52  ? 13  LEU A HG   2  
ATOM 2691  H HD11 . LEU A 1 18  ? 10.173  -5.647  12.650  1.00 63.45 ? 13  LEU A HD11 2  
ATOM 2692  H HD12 . LEU A 1 18  ? 8.833   -4.696  13.288  1.00 23.33 ? 13  LEU A HD12 2  
ATOM 2693  H HD13 . LEU A 1 18  ? 10.315  -3.893  12.771  1.00 21.31 ? 13  LEU A HD13 2  
ATOM 2694  H HD21 . LEU A 1 18  ? 8.116   -2.658  11.105  1.00 31.40 ? 13  LEU A HD21 2  
ATOM 2695  H HD22 . LEU A 1 18  ? 9.075   -3.036  9.674   1.00 31.12 ? 13  LEU A HD22 2  
ATOM 2696  H HD23 . LEU A 1 18  ? 9.876   -2.587  11.181  1.00 4.43  ? 13  LEU A HD23 2  
ATOM 2697  N N    . CYS A 1 19  ? 9.603   -8.282  7.854   1.00 13.20 ? 14  CYS A N    2  
ATOM 2698  C CA   . CYS A 1 19  ? 10.406  -9.058  6.914   1.00 24.10 ? 14  CYS A CA   2  
ATOM 2699  C C    . CYS A 1 19  ? 9.920   -8.851  5.483   1.00 62.31 ? 14  CYS A C    2  
ATOM 2700  O O    . CYS A 1 19  ? 8.719   -8.871  5.217   1.00 12.34 ? 14  CYS A O    2  
ATOM 2701  C CB   . CYS A 1 19  ? 10.356  -10.543 7.273   1.00 74.02 ? 14  CYS A CB   2  
ATOM 2702  S SG   . CYS A 1 19  ? 11.949  -11.236 7.772   1.00 54.30 ? 14  CYS A SG   2  
ATOM 2703  H H    . CYS A 1 19  ? 8.654   -8.500  7.964   1.00 50.40 ? 14  CYS A H    2  
ATOM 2704  H HA   . CYS A 1 19  ? 11.426  -8.713  6.988   1.00 62.23 ? 14  CYS A HA   2  
ATOM 2705  H HB3  . CYS A 1 19  ? 10.007  -11.101 6.416   1.00 51.23 ? 14  CYS A HB3  2  
ATOM 2706  H HG   . CYS A 1 19  ? 11.844  -12.556 7.752   1.00 54.12 ? 14  CYS A HG   2  
ATOM 2707  N N    . ALA A 1 20  ? 10.861  -8.649  4.568   1.00 24.15 ? 15  ALA A N    2  
ATOM 2708  C CA   . ALA A 1 20  ? 10.529  -8.438  3.164   1.00 33.53 ? 15  ALA A CA   2  
ATOM 2709  C C    . ALA A 1 20  ? 10.037  -9.728  2.517   1.00 4.45  ? 15  ALA A C    2  
ATOM 2710  O O    . ALA A 1 20  ? 9.019   -9.737  1.826   1.00 22.24 ? 15  ALA A O    2  
ATOM 2711  C CB   . ALA A 1 20  ? 11.734  -7.895  2.412   1.00 62.20 ? 15  ALA A CB   2  
ATOM 2712  H H    . ALA A 1 20  ? 11.801  -8.644  4.842   1.00 42.24 ? 15  ALA A H    2  
ATOM 2713  H HA   . ALA A 1 20  ? 9.741   -7.699  3.115   1.00 54.40 ? 15  ALA A HA   2  
ATOM 2714  H HB1  . ALA A 1 20  ? 12.571  -7.806  3.090   1.00 23.12 ? 15  ALA A HB1  2  
ATOM 2715  H HB2  . ALA A 1 20  ? 11.992  -8.569  1.608   1.00 74.45 ? 15  ALA A HB2  2  
ATOM 2716  H HB3  . ALA A 1 20  ? 11.496  -6.924  2.004   1.00 22.22 ? 15  ALA A HB3  2  
ATOM 2717  N N    . GLN A 1 21  ? 10.767  -10.816 2.745   1.00 62.33 ? 16  GLN A N    2  
ATOM 2718  C CA   . GLN A 1 21  ? 10.404  -12.111 2.182   1.00 10.10 ? 16  GLN A CA   2  
ATOM 2719  C C    . GLN A 1 21  ? 9.017   -12.540 2.652   1.00 45.13 ? 16  GLN A C    2  
ATOM 2720  O O    . GLN A 1 21  ? 8.202   -13.014 1.860   1.00 44.22 ? 16  GLN A O    2  
ATOM 2721  C CB   . GLN A 1 21  ? 11.438  -13.168 2.573   1.00 73.04 ? 16  GLN A CB   2  
ATOM 2722  C CG   . GLN A 1 21  ? 11.006  -14.590 2.252   1.00 60.42 ? 16  GLN A CG   2  
ATOM 2723  C CD   . GLN A 1 21  ? 10.767  -15.422 3.496   1.00 71.21 ? 16  GLN A CD   2  
ATOM 2724  O OE1  . GLN A 1 21  ? 11.663  -15.598 4.321   1.00 74.01 ? 16  GLN A OE1  2  
ATOM 2725  N NE2  . GLN A 1 21  ? 9.552   -15.941 3.637   1.00 52.25 ? 16  GLN A NE2  2  
ATOM 2726  H H    . GLN A 1 21  ? 11.568  -10.744 3.304   1.00 34.12 ? 16  GLN A H    2  
ATOM 2727  H HA   . GLN A 1 21  ? 10.392  -12.013 1.107   1.00 74.22 ? 16  GLN A HA   2  
ATOM 2728  H HB3  . GLN A 1 21  ? 11.618  -13.102 3.637   1.00 21.34 ? 16  GLN A HB3  2  
ATOM 2729  H HG3  . GLN A 1 21  ? 11.778  -15.062 1.664   1.00 2.13  ? 16  GLN A HG3  2  
ATOM 2730  H HE21 . GLN A 1 21  ? 8.888   -15.760 2.939   1.00 15.12 ? 16  GLN A HE21 2  
ATOM 2731  H HE22 . GLN A 1 21  ? 9.370   -16.484 4.432   1.00 3.12  ? 16  GLN A HE22 2  
ATOM 2732  N N    . HIS A 1 22  ? 8.757   -12.370 3.944   1.00 42.11 ? 17  HIS A N    2  
ATOM 2733  C CA   . HIS A 1 22  ? 7.469   -12.740 4.519   1.00 51.04 ? 17  HIS A CA   2  
ATOM 2734  C C    . HIS A 1 22  ? 6.342   -11.922 3.897   1.00 21.42 ? 17  HIS A C    2  
ATOM 2735  O O    . HIS A 1 22  ? 5.242   -12.430 3.674   1.00 53.01 ? 17  HIS A O    2  
ATOM 2736  C CB   . HIS A 1 22  ? 7.486   -12.536 6.034   1.00 73.02 ? 17  HIS A CB   2  
ATOM 2737  C CG   . HIS A 1 22  ? 6.571   -11.447 6.502   1.00 71.51 ? 17  HIS A CG   2  
ATOM 2738  N ND1  . HIS A 1 22  ? 7.020   -10.199 6.882   1.00 52.12 ? 17  HIS A ND1  2  
ATOM 2739  C CD2  . HIS A 1 22  ? 5.226   -11.422 6.649   1.00 35.51 ? 17  HIS A CD2  2  
ATOM 2740  C CE1  . HIS A 1 22  ? 5.990   -9.454  7.245   1.00 1.24  ? 17  HIS A CE1  2  
ATOM 2741  N NE2  . HIS A 1 22  ? 4.890   -10.173 7.112   1.00 41.11 ? 17  HIS A NE2  2  
ATOM 2742  H H    . HIS A 1 22  ? 9.448   -11.988 4.524   1.00 31.41 ? 17  HIS A H    2  
ATOM 2743  H HA   . HIS A 1 22  ? 7.299   -13.784 4.306   1.00 35.32 ? 17  HIS A HA   2  
ATOM 2744  H HB3  . HIS A 1 22  ? 8.490   -12.285 6.346   1.00 15.14 ? 17  HIS A HB3  2  
ATOM 2745  H HD1  . HIS A 1 22  ? 7.954   -9.904  6.887   1.00 70.10 ? 17  HIS A HD1  2  
ATOM 2746  H HD2  . HIS A 1 22  ? 4.542   -12.233 6.443   1.00 3.41  ? 17  HIS A HD2  2  
ATOM 2747  H HE1  . HIS A 1 22  ? 6.038   -8.433  7.589   1.00 43.15 ? 17  HIS A HE1  2  
ATOM 2748  N N    . CYS A 1 23  ? 6.622   -10.653 3.618   1.00 71.00 ? 18  CYS A N    2  
ATOM 2749  C CA   . CYS A 1 23  ? 5.630   -9.764  3.022   1.00 73.12 ? 18  CYS A CA   2  
ATOM 2750  C C    . CYS A 1 23  ? 5.250   -10.235 1.623   1.00 34.44 ? 18  CYS A C    2  
ATOM 2751  O O    . CYS A 1 23  ? 4.068   -10.357 1.297   1.00 34.53 ? 18  CYS A O    2  
ATOM 2752  C CB   . CYS A 1 23  ? 6.168   -8.334  2.965   1.00 31.45 ? 18  CYS A CB   2  
ATOM 2753  S SG   . CYS A 1 23  ? 5.860   -7.368  4.463   1.00 51.51 ? 18  CYS A SG   2  
ATOM 2754  H H    . CYS A 1 23  ? 7.515   -10.305 3.818   1.00 40.24 ? 18  CYS A H    2  
ATOM 2755  H HA   . CYS A 1 23  ? 4.751   -9.784  3.648   1.00 13.43 ? 18  CYS A HA   2  
ATOM 2756  H HB3  . CYS A 1 23  ? 5.704   -7.816  2.137   1.00 75.35 ? 18  CYS A HB3  2  
ATOM 2757  H HG   . CYS A 1 23  ? 4.793   -6.613  4.251   1.00 15.43 ? 18  CYS A HG   2  
ATOM 2758  N N    . LEU A 1 24  ? 6.257   -10.495 0.797   1.00 31.30 ? 19  LEU A N    2  
ATOM 2759  C CA   . LEU A 1 24  ? 6.028   -10.951 -0.569  1.00 42.22 ? 19  LEU A CA   2  
ATOM 2760  C C    . LEU A 1 24  ? 5.463   -12.368 -0.584  1.00 32.12 ? 19  LEU A C    2  
ATOM 2761  O O    . LEU A 1 24  ? 4.530   -12.666 -1.328  1.00 53.23 ? 19  LEU A O    2  
ATOM 2762  C CB   . LEU A 1 24  ? 7.331   -10.902 -1.369  1.00 45.13 ? 19  LEU A CB   2  
ATOM 2763  C CG   . LEU A 1 24  ? 7.668   -9.559  -2.020  1.00 10.44 ? 19  LEU A CG   2  
ATOM 2764  C CD1  . LEU A 1 24  ? 7.638   -8.442  -0.988  1.00 2.44  ? 19  LEU A CD1  2  
ATOM 2765  C CD2  . LEU A 1 24  ? 9.028   -9.623  -2.701  1.00 11.20 ? 19  LEU A CD2  2  
ATOM 2766  H H    . LEU A 1 24  ? 7.177   -10.380 1.114   1.00 64.30 ? 19  LEU A H    2  
ATOM 2767  H HA   . LEU A 1 24  ? 5.311   -10.286 -1.024  1.00 21.55 ? 19  LEU A HA   2  
ATOM 2768  H HB3  . LEU A 1 24  ? 7.266   -11.643 -2.152  1.00 14.31 ? 19  LEU A HB3  2  
ATOM 2769  H HG   . LEU A 1 24  ? 6.926   -9.337  -2.775  1.00 61.34 ? 19  LEU A HG   2  
ATOM 2770  H HD11 . LEU A 1 24  ? 8.368   -7.692  -1.251  1.00 61.21 ? 19  LEU A HD11 2  
ATOM 2771  H HD12 . LEU A 1 24  ? 7.871   -8.846  -0.014  1.00 21.05 ? 19  LEU A HD12 2  
ATOM 2772  H HD13 . LEU A 1 24  ? 6.653   -7.998  -0.969  1.00 40.25 ? 19  LEU A HD13 2  
ATOM 2773  H HD21 . LEU A 1 24  ? 8.910   -10.003 -3.705  1.00 60.21 ? 19  LEU A HD21 2  
ATOM 2774  H HD22 . LEU A 1 24  ? 9.679   -10.280 -2.143  1.00 72.44 ? 19  LEU A HD22 2  
ATOM 2775  H HD23 . LEU A 1 24  ? 9.458   -8.634  -2.738  1.00 63.10 ? 19  LEU A HD23 2  
ATOM 2776  N N    . ASN A 1 25  ? 6.034   -13.235 0.246   1.00 41.32 ? 20  ASN A N    2  
ATOM 2777  C CA   . ASN A 1 25  ? 5.586   -14.621 0.330   1.00 3.44  ? 20  ASN A CA   2  
ATOM 2778  C C    . ASN A 1 25  ? 4.144   -14.698 0.821   1.00 62.22 ? 20  ASN A C    2  
ATOM 2779  O O    . ASN A 1 25  ? 3.324   -15.425 0.263   1.00 41.34 ? 20  ASN A O    2  
ATOM 2780  C CB   . ASN A 1 25  ? 6.499   -15.419 1.263   1.00 63.50 ? 20  ASN A CB   2  
ATOM 2781  C CG   . ASN A 1 25  ? 7.796   -15.827 0.594   1.00 42.42 ? 20  ASN A CG   2  
ATOM 2782  O OD1  . ASN A 1 25  ? 8.243   -16.967 0.724   1.00 61.20 ? 20  ASN A OD1  2  
ATOM 2783  N ND2  . ASN A 1 25  ? 8.409   -14.895 -0.128  1.00 70.14 ? 20  ASN A ND2  2  
ATOM 2784  H H    . ASN A 1 25  ? 6.775   -12.937 0.814   1.00 10.32 ? 20  ASN A H    2  
ATOM 2785  H HA   . ASN A 1 25  ? 5.640   -15.047 -0.662  1.00 73.41 ? 20  ASN A HA   2  
ATOM 2786  H HB3  . ASN A 1 25  ? 5.984   -16.311 1.585   1.00 31.20 ? 20  ASN A HB3  2  
ATOM 2787  H HD21 . ASN A 1 25  ? 7.995   -14.008 -0.187  1.00 14.52 ? 20  ASN A HD21 2  
ATOM 2788  H HD22 . ASN A 1 25  ? 9.249   -15.133 -0.572  1.00 41.32 ? 20  ASN A HD22 2  
ATOM 2789  N N    . ASN A 1 26  ? 3.842   -13.940 1.871   1.00 61.34 ? 21  ASN A N    2  
ATOM 2790  C CA   . ASN A 1 26  ? 2.499   -13.922 2.440   1.00 1.40  ? 21  ASN A CA   2  
ATOM 2791  C C    . ASN A 1 26  ? 1.496   -13.343 1.446   1.00 74.20 ? 21  ASN A C    2  
ATOM 2792  O O    . ASN A 1 26  ? 0.426   -13.912 1.225   1.00 62.22 ? 21  ASN A O    2  
ATOM 2793  C CB   . ASN A 1 26  ? 2.481   -13.106 3.733   1.00 64.11 ? 21  ASN A CB   2  
ATOM 2794  C CG   . ASN A 1 26  ? 3.138   -13.838 4.887   1.00 65.35 ? 21  ASN A CG   2  
ATOM 2795  O OD1  . ASN A 1 26  ? 2.784   -13.633 6.049   1.00 41.31 ? 21  ASN A OD1  2  
ATOM 2796  N ND2  . ASN A 1 26  ? 4.102   -14.695 4.572   1.00 34.12 ? 21  ASN A ND2  2  
ATOM 2797  H H    . ASN A 1 26  ? 4.539   -13.380 2.274   1.00 73.01 ? 21  ASN A H    2  
ATOM 2798  H HA   . ASN A 1 26  ? 2.220   -14.941 2.663   1.00 61.23 ? 21  ASN A HA   2  
ATOM 2799  H HB3  . ASN A 1 26  ? 1.458   -12.891 4.003   1.00 1.22  ? 21  ASN A HB3  2  
ATOM 2800  H HD21 . ASN A 1 26  ? 4.332   -14.806 3.626   1.00 53.32 ? 21  ASN A HD21 2  
ATOM 2801  H HD22 . ASN A 1 26  ? 4.543   -15.182 5.299   1.00 1.41  ? 21  ASN A HD22 2  
ATOM 2802  N N    . LEU A 1 27  ? 1.850   -12.210 0.849   1.00 13.24 ? 22  LEU A N    2  
ATOM 2803  C CA   . LEU A 1 27  ? 0.981   -11.554 -0.123  1.00 70.44 ? 22  LEU A CA   2  
ATOM 2804  C C    . LEU A 1 27  ? 0.663   -12.487 -1.286  1.00 51.32 ? 22  LEU A C    2  
ATOM 2805  O O    . LEU A 1 27  ? -0.483  -12.574 -1.731  1.00 53.15 ? 22  LEU A O    2  
ATOM 2806  C CB   . LEU A 1 27  ? 1.641   -10.277 -0.643  1.00 25.52 ? 22  LEU A CB   2  
ATOM 2807  C CG   . LEU A 1 27  ? 1.099   -9.732  -1.966  1.00 40.00 ? 22  LEU A CG   2  
ATOM 2808  C CD1  . LEU A 1 27  ? -0.414  -9.588  -1.903  1.00 4.53  ? 22  LEU A CD1  2  
ATOM 2809  C CD2  . LEU A 1 27  ? 1.750   -8.398  -2.302  1.00 14.41 ? 22  LEU A CD2  2  
ATOM 2810  H H    . LEU A 1 27  ? 2.714   -11.805 1.065   1.00 73.15 ? 22  LEU A H    2  
ATOM 2811  H HA   . LEU A 1 27  ? 0.059   -11.296 0.379   1.00 44.54 ? 22  LEU A HA   2  
ATOM 2812  H HB3  . LEU A 1 27  ? 2.694   -10.479 -0.775  1.00 61.32 ? 22  LEU A HB3  2  
ATOM 2813  H HG   . LEU A 1 27  ? 1.334   -10.430 -2.758  1.00 62.41 ? 22  LEU A HG   2  
ATOM 2814  H HD11 . LEU A 1 27  ? -0.707  -8.662  -2.374  1.00 23.14 ? 22  LEU A HD11 2  
ATOM 2815  H HD12 . LEU A 1 27  ? -0.733  -9.583  -0.872  1.00 14.23 ? 22  LEU A HD12 2  
ATOM 2816  H HD13 . LEU A 1 27  ? -0.876  -10.417 -2.420  1.00 61.41 ? 22  LEU A HD13 2  
ATOM 2817  H HD21 . LEU A 1 27  ? 2.560   -8.211  -1.611  1.00 3.35  ? 22  LEU A HD21 2  
ATOM 2818  H HD22 . LEU A 1 27  ? 1.017   -7.609  -2.220  1.00 60.13 ? 22  LEU A HD22 2  
ATOM 2819  H HD23 . LEU A 1 27  ? 2.136   -8.430  -3.310  1.00 40.11 ? 22  LEU A HD23 2  
ATOM 2820  N N    . LEU A 1 28  ? 1.683   -13.184 -1.774  1.00 50.41 ? 23  LEU A N    2  
ATOM 2821  C CA   . LEU A 1 28  ? 1.513   -14.114 -2.886  1.00 31.43 ? 23  LEU A CA   2  
ATOM 2822  C C    . LEU A 1 28  ? 0.920   -15.434 -2.405  1.00 10.51 ? 23  LEU A C    2  
ATOM 2823  O O    . LEU A 1 28  ? 0.657   -16.334 -3.203  1.00 74.31 ? 23  LEU A O    2  
ATOM 2824  C CB   . LEU A 1 28  ? 2.853   -14.364 -3.578  1.00 75.54 ? 23  LEU A CB   2  
ATOM 2825  C CG   . LEU A 1 28  ? 3.515   -13.145 -4.220  1.00 22.24 ? 23  LEU A CG   2  
ATOM 2826  C CD1  . LEU A 1 28  ? 4.871   -13.518 -4.800  1.00 24.24 ? 23  LEU A CD1  2  
ATOM 2827  C CD2  . LEU A 1 28  ? 2.615   -12.557 -5.298  1.00 41.54 ? 23  LEU A CD2  2  
ATOM 2828  H H    . LEU A 1 28  ? 2.572   -13.072 -1.379  1.00 11.12 ? 23  LEU A H    2  
ATOM 2829  H HA   . LEU A 1 28  ? 0.830   -13.664 -3.592  1.00 71.23 ? 23  LEU A HA   2  
ATOM 2830  H HB3  . LEU A 1 28  ? 2.693   -15.102 -4.352  1.00 72.50 ? 23  LEU A HB3  2  
ATOM 2831  H HG   . LEU A 1 28  ? 3.672   -12.388 -3.466  1.00 74.45 ? 23  LEU A HG   2  
ATOM 2832  H HD11 . LEU A 1 28  ? 5.629   -13.405 -4.041  1.00 43.33 ? 23  LEU A HD11 2  
ATOM 2833  H HD12 . LEU A 1 28  ? 5.096   -12.868 -5.634  1.00 54.34 ? 23  LEU A HD12 2  
ATOM 2834  H HD13 . LEU A 1 28  ? 4.848   -14.543 -5.139  1.00 71.34 ? 23  LEU A HD13 2  
ATOM 2835  H HD21 . LEU A 1 28  ? 1.847   -13.271 -5.554  1.00 41.54 ? 23  LEU A HD21 2  
ATOM 2836  H HD22 . LEU A 1 28  ? 3.205   -12.332 -6.176  1.00 51.20 ? 23  LEU A HD22 2  
ATOM 2837  H HD23 . LEU A 1 28  ? 2.158   -11.651 -4.930  1.00 10.41 ? 23  LEU A HD23 2  
ATOM 2838  N N    . GLN A 1 29  ? 0.712   -15.542 -1.097  1.00 75.23 ? 24  GLN A N    2  
ATOM 2839  C CA   . GLN A 1 29  ? 0.149   -16.753 -0.510  1.00 22.40 ? 24  GLN A CA   2  
ATOM 2840  C C    . GLN A 1 29  ? 0.985   -17.975 -0.877  1.00 71.33 ? 24  GLN A C    2  
ATOM 2841  O O    . GLN A 1 29  ? 0.485   -19.098 -0.899  1.00 12.44 ? 24  GLN A O    2  
ATOM 2842  C CB   . GLN A 1 29  ? -1.294  -16.949 -0.979  1.00 73.55 ? 24  GLN A CB   2  
ATOM 2843  C CG   . GLN A 1 29  ? -2.252  -15.890 -0.457  1.00 11.23 ? 24  GLN A CG   2  
ATOM 2844  C CD   . GLN A 1 29  ? -3.460  -16.488 0.237   1.00 63.25 ? 24  GLN A CD   2  
ATOM 2845  O OE1  . GLN A 1 29  ? -4.466  -16.800 -0.401  1.00 42.05 ? 24  GLN A OE1  2  
ATOM 2846  N NE2  . GLN A 1 29  ? -3.368  -16.649 1.552   1.00 24.12 ? 24  GLN A NE2  2  
ATOM 2847  H H    . GLN A 1 29  ? 0.942   -14.791 -0.512  1.00 42.22 ? 24  GLN A H    2  
ATOM 2848  H HA   . GLN A 1 29  ? 0.157   -16.636 0.562   1.00 53.03 ? 24  GLN A HA   2  
ATOM 2849  H HB3  . GLN A 1 29  ? -1.641  -17.915 -0.642  1.00 61.31 ? 24  GLN A HB3  2  
ATOM 2850  H HG3  . GLN A 1 29  ? -2.592  -15.290 -1.288  1.00 31.41 ? 24  GLN A HG3  2  
ATOM 2851  H HE21 . GLN A 1 29  ? -2.536  -16.376 1.995   1.00 12.44 ? 24  GLN A HE21 2  
ATOM 2852  H HE22 . GLN A 1 29  ? -4.134  -17.031 2.027   1.00 11.54 ? 24  GLN A HE22 2  
ATOM 2853  N N    . GLY A 1 30  ? 2.263   -17.747 -1.165  1.00 62.54 ? 25  GLY A N    2  
ATOM 2854  C CA   . GLY A 1 30  ? 3.149   -18.838 -1.528  1.00 73.30 ? 25  GLY A CA   2  
ATOM 2855  C C    . GLY A 1 30  ? 4.595   -18.400 -1.636  1.00 23.12 ? 25  GLY A C    2  
ATOM 2856  O O    . GLY A 1 30  ? 4.877   -17.233 -1.904  1.00 64.45 ? 25  GLY A O    2  
ATOM 2857  H H    . GLY A 1 30  ? 2.607   -16.830 -1.131  1.00 43.23 ? 25  GLY A H    2  
ATOM 2858  H HA2  . GLY A 1 30  ? 3.073   -19.612 -0.778  1.00 32.42 ? 25  GLY A HA2  2  
ATOM 2859  H HA3  . GLY A 1 30  ? 2.834   -19.240 -2.479  1.00 72.03 ? 25  GLY A HA3  2  
ATOM 2860  N N    . GLU A 1 31  ? 5.514   -19.338 -1.427  1.00 73.55 ? 26  GLU A N    2  
ATOM 2861  C CA   . GLU A 1 31  ? 6.939   -19.040 -1.500  1.00 31.02 ? 26  GLU A CA   2  
ATOM 2862  C C    . GLU A 1 31  ? 7.355   -18.720 -2.934  1.00 33.44 ? 26  GLU A C    2  
ATOM 2863  O O    . GLU A 1 31  ? 7.441   -19.609 -3.780  1.00 53.32 ? 26  GLU A O    2  
ATOM 2864  C CB   . GLU A 1 31  ? 7.758   -20.220 -0.972  1.00 24.53 ? 26  GLU A CB   2  
ATOM 2865  C CG   . GLU A 1 31  ? 7.405   -21.545 -1.625  1.00 42.51 ? 26  GLU A CG   2  
ATOM 2866  C CD   . GLU A 1 31  ? 8.613   -22.242 -2.221  1.00 64.35 ? 26  GLU A CD   2  
ATOM 2867  O OE1  . GLU A 1 31  ? 9.280   -23.003 -1.488  1.00 61.30 ? 26  GLU A OE1  2  
ATOM 2868  O OE2  . GLU A 1 31  ? 8.893   -22.027 -3.418  1.00 24.54 ? 26  GLU A OE2  2  
ATOM 2869  H H    . GLU A 1 31  ? 5.226   -20.250 -1.217  1.00 54.24 ? 26  GLU A H    2  
ATOM 2870  H HA   . GLU A 1 31  ? 7.130   -18.176 -0.881  1.00 2.23  ? 26  GLU A HA   2  
ATOM 2871  H HB3  . GLU A 1 31  ? 7.590   -20.311 0.091   1.00 3.03  ? 26  GLU A HB3  2  
ATOM 2872  H HG3  . GLU A 1 31  ? 6.687   -21.365 -2.412  1.00 71.32 ? 26  GLU A HG3  2  
ATOM 2873  N N    . TYR A 1 32  ? 7.611   -17.443 -3.197  1.00 23.14 ? 27  TYR A N    2  
ATOM 2874  C CA   . TYR A 1 32  ? 8.014   -17.005 -4.529  1.00 62.43 ? 27  TYR A CA   2  
ATOM 2875  C C    . TYR A 1 32  ? 9.269   -16.140 -4.460  1.00 44.24 ? 27  TYR A C    2  
ATOM 2876  O O    . TYR A 1 32  ? 9.718   -15.595 -5.469  1.00 54.54 ? 27  TYR A O    2  
ATOM 2877  C CB   . TYR A 1 32  ? 6.880   -16.224 -5.196  1.00 64.12 ? 27  TYR A CB   2  
ATOM 2878  C CG   . TYR A 1 32  ? 5.803   -17.107 -5.786  1.00 64.43 ? 27  TYR A CG   2  
ATOM 2879  C CD1  . TYR A 1 32  ? 5.976   -17.715 -7.024  1.00 63.43 ? 27  TYR A CD1  2  
ATOM 2880  C CD2  . TYR A 1 32  ? 4.614   -17.333 -5.106  1.00 33.50 ? 27  TYR A CD2  2  
ATOM 2881  C CE1  . TYR A 1 32  ? 4.994   -18.521 -7.566  1.00 41.23 ? 27  TYR A CE1  2  
ATOM 2882  C CE2  . TYR A 1 32  ? 3.627   -18.138 -5.640  1.00 11.31 ? 27  TYR A CE2  2  
ATOM 2883  C CZ   . TYR A 1 32  ? 3.822   -18.730 -6.871  1.00 11.04 ? 27  TYR A CZ   2  
ATOM 2884  O OH   . TYR A 1 32  ? 2.843   -19.533 -7.408  1.00 15.24 ? 27  TYR A OH   2  
ATOM 2885  H H    . TYR A 1 32  ? 7.525   -16.779 -2.482  1.00 13.04 ? 27  TYR A H    2  
ATOM 2886  H HA   . TYR A 1 32  ? 8.228   -17.884 -5.118  1.00 35.40 ? 27  TYR A HA   2  
ATOM 2887  H HB3  . TYR A 1 32  ? 7.289   -15.621 -5.994  1.00 41.11 ? 27  TYR A HB3  2  
ATOM 2888  H HD1  . TYR A 1 32  ? 6.896   -17.550 -7.565  1.00 65.33 ? 27  TYR A HD1  2  
ATOM 2889  H HD2  . TYR A 1 32  ? 4.464   -16.868 -4.142  1.00 31.05 ? 27  TYR A HD2  2  
ATOM 2890  H HE1  . TYR A 1 32  ? 5.147   -18.985 -8.529  1.00 43.43 ? 27  TYR A HE1  2  
ATOM 2891  H HE2  . TYR A 1 32  ? 2.708   -18.303 -5.096  1.00 21.14 ? 27  TYR A HE2  2  
ATOM 2892  H HH   . TYR A 1 32  ? 2.517   -19.141 -8.221  1.00 13.34 ? 27  TYR A HH   2  
ATOM 2893  N N    . PHE A 1 33  ? 9.831   -16.019 -3.261  1.00 2.11  ? 28  PHE A N    2  
ATOM 2894  C CA   . PHE A 1 33  ? 11.035  -15.221 -3.059  1.00 51.11 ? 28  PHE A CA   2  
ATOM 2895  C C    . PHE A 1 33  ? 11.805  -15.700 -1.831  1.00 22.55 ? 28  PHE A C    2  
ATOM 2896  O O    . PHE A 1 33  ? 11.210  -16.116 -0.836  1.00 65.54 ? 28  PHE A O    2  
ATOM 2897  C CB   . PHE A 1 33  ? 10.673  -13.744 -2.903  1.00 64.32 ? 28  PHE A CB   2  
ATOM 2898  C CG   . PHE A 1 33  ? 11.089  -12.898 -4.073  1.00 4.10  ? 28  PHE A CG   2  
ATOM 2899  C CD1  . PHE A 1 33  ? 12.429  -12.646 -4.320  1.00 24.30 ? 28  PHE A CD1  2  
ATOM 2900  C CD2  . PHE A 1 33  ? 10.141  -12.355 -4.925  1.00 31.14 ? 28  PHE A CD2  2  
ATOM 2901  C CE1  . PHE A 1 33  ? 12.814  -11.867 -5.396  1.00 54.24 ? 28  PHE A CE1  2  
ATOM 2902  C CE2  . PHE A 1 33  ? 10.520  -11.577 -6.002  1.00 65.55 ? 28  PHE A CE2  2  
ATOM 2903  C CZ   . PHE A 1 33  ? 11.859  -11.333 -6.238  1.00 10.13 ? 28  PHE A CZ   2  
ATOM 2904  H H    . PHE A 1 33  ? 9.426   -16.477 -2.495  1.00 44.31 ? 28  PHE A H    2  
ATOM 2905  H HA   . PHE A 1 33  ? 11.661  -15.340 -3.930  1.00 63.12 ? 28  PHE A HA   2  
ATOM 2906  H HB3  . PHE A 1 33  ? 11.157  -13.353 -2.021  1.00 73.41 ? 28  PHE A HB3  2  
ATOM 2907  H HD1  . PHE A 1 33  ? 13.177  -13.063 -3.664  1.00 52.51 ? 28  PHE A HD1  2  
ATOM 2908  H HD2  . PHE A 1 33  ? 9.092   -12.545 -4.741  1.00 34.21 ? 28  PHE A HD2  2  
ATOM 2909  H HE1  . PHE A 1 33  ? 13.861  -11.678 -5.578  1.00 13.40 ? 28  PHE A HE1  2  
ATOM 2910  H HE2  . PHE A 1 33  ? 9.770   -11.160 -6.658  1.00 71.04 ? 28  PHE A HE2  2  
ATOM 2911  H HZ   . PHE A 1 33  ? 12.157  -10.724 -7.078  1.00 15.11 ? 28  PHE A HZ   2  
ATOM 2912  N N    . SER A 1 34  ? 13.129  -15.640 -1.910  1.00 45.42 ? 29  SER A N    2  
ATOM 2913  C CA   . SER A 1 34  ? 13.982  -16.070 -0.808  1.00 14.21 ? 29  SER A CA   2  
ATOM 2914  C C    . SER A 1 34  ? 14.365  -14.888 0.077   1.00 74.44 ? 29  SER A C    2  
ATOM 2915  O O    . SER A 1 34  ? 14.444  -13.744 -0.371  1.00 20.23 ? 29  SER A O    2  
ATOM 2916  C CB   . SER A 1 34  ? 15.243  -16.749 -1.345  1.00 22.02 ? 29  SER A CB   2  
ATOM 2917  O OG   . SER A 1 34  ? 15.220  -18.143 -1.092  1.00 3.45  ? 29  SER A OG   2  
ATOM 2918  H H    . SER A 1 34  ? 13.544  -15.299 -2.731  1.00 42.34 ? 29  SER A H    2  
ATOM 2919  H HA   . SER A 1 34  ? 13.425  -16.782 -0.216  1.00 5.44  ? 29  SER A HA   2  
ATOM 2920  H HB3  . SER A 1 34  ? 16.111  -16.322 -0.864  1.00 53.33 ? 29  SER A HB3  2  
ATOM 2921  H HG   . SER A 1 34  ? 15.782  -18.342 -0.341  1.00 62.25 ? 29  SER A HG   2  
ATOM 2922  N N    . PRO A 1 35  ? 14.608  -15.170 1.367   1.00 5.05  ? 30  PRO A N    2  
ATOM 2923  C CA   . PRO A 1 35  ? 14.987  -14.144 2.342   1.00 64.01 ? 30  PRO A CA   2  
ATOM 2924  C C    . PRO A 1 35  ? 16.389  -13.598 2.095   1.00 5.21  ? 30  PRO A C    2  
ATOM 2925  O O    . PRO A 1 35  ? 16.645  -12.408 2.279   1.00 21.34 ? 30  PRO A O    2  
ATOM 2926  C CB   . PRO A 1 35  ? 14.931  -14.889 3.679   1.00 45.32 ? 30  PRO A CB   2  
ATOM 2927  C CG   . PRO A 1 35  ? 15.153  -16.319 3.325   1.00 60.51 ? 30  PRO A CG   2  
ATOM 2928  C CD   . PRO A 1 35  ? 14.533  -16.511 1.969   1.00 32.11 ? 30  PRO A CD   2  
ATOM 2929  H HA   . PRO A 1 35  ? 14.281  -13.327 2.353   1.00 74.52 ? 30  PRO A HA   2  
ATOM 2930  H HB3  . PRO A 1 35  ? 13.965  -14.741 4.137   1.00 65.34 ? 30  PRO A HB3  2  
ATOM 2931  H HG3  . PRO A 1 35  ? 14.670  -16.955 4.052   1.00 0.42  ? 30  PRO A HG3  2  
ATOM 2932  H HD3  . PRO A 1 35  ? 13.506  -16.832 2.066   1.00 11.31 ? 30  PRO A HD3  2  
ATOM 2933  N N    . VAL A 1 36  ? 17.296  -14.476 1.676   1.00 64.41 ? 31  VAL A N    2  
ATOM 2934  C CA   . VAL A 1 36  ? 18.672  -14.082 1.402   1.00 24.22 ? 31  VAL A CA   2  
ATOM 2935  C C    . VAL A 1 36  ? 18.745  -13.127 0.216   1.00 21.52 ? 31  VAL A C    2  
ATOM 2936  O O    . VAL A 1 36  ? 19.444  -12.116 0.263   1.00 44.20 ? 31  VAL A O    2  
ATOM 2937  C CB   . VAL A 1 36  ? 19.561  -15.306 1.115   1.00 40.30 ? 31  VAL A CB   2  
ATOM 2938  C CG1  . VAL A 1 36  ? 21.027  -14.902 1.058   1.00 35.54 ? 31  VAL A CG1  2  
ATOM 2939  C CG2  . VAL A 1 36  ? 19.337  -16.383 2.166   1.00 41.30 ? 31  VAL A CG2  2  
ATOM 2940  H H    . VAL A 1 36  ? 17.032  -15.411 1.548   1.00 53.13 ? 31  VAL A H    2  
ATOM 2941  H HA   . VAL A 1 36  ? 19.058  -13.581 2.279   1.00 32.14 ? 31  VAL A HA   2  
ATOM 2942  H HB   . VAL A 1 36  ? 19.284  -15.709 0.152   1.00 74.12 ? 31  VAL A HB   2  
ATOM 2943  H HG11 . VAL A 1 36  ? 21.229  -14.177 1.833   1.00 53.45 ? 31  VAL A HG11 2  
ATOM 2944  H HG12 . VAL A 1 36  ? 21.647  -15.774 1.206   1.00 32.40 ? 31  VAL A HG12 2  
ATOM 2945  H HG13 . VAL A 1 36  ? 21.242  -14.466 0.094   1.00 11.23 ? 31  VAL A HG13 2  
ATOM 2946  H HG21 . VAL A 1 36  ? 19.083  -15.920 3.108   1.00 3.20  ? 31  VAL A HG21 2  
ATOM 2947  H HG22 . VAL A 1 36  ? 18.530  -17.029 1.854   1.00 32.15 ? 31  VAL A HG22 2  
ATOM 2948  H HG23 . VAL A 1 36  ? 20.239  -16.966 2.282   1.00 33.32 ? 31  VAL A HG23 2  
ATOM 2949  N N    . GLU A 1 37  ? 18.014  -13.454 -0.846  1.00 61.45 ? 32  GLU A N    2  
ATOM 2950  C CA   . GLU A 1 37  ? 17.996  -12.624 -2.045  1.00 40.12 ? 32  GLU A CA   2  
ATOM 2951  C C    . GLU A 1 37  ? 17.312  -11.288 -1.771  1.00 4.01  ? 32  GLU A C    2  
ATOM 2952  O O    . GLU A 1 37  ? 17.881  -10.223 -2.019  1.00 54.22 ? 32  GLU A O    2  
ATOM 2953  C CB   . GLU A 1 37  ? 17.281  -13.352 -3.185  1.00 52.50 ? 32  GLU A CB   2  
ATOM 2954  C CG   . GLU A 1 37  ? 18.208  -13.783 -4.309  1.00 2.22  ? 32  GLU A CG   2  
ATOM 2955  C CD   . GLU A 1 37  ? 18.203  -15.283 -4.528  1.00 73.42 ? 32  GLU A CD   2  
ATOM 2956  O OE1  . GLU A 1 37  ? 18.400  -16.026 -3.543  1.00 14.33 ? 32  GLU A OE1  2  
ATOM 2957  O OE2  . GLU A 1 37  ? 18.001  -15.715 -5.682  1.00 71.31 ? 32  GLU A OE2  2  
ATOM 2958  H H    . GLU A 1 37  ? 17.476  -14.273 -0.823  1.00 63.33 ? 32  GLU A H    2  
ATOM 2959  H HA   . GLU A 1 37  ? 19.019  -12.439 -2.335  1.00 64.21 ? 32  GLU A HA   2  
ATOM 2960  H HB3  . GLU A 1 37  ? 16.529  -12.696 -3.599  1.00 73.31 ? 32  GLU A HB3  2  
ATOM 2961  H HG3  . GLU A 1 37  ? 19.214  -13.473 -4.067  1.00 72.11 ? 32  GLU A HG3  2  
ATOM 2962  N N    . LEU A 1 38  ? 16.087  -11.350 -1.261  1.00 52.41 ? 33  LEU A N    2  
ATOM 2963  C CA   . LEU A 1 38  ? 15.324  -10.146 -0.953  1.00 5.34  ? 33  LEU A CA   2  
ATOM 2964  C C    . LEU A 1 38  ? 16.105  -9.230  -0.019  1.00 64.04 ? 33  LEU A C    2  
ATOM 2965  O O    . LEU A 1 38  ? 16.099  -8.009  -0.180  1.00 31.43 ? 33  LEU A O    2  
ATOM 2966  C CB   . LEU A 1 38  ? 13.982  -10.516 -0.320  1.00 13.22 ? 33  LEU A CB   2  
ATOM 2967  C CG   . LEU A 1 38  ? 12.760  -9.763  -0.846  1.00 53.51 ? 33  LEU A CG   2  
ATOM 2968  C CD1  . LEU A 1 38  ? 12.985  -8.262  -0.769  1.00 32.23 ? 33  LEU A CD1  2  
ATOM 2969  C CD2  . LEU A 1 38  ? 12.448  -10.186 -2.274  1.00 23.12 ? 33  LEU A CD2  2  
ATOM 2970  H H    . LEU A 1 38  ? 15.687  -12.227 -1.086  1.00 34.14 ? 33  LEU A H    2  
ATOM 2971  H HA   . LEU A 1 38  ? 15.142  -9.624  -1.881  1.00 41.20 ? 33  LEU A HA   2  
ATOM 2972  H HB3  . LEU A 1 38  ? 14.056  -10.328 0.743   1.00 4.53  ? 33  LEU A HB3  2  
ATOM 2973  H HG   . LEU A 1 38  ? 11.904  -10.005 -0.231  1.00 12.14 ? 33  LEU A HG   2  
ATOM 2974  H HD11 . LEU A 1 38  ? 12.053  -7.770  -0.531  1.00 55.15 ? 33  LEU A HD11 2  
ATOM 2975  H HD12 . LEU A 1 38  ? 13.347  -7.902  -1.720  1.00 53.35 ? 33  LEU A HD12 2  
ATOM 2976  H HD13 . LEU A 1 38  ? 13.712  -8.046  -0.001  1.00 75.34 ? 33  LEU A HD13 2  
ATOM 2977  H HD21 . LEU A 1 38  ? 13.342  -10.579 -2.736  1.00 21.15 ? 33  LEU A HD21 2  
ATOM 2978  H HD22 . LEU A 1 38  ? 12.101  -9.329  -2.835  1.00 14.23 ? 33  LEU A HD22 2  
ATOM 2979  H HD23 . LEU A 1 38  ? 11.682  -10.947 -2.266  1.00 3.11  ? 33  LEU A HD23 2  
ATOM 2980  N N    . SER A 1 39  ? 16.781  -9.826  0.959   1.00 2.55  ? 34  SER A N    2  
ATOM 2981  C CA   . SER A 1 39  ? 17.567  -9.064  1.921   1.00 23.21 ? 34  SER A CA   2  
ATOM 2982  C C    . SER A 1 39  ? 18.782  -8.431  1.250   1.00 61.42 ? 34  SER A C    2  
ATOM 2983  O O    . SER A 1 39  ? 19.121  -7.277  1.515   1.00 73.35 ? 34  SER A O    2  
ATOM 2984  C CB   . SER A 1 39  ? 18.018  -9.965  3.071   1.00 72.25 ? 34  SER A CB   2  
ATOM 2985  O OG   . SER A 1 39  ? 18.919  -10.960 2.618   1.00 3.31  ? 34  SER A OG   2  
ATOM 2986  H H    . SER A 1 39  ? 16.748  -10.803 1.034   1.00 73.12 ? 34  SER A H    2  
ATOM 2987  H HA   . SER A 1 39  ? 16.938  -8.279  2.315   1.00 1.11  ? 34  SER A HA   2  
ATOM 2988  H HB3  . SER A 1 39  ? 17.155  -10.449 3.506   1.00 22.21 ? 34  SER A HB3  2  
ATOM 2989  H HG   . SER A 1 39  ? 19.287  -11.427 3.371   1.00 44.21 ? 34  SER A HG   2  
ATOM 2990  N N    . SER A 1 40  ? 19.433  -9.194  0.379   1.00 44.35 ? 35  SER A N    2  
ATOM 2991  C CA   . SER A 1 40  ? 20.615  -8.710  -0.329  1.00 34.30 ? 35  SER A CA   2  
ATOM 2992  C C    . SER A 1 40  ? 20.250  -7.577  -1.282  1.00 34.23 ? 35  SER A C    2  
ATOM 2993  O O    . SER A 1 40  ? 20.986  -6.599  -1.411  1.00 43.25 ? 35  SER A O    2  
ATOM 2994  C CB   . SER A 1 40  ? 21.273  -9.853  -1.104  1.00 63.32 ? 35  SER A CB   2  
ATOM 2995  O OG   . SER A 1 40  ? 22.506  -9.440  -1.670  1.00 32.34 ? 35  SER A OG   2  
ATOM 2996  H H    . SER A 1 40  ? 19.115  -10.105 0.210   1.00 33.02 ? 35  SER A H    2  
ATOM 2997  H HA   . SER A 1 40  ? 21.311  -8.336  0.407   1.00 40.33 ? 35  SER A HA   2  
ATOM 2998  H HB3  . SER A 1 40  ? 20.614  -10.172 -1.899  1.00 64.52 ? 35  SER A HB3  2  
ATOM 2999  H HG   . SER A 1 40  ? 22.337  -8.901  -2.446  1.00 12.23 ? 35  SER A HG   2  
ATOM 3000  N N    . ILE A 1 41  ? 19.108  -7.716  -1.948  1.00 71.12 ? 36  ILE A N    2  
ATOM 3001  C CA   . ILE A 1 41  ? 18.644  -6.704  -2.888  1.00 3.43  ? 36  ILE A CA   2  
ATOM 3002  C C    . ILE A 1 41  ? 18.295  -5.405  -2.171  1.00 13.35 ? 36  ILE A C    2  
ATOM 3003  O O    . ILE A 1 41  ? 18.723  -4.326  -2.576  1.00 31.31 ? 36  ILE A O    2  
ATOM 3004  C CB   . ILE A 1 41  ? 17.414  -7.190  -3.677  1.00 2.12  ? 36  ILE A CB   2  
ATOM 3005  C CG1  . ILE A 1 41  ? 17.762  -8.438  -4.492  1.00 62.44 ? 36  ILE A CG1  2  
ATOM 3006  C CG2  . ILE A 1 41  ? 16.897  -6.085  -4.586  1.00 50.10 ? 36  ILE A CG2  2  
ATOM 3007  C CD1  . ILE A 1 41  ? 16.555  -9.259  -4.887  1.00 63.32 ? 36  ILE A CD1  2  
ATOM 3008  H H    . ILE A 1 41  ? 18.564  -8.519  -1.802  1.00 64.03 ? 36  ILE A H    2  
ATOM 3009  H HA   . ILE A 1 41  ? 19.444  -6.511  -3.591  1.00 13.24 ? 36  ILE A HA   2  
ATOM 3010  H HB   . ILE A 1 41  ? 16.636  -7.436  -2.971  1.00 73.41 ? 36  ILE A HB   2  
ATOM 3011  H HG13 . ILE A 1 41  ? 18.417  -9.068  -3.907  1.00 30.34 ? 36  ILE A HG13 2  
ATOM 3012  H HG21 . ILE A 1 41  ? 17.613  -5.277  -4.613  1.00 44.50 ? 36  ILE A HG21 2  
ATOM 3013  H HG22 . ILE A 1 41  ? 16.758  -6.475  -5.583  1.00 41.15 ? 36  ILE A HG22 2  
ATOM 3014  H HG23 . ILE A 1 41  ? 15.955  -5.719  -4.208  1.00 70.31 ? 36  ILE A HG23 2  
ATOM 3015  H HD11 . ILE A 1 41  ? 16.847  -10.291 -5.014  1.00 30.22 ? 36  ILE A HD11 2  
ATOM 3016  H HD12 . ILE A 1 41  ? 15.803  -9.188  -4.115  1.00 13.44 ? 36  ILE A HD12 2  
ATOM 3017  H HD13 . ILE A 1 41  ? 16.153  -8.882  -5.816  1.00 32.23 ? 36  ILE A HD13 2  
ATOM 3018  N N    . ALA A 1 42  ? 17.513  -5.519  -1.102  1.00 71.44 ? 37  ALA A N    2  
ATOM 3019  C CA   . ALA A 1 42  ? 17.109  -4.354  -0.324  1.00 22.14 ? 37  ALA A CA   2  
ATOM 3020  C C    . ALA A 1 42  ? 18.319  -3.642  0.270   1.00 2.34  ? 37  ALA A C    2  
ATOM 3021  O O    . ALA A 1 42  ? 18.410  -2.415  0.233   1.00 72.21 ? 37  ALA A O    2  
ATOM 3022  C CB   . ALA A 1 42  ? 16.142  -4.765  0.777   1.00 2.33  ? 37  ALA A CB   2  
ATOM 3023  H H    . ALA A 1 42  ? 17.203  -6.408  -0.829  1.00 62.44 ? 37  ALA A H    2  
ATOM 3024  H HA   . ALA A 1 42  ? 16.593  -3.674  -0.987  1.00 70.31 ? 37  ALA A HA   2  
ATOM 3025  H HB1  . ALA A 1 42  ? 16.630  -4.667  1.736   1.00 15.24 ? 37  ALA A HB1  2  
ATOM 3026  H HB2  . ALA A 1 42  ? 15.271  -4.127  0.748   1.00 63.14 ? 37  ALA A HB2  2  
ATOM 3027  H HB3  . ALA A 1 42  ? 15.842  -5.791  0.628   1.00 52.52 ? 37  ALA A HB3  2  
ATOM 3028  N N    . HIS A 1 43  ? 19.248  -4.421  0.816   1.00 22.31 ? 38  HIS A N    2  
ATOM 3029  C CA   . HIS A 1 43  ? 20.455  -3.864  1.418   1.00 33.24 ? 38  HIS A CA   2  
ATOM 3030  C C    . HIS A 1 43  ? 21.393  -3.315  0.348   1.00 2.34  ? 38  HIS A C    2  
ATOM 3031  O O    . HIS A 1 43  ? 22.113  -2.345  0.579   1.00 22.11 ? 38  HIS A O    2  
ATOM 3032  C CB   . HIS A 1 43  ? 21.174  -4.928  2.247   1.00 41.21 ? 38  HIS A CB   2  
ATOM 3033  C CG   . HIS A 1 43  ? 22.444  -4.441  2.874   1.00 50.44 ? 38  HIS A CG   2  
ATOM 3034  N ND1  . HIS A 1 43  ? 23.582  -5.215  2.965   1.00 73.43 ? 38  HIS A ND1  2  
ATOM 3035  C CD2  . HIS A 1 43  ? 22.752  -3.252  3.441   1.00 45.53 ? 38  HIS A CD2  2  
ATOM 3036  C CE1  . HIS A 1 43  ? 24.536  -4.522  3.563   1.00 34.44 ? 38  HIS A CE1  2  
ATOM 3037  N NE2  . HIS A 1 43  ? 24.057  -3.327  3.861   1.00 71.13 ? 38  HIS A NE2  2  
ATOM 3038  H H    . HIS A 1 43  ? 19.120  -5.392  0.814   1.00 23.35 ? 38  HIS A H    2  
ATOM 3039  H HA   . HIS A 1 43  ? 20.157  -3.054  2.068   1.00 2.35  ? 38  HIS A HA   2  
ATOM 3040  H HB3  . HIS A 1 43  ? 21.417  -5.767  1.611   1.00 4.20  ? 38  HIS A HB3  2  
ATOM 3041  H HD1  . HIS A 1 43  ? 23.677  -6.135  2.643   1.00 72.40 ? 38  HIS A HD1  2  
ATOM 3042  H HD2  . HIS A 1 43  ? 22.094  -2.400  3.543   1.00 40.32 ? 38  HIS A HD2  2  
ATOM 3043  H HE1  . HIS A 1 43  ? 25.535  -4.872  3.773   1.00 3.25  ? 38  HIS A HE1  2  
ATOM 3044  N N    . GLN A 1 44  ? 21.378  -3.944  -0.824  1.00 64.21 ? 39  GLN A N    2  
ATOM 3045  C CA   . GLN A 1 44  ? 22.229  -3.519  -1.929  1.00 44.22 ? 39  GLN A CA   2  
ATOM 3046  C C    . GLN A 1 44  ? 21.801  -2.152  -2.451  1.00 11.43 ? 39  GLN A C    2  
ATOM 3047  O O    . GLN A 1 44  ? 22.629  -1.258  -2.636  1.00 14.35 ? 39  GLN A O    2  
ATOM 3048  C CB   . GLN A 1 44  ? 22.184  -4.547  -3.060  1.00 15.41 ? 39  GLN A CB   2  
ATOM 3049  C CG   . GLN A 1 44  ? 23.245  -5.630  -2.941  1.00 53.41 ? 39  GLN A CG   2  
ATOM 3050  C CD   . GLN A 1 44  ? 24.497  -5.308  -3.732  1.00 42.12 ? 39  GLN A CD   2  
ATOM 3051  O OE1  . GLN A 1 44  ? 24.536  -5.476  -4.951  1.00 65.23 ? 39  GLN A OE1  2  
ATOM 3052  N NE2  . GLN A 1 44  ? 25.532  -4.844  -3.040  1.00 11.11 ? 39  GLN A NE2  2  
ATOM 3053  H H    . GLN A 1 44  ? 20.782  -4.712  -0.947  1.00 63.43 ? 39  GLN A H    2  
ATOM 3054  H HA   . GLN A 1 44  ? 23.241  -3.448  -1.559  1.00 31.12 ? 39  GLN A HA   2  
ATOM 3055  H HB3  . GLN A 1 44  ? 22.326  -4.037  -4.001  1.00 64.11 ? 39  GLN A HB3  2  
ATOM 3056  H HG3  . GLN A 1 44  ? 22.835  -6.560  -3.306  1.00 10.03 ? 39  GLN A HG3  2  
ATOM 3057  H HE21 . GLN A 1 44  ? 25.430  -4.738  -2.071  1.00 22.22 ? 39  GLN A HE21 2  
ATOM 3058  H HE22 . GLN A 1 44  ? 26.354  -4.629  -3.525  1.00 2.32  ? 39  GLN A HE22 2  
ATOM 3059  N N    . LEU A 1 45  ? 20.503  -1.996  -2.688  1.00 25.32 ? 40  LEU A N    2  
ATOM 3060  C CA   . LEU A 1 45  ? 19.964  -0.737  -3.191  1.00 62.31 ? 40  LEU A CA   2  
ATOM 3061  C C    . LEU A 1 45  ? 20.001  0.342   -2.112  1.00 35.01 ? 40  LEU A C    2  
ATOM 3062  O O    . LEU A 1 45  ? 20.250  1.512   -2.398  1.00 51.11 ? 40  LEU A O    2  
ATOM 3063  C CB   . LEU A 1 45  ? 18.528  -0.933  -3.682  1.00 72.03 ? 40  LEU A CB   2  
ATOM 3064  C CG   . LEU A 1 45  ? 17.448  -0.971  -2.599  1.00 51.44 ? 40  LEU A CG   2  
ATOM 3065  C CD1  . LEU A 1 45  ? 16.926  0.429   -2.318  1.00 70.24 ? 40  LEU A CD1  2  
ATOM 3066  C CD2  . LEU A 1 45  ? 16.311  -1.893  -3.013  1.00 34.01 ? 40  LEU A CD2  2  
ATOM 3067  H H    . LEU A 1 45  ? 19.892  -2.743  -2.523  1.00 73.25 ? 40  LEU A H    2  
ATOM 3068  H HA   . LEU A 1 45  ? 20.579  -0.420  -4.021  1.00 71.44 ? 40  LEU A HA   2  
ATOM 3069  H HB3  . LEU A 1 45  ? 18.489  -1.869  -4.222  1.00 72.24 ? 40  LEU A HB3  2  
ATOM 3070  H HG   . LEU A 1 45  ? 17.878  -1.357  -1.684  1.00 21.15 ? 40  LEU A HG   2  
ATOM 3071  H HD11 . LEU A 1 45  ? 17.585  0.926   -1.620  1.00 0.04  ? 40  LEU A HD11 2  
ATOM 3072  H HD12 . LEU A 1 45  ? 15.935  0.365   -1.894  1.00 63.23 ? 40  LEU A HD12 2  
ATOM 3073  H HD13 . LEU A 1 45  ? 16.888  0.991   -3.239  1.00 30.25 ? 40  LEU A HD13 2  
ATOM 3074  H HD21 . LEU A 1 45  ? 15.813  -1.485  -3.880  1.00 64.44 ? 40  LEU A HD21 2  
ATOM 3075  H HD22 . LEU A 1 45  ? 15.604  -1.979  -2.200  1.00 42.42 ? 40  LEU A HD22 2  
ATOM 3076  H HD23 . LEU A 1 45  ? 16.707  -2.869  -3.252  1.00 34.10 ? 40  LEU A HD23 2  
ATOM 3077  N N    . ASP A 1 46  ? 19.755  -0.063  -0.871  1.00 51.32 ? 41  ASP A N    2  
ATOM 3078  C CA   . ASP A 1 46  ? 19.764  0.867   0.253   1.00 22.32 ? 41  ASP A CA   2  
ATOM 3079  C C    . ASP A 1 46  ? 21.182  1.342   0.553   1.00 32.43 ? 41  ASP A C    2  
ATOM 3080  O O    . ASP A 1 46  ? 21.414  2.530   0.777   1.00 3.22  ? 41  ASP A O    2  
ATOM 3081  C CB   . ASP A 1 46  ? 19.159  0.208   1.493   1.00 51.25 ? 41  ASP A CB   2  
ATOM 3082  C CG   . ASP A 1 46  ? 17.660  0.020   1.377   1.00 52.31 ? 41  ASP A CG   2  
ATOM 3083  O OD1  . ASP A 1 46  ? 17.022  0.790   0.630   1.00 62.12 ? 41  ASP A OD1  2  
ATOM 3084  O OD2  . ASP A 1 46  ? 17.123  -0.898  2.034   1.00 43.01 ? 41  ASP A OD2  2  
ATOM 3085  H H    . ASP A 1 46  ? 19.563  -1.010  -0.705  1.00 3.23  ? 41  ASP A H    2  
ATOM 3086  H HA   . ASP A 1 46  ? 19.162  1.720   -0.019  1.00 31.51 ? 41  ASP A HA   2  
ATOM 3087  H HB3  . ASP A 1 46  ? 19.361  0.825   2.356   1.00 63.12 ? 41  ASP A HB3  2  
ATOM 3088  N N    . GLU A 1 47  ? 22.125  0.406   0.558   1.00 43.32 ? 42  GLU A N    2  
ATOM 3089  C CA   . GLU A 1 47  ? 23.521  0.730   0.833   1.00 32.23 ? 42  GLU A CA   2  
ATOM 3090  C C    . GLU A 1 47  ? 24.110  1.589   -0.283  1.00 73.35 ? 42  GLU A C    2  
ATOM 3091  O O    . GLU A 1 47  ? 24.762  2.600   -0.022  1.00 40.31 ? 42  GLU A O    2  
ATOM 3092  C CB   . GLU A 1 47  ? 24.342  -0.550  0.995   1.00 41.40 ? 42  GLU A CB   2  
ATOM 3093  C CG   . GLU A 1 47  ? 25.737  -0.312  1.550   1.00 31.01 ? 42  GLU A CG   2  
ATOM 3094  C CD   . GLU A 1 47  ? 26.733  -1.360  1.092   1.00 62.11 ? 42  GLU A CD   2  
ATOM 3095  O OE1  . GLU A 1 47  ? 26.609  -1.836  -0.055  1.00 4.34  ? 42  GLU A OE1  2  
ATOM 3096  O OE2  . GLU A 1 47  ? 27.638  -1.702  1.883   1.00 4.31  ? 42  GLU A OE2  2  
ATOM 3097  H H    . GLU A 1 47  ? 21.879  -0.523  0.372   1.00 12.13 ? 42  GLU A H    2  
ATOM 3098  H HA   . GLU A 1 47  ? 23.556  1.288   1.757   1.00 20.22 ? 42  GLU A HA   2  
ATOM 3099  H HB3  . GLU A 1 47  ? 24.438  -1.025  0.030   1.00 41.13 ? 42  GLU A HB3  2  
ATOM 3100  H HG3  . GLU A 1 47  ? 25.688  -0.330  2.628   1.00 72.54 ? 42  GLU A HG3  2  
ATOM 3101  N N    . GLU A 1 48  ? 23.876  1.178   -1.524  1.00 12.33 ? 43  GLU A N    2  
ATOM 3102  C CA   . GLU A 1 48  ? 24.385  1.909   -2.679  1.00 54.35 ? 43  GLU A CA   2  
ATOM 3103  C C    . GLU A 1 48  ? 23.773  3.305   -2.752  1.00 42.22 ? 43  GLU A C    2  
ATOM 3104  O O    . GLU A 1 48  ? 24.458  4.277   -3.071  1.00 15.25 ? 43  GLU A O    2  
ATOM 3105  C CB   . GLU A 1 48  ? 24.086  1.142   -3.968  1.00 14.33 ? 43  GLU A CB   2  
ATOM 3106  C CG   . GLU A 1 48  ? 25.079  1.417   -5.085  1.00 53.21 ? 43  GLU A CG   2  
ATOM 3107  C CD   . GLU A 1 48  ? 26.224  0.423   -5.105  1.00 53.51 ? 43  GLU A CD   2  
ATOM 3108  O OE1  . GLU A 1 48  ? 26.901  0.276   -4.065  1.00 11.14 ? 43  GLU A OE1  2  
ATOM 3109  O OE2  . GLU A 1 48  ? 26.444  -0.209  -6.160  1.00 64.15 ? 43  GLU A OE2  2  
ATOM 3110  H H    . GLU A 1 48  ? 23.350  0.364   -1.667  1.00 30.13 ? 43  GLU A H    2  
ATOM 3111  H HA   . GLU A 1 48  ? 25.454  2.003   -2.567  1.00 40.33 ? 43  GLU A HA   2  
ATOM 3112  H HB3  . GLU A 1 48  ? 23.101  1.415   -4.316  1.00 25.12 ? 43  GLU A HB3  2  
ATOM 3113  H HG3  . GLU A 1 48  ? 25.485  2.408   -4.951  1.00 42.14 ? 43  GLU A HG3  2  
ATOM 3114  N N    . GLU A 1 49  ? 22.481  3.395   -2.453  1.00 3.31  ? 44  GLU A N    2  
ATOM 3115  C CA   . GLU A 1 49  ? 21.778  4.672   -2.487  1.00 71.32 ? 44  GLU A CA   2  
ATOM 3116  C C    . GLU A 1 49  ? 22.221  5.567   -1.334  1.00 34.32 ? 44  GLU A C    2  
ATOM 3117  O O    . GLU A 1 49  ? 22.266  6.790   -1.466  1.00 60.42 ? 44  GLU A O    2  
ATOM 3118  C CB   . GLU A 1 49  ? 20.265  4.448   -2.422  1.00 72.11 ? 44  GLU A CB   2  
ATOM 3119  C CG   . GLU A 1 49  ? 19.657  4.011   -3.744  1.00 74.34 ? 44  GLU A CG   2  
ATOM 3120  C CD   . GLU A 1 49  ? 18.185  3.669   -3.623  1.00 15.32 ? 44  GLU A CD   2  
ATOM 3121  O OE1  . GLU A 1 49  ? 17.689  3.569   -2.481  1.00 43.21 ? 44  GLU A OE1  2  
ATOM 3122  O OE2  . GLU A 1 49  ? 17.529  3.499   -4.672  1.00 32.44 ? 44  GLU A OE2  2  
ATOM 3123  H H    . GLU A 1 49  ? 21.990  2.585   -2.206  1.00 15.12 ? 44  GLU A H    2  
ATOM 3124  H HA   . GLU A 1 49  ? 22.020  5.159   -3.419  1.00 63.21 ? 44  GLU A HA   2  
ATOM 3125  H HB3  . GLU A 1 49  ? 19.791  5.369   -2.118  1.00 12.12 ? 44  GLU A HB3  2  
ATOM 3126  H HG3  . GLU A 1 49  ? 20.187  3.140   -4.099  1.00 34.33 ? 44  GLU A HG3  2  
ATOM 3127  N N    . ARG A 1 50  ? 22.546  4.949   -0.203  1.00 73.21 ? 45  ARG A N    2  
ATOM 3128  C CA   . ARG A 1 50  ? 22.984  5.689   0.974   1.00 11.22 ? 45  ARG A CA   2  
ATOM 3129  C C    . ARG A 1 50  ? 24.378  6.269   0.764   1.00 41.25 ? 45  ARG A C    2  
ATOM 3130  O O    . ARG A 1 50  ? 24.638  7.424   1.098   1.00 60.53 ? 45  ARG A O    2  
ATOM 3131  C CB   . ARG A 1 50  ? 22.977  4.781   2.205   1.00 40.14 ? 45  ARG A CB   2  
ATOM 3132  C CG   . ARG A 1 50  ? 23.098  5.535   3.519   1.00 60.14 ? 45  ARG A CG   2  
ATOM 3133  C CD   . ARG A 1 50  ? 23.205  4.584   4.700   1.00 54.32 ? 45  ARG A CD   2  
ATOM 3134  N NE   . ARG A 1 50  ? 24.416  4.816   5.483   1.00 34.32 ? 45  ARG A NE   2  
ATOM 3135  C CZ   . ARG A 1 50  ? 24.613  5.898   6.227   1.00 61.53 ? 45  ARG A CZ   2  
ATOM 3136  N NH1  . ARG A 1 50  ? 23.684  6.842   6.289   1.00 73.22 ? 45  ARG A NH1  2  
ATOM 3137  N NH2  . ARG A 1 50  ? 25.741  6.038   6.912   1.00 40.43 ? 45  ARG A NH2  2  
ATOM 3138  H H    . ARG A 1 50  ? 22.490  3.971   -0.159  1.00 3.44  ? 45  ARG A H    2  
ATOM 3139  H HA   . ARG A 1 50  ? 22.289  6.500   1.133   1.00 41.42 ? 45  ARG A HA   2  
ATOM 3140  H HB3  . ARG A 1 50  ? 23.806  4.092   2.133   1.00 64.21 ? 45  ARG A HB3  2  
ATOM 3141  H HG3  . ARG A 1 50  ? 22.226  6.158   3.647   1.00 61.13 ? 45  ARG A HG3  2  
ATOM 3142  H HD3  . ARG A 1 50  ? 23.216  3.570   4.328   1.00 41.45 ? 45  ARG A HD3  2  
ATOM 3143  H HE   . ARG A 1 50  ? 25.114  4.131   5.451   1.00 52.55 ? 45  ARG A HE   2  
ATOM 3144  H HH11 . ARG A 1 50  ? 22.833  6.739   5.776   1.00 71.13 ? 45  ARG A HH11 2  
ATOM 3145  H HH12 . ARG A 1 50  ? 23.835  7.656   6.852   1.00 41.22 ? 45  ARG A HH12 2  
ATOM 3146  H HH21 . ARG A 1 50  ? 26.443  5.328   6.867   1.00 42.31 ? 45  ARG A HH21 2  
ATOM 3147  H HH22 . ARG A 1 50  ? 25.889  6.853   7.471   1.00 12.33 ? 45  ARG A HH22 2  
ATOM 3148  N N    . MET A 1 51  ? 25.273  5.459   0.207   1.00 43.35 ? 46  MET A N    2  
ATOM 3149  C CA   . MET A 1 51  ? 26.642  5.893   -0.048  1.00 63.12 ? 46  MET A CA   2  
ATOM 3150  C C    . MET A 1 51  ? 26.684  6.926   -1.170  1.00 44.24 ? 46  MET A C    2  
ATOM 3151  O O    . MET A 1 51  ? 27.423  7.908   -1.094  1.00 2.21  ? 46  MET A O    2  
ATOM 3152  C CB   . MET A 1 51  ? 27.521  4.694   -0.409  1.00 12.24 ? 46  MET A CB   2  
ATOM 3153  C CG   . MET A 1 51  ? 27.091  3.988   -1.685  1.00 1.42  ? 46  MET A CG   2  
ATOM 3154  S SD   . MET A 1 51  ? 28.116  2.554   -2.064  1.00 1.22  ? 46  MET A SD   2  
ATOM 3155  C CE   . MET A 1 51  ? 27.541  1.390   -0.830  1.00 4.00  ? 46  MET A CE   2  
ATOM 3156  H H    . MET A 1 51  ? 25.008  4.548   -0.038  1.00 21.34 ? 46  MET A H    2  
ATOM 3157  H HA   . MET A 1 51  ? 27.020  6.345   0.856   1.00 23.41 ? 46  MET A HA   2  
ATOM 3158  H HB3  . MET A 1 51  ? 27.486  3.980   0.400   1.00 71.23 ? 46  MET A HB3  2  
ATOM 3159  H HG3  . MET A 1 51  ? 27.156  4.687   -2.506  1.00 13.31 ? 46  MET A HG3  2  
ATOM 3160  H HE1  . MET A 1 51  ? 27.636  1.831   0.152   1.00 53.53 ? 46  MET A HE1  2  
ATOM 3161  H HE2  . MET A 1 51  ? 26.504  1.151   -1.018  1.00 52.14 ? 46  MET A HE2  2  
ATOM 3162  H HE3  . MET A 1 51  ? 28.135  0.489   -0.880  1.00 2.31  ? 46  MET A HE3  2  
ATOM 3163  N N    . ARG A 1 52  ? 25.889  6.696   -2.210  1.00 61.12 ? 47  ARG A N    2  
ATOM 3164  C CA   . ARG A 1 52  ? 25.838  7.606   -3.348  1.00 11.21 ? 47  ARG A CA   2  
ATOM 3165  C C    . ARG A 1 52  ? 25.191  8.932   -2.956  1.00 13.15 ? 47  ARG A C    2  
ATOM 3166  O O    . ARG A 1 52  ? 25.567  9.990   -3.459  1.00 12.20 ? 47  ARG A O    2  
ATOM 3167  C CB   . ARG A 1 52  ? 25.061  6.970   -4.502  1.00 44.42 ? 47  ARG A CB   2  
ATOM 3168  C CG   . ARG A 1 52  ? 23.562  7.208   -4.433  1.00 54.40 ? 47  ARG A CG   2  
ATOM 3169  C CD   . ARG A 1 52  ? 22.849  6.620   -5.640  1.00 23.35 ? 47  ARG A CD   2  
ATOM 3170  N NE   . ARG A 1 52  ? 22.938  5.163   -5.673  1.00 25.25 ? 47  ARG A NE   2  
ATOM 3171  C CZ   . ARG A 1 52  ? 22.104  4.391   -6.362  1.00 71.41 ? 47  ARG A CZ   2  
ATOM 3172  N NH1  . ARG A 1 52  ? 21.124  4.935   -7.070  1.00 20.11 ? 47  ARG A NH1  2  
ATOM 3173  N NH2  . ARG A 1 52  ? 22.249  3.073   -6.342  1.00 44.53 ? 47  ARG A NH2  2  
ATOM 3174  H H    . ARG A 1 52  ? 25.324  5.896   -2.212  1.00 21.14 ? 47  ARG A H    2  
ATOM 3175  H HA   . ARG A 1 52  ? 26.852  7.795   -3.668  1.00 0.31  ? 47  ARG A HA   2  
ATOM 3176  H HB3  . ARG A 1 52  ? 25.236  5.904   -4.493  1.00 44.12 ? 47  ARG A HB3  2  
ATOM 3177  H HG3  . ARG A 1 52  ? 23.378  8.271   -4.398  1.00 75.41 ? 47  ARG A HG3  2  
ATOM 3178  H HD3  . ARG A 1 52  ? 23.298  7.020   -6.537  1.00 33.02 ? 47  ARG A HD3  2  
ATOM 3179  H HE   . ARG A 1 52  ? 23.654  4.741   -5.157  1.00 13.23 ? 47  ARG A HE   2  
ATOM 3180  H HH11 . ARG A 1 52  ? 21.013  5.929   -7.088  1.00 75.21 ? 47  ARG A HH11 2  
ATOM 3181  H HH12 . ARG A 1 52  ? 20.498  4.352   -7.589  1.00 22.24 ? 47  ARG A HH12 2  
ATOM 3182  H HH21 . ARG A 1 52  ? 22.987  2.659   -5.809  1.00 51.40 ? 47  ARG A HH21 2  
ATOM 3183  H HH22 . ARG A 1 52  ? 21.621  2.492   -6.861  1.00 62.44 ? 47  ARG A HH22 2  
ATOM 3184  N N    . MET A 1 53  ? 24.216  8.864   -2.055  1.00 2.10  ? 48  MET A N    2  
ATOM 3185  C CA   . MET A 1 53  ? 23.518  10.059  -1.596  1.00 73.23 ? 48  MET A CA   2  
ATOM 3186  C C    . MET A 1 53  ? 24.401  10.879  -0.660  1.00 33.24 ? 48  MET A C    2  
ATOM 3187  O O    . MET A 1 53  ? 24.566  12.084  -0.846  1.00 62.54 ? 48  MET A O    2  
ATOM 3188  C CB   . MET A 1 53  ? 22.220  9.674   -0.883  1.00 22.21 ? 48  MET A CB   2  
ATOM 3189  C CG   . MET A 1 53  ? 21.055  9.432   -1.829  1.00 50.42 ? 48  MET A CG   2  
ATOM 3190  S SD   . MET A 1 53  ? 19.983  10.872  -1.995  1.00 13.51 ? 48  MET A SD   2  
ATOM 3191  C CE   . MET A 1 53  ? 21.195  12.178  -2.176  1.00 14.44 ? 48  MET A CE   2  
ATOM 3192  H H    . MET A 1 53  ? 23.961  7.991   -1.690  1.00 24.53 ? 48  MET A H    2  
ATOM 3193  H HA   . MET A 1 53  ? 23.279  10.656  -2.462  1.00 22.42 ? 48  MET A HA   2  
ATOM 3194  H HB3  . MET A 1 53  ? 21.945  10.470  -0.206  1.00 51.10 ? 48  MET A HB3  2  
ATOM 3195  H HG3  . MET A 1 53  ? 20.471  8.605   -1.454  1.00 75.01 ? 48  MET A HG3  2  
ATOM 3196  H HE1  . MET A 1 53  ? 20.689  13.118  -2.338  1.00 60.11 ? 48  MET A HE1  2  
ATOM 3197  H HE2  . MET A 1 53  ? 21.794  12.239  -1.280  1.00 71.34 ? 48  MET A HE2  2  
ATOM 3198  H HE3  . MET A 1 53  ? 21.833  11.961  -3.022  1.00 30.32 ? 48  MET A HE3  2  
ATOM 3199  N N    . ALA A 1 54  ? 24.965  10.218  0.345   1.00 2.43  ? 49  ALA A N    2  
ATOM 3200  C CA   . ALA A 1 54  ? 25.833  10.885  1.307   1.00 42.04 ? 49  ALA A CA   2  
ATOM 3201  C C    . ALA A 1 54  ? 27.038  11.514  0.617   1.00 3.25  ? 49  ALA A C    2  
ATOM 3202  O O    . ALA A 1 54  ? 27.433  12.635  0.935   1.00 54.12 ? 49  ALA A O    2  
ATOM 3203  C CB   . ALA A 1 54  ? 26.288  9.905   2.377   1.00 51.01 ? 49  ALA A CB   2  
ATOM 3204  H H    . ALA A 1 54  ? 24.795  9.258   0.440   1.00 52.52 ? 49  ALA A H    2  
ATOM 3205  H HA   . ALA A 1 54  ? 25.259  11.665  1.788   1.00 51.24 ? 49  ALA A HA   2  
ATOM 3206  H HB1  . ALA A 1 54  ? 25.429  9.549   2.928   1.00 5.22  ? 49  ALA A HB1  2  
ATOM 3207  H HB2  . ALA A 1 54  ? 26.788  9.069   1.910   1.00 54.11 ? 49  ALA A HB2  2  
ATOM 3208  H HB3  . ALA A 1 54  ? 26.969  10.400  3.054   1.00 2.41  ? 49  ALA A HB3  2  
ATOM 3209  N N    . GLU A 1 55  ? 27.618  10.785  -0.332  1.00 51.25 ? 50  GLU A N    2  
ATOM 3210  C CA   . GLU A 1 55  ? 28.780  11.272  -1.067  1.00 73.14 ? 50  GLU A CA   2  
ATOM 3211  C C    . GLU A 1 55  ? 28.369  12.312  -2.105  1.00 40.44 ? 50  GLU A C    2  
ATOM 3212  O O    . GLU A 1 55  ? 29.217  12.917  -2.762  1.00 74.53 ? 50  GLU A O    2  
ATOM 3213  C CB   . GLU A 1 55  ? 29.503  10.109  -1.750  1.00 20.24 ? 50  GLU A CB   2  
ATOM 3214  C CG   . GLU A 1 55  ? 28.798  9.603   -2.998  1.00 72.00 ? 50  GLU A CG   2  
ATOM 3215  C CD   . GLU A 1 55  ? 29.567  9.912   -4.268  1.00 14.35 ? 50  GLU A CD   2  
ATOM 3216  O OE1  . GLU A 1 55  ? 30.272  10.941  -4.299  1.00 64.45 ? 50  GLU A OE1  2  
ATOM 3217  O OE2  . GLU A 1 55  ? 29.463  9.123   -5.231  1.00 53.05 ? 50  GLU A OE2  2  
ATOM 3218  H H    . GLU A 1 55  ? 27.257  9.899   -0.542  1.00 53.31 ? 50  GLU A H    2  
ATOM 3219  H HA   . GLU A 1 55  ? 29.451  11.734  -0.358  1.00 13.12 ? 50  GLU A HA   2  
ATOM 3220  H HB3  . GLU A 1 55  ? 29.584  9.291   -1.050  1.00 10.34 ? 50  GLU A HB3  2  
ATOM 3221  H HG3  . GLU A 1 55  ? 27.825  10.070  -3.061  1.00 52.24 ? 50  GLU A HG3  2  
ATOM 3222  N N    . GLY A 1 56  ? 27.064  12.513  -2.249  1.00 62.51 ? 51  GLY A N    2  
ATOM 3223  C CA   . GLY A 1 56  ? 26.563  13.479  -3.209  1.00 45.32 ? 51  GLY A CA   2  
ATOM 3224  C C    . GLY A 1 56  ? 26.410  12.891  -4.598  1.00 55.14 ? 51  GLY A C    2  
ATOM 3225  O O    . GLY A 1 56  ? 27.347  12.913  -5.396  1.00 75.41 ? 51  GLY A O    2  
ATOM 3226  H H    . GLY A 1 56  ? 26.434  12.002  -1.698  1.00 10.40 ? 51  GLY A H    2  
ATOM 3227  H HA2  . GLY A 1 56  ? 25.602  13.839  -2.874  1.00 1.02  ? 51  GLY A HA2  2  
ATOM 3228  H HA3  . GLY A 1 56  ? 27.251  14.311  -3.257  1.00 64.20 ? 51  GLY A HA3  2  
ATOM 3229  N N    . GLY A 1 57  ? 25.226  12.361  -4.886  1.00 12.45 ? 52  GLY A N    2  
ATOM 3230  C CA   . GLY A 1 57  ? 24.976  11.769  -6.188  1.00 71.02 ? 52  GLY A CA   2  
ATOM 3231  C C    . GLY A 1 57  ? 24.409  12.766  -7.179  1.00 23.04 ? 52  GLY A C    2  
ATOM 3232  O O    . GLY A 1 57  ? 25.018  13.802  -7.445  1.00 23.50 ? 52  GLY A O    2  
ATOM 3233  H H    . GLY A 1 57  ? 24.516  12.371  -4.211  1.00 12.43 ? 52  GLY A H    2  
ATOM 3234  H HA2  . GLY A 1 57  ? 25.904  11.377  -6.578  1.00 74.35 ? 52  GLY A HA2  2  
ATOM 3235  H HA3  . GLY A 1 57  ? 24.274  10.956  -6.073  1.00 35.21 ? 52  GLY A HA3  2  
ATOM 3236  N N    . VAL A 1 58  ? 23.240  12.452  -7.728  1.00 24.22 ? 53  VAL A N    2  
ATOM 3237  C CA   . VAL A 1 58  ? 22.591  13.328  -8.697  1.00 64.10 ? 53  VAL A CA   2  
ATOM 3238  C C    . VAL A 1 58  ? 21.713  14.363  -8.001  1.00 54.43 ? 53  VAL A C    2  
ATOM 3239  O O    . VAL A 1 58  ? 21.721  14.477  -6.774  1.00 12.42 ? 53  VAL A O    2  
ATOM 3240  C CB   . VAL A 1 58  ? 21.730  12.526  -9.691  1.00 21.00 ? 53  VAL A CB   2  
ATOM 3241  C CG1  . VAL A 1 58  ? 22.564  11.455  -10.376 1.00 51.31 ? 53  VAL A CG1  2  
ATOM 3242  C CG2  . VAL A 1 58  ? 20.533  11.911  -8.983  1.00 54.14 ? 53  VAL A CG2  2  
ATOM 3243  H H    . VAL A 1 58  ? 22.803  11.612  -7.477  1.00 41.15 ? 53  VAL A H    2  
ATOM 3244  H HA   . VAL A 1 58  ? 23.362  13.842  -9.253  1.00 40.20 ? 53  VAL A HA   2  
ATOM 3245  H HB   . VAL A 1 58  ? 21.364  13.204  -10.448 1.00 23.01 ? 53  VAL A HB   2  
ATOM 3246  H HG11 . VAL A 1 58  ? 23.102  10.887  -9.631  1.00 73.34 ? 53  VAL A HG11 2  
ATOM 3247  H HG12 . VAL A 1 58  ? 21.916  10.796  -10.934 1.00 15.31 ? 53  VAL A HG12 2  
ATOM 3248  H HG13 . VAL A 1 58  ? 23.269  11.922  -11.048 1.00 15.42 ? 53  VAL A HG13 2  
ATOM 3249  H HG21 . VAL A 1 58  ? 19.929  12.694  -8.550  1.00 61.13 ? 53  VAL A HG21 2  
ATOM 3250  H HG22 . VAL A 1 58  ? 19.942  11.352  -9.694  1.00 12.11 ? 53  VAL A HG22 2  
ATOM 3251  H HG23 . VAL A 1 58  ? 20.877  11.249  -8.202  1.00 0.42  ? 53  VAL A HG23 2  
ATOM 3252  N N    . THR A 1 59  ? 20.954  15.116  -8.791  1.00 15.21 ? 54  THR A N    2  
ATOM 3253  C CA   . THR A 1 59  ? 20.070  16.141  -8.250  1.00 2.33  ? 54  THR A CA   2  
ATOM 3254  C C    . THR A 1 59  ? 18.662  16.007  -8.819  1.00 52.21 ? 54  THR A C    2  
ATOM 3255  O O    . THR A 1 59  ? 18.173  16.901  -9.509  1.00 63.00 ? 54  THR A O    2  
ATOM 3256  C CB   . THR A 1 59  ? 20.601  17.555  -8.552  1.00 73.24 ? 54  THR A CB   2  
ATOM 3257  O OG1  . THR A 1 59  ? 21.976  17.655  -8.165  1.00 11.35 ? 54  THR A OG1  2  
ATOM 3258  C CG2  . THR A 1 59  ? 19.785  18.607  -7.816  1.00 3.10  ? 54  THR A CG2  2  
ATOM 3259  H H    . THR A 1 59  ? 20.991  14.977  -9.760  1.00 63.03 ? 54  THR A H    2  
ATOM 3260  H HA   . THR A 1 59  ? 20.029  16.014  -7.179  1.00 60.14 ? 54  THR A HA   2  
ATOM 3261  H HB   . THR A 1 59  ? 20.520  17.735  -9.614  1.00 24.44 ? 54  THR A HB   2  
ATOM 3262  H HG1  . THR A 1 59  ? 22.063  17.442  -7.232  1.00 2.52  ? 54  THR A HG1  2  
ATOM 3263  H HG21 . THR A 1 59  ? 18.858  18.170  -7.474  1.00 22.04 ? 54  THR A HG21 2  
ATOM 3264  H HG22 . THR A 1 59  ? 19.571  19.428  -8.484  1.00 32.31 ? 54  THR A HG22 2  
ATOM 3265  H HG23 . THR A 1 59  ? 20.346  18.969  -6.968  1.00 20.14 ? 54  THR A HG23 2  
ATOM 3266  N N    . SER A 1 60  ? 18.013  14.885  -8.524  1.00 71.34 ? 55  SER A N    2  
ATOM 3267  C CA   . SER A 1 60  ? 16.661  14.633  -9.008  1.00 63.51 ? 55  SER A CA   2  
ATOM 3268  C C    . SER A 1 60  ? 16.152  13.280  -8.520  1.00 25.14 ? 55  SER A C    2  
ATOM 3269  O O    . SER A 1 60  ? 15.332  13.208  -7.605  1.00 61.13 ? 55  SER A O    2  
ATOM 3270  C CB   . SER A 1 60  ? 16.627  14.683  -10.537 1.00 21.22 ? 55  SER A CB   2  
ATOM 3271  O OG   . SER A 1 60  ? 16.108  15.919  -10.996 1.00 15.33 ? 55  SER A OG   2  
ATOM 3272  H H    . SER A 1 60  ? 18.456  14.209  -7.968  1.00 43.12 ? 55  SER A H    2  
ATOM 3273  H HA   . SER A 1 60  ? 16.019  15.409  -8.617  1.00 64.31 ? 55  SER A HA   2  
ATOM 3274  H HB3  . SER A 1 60  ? 16.001  13.883  -10.906 1.00 34.20 ? 55  SER A HB3  2  
ATOM 3275  H HG   . SER A 1 60  ? 15.261  16.086  -10.577 1.00 72.44 ? 55  SER A HG   2  
ATOM 3276  N N    . GLU A 1 61  ? 16.645  12.212  -9.138  1.00 31.34 ? 56  GLU A N    2  
ATOM 3277  C CA   . GLU A 1 61  ? 16.238  10.862  -8.768  1.00 50.44 ? 56  GLU A CA   2  
ATOM 3278  C C    . GLU A 1 61  ? 16.680  10.531  -7.345  1.00 65.25 ? 56  GLU A C    2  
ATOM 3279  O O    . GLU A 1 61  ? 15.949  9.895   -6.588  1.00 35.41 ? 56  GLU A O    2  
ATOM 3280  C CB   . GLU A 1 61  ? 16.827  9.842   -9.745  1.00 21.20 ? 56  GLU A CB   2  
ATOM 3281  C CG   . GLU A 1 61  ? 15.943  8.626   -9.963  1.00 32.42 ? 56  GLU A CG   2  
ATOM 3282  C CD   . GLU A 1 61  ? 16.463  7.713   -11.056 1.00 73.21 ? 56  GLU A CD   2  
ATOM 3283  O OE1  . GLU A 1 61  ? 17.218  8.199   -11.924 1.00 54.14 ? 56  GLU A OE1  2  
ATOM 3284  O OE2  . GLU A 1 61  ? 16.117  6.513   -11.043 1.00 35.53 ? 56  GLU A OE2  2  
ATOM 3285  H H    . GLU A 1 61  ? 17.295  12.335  -9.861  1.00 22.10 ? 56  GLU A H    2  
ATOM 3286  H HA   . GLU A 1 61  ? 15.162  10.814  -8.817  1.00 12.43 ? 56  GLU A HA   2  
ATOM 3287  H HB3  . GLU A 1 61  ? 17.779  9.504   -9.364  1.00 52.11 ? 56  GLU A HB3  2  
ATOM 3288  H HG3  . GLU A 1 61  ? 14.953  8.961   -10.235 1.00 25.33 ? 56  GLU A HG3  2  
ATOM 3289  N N    . ASP A 1 62  ? 17.884  10.970  -6.989  1.00 1.34  ? 57  ASP A N    2  
ATOM 3290  C CA   . ASP A 1 62  ? 18.424  10.722  -5.657  1.00 23.43 ? 57  ASP A CA   2  
ATOM 3291  C C    . ASP A 1 62  ? 17.608  11.453  -4.595  1.00 44.42 ? 57  ASP A C    2  
ATOM 3292  O O    . ASP A 1 62  ? 17.265  10.881  -3.560  1.00 44.03 ? 57  ASP A O    2  
ATOM 3293  C CB   . ASP A 1 62  ? 19.887  11.163  -5.588  1.00 15.04 ? 57  ASP A CB   2  
ATOM 3294  C CG   . ASP A 1 62  ? 20.848  9.991   -5.634  1.00 52.31 ? 57  ASP A CG   2  
ATOM 3295  O OD1  . ASP A 1 62  ? 20.473  8.940   -6.194  1.00 14.40 ? 57  ASP A OD1  2  
ATOM 3296  O OD2  . ASP A 1 62  ? 21.973  10.126  -5.111  1.00 52.44 ? 57  ASP A OD2  2  
ATOM 3297  H H    . ASP A 1 62  ? 18.420  11.472  -7.637  1.00 0.34  ? 57  ASP A H    2  
ATOM 3298  H HA   . ASP A 1 62  ? 18.368  9.661   -5.470  1.00 73.24 ? 57  ASP A HA   2  
ATOM 3299  H HB3  . ASP A 1 62  ? 20.050  11.703  -4.667  1.00 70.24 ? 57  ASP A HB3  2  
ATOM 3300  N N    . TYR A 1 63  ? 17.302  12.718  -4.859  1.00 3.23  ? 58  TYR A N    2  
ATOM 3301  C CA   . TYR A 1 63  ? 16.530  13.528  -3.924  1.00 4.13  ? 58  TYR A CA   2  
ATOM 3302  C C    . TYR A 1 63  ? 15.135  12.946  -3.722  1.00 3.14  ? 58  TYR A C    2  
ATOM 3303  O O    . TYR A 1 63  ? 14.646  12.850  -2.597  1.00 44.23 ? 58  TYR A O    2  
ATOM 3304  C CB   . TYR A 1 63  ? 16.427  14.968  -4.430  1.00 24.14 ? 58  TYR A CB   2  
ATOM 3305  C CG   . TYR A 1 63  ? 17.585  15.843  -4.009  1.00 33.12 ? 58  TYR A CG   2  
ATOM 3306  C CD1  . TYR A 1 63  ? 17.958  15.940  -2.674  1.00 30.10 ? 58  TYR A CD1  2  
ATOM 3307  C CD2  . TYR A 1 63  ? 18.306  16.573  -4.944  1.00 4.43  ? 58  TYR A CD2  2  
ATOM 3308  C CE1  . TYR A 1 63  ? 19.016  16.739  -2.284  1.00 71.50 ? 58  TYR A CE1  2  
ATOM 3309  C CE2  . TYR A 1 63  ? 19.367  17.373  -4.564  1.00 34.34 ? 58  TYR A CE2  2  
ATOM 3310  C CZ   . TYR A 1 63  ? 19.717  17.453  -3.233  1.00 14.01 ? 58  TYR A CZ   2  
ATOM 3311  O OH   . TYR A 1 63  ? 20.771  18.250  -2.849  1.00 20.11 ? 58  TYR A OH   2  
ATOM 3312  H H    . TYR A 1 63  ? 17.604  13.118  -5.701  1.00 54.43 ? 58  TYR A H    2  
ATOM 3313  H HA   . TYR A 1 63  ? 17.049  13.527  -2.977  1.00 41.41 ? 58  TYR A HA   2  
ATOM 3314  H HB3  . TYR A 1 63  ? 15.519  15.412  -4.048  1.00 53.04 ? 58  TYR A HB3  2  
ATOM 3315  H HD1  . TYR A 1 63  ? 17.406  15.380  -1.932  1.00 44.50 ? 58  TYR A HD1  2  
ATOM 3316  H HD2  . TYR A 1 63  ? 18.029  16.509  -5.987  1.00 54.32 ? 58  TYR A HD2  2  
ATOM 3317  H HE1  . TYR A 1 63  ? 19.291  16.802  -1.241  1.00 2.23  ? 58  TYR A HE1  2  
ATOM 3318  H HE2  . TYR A 1 63  ? 19.916  17.933  -5.307  1.00 12.25 ? 58  TYR A HE2  2  
ATOM 3319  H HH   . TYR A 1 63  ? 20.443  19.116  -2.598  1.00 35.11 ? 58  TYR A HH   2  
ATOM 3320  N N    . ARG A 1 64  ? 14.498  12.558  -4.823  1.00 20.11 ? 59  ARG A N    2  
ATOM 3321  C CA   . ARG A 1 64  ? 13.158  11.985  -4.769  1.00 45.32 ? 59  ARG A CA   2  
ATOM 3322  C C    . ARG A 1 64  ? 13.173  10.636  -4.057  1.00 12.25 ? 59  ARG A C    2  
ATOM 3323  O O    . ARG A 1 64  ? 12.323  10.359  -3.211  1.00 72.52 ? 59  ARG A O    2  
ATOM 3324  C CB   . ARG A 1 64  ? 12.592  11.823  -6.181  1.00 51.30 ? 59  ARG A CB   2  
ATOM 3325  C CG   . ARG A 1 64  ? 12.347  13.143  -6.894  1.00 31.21 ? 59  ARG A CG   2  
ATOM 3326  C CD   . ARG A 1 64  ? 11.083  13.822  -6.389  1.00 51.34 ? 59  ARG A CD   2  
ATOM 3327  N NE   . ARG A 1 64  ? 9.883   13.058  -6.717  1.00 21.43 ? 59  ARG A NE   2  
ATOM 3328  C CZ   . ARG A 1 64  ? 8.687   13.310  -6.197  1.00 23.23 ? 59  ARG A CZ   2  
ATOM 3329  N NH1  . ARG A 1 64  ? 8.532   14.301  -5.330  1.00 54.01 ? 59  ARG A NH1  2  
ATOM 3330  N NH2  . ARG A 1 64  ? 7.642   12.570  -6.546  1.00 71.43 ? 59  ARG A NH2  2  
ATOM 3331  H H    . ARG A 1 64  ? 14.939  12.660  -5.692  1.00 52.23 ? 59  ARG A H    2  
ATOM 3332  H HA   . ARG A 1 64  ? 12.529  12.665  -4.214  1.00 51.42 ? 59  ARG A HA   2  
ATOM 3333  H HB3  . ARG A 1 64  ? 11.655  11.291  -6.121  1.00 61.02 ? 59  ARG A HB3  2  
ATOM 3334  H HG3  . ARG A 1 64  ? 12.247  12.956  -7.952  1.00 21.22 ? 59  ARG A HG3  2  
ATOM 3335  H HD3  . ARG A 1 64  ? 11.012  14.800  -6.841  1.00 75.13 ? 59  ARG A HD3  2  
ATOM 3336  H HE   . ARG A 1 64  ? 9.974   12.322  -7.356  1.00 74.31 ? 59  ARG A HE   2  
ATOM 3337  H HH11 . ARG A 1 64  ? 9.319   14.861  -5.067  1.00 34.52 ? 59  ARG A HH11 2  
ATOM 3338  H HH12 . ARG A 1 64  ? 7.631   14.490  -4.941  1.00 21.04 ? 59  ARG A HH12 2  
ATOM 3339  H HH21 . ARG A 1 64  ? 7.754   11.823  -7.199  1.00 40.13 ? 59  ARG A HH21 2  
ATOM 3340  H HH22 . ARG A 1 64  ? 6.742   12.761  -6.154  1.00 20.44 ? 59  ARG A HH22 2  
ATOM 3341  N N    . THR A 1 65  ? 14.144  9.798   -4.407  1.00 15.33 ? 60  THR A N    2  
ATOM 3342  C CA   . THR A 1 65  ? 14.268  8.477   -3.804  1.00 72.51 ? 60  THR A CA   2  
ATOM 3343  C C    . THR A 1 65  ? 14.392  8.574   -2.287  1.00 23.53 ? 60  THR A C    2  
ATOM 3344  O O    . THR A 1 65  ? 13.694  7.876   -1.550  1.00 4.34  ? 60  THR A O    2  
ATOM 3345  C CB   . THR A 1 65  ? 15.488  7.718   -4.358  1.00 12.45 ? 60  THR A CB   2  
ATOM 3346  O OG1  . THR A 1 65  ? 15.337  7.513   -5.768  1.00 3.22  ? 60  THR A OG1  2  
ATOM 3347  C CG2  . THR A 1 65  ? 15.654  6.376   -3.661  1.00 3.01  ? 60  THR A CG2  2  
ATOM 3348  H H    . THR A 1 65  ? 14.791  10.076  -5.088  1.00 12.34 ? 60  THR A H    2  
ATOM 3349  H HA   . THR A 1 65  ? 13.379  7.914   -4.047  1.00 32.42 ? 60  THR A HA   2  
ATOM 3350  H HB   . THR A 1 65  ? 16.373  8.312   -4.182  1.00 74.33 ? 60  THR A HB   2  
ATOM 3351  H HG1  . THR A 1 65  ? 14.450  7.194   -5.952  1.00 23.24 ? 60  THR A HG1  2  
ATOM 3352  H HG21 . THR A 1 65  ? 15.934  6.539   -2.630  1.00 21.31 ? 60  THR A HG21 2  
ATOM 3353  H HG22 . THR A 1 65  ? 16.424  5.806   -4.157  1.00 14.51 ? 60  THR A HG22 2  
ATOM 3354  H HG23 . THR A 1 65  ? 14.722  5.833   -3.698  1.00 5.44  ? 60  THR A HG23 2  
ATOM 3355  N N    . PHE A 1 66  ? 15.282  9.446   -1.826  1.00 42.44 ? 61  PHE A N    2  
ATOM 3356  C CA   . PHE A 1 66  ? 15.498  9.635   -0.396  1.00 22.33 ? 61  PHE A CA   2  
ATOM 3357  C C    . PHE A 1 66  ? 14.311  10.352  0.242   1.00 52.12 ? 61  PHE A C    2  
ATOM 3358  O O    . PHE A 1 66  ? 13.845  9.970   1.317   1.00 0.45  ? 61  PHE A O    2  
ATOM 3359  C CB   . PHE A 1 66  ? 16.780  10.432  -0.153  1.00 61.35 ? 61  PHE A CB   2  
ATOM 3360  C CG   . PHE A 1 66  ? 17.409  10.163  1.185   1.00 43.05 ? 61  PHE A CG   2  
ATOM 3361  C CD1  . PHE A 1 66  ? 16.794  10.587  2.352   1.00 4.20  ? 61  PHE A CD1  2  
ATOM 3362  C CD2  . PHE A 1 66  ? 18.615  9.486   1.275   1.00 35.14 ? 61  PHE A CD2  2  
ATOM 3363  C CE1  . PHE A 1 66  ? 17.370  10.341  3.583   1.00 73.24 ? 61  PHE A CE1  2  
ATOM 3364  C CE2  . PHE A 1 66  ? 19.196  9.237   2.504   1.00 73.51 ? 61  PHE A CE2  2  
ATOM 3365  C CZ   . PHE A 1 66  ? 18.573  9.664   3.660   1.00 22.52 ? 61  PHE A CZ   2  
ATOM 3366  H H    . PHE A 1 66  ? 15.808  9.975   -2.463  1.00 11.01 ? 61  PHE A H    2  
ATOM 3367  H HA   . PHE A 1 66  ? 15.599  8.660   0.054   1.00 72.22 ? 61  PHE A HA   2  
ATOM 3368  H HB3  . PHE A 1 66  ? 16.557  11.487  -0.210  1.00 54.12 ? 61  PHE A HB3  2  
ATOM 3369  H HD1  . PHE A 1 66  ? 15.854  11.115  2.294   1.00 0.23  ? 61  PHE A HD1  2  
ATOM 3370  H HD2  . PHE A 1 66  ? 19.103  9.151   0.370   1.00 74.55 ? 61  PHE A HD2  2  
ATOM 3371  H HE1  . PHE A 1 66  ? 16.881  10.675  4.486   1.00 63.45 ? 61  PHE A HE1  2  
ATOM 3372  H HE2  . PHE A 1 66  ? 20.135  8.707   2.560   1.00 64.22 ? 61  PHE A HE2  2  
ATOM 3373  H HZ   . PHE A 1 66  ? 19.025  9.471   4.621   1.00 73.43 ? 61  PHE A HZ   2  
ATOM 3374  N N    . LEU A 1 67  ? 13.829  11.393  -0.425  1.00 33.45 ? 62  LEU A N    2  
ATOM 3375  C CA   . LEU A 1 67  ? 12.696  12.165  0.075   1.00 52.14 ? 62  LEU A CA   2  
ATOM 3376  C C    . LEU A 1 67  ? 11.496  11.262  0.342   1.00 40.42 ? 62  LEU A C    2  
ATOM 3377  O O    . LEU A 1 67  ? 10.727  11.495  1.275   1.00 43.13 ? 62  LEU A O    2  
ATOM 3378  C CB   . LEU A 1 67  ? 12.315  13.257  -0.925  1.00 14.44 ? 62  LEU A CB   2  
ATOM 3379  C CG   . LEU A 1 67  ? 13.108  14.560  -0.833  1.00 42.05 ? 62  LEU A CG   2  
ATOM 3380  C CD1  . LEU A 1 67  ? 12.941  15.380  -2.103  1.00 51.13 ? 62  LEU A CD1  2  
ATOM 3381  C CD2  . LEU A 1 67  ? 12.673  15.364  0.384   1.00 31.42 ? 62  LEU A CD2  2  
ATOM 3382  H H    . LEU A 1 67  ? 14.241  11.650  -1.276  1.00 60.50 ? 62  LEU A H    2  
ATOM 3383  H HA   . LEU A 1 67  ? 12.997  12.629  1.004   1.00 15.24 ? 62  LEU A HA   2  
ATOM 3384  H HB3  . LEU A 1 67  ? 11.271  13.492  -0.775  1.00 63.31 ? 62  LEU A HB3  2  
ATOM 3385  H HG   . LEU A 1 67  ? 14.158  14.328  -0.721  1.00 44.20 ? 62  LEU A HG   2  
ATOM 3386  H HD11 . LEU A 1 67  ? 12.494  14.766  -2.870  1.00 34.41 ? 62  LEU A HD11 2  
ATOM 3387  H HD12 . LEU A 1 67  ? 13.908  15.726  -2.437  1.00 22.35 ? 62  LEU A HD12 2  
ATOM 3388  H HD13 . LEU A 1 67  ? 12.304  16.229  -1.902  1.00 0.31  ? 62  LEU A HD13 2  
ATOM 3389  H HD21 . LEU A 1 67  ? 13.477  16.017  0.690   1.00 22.32 ? 62  LEU A HD21 2  
ATOM 3390  H HD22 . LEU A 1 67  ? 12.428  14.690  1.192   1.00 61.01 ? 62  LEU A HD22 2  
ATOM 3391  H HD23 . LEU A 1 67  ? 11.805  15.955  0.133   1.00 24.24 ? 62  LEU A HD23 2  
ATOM 3392  N N    . GLN A 1 68  ? 11.345  10.230  -0.481  1.00 35.42 ? 63  GLN A N    2  
ATOM 3393  C CA   . GLN A 1 68  ? 10.239  9.291   -0.333  1.00 74.35 ? 63  GLN A CA   2  
ATOM 3394  C C    . GLN A 1 68  ? 10.449  8.390   0.881   1.00 24.53 ? 63  GLN A C    2  
ATOM 3395  O O    . GLN A 1 68  ? 9.488   7.899   1.473   1.00 44.32 ? 63  GLN A O    2  
ATOM 3396  C CB   . GLN A 1 68  ? 10.093  8.439   -1.595  1.00 34.41 ? 63  GLN A CB   2  
ATOM 3397  C CG   . GLN A 1 68  ? 9.180   7.237   -1.415  1.00 33.30 ? 63  GLN A CG   2  
ATOM 3398  C CD   . GLN A 1 68  ? 8.299   6.986   -2.623  1.00 43.52 ? 63  GLN A CD   2  
ATOM 3399  O OE1  . GLN A 1 68  ? 7.162   7.454   -2.685  1.00 1.14  ? 63  GLN A OE1  2  
ATOM 3400  N NE2  . GLN A 1 68  ? 8.822   6.245   -3.593  1.00 25.02 ? 63  GLN A NE2  2  
ATOM 3401  H H    . GLN A 1 68  ? 11.991  10.096  -1.205  1.00 63.32 ? 63  GLN A H    2  
ATOM 3402  H HA   . GLN A 1 68  ? 9.335   9.863   -0.189  1.00 50.43 ? 63  GLN A HA   2  
ATOM 3403  H HB3  . GLN A 1 68  ? 11.068  8.081   -1.889  1.00 60.14 ? 63  GLN A HB3  2  
ATOM 3404  H HG3  . GLN A 1 68  ? 8.547   7.407   -0.556  1.00 1.02  ? 63  GLN A HG3  2  
ATOM 3405  H HE21 . GLN A 1 68  ? 9.734   5.905   -3.474  1.00 10.30 ? 63  GLN A HE21 2  
ATOM 3406  H HE22 . GLN A 1 68  ? 8.275   6.067   -4.385  1.00 42.51 ? 63  GLN A HE22 2  
ATOM 3407  N N    . GLN A 1 69  ? 11.710  8.180   1.244   1.00 71.40 ? 64  GLN A N    2  
ATOM 3408  C CA   . GLN A 1 69  ? 12.044  7.338   2.387   1.00 71.33 ? 64  GLN A CA   2  
ATOM 3409  C C    . GLN A 1 69  ? 13.554  7.260   2.583   1.00 5.22  ? 64  GLN A C    2  
ATOM 3410  O O    . GLN A 1 69  ? 14.336  7.449   1.650   1.00 71.04 ? 64  GLN A O    2  
ATOM 3411  C CB   . GLN A 1 69  ? 11.470  5.933   2.198   1.00 4.24  ? 64  GLN A CB   2  
ATOM 3412  C CG   . GLN A 1 69  ? 11.767  5.333   0.833   1.00 5.25  ? 64  GLN A CG   2  
ATOM 3413  C CD   . GLN A 1 69  ? 11.440  3.855   0.760   1.00 74.50 ? 64  GLN A CD   2  
ATOM 3414  O OE1  . GLN A 1 69  ? 10.686  3.415   -0.108  1.00 50.43 ? 64  GLN A OE1  2  
ATOM 3415  N NE2  . GLN A 1 69  ? 12.006  3.078   1.677   1.00 51.42 ? 64  GLN A NE2  2  
ATOM 3416  H H    . GLN A 1 69  ? 12.432  8.600   0.732   1.00 32.42 ? 64  GLN A H    2  
ATOM 3417  H HA   . GLN A 1 69  ? 11.602  7.781   3.266   1.00 61.20 ? 64  GLN A HA   2  
ATOM 3418  H HB3  . GLN A 1 69  ? 10.398  5.975   2.322   1.00 31.02 ? 64  GLN A HB3  2  
ATOM 3419  H HG3  . GLN A 1 69  ? 12.816  5.466   0.616   1.00 53.44 ? 64  GLN A HG3  2  
ATOM 3420  H HE21 . GLN A 1 69  ? 12.595  3.498   2.339   1.00 74.23 ? 64  GLN A HE21 2  
ATOM 3421  H HE22 . GLN A 1 69  ? 11.812  2.118   1.655   1.00 4.33  ? 64  GLN A HE22 2  
ATOM 3422  N N    . PRO A 1 70  ? 13.977  6.977   3.823   1.00 74.43 ? 65  PRO A N    2  
ATOM 3423  C CA   . PRO A 1 70  ? 15.398  6.867   4.170   1.00 23.54 ? 65  PRO A CA   2  
ATOM 3424  C C    . PRO A 1 70  ? 16.049  5.632   3.560   1.00 45.34 ? 65  PRO A C    2  
ATOM 3425  O O    . PRO A 1 70  ? 15.453  4.951   2.726   1.00 74.54 ? 65  PRO A O    2  
ATOM 3426  C CB   . PRO A 1 70  ? 15.382  6.765   5.698   1.00 12.41 ? 65  PRO A CB   2  
ATOM 3427  C CG   . PRO A 1 70  ? 14.042  6.203   6.027   1.00 23.21 ? 65  PRO A CG   2  
ATOM 3428  C CD   . PRO A 1 70  ? 13.102  6.739   4.983   1.00 22.44 ? 65  PRO A CD   2  
ATOM 3429  H HA   . PRO A 1 70  ? 15.948  7.748   3.873   1.00 22.25 ? 65  PRO A HA   2  
ATOM 3430  H HB3  . PRO A 1 70  ? 15.516  7.745   6.129   1.00 1.31  ? 65  PRO A HB3  2  
ATOM 3431  H HG3  . PRO A 1 70  ? 13.738  6.533   7.009   1.00 55.23 ? 65  PRO A HG3  2  
ATOM 3432  H HD3  . PRO A 1 70  ? 12.650  7.661   5.320   1.00 44.34 ? 65  PRO A HD3  2  
ATOM 3433  N N    . SER A 1 71  ? 17.279  5.349   3.980   1.00 15.44 ? 66  SER A N    2  
ATOM 3434  C CA   . SER A 1 71  ? 18.014  4.196   3.471   1.00 73.44 ? 66  SER A CA   2  
ATOM 3435  C C    . SER A 1 71  ? 17.906  3.016   4.433   1.00 2.23  ? 66  SER A C    2  
ATOM 3436  O O    . SER A 1 71  ? 18.752  2.123   4.434   1.00 5.32  ? 66  SER A O    2  
ATOM 3437  C CB   . SER A 1 71  ? 19.485  4.559   3.254   1.00 33.54 ? 66  SER A CB   2  
ATOM 3438  O OG   . SER A 1 71  ? 19.644  5.955   3.067   1.00 34.22 ? 66  SER A OG   2  
ATOM 3439  H H    . SER A 1 71  ? 17.702  5.930   4.646   1.00 2.01  ? 66  SER A H    2  
ATOM 3440  H HA   . SER A 1 71  ? 17.577  3.917   2.525   1.00 14.34 ? 66  SER A HA   2  
ATOM 3441  H HB3  . SER A 1 71  ? 19.852  4.046   2.376   1.00 73.21 ? 66  SER A HB3  2  
ATOM 3442  H HG   . SER A 1 71  ? 19.286  6.207   2.213   1.00 41.32 ? 66  SER A HG   2  
ATOM 3443  N N    . GLY A 1 72  ? 16.857  3.021   5.249   1.00 14.41 ? 67  GLY A N    2  
ATOM 3444  C CA   . GLY A 1 72  ? 16.657  1.947   6.204   1.00 14.53 ? 67  GLY A CA   2  
ATOM 3445  C C    . GLY A 1 72  ? 17.053  2.341   7.613   1.00 13.40 ? 67  GLY A C    2  
ATOM 3446  O O    . GLY A 1 72  ? 16.824  3.474   8.035   1.00 51.02 ? 67  GLY A O    2  
ATOM 3447  H H    . GLY A 1 72  ? 16.214  3.759   5.204   1.00 64.12 ? 67  GLY A H    2  
ATOM 3448  H HA2  . GLY A 1 72  ? 15.614  1.666   6.200   1.00 10.54 ? 67  GLY A HA2  2  
ATOM 3449  H HA3  . GLY A 1 72  ? 17.249  1.095   5.901   1.00 44.22 ? 67  GLY A HA3  2  
ATOM 3450  N N    . ASN A 1 73  ? 17.648  1.404   8.344   1.00 12.41 ? 68  ASN A N    2  
ATOM 3451  C CA   . ASN A 1 73  ? 18.074  1.659   9.714   1.00 52.22 ? 68  ASN A CA   2  
ATOM 3452  C C    . ASN A 1 73  ? 18.727  0.420   10.321  1.00 20.00 ? 68  ASN A C    2  
ATOM 3453  O O    . ASN A 1 73  ? 18.596  0.159   11.516  1.00 71.41 ? 68  ASN A O    2  
ATOM 3454  C CB   . ASN A 1 73  ? 16.882  2.091   10.570  1.00 13.22 ? 68  ASN A CB   2  
ATOM 3455  C CG   . ASN A 1 73  ? 17.189  3.311   11.416  1.00 21.22 ? 68  ASN A CG   2  
ATOM 3456  O OD1  . ASN A 1 73  ? 18.247  3.397   12.040  1.00 32.24 ? 68  ASN A OD1  2  
ATOM 3457  N ND2  . ASN A 1 73  ? 16.263  4.263   11.440  1.00 53.11 ? 68  ASN A ND2  2  
ATOM 3458  H H    . ASN A 1 73  ? 17.803  0.518   7.952   1.00 31.52 ? 68  ASN A H    2  
ATOM 3459  H HA   . ASN A 1 73  ? 18.799  2.459   9.692   1.00 35.51 ? 68  ASN A HA   2  
ATOM 3460  H HB3  . ASN A 1 73  ? 16.605  1.280   11.227  1.00 11.04 ? 68  ASN A HB3  2  
ATOM 3461  H HD21 . ASN A 1 73  ? 15.445  4.126   10.918  1.00 35.03 ? 68  ASN A HD21 2  
ATOM 3462  H HD22 . ASN A 1 73  ? 16.436  5.064   11.979  1.00 14.34 ? 68  ASN A HD22 2  
ATOM 3463  N N    . MET A 1 74  ? 19.432  -0.338  9.488   1.00 32.11 ? 69  MET A N    2  
ATOM 3464  C CA   . MET A 1 74  ? 20.107  -1.548  9.942   1.00 32.10 ? 69  MET A CA   2  
ATOM 3465  C C    . MET A 1 74  ? 19.096  -2.631  10.307  1.00 63.41 ? 69  MET A C    2  
ATOM 3466  O O    . MET A 1 74  ? 18.900  -3.589  9.559   1.00 24.12 ? 69  MET A O    2  
ATOM 3467  C CB   . MET A 1 74  ? 20.998  -1.240  11.147  1.00 63.12 ? 69  MET A CB   2  
ATOM 3468  C CG   . MET A 1 74  ? 22.481  -1.433  10.871  1.00 75.41 ? 69  MET A CG   2  
ATOM 3469  S SD   . MET A 1 74  ? 23.410  -1.875  12.353  1.00 14.42 ? 69  MET A SD   2  
ATOM 3470  C CE   . MET A 1 74  ? 25.081  -1.505  11.827  1.00 44.42 ? 69  MET A CE   2  
ATOM 3471  H H    . MET A 1 74  ? 19.501  -0.079  8.546   1.00 4.11  ? 69  MET A H    2  
ATOM 3472  H HA   . MET A 1 74  ? 20.724  -1.907  9.133   1.00 45.30 ? 69  MET A HA   2  
ATOM 3473  H HB3  . MET A 1 74  ? 20.718  -1.888  11.963  1.00 70.11 ? 69  MET A HB3  2  
ATOM 3474  H HG3  . MET A 1 74  ? 22.881  -0.512  10.473  1.00 53.34 ? 69  MET A HG3  2  
ATOM 3475  H HE1  . MET A 1 74  ? 25.057  -0.753  11.052  1.00 14.43 ? 69  MET A HE1  2  
ATOM 3476  H HE2  . MET A 1 74  ? 25.650  -1.136  12.668  1.00 32.14 ? 69  MET A HE2  2  
ATOM 3477  H HE3  . MET A 1 74  ? 25.545  -2.402  11.444  1.00 63.01 ? 69  MET A HE3  2  
ATOM 3478  N N    . ASP A 1 75  ? 18.457  -2.471  11.461  1.00 14.01 ? 70  ASP A N    2  
ATOM 3479  C CA   . ASP A 1 75  ? 17.464  -3.435  11.925  1.00 45.24 ? 70  ASP A CA   2  
ATOM 3480  C C    . ASP A 1 75  ? 18.073  -4.831  12.034  1.00 23.54 ? 70  ASP A C    2  
ATOM 3481  O O    . ASP A 1 75  ? 19.263  -5.021  11.784  1.00 31.15 ? 70  ASP A O    2  
ATOM 3482  C CB   . ASP A 1 75  ? 16.265  -3.460  10.976  1.00 41.21 ? 70  ASP A CB   2  
ATOM 3483  C CG   . ASP A 1 75  ? 15.875  -2.075  10.499  1.00 0.41  ? 70  ASP A CG   2  
ATOM 3484  O OD1  . ASP A 1 75  ? 15.957  -1.124  11.305  1.00 50.11 ? 70  ASP A OD1  2  
ATOM 3485  O OD2  . ASP A 1 75  ? 15.490  -1.942  9.319   1.00 34.14 ? 70  ASP A OD2  2  
ATOM 3486  H H    . ASP A 1 75  ? 18.657  -1.687  12.013  1.00 71.41 ? 70  ASP A H    2  
ATOM 3487  H HA   . ASP A 1 75  ? 17.132  -3.123  12.903  1.00 13.53 ? 70  ASP A HA   2  
ATOM 3488  H HB3  . ASP A 1 75  ? 15.420  -3.897  11.487  1.00 60.42 ? 70  ASP A HB3  2  
ATOM 3489  N N    . ASP A 1 76  ? 17.247  -5.801  12.409  1.00 52.00 ? 71  ASP A N    2  
ATOM 3490  C CA   . ASP A 1 76  ? 17.702  -7.179  12.552  1.00 41.13 ? 71  ASP A CA   2  
ATOM 3491  C C    . ASP A 1 76  ? 16.646  -8.156  12.045  1.00 50.35 ? 71  ASP A C    2  
ATOM 3492  O O    . ASP A 1 76  ? 16.604  -9.312  12.464  1.00 11.05 ? 71  ASP A O    2  
ATOM 3493  C CB   . ASP A 1 76  ? 18.034  -7.481  14.014  1.00 74.23 ? 71  ASP A CB   2  
ATOM 3494  C CG   . ASP A 1 76  ? 19.458  -7.109  14.374  1.00 44.22 ? 71  ASP A CG   2  
ATOM 3495  O OD1  . ASP A 1 76  ? 20.350  -7.269  13.513  1.00 31.51 ? 71  ASP A OD1  2  
ATOM 3496  O OD2  . ASP A 1 76  ? 19.683  -6.657  15.516  1.00 4.20  ? 71  ASP A OD2  2  
ATOM 3497  H H    . ASP A 1 76  ? 16.309  -5.586  12.595  1.00 24.14 ? 71  ASP A H    2  
ATOM 3498  H HA   . ASP A 1 76  ? 18.597  -7.296  11.959  1.00 62.40 ? 71  ASP A HA   2  
ATOM 3499  H HB3  . ASP A 1 76  ? 17.899  -8.536  14.196  1.00 52.43 ? 71  ASP A HB3  2  
ATOM 3500  N N    . SER A 1 77  ? 15.794  -7.682  11.141  1.00 40.30 ? 72  SER A N    2  
ATOM 3501  C CA   . SER A 1 77  ? 14.735  -8.511  10.581  1.00 1.24  ? 72  SER A CA   2  
ATOM 3502  C C    . SER A 1 77  ? 15.229  -9.266  9.349   1.00 63.21 ? 72  SER A C    2  
ATOM 3503  O O    . SER A 1 77  ? 15.485  -10.468 9.405   1.00 62.31 ? 72  SER A O    2  
ATOM 3504  C CB   . SER A 1 77  ? 13.524  -7.650  10.212  1.00 54.44 ? 72  SER A CB   2  
ATOM 3505  O OG   . SER A 1 77  ? 13.914  -6.520  9.454   1.00 43.54 ? 72  SER A OG   2  
ATOM 3506  H H    . SER A 1 77  ? 15.880  -6.750  10.846  1.00 13.22 ? 72  SER A H    2  
ATOM 3507  H HA   . SER A 1 77  ? 14.441  -9.228  11.333  1.00 41.32 ? 72  SER A HA   2  
ATOM 3508  H HB3  . SER A 1 77  ? 13.038  -7.314  11.117  1.00 65.22 ? 72  SER A HB3  2  
ATOM 3509  H HG   . SER A 1 77  ? 14.035  -5.768  10.038  1.00 43.52 ? 72  SER A HG   2  
ATOM 3510  N N    . GLY A 1 78  ? 15.361  -8.549  8.237   1.00 1.11  ? 73  GLY A N    2  
ATOM 3511  C CA   . GLY A 1 78  ? 15.823  -9.166  7.007   1.00 54.44 ? 73  GLY A CA   2  
ATOM 3512  C C    . GLY A 1 78  ? 16.263  -8.146  5.977   1.00 65.35 ? 73  GLY A C    2  
ATOM 3513  O O    . GLY A 1 78  ? 16.253  -8.420  4.777   1.00 53.12 ? 73  GLY A O    2  
ATOM 3514  H H    . GLY A 1 78  ? 15.142  -7.594  8.252   1.00 64.41 ? 73  GLY A H    2  
ATOM 3515  H HA2  . GLY A 1 78  ? 16.657  -9.815  7.235   1.00 32.43 ? 73  GLY A HA2  2  
ATOM 3516  H HA3  . GLY A 1 78  ? 15.022  -9.758  6.592   1.00 34.14 ? 73  GLY A HA3  2  
ATOM 3517  N N    . PHE A 1 79  ? 16.649  -6.963  6.444   1.00 12.22 ? 74  PHE A N    2  
ATOM 3518  C CA   . PHE A 1 79  ? 17.092  -5.896  5.554   1.00 1.11  ? 74  PHE A CA   2  
ATOM 3519  C C    . PHE A 1 79  ? 16.076  -5.662  4.439   1.00 1.31  ? 74  PHE A C    2  
ATOM 3520  O O    . PHE A 1 79  ? 16.176  -6.248  3.361   1.00 61.20 ? 74  PHE A O    2  
ATOM 3521  C CB   . PHE A 1 79  ? 18.457  -6.239  4.953   1.00 21.03 ? 74  PHE A CB   2  
ATOM 3522  C CG   . PHE A 1 79  ? 19.595  -5.490  5.585   1.00 62.11 ? 74  PHE A CG   2  
ATOM 3523  C CD1  . PHE A 1 79  ? 19.632  -4.105  5.557   1.00 32.01 ? 74  PHE A CD1  2  
ATOM 3524  C CD2  . PHE A 1 79  ? 20.628  -6.172  6.208   1.00 62.22 ? 74  PHE A CD2  2  
ATOM 3525  C CE1  . PHE A 1 79  ? 20.678  -3.414  6.137   1.00 72.23 ? 74  PHE A CE1  2  
ATOM 3526  C CE2  . PHE A 1 79  ? 21.677  -5.486  6.791   1.00 30.31 ? 74  PHE A CE2  2  
ATOM 3527  C CZ   . PHE A 1 79  ? 21.702  -4.106  6.756   1.00 30.32 ? 74  PHE A CZ   2  
ATOM 3528  H H    . PHE A 1 79  ? 16.635  -6.804  7.411   1.00 73.30 ? 74  PHE A H    2  
ATOM 3529  H HA   . PHE A 1 79  ? 17.182  -4.994  6.138   1.00 20.12 ? 74  PHE A HA   2  
ATOM 3530  H HB3  . PHE A 1 79  ? 18.447  -6.002  3.899   1.00 54.12 ? 74  PHE A HB3  2  
ATOM 3531  H HD1  . PHE A 1 79  ? 18.832  -3.563  5.074   1.00 13.42 ? 74  PHE A HD1  2  
ATOM 3532  H HD2  . PHE A 1 79  ? 20.609  -7.252  6.236   1.00 72.14 ? 74  PHE A HD2  2  
ATOM 3533  H HE1  . PHE A 1 79  ? 20.695  -2.335  6.109   1.00 72.35 ? 74  PHE A HE1  2  
ATOM 3534  H HE2  . PHE A 1 79  ? 22.476  -6.029  7.275   1.00 11.33 ? 74  PHE A HE2  2  
ATOM 3535  H HZ   . PHE A 1 79  ? 22.521  -3.568  7.210   1.00 61.45 ? 74  PHE A HZ   2  
ATOM 3536  N N    . PHE A 1 80  ? 15.100  -4.801  4.707   1.00 14.01 ? 75  PHE A N    2  
ATOM 3537  C CA   . PHE A 1 80  ? 14.065  -4.490  3.728   1.00 72.31 ? 75  PHE A CA   2  
ATOM 3538  C C    . PHE A 1 80  ? 13.708  -3.007  3.768   1.00 20.33 ? 75  PHE A C    2  
ATOM 3539  O O    . PHE A 1 80  ? 14.348  -2.222  4.466   1.00 51.21 ? 75  PHE A O    2  
ATOM 3540  C CB   . PHE A 1 80  ? 12.816  -5.334  3.990   1.00 22.45 ? 75  PHE A CB   2  
ATOM 3541  C CG   . PHE A 1 80  ? 11.916  -4.762  5.048   1.00 22.34 ? 75  PHE A CG   2  
ATOM 3542  C CD1  . PHE A 1 80  ? 12.394  -4.519  6.325   1.00 32.44 ? 75  PHE A CD1  2  
ATOM 3543  C CD2  . PHE A 1 80  ? 10.593  -4.466  4.764   1.00 30.43 ? 75  PHE A CD2  2  
ATOM 3544  C CE1  . PHE A 1 80  ? 11.569  -3.992  7.301   1.00 2.12  ? 75  PHE A CE1  2  
ATOM 3545  C CE2  . PHE A 1 80  ? 9.763   -3.938  5.735   1.00 13.21 ? 75  PHE A CE2  2  
ATOM 3546  C CZ   . PHE A 1 80  ? 10.251  -3.702  7.006   1.00 22.34 ? 75  PHE A CZ   2  
ATOM 3547  H H    . PHE A 1 80  ? 15.075  -4.366  5.585   1.00 31.11 ? 75  PHE A H    2  
ATOM 3548  H HA   . PHE A 1 80  ? 14.453  -4.730  2.751   1.00 24.43 ? 75  PHE A HA   2  
ATOM 3549  H HB3  . PHE A 1 80  ? 13.117  -6.321  4.308   1.00 4.13  ? 75  PHE A HB3  2  
ATOM 3550  H HD1  . PHE A 1 80  ? 13.425  -4.746  6.558   1.00 13.41 ? 75  PHE A HD1  2  
ATOM 3551  H HD2  . PHE A 1 80  ? 10.209  -4.650  3.771   1.00 75.01 ? 75  PHE A HD2  2  
ATOM 3552  H HE1  . PHE A 1 80  ? 11.954  -3.809  8.293   1.00 1.01  ? 75  PHE A HE1  2  
ATOM 3553  H HE2  . PHE A 1 80  ? 8.733   -3.713  5.502   1.00 31.54 ? 75  PHE A HE2  2  
ATOM 3554  H HZ   . PHE A 1 80  ? 9.605   -3.289  7.765   1.00 75.11 ? 75  PHE A HZ   2  
ATOM 3555  N N    . SER A 1 81  ? 12.682  -2.632  3.011   1.00 72.40 ? 76  SER A N    2  
ATOM 3556  C CA   . SER A 1 81  ? 12.242  -1.243  2.955   1.00 33.45 ? 76  SER A CA   2  
ATOM 3557  C C    . SER A 1 81  ? 11.079  -1.081  1.980   1.00 24.31 ? 76  SER A C    2  
ATOM 3558  O O    . SER A 1 81  ? 10.733  -2.009  1.249   1.00 32.31 ? 76  SER A O    2  
ATOM 3559  C CB   . SER A 1 81  ? 13.401  -0.335  2.540   1.00 72.44 ? 76  SER A CB   2  
ATOM 3560  O OG   . SER A 1 81  ? 14.381  -1.057  1.817   1.00 51.50 ? 76  SER A OG   2  
ATOM 3561  H H    . SER A 1 81  ? 12.210  -3.305  2.476   1.00 64.24 ? 76  SER A H    2  
ATOM 3562  H HA   . SER A 1 81  ? 11.909  -0.960  3.943   1.00 12.32 ? 76  SER A HA   2  
ATOM 3563  H HB3  . SER A 1 81  ? 13.859  0.085   3.424   1.00 72.13 ? 76  SER A HB3  2  
ATOM 3564  H HG   . SER A 1 81  ? 14.933  -0.444  1.325   1.00 15.22 ? 76  SER A HG   2  
ATOM 3565  N N    . ILE A 1 82  ? 10.482  0.106   1.974   1.00 23.22 ? 77  ILE A N    2  
ATOM 3566  C CA   . ILE A 1 82  ? 9.359   0.392   1.088   1.00 71.35 ? 77  ILE A CA   2  
ATOM 3567  C C    . ILE A 1 82  ? 9.797   0.386   -0.372  1.00 15.21 ? 77  ILE A C    2  
ATOM 3568  O O    . ILE A 1 82  ? 9.011   0.065   -1.263  1.00 12.24 ? 77  ILE A O    2  
ATOM 3569  C CB   . ILE A 1 82  ? 8.717   1.753   1.415   1.00 1.30  ? 77  ILE A CB   2  
ATOM 3570  C CG1  . ILE A 1 82  ? 7.822   1.637   2.650   1.00 55.40 ? 77  ILE A CG1  2  
ATOM 3571  C CG2  . ILE A 1 82  ? 7.921   2.262   0.222   1.00 35.42 ? 77  ILE A CG2  2  
ATOM 3572  C CD1  . ILE A 1 82  ? 6.540   0.873   2.397   1.00 40.00 ? 77  ILE A CD1  2  
ATOM 3573  H H    . ILE A 1 82  ? 10.803  0.806   2.579   1.00 71.54 ? 77  ILE A H    2  
ATOM 3574  H HA   . ILE A 1 82  ? 8.616   -0.379  1.234   1.00 63.02 ? 77  ILE A HA   2  
ATOM 3575  H HB   . ILE A 1 82  ? 9.507   2.460   1.617   1.00 54.52 ? 77  ILE A HB   2  
ATOM 3576  H HG13 . ILE A 1 82  ? 7.556   2.628   2.988   1.00 42.15 ? 77  ILE A HG13 2  
ATOM 3577  H HG21 . ILE A 1 82  ? 7.277   1.476   -0.143  1.00 54.12 ? 77  ILE A HG21 2  
ATOM 3578  H HG22 . ILE A 1 82  ? 7.319   3.106   0.526   1.00 12.32 ? 77  ILE A HG22 2  
ATOM 3579  H HG23 . ILE A 1 82  ? 8.599   2.565   -0.561  1.00 4.11  ? 77  ILE A HG23 2  
ATOM 3580  H HD11 . ILE A 1 82  ? 6.089   0.604   3.341   1.00 65.11 ? 77  ILE A HD11 2  
ATOM 3581  H HD12 . ILE A 1 82  ? 5.858   1.491   1.833   1.00 13.41 ? 77  ILE A HD12 2  
ATOM 3582  H HD13 . ILE A 1 82  ? 6.761   -0.025  1.837   1.00 30.44 ? 77  ILE A HD13 2  
ATOM 3583  N N    . GLN A 1 83  ? 11.056  0.740   -0.610  1.00 72.44 ? 78  GLN A N    2  
ATOM 3584  C CA   . GLN A 1 83  ? 11.598  0.774   -1.962  1.00 24.15 ? 78  GLN A CA   2  
ATOM 3585  C C    . GLN A 1 83  ? 11.582  -0.616  -2.590  1.00 50.04 ? 78  GLN A C    2  
ATOM 3586  O O    . GLN A 1 83  ? 11.133  -0.792  -3.722  1.00 12.51 ? 78  GLN A O    2  
ATOM 3587  C CB   . GLN A 1 83  ? 13.024  1.325   -1.949  1.00 1.12  ? 78  GLN A CB   2  
ATOM 3588  C CG   . GLN A 1 83  ? 13.191  2.599   -2.761  1.00 61.03 ? 78  GLN A CG   2  
ATOM 3589  C CD   . GLN A 1 83  ? 12.778  2.427   -4.209  1.00 40.40 ? 78  GLN A CD   2  
ATOM 3590  O OE1  . GLN A 1 83  ? 11.592  2.469   -4.538  1.00 44.14 ? 78  GLN A OE1  2  
ATOM 3591  N NE2  . GLN A 1 83  ? 13.756  2.231   -5.086  1.00 51.04 ? 78  GLN A NE2  2  
ATOM 3592  H H    . GLN A 1 83  ? 11.633  0.985   0.144   1.00 3.32  ? 78  GLN A H    2  
ATOM 3593  H HA   . GLN A 1 83  ? 10.974  1.428   -2.553  1.00 71.25 ? 78  GLN A HA   2  
ATOM 3594  H HB3  . GLN A 1 83  ? 13.690  0.577   -2.354  1.00 71.42 ? 78  GLN A HB3  2  
ATOM 3595  H HG3  . GLN A 1 83  ? 14.230  2.896   -2.731  1.00 70.41 ? 78  GLN A HG3  2  
ATOM 3596  H HE21 . GLN A 1 83  ? 14.679  2.208   -4.752  1.00 35.31 ? 78  GLN A HE21 2  
ATOM 3597  H HE22 . GLN A 1 83  ? 13.518  2.116   -6.027  1.00 4.31  ? 78  GLN A HE22 2  
ATOM 3598  N N    . VAL A 1 84  ? 12.076  -1.601  -1.846  1.00 40.35 ? 79  VAL A N    2  
ATOM 3599  C CA   . VAL A 1 84  ? 12.120  -2.976  -2.329  1.00 52.20 ? 79  VAL A CA   2  
ATOM 3600  C C    . VAL A 1 84  ? 10.724  -3.586  -2.374  1.00 0.32  ? 79  VAL A C    2  
ATOM 3601  O O    . VAL A 1 84  ? 10.390  -4.333  -3.295  1.00 44.22 ? 79  VAL A O    2  
ATOM 3602  C CB   . VAL A 1 84  ? 13.024  -3.854  -1.443  1.00 61.50 ? 79  VAL A CB   2  
ATOM 3603  C CG1  . VAL A 1 84  ? 12.592  -3.766  0.013   1.00 71.14 ? 79  VAL A CG1  2  
ATOM 3604  C CG2  . VAL A 1 84  ? 13.005  -5.296  -1.927  1.00 33.33 ? 79  VAL A CG2  2  
ATOM 3605  H H    . VAL A 1 84  ? 12.420  -1.398  -0.951  1.00 60.22 ? 79  VAL A H    2  
ATOM 3606  H HA   . VAL A 1 84  ? 12.530  -2.967  -3.328  1.00 63.13 ? 79  VAL A HA   2  
ATOM 3607  H HB   . VAL A 1 84  ? 14.036  -3.485  -1.519  1.00 74.54 ? 79  VAL A HB   2  
ATOM 3608  H HG11 . VAL A 1 84  ? 13.227  -4.400  0.614   1.00 60.53 ? 79  VAL A HG11 2  
ATOM 3609  H HG12 . VAL A 1 84  ? 12.676  -2.744  0.352   1.00 72.52 ? 79  VAL A HG12 2  
ATOM 3610  H HG13 . VAL A 1 84  ? 11.567  -4.094  0.104   1.00 72.42 ? 79  VAL A HG13 2  
ATOM 3611  H HG21 . VAL A 1 84  ? 13.764  -5.860  -1.406  1.00 13.01 ? 79  VAL A HG21 2  
ATOM 3612  H HG22 . VAL A 1 84  ? 12.034  -5.730  -1.729  1.00 63.14 ? 79  VAL A HG22 2  
ATOM 3613  H HG23 . VAL A 1 84  ? 13.200  -5.323  -2.989  1.00 31.32 ? 79  VAL A HG23 2  
ATOM 3614  N N    . ILE A 1 85  ? 9.910   -3.264  -1.373  1.00 50.50 ? 80  ILE A N    2  
ATOM 3615  C CA   . ILE A 1 85  ? 8.549   -3.780  -1.300  1.00 11.01 ? 80  ILE A CA   2  
ATOM 3616  C C    . ILE A 1 85  ? 7.695   -3.241  -2.442  1.00 23.01 ? 80  ILE A C    2  
ATOM 3617  O O    . ILE A 1 85  ? 7.081   -4.005  -3.186  1.00 64.40 ? 80  ILE A O    2  
ATOM 3618  C CB   . ILE A 1 85  ? 7.882   -3.419  0.040   1.00 23.02 ? 80  ILE A CB   2  
ATOM 3619  C CG1  . ILE A 1 85  ? 8.570   -4.155  1.192   1.00 22.34 ? 80  ILE A CG1  2  
ATOM 3620  C CG2  . ILE A 1 85  ? 6.399   -3.754  0.001   1.00 23.42 ? 80  ILE A CG2  2  
ATOM 3621  C CD1  . ILE A 1 85  ? 8.367   -5.653  1.157   1.00 14.24 ? 80  ILE A CD1  2  
ATOM 3622  H H    . ILE A 1 85  ? 10.234  -2.665  -0.669  1.00 33.44 ? 80  ILE A H    2  
ATOM 3623  H HA   . ILE A 1 85  ? 8.596   -4.857  -1.377  1.00 31.32 ? 80  ILE A HA   2  
ATOM 3624  H HB   . ILE A 1 85  ? 7.982   -2.355  0.192   1.00 24.02 ? 80  ILE A HB   2  
ATOM 3625  H HG13 . ILE A 1 85  ? 8.177   -3.788  2.129   1.00 10.43 ? 80  ILE A HG13 2  
ATOM 3626  H HG21 . ILE A 1 85  ? 5.844   -2.891  -0.339  1.00 14.01 ? 80  ILE A HG21 2  
ATOM 3627  H HG22 . ILE A 1 85  ? 6.234   -4.577  -0.679  1.00 61.40 ? 80  ILE A HG22 2  
ATOM 3628  H HG23 . ILE A 1 85  ? 6.064   -4.031  0.989   1.00 45.14 ? 80  ILE A HG23 2  
ATOM 3629  H HD11 . ILE A 1 85  ? 7.311   -5.876  1.194   1.00 23.04 ? 80  ILE A HD11 2  
ATOM 3630  H HD12 . ILE A 1 85  ? 8.788   -6.054  0.247   1.00 61.24 ? 80  ILE A HD12 2  
ATOM 3631  H HD13 . ILE A 1 85  ? 8.858   -6.103  2.009   1.00 24.02 ? 80  ILE A HD13 2  
ATOM 3632  N N    . SER A 1 86  ? 7.661   -1.918  -2.575  1.00 14.43 ? 81  SER A N    2  
ATOM 3633  C CA   . SER A 1 86  ? 6.880   -1.275  -3.626  1.00 51.12 ? 81  SER A CA   2  
ATOM 3634  C C    . SER A 1 86  ? 7.372   -1.703  -5.006  1.00 23.31 ? 81  SER A C    2  
ATOM 3635  O O    . SER A 1 86  ? 6.575   -1.961  -5.907  1.00 44.51 ? 81  SER A O    2  
ATOM 3636  C CB   . SER A 1 86  ? 6.961   0.247   -3.491  1.00 11.34 ? 81  SER A CB   2  
ATOM 3637  O OG   . SER A 1 86  ? 6.322   0.889   -4.582  1.00 72.13 ? 81  SER A OG   2  
ATOM 3638  H H    . SER A 1 86  ? 8.172   -1.362  -1.951  1.00 43.25 ? 81  SER A H    2  
ATOM 3639  H HA   . SER A 1 86  ? 5.852   -1.585  -3.511  1.00 42.33 ? 81  SER A HA   2  
ATOM 3640  H HB3  . SER A 1 86  ? 7.998   0.548   -3.468  1.00 43.02 ? 81  SER A HB3  2  
ATOM 3641  H HG   . SER A 1 86  ? 5.468   0.480   -4.738  1.00 21.41 ? 81  SER A HG   2  
ATOM 3642  N N    . ASN A 1 87  ? 8.689   -1.774  -5.162  1.00 45.03 ? 82  ASN A N    2  
ATOM 3643  C CA   . ASN A 1 87  ? 9.289   -2.168  -6.433  1.00 75.40 ? 82  ASN A CA   2  
ATOM 3644  C C    . ASN A 1 87  ? 8.848   -3.574  -6.828  1.00 75.23 ? 82  ASN A C    2  
ATOM 3645  O O    . ASN A 1 87  ? 8.456   -3.815  -7.969  1.00 4.31  ? 82  ASN A O    2  
ATOM 3646  C CB   . ASN A 1 87  ? 10.814  -2.106  -6.341  1.00 2.22  ? 82  ASN A CB   2  
ATOM 3647  C CG   . ASN A 1 87  ? 11.484  -2.377  -7.675  1.00 24.22 ? 82  ASN A CG   2  
ATOM 3648  O OD1  . ASN A 1 87  ? 11.877  -1.450  -8.384  1.00 24.15 ? 82  ASN A OD1  2  
ATOM 3649  N ND2  . ASN A 1 87  ? 11.618  -3.651  -8.022  1.00 51.33 ? 82  ASN A ND2  2  
ATOM 3650  H H    . ASN A 1 87  ? 9.273   -1.555  -4.406  1.00 62.30 ? 82  ASN A H    2  
ATOM 3651  H HA   . ASN A 1 87  ? 8.953   -1.473  -7.187  1.00 64.21 ? 82  ASN A HA   2  
ATOM 3652  H HB3  . ASN A 1 87  ? 11.157  -2.842  -5.631  1.00 11.22 ? 82  ASN A HB3  2  
ATOM 3653  H HD21 . ASN A 1 87  ? 11.283  -4.337  -7.406  1.00 22.44 ? 82  ASN A HD21 2  
ATOM 3654  H HD22 . ASN A 1 87  ? 12.049  -3.855  -8.878  1.00 31.43 ? 82  ASN A HD22 2  
ATOM 3655  N N    . ALA A 1 88  ? 8.914   -4.499  -5.876  1.00 64.11 ? 83  ALA A N    2  
ATOM 3656  C CA   . ALA A 1 88  ? 8.520   -5.880  -6.123  1.00 24.23 ? 83  ALA A CA   2  
ATOM 3657  C C    . ALA A 1 88  ? 7.053   -5.967  -6.531  1.00 41.41 ? 83  ALA A C    2  
ATOM 3658  O O    . ALA A 1 88  ? 6.693   -6.724  -7.435  1.00 60.24 ? 83  ALA A O    2  
ATOM 3659  C CB   . ALA A 1 88  ? 8.779   -6.732  -4.890  1.00 13.15 ? 83  ALA A CB   2  
ATOM 3660  H H    . ALA A 1 88  ? 9.235   -4.245  -4.985  1.00 12.13 ? 83  ALA A H    2  
ATOM 3661  H HA   . ALA A 1 88  ? 9.130   -6.262  -6.929  1.00 73.01 ? 83  ALA A HA   2  
ATOM 3662  H HB1  . ALA A 1 88  ? 8.022   -6.527  -4.147  1.00 53.02 ? 83  ALA A HB1  2  
ATOM 3663  H HB2  . ALA A 1 88  ? 8.745   -7.776  -5.160  1.00 14.14 ? 83  ALA A HB2  2  
ATOM 3664  H HB3  . ALA A 1 88  ? 9.752   -6.496  -4.487  1.00 62.13 ? 83  ALA A HB3  2  
ATOM 3665  N N    . LEU A 1 89  ? 6.210   -5.191  -5.859  1.00 35.52 ? 84  LEU A N    2  
ATOM 3666  C CA   . LEU A 1 89  ? 4.781   -5.182  -6.151  1.00 23.11 ? 84  LEU A CA   2  
ATOM 3667  C C    . LEU A 1 89  ? 4.517   -4.673  -7.564  1.00 24.35 ? 84  LEU A C    2  
ATOM 3668  O O    . LEU A 1 89  ? 3.788   -5.297  -8.335  1.00 14.33 ? 84  LEU A O    2  
ATOM 3669  C CB   . LEU A 1 89  ? 4.038   -4.309  -5.136  1.00 51.43 ? 84  LEU A CB   2  
ATOM 3670  C CG   . LEU A 1 89  ? 4.195   -4.708  -3.668  1.00 31.35 ? 84  LEU A CG   2  
ATOM 3671  C CD1  . LEU A 1 89  ? 4.167   -3.478  -2.775  1.00 62.11 ? 84  LEU A CD1  2  
ATOM 3672  C CD2  . LEU A 1 89  ? 3.103   -5.688  -3.262  1.00 11.50 ? 84  LEU A CD2  2  
ATOM 3673  H H    . LEU A 1 89  ? 6.555   -4.610  -5.150  1.00 53.14 ? 84  LEU A H    2  
ATOM 3674  H HA   . LEU A 1 89  ? 4.420   -6.197  -6.073  1.00 23.44 ? 84  LEU A HA   2  
ATOM 3675  H HB3  . LEU A 1 89  ? 2.987   -4.344  -5.379  1.00 23.54 ? 84  LEU A HB3  2  
ATOM 3676  H HG   . LEU A 1 89  ? 5.151   -5.196  -3.534  1.00 35.41 ? 84  LEU A HG   2  
ATOM 3677  H HD11 . LEU A 1 89  ? 5.086   -3.422  -2.211  1.00 61.51 ? 84  LEU A HD11 2  
ATOM 3678  H HD12 . LEU A 1 89  ? 3.331   -3.545  -2.095  1.00 25.54 ? 84  LEU A HD12 2  
ATOM 3679  H HD13 . LEU A 1 89  ? 4.064   -2.592  -3.386  1.00 72.33 ? 84  LEU A HD13 2  
ATOM 3680  H HD21 . LEU A 1 89  ? 3.220   -6.607  -3.818  1.00 24.10 ? 84  LEU A HD21 2  
ATOM 3681  H HD22 . LEU A 1 89  ? 2.135   -5.258  -3.477  1.00 1.40  ? 84  LEU A HD22 2  
ATOM 3682  H HD23 . LEU A 1 89  ? 3.179   -5.894  -2.205  1.00 51.44 ? 84  LEU A HD23 2  
ATOM 3683  N N    . LYS A 1 90  ? 5.116   -3.535  -7.900  1.00 51.32 ? 85  LYS A N    2  
ATOM 3684  C CA   . LYS A 1 90  ? 4.950   -2.943  -9.222  1.00 51.01 ? 85  LYS A CA   2  
ATOM 3685  C C    . LYS A 1 90  ? 5.362   -3.925  -10.313 1.00 24.42 ? 85  LYS A C    2  
ATOM 3686  O O    . LYS A 1 90  ? 4.692   -4.046  -11.339 1.00 75.41 ? 85  LYS A O    2  
ATOM 3687  C CB   . LYS A 1 90  ? 5.777   -1.661  -9.336  1.00 65.23 ? 85  LYS A CB   2  
ATOM 3688  C CG   . LYS A 1 90  ? 5.865   -1.118  -10.752 1.00 45.03 ? 85  LYS A CG   2  
ATOM 3689  C CD   . LYS A 1 90  ? 6.370   0.315   -10.769 1.00 24.42 ? 85  LYS A CD   2  
ATOM 3690  C CE   . LYS A 1 90  ? 7.848   0.390   -10.418 1.00 64.34 ? 85  LYS A CE   2  
ATOM 3691  N NZ   . LYS A 1 90  ? 8.206   1.697   -9.800  1.00 73.25 ? 85  LYS A NZ   2  
ATOM 3692  H H    . LYS A 1 90  ? 5.686   -3.083  -7.241  1.00 14.23 ? 85  LYS A H    2  
ATOM 3693  H HA   . LYS A 1 90  ? 3.906   -2.701  -9.347  1.00 24.42 ? 85  LYS A HA   2  
ATOM 3694  H HB3  . LYS A 1 90  ? 6.780   -1.861  -8.986  1.00 30.34 ? 85  LYS A HB3  2  
ATOM 3695  H HG3  . LYS A 1 90  ? 4.883   -1.149  -11.202 1.00 73.32 ? 85  LYS A HG3  2  
ATOM 3696  H HD3  . LYS A 1 90  ? 5.808   0.894   -10.050 1.00 25.42 ? 85  LYS A HD3  2  
ATOM 3697  H HE3  . LYS A 1 90  ? 8.426   0.259   -11.321 1.00 55.22 ? 85  LYS A HE3  2  
ATOM 3698  H HZ1  . LYS A 1 90  ? 7.444   2.013   -9.166  1.00 2.22  ? 85  LYS A HZ1  2  
ATOM 3699  H HZ2  . LYS A 1 90  ? 8.347   2.415   -10.539 1.00 35.25 ? 85  LYS A HZ2  2  
ATOM 3700  H HZ3  . LYS A 1 90  ? 9.084   1.604   -9.250  1.00 12.11 ? 85  LYS A HZ3  2  
ATOM 3701  N N    . VAL A 1 91  ? 6.469   -4.626  -10.086 1.00 14.24 ? 86  VAL A N    2  
ATOM 3702  C CA   . VAL A 1 91  ? 6.968   -5.600  -11.050 1.00 74.52 ? 86  VAL A CA   2  
ATOM 3703  C C    . VAL A 1 91  ? 5.916   -6.660  -11.356 1.00 60.45 ? 86  VAL A C    2  
ATOM 3704  O O    . VAL A 1 91  ? 5.883   -7.218  -12.451 1.00 4.33  ? 86  VAL A O    2  
ATOM 3705  C CB   . VAL A 1 91  ? 8.245   -6.293  -10.537 1.00 64.31 ? 86  VAL A CB   2  
ATOM 3706  C CG1  . VAL A 1 91  ? 8.700   -7.365  -11.514 1.00 4.20  ? 86  VAL A CG1  2  
ATOM 3707  C CG2  . VAL A 1 91  ? 9.347   -5.270  -10.303 1.00 54.44 ? 86  VAL A CG2  2  
ATOM 3708  H H    . VAL A 1 91  ? 6.960   -4.485  -9.250  1.00 75.21 ? 86  VAL A H    2  
ATOM 3709  H HA   . VAL A 1 91  ? 7.211   -5.073  -11.962 1.00 74.30 ? 86  VAL A HA   2  
ATOM 3710  H HB   . VAL A 1 91  ? 8.018   -6.769  -9.594  1.00 24.14 ? 86  VAL A HB   2  
ATOM 3711  H HG11 . VAL A 1 91  ? 8.033   -8.213  -11.453 1.00 43.44 ? 86  VAL A HG11 2  
ATOM 3712  H HG12 . VAL A 1 91  ? 8.686   -6.966  -12.518 1.00 12.44 ? 86  VAL A HG12 2  
ATOM 3713  H HG13 . VAL A 1 91  ? 9.703   -7.677  -11.265 1.00 54.03 ? 86  VAL A HG13 2  
ATOM 3714  H HG21 . VAL A 1 91  ? 10.066  -5.327  -11.107 1.00 52.04 ? 86  VAL A HG21 2  
ATOM 3715  H HG22 . VAL A 1 91  ? 8.919   -4.279  -10.272 1.00 2.11  ? 86  VAL A HG22 2  
ATOM 3716  H HG23 . VAL A 1 91  ? 9.839   -5.479  -9.364  1.00 22.04 ? 86  VAL A HG23 2  
ATOM 3717  N N    . TRP A 1 92  ? 5.057   -6.932  -10.380 1.00 73.14 ? 87  TRP A N    2  
ATOM 3718  C CA   . TRP A 1 92  ? 4.003   -7.926  -10.545 1.00 72.53 ? 87  TRP A CA   2  
ATOM 3719  C C    . TRP A 1 92  ? 2.723   -7.280  -11.066 1.00 54.23 ? 87  TRP A C    2  
ATOM 3720  O O    . TRP A 1 92  ? 1.869   -7.951  -11.643 1.00 61.45 ? 87  TRP A O    2  
ATOM 3721  C CB   . TRP A 1 92  ? 3.728   -8.633  -9.216  1.00 10.13 ? 87  TRP A CB   2  
ATOM 3722  C CG   . TRP A 1 92  ? 4.927   -9.337  -8.658  1.00 45.03 ? 87  TRP A CG   2  
ATOM 3723  C CD1  . TRP A 1 92  ? 6.019   -9.773  -9.354  1.00 63.14 ? 87  TRP A CD1  2  
ATOM 3724  C CD2  . TRP A 1 92  ? 5.156   -9.686  -7.290  1.00 74.44 ? 87  TRP A CD2  2  
ATOM 3725  N NE1  . TRP A 1 92  ? 6.912   -10.372 -8.500  1.00 54.03 ? 87  TRP A NE1  2  
ATOM 3726  C CE2  . TRP A 1 92  ? 6.406   -10.331 -7.227  1.00 43.22 ? 87  TRP A CE2  2  
ATOM 3727  C CE3  . TRP A 1 92  ? 4.427   -9.514  -6.109  1.00 42.42 ? 87  TRP A CE3  2  
ATOM 3728  C CZ2  . TRP A 1 92  ? 6.940   -10.805 -6.031  1.00 44.12 ? 87  TRP A CZ2  2  
ATOM 3729  C CZ3  . TRP A 1 92  ? 4.958   -9.985  -4.923  1.00 41.41 ? 87  TRP A CZ3  2  
ATOM 3730  C CH2  . TRP A 1 92  ? 6.206   -10.624 -4.892  1.00 31.11 ? 87  TRP A CH2  2  
ATOM 3731  H H    . TRP A 1 92  ? 5.134   -6.453  -9.527  1.00 43.24 ? 87  TRP A H    2  
ATOM 3732  H HA   . TRP A 1 92  ? 4.345   -8.653  -11.266 1.00 33.03 ? 87  TRP A HA   2  
ATOM 3733  H HB3  . TRP A 1 92  ? 2.948   -9.367  -9.363  1.00 11.20 ? 87  TRP A HB3  2  
ATOM 3734  H HD1  . TRP A 1 92  ? 6.146   -9.658  -10.420 1.00 53.10 ? 87  TRP A HD1  2  
ATOM 3735  H HE1  . TRP A 1 92  ? 7.773   -10.764 -8.759  1.00 32.40 ? 87  TRP A HE1  2  
ATOM 3736  H HE3  . TRP A 1 92  ? 3.465   -9.025  -6.114  1.00 73.01 ? 87  TRP A HE3  2  
ATOM 3737  H HZ2  . TRP A 1 92  ? 7.901   -11.298 -5.990  1.00 33.14 ? 87  TRP A HZ2  2  
ATOM 3738  H HZ3  . TRP A 1 92  ? 4.409   -9.863  -4.002  1.00 40.12 ? 87  TRP A HZ3  2  
ATOM 3739  H HH2  . TRP A 1 92  ? 6.581   -10.977 -3.944  1.00 61.55 ? 87  TRP A HH2  2  
ATOM 3740  N N    . GLY A 1 93  ? 2.597   -5.973  -10.858 1.00 51.14 ? 88  GLY A N    2  
ATOM 3741  C CA   . GLY A 1 93  ? 1.419   -5.259  -11.312 1.00 24.41 ? 88  GLY A CA   2  
ATOM 3742  C C    . GLY A 1 93  ? 0.652   -4.619  -10.172 1.00 10.53 ? 88  GLY A C    2  
ATOM 3743  O O    . GLY A 1 93  ? -0.399  -4.012  -10.384 1.00 43.22 ? 88  GLY A O    2  
ATOM 3744  H H    . GLY A 1 93  ? 3.311   -5.489  -10.391 1.00 12.11 ? 88  GLY A H    2  
ATOM 3745  H HA2  . GLY A 1 93  ? 1.723   -4.488  -12.005 1.00 53.41 ? 88  GLY A HA2  2  
ATOM 3746  H HA3  . GLY A 1 93  ? 0.768   -5.952  -11.825 1.00 64.13 ? 88  GLY A HA3  2  
ATOM 3747  N N    . LEU A 1 94  ? 1.175   -4.758  -8.960  1.00 72.34 ? 89  LEU A N    2  
ATOM 3748  C CA   . LEU A 1 94  ? 0.532   -4.190  -7.779  1.00 22.33 ? 89  LEU A CA   2  
ATOM 3749  C C    . LEU A 1 94  ? 1.132   -2.832  -7.432  1.00 44.23 ? 89  LEU A C    2  
ATOM 3750  O O    . LEU A 1 94  ? 2.334   -2.616  -7.588  1.00 64.31 ? 89  LEU A O    2  
ATOM 3751  C CB   . LEU A 1 94  ? 0.671   -5.141  -6.590  1.00 72.15 ? 89  LEU A CB   2  
ATOM 3752  C CG   . LEU A 1 94  ? -0.137  -6.437  -6.669  1.00 73.51 ? 89  LEU A CG   2  
ATOM 3753  C CD1  . LEU A 1 94  ? 0.784   -7.629  -6.873  1.00 71.11 ? 89  LEU A CD1  2  
ATOM 3754  C CD2  . LEU A 1 94  ? -0.976  -6.619  -5.412  1.00 33.52 ? 89  LEU A CD2  2  
ATOM 3755  H H    . LEU A 1 94  ? 2.013   -5.252  -8.853  1.00 63.14 ? 89  LEU A H    2  
ATOM 3756  H HA   . LEU A 1 94  ? -0.517  -4.059  -8.005  1.00 72.35 ? 89  LEU A HA   2  
ATOM 3757  H HB3  . LEU A 1 94  ? 0.359   -4.608  -5.703  1.00 53.35 ? 89  LEU A HB3  2  
ATOM 3758  H HG   . LEU A 1 94  ? -0.807  -6.385  -7.516  1.00 74.42 ? 89  LEU A HG   2  
ATOM 3759  H HD11 . LEU A 1 94  ? 1.580   -7.357  -7.549  1.00 14.32 ? 89  LEU A HD11 2  
ATOM 3760  H HD12 . LEU A 1 94  ? 0.221   -8.451  -7.292  1.00 55.24 ? 89  LEU A HD12 2  
ATOM 3761  H HD13 . LEU A 1 94  ? 1.204   -7.928  -5.924  1.00 22.30 ? 89  LEU A HD13 2  
ATOM 3762  H HD21 . LEU A 1 94  ? -1.569  -7.517  -5.502  1.00 3.41  ? 89  LEU A HD21 2  
ATOM 3763  H HD22 . LEU A 1 94  ? -1.630  -5.767  -5.289  1.00 10.02 ? 89  LEU A HD22 2  
ATOM 3764  H HD23 . LEU A 1 94  ? -0.326  -6.701  -4.553  1.00 2.24  ? 89  LEU A HD23 2  
ATOM 3765  N N    . GLU A 1 95  ? 0.288   -1.920  -6.958  1.00 42.32 ? 90  GLU A N    2  
ATOM 3766  C CA   . GLU A 1 95  ? 0.737   -0.584  -6.587  1.00 43.01 ? 90  GLU A CA   2  
ATOM 3767  C C    . GLU A 1 95  ? 0.406   -0.284  -5.128  1.00 51.34 ? 90  GLU A C    2  
ATOM 3768  O O    . GLU A 1 95  ? -0.564  -0.808  -4.579  1.00 40.13 ? 90  GLU A O    2  
ATOM 3769  C CB   . GLU A 1 95  ? 0.090   0.466   -7.494  1.00 61.03 ? 90  GLU A CB   2  
ATOM 3770  C CG   . GLU A 1 95  ? -1.425  0.372   -7.549  1.00 54.13 ? 90  GLU A CG   2  
ATOM 3771  C CD   . GLU A 1 95  ? -2.045  1.454   -8.411  1.00 21.12 ? 90  GLU A CD   2  
ATOM 3772  O OE1  . GLU A 1 95  ? -1.647  1.577   -9.588  1.00 13.13 ? 90  GLU A OE1  2  
ATOM 3773  O OE2  . GLU A 1 95  ? -2.931  2.177   -7.908  1.00 74.01 ? 90  GLU A OE2  2  
ATOM 3774  H H    . GLU A 1 95  ? -0.659  -2.153  -6.856  1.00 44.02 ? 90  GLU A H    2  
ATOM 3775  H HA   . GLU A 1 95  ? 1.809   -0.546  -6.715  1.00 23.13 ? 90  GLU A HA   2  
ATOM 3776  H HB3  . GLU A 1 95  ? 0.474   0.343   -8.495  1.00 3.20  ? 90  GLU A HB3  2  
ATOM 3777  H HG3  . GLU A 1 95  ? -1.816  0.462   -6.546  1.00 61.25 ? 90  GLU A HG3  2  
ATOM 3778  N N    . LEU A 1 96  ? 1.220   0.562   -4.505  1.00 53.30 ? 91  LEU A N    2  
ATOM 3779  C CA   . LEU A 1 96  ? 1.015   0.932   -3.108  1.00 3.43  ? 91  LEU A CA   2  
ATOM 3780  C C    . LEU A 1 96  ? 0.623   2.401   -2.987  1.00 54.20 ? 91  LEU A C    2  
ATOM 3781  O O    . LEU A 1 96  ? 1.154   3.257   -3.695  1.00 35.13 ? 91  LEU A O    2  
ATOM 3782  C CB   . LEU A 1 96  ? 2.284   0.662   -2.298  1.00 73.33 ? 91  LEU A CB   2  
ATOM 3783  C CG   . LEU A 1 96  ? 2.238   -0.547  -1.363  1.00 21.20 ? 91  LEU A CG   2  
ATOM 3784  C CD1  . LEU A 1 96  ? 3.628   -0.867  -0.836  1.00 51.12 ? 91  LEU A CD1  2  
ATOM 3785  C CD2  . LEU A 1 96  ? 1.275   -0.295  -0.212  1.00 13.31 ? 91  LEU A CD2  2  
ATOM 3786  H H    . LEU A 1 96  ? 1.976   0.948   -4.994  1.00 73.00 ? 91  LEU A H    2  
ATOM 3787  H HA   . LEU A 1 96  ? 0.213   0.324   -2.719  1.00 33.23 ? 91  LEU A HA   2  
ATOM 3788  H HB3  . LEU A 1 96  ? 2.485   1.539   -1.698  1.00 34.34 ? 91  LEU A HB3  2  
ATOM 3789  H HG   . LEU A 1 96  ? 1.885   -1.408  -1.914  1.00 23.14 ? 91  LEU A HG   2  
ATOM 3790  H HD11 . LEU A 1 96  ? 4.368   -0.568  -1.564  1.00 32.24 ? 91  LEU A HD11 2  
ATOM 3791  H HD12 . LEU A 1 96  ? 3.709   -1.929  -0.656  1.00 45.14 ? 91  LEU A HD12 2  
ATOM 3792  H HD13 . LEU A 1 96  ? 3.795   -0.332  0.087   1.00 51.35 ? 91  LEU A HD13 2  
ATOM 3793  H HD21 . LEU A 1 96  ? 1.248   0.761   0.010   1.00 50.15 ? 91  LEU A HD21 2  
ATOM 3794  H HD22 . LEU A 1 96  ? 1.607   -0.839  0.661   1.00 1.21  ? 91  LEU A HD22 2  
ATOM 3795  H HD23 . LEU A 1 96  ? 0.286   -0.630  -0.490  1.00 4.00  ? 91  LEU A HD23 2  
ATOM 3796  N N    . ILE A 1 97  ? -0.309  2.686   -2.082  1.00 4.42  ? 92  ILE A N    2  
ATOM 3797  C CA   . ILE A 1 97  ? -0.769  4.052   -1.866  1.00 33.42 ? 92  ILE A CA   2  
ATOM 3798  C C    . ILE A 1 97  ? -1.050  4.309   -0.388  1.00 3.43  ? 92  ILE A C    2  
ATOM 3799  O O    . ILE A 1 97  ? -1.527  3.427   0.326   1.00 75.21 ? 92  ILE A O    2  
ATOM 3800  C CB   . ILE A 1 97  ? -2.043  4.352   -2.678  1.00 44.24 ? 92  ILE A CB   2  
ATOM 3801  C CG1  . ILE A 1 97  ? -1.855  3.927   -4.136  1.00 50.43 ? 92  ILE A CG1  2  
ATOM 3802  C CG2  . ILE A 1 97  ? -2.388  5.832   -2.593  1.00 13.13 ? 92  ILE A CG2  2  
ATOM 3803  C CD1  . ILE A 1 97  ? -3.045  4.241   -5.015  1.00 2.11  ? 92  ILE A CD1  2  
ATOM 3804  H H    . ILE A 1 97  ? -0.694  1.960   -1.548  1.00 65.42 ? 92  ILE A H    2  
ATOM 3805  H HA   . ILE A 1 97  ? 0.012   4.722   -2.195  1.00 31.41 ? 92  ILE A HA   2  
ATOM 3806  H HB   . ILE A 1 97  ? -2.858  3.792   -2.249  1.00 52.10 ? 92  ILE A HB   2  
ATOM 3807  H HG13 . ILE A 1 97  ? -1.687  2.861   -4.173  1.00 55.53 ? 92  ILE A HG13 2  
ATOM 3808  H HG21 . ILE A 1 97  ? -1.598  6.412   -3.047  1.00 33.40 ? 92  ILE A HG21 2  
ATOM 3809  H HG22 . ILE A 1 97  ? -3.315  6.015   -3.116  1.00 52.34 ? 92  ILE A HG22 2  
ATOM 3810  H HG23 . ILE A 1 97  ? -2.495  6.117   -1.558  1.00 33.20 ? 92  ILE A HG23 2  
ATOM 3811  H HD11 . ILE A 1 97  ? -2.777  5.013   -5.722  1.00 13.13 ? 92  ILE A HD11 2  
ATOM 3812  H HD12 . ILE A 1 97  ? -3.345  3.352   -5.547  1.00 12.35 ? 92  ILE A HD12 2  
ATOM 3813  H HD13 . ILE A 1 97  ? -3.865  4.586   -4.401  1.00 1.10  ? 92  ILE A HD13 2  
ATOM 3814  N N    . LEU A 1 98  ? -0.753  5.523   0.062   1.00 2.01  ? 93  LEU A N    2  
ATOM 3815  C CA   . LEU A 1 98  ? -0.975  5.899   1.453   1.00 10.10 ? 93  LEU A CA   2  
ATOM 3816  C C    . LEU A 1 98  ? -2.466  6.023   1.753   1.00 23.11 ? 93  LEU A C    2  
ATOM 3817  O O    . LEU A 1 98  ? -3.224  6.582   0.959   1.00 71.13 ? 93  LEU A O    2  
ATOM 3818  C CB   . LEU A 1 98  ? -0.269  7.219   1.765   1.00 42.03 ? 93  LEU A CB   2  
ATOM 3819  C CG   . LEU A 1 98  ? 0.309   7.355   3.174   1.00 73.22 ? 93  LEU A CG   2  
ATOM 3820  C CD1  . LEU A 1 98  ? 1.589   6.544   3.307   1.00 51.51 ? 93  LEU A CD1  2  
ATOM 3821  C CD2  . LEU A 1 98  ? 0.566   8.817   3.507   1.00 32.11 ? 93  LEU A CD2  2  
ATOM 3822  H H    . LEU A 1 98  ? -0.375  6.183   -0.556  1.00 21.12 ? 93  LEU A H    2  
ATOM 3823  H HA   . LEU A 1 98  ? -0.559  5.121   2.077   1.00 41.23 ? 93  LEU A HA   2  
ATOM 3824  H HB3  . LEU A 1 98  ? -0.983  8.017   1.620   1.00 70.23 ? 93  LEU A HB3  2  
ATOM 3825  H HG   . LEU A 1 98  ? -0.405  6.969   3.888   1.00 54.22 ? 93  LEU A HG   2  
ATOM 3826  H HD11 . LEU A 1 98  ? 2.440   7.205   3.267   1.00 64.41 ? 93  LEU A HD11 2  
ATOM 3827  H HD12 . LEU A 1 98  ? 1.649   5.831   2.498   1.00 22.33 ? 93  LEU A HD12 2  
ATOM 3828  H HD13 . LEU A 1 98  ? 1.585   6.017   4.251   1.00 2.15  ? 93  LEU A HD13 2  
ATOM 3829  H HD21 . LEU A 1 98  ? -0.202  9.429   3.056   1.00 50.41 ? 93  LEU A HD21 2  
ATOM 3830  H HD22 . LEU A 1 98  ? 1.532   9.110   3.122   1.00 71.13 ? 93  LEU A HD22 2  
ATOM 3831  H HD23 . LEU A 1 98  ? 0.549   8.951   4.578   1.00 74.44 ? 93  LEU A HD23 2  
ATOM 3832  N N    . PHE A 1 99  ? -2.879  5.501   2.903   1.00 45.41 ? 94  PHE A N    2  
ATOM 3833  C CA   . PHE A 1 99  ? -4.279  5.555   3.308   1.00 43.42 ? 94  PHE A CA   2  
ATOM 3834  C C    . PHE A 1 99  ? -4.738  6.999   3.485   1.00 21.52 ? 94  PHE A C    2  
ATOM 3835  O O    . PHE A 1 99  ? -5.935  7.281   3.514   1.00 24.50 ? 94  PHE A O    2  
ATOM 3836  C CB   . PHE A 1 99  ? -4.485  4.779   4.610   1.00 30.11 ? 94  PHE A CB   2  
ATOM 3837  C CG   . PHE A 1 99  ? -5.887  4.270   4.788   1.00 54.51 ? 94  PHE A CG   2  
ATOM 3838  C CD1  . PHE A 1 99  ? -6.501  3.530   3.790   1.00 25.54 ? 94  PHE A CD1  2  
ATOM 3839  C CD2  . PHE A 1 99  ? -6.589  4.528   5.953   1.00 62.31 ? 94  PHE A CD2  2  
ATOM 3840  C CE1  . PHE A 1 99  ? -7.791  3.061   3.951   1.00 74.20 ? 94  PHE A CE1  2  
ATOM 3841  C CE2  . PHE A 1 99  ? -7.879  4.061   6.121   1.00 23.23 ? 94  PHE A CE2  2  
ATOM 3842  C CZ   . PHE A 1 99  ? -8.481  3.326   5.119   1.00 12.41 ? 94  PHE A CZ   2  
ATOM 3843  H H    . PHE A 1 99  ? -2.226  5.069   3.493   1.00 13.34 ? 94  PHE A H    2  
ATOM 3844  H HA   . PHE A 1 99  ? -4.867  5.096   2.528   1.00 44.25 ? 94  PHE A HA   2  
ATOM 3845  H HB3  . PHE A 1 99  ? -4.257  5.424   5.444   1.00 73.24 ? 94  PHE A HB3  2  
ATOM 3846  H HD1  . PHE A 1 99  ? -5.963  3.322   2.877   1.00 55.11 ? 94  PHE A HD1  2  
ATOM 3847  H HD2  . PHE A 1 99  ? -6.120  5.105   6.738   1.00 54.34 ? 94  PHE A HD2  2  
ATOM 3848  H HE1  . PHE A 1 99  ? -8.258  2.485   3.167   1.00 1.25  ? 94  PHE A HE1  2  
ATOM 3849  H HE2  . PHE A 1 99  ? -8.416  4.270   7.034   1.00 64.15 ? 94  PHE A HE2  2  
ATOM 3850  H HZ   . PHE A 1 99  ? -9.488  2.960   5.247   1.00 10.13 ? 94  PHE A HZ   2  
ATOM 3851  N N    . ASN A 1 100 ? -3.777  7.910   3.603   1.00 33.14 ? 95  ASN A N    2  
ATOM 3852  C CA   . ASN A 1 100 ? -4.082  9.325   3.779   1.00 3.33  ? 95  ASN A CA   2  
ATOM 3853  C C    . ASN A 1 100 ? -3.470  10.157  2.655   1.00 34.21 ? 95  ASN A C    2  
ATOM 3854  O O    . ASN A 1 100 ? -3.164  11.335  2.837   1.00 11.25 ? 95  ASN A O    2  
ATOM 3855  C CB   . ASN A 1 100 ? -3.564  9.816   5.131   1.00 53.32 ? 95  ASN A CB   2  
ATOM 3856  C CG   . ASN A 1 100 ? -4.633  10.527  5.937   1.00 62.32 ? 95  ASN A CG   2  
ATOM 3857  O OD1  . ASN A 1 100 ? -5.281  11.453  5.448   1.00 61.32 ? 95  ASN A OD1  2  
ATOM 3858  N ND2  . ASN A 1 100 ? -4.823  10.098  7.179   1.00 31.12 ? 95  ASN A ND2  2  
ATOM 3859  H H    . ASN A 1 100 ? -2.840  7.624   3.571   1.00 35.20 ? 95  ASN A H    2  
ATOM 3860  H HA   . ASN A 1 100 ? -5.156  9.438   3.751   1.00 64.34 ? 95  ASN A HA   2  
ATOM 3861  H HB3  . ASN A 1 100 ? -2.745  10.500  4.970   1.00 41.01 ? 95  ASN A HB3  2  
ATOM 3862  H HD21 . ASN A 1 100 ? -4.269  9.356   7.502   1.00 10.14 ? 95  ASN A HD21 2  
ATOM 3863  H HD22 . ASN A 1 100 ? -5.509  10.540  7.722   1.00 44.44 ? 95  ASN A HD22 2  
ATOM 3864  N N    . SER A 1 101 ? -3.297  9.535   1.493   1.00 51.23 ? 96  SER A N    2  
ATOM 3865  C CA   . SER A 1 101 ? -2.720  10.216  0.341   1.00 43.51 ? 96  SER A CA   2  
ATOM 3866  C C    . SER A 1 101 ? -3.811  10.834  -0.528  1.00 43.52 ? 96  SER A C    2  
ATOM 3867  O O    . SER A 1 101 ? -4.979  10.452  -0.467  1.00 31.32 ? 96  SER A O    2  
ATOM 3868  C CB   . SER A 1 101 ? -1.882  9.240   -0.489  1.00 20.20 ? 96  SER A CB   2  
ATOM 3869  O OG   . SER A 1 101 ? -2.163  9.375   -1.872  1.00 54.32 ? 96  SER A OG   2  
ATOM 3870  H H    . SER A 1 101 ? -3.561  8.595   1.410   1.00 11.32 ? 96  SER A H    2  
ATOM 3871  H HA   . SER A 1 101 ? -2.079  11.005  0.708   1.00 13.20 ? 96  SER A HA   2  
ATOM 3872  H HB3  . SER A 1 101 ? -2.107  8.229   -0.184  1.00 1.02  ? 96  SER A HB3  2  
ATOM 3873  H HG   . SER A 1 101 ? -1.341  9.371   -2.367  1.00 2.15  ? 96  SER A HG   2  
ATOM 3874  N N    . PRO A 1 102 ? -3.421  11.813  -1.359  1.00 13.14 ? 97  PRO A N    2  
ATOM 3875  C CA   . PRO A 1 102 ? -4.351  12.504  -2.258  1.00 40.24 ? 97  PRO A CA   2  
ATOM 3876  C C    . PRO A 1 102 ? -4.840  11.606  -3.388  1.00 11.12 ? 97  PRO A C    2  
ATOM 3877  O O    . PRO A 1 102 ? -5.972  11.740  -3.853  1.00 54.24 ? 97  PRO A O    2  
ATOM 3878  C CB   . PRO A 1 102 ? -3.511  13.656  -2.816  1.00 22.50 ? 97  PRO A CB   2  
ATOM 3879  C CG   . PRO A 1 102 ? -2.103  13.184  -2.713  1.00 45.00 ? 97  PRO A CG   2  
ATOM 3880  C CD   . PRO A 1 102 ? -2.044  12.318  -1.485  1.00 4.02  ? 97  PRO A CD   2  
ATOM 3881  H HA   . PRO A 1 102 ? -5.199  12.902  -1.721  1.00 14.31 ? 97  PRO A HA   2  
ATOM 3882  H HB3  . PRO A 1 102 ? -3.674  14.545  -2.224  1.00 32.32 ? 97  PRO A HB3  2  
ATOM 3883  H HG3  . PRO A 1 102 ? -1.439  14.030  -2.608  1.00 33.21 ? 97  PRO A HG3  2  
ATOM 3884  H HD3  . PRO A 1 102 ? -1.770  12.906  -0.622  1.00 24.13 ? 97  PRO A HD3  2  
ATOM 3885  N N    . GLU A 1 103 ? -3.981  10.691  -3.826  1.00 31.11 ? 98  GLU A N    2  
ATOM 3886  C CA   . GLU A 1 103 ? -4.328  9.772   -4.903  1.00 15.11 ? 98  GLU A CA   2  
ATOM 3887  C C    . GLU A 1 103 ? -5.357  8.747   -4.433  1.00 52.21 ? 98  GLU A C    2  
ATOM 3888  O O    . GLU A 1 103 ? -6.255  8.363   -5.183  1.00 43.22 ? 98  GLU A O    2  
ATOM 3889  C CB   . GLU A 1 103 ? -3.077  9.055   -5.416  1.00 21.24 ? 98  GLU A CB   2  
ATOM 3890  C CG   . GLU A 1 103 ? -2.720  9.407   -6.850  1.00 4.14  ? 98  GLU A CG   2  
ATOM 3891  C CD   . GLU A 1 103 ? -1.959  10.714  -6.959  1.00 53.10 ? 98  GLU A CD   2  
ATOM 3892  O OE1  . GLU A 1 103 ? -1.045  10.937  -6.137  1.00 24.21 ? 98  GLU A OE1  2  
ATOM 3893  O OE2  . GLU A 1 103 ? -2.277  11.513  -7.864  1.00 15.33 ? 98  GLU A OE2  2  
ATOM 3894  H H    . GLU A 1 103 ? -3.093  10.633  -3.416  1.00 41.13 ? 98  GLU A H    2  
ATOM 3895  H HA   . GLU A 1 103 ? -4.756  10.349  -5.708  1.00 2.00  ? 98  GLU A HA   2  
ATOM 3896  H HB3  . GLU A 1 103 ? -3.238  7.989   -5.359  1.00 74.54 ? 98  GLU A HB3  2  
ATOM 3897  H HG3  . GLU A 1 103 ? -3.631  9.488   -7.424  1.00 4.14  ? 98  GLU A HG3  2  
ATOM 3898  N N    . TYR A 1 104 ? -5.219  8.307   -3.187  1.00 63.43 ? 99  TYR A N    2  
ATOM 3899  C CA   . TYR A 1 104 ? -6.133  7.325   -2.616  1.00 31.05 ? 99  TYR A CA   2  
ATOM 3900  C C    . TYR A 1 104 ? -7.529  7.916   -2.446  1.00 52.01 ? 99  TYR A C    2  
ATOM 3901  O O    . TYR A 1 104 ? -8.529  7.277   -2.773  1.00 0.41  ? 99  TYR A O    2  
ATOM 3902  C CB   . TYR A 1 104 ? -5.608  6.832   -1.268  1.00 12.42 ? 99  TYR A CB   2  
ATOM 3903  C CG   . TYR A 1 104 ? -6.618  6.025   -0.483  1.00 42.00 ? 99  TYR A CG   2  
ATOM 3904  C CD1  . TYR A 1 104 ? -7.225  4.905   -1.037  1.00 21.11 ? 99  TYR A CD1  2  
ATOM 3905  C CD2  . TYR A 1 104 ? -6.967  6.385   0.813   1.00 73.13 ? 99  TYR A CD2  2  
ATOM 3906  C CE1  . TYR A 1 104 ? -8.149  4.166   -0.324  1.00 22.42 ? 99  TYR A CE1  2  
ATOM 3907  C CE2  . TYR A 1 104 ? -7.889  5.651   1.534   1.00 64.10 ? 99  TYR A CE2  2  
ATOM 3908  C CZ   . TYR A 1 104 ? -8.478  4.543   0.962   1.00 5.54  ? 99  TYR A CZ   2  
ATOM 3909  O OH   . TYR A 1 104 ? -9.397  3.811   1.675   1.00 34.13 ? 99  TYR A OH   2  
ATOM 3910  H H    . TYR A 1 104 ? -4.484  8.650   -2.637  1.00 64.12 ? 99  TYR A H    2  
ATOM 3911  H HA   . TYR A 1 104 ? -6.190  6.489   -3.298  1.00 42.53 ? 99  TYR A HA   2  
ATOM 3912  H HB3  . TYR A 1 104 ? -5.322  7.682   -0.667  1.00 71.50 ? 99  TYR A HB3  2  
ATOM 3913  H HD1  . TYR A 1 104 ? -6.965  4.613   -2.045  1.00 13.33 ? 99  TYR A HD1  2  
ATOM 3914  H HD2  . TYR A 1 104 ? -6.504  7.254   1.259   1.00 31.12 ? 99  TYR A HD2  2  
ATOM 3915  H HE1  . TYR A 1 104 ? -8.610  3.299   -0.773  1.00 53.11 ? 99  TYR A HE1  2  
ATOM 3916  H HE2  . TYR A 1 104 ? -8.147  5.947   2.540   1.00 54.14 ? 99  TYR A HE2  2  
ATOM 3917  H HH   . TYR A 1 104 ? -9.957  4.406   2.181   1.00 12.55 ? 99  TYR A HH   2  
ATOM 3918  N N    . GLN A 1 105 ? -7.588  9.140   -1.931  1.00 23.02 ? 100 GLN A N    2  
ATOM 3919  C CA   . GLN A 1 105 ? -8.861  9.818   -1.716  1.00 15.33 ? 100 GLN A CA   2  
ATOM 3920  C C    . GLN A 1 105 ? -9.536  10.141  -3.045  1.00 65.42 ? 100 GLN A C    2  
ATOM 3921  O O    . GLN A 1 105 ? -10.759 10.069  -3.166  1.00 33.53 ? 100 GLN A O    2  
ATOM 3922  C CB   . GLN A 1 105 ? -8.651  11.100  -0.911  1.00 70.33 ? 100 GLN A CB   2  
ATOM 3923  C CG   . GLN A 1 105 ? -7.710  12.091  -1.578  1.00 12.24 ? 100 GLN A CG   2  
ATOM 3924  C CD   . GLN A 1 105 ? -7.542  13.367  -0.778  1.00 55.51 ? 100 GLN A CD   2  
ATOM 3925  O OE1  . GLN A 1 105 ? -7.771  14.466  -1.284  1.00 33.13 ? 100 GLN A OE1  2  
ATOM 3926  N NE2  . GLN A 1 105 ? -7.141  13.228  0.480   1.00 42.04 ? 100 GLN A NE2  2  
ATOM 3927  H H    . GLN A 1 105 ? -6.757  9.597   -1.690  1.00 41.12 ? 100 GLN A H    2  
ATOM 3928  H HA   . GLN A 1 105 ? -9.500  9.152   -1.156  1.00 31.53 ? 100 GLN A HA   2  
ATOM 3929  H HB3  . GLN A 1 105 ? -8.241  10.842  0.055   1.00 0.21  ? 100 GLN A HB3  2  
ATOM 3930  H HG3  . GLN A 1 105 ? -8.104  12.342  -2.551  1.00 3.12  ? 100 GLN A HG3  2  
ATOM 3931  H HE21 . GLN A 1 105 ? -6.975  12.322  0.816   1.00 72.44 ? 100 GLN A HE21 2  
ATOM 3932  H HE22 . GLN A 1 105 ? -7.023  14.036  1.020   1.00 63.35 ? 100 GLN A HE22 2  
ATOM 3933  N N    . ARG A 1 106 ? -8.732  10.501  -4.040  1.00 43.34 ? 101 ARG A N    2  
ATOM 3934  C CA   . ARG A 1 106 ? -9.251  10.839  -5.359  1.00 13.35 ? 101 ARG A CA   2  
ATOM 3935  C C    . ARG A 1 106 ? -10.098 9.699   -5.918  1.00 51.32 ? 101 ARG A C    2  
ATOM 3936  O O    . ARG A 1 106 ? -11.058 9.928   -6.655  1.00 61.20 ? 101 ARG A O    2  
ATOM 3937  C CB   . ARG A 1 106 ? -8.101  11.151  -6.319  1.00 21.10 ? 101 ARG A CB   2  
ATOM 3938  C CG   . ARG A 1 106 ? -7.805  10.029  -7.301  1.00 32.10 ? 101 ARG A CG   2  
ATOM 3939  C CD   . ARG A 1 106 ? -6.517  10.286  -8.069  1.00 33.54 ? 101 ARG A CD   2  
ATOM 3940  N NE   . ARG A 1 106 ? -6.461  9.522   -9.312  1.00 60.23 ? 101 ARG A NE   2  
ATOM 3941  C CZ   . ARG A 1 106 ? -7.222  9.781   -10.370 1.00 53.25 ? 101 ARG A CZ   2  
ATOM 3942  N NH1  . ARG A 1 106 ? -8.093  10.779  -10.334 1.00 32.24 ? 101 ARG A NH1  2  
ATOM 3943  N NH2  . ARG A 1 106 ? -7.112  9.040   -11.465 1.00 53.11 ? 101 ARG A NH2  2  
ATOM 3944  H H    . ARG A 1 106 ? -7.765  10.540  -3.882  1.00 42.41 ? 101 ARG A H    2  
ATOM 3945  H HA   . ARG A 1 106 ? -9.871  11.716  -5.258  1.00 75.24 ? 101 ARG A HA   2  
ATOM 3946  H HB3  . ARG A 1 106 ? -7.208  11.341  -5.743  1.00 35.43 ? 101 ARG A HB3  2  
ATOM 3947  H HG3  . ARG A 1 106 ? -8.623  9.950   -8.001  1.00 41.21 ? 101 ARG A HG3  2  
ATOM 3948  H HD3  . ARG A 1 106 ? -5.682  10.006  -7.446  1.00 42.32 ? 101 ARG A HD3  2  
ATOM 3949  H HE   . ARG A 1 106 ? -5.824  8.780   -9.360  1.00 51.22 ? 101 ARG A HE   2  
ATOM 3950  H HH11 . ARG A 1 106 ? -8.178  11.339  -9.510  1.00 12.14 ? 101 ARG A HH11 2  
ATOM 3951  H HH12 . ARG A 1 106 ? -8.664  10.973  -11.133 1.00 74.31 ? 101 ARG A HH12 2  
ATOM 3952  H HH21 . ARG A 1 106 ? -6.455  8.287   -11.495 1.00 71.11 ? 101 ARG A HH21 2  
ATOM 3953  H HH22 . ARG A 1 106 ? -7.685  9.235   -12.260 1.00 43.14 ? 101 ARG A HH22 2  
ATOM 3954  N N    . LEU A 1 107 ? -9.736  8.471   -5.562  1.00 20.44 ? 102 LEU A N    2  
ATOM 3955  C CA   . LEU A 1 107 ? -10.464 7.295   -6.028  1.00 53.44 ? 102 LEU A CA   2  
ATOM 3956  C C    . LEU A 1 107 ? -11.494 6.847   -4.996  1.00 41.42 ? 102 LEU A C    2  
ATOM 3957  O O    . LEU A 1 107 ? -12.464 6.166   -5.329  1.00 73.51 ? 102 LEU A O    2  
ATOM 3958  C CB   . LEU A 1 107 ? -9.490  6.152   -6.322  1.00 42.45 ? 102 LEU A CB   2  
ATOM 3959  C CG   . LEU A 1 107 ? -8.454  6.418   -7.416  1.00 2.34  ? 102 LEU A CG   2  
ATOM 3960  C CD1  . LEU A 1 107 ? -7.695  5.144   -7.752  1.00 42.12 ? 102 LEU A CD1  2  
ATOM 3961  C CD2  . LEU A 1 107 ? -9.126  6.984   -8.659  1.00 24.12 ? 102 LEU A CD2  2  
ATOM 3962  H H    . LEU A 1 107 ? -8.964  8.351   -4.973  1.00 63.13 ? 102 LEU A H    2  
ATOM 3963  H HA   . LEU A 1 107 ? -10.977 7.562   -6.940  1.00 33.42 ? 102 LEU A HA   2  
ATOM 3964  H HB3  . LEU A 1 107 ? -10.071 5.291   -6.617  1.00 11.51 ? 102 LEU A HB3  2  
ATOM 3965  H HG   . LEU A 1 107 ? -7.740  7.147   -7.059  1.00 33.03 ? 102 LEU A HG   2  
ATOM 3966  H HD11 . LEU A 1 107 ? -6.636  5.314   -7.630  1.00 44.52 ? 102 LEU A HD11 2  
ATOM 3967  H HD12 . LEU A 1 107 ? -7.899  4.862   -8.775  1.00 61.20 ? 102 LEU A HD12 2  
ATOM 3968  H HD13 . LEU A 1 107 ? -8.012  4.350   -7.091  1.00 42.05 ? 102 LEU A HD13 2  
ATOM 3969  H HD21 . LEU A 1 107 ? -8.416  7.006   -9.472  1.00 1.45  ? 102 LEU A HD21 2  
ATOM 3970  H HD22 . LEU A 1 107 ? -9.471  7.988   -8.456  1.00 51.44 ? 102 LEU A HD22 2  
ATOM 3971  H HD23 . LEU A 1 107 ? -9.965  6.362   -8.930  1.00 13.13 ? 102 LEU A HD23 2  
ATOM 3972  N N    . ARG A 1 108 ? -11.276 7.235   -3.744  1.00 14.11 ? 103 ARG A N    2  
ATOM 3973  C CA   . ARG A 1 108 ? -12.186 6.875   -2.663  1.00 14.41 ? 103 ARG A CA   2  
ATOM 3974  C C    . ARG A 1 108 ? -12.388 5.363   -2.605  1.00 32.32 ? 103 ARG A C    2  
ATOM 3975  O O    . ARG A 1 108 ? -13.505 4.884   -2.399  1.00 2.31  ? 103 ARG A O    2  
ATOM 3976  C CB   . ARG A 1 108 ? -13.534 7.574   -2.848  1.00 41.41 ? 103 ARG A CB   2  
ATOM 3977  C CG   . ARG A 1 108 ? -13.533 9.025   -2.396  1.00 73.53 ? 103 ARG A CG   2  
ATOM 3978  C CD   . ARG A 1 108 ? -14.753 9.344   -1.545  1.00 50.32 ? 103 ARG A CD   2  
ATOM 3979  N NE   . ARG A 1 108 ? -14.635 10.640  -0.884  1.00 43.20 ? 103 ARG A NE   2  
ATOM 3980  C CZ   . ARG A 1 108 ? -15.570 11.146  -0.087  1.00 65.33 ? 103 ARG A CZ   2  
ATOM 3981  N NH1  . ARG A 1 108 ? -16.685 10.468  0.147   1.00 44.34 ? 103 ARG A NH1  2  
ATOM 3982  N NH2  . ARG A 1 108 ? -15.390 12.333  0.478   1.00 70.21 ? 103 ARG A NH2  2  
ATOM 3983  H H    . ARG A 1 108 ? -10.484 7.776   -3.541  1.00 3.33  ? 103 ARG A H    2  
ATOM 3984  H HA   . ARG A 1 108 ? -11.743 7.202   -1.734  1.00 20.55 ? 103 ARG A HA   2  
ATOM 3985  H HB3  . ARG A 1 108 ? -14.282 7.043   -2.280  1.00 50.15 ? 103 ARG A HB3  2  
ATOM 3986  H HG3  . ARG A 1 108 ? -13.535 9.664   -3.267  1.00 54.33 ? 103 ARG A HG3  2  
ATOM 3987  H HD3  . ARG A 1 108 ? -14.862 8.575   -0.794  1.00 22.24 ? 103 ARG A HD3  2  
ATOM 3988  H HE   . ARG A 1 108 ? -13.819 11.159  -1.043  1.00 20.03 ? 103 ARG A HE   2  
ATOM 3989  H HH11 . ARG A 1 108 ? -16.822 9.573   -0.277  1.00 2.14  ? 103 ARG A HH11 2  
ATOM 3990  H HH12 . ARG A 1 108 ? -17.386 10.851  0.748   1.00 35.44 ? 103 ARG A HH12 2  
ATOM 3991  H HH21 . ARG A 1 108 ? -14.550 12.847  0.305   1.00 60.54 ? 103 ARG A HH21 2  
ATOM 3992  H HH22 . ARG A 1 108 ? -16.093 12.713  1.078   1.00 34.32 ? 103 ARG A HH22 2  
ATOM 3993  N N    . ILE A 1 109 ? -11.304 4.619   -2.788  1.00 14.50 ? 104 ILE A N    2  
ATOM 3994  C CA   . ILE A 1 109 ? -11.363 3.162   -2.755  1.00 13.25 ? 104 ILE A CA   2  
ATOM 3995  C C    . ILE A 1 109 ? -11.625 2.653   -1.342  1.00 24.22 ? 104 ILE A C    2  
ATOM 3996  O O    . ILE A 1 109 ? -10.846 2.912   -0.424  1.00 4.24  ? 104 ILE A O    2  
ATOM 3997  C CB   . ILE A 1 109 ? -10.060 2.533   -3.282  1.00 63.12 ? 104 ILE A CB   2  
ATOM 3998  C CG1  . ILE A 1 109 ? -9.650  3.187   -4.604  1.00 64.25 ? 104 ILE A CG1  2  
ATOM 3999  C CG2  . ILE A 1 109 ? -10.229 1.032   -3.457  1.00 4.34  ? 104 ILE A CG2  2  
ATOM 4000  C CD1  . ILE A 1 109 ? -8.377  2.617   -5.190  1.00 4.44  ? 104 ILE A CD1  2  
ATOM 4001  H H    . ILE A 1 109 ? -10.443 5.058   -2.948  1.00 13.20 ? 104 ILE A H    2  
ATOM 4002  H HA   . ILE A 1 109 ? -12.175 2.848   -3.396  1.00 11.33 ? 104 ILE A HA   2  
ATOM 4003  H HB   . ILE A 1 109 ? -9.285  2.701   -2.550  1.00 53.54 ? 104 ILE A HB   2  
ATOM 4004  H HG13 . ILE A 1 109 ? -9.497  4.245   -4.441  1.00 34.11 ? 104 ILE A HG13 2  
ATOM 4005  H HG21 . ILE A 1 109 ? -10.107 0.775   -4.500  1.00 5.00  ? 104 ILE A HG21 2  
ATOM 4006  H HG22 . ILE A 1 109 ? -9.484  0.514   -2.872  1.00 65.50 ? 104 ILE A HG22 2  
ATOM 4007  H HG23 . ILE A 1 109 ? -11.214 0.739   -3.128  1.00 0.22  ? 104 ILE A HG23 2  
ATOM 4008  H HD11 . ILE A 1 109 ? -8.003  1.834   -4.548  1.00 11.32 ? 104 ILE A HD11 2  
ATOM 4009  H HD12 . ILE A 1 109 ? -8.581  2.214   -6.171  1.00 34.42 ? 104 ILE A HD12 2  
ATOM 4010  H HD13 . ILE A 1 109 ? -7.636  3.400   -5.271  1.00 65.21 ? 104 ILE A HD13 2  
ATOM 4011  N N    . ASP A 1 110 ? -12.725 1.928   -1.174  1.00 5.33  ? 105 ASP A N    2  
ATOM 4012  C CA   . ASP A 1 110 ? -13.088 1.380   0.128   1.00 3.35  ? 105 ASP A CA   2  
ATOM 4013  C C    . ASP A 1 110 ? -12.102 0.297   0.555   1.00 61.41 ? 105 ASP A C    2  
ATOM 4014  O O    . ASP A 1 110 ? -11.435 -0.331  -0.267  1.00 65.42 ? 105 ASP A O    2  
ATOM 4015  C CB   . ASP A 1 110 ? -14.506 0.808   0.086   1.00 63.22 ? 105 ASP A CB   2  
ATOM 4016  C CG   . ASP A 1 110 ? -15.427 1.609   -0.814  1.00 71.51 ? 105 ASP A CG   2  
ATOM 4017  O OD1  . ASP A 1 110 ? -15.386 1.397   -2.043  1.00 23.45 ? 105 ASP A OD1  2  
ATOM 4018  O OD2  . ASP A 1 110 ? -16.188 2.448   -0.288  1.00 63.34 ? 105 ASP A OD2  2  
ATOM 4019  H H    . ASP A 1 110 ? -13.306 1.756   -1.946  1.00 74.44 ? 105 ASP A H    2  
ATOM 4020  H HA   . ASP A 1 110 ? -13.055 2.183   0.847   1.00 24.23 ? 105 ASP A HA   2  
ATOM 4021  H HB3  . ASP A 1 110 ? -14.916 0.810   1.085   1.00 13.13 ? 105 ASP A HB3  2  
ATOM 4022  N N    . PRO A 1 111 ? -12.006 0.072   1.874   1.00 31.42 ? 106 PRO A N    2  
ATOM 4023  C CA   . PRO A 1 111 ? -11.104 -0.934  2.442   1.00 13.41 ? 106 PRO A CA   2  
ATOM 4024  C C    . PRO A 1 111 ? -11.555 -2.358  2.132   1.00 74.54 ? 106 PRO A C    2  
ATOM 4025  O O    . PRO A 1 111 ? -10.769 -3.179  1.659   1.00 71.11 ? 106 PRO A O    2  
ATOM 4026  C CB   . PRO A 1 111 ? -11.175 -0.666  3.947   1.00 72.21 ? 106 PRO A CB   2  
ATOM 4027  C CG   . PRO A 1 111 ? -12.503 -0.022  4.155   1.00 43.44 ? 106 PRO A CG   2  
ATOM 4028  C CD   . PRO A 1 111 ? -12.771 0.782   2.913   1.00 44.30 ? 106 PRO A CD   2  
ATOM 4029  H HA   . PRO A 1 111 ? -10.089 -0.797  2.098   1.00 41.31 ? 106 PRO A HA   2  
ATOM 4030  H HB3  . PRO A 1 111 ? -10.368 -0.010  4.239   1.00 5.24  ? 106 PRO A HB3  2  
ATOM 4031  H HG3  . PRO A 1 111 ? -12.465 0.625   5.019   1.00 42.15 ? 106 PRO A HG3  2  
ATOM 4032  H HD3  . PRO A 1 111 ? -12.410 1.794   3.033   1.00 13.03 ? 106 PRO A HD3  2  
ATOM 4033  N N    . ILE A 1 112 ? -12.825 -2.643  2.403   1.00 40.15 ? 107 ILE A N    2  
ATOM 4034  C CA   . ILE A 1 112 ? -13.379 -3.968  2.152   1.00 24.42 ? 107 ILE A CA   2  
ATOM 4035  C C    . ILE A 1 112 ? -13.425 -4.269  0.658   1.00 14.24 ? 107 ILE A C    2  
ATOM 4036  O O    . ILE A 1 112 ? -13.497 -5.428  0.251   1.00 42.33 ? 107 ILE A O    2  
ATOM 4037  C CB   . ILE A 1 112 ? -14.798 -4.103  2.735   1.00 71.42 ? 107 ILE A CB   2  
ATOM 4038  C CG1  . ILE A 1 112 ? -15.728 -3.053  2.125   1.00 4.21  ? 107 ILE A CG1  2  
ATOM 4039  C CG2  . ILE A 1 112 ? -14.762 -3.969  4.251   1.00 11.44 ? 107 ILE A CG2  2  
ATOM 4040  C CD1  . ILE A 1 112 ? -17.098 -3.014  2.762   1.00 52.01 ? 107 ILE A CD1  2  
ATOM 4041  H H    . ILE A 1 112 ? -13.401 -1.947  2.780   1.00 23.34 ? 107 ILE A H    2  
ATOM 4042  H HA   . ILE A 1 112 ? -12.741 -4.693  2.635   1.00 30.20 ? 107 ILE A HA   2  
ATOM 4043  H HB   . ILE A 1 112 ? -15.169 -5.087  2.494   1.00 24.53 ? 107 ILE A HB   2  
ATOM 4044  H HG13 . ILE A 1 112 ? -15.856 -3.265  1.072   1.00 70.21 ? 107 ILE A HG13 2  
ATOM 4045  H HG21 . ILE A 1 112 ? -15.720 -4.254  4.659   1.00 54.12 ? 107 ILE A HG21 2  
ATOM 4046  H HG22 . ILE A 1 112 ? -13.995 -4.614  4.651   1.00 44.42 ? 107 ILE A HG22 2  
ATOM 4047  H HG23 . ILE A 1 112 ? -14.547 -2.945  4.516   1.00 34.41 ? 107 ILE A HG23 2  
ATOM 4048  H HD11 . ILE A 1 112 ? -17.560 -3.988  2.685   1.00 43.14 ? 107 ILE A HD11 2  
ATOM 4049  H HD12 . ILE A 1 112 ? -17.004 -2.741  3.803   1.00 23.13 ? 107 ILE A HD12 2  
ATOM 4050  H HD13 . ILE A 1 112 ? -17.712 -2.284  2.253   1.00 11.14 ? 107 ILE A HD13 2  
ATOM 4051  N N    . ASN A 1 113 ? -13.383 -3.219  -0.155  1.00 45.04 ? 108 ASN A N    2  
ATOM 4052  C CA   . ASN A 1 113 ? -13.418 -3.371  -1.605  1.00 51.22 ? 108 ASN A CA   2  
ATOM 4053  C C    . ASN A 1 113 ? -12.019 -3.623  -2.160  1.00 74.03 ? 108 ASN A C    2  
ATOM 4054  O O    . ASN A 1 113 ? -11.864 -4.167  -3.252  1.00 65.25 ? 108 ASN A O    2  
ATOM 4055  C CB   . ASN A 1 113 ? -14.021 -2.124  -2.255  1.00 43.23 ? 108 ASN A CB   2  
ATOM 4056  C CG   . ASN A 1 113 ? -15.535 -2.110  -2.187  1.00 14.21 ? 108 ASN A CG   2  
ATOM 4057  O OD1  . ASN A 1 113 ? -16.214 -2.234  -3.207  1.00 52.32 ? 108 ASN A OD1  2  
ATOM 4058  N ND2  . ASN A 1 113 ? -16.072 -1.960  -0.982  1.00 2.22  ? 108 ASN A ND2  2  
ATOM 4059  H H    . ASN A 1 113 ? -13.325 -2.319  0.230   1.00 23.23 ? 108 ASN A H    2  
ATOM 4060  H HA   . ASN A 1 113 ? -14.042 -4.222  -1.833  1.00 64.14 ? 108 ASN A HA   2  
ATOM 4061  H HB3  . ASN A 1 113 ? -13.724 -2.087  -3.292  1.00 51.40 ? 108 ASN A HB3  2  
ATOM 4062  H HD21 . ASN A 1 113 ? -15.469 -1.867  -0.214  1.00 1.13  ? 108 ASN A HD21 2  
ATOM 4063  H HD22 . ASN A 1 113 ? -17.049 -1.948  -0.909  1.00 22.43 ? 108 ASN A HD22 2  
ATOM 4064  N N    . GLU A 1 114 ? -11.005 -3.223  -1.398  1.00 2.14  ? 109 GLU A N    2  
ATOM 4065  C CA   . GLU A 1 114 ? -9.620  -3.406  -1.814  1.00 43.41 ? 109 GLU A CA   2  
ATOM 4066  C C    . GLU A 1 114 ? -9.247  -4.886  -1.830  1.00 5.14  ? 109 GLU A C    2  
ATOM 4067  O O    . GLU A 1 114 ? -10.062 -5.745  -1.494  1.00 1.30  ? 109 GLU A O    2  
ATOM 4068  C CB   . GLU A 1 114 ? -8.679  -2.641  -0.881  1.00 54.42 ? 109 GLU A CB   2  
ATOM 4069  C CG   . GLU A 1 114 ? -8.242  -3.443  0.334   1.00 33.04 ? 109 GLU A CG   2  
ATOM 4070  C CD   . GLU A 1 114 ? -8.048  -2.580  1.565   1.00 22.44 ? 109 GLU A CD   2  
ATOM 4071  O OE1  . GLU A 1 114 ? -7.933  -1.346  1.410   1.00 32.53 ? 109 GLU A OE1  2  
ATOM 4072  O OE2  . GLU A 1 114 ? -8.012  -3.137  2.682   1.00 4.23  ? 109 GLU A OE2  2  
ATOM 4073  H H    . GLU A 1 114 ? -11.194 -2.796  -0.537  1.00 62.01 ? 109 GLU A H    2  
ATOM 4074  H HA   . GLU A 1 114 ? -9.519  -3.011  -2.813  1.00 1.33  ? 109 GLU A HA   2  
ATOM 4075  H HB3  . GLU A 1 114 ? -9.180  -1.750  -0.535  1.00 22.31 ? 109 GLU A HB3  2  
ATOM 4076  H HG3  . GLU A 1 114 ? -7.309  -3.937  0.108   1.00 4.32  ? 109 GLU A HG3  2  
ATOM 4077  N N    . ARG A 1 115 ? -8.011  -5.174  -2.224  1.00 4.14  ? 110 ARG A N    2  
ATOM 4078  C CA   . ARG A 1 115 ? -7.530  -6.549  -2.286  1.00 43.31 ? 110 ARG A CA   2  
ATOM 4079  C C    . ARG A 1 115 ? -6.512  -6.819  -1.182  1.00 45.32 ? 110 ARG A C    2  
ATOM 4080  O O    . ARG A 1 115 ? -6.742  -7.647  -0.302  1.00 54.23 ? 110 ARG A O    2  
ATOM 4081  C CB   . ARG A 1 115 ? -6.903  -6.831  -3.653  1.00 33.31 ? 110 ARG A CB   2  
ATOM 4082  C CG   . ARG A 1 115 ? -7.805  -7.626  -4.584  1.00 31.11 ? 110 ARG A CG   2  
ATOM 4083  C CD   . ARG A 1 115 ? -7.042  -8.143  -5.793  1.00 41.23 ? 110 ARG A CD   2  
ATOM 4084  N NE   . ARG A 1 115 ? -7.595  -7.640  -7.046  1.00 23.42 ? 110 ARG A NE   2  
ATOM 4085  C CZ   . ARG A 1 115 ? -8.702  -8.118  -7.605  1.00 5.04  ? 110 ARG A CZ   2  
ATOM 4086  N NH1  . ARG A 1 115 ? -9.369  -9.105  -7.024  1.00 50.32 ? 110 ARG A NH1  2  
ATOM 4087  N NH2  . ARG A 1 115 ? -9.144  -7.607  -8.747  1.00 4.41  ? 110 ARG A NH2  2  
ATOM 4088  H H    . ARG A 1 115 ? -7.408  -4.445  -2.480  1.00 60.14 ? 110 ARG A H    2  
ATOM 4089  H HA   . ARG A 1 115 ? -8.378  -7.204  -2.146  1.00 64.34 ? 110 ARG A HA   2  
ATOM 4090  H HB3  . ARG A 1 115 ? -5.991  -7.389  -3.509  1.00 44.12 ? 110 ARG A HB3  2  
ATOM 4091  H HG3  . ARG A 1 115 ? -8.609  -6.989  -4.921  1.00 4.21  ? 110 ARG A HG3  2  
ATOM 4092  H HD3  . ARG A 1 115 ? -7.088  -9.221  -5.796  1.00 5.43  ? 110 ARG A HD3  2  
ATOM 4093  H HE   . ARG A 1 115 ? -7.119  -6.910  -7.493  1.00 61.54 ? 110 ARG A HE   2  
ATOM 4094  H HH11 . ARG A 1 115 ? -9.039  -9.491  -6.163  1.00 2.21  ? 110 ARG A HH11 2  
ATOM 4095  H HH12 . ARG A 1 115 ? -10.202 -9.462  -7.447  1.00 15.40 ? 110 ARG A HH12 2  
ATOM 4096  H HH21 . ARG A 1 115 ? -8.643  -6.862  -9.189  1.00 14.22 ? 110 ARG A HH21 2  
ATOM 4097  H HH22 . ARG A 1 115 ? -9.975  -7.967  -9.168  1.00 15.05 ? 110 ARG A HH22 2  
ATOM 4098  N N    . SER A 1 116 ? -5.385  -6.115  -1.238  1.00 25.33 ? 111 SER A N    2  
ATOM 4099  C CA   . SER A 1 116 ? -4.330  -6.282  -0.246  1.00 30.23 ? 111 SER A CA   2  
ATOM 4100  C C    . SER A 1 116 ? -4.193  -5.031  0.617   1.00 22.12 ? 111 SER A C    2  
ATOM 4101  O O    . SER A 1 116 ? -4.468  -3.919  0.167   1.00 4.22  ? 111 SER A O    2  
ATOM 4102  C CB   . SER A 1 116 ? -2.999  -6.588  -0.934  1.00 40.13 ? 111 SER A CB   2  
ATOM 4103  O OG   . SER A 1 116 ? -1.920  -6.503  -0.019  1.00 23.13 ? 111 SER A OG   2  
ATOM 4104  H H    . SER A 1 116 ? -5.261  -5.469  -1.966  1.00 54.25 ? 111 SER A H    2  
ATOM 4105  H HA   . SER A 1 116 ? -4.598  -7.115  0.386   1.00 71.50 ? 111 SER A HA   2  
ATOM 4106  H HB3  . SER A 1 116 ? -2.836  -5.877  -1.731  1.00 34.12 ? 111 SER A HB3  2  
ATOM 4107  H HG   . SER A 1 116 ? -1.959  -7.244  0.591   1.00 64.53 ? 111 SER A HG   2  
ATOM 4108  N N    . PHE A 1 117 ? -3.766  -5.223  1.861   1.00 31.13 ? 112 PHE A N    2  
ATOM 4109  C CA   . PHE A 1 117 ? -3.594  -4.112  2.789   1.00 60.12 ? 112 PHE A CA   2  
ATOM 4110  C C    . PHE A 1 117 ? -2.315  -4.278  3.604   1.00 64.21 ? 112 PHE A C    2  
ATOM 4111  O O    . PHE A 1 117 ? -1.870  -5.396  3.860   1.00 13.22 ? 112 PHE A O    2  
ATOM 4112  C CB   . PHE A 1 117 ? -4.799  -4.010  3.726   1.00 74.22 ? 112 PHE A CB   2  
ATOM 4113  C CG   . PHE A 1 117 ? -5.233  -2.598  3.995   1.00 62.42 ? 112 PHE A CG   2  
ATOM 4114  C CD1  . PHE A 1 117 ? -5.435  -1.711  2.950   1.00 0.15  ? 112 PHE A CD1  2  
ATOM 4115  C CD2  . PHE A 1 117 ? -5.439  -2.156  5.292   1.00 10.42 ? 112 PHE A CD2  2  
ATOM 4116  C CE1  . PHE A 1 117 ? -5.834  -0.411  3.194   1.00 64.14 ? 112 PHE A CE1  2  
ATOM 4117  C CE2  . PHE A 1 117 ? -5.838  -0.857  5.542   1.00 73.12 ? 112 PHE A CE2  2  
ATOM 4118  C CZ   . PHE A 1 117 ? -6.036  0.017   4.491   1.00 60.31 ? 112 PHE A CZ   2  
ATOM 4119  H H    . PHE A 1 117 ? -3.564  -6.133  2.162   1.00 13.22 ? 112 PHE A H    2  
ATOM 4120  H HA   . PHE A 1 117 ? -3.522  -3.204  2.210   1.00 12.13 ? 112 PHE A HA   2  
ATOM 4121  H HB3  . PHE A 1 117 ? -4.550  -4.468  4.673   1.00 5.34  ? 112 PHE A HB3  2  
ATOM 4122  H HD1  . PHE A 1 117 ? -5.279  -2.043  1.934   1.00 53.42 ? 112 PHE A HD1  2  
ATOM 4123  H HD2  . PHE A 1 117 ? -5.284  -2.839  6.115   1.00 74.11 ? 112 PHE A HD2  2  
ATOM 4124  H HE1  . PHE A 1 117 ? -5.989  0.271   2.371   1.00 23.13 ? 112 PHE A HE1  2  
ATOM 4125  H HE2  . PHE A 1 117 ? -5.995  -0.526  6.558   1.00 31.40 ? 112 PHE A HE2  2  
ATOM 4126  H HZ   . PHE A 1 117 ? -6.347  1.033   4.685   1.00 2.25  ? 112 PHE A HZ   2  
ATOM 4127  N N    . ILE A 1 118 ? -1.728  -3.155  4.008   1.00 54.31 ? 113 ILE A N    2  
ATOM 4128  C CA   . ILE A 1 118 ? -0.500  -3.176  4.794   1.00 0.34  ? 113 ILE A CA   2  
ATOM 4129  C C    . ILE A 1 118 ? -0.571  -2.183  5.948   1.00 73.15 ? 113 ILE A C    2  
ATOM 4130  O O    . ILE A 1 118 ? -0.969  -1.032  5.769   1.00 25.02 ? 113 ILE A O    2  
ATOM 4131  C CB   . ILE A 1 118 ? 0.729   -2.850  3.925   1.00 21.10 ? 113 ILE A CB   2  
ATOM 4132  C CG1  . ILE A 1 118 ? 0.820   -3.820  2.746   1.00 12.43 ? 113 ILE A CG1  2  
ATOM 4133  C CG2  . ILE A 1 118 ? 1.998   -2.906  4.763   1.00 65.21 ? 113 ILE A CG2  2  
ATOM 4134  C CD1  . ILE A 1 118 ? 1.325   -5.194  3.131   1.00 14.04 ? 113 ILE A CD1  2  
ATOM 4135  H H    . ILE A 1 118 ? -2.131  -2.295  3.772   1.00 65.54 ? 113 ILE A H    2  
ATOM 4136  H HA   . ILE A 1 118 ? -0.379  -4.171  5.195   1.00 54.51 ? 113 ILE A HA   2  
ATOM 4137  H HB   . ILE A 1 118 ? 0.619   -1.845  3.547   1.00 52.34 ? 113 ILE A HB   2  
ATOM 4138  H HG13 . ILE A 1 118 ? 1.494   -3.415  2.006   1.00 70.50 ? 113 ILE A HG13 2  
ATOM 4139  H HG21 . ILE A 1 118 ? 2.060   -3.862  5.260   1.00 1.21  ? 113 ILE A HG21 2  
ATOM 4140  H HG22 . ILE A 1 118 ? 2.857   -2.777  4.121   1.00 53.54 ? 113 ILE A HG22 2  
ATOM 4141  H HG23 . ILE A 1 118 ? 1.978   -2.117  5.500   1.00 20.31 ? 113 ILE A HG23 2  
ATOM 4142  H HD11 . ILE A 1 118 ? 0.745   -5.948  2.619   1.00 30.03 ? 113 ILE A HD11 2  
ATOM 4143  H HD12 . ILE A 1 118 ? 2.364   -5.287  2.855   1.00 60.42 ? 113 ILE A HD12 2  
ATOM 4144  H HD13 . ILE A 1 118 ? 1.223   -5.328  4.199   1.00 2.23  ? 113 ILE A HD13 2  
ATOM 4145  N N    . CYS A 1 119 ? -0.180  -2.636  7.135   1.00 0.33  ? 114 CYS A N    2  
ATOM 4146  C CA   . CYS A 1 119 ? -0.197  -1.787  8.321   1.00 1.40  ? 114 CYS A CA   2  
ATOM 4147  C C    . CYS A 1 119 ? 1.209   -1.621  8.891   1.00 35.53 ? 114 CYS A C    2  
ATOM 4148  O O    . CYS A 1 119 ? 2.002   -2.561  8.894   1.00 61.32 ? 114 CYS A O    2  
ATOM 4149  C CB   . CYS A 1 119 ? -1.125  -2.378  9.384   1.00 11.42 ? 114 CYS A CB   2  
ATOM 4150  S SG   . CYS A 1 119 ? -2.765  -2.822  8.766   1.00 31.32 ? 114 CYS A SG   2  
ATOM 4151  H H    . CYS A 1 119 ? 0.128   -3.563  7.216   1.00 74.11 ? 114 CYS A H    2  
ATOM 4152  H HA   . CYS A 1 119 ? -0.570  -0.817  8.029   1.00 2.53  ? 114 CYS A HA   2  
ATOM 4153  H HB3  . CYS A 1 119 ? -1.256  -1.658  10.177  1.00 41.24 ? 114 CYS A HB3  2  
ATOM 4154  H HG   . CYS A 1 119 ? -3.664  -2.182  9.498   1.00 3.24  ? 114 CYS A HG   2  
ATOM 4155  N N    . ASN A 1 120 ? 1.508   -0.419  9.371   1.00 62.31 ? 115 ASN A N    2  
ATOM 4156  C CA   . ASN A 1 120 ? 2.818   -0.128  9.942   1.00 13.04 ? 115 ASN A CA   2  
ATOM 4157  C C    . ASN A 1 120 ? 2.685   0.704   11.214  1.00 62.12 ? 115 ASN A C    2  
ATOM 4158  O O    . ASN A 1 120 ? 2.138   1.808   11.192  1.00 13.24 ? 115 ASN A O    2  
ATOM 4159  C CB   . ASN A 1 120 ? 3.689   0.611   8.924   1.00 30.42 ? 115 ASN A CB   2  
ATOM 4160  C CG   . ASN A 1 120 ? 4.140   -0.287  7.789   1.00 64.24 ? 115 ASN A CG   2  
ATOM 4161  O OD1  . ASN A 1 120 ? 4.165   -1.511  7.923   1.00 70.41 ? 115 ASN A OD1  2  
ATOM 4162  N ND2  . ASN A 1 120 ? 4.501   0.318   6.663   1.00 24.41 ? 115 ASN A ND2  2  
ATOM 4163  H H    . ASN A 1 120 ? 0.832   0.291   9.341   1.00 23.12 ? 115 ASN A H    2  
ATOM 4164  H HA   . ASN A 1 120 ? 3.288   -1.068  10.188  1.00 34.34 ? 115 ASN A HA   2  
ATOM 4165  H HB3  . ASN A 1 120 ? 4.564   1.000   9.422   1.00 71.53 ? 115 ASN A HB3  2  
ATOM 4166  H HD21 . ASN A 1 120 ? 4.457   1.297   6.629   1.00 15.44 ? 115 ASN A HD21 2  
ATOM 4167  H HD22 . ASN A 1 120 ? 4.797   -0.239  5.913   1.00 71.43 ? 115 ASN A HD22 2  
ATOM 4168  N N    . TYR A 1 121 ? 3.190   0.169   12.319  1.00 74.54 ? 116 TYR A N    2  
ATOM 4169  C CA   . TYR A 1 121 ? 3.126   0.860   13.602  1.00 21.54 ? 116 TYR A CA   2  
ATOM 4170  C C    . TYR A 1 121 ? 4.519   1.272   14.069  1.00 22.04 ? 116 TYR A C    2  
ATOM 4171  O O    . TYR A 1 121 ? 5.267   0.464   14.618  1.00 13.21 ? 116 TYR A O    2  
ATOM 4172  C CB   . TYR A 1 121 ? 2.466   -0.032  14.654  1.00 20.30 ? 116 TYR A CB   2  
ATOM 4173  C CG   . TYR A 1 121 ? 2.774   0.380   16.077  1.00 10.34 ? 116 TYR A CG   2  
ATOM 4174  C CD1  . TYR A 1 121 ? 2.290   1.574   16.596  1.00 3.33  ? 116 TYR A CD1  2  
ATOM 4175  C CD2  . TYR A 1 121 ? 3.549   -0.426  16.901  1.00 14.12 ? 116 TYR A CD2  2  
ATOM 4176  C CE1  . TYR A 1 121 ? 2.571   1.954   17.894  1.00 23.24 ? 116 TYR A CE1  2  
ATOM 4177  C CE2  . TYR A 1 121 ? 3.833   -0.055  18.201  1.00 73.11 ? 116 TYR A CE2  2  
ATOM 4178  C CZ   . TYR A 1 121 ? 3.341   1.136   18.693  1.00 40.32 ? 116 TYR A CZ   2  
ATOM 4179  O OH   . TYR A 1 121 ? 3.621   1.511   19.987  1.00 44.45 ? 116 TYR A OH   2  
ATOM 4180  H H    . TYR A 1 121 ? 3.614   -0.713  12.274  1.00 20.14 ? 116 TYR A H    2  
ATOM 4181  H HA   . TYR A 1 121 ? 2.526   1.749   13.469  1.00 61.51 ? 116 TYR A HA   2  
ATOM 4182  H HB3  . TYR A 1 121 ? 2.808   -1.047  14.521  1.00 12.12 ? 116 TYR A HB3  2  
ATOM 4183  H HD1  . TYR A 1 121 ? 1.686   2.213   15.968  1.00 1.44  ? 116 TYR A HD1  2  
ATOM 4184  H HD2  . TYR A 1 121 ? 3.933   -1.359  16.513  1.00 32.31 ? 116 TYR A HD2  2  
ATOM 4185  H HE1  . TYR A 1 121 ? 2.186   2.887   18.279  1.00 21.43 ? 116 TYR A HE1  2  
ATOM 4186  H HE2  . TYR A 1 121 ? 4.437   -0.695  18.827  1.00 51.11 ? 116 TYR A HE2  2  
ATOM 4187  H HH   . TYR A 1 121 ? 4.569   1.633   20.087  1.00 23.20 ? 116 TYR A HH   2  
ATOM 4188  N N    . LYS A 1 122 ? 4.861   2.537   13.846  1.00 32.55 ? 117 LYS A N    2  
ATOM 4189  C CA   . LYS A 1 122 ? 6.162   3.059   14.244  1.00 45.00 ? 117 LYS A CA   2  
ATOM 4190  C C    . LYS A 1 122 ? 7.290   2.277   13.579  1.00 12.14 ? 117 LYS A C    2  
ATOM 4191  O O    . LYS A 1 122 ? 7.766   2.648   12.507  1.00 42.25 ? 117 LYS A O    2  
ATOM 4192  C CB   . LYS A 1 122 ? 6.314   3.001   15.766  1.00 53.53 ? 117 LYS A CB   2  
ATOM 4193  C CG   . LYS A 1 122 ? 5.576   4.110   16.494  1.00 64.34 ? 117 LYS A CG   2  
ATOM 4194  C CD   . LYS A 1 122 ? 5.237   3.711   17.921  1.00 63.33 ? 117 LYS A CD   2  
ATOM 4195  C CE   . LYS A 1 122 ? 6.136   4.417   18.925  1.00 60.32 ? 117 LYS A CE   2  
ATOM 4196  N NZ   . LYS A 1 122 ? 5.845   5.876   19.000  1.00 60.12 ? 117 LYS A NZ   2  
ATOM 4197  H H    . LYS A 1 122 ? 4.221   3.134   13.403  1.00 54.03 ? 117 LYS A H    2  
ATOM 4198  H HA   . LYS A 1 122 ? 6.218   4.089   13.925  1.00 22.22 ? 117 LYS A HA   2  
ATOM 4199  H HB3  . LYS A 1 122 ? 7.364   3.072   16.014  1.00 3.33  ? 117 LYS A HB3  2  
ATOM 4200  H HG3  . LYS A 1 122 ? 4.660   4.330   15.964  1.00 2.32  ? 117 LYS A HG3  2  
ATOM 4201  H HD3  . LYS A 1 122 ? 5.364   2.643   18.026  1.00 62.55 ? 117 LYS A HD3  2  
ATOM 4202  H HE3  . LYS A 1 122 ? 7.165   4.279   18.628  1.00 1.33  ? 117 LYS A HE3  2  
ATOM 4203  H HZ1  . LYS A 1 122 ? 4.823   6.030   19.115  1.00 23.14 ? 117 LYS A HZ1  2  
ATOM 4204  H HZ2  . LYS A 1 122 ? 6.159   6.348   18.129  1.00 65.03 ? 117 LYS A HZ2  2  
ATOM 4205  H HZ3  . LYS A 1 122 ? 6.341   6.298   19.811  1.00 42.02 ? 117 LYS A HZ3  2  
ATOM 4206  N N    . GLU A 1 123 ? 7.710   1.191   14.221  1.00 75.31 ? 118 GLU A N    2  
ATOM 4207  C CA   . GLU A 1 123 ? 8.781   0.356   13.690  1.00 62.33 ? 118 GLU A CA   2  
ATOM 4208  C C    . GLU A 1 123 ? 8.301   -1.077  13.482  1.00 74.13 ? 118 GLU A C    2  
ATOM 4209  O O    . GLU A 1 123 ? 9.103   -2.010  13.427  1.00 75.35 ? 118 GLU A O    2  
ATOM 4210  C CB   . GLU A 1 123 ? 9.985   0.371   14.635  1.00 53.00 ? 118 GLU A CB   2  
ATOM 4211  C CG   . GLU A 1 123 ? 10.945  1.521   14.380  1.00 63.31 ? 118 GLU A CG   2  
ATOM 4212  C CD   . GLU A 1 123 ? 11.484  2.126   15.661  1.00 11.21 ? 118 GLU A CD   2  
ATOM 4213  O OE1  . GLU A 1 123 ? 10.675  2.430   16.562  1.00 13.34 ? 118 GLU A OE1  2  
ATOM 4214  O OE2  . GLU A 1 123 ? 12.718  2.296   15.762  1.00 74.41 ? 118 GLU A OE2  2  
ATOM 4215  H H    . GLU A 1 123 ? 7.290   0.947   15.073  1.00 2.34  ? 118 GLU A H    2  
ATOM 4216  H HA   . GLU A 1 123 ? 9.079   0.766   12.737  1.00 32.14 ? 118 GLU A HA   2  
ATOM 4217  H HB3  . GLU A 1 123 ? 10.528  -0.555  14.520  1.00 3.02  ? 118 GLU A HB3  2  
ATOM 4218  H HG3  . GLU A 1 123 ? 10.426  2.291   13.827  1.00 14.42 ? 118 GLU A HG3  2  
ATOM 4219  N N    . HIS A 1 124 ? 6.987   -1.244  13.368  1.00 72.02 ? 119 HIS A N    2  
ATOM 4220  C CA   . HIS A 1 124 ? 6.400   -2.564  13.166  1.00 21.22 ? 119 HIS A CA   2  
ATOM 4221  C C    . HIS A 1 124 ? 5.717   -2.652  11.804  1.00 50.44 ? 119 HIS A C    2  
ATOM 4222  O O    . HIS A 1 124 ? 5.161   -1.670  11.313  1.00 52.21 ? 119 HIS A O    2  
ATOM 4223  C CB   . HIS A 1 124 ? 5.393   -2.873  14.274  1.00 63.44 ? 119 HIS A CB   2  
ATOM 4224  C CG   . HIS A 1 124 ? 5.377   -4.312  14.685  1.00 12.33 ? 119 HIS A CG   2  
ATOM 4225  N ND1  . HIS A 1 124 ? 5.056   -5.338  13.821  1.00 45.11 ? 119 HIS A ND1  2  
ATOM 4226  C CD2  . HIS A 1 124 ? 5.646   -4.897  15.876  1.00 33.43 ? 119 HIS A CD2  2  
ATOM 4227  C CE1  . HIS A 1 124 ? 5.126   -6.490  14.462  1.00 40.34 ? 119 HIS A CE1  2  
ATOM 4228  N NE2  . HIS A 1 124 ? 5.482   -6.251  15.711  1.00 63.03 ? 119 HIS A NE2  2  
ATOM 4229  H H    . HIS A 1 124 ? 6.400   -0.463  13.420  1.00 64.32 ? 119 HIS A H    2  
ATOM 4230  H HA   . HIS A 1 124 ? 7.197   -3.291  13.203  1.00 3.43  ? 119 HIS A HA   2  
ATOM 4231  H HB3  . HIS A 1 124 ? 4.401   -2.613  13.934  1.00 63.43 ? 119 HIS A HB3  2  
ATOM 4232  H HD1  . HIS A 1 124 ? 4.811   -5.236  12.877  1.00 73.04 ? 119 HIS A HD1  2  
ATOM 4233  H HD2  . HIS A 1 124 ? 5.934   -4.392  16.788  1.00 34.14 ? 119 HIS A HD2  2  
ATOM 4234  H HE1  . HIS A 1 124 ? 4.927   -7.464  14.038  1.00 62.24 ? 119 HIS A HE1  2  
ATOM 4235  N N    . TRP A 1 125 ? 5.765   -3.834  11.200  1.00 4.41  ? 120 TRP A N    2  
ATOM 4236  C CA   . TRP A 1 125 ? 5.153   -4.049  9.894   1.00 31.55 ? 120 TRP A CA   2  
ATOM 4237  C C    . TRP A 1 125 ? 4.178   -5.221  9.937   1.00 35.34 ? 120 TRP A C    2  
ATOM 4238  O O    . TRP A 1 125 ? 4.455   -6.249  10.554  1.00 54.10 ? 120 TRP A O    2  
ATOM 4239  C CB   . TRP A 1 125 ? 6.229   -4.304  8.838   1.00 11.13 ? 120 TRP A CB   2  
ATOM 4240  C CG   . TRP A 1 125 ? 6.588   -3.081  8.048   1.00 1.22  ? 120 TRP A CG   2  
ATOM 4241  C CD1  . TRP A 1 125 ? 7.039   -1.891  8.541   1.00 61.53 ? 120 TRP A CD1  2  
ATOM 4242  C CD2  . TRP A 1 125 ? 6.523   -2.930  6.625   1.00 73.51 ? 120 TRP A CD2  2  
ATOM 4243  N NE1  . TRP A 1 125 ? 7.259   -1.008  7.511   1.00 10.05 ? 120 TRP A NE1  2  
ATOM 4244  C CE2  . TRP A 1 125 ? 6.950   -1.623  6.326   1.00 64.35 ? 120 TRP A CE2  2  
ATOM 4245  C CE3  . TRP A 1 125 ? 6.147   -3.773  5.576   1.00 52.11 ? 120 TRP A CE3  2  
ATOM 4246  C CZ2  . TRP A 1 125 ? 7.010   -1.140  5.021   1.00 43.42 ? 120 TRP A CZ2  2  
ATOM 4247  C CZ3  . TRP A 1 125 ? 6.207   -3.293  4.282   1.00 51.31 ? 120 TRP A CZ3  2  
ATOM 4248  C CH2  . TRP A 1 125 ? 6.637   -1.987  4.013   1.00 62.20 ? 120 TRP A CH2  2  
ATOM 4249  H H    . TRP A 1 125 ? 6.224   -4.579  11.642  1.00 13.54 ? 120 TRP A H    2  
ATOM 4250  H HA   . TRP A 1 125 ? 4.609   -3.153  9.631   1.00 34.30 ? 120 TRP A HA   2  
ATOM 4251  H HB3  . TRP A 1 125 ? 5.874   -5.056  8.147   1.00 63.04 ? 120 TRP A HB3  2  
ATOM 4252  H HD1  . TRP A 1 125 ? 7.194   -1.686  9.590   1.00 10.13 ? 120 TRP A HD1  2  
ATOM 4253  H HE1  . TRP A 1 125 ? 7.585   -0.089  7.610   1.00 4.15  ? 120 TRP A HE1  2  
ATOM 4254  H HE3  . TRP A 1 125 ? 5.814   -4.783  5.763   1.00 73.52 ? 120 TRP A HE3  2  
ATOM 4255  H HZ2  . TRP A 1 125 ? 7.340   -0.135  4.798   1.00 52.10 ? 120 TRP A HZ2  2  
ATOM 4256  H HZ3  . TRP A 1 125 ? 5.920   -3.930  3.458   1.00 12.32 ? 120 TRP A HZ3  2  
ATOM 4257  H HH2  . TRP A 1 125 ? 6.667   -1.654  2.987   1.00 72.23 ? 120 TRP A HH2  2  
ATOM 4258  N N    . PHE A 1 126 ? 3.035   -5.059  9.277   1.00 3.33  ? 121 PHE A N    2  
ATOM 4259  C CA   . PHE A 1 126 ? 2.019   -6.105  9.241   1.00 4.15  ? 121 PHE A CA   2  
ATOM 4260  C C    . PHE A 1 126 ? 1.456   -6.267  7.831   1.00 74.25 ? 121 PHE A C    2  
ATOM 4261  O O    . PHE A 1 126 ? 1.183   -5.284  7.142   1.00 41.42 ? 121 PHE A O    2  
ATOM 4262  C CB   . PHE A 1 126 ? 0.889   -5.780  10.219  1.00 32.41 ? 121 PHE A CB   2  
ATOM 4263  C CG   . PHE A 1 126 ? 0.433   -6.965  11.023  1.00 42.01 ? 121 PHE A CG   2  
ATOM 4264  C CD1  . PHE A 1 126 ? -0.066  -8.094  10.395  1.00 12.33 ? 121 PHE A CD1  2  
ATOM 4265  C CD2  . PHE A 1 126 ? 0.503   -6.949  12.407  1.00 65.24 ? 121 PHE A CD2  2  
ATOM 4266  C CE1  . PHE A 1 126 ? -0.486  -9.186  11.131  1.00 25.02 ? 121 PHE A CE1  2  
ATOM 4267  C CE2  . PHE A 1 126 ? 0.086   -8.037  13.148  1.00 11.32 ? 121 PHE A CE2  2  
ATOM 4268  C CZ   . PHE A 1 126 ? -0.410  -9.156  12.510  1.00 14.23 ? 121 PHE A CZ   2  
ATOM 4269  H H    . PHE A 1 126 ? 2.872   -4.216  8.804   1.00 12.35 ? 121 PHE A H    2  
ATOM 4270  H HA   . PHE A 1 126 ? 2.487   -7.031  9.538   1.00 30.32 ? 121 PHE A HA   2  
ATOM 4271  H HB3  . PHE A 1 126 ? 0.040   -5.406  9.666   1.00 73.55 ? 121 PHE A HB3  2  
ATOM 4272  H HD1  . PHE A 1 126 ? -0.125  -8.118  9.315   1.00 74.24 ? 121 PHE A HD1  2  
ATOM 4273  H HD2  . PHE A 1 126 ? 0.890   -6.073  12.908  1.00 2.22  ? 121 PHE A HD2  2  
ATOM 4274  H HE1  . PHE A 1 126 ? -0.873  -10.060 10.628  1.00 73.10 ? 121 PHE A HE1  2  
ATOM 4275  H HE2  . PHE A 1 126 ? 0.145   -8.012  14.226  1.00 1.24  ? 121 PHE A HE2  2  
ATOM 4276  H HZ   . PHE A 1 126 ? -0.737  -10.009 13.086  1.00 73.52 ? 121 PHE A HZ   2  
ATOM 4277  N N    . THR A 1 127 ? 1.284   -7.516  7.410   1.00 41.53 ? 122 THR A N    2  
ATOM 4278  C CA   . THR A 1 127 ? 0.756   -7.809  6.084   1.00 5.51  ? 122 THR A CA   2  
ATOM 4279  C C    . THR A 1 127 ? -0.670  -8.341  6.165   1.00 41.34 ? 122 THR A C    2  
ATOM 4280  O O    . THR A 1 127 ? -0.934  -9.335  6.841   1.00 12.35 ? 122 THR A O    2  
ATOM 4281  C CB   . THR A 1 127 ? 1.634   -8.836  5.344   1.00 15.20 ? 122 THR A CB   2  
ATOM 4282  O OG1  . THR A 1 127 ? 2.955   -8.314  5.163   1.00 22.43 ? 122 THR A OG1  2  
ATOM 4283  C CG2  . THR A 1 127 ? 1.033   -9.187  3.991   1.00 12.51 ? 122 THR A CG2  2  
ATOM 4284  H H    . THR A 1 127 ? 1.521   -8.258  8.006   1.00 61.31 ? 122 THR A H    2  
ATOM 4285  H HA   . THR A 1 127 ? 0.757   -6.892  5.514   1.00 25.42 ? 122 THR A HA   2  
ATOM 4286  H HB   . THR A 1 127 ? 1.689   -9.736  5.941   1.00 41.01 ? 122 THR A HB   2  
ATOM 4287  H HG1  . THR A 1 127 ? 3.245   -7.889  5.975   1.00 12.53 ? 122 THR A HG1  2  
ATOM 4288  H HG21 . THR A 1 127 ? 0.951   -8.294  3.390   1.00 65.24 ? 122 THR A HG21 2  
ATOM 4289  H HG22 . THR A 1 127 ? 0.052   -9.616  4.133   1.00 14.30 ? 122 THR A HG22 2  
ATOM 4290  H HG23 . THR A 1 127 ? 1.669   -9.901  3.489   1.00 33.11 ? 122 THR A HG23 2  
ATOM 4291  N N    . VAL A 1 128 ? -1.586  -7.673  5.472   1.00 64.14 ? 123 VAL A N    2  
ATOM 4292  C CA   . VAL A 1 128 ? -2.986  -8.080  5.464   1.00 22.43 ? 123 VAL A CA   2  
ATOM 4293  C C    . VAL A 1 128 ? -3.473  -8.349  4.045   1.00 50.24 ? 123 VAL A C    2  
ATOM 4294  O O    . VAL A 1 128 ? -3.184  -7.586  3.123   1.00 53.24 ? 123 VAL A O    2  
ATOM 4295  C CB   . VAL A 1 128 ? -3.885  -7.007  6.108   1.00 62.11 ? 123 VAL A CB   2  
ATOM 4296  C CG1  . VAL A 1 128 ? -5.346  -7.258  5.763   1.00 45.42 ? 123 VAL A CG1  2  
ATOM 4297  C CG2  . VAL A 1 128 ? -3.683  -6.977  7.616   1.00 1.54  ? 123 VAL A CG2  2  
ATOM 4298  H H    . VAL A 1 128 ? -1.314  -6.888  4.952   1.00 64.20 ? 123 VAL A H    2  
ATOM 4299  H HA   . VAL A 1 128 ? -3.073  -8.987  6.043   1.00 51.23 ? 123 VAL A HA   2  
ATOM 4300  H HB   . VAL A 1 128 ? -3.604  -6.044  5.709   1.00 63.21 ? 123 VAL A HB   2  
ATOM 4301  H HG11 . VAL A 1 128 ? -5.506  -7.056  4.713   1.00 14.41 ? 123 VAL A HG11 2  
ATOM 4302  H HG12 . VAL A 1 128 ? -5.595  -8.286  5.977   1.00 4.23  ? 123 VAL A HG12 2  
ATOM 4303  H HG13 . VAL A 1 128 ? -5.972  -6.605  6.353   1.00 4.12  ? 123 VAL A HG13 2  
ATOM 4304  H HG21 . VAL A 1 128 ? -3.430  -7.967  7.963   1.00 55.42 ? 123 VAL A HG21 2  
ATOM 4305  H HG22 . VAL A 1 128 ? -2.881  -6.295  7.858   1.00 3.11  ? 123 VAL A HG22 2  
ATOM 4306  H HG23 . VAL A 1 128 ? -4.593  -6.648  8.094   1.00 51.25 ? 123 VAL A HG23 2  
ATOM 4307  N N    . ARG A 1 129 ? -4.212  -9.441  3.876   1.00 73.43 ? 124 ARG A N    2  
ATOM 4308  C CA   . ARG A 1 129 ? -4.739  -9.813  2.569   1.00 44.34 ? 124 ARG A CA   2  
ATOM 4309  C C    . ARG A 1 129 ? -6.203  -10.230 2.670   1.00 50.13 ? 124 ARG A C    2  
ATOM 4310  O O    . ARG A 1 129 ? -6.646  -10.732 3.703   1.00 64.35 ? 124 ARG A O    2  
ATOM 4311  C CB   . ARG A 1 129 ? -3.912  -10.952 1.968   1.00 24.54 ? 124 ARG A CB   2  
ATOM 4312  C CG   . ARG A 1 129 ? -3.246  -10.592 0.650   1.00 11.01 ? 124 ARG A CG   2  
ATOM 4313  C CD   . ARG A 1 129 ? -4.268  -10.175 -0.396  1.00 30.34 ? 124 ARG A CD   2  
ATOM 4314  N NE   . ARG A 1 129 ? -5.239  -11.233 -0.664  1.00 22.55 ? 124 ARG A NE   2  
ATOM 4315  C CZ   . ARG A 1 129 ? -4.946  -12.351 -1.319  1.00 73.12 ? 124 ARG A CZ   2  
ATOM 4316  N NH1  . ARG A 1 129 ? -3.716  -12.556 -1.768  1.00 0.35  ? 124 ARG A NH1  2  
ATOM 4317  N NH2  . ARG A 1 129 ? -5.883  -13.267 -1.523  1.00 34.45 ? 124 ARG A NH2  2  
ATOM 4318  H H    . ARG A 1 129 ? -4.408  -10.010 4.650   1.00 0.42  ? 124 ARG A H    2  
ATOM 4319  H HA   . ARG A 1 129 ? -4.666  -8.949  1.924   1.00 12.55 ? 124 ARG A HA   2  
ATOM 4320  H HB3  . ARG A 1 129 ? -4.560  -11.799 1.799   1.00 61.25 ? 124 ARG A HB3  2  
ATOM 4321  H HG3  . ARG A 1 129 ? -2.702  -11.451 0.286   1.00 62.42 ? 124 ARG A HG3  2  
ATOM 4322  H HD3  . ARG A 1 129 ? -3.750  -9.935  -1.311  1.00 5.41  ? 124 ARG A HD3  2  
ATOM 4323  H HE   . ARG A 1 129 ? -6.155  -11.102 -0.340  1.00 3.31  ? 124 ARG A HE   2  
ATOM 4324  H HH11 . ARG A 1 129 ? -3.006  -11.868 -1.615  1.00 31.31 ? 124 ARG A HH11 2  
ATOM 4325  H HH12 . ARG A 1 129 ? -3.497  -13.400 -2.260  1.00 44.04 ? 124 ARG A HH12 2  
ATOM 4326  H HH21 . ARG A 1 129 ? -6.812  -13.116 -1.186  1.00 72.43 ? 124 ARG A HH21 2  
ATOM 4327  H HH22 . ARG A 1 129 ? -5.662  -14.108 -2.016  1.00 75.03 ? 124 ARG A HH22 2  
ATOM 4328  N N    . LYS A 1 130 ? -6.949  -10.019 1.591   1.00 53.03 ? 125 LYS A N    2  
ATOM 4329  C CA   . LYS A 1 130 ? -8.363  -10.374 1.557   1.00 61.40 ? 125 LYS A CA   2  
ATOM 4330  C C    . LYS A 1 130 ? -8.553  -11.807 1.073   1.00 63.12 ? 125 LYS A C    2  
ATOM 4331  O O    . LYS A 1 130 ? -7.984  -12.211 0.058   1.00 44.35 ? 125 LYS A O    2  
ATOM 4332  C CB   . LYS A 1 130 ? -9.129  -9.411  0.648   1.00 24.42 ? 125 LYS A CB   2  
ATOM 4333  C CG   . LYS A 1 130 ? -10.562 -9.838  0.378   1.00 54.23 ? 125 LYS A CG   2  
ATOM 4334  C CD   . LYS A 1 130 ? -11.486 -8.640  0.245   1.00 62.21 ? 125 LYS A CD   2  
ATOM 4335  C CE   . LYS A 1 130 ? -12.909 -8.986  0.655   1.00 32.10 ? 125 LYS A CE   2  
ATOM 4336  N NZ   . LYS A 1 130 ? -13.698 -9.530  -0.485  1.00 43.12 ? 125 LYS A NZ   2  
ATOM 4337  H H    . LYS A 1 130 ? -6.538  -9.615  0.798   1.00 41.21 ? 125 LYS A H    2  
ATOM 4338  H HA   . LYS A 1 130 ? -8.749  -10.291 2.561   1.00 33.40 ? 125 LYS A HA   2  
ATOM 4339  H HB3  . LYS A 1 130 ? -8.612  -9.341  -0.300  1.00 75.45 ? 125 LYS A HB3  2  
ATOM 4340  H HG3  . LYS A 1 130 ? -10.903 -10.456 1.197   1.00 14.22 ? 125 LYS A HG3  2  
ATOM 4341  H HD3  . LYS A 1 130 ? -11.487 -8.309  -0.783  1.00 11.22 ? 125 LYS A HD3  2  
ATOM 4342  H HE3  . LYS A 1 130 ? -13.392 -8.092  1.022   1.00 2.32  ? 125 LYS A HE3  2  
ATOM 4343  H HZ1  . LYS A 1 130 ? -13.086 -10.105 -1.099  1.00 2.32  ? 125 LYS A HZ1  2  
ATOM 4344  H HZ2  . LYS A 1 130 ? -14.099 -8.752  -1.045  1.00 33.25 ? 125 LYS A HZ2  2  
ATOM 4345  H HZ3  . LYS A 1 130 ? -14.473 -10.126 -0.131  1.00 1.01  ? 125 LYS A HZ3  2  
ATOM 4346  N N    . LEU A 1 131 ? -9.356  -12.571 1.804   1.00 12.14 ? 126 LEU A N    2  
ATOM 4347  C CA   . LEU A 1 131 ? -9.623  -13.961 1.448   1.00 54.40 ? 126 LEU A CA   2  
ATOM 4348  C C    . LEU A 1 131 ? -11.124 -14.229 1.383   1.00 41.02 ? 126 LEU A C    2  
ATOM 4349  O O    . LEU A 1 131 ? -11.792 -14.326 2.412   1.00 1.22  ? 126 LEU A O    2  
ATOM 4350  C CB   . LEU A 1 131 ? -8.969  -14.902 2.461   1.00 31.24 ? 126 LEU A CB   2  
ATOM 4351  C CG   . LEU A 1 131 ? -7.752  -15.683 1.963   1.00 10.01 ? 126 LEU A CG   2  
ATOM 4352  C CD1  . LEU A 1 131 ? -6.698  -15.780 3.054   1.00 42.34 ? 126 LEU A CD1  2  
ATOM 4353  C CD2  . LEU A 1 131 ? -8.164  -17.070 1.491   1.00 63.42 ? 126 LEU A CD2  2  
ATOM 4354  H H    . LEU A 1 131 ? -9.781  -12.194 2.601   1.00 32.44 ? 126 LEU A H    2  
ATOM 4355  H HA   . LEU A 1 131 ? -9.195  -14.141 0.473   1.00 10.45 ? 126 LEU A HA   2  
ATOM 4356  H HB3  . LEU A 1 131 ? -9.715  -15.618 2.776   1.00 63.40 ? 126 LEU A HB3  2  
ATOM 4357  H HG   . LEU A 1 131 ? -7.316  -15.159 1.123   1.00 52.53 ? 126 LEU A HG   2  
ATOM 4358  H HD11 . LEU A 1 131 ? -7.181  -15.880 4.014   1.00 10.01 ? 126 LEU A HD11 2  
ATOM 4359  H HD12 . LEU A 1 131 ? -6.090  -14.886 3.049   1.00 1.42  ? 126 LEU A HD12 2  
ATOM 4360  H HD13 . LEU A 1 131 ? -6.071  -16.641 2.874   1.00 32.14 ? 126 LEU A HD13 2  
ATOM 4361  H HD21 . LEU A 1 131 ? -9.220  -17.209 1.665   1.00 11.24 ? 126 LEU A HD21 2  
ATOM 4362  H HD22 . LEU A 1 131 ? -7.608  -17.816 2.040   1.00 52.03 ? 126 LEU A HD22 2  
ATOM 4363  H HD23 . LEU A 1 131 ? -7.954  -17.168 0.437   1.00 35.54 ? 126 LEU A HD23 2  
ATOM 4364  N N    . GLY A 1 132 ? -11.647 -14.348 0.167   1.00 43.44 ? 127 GLY A N    2  
ATOM 4365  C CA   . GLY A 1 132 ? -13.064 -14.605 -0.010  1.00 54.51 ? 127 GLY A CA   2  
ATOM 4366  C C    . GLY A 1 132 ? -13.928 -13.479 0.523   1.00 34.14 ? 127 GLY A C    2  
ATOM 4367  O O    . GLY A 1 132 ? -13.892 -12.362 0.008   1.00 44.23 ? 127 GLY A O    2  
ATOM 4368  H H    . GLY A 1 132 ? -11.065 -14.261 -0.618  1.00 1.31  ? 127 GLY A H    2  
ATOM 4369  H HA2  . GLY A 1 132 ? -13.267 -14.735 -1.062  1.00 20.11 ? 127 GLY A HA2  2  
ATOM 4370  H HA3  . GLY A 1 132 ? -13.320 -15.517 0.510   1.00 34.20 ? 127 GLY A HA3  2  
ATOM 4371  N N    . LYS A 1 133 ? -14.710 -13.774 1.556   1.00 32.21 ? 128 LYS A N    2  
ATOM 4372  C CA   . LYS A 1 133 ? -15.589 -12.778 2.159   1.00 55.34 ? 128 LYS A CA   2  
ATOM 4373  C C    . LYS A 1 133 ? -15.071 -12.356 3.531   1.00 43.31 ? 128 LYS A C    2  
ATOM 4374  O O    . LYS A 1 133 ? -15.786 -11.720 4.304   1.00 61.11 ? 128 LYS A O    2  
ATOM 4375  C CB   . LYS A 1 133 ? -17.009 -13.333 2.287   1.00 73.44 ? 128 LYS A CB   2  
ATOM 4376  C CG   . LYS A 1 133 ? -17.726 -13.482 0.956   1.00 60.53 ? 128 LYS A CG   2  
ATOM 4377  C CD   . LYS A 1 133 ? -18.433 -12.198 0.558   1.00 64.31 ? 128 LYS A CD   2  
ATOM 4378  C CE   . LYS A 1 133 ? -17.624 -11.409 -0.459  1.00 4.12  ? 128 LYS A CE   2  
ATOM 4379  N NZ   . LYS A 1 133 ? -18.491 -10.549 -1.312  1.00 61.14 ? 128 LYS A NZ   2  
ATOM 4380  H H    . LYS A 1 133 ? -14.695 -14.683 1.922   1.00 35.33 ? 128 LYS A H    2  
ATOM 4381  H HA   . LYS A 1 133 ? -15.605 -11.915 1.512   1.00 14.02 ? 128 LYS A HA   2  
ATOM 4382  H HB3  . LYS A 1 133 ? -17.588 -12.668 2.911   1.00 63.15 ? 128 LYS A HB3  2  
ATOM 4383  H HG3  . LYS A 1 133 ? -18.456 -14.274 1.039   1.00 32.24 ? 128 LYS A HG3  2  
ATOM 4384  H HD3  . LYS A 1 133 ? -18.580 -11.589 1.439   1.00 11.14 ? 128 LYS A HD3  2  
ATOM 4385  H HE3  . LYS A 1 133 ? -17.089 -12.103 -1.091  1.00 63.33 ? 128 LYS A HE3  2  
ATOM 4386  H HZ1  . LYS A 1 133 ? -18.853 -11.095 -2.118  1.00 10.24 ? 128 LYS A HZ1  2  
ATOM 4387  H HZ2  . LYS A 1 133 ? -17.946 -9.739  -1.673  1.00 31.20 ? 128 LYS A HZ2  2  
ATOM 4388  H HZ3  . LYS A 1 133 ? -19.295 -10.192 -0.758  1.00 32.51 ? 128 LYS A HZ3  2  
ATOM 4389  N N    . GLN A 1 134 ? -13.824 -12.712 3.823   1.00 4.11  ? 129 GLN A N    2  
ATOM 4390  C CA   . GLN A 1 134 ? -13.212 -12.368 5.101   1.00 24.13 ? 129 GLN A CA   2  
ATOM 4391  C C    . GLN A 1 134 ? -11.756 -11.957 4.913   1.00 25.20 ? 129 GLN A C    2  
ATOM 4392  O O    . GLN A 1 134 ? -11.098 -12.380 3.962   1.00 34.41 ? 129 GLN A O    2  
ATOM 4393  C CB   . GLN A 1 134 ? -13.300 -13.550 6.067   1.00 31.10 ? 129 GLN A CB   2  
ATOM 4394  C CG   . GLN A 1 134 ? -12.675 -14.827 5.526   1.00 64.14 ? 129 GLN A CG   2  
ATOM 4395  C CD   . GLN A 1 134 ? -13.368 -16.076 6.034   1.00 42.30 ? 129 GLN A CD   2  
ATOM 4396  O OE1  . GLN A 1 134 ? -14.562 -16.270 5.813   1.00 31.15 ? 129 GLN A OE1  2  
ATOM 4397  N NE2  . GLN A 1 134 ? -12.617 -16.932 6.718   1.00 21.32 ? 129 GLN A NE2  2  
ATOM 4398  H H    . GLN A 1 134 ? -13.305 -13.218 3.165   1.00 12.41 ? 129 GLN A H    2  
ATOM 4399  H HA   . GLN A 1 134 ? -13.757 -11.534 5.516   1.00 35.22 ? 129 GLN A HA   2  
ATOM 4400  H HB3  . GLN A 1 134 ? -14.340 -13.748 6.282   1.00 32.21 ? 129 GLN A HB3  2  
ATOM 4401  H HG3  . GLN A 1 134 ? -11.638 -14.859 5.827   1.00 10.25 ? 129 GLN A HG3  2  
ATOM 4402  H HE21 . GLN A 1 134 ? -11.672 -16.711 6.856   1.00 71.31 ? 129 GLN A HE21 2  
ATOM 4403  H HE22 . GLN A 1 134 ? -13.039 -17.747 7.058   1.00 33.03 ? 129 GLN A HE22 2  
ATOM 4404  N N    . TRP A 1 135 ? -11.258 -11.128 5.825   1.00 52.42 ? 130 TRP A N    2  
ATOM 4405  C CA   . TRP A 1 135 ? -9.879  -10.660 5.760   1.00 4.12  ? 130 TRP A CA   2  
ATOM 4406  C C    . TRP A 1 135 ? -8.954  -11.575 6.554   1.00 21.34 ? 130 TRP A C    2  
ATOM 4407  O O    . TRP A 1 135 ? -9.392  -12.272 7.469   1.00 54.25 ? 130 TRP A O    2  
ATOM 4408  C CB   . TRP A 1 135 ? -9.779  -9.228  6.289   1.00 33.22 ? 130 TRP A CB   2  
ATOM 4409  C CG   . TRP A 1 135 ? -10.107 -8.189  5.259   1.00 50.31 ? 130 TRP A CG   2  
ATOM 4410  C CD1  . TRP A 1 135 ? -11.300 -7.546  5.094   1.00 53.43 ? 130 TRP A CD1  2  
ATOM 4411  C CD2  . TRP A 1 135 ? -9.229  -7.676  4.252   1.00 41.12 ? 130 TRP A CD2  2  
ATOM 4412  N NE1  . TRP A 1 135 ? -11.217 -6.664  4.045   1.00 3.04  ? 130 TRP A NE1  2  
ATOM 4413  C CE2  . TRP A 1 135 ? -9.957  -6.724  3.511   1.00 43.14 ? 130 TRP A CE2  2  
ATOM 4414  C CE3  . TRP A 1 135 ? -7.899  -7.926  3.904   1.00 1.30  ? 130 TRP A CE3  2  
ATOM 4415  C CZ2  . TRP A 1 135 ? -9.398  -6.024  2.445   1.00 51.35 ? 130 TRP A CZ2  2  
ATOM 4416  C CZ3  . TRP A 1 135 ? -7.345  -7.231  2.845   1.00 32.20 ? 130 TRP A CZ3  2  
ATOM 4417  C CH2  . TRP A 1 135 ? -8.094  -6.289  2.125   1.00 54.05 ? 130 TRP A CH2  2  
ATOM 4418  H H    . TRP A 1 135 ? -11.832 -10.825 6.559   1.00 71.12 ? 130 TRP A H    2  
ATOM 4419  H HA   . TRP A 1 135 ? -9.574  -10.672 4.723   1.00 32.52 ? 130 TRP A HA   2  
ATOM 4420  H HB3  . TRP A 1 135 ? -8.771  -9.049  6.636   1.00 13.52 ? 130 TRP A HB3  2  
ATOM 4421  H HD1  . TRP A 1 135 ? -12.173 -7.718  5.706   1.00 50.33 ? 130 TRP A HD1  2  
ATOM 4422  H HE1  . TRP A 1 135 ? -11.943 -6.084  3.730   1.00 71.32 ? 130 TRP A HE1  2  
ATOM 4423  H HE3  . TRP A 1 135 ? -7.306  -8.648  4.446   1.00 3.30  ? 130 TRP A HE3  2  
ATOM 4424  H HZ2  . TRP A 1 135 ? -9.961  -5.295  1.882   1.00 44.24 ? 130 TRP A HZ2  2  
ATOM 4425  H HZ3  . TRP A 1 135 ? -6.319  -7.411  2.561   1.00 33.11 ? 130 TRP A HZ3  2  
ATOM 4426  H HH2  . TRP A 1 135 ? -7.620  -5.771  1.306   1.00 32.33 ? 130 TRP A HH2  2  
ATOM 4427  N N    . PHE A 1 136 ? -7.673  -11.567 6.200   1.00 75.02 ? 131 PHE A N    2  
ATOM 4428  C CA   . PHE A 1 136 ? -6.687  -12.398 6.881   1.00 24.14 ? 131 PHE A CA   2  
ATOM 4429  C C    . PHE A 1 136 ? -5.388  -11.628 7.103   1.00 12.23 ? 131 PHE A C    2  
ATOM 4430  O O    . PHE A 1 136 ? -4.856  -11.010 6.182   1.00 63.55 ? 131 PHE A O    2  
ATOM 4431  C CB   . PHE A 1 136 ? -6.409  -13.666 6.071   1.00 25.23 ? 131 PHE A CB   2  
ATOM 4432  C CG   . PHE A 1 136 ? -4.968  -13.823 5.679   1.00 70.31 ? 131 PHE A CG   2  
ATOM 4433  C CD1  . PHE A 1 136 ? -4.065  -14.431 6.537   1.00 32.55 ? 131 PHE A CD1  2  
ATOM 4434  C CD2  . PHE A 1 136 ? -4.515  -13.364 4.453   1.00 61.14 ? 131 PHE A CD2  2  
ATOM 4435  C CE1  . PHE A 1 136 ? -2.738  -14.578 6.180   1.00 11.03 ? 131 PHE A CE1  2  
ATOM 4436  C CE2  . PHE A 1 136 ? -3.190  -13.508 4.090   1.00 52.53 ? 131 PHE A CE2  2  
ATOM 4437  C CZ   . PHE A 1 136 ? -2.300  -14.114 4.955   1.00 54.40 ? 131 PHE A CZ   2  
ATOM 4438  H H    . PHE A 1 136 ? -7.385  -10.990 5.462   1.00 45.24 ? 131 PHE A H    2  
ATOM 4439  H HA   . PHE A 1 136 ? -7.095  -12.676 7.840   1.00 34.21 ? 131 PHE A HA   2  
ATOM 4440  H HB3  . PHE A 1 136 ? -7.000  -13.642 5.167   1.00 4.42  ? 131 PHE A HB3  2  
ATOM 4441  H HD1  . PHE A 1 136 ? -4.408  -14.793 7.497   1.00 23.02 ? 131 PHE A HD1  2  
ATOM 4442  H HD2  . PHE A 1 136 ? -5.209  -12.888 3.776   1.00 4.33  ? 131 PHE A HD2  2  
ATOM 4443  H HE1  . PHE A 1 136 ? -2.046  -15.052 6.859   1.00 14.44 ? 131 PHE A HE1  2  
ATOM 4444  H HE2  . PHE A 1 136 ? -2.849  -13.145 3.131   1.00 55.15 ? 131 PHE A HE2  2  
ATOM 4445  H HZ   . PHE A 1 136 ? -1.264  -14.230 4.674   1.00 64.32 ? 131 PHE A HZ   2  
ATOM 4446  N N    . ASN A 1 137 ? -4.884  -11.671 8.333   1.00 13.15 ? 132 ASN A N    2  
ATOM 4447  C CA   . ASN A 1 137 ? -3.649  -10.978 8.677   1.00 72.32 ? 132 ASN A CA   2  
ATOM 4448  C C    . ASN A 1 137 ? -2.484  -11.958 8.777   1.00 53.23 ? 132 ASN A C    2  
ATOM 4449  O O    . ASN A 1 137 ? -2.684  -13.159 8.967   1.00 4.12  ? 132 ASN A O    2  
ATOM 4450  C CB   . ASN A 1 137 ? -3.813  -10.227 10.000  1.00 24.41 ? 132 ASN A CB   2  
ATOM 4451  C CG   . ASN A 1 137 ? -4.680  -8.990  9.859   1.00 42.34 ? 132 ASN A CG   2  
ATOM 4452  O OD1  . ASN A 1 137 ? -5.455  -8.866  8.912   1.00 5.33  ? 132 ASN A OD1  2  
ATOM 4453  N ND2  . ASN A 1 137 ? -4.549  -8.066  10.804  1.00 20.21 ? 132 ASN A ND2  2  
ATOM 4454  H H    . ASN A 1 137 ? -5.355  -12.182 9.025   1.00 44.32 ? 132 ASN A H    2  
ATOM 4455  H HA   . ASN A 1 137 ? -3.439  -10.266 7.893   1.00 51.11 ? 132 ASN A HA   2  
ATOM 4456  H HB3  . ASN A 1 137 ? -2.841  -9.924  10.360  1.00 5.42  ? 132 ASN A HB3  2  
ATOM 4457  H HD21 . ASN A 1 137 ? -3.911  -8.231  11.529  1.00 53.50 ? 132 ASN A HD21 2  
ATOM 4458  H HD22 . ASN A 1 137 ? -5.098  -7.256  10.738  1.00 42.04 ? 132 ASN A HD22 2  
ATOM 4459  N N    . LEU A 1 138 ? -1.268  -11.439 8.649   1.00 71.23 ? 133 LEU A N    2  
ATOM 4460  C CA   . LEU A 1 138 ? -0.070  -12.268 8.726   1.00 61.54 ? 133 LEU A CA   2  
ATOM 4461  C C    . LEU A 1 138 ? 1.171   -11.410 8.956   1.00 0.24  ? 133 LEU A C    2  
ATOM 4462  O O    . LEU A 1 138 ? 1.256   -10.282 8.474   1.00 30.21 ? 133 LEU A O    2  
ATOM 4463  C CB   . LEU A 1 138 ? 0.090   -13.085 7.444   1.00 41.41 ? 133 LEU A CB   2  
ATOM 4464  C CG   . LEU A 1 138 ? 0.378   -14.576 7.631   1.00 3.15  ? 133 LEU A CG   2  
ATOM 4465  C CD1  . LEU A 1 138 ? 0.477   -15.273 6.283   1.00 4.22  ? 133 LEU A CD1  2  
ATOM 4466  C CD2  . LEU A 1 138 ? 1.656   -14.777 8.432   1.00 22.41 ? 133 LEU A CD2  2  
ATOM 4467  H H    . LEU A 1 138 ? -1.172  -10.475 8.500   1.00 33.30 ? 133 LEU A H    2  
ATOM 4468  H HA   . LEU A 1 138 ? -0.187  -12.942 9.561   1.00 71.15 ? 133 LEU A HA   2  
ATOM 4469  H HB3  . LEU A 1 138 ? 0.908   -12.657 6.880   1.00 55.24 ? 133 LEU A HB3  2  
ATOM 4470  H HG   . LEU A 1 138 ? -0.437  -15.027 8.180   1.00 64.02 ? 133 LEU A HG   2  
ATOM 4471  H HD11 . LEU A 1 138 ? -0.393  -15.895 6.134   1.00 44.23 ? 133 LEU A HD11 2  
ATOM 4472  H HD12 . LEU A 1 138 ? 1.366   -15.885 6.258   1.00 44.41 ? 133 LEU A HD12 2  
ATOM 4473  H HD13 . LEU A 1 138 ? 0.529   -14.532 5.497   1.00 34.53 ? 133 LEU A HD13 2  
ATOM 4474  H HD21 . LEU A 1 138 ? 1.414   -14.857 9.481   1.00 13.23 ? 133 LEU A HD21 2  
ATOM 4475  H HD22 . LEU A 1 138 ? 2.313   -13.933 8.279   1.00 63.11 ? 133 LEU A HD22 2  
ATOM 4476  H HD23 . LEU A 1 138 ? 2.147   -15.680 8.104   1.00 53.34 ? 133 LEU A HD23 2  
ATOM 4477  N N    . ASN A 1 139 ? 2.132   -11.957 9.694   1.00 64.12 ? 134 ASN A N    2  
ATOM 4478  C CA   . ASN A 1 139 ? 3.370   -11.242 9.986   1.00 3.32  ? 134 ASN A CA   2  
ATOM 4479  C C    . ASN A 1 139 ? 4.503   -12.219 10.283  1.00 41.23 ? 134 ASN A C    2  
ATOM 4480  O O    . ASN A 1 139 ? 4.275   -13.312 10.801  1.00 4.42  ? 134 ASN A O    2  
ATOM 4481  C CB   . ASN A 1 139 ? 3.171   -10.298 11.173  1.00 34.42 ? 134 ASN A CB   2  
ATOM 4482  C CG   . ASN A 1 139 ? 4.452   -9.591  11.571  1.00 35.15 ? 134 ASN A CG   2  
ATOM 4483  O OD1  . ASN A 1 139 ? 4.755   -9.453  12.756  1.00 52.24 ? 134 ASN A OD1  2  
ATOM 4484  N ND2  . ASN A 1 139 ? 5.211   -9.140  10.580  1.00 14.01 ? 134 ASN A ND2  2  
ATOM 4485  H H    . ASN A 1 139 ? 2.006   -12.860 10.051  1.00 0.42  ? 134 ASN A H    2  
ATOM 4486  H HA   . ASN A 1 139 ? 3.631   -10.661 9.114   1.00 33.43 ? 134 ASN A HA   2  
ATOM 4487  H HB3  . ASN A 1 139 ? 2.814   -10.864 12.020  1.00 51.21 ? 134 ASN A HB3  2  
ATOM 4488  H HD21 . ASN A 1 139 ? 4.907   -9.285  9.660   1.00 15.10 ? 134 ASN A HD21 2  
ATOM 4489  H HD22 . ASN A 1 139 ? 6.046   -8.680  10.809  1.00 24.41 ? 134 ASN A HD22 2  
ATOM 4490  N N    . SER A 1 140 ? 5.727   -11.816 9.953   1.00 34.54 ? 135 SER A N    2  
ATOM 4491  C CA   . SER A 1 140 ? 6.896   -12.656 10.182  1.00 41.11 ? 135 SER A CA   2  
ATOM 4492  C C    . SER A 1 140 ? 7.021   -13.023 11.658  1.00 21.13 ? 135 SER A C    2  
ATOM 4493  O O    . SER A 1 140 ? 7.556   -14.077 12.005  1.00 4.54  ? 135 SER A O    2  
ATOM 4494  C CB   . SER A 1 140 ? 8.164   -11.939 9.714   1.00 11.33 ? 135 SER A CB   2  
ATOM 4495  O OG   . SER A 1 140 ? 7.958   -10.541 9.628   1.00 61.34 ? 135 SER A OG   2  
ATOM 4496  H H    . SER A 1 140 ? 5.844   -10.932 9.544   1.00 14.25 ? 135 SER A H    2  
ATOM 4497  H HA   . SER A 1 140 ? 6.771   -13.561 9.607   1.00 52.42 ? 135 SER A HA   2  
ATOM 4498  H HB3  . SER A 1 140 ? 8.444   -12.311 8.738   1.00 71.43 ? 135 SER A HB3  2  
ATOM 4499  H HG   . SER A 1 140 ? 8.771   -10.082 9.852   1.00 11.42 ? 135 SER A HG   2  
ATOM 4500  N N    . LEU A 1 141 ? 6.524   -12.146 12.523  1.00 71.22 ? 136 LEU A N    2  
ATOM 4501  C CA   . LEU A 1 141 ? 6.579   -12.376 13.962  1.00 11.20 ? 136 LEU A CA   2  
ATOM 4502  C C    . LEU A 1 141 ? 5.785   -13.621 14.346  1.00 51.41 ? 136 LEU A C    2  
ATOM 4503  O O    . LEU A 1 141 ? 6.119   -14.311 15.309  1.00 42.31 ? 136 LEU A O    2  
ATOM 4504  C CB   . LEU A 1 141 ? 6.037   -11.160 14.714  1.00 30.11 ? 136 LEU A CB   2  
ATOM 4505  C CG   . LEU A 1 141 ? 6.485   -11.014 16.169  1.00 13.45 ? 136 LEU A CG   2  
ATOM 4506  C CD1  . LEU A 1 141 ? 7.970   -10.695 16.241  1.00 10.31 ? 136 LEU A CD1  2  
ATOM 4507  C CD2  . LEU A 1 141 ? 5.671   -9.939  16.874  1.00 11.41 ? 136 LEU A CD2  2  
ATOM 4508  H H    . LEU A 1 141 ? 6.110   -11.324 12.187  1.00 33.04 ? 136 LEU A H    2  
ATOM 4509  H HA   . LEU A 1 141 ? 7.613   -12.526 14.234  1.00 63.53 ? 136 LEU A HA   2  
ATOM 4510  H HB3  . LEU A 1 141 ? 4.958   -11.220 14.704  1.00 61.10 ? 136 LEU A HB3  2  
ATOM 4511  H HG   . LEU A 1 141 ? 6.320   -11.951 16.684  1.00 41.15 ? 136 LEU A HG   2  
ATOM 4512  H HD11 . LEU A 1 141 ? 8.107   -9.625  16.270  1.00 3.05  ? 136 LEU A HD11 2  
ATOM 4513  H HD12 . LEU A 1 141 ? 8.468   -11.098 15.371  1.00 32.02 ? 136 LEU A HD12 2  
ATOM 4514  H HD13 . LEU A 1 141 ? 8.390   -11.137 17.132  1.00 60.22 ? 136 LEU A HD13 2  
ATOM 4515  H HD21 . LEU A 1 141 ? 5.179   -9.321  16.137  1.00 22.43 ? 136 LEU A HD21 2  
ATOM 4516  H HD22 . LEU A 1 141 ? 6.328   -9.328  17.476  1.00 12.31 ? 136 LEU A HD22 2  
ATOM 4517  H HD23 . LEU A 1 141 ? 4.930   -10.405 17.506  1.00 54.15 ? 136 LEU A HD23 2  
ATOM 4518  N N    . LEU A 1 142 ? 4.733   -13.903 13.585  1.00 5.12  ? 137 LEU A N    2  
ATOM 4519  C CA   . LEU A 1 142 ? 3.892   -15.066 13.843  1.00 3.42  ? 137 LEU A CA   2  
ATOM 4520  C C    . LEU A 1 142 ? 3.964   -16.057 12.685  1.00 14.05 ? 137 LEU A C    2  
ATOM 4521  O O    . LEU A 1 142 ? 4.526   -15.759 11.631  1.00 25.24 ? 137 LEU A O    2  
ATOM 4522  C CB   . LEU A 1 142 ? 2.443   -14.632 14.069  1.00 40.45 ? 137 LEU A CB   2  
ATOM 4523  C CG   . LEU A 1 142 ? 1.963   -13.439 13.243  1.00 2.01  ? 137 LEU A CG   2  
ATOM 4524  C CD1  . LEU A 1 142 ? 0.573   -13.702 12.683  1.00 55.20 ? 137 LEU A CD1  2  
ATOM 4525  C CD2  . LEU A 1 142 ? 1.970   -12.171 14.083  1.00 24.23 ? 137 LEU A CD2  2  
ATOM 4526  H H    . LEU A 1 142 ? 4.517   -13.316 12.831  1.00 22.42 ? 137 LEU A H    2  
ATOM 4527  H HA   . LEU A 1 142 ? 4.260   -15.549 14.737  1.00 21.15 ? 137 LEU A HA   2  
ATOM 4528  H HB3  . LEU A 1 142 ? 2.334   -14.378 15.114  1.00 50.44 ? 137 LEU A HB3  2  
ATOM 4529  H HG   . LEU A 1 142 ? 2.635   -13.293 12.409  1.00 44.12 ? 137 LEU A HG   2  
ATOM 4530  H HD11 . LEU A 1 142 ? 0.055   -14.400 13.322  1.00 35.44 ? 137 LEU A HD11 2  
ATOM 4531  H HD12 . LEU A 1 142 ? 0.658   -14.118 11.690  1.00 23.12 ? 137 LEU A HD12 2  
ATOM 4532  H HD13 . LEU A 1 142 ? 0.022   -12.774 12.639  1.00 72.10 ? 137 LEU A HD13 2  
ATOM 4533  H HD21 . LEU A 1 142 ? 2.918   -11.666 13.965  1.00 4.25  ? 137 LEU A HD21 2  
ATOM 4534  H HD22 . LEU A 1 142 ? 1.826   -12.427 15.123  1.00 43.34 ? 137 LEU A HD22 2  
ATOM 4535  H HD23 . LEU A 1 142 ? 1.172   -11.519 13.759  1.00 31.15 ? 137 LEU A HD23 2  
ATOM 4536  N N    . THR A 1 143 ? 3.387   -17.238 12.888  1.00 3.21  ? 138 THR A N    2  
ATOM 4537  C CA   . THR A 1 143 ? 3.384   -18.273 11.861  1.00 11.12 ? 138 THR A CA   2  
ATOM 4538  C C    . THR A 1 143 ? 1.963   -18.611 11.425  1.00 72.55 ? 138 THR A C    2  
ATOM 4539  O O    . THR A 1 143 ? 1.753   -19.223 10.379  1.00 60.34 ? 138 THR A O    2  
ATOM 4540  C CB   . THR A 1 143 ? 4.076   -19.557 12.356  1.00 13.55 ? 138 THR A CB   2  
ATOM 4541  O OG1  . THR A 1 143 ? 3.846   -20.625 11.431  1.00 1.51  ? 138 THR A OG1  2  
ATOM 4542  C CG2  . THR A 1 143 ? 3.563   -19.952 13.732  1.00 52.41 ? 138 THR A CG2  2  
ATOM 4543  H H    . THR A 1 143 ? 2.956   -17.417 13.749  1.00 33.54 ? 138 THR A H    2  
ATOM 4544  H HA   . THR A 1 143 ? 3.932   -17.899 11.009  1.00 42.12 ? 138 THR A HA   2  
ATOM 4545  H HB   . THR A 1 143 ? 5.139   -19.372 12.423  1.00 72.23 ? 138 THR A HB   2  
ATOM 4546  H HG1  . THR A 1 143 ? 3.007   -21.048 11.632  1.00 1.12  ? 138 THR A HG1  2  
ATOM 4547  H HG21 . THR A 1 143 ? 3.966   -20.917 14.003  1.00 54.34 ? 138 THR A HG21 2  
ATOM 4548  H HG22 . THR A 1 143 ? 2.485   -20.004 13.714  1.00 0.42  ? 138 THR A HG22 2  
ATOM 4549  H HG23 . THR A 1 143 ? 3.876   -19.216 14.457  1.00 73.24 ? 138 THR A HG23 2  
ATOM 4550  N N    . GLY A 1 144 ? 0.989   -18.207 12.235  1.00 32.24 ? 139 GLY A N    2  
ATOM 4551  C CA   . GLY A 1 144 ? -0.401  -18.476 11.916  1.00 43.42 ? 139 GLY A CA   2  
ATOM 4552  C C    . GLY A 1 144 ? -1.151  -17.227 11.497  1.00 13.34 ? 139 GLY A C    2  
ATOM 4553  O O    . GLY A 1 144 ? -0.931  -16.138 12.026  1.00 2.13  ? 139 GLY A O    2  
ATOM 4554  H H    . GLY A 1 144 ? 1.215   -17.723 13.057  1.00 72.15 ? 139 GLY A H    2  
ATOM 4555  H HA2  . GLY A 1 144 ? -0.442  -19.195 11.111  1.00 43.31 ? 139 GLY A HA2  2  
ATOM 4556  H HA3  . GLY A 1 144 ? -0.884  -18.898 12.785  1.00 61.42 ? 139 GLY A HA3  2  
ATOM 4557  N N    . PRO A 1 145 ? -2.061  -17.378 10.523  1.00 15.13 ? 140 PRO A N    2  
ATOM 4558  C CA   . PRO A 1 145 ? -2.865  -16.264 10.011  1.00 4.10  ? 140 PRO A CA   2  
ATOM 4559  C C    . PRO A 1 145 ? -3.890  -15.773 11.028  1.00 24.22 ? 140 PRO A C    2  
ATOM 4560  O O    . PRO A 1 145 ? -4.161  -16.445 12.023  1.00 24.23 ? 140 PRO A O    2  
ATOM 4561  C CB   . PRO A 1 145 ? -3.567  -16.864 8.790   1.00 34.10 ? 140 PRO A CB   2  
ATOM 4562  C CG   . PRO A 1 145 ? -3.622  -18.327 9.066   1.00 53.24 ? 140 PRO A CG   2  
ATOM 4563  C CD   . PRO A 1 145 ? -2.377  -18.648 9.848   1.00 3.21  ? 140 PRO A CD   2  
ATOM 4564  H HA   . PRO A 1 145 ? -2.243  -15.437 9.700   1.00 0.04  ? 140 PRO A HA   2  
ATOM 4565  H HB3  . PRO A 1 145 ? -2.994  -16.652 7.900   1.00 32.33 ? 140 PRO A HB3  2  
ATOM 4566  H HG3  . PRO A 1 145 ? -3.631  -18.875 8.136   1.00 12.53 ? 140 PRO A HG3  2  
ATOM 4567  H HD3  . PRO A 1 145 ? -1.578  -18.938 9.181   1.00 52.03 ? 140 PRO A HD3  2  
ATOM 4568  N N    . GLU A 1 146 ? -4.456  -14.598 10.770  1.00 32.04 ? 141 GLU A N    2  
ATOM 4569  C CA   . GLU A 1 146 ? -5.452  -14.018 11.664  1.00 54.12 ? 141 GLU A CA   2  
ATOM 4570  C C    . GLU A 1 146 ? -6.718  -13.644 10.900  1.00 51.12 ? 141 GLU A C    2  
ATOM 4571  O O    . GLU A 1 146 ? -6.713  -12.724 10.080  1.00 55.24 ? 141 GLU A O    2  
ATOM 4572  C CB   . GLU A 1 146 ? -4.882  -12.783 12.365  1.00 32.13 ? 141 GLU A CB   2  
ATOM 4573  C CG   . GLU A 1 146 ? -4.997  -12.835 13.880  1.00 0.14  ? 141 GLU A CG   2  
ATOM 4574  C CD   . GLU A 1 146 ? -4.074  -11.849 14.569  1.00 33.31 ? 141 GLU A CD   2  
ATOM 4575  O OE1  . GLU A 1 146 ? -3.821  -10.771 13.991  1.00 75.04 ? 141 GLU A OE1  2  
ATOM 4576  O OE2  . GLU A 1 146 ? -3.605  -12.155 15.685  1.00 74.12 ? 141 GLU A OE2  2  
ATOM 4577  H H    . GLU A 1 146 ? -4.199  -14.110 9.961   1.00 42.23 ? 141 GLU A H    2  
ATOM 4578  H HA   . GLU A 1 146 ? -5.700  -14.759 12.409  1.00 13.14 ? 141 GLU A HA   2  
ATOM 4579  H HB3  . GLU A 1 146 ? -5.412  -11.909 12.015  1.00 13.51 ? 141 GLU A HB3  2  
ATOM 4580  H HG3  . GLU A 1 146 ? -4.749  -13.832 14.213  1.00 12.32 ? 141 GLU A HG3  2  
ATOM 4581  N N    . LEU A 1 147 ? -7.801  -14.364 11.173  1.00 23.14 ? 142 LEU A N    2  
ATOM 4582  C CA   . LEU A 1 147 ? -9.076  -14.109 10.511  1.00 44.32 ? 142 LEU A CA   2  
ATOM 4583  C C    . LEU A 1 147 ? -9.754  -12.871 11.092  1.00 40.52 ? 142 LEU A C    2  
ATOM 4584  O O    . LEU A 1 147 ? -9.897  -12.746 12.308  1.00 64.51 ? 142 LEU A O    2  
ATOM 4585  C CB   . LEU A 1 147 ? -9.997  -15.322 10.649  1.00 62.44 ? 142 LEU A CB   2  
ATOM 4586  C CG   . LEU A 1 147 ? -10.629 -15.530 12.026  1.00 20.11 ? 142 LEU A CG   2  
ATOM 4587  C CD1  . LEU A 1 147 ? -12.011 -14.896 12.080  1.00 60.33 ? 142 LEU A CD1  2  
ATOM 4588  C CD2  . LEU A 1 147 ? -10.708 -17.013 12.359  1.00 22.33 ? 142 LEU A CD2  2  
ATOM 4589  H H    . LEU A 1 147 ? -7.743  -15.083 11.835  1.00 53.53 ? 142 LEU A H    2  
ATOM 4590  H HA   . LEU A 1 147 ? -8.877  -13.936 9.464   1.00 45.23 ? 142 LEU A HA   2  
ATOM 4591  H HB3  . LEU A 1 147 ? -9.418  -16.204 10.413  1.00 21.40 ? 142 LEU A HB3  2  
ATOM 4592  H HG   . LEU A 1 147 ? -10.013 -15.050 12.775  1.00 1.42  ? 142 LEU A HG   2  
ATOM 4593  H HD11 . LEU A 1 147 ? -12.228 -14.592 13.093  1.00 71.10 ? 142 LEU A HD11 2  
ATOM 4594  H HD12 . LEU A 1 147 ? -12.749 -15.613 11.753  1.00 24.25 ? 142 LEU A HD12 2  
ATOM 4595  H HD13 . LEU A 1 147 ? -12.036 -14.033 11.431  1.00 72.54 ? 142 LEU A HD13 2  
ATOM 4596  H HD21 . LEU A 1 147 ? -11.078 -17.554 11.500  1.00 74.34 ? 142 LEU A HD21 2  
ATOM 4597  H HD22 . LEU A 1 147 ? -11.379 -17.160 13.193  1.00 61.12 ? 142 LEU A HD22 2  
ATOM 4598  H HD23 . LEU A 1 147 ? -9.725  -17.376 12.618  1.00 24.14 ? 142 LEU A HD23 2  
ATOM 4599  N N    . ILE A 1 148 ? -10.169 -11.964 10.215  1.00 21.30 ? 143 ILE A N    2  
ATOM 4600  C CA   . ILE A 1 148 ? -10.834 -10.739 10.641  1.00 73.32 ? 143 ILE A CA   2  
ATOM 4601  C C    . ILE A 1 148 ? -12.044 -10.437 9.763   1.00 61.52 ? 143 ILE A C    2  
ATOM 4602  O O    . ILE A 1 148 ? -12.005 -10.626 8.548   1.00 55.33 ? 143 ILE A O    2  
ATOM 4603  C CB   . ILE A 1 148 ? -9.874  -9.536  10.607  1.00 22.34 ? 143 ILE A CB   2  
ATOM 4604  C CG1  . ILE A 1 148 ? -8.667  -9.792  11.510  1.00 11.40 ? 143 ILE A CG1  2  
ATOM 4605  C CG2  . ILE A 1 148 ? -10.600 -8.268  11.031  1.00 24.42 ? 143 ILE A CG2  2  
ATOM 4606  C CD1  . ILE A 1 148 ? -7.476  -8.916  11.190  1.00 44.35 ? 143 ILE A CD1  2  
ATOM 4607  H H    . ILE A 1 148 ? -10.025 -12.122 9.259   1.00 63.31 ? 143 ILE A H    2  
ATOM 4608  H HA   . ILE A 1 148 ? -11.168 -10.879 11.660  1.00 61.32 ? 143 ILE A HA   2  
ATOM 4609  H HB   . ILE A 1 148 ? -9.534  -9.404  9.591   1.00 13.23 ? 143 ILE A HB   2  
ATOM 4610  H HG13 . ILE A 1 148 ? -8.359  -10.822 11.403  1.00 34.02 ? 143 ILE A HG13 2  
ATOM 4611  H HG21 . ILE A 1 148 ? -10.974 -8.385  12.037  1.00 11.51 ? 143 ILE A HG21 2  
ATOM 4612  H HG22 . ILE A 1 148 ? -9.915  -7.433  10.997  1.00 12.11 ? 143 ILE A HG22 2  
ATOM 4613  H HG23 . ILE A 1 148 ? -11.426 -8.082  10.360  1.00 1.42  ? 143 ILE A HG23 2  
ATOM 4614  H HD11 . ILE A 1 148 ? -7.599  -7.953  11.664  1.00 14.02 ? 143 ILE A HD11 2  
ATOM 4615  H HD12 . ILE A 1 148 ? -6.574  -9.385  11.554  1.00 54.00 ? 143 ILE A HD12 2  
ATOM 4616  H HD13 . ILE A 1 148 ? -7.405  -8.782  10.120  1.00 42.15 ? 143 ILE A HD13 2  
ATOM 4617  N N    . SER A 1 149 ? -13.118 -9.964  10.388  1.00 73.42 ? 144 SER A N    2  
ATOM 4618  C CA   . SER A 1 149 ? -14.340 -9.636  9.664   1.00 74.21 ? 144 SER A CA   2  
ATOM 4619  C C    . SER A 1 149 ? -14.204 -8.296  8.946   1.00 35.04 ? 144 SER A C    2  
ATOM 4620  O O    . SER A 1 149 ? -13.663 -7.338  9.496   1.00 65.41 ? 144 SER A O    2  
ATOM 4621  C CB   . SER A 1 149 ? -15.531 -9.594  10.624  1.00 70.12 ? 144 SER A CB   2  
ATOM 4622  O OG   . SER A 1 149 ? -15.704 -10.840 11.277  1.00 43.21 ? 144 SER A OG   2  
ATOM 4623  H H    . SER A 1 149 ? -13.088 -9.834  11.360  1.00 3.43  ? 144 SER A H    2  
ATOM 4624  H HA   . SER A 1 149 ? -14.508 -10.409 8.929   1.00 50.24 ? 144 SER A HA   2  
ATOM 4625  H HB3  . SER A 1 149 ? -16.429 -9.364  10.069  1.00 33.24 ? 144 SER A HB3  2  
ATOM 4626  H HG   . SER A 1 149 ? -16.465 -11.293 10.907  1.00 21.42 ? 144 SER A HG   2  
ATOM 4627  N N    . ASP A 1 150 ? -14.699 -8.240  7.714   1.00 73.12 ? 145 ASP A N    2  
ATOM 4628  C CA   . ASP A 1 150 ? -14.634 -7.019  6.920   1.00 20.21 ? 145 ASP A CA   2  
ATOM 4629  C C    . ASP A 1 150 ? -15.279 -5.852  7.662   1.00 14.10 ? 145 ASP A C    2  
ATOM 4630  O O    . ASP A 1 150 ? -14.760 -4.737  7.660   1.00 64.23 ? 145 ASP A O    2  
ATOM 4631  C CB   . ASP A 1 150 ? -15.326 -7.225  5.571   1.00 44.22 ? 145 ASP A CB   2  
ATOM 4632  C CG   . ASP A 1 150 ? -16.614 -8.013  5.696   1.00 0.25  ? 145 ASP A CG   2  
ATOM 4633  O OD1  . ASP A 1 150 ? -16.540 -9.247  5.874   1.00 33.14 ? 145 ASP A OD1  2  
ATOM 4634  O OD2  . ASP A 1 150 ? -17.698 -7.397  5.615   1.00 43.20 ? 145 ASP A OD2  2  
ATOM 4635  H H    . ASP A 1 150 ? -15.119 -9.038  7.331   1.00 14.20 ? 145 ASP A H    2  
ATOM 4636  H HA   . ASP A 1 150 ? -13.594 -6.789  6.749   1.00 62.24 ? 145 ASP A HA   2  
ATOM 4637  H HB3  . ASP A 1 150 ? -14.659 -7.761  4.911   1.00 30.32 ? 145 ASP A HB3  2  
ATOM 4638  N N    . THR A 1 151 ? -16.417 -6.118  8.298   1.00 12.02 ? 146 THR A N    2  
ATOM 4639  C CA   . THR A 1 151 ? -17.134 -5.091  9.042   1.00 32.42 ? 146 THR A CA   2  
ATOM 4640  C C    . THR A 1 151 ? -16.301 -4.575  10.209  1.00 34.01 ? 146 THR A C    2  
ATOM 4641  O O    . THR A 1 151 ? -16.497 -3.453  10.677  1.00 22.02 ? 146 THR A O    2  
ATOM 4642  C CB   . THR A 1 151 ? -18.478 -5.621  9.580   1.00 50.53 ? 146 THR A CB   2  
ATOM 4643  O OG1  . THR A 1 151 ? -19.199 -4.565  10.223  1.00 11.13 ? 146 THR A OG1  2  
ATOM 4644  C CG2  . THR A 1 151 ? -18.254 -6.762  10.562  1.00 20.44 ? 146 THR A CG2  2  
ATOM 4645  H H    . THR A 1 151 ? -16.782 -7.027  8.262   1.00 71.43 ? 146 THR A H    2  
ATOM 4646  H HA   . THR A 1 151 ? -17.339 -4.272  8.368   1.00 70.10 ? 146 THR A HA   2  
ATOM 4647  H HB   . THR A 1 151 ? -19.060 -5.992  8.748   1.00 50.14 ? 146 THR A HB   2  
ATOM 4648  H HG1  . THR A 1 151 ? -20.139 -4.758  10.195  1.00 33.40 ? 146 THR A HG1  2  
ATOM 4649  H HG21 . THR A 1 151 ? -17.574 -7.481  10.131  1.00 72.41 ? 146 THR A HG21 2  
ATOM 4650  H HG22 . THR A 1 151 ? -19.198 -7.241  10.777  1.00 2.33  ? 146 THR A HG22 2  
ATOM 4651  H HG23 . THR A 1 151 ? -17.833 -6.371  11.477  1.00 4.13  ? 146 THR A HG23 2  
ATOM 4652  N N    . TYR A 1 152 ? -15.370 -5.401  10.676  1.00 62.42 ? 147 TYR A N    2  
ATOM 4653  C CA   . TYR A 1 152 ? -14.508 -5.027  11.791  1.00 52.31 ? 147 TYR A CA   2  
ATOM 4654  C C    . TYR A 1 152 ? -13.179 -4.470  11.288  1.00 74.15 ? 147 TYR A C    2  
ATOM 4655  O O    . TYR A 1 152 ? -12.536 -3.665  11.963  1.00 44.31 ? 147 TYR A O    2  
ATOM 4656  C CB   . TYR A 1 152 ? -14.257 -6.235  12.696  1.00 32.44 ? 147 TYR A CB   2  
ATOM 4657  C CG   . TYR A 1 152 ? -13.408 -5.919  13.906  1.00 72.52 ? 147 TYR A CG   2  
ATOM 4658  C CD1  . TYR A 1 152 ? -13.584 -4.734  14.612  1.00 51.42 ? 147 TYR A CD1  2  
ATOM 4659  C CD2  . TYR A 1 152 ? -12.431 -6.803  14.345  1.00 0.43  ? 147 TYR A CD2  2  
ATOM 4660  C CE1  . TYR A 1 152 ? -12.811 -4.441  15.718  1.00 41.32 ? 147 TYR A CE1  2  
ATOM 4661  C CE2  . TYR A 1 152 ? -11.654 -6.520  15.450  1.00 61.54 ? 147 TYR A CE2  2  
ATOM 4662  C CZ   . TYR A 1 152 ? -11.848 -5.336  16.134  1.00 51.25 ? 147 TYR A CZ   2  
ATOM 4663  O OH   . TYR A 1 152 ? -11.074 -5.048  17.235  1.00 33.02 ? 147 TYR A OH   2  
ATOM 4664  H H    . TYR A 1 152 ? -15.262 -6.281  10.262  1.00 54.51 ? 147 TYR A H    2  
ATOM 4665  H HA   . TYR A 1 152 ? -15.014 -4.262  12.360  1.00 72.41 ? 147 TYR A HA   2  
ATOM 4666  H HB3  . TYR A 1 152 ? -13.753 -7.003  12.128  1.00 10.12 ? 147 TYR A HB3  2  
ATOM 4667  H HD1  . TYR A 1 152 ? -14.339 -4.035  14.284  1.00 44.40 ? 147 TYR A HD1  2  
ATOM 4668  H HD2  . TYR A 1 152 ? -12.282 -7.729  13.807  1.00 20.45 ? 147 TYR A HD2  2  
ATOM 4669  H HE1  . TYR A 1 152 ? -12.961 -3.515  16.254  1.00 21.45 ? 147 TYR A HE1  2  
ATOM 4670  H HE2  . TYR A 1 152 ? -10.900 -7.220  15.776  1.00 40.21 ? 147 TYR A HE2  2  
ATOM 4671  H HH   . TYR A 1 152 ? -11.336 -5.615  17.966  1.00 64.03 ? 147 TYR A HH   2  
ATOM 4672  N N    . LEU A 1 153 ? -12.775 -4.903  10.100  1.00 1.34  ? 148 LEU A N    2  
ATOM 4673  C CA   . LEU A 1 153 ? -11.524 -4.448  9.504   1.00 52.44 ? 148 LEU A CA   2  
ATOM 4674  C C    . LEU A 1 153 ? -11.581 -2.957  9.190   1.00 22.20 ? 148 LEU A C    2  
ATOM 4675  O O    . LEU A 1 153 ? -10.669 -2.205  9.531   1.00 63.42 ? 148 LEU A O    2  
ATOM 4676  C CB   . LEU A 1 153 ? -11.224 -5.239  8.230   1.00 21.20 ? 148 LEU A CB   2  
ATOM 4677  C CG   . LEU A 1 153 ? -10.139 -4.662  7.321   1.00 54.41 ? 148 LEU A CG   2  
ATOM 4678  C CD1  . LEU A 1 153 ? -8.969  -5.628  7.206   1.00 31.35 ? 148 LEU A CD1  2  
ATOM 4679  C CD2  . LEU A 1 153 ? -10.707 -4.345  5.945   1.00 34.40 ? 148 LEU A CD2  2  
ATOM 4680  H H    . LEU A 1 153 ? -13.330 -5.544  9.610   1.00 14.05 ? 148 LEU A H    2  
ATOM 4681  H HA   . LEU A 1 153 ? -10.733 -4.623  10.220  1.00 73.44 ? 148 LEU A HA   2  
ATOM 4682  H HB3  . LEU A 1 153 ? -12.140 -5.299  7.657   1.00 52.54 ? 148 LEU A HB3  2  
ATOM 4683  H HG   . LEU A 1 153 ? -9.770  -3.741  7.751   1.00 50.35 ? 148 LEU A HG   2  
ATOM 4684  H HD11 . LEU A 1 153 ? -8.556  -5.577  6.211   1.00 23.02 ? 148 LEU A HD11 2  
ATOM 4685  H HD12 . LEU A 1 153 ? -9.313  -6.633  7.402   1.00 53.24 ? 148 LEU A HD12 2  
ATOM 4686  H HD13 . LEU A 1 153 ? -8.210  -5.361  7.927   1.00 4.35  ? 148 LEU A HD13 2  
ATOM 4687  H HD21 . LEU A 1 153 ? -9.966  -4.564  5.191   1.00 24.43 ? 148 LEU A HD21 2  
ATOM 4688  H HD22 . LEU A 1 153 ? -10.972 -3.298  5.899   1.00 4.33  ? 148 LEU A HD22 2  
ATOM 4689  H HD23 . LEU A 1 153 ? -11.587 -4.947  5.772   1.00 13.25 ? 148 LEU A HD23 2  
ATOM 4690  N N    . ALA A 1 154 ? -12.660 -2.536  8.538   1.00 10.42 ? 149 ALA A N    2  
ATOM 4691  C CA   . ALA A 1 154 ? -12.838 -1.135  8.180   1.00 71.42 ? 149 ALA A CA   2  
ATOM 4692  C C    . ALA A 1 154 ? -12.665 -0.232  9.397   1.00 64.42 ? 149 ALA A C    2  
ATOM 4693  O O    . ALA A 1 154 ? -11.948 0.769   9.343   1.00 34.34 ? 149 ALA A O    2  
ATOM 4694  C CB   . ALA A 1 154 ? -14.207 -0.920  7.552   1.00 61.31 ? 149 ALA A CB   2  
ATOM 4695  H H    . ALA A 1 154 ? -13.352 -3.184  8.292   1.00 32.01 ? 149 ALA A H    2  
ATOM 4696  H HA   . ALA A 1 154 ? -12.088 -0.879  7.445   1.00 53.24 ? 149 ALA A HA   2  
ATOM 4697  H HB1  . ALA A 1 154 ? -14.736 -0.152  8.097   1.00 40.14 ? 149 ALA A HB1  2  
ATOM 4698  H HB2  . ALA A 1 154 ? -14.087 -0.614  6.524   1.00 2.23  ? 149 ALA A HB2  2  
ATOM 4699  H HB3  . ALA A 1 154 ? -14.769 -1.841  7.591   1.00 70.45 ? 149 ALA A HB3  2  
ATOM 4700  N N    . LEU A 1 155 ? -13.325 -0.590  10.493  1.00 41.22 ? 150 LEU A N    2  
ATOM 4701  C CA   . LEU A 1 155 ? -13.245 0.188   11.724  1.00 44.21 ? 150 LEU A CA   2  
ATOM 4702  C C    . LEU A 1 155 ? -11.885 0.011   12.393  1.00 15.24 ? 150 LEU A C    2  
ATOM 4703  O O    . LEU A 1 155 ? -11.324 0.957   12.943  1.00 64.42 ? 150 LEU A O    2  
ATOM 4704  C CB   . LEU A 1 155 ? -14.358 -0.227  12.687  1.00 24.34 ? 150 LEU A CB   2  
ATOM 4705  C CG   . LEU A 1 155 ? -15.701 0.482   12.505  1.00 43.32 ? 150 LEU A CG   2  
ATOM 4706  C CD1  . LEU A 1 155 ? -15.542 1.983   12.695  1.00 72.20 ? 150 LEU A CD1  2  
ATOM 4707  C CD2  . LEU A 1 155 ? -16.285 0.175   11.134  1.00 22.21 ? 150 LEU A CD2  2  
ATOM 4708  H H    . LEU A 1 155 ? -13.879 -1.397  10.474  1.00 33.21 ? 150 LEU A H    2  
ATOM 4709  H HA   . LEU A 1 155 ? -13.371 1.229   11.466  1.00 23.44 ? 150 LEU A HA   2  
ATOM 4710  H HB3  . LEU A 1 155 ? -14.014 -0.032  13.693  1.00 45.20 ? 150 LEU A HB3  2  
ATOM 4711  H HG   . LEU A 1 155 ? -16.394 0.122   13.253  1.00 23.51 ? 150 LEU A HG   2  
ATOM 4712  H HD11 . LEU A 1 155 ? -15.078 2.410   11.820  1.00 43.32 ? 150 LEU A HD11 2  
ATOM 4713  H HD12 . LEU A 1 155 ? -14.924 2.173   13.560  1.00 13.14 ? 150 LEU A HD12 2  
ATOM 4714  H HD13 . LEU A 1 155 ? -16.514 2.431   12.843  1.00 24.41 ? 150 LEU A HD13 2  
ATOM 4715  H HD21 . LEU A 1 155 ? -16.137 -0.870  10.906  1.00 45.23 ? 150 LEU A HD21 2  
ATOM 4716  H HD22 . LEU A 1 155 ? -15.790 0.780   10.388  1.00 45.14 ? 150 LEU A HD22 2  
ATOM 4717  H HD23 . LEU A 1 155 ? -17.341 0.397   11.135  1.00 3.14  ? 150 LEU A HD23 2  
ATOM 4718  N N    . PHE A 1 156 ? -11.361 -1.210  12.340  1.00 44.52 ? 151 PHE A N    2  
ATOM 4719  C CA   . PHE A 1 156 ? -10.066 -1.512  12.939  1.00 74.12 ? 151 PHE A CA   2  
ATOM 4720  C C    . PHE A 1 156 ? -8.981  -0.595  12.382  1.00 54.12 ? 151 PHE A C    2  
ATOM 4721  O O    . PHE A 1 156 ? -8.259  0.059   13.136  1.00 43.51 ? 151 PHE A O    2  
ATOM 4722  C CB   . PHE A 1 156 ? -9.693  -2.975  12.687  1.00 63.41 ? 151 PHE A CB   2  
ATOM 4723  C CG   . PHE A 1 156 ? -8.241  -3.175  12.360  1.00 10.34 ? 151 PHE A CG   2  
ATOM 4724  C CD1  . PHE A 1 156 ? -7.271  -3.039  13.339  1.00 12.24 ? 151 PHE A CD1  2  
ATOM 4725  C CD2  . PHE A 1 156 ? -7.846  -3.498  11.072  1.00 3.05  ? 151 PHE A CD2  2  
ATOM 4726  C CE1  . PHE A 1 156 ? -5.934  -3.223  13.041  1.00 14.45 ? 151 PHE A CE1  2  
ATOM 4727  C CE2  . PHE A 1 156 ? -6.511  -3.683  10.767  1.00 71.11 ? 151 PHE A CE2  2  
ATOM 4728  C CZ   . PHE A 1 156 ? -5.554  -3.545  11.752  1.00 70.53 ? 151 PHE A CZ   2  
ATOM 4729  H H    . PHE A 1 156 ? -11.857 -1.923  11.886  1.00 13.32 ? 151 PHE A H    2  
ATOM 4730  H HA   . PHE A 1 156 ? -10.149 -1.348  14.002  1.00 74.04 ? 151 PHE A HA   2  
ATOM 4731  H HB3  . PHE A 1 156 ? -10.277 -3.350  11.860  1.00 44.24 ? 151 PHE A HB3  2  
ATOM 4732  H HD1  . PHE A 1 156 ? -7.567  -2.788  14.348  1.00 32.13 ? 151 PHE A HD1  2  
ATOM 4733  H HD2  . PHE A 1 156 ? -8.594  -3.605  10.299  1.00 32.23 ? 151 PHE A HD2  2  
ATOM 4734  H HE1  . PHE A 1 156 ? -5.188  -3.114  13.814  1.00 50.12 ? 151 PHE A HE1  2  
ATOM 4735  H HE2  . PHE A 1 156 ? -6.217  -3.934  9.759   1.00 44.22 ? 151 PHE A HE2  2  
ATOM 4736  H HZ   . PHE A 1 156 ? -4.509  -3.690  11.518  1.00 20.44 ? 151 PHE A HZ   2  
ATOM 4737  N N    . LEU A 1 157 ? -8.872  -0.555  11.059  1.00 24.31 ? 152 LEU A N    2  
ATOM 4738  C CA   . LEU A 1 157 ? -7.875  0.281   10.400  1.00 24.02 ? 152 LEU A CA   2  
ATOM 4739  C C    . LEU A 1 157 ? -8.202  1.761   10.574  1.00 15.53 ? 152 LEU A C    2  
ATOM 4740  O O    . LEU A 1 157 ? -7.316  2.579   10.822  1.00 14.42 ? 152 LEU A O    2  
ATOM 4741  C CB   . LEU A 1 157 ? -7.796  -0.063  8.912   1.00 2.52  ? 152 LEU A CB   2  
ATOM 4742  C CG   . LEU A 1 157 ? -9.114  -0.008  8.139   1.00 63.21 ? 152 LEU A CG   2  
ATOM 4743  C CD1  . LEU A 1 157 ? -9.297  1.358   7.494   1.00 34.21 ? 152 LEU A CD1  2  
ATOM 4744  C CD2  . LEU A 1 157 ? -9.163  -1.106  7.087   1.00 32.21 ? 152 LEU A CD2  2  
ATOM 4745  H H    . LEU A 1 157 ? -9.475  -1.098  10.512  1.00 1.25  ? 152 LEU A H    2  
ATOM 4746  H HA   . LEU A 1 157 ? -6.918  0.081   10.859  1.00 11.42 ? 152 LEU A HA   2  
ATOM 4747  H HB3  . LEU A 1 157 ? -7.403  -1.066  8.826   1.00 42.30 ? 152 LEU A HB3  2  
ATOM 4748  H HG   . LEU A 1 157 ? -9.934  -0.164  8.826   1.00 70.33 ? 152 LEU A HG   2  
ATOM 4749  H HD11 . LEU A 1 157 ? -10.173 1.836   7.907   1.00 4.15  ? 152 LEU A HD11 2  
ATOM 4750  H HD12 . LEU A 1 157 ? -9.419  1.239   6.428   1.00 22.34 ? 152 LEU A HD12 2  
ATOM 4751  H HD13 . LEU A 1 157 ? -8.427  1.968   7.690   1.00 21.04 ? 152 LEU A HD13 2  
ATOM 4752  H HD21 . LEU A 1 157 ? -10.188 -1.277  6.794   1.00 54.23 ? 152 LEU A HD21 2  
ATOM 4753  H HD22 . LEU A 1 157 ? -8.749  -2.016  7.498   1.00 53.44 ? 152 LEU A HD22 2  
ATOM 4754  H HD23 . LEU A 1 157 ? -8.587  -0.805  6.225   1.00 55.41 ? 152 LEU A HD23 2  
ATOM 4755  N N    . ALA A 1 158 ? -9.482  2.097   10.445  1.00 42.52 ? 153 ALA A N    2  
ATOM 4756  C CA   . ALA A 1 158 ? -9.927  3.477   10.592  1.00 71.55 ? 153 ALA A CA   2  
ATOM 4757  C C    . ALA A 1 158 ? -9.545  4.034   11.960  1.00 12.11 ? 153 ALA A C    2  
ATOM 4758  O O    . ALA A 1 158 ? -9.312  5.234   12.107  1.00 74.23 ? 153 ALA A O    2  
ATOM 4759  C CB   . ALA A 1 158 ? -11.431 3.571   10.383  1.00 71.31 ? 153 ALA A CB   2  
ATOM 4760  H H    . ALA A 1 158 ? -10.141 1.400   10.246  1.00 62.42 ? 153 ALA A H    2  
ATOM 4761  H HA   . ALA A 1 158 ? -9.444  4.068   9.827   1.00 4.20  ? 153 ALA A HA   2  
ATOM 4762  H HB1  . ALA A 1 158 ? -11.652 3.502   9.328   1.00 52.53 ? 153 ALA A HB1  2  
ATOM 4763  H HB2  . ALA A 1 158 ? -11.919 2.764   10.908  1.00 44.23 ? 153 ALA A HB2  2  
ATOM 4764  H HB3  . ALA A 1 158 ? -11.788 4.517   10.764  1.00 1.25  ? 153 ALA A HB3  2  
ATOM 4765  N N    . GLN A 1 159 ? -9.484  3.155   12.955  1.00 70.43 ? 154 GLN A N    2  
ATOM 4766  C CA   . GLN A 1 159 ? -9.131  3.561   14.311  1.00 4.05  ? 154 GLN A CA   2  
ATOM 4767  C C    . GLN A 1 159 ? -7.655  3.933   14.402  1.00 3.52  ? 154 GLN A C    2  
ATOM 4768  O O    . GLN A 1 159 ? -7.279  4.855   15.125  1.00 71.55 ? 154 GLN A O    2  
ATOM 4769  C CB   . GLN A 1 159 ? -9.448  2.440   15.300  1.00 12.54 ? 154 GLN A CB   2  
ATOM 4770  C CG   . GLN A 1 159 ? -10.854 2.514   15.875  1.00 22.30 ? 154 GLN A CG   2  
ATOM 4771  C CD   . GLN A 1 159 ? -10.913 2.091   17.330  1.00 11.44 ? 154 GLN A CD   2  
ATOM 4772  O OE1  . GLN A 1 159 ? -11.007 2.927   18.228  1.00 24.00 ? 154 GLN A OE1  2  
ATOM 4773  N NE2  . GLN A 1 159 ? -10.858 0.786   17.570  1.00 4.50  ? 154 GLN A NE2  2  
ATOM 4774  H H    . GLN A 1 159 ? -9.680  2.214   12.774  1.00 12.34 ? 154 GLN A H    2  
ATOM 4775  H HA   . GLN A 1 159 ? -9.724  4.429   14.561  1.00 53.43 ? 154 GLN A HA   2  
ATOM 4776  H HB3  . GLN A 1 159 ? -8.746  2.488   16.118  1.00 15.50 ? 154 GLN A HB3  2  
ATOM 4777  H HG3  . GLN A 1 159 ? -11.498 1.865   15.301  1.00 23.35 ? 154 GLN A HG3  2  
ATOM 4778  H HE21 . GLN A 1 159 ? -10.781 0.178   16.804  1.00 32.11 ? 154 GLN A HE21 2  
ATOM 4779  H HE22 . GLN A 1 159 ? -10.893 0.485   18.501  1.00 62.02 ? 154 GLN A HE22 2  
ATOM 4780  N N    . LEU A 1 160 ? -6.821  3.210   13.662  1.00 10.01 ? 155 LEU A N    2  
ATOM 4781  C CA   . LEU A 1 160 ? -5.385  3.463   13.658  1.00 72.41 ? 155 LEU A CA   2  
ATOM 4782  C C    . LEU A 1 160 ? -5.063  4.761   12.925  1.00 62.24 ? 155 LEU A C    2  
ATOM 4783  O O    . LEU A 1 160 ? -4.341  5.614   13.443  1.00 32.42 ? 155 LEU A O    2  
ATOM 4784  C CB   . LEU A 1 160 ? -4.643  2.296   13.004  1.00 45.24 ? 155 LEU A CB   2  
ATOM 4785  C CG   . LEU A 1 160 ? -5.083  0.896   13.432  1.00 42.24 ? 155 LEU A CG   2  
ATOM 4786  C CD1  . LEU A 1 160 ? -4.329  -0.165  12.644  1.00 70.22 ? 155 LEU A CD1  2  
ATOM 4787  C CD2  . LEU A 1 160 ? -4.870  0.705   14.927  1.00 12.53 ? 155 LEU A CD2  2  
ATOM 4788  H H    . LEU A 1 160 ? -7.179  2.487   13.105  1.00 22.32 ? 155 LEU A H    2  
ATOM 4789  H HA   . LEU A 1 160 ? -5.062  3.553   14.684  1.00 74.33 ? 155 LEU A HA   2  
ATOM 4790  H HB3  . LEU A 1 160 ? -3.593  2.400   13.237  1.00 62.45 ? 155 LEU A HB3  2  
ATOM 4791  H HG   . LEU A 1 160 ? -6.138  0.777   13.226  1.00 25.01 ? 155 LEU A HG   2  
ATOM 4792  H HD11 . LEU A 1 160 ? -4.119  -1.007  13.285  1.00 31.24 ? 155 LEU A HD11 2  
ATOM 4793  H HD12 . LEU A 1 160 ? -3.401  0.251   12.279  1.00 14.50 ? 155 LEU A HD12 2  
ATOM 4794  H HD13 . LEU A 1 160 ? -4.932  -0.488  11.808  1.00 74.03 ? 155 LEU A HD13 2  
ATOM 4795  H HD21 . LEU A 1 160 ? -3.826  0.504   15.118  1.00 62.31 ? 155 LEU A HD21 2  
ATOM 4796  H HD22 . LEU A 1 160 ? -5.465  -0.129  15.271  1.00 12.52 ? 155 LEU A HD22 2  
ATOM 4797  H HD23 . LEU A 1 160 ? -5.168  1.601   15.450  1.00 54.52 ? 155 LEU A HD23 2  
ATOM 4798  N N    . GLN A 1 161 ? -5.603  4.904   11.721  1.00 3.42  ? 156 GLN A N    2  
ATOM 4799  C CA   . GLN A 1 161 ? -5.374  6.099   10.918  1.00 4.44  ? 156 GLN A CA   2  
ATOM 4800  C C    . GLN A 1 161 ? -5.935  7.337   11.610  1.00 41.34 ? 156 GLN A C    2  
ATOM 4801  O O    . GLN A 1 161 ? -5.299  8.390   11.630  1.00 33.23 ? 156 GLN A O    2  
ATOM 4802  C CB   . GLN A 1 161 ? -6.011  5.941   9.536   1.00 45.41 ? 156 GLN A CB   2  
ATOM 4803  C CG   . GLN A 1 161 ? -7.509  5.686   9.582   1.00 2.42  ? 156 GLN A CG   2  
ATOM 4804  C CD   . GLN A 1 161 ? -8.322  6.963   9.510   1.00 73.04 ? 156 GLN A CD   2  
ATOM 4805  O OE1  . GLN A 1 161 ? -7.774  8.053   9.343   1.00 73.05 ? 156 GLN A OE1  2  
ATOM 4806  N NE2  . GLN A 1 161 ? -9.638  6.835   9.637   1.00 63.15 ? 156 GLN A NE2  2  
ATOM 4807  H H    . GLN A 1 161 ? -6.168  4.189   11.362  1.00 31.25 ? 156 GLN A H    2  
ATOM 4808  H HA   . GLN A 1 161 ? -4.308  6.220   10.800  1.00 42.11 ? 156 GLN A HA   2  
ATOM 4809  H HB3  . GLN A 1 161 ? -5.542  5.112   9.029   1.00 2.52  ? 156 GLN A HB3  2  
ATOM 4810  H HG3  . GLN A 1 161 ? -7.745  5.176   10.505  1.00 1.33  ? 156 GLN A HG3  2  
ATOM 4811  H HE21 . GLN A 1 161 ? -10.004 5.935   9.769   1.00 65.12 ? 156 GLN A HE21 2  
ATOM 4812  H HE22 . GLN A 1 161 ? -10.187 7.645   9.596   1.00 52.33 ? 156 GLN A HE22 2  
ATOM 4813  N N    . GLN A 1 162 ? -7.129  7.201   12.178  1.00 73.22 ? 157 GLN A N    2  
ATOM 4814  C CA   . GLN A 1 162 ? -7.775  8.309   12.871  1.00 33.21 ? 157 GLN A CA   2  
ATOM 4815  C C    . GLN A 1 162 ? -7.055  8.629   14.177  1.00 0.34  ? 157 GLN A C    2  
ATOM 4816  O O    . GLN A 1 162 ? -7.201  9.719   14.725  1.00 71.52 ? 157 GLN A O    2  
ATOM 4817  C CB   . GLN A 1 162 ? -9.242  7.976   13.153  1.00 11.51 ? 157 GLN A CB   2  
ATOM 4818  C CG   . GLN A 1 162 ? -9.439  7.059   14.349  1.00 41.54 ? 157 GLN A CG   2  
ATOM 4819  C CD   . GLN A 1 162 ? -10.891 6.679   14.560  1.00 32.02 ? 157 GLN A CD   2  
ATOM 4820  O OE1  . GLN A 1 162 ? -11.723 6.842   13.668  1.00 35.05 ? 157 GLN A OE1  2  
ATOM 4821  N NE2  . GLN A 1 162 ? -11.204 6.169   15.746  1.00 53.41 ? 157 GLN A NE2  2  
ATOM 4822  H H    . GLN A 1 162 ? -7.586  6.335   12.129  1.00 63.42 ? 157 GLN A H    2  
ATOM 4823  H HA   . GLN A 1 162 ? -7.730  9.174   12.228  1.00 51.12 ? 157 GLN A HA   2  
ATOM 4824  H HB3  . GLN A 1 162 ? -9.662  7.492   12.283  1.00 53.43 ? 157 GLN A HB3  2  
ATOM 4825  H HG3  . GLN A 1 162 ? -9.081  7.563   15.235  1.00 11.41 ? 157 GLN A HG3  2  
ATOM 4826  H HE21 . GLN A 1 162 ? -10.488 6.069   16.409  1.00 10.14 ? 157 GLN A HE21 2  
ATOM 4827  H HE22 . GLN A 1 162 ? -12.135 5.915   15.910  1.00 4.12  ? 157 GLN A HE22 2  
ATOM 4828  N N    . GLU A 1 163 ? -6.276  7.669   14.668  1.00 35.01 ? 158 GLU A N    2  
ATOM 4829  C CA   . GLU A 1 163 ? -5.535  7.849   15.910  1.00 70.34 ? 158 GLU A CA   2  
ATOM 4830  C C    . GLU A 1 163 ? -4.166  8.467   15.641  1.00 62.25 ? 158 GLU A C    2  
ATOM 4831  O O    . GLU A 1 163 ? -3.861  9.559   16.119  1.00 65.55 ? 158 GLU A O    2  
ATOM 4832  C CB   . GLU A 1 163 ? -5.369  6.510   16.630  1.00 61.22 ? 158 GLU A CB   2  
ATOM 4833  C CG   . GLU A 1 163 ? -6.510  6.182   17.578  1.00 3.03  ? 158 GLU A CG   2  
ATOM 4834  C CD   . GLU A 1 163 ? -6.357  6.853   18.930  1.00 52.42 ? 158 GLU A CD   2  
ATOM 4835  O OE1  . GLU A 1 163 ? -5.322  6.628   19.590  1.00 53.13 ? 158 GLU A OE1  2  
ATOM 4836  O OE2  . GLU A 1 163 ? -7.274  7.602   19.326  1.00 60.22 ? 158 GLU A OE2  2  
ATOM 4837  H H    . GLU A 1 163 ? -6.200  6.820   14.185  1.00 30.25 ? 158 GLU A H    2  
ATOM 4838  H HA   . GLU A 1 163 ? -6.101  8.519   16.540  1.00 54.41 ? 158 GLU A HA   2  
ATOM 4839  H HB3  . GLU A 1 163 ? -4.451  6.533   17.201  1.00 0.03  ? 158 GLU A HB3  2  
ATOM 4840  H HG3  . GLU A 1 163 ? -6.544  5.113   17.724  1.00 72.52 ? 158 GLU A HG3  2  
ATOM 4841  N N    . GLY A 1 164 ? -3.344  7.760   14.871  1.00 62.43 ? 159 GLY A N    2  
ATOM 4842  C CA   . GLY A 1 164 ? -2.017  8.254   14.552  1.00 74.41 ? 159 GLY A CA   2  
ATOM 4843  C C    . GLY A 1 164 ? -1.058  7.141   14.180  1.00 11.24 ? 159 GLY A C    2  
ATOM 4844  O O    . GLY A 1 164 ? 0.048   7.059   14.713  1.00 72.25 ? 159 GLY A O    2  
ATOM 4845  H H    . GLY A 1 164 ? -3.641  6.895   14.518  1.00 20.02 ? 159 GLY A H    2  
ATOM 4846  H HA2  . GLY A 1 164 ? -2.091  8.944   13.725  1.00 12.24 ? 159 GLY A HA2  2  
ATOM 4847  H HA3  . GLY A 1 164 ? -1.625  8.778   15.411  1.00 52.03 ? 159 GLY A HA3  2  
ATOM 4848  N N    . TYR A 1 165 ? -1.483  6.279   13.261  1.00 62.54 ? 160 TYR A N    2  
ATOM 4849  C CA   . TYR A 1 165 ? -0.655  5.162   12.822  1.00 24.23 ? 160 TYR A CA   2  
ATOM 4850  C C    . TYR A 1 165 ? -0.368  5.254   11.326  1.00 23.34 ? 160 TYR A C    2  
ATOM 4851  O O    . TYR A 1 165 ? -0.750  6.222   10.667  1.00 54.24 ? 160 TYR A O    2  
ATOM 4852  C CB   . TYR A 1 165 ? -1.344  3.833   13.139  1.00 63.12 ? 160 TYR A CB   2  
ATOM 4853  C CG   . TYR A 1 165 ? -1.440  3.540   14.619  1.00 21.43 ? 160 TYR A CG   2  
ATOM 4854  C CD1  . TYR A 1 165 ? -2.212  4.337   15.456  1.00 24.41 ? 160 TYR A CD1  2  
ATOM 4855  C CD2  . TYR A 1 165 ? -0.761  2.467   15.180  1.00 14.33 ? 160 TYR A CD2  2  
ATOM 4856  C CE1  . TYR A 1 165 ? -2.302  4.073   16.809  1.00 40.32 ? 160 TYR A CE1  2  
ATOM 4857  C CE2  . TYR A 1 165 ? -0.846  2.194   16.532  1.00 34.10 ? 160 TYR A CE2  2  
ATOM 4858  C CZ   . TYR A 1 165 ? -1.618  3.001   17.343  1.00 3.25  ? 160 TYR A CZ   2  
ATOM 4859  O OH   . TYR A 1 165 ? -1.706  2.734   18.689  1.00 31.23 ? 160 TYR A OH   2  
ATOM 4860  H H    . TYR A 1 165 ? -2.375  6.395   12.872  1.00 45.03 ? 160 TYR A H    2  
ATOM 4861  H HA   . TYR A 1 165 ? 0.280   5.209   13.359  1.00 61.44 ? 160 TYR A HA   2  
ATOM 4862  H HB3  . TYR A 1 165 ? -0.790  3.030   12.677  1.00 14.23 ? 160 TYR A HB3  2  
ATOM 4863  H HD1  . TYR A 1 165 ? -2.747  5.176   15.036  1.00 3.43  ? 160 TYR A HD1  2  
ATOM 4864  H HD2  . TYR A 1 165 ? -0.157  1.837   14.543  1.00 55.52 ? 160 TYR A HD2  2  
ATOM 4865  H HE1  . TYR A 1 165 ? -2.906  4.704   17.444  1.00 2.14  ? 160 TYR A HE1  2  
ATOM 4866  H HE2  . TYR A 1 165 ? -0.311  1.354   16.950  1.00 4.23  ? 160 TYR A HE2  2  
ATOM 4867  H HH   . TYR A 1 165 ? -1.175  1.962   18.898  1.00 52.53 ? 160 TYR A HH   2  
ATOM 4868  N N    . SER A 1 166 ? 0.307   4.239   10.797  1.00 1.42  ? 161 SER A N    2  
ATOM 4869  C CA   . SER A 1 166 ? 0.649   4.205   9.379   1.00 41.22 ? 161 SER A CA   2  
ATOM 4870  C C    . SER A 1 166 ? -0.077  3.065   8.672   1.00 21.00 ? 161 SER A C    2  
ATOM 4871  O O    . SER A 1 166 ? 0.087   1.897   9.026   1.00 34.24 ? 161 SER A O    2  
ATOM 4872  C CB   . SER A 1 166 ? 2.161   4.049   9.201   1.00 63.34 ? 161 SER A CB   2  
ATOM 4873  O OG   . SER A 1 166 ? 2.747   5.253   8.736   1.00 32.33 ? 161 SER A OG   2  
ATOM 4874  H H    . SER A 1 166 ? 0.584   3.497   11.373  1.00 32.23 ? 161 SER A H    2  
ATOM 4875  H HA   . SER A 1 166 ? 0.338   5.141   8.941   1.00 4.34  ? 161 SER A HA   2  
ATOM 4876  H HB3  . SER A 1 166 ? 2.357   3.266   8.484   1.00 42.54 ? 161 SER A HB3  2  
ATOM 4877  H HG   . SER A 1 166 ? 2.503   5.394   7.817   1.00 74.13 ? 161 SER A HG   2  
ATOM 4878  N N    . ILE A 1 167 ? -0.878  3.413   7.672   1.00 4.24  ? 162 ILE A N    2  
ATOM 4879  C CA   . ILE A 1 167 ? -1.629  2.420   6.913   1.00 54.23 ? 162 ILE A CA   2  
ATOM 4880  C C    . ILE A 1 167 ? -1.423  2.602   5.413   1.00 12.20 ? 162 ILE A C    2  
ATOM 4881  O O    . ILE A 1 167 ? -1.546  3.708   4.889   1.00 3.33  ? 162 ILE A O    2  
ATOM 4882  C CB   . ILE A 1 167 ? -3.135  2.493   7.226   1.00 32.02 ? 162 ILE A CB   2  
ATOM 4883  C CG1  . ILE A 1 167 ? -3.390  2.166   8.698   1.00 54.35 ? 162 ILE A CG1  2  
ATOM 4884  C CG2  . ILE A 1 167 ? -3.910  1.543   6.324   1.00 73.13 ? 162 ILE A CG2  2  
ATOM 4885  C CD1  . ILE A 1 167 ? -3.679  3.384   9.547   1.00 12.14 ? 162 ILE A CD1  2  
ATOM 4886  H H    . ILE A 1 167 ? -0.966  4.360   7.437   1.00 3.22  ? 162 ILE A H    2  
ATOM 4887  H HA   . ILE A 1 167 ? -1.270  1.441   7.199   1.00 64.22 ? 162 ILE A HA   2  
ATOM 4888  H HB   . ILE A 1 167 ? -3.473  3.499   7.024   1.00 13.11 ? 162 ILE A HB   2  
ATOM 4889  H HG13 . ILE A 1 167 ? -2.517  1.676   9.107   1.00 0.22  ? 162 ILE A HG13 2  
ATOM 4890  H HG21 . ILE A 1 167 ? -4.856  1.301   6.786   1.00 21.31 ? 162 ILE A HG21 2  
ATOM 4891  H HG22 . ILE A 1 167 ? -4.086  2.017   5.371   1.00 21.14 ? 162 ILE A HG22 2  
ATOM 4892  H HG23 . ILE A 1 167 ? -3.339  0.639   6.178   1.00 72.43 ? 162 ILE A HG23 2  
ATOM 4893  H HD11 . ILE A 1 167 ? -4.665  3.296   9.979   1.00 35.32 ? 162 ILE A HD11 2  
ATOM 4894  H HD12 . ILE A 1 167 ? -2.945  3.459   10.335  1.00 14.44 ? 162 ILE A HD12 2  
ATOM 4895  H HD13 . ILE A 1 167 ? -3.637  4.271   8.930   1.00 51.32 ? 162 ILE A HD13 2  
ATOM 4896  N N    . PHE A 1 168 ? -1.110  1.507   4.728   1.00 40.41 ? 163 PHE A N    2  
ATOM 4897  C CA   . PHE A 1 168 ? -0.887  1.544   3.287   1.00 64.21 ? 163 PHE A CA   2  
ATOM 4898  C C    . PHE A 1 168 ? -1.874  0.636   2.560   1.00 53.34 ? 163 PHE A C    2  
ATOM 4899  O O    . PHE A 1 168 ? -2.356  -0.349  3.119   1.00 55.13 ? 163 PHE A O    2  
ATOM 4900  C CB   . PHE A 1 168 ? 0.547   1.124   2.959   1.00 73.24 ? 163 PHE A CB   2  
ATOM 4901  C CG   . PHE A 1 168 ? 1.587   2.045   3.532   1.00 12.02 ? 163 PHE A CG   2  
ATOM 4902  C CD1  . PHE A 1 168 ? 1.894   2.012   4.883   1.00 33.02 ? 163 PHE A CD1  2  
ATOM 4903  C CD2  . PHE A 1 168 ? 2.257   2.944   2.719   1.00 43.14 ? 163 PHE A CD2  2  
ATOM 4904  C CE1  . PHE A 1 168 ? 2.850   2.857   5.413   1.00 42.53 ? 163 PHE A CE1  2  
ATOM 4905  C CE2  . PHE A 1 168 ? 3.216   3.791   3.242   1.00 62.43 ? 163 PHE A CE2  2  
ATOM 4906  C CZ   . PHE A 1 168 ? 3.511   3.749   4.591   1.00 60.42 ? 163 PHE A CZ   2  
ATOM 4907  H H    . PHE A 1 168 ? -1.025  0.653   5.203   1.00 11.00 ? 163 PHE A H    2  
ATOM 4908  H HA   . PHE A 1 168 ? -1.040  2.560   2.955   1.00 55.14 ? 163 PHE A HA   2  
ATOM 4909  H HB3  . PHE A 1 168 ? 0.673   1.104   1.888   1.00 44.40 ? 163 PHE A HB3  2  
ATOM 4910  H HD1  . PHE A 1 168 ? 1.376   1.314   5.526   1.00 13.11 ? 163 PHE A HD1  2  
ATOM 4911  H HD2  . PHE A 1 168 ? 2.027   2.980   1.664   1.00 60.31 ? 163 PHE A HD2  2  
ATOM 4912  H HE1  . PHE A 1 168 ? 3.079   2.821   6.467   1.00 30.10 ? 163 PHE A HE1  2  
ATOM 4913  H HE2  . PHE A 1 168 ? 3.731   4.489   2.598   1.00 41.24 ? 163 PHE A HE2  2  
ATOM 4914  H HZ   . PHE A 1 168 ? 4.260   4.410   5.003   1.00 21.53 ? 163 PHE A HZ   2  
ATOM 4915  N N    . VAL A 1 169 ? -2.170  0.973   1.309   1.00 63.32 ? 164 VAL A N    2  
ATOM 4916  C CA   . VAL A 1 169 ? -3.098  0.189   0.505   1.00 1.33  ? 164 VAL A CA   2  
ATOM 4917  C C    . VAL A 1 169 ? -2.386  -0.465  -0.674  1.00 12.04 ? 164 VAL A C    2  
ATOM 4918  O O    . VAL A 1 169 ? -1.686  0.199   -1.437  1.00 61.51 ? 164 VAL A O    2  
ATOM 4919  C CB   . VAL A 1 169 ? -4.254  1.058   -0.026  1.00 44.51 ? 164 VAL A CB   2  
ATOM 4920  C CG1  . VAL A 1 169 ? -5.420  0.186   -0.467  1.00 52.31 ? 164 VAL A CG1  2  
ATOM 4921  C CG2  . VAL A 1 169 ? -4.695  2.060   1.030   1.00 34.32 ? 164 VAL A CG2  2  
ATOM 4922  H H    . VAL A 1 169 ? -1.753  1.770   0.918   1.00 73.35 ? 164 VAL A H    2  
ATOM 4923  H HA   . VAL A 1 169 ? -3.517  -0.582  1.134   1.00 55.54 ? 164 VAL A HA   2  
ATOM 4924  H HB   . VAL A 1 169 ? -3.899  1.607   -0.886  1.00 52.51 ? 164 VAL A HB   2  
ATOM 4925  H HG11 . VAL A 1 169 ? -5.303  -0.072  -1.509  1.00 71.41 ? 164 VAL A HG11 2  
ATOM 4926  H HG12 . VAL A 1 169 ? -5.440  -0.716  0.128   1.00 65.00 ? 164 VAL A HG12 2  
ATOM 4927  H HG13 . VAL A 1 169 ? -6.344  0.726   -0.331  1.00 24.45 ? 164 VAL A HG13 2  
ATOM 4928  H HG21 . VAL A 1 169 ? -4.231  3.015   0.836   1.00 31.34 ? 164 VAL A HG21 2  
ATOM 4929  H HG22 . VAL A 1 169 ? -5.771  2.168   0.996   1.00 43.34 ? 164 VAL A HG22 2  
ATOM 4930  H HG23 . VAL A 1 169 ? -4.401  1.707   2.007   1.00 4.31  ? 164 VAL A HG23 2  
ATOM 4931  N N    . VAL A 1 170 ? -2.571  -1.774  -0.817  1.00 33.40 ? 165 VAL A N    2  
ATOM 4932  C CA   . VAL A 1 170 ? -1.947  -2.520  -1.904  1.00 12.04 ? 165 VAL A CA   2  
ATOM 4933  C C    . VAL A 1 170 ? -2.994  -3.041  -2.883  1.00 44.32 ? 165 VAL A C    2  
ATOM 4934  O O    . VAL A 1 170 ? -3.762  -3.947  -2.564  1.00 15.02 ? 165 VAL A O    2  
ATOM 4935  C CB   . VAL A 1 170 ? -1.124  -3.707  -1.370  1.00 31.13 ? 165 VAL A CB   2  
ATOM 4936  C CG1  . VAL A 1 170 ? -0.563  -4.528  -2.521  1.00 55.15 ? 165 VAL A CG1  2  
ATOM 4937  C CG2  . VAL A 1 170 ? -0.008  -3.214  -0.461  1.00 11.42 ? 165 VAL A CG2  2  
ATOM 4938  H H    . VAL A 1 170 ? -3.140  -2.249  -0.177  1.00 75.10 ? 165 VAL A H    2  
ATOM 4939  H HA   . VAL A 1 170 ? -1.279  -1.852  -2.427  1.00 74.12 ? 165 VAL A HA   2  
ATOM 4940  H HB   . VAL A 1 170 ? -1.779  -4.341  -0.789  1.00 4.30  ? 165 VAL A HB   2  
ATOM 4941  H HG11 . VAL A 1 170 ? 0.011   -3.887  -3.174  1.00 14.41 ? 165 VAL A HG11 2  
ATOM 4942  H HG12 . VAL A 1 170 ? 0.073   -5.309  -2.131  1.00 75.54 ? 165 VAL A HG12 2  
ATOM 4943  H HG13 . VAL A 1 170 ? -1.377  -4.972  -3.076  1.00 44.23 ? 165 VAL A HG13 2  
ATOM 4944  H HG21 . VAL A 1 170 ? 0.325   -4.024  0.171   1.00 35.35 ? 165 VAL A HG21 2  
ATOM 4945  H HG22 . VAL A 1 170 ? 0.819   -2.867  -1.064  1.00 62.45 ? 165 VAL A HG22 2  
ATOM 4946  H HG23 . VAL A 1 170 ? -0.373  -2.404  0.151   1.00 50.03 ? 165 VAL A HG23 2  
ATOM 4947  N N    . LYS A 1 171 ? -3.017  -2.462  -4.079  1.00 65.20 ? 166 LYS A N    2  
ATOM 4948  C CA   . LYS A 1 171 ? -3.967  -2.867  -5.108  1.00 42.32 ? 166 LYS A CA   2  
ATOM 4949  C C    . LYS A 1 171 ? -3.247  -3.511  -6.289  1.00 15.31 ? 166 LYS A C    2  
ATOM 4950  O O    . LYS A 1 171 ? -2.100  -3.182  -6.584  1.00 63.02 ? 166 LYS A O    2  
ATOM 4951  C CB   . LYS A 1 171 ? -4.777  -1.661  -5.587  1.00 52.22 ? 166 LYS A CB   2  
ATOM 4952  C CG   . LYS A 1 171 ? -6.208  -1.649  -5.079  1.00 63.44 ? 166 LYS A CG   2  
ATOM 4953  C CD   . LYS A 1 171 ? -7.027  -2.772  -5.692  1.00 31.11 ? 166 LYS A CD   2  
ATOM 4954  C CE   . LYS A 1 171 ? -8.407  -2.289  -6.112  1.00 1.34  ? 166 LYS A CE   2  
ATOM 4955  N NZ   . LYS A 1 171 ? -8.881  -2.974  -7.347  1.00 41.54 ? 166 LYS A NZ   2  
ATOM 4956  H H    . LYS A 1 171 ? -2.377  -1.744  -4.275  1.00 74.41 ? 166 LYS A H    2  
ATOM 4957  H HA   . LYS A 1 171 ? -4.638  -3.592  -4.672  1.00 23.01 ? 166 LYS A HA   2  
ATOM 4958  H HB3  . LYS A 1 171 ? -4.800  -1.665  -6.668  1.00 33.44 ? 166 LYS A HB3  2  
ATOM 4959  H HG3  . LYS A 1 171 ? -6.663  -0.702  -5.335  1.00 72.31 ? 166 LYS A HG3  2  
ATOM 4960  H HD3  . LYS A 1 171 ? -7.139  -3.563  -4.964  1.00 53.15 ? 166 LYS A HD3  2  
ATOM 4961  H HE3  . LYS A 1 171 ? -8.362  -1.226  -6.296  1.00 41.13 ? 166 LYS A HE3  2  
ATOM 4962  H HZ1  . LYS A 1 171 ? -9.886  -3.224  -7.254  1.00 35.52 ? 166 LYS A HZ1  2  
ATOM 4963  H HZ2  . LYS A 1 171 ? -8.333  -3.843  -7.506  1.00 11.04 ? 166 LYS A HZ2  2  
ATOM 4964  H HZ3  . LYS A 1 171 ? -8.766  -2.349  -8.170  1.00 43.35 ? 166 LYS A HZ3  2  
ATOM 4965  N N    . GLY A 1 172 ? -3.931  -4.432  -6.962  1.00 23.21 ? 167 GLY A N    2  
ATOM 4966  C CA   . GLY A 1 172 ? -3.340  -5.106  -8.104  1.00 34.35 ? 167 GLY A CA   2  
ATOM 4967  C C    . GLY A 1 172 ? -3.746  -6.565  -8.188  1.00 43.22 ? 167 GLY A C    2  
ATOM 4968  O O    . GLY A 1 172 ? -4.575  -7.032  -7.408  1.00 35.44 ? 167 GLY A O    2  
ATOM 4969  H H    . GLY A 1 172 ? -4.843  -4.655  -6.681  1.00 21.20 ? 167 GLY A H    2  
ATOM 4970  H HA2  . GLY A 1 172 ? -3.655  -4.605  -9.006  1.00 24.43 ? 167 GLY A HA2  2  
ATOM 4971  H HA3  . GLY A 1 172 ? -2.265  -5.048  -8.026  1.00 24.43 ? 167 GLY A HA3  2  
ATOM 4972  N N    . ASP A 1 173 ? -3.159  -7.286  -9.138  1.00 63.44 ? 168 ASP A N    2  
ATOM 4973  C CA   . ASP A 1 173 ? -3.464  -8.700  -9.321  1.00 41.23 ? 168 ASP A CA   2  
ATOM 4974  C C    . ASP A 1 173 ? -2.249  -9.564  -8.993  1.00 34.31 ? 168 ASP A C    2  
ATOM 4975  O O    . ASP A 1 173 ? -1.107  -9.139  -9.164  1.00 40.13 ? 168 ASP A O    2  
ATOM 4976  C CB   . ASP A 1 173 ? -3.918  -8.963  -10.758 1.00 41.12 ? 168 ASP A CB   2  
ATOM 4977  C CG   . ASP A 1 173 ? -5.289  -9.608  -10.821 1.00 24.34 ? 168 ASP A CG   2  
ATOM 4978  O OD1  . ASP A 1 173 ? -5.392  -10.813 -10.512 1.00 61.42 ? 168 ASP A OD1  2  
ATOM 4979  O OD2  . ASP A 1 173 ? -6.258  -8.907  -11.182 1.00 15.33 ? 168 ASP A OD2  2  
ATOM 4980  H H    . ASP A 1 173 ? -2.505  -6.856  -9.728  1.00 32.44 ? 168 ASP A H    2  
ATOM 4981  H HA   . ASP A 1 173 ? -4.265  -8.957  -8.647  1.00 32.51 ? 168 ASP A HA   2  
ATOM 4982  H HB3  . ASP A 1 173 ? -3.208  -9.620  -11.238 1.00 23.21 ? 168 ASP A HB3  2  
ATOM 4983  N N    . LEU A 1 174 ? -2.505  -10.778 -8.518  1.00 11.14 ? 169 LEU A N    2  
ATOM 4984  C CA   . LEU A 1 174 ? -1.434  -11.703 -8.165  1.00 73.24 ? 169 LEU A CA   2  
ATOM 4985  C C    . LEU A 1 174 ? -1.292  -12.800 -9.215  1.00 41.43 ? 169 LEU A C    2  
ATOM 4986  O O    . LEU A 1 174 ? -2.232  -13.125 -9.940  1.00 4.52  ? 169 LEU A O    2  
ATOM 4987  C CB   . LEU A 1 174 ? -1.704  -12.326 -6.793  1.00 2.43  ? 169 LEU A CB   2  
ATOM 4988  C CG   . LEU A 1 174 ? -1.582  -11.386 -5.593  1.00 12.45 ? 169 LEU A CG   2  
ATOM 4989  C CD1  . LEU A 1 174 ? -1.866  -12.134 -4.300  1.00 50.15 ? 169 LEU A CD1  2  
ATOM 4990  C CD2  . LEU A 1 174 ? -0.199  -10.751 -5.552  1.00 32.13 ? 169 LEU A CD2  2  
ATOM 4991  H H    . LEU A 1 174 ? -3.436  -11.061 -8.404  1.00 13.23 ? 169 LEU A H    2  
ATOM 4992  H HA   . LEU A 1 174 ? -0.513  -11.141 -8.121  1.00 55.00 ? 169 LEU A HA   2  
ATOM 4993  H HB3  . LEU A 1 174 ? -1.001  -13.136 -6.655  1.00 64.01 ? 169 LEU A HB3  2  
ATOM 4994  H HG   . LEU A 1 174 ? -2.312  -10.595 -5.688  1.00 1.43  ? 169 LEU A HG   2  
ATOM 4995  H HD11 . LEU A 1 174 ? -2.180  -11.433 -3.542  1.00 35.53 ? 169 LEU A HD11 2  
ATOM 4996  H HD12 . LEU A 1 174 ? -0.970  -12.640 -3.973  1.00 21.41 ? 169 LEU A HD12 2  
ATOM 4997  H HD13 . LEU A 1 174 ? -2.648  -12.860 -4.468  1.00 74.21 ? 169 LEU A HD13 2  
ATOM 4998  H HD21 . LEU A 1 174 ? -0.291  -9.683  -5.681  1.00 21.52 ? 169 LEU A HD21 2  
ATOM 4999  H HD22 . LEU A 1 174 ? 0.408   -11.158 -6.348  1.00 32.53 ? 169 LEU A HD22 2  
ATOM 5000  H HD23 . LEU A 1 174 ? 0.265   -10.961 -4.600  1.00 32.34 ? 169 LEU A HD23 2  
ATOM 5001  N N    . PRO A 1 175 ? -0.088  -13.386 -9.300  1.00 73.40 ? 170 PRO A N    2  
ATOM 5002  C CA   . PRO A 1 175 ? 0.205   -14.457 -10.256 1.00 0.34  ? 170 PRO A CA   2  
ATOM 5003  C C    . PRO A 1 175 ? -0.513  -15.758 -9.909  1.00 65.41 ? 170 PRO A C    2  
ATOM 5004  O O    . PRO A 1 175 ? -1.012  -16.456 -10.791 1.00 11.24 ? 170 PRO A O    2  
ATOM 5005  C CB   . PRO A 1 175 ? 1.720   -14.635 -10.136 1.00 40.54 ? 170 PRO A CB   2  
ATOM 5006  C CG   . PRO A 1 175 ? 2.051   -14.157 -8.764  1.00 22.44 ? 170 PRO A CG   2  
ATOM 5007  C CD   . PRO A 1 175 ? 1.078   -13.049 -8.466  1.00 1.31  ? 170 PRO A CD   2  
ATOM 5008  H HA   . PRO A 1 175 ? -0.046  -14.167 -11.266 1.00 54.31 ? 170 PRO A HA   2  
ATOM 5009  H HB3  . PRO A 1 175 ? 2.218   -14.043 -10.890 1.00 35.43 ? 170 PRO A HB3  2  
ATOM 5010  H HG3  . PRO A 1 175 ? 3.063   -13.783 -8.739  1.00 11.41 ? 170 PRO A HG3  2  
ATOM 5011  H HD3  . PRO A 1 175 ? 1.494   -12.095 -8.755  1.00 24.41 ? 170 PRO A HD3  2  
ATOM 5012  N N    . ASP A 1 176 ? -0.561  -16.075 -8.620  1.00 30.13 ? 171 ASP A N    2  
ATOM 5013  C CA   . ASP A 1 176 ? -1.220  -17.290 -8.156  1.00 21.11 ? 171 ASP A CA   2  
ATOM 5014  C C    . ASP A 1 176 ? -2.735  -17.111 -8.128  1.00 71.43 ? 171 ASP A C    2  
ATOM 5015  O O    . ASP A 1 176 ? -3.248  -16.196 -7.482  1.00 24.54 ? 171 ASP A O    2  
ATOM 5016  C CB   . ASP A 1 176 ? -0.713  -17.672 -6.766  1.00 54.35 ? 171 ASP A CB   2  
ATOM 5017  C CG   . ASP A 1 176 ? -1.232  -19.021 -6.309  1.00 32.24 ? 171 ASP A CG   2  
ATOM 5018  O OD1  . ASP A 1 176 ? -1.978  -19.662 -7.080  1.00 4.32  ? 171 ASP A OD1  2  
ATOM 5019  O OD2  . ASP A 1 176 ? -0.895  -19.437 -5.181  1.00 62.42 ? 171 ASP A OD2  2  
ATOM 5020  H H    . ASP A 1 176 ? -0.146  -15.476 -7.965  1.00 55.44 ? 171 ASP A H    2  
ATOM 5021  H HA   . ASP A 1 176 ? -0.977  -18.083 -8.848  1.00 34.45 ? 171 ASP A HA   2  
ATOM 5022  H HB3  . ASP A 1 176 ? -1.032  -16.924 -6.055  1.00 52.14 ? 171 ASP A HB3  2  
ATOM 5023  N N    . MET A 1 6   ? -7.289  -23.806 7.796   1.00 1.43  ? 1   MET A N    3  
ATOM 5024  C CA   . MET A 1 6   ? -6.366  -22.932 7.079   1.00 33.02 ? 1   MET A CA   3  
ATOM 5025  C C    . MET A 1 6   ? -5.417  -23.744 6.203   1.00 32.20 ? 1   MET A C    3  
ATOM 5026  O O    . MET A 1 6   ? -4.279  -23.341 5.969   1.00 41.32 ? 1   MET A O    3  
ATOM 5027  C CB   . MET A 1 6   ? -5.566  -22.082 8.067   1.00 42.12 ? 1   MET A CB   3  
ATOM 5028  C CG   . MET A 1 6   ? -4.784  -22.901 9.080   1.00 74.22 ? 1   MET A CG   3  
ATOM 5029  S SD   . MET A 1 6   ? -5.183  -22.465 10.783  1.00 40.14 ? 1   MET A SD   3  
ATOM 5030  C CE   . MET A 1 6   ? -6.364  -23.747 11.194  1.00 11.44 ? 1   MET A CE   3  
ATOM 5031  H H    . MET A 1 6   ? -8.031  -23.409 8.297   1.00 0.13  ? 1   MET A H    3  
ATOM 5032  H HA   . MET A 1 6   ? -6.951  -22.281 6.448   1.00 31.44 ? 1   MET A HA   3  
ATOM 5033  H HB3  . MET A 1 6   ? -6.247  -21.440 8.605   1.00 63.33 ? 1   MET A HB3  3  
ATOM 5034  H HG3  . MET A 1 6   ? -3.729  -22.736 8.919   1.00 2.13  ? 1   MET A HG3  3  
ATOM 5035  H HE1  . MET A 1 6   ? -6.627  -24.293 10.300  1.00 15.33 ? 1   MET A HE1  3  
ATOM 5036  H HE2  . MET A 1 6   ? -5.927  -24.423 11.913  1.00 41.13 ? 1   MET A HE2  3  
ATOM 5037  H HE3  . MET A 1 6   ? -7.252  -23.297 11.615  1.00 11.41 ? 1   MET A HE3  3  
ATOM 5038  N N    . GLU A 1 7   ? -5.895  -24.889 5.724   1.00 72.05 ? 2   GLU A N    3  
ATOM 5039  C CA   . GLU A 1 7   ? -5.086  -25.756 4.876   1.00 11.21 ? 2   GLU A CA   3  
ATOM 5040  C C    . GLU A 1 7   ? -4.821  -25.102 3.523   1.00 20.53 ? 2   GLU A C    3  
ATOM 5041  O O    . GLU A 1 7   ? -3.823  -25.394 2.865   1.00 23.43 ? 2   GLU A O    3  
ATOM 5042  C CB   . GLU A 1 7   ? -5.783  -27.103 4.674   1.00 32.14 ? 2   GLU A CB   3  
ATOM 5043  C CG   . GLU A 1 7   ? -7.117  -26.997 3.953   1.00 32.43 ? 2   GLU A CG   3  
ATOM 5044  C CD   . GLU A 1 7   ? -7.024  -27.386 2.491   1.00 41.53 ? 2   GLU A CD   3  
ATOM 5045  O OE1  . GLU A 1 7   ? -7.048  -28.600 2.198   1.00 5.54  ? 2   GLU A OE1  3  
ATOM 5046  O OE2  . GLU A 1 7   ? -6.925  -26.477 1.640   1.00 61.32 ? 2   GLU A OE2  3  
ATOM 5047  H H    . GLU A 1 7   ? -6.810  -25.156 5.947   1.00 32.13 ? 2   GLU A H    3  
ATOM 5048  H HA   . GLU A 1 7   ? -4.142  -25.922 5.373   1.00 31.33 ? 2   GLU A HA   3  
ATOM 5049  H HB3  . GLU A 1 7   ? -5.956  -27.553 5.641   1.00 15.43 ? 2   GLU A HB3  3  
ATOM 5050  H HG3  . GLU A 1 7   ? -7.466  -25.976 4.017   1.00 70.32 ? 2   GLU A HG3  3  
ATOM 5051  N N    . SER A 1 8   ? -5.723  -24.214 3.115   1.00 12.22 ? 3   SER A N    3  
ATOM 5052  C CA   . SER A 1 8   ? -5.590  -23.521 1.840   1.00 25.34 ? 3   SER A CA   3  
ATOM 5053  C C    . SER A 1 8   ? -4.593  -22.370 1.948   1.00 1.33  ? 3   SER A C    3  
ATOM 5054  O O    . SER A 1 8   ? -4.040  -21.917 0.945   1.00 31.33 ? 3   SER A O    3  
ATOM 5055  C CB   . SER A 1 8   ? -6.949  -22.989 1.379   1.00 33.01 ? 3   SER A CB   3  
ATOM 5056  O OG   . SER A 1 8   ? -7.940  -23.199 2.370   1.00 54.10 ? 3   SER A OG   3  
ATOM 5057  H H    . SER A 1 8   ? -6.498  -24.024 3.685   1.00 42.21 ? 3   SER A H    3  
ATOM 5058  H HA   . SER A 1 8   ? -5.225  -24.230 1.112   1.00 33.32 ? 3   SER A HA   3  
ATOM 5059  H HB3  . SER A 1 8   ? -7.245  -23.503 0.476   1.00 63.30 ? 3   SER A HB3  3  
ATOM 5060  H HG   . SER A 1 8   ? -8.781  -23.390 1.947   1.00 1.14  ? 3   SER A HG   3  
ATOM 5061  N N    . ILE A 1 9   ? -4.367  -21.904 3.172   1.00 34.22 ? 4   ILE A N    3  
ATOM 5062  C CA   . ILE A 1 9   ? -3.437  -20.809 3.412   1.00 74.23 ? 4   ILE A CA   3  
ATOM 5063  C C    . ILE A 1 9   ? -2.012  -21.326 3.588   1.00 21.53 ? 4   ILE A C    3  
ATOM 5064  O O    . ILE A 1 9   ? -1.774  -22.280 4.328   1.00 1.30  ? 4   ILE A O    3  
ATOM 5065  C CB   . ILE A 1 9   ? -3.833  -19.996 4.660   1.00 1.14  ? 4   ILE A CB   3  
ATOM 5066  C CG1  . ILE A 1 9   ? -5.318  -19.632 4.606   1.00 14.20 ? 4   ILE A CG1  3  
ATOM 5067  C CG2  . ILE A 1 9   ? -2.978  -18.743 4.768   1.00 70.45 ? 4   ILE A CG2  3  
ATOM 5068  C CD1  . ILE A 1 9   ? -5.802  -18.888 5.831   1.00 64.25 ? 4   ILE A CD1  3  
ATOM 5069  H H    . ILE A 1 9   ? -4.838  -22.308 3.931   1.00 64.41 ? 4   ILE A H    3  
ATOM 5070  H HA   . ILE A 1 9   ? -3.467  -20.152 2.554   1.00 62.31 ? 4   ILE A HA   3  
ATOM 5071  H HB   . ILE A 1 9   ? -3.650  -20.605 5.531   1.00 14.11 ? 4   ILE A HB   3  
ATOM 5072  H HG13 . ILE A 1 9   ? -5.901  -20.538 4.517   1.00 42.11 ? 4   ILE A HG13 3  
ATOM 5073  H HG21 . ILE A 1 9   ? -2.258  -18.727 3.964   1.00 31.04 ? 4   ILE A HG21 3  
ATOM 5074  H HG22 . ILE A 1 9   ? -3.610  -17.870 4.702   1.00 63.15 ? 4   ILE A HG22 3  
ATOM 5075  H HG23 . ILE A 1 9   ? -2.459  -18.742 5.715   1.00 74.53 ? 4   ILE A HG23 3  
ATOM 5076  H HD11 . ILE A 1 9   ? -5.102  -19.033 6.641   1.00 1.30  ? 4   ILE A HD11 3  
ATOM 5077  H HD12 . ILE A 1 9   ? -5.879  -17.835 5.605   1.00 74.21 ? 4   ILE A HD12 3  
ATOM 5078  H HD13 . ILE A 1 9   ? -6.771  -19.266 6.123   1.00 23.32 ? 4   ILE A HD13 3  
ATOM 5079  N N    . PHE A 1 10  ? -1.069  -20.689 2.902   1.00 30.43 ? 5   PHE A N    3  
ATOM 5080  C CA   . PHE A 1 10  ? 0.333   -21.083 2.983   1.00 33.35 ? 5   PHE A CA   3  
ATOM 5081  C C    . PHE A 1 10  ? 0.902   -20.788 4.367   1.00 31.31 ? 5   PHE A C    3  
ATOM 5082  O O    . PHE A 1 10  ? 1.058   -19.629 4.753   1.00 20.32 ? 5   PHE A O    3  
ATOM 5083  C CB   . PHE A 1 10  ? 1.152   -20.354 1.916   1.00 71.32 ? 5   PHE A CB   3  
ATOM 5084  C CG   . PHE A 1 10  ? 2.202   -21.214 1.274   1.00 74.23 ? 5   PHE A CG   3  
ATOM 5085  C CD1  . PHE A 1 10  ? 1.901   -21.984 0.162   1.00 52.54 ? 5   PHE A CD1  3  
ATOM 5086  C CD2  . PHE A 1 10  ? 3.490   -21.253 1.783   1.00 53.32 ? 5   PHE A CD2  3  
ATOM 5087  C CE1  . PHE A 1 10  ? 2.866   -22.778 -0.430  1.00 60.43 ? 5   PHE A CE1  3  
ATOM 5088  C CE2  . PHE A 1 10  ? 4.459   -22.045 1.195   1.00 64.33 ? 5   PHE A CE2  3  
ATOM 5089  C CZ   . PHE A 1 10  ? 4.147   -22.807 0.087   1.00 33.24 ? 5   PHE A CZ   3  
ATOM 5090  H H    . PHE A 1 10  ? -1.322  -19.935 2.328   1.00 11.20 ? 5   PHE A H    3  
ATOM 5091  H HA   . PHE A 1 10  ? 0.388   -22.145 2.803   1.00 14.14 ? 5   PHE A HA   3  
ATOM 5092  H HB3  . PHE A 1 10  ? 1.645   -19.507 2.368   1.00 72.13 ? 5   PHE A HB3  3  
ATOM 5093  H HD1  . PHE A 1 10  ? 0.901   -21.962 -0.244  1.00 71.54 ? 5   PHE A HD1  3  
ATOM 5094  H HD2  . PHE A 1 10  ? 3.736   -20.657 2.651   1.00 5.53  ? 5   PHE A HD2  3  
ATOM 5095  H HE1  . PHE A 1 10  ? 2.619   -23.372 -1.296  1.00 13.32 ? 5   PHE A HE1  3  
ATOM 5096  H HE2  . PHE A 1 10  ? 5.459   -22.065 1.602   1.00 3.51  ? 5   PHE A HE2  3  
ATOM 5097  H HZ   . PHE A 1 10  ? 4.902   -23.426 -0.374  1.00 72.01 ? 5   PHE A HZ   3  
ATOM 5098  N N    . HIS A 1 11  ? 1.210   -21.846 5.111   1.00 32.44 ? 6   HIS A N    3  
ATOM 5099  C CA   . HIS A 1 11  ? 1.762   -21.701 6.454   1.00 13.22 ? 6   HIS A CA   3  
ATOM 5100  C C    . HIS A 1 11  ? 3.266   -21.954 6.452   1.00 44.32 ? 6   HIS A C    3  
ATOM 5101  O O    . HIS A 1 11  ? 3.718   -23.064 6.173   1.00 10.42 ? 6   HIS A O    3  
ATOM 5102  C CB   . HIS A 1 11  ? 1.072   -22.666 7.419   1.00 11.33 ? 6   HIS A CB   3  
ATOM 5103  C CG   . HIS A 1 11  ? 1.029   -24.079 6.924   1.00 24.24 ? 6   HIS A CG   3  
ATOM 5104  N ND1  . HIS A 1 11  ? 1.973   -25.025 7.264   1.00 61.32 ? 6   HIS A ND1  3  
ATOM 5105  C CD2  . HIS A 1 11  ? 0.147   -24.706 6.110   1.00 61.55 ? 6   HIS A CD2  3  
ATOM 5106  C CE1  . HIS A 1 11  ? 1.674   -26.172 6.681   1.00 64.32 ? 6   HIS A CE1  3  
ATOM 5107  N NE2  . HIS A 1 11  ? 0.569   -26.005 5.976   1.00 50.52 ? 6   HIS A NE2  3  
ATOM 5108  H H    . HIS A 1 11  ? 1.063   -22.744 4.749   1.00 23.32 ? 6   HIS A H    3  
ATOM 5109  H HA   . HIS A 1 11  ? 1.581   -20.689 6.780   1.00 31.31 ? 6   HIS A HA   3  
ATOM 5110  H HB3  . HIS A 1 11  ? 0.055   -22.338 7.579   1.00 31.11 ? 6   HIS A HB3  3  
ATOM 5111  H HD1  . HIS A 1 11  ? 2.747   -24.877 7.846   1.00 70.11 ? 6   HIS A HD1  3  
ATOM 5112  H HD2  . HIS A 1 11  ? -0.728  -24.266 5.652   1.00 52.15 ? 6   HIS A HD2  3  
ATOM 5113  H HE1  . HIS A 1 11  ? 2.236   -27.089 6.766   1.00 15.40 ? 6   HIS A HE1  3  
ATOM 5114  N N    . GLU A 1 12  ? 4.036   -20.916 6.765   1.00 54.54 ? 7   GLU A N    3  
ATOM 5115  C CA   . GLU A 1 12  ? 5.491   -21.028 6.798   1.00 72.30 ? 7   GLU A CA   3  
ATOM 5116  C C    . GLU A 1 12  ? 6.026   -20.747 8.199   1.00 61.24 ? 7   GLU A C    3  
ATOM 5117  O O    . GLU A 1 12  ? 5.634   -19.773 8.843   1.00 23.03 ? 7   GLU A O    3  
ATOM 5118  C CB   . GLU A 1 12  ? 6.120   -20.059 5.795   1.00 61.45 ? 7   GLU A CB   3  
ATOM 5119  C CG   . GLU A 1 12  ? 6.194   -20.610 4.381   1.00 70.31 ? 7   GLU A CG   3  
ATOM 5120  C CD   . GLU A 1 12  ? 7.519   -20.309 3.706   1.00 74.40 ? 7   GLU A CD   3  
ATOM 5121  O OE1  . GLU A 1 12  ? 7.951   -19.138 3.744   1.00 72.02 ? 7   GLU A OE1  3  
ATOM 5122  O OE2  . GLU A 1 12  ? 8.122   -21.244 3.140   1.00 64.22 ? 7   GLU A OE2  3  
ATOM 5123  H H    . GLU A 1 12  ? 3.618   -20.057 6.979   1.00 20.11 ? 7   GLU A H    3  
ATOM 5124  H HA   . GLU A 1 12  ? 5.752   -22.037 6.522   1.00 10.12 ? 7   GLU A HA   3  
ATOM 5125  H HB3  . GLU A 1 12  ? 7.124   -19.825 6.121   1.00 1.54  ? 7   GLU A HB3  3  
ATOM 5126  H HG3  . GLU A 1 12  ? 5.401   -20.170 3.795   1.00 22.22 ? 7   GLU A HG3  3  
ATOM 5127  N N    . LYS A 1 13  ? 6.925   -21.607 8.666   1.00 31.32 ? 8   LYS A N    3  
ATOM 5128  C CA   . LYS A 1 13  ? 7.516   -21.452 9.990   1.00 13.22 ? 8   LYS A CA   3  
ATOM 5129  C C    . LYS A 1 13  ? 8.875   -20.766 9.902   1.00 2.32  ? 8   LYS A C    3  
ATOM 5130  O O    . LYS A 1 13  ? 9.824   -21.318 9.345   1.00 24.41 ? 8   LYS A O    3  
ATOM 5131  C CB   . LYS A 1 13  ? 7.664   -22.817 10.666  1.00 51.52 ? 8   LYS A CB   3  
ATOM 5132  C CG   . LYS A 1 13  ? 6.434   -23.698 10.537  1.00 14.44 ? 8   LYS A CG   3  
ATOM 5133  C CD   . LYS A 1 13  ? 5.247   -23.112 11.282  1.00 23.32 ? 8   LYS A CD   3  
ATOM 5134  C CE   . LYS A 1 13  ? 5.197   -23.598 12.723  1.00 5.35  ? 8   LYS A CE   3  
ATOM 5135  N NZ   . LYS A 1 13  ? 4.196   -24.685 12.905  1.00 72.34 ? 8   LYS A NZ   3  
ATOM 5136  H H    . LYS A 1 13  ? 7.198   -22.364 8.106   1.00 20.43 ? 8   LYS A H    3  
ATOM 5137  H HA   . LYS A 1 13  ? 6.853   -20.838 10.580  1.00 1.32  ? 8   LYS A HA   3  
ATOM 5138  H HB3  . LYS A 1 13  ? 7.863   -22.665 11.717  1.00 33.31 ? 8   LYS A HB3  3  
ATOM 5139  H HG3  . LYS A 1 13  ? 6.657   -24.674 10.944  1.00 54.22 ? 8   LYS A HG3  3  
ATOM 5140  H HD3  . LYS A 1 13  ? 4.337   -23.406 10.780  1.00 21.34 ? 8   LYS A HD3  3  
ATOM 5141  H HE3  . LYS A 1 13  ? 4.935   -22.766 13.360  1.00 10.01 ? 8   LYS A HE3  3  
ATOM 5142  H HZ1  . LYS A 1 13  ? 4.433   -25.494 12.297  1.00 24.22 ? 8   LYS A HZ1  3  
ATOM 5143  H HZ2  . LYS A 1 13  ? 3.247   -24.342 12.655  1.00 13.32 ? 8   LYS A HZ2  3  
ATOM 5144  H HZ3  . LYS A 1 13  ? 4.190   -25.001 13.897  1.00 24.24 ? 8   LYS A HZ3  3  
ATOM 5145  N N    . GLN A 1 14  ? 8.961   -19.561 10.456  1.00 55.34 ? 9   GLN A N    3  
ATOM 5146  C CA   . GLN A 1 14  ? 10.205  -18.801 10.440  1.00 73.15 ? 9   GLN A CA   3  
ATOM 5147  C C    . GLN A 1 14  ? 10.401  -18.050 11.754  1.00 12.32 ? 9   GLN A C    3  
ATOM 5148  O O    . GLN A 1 14  ? 9.484   -17.396 12.248  1.00 22.23 ? 9   GLN A O    3  
ATOM 5149  C CB   . GLN A 1 14  ? 10.211  -17.816 9.270   1.00 72.23 ? 9   GLN A CB   3  
ATOM 5150  C CG   . GLN A 1 14  ? 11.338  -18.054 8.280   1.00 3.44  ? 9   GLN A CG   3  
ATOM 5151  C CD   . GLN A 1 14  ? 11.195  -19.368 7.537   1.00 60.42 ? 9   GLN A CD   3  
ATOM 5152  O OE1  . GLN A 1 14  ? 12.020  -20.270 7.682   1.00 42.31 ? 9   GLN A OE1  3  
ATOM 5153  N NE2  . GLN A 1 14  ? 10.142  -19.483 6.735   1.00 62.44 ? 9   GLN A NE2  3  
ATOM 5154  H H    . GLN A 1 14  ? 8.170   -19.175 10.886  1.00 12.41 ? 9   GLN A H    3  
ATOM 5155  H HA   . GLN A 1 14  ? 11.019  -19.500 10.315  1.00 62.41 ? 9   GLN A HA   3  
ATOM 5156  H HB3  . GLN A 1 14  ? 10.309  -16.813 9.660   1.00 70.25 ? 9   GLN A HB3  3  
ATOM 5157  H HG3  . GLN A 1 14  ? 12.276  -18.061 8.816   1.00 55.15 ? 9   GLN A HG3  3  
ATOM 5158  H HE21 . GLN A 1 14  ? 9.526   -18.723 6.670   1.00 5.34  ? 9   GLN A HE21 3  
ATOM 5159  H HE22 . GLN A 1 14  ? 10.024  -20.320 6.242   1.00 55.53 ? 9   GLN A HE22 3  
ATOM 5160  N N    . GLU A 1 15  ? 11.603  -18.151 12.314  1.00 3.43  ? 10  GLU A N    3  
ATOM 5161  C CA   . GLU A 1 15  ? 11.917  -17.482 13.571  1.00 4.32  ? 10  GLU A CA   3  
ATOM 5162  C C    . GLU A 1 15  ? 12.294  -16.023 13.331  1.00 23.25 ? 10  GLU A C    3  
ATOM 5163  O O    . GLU A 1 15  ? 13.158  -15.720 12.509  1.00 71.53 ? 10  GLU A O    3  
ATOM 5164  C CB   . GLU A 1 15  ? 13.062  -18.204 14.286  1.00 32.24 ? 10  GLU A CB   3  
ATOM 5165  C CG   . GLU A 1 15  ? 12.715  -19.619 14.713  1.00 12.54 ? 10  GLU A CG   3  
ATOM 5166  C CD   . GLU A 1 15  ? 13.032  -20.646 13.643  1.00 42.51 ? 10  GLU A CD   3  
ATOM 5167  O OE1  . GLU A 1 15  ? 14.231  -20.918 13.421  1.00 12.22 ? 10  GLU A OE1  3  
ATOM 5168  O OE2  . GLU A 1 15  ? 12.084  -21.177 13.028  1.00 34.13 ? 10  GLU A OE2  3  
ATOM 5169  H H    . GLU A 1 15  ? 12.293  -18.688 11.872  1.00 45.01 ? 10  GLU A H    3  
ATOM 5170  H HA   . GLU A 1 15  ? 11.037  -17.516 14.194  1.00 1.34  ? 10  GLU A HA   3  
ATOM 5171  H HB3  . GLU A 1 15  ? 13.331  -17.641 15.167  1.00 72.22 ? 10  GLU A HB3  3  
ATOM 5172  H HG3  . GLU A 1 15  ? 11.658  -19.667 14.934  1.00 22.12 ? 10  GLU A HG3  3  
ATOM 5173  N N    . GLY A 1 16  ? 11.637  -15.121 14.055  1.00 30.03 ? 11  GLY A N    3  
ATOM 5174  C CA   . GLY A 1 16  ? 11.915  -13.704 13.907  1.00 54.51 ? 11  GLY A CA   3  
ATOM 5175  C C    . GLY A 1 16  ? 10.656  -12.883 13.711  1.00 54.12 ? 11  GLY A C    3  
ATOM 5176  O O    . GLY A 1 16  ? 9.550   -13.361 13.963  1.00 52.10 ? 11  GLY A O    3  
ATOM 5177  H H    . GLY A 1 16  ? 10.958  -15.421 14.695  1.00 63.32 ? 11  GLY A H    3  
ATOM 5178  H HA2  . GLY A 1 16  ? 12.427  -13.355 14.791  1.00 41.53 ? 11  GLY A HA2  3  
ATOM 5179  H HA3  . GLY A 1 16  ? 12.559  -13.564 13.051  1.00 3.02  ? 11  GLY A HA3  3  
ATOM 5180  N N    . SER A 1 17  ? 10.824  -11.644 13.262  1.00 11.25 ? 12  SER A N    3  
ATOM 5181  C CA   . SER A 1 17  ? 9.691   -10.753 13.038  1.00 44.23 ? 12  SER A CA   3  
ATOM 5182  C C    . SER A 1 17  ? 10.068  -9.625  12.081  1.00 50.00 ? 12  SER A C    3  
ATOM 5183  O O    . SER A 1 17  ? 11.249  -9.368  11.841  1.00 15.41 ? 12  SER A O    3  
ATOM 5184  C CB   . SER A 1 17  ? 9.204   -10.170 14.365  1.00 62.34 ? 12  SER A CB   3  
ATOM 5185  O OG   . SER A 1 17  ? 9.320   -11.118 15.412  1.00 61.50 ? 12  SER A OG   3  
ATOM 5186  H H    . SER A 1 17  ? 11.731  -11.320 13.079  1.00 33.21 ? 12  SER A H    3  
ATOM 5187  H HA   . SER A 1 17  ? 8.895   -11.333 12.596  1.00 42.32 ? 12  SER A HA   3  
ATOM 5188  H HB3  . SER A 1 17  ? 8.168   -9.881  14.270  1.00 25.24 ? 12  SER A HB3  3  
ATOM 5189  H HG   . SER A 1 17  ? 8.707   -11.841 15.259  1.00 62.13 ? 12  SER A HG   3  
ATOM 5190  N N    . LEU A 1 18  ? 9.057   -8.957  11.539  1.00 65.35 ? 13  LEU A N    3  
ATOM 5191  C CA   . LEU A 1 18  ? 9.281   -7.855  10.608  1.00 32.44 ? 13  LEU A CA   3  
ATOM 5192  C C    . LEU A 1 18  ? 10.180  -8.290  9.456   1.00 43.21 ? 13  LEU A C    3  
ATOM 5193  O O    . LEU A 1 18  ? 11.306  -7.811  9.319   1.00 25.41 ? 13  LEU A O    3  
ATOM 5194  C CB   . LEU A 1 18  ? 9.906   -6.664  11.337  1.00 45.14 ? 13  LEU A CB   3  
ATOM 5195  C CG   . LEU A 1 18  ? 8.931   -5.722  12.044  1.00 41.02 ? 13  LEU A CG   3  
ATOM 5196  C CD1  . LEU A 1 18  ? 9.086   -5.828  13.553  1.00 23.13 ? 13  LEU A CD1  3  
ATOM 5197  C CD2  . LEU A 1 18  ? 9.146   -4.288  11.582  1.00 15.02 ? 13  LEU A CD2  3  
ATOM 5198  H H    . LEU A 1 18  ? 8.139   -9.206  11.768  1.00 75.10 ? 13  LEU A H    3  
ATOM 5199  H HA   . LEU A 1 18  ? 8.322   -7.559  10.208  1.00 54.55 ? 13  LEU A HA   3  
ATOM 5200  H HB3  . LEU A 1 18  ? 10.458  -6.086  10.609  1.00 61.23 ? 13  LEU A HB3  3  
ATOM 5201  H HG   . LEU A 1 18  ? 7.918   -6.008  11.792  1.00 73.23 ? 13  LEU A HG   3  
ATOM 5202  H HD11 . LEU A 1 18  ? 8.120   -5.723  14.022  1.00 63.35 ? 13  LEU A HD11 3  
ATOM 5203  H HD12 . LEU A 1 18  ? 9.744   -5.046  13.902  1.00 51.12 ? 13  LEU A HD12 3  
ATOM 5204  H HD13 . LEU A 1 18  ? 9.507   -6.791  13.805  1.00 3.05  ? 13  LEU A HD13 3  
ATOM 5205  H HD21 . LEU A 1 18  ? 8.348   -4.003  10.912  1.00 62.42 ? 13  LEU A HD21 3  
ATOM 5206  H HD22 . LEU A 1 18  ? 10.092  -4.213  11.067  1.00 74.31 ? 13  LEU A HD22 3  
ATOM 5207  H HD23 . LEU A 1 18  ? 9.148   -3.632  12.439  1.00 64.34 ? 13  LEU A HD23 3  
ATOM 5208  N N    . CYS A 1 19  ? 9.676   -9.199  8.630   1.00 4.25  ? 14  CYS A N    3  
ATOM 5209  C CA   . CYS A 1 19  ? 10.433  -9.699  7.486   1.00 73.42 ? 14  CYS A CA   3  
ATOM 5210  C C    . CYS A 1 19  ? 9.765   -9.299  6.175   1.00 52.00 ? 14  CYS A C    3  
ATOM 5211  O O    . CYS A 1 19  ? 8.550   -9.421  6.024   1.00 13.03 ? 14  CYS A O    3  
ATOM 5212  C CB   . CYS A 1 19  ? 10.567  -11.220 7.563   1.00 2.35  ? 14  CYS A CB   3  
ATOM 5213  S SG   . CYS A 1 19  ? 12.226  -11.835 7.189   1.00 2.33  ? 14  CYS A SG   3  
ATOM 5214  H H    . CYS A 1 19  ? 8.772   -9.544  8.791   1.00 43.01 ? 14  CYS A H    3  
ATOM 5215  H HA   . CYS A 1 19  ? 11.417  -9.257  7.525   1.00 3.40  ? 14  CYS A HA   3  
ATOM 5216  H HB3  . CYS A 1 19  ? 9.882   -11.670 6.859   1.00 73.32 ? 14  CYS A HB3  3  
ATOM 5217  H HG   . CYS A 1 19  ? 13.096  -10.899 7.534   1.00 25.21 ? 14  CYS A HG   3  
ATOM 5218  N N    . ALA A 1 20  ? 10.568  -8.820  5.230   1.00 54.20 ? 15  ALA A N    3  
ATOM 5219  C CA   . ALA A 1 20  ? 10.054  -8.404  3.931   1.00 61.45 ? 15  ALA A CA   3  
ATOM 5220  C C    . ALA A 1 20  ? 9.618   -9.606  3.102   1.00 23.43 ? 15  ALA A C    3  
ATOM 5221  O O    . ALA A 1 20  ? 8.527   -9.614  2.532   1.00 13.42 ? 15  ALA A O    3  
ATOM 5222  C CB   . ALA A 1 20  ? 11.106  -7.597  3.182   1.00 32.43 ? 15  ALA A CB   3  
ATOM 5223  H H    . ALA A 1 20  ? 11.528  -8.748  5.410   1.00 72.32 ? 15  ALA A H    3  
ATOM 5224  H HA   . ALA A 1 20  ? 9.199   -7.765  4.100   1.00 51.33 ? 15  ALA A HA   3  
ATOM 5225  H HB1  . ALA A 1 20  ? 11.067  -7.845  2.132   1.00 13.11 ? 15  ALA A HB1  3  
ATOM 5226  H HB2  . ALA A 1 20  ? 10.910  -6.543  3.311   1.00 33.32 ? 15  ALA A HB2  3  
ATOM 5227  H HB3  . ALA A 1 20  ? 12.084  -7.833  3.573   1.00 41.41 ? 15  ALA A HB3  3  
ATOM 5228  N N    . GLN A 1 21  ? 10.475  -10.618 3.038   1.00 40.55 ? 16  GLN A N    3  
ATOM 5229  C CA   . GLN A 1 21  ? 10.178  -11.826 2.276   1.00 22.10 ? 16  GLN A CA   3  
ATOM 5230  C C    . GLN A 1 21  ? 8.901   -12.488 2.783   1.00 33.44 ? 16  GLN A C    3  
ATOM 5231  O O    . GLN A 1 21  ? 8.113   -13.020 2.001   1.00 30.04 ? 16  GLN A O    3  
ATOM 5232  C CB   . GLN A 1 21  ? 11.345  -12.810 2.363   1.00 50.51 ? 16  GLN A CB   3  
ATOM 5233  C CG   . GLN A 1 21  ? 11.003  -14.206 1.867   1.00 4.02  ? 16  GLN A CG   3  
ATOM 5234  C CD   . GLN A 1 21  ? 10.898  -15.216 2.991   1.00 72.23 ? 16  GLN A CD   3  
ATOM 5235  O OE1  . GLN A 1 21  ? 10.693  -14.853 4.150   1.00 61.04 ? 16  GLN A OE1  3  
ATOM 5236  N NE2  . GLN A 1 21  ? 11.038  -16.493 2.657   1.00 4.51  ? 16  GLN A NE2  3  
ATOM 5237  H H    . GLN A 1 21  ? 11.330  -10.552 3.514   1.00 3.04  ? 16  GLN A H    3  
ATOM 5238  H HA   . GLN A 1 21  ? 10.035  -11.540 1.245   1.00 65.01 ? 16  GLN A HA   3  
ATOM 5239  H HB3  . GLN A 1 21  ? 11.661  -12.885 3.392   1.00 11.41 ? 16  GLN A HB3  3  
ATOM 5240  H HG3  . GLN A 1 21  ? 11.773  -14.529 1.181   1.00 74.20 ? 16  GLN A HG3  3  
ATOM 5241  H HE21 . GLN A 1 21  ? 11.200  -16.708 1.713   1.00 42.15 ? 16  GLN A HE21 3  
ATOM 5242  H HE22 . GLN A 1 21  ? 10.976  -17.167 3.364   1.00 44.42 ? 16  GLN A HE22 3  
ATOM 5243  N N    . HIS A 1 22  ? 8.703   -12.452 4.097   1.00 63.51 ? 17  HIS A N    3  
ATOM 5244  C CA   . HIS A 1 22  ? 7.521   -13.048 4.709   1.00 13.25 ? 17  HIS A CA   3  
ATOM 5245  C C    . HIS A 1 22  ? 6.251   -12.343 4.239   1.00 61.13 ? 17  HIS A C    3  
ATOM 5246  O O    . HIS A 1 22  ? 5.220   -12.981 4.020   1.00 60.44 ? 17  HIS A O    3  
ATOM 5247  C CB   . HIS A 1 22  ? 7.620   -12.982 6.233   1.00 42.24 ? 17  HIS A CB   3  
ATOM 5248  C CG   . HIS A 1 22  ? 6.712   -13.944 6.936   1.00 44.42 ? 17  HIS A CG   3  
ATOM 5249  N ND1  . HIS A 1 22  ? 7.153   -15.125 7.492   1.00 44.32 ? 17  HIS A ND1  3  
ATOM 5250  C CD2  . HIS A 1 22  ? 5.380   -13.893 7.171   1.00 20.00 ? 17  HIS A CD2  3  
ATOM 5251  C CE1  . HIS A 1 22  ? 6.132   -15.760 8.039   1.00 4.23  ? 17  HIS A CE1  3  
ATOM 5252  N NE2  . HIS A 1 22  ? 5.044   -15.033 7.858   1.00 51.51 ? 17  HIS A NE2  3  
ATOM 5253  H H    . HIS A 1 22  ? 9.367   -12.013 4.669   1.00 25.24 ? 17  HIS A H    3  
ATOM 5254  H HA   . HIS A 1 22  ? 7.476   -14.083 4.405   1.00 44.23 ? 17  HIS A HA   3  
ATOM 5255  H HB3  . HIS A 1 22  ? 7.366   -11.984 6.561   1.00 30.22 ? 17  HIS A HB3  3  
ATOM 5256  H HD1  . HIS A 1 22  ? 8.078   -15.450 7.486   1.00 13.23 ? 17  HIS A HD1  3  
ATOM 5257  H HD2  . HIS A 1 22  ? 4.706   -13.102 6.874   1.00 71.42 ? 17  HIS A HD2  3  
ATOM 5258  H HE1  . HIS A 1 22  ? 6.179   -16.712 8.547   1.00 24.34 ? 17  HIS A HE1  3  
ATOM 5259  N N    . CYS A 1 23  ? 6.334   -11.026 4.086   1.00 73.43 ? 18  CYS A N    3  
ATOM 5260  C CA   . CYS A 1 23  ? 5.192   -10.235 3.645   1.00 20.32 ? 18  CYS A CA   3  
ATOM 5261  C C    . CYS A 1 23  ? 4.875   -10.508 2.178   1.00 11.31 ? 18  CYS A C    3  
ATOM 5262  O O    . CYS A 1 23  ? 3.718   -10.708 1.808   1.00 14.55 ? 18  CYS A O    3  
ATOM 5263  C CB   . CYS A 1 23  ? 5.467   -8.744  3.850   1.00 63.10 ? 18  CYS A CB   3  
ATOM 5264  S SG   . CYS A 1 23  ? 4.318   -7.654  2.978   1.00 75.11 ? 18  CYS A SG   3  
ATOM 5265  H H    . CYS A 1 23  ? 7.182   -10.574 4.276   1.00 51.55 ? 18  CYS A H    3  
ATOM 5266  H HA   . CYS A 1 23  ? 4.340   -10.520 4.243   1.00 0.11  ? 18  CYS A HA   3  
ATOM 5267  H HB3  . CYS A 1 23  ? 6.464   -8.519  3.501   1.00 70.01 ? 18  CYS A HB3  3  
ATOM 5268  H HG   . CYS A 1 23  ? 4.998   -6.600  2.552   1.00 33.03 ? 18  CYS A HG   3  
ATOM 5269  N N    . LEU A 1 24  ? 5.911   -10.514 1.346   1.00 13.23 ? 19  LEU A N    3  
ATOM 5270  C CA   . LEU A 1 24  ? 5.744   -10.762 -0.082  1.00 12.14 ? 19  LEU A CA   3  
ATOM 5271  C C    . LEU A 1 24  ? 5.286   -12.196 -0.336  1.00 25.44 ? 19  LEU A C    3  
ATOM 5272  O O    . LEU A 1 24  ? 4.344   -12.431 -1.092  1.00 64.31 ? 19  LEU A O    3  
ATOM 5273  C CB   . LEU A 1 24  ? 7.055   -10.496 -0.822  1.00 43.31 ? 19  LEU A CB   3  
ATOM 5274  C CG   . LEU A 1 24  ? 7.315   -9.043  -1.224  1.00 52.42 ? 19  LEU A CG   3  
ATOM 5275  C CD1  . LEU A 1 24  ? 6.197   -8.527  -2.116  1.00 33.23 ? 19  LEU A CD1  3  
ATOM 5276  C CD2  . LEU A 1 24  ? 7.463   -8.167  0.011   1.00 25.31 ? 19  LEU A CD2  3  
ATOM 5277  H H    . LEU A 1 24  ? 6.809   -10.349 1.699   1.00 52.23 ? 19  LEU A H    3  
ATOM 5278  H HA   . LEU A 1 24  ? 4.988   -10.085 -0.450  1.00 72.10 ? 19  LEU A HA   3  
ATOM 5279  H HB3  . LEU A 1 24  ? 7.054   -11.094 -1.723  1.00 33.40 ? 19  LEU A HB3  3  
ATOM 5280  H HG   . LEU A 1 24  ? 8.239   -8.991  -1.784  1.00 13.42 ? 19  LEU A HG   3  
ATOM 5281  H HD11 . LEU A 1 24  ? 5.438   -9.288  -2.218  1.00 52.45 ? 19  LEU A HD11 3  
ATOM 5282  H HD12 . LEU A 1 24  ? 6.596   -8.283  -3.089  1.00 35.21 ? 19  LEU A HD12 3  
ATOM 5283  H HD13 . LEU A 1 24  ? 5.764   -7.642  -1.673  1.00 33.45 ? 19  LEU A HD13 3  
ATOM 5284  H HD21 . LEU A 1 24  ? 6.596   -8.286  0.642   1.00 32.34 ? 19  LEU A HD21 3  
ATOM 5285  H HD22 . LEU A 1 24  ? 7.550   -7.132  -0.290  1.00 11.01 ? 19  LEU A HD22 3  
ATOM 5286  H HD23 . LEU A 1 24  ? 8.348   -8.459  0.556   1.00 52.01 ? 19  LEU A HD23 3  
ATOM 5287  N N    . ASN A 1 25  ? 5.957   -13.147 0.303   1.00 10.41 ? 20  ASN A N    3  
ATOM 5288  C CA   . ASN A 1 25  ? 5.618   -14.557 0.147   1.00 11.45 ? 20  ASN A CA   3  
ATOM 5289  C C    . ASN A 1 25  ? 4.194   -14.830 0.622   1.00 11.22 ? 20  ASN A C    3  
ATOM 5290  O O    . ASN A 1 25  ? 3.434   -15.538 -0.038  1.00 33.32 ? 20  ASN A O    3  
ATOM 5291  C CB   . ASN A 1 25  ? 6.603   -15.430 0.928   1.00 0.21  ? 20  ASN A CB   3  
ATOM 5292  C CG   . ASN A 1 25  ? 7.899   -15.656 0.172   1.00 35.01 ? 20  ASN A CG   3  
ATOM 5293  O OD1  . ASN A 1 25  ? 8.416   -16.772 0.126   1.00 40.45 ? 20  ASN A OD1  3  
ATOM 5294  N ND2  . ASN A 1 25  ? 8.428   -14.595 -0.424  1.00 43.41 ? 20  ASN A ND2  3  
ATOM 5295  H H    . ASN A 1 25  ? 6.699   -12.897 0.892   1.00 34.31 ? 20  ASN A H    3  
ATOM 5296  H HA   . ASN A 1 25  ? 5.688   -14.801 -0.902  1.00 12.40 ? 20  ASN A HA   3  
ATOM 5297  H HB3  . ASN A 1 25  ? 6.149   -16.389 1.123   1.00 1.51  ? 20  ASN A HB3  3  
ATOM 5298  H HD21 . ASN A 1 25  ? 7.961   -13.738 -0.345  1.00 24.54 ? 20  ASN A HD21 3  
ATOM 5299  H HD22 . ASN A 1 25  ? 9.265   -14.714 -0.921  1.00 44.24 ? 20  ASN A HD22 3  
ATOM 5300  N N    . ASN A 1 26  ? 3.840   -14.261 1.770   1.00 34.12 ? 21  ASN A N    3  
ATOM 5301  C CA   . ASN A 1 26  ? 2.507   -14.443 2.334   1.00 24.33 ? 21  ASN A CA   3  
ATOM 5302  C C    . ASN A 1 26  ? 1.459   -13.716 1.497   1.00 23.33 ? 21  ASN A C    3  
ATOM 5303  O O    . ASN A 1 26  ? 0.374   -14.241 1.246   1.00 53.02 ? 21  ASN A O    3  
ATOM 5304  C CB   . ASN A 1 26  ? 2.467   -13.935 3.776   1.00 32.30 ? 21  ASN A CB   3  
ATOM 5305  C CG   . ASN A 1 26  ? 3.195   -14.857 4.735   1.00 4.23  ? 21  ASN A CG   3  
ATOM 5306  O OD1  . ASN A 1 26  ? 4.273   -15.365 4.426   1.00 54.24 ? 21  ASN A OD1  3  
ATOM 5307  N ND2  . ASN A 1 26  ? 2.607   -15.078 5.905   1.00 62.11 ? 21  ASN A ND2  3  
ATOM 5308  H H    . ASN A 1 26  ? 4.490   -13.708 2.251   1.00 3.41  ? 21  ASN A H    3  
ATOM 5309  H HA   . ASN A 1 26  ? 2.285   -15.500 2.327   1.00 71.12 ? 21  ASN A HA   3  
ATOM 5310  H HB3  . ASN A 1 26  ? 1.439   -13.853 4.094   1.00 60.35 ? 21  ASN A HB3  3  
ATOM 5311  H HD21 . ASN A 1 26  ? 1.748   -14.640 6.082   1.00 41.51 ? 21  ASN A HD21 3  
ATOM 5312  H HD22 . ASN A 1 26  ? 3.056   -15.670 6.544   1.00 20.23 ? 21  ASN A HD22 3  
ATOM 5313  N N    . LEU A 1 27  ? 1.791   -12.503 1.067   1.00 71.34 ? 22  LEU A N    3  
ATOM 5314  C CA   . LEU A 1 27  ? 0.879   -11.702 0.258   1.00 43.12 ? 22  LEU A CA   3  
ATOM 5315  C C    . LEU A 1 27  ? 0.534   -12.418 -1.045  1.00 55.33 ? 22  LEU A C    3  
ATOM 5316  O O    . LEU A 1 27  ? -0.609  -12.382 -1.502  1.00 53.43 ? 22  LEU A O    3  
ATOM 5317  C CB   . LEU A 1 27  ? 1.500   -10.337 -0.047  1.00 54.31 ? 22  LEU A CB   3  
ATOM 5318  C CG   . LEU A 1 27  ? 0.924   -9.591  -1.250  1.00 24.01 ? 22  LEU A CG   3  
ATOM 5319  C CD1  . LEU A 1 27  ? -0.591  -9.510  -1.152  1.00 32.33 ? 22  LEU A CD1  3  
ATOM 5320  C CD2  . LEU A 1 27  ? 1.529   -8.198  -1.353  1.00 12.43 ? 22  LEU A CD2  3  
ATOM 5321  H H    . LEU A 1 27  ? 2.670   -12.137 1.299   1.00 34.24 ? 22  LEU A H    3  
ATOM 5322  H HA   . LEU A 1 27  ? -0.027  -11.557 0.826   1.00 23.45 ? 22  LEU A HA   3  
ATOM 5323  H HB3  . LEU A 1 27  ? 2.556   -10.488 -0.224  1.00 12.54 ? 22  LEU A HB3  3  
ATOM 5324  H HG   . LEU A 1 27  ? 1.170   -10.132 -2.153  1.00 44.43 ? 22  LEU A HG   3  
ATOM 5325  H HD11 . LEU A 1 27  ? -0.910  -9.872  -0.186  1.00 50.45 ? 22  LEU A HD11 3  
ATOM 5326  H HD12 . LEU A 1 27  ? -1.036  -10.116 -1.928  1.00 64.42 ? 22  LEU A HD12 3  
ATOM 5327  H HD13 . LEU A 1 27  ? -0.906  -8.483  -1.273  1.00 54.34 ? 22  LEU A HD13 3  
ATOM 5328  H HD21 . LEU A 1 27  ? 1.483   -7.861  -2.378  1.00 15.43 ? 22  LEU A HD21 3  
ATOM 5329  H HD22 . LEU A 1 27  ? 2.559   -8.229  -1.031  1.00 40.23 ? 22  LEU A HD22 3  
ATOM 5330  H HD23 . LEU A 1 27  ? 0.974   -7.517  -0.725  1.00 0.20  ? 22  LEU A HD23 3  
ATOM 5331  N N    . LEU A 1 28  ? 1.530   -13.071 -1.635  1.00 25.34 ? 23  LEU A N    3  
ATOM 5332  C CA   . LEU A 1 28  ? 1.332   -13.797 -2.885  1.00 54.43 ? 23  LEU A CA   3  
ATOM 5333  C C    . LEU A 1 28  ? 0.676   -15.151 -2.628  1.00 24.32 ? 23  LEU A C    3  
ATOM 5334  O O    . LEU A 1 28  ? 0.393   -15.900 -3.563  1.00 33.21 ? 23  LEU A O    3  
ATOM 5335  C CB   . LEU A 1 28  ? 2.669   -13.994 -3.601  1.00 15.12 ? 23  LEU A CB   3  
ATOM 5336  C CG   . LEU A 1 28  ? 3.150   -12.822 -4.457  1.00 41.42 ? 23  LEU A CG   3  
ATOM 5337  C CD1  . LEU A 1 28  ? 4.611   -13.004 -4.838  1.00 61.30 ? 23  LEU A CD1  3  
ATOM 5338  C CD2  . LEU A 1 28  ? 2.286   -12.680 -5.702  1.00 55.13 ? 23  LEU A CD2  3  
ATOM 5339  H H    . LEU A 1 28  ? 2.419   -13.063 -1.224  1.00 73.42 ? 23  LEU A H    3  
ATOM 5340  H HA   . LEU A 1 28  ? 0.680   -13.208 -3.511  1.00 3.13  ? 23  LEU A HA   3  
ATOM 5341  H HB3  . LEU A 1 28  ? 2.576   -14.858 -4.243  1.00 21.12 ? 23  LEU A HB3  3  
ATOM 5342  H HG   . LEU A 1 28  ? 3.067   -11.909 -3.885  1.00 71.44 ? 23  LEU A HG   3  
ATOM 5343  H HD11 . LEU A 1 28  ? 4.871   -12.301 -5.615  1.00 32.23 ? 23  LEU A HD11 3  
ATOM 5344  H HD12 . LEU A 1 28  ? 4.767   -14.011 -5.196  1.00 20.24 ? 23  LEU A HD12 3  
ATOM 5345  H HD13 . LEU A 1 28  ? 5.233   -12.830 -3.973  1.00 62.11 ? 23  LEU A HD13 3  
ATOM 5346  H HD21 . LEU A 1 28  ? 1.616   -11.841 -5.579  1.00 12.43 ? 23  LEU A HD21 3  
ATOM 5347  H HD22 . LEU A 1 28  ? 1.710   -13.583 -5.844  1.00 52.33 ? 23  LEU A HD22 3  
ATOM 5348  H HD23 . LEU A 1 28  ? 2.917   -12.515 -6.561  1.00 63.14 ? 23  LEU A HD23 3  
ATOM 5349  N N    . GLN A 1 29  ? 0.437   -15.455 -1.357  1.00 15.25 ? 24  GLN A N    3  
ATOM 5350  C CA   . GLN A 1 29  ? -0.188  -16.718 -0.979  1.00 71.10 ? 24  GLN A CA   3  
ATOM 5351  C C    . GLN A 1 29  ? 0.676   -17.901 -1.404  1.00 2.13  ? 24  GLN A C    3  
ATOM 5352  O O    . GLN A 1 29  ? 0.163   -18.957 -1.769  1.00 35.52 ? 24  GLN A O    3  
ATOM 5353  C CB   . GLN A 1 29  ? -1.577  -16.833 -1.609  1.00 75.20 ? 24  GLN A CB   3  
ATOM 5354  C CG   . GLN A 1 29  ? -2.659  -17.247 -0.624  1.00 43.31 ? 24  GLN A CG   3  
ATOM 5355  C CD   . GLN A 1 29  ? -4.042  -17.250 -1.244  1.00 11.11 ? 24  GLN A CD   3  
ATOM 5356  O OE1  . GLN A 1 29  ? -4.557  -18.298 -1.636  1.00 15.41 ? 24  GLN A OE1  3  
ATOM 5357  N NE2  . GLN A 1 29  ? -4.653  -16.075 -1.336  1.00 61.34 ? 24  GLN A NE2  3  
ATOM 5358  H H    . GLN A 1 29  ? 0.685   -14.817 -0.658  1.00 52.24 ? 24  GLN A H    3  
ATOM 5359  H HA   . GLN A 1 29  ? -0.287  -16.729 0.096   1.00 21.53 ? 24  GLN A HA   3  
ATOM 5360  H HB3  . GLN A 1 29  ? -1.541  -17.567 -2.400  1.00 63.21 ? 24  GLN A HB3  3  
ATOM 5361  H HG3  . GLN A 1 29  ? -2.654  -16.558 0.207   1.00 22.32 ? 24  GLN A HG3  3  
ATOM 5362  H HE21 . GLN A 1 29  ? -4.182  -15.282 -1.003  1.00 5.21  ? 24  GLN A HE21 3  
ATOM 5363  H HE22 . GLN A 1 29  ? -5.547  -16.049 -1.733  1.00 64.42 ? 24  GLN A HE22 3  
ATOM 5364  N N    . GLY A 1 30  ? 1.991   -17.715 -1.355  1.00 40.13 ? 25  GLY A N    3  
ATOM 5365  C CA   . GLY A 1 30  ? 2.906   -18.776 -1.738  1.00 30.34 ? 25  GLY A CA   3  
ATOM 5366  C C    . GLY A 1 30  ? 4.335   -18.289 -1.868  1.00 53.44 ? 25  GLY A C    3  
ATOM 5367  O O    . GLY A 1 30  ? 4.576   -17.146 -2.253  1.00 2.22  ? 25  GLY A O    3  
ATOM 5368  H H    . GLY A 1 30  ? 2.344   -16.851 -1.055  1.00 43.40 ? 25  GLY A H    3  
ATOM 5369  H HA2  . GLY A 1 30  ? 2.868   -19.556 -0.992  1.00 32.52 ? 25  GLY A HA2  3  
ATOM 5370  H HA3  . GLY A 1 30  ? 2.589   -19.182 -2.687  1.00 35.13 ? 25  GLY A HA3  3  
ATOM 5371  N N    . GLU A 1 31  ? 5.286   -19.160 -1.545  1.00 74.20 ? 26  GLU A N    3  
ATOM 5372  C CA   . GLU A 1 31  ? 6.700   -18.812 -1.625  1.00 21.53 ? 26  GLU A CA   3  
ATOM 5373  C C    . GLU A 1 31  ? 7.143   -18.670 -3.078  1.00 52.51 ? 26  GLU A C    3  
ATOM 5374  O O    . GLU A 1 31  ? 7.609   -19.631 -3.693  1.00 70.43 ? 26  GLU A O    3  
ATOM 5375  C CB   . GLU A 1 31  ? 7.550   -19.871 -0.921  1.00 53.52 ? 26  GLU A CB   3  
ATOM 5376  C CG   . GLU A 1 31  ? 7.239   -21.293 -1.362  1.00 63.22 ? 26  GLU A CG   3  
ATOM 5377  C CD   . GLU A 1 31  ? 8.460   -22.019 -1.890  1.00 0.45  ? 26  GLU A CD   3  
ATOM 5378  O OE1  . GLU A 1 31  ? 9.533   -21.916 -1.260  1.00 35.31 ? 26  GLU A OE1  3  
ATOM 5379  O OE2  . GLU A 1 31  ? 8.342   -22.693 -2.936  1.00 70.54 ? 26  GLU A OE2  3  
ATOM 5380  H H    . GLU A 1 31  ? 5.031   -20.058 -1.244  1.00 60.33 ? 26  GLU A H    3  
ATOM 5381  H HA   . GLU A 1 31  ? 6.837   -17.865 -1.126  1.00 74.43 ? 26  GLU A HA   3  
ATOM 5382  H HB3  . GLU A 1 31  ? 7.382   -19.803 0.143   1.00 22.54 ? 26  GLU A HB3  3  
ATOM 5383  H HG3  . GLU A 1 31  ? 6.492   -21.258 -2.141  1.00 54.42 ? 26  GLU A HG3  3  
ATOM 5384  N N    . TYR A 1 32  ? 6.994   -17.468 -3.621  1.00 65.10 ? 27  TYR A N    3  
ATOM 5385  C CA   . TYR A 1 32  ? 7.376   -17.200 -5.002  1.00 3.43  ? 27  TYR A CA   3  
ATOM 5386  C C    . TYR A 1 32  ? 8.726   -16.492 -5.067  1.00 25.12 ? 27  TYR A C    3  
ATOM 5387  O O    . TYR A 1 32  ? 9.425   -16.555 -6.079  1.00 25.41 ? 27  TYR A O    3  
ATOM 5388  C CB   . TYR A 1 32  ? 6.308   -16.351 -5.694  1.00 41.15 ? 27  TYR A CB   3  
ATOM 5389  C CG   . TYR A 1 32  ? 5.101   -17.142 -6.142  1.00 14.22 ? 27  TYR A CG   3  
ATOM 5390  C CD1  . TYR A 1 32  ? 5.105   -17.828 -7.351  1.00 24.24 ? 27  TYR A CD1  3  
ATOM 5391  C CD2  . TYR A 1 32  ? 3.957   -17.207 -5.356  1.00 21.22 ? 27  TYR A CD2  3  
ATOM 5392  C CE1  . TYR A 1 32  ? 4.004   -18.553 -7.765  1.00 23.11 ? 27  TYR A CE1  3  
ATOM 5393  C CE2  . TYR A 1 32  ? 2.852   -17.930 -5.762  1.00 20.34 ? 27  TYR A CE2  3  
ATOM 5394  C CZ   . TYR A 1 32  ? 2.880   -18.600 -6.967  1.00 72.11 ? 27  TYR A CZ   3  
ATOM 5395  O OH   . TYR A 1 32  ? 1.782   -19.322 -7.375  1.00 12.24 ? 27  TYR A OH   3  
ATOM 5396  H H    . TYR A 1 32  ? 6.618   -16.742 -3.081  1.00 11.15 ? 27  TYR A H    3  
ATOM 5397  H HA   . TYR A 1 32  ? 7.455   -18.148 -5.515  1.00 74.32 ? 27  TYR A HA   3  
ATOM 5398  H HB3  . TYR A 1 32  ? 6.740   -15.881 -6.566  1.00 30.21 ? 27  TYR A HB3  3  
ATOM 5399  H HD1  . TYR A 1 32  ? 5.987   -17.789 -7.973  1.00 24.22 ? 27  TYR A HD1  3  
ATOM 5400  H HD2  . TYR A 1 32  ? 3.938   -16.681 -4.413  1.00 20.24 ? 27  TYR A HD2  3  
ATOM 5401  H HE1  . TYR A 1 32  ? 4.026   -19.078 -8.709  1.00 73.04 ? 27  TYR A HE1  3  
ATOM 5402  H HE2  . TYR A 1 32  ? 1.971   -17.968 -5.138  1.00 75.23 ? 27  TYR A HE2  3  
ATOM 5403  H HH   . TYR A 1 32  ? 1.530   -19.940 -6.684  1.00 62.11 ? 27  TYR A HH   3  
ATOM 5404  N N    . PHE A 1 33  ? 9.087   -15.818 -3.980  1.00 14.22 ? 28  PHE A N    3  
ATOM 5405  C CA   . PHE A 1 33  ? 10.352  -15.098 -3.912  1.00 51.24 ? 28  PHE A CA   3  
ATOM 5406  C C    . PHE A 1 33  ? 11.202  -15.599 -2.747  1.00 12.24 ? 28  PHE A C    3  
ATOM 5407  O O    . PHE A 1 33  ? 10.677  -16.107 -1.756  1.00 72.04 ? 28  PHE A O    3  
ATOM 5408  C CB   . PHE A 1 33  ? 10.100  -13.596 -3.764  1.00 61.14 ? 28  PHE A CB   3  
ATOM 5409  C CG   . PHE A 1 33  ? 10.047  -12.865 -5.076  1.00 33.14 ? 28  PHE A CG   3  
ATOM 5410  C CD1  . PHE A 1 33  ? 9.189   -13.282 -6.081  1.00 52.12 ? 28  PHE A CD1  3  
ATOM 5411  C CD2  . PHE A 1 33  ? 10.854  -11.763 -5.304  1.00 33.42 ? 28  PHE A CD2  3  
ATOM 5412  C CE1  . PHE A 1 33  ? 9.136   -12.613 -7.289  1.00 41.04 ? 28  PHE A CE1  3  
ATOM 5413  C CE2  . PHE A 1 33  ? 10.805  -11.088 -6.509  1.00 52.14 ? 28  PHE A CE2  3  
ATOM 5414  C CZ   . PHE A 1 33  ? 9.947   -11.515 -7.503  1.00 21.21 ? 28  PHE A CZ   3  
ATOM 5415  H H    . PHE A 1 33  ? 8.487   -15.806 -3.204  1.00 22.14 ? 28  PHE A H    3  
ATOM 5416  H HA   . PHE A 1 33  ? 10.884  -15.276 -4.833  1.00 62.01 ? 28  PHE A HA   3  
ATOM 5417  H HB3  . PHE A 1 33  ? 10.893  -13.162 -3.173  1.00 23.30 ? 28  PHE A HB3  3  
ATOM 5418  H HD1  . PHE A 1 33  ? 8.555   -14.142 -5.915  1.00 71.33 ? 28  PHE A HD1  3  
ATOM 5419  H HD2  . PHE A 1 33  ? 11.526  -11.428 -4.527  1.00 52.34 ? 28  PHE A HD2  3  
ATOM 5420  H HE1  . PHE A 1 33  ? 8.464   -12.949 -8.065  1.00 71.42 ? 28  PHE A HE1  3  
ATOM 5421  H HE2  . PHE A 1 33  ? 11.440  -10.230 -6.674  1.00 72.11 ? 28  PHE A HE2  3  
ATOM 5422  H HZ   . PHE A 1 33  ? 9.907   -10.990 -8.446  1.00 60.34 ? 28  PHE A HZ   3  
ATOM 5423  N N    . SER A 1 34  ? 12.516  -15.453 -2.875  1.00 65.24 ? 29  SER A N    3  
ATOM 5424  C CA   . SER A 1 34  ? 13.439  -15.894 -1.837  1.00 54.12 ? 29  SER A CA   3  
ATOM 5425  C C    . SER A 1 34  ? 13.886  -14.719 -0.972  1.00 53.34 ? 29  SER A C    3  
ATOM 5426  O O    . SER A 1 34  ? 13.930  -13.571 -1.414  1.00 30.13 ? 29  SER A O    3  
ATOM 5427  C CB   . SER A 1 34  ? 14.658  -16.574 -2.463  1.00 44.32 ? 29  SER A CB   3  
ATOM 5428  O OG   . SER A 1 34  ? 14.582  -17.982 -2.330  1.00 73.52 ? 29  SER A OG   3  
ATOM 5429  H H    . SER A 1 34  ? 12.874  -15.040 -3.690  1.00 51.21 ? 29  SER A H    3  
ATOM 5430  H HA   . SER A 1 34  ? 12.922  -16.608 -1.214  1.00 31.54 ? 29  SER A HA   3  
ATOM 5431  H HB3  . SER A 1 34  ? 15.555  -16.225 -1.971  1.00 70.54 ? 29  SER A HB3  3  
ATOM 5432  H HG   . SER A 1 34  ? 13.709  -18.282 -2.592  1.00 74.52 ? 29  SER A HG   3  
ATOM 5433  N N    . PRO A 1 35  ? 14.227  -15.012 0.292   1.00 33.01 ? 30  PRO A N    3  
ATOM 5434  C CA   . PRO A 1 35  ? 14.677  -13.994 1.247   1.00 24.14 ? 30  PRO A CA   3  
ATOM 5435  C C    . PRO A 1 35  ? 16.056  -13.443 0.899   1.00 34.11 ? 30  PRO A C    3  
ATOM 5436  O O    . PRO A 1 35  ? 16.311  -12.247 1.038   1.00 72.14 ? 30  PRO A O    3  
ATOM 5437  C CB   . PRO A 1 35  ? 14.723  -14.751 2.576   1.00 70.52 ? 30  PRO A CB   3  
ATOM 5438  C CG   . PRO A 1 35  ? 14.920  -16.178 2.194   1.00 24.40 ? 30  PRO A CG   3  
ATOM 5439  C CD   . PRO A 1 35  ? 14.199  -16.359 0.887   1.00 1.22  ? 30  PRO A CD   3  
ATOM 5440  H HA   . PRO A 1 35  ? 13.972  -13.178 1.318   1.00 52.14 ? 30  PRO A HA   3  
ATOM 5441  H HB3  . PRO A 1 35  ? 13.794  -14.609 3.108   1.00 45.22 ? 30  PRO A HB3  3  
ATOM 5442  H HG3  . PRO A 1 35  ? 14.493  -16.821 2.949   1.00 44.23 ? 30  PRO A HG3  3  
ATOM 5443  H HD3  . PRO A 1 35  ? 13.183  -16.683 1.058   1.00 0.15  ? 30  PRO A HD3  3  
ATOM 5444  N N    . VAL A 1 36  ? 16.943  -14.324 0.445   1.00 64.12 ? 31  VAL A N    3  
ATOM 5445  C CA   . VAL A 1 36  ? 18.296  -13.925 0.077   1.00 4.24  ? 31  VAL A CA   3  
ATOM 5446  C C    . VAL A 1 36  ? 18.289  -13.044 -1.168  1.00 65.23 ? 31  VAL A C    3  
ATOM 5447  O O    . VAL A 1 36  ? 18.988  -12.032 -1.227  1.00 11.34 ? 31  VAL A O    3  
ATOM 5448  C CB   . VAL A 1 36  ? 19.191  -15.151 -0.181  1.00 44.40 ? 31  VAL A CB   3  
ATOM 5449  C CG1  . VAL A 1 36  ? 18.586  -16.038 -1.258  1.00 22.34 ? 31  VAL A CG1  3  
ATOM 5450  C CG2  . VAL A 1 36  ? 20.596  -14.713 -0.569  1.00 62.45 ? 31  VAL A CG2  3  
ATOM 5451  H H    . VAL A 1 36  ? 16.681  -15.264 0.357   1.00 5.15  ? 31  VAL A H    3  
ATOM 5452  H HA   . VAL A 1 36  ? 18.716  -13.365 0.899   1.00 34.44 ? 31  VAL A HA   3  
ATOM 5453  H HB   . VAL A 1 36  ? 19.254  -15.723 0.731   1.00 54.54 ? 31  VAL A HB   3  
ATOM 5454  H HG11 . VAL A 1 36  ? 18.966  -15.741 -2.225  1.00 51.40 ? 31  VAL A HG11 3  
ATOM 5455  H HG12 . VAL A 1 36  ? 18.849  -17.068 -1.067  1.00 61.42 ? 31  VAL A HG12 3  
ATOM 5456  H HG13 . VAL A 1 36  ? 17.511  -15.933 -1.248  1.00 1.43  ? 31  VAL A HG13 3  
ATOM 5457  H HG21 . VAL A 1 36  ? 21.016  -14.113 0.226   1.00 45.31 ? 31  VAL A HG21 3  
ATOM 5458  H HG22 . VAL A 1 36  ? 21.215  -15.583 -0.728  1.00 12.23 ? 31  VAL A HG22 3  
ATOM 5459  H HG23 . VAL A 1 36  ? 20.554  -14.130 -1.476  1.00 5.33  ? 31  VAL A HG23 3  
ATOM 5460  N N    . GLU A 1 37  ? 17.494  -13.435 -2.159  1.00 42.20 ? 32  GLU A N    3  
ATOM 5461  C CA   . GLU A 1 37  ? 17.397  -12.679 -3.403  1.00 72.10 ? 32  GLU A CA   3  
ATOM 5462  C C    . GLU A 1 37  ? 16.813  -11.292 -3.152  1.00 61.35 ? 32  GLU A C    3  
ATOM 5463  O O    . GLU A 1 37  ? 17.351  -10.287 -3.617  1.00 25.32 ? 32  GLU A O    3  
ATOM 5464  C CB   . GLU A 1 37  ? 16.533  -13.432 -4.417  1.00 74.33 ? 32  GLU A CB   3  
ATOM 5465  C CG   . GLU A 1 37  ? 17.067  -13.369 -5.837  1.00 24.31 ? 32  GLU A CG   3  
ATOM 5466  C CD   . GLU A 1 37  ? 16.588  -14.525 -6.693  1.00 44.31 ? 32  GLU A CD   3  
ATOM 5467  O OE1  . GLU A 1 37  ? 15.875  -15.401 -6.160  1.00 0.11  ? 32  GLU A OE1  3  
ATOM 5468  O OE2  . GLU A 1 37  ? 16.926  -14.555 -7.895  1.00 60.42 ? 32  GLU A OE2  3  
ATOM 5469  H H    . GLU A 1 37  ? 16.961  -14.249 -2.052  1.00 55.33 ? 32  GLU A H    3  
ATOM 5470  H HA   . GLU A 1 37  ? 18.393  -12.570 -3.803  1.00 30.31 ? 32  GLU A HA   3  
ATOM 5471  H HB3  . GLU A 1 37  ? 15.539  -13.009 -4.409  1.00 31.20 ? 32  GLU A HB3  3  
ATOM 5472  H HG3  . GLU A 1 37  ? 18.147  -13.388 -5.804  1.00 63.42 ? 32  GLU A HG3  3  
ATOM 5473  N N    . LEU A 1 38  ? 15.709  -11.245 -2.414  1.00 1.43  ? 33  LEU A N    3  
ATOM 5474  C CA   . LEU A 1 38  ? 15.050  -9.982  -2.101  1.00 44.53 ? 33  LEU A CA   3  
ATOM 5475  C C    . LEU A 1 38  ? 15.940  -9.106  -1.224  1.00 53.43 ? 33  LEU A C    3  
ATOM 5476  O O    . LEU A 1 38  ? 15.940  -7.882  -1.348  1.00 5.21  ? 33  LEU A O    3  
ATOM 5477  C CB   . LEU A 1 38  ? 13.716  -10.239 -1.399  1.00 2.31  ? 33  LEU A CB   3  
ATOM 5478  C CG   . LEU A 1 38  ? 12.509  -10.458 -2.311  1.00 53.21 ? 33  LEU A CG   3  
ATOM 5479  C CD1  . LEU A 1 38  ? 11.241  -10.625 -1.487  1.00 61.10 ? 33  LEU A CD1  3  
ATOM 5480  C CD2  . LEU A 1 38  ? 12.363  -9.303  -3.290  1.00 63.30 ? 33  LEU A CD2  3  
ATOM 5481  H H    . LEU A 1 38  ? 15.327  -12.080 -2.072  1.00 63.25 ? 33  LEU A H    3  
ATOM 5482  H HA   . LEU A 1 38  ? 14.864  -9.466  -3.032  1.00 51.22 ? 33  LEU A HA   3  
ATOM 5483  H HB3  . LEU A 1 38  ? 13.505  -9.387  -0.768  1.00 54.54 ? 33  LEU A HB3  3  
ATOM 5484  H HG   . LEU A 1 38  ? 12.657  -11.365 -2.882  1.00 62.23 ? 33  LEU A HG   3  
ATOM 5485  H HD11 . LEU A 1 38  ? 11.430  -11.305 -0.671  1.00 72.23 ? 33  LEU A HD11 3  
ATOM 5486  H HD12 . LEU A 1 38  ? 10.456  -11.022 -2.113  1.00 13.33 ? 33  LEU A HD12 3  
ATOM 5487  H HD13 . LEU A 1 38  ? 10.938  -9.665  -1.095  1.00 4.33  ? 33  LEU A HD13 3  
ATOM 5488  H HD21 . LEU A 1 38  ? 12.928  -9.516  -4.185  1.00 41.02 ? 33  LEU A HD21 3  
ATOM 5489  H HD22 . LEU A 1 38  ? 12.737  -8.397  -2.835  1.00 61.14 ? 33  LEU A HD22 3  
ATOM 5490  H HD23 . LEU A 1 38  ? 11.322  -9.175  -3.543  1.00 32.54 ? 33  LEU A HD23 3  
ATOM 5491  N N    . SER A 1 39  ? 16.697  -9.744  -0.337  1.00 52.15 ? 34  SER A N    3  
ATOM 5492  C CA   . SER A 1 39  ? 17.591  -9.024  0.563   1.00 0.14  ? 34  SER A CA   3  
ATOM 5493  C C    . SER A 1 39  ? 18.696  -8.319  -0.218  1.00 52.51 ? 34  SER A C    3  
ATOM 5494  O O    . SER A 1 39  ? 19.028  -7.166  0.058   1.00 22.30 ? 34  SER A O    3  
ATOM 5495  C CB   . SER A 1 39  ? 18.205  -9.985  1.583   1.00 61.22 ? 34  SER A CB   3  
ATOM 5496  O OG   . SER A 1 39  ? 19.257  -9.363  2.300   1.00 45.53 ? 34  SER A OG   3  
ATOM 5497  H H    . SER A 1 39  ? 16.652  -10.722 -0.285  1.00 44.24 ? 34  SER A H    3  
ATOM 5498  H HA   . SER A 1 39  ? 17.007  -8.282  1.086   1.00 60.42 ? 34  SER A HA   3  
ATOM 5499  H HB3  . SER A 1 39  ? 18.597  -10.850 1.068   1.00 72.30 ? 34  SER A HB3  3  
ATOM 5500  H HG   . SER A 1 39  ? 20.081  -9.472  1.818   1.00 1.50  ? 34  SER A HG   3  
ATOM 5501  N N    . SER A 1 40  ? 19.262  -9.021  -1.193  1.00 43.50 ? 35  SER A N    3  
ATOM 5502  C CA   . SER A 1 40  ? 20.333  -8.466  -2.013  1.00 72.12 ? 35  SER A CA   3  
ATOM 5503  C C    . SER A 1 40  ? 19.805  -7.358  -2.919  1.00 24.42 ? 35  SER A C    3  
ATOM 5504  O O    . SER A 1 40  ? 20.490  -6.365  -3.169  1.00 13.13 ? 35  SER A O    3  
ATOM 5505  C CB   . SER A 1 40  ? 20.982  -9.565  -2.857  1.00 35.25 ? 35  SER A CB   3  
ATOM 5506  O OG   . SER A 1 40  ? 21.838  -10.374 -2.069  1.00 5.14  ? 35  SER A OG   3  
ATOM 5507  H H    . SER A 1 40  ? 18.955  -9.936  -1.365  1.00 62.30 ? 35  SER A H    3  
ATOM 5508  H HA   . SER A 1 40  ? 21.076  -8.048  -1.349  1.00 2.55  ? 35  SER A HA   3  
ATOM 5509  H HB3  . SER A 1 40  ? 21.561  -9.112  -3.649  1.00 34.24 ? 35  SER A HB3  3  
ATOM 5510  H HG   . SER A 1 40  ? 22.693  -10.449 -2.500  1.00 71.22 ? 35  SER A HG   3  
ATOM 5511  N N    . ILE A 1 41  ? 18.582  -7.536  -3.408  1.00 3.21  ? 36  ILE A N    3  
ATOM 5512  C CA   . ILE A 1 41  ? 17.961  -6.551  -4.287  1.00 55.01 ? 36  ILE A CA   3  
ATOM 5513  C C    . ILE A 1 41  ? 17.713  -5.239  -3.552  1.00 65.42 ? 36  ILE A C    3  
ATOM 5514  O O    . ILE A 1 41  ? 18.034  -4.163  -4.056  1.00 31.42 ? 36  ILE A O    3  
ATOM 5515  C CB   . ILE A 1 41  ? 16.626  -7.068  -4.856  1.00 41.25 ? 36  ILE A CB   3  
ATOM 5516  C CG1  . ILE A 1 41  ? 16.863  -8.302  -5.729  1.00 4.31  ? 36  ILE A CG1  3  
ATOM 5517  C CG2  . ILE A 1 41  ? 15.931  -5.973  -5.651  1.00 1.44  ? 36  ILE A CG2  3  
ATOM 5518  C CD1  . ILE A 1 41  ? 15.691  -9.257  -5.756  1.00 50.14 ? 36  ILE A CD1  3  
ATOM 5519  H H    . ILE A 1 41  ? 18.087  -8.347  -3.173  1.00 12.42 ? 36  ILE A H    3  
ATOM 5520  H HA   . ILE A 1 41  ? 18.635  -6.368  -5.111  1.00 1.34  ? 36  ILE A HA   3  
ATOM 5521  H HB   . ILE A 1 41  ? 15.989  -7.339  -4.028  1.00 64.51 ? 36  ILE A HB   3  
ATOM 5522  H HG13 . ILE A 1 41  ? 17.722  -8.839  -5.355  1.00 61.23 ? 36  ILE A HG13 3  
ATOM 5523  H HG21 . ILE A 1 41  ? 15.374  -5.339  -4.979  1.00 24.03 ? 36  ILE A HG21 3  
ATOM 5524  H HG22 . ILE A 1 41  ? 16.670  -5.384  -6.172  1.00 3.53  ? 36  ILE A HG22 3  
ATOM 5525  H HG23 . ILE A 1 41  ? 15.257  -6.421  -6.366  1.00 32.12 ? 36  ILE A HG23 3  
ATOM 5526  H HD11 . ILE A 1 41  ? 15.236  -9.242  -6.736  1.00 75.52 ? 36  ILE A HD11 3  
ATOM 5527  H HD12 . ILE A 1 41  ? 16.034  -10.256 -5.533  1.00 72.23 ? 36  ILE A HD12 3  
ATOM 5528  H HD13 . ILE A 1 41  ? 14.962  -8.953  -5.017  1.00 1.32  ? 36  ILE A HD13 3  
ATOM 5529  N N    . ALA A 1 42  ? 17.142  -5.335  -2.355  1.00 4.12  ? 37  ALA A N    3  
ATOM 5530  C CA   . ALA A 1 42  ? 16.854  -4.155  -1.549  1.00 61.34 ? 37  ALA A CA   3  
ATOM 5531  C C    . ALA A 1 42  ? 18.140  -3.450  -1.130  1.00 42.24 ? 37  ALA A C    3  
ATOM 5532  O O    . ALA A 1 42  ? 18.239  -2.225  -1.199  1.00 71.32 ? 37  ALA A O    3  
ATOM 5533  C CB   . ALA A 1 42  ? 16.037  -4.539  -0.325  1.00 43.12 ? 37  ALA A CB   3  
ATOM 5534  H H    . ALA A 1 42  ? 16.910  -6.220  -2.007  1.00 12.13 ? 37  ALA A H    3  
ATOM 5535  H HA   . ALA A 1 42  ? 16.263  -3.477  -2.148  1.00 50.12 ? 37  ALA A HA   3  
ATOM 5536  H HB1  . ALA A 1 42  ? 15.239  -5.204  -0.620  1.00 54.32 ? 37  ALA A HB1  3  
ATOM 5537  H HB2  . ALA A 1 42  ? 16.674  -5.036  0.392   1.00 2.31  ? 37  ALA A HB2  3  
ATOM 5538  H HB3  . ALA A 1 42  ? 15.618  -3.650  0.122   1.00 23.32 ? 37  ALA A HB3  3  
ATOM 5539  N N    . HIS A 1 43  ? 19.124  -4.232  -0.694  1.00 33.05 ? 38  HIS A N    3  
ATOM 5540  C CA   . HIS A 1 43  ? 20.403  -3.682  -0.263  1.00 44.22 ? 38  HIS A CA   3  
ATOM 5541  C C    . HIS A 1 43  ? 21.179  -3.117  -1.449  1.00 14.34 ? 38  HIS A C    3  
ATOM 5542  O O    . HIS A 1 43  ? 21.928  -2.150  -1.309  1.00 75.20 ? 38  HIS A O    3  
ATOM 5543  C CB   . HIS A 1 43  ? 21.234  -4.758  0.438   1.00 70.43 ? 38  HIS A CB   3  
ATOM 5544  C CG   . HIS A 1 43  ? 22.247  -4.204  1.394   1.00 25.12 ? 38  HIS A CG   3  
ATOM 5545  N ND1  . HIS A 1 43  ? 23.551  -3.935  1.035   1.00 74.11 ? 38  HIS A ND1  3  
ATOM 5546  C CD2  . HIS A 1 43  ? 22.140  -3.866  2.700   1.00 4.43  ? 38  HIS A CD2  3  
ATOM 5547  C CE1  . HIS A 1 43  ? 24.203  -3.458  2.080   1.00 71.01 ? 38  HIS A CE1  3  
ATOM 5548  N NE2  . HIS A 1 43  ? 23.369  -3.405  3.103   1.00 54.33 ? 38  HIS A NE2  3  
ATOM 5549  H H    . HIS A 1 43  ? 18.984  -5.201  -0.663  1.00 73.04 ? 38  HIS A H    3  
ATOM 5550  H HA   . HIS A 1 43  ? 20.203  -2.882  0.433   1.00 54.33 ? 38  HIS A HA   3  
ATOM 5551  H HB3  . HIS A 1 43  ? 21.760  -5.339  -0.304  1.00 2.35  ? 38  HIS A HB3  3  
ATOM 5552  H HD1  . HIS A 1 43  ? 23.941  -4.076  0.147   1.00 32.24 ? 38  HIS A HD1  3  
ATOM 5553  H HD2  . HIS A 1 43  ? 21.253  -3.944  3.312   1.00 72.22 ? 38  HIS A HD2  3  
ATOM 5554  H HE1  . HIS A 1 43  ? 25.241  -3.161  2.096   1.00 41.11 ? 38  HIS A HE1  3  
ATOM 5555  N N    . GLN A 1 44  ? 20.995  -3.727  -2.615  1.00 20.14 ? 39  GLN A N    3  
ATOM 5556  C CA   . GLN A 1 44  ? 21.678  -3.285  -3.825  1.00 44.21 ? 39  GLN A CA   3  
ATOM 5557  C C    . GLN A 1 44  ? 21.164  -1.922  -4.273  1.00 65.22 ? 39  GLN A C    3  
ATOM 5558  O O    . GLN A 1 44  ? 21.947  -1.013  -4.557  1.00 73.20 ? 39  GLN A O    3  
ATOM 5559  C CB   . GLN A 1 44  ? 21.489  -4.308  -4.946  1.00 51.40 ? 39  GLN A CB   3  
ATOM 5560  C CG   . GLN A 1 44  ? 22.551  -5.396  -4.962  1.00 73.13 ? 39  GLN A CG   3  
ATOM 5561  C CD   . GLN A 1 44  ? 22.272  -6.470  -5.996  1.00 44.15 ? 39  GLN A CD   3  
ATOM 5562  O OE1  . GLN A 1 44  ? 21.171  -6.551  -6.541  1.00 71.24 ? 39  GLN A OE1  3  
ATOM 5563  N NE2  . GLN A 1 44  ? 23.270  -7.300  -6.273  1.00 42.23 ? 39  GLN A NE2  3  
ATOM 5564  H H    . GLN A 1 44  ? 20.385  -4.493  -2.663  1.00 40.11 ? 39  GLN A H    3  
ATOM 5565  H HA   . GLN A 1 44  ? 22.731  -3.203  -3.599  1.00 23.22 ? 39  GLN A HA   3  
ATOM 5566  H HB3  . GLN A 1 44  ? 21.518  -3.794  -5.895  1.00 45.43 ? 39  GLN A HB3  3  
ATOM 5567  H HG3  . GLN A 1 44  ? 22.589  -5.858  -3.986  1.00 3.30  ? 39  GLN A HG3  3  
ATOM 5568  H HE21 . GLN A 1 44  ? 24.120  -7.175  -5.799  1.00 2.11  ? 39  GLN A HE21 3  
ATOM 5569  H HE22 . GLN A 1 44  ? 23.118  -8.002  -6.937  1.00 13.14 ? 39  GLN A HE22 3  
ATOM 5570  N N    . LEU A 1 45  ? 19.844  -1.783  -4.337  1.00 54.42 ? 40  LEU A N    3  
ATOM 5571  C CA   . LEU A 1 45  ? 19.225  -0.530  -4.751  1.00 13.43 ? 40  LEU A CA   3  
ATOM 5572  C C    . LEU A 1 45  ? 19.446  0.558   -3.706  1.00 61.44 ? 40  LEU A C    3  
ATOM 5573  O O    . LEU A 1 45  ? 19.636  1.727   -4.043  1.00 33.34 ? 40  LEU A O    3  
ATOM 5574  C CB   . LEU A 1 45  ? 17.727  -0.732  -4.986  1.00 43.03 ? 40  LEU A CB   3  
ATOM 5575  C CG   . LEU A 1 45  ? 16.837  -0.653  -3.745  1.00 2.12  ? 40  LEU A CG   3  
ATOM 5576  C CD1  . LEU A 1 45  ? 16.422  0.786   -3.475  1.00 4.50  ? 40  LEU A CD1  3  
ATOM 5577  C CD2  . LEU A 1 45  ? 15.612  -1.540  -3.910  1.00 0.10  ? 40  LEU A CD2  3  
ATOM 5578  H H    . LEU A 1 45  ? 19.272  -2.543  -4.099  1.00 23.00 ? 40  LEU A H    3  
ATOM 5579  H HA   . LEU A 1 45  ? 19.688  -0.223  -5.678  1.00 63.53 ? 40  LEU A HA   3  
ATOM 5580  H HB3  . LEU A 1 45  ? 17.591  -1.708  -5.430  1.00 24.45 ? 40  LEU A HB3  3  
ATOM 5581  H HG   . LEU A 1 45  ? 17.393  -1.005  -2.887  1.00 63.11 ? 40  LEU A HG   3  
ATOM 5582  H HD11 . LEU A 1 45  ? 17.191  1.280   -2.901  1.00 11.02 ? 40  LEU A HD11 3  
ATOM 5583  H HD12 . LEU A 1 45  ? 15.496  0.795   -2.922  1.00 22.31 ? 40  LEU A HD12 3  
ATOM 5584  H HD13 . LEU A 1 45  ? 16.286  1.303   -4.414  1.00 11.22 ? 40  LEU A HD13 3  
ATOM 5585  H HD21 . LEU A 1 45  ? 15.914  -2.577  -3.890  1.00 34.32 ? 40  LEU A HD21 3  
ATOM 5586  H HD22 . LEU A 1 45  ? 15.135  -1.323  -4.855  1.00 13.11 ? 40  LEU A HD22 3  
ATOM 5587  H HD23 . LEU A 1 45  ? 14.919  -1.351  -3.104  1.00 61.25 ? 40  LEU A HD23 3  
ATOM 5588  N N    . ASP A 1 46  ? 19.422  0.166   -2.437  1.00 10.54 ? 41  ASP A N    3  
ATOM 5589  C CA   . ASP A 1 46  ? 19.623  1.108   -1.342  1.00 13.14 ? 41  ASP A CA   3  
ATOM 5590  C C    . ASP A 1 46  ? 21.055  1.633   -1.333  1.00 35.50 ? 41  ASP A C    3  
ATOM 5591  O O    . ASP A 1 46  ? 21.284  2.835   -1.200  1.00 13.23 ? 41  ASP A O    3  
ATOM 5592  C CB   . ASP A 1 46  ? 19.302  0.441   -0.003  1.00 44.22 ? 41  ASP A CB   3  
ATOM 5593  C CG   . ASP A 1 46  ? 20.065  1.062   1.150   1.00 62.42 ? 41  ASP A CG   3  
ATOM 5594  O OD1  . ASP A 1 46  ? 20.147  2.308   1.205   1.00 35.24 ? 41  ASP A OD1  3  
ATOM 5595  O OD2  . ASP A 1 46  ? 20.581  0.304   1.999   1.00 2.24  ? 41  ASP A OD2  3  
ATOM 5596  H H    . ASP A 1 46  ? 19.266  -0.779  -2.232  1.00 10.44 ? 41  ASP A H    3  
ATOM 5597  H HA   . ASP A 1 46  ? 18.949  1.937   -1.490  1.00 64.43 ? 41  ASP A HA   3  
ATOM 5598  H HB3  . ASP A 1 46  ? 19.560  -0.606  -0.059  1.00 11.03 ? 41  ASP A HB3  3  
ATOM 5599  N N    . GLU A 1 47  ? 22.015  0.723   -1.473  1.00 31.42 ? 42  GLU A N    3  
ATOM 5600  C CA   . GLU A 1 47  ? 23.424  1.096   -1.479  1.00 30.41 ? 42  GLU A CA   3  
ATOM 5601  C C    . GLU A 1 47  ? 23.743  1.999   -2.666  1.00 42.43 ? 42  GLU A C    3  
ATOM 5602  O O    . GLU A 1 47  ? 24.309  3.079   -2.503  1.00 63.12 ? 42  GLU A O    3  
ATOM 5603  C CB   . GLU A 1 47  ? 24.306  -0.154  -1.523  1.00 35.54 ? 42  GLU A CB   3  
ATOM 5604  C CG   . GLU A 1 47  ? 25.783  0.135   -1.321  1.00 14.03 ? 42  GLU A CG   3  
ATOM 5605  C CD   . GLU A 1 47  ? 26.492  -0.960  -0.548  1.00 33.04 ? 42  GLU A CD   3  
ATOM 5606  O OE1  . GLU A 1 47  ? 26.428  -0.942  0.699   1.00 71.40 ? 42  GLU A OE1  3  
ATOM 5607  O OE2  . GLU A 1 47  ? 27.109  -1.836  -1.190  1.00 20.41 ? 42  GLU A OE2  3  
ATOM 5608  H H    . GLU A 1 47  ? 21.769  -0.219  -1.574  1.00 52.11 ? 42  GLU A H    3  
ATOM 5609  H HA   . GLU A 1 47  ? 23.628  1.636   -0.566  1.00 3.12  ? 42  GLU A HA   3  
ATOM 5610  H HB3  . GLU A 1 47  ? 24.182  -0.632  -2.484  1.00 15.21 ? 42  GLU A HB3  3  
ATOM 5611  H HG3  . GLU A 1 47  ? 25.884  1.062   -0.776  1.00 2.04  ? 42  GLU A HG3  3  
ATOM 5612  N N    . GLU A 1 48  ? 23.377  1.547   -3.862  1.00 54.01 ? 43  GLU A N    3  
ATOM 5613  C CA   . GLU A 1 48  ? 23.625  2.314   -5.077  1.00 13.42 ? 43  GLU A CA   3  
ATOM 5614  C C    . GLU A 1 48  ? 22.991  3.698   -4.986  1.00 33.21 ? 43  GLU A C    3  
ATOM 5615  O O    . GLU A 1 48  ? 23.595  4.695   -5.380  1.00 51.33 ? 43  GLU A O    3  
ATOM 5616  C CB   . GLU A 1 48  ? 23.078  1.569   -6.296  1.00 1.33  ? 43  GLU A CB   3  
ATOM 5617  C CG   . GLU A 1 48  ? 24.046  1.525   -7.468  1.00 34.51 ? 43  GLU A CG   3  
ATOM 5618  C CD   . GLU A 1 48  ? 23.594  0.579   -8.563  1.00 31.03 ? 43  GLU A CD   3  
ATOM 5619  O OE1  . GLU A 1 48  ? 22.426  0.137   -8.522  1.00 73.15 ? 43  GLU A OE1  3  
ATOM 5620  O OE2  . GLU A 1 48  ? 24.407  0.281   -9.461  1.00 5.40  ? 43  GLU A OE2  3  
ATOM 5621  H H    . GLU A 1 48  ? 22.929  0.678   -3.927  1.00 3.22  ? 43  GLU A H    3  
ATOM 5622  H HA   . GLU A 1 48  ? 24.693  2.426   -5.186  1.00 75.04 ? 43  GLU A HA   3  
ATOM 5623  H HB3  . GLU A 1 48  ? 22.172  2.057   -6.624  1.00 13.20 ? 43  GLU A HB3  3  
ATOM 5624  H HG3  . GLU A 1 48  ? 25.011  1.200   -7.108  1.00 11.22 ? 43  GLU A HG3  3  
ATOM 5625  N N    . GLU A 1 49  ? 21.769  3.750   -4.465  1.00 30.40 ? 44  GLU A N    3  
ATOM 5626  C CA   . GLU A 1 49  ? 21.053  5.012   -4.325  1.00 70.12 ? 44  GLU A CA   3  
ATOM 5627  C C    . GLU A 1 49  ? 21.739  5.917   -3.304  1.00 21.12 ? 44  GLU A C    3  
ATOM 5628  O O    . GLU A 1 49  ? 21.717  7.141   -3.430  1.00 33.45 ? 44  GLU A O    3  
ATOM 5629  C CB   . GLU A 1 49  ? 19.604  4.758   -3.903  1.00 42.12 ? 44  GLU A CB   3  
ATOM 5630  C CG   . GLU A 1 49  ? 18.692  5.957   -4.103  1.00 62.23 ? 44  GLU A CG   3  
ATOM 5631  C CD   . GLU A 1 49  ? 17.664  5.733   -5.193  1.00 11.03 ? 44  GLU A CD   3  
ATOM 5632  O OE1  . GLU A 1 49  ? 16.687  4.994   -4.945  1.00 71.50 ? 44  GLU A OE1  3  
ATOM 5633  O OE2  . GLU A 1 49  ? 17.834  6.294   -6.296  1.00 13.14 ? 44  GLU A OE2  3  
ATOM 5634  H H    . GLU A 1 49  ? 21.339  2.920   -4.170  1.00 71.45 ? 44  GLU A H    3  
ATOM 5635  H HA   . GLU A 1 49  ? 21.057  5.506   -5.285  1.00 15.43 ? 44  GLU A HA   3  
ATOM 5636  H HB3  . GLU A 1 49  ? 19.588  4.490   -2.857  1.00 64.22 ? 44  GLU A HB3  3  
ATOM 5637  H HG3  . GLU A 1 49  ? 19.297  6.812   -4.369  1.00 35.13 ? 44  GLU A HG3  3  
ATOM 5638  N N    . ARG A 1 50  ? 22.348  5.304   -2.294  1.00 41.32 ? 45  ARG A N    3  
ATOM 5639  C CA   . ARG A 1 50  ? 23.039  6.053   -1.251  1.00 4.30  ? 45  ARG A CA   3  
ATOM 5640  C C    . ARG A 1 50  ? 24.231  6.813   -1.827  1.00 13.41 ? 45  ARG A C    3  
ATOM 5641  O O    . ARG A 1 50  ? 24.440  7.985   -1.516  1.00 60.01 ? 45  ARG A O    3  
ATOM 5642  C CB   . ARG A 1 50  ? 23.509  5.109   -0.144  1.00 72.23 ? 45  ARG A CB   3  
ATOM 5643  C CG   . ARG A 1 50  ? 22.602  5.101   1.076   1.00 1.25  ? 45  ARG A CG   3  
ATOM 5644  C CD   . ARG A 1 50  ? 23.262  4.410   2.258   1.00 0.21  ? 45  ARG A CD   3  
ATOM 5645  N NE   . ARG A 1 50  ? 23.979  5.353   3.112   1.00 33.31 ? 45  ARG A NE   3  
ATOM 5646  C CZ   . ARG A 1 50  ? 24.538  5.018   4.270   1.00 35.15 ? 45  ARG A CZ   3  
ATOM 5647  N NH1  . ARG A 1 50  ? 24.462  3.769   4.709   1.00 10.10 ? 45  ARG A NH1  3  
ATOM 5648  N NH2  . ARG A 1 50  ? 25.172  5.933   4.991   1.00 41.20 ? 45  ARG A NH2  3  
ATOM 5649  H H    . ARG A 1 50  ? 22.331  4.325   -2.249  1.00 51.43 ? 45  ARG A H    3  
ATOM 5650  H HA   . ARG A 1 50  ? 22.341  6.763   -0.835  1.00 12.03 ? 45  ARG A HA   3  
ATOM 5651  H HB3  . ARG A 1 50  ? 24.497  5.409   0.173   1.00 12.45 ? 45  ARG A HB3  3  
ATOM 5652  H HG3  . ARG A 1 50  ? 21.689  4.580   0.829   1.00 12.44 ? 45  ARG A HG3  3  
ATOM 5653  H HD3  . ARG A 1 50  ? 23.959  3.675   1.884   1.00 63.22 ? 45  ARG A HD3  3  
ATOM 5654  H HE   . ARG A 1 50  ? 24.046  6.281   2.807   1.00 0.31  ? 45  ARG A HE   3  
ATOM 5655  H HH11 . ARG A 1 50  ? 23.985  3.077   4.168   1.00 3.12  ? 45  ARG A HH11 3  
ATOM 5656  H HH12 . ARG A 1 50  ? 24.884  3.519   5.582   1.00 4.51  ? 45  ARG A HH12 3  
ATOM 5657  H HH21 . ARG A 1 50  ? 25.231  6.875   4.663   1.00 72.35 ? 45  ARG A HH21 3  
ATOM 5658  H HH22 . ARG A 1 50  ? 25.592  5.680   5.862   1.00 12.31 ? 45  ARG A HH22 3  
ATOM 5659  N N    . MET A 1 51  ? 25.008  6.136   -2.667  1.00 74.42 ? 46  MET A N    3  
ATOM 5660  C CA   . MET A 1 51  ? 26.177  6.748   -3.286  1.00 71.24 ? 46  MET A CA   3  
ATOM 5661  C C    . MET A 1 51  ? 25.763  7.800   -4.311  1.00 32.11 ? 46  MET A C    3  
ATOM 5662  O O    . MET A 1 51  ? 26.232  8.938   -4.271  1.00 50.23 ? 46  MET A O    3  
ATOM 5663  C CB   . MET A 1 51  ? 27.044  5.680   -3.956  1.00 35.31 ? 46  MET A CB   3  
ATOM 5664  C CG   . MET A 1 51  ? 27.134  4.387   -3.164  1.00 52.44 ? 46  MET A CG   3  
ATOM 5665  S SD   . MET A 1 51  ? 27.619  4.654   -1.448  1.00 20.40 ? 46  MET A SD   3  
ATOM 5666  C CE   . MET A 1 51  ? 29.274  5.302   -1.661  1.00 41.24 ? 46  MET A CE   3  
ATOM 5667  H H    . MET A 1 51  ? 24.789  5.204   -2.877  1.00 41.25 ? 46  MET A H    3  
ATOM 5668  H HA   . MET A 1 51  ? 26.751  7.228   -2.507  1.00 64.22 ? 46  MET A HA   3  
ATOM 5669  H HB3  . MET A 1 51  ? 28.044  6.070   -4.081  1.00 31.25 ? 46  MET A HB3  3  
ATOM 5670  H HG3  . MET A 1 51  ? 27.864  3.743   -3.633  1.00 30.12 ? 46  MET A HG3  3  
ATOM 5671  H HE1  . MET A 1 51  ? 29.692  5.549   -0.696  1.00 55.11 ? 46  MET A HE1  3  
ATOM 5672  H HE2  . MET A 1 51  ? 29.893  4.557   -2.140  1.00 74.21 ? 46  MET A HE2  3  
ATOM 5673  H HE3  . MET A 1 51  ? 29.238  6.190   -2.275  1.00 32.13 ? 46  MET A HE3  3  
ATOM 5674  N N    . ARG A 1 52  ? 24.882  7.412   -5.227  1.00 51.40 ? 47  ARG A N    3  
ATOM 5675  C CA   . ARG A 1 52  ? 24.407  8.320   -6.262  1.00 25.33 ? 47  ARG A CA   3  
ATOM 5676  C C    . ARG A 1 52  ? 23.765  9.561   -5.645  1.00 14.42 ? 47  ARG A C    3  
ATOM 5677  O O    . ARG A 1 52  ? 23.852  10.656  -6.198  1.00 24.41 ? 47  ARG A O    3  
ATOM 5678  C CB   . ARG A 1 52  ? 23.401  7.611   -7.171  1.00 72.33 ? 47  ARG A CB   3  
ATOM 5679  C CG   . ARG A 1 52  ? 21.974  7.652   -6.648  1.00 4.43  ? 47  ARG A CG   3  
ATOM 5680  C CD   . ARG A 1 52  ? 21.033  6.853   -7.536  1.00 61.31 ? 47  ARG A CD   3  
ATOM 5681  N NE   . ARG A 1 52  ? 21.536  5.507   -7.796  1.00 24.15 ? 47  ARG A NE   3  
ATOM 5682  C CZ   . ARG A 1 52  ? 21.116  4.747   -8.801  1.00 22.54 ? 47  ARG A CZ   3  
ATOM 5683  N NH1  . ARG A 1 52  ? 20.190  5.198   -9.636  1.00 31.42 ? 47  ARG A NH1  3  
ATOM 5684  N NH2  . ARG A 1 52  ? 21.622  3.533   -8.973  1.00 54.24 ? 47  ARG A NH2  3  
ATOM 5685  H H    . ARG A 1 52  ? 24.545  6.492   -5.207  1.00 41.50 ? 47  ARG A H    3  
ATOM 5686  H HA   . ARG A 1 52  ? 25.258  8.626   -6.853  1.00 20.32 ? 47  ARG A HA   3  
ATOM 5687  H HB3  . ARG A 1 52  ? 23.694  6.577   -7.274  1.00 30.41 ? 47  ARG A HB3  3  
ATOM 5688  H HG3  . ARG A 1 52  ? 21.641  8.680   -6.617  1.00 11.32 ? 47  ARG A HG3  3  
ATOM 5689  H HD3  . ARG A 1 52  ? 20.918  7.373   -8.476  1.00 61.52 ? 47  ARG A HD3  3  
ATOM 5690  H HE   . ARG A 1 52  ? 22.220  5.154   -7.191  1.00 43.50 ? 47  ARG A HE   3  
ATOM 5691  H HH11 . ARG A 1 52  ? 19.807  6.113   -9.510  1.00 2.00  ? 47  ARG A HH11 3  
ATOM 5692  H HH12 . ARG A 1 52  ? 19.876  4.624   -10.392 1.00 22.14 ? 47  ARG A HH12 3  
ATOM 5693  H HH21 . ARG A 1 52  ? 22.320  3.189   -8.346  1.00 74.22 ? 47  ARG A HH21 3  
ATOM 5694  H HH22 . ARG A 1 52  ? 21.306  2.961   -9.729  1.00 34.33 ? 47  ARG A HH22 3  
ATOM 5695  N N    . MET A 1 53  ? 23.122  9.377   -4.497  1.00 42.23 ? 48  MET A N    3  
ATOM 5696  C CA   . MET A 1 53  ? 22.468  10.481  -3.805  1.00 35.34 ? 48  MET A CA   3  
ATOM 5697  C C    . MET A 1 53  ? 23.495  11.402  -3.155  1.00 73.52 ? 48  MET A C    3  
ATOM 5698  O O    . MET A 1 53  ? 23.452  12.619  -3.334  1.00 41.41 ? 48  MET A O    3  
ATOM 5699  C CB   . MET A 1 53  ? 21.502  9.946   -2.745  1.00 51.14 ? 48  MET A CB   3  
ATOM 5700  C CG   . MET A 1 53  ? 20.146  9.548   -3.302  1.00 64.21 ? 48  MET A CG   3  
ATOM 5701  S SD   . MET A 1 53  ? 19.179  10.967  -3.852  1.00 4.13  ? 48  MET A SD   3  
ATOM 5702  C CE   . MET A 1 53  ? 19.285  10.780  -5.630  1.00 3.14  ? 48  MET A CE   3  
ATOM 5703  H H    . MET A 1 53  ? 23.088  8.480   -4.105  1.00 54.22 ? 48  MET A H    3  
ATOM 5704  H HA   . MET A 1 53  ? 21.907  11.045  -4.536  1.00 70.11 ? 48  MET A HA   3  
ATOM 5705  H HB3  . MET A 1 53  ? 21.350  10.708  -1.995  1.00 71.11 ? 48  MET A HB3  3  
ATOM 5706  H HG3  . MET A 1 53  ? 19.594  9.030   -2.532  1.00 3.11  ? 48  MET A HG3  3  
ATOM 5707  H HE1  . MET A 1 53  ? 20.308  10.579  -5.911  1.00 54.42 ? 48  MET A HE1  3  
ATOM 5708  H HE2  . MET A 1 53  ? 18.657  9.960   -5.944  1.00 24.34 ? 48  MET A HE2  3  
ATOM 5709  H HE3  . MET A 1 53  ? 18.954  11.691  -6.108  1.00 3.13  ? 48  MET A HE3  3  
ATOM 5710  N N    . ALA A 1 54  ? 24.417  10.814  -2.400  1.00 1.20  ? 49  ALA A N    3  
ATOM 5711  C CA   . ALA A 1 54  ? 25.456  11.582  -1.726  1.00 50.24 ? 49  ALA A CA   3  
ATOM 5712  C C    . ALA A 1 54  ? 26.210  12.468  -2.710  1.00 10.12 ? 49  ALA A C    3  
ATOM 5713  O O    . ALA A 1 54  ? 26.393  13.661  -2.470  1.00 23.42 ? 49  ALA A O    3  
ATOM 5714  C CB   . ALA A 1 54  ? 26.420  10.649  -1.008  1.00 54.03 ? 49  ALA A CB   3  
ATOM 5715  H H    . ALA A 1 54  ? 24.399  9.840   -2.295  1.00 34.13 ? 49  ALA A H    3  
ATOM 5716  H HA   . ALA A 1 54  ? 24.981  12.208  -0.984  1.00 32.23 ? 49  ALA A HA   3  
ATOM 5717  H HB1  . ALA A 1 54  ? 26.651  9.810   -1.648  1.00 51.53 ? 49  ALA A HB1  3  
ATOM 5718  H HB2  . ALA A 1 54  ? 27.327  11.182  -0.770  1.00 42.24 ? 49  ALA A HB2  3  
ATOM 5719  H HB3  . ALA A 1 54  ? 25.963  10.292  -0.097  1.00 54.43 ? 49  ALA A HB3  3  
ATOM 5720  N N    . GLU A 1 55  ? 26.646  11.877  -3.819  1.00 53.23 ? 50  GLU A N    3  
ATOM 5721  C CA   . GLU A 1 55  ? 27.382  12.614  -4.838  1.00 5.03  ? 50  GLU A CA   3  
ATOM 5722  C C    . GLU A 1 55  ? 26.537  13.753  -5.403  1.00 15.21 ? 50  GLU A C    3  
ATOM 5723  O O    . GLU A 1 55  ? 27.062  14.701  -5.986  1.00 13.41 ? 50  GLU A O    3  
ATOM 5724  C CB   . GLU A 1 55  ? 27.812  11.676  -5.967  1.00 3.13  ? 50  GLU A CB   3  
ATOM 5725  C CG   . GLU A 1 55  ? 26.649  11.119  -6.773  1.00 64.34 ? 50  GLU A CG   3  
ATOM 5726  C CD   . GLU A 1 55  ? 27.094  10.471  -8.069  1.00 40.34 ? 50  GLU A CD   3  
ATOM 5727  O OE1  . GLU A 1 55  ? 27.550  9.309   -8.024  1.00 41.10 ? 50  GLU A OE1  3  
ATOM 5728  O OE2  . GLU A 1 55  ? 26.987  11.124  -9.127  1.00 11.25 ? 50  GLU A OE2  3  
ATOM 5729  H H    . GLU A 1 55  ? 26.469  10.922  -3.952  1.00 4.21  ? 50  GLU A H    3  
ATOM 5730  H HA   . GLU A 1 55  ? 28.263  13.031  -4.375  1.00 45.01 ? 50  GLU A HA   3  
ATOM 5731  H HB3  . GLU A 1 55  ? 28.357  10.846  -5.542  1.00 11.04 ? 50  GLU A HB3  3  
ATOM 5732  H HG3  . GLU A 1 55  ? 25.970  11.926  -7.006  1.00 64.43 ? 50  GLU A HG3  3  
ATOM 5733  N N    . GLY A 1 56  ? 25.223  13.652  -5.224  1.00 74.33 ? 51  GLY A N    3  
ATOM 5734  C CA   . GLY A 1 56  ? 24.326  14.678  -5.721  1.00 43.10 ? 51  GLY A CA   3  
ATOM 5735  C C    . GLY A 1 56  ? 23.303  14.131  -6.696  1.00 22.40 ? 51  GLY A C    3  
ATOM 5736  O O    . GLY A 1 56  ? 22.814  13.014  -6.533  1.00 2.01  ? 51  GLY A O    3  
ATOM 5737  H H    . GLY A 1 56  ? 24.860  12.874  -4.751  1.00 72.41 ? 51  GLY A H    3  
ATOM 5738  H HA2  . GLY A 1 56  ? 23.808  15.125  -4.885  1.00 54.15 ? 51  GLY A HA2  3  
ATOM 5739  H HA3  . GLY A 1 56  ? 24.908  15.440  -6.218  1.00 5.31  ? 51  GLY A HA3  3  
ATOM 5740  N N    . GLY A 1 57  ? 22.975  14.922  -7.714  1.00 73.32 ? 52  GLY A N    3  
ATOM 5741  C CA   . GLY A 1 57  ? 22.004  14.494  -8.703  1.00 21.40 ? 52  GLY A CA   3  
ATOM 5742  C C    . GLY A 1 57  ? 21.076  15.616  -9.127  1.00 13.20 ? 52  GLY A C    3  
ATOM 5743  O O    . GLY A 1 57  ? 20.558  16.353  -8.289  1.00 71.43 ? 52  GLY A O    3  
ATOM 5744  H H    . GLY A 1 57  ? 23.397  15.804  -7.793  1.00 13.13 ? 52  GLY A H    3  
ATOM 5745  H HA2  . GLY A 1 57  ? 22.529  14.127  -9.572  1.00 21.11 ? 52  GLY A HA2  3  
ATOM 5746  H HA3  . GLY A 1 57  ? 21.413  13.691  -8.287  1.00 61.34 ? 52  GLY A HA3  3  
ATOM 5747  N N    . VAL A 1 58  ? 20.865  15.745  -10.433 1.00 20.32 ? 53  VAL A N    3  
ATOM 5748  C CA   . VAL A 1 58  ? 19.993  16.785  -10.968 1.00 53.33 ? 53  VAL A CA   3  
ATOM 5749  C C    . VAL A 1 58  ? 18.974  16.201  -11.940 1.00 43.24 ? 53  VAL A C    3  
ATOM 5750  O O    . VAL A 1 58  ? 19.207  16.158  -13.148 1.00 14.44 ? 53  VAL A O    3  
ATOM 5751  C CB   . VAL A 1 58  ? 20.803  17.881  -11.686 1.00 34.41 ? 53  VAL A CB   3  
ATOM 5752  C CG1  . VAL A 1 58  ? 21.476  18.796  -10.674 1.00 41.32 ? 53  VAL A CG1  3  
ATOM 5753  C CG2  . VAL A 1 58  ? 21.828  17.259  -12.621 1.00 43.51 ? 53  VAL A CG2  3  
ATOM 5754  H H    . VAL A 1 58  ? 21.306  15.126  -11.052 1.00 23.33 ? 53  VAL A H    3  
ATOM 5755  H HA   . VAL A 1 58  ? 19.468  17.238  -10.140 1.00 71.54 ? 53  VAL A HA   3  
ATOM 5756  H HB   . VAL A 1 58  ? 20.121  18.475  -12.276 1.00 13.45 ? 53  VAL A HB   3  
ATOM 5757  H HG11 . VAL A 1 58  ? 20.823  18.939  -9.826  1.00 51.41 ? 53  VAL A HG11 3  
ATOM 5758  H HG12 . VAL A 1 58  ? 22.403  18.350  -10.346 1.00 52.12 ? 53  VAL A HG12 3  
ATOM 5759  H HG13 . VAL A 1 58  ? 21.680  19.752  -11.134 1.00 41.53 ? 53  VAL A HG13 3  
ATOM 5760  H HG21 . VAL A 1 58  ? 21.505  16.267  -12.899 1.00 44.40 ? 53  VAL A HG21 3  
ATOM 5761  H HG22 . VAL A 1 58  ? 21.923  17.870  -13.508 1.00 15.40 ? 53  VAL A HG22 3  
ATOM 5762  H HG23 . VAL A 1 58  ? 22.783  17.201  -12.122 1.00 75.13 ? 53  VAL A HG23 3  
ATOM 5763  N N    . THR A 1 59  ? 17.842  15.755  -11.404 1.00 52.50 ? 54  THR A N    3  
ATOM 5764  C CA   . THR A 1 59  ? 16.787  15.173  -12.224 1.00 53.01 ? 54  THR A CA   3  
ATOM 5765  C C    . THR A 1 59  ? 15.567  14.818  -11.380 1.00 51.33 ? 54  THR A C    3  
ATOM 5766  O O    . THR A 1 59  ? 15.638  14.790  -10.152 1.00 62.24 ? 54  THR A O    3  
ATOM 5767  C CB   . THR A 1 59  ? 17.276  13.909  -12.955 1.00 5.14  ? 54  THR A CB   3  
ATOM 5768  O OG1  . THR A 1 59  ? 16.234  13.393  -13.791 1.00 32.10 ? 54  THR A OG1  3  
ATOM 5769  C CG2  . THR A 1 59  ? 17.711  12.842  -11.963 1.00 63.24 ? 54  THR A CG2  3  
ATOM 5770  H H    . THR A 1 59  ? 17.716  15.817  -10.435 1.00 50.03 ? 54  THR A H    3  
ATOM 5771  H HA   . THR A 1 59  ? 16.499  15.905  -12.965 1.00 72.12 ? 54  THR A HA   3  
ATOM 5772  H HB   . THR A 1 59  ? 18.124  14.174  -13.573 1.00 35.45 ? 54  THR A HB   3  
ATOM 5773  H HG1  . THR A 1 59  ? 16.600  13.142  -14.642 1.00 1.40  ? 54  THR A HG1  3  
ATOM 5774  H HG21 . THR A 1 59  ? 18.718  12.527  -12.192 1.00 14.12 ? 54  THR A HG21 3  
ATOM 5775  H HG22 . THR A 1 59  ? 17.044  11.996  -12.028 1.00 51.13 ? 54  THR A HG22 3  
ATOM 5776  H HG23 . THR A 1 59  ? 17.681  13.249  -10.962 1.00 45.31 ? 54  THR A HG23 3  
ATOM 5777  N N    . SER A 1 60  ? 14.450  14.547  -12.047 1.00 45.14 ? 55  SER A N    3  
ATOM 5778  C CA   . SER A 1 60  ? 13.214  14.197  -11.357 1.00 4.10  ? 55  SER A CA   3  
ATOM 5779  C C    . SER A 1 60  ? 13.449  13.062  -10.366 1.00 53.20 ? 55  SER A C    3  
ATOM 5780  O O    . SER A 1 60  ? 13.095  13.166  -9.192  1.00 72.12 ? 55  SER A O    3  
ATOM 5781  C CB   . SER A 1 60  ? 12.138  13.793  -12.367 1.00 44.11 ? 55  SER A CB   3  
ATOM 5782  O OG   . SER A 1 60  ? 11.048  14.698  -12.341 1.00 54.34 ? 55  SER A OG   3  
ATOM 5783  H H    . SER A 1 60  ? 14.457  14.586  -13.026 1.00 22.01 ? 55  SER A H    3  
ATOM 5784  H HA   . SER A 1 60  ? 12.878  15.069  -10.816 1.00 14.20 ? 55  SER A HA   3  
ATOM 5785  H HB3  . SER A 1 60  ? 11.777  12.804  -12.127 1.00 30.14 ? 55  SER A HB3  3  
ATOM 5786  H HG   . SER A 1 60  ? 10.263  14.264  -12.681 1.00 34.21 ? 55  SER A HG   3  
ATOM 5787  N N    . GLU A 1 61  ? 14.048  11.977  -10.848 1.00 35.34 ? 56  GLU A N    3  
ATOM 5788  C CA   . GLU A 1 61  ? 14.328  10.822  -10.004 1.00 52.32 ? 56  GLU A CA   3  
ATOM 5789  C C    . GLU A 1 61  ? 15.109  11.234  -8.760  1.00 50.34 ? 56  GLU A C    3  
ATOM 5790  O O    . GLU A 1 61  ? 14.788  10.818  -7.646  1.00 72.15 ? 56  GLU A O    3  
ATOM 5791  C CB   . GLU A 1 61  ? 15.116  9.769   -10.788 1.00 74.31 ? 56  GLU A CB   3  
ATOM 5792  C CG   . GLU A 1 61  ? 14.643  8.346   -10.539 1.00 43.21 ? 56  GLU A CG   3  
ATOM 5793  C CD   . GLU A 1 61  ? 15.650  7.310   -10.998 1.00 53.54 ? 56  GLU A CD   3  
ATOM 5794  O OE1  . GLU A 1 61  ? 16.320  7.545   -12.025 1.00 75.01 ? 56  GLU A OE1  3  
ATOM 5795  O OE2  . GLU A 1 61  ? 15.769  6.261   -10.327 1.00 65.52 ? 56  GLU A OE2  3  
ATOM 5796  H H    . GLU A 1 61  ? 14.306  11.953  -11.793 1.00 60.02 ? 56  GLU A H    3  
ATOM 5797  H HA   . GLU A 1 61  ? 13.385  10.397  -9.697  1.00 12.42 ? 56  GLU A HA   3  
ATOM 5798  H HB3  . GLU A 1 61  ? 16.157  9.834   -10.509 1.00 41.13 ? 56  GLU A HB3  3  
ATOM 5799  H HG3  . GLU A 1 61  ? 13.719  8.189   -11.074 1.00 12.35 ? 56  GLU A HG3  3  
ATOM 5800  N N    . ASP A 1 62  ? 16.137  12.052  -8.957  1.00 51.12 ? 57  ASP A N    3  
ATOM 5801  C CA   . ASP A 1 62  ? 16.964  12.521  -7.852  1.00 42.54 ? 57  ASP A CA   3  
ATOM 5802  C C    . ASP A 1 62  ? 16.139  13.340  -6.864  1.00 42.41 ? 57  ASP A C    3  
ATOM 5803  O O    . ASP A 1 62  ? 16.309  13.222  -5.650  1.00 42.11 ? 57  ASP A O    3  
ATOM 5804  C CB   . ASP A 1 62  ? 18.130  13.359  -8.379  1.00 23.31 ? 57  ASP A CB   3  
ATOM 5805  C CG   . ASP A 1 62  ? 19.205  12.512  -9.032  1.00 31.24 ? 57  ASP A CG   3  
ATOM 5806  O OD1  . ASP A 1 62  ? 19.388  11.353  -8.604  1.00 20.21 ? 57  ASP A OD1  3  
ATOM 5807  O OD2  . ASP A 1 62  ? 19.861  13.007  -9.972  1.00 70.35 ? 57  ASP A OD2  3  
ATOM 5808  H H    . ASP A 1 62  ? 16.344  12.348  -9.869  1.00 34.11 ? 57  ASP A H    3  
ATOM 5809  H HA   . ASP A 1 62  ? 17.358  11.655  -7.341  1.00 44.44 ? 57  ASP A HA   3  
ATOM 5810  H HB3  . ASP A 1 62  ? 18.574  13.903  -7.559  1.00 51.31 ? 57  ASP A HB3  3  
ATOM 5811  N N    . TYR A 1 63  ? 15.246  14.168  -7.393  1.00 21.42 ? 58  TYR A N    3  
ATOM 5812  C CA   . TYR A 1 63  ? 14.396  15.009  -6.558  1.00 24.34 ? 58  TYR A CA   3  
ATOM 5813  C C    . TYR A 1 63  ? 13.523  14.160  -5.639  1.00 4.25  ? 58  TYR A C    3  
ATOM 5814  O O    . TYR A 1 63  ? 13.494  14.366  -4.426  1.00 24.33 ? 58  TYR A O    3  
ATOM 5815  C CB   . TYR A 1 63  ? 13.516  15.906  -7.431  1.00 34.41 ? 58  TYR A CB   3  
ATOM 5816  C CG   . TYR A 1 63  ? 14.249  17.096  -8.008  1.00 14.24 ? 58  TYR A CG   3  
ATOM 5817  C CD1  . TYR A 1 63  ? 15.034  17.911  -7.203  1.00 44.31 ? 58  TYR A CD1  3  
ATOM 5818  C CD2  . TYR A 1 63  ? 14.157  17.402  -9.361  1.00 64.11 ? 58  TYR A CD2  3  
ATOM 5819  C CE1  . TYR A 1 63  ? 15.705  19.000  -7.728  1.00 54.11 ? 58  TYR A CE1  3  
ATOM 5820  C CE2  . TYR A 1 63  ? 14.826  18.487  -9.893  1.00 45.41 ? 58  TYR A CE2  3  
ATOM 5821  C CZ   . TYR A 1 63  ? 15.598  19.283  -9.074  1.00 70.52 ? 58  TYR A CZ   3  
ATOM 5822  O OH   . TYR A 1 63  ? 16.266  20.364  -9.600  1.00 63.44 ? 58  TYR A OH   3  
ATOM 5823  H H    . TYR A 1 63  ? 15.156  14.217  -8.367  1.00 65.25 ? 58  TYR A H    3  
ATOM 5824  H HA   . TYR A 1 63  ? 15.038  15.631  -5.952  1.00 62.44 ? 58  TYR A HA   3  
ATOM 5825  H HB3  . TYR A 1 63  ? 12.694  16.280  -6.836  1.00 1.35  ? 58  TYR A HB3  3  
ATOM 5826  H HD1  . TYR A 1 63  ? 15.116  17.686  -6.150  1.00 1.11  ? 58  TYR A HD1  3  
ATOM 5827  H HD2  . TYR A 1 63  ? 13.553  16.777  -10.001 1.00 35.14 ? 58  TYR A HD2  3  
ATOM 5828  H HE1  . TYR A 1 63  ? 16.309  19.622  -7.085  1.00 4.41  ? 58  TYR A HE1  3  
ATOM 5829  H HE2  . TYR A 1 63  ? 14.743  18.710  -10.947 1.00 4.45  ? 58  TYR A HE2  3  
ATOM 5830  H HH   . TYR A 1 63  ? 16.721  20.100  -10.402 1.00 3.05  ? 58  TYR A HH   3  
ATOM 5831  N N    . ARG A 1 64  ? 12.812  13.202  -6.228  1.00 64.22 ? 59  ARG A N    3  
ATOM 5832  C CA   . ARG A 1 64  ? 11.938  12.321  -5.464  1.00 33.31 ? 59  ARG A CA   3  
ATOM 5833  C C    . ARG A 1 64  ? 12.748  11.422  -4.535  1.00 63.33 ? 59  ARG A C    3  
ATOM 5834  O O    . ARG A 1 64  ? 12.412  11.258  -3.362  1.00 71.31 ? 59  ARG A O    3  
ATOM 5835  C CB   . ARG A 1 64  ? 11.090  11.465  -6.408  1.00 71.34 ? 59  ARG A CB   3  
ATOM 5836  C CG   . ARG A 1 64  ? 10.263  12.279  -7.390  1.00 11.12 ? 59  ARG A CG   3  
ATOM 5837  C CD   . ARG A 1 64  ? 8.819   11.803  -7.430  1.00 53.15 ? 59  ARG A CD   3  
ATOM 5838  N NE   . ARG A 1 64  ? 7.946   12.761  -8.103  1.00 55.33 ? 59  ARG A NE   3  
ATOM 5839  C CZ   . ARG A 1 64  ? 7.838   12.853  -9.424  1.00 72.34 ? 59  ARG A CZ   3  
ATOM 5840  N NH1  . ARG A 1 64  ? 8.544   12.051  -10.208 1.00 15.32 ? 59  ARG A NH1  3  
ATOM 5841  N NH2  . ARG A 1 64  ? 7.021   13.750  -9.963  1.00 70.43 ? 59  ARG A NH2  3  
ATOM 5842  H H    . ARG A 1 64  ? 12.878  13.087  -7.199  1.00 31.12 ? 59  ARG A H    3  
ATOM 5843  H HA   . ARG A 1 64  ? 11.283  12.939  -4.867  1.00 30.40 ? 59  ARG A HA   3  
ATOM 5844  H HB3  . ARG A 1 64  ? 10.419  10.860  -5.819  1.00 33.41 ? 59  ARG A HB3  3  
ATOM 5845  H HG3  . ARG A 1 64  ? 10.693  12.180  -8.375  1.00 23.13 ? 59  ARG A HG3  3  
ATOM 5846  H HD3  . ARG A 1 64  ? 8.473   11.664  -6.416  1.00 70.51 ? 59  ARG A HD3  3  
ATOM 5847  H HE   . ARG A 1 64  ? 7.415   13.364  -7.542  1.00 52.41 ? 59  ARG A HE   3  
ATOM 5848  H HH11 . ARG A 1 64  ? 9.159   11.373  -9.805  1.00 51.22 ? 59  ARG A HH11 3  
ATOM 5849  H HH12 . ARG A 1 64  ? 8.460   12.122  -11.203 1.00 34.42 ? 59  ARG A HH12 3  
ATOM 5850  H HH21 . ARG A 1 64  ? 6.488   14.357  -9.374  1.00 34.32 ? 59  ARG A HH21 3  
ATOM 5851  H HH22 . ARG A 1 64  ? 6.941   13.820  -10.956 1.00 14.01 ? 59  ARG A HH22 3  
ATOM 5852  N N    . THR A 1 65  ? 13.819  10.842  -5.067  1.00 52.20 ? 60  THR A N    3  
ATOM 5853  C CA   . THR A 1 65  ? 14.677  9.959   -4.288  1.00 54.44 ? 60  THR A CA   3  
ATOM 5854  C C    . THR A 1 65  ? 15.222  10.670  -3.054  1.00 11.21 ? 60  THR A C    3  
ATOM 5855  O O    . THR A 1 65  ? 15.159  10.143  -1.943  1.00 33.10 ? 60  THR A O    3  
ATOM 5856  C CB   . THR A 1 65  ? 15.858  9.436   -5.127  1.00 22.33 ? 60  THR A CB   3  
ATOM 5857  O OG1  . THR A 1 65  ? 15.369  8.699   -6.254  1.00 32.44 ? 60  THR A OG1  3  
ATOM 5858  C CG2  . THR A 1 65  ? 16.767  8.549   -4.290  1.00 10.13 ? 60  THR A CG2  3  
ATOM 5859  H H    . THR A 1 65  ? 14.036  11.012  -6.008  1.00 71.13 ? 60  THR A H    3  
ATOM 5860  H HA   . THR A 1 65  ? 14.084  9.112   -3.971  1.00 43.24 ? 60  THR A HA   3  
ATOM 5861  H HB   . THR A 1 65  ? 16.430  10.282  -5.481  1.00 41.33 ? 60  THR A HB   3  
ATOM 5862  H HG1  . THR A 1 65  ? 14.523  8.300   -6.032  1.00 44.41 ? 60  THR A HG1  3  
ATOM 5863  H HG21 . THR A 1 65  ? 17.127  9.106   -3.438  1.00 31.10 ? 60  THR A HG21 3  
ATOM 5864  H HG22 . THR A 1 65  ? 17.604  8.225   -4.890  1.00 40.30 ? 60  THR A HG22 3  
ATOM 5865  H HG23 . THR A 1 65  ? 16.213  7.688   -3.949  1.00 54.32 ? 60  THR A HG23 3  
ATOM 5866  N N    . PHE A 1 66  ? 15.755  11.870  -3.255  1.00 24.02 ? 61  PHE A N    3  
ATOM 5867  C CA   . PHE A 1 66  ? 16.311  12.654  -2.159  1.00 40.31 ? 61  PHE A CA   3  
ATOM 5868  C C    . PHE A 1 66  ? 15.221  13.059  -1.172  1.00 23.52 ? 61  PHE A C    3  
ATOM 5869  O O    . PHE A 1 66  ? 15.405  12.981  0.043   1.00 43.42 ? 61  PHE A O    3  
ATOM 5870  C CB   . PHE A 1 66  ? 17.015  13.900  -2.700  1.00 75.21 ? 61  PHE A CB   3  
ATOM 5871  C CG   . PHE A 1 66  ? 18.086  14.427  -1.788  1.00 24.45 ? 61  PHE A CG   3  
ATOM 5872  C CD1  . PHE A 1 66  ? 17.758  14.990  -0.565  1.00 24.33 ? 61  PHE A CD1  3  
ATOM 5873  C CD2  . PHE A 1 66  ? 19.420  14.360  -2.154  1.00 11.44 ? 61  PHE A CD2  3  
ATOM 5874  C CE1  . PHE A 1 66  ? 18.741  15.476  0.275   1.00 63.11 ? 61  PHE A CE1  3  
ATOM 5875  C CE2  . PHE A 1 66  ? 20.408  14.845  -1.318  1.00 2.24  ? 61  PHE A CE2  3  
ATOM 5876  C CZ   . PHE A 1 66  ? 20.068  15.403  -0.101  1.00 3.34  ? 61  PHE A CZ   3  
ATOM 5877  H H    . PHE A 1 66  ? 15.776  12.237  -4.165  1.00 70.04 ? 61  PHE A H    3  
ATOM 5878  H HA   . PHE A 1 66  ? 17.033  12.038  -1.645  1.00 51.20 ? 61  PHE A HA   3  
ATOM 5879  H HB3  . PHE A 1 66  ? 16.284  14.682  -2.844  1.00 71.32 ? 61  PHE A HB3  3  
ATOM 5880  H HD1  . PHE A 1 66  ? 16.720  15.048  -0.269  1.00 54.23 ? 61  PHE A HD1  3  
ATOM 5881  H HD2  . PHE A 1 66  ? 19.687  13.923  -3.106  1.00 44.23 ? 61  PHE A HD2  3  
ATOM 5882  H HE1  . PHE A 1 66  ? 18.473  15.912  1.225   1.00 61.25 ? 61  PHE A HE1  3  
ATOM 5883  H HE2  . PHE A 1 66  ? 21.444  14.785  -1.616  1.00 43.32 ? 61  PHE A HE2  3  
ATOM 5884  H HZ   . PHE A 1 66  ? 20.839  15.782  0.553   1.00 32.42 ? 61  PHE A HZ   3  
ATOM 5885  N N    . LEU A 1 67  ? 14.083  13.494  -1.703  1.00 34.35 ? 62  LEU A N    3  
ATOM 5886  C CA   . LEU A 1 67  ? 12.960  13.912  -0.871  1.00 64.53 ? 62  LEU A CA   3  
ATOM 5887  C C    . LEU A 1 67  ? 12.552  12.802  0.091   1.00 54.21 ? 62  LEU A C    3  
ATOM 5888  O O    . LEU A 1 67  ? 12.296  13.051  1.269   1.00 25.42 ? 62  LEU A O    3  
ATOM 5889  C CB   . LEU A 1 67  ? 11.770  14.308  -1.746  1.00 50.31 ? 62  LEU A CB   3  
ATOM 5890  C CG   . LEU A 1 67  ? 11.797  15.728  -2.314  1.00 53.11 ? 62  LEU A CG   3  
ATOM 5891  C CD1  . LEU A 1 67  ? 10.943  15.817  -3.569  1.00 33.24 ? 62  LEU A CD1  3  
ATOM 5892  C CD2  . LEU A 1 67  ? 11.322  16.729  -1.270  1.00 3.34  ? 62  LEU A CD2  3  
ATOM 5893  H H    . LEU A 1 67  ? 13.995  13.533  -2.678  1.00 24.50 ? 62  LEU A H    3  
ATOM 5894  H HA   . LEU A 1 67  ? 13.276  14.771  -0.297  1.00 70.20 ? 62  LEU A HA   3  
ATOM 5895  H HB3  . LEU A 1 67  ? 10.874  14.206  -1.151  1.00 30.01 ? 62  LEU A HB3  3  
ATOM 5896  H HG   . LEU A 1 67  ? 12.813  15.981  -2.584  1.00 63.41 ? 62  LEU A HG   3  
ATOM 5897  H HD11 . LEU A 1 67  ? 9.911   15.976  -3.292  1.00 62.11 ? 62  LEU A HD11 3  
ATOM 5898  H HD12 . LEU A 1 67  ? 11.027  14.897  -4.128  1.00 1.31  ? 62  LEU A HD12 3  
ATOM 5899  H HD13 . LEU A 1 67  ? 11.284  16.640  -4.179  1.00 20.42 ? 62  LEU A HD13 3  
ATOM 5900  H HD21 . LEU A 1 67  ? 11.949  16.659  -0.394  1.00 62.12 ? 62  LEU A HD21 3  
ATOM 5901  H HD22 . LEU A 1 67  ? 10.299  16.508  -1.000  1.00 14.15 ? 62  LEU A HD22 3  
ATOM 5902  H HD23 . LEU A 1 67  ? 11.380  17.727  -1.677  1.00 31.54 ? 62  LEU A HD23 3  
ATOM 5903  N N    . GLN A 1 68  ? 12.495  11.576  -0.418  1.00 22.33 ? 63  GLN A N    3  
ATOM 5904  C CA   . GLN A 1 68  ? 12.117  10.427  0.397   1.00 45.55 ? 63  GLN A CA   3  
ATOM 5905  C C    . GLN A 1 68  ? 13.349  9.766   1.007   1.00 65.04 ? 63  GLN A C    3  
ATOM 5906  O O    . GLN A 1 68  ? 13.244  8.749   1.692   1.00 3.32  ? 63  GLN A O    3  
ATOM 5907  C CB   . GLN A 1 68  ? 11.343  9.411   -0.443  1.00 22.35 ? 63  GLN A CB   3  
ATOM 5908  C CG   . GLN A 1 68  ? 9.834   9.510   -0.279  1.00 43.51 ? 63  GLN A CG   3  
ATOM 5909  C CD   . GLN A 1 68  ? 9.175   8.155   -0.119  1.00 34.11 ? 63  GLN A CD   3  
ATOM 5910  O OE1  . GLN A 1 68  ? 9.327   7.273   -0.965  1.00 4.31  ? 63  GLN A OE1  3  
ATOM 5911  N NE2  . GLN A 1 68  ? 8.437   7.980   0.971   1.00 65.34 ? 63  GLN A NE2  3  
ATOM 5912  H H    . GLN A 1 68  ? 12.709  11.441  -1.364  1.00 54.31 ? 63  GLN A H    3  
ATOM 5913  H HA   . GLN A 1 68  ? 11.483  10.781  1.194   1.00 73.20 ? 63  GLN A HA   3  
ATOM 5914  H HB3  . GLN A 1 68  ? 11.649  8.416   -0.156  1.00 53.53 ? 63  GLN A HB3  3  
ATOM 5915  H HG3  . GLN A 1 68  ? 9.422   9.994   -1.151  1.00 3.23  ? 63  GLN A HG3  3  
ATOM 5916  H HE21 . GLN A 1 68  ? 8.360   8.728   1.602   1.00 11.13 ? 63  GLN A HE21 3  
ATOM 5917  H HE22 . GLN A 1 68  ? 7.998   7.114   1.100   1.00 61.34 ? 63  GLN A HE22 3  
ATOM 5918  N N    . GLN A 1 69  ? 14.516  10.351  0.754   1.00 41.14 ? 64  GLN A N    3  
ATOM 5919  C CA   . GLN A 1 69  ? 15.767  9.818   1.278   1.00 53.21 ? 64  GLN A CA   3  
ATOM 5920  C C    . GLN A 1 69  ? 16.058  8.439   0.695   1.00 41.34 ? 64  GLN A C    3  
ATOM 5921  O O    . GLN A 1 69  ? 15.154  7.703   0.297   1.00 41.32 ? 64  GLN A O    3  
ATOM 5922  C CB   . GLN A 1 69  ? 15.712  9.737   2.805   1.00 52.25 ? 64  GLN A CB   3  
ATOM 5923  C CG   . GLN A 1 69  ? 15.101  10.966  3.458   1.00 64.11 ? 64  GLN A CG   3  
ATOM 5924  C CD   . GLN A 1 69  ? 15.184  10.925  4.971   1.00 24.14 ? 64  GLN A CD   3  
ATOM 5925  O OE1  . GLN A 1 69  ? 15.959  11.661  5.582   1.00 44.32 ? 64  GLN A OE1  3  
ATOM 5926  N NE2  . GLN A 1 69  ? 14.382  10.063  5.585   1.00 22.43 ? 64  GLN A NE2  3  
ATOM 5927  H H    . GLN A 1 69  ? 14.535  11.161  0.202   1.00 14.43 ? 64  GLN A H    3  
ATOM 5928  H HA   . GLN A 1 69  ? 16.561  10.491  0.991   1.00 0.41  ? 64  GLN A HA   3  
ATOM 5929  H HB3  . GLN A 1 69  ? 16.717  9.617   3.184   1.00 62.01 ? 64  GLN A HB3  3  
ATOM 5930  H HG3  . GLN A 1 69  ? 14.063  11.032  3.169   1.00 15.23 ? 64  GLN A HG3  3  
ATOM 5931  H HE21 . GLN A 1 69  ? 13.790  9.509   5.033   1.00 32.11 ? 64  GLN A HE21 3  
ATOM 5932  H HE22 . GLN A 1 69  ? 14.415  10.016  6.562   1.00 34.42 ? 64  GLN A HE22 3  
ATOM 5933  N N    . PRO A 1 70  ? 17.350  8.079   0.640   1.00 35.34 ? 65  PRO A N    3  
ATOM 5934  C CA   . PRO A 1 70  ? 17.788  6.786   0.107   1.00 42.35 ? 65  PRO A CA   3  
ATOM 5935  C C    . PRO A 1 70  ? 17.401  5.623   1.014   1.00 2.44  ? 65  PRO A C    3  
ATOM 5936  O O    . PRO A 1 70  ? 16.959  5.825   2.143   1.00 72.43 ? 65  PRO A O    3  
ATOM 5937  C CB   . PRO A 1 70  ? 19.311  6.929   0.041   1.00 55.14 ? 65  PRO A CB   3  
ATOM 5938  C CG   . PRO A 1 70  ? 19.641  7.951   1.073   1.00 72.35 ? 65  PRO A CG   3  
ATOM 5939  C CD   . PRO A 1 70  ? 18.479  8.906   1.096   1.00 21.24 ? 65  PRO A CD   3  
ATOM 5940  H HA   . PRO A 1 70  ? 17.399  6.613   -0.886  1.00 22.41 ? 65  PRO A HA   3  
ATOM 5941  H HB3  . PRO A 1 70  ? 19.605  7.256   -0.945  1.00 32.32 ? 65  PRO A HB3  3  
ATOM 5942  H HG3  . PRO A 1 70  ? 20.547  8.471   0.799   1.00 70.10 ? 65  PRO A HG3  3  
ATOM 5943  H HD3  . PRO A 1 70  ? 18.653  9.728   0.417   1.00 35.22 ? 65  PRO A HD3  3  
ATOM 5944  N N    . SER A 1 71  ? 17.571  4.404   0.510   1.00 23.33 ? 66  SER A N    3  
ATOM 5945  C CA   . SER A 1 71  ? 17.236  3.208   1.273   1.00 72.42 ? 66  SER A CA   3  
ATOM 5946  C C    . SER A 1 71  ? 15.723  3.043   1.387   1.00 61.25 ? 66  SER A C    3  
ATOM 5947  O O    . SER A 1 71  ? 15.142  2.128   0.806   1.00 24.23 ? 66  SER A O    3  
ATOM 5948  C CB   . SER A 1 71  ? 17.859  3.277   2.668   1.00 55.35 ? 66  SER A CB   3  
ATOM 5949  O OG   . SER A 1 71  ? 18.013  1.982   3.222   1.00 52.32 ? 66  SER A OG   3  
ATOM 5950  H H    . SER A 1 71  ? 17.928  4.309   -0.398  1.00 12.23 ? 66  SER A H    3  
ATOM 5951  H HA   . SER A 1 71  ? 17.641  2.356   0.749   1.00 32.13 ? 66  SER A HA   3  
ATOM 5952  H HB3  . SER A 1 71  ? 17.220  3.859   3.317   1.00 42.30 ? 66  SER A HB3  3  
ATOM 5953  H HG   . SER A 1 71  ? 18.707  1.998   3.885   1.00 74.15 ? 66  SER A HG   3  
ATOM 5954  N N    . GLY A 1 72  ? 15.091  3.937   2.143   1.00 41.42 ? 67  GLY A N    3  
ATOM 5955  C CA   . GLY A 1 72  ? 13.653  3.874   2.321   1.00 10.55 ? 67  GLY A CA   3  
ATOM 5956  C C    . GLY A 1 72  ? 13.246  3.934   3.779   1.00 24.11 ? 67  GLY A C    3  
ATOM 5957  O O    . GLY A 1 72  ? 13.846  4.662   4.568   1.00 72.14 ? 67  GLY A O    3  
ATOM 5958  H H    . GLY A 1 72  ? 15.607  4.645   2.583   1.00 14.22 ? 67  GLY A H    3  
ATOM 5959  H HA2  . GLY A 1 72  ? 13.199  4.701   1.796   1.00 25.03 ? 67  GLY A HA2  3  
ATOM 5960  H HA3  . GLY A 1 72  ? 13.290  2.949   1.895   1.00 73.54 ? 67  GLY A HA3  3  
ATOM 5961  N N    . ASN A 1 73  ? 12.220  3.169   4.138   1.00 52.44 ? 68  ASN A N    3  
ATOM 5962  C CA   . ASN A 1 73  ? 11.732  3.140   5.511   1.00 75.52 ? 68  ASN A CA   3  
ATOM 5963  C C    . ASN A 1 73  ? 12.537  2.156   6.355   1.00 32.22 ? 68  ASN A C    3  
ATOM 5964  O O    . ASN A 1 73  ? 11.975  1.266   6.994   1.00 60.24 ? 68  ASN A O    3  
ATOM 5965  C CB   . ASN A 1 73  ? 10.250  2.761   5.540   1.00 60.30 ? 68  ASN A CB   3  
ATOM 5966  C CG   . ASN A 1 73  ? 9.343   3.956   5.327   1.00 23.55 ? 68  ASN A CG   3  
ATOM 5967  O OD1  . ASN A 1 73  ? 9.802   5.098   5.274   1.00 74.34 ? 68  ASN A OD1  3  
ATOM 5968  N ND2  . ASN A 1 73  ? 8.045   3.700   5.201   1.00 62.31 ? 68  ASN A ND2  3  
ATOM 5969  H H    . ASN A 1 73  ? 11.781  2.610   3.463   1.00 50.44 ? 68  ASN A H    3  
ATOM 5970  H HA   . ASN A 1 73  ? 11.848  4.131   5.925   1.00 51.35 ? 68  ASN A HA   3  
ATOM 5971  H HB3  . ASN A 1 73  ? 10.015  2.320   6.498   1.00 23.22 ? 68  ASN A HB3  3  
ATOM 5972  H HD21 . ASN A 1 73  ? 7.751   2.767   5.253   1.00 33.31 ? 68  ASN A HD21 3  
ATOM 5973  H HD22 . ASN A 1 73  ? 7.437   4.455   5.061   1.00 72.41 ? 68  ASN A HD22 3  
ATOM 5974  N N    . MET A 1 74  ? 13.855  2.324   6.354   1.00 2.51  ? 69  MET A N    3  
ATOM 5975  C CA   . MET A 1 74  ? 14.737  1.451   7.119   1.00 73.24 ? 69  MET A CA   3  
ATOM 5976  C C    . MET A 1 74  ? 15.032  2.048   8.493   1.00 10.52 ? 69  MET A C    3  
ATOM 5977  O O    . MET A 1 74  ? 15.814  2.991   8.614   1.00 73.12 ? 69  MET A O    3  
ATOM 5978  C CB   . MET A 1 74  ? 16.044  1.218   6.360   1.00 53.12 ? 69  MET A CB   3  
ATOM 5979  C CG   . MET A 1 74  ? 16.469  -0.241  6.318   1.00 43.24 ? 69  MET A CG   3  
ATOM 5980  S SD   . MET A 1 74  ? 18.118  -0.504  7.001   1.00 72.22 ? 69  MET A SD   3  
ATOM 5981  C CE   . MET A 1 74  ? 18.982  -1.137  5.566   1.00 62.03 ? 69  MET A CE   3  
ATOM 5982  H H    . MET A 1 74  ? 14.245  3.051   5.824   1.00 71.42 ? 69  MET A H    3  
ATOM 5983  H HA   . MET A 1 74  ? 14.234  0.505   7.252   1.00 32.22 ? 69  MET A HA   3  
ATOM 5984  H HB3  . MET A 1 74  ? 16.830  1.786   6.836   1.00 34.12 ? 69  MET A HB3  3  
ATOM 5985  H HG3  . MET A 1 74  ? 16.463  -0.573  5.291   1.00 44.51 ? 69  MET A HG3  3  
ATOM 5986  H HE1  . MET A 1 74  ? 19.866  -0.543  5.387   1.00 61.00 ? 69  MET A HE1  3  
ATOM 5987  H HE2  . MET A 1 74  ? 19.269  -2.163  5.742   1.00 32.33 ? 69  MET A HE2  3  
ATOM 5988  H HE3  . MET A 1 74  ? 18.333  -1.087  4.704   1.00 74.21 ? 69  MET A HE3  3  
ATOM 5989  N N    . ASP A 1 75  ? 14.403  1.491   9.522   1.00 41.33 ? 70  ASP A N    3  
ATOM 5990  C CA   . ASP A 1 75  ? 14.599  1.967   10.886  1.00 61.22 ? 70  ASP A CA   3  
ATOM 5991  C C    . ASP A 1 75  ? 13.779  1.142   11.873  1.00 43.30 ? 70  ASP A C    3  
ATOM 5992  O O    . ASP A 1 75  ? 14.260  0.784   12.948  1.00 62.12 ? 70  ASP A O    3  
ATOM 5993  C CB   . ASP A 1 75  ? 14.215  3.444   10.993  1.00 35.14 ? 70  ASP A CB   3  
ATOM 5994  C CG   . ASP A 1 75  ? 15.269  4.266   11.708  1.00 71.44 ? 70  ASP A CG   3  
ATOM 5995  O OD1  . ASP A 1 75  ? 15.615  3.917   12.857  1.00 11.50 ? 70  ASP A OD1  3  
ATOM 5996  O OD2  . ASP A 1 75  ? 15.748  5.259   11.121  1.00 21.02 ? 70  ASP A OD2  3  
ATOM 5997  H H    . ASP A 1 75  ? 13.792  0.742   9.360   1.00 1.30  ? 70  ASP A H    3  
ATOM 5998  H HA   . ASP A 1 75  ? 15.645  1.859   11.128  1.00 1.11  ? 70  ASP A HA   3  
ATOM 5999  H HB3  . ASP A 1 75  ? 13.287  3.529   11.539  1.00 21.15 ? 70  ASP A HB3  3  
ATOM 6000  N N    . ASP A 1 76  ? 12.539  0.844   11.500  1.00 63.33 ? 71  ASP A N    3  
ATOM 6001  C CA   . ASP A 1 76  ? 11.651  0.062   12.353  1.00 44.55 ? 71  ASP A CA   3  
ATOM 6002  C C    . ASP A 1 76  ? 12.271  -1.292  12.683  1.00 41.44 ? 71  ASP A C    3  
ATOM 6003  O O    . ASP A 1 76  ? 12.208  -1.753  13.823  1.00 1.02  ? 71  ASP A O    3  
ATOM 6004  C CB   . ASP A 1 76  ? 10.297  -0.136  11.670  1.00 63.24 ? 71  ASP A CB   3  
ATOM 6005  C CG   . ASP A 1 76  ? 9.597   1.178   11.383  1.00 3.42  ? 71  ASP A CG   3  
ATOM 6006  O OD1  . ASP A 1 76  ? 9.522   2.023   12.298  1.00 53.01 ? 71  ASP A OD1  3  
ATOM 6007  O OD2  . ASP A 1 76  ? 9.123   1.360   10.242  1.00 21.15 ? 71  ASP A OD2  3  
ATOM 6008  H H    . ASP A 1 76  ? 12.213  1.159   10.630  1.00 73.05 ? 71  ASP A H    3  
ATOM 6009  H HA   . ASP A 1 76  ? 11.505  0.611   13.271  1.00 14.13 ? 71  ASP A HA   3  
ATOM 6010  H HB3  . ASP A 1 76  ? 9.662   -0.730  12.310  1.00 74.05 ? 71  ASP A HB3  3  
ATOM 6011  N N    . SER A 1 77  ? 12.869  -1.925  11.679  1.00 52.04 ? 72  SER A N    3  
ATOM 6012  C CA   . SER A 1 77  ? 13.496  -3.228  11.862  1.00 54.20 ? 72  SER A CA   3  
ATOM 6013  C C    . SER A 1 77  ? 14.985  -3.166  11.533  1.00 14.21 ? 72  SER A C    3  
ATOM 6014  O O    . SER A 1 77  ? 15.792  -3.888  12.119  1.00 63.50 ? 72  SER A O    3  
ATOM 6015  C CB   . SER A 1 77  ? 12.811  -4.276  10.982  1.00 22.24 ? 72  SER A CB   3  
ATOM 6016  O OG   . SER A 1 77  ? 13.702  -4.780  10.002  1.00 71.11 ? 72  SER A OG   3  
ATOM 6017  H H    . SER A 1 77  ? 12.887  -1.505  10.794  1.00 12.54 ? 72  SER A H    3  
ATOM 6018  H HA   . SER A 1 77  ? 13.380  -3.510  12.898  1.00 72.41 ? 72  SER A HA   3  
ATOM 6019  H HB3  . SER A 1 77  ? 11.965  -3.825  10.483  1.00 62.25 ? 72  SER A HB3  3  
ATOM 6020  H HG   . SER A 1 77  ? 13.218  -5.332  9.383   1.00 42.40 ? 72  SER A HG   3  
ATOM 6021  N N    . GLY A 1 78  ? 15.341  -2.300  10.591  1.00 22.31 ? 73  GLY A N    3  
ATOM 6022  C CA   . GLY A 1 78  ? 16.731  -2.158  10.199  1.00 51.41 ? 73  GLY A CA   3  
ATOM 6023  C C    . GLY A 1 78  ? 17.073  -2.978  8.970   1.00 61.51 ? 73  GLY A C    3  
ATOM 6024  O O    . GLY A 1 78  ? 18.245  -3.235  8.694   1.00 2.02  ? 73  GLY A O    3  
ATOM 6025  H H    . GLY A 1 78  ? 14.654  -1.751  10.157  1.00 34.52 ? 73  GLY A H    3  
ATOM 6026  H HA2  . GLY A 1 78  ? 16.932  -1.118  9.994   1.00 1.22  ? 73  GLY A HA2  3  
ATOM 6027  H HA3  . GLY A 1 78  ? 17.358  -2.480  11.018  1.00 54.51 ? 73  GLY A HA3  3  
ATOM 6028  N N    . PHE A 1 79  ? 16.049  -3.389  8.232   1.00 25.55 ? 74  PHE A N    3  
ATOM 6029  C CA   . PHE A 1 79  ? 16.245  -4.186  7.026   1.00 45.33 ? 74  PHE A CA   3  
ATOM 6030  C C    . PHE A 1 79  ? 15.184  -3.861  5.979   1.00 41.04 ? 74  PHE A C    3  
ATOM 6031  O O    . PHE A 1 79  ? 14.069  -3.459  6.313   1.00 52.53 ? 74  PHE A O    3  
ATOM 6032  C CB   . PHE A 1 79  ? 16.206  -5.677  7.364   1.00 5.55  ? 74  PHE A CB   3  
ATOM 6033  C CG   . PHE A 1 79  ? 17.268  -6.100  8.338   1.00 30.31 ? 74  PHE A CG   3  
ATOM 6034  C CD1  . PHE A 1 79  ? 18.586  -6.234  7.932   1.00 1.31  ? 74  PHE A CD1  3  
ATOM 6035  C CD2  . PHE A 1 79  ? 16.949  -6.362  9.661   1.00 21.11 ? 74  PHE A CD2  3  
ATOM 6036  C CE1  . PHE A 1 79  ? 19.565  -6.623  8.826   1.00 75.32 ? 74  PHE A CE1  3  
ATOM 6037  C CE2  . PHE A 1 79  ? 17.923  -6.752  10.560  1.00 63.22 ? 74  PHE A CE2  3  
ATOM 6038  C CZ   . PHE A 1 79  ? 19.233  -6.881  10.143  1.00 61.01 ? 74  PHE A CZ   3  
ATOM 6039  H H    . PHE A 1 79  ? 15.137  -3.151  8.503   1.00 73.22 ? 74  PHE A H    3  
ATOM 6040  H HA   . PHE A 1 79  ? 17.217  -3.941  6.624   1.00 13.33 ? 74  PHE A HA   3  
ATOM 6041  H HB3  . PHE A 1 79  ? 16.340  -6.248  6.457   1.00 64.02 ? 74  PHE A HB3  3  
ATOM 6042  H HD1  . PHE A 1 79  ? 18.848  -6.032  6.904   1.00 34.44 ? 74  PHE A HD1  3  
ATOM 6043  H HD2  . PHE A 1 79  ? 15.924  -6.260  9.988   1.00 15.24 ? 74  PHE A HD2  3  
ATOM 6044  H HE1  . PHE A 1 79  ? 20.588  -6.724  8.499   1.00 0.20  ? 74  PHE A HE1  3  
ATOM 6045  H HE2  . PHE A 1 79  ? 17.660  -6.953  11.588  1.00 65.53 ? 74  PHE A HE2  3  
ATOM 6046  H HZ   . PHE A 1 79  ? 19.996  -7.186  10.844  1.00 0.12  ? 74  PHE A HZ   3  
ATOM 6047  N N    . PHE A 1 80  ? 15.539  -4.038  4.711   1.00 70.21 ? 75  PHE A N    3  
ATOM 6048  C CA   . PHE A 1 80  ? 14.619  -3.763  3.614   1.00 34.55 ? 75  PHE A CA   3  
ATOM 6049  C C    . PHE A 1 80  ? 14.047  -2.352  3.724   1.00 54.24 ? 75  PHE A C    3  
ATOM 6050  O O    . PHE A 1 80  ? 14.453  -1.572  4.585   1.00 40.00 ? 75  PHE A O    3  
ATOM 6051  C CB   . PHE A 1 80  ? 13.481  -4.786  3.606   1.00 11.21 ? 75  PHE A CB   3  
ATOM 6052  C CG   . PHE A 1 80  ? 13.808  -6.039  2.844   1.00 1.10  ? 75  PHE A CG   3  
ATOM 6053  C CD1  . PHE A 1 80  ? 14.548  -7.052  3.434   1.00 24.11 ? 75  PHE A CD1  3  
ATOM 6054  C CD2  . PHE A 1 80  ? 13.375  -6.204  1.538   1.00 75.02 ? 75  PHE A CD2  3  
ATOM 6055  C CE1  . PHE A 1 80  ? 14.851  -8.204  2.735   1.00 14.21 ? 75  PHE A CE1  3  
ATOM 6056  C CE2  . PHE A 1 80  ? 13.674  -7.356  0.834   1.00 41.20 ? 75  PHE A CE2  3  
ATOM 6057  C CZ   . PHE A 1 80  ? 14.412  -8.357  1.434   1.00 1.40  ? 75  PHE A CZ   3  
ATOM 6058  H H    . PHE A 1 80  ? 16.442  -4.360  4.507   1.00 54.31 ? 75  PHE A H    3  
ATOM 6059  H HA   . PHE A 1 80  ? 15.171  -3.843  2.690   1.00 71.12 ? 75  PHE A HA   3  
ATOM 6060  H HB3  . PHE A 1 80  ? 12.608  -4.340  3.154   1.00 13.21 ? 75  PHE A HB3  3  
ATOM 6061  H HD1  . PHE A 1 80  ? 14.891  -6.934  4.451   1.00 23.11 ? 75  PHE A HD1  3  
ATOM 6062  H HD2  . PHE A 1 80  ? 12.797  -5.421  1.068   1.00 2.04  ? 75  PHE A HD2  3  
ATOM 6063  H HE1  . PHE A 1 80  ? 15.428  -8.986  3.206   1.00 21.13 ? 75  PHE A HE1  3  
ATOM 6064  H HE2  . PHE A 1 80  ? 13.329  -7.473  -0.183  1.00 62.14 ? 75  PHE A HE2  3  
ATOM 6065  H HZ   . PHE A 1 80  ? 14.647  -9.257  0.885   1.00 51.14 ? 75  PHE A HZ   3  
ATOM 6066  N N    . SER A 1 81  ? 13.102  -2.032  2.845   1.00 73.15 ? 76  SER A N    3  
ATOM 6067  C CA   . SER A 1 81  ? 12.478  -0.715  2.841   1.00 4.22  ? 76  SER A CA   3  
ATOM 6068  C C    . SER A 1 81  ? 11.246  -0.702  1.941   1.00 24.40 ? 76  SER A C    3  
ATOM 6069  O O    . SER A 1 81  ? 10.987  -1.658  1.210   1.00 71.50 ? 76  SER A O    3  
ATOM 6070  C CB   . SER A 1 81  ? 13.477  0.345   2.372   1.00 23.01 ? 76  SER A CB   3  
ATOM 6071  O OG   . SER A 1 81  ? 13.930  1.134   3.458   1.00 43.31 ? 76  SER A OG   3  
ATOM 6072  H H    . SER A 1 81  ? 12.821  -2.698  2.184   1.00 4.32  ? 76  SER A H    3  
ATOM 6073  H HA   . SER A 1 81  ? 12.173  -0.488  3.851   1.00 50.43 ? 76  SER A HA   3  
ATOM 6074  H HB3  . SER A 1 81  ? 13.000  0.990   1.648   1.00 14.22 ? 76  SER A HB3  3  
ATOM 6075  H HG   . SER A 1 81  ? 14.792  0.821   3.742   1.00 42.14 ? 76  SER A HG   3  
ATOM 6076  N N    . ILE A 1 82  ? 10.489  0.389   2.001   1.00 45.42 ? 77  ILE A N    3  
ATOM 6077  C CA   . ILE A 1 82  ? 9.285   0.529   1.191   1.00 53.12 ? 77  ILE A CA   3  
ATOM 6078  C C    . ILE A 1 82  ? 9.626   0.603   -0.293  1.00 34.24 ? 77  ILE A C    3  
ATOM 6079  O O    . ILE A 1 82  ? 8.831   0.201   -1.143  1.00 74.32 ? 77  ILE A O    3  
ATOM 6080  C CB   . ILE A 1 82  ? 8.483   1.783   1.585   1.00 60.22 ? 77  ILE A CB   3  
ATOM 6081  C CG1  . ILE A 1 82  ? 7.670   1.517   2.854   1.00 24.20 ? 77  ILE A CG1  3  
ATOM 6082  C CG2  . ILE A 1 82  ? 7.572   2.209   0.445   1.00 3.02  ? 77  ILE A CG2  3  
ATOM 6083  C CD1  . ILE A 1 82  ? 6.498   0.586   2.636   1.00 0.11  ? 77  ILE A CD1  3  
ATOM 6084  H H    . ILE A 1 82  ? 10.747  1.118   2.602   1.00 71.04 ? 77  ILE A H    3  
ATOM 6085  H HA   . ILE A 1 82  ? 8.665   -0.340  1.364   1.00 43.03 ? 77  ILE A HA   3  
ATOM 6086  H HB   . ILE A 1 82  ? 9.182   2.584   1.775   1.00 35.24 ? 77  ILE A HB   3  
ATOM 6087  H HG13 . ILE A 1 82  ? 7.285   2.454   3.229   1.00 23.41 ? 77  ILE A HG13 3  
ATOM 6088  H HG21 . ILE A 1 82  ? 6.878   2.958   0.799   1.00 11.51 ? 77  ILE A HG21 3  
ATOM 6089  H HG22 . ILE A 1 82  ? 8.167   2.622   -0.356  1.00 31.02 ? 77  ILE A HG22 3  
ATOM 6090  H HG23 . ILE A 1 82  ? 7.023   1.354   0.082   1.00 13.41 ? 77  ILE A HG23 3  
ATOM 6091  H HD11 . ILE A 1 82  ? 6.781   -0.193  1.944   1.00 11.13 ? 77  ILE A HD11 3  
ATOM 6092  H HD12 . ILE A 1 82  ? 6.208   0.145   3.577   1.00 71.32 ? 77  ILE A HD12 3  
ATOM 6093  H HD13 . ILE A 1 82  ? 5.666   1.144   2.229   1.00 11.41 ? 77  ILE A HD13 3  
ATOM 6094  N N    . GLN A 1 83  ? 10.813  1.117   -0.597  1.00 62.20 ? 78  GLN A N    3  
ATOM 6095  C CA   . GLN A 1 83  ? 11.259  1.243   -1.980  1.00 61.54 ? 78  GLN A CA   3  
ATOM 6096  C C    . GLN A 1 83  ? 11.343  -0.124  -2.651  1.00 24.01 ? 78  GLN A C    3  
ATOM 6097  O O    . GLN A 1 83  ? 10.825  -0.320  -3.751  1.00 71.44 ? 78  GLN A O    3  
ATOM 6098  C CB   . GLN A 1 83  ? 12.621  1.938   -2.037  1.00 54.13 ? 78  GLN A CB   3  
ATOM 6099  C CG   . GLN A 1 83  ? 12.561  3.423   -1.717  1.00 53.41 ? 78  GLN A CG   3  
ATOM 6100  C CD   . GLN A 1 83  ? 13.382  4.260   -2.678  1.00 21.11 ? 78  GLN A CD   3  
ATOM 6101  O OE1  . GLN A 1 83  ? 14.579  4.466   -2.474  1.00 72.51 ? 78  GLN A OE1  3  
ATOM 6102  N NE2  . GLN A 1 83  ? 12.742  4.748   -3.734  1.00 32.21 ? 78  GLN A NE2  3  
ATOM 6103  H H    . GLN A 1 83  ? 11.402  1.420   0.125   1.00 23.22 ? 78  GLN A H    3  
ATOM 6104  H HA   . GLN A 1 83  ? 10.536  1.846   -2.509  1.00 72.34 ? 78  GLN A HA   3  
ATOM 6105  H HB3  . GLN A 1 83  ? 13.029  1.822   -3.030  1.00 14.45 ? 78  GLN A HB3  3  
ATOM 6106  H HG3  . GLN A 1 83  ? 12.936  3.577   -0.717  1.00 32.11 ? 78  GLN A HG3  3  
ATOM 6107  H HE21 . GLN A 1 83  ? 11.787  4.543   -3.831  1.00 3.54  ? 78  GLN A HE21 3  
ATOM 6108  H HE22 . GLN A 1 83  ? 13.247  5.293   -4.371  1.00 1.43  ? 78  GLN A HE22 3  
ATOM 6109  N N    . VAL A 1 84  ? 12.000  -1.067  -1.982  1.00 64.31 ? 79  VAL A N    3  
ATOM 6110  C CA   . VAL A 1 84  ? 12.152  -2.415  -2.513  1.00 12.34 ? 79  VAL A CA   3  
ATOM 6111  C C    . VAL A 1 84  ? 10.830  -3.175  -2.472  1.00 64.41 ? 79  VAL A C    3  
ATOM 6112  O O    . VAL A 1 84  ? 10.508  -3.931  -3.388  1.00 14.41 ? 79  VAL A O    3  
ATOM 6113  C CB   . VAL A 1 84  ? 13.213  -3.211  -1.731  1.00 51.31 ? 79  VAL A CB   3  
ATOM 6114  C CG1  . VAL A 1 84  ? 12.894  -3.205  -0.243  1.00 43.43 ? 79  VAL A CG1  3  
ATOM 6115  C CG2  . VAL A 1 84  ? 13.307  -4.635  -2.258  1.00 50.11 ? 79  VAL A CG2  3  
ATOM 6116  H H    . VAL A 1 84  ? 12.392  -0.849  -1.110  1.00 32.24 ? 79  VAL A H    3  
ATOM 6117  H HA   . VAL A 1 84  ? 12.477  -2.335  -3.540  1.00 11.52 ? 79  VAL A HA   3  
ATOM 6118  H HB   . VAL A 1 84  ? 14.170  -2.732  -1.873  1.00 53.41 ? 79  VAL A HB   3  
ATOM 6119  H HG11 . VAL A 1 84  ? 13.634  -3.789  0.285   1.00 53.42 ? 79  VAL A HG11 3  
ATOM 6120  H HG12 . VAL A 1 84  ? 12.907  -2.190  0.124   1.00 64.11 ? 79  VAL A HG12 3  
ATOM 6121  H HG13 . VAL A 1 84  ? 11.917  -3.634  -0.083  1.00 31.31 ? 79  VAL A HG13 3  
ATOM 6122  H HG21 . VAL A 1 84  ? 12.790  -4.702  -3.203  1.00 1.42  ? 79  VAL A HG21 3  
ATOM 6123  H HG22 . VAL A 1 84  ? 14.346  -4.900  -2.396  1.00 14.44 ? 79  VAL A HG22 3  
ATOM 6124  H HG23 . VAL A 1 84  ? 12.854  -5.312  -1.550  1.00 2.35  ? 79  VAL A HG23 3  
ATOM 6125  N N    . ILE A 1 85  ? 10.068  -2.966  -1.403  1.00 4.33  ? 80  ILE A N    3  
ATOM 6126  C CA   . ILE A 1 85  ? 8.780   -3.630  -1.244  1.00 73.44 ? 80  ILE A CA   3  
ATOM 6127  C C    . ILE A 1 85  ? 7.796   -3.187  -2.320  1.00 61.51 ? 80  ILE A C    3  
ATOM 6128  O O    . ILE A 1 85  ? 7.193   -4.015  -3.003  1.00 24.12 ? 80  ILE A O    3  
ATOM 6129  C CB   . ILE A 1 85  ? 8.170   -3.346  0.143   1.00 2.21  ? 80  ILE A CB   3  
ATOM 6130  C CG1  . ILE A 1 85  ? 8.997   -4.023  1.237   1.00 12.03 ? 80  ILE A CG1  3  
ATOM 6131  C CG2  . ILE A 1 85  ? 6.725   -3.822  0.192   1.00 55.41 ? 80  ILE A CG2  3  
ATOM 6132  C CD1  . ILE A 1 85  ? 8.966   -5.535  1.171   1.00 22.23 ? 80  ILE A CD1  3  
ATOM 6133  H H    . ILE A 1 85  ? 10.380  -2.352  -0.707  1.00 34.31 ? 80  ILE A H    3  
ATOM 6134  H HA   . ILE A 1 85  ? 8.940   -4.694  -1.333  1.00 40.33 ? 80  ILE A HA   3  
ATOM 6135  H HB   . ILE A 1 85  ? 8.178   -2.279  0.303   1.00 30.01 ? 80  ILE A HB   3  
ATOM 6136  H HG13 . ILE A 1 85  ? 8.616   -3.725  2.202   1.00 20.41 ? 80  ILE A HG13 3  
ATOM 6137  H HG21 . ILE A 1 85  ? 6.079   -3.051  -0.201  1.00 54.52 ? 80  ILE A HG21 3  
ATOM 6138  H HG22 . ILE A 1 85  ? 6.621   -4.717  -0.405  1.00 60.35 ? 80  ILE A HG22 3  
ATOM 6139  H HG23 . ILE A 1 85  ? 6.451   -4.036  1.213   1.00 55.44 ? 80  ILE A HG23 3  
ATOM 6140  H HD11 . ILE A 1 85  ? 9.515   -5.943  2.005   1.00 52.55 ? 80  ILE A HD11 3  
ATOM 6141  H HD12 . ILE A 1 85  ? 7.942   -5.876  1.211   1.00 41.40 ? 80  ILE A HD12 3  
ATOM 6142  H HD13 . ILE A 1 85  ? 9.419   -5.863  0.246   1.00 55.24 ? 80  ILE A HD13 3  
ATOM 6143  N N    . SER A 1 86  ? 7.640   -1.875  -2.468  1.00 42.10 ? 81  SER A N    3  
ATOM 6144  C CA   . SER A 1 86  ? 6.727   -1.321  -3.461  1.00 43.31 ? 81  SER A CA   3  
ATOM 6145  C C    . SER A 1 86  ? 7.156   -1.714  -4.872  1.00 50.51 ? 81  SER A C    3  
ATOM 6146  O O    . SER A 1 86  ? 6.326   -2.072  -5.707  1.00 50.42 ? 81  SER A O    3  
ATOM 6147  C CB   . SER A 1 86  ? 6.670   0.202   -3.339  1.00 23.30 ? 81  SER A CB   3  
ATOM 6148  O OG   . SER A 1 86  ? 5.846   0.765   -4.345  1.00 1.12  ? 81  SER A OG   3  
ATOM 6149  H H    . SER A 1 86  ? 8.149   -1.266  -1.893  1.00 23.32 ? 81  SER A H    3  
ATOM 6150  H HA   . SER A 1 86  ? 5.744   -1.726  -3.271  1.00 55.04 ? 81  SER A HA   3  
ATOM 6151  H HB3  . SER A 1 86  ? 7.667   0.606   -3.439  1.00 21.32 ? 81  SER A HB3  3  
ATOM 6152  H HG   . SER A 1 86  ? 6.267   1.549   -4.704  1.00 41.35 ? 81  SER A HG   3  
ATOM 6153  N N    . ASN A 1 87  ? 8.458   -1.644  -5.129  1.00 72.33 ? 82  ASN A N    3  
ATOM 6154  C CA   . ASN A 1 87  ? 8.999   -1.991  -6.438  1.00 72.42 ? 82  ASN A CA   3  
ATOM 6155  C C    . ASN A 1 87  ? 8.679   -3.440  -6.792  1.00 32.51 ? 82  ASN A C    3  
ATOM 6156  O O    . ASN A 1 87  ? 8.235   -3.736  -7.901  1.00 63.42 ? 82  ASN A O    3  
ATOM 6157  C CB   . ASN A 1 87  ? 10.512  -1.770  -6.463  1.00 72.02 ? 82  ASN A CB   3  
ATOM 6158  C CG   . ASN A 1 87  ? 11.109  -2.004  -7.837  1.00 64.42 ? 82  ASN A CG   3  
ATOM 6159  O OD1  . ASN A 1 87  ? 11.428  -1.057  -8.557  1.00 24.42 ? 82  ASN A OD1  3  
ATOM 6160  N ND2  . ASN A 1 87  ? 11.261  -3.269  -8.208  1.00 44.20 ? 82  ASN A ND2  3  
ATOM 6161  H H    . ASN A 1 87  ? 9.069   -1.351  -4.421  1.00 44.52 ? 82  ASN A H    3  
ATOM 6162  H HA   . ASN A 1 87  ? 8.538   -1.344  -7.169  1.00 11.11 ? 82  ASN A HA   3  
ATOM 6163  H HB3  . ASN A 1 87  ? 10.981  -2.450  -5.767  1.00 62.11 ? 82  ASN A HB3  3  
ATOM 6164  H HD21 . ASN A 1 87  ? 10.985  -3.972  -7.584  1.00 61.00 ? 82  ASN A HD21 3  
ATOM 6165  H HD22 . ASN A 1 87  ? 11.645  -3.449  -9.092  1.00 4.12  ? 82  ASN A HD22 3  
ATOM 6166  N N    . ALA A 1 88  ? 8.907   -4.340  -5.840  1.00 64.03 ? 83  ALA A N    3  
ATOM 6167  C CA   . ALA A 1 88  ? 8.641   -5.758  -6.050  1.00 64.32 ? 83  ALA A CA   3  
ATOM 6168  C C    . ALA A 1 88  ? 7.168   -6.000  -6.360  1.00 73.33 ? 83  ALA A C    3  
ATOM 6169  O O    . ALA A 1 88  ? 6.831   -6.782  -7.249  1.00 5.14  ? 83  ALA A O    3  
ATOM 6170  C CB   . ALA A 1 88  ? 9.065   -6.560  -4.828  1.00 4.50  ? 83  ALA A CB   3  
ATOM 6171  H H    . ALA A 1 88  ? 9.262   -4.042  -4.976  1.00 12.54 ? 83  ALA A H    3  
ATOM 6172  H HA   . ALA A 1 88  ? 9.235   -6.088  -6.891  1.00 24.21 ? 83  ALA A HA   3  
ATOM 6173  H HB1  . ALA A 1 88  ? 8.284   -6.518  -4.083  1.00 64.10 ? 83  ALA A HB1  3  
ATOM 6174  H HB2  . ALA A 1 88  ? 9.235   -7.587  -5.115  1.00 50.53 ? 83  ALA A HB2  3  
ATOM 6175  H HB3  . ALA A 1 88  ? 9.975   -6.144  -4.423  1.00 31.43 ? 83  ALA A HB3  3  
ATOM 6176  N N    . LEU A 1 89  ? 6.294   -5.326  -5.620  1.00 63.23 ? 84  LEU A N    3  
ATOM 6177  C CA   . LEU A 1 89  ? 4.856   -5.468  -5.815  1.00 2.33  ? 84  LEU A CA   3  
ATOM 6178  C C    . LEU A 1 89  ? 4.425   -4.860  -7.147  1.00 34.34 ? 84  LEU A C    3  
ATOM 6179  O O    . LEU A 1 89  ? 3.629   -5.447  -7.881  1.00 12.33 ? 84  LEU A O    3  
ATOM 6180  C CB   . LEU A 1 89  ? 4.097   -4.800  -4.668  1.00 53.02 ? 84  LEU A CB   3  
ATOM 6181  C CG   . LEU A 1 89  ? 4.354   -5.371  -3.272  1.00 72.42 ? 84  LEU A CG   3  
ATOM 6182  C CD1  . LEU A 1 89  ? 3.802   -4.439  -2.204  1.00 23.52 ? 84  LEU A CD1  3  
ATOM 6183  C CD2  . LEU A 1 89  ? 3.740   -6.757  -3.141  1.00 75.13 ? 84  LEU A CD2  3  
ATOM 6184  H H    . LEU A 1 89  ? 6.623   -4.717  -4.926  1.00 4.22  ? 84  LEU A H    3  
ATOM 6185  H HA   . LEU A 1 89  ? 4.625   -6.523  -5.823  1.00 2.11  ? 84  LEU A HA   3  
ATOM 6186  H HB3  . LEU A 1 89  ? 3.039   -4.891  -4.874  1.00 50.54 ? 84  LEU A HB3  3  
ATOM 6187  H HG   . LEU A 1 89  ? 5.420   -5.460  -3.118  1.00 75.14 ? 84  LEU A HG   3  
ATOM 6188  H HD11 . LEU A 1 89  ? 4.618   -3.926  -1.718  1.00 32.12 ? 84  LEU A HD11 3  
ATOM 6189  H HD12 . LEU A 1 89  ? 3.251   -5.013  -1.475  1.00 42.51 ? 84  LEU A HD12 3  
ATOM 6190  H HD13 . LEU A 1 89  ? 3.144   -3.715  -2.664  1.00 61.44 ? 84  LEU A HD13 3  
ATOM 6191  H HD21 . LEU A 1 89  ? 4.294   -7.455  -3.751  1.00 60.11 ? 84  LEU A HD21 3  
ATOM 6192  H HD22 . LEU A 1 89  ? 2.711   -6.728  -3.472  1.00 71.14 ? 84  LEU A HD22 3  
ATOM 6193  H HD23 . LEU A 1 89  ? 3.778   -7.071  -2.109  1.00 14.41 ? 84  LEU A HD23 3  
ATOM 6194  N N    . LYS A 1 90  ? 4.955   -3.682  -7.453  1.00 71.12 ? 85  LYS A N    3  
ATOM 6195  C CA   . LYS A 1 90  ? 4.628   -2.995  -8.697  1.00 55.03 ? 85  LYS A CA   3  
ATOM 6196  C C    . LYS A 1 90  ? 4.946   -3.874  -9.903  1.00 22.32 ? 85  LYS A C    3  
ATOM 6197  O O    . LYS A 1 90  ? 4.194   -3.904  -10.876 1.00 10.45 ? 85  LYS A O    3  
ATOM 6198  C CB   . LYS A 1 90  ? 5.401   -1.678  -8.794  1.00 21.41 ? 85  LYS A CB   3  
ATOM 6199  C CG   . LYS A 1 90  ? 5.259   -0.987  -10.140 1.00 74.33 ? 85  LYS A CG   3  
ATOM 6200  C CD   . LYS A 1 90  ? 5.498   0.509   -10.026 1.00 45.32 ? 85  LYS A CD   3  
ATOM 6201  C CE   . LYS A 1 90  ? 6.931   0.815   -9.615  1.00 12.43 ? 85  LYS A CE   3  
ATOM 6202  N NZ   . LYS A 1 90  ? 6.988   1.717   -8.432  1.00 34.43 ? 85  LYS A NZ   3  
ATOM 6203  H H    . LYS A 1 90  ? 5.583   -3.263  -6.827  1.00 33.43 ? 85  LYS A H    3  
ATOM 6204  H HA   . LYS A 1 90  ? 3.570   -2.782  -8.690  1.00 61.10 ? 85  LYS A HA   3  
ATOM 6205  H HB3  . LYS A 1 90  ? 6.449   -1.876  -8.623  1.00 5.42  ? 85  LYS A HB3  3  
ATOM 6206  H HG3  . LYS A 1 90  ? 4.259   -1.155  -10.516 1.00 63.33 ? 85  LYS A HG3  3  
ATOM 6207  H HD3  . LYS A 1 90  ? 4.825   0.918   -9.286  1.00 45.00 ? 85  LYS A HD3  3  
ATOM 6208  H HE3  . LYS A 1 90  ? 7.435   1.290   -10.444 1.00 74.02 ? 85  LYS A HE3  3  
ATOM 6209  H HZ1  . LYS A 1 90  ? 6.399   2.559   -8.596  1.00 43.12 ? 85  LYS A HZ1  3  
ATOM 6210  H HZ2  . LYS A 1 90  ? 7.967   2.020   -8.261  1.00 12.51 ? 85  LYS A HZ2  3  
ATOM 6211  H HZ3  . LYS A 1 90  ? 6.637   1.221   -7.588  1.00 32.13 ? 85  LYS A HZ3  3  
ATOM 6212  N N    . VAL A 1 91  ? 6.065   -4.587  -9.830  1.00 4.55  ? 86  VAL A N    3  
ATOM 6213  C CA   . VAL A 1 91  ? 6.481   -5.468  -10.915 1.00 4.23  ? 86  VAL A CA   3  
ATOM 6214  C C    . VAL A 1 91  ? 5.403   -6.500  -11.230 1.00 24.55 ? 86  VAL A C    3  
ATOM 6215  O O    . VAL A 1 91  ? 5.218   -6.886  -12.384 1.00 72.15 ? 86  VAL A O    3  
ATOM 6216  C CB   . VAL A 1 91  ? 7.792   -6.200  -10.572 1.00 14.42 ? 86  VAL A CB   3  
ATOM 6217  C CG1  . VAL A 1 91  ? 8.179   -7.155  -11.691 1.00 34.23 ? 86  VAL A CG1  3  
ATOM 6218  C CG2  . VAL A 1 91  ? 8.906   -5.200  -10.304 1.00 2.41  ? 86  VAL A CG2  3  
ATOM 6219  H H    . VAL A 1 91  ? 6.624   -4.520  -9.029  1.00 74.30 ? 86  VAL A H    3  
ATOM 6220  H HA   . VAL A 1 91  ? 6.652   -4.861  -11.792 1.00 20.23 ? 86  VAL A HA   3  
ATOM 6221  H HB   . VAL A 1 91  ? 7.633   -6.779  -9.674  1.00 12.51 ? 86  VAL A HB   3  
ATOM 6222  H HG11 . VAL A 1 91  ? 7.912   -6.721  -12.643 1.00 4.13  ? 86  VAL A HG11 3  
ATOM 6223  H HG12 . VAL A 1 91  ? 9.244   -7.334  -11.662 1.00 72.35 ? 86  VAL A HG12 3  
ATOM 6224  H HG13 . VAL A 1 91  ? 7.654   -8.091  -11.564 1.00 71.32 ? 86  VAL A HG13 3  
ATOM 6225  H HG21 . VAL A 1 91  ? 9.706   -5.356  -11.013 1.00 52.32 ? 86  VAL A HG21 3  
ATOM 6226  H HG22 . VAL A 1 91  ? 8.522   -4.196  -10.410 1.00 42.21 ? 86  VAL A HG22 3  
ATOM 6227  H HG23 . VAL A 1 91  ? 9.281   -5.338  -9.302  1.00 52.52 ? 86  VAL A HG23 3  
ATOM 6228  N N    . TRP A 1 92  ? 4.693   -6.939  -10.197 1.00 44.53 ? 87  TRP A N    3  
ATOM 6229  C CA   . TRP A 1 92  ? 3.633   -7.926  -10.364 1.00 71.24 ? 87  TRP A CA   3  
ATOM 6230  C C    . TRP A 1 92  ? 2.316   -7.251  -10.731 1.00 15.15 ? 87  TRP A C    3  
ATOM 6231  O O    . TRP A 1 92  ? 1.426   -7.878  -11.306 1.00 43.33 ? 87  TRP A O    3  
ATOM 6232  C CB   . TRP A 1 92  ? 3.462   -8.743  -9.081  1.00 3.24  ? 87  TRP A CB   3  
ATOM 6233  C CG   . TRP A 1 92  ? 4.755   -9.270  -8.536  1.00 71.51 ? 87  TRP A CG   3  
ATOM 6234  C CD1  . TRP A 1 92  ? 5.879   -9.580  -9.247  1.00 61.11 ? 87  TRP A CD1  3  
ATOM 6235  C CD2  . TRP A 1 92  ? 5.056   -9.549  -7.165  1.00 71.14 ? 87  TRP A CD2  3  
ATOM 6236  N NE1  . TRP A 1 92  ? 6.860   -10.036 -8.401  1.00 71.51 ? 87  TRP A NE1  3  
ATOM 6237  C CE2  . TRP A 1 92  ? 6.381   -10.025 -7.117  1.00 61.43 ? 87  TRP A CE2  3  
ATOM 6238  C CE3  . TRP A 1 92  ? 4.336   -9.441  -5.971  1.00 3.44  ? 87  TRP A CE3  3  
ATOM 6239  C CZ2  . TRP A 1 92  ? 6.997   -10.393 -5.924  1.00 63.42 ? 87  TRP A CZ2  3  
ATOM 6240  C CZ3  . TRP A 1 92  ? 4.949   -9.807  -4.789  1.00 61.44 ? 87  TRP A CZ3  3  
ATOM 6241  C CH2  . TRP A 1 92  ? 6.269   -10.277 -4.771  1.00 13.43 ? 87  TRP A CH2  3  
ATOM 6242  H H    . TRP A 1 92  ? 4.889   -6.593  -9.301  1.00 54.21 ? 87  TRP A H    3  
ATOM 6243  H HA   . TRP A 1 92  ? 3.921   -8.589  -11.166 1.00 43.11 ? 87  TRP A HA   3  
ATOM 6244  H HB3  . TRP A 1 92  ? 2.817   -9.586  -9.284  1.00 21.43 ? 87  TRP A HB3  3  
ATOM 6245  H HD1  . TRP A 1 92  ? 5.968   -9.479  -10.318 1.00 63.11 ? 87  TRP A HD1  3  
ATOM 6246  H HE1  . TRP A 1 92  ? 7.759   -10.320 -8.672  1.00 31.41 ? 87  TRP A HE1  3  
ATOM 6247  H HE3  . TRP A 1 92  ? 3.318   -9.080  -5.965  1.00 73.53 ? 87  TRP A HE3  3  
ATOM 6248  H HZ2  . TRP A 1 92  ? 8.014   -10.756 -5.895  1.00 72.01 ? 87  TRP A HZ2  3  
ATOM 6249  H HZ3  . TRP A 1 92  ? 4.409   -9.730  -3.856  1.00 11.02 ? 87  TRP A HZ3  3  
ATOM 6250  H HH2  . TRP A 1 92  ? 6.708   -10.551 -3.824  1.00 13.24 ? 87  TRP A HH2  3  
ATOM 6251  N N    . GLY A 1 93  ? 2.197   -5.971  -10.394 1.00 33.23 ? 88  GLY A N    3  
ATOM 6252  C CA   . GLY A 1 93  ? 0.984   -5.234  -10.697 1.00 61.22 ? 88  GLY A CA   3  
ATOM 6253  C C    . GLY A 1 93  ? 0.349   -4.629  -9.460  1.00 51.24 ? 88  GLY A C    3  
ATOM 6254  O O    . GLY A 1 93  ? -0.617  -3.872  -9.557  1.00 31.21 ? 88  GLY A O    3  
ATOM 6255  H H    . GLY A 1 93  ? 2.938   -5.523  -9.936  1.00 51.03 ? 88  GLY A H    3  
ATOM 6256  H HA2  . GLY A 1 93  ? 1.221   -4.441  -11.391 1.00 12.14 ? 88  GLY A HA2  3  
ATOM 6257  H HA3  . GLY A 1 93  ? 0.275   -5.905  -11.159 1.00 21.14 ? 88  GLY A HA3  3  
ATOM 6258  N N    . LEU A 1 94  ? 0.892   -4.964  -8.295  1.00 34.33 ? 89  LEU A N    3  
ATOM 6259  C CA   . LEU A 1 94  ? 0.371   -4.450  -7.032  1.00 31.34 ? 89  LEU A CA   3  
ATOM 6260  C C    . LEU A 1 94  ? 1.088   -3.165  -6.632  1.00 31.52 ? 89  LEU A C    3  
ATOM 6261  O O    . LEU A 1 94  ? 2.315   -3.089  -6.672  1.00 61.50 ? 89  LEU A O    3  
ATOM 6262  C CB   . LEU A 1 94  ? 0.525   -5.499  -5.930  1.00 34.30 ? 89  LEU A CB   3  
ATOM 6263  C CG   . LEU A 1 94  ? -0.317  -6.765  -6.085  1.00 21.04 ? 89  LEU A CG   3  
ATOM 6264  C CD1  . LEU A 1 94  ? 0.477   -7.990  -5.660  1.00 41.20 ? 89  LEU A CD1  3  
ATOM 6265  C CD2  . LEU A 1 94  ? -1.602  -6.655  -5.278  1.00 5.04  ? 89  LEU A CD2  3  
ATOM 6266  H H    . LEU A 1 94  ? 1.660   -5.571  -8.281  1.00 2.34  ? 89  LEU A H    3  
ATOM 6267  H HA   . LEU A 1 94  ? -0.679  -4.235  -7.170  1.00 44.33 ? 89  LEU A HA   3  
ATOM 6268  H HB3  . LEU A 1 94  ? 0.255   -5.034  -4.992  1.00 21.24 ? 89  LEU A HB3  3  
ATOM 6269  H HG   . LEU A 1 94  ? -0.584  -6.886  -7.127  1.00 33.13 ? 89  LEU A HG   3  
ATOM 6270  H HD11 . LEU A 1 94  ? 1.532   -7.792  -5.773  1.00 5.41  ? 89  LEU A HD11 3  
ATOM 6271  H HD12 . LEU A 1 94  ? 0.200   -8.832  -6.278  1.00 60.31 ? 89  LEU A HD12 3  
ATOM 6272  H HD13 . LEU A 1 94  ? 0.262   -8.218  -4.626  1.00 63.21 ? 89  LEU A HD13 3  
ATOM 6273  H HD21 . LEU A 1 94  ? -2.451  -6.748  -5.939  1.00 23.53 ? 89  LEU A HD21 3  
ATOM 6274  H HD22 . LEU A 1 94  ? -1.635  -5.694  -4.784  1.00 12.21 ? 89  LEU A HD22 3  
ATOM 6275  H HD23 . LEU A 1 94  ? -1.633  -7.441  -4.539  1.00 3.11  ? 89  LEU A HD23 3  
ATOM 6276  N N    . GLU A 1 95  ? 0.311   -2.157  -6.242  1.00 4.34  ? 90  GLU A N    3  
ATOM 6277  C CA   . GLU A 1 95  ? 0.873   -0.876  -5.832  1.00 23.21 ? 90  GLU A CA   3  
ATOM 6278  C C    . GLU A 1 95  ? 0.287   -0.427  -4.497  1.00 70.12 ? 90  GLU A C    3  
ATOM 6279  O O    . GLU A 1 95  ? -0.900  -0.621  -4.231  1.00 74.55 ? 90  GLU A O    3  
ATOM 6280  C CB   . GLU A 1 95  ? 0.609   0.188   -6.901  1.00 15.52 ? 90  GLU A CB   3  
ATOM 6281  C CG   . GLU A 1 95  ? -0.847  0.273   -7.328  1.00 31.12 ? 90  GLU A CG   3  
ATOM 6282  C CD   . GLU A 1 95  ? -1.130  1.484   -8.195  1.00 73.50 ? 90  GLU A CD   3  
ATOM 6283  O OE1  . GLU A 1 95  ? -0.166  2.065   -8.735  1.00 43.13 ? 90  GLU A OE1  3  
ATOM 6284  O OE2  . GLU A 1 95  ? -2.316  1.851   -8.332  1.00 22.31 ? 90  GLU A OE2  3  
ATOM 6285  H H    . GLU A 1 95  ? -0.660  -2.279  -6.232  1.00 35.23 ? 90  GLU A H    3  
ATOM 6286  H HA   . GLU A 1 95  ? 1.940   -1.002  -5.719  1.00 23.53 ? 90  GLU A HA   3  
ATOM 6287  H HB3  . GLU A 1 95  ? 1.204   -0.040  -7.773  1.00 41.33 ? 90  GLU A HB3  3  
ATOM 6288  H HG3  . GLU A 1 95  ? -1.465  0.327   -6.444  1.00 61.44 ? 90  GLU A HG3  3  
ATOM 6289  N N    . LEU A 1 96  ? 1.127   0.174   -3.662  1.00 74.42 ? 91  LEU A N    3  
ATOM 6290  C CA   . LEU A 1 96  ? 0.693   0.650   -2.353  1.00 71.13 ? 91  LEU A CA   3  
ATOM 6291  C C    . LEU A 1 96  ? 0.460   2.158   -2.372  1.00 54.20 ? 91  LEU A C    3  
ATOM 6292  O O    . LEU A 1 96  ? 1.170   2.897   -3.054  1.00 14.33 ? 91  LEU A O    3  
ATOM 6293  C CB   . LEU A 1 96  ? 1.734   0.297   -1.289  1.00 72.41 ? 91  LEU A CB   3  
ATOM 6294  C CG   . LEU A 1 96  ? 2.216   -1.153  -1.277  1.00 54.32 ? 91  LEU A CG   3  
ATOM 6295  C CD1  . LEU A 1 96  ? 3.590   -1.266  -1.920  1.00 22.42 ? 91  LEU A CD1  3  
ATOM 6296  C CD2  . LEU A 1 96  ? 2.246   -1.694  0.145   1.00 34.13 ? 91  LEU A CD2  3  
ATOM 6297  H H    . LEU A 1 96  ? 2.060   0.300   -3.929  1.00 45.40 ? 91  LEU A H    3  
ATOM 6298  H HA   . LEU A 1 96  ? -0.238  0.157   -2.111  1.00 44.41 ? 91  LEU A HA   3  
ATOM 6299  H HB3  . LEU A 1 96  ? 1.302   0.512   -0.321  1.00 3.21  ? 91  LEU A HB3  3  
ATOM 6300  H HG   . LEU A 1 96  ? 1.529   -1.760  -1.852  1.00 72.41 ? 91  LEU A HG   3  
ATOM 6301  H HD11 . LEU A 1 96  ? 3.481   -1.566  -2.951  1.00 35.35 ? 91  LEU A HD11 3  
ATOM 6302  H HD12 . LEU A 1 96  ? 4.176   -2.000  -1.391  1.00 14.21 ? 91  LEU A HD12 3  
ATOM 6303  H HD13 . LEU A 1 96  ? 4.087   -0.307  -1.875  1.00 72.12 ? 91  LEU A HD13 3  
ATOM 6304  H HD21 . LEU A 1 96  ? 1.319   -1.449  0.643   1.00 33.33 ? 91  LEU A HD21 3  
ATOM 6305  H HD22 . LEU A 1 96  ? 3.071   -1.249  0.682   1.00 41.15 ? 91  LEU A HD22 3  
ATOM 6306  H HD23 . LEU A 1 96  ? 2.368   -2.766  0.120   1.00 54.01 ? 91  LEU A HD23 3  
ATOM 6307  N N    . ILE A 1 97  ? -0.538  2.607   -1.617  1.00 54.24 ? 92  ILE A N    3  
ATOM 6308  C CA   . ILE A 1 97  ? -0.861  4.026   -1.545  1.00 54.32 ? 92  ILE A CA   3  
ATOM 6309  C C    . ILE A 1 97  ? -1.120  4.458   -0.106  1.00 33.42 ? 92  ILE A C    3  
ATOM 6310  O O    . ILE A 1 97  ? -1.694  3.709   0.686   1.00 54.54 ? 92  ILE A O    3  
ATOM 6311  C CB   . ILE A 1 97  ? -2.095  4.366   -2.401  1.00 51.32 ? 92  ILE A CB   3  
ATOM 6312  C CG1  . ILE A 1 97  ? -1.884  3.904   -3.845  1.00 71.34 ? 92  ILE A CG1  3  
ATOM 6313  C CG2  . ILE A 1 97  ? -2.378  5.860   -2.353  1.00 42.11 ? 92  ILE A CG2  3  
ATOM 6314  C CD1  . ILE A 1 97  ? -3.046  4.227   -4.758  1.00 1.51  ? 92  ILE A CD1  3  
ATOM 6315  H H    . ILE A 1 97  ? -1.067  1.969   -1.096  1.00 55.03 ? 92  ILE A H    3  
ATOM 6316  H HA   . ILE A 1 97  ? -0.017  4.580   -1.929  1.00 63.11 ? 92  ILE A HA   3  
ATOM 6317  H HB   . ILE A 1 97  ? -2.947  3.849   -1.986  1.00 21.03 ? 92  ILE A HB   3  
ATOM 6318  H HG13 . ILE A 1 97  ? -1.741  2.833   -3.855  1.00 61.15 ? 92  ILE A HG13 3  
ATOM 6319  H HG21 . ILE A 1 97  ? -1.540  6.398   -2.772  1.00 4.45  ? 92  ILE A HG21 3  
ATOM 6320  H HG22 . ILE A 1 97  ? -3.266  6.076   -2.927  1.00 33.52 ? 92  ILE A HG22 3  
ATOM 6321  H HG23 . ILE A 1 97  ? -2.526  6.166   -1.329  1.00 40.14 ? 92  ILE A HG23 3  
ATOM 6322  H HD11 . ILE A 1 97  ? -3.936  3.732   -4.398  1.00 41.44 ? 92  ILE A HD11 3  
ATOM 6323  H HD12 . ILE A 1 97  ? -3.207  5.294   -4.774  1.00 54.02 ? 92  ILE A HD12 3  
ATOM 6324  H HD13 . ILE A 1 97  ? -2.824  3.882   -5.758  1.00 55.11 ? 92  ILE A HD13 3  
ATOM 6325  N N    . LEU A 1 98  ? -0.697  5.673   0.226   1.00 55.05 ? 93  LEU A N    3  
ATOM 6326  C CA   . LEU A 1 98  ? -0.884  6.207   1.570   1.00 73.33 ? 93  LEU A CA   3  
ATOM 6327  C C    . LEU A 1 98  ? -2.355  6.512   1.835   1.00 35.10 ? 93  LEU A C    3  
ATOM 6328  O O    . LEU A 1 98  ? -2.977  7.294   1.117   1.00 22.13 ? 93  LEU A O    3  
ATOM 6329  C CB   . LEU A 1 98  ? -0.049  7.475   1.758   1.00 54.43 ? 93  LEU A CB   3  
ATOM 6330  C CG   . LEU A 1 98  ? 1.272   7.301   2.509   1.00 43.13 ? 93  LEU A CG   3  
ATOM 6331  C CD1  . LEU A 1 98  ? 2.188   8.490   2.259   1.00 74.11 ? 93  LEU A CD1  3  
ATOM 6332  C CD2  . LEU A 1 98  ? 1.020   7.124   4.000   1.00 43.52 ? 93  LEU A CD2  3  
ATOM 6333  H H    . LEU A 1 98  ? -0.248  6.224   -0.447  1.00 40.34 ? 93  LEU A H    3  
ATOM 6334  H HA   . LEU A 1 98  ? -0.552  5.458   2.275   1.00 64.41 ? 93  LEU A HA   3  
ATOM 6335  H HB3  . LEU A 1 98  ? -0.650  8.188   2.304   1.00 45.24 ? 93  LEU A HB3  3  
ATOM 6336  H HG   . LEU A 1 98  ? 1.773   6.414   2.145   1.00 53.01 ? 93  LEU A HG   3  
ATOM 6337  H HD11 . LEU A 1 98  ? 2.840   8.274   1.426   1.00 61.51 ? 93  LEU A HD11 3  
ATOM 6338  H HD12 . LEU A 1 98  ? 2.782   8.679   3.141   1.00 54.04 ? 93  LEU A HD12 3  
ATOM 6339  H HD13 . LEU A 1 98  ? 1.592   9.363   2.035   1.00 11.22 ? 93  LEU A HD13 3  
ATOM 6340  H HD21 . LEU A 1 98  ? 1.753   7.687   4.557   1.00 51.34 ? 93  LEU A HD21 3  
ATOM 6341  H HD22 . LEU A 1 98  ? 1.099   6.077   4.256   1.00 22.13 ? 93  LEU A HD22 3  
ATOM 6342  H HD23 . LEU A 1 98  ? 0.031   7.482   4.242   1.00 13.42 ? 93  LEU A HD23 3  
ATOM 6343  N N    . PHE A 1 99  ? -2.906  5.889   2.872   1.00 22.41 ? 94  PHE A N    3  
ATOM 6344  C CA   . PHE A 1 99  ? -4.304  6.094   3.233   1.00 32.11 ? 94  PHE A CA   3  
ATOM 6345  C C    . PHE A 1 99  ? -4.608  7.579   3.408   1.00 31.13 ? 94  PHE A C    3  
ATOM 6346  O O    . PHE A 1 99  ? -5.742  8.017   3.219   1.00 21.54 ? 94  PHE A O    3  
ATOM 6347  C CB   . PHE A 1 99  ? -4.636  5.339   4.521   1.00 74.10 ? 94  PHE A CB   3  
ATOM 6348  C CG   . PHE A 1 99  ? -6.064  4.877   4.595   1.00 3.14  ? 94  PHE A CG   3  
ATOM 6349  C CD1  . PHE A 1 99  ? -7.043  5.690   5.143   1.00 44.55 ? 94  PHE A CD1  3  
ATOM 6350  C CD2  . PHE A 1 99  ? -6.427  3.628   4.116   1.00 4.31  ? 94  PHE A CD2  3  
ATOM 6351  C CE1  . PHE A 1 99  ? -8.357  5.268   5.211   1.00 54.32 ? 94  PHE A CE1  3  
ATOM 6352  C CE2  . PHE A 1 99  ? -7.739  3.201   4.181   1.00 25.01 ? 94  PHE A CE2  3  
ATOM 6353  C CZ   . PHE A 1 99  ? -8.705  4.021   4.731   1.00 5.45  ? 94  PHE A CZ   3  
ATOM 6354  H H    . PHE A 1 99  ? -2.359  5.276   3.408   1.00 62.24 ? 94  PHE A H    3  
ATOM 6355  H HA   . PHE A 1 99  ? -4.913  5.705   2.431   1.00 61.24 ? 94  PHE A HA   3  
ATOM 6356  H HB3  . PHE A 1 99  ? -4.452  5.985   5.366   1.00 70.35 ? 94  PHE A HB3  3  
ATOM 6357  H HD1  . PHE A 1 99  ? -6.770  6.666   5.519   1.00 32.32 ? 94  PHE A HD1  3  
ATOM 6358  H HD2  . PHE A 1 99  ? -5.672  2.985   3.686   1.00 74.41 ? 94  PHE A HD2  3  
ATOM 6359  H HE1  . PHE A 1 99  ? -9.109  5.912   5.641   1.00 72.24 ? 94  PHE A HE1  3  
ATOM 6360  H HE2  . PHE A 1 99  ? -8.009  2.226   3.805   1.00 12.24 ? 94  PHE A HE2  3  
ATOM 6361  H HZ   . PHE A 1 99  ? -9.732  3.690   4.782   1.00 41.11 ? 94  PHE A HZ   3  
ATOM 6362  N N    . ASN A 1 100 ? -3.587  8.348   3.769   1.00 53.53 ? 95  ASN A N    3  
ATOM 6363  C CA   . ASN A 1 100 ? -3.745  9.784   3.971   1.00 43.51 ? 95  ASN A CA   3  
ATOM 6364  C C    . ASN A 1 100 ? -3.191  10.564  2.783   1.00 5.24  ? 95  ASN A C    3  
ATOM 6365  O O    . ASN A 1 100 ? -2.604  11.634  2.947   1.00 34.05 ? 95  ASN A O    3  
ATOM 6366  C CB   . ASN A 1 100 ? -3.037  10.220  5.255   1.00 31.35 ? 95  ASN A CB   3  
ATOM 6367  C CG   . ASN A 1 100 ? -3.846  11.232  6.044   1.00 63.24 ? 95  ASN A CG   3  
ATOM 6368  O OD1  . ASN A 1 100 ? -4.937  10.930  6.528   1.00 65.53 ? 95  ASN A OD1  3  
ATOM 6369  N ND2  . ASN A 1 100 ? -3.312  12.441  6.179   1.00 3.40  ? 95  ASN A ND2  3  
ATOM 6370  H H    . ASN A 1 100 ? -2.706  7.940   3.904   1.00 61.24 ? 95  ASN A H    3  
ATOM 6371  H HA   . ASN A 1 100 ? -4.800  9.991   4.063   1.00 3.03  ? 95  ASN A HA   3  
ATOM 6372  H HB3  . ASN A 1 100 ? -2.086  10.664  5.003   1.00 13.15 ? 95  ASN A HB3  3  
ATOM 6373  H HD21 . ASN A 1 100 ? -2.438  12.609  5.767   1.00 23.45 ? 95  ASN A HD21 3  
ATOM 6374  H HD22 . ASN A 1 100 ? -3.812  13.114  6.684   1.00 75.54 ? 95  ASN A HD22 3  
ATOM 6375  N N    . SER A 1 101 ? -3.383  10.021  1.584   1.00 42.22 ? 96  SER A N    3  
ATOM 6376  C CA   . SER A 1 101 ? -2.900  10.663  0.367   1.00 61.23 ? 96  SER A CA   3  
ATOM 6377  C C    . SER A 1 101 ? -4.063  11.046  -0.543  1.00 23.11 ? 96  SER A C    3  
ATOM 6378  O O    . SER A 1 101 ? -5.170  10.519  -0.433  1.00 11.34 ? 96  SER A O    3  
ATOM 6379  C CB   . SER A 1 101 ? -1.938  9.736   -0.377  1.00 23.13 ? 96  SER A CB   3  
ATOM 6380  O OG   . SER A 1 101 ? -2.573  9.128   -1.489  1.00 61.42 ? 96  SER A OG   3  
ATOM 6381  H H    . SER A 1 101 ? -3.858  9.166   1.517   1.00 53.41 ? 96  SER A H    3  
ATOM 6382  H HA   . SER A 1 101 ? -2.372  11.561  0.654   1.00 43.11 ? 96  SER A HA   3  
ATOM 6383  H HB3  . SER A 1 101 ? -1.596  8.962   0.294   1.00 41.10 ? 96  SER A HB3  3  
ATOM 6384  H HG   . SER A 1 101 ? -1.971  9.119   -2.237  1.00 32.30 ? 96  SER A HG   3  
ATOM 6385  N N    . PRO A 1 102 ? -3.807  11.987  -1.465  1.00 73.12 ? 97  PRO A N    3  
ATOM 6386  C CA   . PRO A 1 102 ? -4.819  12.462  -2.413  1.00 74.10 ? 97  PRO A CA   3  
ATOM 6387  C C    . PRO A 1 102 ? -5.182  11.405  -3.450  1.00 11.04 ? 97  PRO A C    3  
ATOM 6388  O O    . PRO A 1 102 ? -6.298  11.390  -3.969  1.00 32.54 ? 97  PRO A O    3  
ATOM 6389  C CB   . PRO A 1 102 ? -4.143  13.659  -3.084  1.00 71.45 ? 97  PRO A CB   3  
ATOM 6390  C CG   . PRO A 1 102 ? -2.683  13.392  -2.954  1.00 54.54 ? 97  PRO A CG   3  
ATOM 6391  C CD   . PRO A 1 102 ? -2.511  12.659  -1.651  1.00 4.10  ? 97  PRO A CD   3  
ATOM 6392  H HA   . PRO A 1 102 ? -5.715  12.790  -1.906  1.00 71.23 ? 97  PRO A HA   3  
ATOM 6393  H HB3  . PRO A 1 102 ? -4.423  14.569  -2.573  1.00 22.12 ? 97  PRO A HB3  3  
ATOM 6394  H HG3  . PRO A 1 102 ? -2.139  14.324  -2.933  1.00 63.22 ? 97  PRO A HG3  3  
ATOM 6395  H HD3  . PRO A 1 102 ? -2.319  13.356  -0.849  1.00 55.33 ? 97  PRO A HD3  3  
ATOM 6396  N N    . GLU A 1 103 ? -4.234  10.523  -3.747  1.00 71.32 ? 98  GLU A N    3  
ATOM 6397  C CA   . GLU A 1 103 ? -4.456  9.463   -4.724  1.00 50.13 ? 98  GLU A CA   3  
ATOM 6398  C C    . GLU A 1 103 ? -5.489  8.463   -4.216  1.00 33.35 ? 98  GLU A C    3  
ATOM 6399  O O    . GLU A 1 103 ? -6.404  8.075   -4.943  1.00 1.20  ? 98  GLU A O    3  
ATOM 6400  C CB   . GLU A 1 103 ? -3.142  8.742   -5.034  1.00 75.11 ? 98  GLU A CB   3  
ATOM 6401  C CG   . GLU A 1 103 ? -2.896  8.537   -6.519  1.00 31.32 ? 98  GLU A CG   3  
ATOM 6402  C CD   . GLU A 1 103 ? -2.172  9.707   -7.158  1.00 32.15 ? 98  GLU A CD   3  
ATOM 6403  O OE1  . GLU A 1 103 ? -0.932  9.774   -7.037  1.00 45.30 ? 98  GLU A OE1  3  
ATOM 6404  O OE2  . GLU A 1 103 ? -2.848  10.554  -7.778  1.00 4.23  ? 98  GLU A OE2  3  
ATOM 6405  H H    . GLU A 1 103 ? -3.364  10.587  -3.299  1.00 43.10 ? 98  GLU A H    3  
ATOM 6406  H HA   . GLU A 1 103 ? -4.827  9.919   -5.629  1.00 21.24 ? 98  GLU A HA   3  
ATOM 6407  H HB3  . GLU A 1 103 ? -3.156  7.774   -4.555  1.00 4.24  ? 98  GLU A HB3  3  
ATOM 6408  H HG3  . GLU A 1 103 ? -3.848  8.408   -7.014  1.00 12.31 ? 98  GLU A HG3  3  
ATOM 6409  N N    . TYR A 1 104 ? -5.338  8.049   -2.962  1.00 2.32  ? 99  TYR A N    3  
ATOM 6410  C CA   . TYR A 1 104 ? -6.256  7.091   -2.357  1.00 65.33 ? 99  TYR A CA   3  
ATOM 6411  C C    . TYR A 1 104 ? -7.679  7.640   -2.339  1.00 33.25 ? 99  TYR A C    3  
ATOM 6412  O O    . TYR A 1 104 ? -8.628  6.941   -2.697  1.00 71.10 ? 99  TYR A O    3  
ATOM 6413  C CB   . TYR A 1 104 ? -5.809  6.756   -0.933  1.00 0.41  ? 99  TYR A CB   3  
ATOM 6414  C CG   . TYR A 1 104 ? -6.796  5.895   -0.177  1.00 75.31 ? 99  TYR A CG   3  
ATOM 6415  C CD1  . TYR A 1 104 ? -7.211  4.670   -0.684  1.00 74.33 ? 99  TYR A CD1  3  
ATOM 6416  C CD2  . TYR A 1 104 ? -7.312  6.307   1.046   1.00 71.01 ? 99  TYR A CD2  3  
ATOM 6417  C CE1  . TYR A 1 104 ? -8.113  3.880   0.005   1.00 65.23 ? 99  TYR A CE1  3  
ATOM 6418  C CE2  . TYR A 1 104 ? -8.213  5.524   1.742   1.00 23.02 ? 99  TYR A CE2  3  
ATOM 6419  C CZ   . TYR A 1 104 ? -8.611  4.312   1.216   1.00 61.34 ? 99  TYR A CZ   3  
ATOM 6420  O OH   . TYR A 1 104 ? -9.508  3.528   1.906   1.00 4.24  ? 99  TYR A OH   3  
ATOM 6421  H H    . TYR A 1 104 ? -4.590  8.394   -2.432  1.00 63.11 ? 99  TYR A H    3  
ATOM 6422  H HA   . TYR A 1 104 ? -6.236  6.191   -2.952  1.00 32.43 ? 99  TYR A HA   3  
ATOM 6423  H HB3  . TYR A 1 104 ? -5.676  7.673   -0.379  1.00 53.53 ? 99  TYR A HB3  3  
ATOM 6424  H HD1  . TYR A 1 104 ? -6.818  4.335   -1.632  1.00 12.42 ? 99  TYR A HD1  3  
ATOM 6425  H HD2  . TYR A 1 104 ? -6.999  7.257   1.455   1.00 40.14 ? 99  TYR A HD2  3  
ATOM 6426  H HE1  . TYR A 1 104 ? -8.423  2.932   -0.406  1.00 12.54 ? 99  TYR A HE1  3  
ATOM 6427  H HE2  . TYR A 1 104 ? -8.604  5.862   2.690   1.00 14.10 ? 99  TYR A HE2  3  
ATOM 6428  H HH   . TYR A 1 104 ? -10.380 3.927   1.861   1.00 0.10  ? 99  TYR A HH   3  
ATOM 6429  N N    . GLN A 1 105 ? -7.820  8.893   -1.921  1.00 53.22 ? 100 GLN A N    3  
ATOM 6430  C CA   . GLN A 1 105 ? -9.127  9.535   -1.857  1.00 73.34 ? 100 GLN A CA   3  
ATOM 6431  C C    . GLN A 1 105 ? -9.652  9.845   -3.254  1.00 44.41 ? 100 GLN A C    3  
ATOM 6432  O O    . GLN A 1 105 ? -10.859 9.825   -3.493  1.00 23.15 ? 100 GLN A O    3  
ATOM 6433  C CB   . GLN A 1 105 ? -9.047  10.821  -1.032  1.00 33.40 ? 100 GLN A CB   3  
ATOM 6434  C CG   . GLN A 1 105 ? -8.131  11.874  -1.634  1.00 4.43  ? 100 GLN A CG   3  
ATOM 6435  C CD   . GLN A 1 105 ? -7.919  13.059  -0.713  1.00 74.42 ? 100 GLN A CD   3  
ATOM 6436  O OE1  . GLN A 1 105 ? -7.058  13.029  0.167   1.00 61.54 ? 100 GLN A OE1  3  
ATOM 6437  N NE2  . GLN A 1 105 ? -8.705  14.111  -0.910  1.00 11.44 ? 100 GLN A NE2  3  
ATOM 6438  H H    . GLN A 1 105 ? -7.026  9.397   -1.649  1.00 62.14 ? 100 GLN A H    3  
ATOM 6439  H HA   . GLN A 1 105 ? -9.809  8.851   -1.374  1.00 53.24 ? 100 GLN A HA   3  
ATOM 6440  H HB3  . GLN A 1 105 ? -8.682  10.580  -0.044  1.00 2.42  ? 100 GLN A HB3  3  
ATOM 6441  H HG3  . GLN A 1 105 ? -8.569  12.227  -2.557  1.00 42.45 ? 100 GLN A HG3  3  
ATOM 6442  H HE21 . GLN A 1 105 ? -9.369  14.063  -1.630  1.00 33.21 ? 100 GLN A HE21 3  
ATOM 6443  H HE22 . GLN A 1 105 ? -8.590  14.890  -0.329  1.00 12.12 ? 100 GLN A HE22 3  
ATOM 6444  N N    . ARG A 1 106 ? -8.736  10.131  -4.174  1.00 30.23 ? 101 ARG A N    3  
ATOM 6445  C CA   . ARG A 1 106 ? -9.106  10.447  -5.548  1.00 23.11 ? 101 ARG A CA   3  
ATOM 6446  C C    . ARG A 1 106 ? -10.022 9.372   -6.126  1.00 54.41 ? 101 ARG A C    3  
ATOM 6447  O O    . ARG A 1 106 ? -11.111 9.667   -6.619  1.00 42.54 ? 101 ARG A O    3  
ATOM 6448  C CB   . ARG A 1 106 ? -7.855  10.588  -6.416  1.00 2.52  ? 101 ARG A CB   3  
ATOM 6449  C CG   . ARG A 1 106 ? -7.555  12.020  -6.828  1.00 31.30 ? 101 ARG A CG   3  
ATOM 6450  C CD   . ARG A 1 106 ? -7.029  12.092  -8.253  1.00 32.34 ? 101 ARG A CD   3  
ATOM 6451  N NE   . ARG A 1 106 ? -6.964  13.467  -8.742  1.00 30.33 ? 101 ARG A NE   3  
ATOM 6452  C CZ   . ARG A 1 106 ? -6.017  14.329  -8.389  1.00 52.42 ? 101 ARG A CZ   3  
ATOM 6453  N NH1  . ARG A 1 106 ? -5.060  13.959  -7.547  1.00 24.15 ? 101 ARG A NH1  3  
ATOM 6454  N NH2  . ARG A 1 106 ? -6.025  15.562  -8.878  1.00 60.25 ? 101 ARG A NH2  3  
ATOM 6455  H H    . ARG A 1 106 ? -7.789  10.131  -3.922  1.00 45.20 ? 101 ARG A H    3  
ATOM 6456  H HA   . ARG A 1 106 ? -9.636  11.389  -5.541  1.00 14.32 ? 101 ARG A HA   3  
ATOM 6457  H HB3  . ARG A 1 106 ? -7.985  9.999   -7.312  1.00 11.45 ? 101 ARG A HB3  3  
ATOM 6458  H HG3  . ARG A 1 106 ? -6.813  12.429  -6.158  1.00 22.33 ? 101 ARG A HG3  3  
ATOM 6459  H HD3  . ARG A 1 106 ? -7.685  11.522  -8.894  1.00 70.51 ? 101 ARG A HD3  3  
ATOM 6460  H HE   . ARG A 1 106 ? -7.661  13.760  -9.365  1.00 1.21  ? 101 ARG A HE   3  
ATOM 6461  H HH11 . ARG A 1 106 ? -5.052  13.030  -7.179  1.00 41.23 ? 101 ARG A HH11 3  
ATOM 6462  H HH12 . ARG A 1 106 ? -4.348  14.610  -7.285  1.00 71.15 ? 101 ARG A HH12 3  
ATOM 6463  H HH21 . ARG A 1 106 ? -6.744  15.844  -9.512  1.00 70.11 ? 101 ARG A HH21 3  
ATOM 6464  H HH22 . ARG A 1 106 ? -5.312  16.210  -8.611  1.00 13.41 ? 101 ARG A HH22 3  
ATOM 6465  N N    . LEU A 1 107 ? -9.572  8.123   -6.061  1.00 24.13 ? 102 LEU A N    3  
ATOM 6466  C CA   . LEU A 1 107 ? -10.349 7.002   -6.579  1.00 31.42 ? 102 LEU A CA   3  
ATOM 6467  C C    . LEU A 1 107 ? -11.400 6.555   -5.566  1.00 42.14 ? 102 LEU A C    3  
ATOM 6468  O O    . LEU A 1 107 ? -12.399 5.934   -5.926  1.00 41.41 ? 102 LEU A O    3  
ATOM 6469  C CB   . LEU A 1 107 ? -9.427  5.833   -6.925  1.00 53.11 ? 102 LEU A CB   3  
ATOM 6470  C CG   . LEU A 1 107 ? -8.175  6.181   -7.730  1.00 2.14  ? 102 LEU A CG   3  
ATOM 6471  C CD1  . LEU A 1 107 ? -7.379  4.924   -8.049  1.00 24.42 ? 102 LEU A CD1  3  
ATOM 6472  C CD2  . LEU A 1 107 ? -8.551  6.916   -9.009  1.00 61.14 ? 102 LEU A CD2  3  
ATOM 6473  H H    . LEU A 1 107 ? -8.697  7.950   -5.657  1.00 42.20 ? 102 LEU A H    3  
ATOM 6474  H HA   . LEU A 1 107 ? -10.851 7.333   -7.476  1.00 44.12 ? 102 LEU A HA   3  
ATOM 6475  H HB3  . LEU A 1 107 ? -10.002 5.117   -7.496  1.00 43.12 ? 102 LEU A HB3  3  
ATOM 6476  H HG   . LEU A 1 107 ? -7.546  6.833   -7.140  1.00 51.32 ? 102 LEU A HG   3  
ATOM 6477  H HD11 . LEU A 1 107 ? -8.036  4.181   -8.477  1.00 25.50 ? 102 LEU A HD11 3  
ATOM 6478  H HD12 . LEU A 1 107 ? -6.939  4.537   -7.143  1.00 32.20 ? 102 LEU A HD12 3  
ATOM 6479  H HD13 . LEU A 1 107 ? -6.597  5.164   -8.755  1.00 14.21 ? 102 LEU A HD13 3  
ATOM 6480  H HD21 . LEU A 1 107 ? -8.667  7.968   -8.796  1.00 63.32 ? 102 LEU A HD21 3  
ATOM 6481  H HD22 . LEU A 1 107 ? -9.480  6.520   -9.391  1.00 21.52 ? 102 LEU A HD22 3  
ATOM 6482  H HD23 . LEU A 1 107 ? -7.771  6.781   -9.743  1.00 0.53  ? 102 LEU A HD23 3  
ATOM 6483  N N    . ARG A 1 108 ? -11.166 6.878   -4.298  1.00 53.33 ? 103 ARG A N    3  
ATOM 6484  C CA   . ARG A 1 108 ? -12.092 6.509   -3.233  1.00 42.25 ? 103 ARG A CA   3  
ATOM 6485  C C    . ARG A 1 108 ? -12.297 4.998   -3.190  1.00 20.31 ? 103 ARG A C    3  
ATOM 6486  O O    . ARG A 1 108 ? -13.429 4.517   -3.122  1.00 43.12 ? 103 ARG A O    3  
ATOM 6487  C CB   . ARG A 1 108 ? -13.435 7.212   -3.431  1.00 2.13  ? 103 ARG A CB   3  
ATOM 6488  C CG   . ARG A 1 108 ? -13.448 8.651   -2.942  1.00 63.12 ? 103 ARG A CG   3  
ATOM 6489  C CD   . ARG A 1 108 ? -14.687 8.946   -2.110  1.00 51.55 ? 103 ARG A CD   3  
ATOM 6490  N NE   . ARG A 1 108 ? -14.504 8.580   -0.708  1.00 3.45  ? 103 ARG A NE   3  
ATOM 6491  C CZ   . ARG A 1 108 ? -13.809 9.309   0.157   1.00 22.42 ? 103 ARG A CZ   3  
ATOM 6492  N NH1  . ARG A 1 108 ? -13.235 10.439  -0.234  1.00 53.30 ? 103 ARG A NH1  3  
ATOM 6493  N NH2  . ARG A 1 108 ? -13.688 8.910   1.416   1.00 71.43 ? 103 ARG A NH2  3  
ATOM 6494  H H    . ARG A 1 108 ? -10.351 7.373   -4.073  1.00 11.00 ? 103 ARG A H    3  
ATOM 6495  H HA   . ARG A 1 108 ? -11.663 6.830   -2.295  1.00 2.42  ? 103 ARG A HA   3  
ATOM 6496  H HB3  . ARG A 1 108 ? -14.196 6.666   -2.895  1.00 0.41  ? 103 ARG A HB3  3  
ATOM 6497  H HG3  . ARG A 1 108 ? -13.433 9.312   -3.796  1.00 60.11 ? 103 ARG A HG3  3  
ATOM 6498  H HD3  . ARG A 1 108 ? -15.516 8.386   -2.514  1.00 15.34 ? 103 ARG A HD3  3  
ATOM 6499  H HE   . ARG A 1 108 ? -14.920 7.749   -0.398  1.00 73.20 ? 103 ARG A HE   3  
ATOM 6500  H HH11 . ARG A 1 108 ? -13.326 10.743  -1.181  1.00 4.51  ? 103 ARG A HH11 3  
ATOM 6501  H HH12 . ARG A 1 108 ? -12.713 10.988  0.420   1.00 13.03 ? 103 ARG A HH12 3  
ATOM 6502  H HH21 . ARG A 1 108 ? -14.120 8.060   1.715   1.00 74.53 ? 103 ARG A HH21 3  
ATOM 6503  H HH22 . ARG A 1 108 ? -13.165 9.461   2.067   1.00 74.10 ? 103 ARG A HH22 3  
ATOM 6504  N N    . ILE A 1 109 ? -11.196 4.255   -3.230  1.00 62.15 ? 104 ILE A N    3  
ATOM 6505  C CA   . ILE A 1 109 ? -11.256 2.799   -3.194  1.00 2.42  ? 104 ILE A CA   3  
ATOM 6506  C C    . ILE A 1 109 ? -11.656 2.299   -1.810  1.00 55.33 ? 104 ILE A C    3  
ATOM 6507  O O    . ILE A 1 109 ? -10.969 2.561   -0.822  1.00 62.32 ? 104 ILE A O    3  
ATOM 6508  C CB   . ILE A 1 109 ? -9.905  2.170   -3.585  1.00 33.43 ? 104 ILE A CB   3  
ATOM 6509  C CG1  . ILE A 1 109 ? -9.361  2.827   -4.855  1.00 1.35  ? 104 ILE A CG1  3  
ATOM 6510  C CG2  . ILE A 1 109 ? -10.058 0.669   -3.782  1.00 64.41 ? 104 ILE A CG2  3  
ATOM 6511  C CD1  . ILE A 1 109 ? -8.031  2.263   -5.305  1.00 33.43 ? 104 ILE A CD1  3  
ATOM 6512  H H    . ILE A 1 109 ? -10.323 4.696   -3.283  1.00 2.32  ? 104 ILE A H    3  
ATOM 6513  H HA   . ILE A 1 109 ? -12.000 2.479   -3.910  1.00 75.12 ? 104 ILE A HA   3  
ATOM 6514  H HB   . ILE A 1 109 ? -9.210  2.335   -2.777  1.00 11.22 ? 104 ILE A HB   3  
ATOM 6515  H HG13 . ILE A 1 109 ? -9.231  3.885   -4.677  1.00 55.40 ? 104 ILE A HG13 3  
ATOM 6516  H HG21 . ILE A 1 109 ? -10.803 0.291   -3.098  1.00 51.41 ? 104 ILE A HG21 3  
ATOM 6517  H HG22 . ILE A 1 109 ? -10.367 0.469   -4.796  1.00 2.22  ? 104 ILE A HG22 3  
ATOM 6518  H HG23 . ILE A 1 109 ? -9.113  0.184   -3.591  1.00 14.11 ? 104 ILE A HG23 3  
ATOM 6519  H HD11 . ILE A 1 109 ? -7.666  1.569   -4.563  1.00 53.24 ? 104 ILE A HD11 3  
ATOM 6520  H HD12 . ILE A 1 109 ? -8.157  1.753   -6.247  1.00 13.21 ? 104 ILE A HD12 3  
ATOM 6521  H HD13 . ILE A 1 109 ? -7.321  3.069   -5.423  1.00 0.51  ? 104 ILE A HD13 3  
ATOM 6522  N N    . ASP A 1 110 ? -12.768 1.576   -1.746  1.00 10.24 ? 105 ASP A N    3  
ATOM 6523  C CA   . ASP A 1 110 ? -13.257 1.035   -0.483  1.00 1.34  ? 105 ASP A CA   3  
ATOM 6524  C C    . ASP A 1 110 ? -12.351 -0.086  0.015   1.00 33.24 ? 105 ASP A C    3  
ATOM 6525  O O    . ASP A 1 110 ? -11.592 -0.688  -0.745  1.00 52.05 ? 105 ASP A O    3  
ATOM 6526  C CB   . ASP A 1 110 ? -14.688 0.519   -0.645  1.00 3.25  ? 105 ASP A CB   3  
ATOM 6527  C CG   . ASP A 1 110 ? -15.710 1.427   0.010   1.00 51.41 ? 105 ASP A CG   3  
ATOM 6528  O OD1  . ASP A 1 110 ? -15.473 2.653   0.050   1.00 11.34 ? 105 ASP A OD1  3  
ATOM 6529  O OD2  . ASP A 1 110 ? -16.744 0.912   0.483   1.00 33.12 ? 105 ASP A OD2  3  
ATOM 6530  H H    . ASP A 1 110 ? -13.271 1.401   -2.569  1.00 14.31 ? 105 ASP A H    3  
ATOM 6531  H HA   . ASP A 1 110 ? -13.253 1.834   0.243   1.00 12.21 ? 105 ASP A HA   3  
ATOM 6532  H HB3  . ASP A 1 110 ? -14.762 -0.461  -0.197  1.00 21.14 ? 105 ASP A HB3  3  
ATOM 6533  N N    . PRO A 1 111 ? -12.431 -0.375  1.323   1.00 61.32 ? 106 PRO A N    3  
ATOM 6534  C CA   . PRO A 1 111 ? -11.625 -1.424  1.952   1.00 54.21 ? 106 PRO A CA   3  
ATOM 6535  C C    . PRO A 1 111 ? -12.053 -2.823  1.518   1.00 30.55 ? 106 PRO A C    3  
ATOM 6536  O O    . PRO A 1 111 ? -11.221 -3.645  1.134   1.00 70.02 ? 106 PRO A O    3  
ATOM 6537  C CB   . PRO A 1 111 ? -11.888 -1.225  3.447   1.00 71.22 ? 106 PRO A CB   3  
ATOM 6538  C CG   . PRO A 1 111 ? -13.221 -0.564  3.513   1.00 12.13 ? 106 PRO A CG   3  
ATOM 6539  C CD   . PRO A 1 111 ? -13.315 0.302   2.287   1.00 41.25 ? 106 PRO A CD   3  
ATOM 6540  H HA   . PRO A 1 111 ? -10.573 -1.292  1.750   1.00 51.20 ? 106 PRO A HA   3  
ATOM 6541  H HB3  . PRO A 1 111 ? -11.117 -0.600  3.872   1.00 54.44 ? 106 PRO A HB3  3  
ATOM 6542  H HG3  . PRO A 1 111 ? -13.288 0.041   4.404   1.00 54.45 ? 106 PRO A HG3  3  
ATOM 6543  H HD3  . PRO A 1 111 ? -12.958 1.299   2.502   1.00 4.12  ? 106 PRO A HD3  3  
ATOM 6544  N N    . ILE A 1 112 ? -13.354 -3.085  1.581   1.00 25.43 ? 107 ILE A N    3  
ATOM 6545  C CA   . ILE A 1 112 ? -13.892 -4.382  1.193   1.00 3.44  ? 107 ILE A CA   3  
ATOM 6546  C C    . ILE A 1 112 ? -13.666 -4.649  -0.292  1.00 21.20 ? 107 ILE A C    3  
ATOM 6547  O O    . ILE A 1 112 ? -13.640 -5.798  -0.729  1.00 43.34 ? 107 ILE A O    3  
ATOM 6548  C CB   . ILE A 1 112 ? -15.398 -4.482  1.497   1.00 70.50 ? 107 ILE A CB   3  
ATOM 6549  C CG1  . ILE A 1 112 ? -16.148 -3.314  0.854   1.00 33.24 ? 107 ILE A CG1  3  
ATOM 6550  C CG2  . ILE A 1 112 ? -15.634 -4.507  3.000   1.00 54.41 ? 107 ILE A CG2  3  
ATOM 6551  C CD1  . ILE A 1 112 ? -16.578 -2.254  1.844   1.00 12.13 ? 107 ILE A CD1  3  
ATOM 6552  H H    . ILE A 1 112 ? -13.967 -2.387  1.895   1.00 33.12 ? 107 ILE A H    3  
ATOM 6553  H HA   . ILE A 1 112 ? -13.378 -5.140  1.765   1.00 73.44 ? 107 ILE A HA   3  
ATOM 6554  H HB   . ILE A 1 112 ? -15.766 -5.408  1.084   1.00 1.31  ? 107 ILE A HB   3  
ATOM 6555  H HG13 . ILE A 1 112 ? -17.036 -3.691  0.366   1.00 2.42  ? 107 ILE A HG13 3  
ATOM 6556  H HG21 . ILE A 1 112 ? -16.694 -4.453  3.199   1.00 30.04 ? 107 ILE A HG21 3  
ATOM 6557  H HG22 . ILE A 1 112 ? -15.239 -5.425  3.410   1.00 61.42 ? 107 ILE A HG22 3  
ATOM 6558  H HG23 . ILE A 1 112 ? -15.138 -3.666  3.457   1.00 64.43 ? 107 ILE A HG23 3  
ATOM 6559  H HD11 . ILE A 1 112 ? -15.740 -1.982  2.467   1.00 62.23 ? 107 ILE A HD11 3  
ATOM 6560  H HD12 . ILE A 1 112 ? -16.930 -1.383  1.311   1.00 51.51 ? 107 ILE A HD12 3  
ATOM 6561  H HD13 . ILE A 1 112 ? -17.375 -2.642  2.463   1.00 63.42 ? 107 ILE A HD13 3  
ATOM 6562  N N    . ASN A 1 113 ? -13.501 -3.578  -1.062  1.00 72.53 ? 108 ASN A N    3  
ATOM 6563  C CA   . ASN A 1 113 ? -13.276 -3.696  -2.497  1.00 21.42 ? 108 ASN A CA   3  
ATOM 6564  C C    . ASN A 1 113 ? -11.793 -3.890  -2.801  1.00 72.31 ? 108 ASN A C    3  
ATOM 6565  O O    . ASN A 1 113 ? -11.428 -4.390  -3.864  1.00 11.04 ? 108 ASN A O    3  
ATOM 6566  C CB   . ASN A 1 113 ? -13.799 -2.453  -3.221  1.00 62.15 ? 108 ASN A CB   3  
ATOM 6567  C CG   . ASN A 1 113 ? -14.980 -2.760  -4.119  1.00 12.12 ? 108 ASN A CG   3  
ATOM 6568  O OD1  . ASN A 1 113 ? -14.988 -3.764  -4.832  1.00 2.32  ? 108 ASN A OD1  3  
ATOM 6569  N ND2  . ASN A 1 113 ? -15.988 -1.895  -4.089  1.00 14.50 ? 108 ASN A ND2  3  
ATOM 6570  H H    . ASN A 1 113 ? -13.533 -2.687  -0.654  1.00 4.11  ? 108 ASN A H    3  
ATOM 6571  H HA   . ASN A 1 113 ? -13.819 -4.560  -2.849  1.00 72.33 ? 108 ASN A HA   3  
ATOM 6572  H HB3  . ASN A 1 113 ? -13.007 -2.037  -3.826  1.00 24.21 ? 108 ASN A HB3  3  
ATOM 6573  H HD21 . ASN A 1 113 ? -15.913 -1.118  -3.496  1.00 3.14  ? 108 ASN A HD21 3  
ATOM 6574  H HD22 . ASN A 1 113 ? -16.765 -2.071  -4.659  1.00 31.22 ? 108 ASN A HD22 3  
ATOM 6575  N N    . GLU A 1 114 ? -10.945 -3.489  -1.859  1.00 15.35 ? 109 GLU A N    3  
ATOM 6576  C CA   . GLU A 1 114 ? -9.502  -3.620  -2.027  1.00 70.12 ? 109 GLU A CA   3  
ATOM 6577  C C    . GLU A 1 114 ? -9.096  -5.088  -2.124  1.00 60.34 ? 109 GLU A C    3  
ATOM 6578  O O    . GLU A 1 114 ? -9.913  -5.984  -1.914  1.00 24.32 ? 109 GLU A O    3  
ATOM 6579  C CB   . GLU A 1 114 ? -8.769  -2.951  -0.861  1.00 2.54  ? 109 GLU A CB   3  
ATOM 6580  C CG   . GLU A 1 114 ? -8.158  -1.607  -1.218  1.00 22.34 ? 109 GLU A CG   3  
ATOM 6581  C CD   . GLU A 1 114 ? -8.730  -0.470  -0.395  1.00 64.42 ? 109 GLU A CD   3  
ATOM 6582  O OE1  . GLU A 1 114 ? -8.616  -0.521  0.848   1.00 22.14 ? 109 GLU A OE1  3  
ATOM 6583  O OE2  . GLU A 1 114 ? -9.290  0.473   -0.993  1.00 12.14 ? 109 GLU A OE2  3  
ATOM 6584  H H    . GLU A 1 114 ? -11.297 -3.098  -1.033  1.00 54.45 ? 109 GLU A H    3  
ATOM 6585  H HA   . GLU A 1 114 ? -9.229  -3.122  -2.945  1.00 71.33 ? 109 GLU A HA   3  
ATOM 6586  H HB3  . GLU A 1 114 ? -7.976  -3.606  -0.529  1.00 20.45 ? 109 GLU A HB3  3  
ATOM 6587  H HG3  . GLU A 1 114 ? -8.347  -1.406  -2.263  1.00 62.25 ? 109 GLU A HG3  3  
ATOM 6588  N N    . ARG A 1 115 ? -7.827  -5.324  -2.442  1.00 14.11 ? 110 ARG A N    3  
ATOM 6589  C CA   . ARG A 1 115 ? -7.311  -6.682  -2.568  1.00 30.23 ? 110 ARG A CA   3  
ATOM 6590  C C    . ARG A 1 115 ? -6.307  -6.987  -1.460  1.00 3.32  ? 110 ARG A C    3  
ATOM 6591  O O    . ARG A 1 115 ? -6.471  -7.948  -0.708  1.00 51.33 ? 110 ARG A O    3  
ATOM 6592  C CB   . ARG A 1 115 ? -6.654  -6.876  -3.936  1.00 40.22 ? 110 ARG A CB   3  
ATOM 6593  C CG   . ARG A 1 115 ? -7.645  -7.145  -5.056  1.00 34.13 ? 110 ARG A CG   3  
ATOM 6594  C CD   . ARG A 1 115 ? -6.938  -7.376  -6.382  1.00 13.42 ? 110 ARG A CD   3  
ATOM 6595  N NE   . ARG A 1 115 ? -7.539  -8.471  -7.139  1.00 2.21  ? 110 ARG A NE   3  
ATOM 6596  C CZ   . ARG A 1 115 ? -7.471  -9.745  -6.770  1.00 73.44 ? 110 ARG A CZ   3  
ATOM 6597  N NH1  . ARG A 1 115 ? -6.831  -10.083 -5.659  1.00 22.41 ? 110 ARG A NH1  3  
ATOM 6598  N NH2  . ARG A 1 115 ? -8.044  -10.683 -7.512  1.00 53.52 ? 110 ARG A NH2  3  
ATOM 6599  H H    . ARG A 1 115 ? -7.224  -4.568  -2.596  1.00 42.42 ? 110 ARG A H    3  
ATOM 6600  H HA   . ARG A 1 115 ? -8.144  -7.363  -2.480  1.00 33.24 ? 110 ARG A HA   3  
ATOM 6601  H HB3  . ARG A 1 115 ? -5.972  -7.711  -3.879  1.00 31.43 ? 110 ARG A HB3  3  
ATOM 6602  H HG3  . ARG A 1 115 ? -8.304  -6.295  -5.152  1.00 71.11 ? 110 ARG A HG3  3  
ATOM 6603  H HD3  . ARG A 1 115 ? -5.902  -7.612  -6.186  1.00 13.14 ? 110 ARG A HD3  3  
ATOM 6604  H HE   . ARG A 1 115 ? -8.017  -8.243  -7.964  1.00 42.22 ? 110 ARG A HE   3  
ATOM 6605  H HH11 . ARG A 1 115 ? -6.399  -9.378  -5.097  1.00 24.44 ? 110 ARG A HH11 3  
ATOM 6606  H HH12 . ARG A 1 115 ? -6.782  -11.043 -5.382  1.00 60.01 ? 110 ARG A HH12 3  
ATOM 6607  H HH21 . ARG A 1 115 ? -8.527  -10.433 -8.350  1.00 22.52 ? 110 ARG A HH21 3  
ATOM 6608  H HH22 . ARG A 1 115 ? -7.992  -11.643 -7.233  1.00 63.44 ? 110 ARG A HH22 3  
ATOM 6609  N N    . SER A 1 116 ? -5.267  -6.164  -1.368  1.00 33.04 ? 111 SER A N    3  
ATOM 6610  C CA   . SER A 1 116 ? -4.235  -6.348  -0.356  1.00 52.41 ? 111 SER A CA   3  
ATOM 6611  C C    . SER A 1 116 ? -4.094  -5.101  0.511   1.00 64.30 ? 111 SER A C    3  
ATOM 6612  O O    . SER A 1 116 ? -4.401  -3.991  0.075   1.00 73.44 ? 111 SER A O    3  
ATOM 6613  C CB   . SER A 1 116 ? -2.896  -6.676  -1.018  1.00 42.34 ? 111 SER A CB   3  
ATOM 6614  O OG   . SER A 1 116 ? -2.836  -6.156  -2.335  1.00 42.42 ? 111 SER A OG   3  
ATOM 6615  H H    . SER A 1 116 ? -5.193  -5.416  -1.997  1.00 32.24 ? 111 SER A H    3  
ATOM 6616  H HA   . SER A 1 116 ? -4.529  -7.176  0.271   1.00 14.42 ? 111 SER A HA   3  
ATOM 6617  H HB3  . SER A 1 116 ? -2.771  -7.749  -1.062  1.00 61.34 ? 111 SER A HB3  3  
ATOM 6618  H HG   . SER A 1 116 ? -3.135  -6.823  -2.957  1.00 35.31 ? 111 SER A HG   3  
ATOM 6619  N N    . PHE A 1 117 ? -3.629  -5.292  1.741   1.00 11.11 ? 112 PHE A N    3  
ATOM 6620  C CA   . PHE A 1 117 ? -3.449  -4.182  2.670   1.00 55.33 ? 112 PHE A CA   3  
ATOM 6621  C C    . PHE A 1 117 ? -2.157  -4.346  3.467   1.00 44.21 ? 112 PHE A C    3  
ATOM 6622  O O    . PHE A 1 117 ? -1.742  -5.463  3.774   1.00 44.33 ? 112 PHE A O    3  
ATOM 6623  C CB   . PHE A 1 117 ? -4.641  -4.090  3.625   1.00 11.40 ? 112 PHE A CB   3  
ATOM 6624  C CG   . PHE A 1 117 ? -5.184  -2.698  3.773   1.00 14.53 ? 112 PHE A CG   3  
ATOM 6625  C CD1  . PHE A 1 117 ? -5.529  -1.953  2.656   1.00 0.31  ? 112 PHE A CD1  3  
ATOM 6626  C CD2  . PHE A 1 117 ? -5.351  -2.134  5.026   1.00 74.23 ? 112 PHE A CD2  3  
ATOM 6627  C CE1  . PHE A 1 117 ? -6.029  -0.672  2.788   1.00 53.04 ? 112 PHE A CE1  3  
ATOM 6628  C CE2  . PHE A 1 117 ? -5.850  -0.853  5.166   1.00 21.04 ? 112 PHE A CE2  3  
ATOM 6629  C CZ   . PHE A 1 117 ? -6.191  -0.121  4.045   1.00 15.23 ? 112 PHE A CZ   3  
ATOM 6630  H H    . PHE A 1 117 ? -3.402  -6.201  2.030   1.00 62.43 ? 112 PHE A H    3  
ATOM 6631  H HA   . PHE A 1 117 ? -3.389  -3.274  2.093   1.00 62.44 ? 112 PHE A HA   3  
ATOM 6632  H HB3  . PHE A 1 117 ? -4.338  -4.435  4.602   1.00 73.24 ? 112 PHE A HB3  3  
ATOM 6633  H HD1  . PHE A 1 117 ? -5.404  -2.383  1.673   1.00 31.14 ? 112 PHE A HD1  3  
ATOM 6634  H HD2  . PHE A 1 117 ? -5.085  -2.706  5.905   1.00 11.40 ? 112 PHE A HD2  3  
ATOM 6635  H HE1  . PHE A 1 117 ? -6.295  -0.102  1.911   1.00 51.05 ? 112 PHE A HE1  3  
ATOM 6636  H HE2  . PHE A 1 117 ? -5.976  -0.426  6.150   1.00 0.54  ? 112 PHE A HE2  3  
ATOM 6637  H HZ   . PHE A 1 117 ? -6.581  0.880   4.152   1.00 10.54 ? 112 PHE A HZ   3  
ATOM 6638  N N    . ILE A 1 118 ? -1.527  -3.223  3.797   1.00 44.43 ? 113 ILE A N    3  
ATOM 6639  C CA   . ILE A 1 118 ? -0.283  -3.240  4.556   1.00 50.12 ? 113 ILE A CA   3  
ATOM 6640  C C    . ILE A 1 118 ? -0.294  -2.180  5.652   1.00 60.32 ? 113 ILE A C    3  
ATOM 6641  O O    . ILE A 1 118 ? -0.589  -1.012  5.398   1.00 4.34  ? 113 ILE A O    3  
ATOM 6642  C CB   . ILE A 1 118 ? 0.937   -3.009  3.646   1.00 43.00 ? 113 ILE A CB   3  
ATOM 6643  C CG1  . ILE A 1 118 ? 1.010   -4.092  2.568   1.00 21.45 ? 113 ILE A CG1  3  
ATOM 6644  C CG2  . ILE A 1 118 ? 2.216   -2.986  4.468   1.00 34.21 ? 113 ILE A CG2  3  
ATOM 6645  C CD1  . ILE A 1 118 ? 1.586   -5.400  3.063   1.00 63.20 ? 113 ILE A CD1  3  
ATOM 6646  H H    . ILE A 1 118 ? -1.908  -2.363  3.523   1.00 3.31  ? 113 ILE A H    3  
ATOM 6647  H HA   . ILE A 1 118 ? -0.186  -4.214  5.014   1.00 14.35 ? 113 ILE A HA   3  
ATOM 6648  H HB   . ILE A 1 118 ? 0.826   -2.045  3.171   1.00 42.42 ? 113 ILE A HB   3  
ATOM 6649  H HG13 . ILE A 1 118 ? 1.630   -3.741  1.757   1.00 24.14 ? 113 ILE A HG13 3  
ATOM 6650  H HG21 . ILE A 1 118 ? 2.206   -2.130  5.126   1.00 74.22 ? 113 ILE A HG21 3  
ATOM 6651  H HG22 . ILE A 1 118 ? 2.281   -3.890  5.056   1.00 72.33 ? 113 ILE A HG22 3  
ATOM 6652  H HG23 . ILE A 1 118 ? 3.068   -2.924  3.809   1.00 71.43 ? 113 ILE A HG23 3  
ATOM 6653  H HD11 . ILE A 1 118 ? 2.648   -5.423  2.868   1.00 63.32 ? 113 ILE A HD11 3  
ATOM 6654  H HD12 . ILE A 1 118 ? 1.412   -5.492  4.124   1.00 61.52 ? 113 ILE A HD12 3  
ATOM 6655  H HD13 . ILE A 1 118 ? 1.109   -6.221  2.548   1.00 41.35 ? 113 ILE A HD13 3  
ATOM 6656  N N    . CYS A 1 119 ? 0.032   -2.595  6.872   1.00 1.11  ? 114 CYS A N    3  
ATOM 6657  C CA   . CYS A 1 119 ? 0.060   -1.680  8.008   1.00 13.51 ? 114 CYS A CA   3  
ATOM 6658  C C    . CYS A 1 119 ? 1.489   -1.471  8.501   1.00 12.31 ? 114 CYS A C    3  
ATOM 6659  O O    . CYS A 1 119 ? 2.299   -2.396  8.497   1.00 0.32  ? 114 CYS A O    3  
ATOM 6660  C CB   . CYS A 1 119 ? -0.811  -2.217  9.144   1.00 11.05 ? 114 CYS A CB   3  
ATOM 6661  S SG   . CYS A 1 119 ? -2.453  -2.763  8.620   1.00 2.32  ? 114 CYS A SG   3  
ATOM 6662  H H    . CYS A 1 119 ? 0.257   -3.538  7.013   1.00 3.35  ? 114 CYS A H    3  
ATOM 6663  H HA   . CYS A 1 119 ? -0.336  -0.731  7.679   1.00 14.04 ? 114 CYS A HA   3  
ATOM 6664  H HB3  . CYS A 1 119 ? -0.942  -1.443  9.885   1.00 43.33 ? 114 CYS A HB3  3  
ATOM 6665  H HG   . CYS A 1 119 ? -2.485  -2.751  7.296   1.00 2.41  ? 114 CYS A HG   3  
ATOM 6666  N N    . ASN A 1 120 ? 1.790   -0.248  8.924   1.00 22.32 ? 115 ASN A N    3  
ATOM 6667  C CA   . ASN A 1 120 ? 3.121   0.084   9.419   1.00 21.52 ? 115 ASN A CA   3  
ATOM 6668  C C    . ASN A 1 120 ? 3.042   0.747   10.790  1.00 51.45 ? 115 ASN A C    3  
ATOM 6669  O O    . ASN A 1 120 ? 2.496   1.842   10.932  1.00 54.10 ? 115 ASN A O    3  
ATOM 6670  C CB   . ASN A 1 120 ? 3.838   1.009   8.434   1.00 5.55  ? 115 ASN A CB   3  
ATOM 6671  C CG   . ASN A 1 120 ? 4.935   1.821   9.095   1.00 14.53 ? 115 ASN A CG   3  
ATOM 6672  O OD1  . ASN A 1 120 ? 4.974   3.045   8.976   1.00 44.21 ? 115 ASN A OD1  3  
ATOM 6673  N ND2  . ASN A 1 120 ? 5.833   1.139   9.797   1.00 73.43 ? 115 ASN A ND2  3  
ATOM 6674  H H    . ASN A 1 120 ? 1.101   0.449   8.903   1.00 30.30 ? 115 ASN A H    3  
ATOM 6675  H HA   . ASN A 1 120 ? 3.680   -0.836  9.507   1.00 61.34 ? 115 ASN A HA   3  
ATOM 6676  H HB3  . ASN A 1 120 ? 3.121   1.691   8.001   1.00 73.41 ? 115 ASN A HB3  3  
ATOM 6677  H HD21 . ASN A 1 120 ? 5.738   0.165   9.849   1.00 22.10 ? 115 ASN A HD21 3  
ATOM 6678  H HD22 . ASN A 1 120 ? 6.553   1.638   10.237  1.00 23.43 ? 115 ASN A HD22 3  
ATOM 6679  N N    . TYR A 1 121 ? 3.592   0.077   11.798  1.00 43.00 ? 116 TYR A N    3  
ATOM 6680  C CA   . TYR A 1 121 ? 3.582   0.600   13.159  1.00 41.53 ? 116 TYR A CA   3  
ATOM 6681  C C    . TYR A 1 121 ? 4.997   0.926   13.627  1.00 53.22 ? 116 TYR A C    3  
ATOM 6682  O O    . TYR A 1 121 ? 5.943   0.189   13.343  1.00 43.25 ? 116 TYR A O    3  
ATOM 6683  C CB   . TYR A 1 121 ? 2.937   -0.408  14.110  1.00 11.10 ? 116 TYR A CB   3  
ATOM 6684  C CG   . TYR A 1 121 ? 3.082   -0.042  15.569  1.00 73.24 ? 116 TYR A CG   3  
ATOM 6685  C CD1  . TYR A 1 121 ? 2.752   1.229   16.023  1.00 71.42 ? 116 TYR A CD1  3  
ATOM 6686  C CD2  . TYR A 1 121 ? 3.550   -0.967  16.496  1.00 20.44 ? 116 TYR A CD2  3  
ATOM 6687  C CE1  . TYR A 1 121 ? 2.883   1.568   17.357  1.00 2.40  ? 116 TYR A CE1  3  
ATOM 6688  C CE2  . TYR A 1 121 ? 3.683   -0.637  17.830  1.00 71.42 ? 116 TYR A CE2  3  
ATOM 6689  C CZ   . TYR A 1 121 ? 3.348   0.632   18.255  1.00 72.04 ? 116 TYR A CZ   3  
ATOM 6690  O OH   . TYR A 1 121 ? 3.479   0.965   19.585  1.00 45.11 ? 116 TYR A OH   3  
ATOM 6691  H H    . TYR A 1 121 ? 4.012   -0.790  11.622  1.00 11.33 ? 116 TYR A H    3  
ATOM 6692  H HA   . TYR A 1 121 ? 2.998   1.508   13.161  1.00 32.32 ? 116 TYR A HA   3  
ATOM 6693  H HB3  . TYR A 1 121 ? 3.396   -1.375  13.964  1.00 1.15  ? 116 TYR A HB3  3  
ATOM 6694  H HD1  . TYR A 1 121 ? 2.387   1.959   15.317  1.00 25.41 ? 116 TYR A HD1  3  
ATOM 6695  H HD2  . TYR A 1 121 ? 3.810   -1.960  16.160  1.00 4.44  ? 116 TYR A HD2  3  
ATOM 6696  H HE1  . TYR A 1 121 ? 2.621   2.561   17.690  1.00 44.14 ? 116 TYR A HE1  3  
ATOM 6697  H HE2  . TYR A 1 121 ? 4.047   -1.369  18.535  1.00 74.04 ? 116 TYR A HE2  3  
ATOM 6698  H HH   . TYR A 1 121 ? 2.746   0.595   20.081  1.00 73.23 ? 116 TYR A HH   3  
ATOM 6699  N N    . LYS A 1 122 ? 5.135   2.033   14.347  1.00 43.30 ? 117 LYS A N    3  
ATOM 6700  C CA   . LYS A 1 122 ? 6.434   2.458   14.858  1.00 34.43 ? 117 LYS A CA   3  
ATOM 6701  C C    . LYS A 1 122 ? 7.240   1.262   15.356  1.00 4.34  ? 117 LYS A C    3  
ATOM 6702  O O    . LYS A 1 122 ? 6.949   0.704   16.414  1.00 4.13  ? 117 LYS A O    3  
ATOM 6703  C CB   . LYS A 1 122 ? 6.252   3.472   15.990  1.00 21.04 ? 117 LYS A CB   3  
ATOM 6704  C CG   . LYS A 1 122 ? 5.796   4.840   15.514  1.00 21.24 ? 117 LYS A CG   3  
ATOM 6705  C CD   . LYS A 1 122 ? 5.042   5.586   16.602  1.00 11.22 ? 117 LYS A CD   3  
ATOM 6706  C CE   . LYS A 1 122 ? 5.584   6.995   16.789  1.00 31.55 ? 117 LYS A CE   3  
ATOM 6707  N NZ   . LYS A 1 122 ? 6.887   6.998   17.509  1.00 34.53 ? 117 LYS A NZ   3  
ATOM 6708  H H    . LYS A 1 122 ? 4.344   2.580   14.540  1.00 13.10 ? 117 LYS A H    3  
ATOM 6709  H HA   . LYS A 1 122 ? 6.971   2.927   14.049  1.00 5.23  ? 117 LYS A HA   3  
ATOM 6710  H HB3  . LYS A 1 122 ? 7.194   3.589   16.506  1.00 54.04 ? 117 LYS A HB3  3  
ATOM 6711  H HG3  . LYS A 1 122 ? 5.147   4.715   14.659  1.00 32.55 ? 117 LYS A HG3  3  
ATOM 6712  H HD3  . LYS A 1 122 ? 5.142   5.045   17.533  1.00 14.20 ? 117 LYS A HD3  3  
ATOM 6713  H HE3  . LYS A 1 122 ? 4.866   7.570   17.357  1.00 54.43 ? 117 LYS A HE3  3  
ATOM 6714  H HZ1  . LYS A 1 122 ? 7.647   6.680   16.874  1.00 33.35 ? 117 LYS A HZ1  3  
ATOM 6715  H HZ2  . LYS A 1 122 ? 6.844   6.357   18.327  1.00 71.41 ? 117 LYS A HZ2  3  
ATOM 6716  H HZ3  . LYS A 1 122 ? 7.108   7.957   17.845  1.00 73.33 ? 117 LYS A HZ3  3  
ATOM 6717  N N    . GLU A 1 123 ? 8.253   0.877   14.587  1.00 73.11 ? 118 GLU A N    3  
ATOM 6718  C CA   . GLU A 1 123 ? 9.101   -0.252  14.952  1.00 74.13 ? 118 GLU A CA   3  
ATOM 6719  C C    . GLU A 1 123 ? 8.329   -1.565  14.859  1.00 53.11 ? 118 GLU A C    3  
ATOM 6720  O O    . GLU A 1 123 ? 8.386   -2.399  15.764  1.00 45.24 ? 118 GLU A O    3  
ATOM 6721  C CB   . GLU A 1 123 ? 9.649   -0.070  16.369  1.00 54.11 ? 118 GLU A CB   3  
ATOM 6722  C CG   . GLU A 1 123 ? 10.976  -0.771  16.604  1.00 62.25 ? 118 GLU A CG   3  
ATOM 6723  C CD   . GLU A 1 123 ? 11.425  -0.702  18.050  1.00 52.25 ? 118 GLU A CD   3  
ATOM 6724  O OE1  . GLU A 1 123 ? 10.563  -0.498  18.931  1.00 64.12 ? 118 GLU A OE1  3  
ATOM 6725  O OE2  . GLU A 1 123 ? 12.640  -0.852  18.302  1.00 21.35 ? 118 GLU A OE2  3  
ATOM 6726  H H    . GLU A 1 123 ? 8.435   1.362   13.756  1.00 50.42 ? 118 GLU A H    3  
ATOM 6727  H HA   . GLU A 1 123 ? 9.927   -0.284  14.259  1.00 53.54 ? 118 GLU A HA   3  
ATOM 6728  H HB3  . GLU A 1 123 ? 8.929   -0.463  17.074  1.00 3.21  ? 118 GLU A HB3  3  
ATOM 6729  H HG3  . GLU A 1 123 ? 11.729  -0.304  15.986  1.00 12.23 ? 118 GLU A HG3  3  
ATOM 6730  N N    . HIS A 1 124 ? 7.605   -1.742  13.758  1.00 51.41 ? 119 HIS A N    3  
ATOM 6731  C CA   . HIS A 1 124 ? 6.821   -2.954  13.545  1.00 61.22 ? 119 HIS A CA   3  
ATOM 6732  C C    . HIS A 1 124 ? 6.091   -2.900  12.206  1.00 1.53  ? 119 HIS A C    3  
ATOM 6733  O O    . HIS A 1 124 ? 5.640   -1.838  11.776  1.00 51.30 ? 119 HIS A O    3  
ATOM 6734  C CB   . HIS A 1 124 ? 5.814   -3.141  14.680  1.00 73.44 ? 119 HIS A CB   3  
ATOM 6735  C CG   . HIS A 1 124 ? 4.825   -4.237  14.430  1.00 1.54  ? 119 HIS A CG   3  
ATOM 6736  N ND1  . HIS A 1 124 ? 5.194   -5.511  14.051  1.00 25.04 ? 119 HIS A ND1  3  
ATOM 6737  C CD2  . HIS A 1 124 ? 3.474   -4.245  14.506  1.00 52.33 ? 119 HIS A CD2  3  
ATOM 6738  C CE1  . HIS A 1 124 ? 4.112   -6.254  13.903  1.00 73.34 ? 119 HIS A CE1  3  
ATOM 6739  N NE2  . HIS A 1 124 ? 3.055   -5.510  14.175  1.00 11.23 ? 119 HIS A NE2  3  
ATOM 6740  H H    . HIS A 1 124 ? 7.599   -1.042  13.072  1.00 55.24 ? 119 HIS A H    3  
ATOM 6741  H HA   . HIS A 1 124 ? 7.501   -3.791  13.536  1.00 54.22 ? 119 HIS A HA   3  
ATOM 6742  H HB3  . HIS A 1 124 ? 5.263   -2.221  14.820  1.00 44.51 ? 119 HIS A HB3  3  
ATOM 6743  H HD1  . HIS A 1 124 ? 6.111   -5.822  13.909  1.00 53.43 ? 119 HIS A HD1  3  
ATOM 6744  H HD2  . HIS A 1 124 ? 2.842   -3.411  14.777  1.00 30.22 ? 119 HIS A HD2  3  
ATOM 6745  H HE1  . HIS A 1 124 ? 4.093   -7.294  13.613  1.00 3.21  ? 119 HIS A HE1  3  
ATOM 6746  N N    . TRP A 1 125 ? 5.980   -4.050  11.552  1.00 53.22 ? 120 TRP A N    3  
ATOM 6747  C CA   . TRP A 1 125 ? 5.306   -4.134  10.262  1.00 4.24  ? 120 TRP A CA   3  
ATOM 6748  C C    . TRP A 1 125 ? 4.204   -5.186  10.290  1.00 0.14  ? 120 TRP A C    3  
ATOM 6749  O O    . TRP A 1 125 ? 4.291   -6.170  11.024  1.00 33.11 ? 120 TRP A O    3  
ATOM 6750  C CB   . TRP A 1 125 ? 6.313   -4.462  9.157   1.00 34.42 ? 120 TRP A CB   3  
ATOM 6751  C CG   . TRP A 1 125 ? 6.802   -3.252  8.422   1.00 44.30 ? 120 TRP A CG   3  
ATOM 6752  C CD1  . TRP A 1 125 ? 7.291   -2.100  8.970   1.00 1.11  ? 120 TRP A CD1  3  
ATOM 6753  C CD2  . TRP A 1 125 ? 6.850   -3.073  7.001   1.00 32.42 ? 120 TRP A CD2  3  
ATOM 6754  N NE1  . TRP A 1 125 ? 7.638   -1.217  7.976   1.00 61.35 ? 120 TRP A NE1  3  
ATOM 6755  C CE2  . TRP A 1 125 ? 7.378   -1.790  6.760   1.00 61.44 ? 120 TRP A CE2  3  
ATOM 6756  C CE3  . TRP A 1 125 ? 6.498   -3.873  5.911   1.00 43.42 ? 120 TRP A CE3  3  
ATOM 6757  C CZ2  . TRP A 1 125 ? 7.562   -1.290  5.474   1.00 4.34  ? 120 TRP A CZ2  3  
ATOM 6758  C CZ3  . TRP A 1 125 ? 6.681   -3.375  4.635   1.00 2.23  ? 120 TRP A CZ3  3  
ATOM 6759  C CH2  . TRP A 1 125 ? 7.209   -2.094  4.424   1.00 0.51  ? 120 TRP A CH2  3  
ATOM 6760  H H    . TRP A 1 125 ? 6.361   -4.863  11.946  1.00 2.32  ? 120 TRP A H    3  
ATOM 6761  H HA   . TRP A 1 125 ? 4.863   -3.170  10.057  1.00 14.32 ? 120 TRP A HA   3  
ATOM 6762  H HB3  . TRP A 1 125 ? 5.847   -5.123  8.441   1.00 62.32 ? 120 TRP A HB3  3  
ATOM 6763  H HD1  . TRP A 1 125 ? 7.383   -1.923  10.030  1.00 35.21 ? 120 TRP A HD1  3  
ATOM 6764  H HE1  . TRP A 1 125 ? 8.013   -0.322  8.117   1.00 70.30 ? 120 TRP A HE1  3  
ATOM 6765  H HE3  . TRP A 1 125 ? 6.090   -4.862  6.052   1.00 12.31 ? 120 TRP A HE3  3  
ATOM 6766  H HZ2  . TRP A 1 125 ? 7.969   -0.306  5.295   1.00 71.53 ? 120 TRP A HZ2  3  
ATOM 6767  H HZ3  . TRP A 1 125 ? 6.415   -3.979  3.779   1.00 5.31  ? 120 TRP A HZ3  3  
ATOM 6768  H HH2  . TRP A 1 125 ? 7.334   -1.747  3.410   1.00 43.44 ? 120 TRP A HH2  3  
ATOM 6769  N N    . PHE A 1 126 ? 3.167   -4.972  9.487   1.00 11.42 ? 121 PHE A N    3  
ATOM 6770  C CA   . PHE A 1 126 ? 2.046   -5.903  9.421   1.00 2.31  ? 121 PHE A CA   3  
ATOM 6771  C C    . PHE A 1 126 ? 1.591   -6.107  7.979   1.00 41.24 ? 121 PHE A C    3  
ATOM 6772  O O    . PHE A 1 126 ? 1.521   -5.158  7.197   1.00 64.22 ? 121 PHE A O    3  
ATOM 6773  C CB   . PHE A 1 126 ? 0.880   -5.391  10.268  1.00 22.43 ? 121 PHE A CB   3  
ATOM 6774  C CG   . PHE A 1 126 ? 0.265   -6.445  11.142  1.00 34.12 ? 121 PHE A CG   3  
ATOM 6775  C CD1  . PHE A 1 126 ? -0.238  -7.614  10.593  1.00 53.14 ? 121 PHE A CD1  3  
ATOM 6776  C CD2  . PHE A 1 126 ? 0.189   -6.267  12.515  1.00 55.41 ? 121 PHE A CD2  3  
ATOM 6777  C CE1  . PHE A 1 126 ? -0.805  -8.585  11.396  1.00 54.32 ? 121 PHE A CE1  3  
ATOM 6778  C CE2  . PHE A 1 126 ? -0.377  -7.236  13.323  1.00 30.00 ? 121 PHE A CE2  3  
ATOM 6779  C CZ   . PHE A 1 126 ? -0.873  -8.397  12.763  1.00 23.22 ? 121 PHE A CZ   3  
ATOM 6780  H H    . PHE A 1 126 ? 3.155   -4.170  8.924   1.00 72.24 ? 121 PHE A H    3  
ATOM 6781  H HA   . PHE A 1 126 ? 2.379   -6.850  9.818   1.00 2.23  ? 121 PHE A HA   3  
ATOM 6782  H HB3  . PHE A 1 126 ? 0.110   -5.010  9.614   1.00 23.14 ? 121 PHE A HB3  3  
ATOM 6783  H HD1  . PHE A 1 126 ? -0.184  -7.763  9.525   1.00 61.13 ? 121 PHE A HD1  3  
ATOM 6784  H HD2  . PHE A 1 126 ? 0.577   -5.360  12.954  1.00 40.30 ? 121 PHE A HD2  3  
ATOM 6785  H HE1  . PHE A 1 126 ? -1.192  -9.492  10.956  1.00 61.21 ? 121 PHE A HE1  3  
ATOM 6786  H HE2  . PHE A 1 126 ? -0.429  -7.085  14.392  1.00 4.53  ? 121 PHE A HE2  3  
ATOM 6787  H HZ   . PHE A 1 126 ? -1.316  -9.155  13.392  1.00 71.33 ? 121 PHE A HZ   3  
ATOM 6788  N N    . THR A 1 127 ? 1.285   -7.353  7.631   1.00 30.12 ? 122 THR A N    3  
ATOM 6789  C CA   . THR A 1 127 ? 0.839   -7.683  6.283   1.00 73.55 ? 122 THR A CA   3  
ATOM 6790  C C    . THR A 1 127 ? -0.590  -8.213  6.291   1.00 54.20 ? 122 THR A C    3  
ATOM 6791  O O    . THR A 1 127 ? -0.907  -9.162  7.010   1.00 11.04 ? 122 THR A O    3  
ATOM 6792  C CB   . THR A 1 127 ? 1.760   -8.730  5.628   1.00 34.20 ? 122 THR A CB   3  
ATOM 6793  O OG1  . THR A 1 127 ? 3.127   -8.322  5.745   1.00 53.21 ? 122 THR A OG1  3  
ATOM 6794  C CG2  . THR A 1 127 ? 1.405   -8.919  4.161   1.00 12.41 ? 122 THR A CG2  3  
ATOM 6795  H H    . THR A 1 127 ? 1.361   -8.067  8.299   1.00 50.30 ? 122 THR A H    3  
ATOM 6796  H HA   . THR A 1 127 ? 0.876   -6.781  5.690   1.00 33.44 ? 122 THR A HA   3  
ATOM 6797  H HB   . THR A 1 127 ? 1.628   -9.673  6.139   1.00 13.52 ? 122 THR A HB   3  
ATOM 6798  H HG1  . THR A 1 127 ? 3.242   -7.814  6.552   1.00 74.24 ? 122 THR A HG1  3  
ATOM 6799  H HG21 . THR A 1 127 ? 0.379   -9.246  4.077   1.00 24.41 ? 122 THR A HG21 3  
ATOM 6800  H HG22 . THR A 1 127 ? 2.056   -9.663  3.726   1.00 42.15 ? 122 THR A HG22 3  
ATOM 6801  H HG23 . THR A 1 127 ? 1.529   -7.983  3.638   1.00 72.20 ? 122 THR A HG23 3  
ATOM 6802  N N    . VAL A 1 128 ? -1.450  -7.596  5.488   1.00 44.33 ? 123 VAL A N    3  
ATOM 6803  C CA   . VAL A 1 128 ? -2.846  -8.007  5.400   1.00 74.31 ? 123 VAL A CA   3  
ATOM 6804  C C    . VAL A 1 128 ? -3.223  -8.375  3.970   1.00 64.32 ? 123 VAL A C    3  
ATOM 6805  O O    . VAL A 1 128 ? -2.871  -7.669  3.024   1.00 12.33 ? 123 VAL A O    3  
ATOM 6806  C CB   . VAL A 1 128 ? -3.790  -6.898  5.900   1.00 41.02 ? 123 VAL A CB   3  
ATOM 6807  C CG1  . VAL A 1 128 ? -5.214  -7.156  5.429   1.00 63.55 ? 123 VAL A CG1  3  
ATOM 6808  C CG2  . VAL A 1 128 ? -3.732  -6.790  7.416   1.00 14.43 ? 123 VAL A CG2  3  
ATOM 6809  H H    . VAL A 1 128 ? -1.138  -6.846  4.940   1.00 43.53 ? 123 VAL A H    3  
ATOM 6810  H HA   . VAL A 1 128 ? -2.978  -8.874  6.032   1.00 32.32 ? 123 VAL A HA   3  
ATOM 6811  H HB   . VAL A 1 128 ? -3.461  -5.958  5.481   1.00 61.21 ? 123 VAL A HB   3  
ATOM 6812  H HG11 . VAL A 1 128 ? -5.272  -7.005  4.361   1.00 35.42 ? 123 VAL A HG11 3  
ATOM 6813  H HG12 . VAL A 1 128 ? -5.492  -8.172  5.666   1.00 74.42 ? 123 VAL A HG12 3  
ATOM 6814  H HG13 . VAL A 1 128 ? -5.886  -6.472  5.927   1.00 2.22  ? 123 VAL A HG13 3  
ATOM 6815  H HG21 . VAL A 1 128 ? -4.721  -6.588  7.800   1.00 61.12 ? 123 VAL A HG21 3  
ATOM 6816  H HG22 . VAL A 1 128 ? -3.370  -7.721  7.829   1.00 43.12 ? 123 VAL A HG22 3  
ATOM 6817  H HG23 . VAL A 1 128 ? -3.065  -5.989  7.696   1.00 0.14  ? 123 VAL A HG23 3  
ATOM 6818  N N    . ARG A 1 129 ? -3.941  -9.483  3.819   1.00 72.03 ? 124 ARG A N    3  
ATOM 6819  C CA   . ARG A 1 129 ? -4.365  -9.945  2.503   1.00 42.32 ? 124 ARG A CA   3  
ATOM 6820  C C    . ARG A 1 129 ? -5.832  -10.364 2.521   1.00 12.12 ? 124 ARG A C    3  
ATOM 6821  O O    . ARG A 1 129 ? -6.334  -10.862 3.528   1.00 55.05 ? 124 ARG A O    3  
ATOM 6822  C CB   . ARG A 1 129 ? -3.494  -11.116 2.045   1.00 41.05 ? 124 ARG A CB   3  
ATOM 6823  C CG   . ARG A 1 129 ? -3.949  -11.738 0.735   1.00 51.11 ? 124 ARG A CG   3  
ATOM 6824  C CD   . ARG A 1 129 ? -3.735  -10.791 -0.435  1.00 24.31 ? 124 ARG A CD   3  
ATOM 6825  N NE   . ARG A 1 129 ? -3.344  -11.501 -1.650  1.00 60.22 ? 124 ARG A NE   3  
ATOM 6826  C CZ   . ARG A 1 129 ? -4.205  -12.124 -2.446  1.00 70.11 ? 124 ARG A CZ   3  
ATOM 6827  N NH1  . ARG A 1 129 ? -5.499  -12.125 -2.158  1.00 71.00 ? 124 ARG A NH1  3  
ATOM 6828  N NH2  . ARG A 1 129 ? -3.772  -12.748 -3.534  1.00 10.23 ? 124 ARG A NH2  3  
ATOM 6829  H H    . ARG A 1 129 ? -4.191  -10.003 4.611   1.00 51.41 ? 124 ARG A H    3  
ATOM 6830  H HA   . ARG A 1 129 ? -4.245  -9.126  1.810   1.00 22.12 ? 124 ARG A HA   3  
ATOM 6831  H HB3  . ARG A 1 129 ? -3.512  -11.881 2.806   1.00 42.44 ? 124 ARG A HB3  3  
ATOM 6832  H HG3  . ARG A 1 129 ? -5.000  -11.976 0.806   1.00 71.12 ? 124 ARG A HG3  3  
ATOM 6833  H HD3  . ARG A 1 129 ? -2.958  -10.088 -0.174  1.00 21.23 ? 124 ARG A HD3  3  
ATOM 6834  H HE   . ARG A 1 129 ? -2.392  -11.513 -1.882  1.00 22.34 ? 124 ARG A HE   3  
ATOM 6835  H HH11 . ARG A 1 129 ? -5.828  -11.655 -1.339  1.00 22.04 ? 124 ARG A HH11 3  
ATOM 6836  H HH12 . ARG A 1 129 ? -6.145  -12.595 -2.760  1.00 33.31 ? 124 ARG A HH12 3  
ATOM 6837  H HH21 . ARG A 1 129 ? -2.797  -12.750 -3.755  1.00 1.21  ? 124 ARG A HH21 3  
ATOM 6838  H HH22 . ARG A 1 129 ? -4.421  -13.218 -4.133  1.00 61.12 ? 124 ARG A HH22 3  
ATOM 6839  N N    . LYS A 1 130 ? -6.514  -10.160 1.399   1.00 31.12 ? 125 LYS A N    3  
ATOM 6840  C CA   . LYS A 1 130 ? -7.923  -10.517 1.284   1.00 41.20 ? 125 LYS A CA   3  
ATOM 6841  C C    . LYS A 1 130 ? -8.082  -11.957 0.806   1.00 5.05  ? 125 LYS A C    3  
ATOM 6842  O O    . LYS A 1 130 ? -7.461  -12.368 -0.175  1.00 5.33  ? 125 LYS A O    3  
ATOM 6843  C CB   . LYS A 1 130 ? -8.634  -9.566  0.319   1.00 2.21  ? 125 LYS A CB   3  
ATOM 6844  C CG   . LYS A 1 130 ? -10.080 -9.944  0.046   1.00 55.53 ? 125 LYS A CG   3  
ATOM 6845  C CD   . LYS A 1 130 ? -10.946 -8.717  -0.171  1.00 22.54 ? 125 LYS A CD   3  
ATOM 6846  C CE   . LYS A 1 130 ? -12.089 -8.656  0.831   1.00 23.22 ? 125 LYS A CE   3  
ATOM 6847  N NZ   . LYS A 1 130 ? -13.370 -9.135  0.242   1.00 24.31 ? 125 LYS A NZ   3  
ATOM 6848  H H    . LYS A 1 130 ? -6.058  -9.759  0.629   1.00 50.30 ? 125 LYS A H    3  
ATOM 6849  H HA   . LYS A 1 130 ? -8.370  -10.425 2.262   1.00 60.35 ? 125 LYS A HA   3  
ATOM 6850  H HB3  . LYS A 1 130 ? -8.101  -9.562  -0.621  1.00 34.23 ? 125 LYS A HB3  3  
ATOM 6851  H HG3  . LYS A 1 130 ? -10.462 -10.500 0.891   1.00 62.43 ? 125 LYS A HG3  3  
ATOM 6852  H HD3  . LYS A 1 130 ? -11.357 -8.749  -1.171  1.00 22.42 ? 125 LYS A HD3  3  
ATOM 6853  H HE3  . LYS A 1 130 ? -12.212 -7.633  1.155   1.00 72.41 ? 125 LYS A HE3  3  
ATOM 6854  H HZ1  . LYS A 1 130 ? -13.717 -8.450  -0.460  1.00 23.14 ? 125 LYS A HZ1  3  
ATOM 6855  H HZ2  . LYS A 1 130 ? -14.087 -9.243  0.987   1.00 2.23  ? 125 LYS A HZ2  3  
ATOM 6856  H HZ3  . LYS A 1 130 ? -13.228 -10.052 -0.225  1.00 0.34  ? 125 LYS A HZ3  3  
ATOM 6857  N N    . LEU A 1 131 ? -8.919  -12.718 1.503   1.00 41.13 ? 126 LEU A N    3  
ATOM 6858  C CA   . LEU A 1 131 ? -9.161  -14.112 1.148   1.00 40.40 ? 126 LEU A CA   3  
ATOM 6859  C C    . LEU A 1 131 ? -10.655 -14.387 1.011   1.00 3.42  ? 126 LEU A C    3  
ATOM 6860  O O    . LEU A 1 131 ? -11.410 -14.265 1.974   1.00 30.11 ? 126 LEU A O    3  
ATOM 6861  C CB   . LEU A 1 131 ? -8.553  -15.040 2.201   1.00 31.34 ? 126 LEU A CB   3  
ATOM 6862  C CG   . LEU A 1 131 ? -7.452  -15.980 1.713   1.00 51.25 ? 126 LEU A CG   3  
ATOM 6863  C CD1  . LEU A 1 131 ? -6.087  -15.487 2.171   1.00 64.41 ? 126 LEU A CD1  3  
ATOM 6864  C CD2  . LEU A 1 131 ? -7.701  -17.397 2.207   1.00 3.34  ? 126 LEU A CD2  3  
ATOM 6865  H H    . LEU A 1 131 ? -9.384  -12.335 2.274   1.00 23.32 ? 126 LEU A H    3  
ATOM 6866  H HA   . LEU A 1 131 ? -8.684  -14.299 0.197   1.00 14.31 ? 126 LEU A HA   3  
ATOM 6867  H HB3  . LEU A 1 131 ? -9.352  -15.646 2.605   1.00 75.03 ? 126 LEU A HB3  3  
ATOM 6868  H HG   . LEU A 1 131 ? -7.454  -15.997 0.632   1.00 64.21 ? 126 LEU A HG   3  
ATOM 6869  H HD11 . LEU A 1 131 ? -6.182  -15.007 3.134   1.00 12.25 ? 126 LEU A HD11 3  
ATOM 6870  H HD12 . LEU A 1 131 ? -5.701  -14.778 1.453   1.00 14.21 ? 126 LEU A HD12 3  
ATOM 6871  H HD13 . LEU A 1 131 ? -5.410  -16.325 2.250   1.00 61.25 ? 126 LEU A HD13 3  
ATOM 6872  H HD21 . LEU A 1 131 ? -7.955  -17.373 3.256   1.00 42.24 ? 126 LEU A HD21 3  
ATOM 6873  H HD22 . LEU A 1 131 ? -6.808  -17.990 2.066   1.00 22.33 ? 126 LEU A HD22 3  
ATOM 6874  H HD23 . LEU A 1 131 ? -8.516  -17.834 1.649   1.00 50.03 ? 126 LEU A HD23 3  
ATOM 6875  N N    . GLY A 1 132 ? -11.074 -14.762 -0.194  1.00 34.32 ? 127 GLY A N    3  
ATOM 6876  C CA   . GLY A 1 132 ? -12.476 -15.051 -0.434  1.00 1.12  ? 127 GLY A CA   3  
ATOM 6877  C C    . GLY A 1 132 ? -13.366 -13.847 -0.196  1.00 12.31 ? 127 GLY A C    3  
ATOM 6878  O O    . GLY A 1 132 ? -13.458 -12.957 -1.041  1.00 40.14 ? 127 GLY A O    3  
ATOM 6879  H H    . GLY A 1 132 ? -10.427 -14.842 -0.925  1.00 15.31 ? 127 GLY A H    3  
ATOM 6880  H HA2  . GLY A 1 132 ? -12.595 -15.377 -1.456  1.00 3.32  ? 127 GLY A HA2  3  
ATOM 6881  H HA3  . GLY A 1 132 ? -12.786 -15.850 0.225   1.00 63.43 ? 127 GLY A HA3  3  
ATOM 6882  N N    . LYS A 1 133 ? -14.025 -13.820 0.957   1.00 51.21 ? 128 LYS A N    3  
ATOM 6883  C CA   . LYS A 1 133 ? -14.912 -12.717 1.306   1.00 5.04  ? 128 LYS A CA   3  
ATOM 6884  C C    . LYS A 1 133 ? -14.478 -12.060 2.613   1.00 5.32  ? 128 LYS A C    3  
ATOM 6885  O O    . LYS A 1 133 ? -15.066 -11.070 3.044   1.00 64.04 ? 128 LYS A O    3  
ATOM 6886  C CB   . LYS A 1 133 ? -16.354 -13.215 1.429   1.00 11.15 ? 128 LYS A CB   3  
ATOM 6887  C CG   . LYS A 1 133 ? -17.301 -12.593 0.417   1.00 2.03  ? 128 LYS A CG   3  
ATOM 6888  C CD   . LYS A 1 133 ? -18.746 -12.968 0.700   1.00 60.22 ? 128 LYS A CD   3  
ATOM 6889  C CE   . LYS A 1 133 ? -19.558 -13.068 -0.582  1.00 42.11 ? 128 LYS A CE   3  
ATOM 6890  N NZ   . LYS A 1 133 ? -21.006 -13.279 -0.306  1.00 0.43  ? 128 LYS A NZ   3  
ATOM 6891  H H    . LYS A 1 133 ? -13.910 -14.560 1.591   1.00 33.23 ? 128 LYS A H    3  
ATOM 6892  H HA   . LYS A 1 133 ? -14.860 -11.986 0.514   1.00 44.00 ? 128 LYS A HA   3  
ATOM 6893  H HB3  . LYS A 1 133 ? -16.719 -12.985 2.419   1.00 51.54 ? 128 LYS A HB3  3  
ATOM 6894  H HG3  . LYS A 1 133 ? -17.035 -12.939 -0.572  1.00 15.13 ? 128 LYS A HG3  3  
ATOM 6895  H HD3  . LYS A 1 133 ? -19.186 -12.214 1.336   1.00 75.44 ? 128 LYS A HD3  3  
ATOM 6896  H HE3  . LYS A 1 133 ? -19.185 -13.898 -1.164  1.00 34.44 ? 128 LYS A HE3  3  
ATOM 6897  H HZ1  . LYS A 1 133 ? -21.550 -12.440 -0.594  1.00 54.20 ? 128 LYS A HZ1  3  
ATOM 6898  H HZ2  . LYS A 1 133 ? -21.156 -13.444 0.709   1.00 54.43 ? 128 LYS A HZ2  3  
ATOM 6899  H HZ3  . LYS A 1 133 ? -21.354 -14.104 -0.836  1.00 25.03 ? 128 LYS A HZ3  3  
ATOM 6900  N N    . GLN A 1 134 ? -13.444 -12.618 3.235   1.00 2.04  ? 129 GLN A N    3  
ATOM 6901  C CA   . GLN A 1 134 ? -12.931 -12.085 4.490   1.00 64.23 ? 129 GLN A CA   3  
ATOM 6902  C C    . GLN A 1 134 ? -11.444 -11.763 4.378   1.00 73.31 ? 129 GLN A C    3  
ATOM 6903  O O    . GLN A 1 134 ? -10.759 -12.256 3.483   1.00 24.12 ? 129 GLN A O    3  
ATOM 6904  C CB   . GLN A 1 134 ? -13.165 -13.082 5.626   1.00 15.42 ? 129 GLN A CB   3  
ATOM 6905  C CG   . GLN A 1 134 ? -14.628 -13.230 6.014   1.00 12.42 ? 129 GLN A CG   3  
ATOM 6906  C CD   . GLN A 1 134 ? -14.972 -14.636 6.469   1.00 44.15 ? 129 GLN A CD   3  
ATOM 6907  O OE1  . GLN A 1 134 ? -15.868 -15.276 5.920   1.00 51.40 ? 129 GLN A OE1  3  
ATOM 6908  N NE2  . GLN A 1 134 ? -14.258 -15.122 7.477   1.00 51.35 ? 129 GLN A NE2  3  
ATOM 6909  H H    . GLN A 1 134 ? -13.017 -13.406 2.840   1.00 12.11 ? 129 GLN A H    3  
ATOM 6910  H HA   . GLN A 1 134 ? -13.468 -11.174 4.707   1.00 73.41 ? 129 GLN A HA   3  
ATOM 6911  H HB3  . GLN A 1 134 ? -12.616 -12.755 6.497   1.00 2.15  ? 129 GLN A HB3  3  
ATOM 6912  H HG3  . GLN A 1 134 ? -15.240 -12.985 5.158   1.00 72.02 ? 129 GLN A HG3  3  
ATOM 6913  H HE21 . GLN A 1 134 ? -13.560 -14.555 7.867   1.00 64.34 ? 129 GLN A HE21 3  
ATOM 6914  H HE22 . GLN A 1 134 ? -14.459 -16.027 7.792   1.00 70.34 ? 129 GLN A HE22 3  
ATOM 6915  N N    . TRP A 1 135 ? -10.953 -10.935 5.293   1.00 71.12 ? 130 TRP A N    3  
ATOM 6916  C CA   . TRP A 1 135 ? -9.547  -10.548 5.296   1.00 64.14 ? 130 TRP A CA   3  
ATOM 6917  C C    . TRP A 1 135 ? -8.734  -11.456 6.213   1.00 1.41  ? 130 TRP A C    3  
ATOM 6918  O O    . TRP A 1 135 ? -9.271  -12.055 7.145   1.00 21.44 ? 130 TRP A O    3  
ATOM 6919  C CB   . TRP A 1 135 ? -9.399  -9.091  5.740   1.00 54.42 ? 130 TRP A CB   3  
ATOM 6920  C CG   . TRP A 1 135 ? -9.767  -8.105  4.673   1.00 3.22  ? 130 TRP A CG   3  
ATOM 6921  C CD1  . TRP A 1 135 ? -10.987 -7.524  4.479   1.00 41.41 ? 130 TRP A CD1  3  
ATOM 6922  C CD2  . TRP A 1 135 ? -8.906  -7.587  3.652   1.00 23.14 ? 130 TRP A CD2  3  
ATOM 6923  N NE1  . TRP A 1 135 ? -10.937 -6.676  3.399   1.00 33.54 ? 130 TRP A NE1  3  
ATOM 6924  C CE2  . TRP A 1 135 ? -9.672  -6.696  2.875   1.00 11.13 ? 130 TRP A CE2  3  
ATOM 6925  C CE3  . TRP A 1 135 ? -7.564  -7.787  3.320   1.00 1.33  ? 130 TRP A CE3  3  
ATOM 6926  C CZ2  . TRP A 1 135 ? -9.139  -6.010  1.787   1.00 72.55 ? 130 TRP A CZ2  3  
ATOM 6927  C CZ3  . TRP A 1 135 ? -7.036  -7.106  2.240   1.00 40.11 ? 130 TRP A CZ3  3  
ATOM 6928  C CH2  . TRP A 1 135 ? -7.822  -6.225  1.485   1.00 23.22 ? 130 TRP A CH2  3  
ATOM 6929  H H    . TRP A 1 135 ? -11.550 -10.575 5.983   1.00 1.14  ? 130 TRP A H    3  
ATOM 6930  H HA   . TRP A 1 135 ? -9.174  -10.647 4.288   1.00 24.20 ? 130 TRP A HA   3  
ATOM 6931  H HB3  . TRP A 1 135 ? -8.371  -8.911  6.022   1.00 3.55  ? 130 TRP A HB3  3  
ATOM 6932  H HD1  . TRP A 1 135 ? -11.855 -7.715  5.092   1.00 24.25 ? 130 TRP A HD1  3  
ATOM 6933  H HE1  . TRP A 1 135 ? -11.688 -6.141  3.061   1.00 51.42 ? 130 TRP A HE1  3  
ATOM 6934  H HE3  . TRP A 1 135 ? -6.943  -8.463  3.889   1.00 63.31 ? 130 TRP A HE3  3  
ATOM 6935  H HZ2  . TRP A 1 135 ? -9.731  -5.327  1.196   1.00 62.42 ? 130 TRP A HZ2  3  
ATOM 6936  H HZ3  . TRP A 1 135 ? -6.001  -7.248  1.968   1.00 20.10 ? 130 TRP A HZ3  3  
ATOM 6937  H HH2  . TRP A 1 135 ? -7.368  -5.714  0.650   1.00 45.41 ? 130 TRP A HH2  3  
ATOM 6938  N N    . PHE A 1 136 ? -7.437  -11.554 5.942   1.00 14.01 ? 131 PHE A N    3  
ATOM 6939  C CA   . PHE A 1 136 ? -6.550  -12.391 6.742   1.00 13.43 ? 131 PHE A CA   3  
ATOM 6940  C C    . PHE A 1 136 ? -5.241  -11.667 7.040   1.00 32.42 ? 131 PHE A C    3  
ATOM 6941  O O    . PHE A 1 136 ? -4.501  -11.299 6.129   1.00 30.43 ? 131 PHE A O    3  
ATOM 6942  C CB   . PHE A 1 136 ? -6.264  -13.708 6.016   1.00 43.35 ? 131 PHE A CB   3  
ATOM 6943  C CG   . PHE A 1 136 ? -7.011  -14.880 6.585   1.00 51.40 ? 131 PHE A CG   3  
ATOM 6944  C CD1  . PHE A 1 136 ? -6.905  -15.200 7.929   1.00 4.32  ? 131 PHE A CD1  3  
ATOM 6945  C CD2  . PHE A 1 136 ? -7.818  -15.663 5.774   1.00 55.42 ? 131 PHE A CD2  3  
ATOM 6946  C CE1  . PHE A 1 136 ? -7.591  -16.278 8.455   1.00 14.31 ? 131 PHE A CE1  3  
ATOM 6947  C CE2  . PHE A 1 136 ? -8.506  -16.742 6.295   1.00 31.03 ? 131 PHE A CE2  3  
ATOM 6948  C CZ   . PHE A 1 136 ? -8.391  -17.051 7.636   1.00 33.31 ? 131 PHE A CZ   3  
ATOM 6949  H H    . PHE A 1 136 ? -7.067  -11.053 5.185   1.00 52.40 ? 131 PHE A H    3  
ATOM 6950  H HA   . PHE A 1 136 ? -7.050  -12.605 7.674   1.00 35.12 ? 131 PHE A HA   3  
ATOM 6951  H HB3  . PHE A 1 136 ? -5.208  -13.922 6.079   1.00 74.33 ? 131 PHE A HB3  3  
ATOM 6952  H HD1  . PHE A 1 136 ? -6.279  -14.596 8.570   1.00 54.51 ? 131 PHE A HD1  3  
ATOM 6953  H HD2  . PHE A 1 136 ? -7.907  -15.424 4.725   1.00 72.35 ? 131 PHE A HD2  3  
ATOM 6954  H HE1  . PHE A 1 136 ? -7.500  -16.518 9.504   1.00 71.45 ? 131 PHE A HE1  3  
ATOM 6955  H HE2  . PHE A 1 136 ? -9.131  -17.345 5.653   1.00 55.14 ? 131 PHE A HE2  3  
ATOM 6956  H HZ   . PHE A 1 136 ? -8.929  -17.894 8.046   1.00 64.01 ? 131 PHE A HZ   3  
ATOM 6957  N N    . ASN A 1 137 ? -4.963  -11.464 8.324   1.00 12.31 ? 132 ASN A N    3  
ATOM 6958  C CA   . ASN A 1 137 ? -3.745  -10.783 8.744   1.00 41.53 ? 132 ASN A CA   3  
ATOM 6959  C C    . ASN A 1 137 ? -2.638  -11.787 9.056   1.00 35.31 ? 132 ASN A C    3  
ATOM 6960  O O    . ASN A 1 137 ? -2.891  -12.846 9.634   1.00 62.24 ? 132 ASN A O    3  
ATOM 6961  C CB   . ASN A 1 137 ? -4.019  -9.912  9.972   1.00 51.02 ? 132 ASN A CB   3  
ATOM 6962  C CG   . ASN A 1 137 ? -4.810  -8.665  9.631   1.00 33.54 ? 132 ASN A CG   3  
ATOM 6963  O OD1  . ASN A 1 137 ? -5.576  -8.646  8.667   1.00 22.04 ? 132 ASN A OD1  3  
ATOM 6964  N ND2  . ASN A 1 137 ? -4.629  -7.614  10.422  1.00 73.14 ? 132 ASN A ND2  3  
ATOM 6965  H H    . ASN A 1 137 ? -5.592  -11.782 9.006   1.00 24.44 ? 132 ASN A H    3  
ATOM 6966  H HA   . ASN A 1 137 ? -3.421  -10.151 7.930   1.00 61.45 ? 132 ASN A HA   3  
ATOM 6967  H HB3  . ASN A 1 137 ? -3.079  -9.612  10.410  1.00 74.25 ? 132 ASN A HB3  3  
ATOM 6968  H HD21 . ASN A 1 137 ? -4.003  -7.701  11.171  1.00 71.04 ? 132 ASN A HD21 3  
ATOM 6969  H HD22 . ASN A 1 137 ? -5.129  -6.795  10.225  1.00 63.22 ? 132 ASN A HD22 3  
ATOM 6970  N N    . LEU A 1 138 ? -1.414  -11.449 8.670   1.00 4.42  ? 133 LEU A N    3  
ATOM 6971  C CA   . LEU A 1 138 ? -0.268  -12.320 8.908   1.00 72.04 ? 133 LEU A CA   3  
ATOM 6972  C C    . LEU A 1 138 ? 1.039   -11.543 8.800   1.00 54.22 ? 133 LEU A C    3  
ATOM 6973  O O    . LEU A 1 138 ? 1.079   -10.452 8.234   1.00 74.43 ? 133 LEU A O    3  
ATOM 6974  C CB   . LEU A 1 138 ? -0.269  -13.481 7.911   1.00 62.34 ? 133 LEU A CB   3  
ATOM 6975  C CG   . LEU A 1 138 ? -0.718  -13.143 6.490   1.00 45.31 ? 133 LEU A CG   3  
ATOM 6976  C CD1  . LEU A 1 138 ? 0.304   -12.249 5.804   1.00 31.12 ? 133 LEU A CD1  3  
ATOM 6977  C CD2  . LEU A 1 138 ? -0.941  -14.415 5.685   1.00 2.30  ? 133 LEU A CD2  3  
ATOM 6978  H H    . LEU A 1 138 ? -1.274  -10.594 8.214   1.00 23.42 ? 133 LEU A H    3  
ATOM 6979  H HA   . LEU A 1 138 ? -0.356  -12.717 9.910   1.00 4.31  ? 133 LEU A HA   3  
ATOM 6980  H HB3  . LEU A 1 138 ? -0.929  -14.245 8.295   1.00 21.01 ? 133 LEU A HB3  3  
ATOM 6981  H HG   . LEU A 1 138 ? -1.655  -12.605 6.532   1.00 74.33 ? 133 LEU A HG   3  
ATOM 6982  H HD11 . LEU A 1 138 ? 0.108   -11.218 6.058   1.00 54.15 ? 133 LEU A HD11 3  
ATOM 6983  H HD12 . LEU A 1 138 ? 0.234   -12.377 4.734   1.00 22.44 ? 133 LEU A HD12 3  
ATOM 6984  H HD13 . LEU A 1 138 ? 1.296   -12.519 6.134   1.00 50.43 ? 133 LEU A HD13 3  
ATOM 6985  H HD21 . LEU A 1 138 ? -1.228  -15.216 6.349   1.00 75.54 ? 133 LEU A HD21 3  
ATOM 6986  H HD22 . LEU A 1 138 ? -0.026  -14.683 5.174   1.00 34.15 ? 133 LEU A HD22 3  
ATOM 6987  H HD23 . LEU A 1 138 ? -1.723  -14.250 4.959   1.00 35.52 ? 133 LEU A HD23 3  
ATOM 6988  N N    . ASN A 1 139 ? 2.108   -12.114 9.347   1.00 4.44  ? 134 ASN A N    3  
ATOM 6989  C CA   . ASN A 1 139 ? 3.419   -11.475 9.310   1.00 60.41 ? 134 ASN A CA   3  
ATOM 6990  C C    . ASN A 1 139 ? 4.471   -12.353 9.980   1.00 2.21  ? 134 ASN A C    3  
ATOM 6991  O O    . ASN A 1 139 ? 4.143   -13.253 10.752  1.00 15.24 ? 134 ASN A O    3  
ATOM 6992  C CB   . ASN A 1 139 ? 3.363   -10.111 10.000  1.00 64.32 ? 134 ASN A CB   3  
ATOM 6993  C CG   . ASN A 1 139 ? 4.293   -9.100  9.358   1.00 61.22 ? 134 ASN A CG   3  
ATOM 6994  O OD1  . ASN A 1 139 ? 3.857   -8.230  8.603   1.00 14.44 ? 134 ASN A OD1  3  
ATOM 6995  N ND2  . ASN A 1 139 ? 5.583   -9.209  9.656   1.00 3.24  ? 134 ASN A ND2  3  
ATOM 6996  H H    . ASN A 1 139 ? 2.014   -12.985 9.784   1.00 10.12 ? 134 ASN A H    3  
ATOM 6997  H HA   . ASN A 1 139 ? 3.690   -11.334 8.275   1.00 11.14 ? 134 ASN A HA   3  
ATOM 6998  H HB3  . ASN A 1 139 ? 3.646   -10.225 11.036  1.00 20.32 ? 134 ASN A HB3  3  
ATOM 6999  H HD21 . ASN A 1 139 ? 5.858   -9.926  10.264  1.00 53.24 ? 134 ASN A HD21 3  
ATOM 7000  H HD22 . ASN A 1 139 ? 6.206   -8.568  9.254   1.00 33.40 ? 134 ASN A HD22 3  
ATOM 7001  N N    . SER A 1 140 ? 5.738   -12.084 9.679   1.00 11.43 ? 135 SER A N    3  
ATOM 7002  C CA   . SER A 1 140 ? 6.839   -12.851 10.249  1.00 11.55 ? 135 SER A CA   3  
ATOM 7003  C C    . SER A 1 140 ? 6.837   -12.755 11.771  1.00 44.24 ? 135 SER A C    3  
ATOM 7004  O O    . SER A 1 140 ? 7.446   -13.577 12.458  1.00 1.35  ? 135 SER A O    3  
ATOM 7005  C CB   . SER A 1 140 ? 8.175   -12.354 9.695   1.00 75.00 ? 135 SER A CB   3  
ATOM 7006  O OG   . SER A 1 140 ? 8.979   -13.435 9.255   1.00 64.34 ? 135 SER A OG   3  
ATOM 7007  H H    . SER A 1 140 ? 5.935   -11.354 9.056   1.00 44.35 ? 135 SER A H    3  
ATOM 7008  H HA   . SER A 1 140 ? 6.704   -13.886 9.965   1.00 64.52 ? 135 SER A HA   3  
ATOM 7009  H HB3  . SER A 1 140 ? 8.705   -11.819 10.470  1.00 62.44 ? 135 SER A HB3  3  
ATOM 7010  H HG   . SER A 1 140 ? 9.096   -14.061 9.974   1.00 31.25 ? 135 SER A HG   3  
ATOM 7011  N N    . LEU A 1 141 ? 6.149   -11.745 12.293  1.00 4.33  ? 136 LEU A N    3  
ATOM 7012  C CA   . LEU A 1 141 ? 6.068   -11.539 13.734  1.00 20.34 ? 136 LEU A CA   3  
ATOM 7013  C C    . LEU A 1 141 ? 5.178   -12.593 14.386  1.00 4.43  ? 136 LEU A C    3  
ATOM 7014  O O    . LEU A 1 141 ? 5.373   -12.955 15.547  1.00 44.22 ? 136 LEU A O    3  
ATOM 7015  C CB   . LEU A 1 141 ? 5.529   -10.141 14.039  1.00 61.23 ? 136 LEU A CB   3  
ATOM 7016  C CG   . LEU A 1 141 ? 5.438   -9.764  15.519  1.00 4.32  ? 136 LEU A CG   3  
ATOM 7017  C CD1  . LEU A 1 141 ? 6.472   -8.705  15.865  1.00 51.33 ? 136 LEU A CD1  3  
ATOM 7018  C CD2  . LEU A 1 141 ? 4.037   -9.276  15.859  1.00 73.35 ? 136 LEU A CD2  3  
ATOM 7019  H H    . LEU A 1 141 ? 5.685   -11.123 11.695  1.00 51.52 ? 136 LEU A H    3  
ATOM 7020  H HA   . LEU A 1 141 ? 7.066   -11.628 14.139  1.00 32.13 ? 136 LEU A HA   3  
ATOM 7021  H HB3  . LEU A 1 141 ? 4.537   -10.070 13.618  1.00 31.03 ? 136 LEU A HB3  3  
ATOM 7022  H HG   . LEU A 1 141 ? 5.644   -10.640 16.120  1.00 5.12  ? 136 LEU A HG   3  
ATOM 7023  H HD11 . LEU A 1 141 ? 6.189   -8.211  16.782  1.00 24.01 ? 136 LEU A HD11 3  
ATOM 7024  H HD12 . LEU A 1 141 ? 6.525   -7.980  15.067  1.00 64.03 ? 136 LEU A HD12 3  
ATOM 7025  H HD13 . LEU A 1 141 ? 7.438   -9.173  15.990  1.00 63.14 ? 136 LEU A HD13 3  
ATOM 7026  H HD21 . LEU A 1 141 ? 3.345   -10.103 15.800  1.00 74.32 ? 136 LEU A HD21 3  
ATOM 7027  H HD22 . LEU A 1 141 ? 3.743   -8.509  15.159  1.00 0.24  ? 136 LEU A HD22 3  
ATOM 7028  H HD23 . LEU A 1 141 ? 4.032   -8.872  16.862  1.00 24.44 ? 136 LEU A HD23 3  
ATOM 7029  N N    . LEU A 1 142 ? 4.201   -13.083 13.630  1.00 33.41 ? 137 LEU A N    3  
ATOM 7030  C CA   . LEU A 1 142 ? 3.281   -14.098 14.133  1.00 54.22 ? 137 LEU A CA   3  
ATOM 7031  C C    . LEU A 1 142 ? 3.543   -15.447 13.470  1.00 21.44 ? 137 LEU A C    3  
ATOM 7032  O O    . LEU A 1 142 ? 4.379   -15.557 12.572  1.00 14.43 ? 137 LEU A O    3  
ATOM 7033  C CB   . LEU A 1 142 ? 1.834   -13.669 13.888  1.00 61.53 ? 137 LEU A CB   3  
ATOM 7034  C CG   . LEU A 1 142 ? 1.478   -13.299 12.448  1.00 31.25 ? 137 LEU A CG   3  
ATOM 7035  C CD1  . LEU A 1 142 ? 1.270   -14.551 11.611  1.00 13.50 ? 137 LEU A CD1  3  
ATOM 7036  C CD2  . LEU A 1 142 ? 0.235   -12.421 12.414  1.00 74.50 ? 137 LEU A CD2  3  
ATOM 7037  H H    . LEU A 1 142 ? 4.095   -12.756 12.714  1.00 4.33  ? 137 LEU A H    3  
ATOM 7038  H HA   . LEU A 1 142 ? 3.444   -14.196 15.196  1.00 71.25 ? 137 LEU A HA   3  
ATOM 7039  H HB3  . LEU A 1 142 ? 1.635   -12.807 14.511  1.00 12.45 ? 137 LEU A HB3  3  
ATOM 7040  H HG   . LEU A 1 142 ? 2.295   -12.739 12.014  1.00 12.02 ? 137 LEU A HG   3  
ATOM 7041  H HD11 . LEU A 1 142 ? 2.101   -14.671 10.931  1.00 20.34 ? 137 LEU A HD11 3  
ATOM 7042  H HD12 . LEU A 1 142 ? 0.354   -14.460 11.047  1.00 20.42 ? 137 LEU A HD12 3  
ATOM 7043  H HD13 . LEU A 1 142 ? 1.209   -15.412 12.260  1.00 21.23 ? 137 LEU A HD13 3  
ATOM 7044  H HD21 . LEU A 1 142 ? 0.417   -11.565 11.781  1.00 71.23 ? 137 LEU A HD21 3  
ATOM 7045  H HD22 . LEU A 1 142 ? 0.003   -12.087 13.415  1.00 62.11 ? 137 LEU A HD22 3  
ATOM 7046  H HD23 . LEU A 1 142 ? -0.596  -12.988 12.022  1.00 70.12 ? 137 LEU A HD23 3  
ATOM 7047  N N    . THR A 1 143 ? 2.822   -16.470 13.916  1.00 21.42 ? 138 THR A N    3  
ATOM 7048  C CA   . THR A 1 143 ? 2.974   -17.811 13.366  1.00 71.02 ? 138 THR A CA   3  
ATOM 7049  C C    . THR A 1 143 ? 1.682   -18.287 12.711  1.00 5.11  ? 138 THR A C    3  
ATOM 7050  O O    . THR A 1 143 ? 1.690   -19.213 11.901  1.00 41.34 ? 138 THR A O    3  
ATOM 7051  C CB   . THR A 1 143 ? 3.388   -18.820 14.453  1.00 32.25 ? 138 THR A CB   3  
ATOM 7052  O OG1  . THR A 1 143 ? 2.494   -18.734 15.568  1.00 65.44 ? 138 THR A OG1  3  
ATOM 7053  C CG2  . THR A 1 143 ? 4.813   -18.562 14.917  1.00 42.11 ? 138 THR A CG2  3  
ATOM 7054  H H    . THR A 1 143 ? 2.171   -16.318 14.633  1.00 55.03 ? 138 THR A H    3  
ATOM 7055  H HA   . THR A 1 143 ? 3.755   -17.777 12.619  1.00 13.14 ? 138 THR A HA   3  
ATOM 7056  H HB   . THR A 1 143 ? 3.336   -19.816 14.037  1.00 21.44 ? 138 THR A HB   3  
ATOM 7057  H HG1  . THR A 1 143 ? 1.907   -19.493 15.569  1.00 2.13  ? 138 THR A HG1  3  
ATOM 7058  H HG21 . THR A 1 143 ? 5.069   -19.260 15.701  1.00 32.53 ? 138 THR A HG21 3  
ATOM 7059  H HG22 . THR A 1 143 ? 4.891   -17.553 15.293  1.00 71.05 ? 138 THR A HG22 3  
ATOM 7060  H HG23 . THR A 1 143 ? 5.491   -18.690 14.086  1.00 73.41 ? 138 THR A HG23 3  
ATOM 7061  N N    . GLY A 1 144 ? 0.573   -17.646 13.066  1.00 53.04 ? 139 GLY A N    3  
ATOM 7062  C CA   . GLY A 1 144 ? -0.712  -18.020 12.503  1.00 65.33 ? 139 GLY A CA   3  
ATOM 7063  C C    . GLY A 1 144 ? -1.465  -16.830 11.941  1.00 55.12 ? 139 GLY A C    3  
ATOM 7064  O O    . GLY A 1 144 ? -1.258  -15.687 12.350  1.00 73.20 ? 139 GLY A O    3  
ATOM 7065  H H    . GLY A 1 144 ? 0.627   -16.915 13.717  1.00 35.11 ? 139 GLY A H    3  
ATOM 7066  H HA2  . GLY A 1 144 ? -0.552  -18.737 11.713  1.00 43.44 ? 139 GLY A HA2  3  
ATOM 7067  H HA3  . GLY A 1 144 ? -1.311  -18.478 13.276  1.00 73.34 ? 139 GLY A HA3  3  
ATOM 7068  N N    . PRO A 1 145 ? -2.362  -17.093 10.980  1.00 2.51  ? 140 PRO A N    3  
ATOM 7069  C CA   . PRO A 1 145 ? -3.166  -16.048 10.338  1.00 75.44 ? 140 PRO A CA   3  
ATOM 7070  C C    . PRO A 1 145 ? -4.207  -15.457 11.283  1.00 54.44 ? 140 PRO A C    3  
ATOM 7071  O O    . PRO A 1 145 ? -4.474  -16.009 12.350  1.00 40.14 ? 140 PRO A O    3  
ATOM 7072  C CB   . PRO A 1 145 ? -3.848  -16.785 9.183   1.00 33.41 ? 140 PRO A CB   3  
ATOM 7073  C CG   . PRO A 1 145 ? -3.897  -18.209 9.617   1.00 31.11 ? 140 PRO A CG   3  
ATOM 7074  C CD   . PRO A 1 145 ? -2.660  -18.432 10.443  1.00 62.11 ? 140 PRO A CD   3  
ATOM 7075  H HA   . PRO A 1 145 ? -2.545  -15.255 9.946   1.00 33.24 ? 140 PRO A HA   3  
ATOM 7076  H HB3  . PRO A 1 145 ? -3.267  -16.666 8.282   1.00 44.42 ? 140 PRO A HB3  3  
ATOM 7077  H HG3  . PRO A 1 145 ? -3.891  -18.856 8.753   1.00 45.20 ? 140 PRO A HG3  3  
ATOM 7078  H HD3  . PRO A 1 145 ? -1.851  -18.787 9.822   1.00 54.40 ? 140 PRO A HD3  3  
ATOM 7079  N N    . GLU A 1 146 ? -4.792  -14.333 10.882  1.00 43.01 ? 141 GLU A N    3  
ATOM 7080  C CA   . GLU A 1 146 ? -5.804  -13.668 11.694  1.00 63.53 ? 141 GLU A CA   3  
ATOM 7081  C C    . GLU A 1 146 ? -7.033  -13.323 10.858  1.00 1.13  ? 141 GLU A C    3  
ATOM 7082  O O    . GLU A 1 146 ? -6.973  -12.476 9.966   1.00 21.13 ? 141 GLU A O    3  
ATOM 7083  C CB   . GLU A 1 146 ? -5.230  -12.398 12.325  1.00 25.24 ? 141 GLU A CB   3  
ATOM 7084  C CG   . GLU A 1 146 ? -5.327  -12.373 13.841  1.00 0.22  ? 141 GLU A CG   3  
ATOM 7085  C CD   . GLU A 1 146 ? -4.263  -11.502 14.480  1.00 42.01 ? 141 GLU A CD   3  
ATOM 7086  O OE1  . GLU A 1 146 ? -3.881  -10.485 13.864  1.00 3.21  ? 141 GLU A OE1  3  
ATOM 7087  O OE2  . GLU A 1 146 ? -3.812  -11.838 15.595  1.00 24.34 ? 141 GLU A OE2  3  
ATOM 7088  H H    . GLU A 1 146 ? -4.537  -13.941 10.020  1.00 35.21 ? 141 GLU A H    3  
ATOM 7089  H HA   . GLU A 1 146 ? -6.098  -14.347 12.480  1.00 74.24 ? 141 GLU A HA   3  
ATOM 7090  H HB3  . GLU A 1 146 ? -5.767  -11.544 11.937  1.00 44.20 ? 141 GLU A HB3  3  
ATOM 7091  H HG3  . GLU A 1 146 ? -5.218  -13.381 14.212  1.00 74.24 ? 141 GLU A HG3  3  
ATOM 7092  N N    . LEU A 1 147 ? -8.146  -13.986 11.152  1.00 1.30  ? 142 LEU A N    3  
ATOM 7093  C CA   . LEU A 1 147 ? -9.390  -13.751 10.427  1.00 72.42 ? 142 LEU A CA   3  
ATOM 7094  C C    . LEU A 1 147 ? -10.006 -12.413 10.823  1.00 1.14  ? 142 LEU A C    3  
ATOM 7095  O O    . LEU A 1 147 ? -10.166 -12.119 12.007  1.00 33.51 ? 142 LEU A O    3  
ATOM 7096  C CB   . LEU A 1 147 ? -10.383 -14.883 10.698  1.00 61.43 ? 142 LEU A CB   3  
ATOM 7097  C CG   . LEU A 1 147 ? -11.056 -14.871 12.072  1.00 4.34  ? 142 LEU A CG   3  
ATOM 7098  C CD1  . LEU A 1 147 ? -12.400 -14.163 12.001  1.00 44.12 ? 142 LEU A CD1  3  
ATOM 7099  C CD2  . LEU A 1 147 ? -11.225 -16.290 12.594  1.00 62.33 ? 142 LEU A CD2  3  
ATOM 7100  H H    . LEU A 1 147 ? -8.132  -14.649 11.872  1.00 72.21 ? 142 LEU A H    3  
ATOM 7101  H HA   . LEU A 1 147 ? -9.160  -13.730 9.372   1.00 70.34 ? 142 LEU A HA   3  
ATOM 7102  H HB3  . LEU A 1 147 ? -9.852  -15.819 10.597  1.00 43.03 ? 142 LEU A HB3  3  
ATOM 7103  H HG   . LEU A 1 147 ? -10.430 -14.329 12.767  1.00 32.20 ? 142 LEU A HG   3  
ATOM 7104  H HD11 . LEU A 1 147 ? -12.351 -13.370 11.270  1.00 13.21 ? 142 LEU A HD11 3  
ATOM 7105  H HD12 . LEU A 1 147 ? -12.638 -13.747 12.968  1.00 73.30 ? 142 LEU A HD12 3  
ATOM 7106  H HD13 . LEU A 1 147 ? -13.165 -14.870 11.715  1.00 54.22 ? 142 LEU A HD13 3  
ATOM 7107  H HD21 . LEU A 1 147 ? -11.533 -16.937 11.787  1.00 65.42 ? 142 LEU A HD21 3  
ATOM 7108  H HD22 . LEU A 1 147 ? -11.977 -16.300 13.371  1.00 44.21 ? 142 LEU A HD22 3  
ATOM 7109  H HD23 . LEU A 1 147 ? -10.286 -16.639 12.997  1.00 71.32 ? 142 LEU A HD23 3  
ATOM 7110  N N    . ILE A 1 148 ? -10.352 -11.608 9.824   1.00 11.31 ? 143 ILE A N    3  
ATOM 7111  C CA   . ILE A 1 148 ? -10.954 -10.303 10.068  1.00 31.12 ? 143 ILE A CA   3  
ATOM 7112  C C    . ILE A 1 148 ? -12.133 -10.059 9.133   1.00 23.33 ? 143 ILE A C    3  
ATOM 7113  O O    . ILE A 1 148 ? -12.033 -10.265 7.923   1.00 72.34 ? 143 ILE A O    3  
ATOM 7114  C CB   . ILE A 1 148 ? -9.928  -9.169  9.891   1.00 63.41 ? 143 ILE A CB   3  
ATOM 7115  C CG1  . ILE A 1 148 ? -8.755  -9.356  10.855  1.00 1.40  ? 143 ILE A CG1  3  
ATOM 7116  C CG2  . ILE A 1 148 ? -10.591 -7.816  10.113  1.00 2.23  ? 143 ILE A CG2  3  
ATOM 7117  C CD1  . ILE A 1 148 ? -7.697  -8.282  10.736  1.00 71.41 ? 143 ILE A CD1  3  
ATOM 7118  H H    . ILE A 1 148 ? -10.199 -11.899 8.900   1.00 54.01 ? 143 ILE A H    3  
ATOM 7119  H HA   . ILE A 1 148 ? -11.308 -10.285 11.089  1.00 13.41 ? 143 ILE A HA   3  
ATOM 7120  H HB   . ILE A 1 148 ? -9.561  -9.200  8.876   1.00 74.32 ? 143 ILE A HB   3  
ATOM 7121  H HG13 . ILE A 1 148 ? -8.285  -10.308 10.655  1.00 52.54 ? 143 ILE A HG13 3  
ATOM 7122  H HG21 . ILE A 1 148 ? -9.862  -7.032  9.974   1.00 23.24 ? 143 ILE A HG21 3  
ATOM 7123  H HG22 . ILE A 1 148 ? -11.395 -7.690  9.402   1.00 72.22 ? 143 ILE A HG22 3  
ATOM 7124  H HG23 . ILE A 1 148 ? -10.985 -7.769  11.116  1.00 22.32 ? 143 ILE A HG23 3  
ATOM 7125  H HD11 . ILE A 1 148 ? -6.774  -8.635  11.172  1.00 33.44 ? 143 ILE A HD11 3  
ATOM 7126  H HD12 . ILE A 1 148 ? -7.539  -8.044  9.696   1.00 22.32 ? 143 ILE A HD12 3  
ATOM 7127  H HD13 . ILE A 1 148 ? -8.026  -7.395  11.262  1.00 3.42  ? 143 ILE A HD13 3  
ATOM 7128  N N    . SER A 1 149 ? -13.250 -9.614  9.701   1.00 52.34 ? 144 SER A N    3  
ATOM 7129  C CA   . SER A 1 149 ? -14.450 -9.343  8.918   1.00 63.24 ? 144 SER A CA   3  
ATOM 7130  C C    . SER A 1 149 ? -14.372 -7.966  8.265   1.00 20.34 ? 144 SER A C    3  
ATOM 7131  O O    . SER A 1 149 ? -13.478 -7.175  8.564   1.00 64.13 ? 144 SER A O    3  
ATOM 7132  C CB   . SER A 1 149 ? -15.693 -9.429  9.806   1.00 4.11  ? 144 SER A CB   3  
ATOM 7133  O OG   . SER A 1 149 ? -16.456 -10.584 9.504   1.00 13.43 ? 144 SER A OG   3  
ATOM 7134  H H    . SER A 1 149 ? -13.267 -9.469  10.670  1.00 33.43 ? 144 SER A H    3  
ATOM 7135  H HA   . SER A 1 149 ? -14.518 -10.092 8.144   1.00 33.00 ? 144 SER A HA   3  
ATOM 7136  H HB3  . SER A 1 149 ? -16.308 -8.554  9.645   1.00 74.24 ? 144 SER A HB3  3  
ATOM 7137  H HG   . SER A 1 149 ? -16.350 -10.804 8.575   1.00 35.23 ? 144 SER A HG   3  
ATOM 7138  N N    . ASP A 1 150 ? -15.314 -7.689  7.372   1.00 24.45 ? 145 ASP A N    3  
ATOM 7139  C CA   . ASP A 1 150 ? -15.355 -6.408  6.675   1.00 24.12 ? 145 ASP A CA   3  
ATOM 7140  C C    . ASP A 1 150 ? -15.693 -5.275  7.639   1.00 52.20 ? 145 ASP A C    3  
ATOM 7141  O O    . ASP A 1 150 ? -15.099 -4.198  7.584   1.00 4.15  ? 145 ASP A O    3  
ATOM 7142  C CB   . ASP A 1 150 ? -16.380 -6.452  5.541   1.00 64.23 ? 145 ASP A CB   3  
ATOM 7143  C CG   . ASP A 1 150 ? -17.687 -7.090  5.966   1.00 72.11 ? 145 ASP A CG   3  
ATOM 7144  O OD1  . ASP A 1 150 ? -18.578 -6.358  6.447   1.00 62.24 ? 145 ASP A OD1  3  
ATOM 7145  O OD2  . ASP A 1 150 ? -17.821 -8.323  5.818   1.00 1.03  ? 145 ASP A OD2  3  
ATOM 7146  H H    . ASP A 1 150 ? -16.001 -8.361  7.175   1.00 63.53 ? 145 ASP A H    3  
ATOM 7147  H HA   . ASP A 1 150 ? -14.376 -6.226  6.257   1.00 12.13 ? 145 ASP A HA   3  
ATOM 7148  H HB3  . ASP A 1 150 ? -15.973 -7.020  4.718   1.00 55.43 ? 145 ASP A HB3  3  
ATOM 7149  N N    . THR A 1 151 ? -16.653 -5.525  8.525   1.00 4.32  ? 146 THR A N    3  
ATOM 7150  C CA   . THR A 1 151 ? -17.072 -4.527  9.500   1.00 63.21 ? 146 THR A CA   3  
ATOM 7151  C C    . THR A 1 151 ? -15.999 -4.309  10.560  1.00 71.12 ? 146 THR A C    3  
ATOM 7152  O O    . THR A 1 151 ? -15.895 -3.228  11.139  1.00 64.33 ? 146 THR A O    3  
ATOM 7153  C CB   . THR A 1 151 ? -18.386 -4.935  10.193  1.00 2.31  ? 146 THR A CB   3  
ATOM 7154  O OG1  . THR A 1 151 ? -18.780 -3.926  11.130  1.00 22.14 ? 146 THR A OG1  3  
ATOM 7155  C CG2  . THR A 1 151 ? -18.228 -6.267  10.912  1.00 65.41 ? 146 THR A CG2  3  
ATOM 7156  H H    . THR A 1 151 ? -17.089 -6.402  8.520   1.00 34.24 ? 146 THR A H    3  
ATOM 7157  H HA   . THR A 1 151 ? -17.241 -3.598  8.975   1.00 74.14 ? 146 THR A HA   3  
ATOM 7158  H HB   . THR A 1 151 ? -19.155 -5.038  9.441   1.00 4.33  ? 146 THR A HB   3  
ATOM 7159  H HG1  . THR A 1 151 ? -18.304 -4.050  11.953  1.00 43.13 ? 146 THR A HG1  3  
ATOM 7160  H HG21 . THR A 1 151 ? -17.503 -6.163  11.706  1.00 11.35 ? 146 THR A HG21 3  
ATOM 7161  H HG22 . THR A 1 151 ? -17.890 -7.016  10.210  1.00 73.12 ? 146 THR A HG22 3  
ATOM 7162  H HG23 . THR A 1 151 ? -19.177 -6.565  11.328  1.00 11.01 ? 146 THR A HG23 3  
ATOM 7163  N N    . TYR A 1 152 ? -15.201 -5.341  10.809  1.00 14.43 ? 147 TYR A N    3  
ATOM 7164  C CA   . TYR A 1 152 ? -14.136 -5.263  11.801  1.00 34.20 ? 147 TYR A CA   3  
ATOM 7165  C C    . TYR A 1 152 ? -12.869 -4.667  11.195  1.00 11.34 ? 147 TYR A C    3  
ATOM 7166  O O    . TYR A 1 152 ? -12.140 -3.925  11.854  1.00 61.40 ? 147 TYR A O    3  
ATOM 7167  C CB   . TYR A 1 152 ? -13.838 -6.650  12.371  1.00 53.32 ? 147 TYR A CB   3  
ATOM 7168  C CG   . TYR A 1 152 ? -12.789 -6.645  13.461  1.00 10.33 ? 147 TYR A CG   3  
ATOM 7169  C CD1  . TYR A 1 152 ? -12.731 -5.615  14.391  1.00 31.34 ? 147 TYR A CD1  3  
ATOM 7170  C CD2  . TYR A 1 152 ? -11.857 -7.671  13.560  1.00 65.24 ? 147 TYR A CD2  3  
ATOM 7171  C CE1  . TYR A 1 152 ? -11.775 -5.605  15.387  1.00 51.01 ? 147 TYR A CE1  3  
ATOM 7172  C CE2  . TYR A 1 152 ? -10.897 -7.670  14.553  1.00 74.33 ? 147 TYR A CE2  3  
ATOM 7173  C CZ   . TYR A 1 152 ? -10.860 -6.635  15.466  1.00 22.15 ? 147 TYR A CZ   3  
ATOM 7174  O OH   . TYR A 1 152 ? -9.906  -6.630  16.456  1.00 60.20 ? 147 TYR A OH   3  
ATOM 7175  H H    . TYR A 1 152 ? -15.334 -6.178  10.315  1.00 60.04 ? 147 TYR A H    3  
ATOM 7176  H HA   . TYR A 1 152 ? -14.475 -4.621  12.602  1.00 45.41 ? 147 TYR A HA   3  
ATOM 7177  H HB3  . TYR A 1 152 ? -13.486 -7.291  11.576  1.00 1.23  ? 147 TYR A HB3  3  
ATOM 7178  H HD1  . TYR A 1 152 ? -13.449 -4.810  14.327  1.00 62.44 ? 147 TYR A HD1  3  
ATOM 7179  H HD2  . TYR A 1 152 ? -11.888 -8.479  12.844  1.00 42.10 ? 147 TYR A HD2  3  
ATOM 7180  H HE1  . TYR A 1 152 ? -11.746 -4.795  16.102  1.00 3.50  ? 147 TYR A HE1  3  
ATOM 7181  H HE2  . TYR A 1 152 ? -10.181 -8.476  14.615  1.00 20.13 ? 147 TYR A HE2  3  
ATOM 7182  H HH   . TYR A 1 152 ? -9.114  -7.072  16.141  1.00 33.25 ? 147 TYR A HH   3  
ATOM 7183  N N    . LEU A 1 153 ? -12.614 -4.997  9.933   1.00 22.21 ? 148 LEU A N    3  
ATOM 7184  C CA   . LEU A 1 153 ? -11.436 -4.494  9.234   1.00 74.03 ? 148 LEU A CA   3  
ATOM 7185  C C    . LEU A 1 153 ? -11.528 -2.986  9.027   1.00 2.04  ? 148 LEU A C    3  
ATOM 7186  O O    . LEU A 1 153 ? -10.578 -2.253  9.299   1.00 0.44  ? 148 LEU A O    3  
ATOM 7187  C CB   . LEU A 1 153 ? -11.280 -5.198  7.885   1.00 32.35 ? 148 LEU A CB   3  
ATOM 7188  C CG   . LEU A 1 153 ? -10.192 -4.648  6.963   1.00 51.43 ? 148 LEU A CG   3  
ATOM 7189  C CD1  . LEU A 1 153 ? -8.958  -5.537  7.004   1.00 21.42 ? 148 LEU A CD1  3  
ATOM 7190  C CD2  . LEU A 1 153 ? -10.713 -4.521  5.539   1.00 64.41 ? 148 LEU A CD2  3  
ATOM 7191  H H    . LEU A 1 153 ? -13.231 -5.591  9.460   1.00 31.15 ? 148 LEU A H    3  
ATOM 7192  H HA   . LEU A 1 153 ? -10.572 -4.709  9.845   1.00 2.02  ? 148 LEU A HA   3  
ATOM 7193  H HB3  . LEU A 1 153 ? -12.224 -5.125  7.364   1.00 21.45 ? 148 LEU A HB3  3  
ATOM 7194  H HG   . LEU A 1 153 ? -9.904  -3.663  7.304   1.00 4.32  ? 148 LEU A HG   3  
ATOM 7195  H HD11 . LEU A 1 153 ? -8.261  -5.152  7.732   1.00 21.01 ? 148 LEU A HD11 3  
ATOM 7196  H HD12 . LEU A 1 153 ? -8.491  -5.549  6.030   1.00 33.33 ? 148 LEU A HD12 3  
ATOM 7197  H HD13 . LEU A 1 153 ? -9.248  -6.541  7.277   1.00 51.41 ? 148 LEU A HD13 3  
ATOM 7198  H HD21 . LEU A 1 153 ? -11.625 -5.089  5.438   1.00 32.34 ? 148 LEU A HD21 3  
ATOM 7199  H HD22 . LEU A 1 153 ? -9.973  -4.902  4.849   1.00 31.41 ? 148 LEU A HD22 3  
ATOM 7200  H HD23 . LEU A 1 153 ? -10.910 -3.482  5.318   1.00 61.44 ? 148 LEU A HD23 3  
ATOM 7201  N N    . ALA A 1 154 ? -12.679 -2.529  8.545   1.00 32.24 ? 149 ALA A N    3  
ATOM 7202  C CA   . ALA A 1 154 ? -12.897 -1.108  8.305   1.00 15.34 ? 149 ALA A CA   3  
ATOM 7203  C C    . ALA A 1 154 ? -12.600 -0.288  9.556   1.00 0.05  ? 149 ALA A C    3  
ATOM 7204  O O    . ALA A 1 154 ? -11.887 0.714   9.499   1.00 24.33 ? 149 ALA A O    3  
ATOM 7205  C CB   . ALA A 1 154 ? -14.325 -0.865  7.838   1.00 61.13 ? 149 ALA A CB   3  
ATOM 7206  H H    . ALA A 1 154 ? -13.400 -3.163  8.347   1.00 31.11 ? 149 ALA A H    3  
ATOM 7207  H HA   . ALA A 1 154 ? -12.228 -0.797  7.515   1.00 2.12  ? 149 ALA A HA   3  
ATOM 7208  H HB1  . ALA A 1 154 ? -14.929 -1.731  8.063   1.00 12.12 ? 149 ALA A HB1  3  
ATOM 7209  H HB2  . ALA A 1 154 ? -14.728 -0.002  8.347   1.00 43.13 ? 149 ALA A HB2  3  
ATOM 7210  H HB3  . ALA A 1 154 ? -14.329 -0.689  6.773   1.00 24.51 ? 149 ALA A HB3  3  
ATOM 7211  N N    . LEU A 1 155 ? -13.152 -0.719  10.684  1.00 13.13 ? 150 LEU A N    3  
ATOM 7212  C CA   . LEU A 1 155 ? -12.947 -0.025  11.950  1.00 72.13 ? 150 LEU A CA   3  
ATOM 7213  C C    . LEU A 1 155 ? -11.529 -0.242  12.468  1.00 45.41 ? 150 LEU A C    3  
ATOM 7214  O O    . LEU A 1 155 ? -10.910 0.669   13.018  1.00 2.10  ? 150 LEU A O    3  
ATOM 7215  C CB   . LEU A 1 155 ? -13.960 -0.508  12.990  1.00 71.20 ? 150 LEU A CB   3  
ATOM 7216  C CG   . LEU A 1 155 ? -15.137 0.428   13.264  1.00 74.55 ? 150 LEU A CG   3  
ATOM 7217  C CD1  . LEU A 1 155 ? -16.063 0.489   12.060  1.00 23.32 ? 150 LEU A CD1  3  
ATOM 7218  C CD2  . LEU A 1 155 ? -15.900 -0.022  14.503  1.00 5.51  ? 150 LEU A CD2  3  
ATOM 7219  H H    . LEU A 1 155 ? -13.711 -1.524  10.667  1.00 12.21 ? 150 LEU A H    3  
ATOM 7220  H HA   . LEU A 1 155 ? -13.096 1.030   11.777  1.00 21.32 ? 150 LEU A HA   3  
ATOM 7221  H HB3  . LEU A 1 155 ? -13.432 -0.659  13.921  1.00 45.00 ? 150 LEU A HB3  3  
ATOM 7222  H HG   . LEU A 1 155 ? -14.762 1.426   13.447  1.00 43.21 ? 150 LEU A HG   3  
ATOM 7223  H HD11 . LEU A 1 155 ? -16.216 -0.506  11.672  1.00 30.12 ? 150 LEU A HD11 3  
ATOM 7224  H HD12 . LEU A 1 155 ? -15.618 1.109   11.295  1.00 20.31 ? 150 LEU A HD12 3  
ATOM 7225  H HD13 . LEU A 1 155 ? -17.013 0.911   12.356  1.00 55.14 ? 150 LEU A HD13 3  
ATOM 7226  H HD21 . LEU A 1 155 ? -16.951 0.183   14.372  1.00 24.44 ? 150 LEU A HD21 3  
ATOM 7227  H HD22 . LEU A 1 155 ? -15.533 0.515   15.366  1.00 45.32 ? 150 LEU A HD22 3  
ATOM 7228  H HD23 . LEU A 1 155 ? -15.754 -1.082  14.648  1.00 32.21 ? 150 LEU A HD23 3  
ATOM 7229  N N    . PHE A 1 156 ? -11.017 -1.455  12.285  1.00 11.22 ? 151 PHE A N    3  
ATOM 7230  C CA   . PHE A 1 156 ? -9.670  -1.792  12.731  1.00 30.33 ? 151 PHE A CA   3  
ATOM 7231  C C    . PHE A 1 156 ? -8.643  -0.837  12.131  1.00 1.10  ? 151 PHE A C    3  
ATOM 7232  O O    . PHE A 1 156 ? -7.860  -0.216  12.852  1.00 2.55  ? 151 PHE A O    3  
ATOM 7233  C CB   . PHE A 1 156 ? -9.328  -3.233  12.347  1.00 3.14  ? 151 PHE A CB   3  
ATOM 7234  C CG   . PHE A 1 156 ? -7.884  -3.431  11.986  1.00 20.02 ? 151 PHE A CG   3  
ATOM 7235  C CD1  . PHE A 1 156 ? -6.908  -3.463  12.969  1.00 20.31 ? 151 PHE A CD1  3  
ATOM 7236  C CD2  . PHE A 1 156 ? -7.501  -3.584  10.663  1.00 62.41 ? 151 PHE A CD2  3  
ATOM 7237  C CE1  . PHE A 1 156 ? -5.578  -3.645  12.640  1.00 73.12 ? 151 PHE A CE1  3  
ATOM 7238  C CE2  . PHE A 1 156 ? -6.173  -3.767  10.328  1.00 45.11 ? 151 PHE A CE2  3  
ATOM 7239  C CZ   . PHE A 1 156 ? -5.210  -3.796  11.318  1.00 24.35 ? 151 PHE A CZ   3  
ATOM 7240  H H    . PHE A 1 156 ? -11.559 -2.140  11.839  1.00 51.11 ? 151 PHE A H    3  
ATOM 7241  H HA   . PHE A 1 156 ? -9.646  -1.700  13.806  1.00 65.11 ? 151 PHE A HA   3  
ATOM 7242  H HB3  . PHE A 1 156 ? -9.927  -3.523  11.496  1.00 23.44 ? 151 PHE A HB3  3  
ATOM 7243  H HD1  . PHE A 1 156 ? -7.196  -3.345  14.005  1.00 41.41 ? 151 PHE A HD1  3  
ATOM 7244  H HD2  . PHE A 1 156 ? -8.253  -3.560  9.887   1.00 24.00 ? 151 PHE A HD2  3  
ATOM 7245  H HE1  . PHE A 1 156 ? -4.829  -3.668  13.417  1.00 42.12 ? 151 PHE A HE1  3  
ATOM 7246  H HE2  . PHE A 1 156 ? -5.888  -3.883  9.293   1.00 50.32 ? 151 PHE A HE2  3  
ATOM 7247  H HZ   . PHE A 1 156 ? -4.172  -3.938  11.059  1.00 13.42 ? 151 PHE A HZ   3  
ATOM 7248  N N    . LEU A 1 157 ? -8.652  -0.723  10.807  1.00 53.23 ? 152 LEU A N    3  
ATOM 7249  C CA   . LEU A 1 157 ? -7.721  0.156   10.109  1.00 2.30  ? 152 LEU A CA   3  
ATOM 7250  C C    . LEU A 1 157 ? -8.042  1.621   10.388  1.00 54.32 ? 152 LEU A C    3  
ATOM 7251  O O    . LEU A 1 157 ? -7.142  2.433   10.601  1.00 74.42 ? 152 LEU A O    3  
ATOM 7252  C CB   . LEU A 1 157 ? -7.769  -0.111  8.604   1.00 22.13 ? 152 LEU A CB   3  
ATOM 7253  C CG   . LEU A 1 157 ? -9.149  -0.023  7.950   1.00 72.32 ? 152 LEU A CG   3  
ATOM 7254  C CD1  . LEU A 1 157 ? -9.350  1.341   7.308   1.00 12.53 ? 152 LEU A CD1  3  
ATOM 7255  C CD2  . LEU A 1 157 ? -9.323  -1.131  6.922   1.00 24.24 ? 152 LEU A CD2  3  
ATOM 7256  H H    . LEU A 1 157 ? -9.298  -1.243  10.287  1.00 12.11 ? 152 LEU A H    3  
ATOM 7257  H HA   . LEU A 1 157 ? -6.726  -0.059  10.472  1.00 21.53 ? 152 LEU A HA   3  
ATOM 7258  H HB3  . LEU A 1 157 ? -7.383  -1.105  8.432   1.00 42.13 ? 152 LEU A HB3  3  
ATOM 7259  H HG   . LEU A 1 157 ? -9.909  -0.149  8.710   1.00 63.02 ? 152 LEU A HG   3  
ATOM 7260  H HD11 . LEU A 1 157 ? -9.264  1.249   6.235   1.00 61.32 ? 152 LEU A HD11 3  
ATOM 7261  H HD12 . LEU A 1 157 ? -8.598  2.025   7.673   1.00 12.03 ? 152 LEU A HD12 3  
ATOM 7262  H HD13 . LEU A 1 157 ? -10.331 1.716   7.560   1.00 74.41 ? 152 LEU A HD13 3  
ATOM 7263  H HD21 . LEU A 1 157 ? -8.945  -0.797  5.966   1.00 65.42 ? 152 LEU A HD21 3  
ATOM 7264  H HD22 . LEU A 1 157 ? -10.372 -1.373  6.828   1.00 14.31 ? 152 LEU A HD22 3  
ATOM 7265  H HD23 . LEU A 1 157 ? -8.777  -2.006  7.240   1.00 2.23  ? 152 LEU A HD23 3  
ATOM 7266  N N    . ALA A 1 158 ? -9.329  1.950   10.387  1.00 72.14 ? 153 ALA A N    3  
ATOM 7267  C CA   . ALA A 1 158 ? -9.769  3.315   10.645  1.00 65.44 ? 153 ALA A CA   3  
ATOM 7268  C C    . ALA A 1 158 ? -9.266  3.808   11.999  1.00 14.32 ? 153 ALA A C    3  
ATOM 7269  O O    . ALA A 1 158 ? -9.021  4.999   12.183  1.00 20.11 ? 153 ALA A O    3  
ATOM 7270  C CB   . ALA A 1 158 ? -11.287 3.402   10.580  1.00 43.24 ? 153 ALA A CB   3  
ATOM 7271  H H    . ALA A 1 158 ? -9.999  1.257   10.212  1.00 24.13 ? 153 ALA A H    3  
ATOM 7272  H HA   . ALA A 1 158 ? -9.362  3.948   9.870   1.00 24.04 ? 153 ALA A HA   3  
ATOM 7273  H HB1  . ALA A 1 158 ? -11.717 2.642   11.216  1.00 70.35 ? 153 ALA A HB1  3  
ATOM 7274  H HB2  . ALA A 1 158 ? -11.605 4.377   10.917  1.00 21.51 ? 153 ALA A HB2  3  
ATOM 7275  H HB3  . ALA A 1 158 ? -11.612 3.248   9.563   1.00 13.10 ? 153 ALA A HB3  3  
ATOM 7276  N N    . GLN A 1 159 ? -9.115  2.883   12.941  1.00 34.41 ? 154 GLN A N    3  
ATOM 7277  C CA   . GLN A 1 159 ? -8.644  3.225   14.277  1.00 52.45 ? 154 GLN A CA   3  
ATOM 7278  C C    . GLN A 1 159 ? -7.165  3.598   14.254  1.00 13.43 ? 154 GLN A C    3  
ATOM 7279  O O    . GLN A 1 159 ? -6.725  4.481   14.991  1.00 52.45 ? 154 GLN A O    3  
ATOM 7280  C CB   . GLN A 1 159 ? -8.871  2.055   15.236  1.00 34.42 ? 154 GLN A CB   3  
ATOM 7281  C CG   . GLN A 1 159 ? -10.117 2.205   16.095  1.00 23.04 ? 154 GLN A CG   3  
ATOM 7282  C CD   . GLN A 1 159 ? -10.106 1.291   17.305  1.00 25.21 ? 154 GLN A CD   3  
ATOM 7283  O OE1  . GLN A 1 159 ? -10.143 1.754   18.445  1.00 14.10 ? 154 GLN A OE1  3  
ATOM 7284  N NE2  . GLN A 1 159 ? -10.054 -0.013  17.061  1.00 74.31 ? 154 GLN A NE2  3  
ATOM 7285  H H    . GLN A 1 159 ? -9.327  1.950   12.733  1.00 14.20 ? 154 GLN A H    3  
ATOM 7286  H HA   . GLN A 1 159 ? -9.212  4.076   14.622  1.00 0.40  ? 154 GLN A HA   3  
ATOM 7287  H HB3  . GLN A 1 159 ? -8.017  1.971   15.892  1.00 35.25 ? 154 GLN A HB3  3  
ATOM 7288  H HG3  . GLN A 1 159 ? -10.983 1.971   15.493  1.00 31.12 ? 154 GLN A HG3  3  
ATOM 7289  H HE21 . GLN A 1 159 ? -10.026 -0.309  16.127  1.00 63.03 ? 154 GLN A HE21 3  
ATOM 7290  H HE22 . GLN A 1 159 ? -10.046 -0.625  17.825  1.00 54.32 ? 154 GLN A HE22 3  
ATOM 7291  N N    . LEU A 1 160 ? -6.403  2.920   13.404  1.00 44.31 ? 155 LEU A N    3  
ATOM 7292  C CA   . LEU A 1 160 ? -4.972  3.179   13.283  1.00 63.44 ? 155 LEU A CA   3  
ATOM 7293  C C    . LEU A 1 160 ? -4.717  4.516   12.593  1.00 12.55 ? 155 LEU A C    3  
ATOM 7294  O O    . LEU A 1 160 ? -3.953  5.343   13.086  1.00 41.14 ? 155 LEU A O    3  
ATOM 7295  C CB   . LEU A 1 160 ? -4.293  2.052   12.505  1.00 43.02 ? 155 LEU A CB   3  
ATOM 7296  C CG   . LEU A 1 160 ? -4.837  0.644   12.749  1.00 73.15 ? 155 LEU A CG   3  
ATOM 7297  C CD1  . LEU A 1 160 ? -3.947  -0.395  12.086  1.00 53.21 ? 155 LEU A CD1  3  
ATOM 7298  C CD2  . LEU A 1 160 ? -4.960  0.372   14.241  1.00 31.11 ? 155 LEU A CD2  3  
ATOM 7299  H H    . LEU A 1 160 ? -6.810  2.227   12.842  1.00 24.22 ? 155 LEU A H    3  
ATOM 7300  H HA   . LEU A 1 160 ? -4.557  3.219   14.280  1.00 31.45 ? 155 LEU A HA   3  
ATOM 7301  H HB3  . LEU A 1 160 ? -3.245  2.053   12.769  1.00 75.24 ? 155 LEU A HB3  3  
ATOM 7302  H HG   . LEU A 1 160 ? -5.823  0.566   12.312  1.00 1.33  ? 155 LEU A HG   3  
ATOM 7303  H HD11 . LEU A 1 160 ? -3.747  -1.194  12.783  1.00 53.34 ? 155 LEU A HD11 3  
ATOM 7304  H HD12 . LEU A 1 160 ? -3.015  0.065   11.791  1.00 24.13 ? 155 LEU A HD12 3  
ATOM 7305  H HD13 . LEU A 1 160 ? -4.445  -0.793  11.214  1.00 62.40 ? 155 LEU A HD13 3  
ATOM 7306  H HD21 . LEU A 1 160 ? -4.245  0.978   14.778  1.00 22.11 ? 155 LEU A HD21 3  
ATOM 7307  H HD22 . LEU A 1 160 ? -4.762  -0.674  14.433  1.00 61.43 ? 155 LEU A HD22 3  
ATOM 7308  H HD23 . LEU A 1 160 ? -5.958  0.615   14.571  1.00 24.33 ? 155 LEU A HD23 3  
ATOM 7309  N N    . GLN A 1 161 ? -5.366  4.718   11.450  1.00 54.24 ? 156 GLN A N    3  
ATOM 7310  C CA   . GLN A 1 161 ? -5.210  5.955   10.692  1.00 54.12 ? 156 GLN A CA   3  
ATOM 7311  C C    . GLN A 1 161 ? -5.711  7.151   11.495  1.00 42.42 ? 156 GLN A C    3  
ATOM 7312  O O    . GLN A 1 161 ? -5.081  8.208   11.507  1.00 33.41 ? 156 GLN A O    3  
ATOM 7313  C CB   . GLN A 1 161 ? -5.966  5.863   9.366   1.00 63.03 ? 156 GLN A CB   3  
ATOM 7314  C CG   . GLN A 1 161 ? -7.452  5.587   9.529   1.00 53.43 ? 156 GLN A CG   3  
ATOM 7315  C CD   . GLN A 1 161 ? -8.275  6.856   9.607   1.00 30.21 ? 156 GLN A CD   3  
ATOM 7316  O OE1  . GLN A 1 161 ? -7.773  7.953   9.360   1.00 13.22 ? 156 GLN A OE1  3  
ATOM 7317  N NE2  . GLN A 1 161 ? -9.550  6.715   9.952   1.00 4.21  ? 156 GLN A NE2  3  
ATOM 7318  H H    . GLN A 1 161 ? -5.962  4.019   11.108  1.00 63.35 ? 156 GLN A H    3  
ATOM 7319  H HA   . GLN A 1 161 ? -4.159  6.088   10.489  1.00 71.23 ? 156 GLN A HA   3  
ATOM 7320  H HB3  . GLN A 1 161 ? -5.536  5.067   8.776   1.00 2.55  ? 156 GLN A HB3  3  
ATOM 7321  H HG3  . GLN A 1 161 ? -7.601  5.021   10.437  1.00 71.31 ? 156 GLN A HG3  3  
ATOM 7322  H HE21 . GLN A 1 161 ? -9.882  5.811   10.135  1.00 74.01 ? 156 GLN A HE21 3  
ATOM 7323  H HE22 . GLN A 1 161 ? -10.106 7.519   10.010  1.00 72.33 ? 156 GLN A HE22 3  
ATOM 7324  N N    . GLN A 1 162 ? -6.847  6.975   12.163  1.00 62.33 ? 157 GLN A N    3  
ATOM 7325  C CA   . GLN A 1 162 ? -7.431  8.042   12.966  1.00 33.32 ? 157 GLN A CA   3  
ATOM 7326  C C    . GLN A 1 162 ? -6.600  8.299   14.219  1.00 2.21  ? 157 GLN A C    3  
ATOM 7327  O O    . GLN A 1 162 ? -6.699  9.359   14.834  1.00 62.44 ? 157 GLN A O    3  
ATOM 7328  C CB   . GLN A 1 162 ? -8.867  7.686   13.357  1.00 70.14 ? 157 GLN A CB   3  
ATOM 7329  C CG   . GLN A 1 162 ? -8.957  6.709   14.518  1.00 70.30 ? 157 GLN A CG   3  
ATOM 7330  C CD   . GLN A 1 162 ? -10.383 6.294   14.822  1.00 30.23 ? 157 GLN A CD   3  
ATOM 7331  O OE1  . GLN A 1 162 ? -11.037 5.636   14.012  1.00 10.21 ? 157 GLN A OE1  3  
ATOM 7332  N NE2  . GLN A 1 162 ? -10.874 6.678   15.994  1.00 32.30 ? 157 GLN A NE2  3  
ATOM 7333  H H    . GLN A 1 162 ? -7.301  6.110   12.113  1.00 34.15 ? 157 GLN A H    3  
ATOM 7334  H HA   . GLN A 1 162 ? -7.444  8.941   12.368  1.00 11.52 ? 157 GLN A HA   3  
ATOM 7335  H HB3  . GLN A 1 162 ? -9.361  7.245   12.504  1.00 52.23 ? 157 GLN A HB3  3  
ATOM 7336  H HG3  . GLN A 1 162 ? -8.538  7.175   15.398  1.00 11.24 ? 157 GLN A HG3  3  
ATOM 7337  H HE21 . GLN A 1 162 ? -10.297 7.201   16.589  1.00 10.01 ? 157 GLN A HE21 3  
ATOM 7338  H HE22 . GLN A 1 162 ? -11.794 6.424   16.216  1.00 73.05 ? 157 GLN A HE22 3  
ATOM 7339  N N    . GLU A 1 163 ? -5.781  7.320   14.590  1.00 74.22 ? 158 GLU A N    3  
ATOM 7340  C CA   . GLU A 1 163 ? -4.933  7.441   15.771  1.00 15.15 ? 158 GLU A CA   3  
ATOM 7341  C C    . GLU A 1 163 ? -3.607  8.109   15.423  1.00 11.53 ? 158 GLU A C    3  
ATOM 7342  O O    . GLU A 1 163 ? -3.363  9.258   15.787  1.00 23.03 ? 158 GLU A O    3  
ATOM 7343  C CB   . GLU A 1 163 ? -4.678  6.062   16.385  1.00 43.43 ? 158 GLU A CB   3  
ATOM 7344  C CG   . GLU A 1 163 ? -5.706  5.660   17.428  1.00 34.34 ? 158 GLU A CG   3  
ATOM 7345  C CD   . GLU A 1 163 ? -5.329  6.111   18.825  1.00 13.23 ? 158 GLU A CD   3  
ATOM 7346  O OE1  . GLU A 1 163 ? -4.150  5.948   19.204  1.00 51.32 ? 158 GLU A OE1  3  
ATOM 7347  O OE2  . GLU A 1 163 ? -6.213  6.628   19.540  1.00 42.33 ? 158 GLU A OE2  3  
ATOM 7348  H H    . GLU A 1 163 ? -5.747  6.497   14.059  1.00 11.04 ? 158 GLU A H    3  
ATOM 7349  H HA   . GLU A 1 163 ? -5.454  8.053   16.492  1.00 5.31  ? 158 GLU A HA   3  
ATOM 7350  H HB3  . GLU A 1 163 ? -3.704  6.066   16.853  1.00 34.23 ? 158 GLU A HB3  3  
ATOM 7351  H HG3  . GLU A 1 163 ? -5.800  4.584   17.426  1.00 51.33 ? 158 GLU A HG3  3  
ATOM 7352  N N    . GLY A 1 164 ? -2.751  7.378   14.713  1.00 74.30 ? 159 GLY A N    3  
ATOM 7353  C CA   . GLY A 1 164 ? -1.460  7.915   14.327  1.00 64.22 ? 159 GLY A CA   3  
ATOM 7354  C C    . GLY A 1 164 ? -0.535  6.855   13.766  1.00 14.52 ? 159 GLY A C    3  
ATOM 7355  O O    . GLY A 1 164 ? 0.674   6.890   13.994  1.00 65.05 ? 159 GLY A O    3  
ATOM 7356  H H    . GLY A 1 164 ? -3.000  6.467   14.450  1.00 42.42 ? 159 GLY A H    3  
ATOM 7357  H HA2  . GLY A 1 164 ? -1.609  8.681   13.580  1.00 13.35 ? 159 GLY A HA2  3  
ATOM 7358  H HA3  . GLY A 1 164 ? -0.994  8.360   15.195  1.00 44.42 ? 159 GLY A HA3  3  
ATOM 7359  N N    . TYR A 1 165 ? -1.104  5.905   13.031  1.00 41.21 ? 160 TYR A N    3  
ATOM 7360  C CA   . TYR A 1 165 ? -0.322  4.826   12.438  1.00 72.51 ? 160 TYR A CA   3  
ATOM 7361  C C    . TYR A 1 165 ? -0.120  5.057   10.944  1.00 45.22 ? 160 TYR A C    3  
ATOM 7362  O O    . TYR A 1 165 ? -0.510  6.093   10.406  1.00 15.13 ? 160 TYR A O    3  
ATOM 7363  C CB   . TYR A 1 165 ? -1.014  3.481   12.669  1.00 45.32 ? 160 TYR A CB   3  
ATOM 7364  C CG   . TYR A 1 165 ? -1.083  3.077   14.123  1.00 41.35 ? 160 TYR A CG   3  
ATOM 7365  C CD1  . TYR A 1 165 ? -1.884  3.771   15.021  1.00 74.01 ? 160 TYR A CD1  3  
ATOM 7366  C CD2  . TYR A 1 165 ? -0.344  2.001   14.602  1.00 45.22 ? 160 TYR A CD2  3  
ATOM 7367  C CE1  . TYR A 1 165 ? -1.950  3.405   16.352  1.00 64.32 ? 160 TYR A CE1  3  
ATOM 7368  C CE2  . TYR A 1 165 ? -0.404  1.628   15.930  1.00 15.21 ? 160 TYR A CE2  3  
ATOM 7369  C CZ   . TYR A 1 165 ? -1.208  2.333   16.801  1.00 52.53 ? 160 TYR A CZ   3  
ATOM 7370  O OH   . TYR A 1 165 ? -1.269  1.965   18.126  1.00 32.14 ? 160 TYR A OH   3  
ATOM 7371  H H    . TYR A 1 165 ? -2.072  5.929   12.884  1.00 34.10 ? 160 TYR A H    3  
ATOM 7372  H HA   . TYR A 1 165 ? 0.644   4.811   12.923  1.00 34.34 ? 160 TYR A HA   3  
ATOM 7373  H HB3  . TYR A 1 165 ? -0.476  2.712   12.134  1.00 54.32 ? 160 TYR A HB3  3  
ATOM 7374  H HD1  . TYR A 1 165 ? -2.464  4.611   14.666  1.00 2.45  ? 160 TYR A HD1  3  
ATOM 7375  H HD2  . TYR A 1 165 ? 0.286   1.451   13.916  1.00 35.45 ? 160 TYR A HD2  3  
ATOM 7376  H HE1  . TYR A 1 165 ? -2.579  3.957   17.034  1.00 70.03 ? 160 TYR A HE1  3  
ATOM 7377  H HE2  . TYR A 1 165 ? 0.177   0.788   16.283  1.00 22.43 ? 160 TYR A HE2  3  
ATOM 7378  H HH   . TYR A 1 165 ? -0.476  2.262   18.577  1.00 22.30 ? 160 TYR A HH   3  
ATOM 7379  N N    . SER A 1 166 ? 0.495   4.083   10.279  1.00 25.41 ? 161 SER A N    3  
ATOM 7380  C CA   . SER A 1 166 ? 0.754   4.181   8.848   1.00 11.14 ? 161 SER A CA   3  
ATOM 7381  C C    . SER A 1 166 ? 0.002   3.094   8.085   1.00 34.04 ? 161 SER A C    3  
ATOM 7382  O O    . SER A 1 166 ? 0.418   1.935   8.063   1.00 31.01 ? 161 SER A O    3  
ATOM 7383  C CB   . SER A 1 166 ? 2.254   4.069   8.570   1.00 22.03 ? 161 SER A CB   3  
ATOM 7384  O OG   . SER A 1 166 ? 2.928   5.265   8.923   1.00 61.34 ? 161 SER A OG   3  
ATOM 7385  H H    . SER A 1 166 ? 0.783   3.282   10.764  1.00 62.32 ? 161 SER A H    3  
ATOM 7386  H HA   . SER A 1 166 ? 0.405   5.146   8.512   1.00 21.23 ? 161 SER A HA   3  
ATOM 7387  H HB3  . SER A 1 166 ? 2.410   3.880   7.517   1.00 34.41 ? 161 SER A HB3  3  
ATOM 7388  H HG   . SER A 1 166 ? 3.283   5.182   9.811   1.00 11.22 ? 161 SER A HG   3  
ATOM 7389  N N    . ILE A 1 167 ? -1.107  3.477   7.460   1.00 55.14 ? 162 ILE A N    3  
ATOM 7390  C CA   . ILE A 1 167 ? -1.916  2.536   6.696   1.00 24.02 ? 162 ILE A CA   3  
ATOM 7391  C C    . ILE A 1 167 ? -1.652  2.673   5.200   1.00 52.22 ? 162 ILE A C    3  
ATOM 7392  O O    . ILE A 1 167 ? -1.794  3.755   4.630   1.00 51.11 ? 162 ILE A O    3  
ATOM 7393  C CB   . ILE A 1 167 ? -3.419  2.741   6.962   1.00 23.34 ? 162 ILE A CB   3  
ATOM 7394  C CG1  . ILE A 1 167 ? -3.687  2.830   8.465   1.00 62.03 ? 162 ILE A CG1  3  
ATOM 7395  C CG2  . ILE A 1 167 ? -4.226  1.611   6.341   1.00 20.02 ? 162 ILE A CG2  3  
ATOM 7396  C CD1  . ILE A 1 167 ? -3.213  1.618   9.236   1.00 13.14 ? 162 ILE A CD1  3  
ATOM 7397  H H    . ILE A 1 167 ? -1.387  4.414   7.515   1.00 50.24 ? 162 ILE A H    3  
ATOM 7398  H HA   . ILE A 1 167 ? -1.649  1.537   7.008   1.00 3.45  ? 162 ILE A HA   3  
ATOM 7399  H HB   . ILE A 1 167 ? -3.721  3.666   6.494   1.00 31.53 ? 162 ILE A HB   3  
ATOM 7400  H HG13 . ILE A 1 167 ? -4.749  2.935   8.629   1.00 30.35 ? 162 ILE A HG13 3  
ATOM 7401  H HG21 . ILE A 1 167 ? -3.691  0.680   6.458   1.00 60.33 ? 162 ILE A HG21 3  
ATOM 7402  H HG22 . ILE A 1 167 ? -5.184  1.539   6.834   1.00 64.15 ? 162 ILE A HG22 3  
ATOM 7403  H HG23 . ILE A 1 167 ? -4.376  1.810   5.290   1.00 53.35 ? 162 ILE A HG23 3  
ATOM 7404  H HD11 . ILE A 1 167 ? -2.830  0.880   8.546   1.00 12.30 ? 162 ILE A HD11 3  
ATOM 7405  H HD12 . ILE A 1 167 ? -2.435  1.908   9.924   1.00 72.41 ? 162 ILE A HD12 3  
ATOM 7406  H HD13 . ILE A 1 167 ? -4.042  1.196   9.787   1.00 31.40 ? 162 ILE A HD13 3  
ATOM 7407  N N    . PHE A 1 168 ? -1.268  1.569   4.569   1.00 34.41 ? 163 PHE A N    3  
ATOM 7408  C CA   . PHE A 1 168 ? -0.986  1.564   3.139   1.00 25.01 ? 163 PHE A CA   3  
ATOM 7409  C C    . PHE A 1 168 ? -1.969  0.668   2.392   1.00 1.52  ? 163 PHE A C    3  
ATOM 7410  O O    . PHE A 1 168 ? -2.142  -0.502  2.732   1.00 40.45 ? 163 PHE A O    3  
ATOM 7411  C CB   . PHE A 1 168 ? 0.448   1.092   2.882   1.00 72.40 ? 163 PHE A CB   3  
ATOM 7412  C CG   . PHE A 1 168 ? 1.492   2.024   3.427   1.00 24.15 ? 163 PHE A CG   3  
ATOM 7413  C CD1  . PHE A 1 168 ? 1.963   1.878   4.722   1.00 24.02 ? 163 PHE A CD1  3  
ATOM 7414  C CD2  . PHE A 1 168 ? 2.002   3.048   2.643   1.00 71.10 ? 163 PHE A CD2  3  
ATOM 7415  C CE1  . PHE A 1 168 ? 2.924   2.734   5.225   1.00 73.02 ? 163 PHE A CE1  3  
ATOM 7416  C CE2  . PHE A 1 168 ? 2.964   3.906   3.142   1.00 32.13 ? 163 PHE A CE2  3  
ATOM 7417  C CZ   . PHE A 1 168 ? 3.424   3.750   4.435   1.00 12.41 ? 163 PHE A CZ   3  
ATOM 7418  H H    . PHE A 1 168 ? -1.173  0.736   5.078   1.00 63.23 ? 163 PHE A H    3  
ATOM 7419  H HA   . PHE A 1 168 ? -1.093  2.575   2.777   1.00 42.14 ? 163 PHE A HA   3  
ATOM 7420  H HB3  . PHE A 1 168 ? 0.603   1.002   1.818   1.00 3.41  ? 163 PHE A HB3  3  
ATOM 7421  H HD1  . PHE A 1 168 ? 1.572   1.084   5.341   1.00 3.43  ? 163 PHE A HD1  3  
ATOM 7422  H HD2  . PHE A 1 168 ? 1.642   3.172   1.633   1.00 62.00 ? 163 PHE A HD2  3  
ATOM 7423  H HE1  . PHE A 1 168 ? 3.282   2.609   6.236   1.00 13.14 ? 163 PHE A HE1  3  
ATOM 7424  H HE2  . PHE A 1 168 ? 3.353   4.700   2.522   1.00 13.20 ? 163 PHE A HE2  3  
ATOM 7425  H HZ   . PHE A 1 168 ? 4.176   4.419   4.826   1.00 64.21 ? 163 PHE A HZ   3  
ATOM 7426  N N    . VAL A 1 169 ? -2.614  1.227   1.372   1.00 52.04 ? 164 VAL A N    3  
ATOM 7427  C CA   . VAL A 1 169 ? -3.580  0.480   0.577   1.00 24.02 ? 164 VAL A CA   3  
ATOM 7428  C C    . VAL A 1 169 ? -2.914  -0.164  -0.634  1.00 12.25 ? 164 VAL A C    3  
ATOM 7429  O O    . VAL A 1 169 ? -2.411  0.526   -1.521  1.00 22.42 ? 164 VAL A O    3  
ATOM 7430  C CB   . VAL A 1 169 ? -4.730  1.384   0.096   1.00 25.51 ? 164 VAL A CB   3  
ATOM 7431  C CG1  . VAL A 1 169 ? -5.826  0.555   -0.556  1.00 44.22 ? 164 VAL A CG1  3  
ATOM 7432  C CG2  . VAL A 1 169 ? -5.285  2.201   1.253   1.00 53.20 ? 164 VAL A CG2  3  
ATOM 7433  H H    . VAL A 1 169 ? -2.434  2.164   1.150   1.00 65.22 ? 164 VAL A H    3  
ATOM 7434  H HA   . VAL A 1 169 ? -3.998  -0.296  1.201   1.00 12.51 ? 164 VAL A HA   3  
ATOM 7435  H HB   . VAL A 1 169 ? -4.339  2.068   -0.643  1.00 1.21  ? 164 VAL A HB   3  
ATOM 7436  H HG11 . VAL A 1 169 ? -6.767  1.078   -0.479  1.00 1.10  ? 164 VAL A HG11 3  
ATOM 7437  H HG12 . VAL A 1 169 ? -5.585  0.395   -1.597  1.00 13.14 ? 164 VAL A HG12 3  
ATOM 7438  H HG13 . VAL A 1 169 ? -5.902  -0.398  -0.053  1.00 23.24 ? 164 VAL A HG13 3  
ATOM 7439  H HG21 . VAL A 1 169 ? -5.099  1.681   2.181   1.00 12.53 ? 164 VAL A HG21 3  
ATOM 7440  H HG22 . VAL A 1 169 ? -4.801  3.166   1.279   1.00 63.14 ? 164 VAL A HG22 3  
ATOM 7441  H HG23 . VAL A 1 169 ? -6.348  2.335   1.122   1.00 30.22 ? 164 VAL A HG23 3  
ATOM 7442  N N    . VAL A 1 170 ? -2.914  -1.493  -0.665  1.00 21.24 ? 165 VAL A N    3  
ATOM 7443  C CA   . VAL A 1 170 ? -2.311  -2.231  -1.769  1.00 75.30 ? 165 VAL A CA   3  
ATOM 7444  C C    . VAL A 1 170 ? -3.369  -2.684  -2.770  1.00 62.12 ? 165 VAL A C    3  
ATOM 7445  O O    . VAL A 1 170 ? -4.192  -3.550  -2.471  1.00 24.51 ? 165 VAL A O    3  
ATOM 7446  C CB   . VAL A 1 170 ? -1.538  -3.464  -1.263  1.00 71.44 ? 165 VAL A CB   3  
ATOM 7447  C CG1  . VAL A 1 170 ? -0.751  -4.104  -2.397  1.00 33.32 ? 165 VAL A CG1  3  
ATOM 7448  C CG2  . VAL A 1 170 ? -0.617  -3.080  -0.114  1.00 5.41  ? 165 VAL A CG2  3  
ATOM 7449  H H    . VAL A 1 170 ? -3.330  -1.989  0.071   1.00 44.11 ? 165 VAL A H    3  
ATOM 7450  H HA   . VAL A 1 170 ? -1.614  -1.575  -2.269  1.00 51.12 ? 165 VAL A HA   3  
ATOM 7451  H HB   . VAL A 1 170 ? -2.252  -4.187  -0.897  1.00 64.42 ? 165 VAL A HB   3  
ATOM 7452  H HG11 . VAL A 1 170 ? 0.107   -3.492  -2.629  1.00 63.12 ? 165 VAL A HG11 3  
ATOM 7453  H HG12 . VAL A 1 170 ? -0.423  -5.088  -2.097  1.00 14.13 ? 165 VAL A HG12 3  
ATOM 7454  H HG13 . VAL A 1 170 ? -1.382  -4.184  -3.271  1.00 70.23 ? 165 VAL A HG13 3  
ATOM 7455  H HG21 . VAL A 1 170 ? 0.315   -3.617  -0.207  1.00 51.32 ? 165 VAL A HG21 3  
ATOM 7456  H HG22 . VAL A 1 170 ? -0.424  -2.017  -0.147  1.00 43.00 ? 165 VAL A HG22 3  
ATOM 7457  H HG23 . VAL A 1 170 ? -1.086  -3.331  0.825   1.00 0.34  ? 165 VAL A HG23 3  
ATOM 7458  N N    . LYS A 1 171 ? -3.340  -2.094  -3.959  1.00 21.00 ? 166 LYS A N    3  
ATOM 7459  C CA   . LYS A 1 171 ? -4.294  -2.436  -5.007  1.00 2.44  ? 166 LYS A CA   3  
ATOM 7460  C C    . LYS A 1 171 ? -3.574  -2.783  -6.306  1.00 3.31  ? 166 LYS A C    3  
ATOM 7461  O O    . LYS A 1 171 ? -2.574  -2.159  -6.659  1.00 61.40 ? 166 LYS A O    3  
ATOM 7462  C CB   . LYS A 1 171 ? -5.263  -1.276  -5.243  1.00 33.21 ? 166 LYS A CB   3  
ATOM 7463  C CG   . LYS A 1 171 ? -6.150  -1.462  -6.461  1.00 34.25 ? 166 LYS A CG   3  
ATOM 7464  C CD   . LYS A 1 171 ? -7.048  -2.679  -6.316  1.00 12.32 ? 166 LYS A CD   3  
ATOM 7465  C CE   . LYS A 1 171 ? -8.496  -2.347  -6.641  1.00 23.34 ? 166 LYS A CE   3  
ATOM 7466  N NZ   . LYS A 1 171 ? -8.798  -2.535  -8.088  1.00 74.43 ? 166 LYS A NZ   3  
ATOM 7467  H H    . LYS A 1 171 ? -2.659  -1.411  -4.137  1.00 44.30 ? 166 LYS A H    3  
ATOM 7468  H HA   . LYS A 1 171 ? -4.853  -3.300  -4.678  1.00 52.14 ? 166 LYS A HA   3  
ATOM 7469  H HB3  . LYS A 1 171 ? -4.693  -0.368  -5.373  1.00 24.13 ? 166 LYS A HB3  3  
ATOM 7470  H HG3  . LYS A 1 171 ? -5.526  -1.587  -7.334  1.00 14.41 ? 166 LYS A HG3  3  
ATOM 7471  H HD3  . LYS A 1 171 ? -6.990  -3.040  -5.299  1.00 20.03 ? 166 LYS A HD3  3  
ATOM 7472  H HE3  . LYS A 1 171 ? -8.683  -1.317  -6.374  1.00 74.42 ? 166 LYS A HE3  3  
ATOM 7473  H HZ1  . LYS A 1 171 ? -7.930  -2.786  -8.603  1.00 64.31 ? 166 LYS A HZ1  3  
ATOM 7474  H HZ2  . LYS A 1 171 ? -9.184  -1.657  -8.489  1.00 34.35 ? 166 LYS A HZ2  3  
ATOM 7475  H HZ3  . LYS A 1 171 ? -9.495  -3.296  -8.211  1.00 14.35 ? 166 LYS A HZ3  3  
ATOM 7476  N N    . GLY A 1 172 ? -4.091  -3.781  -7.017  1.00 21.34 ? 167 GLY A N    3  
ATOM 7477  C CA   . GLY A 1 172 ? -3.485  -4.191  -8.270  1.00 0.34  ? 167 GLY A CA   3  
ATOM 7478  C C    . GLY A 1 172 ? -3.922  -5.579  -8.698  1.00 41.04 ? 167 GLY A C    3  
ATOM 7479  O O    . GLY A 1 172 ? -4.974  -6.063  -8.280  1.00 3.22  ? 167 GLY A O    3  
ATOM 7480  H H    . GLY A 1 172 ? -4.891  -4.242  -6.687  1.00 74.02 ? 167 GLY A H    3  
ATOM 7481  H HA2  . GLY A 1 172 ? -3.761  -3.486  -9.039  1.00 24.24 ? 167 GLY A HA2  3  
ATOM 7482  H HA3  . GLY A 1 172 ? -2.412  -4.183  -8.156  1.00 5.42  ? 167 GLY A HA3  3  
ATOM 7483  N N    . ASP A 1 173 ? -3.112  -6.219  -9.534  1.00 12.50 ? 168 ASP A N    3  
ATOM 7484  C CA   . ASP A 1 173 ? -3.420  -7.560  -10.019 1.00 53.24 ? 168 ASP A CA   3  
ATOM 7485  C C    . ASP A 1 173 ? -2.412  -8.576  -9.488  1.00 24.52 ? 168 ASP A C    3  
ATOM 7486  O O    . ASP A 1 173 ? -1.203  -8.341  -9.521  1.00 35.43 ? 168 ASP A O    3  
ATOM 7487  C CB   . ASP A 1 173 ? -3.428  -7.582  -11.548 1.00 2.13  ? 168 ASP A CB   3  
ATOM 7488  C CG   . ASP A 1 173 ? -4.492  -8.506  -12.108 1.00 23.22 ? 168 ASP A CG   3  
ATOM 7489  O OD1  . ASP A 1 173 ? -5.691  -8.198  -11.944 1.00 1.44  ? 168 ASP A OD1  3  
ATOM 7490  O OD2  . ASP A 1 173 ? -4.126  -9.536  -12.712 1.00 41.35 ? 168 ASP A OD2  3  
ATOM 7491  H H    . ASP A 1 173 ? -2.287  -5.781  -9.831  1.00 74.40 ? 168 ASP A H    3  
ATOM 7492  H HA   . ASP A 1 173 ? -4.403  -7.825  -9.659  1.00 42.43 ? 168 ASP A HA   3  
ATOM 7493  H HB3  . ASP A 1 173 ? -2.464  -7.917  -11.902 1.00 70.24 ? 168 ASP A HB3  3  
ATOM 7494  N N    . LEU A 1 174 ? -2.918  -9.702  -8.999  1.00 51.33 ? 169 LEU A N    3  
ATOM 7495  C CA   . LEU A 1 174 ? -2.062  -10.753 -8.461  1.00 73.05 ? 169 LEU A CA   3  
ATOM 7496  C C    . LEU A 1 174 ? -1.963  -11.926 -9.431  1.00 32.20 ? 169 LEU A C    3  
ATOM 7497  O O    . LEU A 1 174 ? -2.804  -12.108 -10.311 1.00 61.31 ? 169 LEU A O    3  
ATOM 7498  C CB   . LEU A 1 174 ? -2.601  -11.237 -7.113  1.00 21.33 ? 169 LEU A CB   3  
ATOM 7499  C CG   . LEU A 1 174 ? -2.168  -10.430 -5.888  1.00 70.24 ? 169 LEU A CG   3  
ATOM 7500  C CD1  . LEU A 1 174 ? -3.372  -10.067 -5.034  1.00 31.54 ? 169 LEU A CD1  3  
ATOM 7501  C CD2  . LEU A 1 174 ? -1.147  -11.209 -5.070  1.00 24.32 ? 169 LEU A CD2  3  
ATOM 7502  H H    . LEU A 1 174 ? -3.889  -9.832  -9.000  1.00 45.22 ? 169 LEU A H    3  
ATOM 7503  H HA   . LEU A 1 174 ? -1.077  -10.336 -8.316  1.00 12.40 ? 169 LEU A HA   3  
ATOM 7504  H HB3  . LEU A 1 174 ? -2.273  -12.256 -6.972  1.00 45.32 ? 169 LEU A HB3  3  
ATOM 7505  H HG   . LEU A 1 174 ? -1.704  -9.510  -6.217  1.00 54.41 ? 169 LEU A HG   3  
ATOM 7506  H HD11 . LEU A 1 174 ? -3.106  -10.130 -3.990  1.00 33.12 ? 169 LEU A HD11 3  
ATOM 7507  H HD12 . LEU A 1 174 ? -4.181  -10.752 -5.242  1.00 15.32 ? 169 LEU A HD12 3  
ATOM 7508  H HD13 . LEU A 1 174 ? -3.688  -9.060  -5.265  1.00 43.31 ? 169 LEU A HD13 3  
ATOM 7509  H HD21 . LEU A 1 174 ? -1.290  -12.267 -5.231  1.00 21.42 ? 169 LEU A HD21 3  
ATOM 7510  H HD22 . LEU A 1 174 ? -1.279  -10.982 -4.023  1.00 72.23 ? 169 LEU A HD22 3  
ATOM 7511  H HD23 . LEU A 1 174 ? -0.151  -10.928 -5.378  1.00 73.13 ? 169 LEU A HD23 3  
ATOM 7512  N N    . PRO A 1 175 ? -0.912  -12.742 -9.267  1.00 43.43 ? 170 PRO A N    3  
ATOM 7513  C CA   . PRO A 1 175 ? -0.678  -13.914 -10.118 1.00 70.42 ? 170 PRO A CA   3  
ATOM 7514  C C    . PRO A 1 175 ? -1.699  -15.019 -9.874  1.00 13.34 ? 170 PRO A C    3  
ATOM 7515  O O    . PRO A 1 175 ? -2.355  -15.488 -10.804 1.00 21.04 ? 170 PRO A O    3  
ATOM 7516  C CB   . PRO A 1 175 ? 0.722   -14.377 -9.707  1.00 33.24 ? 170 PRO A CB   3  
ATOM 7517  C CG   . PRO A 1 175 ? 0.891   -13.882 -8.313  1.00 23.42 ? 170 PRO A CG   3  
ATOM 7518  C CD   . PRO A 1 175 ? 0.131   -12.586 -8.239  1.00 3.22  ? 170 PRO A CD   3  
ATOM 7519  H HA   . PRO A 1 175 ? -0.679  -13.649 -11.165 1.00 1.13  ? 170 PRO A HA   3  
ATOM 7520  H HB3  . PRO A 1 175 ? 1.457   -13.948 -10.371 1.00 21.23 ? 170 PRO A HB3  3  
ATOM 7521  H HG3  . PRO A 1 175 ? 1.938   -13.713 -8.108  1.00 2.42  ? 170 PRO A HG3  3  
ATOM 7522  H HD3  . PRO A 1 175 ? 0.780   -11.754 -8.472  1.00 10.23 ? 170 PRO A HD3  3  
ATOM 7523  N N    . ASP A 1 176 ? -1.830  -15.432 -8.618  1.00 45.13 ? 171 ASP A N    3  
ATOM 7524  C CA   . ASP A 1 176 ? -2.772  -16.481 -8.252  1.00 55.50 ? 171 ASP A CA   3  
ATOM 7525  C C    . ASP A 1 176 ? -2.886  -17.521 -9.362  1.00 41.42 ? 171 ASP A C    3  
ATOM 7526  O O    . ASP A 1 176 ? -2.086  -18.455 -9.436  1.00 30.10 ? 171 ASP A O    3  
ATOM 7527  C CB   . ASP A 1 176 ? -4.148  -15.881 -7.955  1.00 55.41 ? 171 ASP A CB   3  
ATOM 7528  C CG   . ASP A 1 176 ? -5.267  -16.889 -8.123  1.00 2.45  ? 171 ASP A CG   3  
ATOM 7529  O OD1  . ASP A 1 176 ? -5.481  -17.698 -7.196  1.00 11.23 ? 171 ASP A OD1  3  
ATOM 7530  O OD2  . ASP A 1 176 ? -5.931  -16.870 -9.182  1.00 64.34 ? 171 ASP A OD2  3  
ATOM 7531  H H    . ASP A 1 176 ? -1.278  -15.019 -7.920  1.00 2.20  ? 171 ASP A H    3  
ATOM 7532  H HA   . ASP A 1 176 ? -2.401  -16.965 -7.361  1.00 55.14 ? 171 ASP A HA   3  
ATOM 7533  H HB3  . ASP A 1 176 ? -4.325  -15.056 -8.629  1.00 72.23 ? 171 ASP A HB3  3  
ATOM 7534  N N    . MET A 1 6   ? -10.174 -21.367 3.262   1.00 43.41 ? 1   MET A N    4  
ATOM 7535  C CA   . MET A 1 6   ? -8.949  -21.483 4.044   1.00 54.45 ? 1   MET A CA   4  
ATOM 7536  C C    . MET A 1 6   ? -8.532  -22.944 4.187   1.00 62.52 ? 1   MET A C    4  
ATOM 7537  O O    . MET A 1 6   ? -8.385  -23.450 5.298   1.00 34.40 ? 1   MET A O    4  
ATOM 7538  C CB   . MET A 1 6   ? -9.141  -20.859 5.427   1.00 73.34 ? 1   MET A CB   4  
ATOM 7539  C CG   . MET A 1 6   ? -10.312 -21.443 6.201   1.00 52.25 ? 1   MET A CG   4  
ATOM 7540  S SD   . MET A 1 6   ? -10.142 -21.230 7.984   1.00 62.13 ? 1   MET A SD   4  
ATOM 7541  C CE   . MET A 1 6   ? -11.537 -20.162 8.331   1.00 62.22 ? 1   MET A CE   4  
ATOM 7542  H H    . MET A 1 6   ? -10.781 -22.133 3.208   1.00 14.43 ? 1   MET A H    4  
ATOM 7543  H HA   . MET A 1 6   ? -8.169  -20.948 3.522   1.00 34.41 ? 1   MET A HA   4  
ATOM 7544  H HB3  . MET A 1 6   ? -9.309  -19.799 5.311   1.00 63.43 ? 1   MET A HB3  4  
ATOM 7545  H HG3  . MET A 1 6   ? -10.377 -22.499 5.983   1.00 53.13 ? 1   MET A HG3  4  
ATOM 7546  H HE1  . MET A 1 6   ? -11.202 -19.305 8.898   1.00 4.13  ? 1   MET A HE1  4  
ATOM 7547  H HE2  . MET A 1 6   ? -11.975 -19.829 7.402   1.00 32.33 ? 1   MET A HE2  4  
ATOM 7548  H HE3  . MET A 1 6   ? -12.273 -20.706 8.903   1.00 34.34 ? 1   MET A HE3  4  
ATOM 7549  N N    . GLU A 1 7   ? -8.342  -23.614 3.055   1.00 34.34 ? 2   GLU A N    4  
ATOM 7550  C CA   . GLU A 1 7   ? -7.944  -25.016 3.055   1.00 55.12 ? 2   GLU A CA   4  
ATOM 7551  C C    . GLU A 1 7   ? -6.667  -25.219 2.245   1.00 14.13 ? 2   GLU A C    4  
ATOM 7552  O O    . GLU A 1 7   ? -6.416  -26.306 1.725   1.00 4.53  ? 2   GLU A O    4  
ATOM 7553  C CB   . GLU A 1 7   ? -9.065  -25.889 2.488   1.00 32.43 ? 2   GLU A CB   4  
ATOM 7554  C CG   . GLU A 1 7   ? -9.414  -25.569 1.045   1.00 3.14  ? 2   GLU A CG   4  
ATOM 7555  C CD   . GLU A 1 7   ? -10.563 -26.410 0.521   1.00 51.23 ? 2   GLU A CD   4  
ATOM 7556  O OE1  . GLU A 1 7   ? -11.501 -26.682 1.299   1.00 61.53 ? 2   GLU A OE1  4  
ATOM 7557  O OE2  . GLU A 1 7   ? -10.523 -26.797 -0.666  1.00 50.51 ? 2   GLU A OE2  4  
ATOM 7558  H H    . GLU A 1 7   ? -8.476  -23.155 2.199   1.00 41.30 ? 2   GLU A H    4  
ATOM 7559  H HA   . GLU A 1 7   ? -7.757  -25.307 4.078   1.00 12.34 ? 2   GLU A HA   4  
ATOM 7560  H HB3  . GLU A 1 7   ? -9.952  -25.751 3.089   1.00 60.50 ? 2   GLU A HB3  4  
ATOM 7561  H HG3  . GLU A 1 7   ? -8.545  -25.750 0.428   1.00 64.54 ? 2   GLU A HG3  4  
ATOM 7562  N N    . SER A 1 8   ? -5.864  -24.165 2.142   1.00 75.10 ? 3   SER A N    4  
ATOM 7563  C CA   . SER A 1 8   ? -4.615  -24.226 1.392   1.00 23.22 ? 3   SER A CA   4  
ATOM 7564  C C    . SER A 1 8   ? -3.682  -23.089 1.800   1.00 4.04  ? 3   SER A C    4  
ATOM 7565  O O    . SER A 1 8   ? -2.861  -22.631 1.004   1.00 24.13 ? 3   SER A O    4  
ATOM 7566  C CB   . SER A 1 8   ? -4.895  -24.157 -0.110  1.00 11.54 ? 3   SER A CB   4  
ATOM 7567  O OG   . SER A 1 8   ? -3.815  -24.694 -0.854  1.00 2.15  ? 3   SER A OG   4  
ATOM 7568  H H    . SER A 1 8   ? -6.120  -23.326 2.581   1.00 0.52  ? 3   SER A H    4  
ATOM 7569  H HA   . SER A 1 8   ? -4.138  -25.166 1.618   1.00 54.12 ? 3   SER A HA   4  
ATOM 7570  H HB3  . SER A 1 8   ? -5.041  -23.127 -0.400  1.00 44.33 ? 3   SER A HB3  4  
ATOM 7571  H HG   . SER A 1 8   ? -4.102  -25.490 -1.307  1.00 75.12 ? 3   SER A HG   4  
ATOM 7572  N N    . ILE A 1 9   ? -3.814  -22.640 3.043   1.00 54.00 ? 4   ILE A N    4  
ATOM 7573  C CA   . ILE A 1 9   ? -2.983  -21.559 3.556   1.00 40.15 ? 4   ILE A CA   4  
ATOM 7574  C C    . ILE A 1 9   ? -1.610  -22.073 3.977   1.00 53.12 ? 4   ILE A C    4  
ATOM 7575  O O    . ILE A 1 9   ? -1.499  -23.106 4.637   1.00 54.43 ? 4   ILE A O    4  
ATOM 7576  C CB   . ILE A 1 9   ? -3.647  -20.859 4.757   1.00 53.45 ? 4   ILE A CB   4  
ATOM 7577  C CG1  . ILE A 1 9   ? -5.083  -20.459 4.412   1.00 55.02 ? 4   ILE A CG1  4  
ATOM 7578  C CG2  . ILE A 1 9   ? -2.838  -19.641 5.175   1.00 3.51  ? 4   ILE A CG2  4  
ATOM 7579  C CD1  . ILE A 1 9   ? -5.819  -19.804 5.558   1.00 72.42 ? 4   ILE A CD1  4  
ATOM 7580  H H    . ILE A 1 9   ? -4.487  -23.046 3.629   1.00 45.32 ? 4   ILE A H    4  
ATOM 7581  H HA   . ILE A 1 9   ? -2.856  -20.832 2.767   1.00 53.12 ? 4   ILE A HA   4  
ATOM 7582  H HB   . ILE A 1 9   ? -3.663  -21.552 5.585   1.00 4.33  ? 4   ILE A HB   4  
ATOM 7583  H HG13 . ILE A 1 9   ? -5.635  -21.342 4.122   1.00 74.35 ? 4   ILE A HG13 4  
ATOM 7584  H HG21 . ILE A 1 9   ? -1.858  -19.955 5.505   1.00 44.02 ? 4   ILE A HG21 4  
ATOM 7585  H HG22 . ILE A 1 9   ? -2.735  -18.972 4.333   1.00 0.31  ? 4   ILE A HG22 4  
ATOM 7586  H HG23 . ILE A 1 9   ? -3.343  -19.132 5.981   1.00 24.23 ? 4   ILE A HG23 4  
ATOM 7587  H HD11 . ILE A 1 9   ? -5.337  -18.872 5.811   1.00 64.42 ? 4   ILE A HD11 4  
ATOM 7588  H HD12 . ILE A 1 9   ? -6.842  -19.616 5.269   1.00 62.54 ? 4   ILE A HD12 4  
ATOM 7589  H HD13 . ILE A 1 9   ? -5.804  -20.459 6.417   1.00 73.34 ? 4   ILE A HD13 4  
ATOM 7590  N N    . PHE A 1 10  ? -0.567  -21.345 3.592   1.00 32.21 ? 5   PHE A N    4  
ATOM 7591  C CA   . PHE A 1 10  ? 0.798   -21.727 3.931   1.00 42.13 ? 5   PHE A CA   4  
ATOM 7592  C C    . PHE A 1 10  ? 1.042   -21.605 5.432   1.00 73.50 ? 5   PHE A C    4  
ATOM 7593  O O    . PHE A 1 10  ? 1.076   -20.502 5.979   1.00 74.40 ? 5   PHE A O    4  
ATOM 7594  C CB   . PHE A 1 10  ? 1.798   -20.854 3.169   1.00 43.22 ? 5   PHE A CB   4  
ATOM 7595  C CG   . PHE A 1 10  ? 2.545   -21.595 2.097   1.00 5.40  ? 5   PHE A CG   4  
ATOM 7596  C CD1  . PHE A 1 10  ? 3.520   -22.522 2.428   1.00 0.32  ? 5   PHE A CD1  4  
ATOM 7597  C CD2  . PHE A 1 10  ? 2.273   -21.364 0.758   1.00 2.32  ? 5   PHE A CD2  4  
ATOM 7598  C CE1  . PHE A 1 10  ? 4.209   -23.206 1.444   1.00 24.11 ? 5   PHE A CE1  4  
ATOM 7599  C CE2  . PHE A 1 10  ? 2.958   -22.045 -0.230  1.00 12.02 ? 5   PHE A CE2  4  
ATOM 7600  C CZ   . PHE A 1 10  ? 3.929   -22.966 0.114   1.00 3.45  ? 5   PHE A CZ   4  
ATOM 7601  H H    . PHE A 1 10  ? -0.721  -20.531 3.068   1.00 41.11 ? 5   PHE A H    4  
ATOM 7602  H HA   . PHE A 1 10  ? 0.936   -22.756 3.638   1.00 61.13 ? 5   PHE A HA   4  
ATOM 7603  H HB3  . PHE A 1 10  ? 2.521   -20.456 3.864   1.00 31.22 ? 5   PHE A HB3  4  
ATOM 7604  H HD1  . PHE A 1 10  ? 3.741   -22.710 3.469   1.00 73.43 ? 5   PHE A HD1  4  
ATOM 7605  H HD2  . PHE A 1 10  ? 1.515   -20.644 0.488   1.00 24.51 ? 5   PHE A HD2  4  
ATOM 7606  H HE1  . PHE A 1 10  ? 4.967   -23.925 1.717   1.00 2.14  ? 5   PHE A HE1  4  
ATOM 7607  H HE2  . PHE A 1 10  ? 2.737   -21.856 -1.270  1.00 60.33 ? 5   PHE A HE2  4  
ATOM 7608  H HZ   . PHE A 1 10  ? 4.465   -23.500 -0.657  1.00 61.33 ? 5   PHE A HZ   4  
ATOM 7609  N N    . HIS A 1 11  ? 1.209   -22.746 6.092   1.00 74.35 ? 6   HIS A N    4  
ATOM 7610  C CA   . HIS A 1 11  ? 1.448   -22.769 7.531   1.00 62.34 ? 6   HIS A CA   4  
ATOM 7611  C C    . HIS A 1 11  ? 2.937   -22.918 7.832   1.00 20.51 ? 6   HIS A C    4  
ATOM 7612  O O    . HIS A 1 11  ? 3.575   -23.873 7.392   1.00 54.04 ? 6   HIS A O    4  
ATOM 7613  C CB   . HIS A 1 11  ? 0.668   -23.911 8.183   1.00 21.23 ? 6   HIS A CB   4  
ATOM 7614  C CG   . HIS A 1 11  ? 1.044   -25.265 7.664   1.00 71.33 ? 6   HIS A CG   4  
ATOM 7615  N ND1  . HIS A 1 11  ? 0.507   -25.806 6.516   1.00 4.24  ? 6   HIS A ND1  4  
ATOM 7616  C CD2  . HIS A 1 11  ? 1.910   -26.186 8.143   1.00 54.25 ? 6   HIS A CD2  4  
ATOM 7617  C CE1  . HIS A 1 11  ? 1.026   -27.004 6.312   1.00 24.44 ? 6   HIS A CE1  4  
ATOM 7618  N NE2  . HIS A 1 11  ? 1.880   -27.259 7.286   1.00 43.53 ? 6   HIS A NE2  4  
ATOM 7619  H H    . HIS A 1 11  ? 1.171   -23.593 5.601   1.00 61.31 ? 6   HIS A H    4  
ATOM 7620  H HA   . HIS A 1 11  ? 1.105   -21.830 7.940   1.00 21.22 ? 6   HIS A HA   4  
ATOM 7621  H HB3  . HIS A 1 11  ? -0.387  -23.767 8.001   1.00 24.51 ? 6   HIS A HB3  4  
ATOM 7622  H HD1  . HIS A 1 11  ? -0.157  -25.378 5.936   1.00 64.23 ? 6   HIS A HD1  4  
ATOM 7623  H HD2  . HIS A 1 11  ? 2.514   -26.098 9.037   1.00 4.14  ? 6   HIS A HD2  4  
ATOM 7624  H HE1  . HIS A 1 11  ? 0.791   -27.663 5.489   1.00 52.13 ? 6   HIS A HE1  4  
ATOM 7625  N N    . GLU A 1 12  ? 3.482   -21.966 8.582   1.00 42.24 ? 7   GLU A N    4  
ATOM 7626  C CA   . GLU A 1 12  ? 4.897   -21.991 8.939   1.00 14.22 ? 7   GLU A CA   4  
ATOM 7627  C C    . GLU A 1 12  ? 5.258   -20.797 9.817   1.00 70.23 ? 7   GLU A C    4  
ATOM 7628  O O    . GLU A 1 12  ? 4.770   -19.687 9.606   1.00 65.03 ? 7   GLU A O    4  
ATOM 7629  C CB   . GLU A 1 12  ? 5.763   -21.994 7.679   1.00 42.04 ? 7   GLU A CB   4  
ATOM 7630  C CG   . GLU A 1 12  ? 6.484   -23.309 7.437   1.00 12.10 ? 7   GLU A CG   4  
ATOM 7631  C CD   . GLU A 1 12  ? 6.343   -23.798 6.009   1.00 24.30 ? 7   GLU A CD   4  
ATOM 7632  O OE1  . GLU A 1 12  ? 6.702   -23.038 5.084   1.00 71.24 ? 7   GLU A OE1  4  
ATOM 7633  O OE2  . GLU A 1 12  ? 5.874   -24.939 5.815   1.00 62.11 ? 7   GLU A OE2  4  
ATOM 7634  H H    . GLU A 1 12  ? 2.922   -21.229 8.904   1.00 2.33  ? 7   GLU A H    4  
ATOM 7635  H HA   . GLU A 1 12  ? 5.082   -22.899 9.493   1.00 72.22 ? 7   GLU A HA   4  
ATOM 7636  H HB3  . GLU A 1 12  ? 6.505   -21.213 7.766   1.00 23.14 ? 7   GLU A HB3  4  
ATOM 7637  H HG3  . GLU A 1 12  ? 6.074   -24.057 8.100   1.00 35.32 ? 7   GLU A HG3  4  
ATOM 7638  N N    . LYS A 1 13  ? 6.117   -21.033 10.803  1.00 11.12 ? 8   LYS A N    4  
ATOM 7639  C CA   . LYS A 1 13  ? 6.546   -19.978 11.714  1.00 35.13 ? 8   LYS A CA   4  
ATOM 7640  C C    . LYS A 1 13  ? 8.064   -19.838 11.706  1.00 41.44 ? 8   LYS A C    4  
ATOM 7641  O O    . LYS A 1 13  ? 8.788   -20.831 11.650  1.00 15.20 ? 8   LYS A O    4  
ATOM 7642  C CB   . LYS A 1 13  ? 6.058   -20.273 13.134  1.00 20.14 ? 8   LYS A CB   4  
ATOM 7643  C CG   . LYS A 1 13  ? 6.273   -21.713 13.565  1.00 62.22 ? 8   LYS A CG   4  
ATOM 7644  C CD   . LYS A 1 13  ? 5.020   -22.549 13.363  1.00 42.53 ? 8   LYS A CD   4  
ATOM 7645  C CE   . LYS A 1 13  ? 3.907   -22.123 14.306  1.00 31.01 ? 8   LYS A CE   4  
ATOM 7646  N NZ   . LYS A 1 13  ? 3.074   -23.279 14.739  1.00 70.04 ? 8   LYS A NZ   4  
ATOM 7647  H H    . LYS A 1 13  ? 6.471   -21.940 10.921  1.00 54.41 ? 8   LYS A H    4  
ATOM 7648  H HA   . LYS A 1 13  ? 6.108   -19.051 11.377  1.00 41.13 ? 8   LYS A HA   4  
ATOM 7649  H HB3  . LYS A 1 13  ? 5.000   -20.057 13.191  1.00 23.25 ? 8   LYS A HB3  4  
ATOM 7650  H HG3  . LYS A 1 13  ? 6.541   -21.729 14.613  1.00 0.43  ? 8   LYS A HG3  4  
ATOM 7651  H HD3  . LYS A 1 13  ? 5.258   -23.588 13.547  1.00 41.32 ? 8   LYS A HD3  4  
ATOM 7652  H HE3  . LYS A 1 13  ? 3.278   -21.406 13.799  1.00 52.32 ? 8   LYS A HE3  4  
ATOM 7653  H HZ1  . LYS A 1 13  ? 3.542   -23.783 15.519  1.00 54.50 ? 8   LYS A HZ1  4  
ATOM 7654  H HZ2  . LYS A 1 13  ? 2.938   -23.938 13.948  1.00 21.14 ? 8   LYS A HZ2  4  
ATOM 7655  H HZ3  . LYS A 1 13  ? 2.144   -22.947 15.065  1.00 22.44 ? 8   LYS A HZ3  4  
ATOM 7656  N N    . GLN A 1 14  ? 8.539   -18.598 11.764  1.00 41.14 ? 9   GLN A N    4  
ATOM 7657  C CA   . GLN A 1 14  ? 9.972   -18.329 11.765  1.00 42.14 ? 9   GLN A CA   4  
ATOM 7658  C C    . GLN A 1 14  ? 10.308  -17.168 12.696  1.00 53.55 ? 9   GLN A C    4  
ATOM 7659  O O    . GLN A 1 14  ? 9.438   -16.377 13.055  1.00 12.24 ? 9   GLN A O    4  
ATOM 7660  C CB   . GLN A 1 14  ? 10.456  -18.017 10.347  1.00 32.54 ? 9   GLN A CB   4  
ATOM 7661  C CG   . GLN A 1 14  ? 9.786   -16.799 9.732   1.00 25.55 ? 9   GLN A CG   4  
ATOM 7662  C CD   . GLN A 1 14  ? 10.640  -15.550 9.829   1.00 53.41 ? 9   GLN A CD   4  
ATOM 7663  O OE1  . GLN A 1 14  ? 11.632  -15.406 9.114   1.00 0.02  ? 9   GLN A OE1  4  
ATOM 7664  N NE2  . GLN A 1 14  ? 10.261  -14.641 10.719  1.00 31.35 ? 9   GLN A NE2  4  
ATOM 7665  H H    . GLN A 1 14  ? 7.913   -17.848 11.808  1.00 24.34 ? 9   GLN A H    4  
ATOM 7666  H HA   . GLN A 1 14  ? 10.476  -19.215 12.119  1.00 0.12  ? 9   GLN A HA   4  
ATOM 7667  H HB3  . GLN A 1 14  ? 10.254  -18.869 9.715   1.00 70.41 ? 9   GLN A HB3  4  
ATOM 7668  H HG3  . GLN A 1 14  ? 8.852   -16.620 10.244  1.00 22.32 ? 9   GLN A HG3  4  
ATOM 7669  H HE21 . GLN A 1 14  ? 9.460   -14.825 11.255  1.00 61.22 ? 9   GLN A HE21 4  
ATOM 7670  H HE22 . GLN A 1 14  ? 10.794  -13.825 10.804  1.00 44.50 ? 9   GLN A HE22 4  
ATOM 7671  N N    . GLU A 1 15  ? 11.577  -17.075 13.083  1.00 31.01 ? 10  GLU A N    4  
ATOM 7672  C CA   . GLU A 1 15  ? 12.026  -16.012 13.974  1.00 65.13 ? 10  GLU A CA   4  
ATOM 7673  C C    . GLU A 1 15  ? 12.673  -14.877 13.184  1.00 21.44 ? 10  GLU A C    4  
ATOM 7674  O O    . GLU A 1 15  ? 13.633  -15.090 12.444  1.00 34.32 ? 10  GLU A O    4  
ATOM 7675  C CB   . GLU A 1 15  ? 13.017  -16.561 15.002  1.00 4.21  ? 10  GLU A CB   4  
ATOM 7676  C CG   . GLU A 1 15  ? 12.356  -17.078 16.268  1.00 61.42 ? 10  GLU A CG   4  
ATOM 7677  C CD   . GLU A 1 15  ? 13.360  -17.431 17.348  1.00 31.21 ? 10  GLU A CD   4  
ATOM 7678  O OE1  . GLU A 1 15  ? 14.576  -17.346 17.079  1.00 52.12 ? 10  GLU A OE1  4  
ATOM 7679  O OE2  . GLU A 1 15  ? 12.928  -17.794 18.463  1.00 44.44 ? 10  GLU A OE2  4  
ATOM 7680  H H    . GLU A 1 15  ? 12.225  -17.736 12.763  1.00 61.14 ? 10  GLU A H    4  
ATOM 7681  H HA   . GLU A 1 15  ? 11.161  -15.624 14.492  1.00 54.41 ? 10  GLU A HA   4  
ATOM 7682  H HB3  . GLU A 1 15  ? 13.705  -15.775 15.275  1.00 42.44 ? 10  GLU A HB3  4  
ATOM 7683  H HG3  . GLU A 1 15  ? 11.783  -17.960 16.026  1.00 75.12 ? 10  GLU A HG3  4  
ATOM 7684  N N    . GLY A 1 16  ? 12.139  -13.670 13.347  1.00 61.41 ? 11  GLY A N    4  
ATOM 7685  C CA   . GLY A 1 16  ? 12.676  -12.520 12.643  1.00 33.22 ? 11  GLY A CA   4  
ATOM 7686  C C    . GLY A 1 16  ? 11.840  -11.272 12.850  1.00 61.10 ? 11  GLY A C    4  
ATOM 7687  O O    . GLY A 1 16  ? 12.345  -10.249 13.312  1.00 23.13 ? 11  GLY A O    4  
ATOM 7688  H H    . GLY A 1 16  ? 11.374  -13.560 13.950  1.00 72.34 ? 11  GLY A H    4  
ATOM 7689  H HA2  . GLY A 1 16  ? 13.679  -12.332 12.995  1.00 31.31 ? 11  GLY A HA2  4  
ATOM 7690  H HA3  . GLY A 1 16  ? 12.712  -12.744 11.587  1.00 52.14 ? 11  GLY A HA3  4  
ATOM 7691  N N    . SER A 1 17  ? 10.559  -11.355 12.506  1.00 54.23 ? 12  SER A N    4  
ATOM 7692  C CA   . SER A 1 17  ? 9.653   -10.222 12.651  1.00 75.31 ? 12  SER A CA   4  
ATOM 7693  C C    . SER A 1 17  ? 10.047  -9.088  11.711  1.00 60.13 ? 12  SER A C    4  
ATOM 7694  O O    . SER A 1 17  ? 11.230  -8.861  11.455  1.00 44.34 ? 12  SER A O    4  
ATOM 7695  C CB   . SER A 1 17  ? 9.653   -9.724  14.098  1.00 54.30 ? 12  SER A CB   4  
ATOM 7696  O OG   . SER A 1 17  ? 10.544  -8.634  14.262  1.00 50.55 ? 12  SER A OG   4  
ATOM 7697  H H    . SER A 1 17  ? 10.215  -12.199 12.143  1.00 53.34 ? 12  SER A H    4  
ATOM 7698  H HA   . SER A 1 17  ? 8.659   -10.558 12.396  1.00 44.21 ? 12  SER A HA   4  
ATOM 7699  H HB3  . SER A 1 17  ? 9.961   -10.527 14.752  1.00 44.41 ? 12  SER A HB3  4  
ATOM 7700  H HG   . SER A 1 17  ? 11.392  -8.959  14.575  1.00 64.21 ? 12  SER A HG   4  
ATOM 7701  N N    . LEU A 1 18  ? 9.048   -8.378  11.199  1.00 10.23 ? 13  LEU A N    4  
ATOM 7702  C CA   . LEU A 1 18  ? 9.288   -7.266  10.286  1.00 51.23 ? 13  LEU A CA   4  
ATOM 7703  C C    . LEU A 1 18  ? 10.197  -7.691  9.138   1.00 41.31 ? 13  LEU A C    4  
ATOM 7704  O O    . LEU A 1 18  ? 11.291  -7.151  8.966   1.00 53.43 ? 13  LEU A O    4  
ATOM 7705  C CB   . LEU A 1 18  ? 9.914   -6.089  11.038  1.00 11.10 ? 13  LEU A CB   4  
ATOM 7706  C CG   . LEU A 1 18  ? 8.952   -5.231  11.860  1.00 60.10 ? 13  LEU A CG   4  
ATOM 7707  C CD1  . LEU A 1 18  ? 9.190   -5.439  13.348  1.00 21.23 ? 13  LEU A CD1  4  
ATOM 7708  C CD2  . LEU A 1 18  ? 9.103   -3.762  11.494  1.00 62.20 ? 13  LEU A CD2  4  
ATOM 7709  H H    . LEU A 1 18  ? 8.126   -8.607  11.440  1.00 64.32 ? 13  LEU A H    4  
ATOM 7710  H HA   . LEU A 1 18  ? 8.336   -6.958  9.881   1.00 62.04 ? 13  LEU A HA   4  
ATOM 7711  H HB3  . LEU A 1 18  ? 10.391  -5.449  10.310  1.00 0.13  ? 13  LEU A HB3  4  
ATOM 7712  H HG   . LEU A 1 18  ? 7.936   -5.529  11.640  1.00 31.31 ? 13  LEU A HG   4  
ATOM 7713  H HD11 . LEU A 1 18  ? 10.224  -5.699  13.514  1.00 32.13 ? 13  LEU A HD11 4  
ATOM 7714  H HD12 . LEU A 1 18  ? 8.555   -6.236  13.706  1.00 23.23 ? 13  LEU A HD12 4  
ATOM 7715  H HD13 . LEU A 1 18  ? 8.958   -4.528  13.880  1.00 35.34 ? 13  LEU A HD13 4  
ATOM 7716  H HD21 . LEU A 1 18  ? 9.113   -3.167  12.395  1.00 64.45 ? 13  LEU A HD21 4  
ATOM 7717  H HD22 . LEU A 1 18  ? 8.272   -3.458  10.873  1.00 41.43 ? 13  LEU A HD22 4  
ATOM 7718  H HD23 . LEU A 1 18  ? 10.027  -3.618  10.956  1.00 0.10  ? 13  LEU A HD23 4  
ATOM 7719  N N    . CYS A 1 19  ? 9.736   -8.659  8.353   1.00 43.30 ? 14  CYS A N    4  
ATOM 7720  C CA   . CYS A 1 19  ? 10.508  -9.156  7.218   1.00 20.54 ? 14  CYS A CA   4  
ATOM 7721  C C    . CYS A 1 19  ? 9.796   -8.855  5.904   1.00 12.23 ? 14  CYS A C    4  
ATOM 7722  O O    . CYS A 1 19  ? 8.589   -9.062  5.779   1.00 74.30 ? 14  CYS A O    4  
ATOM 7723  C CB   . CYS A 1 19  ? 10.742  -10.661 7.354   1.00 22.11 ? 14  CYS A CB   4  
ATOM 7724  S SG   . CYS A 1 19  ? 12.478  -11.151 7.229   1.00 11.44 ? 14  CYS A SG   4  
ATOM 7725  H H    . CYS A 1 19  ? 8.858   -9.049  8.540   1.00 11.03 ? 14  CYS A H    4  
ATOM 7726  H HA   . CYS A 1 19  ? 11.461  -8.650  7.220   1.00 61.02 ? 14  CYS A HA   4  
ATOM 7727  H HB3  . CYS A 1 19  ? 10.197  -11.173 6.576   1.00 72.12 ? 14  CYS A HB3  4  
ATOM 7728  H HG   . CYS A 1 19  ? 12.841  -11.666 8.394   1.00 44.21 ? 14  CYS A HG   4  
ATOM 7729  N N    . ALA A 1 20  ? 10.550  -8.366  4.926   1.00 44.35 ? 15  ALA A N    4  
ATOM 7730  C CA   . ALA A 1 20  ? 9.991   -8.038  3.621   1.00 3.42  ? 15  ALA A CA   4  
ATOM 7731  C C    . ALA A 1 20  ? 9.630   -9.300  2.845   1.00 1.44  ? 15  ALA A C    4  
ATOM 7732  O O    . ALA A 1 20  ? 8.540   -9.403  2.281   1.00 44.43 ? 15  ALA A O    4  
ATOM 7733  C CB   . ALA A 1 20  ? 10.972  -7.189  2.824   1.00 55.02 ? 15  ALA A CB   4  
ATOM 7734  H H    . ALA A 1 20  ? 11.506  -8.223  5.085   1.00 55.33 ? 15  ALA A H    4  
ATOM 7735  H HA   . ALA A 1 20  ? 9.094   -7.456  3.778   1.00 3.41  ? 15  ALA A HA   4  
ATOM 7736  H HB1  . ALA A 1 20  ? 10.705  -6.147  2.920   1.00 73.43 ? 15  ALA A HB1  4  
ATOM 7737  H HB2  . ALA A 1 20  ? 11.971  -7.343  3.204   1.00 32.20 ? 15  ALA A HB2  4  
ATOM 7738  H HB3  . ALA A 1 20  ? 10.934  -7.476  1.784   1.00 1.35  ? 15  ALA A HB3  4  
ATOM 7739  N N    . GLN A 1 21  ? 10.552  -10.258 2.821   1.00 13.43 ? 16  GLN A N    4  
ATOM 7740  C CA   . GLN A 1 21  ? 10.330  -11.514 2.112   1.00 63.40 ? 16  GLN A CA   4  
ATOM 7741  C C    . GLN A 1 21  ? 9.112   -12.244 2.668   1.00 72.03 ? 16  GLN A C    4  
ATOM 7742  O O    . GLN A 1 21  ? 8.277   -12.745 1.915   1.00 3.22  ? 16  GLN A O    4  
ATOM 7743  C CB   . GLN A 1 21  ? 11.566  -12.407 2.215   1.00 41.34 ? 16  GLN A CB   4  
ATOM 7744  C CG   . GLN A 1 21  ? 11.264  -13.887 2.044   1.00 72.34 ? 16  GLN A CG   4  
ATOM 7745  C CD   . GLN A 1 21  ? 11.025  -14.589 3.366   1.00 54.44 ? 16  GLN A CD   4  
ATOM 7746  O OE1  . GLN A 1 21  ? 10.019  -15.278 3.544   1.00 70.12 ? 16  GLN A OE1  4  
ATOM 7747  N NE2  . GLN A 1 21  ? 11.951  -14.421 4.302   1.00 64.33 ? 16  GLN A NE2  4  
ATOM 7748  H H    . GLN A 1 21  ? 11.400  -10.117 3.289   1.00 71.02 ? 16  GLN A H    4  
ATOM 7749  H HA   . GLN A 1 21  ? 10.150  -11.280 1.074   1.00 21.04 ? 16  GLN A HA   4  
ATOM 7750  H HB3  . GLN A 1 21  ? 12.020  -12.264 3.185   1.00 30.42 ? 16  GLN A HB3  4  
ATOM 7751  H HG3  . GLN A 1 21  ? 12.101  -14.357 1.549   1.00 11.44 ? 16  GLN A HG3  4  
ATOM 7752  H HE21 . GLN A 1 21  ? 12.726  -13.858 4.090   1.00 60.25 ? 16  GLN A HE21 4  
ATOM 7753  H HE22 . GLN A 1 21  ? 11.822  -14.863 5.166   1.00 52.03 ? 16  GLN A HE22 4  
ATOM 7754  N N    . HIS A 1 22  ? 9.017   -12.303 3.994   1.00 25.32 ? 17  HIS A N    4  
ATOM 7755  C CA   . HIS A 1 22  ? 7.901   -12.972 4.651   1.00 54.15 ? 17  HIS A CA   4  
ATOM 7756  C C    . HIS A 1 22  ? 6.575   -12.328 4.262   1.00 23.42 ? 17  HIS A C    4  
ATOM 7757  O O    . HIS A 1 22  ? 5.584   -13.019 4.019   1.00 41.23 ? 17  HIS A O    4  
ATOM 7758  C CB   . HIS A 1 22  ? 8.076   -12.929 6.170   1.00 14.43 ? 17  HIS A CB   4  
ATOM 7759  C CG   . HIS A 1 22  ? 7.554   -14.148 6.868   1.00 45.22 ? 17  HIS A CG   4  
ATOM 7760  N ND1  . HIS A 1 22  ? 6.210   -14.402 7.034   1.00 0.22  ? 17  HIS A ND1  4  
ATOM 7761  C CD2  . HIS A 1 22  ? 8.207   -15.186 7.441   1.00 34.31 ? 17  HIS A CD2  4  
ATOM 7762  C CE1  . HIS A 1 22  ? 6.057   -15.543 7.682   1.00 55.30 ? 17  HIS A CE1  4  
ATOM 7763  N NE2  . HIS A 1 22  ? 7.253   -16.039 7.940   1.00 13.24 ? 17  HIS A NE2  4  
ATOM 7764  H H    . HIS A 1 22  ? 9.714   -11.884 4.541   1.00 32.12 ? 17  HIS A H    4  
ATOM 7765  H HA   . HIS A 1 22  ? 7.895   -14.002 4.328   1.00 24.02 ? 17  HIS A HA   4  
ATOM 7766  H HB3  . HIS A 1 22  ? 7.551   -12.071 6.562   1.00 50.22 ? 17  HIS A HB3  4  
ATOM 7767  H HD1  . HIS A 1 22  ? 5.477   -13.830 6.725   1.00 11.22 ? 17  HIS A HD1  4  
ATOM 7768  H HD2  . HIS A 1 22  ? 9.278   -15.320 7.498   1.00 23.45 ? 17  HIS A HD2  4  
ATOM 7769  H HE1  . HIS A 1 22  ? 5.114   -15.994 7.953   1.00 41.21 ? 17  HIS A HE1  4  
ATOM 7770  N N    . CYS A 1 23  ? 6.562   -11.000 4.206   1.00 33.34 ? 18  CYS A N    4  
ATOM 7771  C CA   . CYS A 1 23  ? 5.356   -10.261 3.847   1.00 74.13 ? 18  CYS A CA   4  
ATOM 7772  C C    . CYS A 1 23  ? 4.983   -10.504 2.389   1.00 1.31  ? 18  CYS A C    4  
ATOM 7773  O O    . CYS A 1 23  ? 3.818   -10.745 2.066   1.00 41.44 ? 18  CYS A O    4  
ATOM 7774  C CB   . CYS A 1 23  ? 5.557   -8.766  4.094   1.00 41.20 ? 18  CYS A CB   4  
ATOM 7775  S SG   . CYS A 1 23  ? 4.329   -7.713  3.285   1.00 53.32 ? 18  CYS A SG   4  
ATOM 7776  H H    . CYS A 1 23  ? 7.382   -10.504 4.411   1.00 0.23  ? 18  CYS A H    4  
ATOM 7777  H HA   . CYS A 1 23  ? 4.552   -10.615 4.476   1.00 15.42 ? 18  CYS A HA   4  
ATOM 7778  H HB3  . CYS A 1 23  ? 6.531   -8.477  3.729   1.00 24.13 ? 18  CYS A HB3  4  
ATOM 7779  H HG   . CYS A 1 23  ? 4.779   -7.414  2.076   1.00 11.11 ? 18  CYS A HG   4  
ATOM 7780  N N    . LEU A 1 24  ? 5.978   -10.437 1.511   1.00 31.23 ? 19  LEU A N    4  
ATOM 7781  C CA   . LEU A 1 24  ? 5.754   -10.647 0.084   1.00 74.12 ? 19  LEU A CA   4  
ATOM 7782  C C    . LEU A 1 24  ? 5.360   -12.094 -0.198  1.00 75.50 ? 19  LEU A C    4  
ATOM 7783  O O    . LEU A 1 24  ? 4.394   -12.357 -0.911  1.00 21.35 ? 19  LEU A O    4  
ATOM 7784  C CB   . LEU A 1 24  ? 7.011   -10.286 -0.708  1.00 51.45 ? 19  LEU A CB   4  
ATOM 7785  C CG   . LEU A 1 24  ? 7.002   -8.921  -1.396  1.00 61.43 ? 19  LEU A CG   4  
ATOM 7786  C CD1  . LEU A 1 24  ? 6.553   -7.838  -0.427  1.00 21.21 ? 19  LEU A CD1  4  
ATOM 7787  C CD2  . LEU A 1 24  ? 8.379   -8.598  -1.959  1.00 21.20 ? 19  LEU A CD2  4  
ATOM 7788  H H    . LEU A 1 24  ? 6.883   -10.242 1.828   1.00 62.23 ? 19  LEU A H    4  
ATOM 7789  H HA   . LEU A 1 24  ? 4.946   -10.000 -0.223  1.00 11.34 ? 19  LEU A HA   4  
ATOM 7790  H HB3  . LEU A 1 24  ? 7.150   -11.041 -1.469  1.00 52.14 ? 19  LEU A HB3  4  
ATOM 7791  H HG   . LEU A 1 24  ? 6.301   -8.944  -2.218  1.00 32.21 ? 19  LEU A HG   4  
ATOM 7792  H HD11 . LEU A 1 24  ? 6.863   -8.098  0.573   1.00 14.02 ? 19  LEU A HD11 4  
ATOM 7793  H HD12 . LEU A 1 24  ? 5.478   -7.750  -0.459  1.00 23.23 ? 19  LEU A HD12 4  
ATOM 7794  H HD13 . LEU A 1 24  ? 6.999   -6.896  -0.709  1.00 60.33 ? 19  LEU A HD13 4  
ATOM 7795  H HD21 . LEU A 1 24  ? 8.477   -9.037  -2.940  1.00 4.52  ? 19  LEU A HD21 4  
ATOM 7796  H HD22 . LEU A 1 24  ? 9.139   -9.002  -1.306  1.00 73.15 ? 19  LEU A HD22 4  
ATOM 7797  H HD23 . LEU A 1 24  ? 8.497   -7.527  -2.029  1.00 23.14 ? 19  LEU A HD23 4  
ATOM 7798  N N    . ASN A 1 25  ? 6.114   -13.029 0.371   1.00 51.53 ? 20  ASN A N    4  
ATOM 7799  C CA   . ASN A 1 25  ? 5.843   -14.450 0.183   1.00 44.43 ? 20  ASN A CA   4  
ATOM 7800  C C    . ASN A 1 25  ? 4.432   -14.799 0.643   1.00 53.21 ? 20  ASN A C    4  
ATOM 7801  O O    . ASN A 1 25  ? 3.707   -15.523 -0.038  1.00 15.31 ? 20  ASN A O    4  
ATOM 7802  C CB   . ASN A 1 25  ? 6.865   -15.291 0.949   1.00 10.42 ? 20  ASN A CB   4  
ATOM 7803  C CG   . ASN A 1 25  ? 8.034   -15.714 0.079   1.00 41.22 ? 20  ASN A CG   4  
ATOM 7804  O OD1  . ASN A 1 25  ? 8.502   -16.850 0.157   1.00 55.01 ? 20  ASN A OD1  4  
ATOM 7805  N ND2  . ASN A 1 25  ? 8.512   -14.799 -0.756  1.00 64.32 ? 20  ASN A ND2  4  
ATOM 7806  H H    . ASN A 1 25  ? 6.873   -12.758 0.930   1.00 23.45 ? 20  ASN A H    4  
ATOM 7807  H HA   . ASN A 1 25  ? 5.929   -14.666 -0.872  1.00 63.12 ? 20  ASN A HA   4  
ATOM 7808  H HB3  . ASN A 1 25  ? 6.381   -16.180 1.326   1.00 60.02 ? 20  ASN A HB3  4  
ATOM 7809  H HD21 . ASN A 1 25  ? 8.089   -13.914 -0.764  1.00 50.44 ? 20  ASN A HD21 4  
ATOM 7810  H HD22 . ASN A 1 25  ? 9.267   -15.045 -1.330  1.00 14.11 ? 20  ASN A HD22 4  
ATOM 7811  N N    . ASN A 1 26  ? 4.048   -14.279 1.805   1.00 41.45 ? 21  ASN A N    4  
ATOM 7812  C CA   . ASN A 1 26  ? 2.724   -14.536 2.358   1.00 23.12 ? 21  ASN A CA   4  
ATOM 7813  C C    . ASN A 1 26  ? 1.643   -13.869 1.513   1.00 23.44 ? 21  ASN A C    4  
ATOM 7814  O O    . ASN A 1 26  ? 0.598   -14.462 1.239   1.00 13.53 ? 21  ASN A O    4  
ATOM 7815  C CB   . ASN A 1 26  ? 2.643   -14.032 3.800   1.00 22.12 ? 21  ASN A CB   4  
ATOM 7816  C CG   . ASN A 1 26  ? 3.534   -14.821 4.739   1.00 13.43 ? 21  ASN A CG   4  
ATOM 7817  O OD1  . ASN A 1 26  ? 4.548   -15.383 4.325   1.00 63.04 ? 21  ASN A OD1  4  
ATOM 7818  N ND2  . ASN A 1 26  ? 3.158   -14.868 6.012   1.00 0.00  ? 21  ASN A ND2  4  
ATOM 7819  H H    . ASN A 1 26  ? 4.671   -13.709 2.302   1.00 33.12 ? 21  ASN A H    4  
ATOM 7820  H HA   . ASN A 1 26  ? 2.562   -15.604 2.350   1.00 44.51 ? 21  ASN A HA   4  
ATOM 7821  H HB3  . ASN A 1 26  ? 1.623   -14.112 4.147   1.00 41.25 ? 21  ASN A HB3  4  
ATOM 7822  H HD21 . ASN A 1 26  ? 2.338   -14.397 6.270   1.00 22.23 ? 21  ASN A HD21 4  
ATOM 7823  H HD22 . ASN A 1 26  ? 3.716   -15.371 6.641   1.00 10.50 ? 21  ASN A HD22 4  
ATOM 7824  N N    . LEU A 1 27  ? 1.900   -12.632 1.101   1.00 52.51 ? 22  LEU A N    4  
ATOM 7825  C CA   . LEU A 1 27  ? 0.950   -11.884 0.287   1.00 23.14 ? 22  LEU A CA   4  
ATOM 7826  C C    . LEU A 1 27  ? 0.752   -12.551 -1.070  1.00 4.42  ? 22  LEU A C    4  
ATOM 7827  O O    . LEU A 1 27  ? -0.318  -12.454 -1.672  1.00 3.25  ? 22  LEU A O    4  
ATOM 7828  C CB   . LEU A 1 27  ? 1.435   -10.446 0.094   1.00 23.11 ? 22  LEU A CB   4  
ATOM 7829  C CG   . LEU A 1 27  ? 0.978   -9.749  -1.187  1.00 24.44 ? 22  LEU A CG   4  
ATOM 7830  C CD1  . LEU A 1 27  ? -0.538  -9.619  -1.213  1.00 52.44 ? 22  LEU A CD1  4  
ATOM 7831  C CD2  . LEU A 1 27  ? 1.633   -8.381  -1.314  1.00 31.31 ? 22  LEU A CD2  4  
ATOM 7832  H H    . LEU A 1 27  ? 2.750   -12.212 1.351   1.00 22.24 ? 22  LEU A H    4  
ATOM 7833  H HA   . LEU A 1 27  ? 0.005   -11.869 0.808   1.00 50.23 ? 22  LEU A HA   4  
ATOM 7834  H HB3  . LEU A 1 27  ? 2.516   -10.459 0.097   1.00 5.41  ? 22  LEU A HB3  4  
ATOM 7835  H HG   . LEU A 1 27  ? 1.275   -10.344 -2.040  1.00 31.50 ? 22  LEU A HG   4  
ATOM 7836  H HD11 . LEU A 1 27  ? -0.980  -10.474 -0.723  1.00 62.20 ? 22  LEU A HD11 4  
ATOM 7837  H HD12 . LEU A 1 27  ? -0.878  -9.575  -2.236  1.00 23.32 ? 22  LEU A HD12 4  
ATOM 7838  H HD13 . LEU A 1 27  ? -0.831  -8.716  -0.696  1.00 3.24  ? 22  LEU A HD13 4  
ATOM 7839  H HD21 . LEU A 1 27  ? 2.622   -8.494  -1.733  1.00 31.43 ? 22  LEU A HD21 4  
ATOM 7840  H HD22 . LEU A 1 27  ? 1.706   -7.925  -0.338  1.00 60.40 ? 22  LEU A HD22 4  
ATOM 7841  H HD23 . LEU A 1 27  ? 1.037   -7.754  -1.961  1.00 50.03 ? 22  LEU A HD23 4  
ATOM 7842  N N    . LEU A 1 28  ? 1.790   -13.230 -1.547  1.00 2.03  ? 23  LEU A N    4  
ATOM 7843  C CA   . LEU A 1 28  ? 1.730   -13.916 -2.833  1.00 53.10 ? 23  LEU A CA   4  
ATOM 7844  C C    . LEU A 1 28  ? 1.041   -15.270 -2.696  1.00 33.45 ? 23  LEU A C    4  
ATOM 7845  O O    . LEU A 1 28  ? 0.923   -16.019 -3.666  1.00 62.24 ? 23  LEU A O    4  
ATOM 7846  C CB   . LEU A 1 28  ? 3.138   -14.104 -3.400  1.00 51.04 ? 23  LEU A CB   4  
ATOM 7847  C CG   . LEU A 1 28  ? 3.807   -12.851 -3.966  1.00 62.44 ? 23  LEU A CG   4  
ATOM 7848  C CD1  . LEU A 1 28  ? 5.316   -13.031 -4.026  1.00 75.54 ? 23  LEU A CD1  4  
ATOM 7849  C CD2  . LEU A 1 28  ? 3.252   -12.527 -5.345  1.00 52.21 ? 23  LEU A CD2  4  
ATOM 7850  H H    . LEU A 1 28  ? 2.616   -13.271 -1.023  1.00 12.23 ? 23  LEU A H    4  
ATOM 7851  H HA   . LEU A 1 28  ? 1.157   -13.301 -3.511  1.00 40.34 ? 23  LEU A HA   4  
ATOM 7852  H HB3  . LEU A 1 28  ? 3.080   -14.836 -4.193  1.00 42.51 ? 23  LEU A HB3  4  
ATOM 7853  H HG   . LEU A 1 28  ? 3.597   -12.013 -3.314  1.00 21.15 ? 23  LEU A HG   4  
ATOM 7854  H HD11 . LEU A 1 28  ? 5.642   -13.003 -5.053  1.00 23.25 ? 23  LEU A HD11 4  
ATOM 7855  H HD12 . LEU A 1 28  ? 5.581   -13.983 -3.589  1.00 64.35 ? 23  LEU A HD12 4  
ATOM 7856  H HD13 . LEU A 1 28  ? 5.795   -12.236 -3.473  1.00 74.13 ? 23  LEU A HD13 4  
ATOM 7857  H HD21 . LEU A 1 28  ? 2.531   -11.727 -5.263  1.00 64.31 ? 23  LEU A HD21 4  
ATOM 7858  H HD22 . LEU A 1 28  ? 2.771   -13.404 -5.755  1.00 42.23 ? 23  LEU A HD22 4  
ATOM 7859  H HD23 . LEU A 1 28  ? 4.058   -12.221 -5.994  1.00 21.31 ? 23  LEU A HD23 4  
ATOM 7860  N N    . GLN A 1 29  ? 0.583   -15.576 -1.486  1.00 63.33 ? 24  GLN A N    4  
ATOM 7861  C CA   . GLN A 1 29  ? -0.097  -16.839 -1.223  1.00 25.21 ? 24  GLN A CA   4  
ATOM 7862  C C    . GLN A 1 29  ? 0.856   -18.016 -1.397  1.00 73.44 ? 24  GLN A C    4  
ATOM 7863  O O    . GLN A 1 29  ? 0.429   -19.167 -1.476  1.00 63.11 ? 24  GLN A O    4  
ATOM 7864  C CB   . GLN A 1 29  ? -1.299  -16.998 -2.155  1.00 31.20 ? 24  GLN A CB   4  
ATOM 7865  C CG   . GLN A 1 29  ? -2.635  -17.008 -1.429  1.00 4.12  ? 24  GLN A CG   4  
ATOM 7866  C CD   . GLN A 1 29  ? -3.702  -17.779 -2.180  1.00 15.13 ? 24  GLN A CD   4  
ATOM 7867  O OE1  . GLN A 1 29  ? -4.097  -18.872 -1.771  1.00 21.24 ? 24  GLN A OE1  4  
ATOM 7868  N NE2  . GLN A 1 29  ? -4.174  -17.216 -3.285  1.00 3.00  ? 24  GLN A NE2  4  
ATOM 7869  H H    . GLN A 1 29  ? 0.706   -14.937 -0.753  1.00 3.22  ? 24  GLN A H    4  
ATOM 7870  H HA   . GLN A 1 29  ? -0.446  -16.821 -0.202  1.00 42.05 ? 24  GLN A HA   4  
ATOM 7871  H HB3  . GLN A 1 29  ? -1.201  -17.929 -2.694  1.00 52.51 ? 24  GLN A HB3  4  
ATOM 7872  H HG3  . GLN A 1 29  ? -2.970  -15.988 -1.305  1.00 52.44 ? 24  GLN A HG3  4  
ATOM 7873  H HE21 . GLN A 1 29  ? -3.811  -16.344 -3.552  1.00 54.35 ? 24  GLN A HE21 4  
ATOM 7874  H HE22 . GLN A 1 29  ? -4.863  -17.693 -3.791  1.00 21.21 ? 24  GLN A HE22 4  
ATOM 7875  N N    . GLY A 1 30  ? 2.151   -17.720 -1.455  1.00 32.24 ? 25  GLY A N    4  
ATOM 7876  C CA   . GLY A 1 30  ? 3.144   -18.764 -1.620  1.00 52.34 ? 25  GLY A CA   4  
ATOM 7877  C C    . GLY A 1 30  ? 4.533   -18.210 -1.867  1.00 54.25 ? 25  GLY A C    4  
ATOM 7878  O O    . GLY A 1 30  ? 4.688   -17.043 -2.225  1.00 10.22 ? 25  GLY A O    4  
ATOM 7879  H H    . GLY A 1 30  ? 2.434   -16.784 -1.387  1.00 40.43 ? 25  GLY A H    4  
ATOM 7880  H HA2  . GLY A 1 30  ? 3.164   -19.373 -0.727  1.00 23.54 ? 25  GLY A HA2  4  
ATOM 7881  H HA3  . GLY A 1 30  ? 2.862   -19.385 -2.459  1.00 64.15 ? 25  GLY A HA3  4  
ATOM 7882  N N    . GLU A 1 31  ? 5.547   -19.049 -1.673  1.00 54.10 ? 26  GLU A N    4  
ATOM 7883  C CA   . GLU A 1 31  ? 6.930   -18.634 -1.874  1.00 54.01 ? 26  GLU A CA   4  
ATOM 7884  C C    . GLU A 1 31  ? 7.243   -18.487 -3.360  1.00 14.20 ? 26  GLU A C    4  
ATOM 7885  O O    . GLU A 1 31  ? 7.442   -19.478 -4.064  1.00 14.12 ? 26  GLU A O    4  
ATOM 7886  C CB   . GLU A 1 31  ? 7.886   -19.644 -1.237  1.00 41.23 ? 26  GLU A CB   4  
ATOM 7887  C CG   . GLU A 1 31  ? 7.629   -21.079 -1.664  1.00 13.22 ? 26  GLU A CG   4  
ATOM 7888  C CD   . GLU A 1 31  ? 7.204   -21.965 -0.508  1.00 63.34 ? 26  GLU A CD   4  
ATOM 7889  O OE1  . GLU A 1 31  ? 6.537   -21.455 0.416   1.00 3.51  ? 26  GLU A OE1  4  
ATOM 7890  O OE2  . GLU A 1 31  ? 7.539   -23.168 -0.528  1.00 4.42  ? 26  GLU A OE2  4  
ATOM 7891  H H    . GLU A 1 31  ? 5.360   -19.967 -1.386  1.00 12.35 ? 26  GLU A H    4  
ATOM 7892  H HA   . GLU A 1 31  ? 7.062   -17.676 -1.395  1.00 74.22 ? 26  GLU A HA   4  
ATOM 7893  H HB3  . GLU A 1 31  ? 7.788   -19.587 -0.163  1.00 12.42 ? 26  GLU A HB3  4  
ATOM 7894  H HG3  . GLU A 1 31  ? 8.534   -21.483 -2.092  1.00 45.21 ? 26  GLU A HG3  4  
ATOM 7895  N N    . TYR A 1 32  ? 7.286   -17.246 -3.830  1.00 20.10 ? 27  TYR A N    4  
ATOM 7896  C CA   . TYR A 1 32  ? 7.572   -16.969 -5.233  1.00 74.14 ? 27  TYR A CA   4  
ATOM 7897  C C    . TYR A 1 32  ? 9.039   -16.600 -5.427  1.00 64.52 ? 27  TYR A C    4  
ATOM 7898  O O    . TYR A 1 32  ? 9.515   -16.468 -6.555  1.00 35.22 ? 27  TYR A O    4  
ATOM 7899  C CB   . TYR A 1 32  ? 6.677   -15.838 -5.744  1.00 12.20 ? 27  TYR A CB   4  
ATOM 7900  C CG   . TYR A 1 32  ? 5.369   -16.319 -6.330  1.00 75.52 ? 27  TYR A CG   4  
ATOM 7901  C CD1  . TYR A 1 32  ? 4.448   -17.010 -5.550  1.00 4.21  ? 27  TYR A CD1  4  
ATOM 7902  C CD2  . TYR A 1 32  ? 5.053   -16.084 -7.662  1.00 33.30 ? 27  TYR A CD2  4  
ATOM 7903  C CE1  . TYR A 1 32  ? 3.252   -17.451 -6.081  1.00 51.31 ? 27  TYR A CE1  4  
ATOM 7904  C CE2  . TYR A 1 32  ? 3.859   -16.521 -8.201  1.00 22.41 ? 27  TYR A CE2  4  
ATOM 7905  C CZ   . TYR A 1 32  ? 2.961   -17.203 -7.406  1.00 2.44  ? 27  TYR A CZ   4  
ATOM 7906  O OH   . TYR A 1 32  ? 1.771   -17.642 -7.940  1.00 2.00  ? 27  TYR A OH   4  
ATOM 7907  H H    . TYR A 1 32  ? 7.119   -16.498 -3.220  1.00 63.01 ? 27  TYR A H    4  
ATOM 7908  H HA   . TYR A 1 32  ? 7.360   -17.865 -5.797  1.00 21.12 ? 27  TYR A HA   4  
ATOM 7909  H HB3  . TYR A 1 32  ? 7.204   -15.291 -6.512  1.00 33.11 ? 27  TYR A HB3  4  
ATOM 7910  H HD1  . TYR A 1 32  ? 4.679   -17.202 -4.512  1.00 62.23 ? 27  TYR A HD1  4  
ATOM 7911  H HD2  . TYR A 1 32  ? 5.759   -15.549 -8.281  1.00 22.43 ? 27  TYR A HD2  4  
ATOM 7912  H HE1  . TYR A 1 32  ? 2.549   -17.987 -5.460  1.00 62.44 ? 27  TYR A HE1  4  
ATOM 7913  H HE2  . TYR A 1 32  ? 3.631   -16.327 -9.238  1.00 0.12  ? 27  TYR A HE2  4  
ATOM 7914  H HH   . TYR A 1 32  ? 1.518   -18.468 -7.522  1.00 1.12  ? 27  TYR A HH   4  
ATOM 7915  N N    . PHE A 1 33  ? 9.752   -16.433 -4.318  1.00 72.11 ? 28  PHE A N    4  
ATOM 7916  C CA   . PHE A 1 33  ? 11.166  -16.078 -4.365  1.00 32.42 ? 28  PHE A CA   4  
ATOM 7917  C C    . PHE A 1 33  ? 11.863  -16.451 -3.059  1.00 22.30 ? 28  PHE A C    4  
ATOM 7918  O O    . PHE A 1 33  ? 11.221  -16.600 -2.020  1.00 63.50 ? 28  PHE A O    4  
ATOM 7919  C CB   . PHE A 1 33  ? 11.329  -14.580 -4.633  1.00 11.11 ? 28  PHE A CB   4  
ATOM 7920  C CG   . PHE A 1 33  ? 10.744  -13.711 -3.557  1.00 54.00 ? 28  PHE A CG   4  
ATOM 7921  C CD1  . PHE A 1 33  ? 11.336  -13.642 -2.306  1.00 23.44 ? 28  PHE A CD1  4  
ATOM 7922  C CD2  . PHE A 1 33  ? 9.601   -12.965 -3.796  1.00 64.32 ? 28  PHE A CD2  4  
ATOM 7923  C CE1  . PHE A 1 33  ? 10.800  -12.842 -1.314  1.00 53.21 ? 28  PHE A CE1  4  
ATOM 7924  C CE2  . PHE A 1 33  ? 9.062   -12.163 -2.808  1.00 62.52 ? 28  PHE A CE2  4  
ATOM 7925  C CZ   . PHE A 1 33  ? 9.661   -12.102 -1.564  1.00 54.42 ? 28  PHE A CZ   4  
ATOM 7926  H H    . PHE A 1 33  ? 9.316   -16.551 -3.448  1.00 54.34 ? 28  PHE A H    4  
ATOM 7927  H HA   . PHE A 1 33  ? 11.619  -16.632 -5.172  1.00 64.23 ? 28  PHE A HA   4  
ATOM 7928  H HB3  . PHE A 1 33  ? 10.839  -14.334 -5.563  1.00 63.34 ? 28  PHE A HB3  4  
ATOM 7929  H HD1  . PHE A 1 33  ? 12.228  -14.220 -2.109  1.00 74.22 ? 28  PHE A HD1  4  
ATOM 7930  H HD2  . PHE A 1 33  ? 9.131   -13.011 -4.766  1.00 22.14 ? 28  PHE A HD2  4  
ATOM 7931  H HE1  . PHE A 1 33  ? 11.272  -12.797 -0.343  1.00 13.24 ? 28  PHE A HE1  4  
ATOM 7932  H HE2  . PHE A 1 33  ? 8.170   -11.586 -3.005  1.00 44.41 ? 28  PHE A HE2  4  
ATOM 7933  H HZ   . PHE A 1 33  ? 9.242   -11.478 -0.791  1.00 60.23 ? 28  PHE A HZ   4  
ATOM 7934  N N    . SER A 1 34  ? 13.183  -16.600 -3.122  1.00 32.33 ? 29  SER A N    4  
ATOM 7935  C CA   . SER A 1 34  ? 13.968  -16.960 -1.948  1.00 72.43 ? 29  SER A CA   4  
ATOM 7936  C C    . SER A 1 34  ? 14.296  -15.726 -1.114  1.00 64.44 ? 29  SER A C    4  
ATOM 7937  O O    . SER A 1 34  ? 14.378  -14.606 -1.622  1.00 74.42 ? 29  SER A O    4  
ATOM 7938  C CB   . SER A 1 34  ? 15.260  -17.664 -2.368  1.00 31.52 ? 29  SER A CB   4  
ATOM 7939  O OG   . SER A 1 34  ? 15.894  -16.974 -3.430  1.00 72.22 ? 29  SER A OG   4  
ATOM 7940  H H    . SER A 1 34  ? 13.638  -16.467 -3.980  1.00 13.23 ? 29  SER A H    4  
ATOM 7941  H HA   . SER A 1 34  ? 13.377  -17.637 -1.349  1.00 54.34 ? 29  SER A HA   4  
ATOM 7942  H HB3  . SER A 1 34  ? 15.030  -18.669 -2.693  1.00 24.41 ? 29  SER A HB3  4  
ATOM 7943  H HG   . SER A 1 34  ? 16.844  -17.095 -3.369  1.00 61.34 ? 29  SER A HG   4  
ATOM 7944  N N    . PRO A 1 35  ? 14.489  -15.931 0.197   1.00 34.23 ? 30  PRO A N    4  
ATOM 7945  C CA   . PRO A 1 35  ? 14.811  -14.847 1.130   1.00 23.41 ? 30  PRO A CA   4  
ATOM 7946  C C    . PRO A 1 35  ? 16.215  -14.293 0.911   1.00 74.22 ? 30  PRO A C    4  
ATOM 7947  O O    . PRO A 1 35  ? 16.465  -13.107 1.125   1.00 1.13  ? 30  PRO A O    4  
ATOM 7948  C CB   . PRO A 1 35  ? 14.708  -15.518 2.502   1.00 41.01 ? 30  PRO A CB   4  
ATOM 7949  C CG   . PRO A 1 35  ? 14.965  -16.962 2.238   1.00 62.52 ? 30  PRO A CG   4  
ATOM 7950  C CD   . PRO A 1 35  ? 14.406  -17.239 0.870   1.00 63.44 ? 30  PRO A CD   4  
ATOM 7951  H HA   . PRO A 1 35  ? 14.093  -14.042 1.066   1.00 61.23 ? 30  PRO A HA   4  
ATOM 7952  H HB3  . PRO A 1 35  ? 13.721  -15.360 2.911   1.00 53.40 ? 30  PRO A HB3  4  
ATOM 7953  H HG3  . PRO A 1 35  ? 14.460  -17.564 2.978   1.00 53.35 ? 30  PRO A HG3  4  
ATOM 7954  H HD3  . PRO A 1 35  ? 13.381  -17.570 0.942   1.00 21.13 ? 30  PRO A HD3  4  
ATOM 7955  N N    . VAL A 1 36  ? 17.128  -15.159 0.484   1.00 13.23 ? 31  VAL A N    4  
ATOM 7956  C CA   . VAL A 1 36  ? 18.507  -14.756 0.234   1.00 63.53 ? 31  VAL A CA   4  
ATOM 7957  C C    . VAL A 1 36  ? 18.580  -13.696 -0.859  1.00 1.43  ? 31  VAL A C    4  
ATOM 7958  O O    . VAL A 1 36  ? 19.274  -12.691 -0.717  1.00 64.23 ? 31  VAL A O    4  
ATOM 7959  C CB   . VAL A 1 36  ? 19.379  -15.958 -0.171  1.00 2.31  ? 31  VAL A CB   4  
ATOM 7960  C CG1  . VAL A 1 36  ? 20.847  -15.562 -0.217  1.00 11.34 ? 31  VAL A CG1  4  
ATOM 7961  C CG2  . VAL A 1 36  ? 19.161  -17.121 0.786   1.00 61.24 ? 31  VAL A CG2  4  
ATOM 7962  H H    . VAL A 1 36  ? 16.868  -16.091 0.332   1.00 12.11 ? 31  VAL A H    4  
ATOM 7963  H HA   . VAL A 1 36  ? 18.904  -14.342 1.150   1.00 2.40  ? 31  VAL A HA   4  
ATOM 7964  H HB   . VAL A 1 36  ? 19.082  -16.274 -1.161  1.00 50.55 ? 31  VAL A HB   4  
ATOM 7965  H HG11 . VAL A 1 36  ? 20.929  -14.516 -0.469  1.00 24.51 ? 31  VAL A HG11 4  
ATOM 7966  H HG12 . VAL A 1 36  ? 21.297  -15.738 0.749   1.00 43.54 ? 31  VAL A HG12 4  
ATOM 7967  H HG13 . VAL A 1 36  ? 21.355  -16.152 -0.965  1.00 11.45 ? 31  VAL A HG13 4  
ATOM 7968  H HG21 . VAL A 1 36  ? 18.935  -16.737 1.770   1.00 14.35 ? 31  VAL A HG21 4  
ATOM 7969  H HG22 . VAL A 1 36  ? 18.338  -17.726 0.437   1.00 23.24 ? 31  VAL A HG22 4  
ATOM 7970  H HG23 . VAL A 1 36  ? 20.056  -17.723 0.830   1.00 62.43 ? 31  VAL A HG23 4  
ATOM 7971  N N    . GLU A 1 37  ? 17.859  -13.930 -1.952  1.00 73.40 ? 32  GLU A N    4  
ATOM 7972  C CA   . GLU A 1 37  ? 17.842  -12.995 -3.070  1.00 13.52 ? 32  GLU A CA   4  
ATOM 7973  C C    . GLU A 1 37  ? 17.119  -11.706 -2.692  1.00 64.22 ? 32  GLU A C    4  
ATOM 7974  O O    . GLU A 1 37  ? 17.621  -10.606 -2.929  1.00 12.13 ? 32  GLU A O    4  
ATOM 7975  C CB   . GLU A 1 37  ? 17.169  -13.633 -4.287  1.00 30.23 ? 32  GLU A CB   4  
ATOM 7976  C CG   . GLU A 1 37  ? 17.672  -13.092 -5.614  1.00 1.13  ? 32  GLU A CG   4  
ATOM 7977  C CD   . GLU A 1 37  ? 18.363  -14.150 -6.452  1.00 40.45 ? 32  GLU A CD   4  
ATOM 7978  O OE1  . GLU A 1 37  ? 19.302  -14.793 -5.936  1.00 1.20  ? 32  GLU A OE1  4  
ATOM 7979  O OE2  . GLU A 1 37  ? 17.967  -14.336 -7.621  1.00 13.00 ? 32  GLU A OE2  4  
ATOM 7980  H H    . GLU A 1 37  ? 17.325  -14.751 -2.006  1.00 60.44 ? 32  GLU A H    4  
ATOM 7981  H HA   . GLU A 1 37  ? 18.866  -12.759 -3.320  1.00 13.32 ? 32  GLU A HA   4  
ATOM 7982  H HB3  . GLU A 1 37  ? 16.105  -13.453 -4.229  1.00 12.24 ? 32  GLU A HB3  4  
ATOM 7983  H HG3  . GLU A 1 37  ? 18.372  -12.292 -5.421  1.00 10.44 ? 32  GLU A HG3  4  
ATOM 7984  N N    . LEU A 1 38  ? 15.937  -11.849 -2.102  1.00 2.43  ? 33  LEU A N    4  
ATOM 7985  C CA   . LEU A 1 38  ? 15.143  -10.696 -1.691  1.00 32.12 ? 33  LEU A CA   4  
ATOM 7986  C C    . LEU A 1 38  ? 15.897  -9.853  -0.668  1.00 32.51 ? 33  LEU A C    4  
ATOM 7987  O O    . LEU A 1 38  ? 15.850  -8.624  -0.706  1.00 33.31 ? 33  LEU A O    4  
ATOM 7988  C CB   . LEU A 1 38  ? 13.806  -11.156 -1.106  1.00 52.33 ? 33  LEU A CB   4  
ATOM 7989  C CG   . LEU A 1 38  ? 12.617  -10.223 -1.335  1.00 61.34 ? 33  LEU A CG   4  
ATOM 7990  C CD1  . LEU A 1 38  ? 12.972  -8.798  -0.938  1.00 15.33 ? 33  LEU A CD1  4  
ATOM 7991  C CD2  . LEU A 1 38  ? 12.169  -10.278 -2.787  1.00 24.43 ? 33  LEU A CD2  4  
ATOM 7992  H H    . LEU A 1 38  ? 15.590  -12.750 -1.940  1.00 13.44 ? 33  LEU A H    4  
ATOM 7993  H HA   . LEU A 1 38  ? 14.955  -10.094 -2.568  1.00 72.52 ? 33  LEU A HA   4  
ATOM 7994  H HB3  . LEU A 1 38  ? 13.936  -11.272 -0.039  1.00 50.55 ? 33  LEU A HB3  4  
ATOM 7995  H HG   . LEU A 1 38  ? 11.791  -10.545 -0.716  1.00 2.04  ? 33  LEU A HG   4  
ATOM 7996  H HD11 . LEU A 1 38  ? 13.526  -8.810  -0.011  1.00 73.51 ? 33  LEU A HD11 4  
ATOM 7997  H HD12 . LEU A 1 38  ? 12.066  -8.225  -0.809  1.00 62.04 ? 33  LEU A HD12 4  
ATOM 7998  H HD13 . LEU A 1 38  ? 13.576  -8.349  -1.713  1.00 61.21 ? 33  LEU A HD13 4  
ATOM 7999  H HD21 . LEU A 1 38  ? 11.181  -9.847  -2.875  1.00 43.52 ? 33  LEU A HD21 4  
ATOM 8000  H HD22 . LEU A 1 38  ? 12.143  -11.306 -3.118  1.00 33.00 ? 33  LEU A HD22 4  
ATOM 8001  H HD23 . LEU A 1 38  ? 12.861  -9.720  -3.400  1.00 65.23 ? 33  LEU A HD23 4  
ATOM 8002  N N    . SER A 1 39  ? 16.593  -10.523 0.245   1.00 52.13 ? 34  SER A N    4  
ATOM 8003  C CA   . SER A 1 39  ? 17.356  -9.835  1.280   1.00 12.30 ? 34  SER A CA   4  
ATOM 8004  C C    . SER A 1 39  ? 18.525  -9.066  0.673   1.00 44.42 ? 34  SER A C    4  
ATOM 8005  O O    . SER A 1 39  ? 18.799  -7.928  1.054   1.00 2.42  ? 34  SER A O    4  
ATOM 8006  C CB   . SER A 1 39  ? 17.872  -10.838 2.314   1.00 33.11 ? 34  SER A CB   4  
ATOM 8007  O OG   . SER A 1 39  ? 16.816  -11.327 3.122   1.00 13.24 ? 34  SER A OG   4  
ATOM 8008  H H    . SER A 1 39  ? 16.591  -11.503 0.223   1.00 63.21 ? 34  SER A H    4  
ATOM 8009  H HA   . SER A 1 39  ? 16.695  -9.135  1.769   1.00 12.02 ? 34  SER A HA   4  
ATOM 8010  H HB3  . SER A 1 39  ? 18.600  -10.354 2.949   1.00 62.13 ? 34  SER A HB3  4  
ATOM 8011  H HG   . SER A 1 39  ? 16.939  -12.266 3.276   1.00 10.25 ? 34  SER A HG   4  
ATOM 8012  N N    . SER A 1 40  ? 19.212  -9.697  -0.274  1.00 22.14 ? 35  SER A N    4  
ATOM 8013  C CA   . SER A 1 40  ? 20.355  -9.075  -0.933  1.00 32.43 ? 35  SER A CA   4  
ATOM 8014  C C    . SER A 1 40  ? 19.936  -7.800  -1.659  1.00 11.34 ? 35  SER A C    4  
ATOM 8015  O O    . SER A 1 40  ? 20.569  -6.755  -1.515  1.00 43.33 ? 35  SER A O    4  
ATOM 8016  C CB   . SER A 1 40  ? 20.994  -10.051 -1.922  1.00 14.20 ? 35  SER A CB   4  
ATOM 8017  O OG   . SER A 1 40  ? 21.696  -9.360  -2.941  1.00 74.43 ? 35  SER A OG   4  
ATOM 8018  H H    . SER A 1 40  ? 18.945  -10.603 -0.535  1.00 31.33 ? 35  SER A H    4  
ATOM 8019  H HA   . SER A 1 40  ? 21.077  -8.821  -0.172  1.00 42.22 ? 35  SER A HA   4  
ATOM 8020  H HB3  . SER A 1 40  ? 20.222  -10.654 -2.378  1.00 12.31 ? 35  SER A HB3  4  
ATOM 8021  H HG   . SER A 1 40  ? 22.444  -9.888  -3.230  1.00 32.15 ? 35  SER A HG   4  
ATOM 8022  N N    . ILE A 1 41  ? 18.863  -7.896  -2.439  1.00 40.42 ? 36  ILE A N    4  
ATOM 8023  C CA   . ILE A 1 41  ? 18.359  -6.751  -3.187  1.00 54.22 ? 36  ILE A CA   4  
ATOM 8024  C C    . ILE A 1 41  ? 17.927  -5.629  -2.248  1.00 10.44 ? 36  ILE A C    4  
ATOM 8025  O O    . ILE A 1 41  ? 18.298  -4.471  -2.437  1.00 51.50 ? 36  ILE A O    4  
ATOM 8026  C CB   . ILE A 1 41  ? 17.169  -7.144  -4.082  1.00 60.11 ? 36  ILE A CB   4  
ATOM 8027  C CG1  . ILE A 1 41  ? 17.581  -8.245  -5.062  1.00 50.15 ? 36  ILE A CG1  4  
ATOM 8028  C CG2  . ILE A 1 41  ? 16.647  -5.928  -4.832  1.00 21.33 ? 36  ILE A CG2  4  
ATOM 8029  C CD1  . ILE A 1 41  ? 16.412  -8.887  -5.775  1.00 2.14  ? 36  ILE A CD1  4  
ATOM 8030  H H    . ILE A 1 41  ? 18.401  -8.756  -2.512  1.00 73.11 ? 36  ILE A H    4  
ATOM 8031  H HA   . ILE A 1 41  ? 19.156  -6.389  -3.819  1.00 2.14  ? 36  ILE A HA   4  
ATOM 8032  H HB   . ILE A 1 41  ? 16.377  -7.514  -3.448  1.00 43.55 ? 36  ILE A HB   4  
ATOM 8033  H HG13 . ILE A 1 41  ? 18.107  -9.019  -4.521  1.00 41.23 ? 36  ILE A HG13 4  
ATOM 8034  H HG21 . ILE A 1 41  ? 16.140  -6.250  -5.729  1.00 3.03  ? 36  ILE A HG21 4  
ATOM 8035  H HG22 . ILE A 1 41  ? 15.955  -5.388  -4.203  1.00 11.11 ? 36  ILE A HG22 4  
ATOM 8036  H HG23 . ILE A 1 41  ? 17.473  -5.285  -5.095  1.00 31.33 ? 36  ILE A HG23 4  
ATOM 8037  H HD11 . ILE A 1 41  ? 15.515  -8.317  -5.583  1.00 1.02  ? 36  ILE A HD11 4  
ATOM 8038  H HD12 . ILE A 1 41  ? 16.606  -8.908  -6.837  1.00 73.12 ? 36  ILE A HD12 4  
ATOM 8039  H HD13 . ILE A 1 41  ? 16.280  -9.896  -5.413  1.00 52.42 ? 36  ILE A HD13 4  
ATOM 8040  N N    . ALA A 1 42  ? 17.141  -5.982  -1.236  1.00 5.22  ? 37  ALA A N    4  
ATOM 8041  C CA   . ALA A 1 42  ? 16.662  -5.005  -0.266  1.00 31.45 ? 37  ALA A CA   4  
ATOM 8042  C C    . ALA A 1 42  ? 17.824  -4.306  0.429   1.00 73.23 ? 37  ALA A C    4  
ATOM 8043  O O    . ALA A 1 42  ? 17.836  -3.082  0.560   1.00 64.23 ? 37  ALA A O    4  
ATOM 8044  C CB   . ALA A 1 42  ? 15.758  -5.678  0.758   1.00 44.22 ? 37  ALA A CB   4  
ATOM 8045  H H    . ALA A 1 42  ? 16.879  -6.921  -1.139  1.00 3.32  ? 37  ALA A H    4  
ATOM 8046  H HA   . ALA A 1 42  ? 16.076  -4.267  -0.796  1.00 14.24 ? 37  ALA A HA   4  
ATOM 8047  H HB1  . ALA A 1 42  ? 15.120  -6.393  0.258   1.00 71.13 ? 37  ALA A HB1  4  
ATOM 8048  H HB2  . ALA A 1 42  ? 16.365  -6.187  1.492   1.00 13.15 ? 37  ALA A HB2  4  
ATOM 8049  H HB3  . ALA A 1 42  ? 15.151  -4.932  1.247   1.00 44.03 ? 37  ALA A HB3  4  
ATOM 8050  N N    . HIS A 1 43  ? 18.799  -5.090  0.876   1.00 10.12 ? 38  HIS A N    4  
ATOM 8051  C CA   . HIS A 1 43  ? 19.967  -4.545  1.559   1.00 13.50 ? 38  HIS A CA   4  
ATOM 8052  C C    . HIS A 1 43  ? 20.694  -3.538  0.673   1.00 23.34 ? 38  HIS A C    4  
ATOM 8053  O O    . HIS A 1 43  ? 21.063  -2.454  1.125   1.00 2.22  ? 38  HIS A O    4  
ATOM 8054  C CB   . HIS A 1 43  ? 20.922  -5.671  1.959   1.00 23.52 ? 38  HIS A CB   4  
ATOM 8055  C CG   . HIS A 1 43  ? 22.229  -5.183  2.503   1.00 24.33 ? 38  HIS A CG   4  
ATOM 8056  N ND1  . HIS A 1 43  ? 23.389  -5.926  2.453   1.00 61.05 ? 38  HIS A ND1  4  
ATOM 8057  C CD2  . HIS A 1 43  ? 22.556  -4.017  3.109   1.00 33.22 ? 38  HIS A CD2  4  
ATOM 8058  C CE1  . HIS A 1 43  ? 24.373  -5.239  3.007   1.00 75.34 ? 38  HIS A CE1  4  
ATOM 8059  N NE2  . HIS A 1 43  ? 23.894  -4.077  3.412   1.00 74.21 ? 38  HIS A NE2  4  
ATOM 8060  H H    . HIS A 1 43  ? 18.732  -6.059  0.741   1.00 42.11 ? 38  HIS A H    4  
ATOM 8061  H HA   . HIS A 1 43  ? 19.626  -4.041  2.449   1.00 34.45 ? 38  HIS A HA   4  
ATOM 8062  H HB3  . HIS A 1 43  ? 21.130  -6.283  1.093   1.00 34.04 ? 38  HIS A HB3  4  
ATOM 8063  H HD1  . HIS A 1 43  ? 23.478  -6.823  2.072   1.00 0.22  ? 38  HIS A HD1  4  
ATOM 8064  H HD2  . HIS A 1 43  ? 21.888  -3.192  3.316   1.00 54.24 ? 38  HIS A HD2  4  
ATOM 8065  H HE1  . HIS A 1 43  ? 25.395  -5.571  3.111   1.00 10.33 ? 38  HIS A HE1  4  
ATOM 8066  N N    . GLN A 1 44  ? 20.894  -3.903  -0.589  1.00 42.41 ? 39  GLN A N    4  
ATOM 8067  C CA   . GLN A 1 44  ? 21.579  -3.031  -1.537  1.00 34.55 ? 39  GLN A CA   4  
ATOM 8068  C C    . GLN A 1 44  ? 20.801  -1.735  -1.743  1.00 61.43 ? 39  GLN A C    4  
ATOM 8069  O O    . GLN A 1 44  ? 21.387  -0.655  -1.838  1.00 14.44 ? 39  GLN A O    4  
ATOM 8070  C CB   . GLN A 1 44  ? 21.764  -3.745  -2.877  1.00 43.21 ? 39  GLN A CB   4  
ATOM 8071  C CG   . GLN A 1 44  ? 22.982  -4.654  -2.918  1.00 74.44 ? 39  GLN A CG   4  
ATOM 8072  C CD   . GLN A 1 44  ? 23.138  -5.363  -4.249  1.00 62.24 ? 39  GLN A CD   4  
ATOM 8073  O OE1  . GLN A 1 44  ? 22.162  -5.577  -4.969  1.00 71.25 ? 39  GLN A OE1  4  
ATOM 8074  N NE2  . GLN A 1 44  ? 24.369  -5.730  -4.583  1.00 4.41  ? 39  GLN A NE2  4  
ATOM 8075  H H    . GLN A 1 44  ? 20.577  -4.780  -0.890  1.00 30.43 ? 39  GLN A H    4  
ATOM 8076  H HA   . GLN A 1 44  ? 22.548  -2.793  -1.129  1.00 73.14 ? 39  GLN A HA   4  
ATOM 8077  H HB3  . GLN A 1 44  ? 21.870  -3.004  -3.655  1.00 64.13 ? 39  GLN A HB3  4  
ATOM 8078  H HG3  . GLN A 1 44  ? 22.886  -5.398  -2.139  1.00 30.12 ? 39  GLN A HG3  4  
ATOM 8079  H HE21 . GLN A 1 44  ? 25.098  -5.528  -3.959  1.00 21.04 ? 39  GLN A HE21 4  
ATOM 8080  H HE22 . GLN A 1 44  ? 24.498  -6.191  -5.438  1.00 70.13 ? 39  GLN A HE22 4  
ATOM 8081  N N    . LEU A 1 45  ? 19.479  -1.848  -1.810  1.00 74.42 ? 40  LEU A N    4  
ATOM 8082  C CA   . LEU A 1 45  ? 18.621  -0.685  -2.004  1.00 32.43 ? 40  LEU A CA   4  
ATOM 8083  C C    . LEU A 1 45  ? 18.764  0.297   -0.846  1.00 71.34 ? 40  LEU A C    4  
ATOM 8084  O O    . LEU A 1 45  ? 18.891  1.505   -1.055  1.00 34.12 ? 40  LEU A O    4  
ATOM 8085  C CB   . LEU A 1 45  ? 17.160  -1.120  -2.140  1.00 51.42 ? 40  LEU A CB   4  
ATOM 8086  C CG   . LEU A 1 45  ? 16.607  -1.178  -3.564  1.00 45.03 ? 40  LEU A CG   4  
ATOM 8087  C CD1  . LEU A 1 45  ? 15.342  -2.021  -3.612  1.00 4.32  ? 40  LEU A CD1  4  
ATOM 8088  C CD2  . LEU A 1 45  ? 16.335  0.226   -4.087  1.00 53.13 ? 40  LEU A CD2  4  
ATOM 8089  H H    . LEU A 1 45  ? 19.069  -2.734  -1.727  1.00 43.34 ? 40  LEU A H    4  
ATOM 8090  H HA   . LEU A 1 45  ? 18.929  -0.195  -2.916  1.00 31.45 ? 40  LEU A HA   4  
ATOM 8091  H HB3  . LEU A 1 45  ? 16.555  -0.425  -1.575  1.00 2.44  ? 40  LEU A HB3  4  
ATOM 8092  H HG   . LEU A 1 45  ? 17.340  -1.639  -4.211  1.00 13.21 ? 40  LEU A HG   4  
ATOM 8093  H HD11 . LEU A 1 45  ? 15.570  -3.029  -3.300  1.00 1.54  ? 40  LEU A HD11 4  
ATOM 8094  H HD12 . LEU A 1 45  ? 14.956  -2.034  -4.621  1.00 63.43 ? 40  LEU A HD12 4  
ATOM 8095  H HD13 . LEU A 1 45  ? 14.602  -1.597  -2.950  1.00 34.31 ? 40  LEU A HD13 4  
ATOM 8096  H HD21 . LEU A 1 45  ? 17.202  0.846   -3.920  1.00 42.23 ? 40  LEU A HD21 4  
ATOM 8097  H HD22 . LEU A 1 45  ? 15.487  0.646   -3.565  1.00 4.34  ? 40  LEU A HD22 4  
ATOM 8098  H HD23 . LEU A 1 45  ? 16.122  0.181   -5.144  1.00 1.50  ? 40  LEU A HD23 4  
ATOM 8099  N N    . ASP A 1 46  ? 18.745  -0.228  0.374   1.00 4.30  ? 41  ASP A N    4  
ATOM 8100  C CA   . ASP A 1 46  ? 18.876  0.602   1.566   1.00 41.33 ? 41  ASP A CA   4  
ATOM 8101  C C    . ASP A 1 46  ? 20.247  1.272   1.614   1.00 34.23 ? 41  ASP A C    4  
ATOM 8102  O O    . ASP A 1 46  ? 20.355  2.465   1.896   1.00 12.12 ? 41  ASP A O    4  
ATOM 8103  C CB   . ASP A 1 46  ? 18.661  -0.238  2.825   1.00 53.51 ? 41  ASP A CB   4  
ATOM 8104  C CG   . ASP A 1 46  ? 17.214  -0.653  3.004   1.00 13.32 ? 41  ASP A CG   4  
ATOM 8105  O OD1  . ASP A 1 46  ? 16.670  -1.316  2.096   1.00 54.21 ? 41  ASP A OD1  4  
ATOM 8106  O OD2  . ASP A 1 46  ? 16.625  -0.317  4.053   1.00 44.24 ? 41  ASP A OD2  4  
ATOM 8107  H H    . ASP A 1 46  ? 18.641  -1.196  0.475   1.00 54.52 ? 41  ASP A H    4  
ATOM 8108  H HA   . ASP A 1 46  ? 18.117  1.368   1.522   1.00 21.14 ? 41  ASP A HA   4  
ATOM 8109  H HB3  . ASP A 1 46  ? 18.962  0.336   3.689   1.00 53.52 ? 41  ASP A HB3  4  
ATOM 8110  N N    . GLU A 1 47  ? 21.289  0.494   1.338   1.00 4.11  ? 42  GLU A N    4  
ATOM 8111  C CA   . GLU A 1 47  ? 22.652  1.013   1.352   1.00 1.41  ? 42  GLU A CA   4  
ATOM 8112  C C    . GLU A 1 47  ? 22.847  2.060   0.260   1.00 40.41 ? 42  GLU A C    4  
ATOM 8113  O O    . GLU A 1 47  ? 23.361  3.149   0.515   1.00 15.02 ? 42  GLU A O    4  
ATOM 8114  C CB   . GLU A 1 47  ? 23.656  -0.127  1.165   1.00 40.12 ? 42  GLU A CB   4  
ATOM 8115  C CG   . GLU A 1 47  ? 25.028  0.170   1.747   1.00 50.44 ? 42  GLU A CG   4  
ATOM 8116  C CD   . GLU A 1 47  ? 26.104  -0.749  1.202   1.00 61.45 ? 42  GLU A CD   4  
ATOM 8117  O OE1  . GLU A 1 47  ? 25.995  -1.157  0.027   1.00 41.15 ? 42  GLU A OE1  4  
ATOM 8118  O OE2  . GLU A 1 47  ? 27.055  -1.059  1.950   1.00 2.34  ? 42  GLU A OE2  4  
ATOM 8119  H H    . GLU A 1 47  ? 21.138  -0.449  1.120   1.00 63.13 ? 42  GLU A H    4  
ATOM 8120  H HA   . GLU A 1 47  ? 22.821  1.475   2.312   1.00 4.01  ? 42  GLU A HA   4  
ATOM 8121  H HB3  . GLU A 1 47  ? 23.771  -0.320  0.109   1.00 53.01 ? 42  GLU A HB3  4  
ATOM 8122  H HG3  . GLU A 1 47  ? 24.984  0.051   2.820   1.00 12.42 ? 42  GLU A HG3  4  
ATOM 8123  N N    . GLU A 1 48  ? 22.434  1.722   -0.958  1.00 31.13 ? 43  GLU A N    4  
ATOM 8124  C CA   . GLU A 1 48  ? 22.565  2.632   -2.089  1.00 23.35 ? 43  GLU A CA   4  
ATOM 8125  C C    . GLU A 1 48  ? 21.789  3.924   -1.841  1.00 54.44 ? 43  GLU A C    4  
ATOM 8126  O O    . GLU A 1 48  ? 22.229  5.006   -2.225  1.00 21.34 ? 43  GLU A O    4  
ATOM 8127  C CB   . GLU A 1 48  ? 22.064  1.963   -3.371  1.00 44.13 ? 43  GLU A CB   4  
ATOM 8128  C CG   . GLU A 1 48  ? 22.475  2.695   -4.639  1.00 34.01 ? 43  GLU A CG   4  
ATOM 8129  C CD   . GLU A 1 48  ? 22.535  1.780   -5.846  1.00 15.22 ? 43  GLU A CD   4  
ATOM 8130  O OE1  . GLU A 1 48  ? 21.465  1.459   -6.403  1.00 61.40 ? 43  GLU A OE1  4  
ATOM 8131  O OE2  . GLU A 1 48  ? 23.654  1.384   -6.234  1.00 61.03 ? 43  GLU A OE2  4  
ATOM 8132  H H    . GLU A 1 48  ? 22.032  0.839   -1.099  1.00 61.42 ? 43  GLU A H    4  
ATOM 8133  H HA   . GLU A 1 48  ? 23.610  2.872   -2.203  1.00 40.12 ? 43  GLU A HA   4  
ATOM 8134  H HB3  . GLU A 1 48  ? 20.986  1.916   -3.341  1.00 25.02 ? 43  GLU A HB3  4  
ATOM 8135  H HG3  . GLU A 1 48  ? 23.450  3.132   -4.487  1.00 64.43 ? 43  GLU A HG3  4  
ATOM 8136  N N    . GLU A 1 49  ? 20.634  3.798   -1.195  1.00 75.41 ? 44  GLU A N    4  
ATOM 8137  C CA   . GLU A 1 49  ? 19.797  4.955   -0.896  1.00 2.40  ? 44  GLU A CA   4  
ATOM 8138  C C    . GLU A 1 49  ? 20.376  5.760   0.263   1.00 61.10 ? 44  GLU A C    4  
ATOM 8139  O O    . GLU A 1 49  ? 20.295  6.988   0.281   1.00 21.25 ? 44  GLU A O    4  
ATOM 8140  C CB   . GLU A 1 49  ? 18.372  4.508   -0.561  1.00 71.45 ? 44  GLU A CB   4  
ATOM 8141  C CG   . GLU A 1 49  ? 17.487  4.329   -1.783  1.00 54.45 ? 44  GLU A CG   4  
ATOM 8142  C CD   . GLU A 1 49  ? 16.845  5.626   -2.233  1.00 10.12 ? 44  GLU A CD   4  
ATOM 8143  O OE1  . GLU A 1 49  ? 17.332  6.702   -1.826  1.00 51.33 ? 44  GLU A OE1  4  
ATOM 8144  O OE2  . GLU A 1 49  ? 15.855  5.567   -2.993  1.00 61.32 ? 44  GLU A OE2  4  
ATOM 8145  H H    . GLU A 1 49  ? 20.337  2.908   -0.913  1.00 15.44 ? 44  GLU A H    4  
ATOM 8146  H HA   . GLU A 1 49  ? 19.770  5.580   -1.775  1.00 44.25 ? 44  GLU A HA   4  
ATOM 8147  H HB3  . GLU A 1 49  ? 17.918  5.248   0.081   1.00 3.03  ? 44  GLU A HB3  4  
ATOM 8148  H HG3  . GLU A 1 49  ? 16.706  3.621   -1.545  1.00 71.11 ? 44  GLU A HG3  4  
ATOM 8149  N N    . ARG A 1 50  ? 20.959  5.058   1.230   1.00 22.40 ? 45  ARG A N    4  
ATOM 8150  C CA   . ARG A 1 50  ? 21.549  5.708   2.395   1.00 10.33 ? 45  ARG A CA   4  
ATOM 8151  C C    . ARG A 1 50  ? 22.730  6.585   1.987   1.00 74.21 ? 45  ARG A C    4  
ATOM 8152  O O    . ARG A 1 50  ? 22.847  7.728   2.429   1.00 21.23 ? 45  ARG A O    4  
ATOM 8153  C CB   . ARG A 1 50  ? 22.006  4.660   3.411   1.00 74.10 ? 45  ARG A CB   4  
ATOM 8154  C CG   . ARG A 1 50  ? 22.770  5.246   4.588   1.00 15.13 ? 45  ARG A CG   4  
ATOM 8155  C CD   . ARG A 1 50  ? 24.267  5.025   4.446   1.00 5.33  ? 45  ARG A CD   4  
ATOM 8156  N NE   . ARG A 1 50  ? 24.921  4.845   5.739   1.00 3.14  ? 45  ARG A NE   4  
ATOM 8157  C CZ   . ARG A 1 50  ? 25.252  5.851   6.541   1.00 24.45 ? 45  ARG A CZ   4  
ATOM 8158  N NH1  . ARG A 1 50  ? 24.992  7.102   6.184   1.00 14.21 ? 45  ARG A NH1  4  
ATOM 8159  N NH2  . ARG A 1 50  ? 25.843  5.607   7.704   1.00 3.10  ? 45  ARG A NH2  4  
ATOM 8160  H H    . ARG A 1 50  ? 20.992  4.082   1.159   1.00 74.33 ? 45  ARG A H    4  
ATOM 8161  H HA   . ARG A 1 50  ? 20.792  6.330   2.848   1.00 51.40 ? 45  ARG A HA   4  
ATOM 8162  H HB3  . ARG A 1 50  ? 22.646  3.947   2.914   1.00 23.00 ? 45  ARG A HB3  4  
ATOM 8163  H HG3  . ARG A 1 50  ? 22.430  4.773   5.498   1.00 0.34  ? 45  ARG A HG3  4  
ATOM 8164  H HD3  . ARG A 1 50  ? 24.698  5.882   3.951   1.00 44.23 ? 45  ARG A HD3  4  
ATOM 8165  H HE   . ARG A 1 50  ? 25.122  3.930   6.022   1.00 75.42 ? 45  ARG A HE   4  
ATOM 8166  H HH11 . ARG A 1 50  ? 24.545  7.288   5.309   1.00 51.23 ? 45  ARG A HH11 4  
ATOM 8167  H HH12 . ARG A 1 50  ? 25.241  7.857   6.790   1.00 73.11 ? 45  ARG A HH12 4  
ATOM 8168  H HH21 . ARG A 1 50  ? 26.040  4.666   7.976   1.00 61.31 ? 45  ARG A HH21 4  
ATOM 8169  H HH22 . ARG A 1 50  ? 26.092  6.365   8.306   1.00 13.01 ? 45  ARG A HH22 4  
ATOM 8170  N N    . MET A 1 51  ? 23.600  6.042   1.144   1.00 43.34 ? 46  MET A N    4  
ATOM 8171  C CA   . MET A 1 51  ? 24.772  6.776   0.678   1.00 23.43 ? 46  MET A CA   4  
ATOM 8172  C C    . MET A 1 51  ? 24.370  7.869   -0.308  1.00 14.31 ? 46  MET A C    4  
ATOM 8173  O O    . MET A 1 51  ? 24.942  8.959   -0.307  1.00 43.52 ? 46  MET A O    4  
ATOM 8174  C CB   . MET A 1 51  ? 25.770  5.822   0.020   1.00 52.15 ? 46  MET A CB   4  
ATOM 8175  C CG   . MET A 1 51  ? 25.134  4.872   -0.983  1.00 74.45 ? 46  MET A CG   4  
ATOM 8176  S SD   . MET A 1 51  ? 25.897  4.970   -2.612  1.00 43.44 ? 46  MET A SD   4  
ATOM 8177  C CE   . MET A 1 51  ? 25.628  6.696   -3.009  1.00 44.45 ? 46  MET A CE   4  
ATOM 8178  H H    . MET A 1 51  ? 23.454  5.127   0.827   1.00 2.41  ? 46  MET A H    4  
ATOM 8179  H HA   . MET A 1 51  ? 25.238  7.236   1.536   1.00 74.00 ? 46  MET A HA   4  
ATOM 8180  H HB3  . MET A 1 51  ? 26.247  5.232   0.789   1.00 32.12 ? 46  MET A HB3  4  
ATOM 8181  H HG3  . MET A 1 51  ? 24.086  5.118   -1.074  1.00 52.53 ? 46  MET A HG3  4  
ATOM 8182  H HE1  . MET A 1 51  ? 24.580  6.859   -3.215  1.00 51.24 ? 46  MET A HE1  4  
ATOM 8183  H HE2  . MET A 1 51  ? 25.931  7.309   -2.173  1.00 11.42 ? 46  MET A HE2  4  
ATOM 8184  H HE3  . MET A 1 51  ? 26.211  6.960   -3.880  1.00 52.54 ? 46  MET A HE3  4  
ATOM 8185  N N    . ARG A 1 52  ? 23.385  7.570   -1.148  1.00 31.12 ? 47  ARG A N    4  
ATOM 8186  C CA   . ARG A 1 52  ? 22.909  8.526   -2.139  1.00 22.45 ? 47  ARG A CA   4  
ATOM 8187  C C    . ARG A 1 52  ? 22.398  9.798   -1.467  1.00 51.13 ? 47  ARG A C    4  
ATOM 8188  O O    . ARG A 1 52  ? 22.785  10.906  -1.838  1.00 53.14 ? 47  ARG A O    4  
ATOM 8189  C CB   . ARG A 1 52  ? 21.798  7.904   -2.987  1.00 43.41 ? 47  ARG A CB   4  
ATOM 8190  C CG   . ARG A 1 52  ? 20.661  8.863   -3.302  1.00 65.21 ? 47  ARG A CG   4  
ATOM 8191  C CD   . ARG A 1 52  ? 19.914  8.448   -4.559  1.00 20.25 ? 47  ARG A CD   4  
ATOM 8192  N NE   . ARG A 1 52  ? 19.915  9.502   -5.570  1.00 40.23 ? 47  ARG A NE   4  
ATOM 8193  C CZ   . ARG A 1 52  ? 19.102  10.553  -5.538  1.00 11.44 ? 47  ARG A CZ   4  
ATOM 8194  N NH1  . ARG A 1 52  ? 18.227  10.688  -4.551  1.00 65.44 ? 47  ARG A NH1  4  
ATOM 8195  N NH2  . ARG A 1 52  ? 19.163  11.469  -6.495  1.00 42.14 ? 47  ARG A NH2  4  
ATOM 8196  H H    . ARG A 1 52  ? 22.968  6.684   -1.100  1.00 72.41 ? 47  ARG A H    4  
ATOM 8197  H HA   . ARG A 1 52  ? 23.739  8.781   -2.780  1.00 64.11 ? 47  ARG A HA   4  
ATOM 8198  H HB3  . ARG A 1 52  ? 21.389  7.057   -2.458  1.00 24.13 ? 47  ARG A HB3  4  
ATOM 8199  H HG3  . ARG A 1 52  ? 21.068  9.854   -3.446  1.00 54.10 ? 47  ARG A HG3  4  
ATOM 8200  H HD3  . ARG A 1 52  ? 18.892  8.217   -4.294  1.00 61.13 ? 47  ARG A HD3  4  
ATOM 8201  H HE   . ARG A 1 52  ? 20.553  9.422   -6.308  1.00 13.50 ? 47  ARG A HE   4  
ATOM 8202  H HH11 . ARG A 1 52  ? 18.180  9.999   -3.829  1.00 61.44 ? 47  ARG A HH11 4  
ATOM 8203  H HH12 . ARG A 1 52  ? 17.618  11.481  -4.529  1.00 73.00 ? 47  ARG A HH12 4  
ATOM 8204  H HH21 . ARG A 1 52  ? 19.821  11.371  -7.241  1.00 40.44 ? 47  ARG A HH21 4  
ATOM 8205  H HH22 . ARG A 1 52  ? 18.552  12.259  -6.470  1.00 24.22 ? 47  ARG A HH22 4  
ATOM 8206  N N    . MET A 1 53  ? 21.528  9.630   -0.477  1.00 12.44 ? 48  MET A N    4  
ATOM 8207  C CA   . MET A 1 53  ? 20.964  10.763  0.247   1.00 40.50 ? 48  MET A CA   4  
ATOM 8208  C C    . MET A 1 53  ? 21.999  11.376  1.185   1.00 64.40 ? 48  MET A C    4  
ATOM 8209  O O    . MET A 1 53  ? 22.053  12.594  1.353   1.00 72.22 ? 48  MET A O    4  
ATOM 8210  C CB   . MET A 1 53  ? 19.732  10.327  1.042   1.00 50.43 ? 48  MET A CB   4  
ATOM 8211  C CG   . MET A 1 53  ? 20.041  9.313   2.131   1.00 74.33 ? 48  MET A CG   4  
ATOM 8212  S SD   . MET A 1 53  ? 20.273  10.078  3.748   1.00 44.31 ? 48  MET A SD   4  
ATOM 8213  C CE   . MET A 1 53  ? 21.241  8.823   4.580   1.00 53.11 ? 48  MET A CE   4  
ATOM 8214  H H    . MET A 1 53  ? 21.257  8.721   -0.227  1.00 41.21 ? 48  MET A H    4  
ATOM 8215  H HA   . MET A 1 53  ? 20.669  11.505  -0.479  1.00 62.31 ? 48  MET A HA   4  
ATOM 8216  H HB3  . MET A 1 53  ? 19.018  9.887   0.363   1.00 21.34 ? 48  MET A HB3  4  
ATOM 8217  H HG3  . MET A 1 53  ? 20.943  8.783   1.865   1.00 73.00 ? 48  MET A HG3  4  
ATOM 8218  H HE1  . MET A 1 53  ? 21.152  7.887   4.049   1.00 12.43 ? 48  MET A HE1  4  
ATOM 8219  H HE2  . MET A 1 53  ? 22.278  9.125   4.605   1.00 14.53 ? 48  MET A HE2  4  
ATOM 8220  H HE3  . MET A 1 53  ? 20.878  8.699   5.590   1.00 31.41 ? 48  MET A HE3  4  
ATOM 8221  N N    . ALA A 1 54  ? 22.818  10.525  1.794   1.00 4.43  ? 49  ALA A N    4  
ATOM 8222  C CA   . ALA A 1 54  ? 23.852  10.984  2.713   1.00 21.33 ? 49  ALA A CA   4  
ATOM 8223  C C    . ALA A 1 54  ? 24.755  12.019  2.051   1.00 61.22 ? 49  ALA A C    4  
ATOM 8224  O O    . ALA A 1 54  ? 25.011  13.083  2.614   1.00 70.32 ? 49  ALA A O    4  
ATOM 8225  C CB   . ALA A 1 54  ? 24.675  9.806   3.212   1.00 70.34 ? 49  ALA A CB   4  
ATOM 8226  H H    . ALA A 1 54  ? 22.726  9.566   1.619   1.00 11.15 ? 49  ALA A H    4  
ATOM 8227  H HA   . ALA A 1 54  ? 23.364  11.438  3.563   1.00 74.03 ? 49  ALA A HA   4  
ATOM 8228  H HB1  . ALA A 1 54  ? 24.206  9.387   4.092   1.00 63.33 ? 49  ALA A HB1  4  
ATOM 8229  H HB2  . ALA A 1 54  ? 24.730  9.052   2.441   1.00 64.20 ? 49  ALA A HB2  4  
ATOM 8230  H HB3  . ALA A 1 54  ? 25.670  10.142  3.461   1.00 53.44 ? 49  ALA A HB3  4  
ATOM 8231  N N    . GLU A 1 55  ? 25.236  11.700  0.853   1.00 32.14 ? 50  GLU A N    4  
ATOM 8232  C CA   . GLU A 1 55  ? 26.111  12.603  0.117   1.00 42.32 ? 50  GLU A CA   4  
ATOM 8233  C C    . GLU A 1 55  ? 25.347  13.835  -0.358  1.00 5.33  ? 50  GLU A C    4  
ATOM 8234  O O    . GLU A 1 55  ? 25.943  14.813  -0.809  1.00 53.23 ? 50  GLU A O    4  
ATOM 8235  C CB   . GLU A 1 55  ? 26.734  11.882  -1.082  1.00 14.01 ? 50  GLU A CB   4  
ATOM 8236  C CG   . GLU A 1 55  ? 25.728  11.516  -2.160  1.00 2.40  ? 50  GLU A CG   4  
ATOM 8237  C CD   . GLU A 1 55  ? 26.390  11.023  -3.432  1.00 41.42 ? 50  GLU A CD   4  
ATOM 8238  O OE1  . GLU A 1 55  ? 27.344  11.682  -3.898  1.00 13.24 ? 50  GLU A OE1  4  
ATOM 8239  O OE2  . GLU A 1 55  ? 25.956  9.979   -3.961  1.00 3.24  ? 50  GLU A OE2  4  
ATOM 8240  H H    . GLU A 1 55  ? 24.996  10.837  0.457   1.00 11.14 ? 50  GLU A H    4  
ATOM 8241  H HA   . GLU A 1 55  ? 26.900  12.918  0.783   1.00 74.14 ? 50  GLU A HA   4  
ATOM 8242  H HB3  . GLU A 1 55  ? 27.204  10.973  -0.735  1.00 34.33 ? 50  GLU A HB3  4  
ATOM 8243  H HG3  . GLU A 1 55  ? 25.138  12.390  -2.395  1.00 12.04 ? 50  GLU A HG3  4  
ATOM 8244  N N    . GLY A 1 56  ? 24.023  13.780  -0.254  1.00 43.51 ? 51  GLY A N    4  
ATOM 8245  C CA   . GLY A 1 56  ? 23.198  14.897  -0.677  1.00 3.52  ? 51  GLY A CA   4  
ATOM 8246  C C    . GLY A 1 56  ? 22.124  14.483  -1.664  1.00 61.21 ? 51  GLY A C    4  
ATOM 8247  O O    . GLY A 1 56  ? 21.521  13.420  -1.525  1.00 11.14 ? 51  GLY A O    4  
ATOM 8248  H H    . GLY A 1 56  ? 23.603  12.974  0.113   1.00 23.25 ? 51  GLY A H    4  
ATOM 8249  H HA2  . GLY A 1 56  ? 22.727  15.331  0.192   1.00 11.21 ? 51  GLY A HA2  4  
ATOM 8250  H HA3  . GLY A 1 56  ? 23.830  15.640  -1.141  1.00 41.30 ? 51  GLY A HA3  4  
ATOM 8251  N N    . GLY A 1 57  ? 21.884  15.328  -2.663  1.00 75.21 ? 52  GLY A N    4  
ATOM 8252  C CA   . GLY A 1 57  ? 20.874  15.027  -3.660  1.00 20.54 ? 52  GLY A CA   4  
ATOM 8253  C C    . GLY A 1 57  ? 19.471  15.345  -3.180  1.00 44.24 ? 52  GLY A C    4  
ATOM 8254  O O    . GLY A 1 57  ? 18.886  14.589  -2.405  1.00 10.14 ? 52  GLY A O    4  
ATOM 8255  H H    . GLY A 1 57  ? 22.396  16.161  -2.722  1.00 14.32 ? 52  GLY A H    4  
ATOM 8256  H HA2  . GLY A 1 57  ? 21.078  15.605  -4.549  1.00 21.23 ? 52  GLY A HA2  4  
ATOM 8257  H HA3  . GLY A 1 57  ? 20.927  13.976  -3.905  1.00 21.02 ? 52  GLY A HA3  4  
ATOM 8258  N N    . VAL A 1 58  ? 18.931  16.470  -3.639  1.00 12.24 ? 53  VAL A N    4  
ATOM 8259  C CA   . VAL A 1 58  ? 17.589  16.887  -3.251  1.00 23.22 ? 53  VAL A CA   4  
ATOM 8260  C C    . VAL A 1 58  ? 16.538  16.288  -4.177  1.00 12.14 ? 53  VAL A C    4  
ATOM 8261  O O    . VAL A 1 58  ? 16.329  16.767  -5.292  1.00 45.21 ? 53  VAL A O    4  
ATOM 8262  C CB   . VAL A 1 58  ? 17.453  18.422  -3.263  1.00 42.34 ? 53  VAL A CB   4  
ATOM 8263  C CG1  . VAL A 1 58  ? 16.119  18.845  -2.667  1.00 41.43 ? 53  VAL A CG1  4  
ATOM 8264  C CG2  . VAL A 1 58  ? 18.609  19.065  -2.512  1.00 41.54 ? 53  VAL A CG2  4  
ATOM 8265  H H    . VAL A 1 58  ? 19.448  17.031  -4.254  1.00 22.31 ? 53  VAL A H    4  
ATOM 8266  H HA   . VAL A 1 58  ? 17.409  16.539  -2.244  1.00 1.10  ? 53  VAL A HA   4  
ATOM 8267  H HB   . VAL A 1 58  ? 17.487  18.758  -4.288  1.00 3.32  ? 53  VAL A HB   4  
ATOM 8268  H HG11 . VAL A 1 58  ? 16.292  19.404  -1.759  1.00 15.14 ? 53  VAL A HG11 4  
ATOM 8269  H HG12 . VAL A 1 58  ? 15.588  19.462  -3.376  1.00 22.24 ? 53  VAL A HG12 4  
ATOM 8270  H HG13 . VAL A 1 58  ? 15.531  17.967  -2.443  1.00 72.33 ? 53  VAL A HG13 4  
ATOM 8271  H HG21 . VAL A 1 58  ? 18.459  20.133  -2.466  1.00 13.44 ? 53  VAL A HG21 4  
ATOM 8272  H HG22 . VAL A 1 58  ? 18.655  18.665  -1.510  1.00 73.05 ? 53  VAL A HG22 4  
ATOM 8273  H HG23 . VAL A 1 58  ? 19.536  18.853  -3.025  1.00 13.05 ? 53  VAL A HG23 4  
ATOM 8274  N N    . THR A 1 59  ? 15.875  15.235  -3.708  1.00 2.44  ? 54  THR A N    4  
ATOM 8275  C CA   . THR A 1 59  ? 14.844  14.568  -4.495  1.00 65.24 ? 54  THR A CA   4  
ATOM 8276  C C    . THR A 1 59  ? 13.647  14.195  -3.628  1.00 2.04  ? 54  THR A C    4  
ATOM 8277  O O    . THR A 1 59  ? 13.800  13.583  -2.572  1.00 41.00 ? 54  THR A O    4  
ATOM 8278  C CB   . THR A 1 59  ? 15.390  13.297  -5.172  1.00 34.21 ? 54  THR A CB   4  
ATOM 8279  O OG1  . THR A 1 59  ? 16.451  13.637  -6.071  1.00 53.44 ? 54  THR A OG1  4  
ATOM 8280  C CG2  . THR A 1 59  ? 14.288  12.573  -5.932  1.00 30.41 ? 54  THR A CG2  4  
ATOM 8281  H H    . THR A 1 59  ? 16.085  14.899  -2.813  1.00 40.22 ? 54  THR A H    4  
ATOM 8282  H HA   . THR A 1 59  ? 14.520  15.251  -5.266  1.00 23.13 ? 54  THR A HA   4  
ATOM 8283  H HB   . THR A 1 59  ? 15.773  12.636  -4.407  1.00 2.33  ? 54  THR A HB   4  
ATOM 8284  H HG1  . THR A 1 59  ? 16.154  14.325  -6.671  1.00 44.23 ? 54  THR A HG1  4  
ATOM 8285  H HG21 . THR A 1 59  ? 14.693  11.687  -6.398  1.00 71.41 ? 54  THR A HG21 4  
ATOM 8286  H HG22 . THR A 1 59  ? 13.885  13.227  -6.690  1.00 23.03 ? 54  THR A HG22 4  
ATOM 8287  H HG23 . THR A 1 59  ? 13.503  12.291  -5.245  1.00 24.21 ? 54  THR A HG23 4  
ATOM 8288  N N    . SER A 1 60  ? 12.455  14.568  -4.083  1.00 64.11 ? 55  SER A N    4  
ATOM 8289  C CA   . SER A 1 60  ? 11.231  14.275  -3.348  1.00 74.44 ? 55  SER A CA   4  
ATOM 8290  C C    . SER A 1 60  ? 11.142  12.789  -3.010  1.00 24.20 ? 55  SER A C    4  
ATOM 8291  O O    . SER A 1 60  ? 10.898  12.417  -1.862  1.00 10.35 ? 55  SER A O    4  
ATOM 8292  C CB   . SER A 1 60  ? 10.007  14.699  -4.162  1.00 13.15 ? 55  SER A CB   4  
ATOM 8293  O OG   . SER A 1 60  ? 9.237   15.661  -3.463  1.00 23.54 ? 55  SER A OG   4  
ATOM 8294  H H    . SER A 1 60  ? 12.398  15.054  -4.932  1.00 24.14 ? 55  SER A H    4  
ATOM 8295  H HA   . SER A 1 60  ? 11.254  14.840  -2.428  1.00 31.41 ? 55  SER A HA   4  
ATOM 8296  H HB3  . SER A 1 60  ? 9.390   13.833  -4.356  1.00 53.20 ? 55  SER A HB3  4  
ATOM 8297  H HG   . SER A 1 60  ? 9.165   15.405  -2.540  1.00 23.14 ? 55  SER A HG   4  
ATOM 8298  N N    . GLU A 1 61  ? 11.341  11.947  -4.018  1.00 2.13  ? 56  GLU A N    4  
ATOM 8299  C CA   . GLU A 1 61  ? 11.283  10.502  -3.830  1.00 30.41 ? 56  GLU A CA   4  
ATOM 8300  C C    . GLU A 1 61  ? 12.224  10.061  -2.712  1.00 63.42 ? 56  GLU A C    4  
ATOM 8301  O O    . GLU A 1 61  ? 11.876  9.211   -1.893  1.00 62.12 ? 56  GLU A O    4  
ATOM 8302  C CB   . GLU A 1 61  ? 11.643  9.781   -5.129  1.00 11.33 ? 56  GLU A CB   4  
ATOM 8303  C CG   . GLU A 1 61  ? 10.483  9.011   -5.740  1.00 63.43 ? 56  GLU A CG   4  
ATOM 8304  C CD   . GLU A 1 61  ? 10.941  7.937   -6.707  1.00 51.21 ? 56  GLU A CD   4  
ATOM 8305  O OE1  . GLU A 1 61  ? 11.381  6.866   -6.240  1.00 51.31 ? 56  GLU A OE1  4  
ATOM 8306  O OE2  . GLU A 1 61  ? 10.858  8.168   -7.932  1.00 52.25 ? 56  GLU A OE2  4  
ATOM 8307  H H    . GLU A 1 61  ? 11.531  12.306  -4.910  1.00 2.43  ? 56  GLU A H    4  
ATOM 8308  H HA   . GLU A 1 61  ? 10.271  10.244  -3.554  1.00 64.31 ? 56  GLU A HA   4  
ATOM 8309  H HB3  . GLU A 1 61  ? 12.443  9.085   -4.930  1.00 54.42 ? 56  GLU A HB3  4  
ATOM 8310  H HG3  . GLU A 1 61  ? 9.847   9.705   -6.270  1.00 21.42 ? 56  GLU A HG3  4  
ATOM 8311  N N    . ASP A 1 62  ? 13.417  10.646  -2.687  1.00 23.13 ? 57  ASP A N    4  
ATOM 8312  C CA   . ASP A 1 62  ? 14.409  10.314  -1.670  1.00 24.24 ? 57  ASP A CA   4  
ATOM 8313  C C    . ASP A 1 62  ? 13.933  10.743  -0.286  1.00 24.13 ? 57  ASP A C    4  
ATOM 8314  O O    . ASP A 1 62  ? 14.136  10.033  0.699   1.00 42.41 ? 57  ASP A O    4  
ATOM 8315  C CB   . ASP A 1 62  ? 15.745  10.985  -1.995  1.00 31.42 ? 57  ASP A CB   4  
ATOM 8316  C CG   . ASP A 1 62  ? 16.915  10.300  -1.318  1.00 70.32 ? 57  ASP A CG   4  
ATOM 8317  O OD1  . ASP A 1 62  ? 16.677  9.495   -0.393  1.00 70.22 ? 57  ASP A OD1  4  
ATOM 8318  O OD2  . ASP A 1 62  ? 18.070  10.569  -1.711  1.00 32.23 ? 57  ASP A OD2  4  
ATOM 8319  H H    . ASP A 1 62  ? 13.635  11.317  -3.367  1.00 5.43  ? 57  ASP A H    4  
ATOM 8320  H HA   . ASP A 1 62  ? 14.543  9.244   -1.675  1.00 1.32  ? 57  ASP A HA   4  
ATOM 8321  H HB3  . ASP A 1 62  ? 15.713  12.013  -1.666  1.00 62.42 ? 57  ASP A HB3  4  
ATOM 8322  N N    . TYR A 1 63  ? 13.299  11.909  -0.219  1.00 33.42 ? 58  TYR A N    4  
ATOM 8323  C CA   . TYR A 1 63  ? 12.797  12.433  1.045   1.00 42.22 ? 58  TYR A CA   4  
ATOM 8324  C C    . TYR A 1 63  ? 11.744  11.504  1.642   1.00 43.41 ? 58  TYR A C    4  
ATOM 8325  O O    . TYR A 1 63  ? 11.837  11.108  2.804   1.00 44.43 ? 58  TYR A O    4  
ATOM 8326  C CB   . TYR A 1 63  ? 12.204  13.829  0.843   1.00 51.13 ? 58  TYR A CB   4  
ATOM 8327  C CG   . TYR A 1 63  ? 13.247  14.905  0.639   1.00 61.12 ? 58  TYR A CG   4  
ATOM 8328  C CD1  . TYR A 1 63  ? 14.380  14.965  1.442   1.00 34.32 ? 58  TYR A CD1  4  
ATOM 8329  C CD2  . TYR A 1 63  ? 13.099  15.863  -0.356  1.00 61.24 ? 58  TYR A CD2  4  
ATOM 8330  C CE1  . TYR A 1 63  ? 15.333  15.946  1.260   1.00 61.43 ? 58  TYR A CE1  4  
ATOM 8331  C CE2  . TYR A 1 63  ? 14.049  16.849  -0.546  1.00 12.33 ? 58  TYR A CE2  4  
ATOM 8332  C CZ   . TYR A 1 63  ? 15.164  16.887  0.265   1.00 15.12 ? 58  TYR A CZ   4  
ATOM 8333  O OH   . TYR A 1 63  ? 16.113  17.866  0.080   1.00 12.52 ? 58  TYR A OH   4  
ATOM 8334  H H    . TYR A 1 63  ? 13.166  12.429  -1.038  1.00 64.31 ? 58  TYR A H    4  
ATOM 8335  H HA   . TYR A 1 63  ? 13.630  12.502  1.729   1.00 70.43 ? 58  TYR A HA   4  
ATOM 8336  H HB3  . TYR A 1 63  ? 11.619  14.093  1.711   1.00 21.53 ? 58  TYR A HB3  4  
ATOM 8337  H HD1  . TYR A 1 63  ? 14.509  14.226  2.221   1.00 30.51 ? 58  TYR A HD1  4  
ATOM 8338  H HD2  . TYR A 1 63  ? 12.225  15.832  -0.990  1.00 11.53 ? 58  TYR A HD2  4  
ATOM 8339  H HE1  . TYR A 1 63  ? 16.206  15.975  1.895   1.00 64.43 ? 58  TYR A HE1  4  
ATOM 8340  H HE2  . TYR A 1 63  ? 13.917  17.585  -1.325  1.00 54.31 ? 58  TYR A HE2  4  
ATOM 8341  H HH   . TYR A 1 63  ? 16.176  18.404  0.873   1.00 24.35 ? 58  TYR A HH   4  
ATOM 8342  N N    . ARG A 1 64  ? 10.745  11.159  0.837   1.00 21.52 ? 59  ARG A N    4  
ATOM 8343  C CA   . ARG A 1 64  ? 9.673   10.277  1.284   1.00 52.22 ? 59  ARG A CA   4  
ATOM 8344  C C    . ARG A 1 64  ? 10.217  8.892   1.626   1.00 23.22 ? 59  ARG A C    4  
ATOM 8345  O O    . ARG A 1 64  ? 9.838   8.296   2.634   1.00 32.11 ? 59  ARG A O    4  
ATOM 8346  C CB   . ARG A 1 64  ? 8.595   10.161  0.206   1.00 23.14 ? 59  ARG A CB   4  
ATOM 8347  C CG   . ARG A 1 64  ? 9.130   9.710   -1.144  1.00 75.23 ? 59  ARG A CG   4  
ATOM 8348  C CD   . ARG A 1 64  ? 8.044   9.732   -2.209  1.00 55.12 ? 59  ARG A CD   4  
ATOM 8349  N NE   . ARG A 1 64  ? 6.924   8.859   -1.867  1.00 64.34 ? 59  ARG A NE   4  
ATOM 8350  C CZ   . ARG A 1 64  ? 5.733   8.931   -2.451  1.00 71.14 ? 59  ARG A CZ   4  
ATOM 8351  N NH1  . ARG A 1 64  ? 5.508   9.829   -3.399  1.00 32.10 ? 59  ARG A NH1  4  
ATOM 8352  N NH2  . ARG A 1 64  ? 4.763   8.102   -2.085  1.00 41.53 ? 59  ARG A NH2  4  
ATOM 8353  H H    . ARG A 1 64  ? 10.725  11.508  -0.078  1.00 4.52  ? 59  ARG A H    4  
ATOM 8354  H HA   . ARG A 1 64  ? 9.237   10.709  2.173   1.00 13.51 ? 59  ARG A HA   4  
ATOM 8355  H HB3  . ARG A 1 64  ? 8.126   11.126  0.078   1.00 15.01 ? 59  ARG A HB3  4  
ATOM 8356  H HG3  . ARG A 1 64  ? 9.510   8.704   -1.051  1.00 14.31 ? 59  ARG A HG3  4  
ATOM 8357  H HD3  . ARG A 1 64  ? 8.471   9.405   -3.145  1.00 52.12 ? 59  ARG A HD3  4  
ATOM 8358  H HE   . ARG A 1 64  ? 7.068   8.189   -1.169  1.00 14.21 ? 59  ARG A HE   4  
ATOM 8359  H HH11 . ARG A 1 64  ? 6.237   10.454  -3.678  1.00 61.52 ? 59  ARG A HH11 4  
ATOM 8360  H HH12 . ARG A 1 64  ? 4.610   9.880   -3.838  1.00 62.33 ? 59  ARG A HH12 4  
ATOM 8361  H HH21 . ARG A 1 64  ? 4.929   7.423   -1.370  1.00 22.11 ? 59  ARG A HH21 4  
ATOM 8362  H HH22 . ARG A 1 64  ? 3.867   8.156   -2.524  1.00 4.32  ? 59  ARG A HH22 4  
ATOM 8363  N N    . THR A 1 65  ? 11.107  8.386   0.779   1.00 43.12 ? 60  THR A N    4  
ATOM 8364  C CA   . THR A 1 65  ? 11.702  7.072   0.990   1.00 11.14 ? 60  THR A CA   4  
ATOM 8365  C C    . THR A 1 65  ? 12.392  6.991   2.346   1.00 64.44 ? 60  THR A C    4  
ATOM 8366  O O    . THR A 1 65  ? 12.180  6.047   3.107   1.00 4.14  ? 60  THR A O    4  
ATOM 8367  C CB   . THR A 1 65  ? 12.722  6.734   -0.114  1.00 34.35 ? 60  THR A CB   4  
ATOM 8368  O OG1  . THR A 1 65  ? 12.067  6.676   -1.386  1.00 71.14 ? 60  THR A OG1  4  
ATOM 8369  C CG2  . THR A 1 65  ? 13.405  5.405   0.171   1.00 3.32  ? 60  THR A CG2  4  
ATOM 8370  H H    . THR A 1 65  ? 11.369  8.909   -0.007  1.00 61.42 ? 60  THR A H    4  
ATOM 8371  H HA   . THR A 1 65  ? 10.909  6.339   0.955   1.00 74.21 ? 60  THR A HA   4  
ATOM 8372  H HB   . THR A 1 65  ? 13.473  7.511   -0.139  1.00 13.23 ? 60  THR A HB   4  
ATOM 8373  H HG1  . THR A 1 65  ? 11.504  7.447   -1.492  1.00 50.05 ? 60  THR A HG1  4  
ATOM 8374  H HG21 . THR A 1 65  ? 12.658  4.635   0.297   1.00 42.12 ? 60  THR A HG21 4  
ATOM 8375  H HG22 . THR A 1 65  ? 13.993  5.488   1.073   1.00 71.21 ? 60  THR A HG22 4  
ATOM 8376  H HG23 . THR A 1 65  ? 14.050  5.147   -0.656  1.00 24.42 ? 60  THR A HG23 4  
ATOM 8377  N N    . PHE A 1 66  ? 13.217  7.989   2.645   1.00 44.24 ? 61  PHE A N    4  
ATOM 8378  C CA   . PHE A 1 66  ? 13.939  8.031   3.911   1.00 43.12 ? 61  PHE A CA   4  
ATOM 8379  C C    . PHE A 1 66  ? 12.993  8.343   5.066   1.00 54.13 ? 61  PHE A C    4  
ATOM 8380  O O    . PHE A 1 66  ? 13.064  7.720   6.128   1.00 43.42 ? 61  PHE A O    4  
ATOM 8381  C CB   . PHE A 1 66  ? 15.054  9.079   3.853   1.00 31.43 ? 61  PHE A CB   4  
ATOM 8382  C CG   . PHE A 1 66  ? 16.147  8.847   4.855   1.00 72.24 ? 61  PHE A CG   4  
ATOM 8383  C CD1  . PHE A 1 66  ? 16.048  9.359   6.140   1.00 14.02 ? 61  PHE A CD1  4  
ATOM 8384  C CD2  . PHE A 1 66  ? 17.275  8.118   4.514   1.00 65.53 ? 61  PHE A CD2  4  
ATOM 8385  C CE1  . PHE A 1 66  ? 17.051  9.147   7.065   1.00 44.23 ? 61  PHE A CE1  4  
ATOM 8386  C CE2  . PHE A 1 66  ? 18.282  7.903   5.435   1.00 60.35 ? 61  PHE A CE2  4  
ATOM 8387  C CZ   . PHE A 1 66  ? 18.171  8.419   6.712   1.00 63.34 ? 61  PHE A CZ   4  
ATOM 8388  H H    . PHE A 1 66  ? 13.345  8.715   1.996   1.00 74.44 ? 61  PHE A H    4  
ATOM 8389  H HA   . PHE A 1 66  ? 14.379  7.059   4.073   1.00 23.12 ? 61  PHE A HA   4  
ATOM 8390  H HB3  . PHE A 1 66  ? 14.631  10.054  4.040   1.00 35.43 ? 61  PHE A HB3  4  
ATOM 8391  H HD1  . PHE A 1 66  ? 15.172  9.929   6.416   1.00 73.13 ? 61  PHE A HD1  4  
ATOM 8392  H HD2  . PHE A 1 66  ? 17.364  7.716   3.517   1.00 42.42 ? 61  PHE A HD2  4  
ATOM 8393  H HE1  . PHE A 1 66  ? 16.962  9.552   8.062   1.00 62.10 ? 61  PHE A HE1  4  
ATOM 8394  H HE2  . PHE A 1 66  ? 19.157  7.335   5.157   1.00 51.12 ? 61  PHE A HE2  4  
ATOM 8395  H HZ   . PHE A 1 66  ? 18.957  8.253   7.434   1.00 54.04 ? 61  PHE A HZ   4  
ATOM 8396  N N    . LEU A 1 67  ? 12.107  9.310   4.854   1.00 42.34 ? 62  LEU A N    4  
ATOM 8397  C CA   . LEU A 1 67  ? 11.146  9.705   5.877   1.00 74.14 ? 62  LEU A CA   4  
ATOM 8398  C C    . LEU A 1 67  ? 10.391  8.493   6.412   1.00 73.40 ? 62  LEU A C    4  
ATOM 8399  O O    . LEU A 1 67  ? 10.153  8.379   7.615   1.00 40.42 ? 62  LEU A O    4  
ATOM 8400  C CB   . LEU A 1 67  ? 10.159  10.726  5.310   1.00 23.14 ? 62  LEU A CB   4  
ATOM 8401  C CG   . LEU A 1 67  ? 10.602  12.189  5.361   1.00 1.31  ? 62  LEU A CG   4  
ATOM 8402  C CD1  . LEU A 1 67  ? 9.796   13.024  4.379   1.00 64.31 ? 62  LEU A CD1  4  
ATOM 8403  C CD2  . LEU A 1 67  ? 10.463  12.739  6.773   1.00 0.31  ? 62  LEU A CD2  4  
ATOM 8404  H H    . LEU A 1 67  ? 12.099  9.769   3.989   1.00 21.23 ? 62  LEU A H    4  
ATOM 8405  H HA   . LEU A 1 67  ? 11.694  10.159  6.689   1.00 42.12 ? 62  LEU A HA   4  
ATOM 8406  H HB3  . LEU A 1 67  ? 9.237   10.639  5.868   1.00 22.05 ? 62  LEU A HB3  4  
ATOM 8407  H HG   . LEU A 1 67  ? 11.643  12.253  5.077   1.00 52.32 ? 62  LEU A HG   4  
ATOM 8408  H HD11 . LEU A 1 67  ? 9.473   12.403  3.558   1.00 34.54 ? 62  LEU A HD11 4  
ATOM 8409  H HD12 . LEU A 1 67  ? 10.411  13.828  4.001   1.00 20.51 ? 62  LEU A HD12 4  
ATOM 8410  H HD13 . LEU A 1 67  ? 8.933   13.437  4.881   1.00 63.21 ? 62  LEU A HD13 4  
ATOM 8411  H HD21 . LEU A 1 67  ? 11.397  12.619  7.299   1.00 43.44 ? 62  LEU A HD21 4  
ATOM 8412  H HD22 . LEU A 1 67  ? 9.685   12.200  7.294   1.00 23.30 ? 62  LEU A HD22 4  
ATOM 8413  H HD23 . LEU A 1 67  ? 10.208  13.787  6.726   1.00 62.40 ? 62  LEU A HD23 4  
ATOM 8414  N N    . GLN A 1 68  ? 10.018  7.589   5.512   1.00 11.14 ? 63  GLN A N    4  
ATOM 8415  C CA   . GLN A 1 68  ? 9.291   6.385   5.895   1.00 2.22  ? 63  GLN A CA   4  
ATOM 8416  C C    . GLN A 1 68  ? 10.014  5.646   7.015   1.00 53.32 ? 63  GLN A C    4  
ATOM 8417  O O    . GLN A 1 68  ? 9.381   5.081   7.908   1.00 44.40 ? 63  GLN A O    4  
ATOM 8418  C CB   . GLN A 1 68  ? 9.119   5.462   4.686   1.00 55.14 ? 63  GLN A CB   4  
ATOM 8419  C CG   . GLN A 1 68  ? 8.142   5.992   3.650   1.00 74.51 ? 63  GLN A CG   4  
ATOM 8420  C CD   . GLN A 1 68  ? 7.088   4.971   3.266   1.00 73.33 ? 63  GLN A CD   4  
ATOM 8421  O OE1  . GLN A 1 68  ? 6.871   4.700   2.086   1.00 34.15 ? 63  GLN A OE1  4  
ATOM 8422  N NE2  . GLN A 1 68  ? 6.426   4.399   4.266   1.00 64.12 ? 63  GLN A NE2  4  
ATOM 8423  H H    . GLN A 1 68  ? 10.236  7.736   4.568   1.00 42.22 ? 63  GLN A H    4  
ATOM 8424  H HA   . GLN A 1 68  ? 8.316   6.684   6.248   1.00 72.11 ? 63  GLN A HA   4  
ATOM 8425  H HB3  . GLN A 1 68  ? 8.762   4.502   5.029   1.00 73.22 ? 63  GLN A HB3  4  
ATOM 8426  H HG3  . GLN A 1 68  ? 8.693   6.269   2.764   1.00 22.14 ? 63  GLN A HG3  4  
ATOM 8427  H HE21 . GLN A 1 68  ? 6.651   4.666   5.182   1.00 52.24 ? 63  GLN A HE21 4  
ATOM 8428  H HE22 . GLN A 1 68  ? 5.740   3.737   4.048   1.00 21.15 ? 63  GLN A HE22 4  
ATOM 8429  N N    . GLN A 1 69  ? 11.342  5.653   6.962   1.00 13.51 ? 64  GLN A N    4  
ATOM 8430  C CA   . GLN A 1 69  ? 12.151  4.982   7.973   1.00 11.14 ? 64  GLN A CA   4  
ATOM 8431  C C    . GLN A 1 69  ? 13.637  5.128   7.666   1.00 74.42 ? 64  GLN A C    4  
ATOM 8432  O O    . GLN A 1 69  ? 14.041  5.354   6.526   1.00 64.12 ? 64  GLN A O    4  
ATOM 8433  C CB   . GLN A 1 69  ? 11.777  3.501   8.054   1.00 41.43 ? 64  GLN A CB   4  
ATOM 8434  C CG   . GLN A 1 69  ? 11.591  2.845   6.695   1.00 25.03 ? 64  GLN A CG   4  
ATOM 8435  C CD   . GLN A 1 69  ? 12.039  1.397   6.679   1.00 41.31 ? 64  GLN A CD   4  
ATOM 8436  O OE1  . GLN A 1 69  ? 11.223  0.484   6.552   1.00 54.30 ? 64  GLN A OE1  4  
ATOM 8437  N NE2  . GLN A 1 69  ? 13.344  1.179   6.808   1.00 33.54 ? 64  GLN A NE2  4  
ATOM 8438  H H    . GLN A 1 69  ? 11.788  6.120   6.226   1.00 62.23 ? 64  GLN A H    4  
ATOM 8439  H HA   . GLN A 1 69  ? 11.945  5.448   8.925   1.00 3.32  ? 64  GLN A HA   4  
ATOM 8440  H HB3  . GLN A 1 69  ? 10.854  3.404   8.605   1.00 33.51 ? 64  GLN A HB3  4  
ATOM 8441  H HG3  . GLN A 1 69  ? 12.167  3.393   5.963   1.00 34.54 ? 64  GLN A HG3  4  
ATOM 8442  H HE21 . GLN A 1 69  ? 13.934  1.956   6.906   1.00 22.12 ? 64  GLN A HE21 4  
ATOM 8443  H HE22 . GLN A 1 69  ? 13.661  0.253   6.801   1.00 62.53 ? 64  GLN A HE22 4  
ATOM 8444  N N    . PRO A 1 70  ? 14.472  4.996   8.707   1.00 73.04 ? 65  PRO A N    4  
ATOM 8445  C CA   . PRO A 1 70  ? 15.928  5.109   8.574   1.00 52.31 ? 65  PRO A CA   4  
ATOM 8446  C C    . PRO A 1 70  ? 16.534  3.934   7.813   1.00 73.30 ? 65  PRO A C    4  
ATOM 8447  O O    . PRO A 1 70  ? 15.814  3.112   7.245   1.00 64.44 ? 65  PRO A O    4  
ATOM 8448  C CB   . PRO A 1 70  ? 16.418  5.116   10.024  1.00 71.53 ? 65  PRO A CB   4  
ATOM 8449  C CG   . PRO A 1 70  ? 15.356  4.401   10.786  1.00 30.23 ? 65  PRO A CG   4  
ATOM 8450  C CD   . PRO A 1 70  ? 14.061  4.724   10.095  1.00 32.40 ? 65  PRO A CD   4  
ATOM 8451  H HA   . PRO A 1 70  ? 16.211  6.033   8.092   1.00 53.51 ? 65  PRO A HA   4  
ATOM 8452  H HB3  . PRO A 1 70  ? 16.529  6.134   10.365  1.00 44.35 ? 65  PRO A HB3  4  
ATOM 8453  H HG3  . PRO A 1 70  ? 15.334  4.755   11.807  1.00 42.42 ? 65  PRO A HG3  4  
ATOM 8454  H HD3  . PRO A 1 70  ? 13.604  5.598   10.539  1.00 12.41 ? 65  PRO A HD3  4  
ATOM 8455  N N    . SER A 1 71  ? 17.861  3.860   7.807   1.00 61.01 ? 66  SER A N    4  
ATOM 8456  C CA   . SER A 1 71  ? 18.563  2.788   7.114   1.00 1.34  ? 66  SER A CA   4  
ATOM 8457  C C    . SER A 1 71  ? 19.068  1.740   8.101   1.00 42.42 ? 66  SER A C    4  
ATOM 8458  O O    . SER A 1 71  ? 18.887  0.540   7.898   1.00 33.40 ? 66  SER A O    4  
ATOM 8459  C CB   . SER A 1 71  ? 19.735  3.353   6.309   1.00 43.52 ? 66  SER A CB   4  
ATOM 8460  O OG   . SER A 1 71  ? 20.536  2.313   5.775   1.00 63.13 ? 66  SER A OG   4  
ATOM 8461  H H    . SER A 1 71  ? 18.379  4.546   8.278   1.00 52.24 ? 66  SER A H    4  
ATOM 8462  H HA   . SER A 1 71  ? 17.865  2.318   6.435   1.00 63.44 ? 66  SER A HA   4  
ATOM 8463  H HB3  . SER A 1 71  ? 20.347  3.968   6.954   1.00 61.11 ? 66  SER A HB3  4  
ATOM 8464  H HG   . SER A 1 71  ? 21.389  2.306   6.218   1.00 74.20 ? 66  SER A HG   4  
ATOM 8465  N N    . GLY A 1 72  ? 19.704  2.205   9.173   1.00 32.11 ? 67  GLY A N    4  
ATOM 8466  C CA   . GLY A 1 72  ? 20.226  1.296   10.177  1.00 21.41 ? 67  GLY A CA   4  
ATOM 8467  C C    . GLY A 1 72  ? 21.387  0.469   9.662   1.00 35.31 ? 67  GLY A C    4  
ATOM 8468  O O    . GLY A 1 72  ? 21.296  -0.148  8.602   1.00 11.41 ? 67  GLY A O    4  
ATOM 8469  H H    . GLY A 1 72  ? 19.820  3.172   9.282   1.00 31.22 ? 67  GLY A H    4  
ATOM 8470  H HA2  . GLY A 1 72  ? 20.557  1.871   11.029  1.00 33.23 ? 67  GLY A HA2  4  
ATOM 8471  H HA3  . GLY A 1 72  ? 19.435  0.631   10.490  1.00 21.03 ? 67  GLY A HA3  4  
ATOM 8472  N N    . ASN A 1 73  ? 22.482  0.455   10.416  1.00 71.02 ? 68  ASN A N    4  
ATOM 8473  C CA   . ASN A 1 73  ? 23.667  -0.302  10.029  1.00 40.11 ? 68  ASN A CA   4  
ATOM 8474  C C    . ASN A 1 73  ? 23.431  -1.801  10.187  1.00 33.51 ? 68  ASN A C    4  
ATOM 8475  O O    . ASN A 1 73  ? 23.498  -2.555  9.217   1.00 73.20 ? 68  ASN A O    4  
ATOM 8476  C CB   . ASN A 1 73  ? 24.870  0.129   10.871  1.00 30.13 ? 68  ASN A CB   4  
ATOM 8477  C CG   . ASN A 1 73  ? 25.810  1.043   10.110  1.00 61.33 ? 68  ASN A CG   4  
ATOM 8478  O OD1  . ASN A 1 73  ? 26.647  0.585   9.332   1.00 75.11 ? 68  ASN A OD1  4  
ATOM 8479  N ND2  . ASN A 1 73  ? 25.676  2.346   10.332  1.00 53.41 ? 68  ASN A ND2  4  
ATOM 8480  H H    . ASN A 1 73  ? 22.493  0.967   11.252  1.00 41.23 ? 68  ASN A H    4  
ATOM 8481  H HA   . ASN A 1 73  ? 23.871  -0.088  8.990   1.00 52.31 ? 68  ASN A HA   4  
ATOM 8482  H HB3  . ASN A 1 73  ? 25.419  -0.748  11.178  1.00 11.53 ? 68  ASN A HB3  4  
ATOM 8483  H HD21 . ASN A 1 73  ? 24.988  2.640   10.966  1.00 44.50 ? 68  ASN A HD21 4  
ATOM 8484  H HD22 . ASN A 1 73  ? 26.271  2.960   9.853   1.00 51.13 ? 68  ASN A HD22 4  
ATOM 8485  N N    . MET A 1 74  ? 23.153  -2.223  11.416  1.00 11.41 ? 69  MET A N    4  
ATOM 8486  C CA   . MET A 1 74  ? 22.905  -3.632  11.702  1.00 3.03  ? 69  MET A CA   4  
ATOM 8487  C C    . MET A 1 74  ? 21.572  -4.080  11.112  1.00 22.24 ? 69  MET A C    4  
ATOM 8488  O O    . MET A 1 74  ? 20.949  -3.352  10.338  1.00 20.21 ? 69  MET A O    4  
ATOM 8489  C CB   . MET A 1 74  ? 22.916  -3.879  13.211  1.00 44.35 ? 69  MET A CB   4  
ATOM 8490  C CG   . MET A 1 74  ? 24.134  -3.297  13.912  1.00 75.02 ? 69  MET A CG   4  
ATOM 8491  S SD   . MET A 1 74  ? 24.248  -3.804  15.639  1.00 63.11 ? 69  MET A SD   4  
ATOM 8492  C CE   . MET A 1 74  ? 25.762  -4.761  15.610  1.00 61.35 ? 69  MET A CE   4  
ATOM 8493  H H    . MET A 1 74  ? 23.113  -1.574  12.149  1.00 62.32 ? 69  MET A H    4  
ATOM 8494  H HA   . MET A 1 74  ? 23.698  -4.207  11.246  1.00 63.20 ? 69  MET A HA   4  
ATOM 8495  H HB3  . MET A 1 74  ? 22.899  -4.943  13.391  1.00 43.22 ? 69  MET A HB3  4  
ATOM 8496  H HG3  . MET A 1 74  ? 24.074  -2.220  13.871  1.00 45.11 ? 69  MET A HG3  4  
ATOM 8497  H HE1  . MET A 1 74  ? 26.396  -4.410  14.809  1.00 32.14 ? 69  MET A HE1  4  
ATOM 8498  H HE2  . MET A 1 74  ? 26.278  -4.647  16.553  1.00 32.11 ? 69  MET A HE2  4  
ATOM 8499  H HE3  . MET A 1 74  ? 25.525  -5.804  15.453  1.00 62.34 ? 69  MET A HE3  4  
ATOM 8500  N N    . ASP A 1 75  ? 21.139  -5.280  11.482  1.00 23.51 ? 70  ASP A N    4  
ATOM 8501  C CA   . ASP A 1 75  ? 19.878  -5.823  10.989  1.00 71.04 ? 70  ASP A CA   4  
ATOM 8502  C C    . ASP A 1 75  ? 18.695  -5.205  11.728  1.00 44.00 ? 70  ASP A C    4  
ATOM 8503  O O    . ASP A 1 75  ? 17.992  -4.350  11.188  1.00 1.14  ? 70  ASP A O    4  
ATOM 8504  C CB   . ASP A 1 75  ? 19.857  -7.344  11.150  1.00 54.24 ? 70  ASP A CB   4  
ATOM 8505  C CG   . ASP A 1 75  ? 18.522  -7.948  10.763  1.00 13.32 ? 70  ASP A CG   4  
ATOM 8506  O OD1  . ASP A 1 75  ? 17.762  -7.287  10.025  1.00 44.23 ? 70  ASP A OD1  4  
ATOM 8507  O OD2  . ASP A 1 75  ? 18.235  -9.084  11.200  1.00 44.11 ? 70  ASP A OD2  4  
ATOM 8508  H H    . ASP A 1 75  ? 21.680  -5.812  12.102  1.00 1.34  ? 70  ASP A H    4  
ATOM 8509  H HA   . ASP A 1 75  ? 19.799  -5.581  9.941   1.00 24.02 ? 70  ASP A HA   4  
ATOM 8510  H HB3  . ASP A 1 75  ? 20.060  -7.593  12.182  1.00 33.23 ? 70  ASP A HB3  4  
ATOM 8511  N N    . ASP A 1 76  ? 18.480  -5.642  12.963  1.00 73.02 ? 71  ASP A N    4  
ATOM 8512  C CA   . ASP A 1 76  ? 17.381  -5.132  13.775  1.00 43.42 ? 71  ASP A CA   4  
ATOM 8513  C C    . ASP A 1 76  ? 16.060  -5.221  13.019  1.00 32.31 ? 71  ASP A C    4  
ATOM 8514  O O    . ASP A 1 76  ? 15.154  -4.417  13.237  1.00 34.23 ? 71  ASP A O    4  
ATOM 8515  C CB   . ASP A 1 76  ? 17.653  -3.684  14.186  1.00 45.02 ? 71  ASP A CB   4  
ATOM 8516  C CG   . ASP A 1 76  ? 16.850  -3.267  15.402  1.00 53.20 ? 71  ASP A CG   4  
ATOM 8517  O OD1  . ASP A 1 76  ? 17.351  -3.443  16.533  1.00 14.03 ? 71  ASP A OD1  4  
ATOM 8518  O OD2  . ASP A 1 76  ? 15.721  -2.764  15.223  1.00 63.14 ? 71  ASP A OD2  4  
ATOM 8519  H H    . ASP A 1 76  ? 19.075  -6.325  13.339  1.00 1.43  ? 71  ASP A H    4  
ATOM 8520  H HA   . ASP A 1 76  ? 17.316  -5.742  14.664  1.00 22.34 ? 71  ASP A HA   4  
ATOM 8521  H HB3  . ASP A 1 76  ? 17.397  -3.030  13.365  1.00 33.35 ? 71  ASP A HB3  4  
ATOM 8522  N N    . SER A 1 77  ? 15.959  -6.202  12.128  1.00 22.21 ? 72  SER A N    4  
ATOM 8523  C CA   . SER A 1 77  ? 14.750  -6.393  11.335  1.00 62.51 ? 72  SER A CA   4  
ATOM 8524  C C    . SER A 1 77  ? 14.385  -5.115  10.584  1.00 71.32 ? 72  SER A C    4  
ATOM 8525  O O    . SER A 1 77  ? 13.221  -4.883  10.259  1.00 30.01 ? 72  SER A O    4  
ATOM 8526  C CB   . SER A 1 77  ? 13.588  -6.819  12.234  1.00 32.05 ? 72  SER A CB   4  
ATOM 8527  O OG   . SER A 1 77  ? 13.944  -7.932  13.035  1.00 0.44  ? 72  SER A OG   4  
ATOM 8528  H H    . SER A 1 77  ? 16.717  -6.810  11.998  1.00 31.41 ? 72  SER A H    4  
ATOM 8529  H HA   . SER A 1 77  ? 14.944  -7.174  10.617  1.00 10.04 ? 72  SER A HA   4  
ATOM 8530  H HB3  . SER A 1 77  ? 12.741  -7.090  11.618  1.00 42.12 ? 72  SER A HB3  4  
ATOM 8531  H HG   . SER A 1 77  ? 13.178  -8.497  13.159  1.00 3.15  ? 72  SER A HG   4  
ATOM 8532  N N    . GLY A 1 78  ? 15.390  -4.287  10.314  1.00 42.50 ? 73  GLY A N    4  
ATOM 8533  C CA   . GLY A 1 78  ? 15.156  -3.044  9.604   1.00 62.30 ? 73  GLY A CA   4  
ATOM 8534  C C    . GLY A 1 78  ? 15.956  -2.949  8.320   1.00 34.22 ? 73  GLY A C    4  
ATOM 8535  O O    . GLY A 1 78  ? 16.203  -1.854  7.814   1.00 4.10  ? 73  GLY A O    4  
ATOM 8536  H H    . GLY A 1 78  ? 16.298  -4.525  10.598  1.00 24.13 ? 73  GLY A H    4  
ATOM 8537  H HA2  . GLY A 1 78  ? 14.105  -2.968  9.368   1.00 14.34 ? 73  GLY A HA2  4  
ATOM 8538  H HA3  . GLY A 1 78  ? 15.430  -2.220  10.247  1.00 23.34 ? 73  GLY A HA3  4  
ATOM 8539  N N    . PHE A 1 79  ? 16.363  -4.098  7.793   1.00 10.32 ? 74  PHE A N    4  
ATOM 8540  C CA   . PHE A 1 79  ? 17.143  -4.141  6.560   1.00 62.53 ? 74  PHE A CA   4  
ATOM 8541  C C    . PHE A 1 79  ? 16.279  -3.777  5.357   1.00 32.23 ? 74  PHE A C    4  
ATOM 8542  O O    . PHE A 1 79  ? 16.627  -2.896  4.570   1.00 74.13 ? 74  PHE A O    4  
ATOM 8543  C CB   . PHE A 1 79  ? 17.751  -5.531  6.365   1.00 44.31 ? 74  PHE A CB   4  
ATOM 8544  C CG   . PHE A 1 79  ? 19.232  -5.578  6.615   1.00 25.31 ? 74  PHE A CG   4  
ATOM 8545  C CD1  . PHE A 1 79  ? 20.087  -4.707  5.958   1.00 10.14 ? 74  PHE A CD1  4  
ATOM 8546  C CD2  . PHE A 1 79  ? 19.768  -6.492  7.507   1.00 41.53 ? 74  PHE A CD2  4  
ATOM 8547  C CE1  . PHE A 1 79  ? 21.449  -4.747  6.186   1.00 51.43 ? 74  PHE A CE1  4  
ATOM 8548  C CE2  . PHE A 1 79  ? 21.130  -6.537  7.739   1.00 71.24 ? 74  PHE A CE2  4  
ATOM 8549  C CZ   . PHE A 1 79  ? 21.972  -5.664  7.078   1.00 3.24  ? 74  PHE A CZ   4  
ATOM 8550  H H    . PHE A 1 79  ? 16.135  -4.938  8.243   1.00 10.44 ? 74  PHE A H    4  
ATOM 8551  H HA   . PHE A 1 79  ? 17.939  -3.417  6.648   1.00 31.01 ? 74  PHE A HA   4  
ATOM 8552  H HB3  . PHE A 1 79  ? 17.575  -5.853  5.350   1.00 44.21 ? 74  PHE A HB3  4  
ATOM 8553  H HD1  . PHE A 1 79  ? 19.679  -3.989  5.261   1.00 5.52  ? 74  PHE A HD1  4  
ATOM 8554  H HD2  . PHE A 1 79  ? 19.112  -7.176  8.024   1.00 62.41 ? 74  PHE A HD2  4  
ATOM 8555  H HE1  . PHE A 1 79  ? 22.104  -4.064  5.667   1.00 41.11 ? 74  PHE A HE1  4  
ATOM 8556  H HE2  . PHE A 1 79  ? 21.536  -7.255  8.436   1.00 62.22 ? 74  PHE A HE2  4  
ATOM 8557  H HZ   . PHE A 1 79  ? 23.037  -5.697  7.258   1.00 34.45 ? 74  PHE A HZ   4  
ATOM 8558  N N    . PHE A 1 80  ? 15.149  -4.463  5.219   1.00 15.44 ? 75  PHE A N    4  
ATOM 8559  C CA   . PHE A 1 80  ? 14.233  -4.215  4.111   1.00 51.43 ? 75  PHE A CA   4  
ATOM 8560  C C    . PHE A 1 80  ? 13.714  -2.781  4.146   1.00 33.32 ? 75  PHE A C    4  
ATOM 8561  O O    . PHE A 1 80  ? 14.215  -1.945  4.897   1.00 43.31 ? 75  PHE A O    4  
ATOM 8562  C CB   . PHE A 1 80  ? 13.061  -5.197  4.160   1.00 61.55 ? 75  PHE A CB   4  
ATOM 8563  C CG   . PHE A 1 80  ? 12.026  -4.843  5.189   1.00 64.42 ? 75  PHE A CG   4  
ATOM 8564  C CD1  . PHE A 1 80  ? 12.295  -4.986  6.541   1.00 22.04 ? 75  PHE A CD1  4  
ATOM 8565  C CD2  . PHE A 1 80  ? 10.783  -4.366  4.805   1.00 11.14 ? 75  PHE A CD2  4  
ATOM 8566  C CE1  . PHE A 1 80  ? 11.345  -4.661  7.490   1.00 23.40 ? 75  PHE A CE1  4  
ATOM 8567  C CE2  . PHE A 1 80  ? 9.828   -4.039  5.750   1.00 13.55 ? 75  PHE A CE2  4  
ATOM 8568  C CZ   . PHE A 1 80  ? 10.109  -4.187  7.094   1.00 40.34 ? 75  PHE A CZ   4  
ATOM 8569  H H    . PHE A 1 80  ? 14.924  -5.153  5.879   1.00 50.33 ? 75  PHE A H    4  
ATOM 8570  H HA   . PHE A 1 80  ? 14.779  -4.365  3.192   1.00 32.11 ? 75  PHE A HA   4  
ATOM 8571  H HB3  . PHE A 1 80  ? 13.436  -6.183  4.390   1.00 33.30 ? 75  PHE A HB3  4  
ATOM 8572  H HD1  . PHE A 1 80  ? 13.262  -5.357  6.852   1.00 5.53  ? 75  PHE A HD1  4  
ATOM 8573  H HD2  . PHE A 1 80  ? 10.561  -4.251  3.754   1.00 34.10 ? 75  PHE A HD2  4  
ATOM 8574  H HE1  . PHE A 1 80  ? 11.568  -4.778  8.540   1.00 2.30  ? 75  PHE A HE1  4  
ATOM 8575  H HE2  . PHE A 1 80  ? 8.863   -3.669  5.437   1.00 52.24 ? 75  PHE A HE2  4  
ATOM 8576  H HZ   . PHE A 1 80  ? 9.366   -3.932  7.834   1.00 54.33 ? 75  PHE A HZ   4  
ATOM 8577  N N    . SER A 1 81  ? 12.703  -2.504  3.327   1.00 51.24 ? 76  SER A N    4  
ATOM 8578  C CA   . SER A 1 81  ? 12.117  -1.171  3.261   1.00 10.21 ? 76  SER A CA   4  
ATOM 8579  C C    . SER A 1 81  ? 11.006  -1.118  2.216   1.00 73.04 ? 76  SER A C    4  
ATOM 8580  O O    . SER A 1 81  ? 10.745  -2.101  1.522   1.00 71.40 ? 76  SER A O    4  
ATOM 8581  C CB   . SER A 1 81  ? 13.192  -0.134  2.932   1.00 52.24 ? 76  SER A CB   4  
ATOM 8582  O OG   . SER A 1 81  ? 13.167  0.938   3.859   1.00 40.41 ? 76  SER A OG   4  
ATOM 8583  H H    . SER A 1 81  ? 12.346  -3.214  2.753   1.00 33.15 ? 76  SER A H    4  
ATOM 8584  H HA   . SER A 1 81  ? 11.695  -0.946  4.229   1.00 72.13 ? 76  SER A HA   4  
ATOM 8585  H HB3  . SER A 1 81  ? 13.018  0.259   1.940   1.00 62.43 ? 76  SER A HB3  4  
ATOM 8586  H HG   . SER A 1 81  ? 13.408  0.613   4.730   1.00 42.13 ? 76  SER A HG   4  
ATOM 8587  N N    . ILE A 1 82  ? 10.357  0.037   2.111   1.00 11.33 ? 77  ILE A N    4  
ATOM 8588  C CA   . ILE A 1 82  ? 9.275   0.220   1.151   1.00 14.22 ? 77  ILE A CA   4  
ATOM 8589  C C    . ILE A 1 82  ? 9.796   0.164   -0.281  1.00 40.11 ? 77  ILE A C    4  
ATOM 8590  O O    . ILE A 1 82  ? 9.075   -0.226  -1.199  1.00 42.53 ? 77  ILE A O    4  
ATOM 8591  C CB   . ILE A 1 82  ? 8.549   1.560   1.369   1.00 30.25 ? 77  ILE A CB   4  
ATOM 8592  C CG1  . ILE A 1 82  ? 7.621   1.470   2.582   1.00 32.20 ? 77  ILE A CG1  4  
ATOM 8593  C CG2  . ILE A 1 82  ? 7.766   1.947   0.123   1.00 75.41 ? 77  ILE A CG2  4  
ATOM 8594  C CD1  . ILE A 1 82  ? 6.420   0.577   2.360   1.00 72.14 ? 77  ILE A CD1  4  
ATOM 8595  H H    . ILE A 1 82  ? 10.611  0.783   2.692   1.00 44.13 ? 77  ILE A H    4  
ATOM 8596  H HA   . ILE A 1 82  ? 8.563   -0.581  1.295   1.00 41.13 ? 77  ILE A HA   4  
ATOM 8597  H HB   . ILE A 1 82  ? 9.292   2.321   1.549   1.00 25.23 ? 77  ILE A HB   4  
ATOM 8598  H HG13 . ILE A 1 82  ? 7.260   2.459   2.824   1.00 52.21 ? 77  ILE A HG13 4  
ATOM 8599  H HG21 . ILE A 1 82  ? 7.170   1.106   -0.202  1.00 62.12 ? 77  ILE A HG21 4  
ATOM 8600  H HG22 . ILE A 1 82  ? 7.117   2.779   0.351   1.00 64.54 ? 77  ILE A HG22 4  
ATOM 8601  H HG23 . ILE A 1 82  ? 8.451   2.228   -0.661  1.00 42.03 ? 77  ILE A HG23 4  
ATOM 8602  H HD11 . ILE A 1 82  ? 6.177   0.065   3.280   1.00 25.33 ? 77  ILE A HD11 4  
ATOM 8603  H HD12 . ILE A 1 82  ? 5.579   1.176   2.047   1.00 24.34 ? 77  ILE A HD12 4  
ATOM 8604  H HD13 . ILE A 1 82  ? 6.650   -0.150  1.594   1.00 74.30 ? 77  ILE A HD13 4  
ATOM 8605  N N    . GLN A 1 83  ? 11.054  0.555   -0.463  1.00 22.14 ? 78  GLN A N    4  
ATOM 8606  C CA   . GLN A 1 83  ? 11.671  0.549   -1.784  1.00 1.12  ? 78  GLN A CA   4  
ATOM 8607  C C    . GLN A 1 83  ? 11.690  -0.859  -2.369  1.00 20.35 ? 78  GLN A C    4  
ATOM 8608  O O    . GLN A 1 83  ? 11.297  -1.071  -3.517  1.00 72.22 ? 78  GLN A O    4  
ATOM 8609  C CB   . GLN A 1 83  ? 13.096  1.100   -1.706  1.00 3.04  ? 78  GLN A CB   4  
ATOM 8610  C CG   . GLN A 1 83  ? 13.198  2.418   -0.955  1.00 43.02 ? 78  GLN A CG   4  
ATOM 8611  C CD   . GLN A 1 83  ? 14.082  2.321   0.273   1.00 62.34 ? 78  GLN A CD   4  
ATOM 8612  O OE1  . GLN A 1 83  ? 15.262  1.985   0.178   1.00 53.21 ? 78  GLN A OE1  4  
ATOM 8613  N NE2  . GLN A 1 83  ? 13.514  2.618   1.436   1.00 74.32 ? 78  GLN A NE2  4  
ATOM 8614  H H    . GLN A 1 83  ? 11.577  0.856   0.308   1.00 2.24  ? 78  GLN A H    4  
ATOM 8615  H HA   . GLN A 1 83  ? 11.083  1.185   -2.429  1.00 73.33 ? 78  GLN A HA   4  
ATOM 8616  H HB3  . GLN A 1 83  ? 13.464  1.255   -2.709  1.00 4.44  ? 78  GLN A HB3  4  
ATOM 8617  H HG3  . GLN A 1 83  ? 12.208  2.719   -0.645  1.00 12.34 ? 78  GLN A HG3  4  
ATOM 8618  H HE21 . GLN A 1 83  ? 12.569  2.877   1.436   1.00 21.51 ? 78  GLN A HE21 4  
ATOM 8619  H HE22 . GLN A 1 83  ? 14.061  2.563   2.246   1.00 43.14 ? 78  GLN A HE22 4  
ATOM 8620  N N    . VAL A 1 84  ? 12.150  -1.820  -1.574  1.00 61.24 ? 79  VAL A N    4  
ATOM 8621  C CA   . VAL A 1 84  ? 12.219  -3.209  -2.012  1.00 25.13 ? 79  VAL A CA   4  
ATOM 8622  C C    . VAL A 1 84  ? 10.829  -3.828  -2.098  1.00 31.42 ? 79  VAL A C    4  
ATOM 8623  O O    . VAL A 1 84  ? 10.540  -4.606  -3.008  1.00 61.02 ? 79  VAL A O    4  
ATOM 8624  C CB   . VAL A 1 84  ? 13.089  -4.054  -1.063  1.00 31.34 ? 79  VAL A CB   4  
ATOM 8625  C CG1  . VAL A 1 84  ? 12.599  -3.921  0.370   1.00 53.11 ? 79  VAL A CG1  4  
ATOM 8626  C CG2  . VAL A 1 84  ? 13.093  -5.512  -1.501  1.00 65.31 ? 79  VAL A CG2  4  
ATOM 8627  H H    . VAL A 1 84  ? 12.448  -1.589  -0.669  1.00 64.11 ? 79  VAL A H    4  
ATOM 8628  H HA   . VAL A 1 84  ? 12.672  -3.227  -2.993  1.00 3.05  ? 79  VAL A HA   4  
ATOM 8629  H HB   . VAL A 1 84  ? 14.102  -3.684  -1.110  1.00 70.30 ? 79  VAL A HB   4  
ATOM 8630  H HG11 . VAL A 1 84  ? 12.688  -2.892  0.687   1.00 51.01 ? 79  VAL A HG11 4  
ATOM 8631  H HG12 . VAL A 1 84  ? 11.565  -4.228  0.428   1.00 14.10 ? 79  VAL A HG12 4  
ATOM 8632  H HG13 . VAL A 1 84  ? 13.198  -4.548  1.014   1.00 72.01 ? 79  VAL A HG13 4  
ATOM 8633  H HG21 . VAL A 1 84  ? 12.404  -6.072  -0.888  1.00 35.12 ? 79  VAL A HG21 4  
ATOM 8634  H HG22 . VAL A 1 84  ? 12.789  -5.577  -2.536  1.00 41.11 ? 79  VAL A HG22 4  
ATOM 8635  H HG23 . VAL A 1 84  ? 14.087  -5.918  -1.392  1.00 21.52 ? 79  VAL A HG23 4  
ATOM 8636  N N    . ILE A 1 85  ? 9.972   -3.478  -1.145  1.00 22.33 ? 80  ILE A N    4  
ATOM 8637  C CA   . ILE A 1 85  ? 8.611   -3.999  -1.114  1.00 72.52 ? 80  ILE A CA   4  
ATOM 8638  C C    . ILE A 1 85  ? 7.817   -3.537  -2.331  1.00 2.42  ? 80  ILE A C    4  
ATOM 8639  O O    . ILE A 1 85  ? 7.244   -4.350  -3.056  1.00 1.10  ? 80  ILE A O    4  
ATOM 8640  C CB   . ILE A 1 85  ? 7.870   -3.562  0.164   1.00 62.43 ? 80  ILE A CB   4  
ATOM 8641  C CG1  . ILE A 1 85  ? 8.482   -4.238  1.393   1.00 5.05  ? 80  ILE A CG1  4  
ATOM 8642  C CG2  . ILE A 1 85  ? 6.389   -3.888  0.055   1.00 32.53 ? 80  ILE A CG2  4  
ATOM 8643  C CD1  . ILE A 1 85  ? 8.303   -5.740  1.406   1.00 51.12 ? 80  ILE A CD1  4  
ATOM 8644  H H    . ILE A 1 85  ? 10.261  -2.855  -0.447  1.00 3.01  ? 80  ILE A H    4  
ATOM 8645  H HA   . ILE A 1 85  ? 8.667   -5.078  -1.122  1.00 65.55 ? 80  ILE A HA   4  
ATOM 8646  H HB   . ILE A 1 85  ? 7.972   -2.491  0.264   1.00 33.14 ? 80  ILE A HB   4  
ATOM 8647  H HG13 . ILE A 1 85  ? 8.018   -3.840  2.282   1.00 74.53 ? 80  ILE A HG13 4  
ATOM 8648  H HG21 . ILE A 1 85  ? 6.257   -4.757  -0.572  1.00 11.34 ? 80  ILE A HG21 4  
ATOM 8649  H HG22 . ILE A 1 85  ? 5.992   -4.092  1.039   1.00 52.20 ? 80  ILE A HG22 4  
ATOM 8650  H HG23 . ILE A 1 85  ? 5.864   -3.049  -0.377  1.00 40.31 ? 80  ILE A HG23 4  
ATOM 8651  H HD11 . ILE A 1 85  ? 7.257   -5.979  1.287   1.00 11.44 ? 80  ILE A HD11 4  
ATOM 8652  H HD12 . ILE A 1 85  ? 8.869   -6.178  0.598   1.00 31.03 ? 80  ILE A HD12 4  
ATOM 8653  H HD13 . ILE A 1 85  ? 8.656   -6.136  2.348   1.00 24.21 ? 80  ILE A HD13 4  
ATOM 8654  N N    . SER A 1 86  ? 7.790   -2.226  -2.551  1.00 72.11 ? 81  SER A N    4  
ATOM 8655  C CA   . SER A 1 86  ? 7.066   -1.656  -3.680  1.00 30.51 ? 81  SER A CA   4  
ATOM 8656  C C    . SER A 1 86  ? 7.669   -2.118  -5.003  1.00 23.11 ? 81  SER A C    4  
ATOM 8657  O O    . SER A 1 86  ? 6.952   -2.391  -5.964  1.00 34.53 ? 81  SER A O    4  
ATOM 8658  C CB   . SER A 1 86  ? 7.083   -0.128  -3.605  1.00 21.12 ? 81  SER A CB   4  
ATOM 8659  O OG   . SER A 1 86  ? 6.732   0.449   -4.852  1.00 74.14 ? 81  SER A OG   4  
ATOM 8660  H H    . SER A 1 86  ? 8.267   -1.629  -1.937  1.00 22.23 ? 81  SER A H    4  
ATOM 8661  H HA   . SER A 1 86  ? 6.043   -1.999  -3.626  1.00 61.40 ? 81  SER A HA   4  
ATOM 8662  H HB3  . SER A 1 86  ? 8.074   0.205   -3.333  1.00 10.11 ? 81  SER A HB3  4  
ATOM 8663  H HG   . SER A 1 86  ? 7.178   1.293   -4.950  1.00 44.24 ? 81  SER A HG   4  
ATOM 8664  N N    . ASN A 1 87  ? 8.995   -2.203  -5.043  1.00 71.33 ? 82  ASN A N    4  
ATOM 8665  C CA   . ASN A 1 87  ? 9.697   -2.631  -6.247  1.00 51.54 ? 82  ASN A CA   4  
ATOM 8666  C C    . ASN A 1 87  ? 9.271   -4.038  -6.654  1.00 21.45 ? 82  ASN A C    4  
ATOM 8667  O O    . ASN A 1 87  ? 8.951   -4.289  -7.815  1.00 4.24  ? 82  ASN A O    4  
ATOM 8668  C CB   . ASN A 1 87  ? 11.210  -2.589  -6.023  1.00 53.42 ? 82  ASN A CB   4  
ATOM 8669  C CG   . ASN A 1 87  ? 11.981  -3.227  -7.162  1.00 3.31  ? 82  ASN A CG   4  
ATOM 8670  O OD1  . ASN A 1 87  ? 12.430  -2.543  -8.082  1.00 5.10  ? 82  ASN A OD1  4  
ATOM 8671  N ND2  . ASN A 1 87  ? 12.140  -4.544  -7.106  1.00 22.12 ? 82  ASN A ND2  4  
ATOM 8672  H H    . ASN A 1 87  ? 9.514   -1.971  -4.244  1.00 12.12 ? 82  ASN A H    4  
ATOM 8673  H HA   . ASN A 1 87  ? 9.442   -1.946  -7.041  1.00 3.14  ? 82  ASN A HA   4  
ATOM 8674  H HB3  . ASN A 1 87  ? 11.448  -3.118  -5.111  1.00 42.01 ? 82  ASN A HB3  4  
ATOM 8675  H HD21 . ASN A 1 87  ? 11.754  -5.025  -6.343  1.00 43.34 ? 82  ASN A HD21 4  
ATOM 8676  H HD22 . ASN A 1 87  ? 12.635  -4.982  -7.830  1.00 62.44 ? 82  ASN A HD22 4  
ATOM 8677  N N    . ALA A 1 88  ? 9.268   -4.953  -5.690  1.00 25.41 ? 83  ALA A N    4  
ATOM 8678  C CA   . ALA A 1 88  ? 8.878   -6.333  -5.947  1.00 63.13 ? 83  ALA A CA   4  
ATOM 8679  C C    . ALA A 1 88  ? 7.428   -6.417  -6.409  1.00 21.52 ? 83  ALA A C    4  
ATOM 8680  O O    . ALA A 1 88  ? 7.103   -7.155  -7.341  1.00 44.01 ? 83  ALA A O    4  
ATOM 8681  C CB   . ALA A 1 88  ? 9.087   -7.181  -4.700  1.00 4.44  ? 83  ALA A CB   4  
ATOM 8682  H H    . ALA A 1 88  ? 9.533   -4.691  -4.783  1.00 4.21  ? 83  ALA A H    4  
ATOM 8683  H HA   . ALA A 1 88  ? 9.517   -6.720  -6.728  1.00 15.02 ? 83  ALA A HA   4  
ATOM 8684  H HB1  . ALA A 1 88  ? 9.052   -8.227  -4.969  1.00 51.21 ? 83  ALA A HB1  4  
ATOM 8685  H HB2  . ALA A 1 88  ? 10.050  -6.952  -4.267  1.00 30.43 ? 83  ALA A HB2  4  
ATOM 8686  H HB3  . ALA A 1 88  ? 8.309   -6.966  -3.985  1.00 73.45 ? 83  ALA A HB3  4  
ATOM 8687  N N    . LEU A 1 89  ? 6.557   -5.658  -5.751  1.00 3.43  ? 84  LEU A N    4  
ATOM 8688  C CA   . LEU A 1 89  ? 5.140   -5.647  -6.095  1.00 25.01 ? 84  LEU A CA   4  
ATOM 8689  C C    . LEU A 1 89  ? 4.921   -5.066  -7.488  1.00 10.13 ? 84  LEU A C    4  
ATOM 8690  O O    . LEU A 1 89  ? 4.175   -5.623  -8.294  1.00 5.53  ? 84  LEU A O    4  
ATOM 8691  C CB   . LEU A 1 89  ? 4.352   -4.837  -5.064  1.00 32.15 ? 84  LEU A CB   4  
ATOM 8692  C CG   . LEU A 1 89  ? 4.207   -5.473  -3.680  1.00 64.04 ? 84  LEU A CG   4  
ATOM 8693  C CD1  . LEU A 1 89  ? 4.001   -4.402  -2.621  1.00 61.15 ? 84  LEU A CD1  4  
ATOM 8694  C CD2  . LEU A 1 89  ? 3.055   -6.466  -3.667  1.00 55.20 ? 84  LEU A CD2  4  
ATOM 8695  H H    . LEU A 1 89  ? 6.875   -5.091  -5.019  1.00 72.22 ? 84  LEU A H    4  
ATOM 8696  H HA   . LEU A 1 89  ? 4.789   -6.668  -6.084  1.00 31.43 ? 84  LEU A HA   4  
ATOM 8697  H HB3  . LEU A 1 89  ? 3.359   -4.676  -5.460  1.00 23.43 ? 84  LEU A HB3  4  
ATOM 8698  H HG   . LEU A 1 89  ? 5.115   -6.008  -3.440  1.00 1.32  ? 84  LEU A HG   4  
ATOM 8699  H HD11 . LEU A 1 89  ? 4.205   -3.431  -3.045  1.00 3.31  ? 84  LEU A HD11 4  
ATOM 8700  H HD12 . LEU A 1 89  ? 4.672   -4.580  -1.793  1.00 75.01 ? 84  LEU A HD12 4  
ATOM 8701  H HD13 . LEU A 1 89  ? 2.980   -4.434  -2.270  1.00 74.22 ? 84  LEU A HD13 4  
ATOM 8702  H HD21 . LEU A 1 89  ? 2.431   -6.282  -2.805  1.00 1.53  ? 84  LEU A HD21 4  
ATOM 8703  H HD22 . LEU A 1 89  ? 3.448   -7.472  -3.617  1.00 0.45  ? 84  LEU A HD22 4  
ATOM 8704  H HD23 . LEU A 1 89  ? 2.471   -6.352  -4.568  1.00 33.30 ? 84  LEU A HD23 4  
ATOM 8705  N N    . LYS A 1 90  ? 5.578   -3.945  -7.766  1.00 12.13 ? 85  LYS A N    4  
ATOM 8706  C CA   . LYS A 1 90  ? 5.460   -3.290  -9.064  1.00 34.22 ? 85  LYS A CA   4  
ATOM 8707  C C    . LYS A 1 90  ? 5.856   -4.239  -10.190 1.00 23.25 ? 85  LYS A C    4  
ATOM 8708  O O    . LYS A 1 90  ? 5.188   -4.305  -11.223 1.00 13.13 ? 85  LYS A O    4  
ATOM 8709  C CB   . LYS A 1 90  ? 6.335   -2.036  -9.107  1.00 52.42 ? 85  LYS A CB   4  
ATOM 8710  C CG   . LYS A 1 90  ? 6.445   -1.418  -10.489 1.00 44.50 ? 85  LYS A CG   4  
ATOM 8711  C CD   . LYS A 1 90  ? 7.126   -0.061  -10.441 1.00 43.24 ? 85  LYS A CD   4  
ATOM 8712  C CE   . LYS A 1 90  ? 8.582   -0.152  -10.872 1.00 1.04  ? 85  LYS A CE   4  
ATOM 8713  N NZ   . LYS A 1 90  ? 9.257   1.175   -10.831 1.00 64.22 ? 85  LYS A NZ   4  
ATOM 8714  H H    . LYS A 1 90  ? 6.157   -3.549  -7.082  1.00 41.45 ? 85  LYS A H    4  
ATOM 8715  H HA   . LYS A 1 90  ? 4.428   -3.002  -9.197  1.00 14.20 ? 85  LYS A HA   4  
ATOM 8716  H HB3  . LYS A 1 90  ? 7.330   -2.295  -8.771  1.00 3.01  ? 85  LYS A HB3  4  
ATOM 8717  H HG3  . LYS A 1 90  ? 5.452   -1.298  -10.899 1.00 4.33  ? 85  LYS A HG3  4  
ATOM 8718  H HD3  . LYS A 1 90  ? 7.083   0.318   -9.430  1.00 62.22 ? 85  LYS A HD3  4  
ATOM 8719  H HE3  . LYS A 1 90  ? 8.621   -0.534  -11.882 1.00 53.03 ? 85  LYS A HE3  4  
ATOM 8720  H HZ1  . LYS A 1 90  ? 8.630   1.881   -10.394 1.00 53.34 ? 85  LYS A HZ1  4  
ATOM 8721  H HZ2  . LYS A 1 90  ? 9.493   1.487   -11.794 1.00 14.54 ? 85  LYS A HZ2  4  
ATOM 8722  H HZ3  . LYS A 1 90  ? 10.134  1.113   -10.275 1.00 74.52 ? 85  LYS A HZ3  4  
ATOM 8723  N N    . VAL A 1 91  ? 6.945   -4.972  -9.985  1.00 21.00 ? 86  VAL A N    4  
ATOM 8724  C CA   . VAL A 1 91  ? 7.428   -5.919  -10.983 1.00 4.21  ? 86  VAL A CA   4  
ATOM 8725  C C    . VAL A 1 91  ? 6.355   -6.944  -11.334 1.00 63.45 ? 86  VAL A C    4  
ATOM 8726  O O    . VAL A 1 91  ? 6.328   -7.472  -12.445 1.00 54.31 ? 86  VAL A O    4  
ATOM 8727  C CB   . VAL A 1 91  ? 8.687   -6.658  -10.492 1.00 43.21 ? 86  VAL A CB   4  
ATOM 8728  C CG1  . VAL A 1 91  ? 9.130   -7.696  -11.512 1.00 62.31 ? 86  VAL A CG1  4  
ATOM 8729  C CG2  . VAL A 1 91  ? 9.808   -5.670  -10.206 1.00 61.40 ? 86  VAL A CG2  4  
ATOM 8730  H H    . VAL A 1 91  ? 7.435   -4.874  -9.142  1.00 2.34  ? 86  VAL A H    4  
ATOM 8731  H HA   . VAL A 1 91  ? 7.687   -5.363  -11.873 1.00 41.22 ? 86  VAL A HA   4  
ATOM 8732  H HB   . VAL A 1 91  ? 8.444   -7.170  -9.572  1.00 11.24 ? 86  VAL A HB   4  
ATOM 8733  H HG11 . VAL A 1 91  ? 8.525   -8.585  -11.406 1.00 62.33 ? 86  VAL A HG11 4  
ATOM 8734  H HG12 . VAL A 1 91  ? 9.011   -7.295  -12.509 1.00 53.03 ? 86  VAL A HG12 4  
ATOM 8735  H HG13 . VAL A 1 91  ? 10.167  -7.945  -11.345 1.00 54.30 ? 86  VAL A HG13 4  
ATOM 8736  H HG21 . VAL A 1 91  ? 10.596  -5.798  -10.933 1.00 34.04 ? 86  VAL A HG21 4  
ATOM 8737  H HG22 . VAL A 1 91  ? 9.423   -4.661  -10.267 1.00 41.43 ? 86  VAL A HG22 4  
ATOM 8738  H HG23 . VAL A 1 91  ? 10.199  -5.846  -9.215  1.00 24.20 ? 86  VAL A HG23 4  
ATOM 8739  N N    . TRP A 1 92  ? 5.474   -7.218  -10.379 1.00 14.25 ? 87  TRP A N    4  
ATOM 8740  C CA   . TRP A 1 92  ? 4.397   -8.180  -10.588 1.00 73.11 ? 87  TRP A CA   4  
ATOM 8741  C C    . TRP A 1 92  ? 3.141   -7.487  -11.106 1.00 52.44 ? 87  TRP A C    4  
ATOM 8742  O O    . TRP A 1 92  ? 2.279   -8.119  -11.715 1.00 70.14 ? 87  TRP A O    4  
ATOM 8743  C CB   . TRP A 1 92  ? 4.086   -8.919  -9.286  1.00 72.15 ? 87  TRP A CB   4  
ATOM 8744  C CG   . TRP A 1 92  ? 5.309   -9.444  -8.594  1.00 33.42 ? 87  TRP A CG   4  
ATOM 8745  C CD1  . TRP A 1 92  ? 6.449   -9.907  -9.185  1.00 13.20 ? 87  TRP A CD1  4  
ATOM 8746  C CD2  . TRP A 1 92  ? 5.511   -9.560  -7.182  1.00 73.15 ? 87  TRP A CD2  4  
ATOM 8747  N NE1  . TRP A 1 92  ? 7.349   -10.304 -8.226  1.00 35.30 ? 87  TRP A NE1  4  
ATOM 8748  C CE2  . TRP A 1 92  ? 6.797   -10.102 -6.988  1.00 63.42 ? 87  TRP A CE2  4  
ATOM 8749  C CE3  . TRP A 1 92  ? 4.731   -9.258  -6.061  1.00 52.42 ? 87  TRP A CE3  4  
ATOM 8750  C CZ2  . TRP A 1 92  ? 7.317   -10.347 -5.721  1.00 50.25 ? 87  TRP A CZ2  4  
ATOM 8751  C CZ3  . TRP A 1 92  ? 5.250   -9.503  -4.804  1.00 20.20 ? 87  TRP A CZ3  4  
ATOM 8752  C CH2  . TRP A 1 92  ? 6.533   -10.042 -4.642  1.00 15.21 ? 87  TRP A CH2  4  
ATOM 8753  H H    . TRP A 1 92  ? 5.548   -6.764  -9.514  1.00 2.10  ? 87  TRP A H    4  
ATOM 8754  H HA   . TRP A 1 92  ? 4.730   -8.895  -11.326 1.00 61.32 ? 87  TRP A HA   4  
ATOM 8755  H HB3  . TRP A 1 92  ? 3.439   -9.756  -9.501  1.00 42.31 ? 87  TRP A HB3  4  
ATOM 8756  H HD1  . TRP A 1 92  ? 6.606   -9.950  -10.253 1.00 74.24 ? 87  TRP A HD1  4  
ATOM 8757  H HE1  . TRP A 1 92  ? 8.240   -10.673 -8.400  1.00 71.43 ? 87  TRP A HE1  4  
ATOM 8758  H HE3  . TRP A 1 92  ? 3.741   -8.842  -6.166  1.00 14.15 ? 87  TRP A HE3  4  
ATOM 8759  H HZ2  . TRP A 1 92  ? 8.306   -10.762 -5.579  1.00 24.52 ? 87  TRP A HZ2  4  
ATOM 8760  H HZ3  . TRP A 1 92  ? 4.663   -9.277  -3.927  1.00 32.22 ? 87  TRP A HZ3  4  
ATOM 8761  H HH2  . TRP A 1 92  ? 6.898   -10.217 -3.641  1.00 74.31 ? 87  TRP A HH2  4  
ATOM 8762  N N    . GLY A 1 93  ? 3.045   -6.184  -10.860 1.00 52.41 ? 88  GLY A N    4  
ATOM 8763  C CA   . GLY A 1 93  ? 1.890   -5.428  -11.309 1.00 72.24 ? 88  GLY A CA   4  
ATOM 8764  C C    . GLY A 1 93  ? 1.103   -4.835  -10.157 1.00 23.45 ? 88  GLY A C    4  
ATOM 8765  O O    . GLY A 1 93  ? 0.093   -4.161  -10.368 1.00 41.22 ? 88  GLY A O    4  
ATOM 8766  H H    . GLY A 1 93  ? 3.764   -5.733  -10.369 1.00 22.02 ? 88  GLY A H    4  
ATOM 8767  H HA2  . GLY A 1 93  ? 2.226   -4.628  -11.952 1.00 12.22 ? 88  GLY A HA2  4  
ATOM 8768  H HA3  . GLY A 1 93  ? 1.242   -6.083  -11.872 1.00 40.50 ? 88  GLY A HA3  4  
ATOM 8769  N N    . LEU A 1 94  ? 1.563   -5.086  -8.937  1.00 73.54 ? 89  LEU A N    4  
ATOM 8770  C CA   . LEU A 1 94  ? 0.893   -4.572  -7.747  1.00 72.25 ? 89  LEU A CA   4  
ATOM 8771  C C    . LEU A 1 94  ? 1.461   -3.215  -7.345  1.00 24.45 ? 89  LEU A C    4  
ATOM 8772  O O    . LEU A 1 94  ? 2.676   -3.026  -7.310  1.00 62.31 ? 89  LEU A O    4  
ATOM 8773  C CB   . LEU A 1 94  ? 1.039   -5.561  -6.589  1.00 42.24 ? 89  LEU A CB   4  
ATOM 8774  C CG   . LEU A 1 94  ? 0.201   -6.837  -6.686  1.00 72.34 ? 89  LEU A CG   4  
ATOM 8775  C CD1  . LEU A 1 94  ? 1.099   -8.064  -6.716  1.00 21.11 ? 89  LEU A CD1  4  
ATOM 8776  C CD2  . LEU A 1 94  ? -0.780  -6.920  -5.526  1.00 54.04 ? 89  LEU A CD2  4  
ATOM 8777  H H    . LEU A 1 94  ? 2.372   -5.628  -8.832  1.00 34.42 ? 89  LEU A H    4  
ATOM 8778  H HA   . LEU A 1 94  ? -0.155  -4.456  -7.980  1.00 53.22 ? 89  LEU A HA   4  
ATOM 8779  H HB3  . LEU A 1 94  ? 0.759   -5.049  -5.679  1.00 42.13 ? 89  LEU A HB3  4  
ATOM 8780  H HG   . LEU A 1 94  ? -0.367  -6.817  -7.605  1.00 40.11 ? 89  LEU A HG   4  
ATOM 8781  H HD11 . LEU A 1 94  ? 0.597   -8.864  -7.239  1.00 53.22 ? 89  LEU A HD11 4  
ATOM 8782  H HD12 . LEU A 1 94  ? 1.317   -8.375  -5.705  1.00 54.13 ? 89  LEU A HD12 4  
ATOM 8783  H HD13 . LEU A 1 94  ? 2.021   -7.823  -7.224  1.00 23.00 ? 89  LEU A HD13 4  
ATOM 8784  H HD21 . LEU A 1 94  ? -0.257  -6.740  -4.598  1.00 11.23 ? 89  LEU A HD21 4  
ATOM 8785  H HD22 . LEU A 1 94  ? -1.227  -7.903  -5.502  1.00 2.40  ? 89  LEU A HD22 4  
ATOM 8786  H HD23 . LEU A 1 94  ? -1.552  -6.177  -5.654  1.00 22.43 ? 89  LEU A HD23 4  
ATOM 8787  N N    . GLU A 1 95  ? 0.573   -2.273  -7.042  1.00 34.33 ? 90  GLU A N    4  
ATOM 8788  C CA   . GLU A 1 95  ? 0.986   -0.934  -6.641  1.00 41.15 ? 90  GLU A CA   4  
ATOM 8789  C C    . GLU A 1 95  ? 0.433   -0.583  -5.263  1.00 23.50 ? 90  GLU A C    4  
ATOM 8790  O O    . GLU A 1 95  ? -0.639  -1.048  -4.874  1.00 62.11 ? 90  GLU A O    4  
ATOM 8791  C CB   . GLU A 1 95  ? 0.517   0.098   -7.669  1.00 10.33 ? 90  GLU A CB   4  
ATOM 8792  C CG   . GLU A 1 95  ? -0.995  0.223   -7.759  1.00 30.14 ? 90  GLU A CG   4  
ATOM 8793  C CD   . GLU A 1 95  ? -1.538  -0.225  -9.102  1.00 30.33 ? 90  GLU A CD   4  
ATOM 8794  O OE1  . GLU A 1 95  ? -1.572  -1.448  -9.350  1.00 31.22 ? 90  GLU A OE1  4  
ATOM 8795  O OE2  . GLU A 1 95  ? -1.931  0.648   -9.904  1.00 21.11 ? 90  GLU A OE2  4  
ATOM 8796  H H    . GLU A 1 95  ? -0.384  -2.484  -7.088  1.00 52.40 ? 90  GLU A H    4  
ATOM 8797  H HA   . GLU A 1 95  ? 2.065   -0.919  -6.596  1.00 2.34  ? 90  GLU A HA   4  
ATOM 8798  H HB3  . GLU A 1 95  ? 0.892   -0.186  -8.642  1.00 70.54 ? 90  GLU A HB3  4  
ATOM 8799  H HG3  . GLU A 1 95  ? -1.268  1.256   -7.603  1.00 1.23  ? 90  GLU A HG3  4  
ATOM 8800  N N    . LEU A 1 96  ? 1.173   0.241   -4.528  1.00 33.55 ? 91  LEU A N    4  
ATOM 8801  C CA   . LEU A 1 96  ? 0.757   0.655   -3.192  1.00 75.21 ? 91  LEU A CA   4  
ATOM 8802  C C    . LEU A 1 96  ? 0.477   2.154   -3.148  1.00 44.31 ? 91  LEU A C    4  
ATOM 8803  O O    . LEU A 1 96  ? 1.106   2.933   -3.865  1.00 45.05 ? 91  LEU A O    4  
ATOM 8804  C CB   . LEU A 1 96  ? 1.834   0.295   -2.168  1.00 70.35 ? 91  LEU A CB   4  
ATOM 8805  C CG   . LEU A 1 96  ? 2.625   -0.983  -2.445  1.00 71.02 ? 91  LEU A CG   4  
ATOM 8806  C CD1  . LEU A 1 96  ? 3.680   -1.202  -1.372  1.00 53.03 ? 91  LEU A CD1  4  
ATOM 8807  C CD2  . LEU A 1 96  ? 1.690   -2.180  -2.530  1.00 13.42 ? 91  LEU A CD2  4  
ATOM 8808  H H    . LEU A 1 96  ? 2.017   0.579   -4.890  1.00 11.13 ? 91  LEU A H    4  
ATOM 8809  H HA   . LEU A 1 96  ? -0.152  0.125   -2.947  1.00 2.42  ? 91  LEU A HA   4  
ATOM 8810  H HB3  . LEU A 1 96  ? 1.352   0.186   -1.206  1.00 55.44 ? 91  LEU A HB3  4  
ATOM 8811  H HG   . LEU A 1 96  ? 3.132   -0.886  -3.395  1.00 43.22 ? 91  LEU A HG   4  
ATOM 8812  H HD11 . LEU A 1 96  ? 4.583   -1.580  -1.827  1.00 75.14 ? 91  LEU A HD11 4  
ATOM 8813  H HD12 . LEU A 1 96  ? 3.315   -1.917  -0.649  1.00 35.43 ? 91  LEU A HD12 4  
ATOM 8814  H HD13 . LEU A 1 96  ? 3.890   -0.266  -0.877  1.00 64.44 ? 91  LEU A HD13 4  
ATOM 8815  H HD21 . LEU A 1 96  ? 0.666   -1.840  -2.499  1.00 44.22 ? 91  LEU A HD21 4  
ATOM 8816  H HD22 . LEU A 1 96  ? 1.875   -2.841  -1.695  1.00 71.33 ? 91  LEU A HD22 4  
ATOM 8817  H HD23 . LEU A 1 96  ? 1.867   -2.710  -3.454  1.00 31.11 ? 91  LEU A HD23 4  
ATOM 8818  N N    . ILE A 1 97  ? -0.467  2.550   -2.303  1.00 35.44 ? 92  ILE A N    4  
ATOM 8819  C CA   . ILE A 1 97  ? -0.827  3.956   -2.165  1.00 33.32 ? 92  ILE A CA   4  
ATOM 8820  C C    . ILE A 1 97  ? -0.967  4.345   -0.697  1.00 61.52 ? 92  ILE A C    4  
ATOM 8821  O O    . ILE A 1 97  ? -1.344  3.525   0.142   1.00 30.10 ? 92  ILE A O    4  
ATOM 8822  C CB   . ILE A 1 97  ? -2.145  4.275   -2.896  1.00 52.34 ? 92  ILE A CB   4  
ATOM 8823  C CG1  . ILE A 1 97  ? -2.145  3.644   -4.290  1.00 60.32 ? 92  ILE A CG1  4  
ATOM 8824  C CG2  . ILE A 1 97  ? -2.348  5.780   -2.990  1.00 14.50 ? 92  ILE A CG2  4  
ATOM 8825  C CD1  . ILE A 1 97  ? -3.410  3.912   -5.074  1.00 11.43 ? 92  ILE A CD1  4  
ATOM 8826  H H    . ILE A 1 97  ? -0.933  1.882   -1.759  1.00 34.14 ? 92  ILE A H    4  
ATOM 8827  H HA   . ILE A 1 97  ? -0.040  4.546   -2.609  1.00 62.21 ? 92  ILE A HA   4  
ATOM 8828  H HB   . ILE A 1 97  ? -2.959  3.860   -2.322  1.00 60.32 ? 92  ILE A HB   4  
ATOM 8829  H HG13 . ILE A 1 97  ? -2.034  2.574   -4.192  1.00 14.54 ? 92  ILE A HG13 4  
ATOM 8830  H HG21 . ILE A 1 97  ? -2.410  6.197   -1.995  1.00 10.32 ? 92  ILE A HG21 4  
ATOM 8831  H HG22 . ILE A 1 97  ? -1.514  6.223   -3.514  1.00 53.24 ? 92  ILE A HG22 4  
ATOM 8832  H HG23 . ILE A 1 97  ? -3.262  5.987   -3.526  1.00 74.11 ? 92  ILE A HG23 4  
ATOM 8833  H HD11 . ILE A 1 97  ? -3.489  4.968   -5.282  1.00 1.32  ? 92  ILE A HD11 4  
ATOM 8834  H HD12 . ILE A 1 97  ? -3.382  3.362   -6.003  1.00 12.34 ? 92  ILE A HD12 4  
ATOM 8835  H HD13 . ILE A 1 97  ? -4.266  3.594   -4.496  1.00 73.10 ? 92  ILE A HD13 4  
ATOM 8836  N N    . LEU A 1 98  ? -0.664  5.602   -0.393  1.00 54.23 ? 93  LEU A N    4  
ATOM 8837  C CA   . LEU A 1 98  ? -0.757  6.103   0.975   1.00 13.24 ? 93  LEU A CA   4  
ATOM 8838  C C    . LEU A 1 98  ? -2.162  6.617   1.271   1.00 75.31 ? 93  LEU A C    4  
ATOM 8839  O O    . LEU A 1 98  ? -2.633  7.565   0.642   1.00 1.10  ? 93  LEU A O    4  
ATOM 8840  C CB   . LEU A 1 98  ? 0.266   7.217   1.202   1.00 13.24 ? 93  LEU A CB   4  
ATOM 8841  C CG   . LEU A 1 98  ? 0.149   7.976   2.524   1.00 13.13 ? 93  LEU A CG   4  
ATOM 8842  C CD1  . LEU A 1 98  ? 0.152   7.008   3.698   1.00 22.42 ? 93  LEU A CD1  4  
ATOM 8843  C CD2  . LEU A 1 98  ? 1.278   8.986   2.661   1.00 51.30 ? 93  LEU A CD2  4  
ATOM 8844  H H    . LEU A 1 98  ? -0.369  6.208   -1.103  1.00 20.30 ? 93  LEU A H    4  
ATOM 8845  H HA   . LEU A 1 98  ? -0.539  5.283   1.643   1.00 73.32 ? 93  LEU A HA   4  
ATOM 8846  H HB3  . LEU A 1 98  ? 0.159   7.931   0.398   1.00 60.21 ? 93  LEU A HB3  4  
ATOM 8847  H HG   . LEU A 1 98  ? -0.788  8.516   2.540   1.00 61.14 ? 93  LEU A HG   4  
ATOM 8848  H HD11 . LEU A 1 98  ? -0.797  6.496   3.744   1.00 12.31 ? 93  LEU A HD11 4  
ATOM 8849  H HD12 . LEU A 1 98  ? 0.311   7.555   4.615   1.00 1.14  ? 93  LEU A HD12 4  
ATOM 8850  H HD13 . LEU A 1 98  ? 0.946   6.287   3.567   1.00 33.22 ? 93  LEU A HD13 4  
ATOM 8851  H HD21 . LEU A 1 98  ? 2.186   8.568   2.251   1.00 25.03 ? 93  LEU A HD21 4  
ATOM 8852  H HD22 . LEU A 1 98  ? 1.428   9.218   3.706   1.00 44.32 ? 93  LEU A HD22 4  
ATOM 8853  H HD23 . LEU A 1 98  ? 1.022   9.888   2.125   1.00 0.53  ? 93  LEU A HD23 4  
ATOM 8854  N N    . PHE A 1 99  ? -2.826  5.988   2.235   1.00 1.14  ? 94  PHE A N    4  
ATOM 8855  C CA   . PHE A 1 99  ? -4.177  6.383   2.616   1.00 73.22 ? 94  PHE A CA   4  
ATOM 8856  C C    . PHE A 1 99  ? -4.212  7.844   3.057   1.00 52.21 ? 94  PHE A C    4  
ATOM 8857  O O    . PHE A 1 99  ? -5.250  8.500   2.986   1.00 12.31 ? 94  PHE A O    4  
ATOM 8858  C CB   . PHE A 1 99  ? -4.695  5.486   3.743   1.00 11.44 ? 94  PHE A CB   4  
ATOM 8859  C CG   . PHE A 1 99  ? -5.494  6.225   4.778   1.00 0.21  ? 94  PHE A CG   4  
ATOM 8860  C CD1  . PHE A 1 99  ? -6.807  6.589   4.529   1.00 23.31 ? 94  PHE A CD1  4  
ATOM 8861  C CD2  . PHE A 1 99  ? -4.931  6.554   6.001   1.00 13.45 ? 94  PHE A CD2  4  
ATOM 8862  C CE1  . PHE A 1 99  ? -7.545  7.269   5.479   1.00 32.52 ? 94  PHE A CE1  4  
ATOM 8863  C CE2  . PHE A 1 99  ? -5.665  7.232   6.955   1.00 63.55 ? 94  PHE A CE2  4  
ATOM 8864  C CZ   . PHE A 1 99  ? -6.973  7.591   6.694   1.00 65.21 ? 94  PHE A CZ   4  
ATOM 8865  H H    . PHE A 1 99  ? -2.398  5.239   2.700   1.00 73.21 ? 94  PHE A H    4  
ATOM 8866  H HA   . PHE A 1 99  ? -4.812  6.266   1.753   1.00 2.44  ? 94  PHE A HA   4  
ATOM 8867  H HB3  . PHE A 1 99  ? -3.856  5.022   4.237   1.00 12.14 ? 94  PHE A HB3  4  
ATOM 8868  H HD1  . PHE A 1 99  ? -7.257  6.338   3.578   1.00 44.44 ? 94  PHE A HD1  4  
ATOM 8869  H HD2  . PHE A 1 99  ? -3.908  6.275   6.206   1.00 35.21 ? 94  PHE A HD2  4  
ATOM 8870  H HE1  . PHE A 1 99  ? -8.567  7.548   5.271   1.00 74.44 ? 94  PHE A HE1  4  
ATOM 8871  H HE2  . PHE A 1 99  ? -5.215  7.484   7.904   1.00 62.34 ? 94  PHE A HE2  4  
ATOM 8872  H HZ   . PHE A 1 99  ? -7.548  8.122   7.439   1.00 11.10 ? 94  PHE A HZ   4  
ATOM 8873  N N    . ASN A 1 100 ? -3.069  8.345   3.515   1.00 22.14 ? 95  ASN A N    4  
ATOM 8874  C CA   . ASN A 1 100 ? -2.969  9.727   3.970   1.00 1.51  ? 95  ASN A CA   4  
ATOM 8875  C C    . ASN A 1 100 ? -2.793  10.676  2.788   1.00 65.02 ? 95  ASN A C    4  
ATOM 8876  O O    . ASN A 1 100 ? -2.946  11.890  2.926   1.00 12.11 ? 95  ASN A O    4  
ATOM 8877  C CB   . ASN A 1 100 ? -1.798  9.882   4.942   1.00 3.32  ? 95  ASN A CB   4  
ATOM 8878  C CG   . ASN A 1 100 ? -2.256  10.017  6.381   1.00 72.32 ? 95  ASN A CG   4  
ATOM 8879  O OD1  . ASN A 1 100 ? -2.988  10.944  6.727   1.00 2.10  ? 95  ASN A OD1  4  
ATOM 8880  N ND2  . ASN A 1 100 ? -1.825  9.090   7.228   1.00 74.45 ? 95  ASN A ND2  4  
ATOM 8881  H H    . ASN A 1 100 ? -2.275  7.772   3.548   1.00 15.05 ? 95  ASN A H    4  
ATOM 8882  H HA   . ASN A 1 100 ? -3.886  9.974   4.482   1.00 62.42 ? 95  ASN A HA   4  
ATOM 8883  H HB3  . ASN A 1 100 ? -1.232  10.763  4.678   1.00 32.21 ? 95  ASN A HB3  4  
ATOM 8884  H HD21 . ASN A 1 100 ? -1.244  8.380   6.883   1.00 45.32 ? 95  ASN A HD21 4  
ATOM 8885  H HD22 . ASN A 1 100 ? -2.106  9.152   8.165   1.00 65.42 ? 95  ASN A HD22 4  
ATOM 8886  N N    . SER A 1 101 ? -2.470  10.114  1.628   1.00 25.52 ? 96  SER A N    4  
ATOM 8887  C CA   . SER A 1 101 ? -2.269  10.911  0.423   1.00 31.12 ? 96  SER A CA   4  
ATOM 8888  C C    . SER A 1 101 ? -3.596  11.165  -0.288  1.00 73.33 ? 96  SER A C    4  
ATOM 8889  O O    . SER A 1 101 ? -4.570  10.431  -0.119  1.00 72.11 ? 96  SER A O    4  
ATOM 8890  C CB   . SER A 1 101 ? -1.297  10.205  -0.525  1.00 62.43 ? 96  SER A CB   4  
ATOM 8891  O OG   . SER A 1 101 ? -1.717  10.331  -1.872  1.00 14.35 ? 96  SER A OG   4  
ATOM 8892  H H    . SER A 1 101 ? -2.362  9.142   1.582   1.00 4.44  ? 96  SER A H    4  
ATOM 8893  H HA   . SER A 1 101 ? -1.846  11.860  0.718   1.00 34.23 ? 96  SER A HA   4  
ATOM 8894  H HB3  . SER A 1 101 ? -1.249  9.157   -0.271  1.00 30.24 ? 96  SER A HB3  4  
ATOM 8895  H HG   . SER A 1 101 ? -0.955  10.266  -2.452  1.00 4.23  ? 96  SER A HG   4  
ATOM 8896  N N    . PRO A 1 102 ? -3.636  12.229  -1.102  1.00 24.11 ? 97  PRO A N    4  
ATOM 8897  C CA   . PRO A 1 102 ? -4.836  12.605  -1.857  1.00 75.34 ? 97  PRO A CA   4  
ATOM 8898  C C    . PRO A 1 102 ? -5.153  11.616  -2.973  1.00 73.11 ? 97  PRO A C    4  
ATOM 8899  O O    . PRO A 1 102 ? -6.208  11.693  -3.600  1.00 14.14 ? 97  PRO A O    4  
ATOM 8900  C CB   . PRO A 1 102 ? -4.474  13.973  -2.440  1.00 0.13  ? 97  PRO A CB   4  
ATOM 8901  C CG   . PRO A 1 102 ? -2.986  13.970  -2.518  1.00 22.42 ? 97  PRO A CG   4  
ATOM 8902  C CD   . PRO A 1 102 ? -2.512  13.148  -1.352  1.00 75.52 ? 97  PRO A CD   4  
ATOM 8903  H HA   . PRO A 1 102 ? -5.695  12.704  -1.209  1.00 1.22  ? 97  PRO A HA   4  
ATOM 8904  H HB3  . PRO A 1 102 ? -4.833  14.754  -1.788  1.00 52.14 ? 97  PRO A HB3  4  
ATOM 8905  H HG3  . PRO A 1 102 ? -2.613  14.981  -2.440  1.00 0.31  ? 97  PRO A HG3  4  
ATOM 8906  H HD3  . PRO A 1 102 ? -2.333  13.778  -0.493  1.00 62.32 ? 97  PRO A HD3  4  
ATOM 8907  N N    . GLU A 1 103 ? -4.232  10.688  -3.214  1.00 61.02 ? 98  GLU A N    4  
ATOM 8908  C CA   . GLU A 1 103 ? -4.415  9.685   -4.256  1.00 53.12 ? 98  GLU A CA   4  
ATOM 8909  C C    . GLU A 1 103 ? -5.498  8.684   -3.863  1.00 61.22 ? 98  GLU A C    4  
ATOM 8910  O O    . GLU A 1 103 ? -6.401  8.391   -4.647  1.00 70.51 ? 98  GLU A O    4  
ATOM 8911  C CB   . GLU A 1 103 ? -3.100  8.949   -4.523  1.00 64.30 ? 98  GLU A CB   4  
ATOM 8912  C CG   . GLU A 1 103 ? -2.116  9.748   -5.361  1.00 42.20 ? 98  GLU A CG   4  
ATOM 8913  C CD   . GLU A 1 103 ? -1.867  9.125   -6.721  1.00 70.12 ? 98  GLU A CD   4  
ATOM 8914  O OE1  . GLU A 1 103 ? -2.629  9.432   -7.663  1.00 54.14 ? 98  GLU A OE1  4  
ATOM 8915  O OE2  . GLU A 1 103 ? -0.911  8.330   -6.843  1.00 4.34  ? 98  GLU A OE2  4  
ATOM 8916  H H    . GLU A 1 103 ? -3.410  10.679  -2.679  1.00 24.14 ? 98  GLU A H    4  
ATOM 8917  H HA   . GLU A 1 103 ? -4.722  10.194  -5.157  1.00 40.11 ? 98  GLU A HA   4  
ATOM 8918  H HB3  . GLU A 1 103 ? -3.317  8.028   -5.043  1.00 52.25 ? 98  GLU A HB3  4  
ATOM 8919  H HG3  . GLU A 1 103 ? -1.176  9.808   -4.832  1.00 22.33 ? 98  GLU A HG3  4  
ATOM 8920  N N    . TYR A 1 104 ? -5.401  8.164   -2.645  1.00 41.20 ? 99  TYR A N    4  
ATOM 8921  C CA   . TYR A 1 104 ? -6.370  7.194   -2.149  1.00 75.05 ? 99  TYR A CA   4  
ATOM 8922  C C    . TYR A 1 104 ? -7.772  7.794   -2.115  1.00 11.54 ? 99  TYR A C    4  
ATOM 8923  O O    . TYR A 1 104 ? -8.736  7.168   -2.557  1.00 32.31 ? 99  TYR A O    4  
ATOM 8924  C CB   . TYR A 1 104 ? -5.975  6.716   -0.750  1.00 71.03 ? 99  TYR A CB   4  
ATOM 8925  C CG   . TYR A 1 104 ? -7.042  5.892   -0.067  1.00 3.12  ? 99  TYR A CG   4  
ATOM 8926  C CD1  . TYR A 1 104 ? -7.288  4.581   -0.453  1.00 12.52 ? 99  TYR A CD1  4  
ATOM 8927  C CD2  . TYR A 1 104 ? -7.804  6.425   0.965   1.00 33.01 ? 99  TYR A CD2  4  
ATOM 8928  C CE1  . TYR A 1 104 ? -8.263  3.824   0.167   1.00 73.42 ? 99  TYR A CE1  4  
ATOM 8929  C CE2  . TYR A 1 104 ? -8.780  5.675   1.592   1.00 75.32 ? 99  TYR A CE2  4  
ATOM 8930  C CZ   . TYR A 1 104 ? -9.007  4.375   1.190   1.00 45.43 ? 99  TYR A CZ   4  
ATOM 8931  O OH   . TYR A 1 104 ? -9.978  3.624   1.812   1.00 63.42 ? 99  TYR A OH   4  
ATOM 8932  H H    . TYR A 1 104 ? -4.658  8.436   -2.066  1.00 30.44 ? 99  TYR A H    4  
ATOM 8933  H HA   . TYR A 1 104 ? -6.368  6.348   -2.820  1.00 45.43 ? 99  TYR A HA   4  
ATOM 8934  H HB3  . TYR A 1 104 ? -5.770  7.575   -0.128  1.00 44.02 ? 99  TYR A HB3  4  
ATOM 8935  H HD1  . TYR A 1 104 ? -6.704  4.151   -1.255  1.00 70.54 ? 99  TYR A HD1  4  
ATOM 8936  H HD2  . TYR A 1 104 ? -7.625  7.443   1.279   1.00 4.31  ? 99  TYR A HD2  4  
ATOM 8937  H HE1  . TYR A 1 104 ? -8.440  2.806   -0.147  1.00 41.20 ? 99  TYR A HE1  4  
ATOM 8938  H HE2  . TYR A 1 104 ? -9.363  6.107   2.393   1.00 21.50 ? 99  TYR A HE2  4  
ATOM 8939  H HH   . TYR A 1 104 ? -10.742 4.178   1.994   1.00 51.13 ? 99  TYR A HH   4  
ATOM 8940  N N    . GLN A 1 105 ? -7.877  9.009   -1.590  1.00 71.22 ? 100 GLN A N    4  
ATOM 8941  C CA   . GLN A 1 105 ? -9.161  9.694   -1.499  1.00 35.12 ? 100 GLN A CA   4  
ATOM 8942  C C    . GLN A 1 105 ? -9.651  10.120  -2.879  1.00 45.53 ? 100 GLN A C    4  
ATOM 8943  O O    . GLN A 1 105 ? -10.853 10.161  -3.136  1.00 24.31 ? 100 GLN A O    4  
ATOM 8944  C CB   . GLN A 1 105 ? -9.048  10.916  -0.585  1.00 52.12 ? 100 GLN A CB   4  
ATOM 8945  C CG   . GLN A 1 105 ? -8.320  12.088  -1.224  1.00 13.53 ? 100 GLN A CG   4  
ATOM 8946  C CD   . GLN A 1 105 ? -8.023  13.199  -0.237  1.00 41.21 ? 100 GLN A CD   4  
ATOM 8947  O OE1  . GLN A 1 105 ? -8.430  14.345  -0.433  1.00 41.43 ? 100 GLN A OE1  4  
ATOM 8948  N NE2  . GLN A 1 105 ? -7.311  12.865  0.833   1.00 21.20 ? 100 GLN A NE2  4  
ATOM 8949  H H    . GLN A 1 105 ? -7.072  9.456   -1.255  1.00 32.40 ? 100 GLN A H    4  
ATOM 8950  H HA   . GLN A 1 105 ? -9.876  9.004   -1.074  1.00 44.51 ? 100 GLN A HA   4  
ATOM 8951  H HB3  . GLN A 1 105 ? -8.513  10.633  0.310   1.00 22.34 ? 100 GLN A HB3  4  
ATOM 8952  H HG3  . GLN A 1 105 ? -8.934  12.486  -2.018  1.00 33.24 ? 100 GLN A HG3  4  
ATOM 8953  H HE21 . GLN A 1 105 ? -7.020  11.933  0.923   1.00 63.15 ? 100 GLN A HE21 4  
ATOM 8954  H HE22 . GLN A 1 105 ? -7.103  13.564  1.487   1.00 30.01 ? 100 GLN A HE22 4  
ATOM 8955  N N    . ARG A 1 106 ? -8.709  10.435  -3.763  1.00 21.31 ? 101 ARG A N    4  
ATOM 8956  C CA   . ARG A 1 106 ? -9.044  10.859  -5.117  1.00 61.44 ? 101 ARG A CA   4  
ATOM 8957  C C    . ARG A 1 106 ? -9.996  9.866   -5.778  1.00 30.41 ? 101 ARG A C    4  
ATOM 8958  O O    . ARG A 1 106 ? -10.877 10.252  -6.547  1.00 3.35  ? 101 ARG A O    4  
ATOM 8959  C CB   . ARG A 1 106 ? -7.775  11.003  -5.959  1.00 75.42 ? 101 ARG A CB   4  
ATOM 8960  C CG   . ARG A 1 106 ? -7.372  12.446  -6.212  1.00 41.40 ? 101 ARG A CG   4  
ATOM 8961  C CD   . ARG A 1 106 ? -7.352  12.766  -7.699  1.00 43.33 ? 101 ARG A CD   4  
ATOM 8962  N NE   . ARG A 1 106 ? -6.296  13.716  -8.040  1.00 34.44 ? 101 ARG A NE   4  
ATOM 8963  C CZ   . ARG A 1 106 ? -6.323  14.999  -7.696  1.00 12.22 ? 101 ARG A CZ   4  
ATOM 8964  N NH1  . ARG A 1 106 ? -7.347  15.482  -7.004  1.00 0.44  ? 101 ARG A NH1  4  
ATOM 8965  N NH2  . ARG A 1 106 ? -5.325  15.802  -8.043  1.00 74.03 ? 101 ARG A NH2  4  
ATOM 8966  H H    . ARG A 1 106 ? -7.766  10.382  -3.499  1.00 30.33 ? 101 ARG A H    4  
ATOM 8967  H HA   . ARG A 1 106 ? -9.533  11.819  -5.052  1.00 25.22 ? 101 ARG A HA   4  
ATOM 8968  H HB3  . ARG A 1 106 ? -7.934  10.523  -6.912  1.00 12.23 ? 101 ARG A HB3  4  
ATOM 8969  H HG3  . ARG A 1 106 ? -6.386  12.612  -5.803  1.00 35.01 ? 101 ARG A HG3  4  
ATOM 8970  H HD3  . ARG A 1 106 ? -8.307  13.187  -7.976  1.00 42.04 ? 101 ARG A HD3  4  
ATOM 8971  H HE   . ARG A 1 106 ? -5.531  13.380  -8.550  1.00 61.12 ? 101 ARG A HE   4  
ATOM 8972  H HH11 . ARG A 1 106 ? -8.100  14.879  -6.741  1.00 62.23 ? 101 ARG A HH11 4  
ATOM 8973  H HH12 . ARG A 1 106 ? -7.364  16.448  -6.746  1.00 12.44 ? 101 ARG A HH12 4  
ATOM 8974  H HH21 . ARG A 1 106 ? -4.552  15.441  -8.564  1.00 72.42 ? 101 ARG A HH21 4  
ATOM 8975  H HH22 . ARG A 1 106 ? -5.346  16.767  -7.783  1.00 10.15 ? 101 ARG A HH22 4  
ATOM 8976  N N    . LEU A 1 107 ? -9.812  8.587   -5.473  1.00 34.15 ? 102 LEU A N    4  
ATOM 8977  C CA   . LEU A 1 107 ? -10.655 7.537   -6.037  1.00 30.42 ? 102 LEU A CA   4  
ATOM 8978  C C    . LEU A 1 107 ? -11.614 6.986   -4.988  1.00 55.44 ? 102 LEU A C    4  
ATOM 8979  O O    . LEU A 1 107 ? -12.648 6.407   -5.320  1.00 11.22 ? 102 LEU A O    4  
ATOM 8980  C CB   . LEU A 1 107 ? -9.789  6.408   -6.598  1.00 43.13 ? 102 LEU A CB   4  
ATOM 8981  C CG   . LEU A 1 107 ? -8.587  6.838   -7.439  1.00 3.02  ? 102 LEU A CG   4  
ATOM 8982  C CD1  . LEU A 1 107 ? -7.825  5.622   -7.942  1.00 32.05 ? 102 LEU A CD1  4  
ATOM 8983  C CD2  . LEU A 1 107 ? -9.037  7.708   -8.605  1.00 13.10 ? 102 LEU A CD2  4  
ATOM 8984  H H    . LEU A 1 107 ? -9.095  8.340   -4.853  1.00 30.45 ? 102 LEU A H    4  
ATOM 8985  H HA   . LEU A 1 107 ? -11.231 7.971   -6.841  1.00 75.55 ? 102 LEU A HA   4  
ATOM 8986  H HB3  . LEU A 1 107 ? -10.420 5.784   -7.214  1.00 12.44 ? 102 LEU A HB3  4  
ATOM 8987  H HG   . LEU A 1 107 ? -7.915  7.422   -6.825  1.00 12.34 ? 102 LEU A HG   4  
ATOM 8988  H HD11 . LEU A 1 107 ? -8.517  4.814   -8.126  1.00 1.24  ? 102 LEU A HD11 4  
ATOM 8989  H HD12 . LEU A 1 107 ? -7.104  5.316   -7.199  1.00 21.41 ? 102 LEU A HD12 4  
ATOM 8990  H HD13 . LEU A 1 107 ? -7.312  5.872   -8.860  1.00 71.23 ? 102 LEU A HD13 4  
ATOM 8991  H HD21 . LEU A 1 107 ? -8.310  7.644   -9.401  1.00 62.20 ? 102 LEU A HD21 4  
ATOM 8992  H HD22 . LEU A 1 107 ? -9.123  8.733   -8.276  1.00 10.32 ? 102 LEU A HD22 4  
ATOM 8993  H HD23 . LEU A 1 107 ? -9.995  7.362   -8.964  1.00 33.21 ? 102 LEU A HD23 4  
ATOM 8994  N N    . ARG A 1 108 ? -11.264 7.169   -3.719  1.00 72.42 ? 103 ARG A N    4  
ATOM 8995  C CA   . ARG A 1 108 ? -12.095 6.691   -2.619  1.00 4.33  ? 103 ARG A CA   4  
ATOM 8996  C C    . ARG A 1 108 ? -12.322 5.186   -2.726  1.00 53.22 ? 103 ARG A C    4  
ATOM 8997  O O    . ARG A 1 108 ? -13.439 4.733   -2.978  1.00 3.55  ? 103 ARG A O    4  
ATOM 8998  C CB   . ARG A 1 108 ? -13.439 7.421   -2.613  1.00 52.41 ? 103 ARG A CB   4  
ATOM 8999  C CG   . ARG A 1 108 ? -13.403 8.755   -1.885  1.00 54.30 ? 103 ARG A CG   4  
ATOM 9000  C CD   . ARG A 1 108 ? -14.706 9.022   -1.147  1.00 73.01 ? 103 ARG A CD   4  
ATOM 9001  N NE   . ARG A 1 108 ? -14.476 9.435   0.236   1.00 14.05 ? 103 ARG A NE   4  
ATOM 9002  C CZ   . ARG A 1 108 ? -15.452 9.759   1.077   1.00 23.14 ? 103 ARG A CZ   4  
ATOM 9003  N NH1  . ARG A 1 108 ? -16.716 9.719   0.678   1.00 31.12 ? 103 ARG A NH1  4  
ATOM 9004  N NH2  . ARG A 1 108 ? -15.164 10.126  2.319   1.00 32.34 ? 103 ARG A NH2  4  
ATOM 9005  H H    . ARG A 1 108 ? -10.428 7.639   -3.516  1.00 55.51 ? 103 ARG A H    4  
ATOM 9006  H HA   . ARG A 1 108 ? -11.576 6.901   -1.696  1.00 2.33  ? 103 ARG A HA   4  
ATOM 9007  H HB3  . ARG A 1 108 ? -14.173 6.793   -2.132  1.00 53.04 ? 103 ARG A HB3  4  
ATOM 9008  H HG3  . ARG A 1 108 ? -13.240 9.543   -2.605  1.00 42.25 ? 103 ARG A HG3  4  
ATOM 9009  H HD3  . ARG A 1 108 ? -15.297 8.118   -1.149  1.00 3.20  ? 103 ARG A HD3  4  
ATOM 9010  H HE   . ARG A 1 108 ? -13.550 9.471   0.550   1.00 61.14 ? 103 ARG A HE   4  
ATOM 9011  H HH11 . ARG A 1 108 ? -16.936 9.443   -0.257  1.00 53.11 ? 103 ARG A HH11 4  
ATOM 9012  H HH12 . ARG A 1 108 ? -17.449 9.963   1.314   1.00 63.21 ? 103 ARG A HH12 4  
ATOM 9013  H HH21 . ARG A 1 108 ? -14.213 10.157  2.623   1.00 3.42  ? 103 ARG A HH21 4  
ATOM 9014  H HH22 . ARG A 1 108 ? -15.899 10.370  2.951   1.00 72.12 ? 103 ARG A HH22 4  
ATOM 9015  N N    . ILE A 1 109 ? -11.256 4.417   -2.531  1.00 44.42 ? 104 ILE A N    4  
ATOM 9016  C CA   . ILE A 1 109 ? -11.339 2.963   -2.605  1.00 32.45 ? 104 ILE A CA   4  
ATOM 9017  C C    . ILE A 1 109 ? -11.825 2.373   -1.286  1.00 35.30 ? 104 ILE A C    4  
ATOM 9018  O O    . ILE A 1 109 ? -11.196 2.555   -0.243  1.00 62.23 ? 104 ILE A O    4  
ATOM 9019  C CB   . ILE A 1 109 ? -9.978  2.338   -2.963  1.00 31.03 ? 104 ILE A CB   4  
ATOM 9020  C CG1  . ILE A 1 109 ? -9.367  3.052   -4.171  1.00 0.43  ? 104 ILE A CG1  4  
ATOM 9021  C CG2  . ILE A 1 109 ? -10.135 0.851   -3.242  1.00 23.24 ? 104 ILE A CG2  4  
ATOM 9022  C CD1  . ILE A 1 109 ? -8.015  2.507   -4.574  1.00 42.51 ? 104 ILE A CD1  4  
ATOM 9023  H H    . ILE A 1 109 ? -10.393 4.836   -2.333  1.00 3.13  ? 104 ILE A H    4  
ATOM 9024  H HA   . ILE A 1 109 ? -12.045 2.710   -3.383  1.00 13.21 ? 104 ILE A HA   4  
ATOM 9025  H HB   . ILE A 1 109 ? -9.320  2.453   -2.116  1.00 64.21 ? 104 ILE A HB   4  
ATOM 9026  H HG13 . ILE A 1 109 ? -9.248  4.100   -3.939  1.00 42.21 ? 104 ILE A HG13 4  
ATOM 9027  H HG21 . ILE A 1 109 ? -10.359 0.703   -4.289  1.00 22.13 ? 104 ILE A HG21 4  
ATOM 9028  H HG22 . ILE A 1 109 ? -9.217  0.341   -2.996  1.00 15.41 ? 104 ILE A HG22 4  
ATOM 9029  H HG23 . ILE A 1 109 ? -10.940 0.455   -2.643  1.00 53.31 ? 104 ILE A HG23 4  
ATOM 9030  H HD11 . ILE A 1 109 ? -8.091  2.032   -5.540  1.00 5.54  ? 104 ILE A HD11 4  
ATOM 9031  H HD12 . ILE A 1 109 ? -7.301  3.315   -4.624  1.00 53.21 ? 104 ILE A HD12 4  
ATOM 9032  H HD13 . ILE A 1 109 ? -7.686  1.782   -3.843  1.00 14.02 ? 104 ILE A HD13 4  
ATOM 9033  N N    . ASP A 1 110 ? -12.947 1.664   -1.338  1.00 24.33 ? 105 ASP A N    4  
ATOM 9034  C CA   . ASP A 1 110 ? -13.517 1.044   -0.148  1.00 22.10 ? 105 ASP A CA   4  
ATOM 9035  C C    . ASP A 1 110 ? -12.593 -0.041  0.393   1.00 75.53 ? 105 ASP A C    4  
ATOM 9036  O O    . ASP A 1 110 ? -11.788 -0.626  -0.332  1.00 32.23 ? 105 ASP A O    4  
ATOM 9037  C CB   . ASP A 1 110 ? -14.891 0.451   -0.463  1.00 2.03  ? 105 ASP A CB   4  
ATOM 9038  C CG   . ASP A 1 110 ? -15.906 1.512   -0.841  1.00 34.04 ? 105 ASP A CG   4  
ATOM 9039  O OD1  . ASP A 1 110 ? -15.923 1.925   -2.020  1.00 3.04  ? 105 ASP A OD1  4  
ATOM 9040  O OD2  . ASP A 1 110 ? -16.686 1.929   0.041   1.00 53.44 ? 105 ASP A OD2  4  
ATOM 9041  H H    . ASP A 1 110 ? -13.403 1.555   -2.199  1.00 34.15 ? 105 ASP A H    4  
ATOM 9042  H HA   . ASP A 1 110 ? -13.630 1.811   0.604   1.00 10.34 ? 105 ASP A HA   4  
ATOM 9043  H HB3  . ASP A 1 110 ? -15.256 -0.078  0.405   1.00 10.11 ? 105 ASP A HB3  4  
ATOM 9044  N N    . PRO A 1 111 ? -12.708 -0.319  1.702   1.00 64.31 ? 106 PRO A N    4  
ATOM 9045  C CA   . PRO A 1 111 ? -11.891 -1.335  2.371   1.00 4.21  ? 106 PRO A CA   4  
ATOM 9046  C C    . PRO A 1 111 ? -12.257 -2.751  1.938   1.00 24.24 ? 106 PRO A C    4  
ATOM 9047  O O    . PRO A 1 111 ? -11.392 -3.533  1.546   1.00 1.43  ? 106 PRO A O    4  
ATOM 9048  C CB   . PRO A 1 111 ? -12.211 -1.129  3.853   1.00 24.21 ? 106 PRO A CB   4  
ATOM 9049  C CG   . PRO A 1 111 ? -13.567 -0.512  3.865   1.00 24.32 ? 106 PRO A CG   4  
ATOM 9050  C CD   . PRO A 1 111 ? -13.646 0.339   2.627   1.00 22.11 ? 106 PRO A CD   4  
ATOM 9051  H HA   . PRO A 1 111 ? -10.837 -1.171  2.202   1.00 65.21 ? 106 PRO A HA   4  
ATOM 9052  H HB3  . PRO A 1 111 ? -11.476 -0.474  4.296   1.00 11.22 ? 106 PRO A HB3  4  
ATOM 9053  H HG3  . PRO A 1 111 ? -13.683 0.100   4.748   1.00 24.51 ? 106 PRO A HG3  4  
ATOM 9054  H HD3  . PRO A 1 111 ? -13.329 1.349   2.843   1.00 32.22 ? 106 PRO A HD3  4  
ATOM 9055  N N    . ILE A 1 112 ? -13.545 -3.072  2.012   1.00 2.13  ? 107 ILE A N    4  
ATOM 9056  C CA   . ILE A 1 112 ? -14.025 -4.393  1.625   1.00 71.31 ? 107 ILE A CA   4  
ATOM 9057  C C    . ILE A 1 112 ? -13.855 -4.624  0.128   1.00 13.33 ? 107 ILE A C    4  
ATOM 9058  O O    . ILE A 1 112 ? -13.834 -5.763  -0.336  1.00 62.12 ? 107 ILE A O    4  
ATOM 9059  C CB   . ILE A 1 112 ? -15.507 -4.584  1.998   1.00 4.24  ? 107 ILE A CB   4  
ATOM 9060  C CG1  . ILE A 1 112 ? -16.405 -3.844  1.004   1.00 60.50 ? 107 ILE A CG1  4  
ATOM 9061  C CG2  . ILE A 1 112 ? -15.764 -4.097  3.417   1.00 2.31  ? 107 ILE A CG2  4  
ATOM 9062  C CD1  . ILE A 1 112 ? -16.291 -2.338  1.092   1.00 62.25 ? 107 ILE A CD1  4  
ATOM 9063  H H    . ILE A 1 112 ? -14.187 -2.404  2.331   1.00 15.31 ? 107 ILE A H    4  
ATOM 9064  H HA   . ILE A 1 112 ? -13.443 -5.129  2.161   1.00 25.30 ? 107 ILE A HA   4  
ATOM 9065  H HB   . ILE A 1 112 ? -15.732 -5.638  1.959   1.00 11.11 ? 107 ILE A HB   4  
ATOM 9066  H HG13 . ILE A 1 112 ? -17.435 -4.111  1.193   1.00 4.53  ? 107 ILE A HG13 4  
ATOM 9067  H HG21 . ILE A 1 112 ? -15.535 -3.044  3.482   1.00 62.41 ? 107 ILE A HG21 4  
ATOM 9068  H HG22 . ILE A 1 112 ? -16.802 -4.255  3.668   1.00 52.30 ? 107 ILE A HG22 4  
ATOM 9069  H HG23 . ILE A 1 112 ? -15.138 -4.645  4.104   1.00 35.01 ? 107 ILE A HG23 4  
ATOM 9070  H HD11 . ILE A 1 112 ? -16.468 -2.022  2.110   1.00 62.12 ? 107 ILE A HD11 4  
ATOM 9071  H HD12 . ILE A 1 112 ? -15.302 -2.032  0.786   1.00 71.42 ? 107 ILE A HD12 4  
ATOM 9072  H HD13 . ILE A 1 112 ? -17.025 -1.882  0.443   1.00 54.12 ? 107 ILE A HD13 4  
ATOM 9073  N N    . ASN A 1 113 ? -13.733 -3.534  -0.623  1.00 53.50 ? 108 ASN A N    4  
ATOM 9074  C CA   . ASN A 1 113 ? -13.562 -3.618  -2.069  1.00 20.21 ? 108 ASN A CA   4  
ATOM 9075  C C    . ASN A 1 113 ? -12.093 -3.808  -2.434  1.00 20.24 ? 108 ASN A C    4  
ATOM 9076  O O    . ASN A 1 113 ? -11.770 -4.262  -3.532  1.00 71.22 ? 108 ASN A O    4  
ATOM 9077  C CB   . ASN A 1 113 ? -14.107 -2.357  -2.742  1.00 71.41 ? 108 ASN A CB   4  
ATOM 9078  C CG   . ASN A 1 113 ? -14.502 -2.596  -4.187  1.00 52.13 ? 108 ASN A CG   4  
ATOM 9079  O OD1  . ASN A 1 113 ? -15.478 -3.292  -4.468  1.00 52.32 ? 108 ASN A OD1  4  
ATOM 9080  N ND2  . ASN A 1 113 ? -13.743 -2.019  -5.110  1.00 43.11 ? 108 ASN A ND2  4  
ATOM 9081  H H    . ASN A 1 113 ? -13.757 -2.653  -0.196  1.00 14.11 ? 108 ASN A H    4  
ATOM 9082  H HA   . ASN A 1 113 ? -14.122 -4.473  -2.419  1.00 43.41 ? 108 ASN A HA   4  
ATOM 9083  H HB3  . ASN A 1 113 ? -13.351 -1.587  -2.717  1.00 32.43 ? 108 ASN A HB3  4  
ATOM 9084  H HD21 . ASN A 1 113 ? -12.982 -1.479  -4.813  1.00 43.24 ? 108 ASN A HD21 4  
ATOM 9085  H HD22 . ASN A 1 113 ? -13.976 -2.157  -6.052  1.00 2.01  ? 108 ASN A HD22 4  
ATOM 9086  N N    . GLU A 1 114 ? -11.208 -3.459  -1.506  1.00 21.45 ? 109 GLU A N    4  
ATOM 9087  C CA   . GLU A 1 114 ? -9.774  -3.590  -1.730  1.00 10.42 ? 109 GLU A CA   4  
ATOM 9088  C C    . GLU A 1 114 ? -9.371  -5.059  -1.831  1.00 31.45 ? 109 GLU A C    4  
ATOM 9089  O O    . GLU A 1 114 ? -10.113 -5.947  -1.409  1.00 11.35 ? 109 GLU A O    4  
ATOM 9090  C CB   . GLU A 1 114 ? -8.994  -2.913  -0.602  1.00 44.31 ? 109 GLU A CB   4  
ATOM 9091  C CG   . GLU A 1 114 ? -8.071  -1.805  -1.080  1.00 43.43 ? 109 GLU A CG   4  
ATOM 9092  C CD   . GLU A 1 114 ? -7.004  -2.307  -2.035  1.00 1.21  ? 109 GLU A CD   4  
ATOM 9093  O OE1  . GLU A 1 114 ? -6.392  -3.356  -1.745  1.00 30.03 ? 109 GLU A OE1  4  
ATOM 9094  O OE2  . GLU A 1 114 ? -6.782  -1.649  -3.074  1.00 12.32 ? 109 GLU A OE2  4  
ATOM 9095  H H    . GLU A 1 114 ? -11.528 -3.104  -0.650  1.00 24.52 ? 109 GLU A H    4  
ATOM 9096  H HA   . GLU A 1 114 ? -9.538  -3.102  -2.663  1.00 64.32 ? 109 GLU A HA   4  
ATOM 9097  H HB3  . GLU A 1 114 ? -8.396  -3.658  -0.096  1.00 22.14 ? 109 GLU A HB3  4  
ATOM 9098  H HG3  . GLU A 1 114 ? -7.585  -1.363  -0.222  1.00 12.24 ? 109 GLU A HG3  4  
ATOM 9099  N N    . ARG A 1 115 ? -8.193  -5.308  -2.392  1.00 65.21 ? 110 ARG A N    4  
ATOM 9100  C CA   . ARG A 1 115 ? -7.692  -6.667  -2.550  1.00 14.23 ? 110 ARG A CA   4  
ATOM 9101  C C    . ARG A 1 115 ? -6.588  -6.961  -1.539  1.00 64.32 ? 110 ARG A C    4  
ATOM 9102  O O    . ARG A 1 115 ? -6.597  -7.999  -0.879  1.00 55.44 ? 110 ARG A O    4  
ATOM 9103  C CB   . ARG A 1 115 ? -7.168  -6.879  -3.971  1.00 44.25 ? 110 ARG A CB   4  
ATOM 9104  C CG   . ARG A 1 115 ? -7.883  -7.987  -4.726  1.00 22.24 ? 110 ARG A CG   4  
ATOM 9105  C CD   . ARG A 1 115 ? -6.906  -8.845  -5.514  1.00 71.31 ? 110 ARG A CD   4  
ATOM 9106  N NE   . ARG A 1 115 ? -7.591  -9.776  -6.406  1.00 53.24 ? 110 ARG A NE   4  
ATOM 9107  C CZ   . ARG A 1 115 ? -8.198  -9.408  -7.528  1.00 22.12 ? 110 ARG A CZ   4  
ATOM 9108  N NH1  . ARG A 1 115 ? -8.204  -8.134  -7.895  1.00 43.43 ? 110 ARG A NH1  4  
ATOM 9109  N NH2  . ARG A 1 115 ? -8.799  -10.315 -8.287  1.00 33.53 ? 110 ARG A NH2  4  
ATOM 9110  H H    . ARG A 1 115 ? -7.647  -4.558  -2.709  1.00 65.44 ? 110 ARG A H    4  
ATOM 9111  H HA   . ARG A 1 115 ? -8.514  -7.346  -2.374  1.00 4.43  ? 110 ARG A HA   4  
ATOM 9112  H HB3  . ARG A 1 115 ? -6.118  -7.127  -3.920  1.00 44.13 ? 110 ARG A HB3  4  
ATOM 9113  H HG3  . ARG A 1 115 ? -8.591  -7.543  -5.410  1.00 32.44 ? 110 ARG A HG3  4  
ATOM 9114  H HD3  . ARG A 1 115 ? -6.300  -9.406  -4.818  1.00 2.43  ? 110 ARG A HD3  4  
ATOM 9115  H HE   . ARG A 1 115 ? -7.599  -10.723 -6.154  1.00 52.10 ? 110 ARG A HE   4  
ATOM 9116  H HH11 . ARG A 1 115 ? -7.749  -7.449  -7.326  1.00 25.41 ? 110 ARG A HH11 4  
ATOM 9117  H HH12 . ARG A 1 115 ? -8.660  -7.859  -8.742  1.00 53.45 ? 110 ARG A HH12 4  
ATOM 9118  H HH21 . ARG A 1 115 ? -8.798  -11.276 -8.014  1.00 24.03 ? 110 ARG A HH21 4  
ATOM 9119  H HH22 . ARG A 1 115 ? -9.256  -10.036 -9.132  1.00 14.51 ? 110 ARG A HH22 4  
ATOM 9120  N N    . SER A 1 116 ? -5.638  -6.039  -1.424  1.00 64.23 ? 111 SER A N    4  
ATOM 9121  C CA   . SER A 1 116 ? -4.524  -6.200  -0.497  1.00 35.12 ? 111 SER A CA   4  
ATOM 9122  C C    . SER A 1 116 ? -4.266  -4.908  0.273   1.00 50.40 ? 111 SER A C    4  
ATOM 9123  O O    . SER A 1 116 ? -4.304  -3.816  -0.295  1.00 61.22 ? 111 SER A O    4  
ATOM 9124  C CB   . SER A 1 116 ? -3.261  -6.618  -1.252  1.00 21.12 ? 111 SER A CB   4  
ATOM 9125  O OG   . SER A 1 116 ? -3.308  -6.189  -2.601  1.00 51.51 ? 111 SER A OG   4  
ATOM 9126  H H    . SER A 1 116 ? -5.686  -5.231  -1.977  1.00 41.20 ? 111 SER A H    4  
ATOM 9127  H HA   . SER A 1 116 ? -4.787  -6.977  0.205   1.00 70.25 ? 111 SER A HA   4  
ATOM 9128  H HB3  . SER A 1 116 ? -3.173  -7.695  -1.231  1.00 20.04 ? 111 SER A HB3  4  
ATOM 9129  H HG   . SER A 1 116 ? -2.767  -6.770  -3.141  1.00 2.01  ? 111 SER A HG   4  
ATOM 9130  N N    . PHE A 1 117 ? -4.002  -5.041  1.568   1.00 52.11 ? 112 PHE A N    4  
ATOM 9131  C CA   . PHE A 1 117 ? -3.738  -3.886  2.418   1.00 25.25 ? 112 PHE A CA   4  
ATOM 9132  C C    . PHE A 1 117 ? -2.445  -4.073  3.206   1.00 34.05 ? 112 PHE A C    4  
ATOM 9133  O O    . PHE A 1 117 ? -2.073  -5.196  3.550   1.00 45.40 ? 112 PHE A O    4  
ATOM 9134  C CB   . PHE A 1 117 ? -4.906  -3.655  3.379   1.00 51.21 ? 112 PHE A CB   4  
ATOM 9135  C CG   . PHE A 1 117 ? -5.630  -2.360  3.144   1.00 1.42  ? 112 PHE A CG   4  
ATOM 9136  C CD1  . PHE A 1 117 ? -4.990  -1.147  3.346   1.00 15.44 ? 112 PHE A CD1  4  
ATOM 9137  C CD2  . PHE A 1 117 ? -6.949  -2.356  2.720   1.00 45.15 ? 112 PHE A CD2  4  
ATOM 9138  C CE1  . PHE A 1 117 ? -5.655  0.046   3.131   1.00 12.01 ? 112 PHE A CE1  4  
ATOM 9139  C CE2  . PHE A 1 117 ? -7.618  -1.166  2.503   1.00 71.33 ? 112 PHE A CE2  4  
ATOM 9140  C CZ   . PHE A 1 117 ? -6.969  0.036   2.708   1.00 21.22 ? 112 PHE A CZ   4  
ATOM 9141  H H    . PHE A 1 117 ? -3.985  -5.938  1.963   1.00 74.22 ? 112 PHE A H    4  
ATOM 9142  H HA   . PHE A 1 117 ? -3.634  -3.022  1.779   1.00 4.35  ? 112 PHE A HA   4  
ATOM 9143  H HB3  . PHE A 1 117 ? -4.532  -3.649  4.392   1.00 70.43 ? 112 PHE A HB3  4  
ATOM 9144  H HD1  . PHE A 1 117 ? -3.962  -1.138  3.676   1.00 34.11 ? 112 PHE A HD1  4  
ATOM 9145  H HD2  . PHE A 1 117 ? -7.457  -3.296  2.559   1.00 22.52 ? 112 PHE A HD2  4  
ATOM 9146  H HE1  . PHE A 1 117 ? -5.145  0.984   3.292   1.00 22.43 ? 112 PHE A HE1  4  
ATOM 9147  H HE2  . PHE A 1 117 ? -8.646  -1.176  2.172   1.00 40.33 ? 112 PHE A HE2  4  
ATOM 9148  H HZ   . PHE A 1 117 ? -7.490  0.967   2.540   1.00 20.42 ? 112 PHE A HZ   4  
ATOM 9149  N N    . ILE A 1 118 ? -1.765  -2.967  3.488   1.00 10.43 ? 113 ILE A N    4  
ATOM 9150  C CA   . ILE A 1 118 ? -0.515  -3.009  4.235   1.00 41.41 ? 113 ILE A CA   4  
ATOM 9151  C C    . ILE A 1 118 ? -0.466  -1.908  5.287   1.00 65.35 ? 113 ILE A C    4  
ATOM 9152  O O    . ILE A 1 118 ? -0.584  -0.724  4.968   1.00 24.21 ? 113 ILE A O    4  
ATOM 9153  C CB   . ILE A 1 118 ? 0.703   -2.869  3.303   1.00 43.54 ? 113 ILE A CB   4  
ATOM 9154  C CG1  . ILE A 1 118 ? 0.723   -4.004  2.278   1.00 10.22 ? 113 ILE A CG1  4  
ATOM 9155  C CG2  . ILE A 1 118 ? 1.991   -2.857  4.113   1.00 3.54  ? 113 ILE A CG2  4  
ATOM 9156  C CD1  . ILE A 1 118 ? 1.167   -5.331  2.854   1.00 21.22 ? 113 ILE A CD1  4  
ATOM 9157  H H    . ILE A 1 118 ? -2.113  -2.102  3.186   1.00 73.25 ? 113 ILE A H    4  
ATOM 9158  H HA   . ILE A 1 118 ? -0.454  -3.968  4.730   1.00 31.33 ? 113 ILE A HA   4  
ATOM 9159  H HB   . ILE A 1 118 ? 0.624   -1.926  2.784   1.00 43.01 ? 113 ILE A HB   4  
ATOM 9160  H HG13 . ILE A 1 118 ? 1.401   -3.745  1.477   1.00 61.40 ? 113 ILE A HG13 4  
ATOM 9161  H HG21 . ILE A 1 118 ? 2.045   -3.750  4.717   1.00 14.51 ? 113 ILE A HG21 4  
ATOM 9162  H HG22 . ILE A 1 118 ? 2.837   -2.826  3.442   1.00 31.50 ? 113 ILE A HG22 4  
ATOM 9163  H HG23 . ILE A 1 118 ? 2.007   -1.988  4.753   1.00 33.23 ? 113 ILE A HG23 4  
ATOM 9164  H HD11 . ILE A 1 118 ? 1.034   -5.321  3.925   1.00 41.33 ? 113 ILE A HD11 4  
ATOM 9165  H HD12 . ILE A 1 118 ? 0.576   -6.126  2.424   1.00 71.33 ? 113 ILE A HD12 4  
ATOM 9166  H HD13 . ILE A 1 118 ? 2.210   -5.492  2.622   1.00 52.02 ? 113 ILE A HD13 4  
ATOM 9167  N N    . CYS A 1 119 ? -0.288  -2.303  6.543   1.00 4.31  ? 114 CYS A N    4  
ATOM 9168  C CA   . CYS A 1 119 ? -0.222  -1.348  7.644   1.00 0.23  ? 114 CYS A CA   4  
ATOM 9169  C C    . CYS A 1 119 ? 1.219   -1.144  8.101   1.00 14.43 ? 114 CYS A C    4  
ATOM 9170  O O    . CYS A 1 119 ? 2.039   -2.058  8.026   1.00 51.11 ? 114 CYS A O    4  
ATOM 9171  C CB   . CYS A 1 119 ? -1.079  -1.828  8.815   1.00 32.31 ? 114 CYS A CB   4  
ATOM 9172  S SG   . CYS A 1 119 ? -2.363  -0.659  9.319   1.00 51.51 ? 114 CYS A SG   4  
ATOM 9173  H H    . CYS A 1 119 ? -0.200  -3.259  6.735   1.00 10.32 ? 114 CYS A H    4  
ATOM 9174  H HA   . CYS A 1 119 ? -0.609  -0.406  7.287   1.00 74.35 ? 114 CYS A HA   4  
ATOM 9175  H HB3  . CYS A 1 119 ? -0.441  -2.006  9.669   1.00 3.15  ? 114 CYS A HB3  4  
ATOM 9176  H HG   . CYS A 1 119 ? -3.472  -0.962  8.662   1.00 11.00 ? 114 CYS A HG   4  
ATOM 9177  N N    . ASN A 1 120 ? 1.520   0.061   8.574   1.00 11.42 ? 115 ASN A N    4  
ATOM 9178  C CA   . ASN A 1 120 ? 2.863   0.384   9.042   1.00 21.44 ? 115 ASN A CA   4  
ATOM 9179  C C    . ASN A 1 120 ? 2.821   0.971   10.450  1.00 41.43 ? 115 ASN A C    4  
ATOM 9180  O O    . ASN A 1 120 ? 2.289   2.059   10.665  1.00 33.52 ? 115 ASN A O    4  
ATOM 9181  C CB   . ASN A 1 120 ? 3.534   1.373   8.086   1.00 12.25 ? 115 ASN A CB   4  
ATOM 9182  C CG   . ASN A 1 120 ? 4.827   0.831   7.508   1.00 12.13 ? 115 ASN A CG   4  
ATOM 9183  O OD1  . ASN A 1 120 ? 5.805   0.627   8.229   1.00 0.35  ? 115 ASN A OD1  4  
ATOM 9184  N ND2  . ASN A 1 120 ? 4.838   0.594   6.201   1.00 32.41 ? 115 ASN A ND2  4  
ATOM 9185  H H    . ASN A 1 120 ? 0.823   0.749   8.609   1.00 51.31 ? 115 ASN A H    4  
ATOM 9186  H HA   . ASN A 1 120 ? 3.436   -0.530  9.062   1.00 2.21  ? 115 ASN A HA   4  
ATOM 9187  H HB3  . ASN A 1 120 ? 3.753   2.287   8.617   1.00 4.53  ? 115 ASN A HB3  4  
ATOM 9188  H HD21 . ASN A 1 120 ? 4.023   0.780   5.690   1.00 5.32  ? 115 ASN A HD21 4  
ATOM 9189  H HD22 . ASN A 1 120 ? 5.661   0.243   5.801   1.00 74.11 ? 115 ASN A HD22 4  
ATOM 9190  N N    . TYR A 1 121 ? 3.388   0.242   11.405  1.00 4.11  ? 116 TYR A N    4  
ATOM 9191  C CA   . TYR A 1 121 ? 3.416   0.688   12.792  1.00 33.14 ? 116 TYR A CA   4  
ATOM 9192  C C    . TYR A 1 121 ? 4.847   0.935   13.258  1.00 31.23 ? 116 TYR A C    4  
ATOM 9193  O O    . TYR A 1 121 ? 5.759   0.175   12.931  1.00 71.24 ? 116 TYR A O    4  
ATOM 9194  C CB   . TYR A 1 121 ? 2.745   -0.349  13.697  1.00 5.11  ? 116 TYR A CB   4  
ATOM 9195  C CG   . TYR A 1 121 ? 2.924   -0.071  15.172  1.00 32.53 ? 116 TYR A CG   4  
ATOM 9196  C CD1  . TYR A 1 121 ? 2.658   1.187   15.700  1.00 4.14  ? 116 TYR A CD1  4  
ATOM 9197  C CD2  . TYR A 1 121 ? 3.356   -1.067  16.038  1.00 41.24 ? 116 TYR A CD2  4  
ATOM 9198  C CE1  . TYR A 1 121 ? 2.821   1.445   17.047  1.00 42.10 ? 116 TYR A CE1  4  
ATOM 9199  C CE2  . TYR A 1 121 ? 3.520   -0.818  17.388  1.00 43.25 ? 116 TYR A CE2  4  
ATOM 9200  C CZ   . TYR A 1 121 ? 3.253   0.440   17.886  1.00 34.44 ? 116 TYR A CZ   4  
ATOM 9201  O OH   . TYR A 1 121 ? 3.414   0.693   19.229  1.00 35.43 ? 116 TYR A OH   4  
ATOM 9202  H H    . TYR A 1 121 ? 3.797   -0.618  11.171  1.00 1.30  ? 116 TYR A H    4  
ATOM 9203  H HA   . TYR A 1 121 ? 2.864   1.614   12.854  1.00 24.41 ? 116 TYR A HA   4  
ATOM 9204  H HB3  . TYR A 1 121 ? 3.164   -1.322  13.489  1.00 1.51  ? 116 TYR A HB3  4  
ATOM 9205  H HD1  . TYR A 1 121 ? 2.320   1.972   15.039  1.00 43.42 ? 116 TYR A HD1  4  
ATOM 9206  H HD2  . TYR A 1 121 ? 3.566   -2.051  15.645  1.00 43.04 ? 116 TYR A HD2  4  
ATOM 9207  H HE1  . TYR A 1 121 ? 2.610   2.429   17.438  1.00 65.35 ? 116 TYR A HE1  4  
ATOM 9208  H HE2  . TYR A 1 121 ? 3.859   -1.604  18.046  1.00 14.24 ? 116 TYR A HE2  4  
ATOM 9209  H HH   . TYR A 1 121 ? 3.457   -0.139  19.709  1.00 3.21  ? 116 TYR A HH   4  
ATOM 9210  N N    . LYS A 1 122 ? 5.037   2.005   14.023  1.00 31.31 ? 117 LYS A N    4  
ATOM 9211  C CA   . LYS A 1 122 ? 6.357   2.354   14.536  1.00 21.42 ? 117 LYS A CA   4  
ATOM 9212  C C    . LYS A 1 122 ? 7.088   1.116   15.045  1.00 34.42 ? 117 LYS A C    4  
ATOM 9213  O O    . LYS A 1 122 ? 6.755   0.580   16.102  1.00 13.44 ? 117 LYS A O    4  
ATOM 9214  C CB   . LYS A 1 122 ? 6.231   3.385   15.661  1.00 40.33 ? 117 LYS A CB   4  
ATOM 9215  C CG   . LYS A 1 122 ? 6.050   4.808   15.164  1.00 21.11 ? 117 LYS A CG   4  
ATOM 9216  C CD   . LYS A 1 122 ? 5.197   5.627   16.118  1.00 63.24 ? 117 LYS A CD   4  
ATOM 9217  C CE   . LYS A 1 122 ? 5.838   6.973   16.422  1.00 23.54 ? 117 LYS A CE   4  
ATOM 9218  N NZ   . LYS A 1 122 ? 4.899   7.886   17.131  1.00 71.41 ? 117 LYS A NZ   4  
ATOM 9219  H H    . LYS A 1 122 ? 4.270   2.573   14.248  1.00 70.21 ? 117 LYS A H    4  
ATOM 9220  H HA   . LYS A 1 122 ? 6.925   2.785   13.726  1.00 31.05 ? 117 LYS A HA   4  
ATOM 9221  H HB3  . LYS A 1 122 ? 7.126   3.349   16.266  1.00 22.12 ? 117 LYS A HB3  4  
ATOM 9222  H HG3  . LYS A 1 122 ? 5.569   4.783   14.197  1.00 22.24 ? 117 LYS A HG3  4  
ATOM 9223  H HD3  . LYS A 1 122 ? 5.078   5.079   17.042  1.00 34.33 ? 117 LYS A HD3  4  
ATOM 9224  H HE3  . LYS A 1 122 ? 6.139   7.432   15.491  1.00 60.33 ? 117 LYS A HE3  4  
ATOM 9225  H HZ1  . LYS A 1 122 ? 4.520   8.593   16.469  1.00 2.21  ? 117 LYS A HZ1  4  
ATOM 9226  H HZ2  . LYS A 1 122 ? 5.395   8.380   17.901  1.00 20.23 ? 117 LYS A HZ2  4  
ATOM 9227  H HZ3  . LYS A 1 122 ? 4.108   7.345   17.533  1.00 75.13 ? 117 LYS A HZ3  4  
ATOM 9228  N N    . GLU A 1 123 ? 8.085   0.670   14.288  1.00 12.11 ? 118 GLU A N    4  
ATOM 9229  C CA   . GLU A 1 123 ? 8.862   -0.505  14.665  1.00 54.25 ? 118 GLU A CA   4  
ATOM 9230  C C    . GLU A 1 123 ? 8.028   -1.776  14.531  1.00 1.04  ? 118 GLU A C    4  
ATOM 9231  O O    . GLU A 1 123 ? 8.040   -2.636  15.412  1.00 33.33 ? 118 GLU A O    4  
ATOM 9232  C CB   . GLU A 1 123 ? 9.373   -0.367  16.101  1.00 4.51  ? 118 GLU A CB   4  
ATOM 9233  C CG   . GLU A 1 123 ? 10.735  -1.001  16.326  1.00 44.31 ? 118 GLU A CG   4  
ATOM 9234  C CD   . GLU A 1 123 ? 11.003  -1.305  17.787  1.00 1.22  ? 118 GLU A CD   4  
ATOM 9235  O OE1  . GLU A 1 123 ? 11.179  -0.347  18.568  1.00 71.42 ? 118 GLU A OE1  4  
ATOM 9236  O OE2  . GLU A 1 123 ? 11.038  -2.499  18.148  1.00 73.21 ? 118 GLU A OE2  4  
ATOM 9237  H H    . GLU A 1 123 ? 8.301   1.141   13.457  1.00 40.43 ? 118 GLU A H    4  
ATOM 9238  H HA   . GLU A 1 123 ? 9.707   -0.571  13.998  1.00 5.51  ? 118 GLU A HA   4  
ATOM 9239  H HB3  . GLU A 1 123 ? 8.666   -0.837  16.768  1.00 21.10 ? 118 GLU A HB3  4  
ATOM 9240  H HG3  . GLU A 1 123 ? 11.497  -0.323  15.968  1.00 13.41 ? 118 GLU A HG3  4  
ATOM 9241  N N    . HIS A 1 124 ? 7.304   -1.887  13.421  1.00 1.40  ? 119 HIS A N    4  
ATOM 9242  C CA   . HIS A 1 124 ? 6.464   -3.052  13.169  1.00 74.24 ? 119 HIS A CA   4  
ATOM 9243  C C    . HIS A 1 124 ? 5.738   -2.921  11.834  1.00 1.31  ? 119 HIS A C    4  
ATOM 9244  O O    . HIS A 1 124 ? 5.417   -1.816  11.397  1.00 70.41 ? 119 HIS A O    4  
ATOM 9245  C CB   . HIS A 1 124 ? 5.450   -3.228  14.299  1.00 14.24 ? 119 HIS A CB   4  
ATOM 9246  C CG   . HIS A 1 124 ? 5.330   -4.642  14.783  1.00 65.43 ? 119 HIS A CG   4  
ATOM 9247  N ND1  . HIS A 1 124 ? 4.949   -5.686  13.967  1.00 51.51 ? 119 HIS A ND1  4  
ATOM 9248  C CD2  . HIS A 1 124 ? 5.547   -5.179  16.006  1.00 2.34  ? 119 HIS A CD2  4  
ATOM 9249  C CE1  . HIS A 1 124 ? 4.934   -6.806  14.669  1.00 44.32 ? 119 HIS A CE1  4  
ATOM 9250  N NE2  . HIS A 1 124 ? 5.294   -6.526  15.908  1.00 33.21 ? 119 HIS A NE2  4  
ATOM 9251  H H    . HIS A 1 124 ? 7.338   -1.168  12.755  1.00 31.13 ? 119 HIS A H    4  
ATOM 9252  H HA   . HIS A 1 124 ? 7.104   -3.921  13.133  1.00 65.31 ? 119 HIS A HA   4  
ATOM 9253  H HB3  . HIS A 1 124 ? 4.476   -2.912  13.953  1.00 11.51 ? 119 HIS A HB3  4  
ATOM 9254  H HD1  . HIS A 1 124 ? 4.722   -5.616  13.017  1.00 13.44 ? 119 HIS A HD1  4  
ATOM 9255  H HD2  . HIS A 1 124 ? 5.860   -4.649  16.894  1.00 32.32 ? 119 HIS A HD2  4  
ATOM 9256  H HE1  . HIS A 1 124 ? 4.674   -7.783  14.292  1.00 75.43 ? 119 HIS A HE1  4  
ATOM 9257  N N    . TRP A 1 125 ? 5.486   -4.054  11.190  1.00 11.24 ? 120 TRP A N    4  
ATOM 9258  C CA   . TRP A 1 125 ? 4.798   -4.065  9.903   1.00 51.54 ? 120 TRP A CA   4  
ATOM 9259  C C    . TRP A 1 125 ? 3.574   -4.974  9.947   1.00 61.34 ? 120 TRP A C    4  
ATOM 9260  O O    . TRP A 1 125 ? 3.516   -5.915  10.739  1.00 4.32  ? 120 TRP A O    4  
ATOM 9261  C CB   . TRP A 1 125 ? 5.750   -4.526  8.798   1.00 63.11 ? 120 TRP A CB   4  
ATOM 9262  C CG   . TRP A 1 125 ? 6.364   -3.393  8.032   1.00 72.41 ? 120 TRP A CG   4  
ATOM 9263  C CD1  . TRP A 1 125 ? 7.004   -2.304  8.552   1.00 73.23 ? 120 TRP A CD1  4  
ATOM 9264  C CD2  . TRP A 1 125 ? 6.394   -3.237  6.610   1.00 30.02 ? 120 TRP A CD2  4  
ATOM 9265  N NE1  . TRP A 1 125 ? 7.430   -1.481  7.539   1.00 2.12  ? 120 TRP A NE1  4  
ATOM 9266  C CE2  . TRP A 1 125 ? 7.069   -2.031  6.337   1.00 31.34 ? 120 TRP A CE2  4  
ATOM 9267  C CE3  . TRP A 1 125 ? 5.919   -3.999  5.540   1.00 32.25 ? 120 TRP A CE3  4  
ATOM 9268  C CZ2  . TRP A 1 125 ? 7.276   -1.571  5.039   1.00 41.13 ? 120 TRP A CZ2  4  
ATOM 9269  C CZ3  . TRP A 1 125 ? 6.125   -3.542  4.252   1.00 64.22 ? 120 TRP A CZ3  4  
ATOM 9270  C CH2  . TRP A 1 125 ? 6.800   -2.338  4.011   1.00 4.02  ? 120 TRP A CH2  4  
ATOM 9271  H H    . TRP A 1 125 ? 5.767   -4.904  11.589  1.00 10.43 ? 120 TRP A H    4  
ATOM 9272  H HA   . TRP A 1 125 ? 4.476   -3.056  9.692   1.00 40.43 ? 120 TRP A HA   4  
ATOM 9273  H HB3  . TRP A 1 125 ? 5.205   -5.145  8.100   1.00 64.01 ? 120 TRP A HB3  4  
ATOM 9274  H HD1  . TRP A 1 125 ? 7.145   -2.129  9.609   1.00 3.23  ? 120 TRP A HD1  4  
ATOM 9275  H HE1  . TRP A 1 125 ? 7.915   -0.636  7.657   1.00 54.20 ? 120 TRP A HE1  4  
ATOM 9276  H HE3  . TRP A 1 125 ? 5.396   -4.929  5.705   1.00 51.30 ? 120 TRP A HE3  4  
ATOM 9277  H HZ2  . TRP A 1 125 ? 7.796   -0.645  4.837   1.00 15.23 ? 120 TRP A HZ2  4  
ATOM 9278  H HZ3  . TRP A 1 125 ? 5.764   -4.117  3.412   1.00 12.10 ? 120 TRP A HZ3  4  
ATOM 9279  H HH2  . TRP A 1 125 ? 6.939   -2.019  2.989   1.00 1.21  ? 120 TRP A HH2  4  
ATOM 9280  N N    . PHE A 1 126 ? 2.598   -4.685  9.093   1.00 72.43 ? 121 PHE A N    4  
ATOM 9281  C CA   . PHE A 1 126 ? 1.373   -5.475  9.036   1.00 72.24 ? 121 PHE A CA   4  
ATOM 9282  C C    . PHE A 1 126 ? 0.995   -5.788  7.592   1.00 5.21  ? 121 PHE A C    4  
ATOM 9283  O O    . PHE A 1 126 ? 0.978   -4.903  6.736   1.00 51.05 ? 121 PHE A O    4  
ATOM 9284  C CB   . PHE A 1 126 ? 0.228   -4.730  9.726   1.00 11.44 ? 121 PHE A CB   4  
ATOM 9285  C CG   . PHE A 1 126 ? -0.574  -5.595  10.657  1.00 4.32  ? 121 PHE A CG   4  
ATOM 9286  C CD1  . PHE A 1 126 ? -0.055  -5.986  11.880  1.00 12.21 ? 121 PHE A CD1  4  
ATOM 9287  C CD2  . PHE A 1 126 ? -1.847  -6.017  10.308  1.00 44.32 ? 121 PHE A CD2  4  
ATOM 9288  C CE1  . PHE A 1 126 ? -0.790  -6.781  12.739  1.00 12.10 ? 121 PHE A CE1  4  
ATOM 9289  C CE2  . PHE A 1 126 ? -2.587  -6.811  11.163  1.00 42.02 ? 121 PHE A CE2  4  
ATOM 9290  C CZ   . PHE A 1 126 ? -2.058  -7.195  12.379  1.00 73.42 ? 121 PHE A CZ   4  
ATOM 9291  H H    . PHE A 1 126 ? 2.703   -3.921  8.488   1.00 33.02 ? 121 PHE A H    4  
ATOM 9292  H HA   . PHE A 1 126 ? 1.554   -6.402  9.558   1.00 0.22  ? 121 PHE A HA   4  
ATOM 9293  H HB3  . PHE A 1 126 ? -0.441  -4.340  8.974   1.00 62.15 ? 121 PHE A HB3  4  
ATOM 9294  H HD1  . PHE A 1 126 ? 0.937   -5.664  12.163  1.00 64.25 ? 121 PHE A HD1  4  
ATOM 9295  H HD2  . PHE A 1 126 ? -2.262  -5.718  9.356   1.00 74.32 ? 121 PHE A HD2  4  
ATOM 9296  H HE1  . PHE A 1 126 ? -0.373  -7.079  13.690  1.00 1.42  ? 121 PHE A HE1  4  
ATOM 9297  H HE2  . PHE A 1 126 ? -3.578  -7.134  10.879  1.00 24.41 ? 121 PHE A HE2  4  
ATOM 9298  H HZ   . PHE A 1 126 ? -2.634  -7.815  13.049  1.00 4.02  ? 121 PHE A HZ   4  
ATOM 9299  N N    . THR A 1 127 ? 0.691   -7.055  7.328   1.00 45.41 ? 122 THR A N    4  
ATOM 9300  C CA   . THR A 1 127 ? 0.316   -7.487  5.987   1.00 23.32 ? 122 THR A CA   4  
ATOM 9301  C C    . THR A 1 127 ? -1.107  -8.033  5.964   1.00 73.14 ? 122 THR A C    4  
ATOM 9302  O O    . THR A 1 127 ? -1.369  -9.132  6.453   1.00 54.34 ? 122 THR A O    4  
ATOM 9303  C CB   . THR A 1 127 ? 1.277   -8.566  5.454   1.00 24.14 ? 122 THR A CB   4  
ATOM 9304  O OG1  . THR A 1 127 ? 2.625   -8.238  5.805   1.00 14.03 ? 122 THR A OG1  4  
ATOM 9305  C CG2  . THR A 1 127 ? 1.159   -8.697  3.943   1.00 22.24 ? 122 THR A CG2  4  
ATOM 9306  H H    . THR A 1 127 ? 0.723   -7.714  8.051   1.00 14.21 ? 122 THR A H    4  
ATOM 9307  H HA   . THR A 1 127 ? 0.372   -6.629  5.332   1.00 11.20 ? 122 THR A HA   4  
ATOM 9308  H HB   . THR A 1 127 ? 1.015   -9.513  5.904   1.00 51.01 ? 122 THR A HB   4  
ATOM 9309  H HG1  . THR A 1 127 ? 2.984   -8.924  6.374   1.00 60.41 ? 122 THR A HG1  4  
ATOM 9310  H HG21 . THR A 1 127 ? 0.120   -8.826  3.673   1.00 52.40 ? 122 THR A HG21 4  
ATOM 9311  H HG22 . THR A 1 127 ? 1.727   -9.552  3.610   1.00 53.22 ? 122 THR A HG22 4  
ATOM 9312  H HG23 . THR A 1 127 ? 1.543   -7.804  3.473   1.00 21.21 ? 122 THR A HG23 4  
ATOM 9313  N N    . VAL A 1 128 ? -2.025  -7.259  5.394   1.00 13.34 ? 123 VAL A N    4  
ATOM 9314  C CA   . VAL A 1 128 ? -3.421  -7.667  5.306   1.00 31.54 ? 123 VAL A CA   4  
ATOM 9315  C C    . VAL A 1 128 ? -3.785  -8.085  3.886   1.00 62.13 ? 123 VAL A C    4  
ATOM 9316  O O    . VAL A 1 128 ? -3.491  -7.374  2.925   1.00 20.51 ? 123 VAL A O    4  
ATOM 9317  C CB   . VAL A 1 128 ? -4.366  -6.535  5.754   1.00 11.13 ? 123 VAL A CB   4  
ATOM 9318  C CG1  . VAL A 1 128 ? -5.788  -6.811  5.289   1.00 44.20 ? 123 VAL A CG1  4  
ATOM 9319  C CG2  . VAL A 1 128 ? -4.315  -6.365  7.265   1.00 42.33 ? 123 VAL A CG2  4  
ATOM 9320  H H    . VAL A 1 128 ? -1.756  -6.393  5.022   1.00 40.24 ? 123 VAL A H    4  
ATOM 9321  H HA   . VAL A 1 128 ? -3.566  -8.510  5.967   1.00 3.21  ? 123 VAL A HA   4  
ATOM 9322  H HB   . VAL A 1 128 ? -4.033  -5.615  5.298   1.00 22.22 ? 123 VAL A HB   4  
ATOM 9323  H HG11 . VAL A 1 128 ? -6.486  -6.364  5.982   1.00 30.23 ? 123 VAL A HG11 4  
ATOM 9324  H HG12 . VAL A 1 128 ? -5.934  -6.387  4.305   1.00 51.31 ? 123 VAL A HG12 4  
ATOM 9325  H HG13 . VAL A 1 128 ? -5.954  -7.877  5.249   1.00 54.12 ? 123 VAL A HG13 4  
ATOM 9326  H HG21 . VAL A 1 128 ? -4.328  -7.336  7.736   1.00 52.01 ? 123 VAL A HG21 4  
ATOM 9327  H HG22 . VAL A 1 128 ? -3.408  -5.845  7.538   1.00 45.22 ? 123 VAL A HG22 4  
ATOM 9328  H HG23 . VAL A 1 128 ? -5.170  -5.793  7.592   1.00 70.14 ? 123 VAL A HG23 4  
ATOM 9329  N N    . ARG A 1 129 ? -4.425  -9.243  3.761   1.00 23.13 ? 124 ARG A N    4  
ATOM 9330  C CA   . ARG A 1 129 ? -4.828  -9.755  2.457   1.00 5.44  ? 124 ARG A CA   4  
ATOM 9331  C C    . ARG A 1 129 ? -6.286  -10.206 2.476   1.00 42.32 ? 124 ARG A C    4  
ATOM 9332  O O    . ARG A 1 129 ? -6.790  -10.669 3.499   1.00 71.45 ? 124 ARG A O    4  
ATOM 9333  C CB   . ARG A 1 129 ? -3.928  -10.922 2.043   1.00 74.35 ? 124 ARG A CB   4  
ATOM 9334  C CG   . ARG A 1 129 ? -3.018  -10.603 0.868   1.00 70.34 ? 124 ARG A CG   4  
ATOM 9335  C CD   . ARG A 1 129 ? -3.786  -10.594 -0.444  1.00 3.24  ? 124 ARG A CD   4  
ATOM 9336  N NE   . ARG A 1 129 ? -3.464  -11.752 -1.274  1.00 2.10  ? 124 ARG A NE   4  
ATOM 9337  C CZ   . ARG A 1 129 ? -4.246  -12.196 -2.252  1.00 25.21 ? 124 ARG A CZ   4  
ATOM 9338  N NH1  . ARG A 1 129 ? -5.389  -11.581 -2.521  1.00 1.14  ? 124 ARG A NH1  4  
ATOM 9339  N NH2  . ARG A 1 129 ? -3.884  -13.255 -2.964  1.00 41.01 ? 124 ARG A NH2  4  
ATOM 9340  H H    . ARG A 1 129 ? -4.632  -9.764  4.564   1.00 44.41 ? 124 ARG A H    4  
ATOM 9341  H HA   . ARG A 1 129 ? -4.719  -8.957  1.738   1.00 33.51 ? 124 ARG A HA   4  
ATOM 9342  H HB3  . ARG A 1 129 ? -4.549  -11.761 1.772   1.00 35.22 ? 124 ARG A HB3  4  
ATOM 9343  H HG3  . ARG A 1 129 ? -2.239  -11.349 0.815   1.00 23.31 ? 124 ARG A HG3  4  
ATOM 9344  H HD3  . ARG A 1 129 ? -3.538  -9.694  -0.985  1.00 4.31  ? 124 ARG A HD3  4  
ATOM 9345  H HE   . ARG A 1 129 ? -2.623  -12.220 -1.092  1.00 33.04 ? 124 ARG A HE   4  
ATOM 9346  H HH11 . ARG A 1 129 ? -5.664  -10.782 -1.987  1.00 3.23  ? 124 ARG A HH11 4  
ATOM 9347  H HH12 . ARG A 1 129 ? -5.977  -11.916 -3.259  1.00 41.43 ? 124 ARG A HH12 4  
ATOM 9348  H HH21 . ARG A 1 129 ? -3.022  -13.721 -2.764  1.00 35.33 ? 124 ARG A HH21 4  
ATOM 9349  H HH22 . ARG A 1 129 ? -4.473  -13.588 -3.699  1.00 14.32 ? 124 ARG A HH22 4  
ATOM 9350  N N    . LYS A 1 130 ? -6.957  -10.068 1.338   1.00 64.41 ? 125 LYS A N    4  
ATOM 9351  C CA   . LYS A 1 130 ? -8.357  -10.460 1.222   1.00 55.41 ? 125 LYS A CA   4  
ATOM 9352  C C    . LYS A 1 130 ? -8.478  -11.923 0.804   1.00 23.24 ? 125 LYS A C    4  
ATOM 9353  O O    . LYS A 1 130 ? -7.944  -12.330 -0.228  1.00 45.34 ? 125 LYS A O    4  
ATOM 9354  C CB   . LYS A 1 130 ? -9.076  -9.568  0.210   1.00 30.44 ? 125 LYS A CB   4  
ATOM 9355  C CG   . LYS A 1 130 ? -10.472 -10.051 -0.144  1.00 54.53 ? 125 LYS A CG   4  
ATOM 9356  C CD   . LYS A 1 130 ? -11.460 -8.900  -0.215  1.00 23.41 ? 125 LYS A CD   4  
ATOM 9357  C CE   . LYS A 1 130 ? -12.273 -8.783  1.066   1.00 44.34 ? 125 LYS A CE   4  
ATOM 9358  N NZ   . LYS A 1 130 ? -13.240 -9.905  1.213   1.00 1.41  ? 125 LYS A NZ   4  
ATOM 9359  H H    . LYS A 1 130 ? -6.499  -9.693  0.555   1.00 34.30 ? 125 LYS A H    4  
ATOM 9360  H HA   . LYS A 1 130 ? -8.817  -10.336 2.191   1.00 13.43 ? 125 LYS A HA   4  
ATOM 9361  H HB3  . LYS A 1 130 ? -8.491  -9.529  -0.698  1.00 64.42 ? 125 LYS A HB3  4  
ATOM 9362  H HG3  . LYS A 1 130 ? -10.802 -10.752 0.610   1.00 31.03 ? 125 LYS A HG3  4  
ATOM 9363  H HD3  . LYS A 1 130 ? -12.133 -9.065  -1.044  1.00 4.24  ? 125 LYS A HD3  4  
ATOM 9364  H HE3  . LYS A 1 130 ? -12.817 -7.850  1.047   1.00 41.05 ? 125 LYS A HE3  4  
ATOM 9365  H HZ1  . LYS A 1 130 ? -12.819 -10.788 0.860   1.00 34.21 ? 125 LYS A HZ1  4  
ATOM 9366  H HZ2  . LYS A 1 130 ? -14.104 -9.706  0.671   1.00 22.03 ? 125 LYS A HZ2  4  
ATOM 9367  H HZ3  . LYS A 1 130 ? -13.493 -10.030 2.214   1.00 62.13 ? 125 LYS A HZ3  4  
ATOM 9368  N N    . LEU A 1 131 ? -9.186  -12.707 1.610   1.00 10.34 ? 126 LEU A N    4  
ATOM 9369  C CA   . LEU A 1 131 ? -9.380  -14.124 1.322   1.00 51.22 ? 126 LEU A CA   4  
ATOM 9370  C C    . LEU A 1 131 ? -10.860 -14.490 1.358   1.00 74.25 ? 126 LEU A C    4  
ATOM 9371  O O    . LEU A 1 131 ? -11.530 -14.305 2.374   1.00 15.32 ? 126 LEU A O    4  
ATOM 9372  C CB   . LEU A 1 131 ? -8.606  -14.979 2.327   1.00 41.34 ? 126 LEU A CB   4  
ATOM 9373  C CG   . LEU A 1 131 ? -7.196  -15.399 1.908   1.00 25.25 ? 126 LEU A CG   4  
ATOM 9374  C CD1  . LEU A 1 131 ? -6.228  -14.236 2.052   1.00 62.22 ? 126 LEU A CD1  4  
ATOM 9375  C CD2  . LEU A 1 131 ? -6.729  -16.591 2.729   1.00 63.14 ? 126 LEU A CD2  4  
ATOM 9376  H H    . LEU A 1 131 ? -9.588  -12.325 2.417   1.00 72.25 ? 126 LEU A H    4  
ATOM 9377  H HA   . LEU A 1 131 ? -8.998  -14.315 0.329   1.00 55.05 ? 126 LEU A HA   4  
ATOM 9378  H HB3  . LEU A 1 131 ? -9.180  -15.876 2.507   1.00 13.32 ? 126 LEU A HB3  4  
ATOM 9379  H HG   . LEU A 1 131 ? -7.211  -15.693 0.867   1.00 20.30 ? 126 LEU A HG   4  
ATOM 9380  H HD11 . LEU A 1 131 ? -5.458  -14.495 2.763   1.00 42.41 ? 126 LEU A HD11 4  
ATOM 9381  H HD12 . LEU A 1 131 ? -6.762  -13.364 2.402   1.00 5.22  ? 126 LEU A HD12 4  
ATOM 9382  H HD13 . LEU A 1 131 ? -5.777  -14.021 1.094   1.00 0.04  ? 126 LEU A HD13 4  
ATOM 9383  H HD21 . LEU A 1 131 ? -5.650  -16.639 2.709   1.00 52.24 ? 126 LEU A HD21 4  
ATOM 9384  H HD22 . LEU A 1 131 ? -7.137  -17.499 2.311   1.00 3.41  ? 126 LEU A HD22 4  
ATOM 9385  H HD23 . LEU A 1 131 ? -7.065  -16.480 3.748   1.00 31.20 ? 126 LEU A HD23 4  
ATOM 9386  N N    . GLY A 1 132 ? -11.363 -15.011 0.244   1.00 51.01 ? 127 GLY A N    4  
ATOM 9387  C CA   . GLY A 1 132 ? -12.761 -15.397 0.171   1.00 53.15 ? 127 GLY A CA   4  
ATOM 9388  C C    . GLY A 1 132 ? -13.696 -14.211 0.296   1.00 32.04 ? 127 GLY A C    4  
ATOM 9389  O O    . GLY A 1 132 ? -13.965 -13.516 -0.684  1.00 2.15  ? 127 GLY A O    4  
ATOM 9390  H H    . GLY A 1 132 ? -10.781 -15.135 -0.535  1.00 31.52 ? 127 GLY A H    4  
ATOM 9391  H HA2  . GLY A 1 132 ? -12.939 -15.884 -0.776  1.00 55.30 ? 127 GLY A HA2  4  
ATOM 9392  H HA3  . GLY A 1 132 ? -12.973 -16.093 0.969   1.00 41.34 ? 127 GLY A HA3  4  
ATOM 9393  N N    . LYS A 1 133 ? -14.197 -13.979 1.505   1.00 21.30 ? 128 LYS A N    4  
ATOM 9394  C CA   . LYS A 1 133 ? -15.109 -12.869 1.756   1.00 14.13 ? 128 LYS A CA   4  
ATOM 9395  C C    . LYS A 1 133 ? -14.686 -12.087 2.995   1.00 22.34 ? 128 LYS A C    4  
ATOM 9396  O O    . LYS A 1 133 ? -15.417 -11.219 3.470   1.00 3.21  ? 128 LYS A O    4  
ATOM 9397  C CB   . LYS A 1 133 ? -16.539 -13.387 1.930   1.00 4.31  ? 128 LYS A CB   4  
ATOM 9398  C CG   . LYS A 1 133 ? -16.687 -14.394 3.057   1.00 74.43 ? 128 LYS A CG   4  
ATOM 9399  C CD   . LYS A 1 133 ? -17.248 -15.714 2.556   1.00 12.50 ? 128 LYS A CD   4  
ATOM 9400  C CE   . LYS A 1 133 ? -17.967 -16.471 3.661   1.00 53.23 ? 128 LYS A CE   4  
ATOM 9401  N NZ   . LYS A 1 133 ? -17.011 -17.131 4.594   1.00 24.45 ? 128 LYS A NZ   4  
ATOM 9402  H H    . LYS A 1 133 ? -13.945 -14.568 2.247   1.00 10.02 ? 128 LYS A H    4  
ATOM 9403  H HA   . LYS A 1 133 ? -15.075 -12.212 0.900   1.00 34.40 ? 128 LYS A HA   4  
ATOM 9404  H HB3  . LYS A 1 133 ? -16.852 -13.859 1.010   1.00 14.53 ? 128 LYS A HB3  4  
ATOM 9405  H HG3  . LYS A 1 133 ? -17.357 -13.990 3.803   1.00 21.30 ? 128 LYS A HG3  4  
ATOM 9406  H HD3  . LYS A 1 133 ? -16.436 -16.323 2.185   1.00 44.52 ? 128 LYS A HD3  4  
ATOM 9407  H HE3  . LYS A 1 133 ? -18.597 -17.224 3.213   1.00 35.42 ? 128 LYS A HE3  4  
ATOM 9408  H HZ1  . LYS A 1 133 ? -17.530 -17.599 5.365   1.00 2.21  ? 128 LYS A HZ1  4  
ATOM 9409  H HZ2  . LYS A 1 133 ? -16.367 -16.425 5.004   1.00 30.02 ? 128 LYS A HZ2  4  
ATOM 9410  H HZ3  . LYS A 1 133 ? -16.449 -17.843 4.085   1.00 73.42 ? 128 LYS A HZ3  4  
ATOM 9411  N N    . GLN A 1 134 ? -13.502 -12.400 3.511   1.00 23.01 ? 129 GLN A N    4  
ATOM 9412  C CA   . GLN A 1 134 ? -12.982 -11.724 4.694   1.00 34.24 ? 129 GLN A CA   4  
ATOM 9413  C C    . GLN A 1 134 ? -11.487 -11.459 4.557   1.00 23.42 ? 129 GLN A C    4  
ATOM 9414  O O    . GLN A 1 134 ? -10.815 -12.058 3.718   1.00 43.40 ? 129 GLN A O    4  
ATOM 9415  C CB   . GLN A 1 134 ? -13.250 -12.563 5.945   1.00 31.53 ? 129 GLN A CB   4  
ATOM 9416  C CG   . GLN A 1 134 ? -14.707 -12.965 6.106   1.00 35.32 ? 129 GLN A CG   4  
ATOM 9417  C CD   . GLN A 1 134 ? -14.961 -13.740 7.385   1.00 60.13 ? 129 GLN A CD   4  
ATOM 9418  O OE1  . GLN A 1 134 ? -15.725 -13.304 8.247   1.00 23.12 ? 129 GLN A OE1  4  
ATOM 9419  N NE2  . GLN A 1 134 ? -14.320 -14.896 7.515   1.00 64.45 ? 129 GLN A NE2  4  
ATOM 9420  H H    . GLN A 1 134 ? -12.966 -13.101 3.087   1.00 44.11 ? 129 GLN A H    4  
ATOM 9421  H HA   . GLN A 1 134 ? -13.496 -10.779 4.789   1.00 32.13 ? 129 GLN A HA   4  
ATOM 9422  H HB3  . GLN A 1 134 ? -12.959 -11.993 6.815   1.00 11.22 ? 129 GLN A HB3  4  
ATOM 9423  H HG3  . GLN A 1 134 ? -14.992 -13.582 5.267   1.00 14.13 ? 129 GLN A HG3  4  
ATOM 9424  H HE21 . GLN A 1 134 ? -13.726 -15.178 6.788   1.00 51.42 ? 129 GLN A HE21 4  
ATOM 9425  H HE22 . GLN A 1 134 ? -14.464 -15.416 8.331   1.00 61.33 ? 129 GLN A HE22 4  
ATOM 9426  N N    . TRP A 1 135 ? -10.973 -10.558 5.386   1.00 23.11 ? 130 TRP A N    4  
ATOM 9427  C CA   . TRP A 1 135 ? -9.556  -10.212 5.356   1.00 33.05 ? 130 TRP A CA   4  
ATOM 9428  C C    . TRP A 1 135 ? -8.773  -11.037 6.372   1.00 31.34 ? 130 TRP A C    4  
ATOM 9429  O O    . TRP A 1 135 ? -9.350  -11.609 7.298   1.00 50.43 ? 130 TRP A O    4  
ATOM 9430  C CB   . TRP A 1 135 ? -9.368  -8.720  5.637   1.00 55.44 ? 130 TRP A CB   4  
ATOM 9431  C CG   . TRP A 1 135 ? -9.872  -7.840  4.535   1.00 42.23 ? 130 TRP A CG   4  
ATOM 9432  C CD1  . TRP A 1 135 ? -11.129 -7.321  4.410   1.00 71.14 ? 130 TRP A CD1  4  
ATOM 9433  C CD2  . TRP A 1 135 ? -9.130  -7.378  3.400   1.00 70.25 ? 130 TRP A CD2  4  
ATOM 9434  N NE1  . TRP A 1 135 ? -11.213 -6.564  3.267   1.00 24.31 ? 130 TRP A NE1  4  
ATOM 9435  C CE2  . TRP A 1 135 ? -10.000 -6.581  2.631   1.00 10.53 ? 130 TRP A CE2  4  
ATOM 9436  C CE3  . TRP A 1 135 ? -7.815  -7.557  2.962   1.00 61.51 ? 130 TRP A CE3  4  
ATOM 9437  C CZ2  . TRP A 1 135 ? -9.596  -5.969  1.447   1.00 63.51 ? 130 TRP A CZ2  4  
ATOM 9438  C CZ3  . TRP A 1 135 ? -7.417  -6.947  1.787   1.00 52.43 ? 130 TRP A CZ3  4  
ATOM 9439  C CH2  . TRP A 1 135 ? -8.304  -6.161  1.042   1.00 22.12 ? 130 TRP A CH2  4  
ATOM 9440  H H    . TRP A 1 135 ? -11.559 -10.114 6.034   1.00 24.45 ? 130 TRP A H    4  
ATOM 9441  H HA   . TRP A 1 135 ? -9.183  -10.433 4.367   1.00 44.21 ? 130 TRP A HA   4  
ATOM 9442  H HB3  . TRP A 1 135 ? -8.315  -8.518  5.773   1.00 13.02 ? 130 TRP A HB3  4  
ATOM 9443  H HD1  . TRP A 1 135 ? -11.929 -7.491  5.113   1.00 33.31 ? 130 TRP A HD1  4  
ATOM 9444  H HE1  . TRP A 1 135 ? -12.012 -6.085  2.958   1.00 55.21 ? 130 TRP A HE1  4  
ATOM 9445  H HE3  . TRP A 1 135 ? -7.116  -8.159  3.523   1.00 31.22 ? 130 TRP A HE3  4  
ATOM 9446  H HZ2  . TRP A 1 135 ? -10.268 -5.359  0.861   1.00 63.42 ? 130 TRP A HZ2  4  
ATOM 9447  H HZ3  . TRP A 1 135 ? -6.404  -7.075  1.433   1.00 23.54 ? 130 TRP A HZ3  4  
ATOM 9448  H HH2  . TRP A 1 135 ? -7.949  -5.704  0.131   1.00 5.44  ? 130 TRP A HH2  4  
ATOM 9449  N N    . PHE A 1 136 ? -7.458  -11.094 6.194   1.00 51.01 ? 131 PHE A N    4  
ATOM 9450  C CA   . PHE A 1 136 ? -6.597  -11.850 7.096   1.00 44.11 ? 131 PHE A CA   4  
ATOM 9451  C C    . PHE A 1 136 ? -5.291  -11.105 7.352   1.00 70.34 ? 131 PHE A C    4  
ATOM 9452  O O    . PHE A 1 136 ? -4.809  -10.362 6.498   1.00 72.01 ? 131 PHE A O    4  
ATOM 9453  C CB   . PHE A 1 136 ? -6.301  -13.234 6.513   1.00 22.15 ? 131 PHE A CB   4  
ATOM 9454  C CG   . PHE A 1 136 ? -7.382  -14.241 6.782   1.00 40.10 ? 131 PHE A CG   4  
ATOM 9455  C CD1  . PHE A 1 136 ? -8.584  -14.188 6.095   1.00 43.32 ? 131 PHE A CD1  4  
ATOM 9456  C CD2  . PHE A 1 136 ? -7.196  -15.241 7.722   1.00 74.43 ? 131 PHE A CD2  4  
ATOM 9457  C CE1  . PHE A 1 136 ? -9.581  -15.113 6.340   1.00 54.35 ? 131 PHE A CE1  4  
ATOM 9458  C CE2  . PHE A 1 136 ? -8.188  -16.170 7.972   1.00 11.15 ? 131 PHE A CE2  4  
ATOM 9459  C CZ   . PHE A 1 136 ? -9.383  -16.106 7.280   1.00 73.35 ? 131 PHE A CZ   4  
ATOM 9460  H H    . PHE A 1 136 ? -7.057  -10.617 5.437   1.00 34.21 ? 131 PHE A H    4  
ATOM 9461  H HA   . PHE A 1 136 ? -7.120  -11.968 8.032   1.00 72.33 ? 131 PHE A HA   4  
ATOM 9462  H HB3  . PHE A 1 136 ? -5.383  -13.607 6.941   1.00 11.54 ? 131 PHE A HB3  4  
ATOM 9463  H HD1  . PHE A 1 136 ? -8.740  -13.412 5.358   1.00 72.24 ? 131 PHE A HD1  4  
ATOM 9464  H HD2  . PHE A 1 136 ? -6.263  -15.292 8.265   1.00 41.31 ? 131 PHE A HD2  4  
ATOM 9465  H HE1  . PHE A 1 136 ? -10.513 -15.060 5.798   1.00 41.53 ? 131 PHE A HE1  4  
ATOM 9466  H HE2  . PHE A 1 136 ? -8.032  -16.945 8.708   1.00 43.03 ? 131 PHE A HE2  4  
ATOM 9467  H HZ   . PHE A 1 136 ? -10.159 -16.830 7.474   1.00 13.04 ? 131 PHE A HZ   4  
ATOM 9468  N N    . ASN A 1 137 ? -4.723  -11.308 8.538   1.00 41.11 ? 132 ASN A N    4  
ATOM 9469  C CA   . ASN A 1 137 ? -3.473  -10.654 8.909   1.00 33.03 ? 132 ASN A CA   4  
ATOM 9470  C C    . ASN A 1 137 ? -2.315  -11.648 8.899   1.00 32.44 ? 132 ASN A C    4  
ATOM 9471  O O    . ASN A 1 137 ? -2.428  -12.754 9.432   1.00 63.43 ? 132 ASN A O    4  
ATOM 9472  C CB   . ASN A 1 137 ? -3.599  -10.014 10.292  1.00 34.21 ? 132 ASN A CB   4  
ATOM 9473  C CG   . ASN A 1 137 ? -2.297  -10.050 11.067  1.00 52.15 ? 132 ASN A CG   4  
ATOM 9474  O OD1  . ASN A 1 137 ? -2.224  -10.620 12.157  1.00 2.35  ? 132 ASN A OD1  4  
ATOM 9475  N ND2  . ASN A 1 137 ? -1.259  -9.439  10.508  1.00 52.32 ? 132 ASN A ND2  4  
ATOM 9476  H H    . ASN A 1 137 ? -5.155  -11.912 9.177   1.00 61.24 ? 132 ASN A H    4  
ATOM 9477  H HA   . ASN A 1 137 ? -3.275  -9.882  8.182   1.00 24.11 ? 132 ASN A HA   4  
ATOM 9478  H HB3  . ASN A 1 137 ? -4.350  -10.543 10.860  1.00 73.51 ? 132 ASN A HB3  4  
ATOM 9479  H HD21 . ASN A 1 137 ? -1.390  -9.006  9.639   1.00 65.33 ? 132 ASN A HD21 4  
ATOM 9480  H HD22 . ASN A 1 137 ? -0.404  -9.448  10.987  1.00 43.35 ? 132 ASN A HD22 4  
ATOM 9481  N N    . LEU A 1 138 ? -1.205  -11.248 8.291   1.00 15.43 ? 133 LEU A N    4  
ATOM 9482  C CA   . LEU A 1 138 ? -0.025  -12.104 8.213   1.00 24.51 ? 133 LEU A CA   4  
ATOM 9483  C C    . LEU A 1 138 ? 1.252   -11.284 8.366   1.00 72.40 ? 133 LEU A C    4  
ATOM 9484  O O    . LEU A 1 138 ? 1.278   -10.093 8.058   1.00 53.41 ? 133 LEU A O    4  
ATOM 9485  C CB   . LEU A 1 138 ? -0.005  -12.856 6.881   1.00 52.44 ? 133 LEU A CB   4  
ATOM 9486  C CG   . LEU A 1 138 ? -1.042  -12.419 5.847   1.00 40.52 ? 133 LEU A CG   4  
ATOM 9487  C CD1  . LEU A 1 138 ? -0.584  -12.786 4.444   1.00 0.12  ? 133 LEU A CD1  4  
ATOM 9488  C CD2  . LEU A 1 138 ? -2.395  -13.046 6.149   1.00 14.10 ? 133 LEU A CD2  4  
ATOM 9489  H H    . LEU A 1 138 ? -1.176  -10.358 7.885   1.00 25.23 ? 133 LEU A H    4  
ATOM 9490  H HA   . LEU A 1 138 ? -0.080  -12.818 9.020   1.00 61.03 ? 133 LEU A HA   4  
ATOM 9491  H HB3  . LEU A 1 138 ? -0.169  -13.904 7.093   1.00 45.53 ? 133 LEU A HB3  4  
ATOM 9492  H HG   . LEU A 1 138 ? -1.153  -11.344 5.890   1.00 13.05 ? 133 LEU A HG   4  
ATOM 9493  H HD11 . LEU A 1 138 ? 0.292   -12.209 4.188   1.00 20.11 ? 133 LEU A HD11 4  
ATOM 9494  H HD12 . LEU A 1 138 ? -1.375  -12.571 3.739   1.00 52.22 ? 133 LEU A HD12 4  
ATOM 9495  H HD13 . LEU A 1 138 ? -0.346  -13.839 4.407   1.00 5.51  ? 133 LEU A HD13 4  
ATOM 9496  H HD21 . LEU A 1 138 ? -2.263  -13.872 6.832   1.00 11.54 ? 133 LEU A HD21 4  
ATOM 9497  H HD22 . LEU A 1 138 ? -2.839  -13.404 5.232   1.00 24.44 ? 133 LEU A HD22 4  
ATOM 9498  H HD23 . LEU A 1 138 ? -3.041  -12.308 6.599   1.00 24.41 ? 133 LEU A HD23 4  
ATOM 9499  N N    . ASN A 1 139 ? 2.311   -11.932 8.843   1.00 30.35 ? 134 ASN A N    4  
ATOM 9500  C CA   . ASN A 1 139 ? 3.592   -11.263 9.035   1.00 53.21 ? 134 ASN A CA   4  
ATOM 9501  C C    . ASN A 1 139 ? 4.637   -12.236 9.575   1.00 61.32 ? 134 ASN A C    4  
ATOM 9502  O O    . ASN A 1 139 ? 4.299   -13.262 10.165  1.00 21.03 ? 134 ASN A O    4  
ATOM 9503  C CB   . ASN A 1 139 ? 3.436   -10.081 9.995   1.00 4.31  ? 134 ASN A CB   4  
ATOM 9504  C CG   . ASN A 1 139 ? 4.335   -8.916  9.628   1.00 0.15  ? 134 ASN A CG   4  
ATOM 9505  O OD1  . ASN A 1 139 ? 3.873   -7.903  9.103   1.00 13.30 ? 134 ASN A OD1  4  
ATOM 9506  N ND2  . ASN A 1 139 ? 5.626   -9.056  9.905   1.00 3.34  ? 134 ASN A ND2  4  
ATOM 9507  H H    . ASN A 1 139 ? 2.228   -12.881 9.071   1.00 10.32 ? 134 ASN A H    4  
ATOM 9508  H HA   . ASN A 1 139 ? 3.922   -10.895 8.076   1.00 1.50  ? 134 ASN A HA   4  
ATOM 9509  H HB3  . ASN A 1 139 ? 3.682   -10.402 10.996  1.00 4.55  ? 134 ASN A HB3  4  
ATOM 9510  H HD21 . ASN A 1 139 ? 5.922   -9.891  10.323  1.00 52.34 ? 134 ASN A HD21 4  
ATOM 9511  H HD22 . ASN A 1 139 ? 6.230   -8.318  9.678   1.00 30.51 ? 134 ASN A HD22 4  
ATOM 9512  N N    . SER A 1 140 ? 5.908   -11.905 9.369   1.00 41.12 ? 135 SER A N    4  
ATOM 9513  C CA   . SER A 1 140 ? 7.003   -12.749 9.832   1.00 14.05 ? 135 SER A CA   4  
ATOM 9514  C C    . SER A 1 140 ? 6.924   -12.962 11.341  1.00 4.21  ? 135 SER A C    4  
ATOM 9515  O O    . SER A 1 140 ? 7.472   -13.929 11.872  1.00 70.52 ? 135 SER A O    4  
ATOM 9516  C CB   . SER A 1 140 ? 8.349   -12.124 9.462   1.00 33.13 ? 135 SER A CB   4  
ATOM 9517  O OG   . SER A 1 140 ? 8.179   -10.817 8.941   1.00 34.03 ? 135 SER A OG   4  
ATOM 9518  H H    . SER A 1 140 ? 6.113   -11.074 8.892   1.00 62.25 ? 135 SER A H    4  
ATOM 9519  H HA   . SER A 1 140 ? 6.913   -13.707 9.340   1.00 20.02 ? 135 SER A HA   4  
ATOM 9520  H HB3  . SER A 1 140 ? 8.834   -12.736 8.716   1.00 11.34 ? 135 SER A HB3  4  
ATOM 9521  H HG   . SER A 1 140 ? 8.232   -10.845 7.983   1.00 41.50 ? 135 SER A HG   4  
ATOM 9522  N N    . LEU A 1 141 ? 6.241   -12.051 12.024  1.00 74.24 ? 136 LEU A N    4  
ATOM 9523  C CA   . LEU A 1 141 ? 6.090   -12.137 13.474  1.00 4.33  ? 136 LEU A CA   4  
ATOM 9524  C C    . LEU A 1 141 ? 4.826   -12.906 13.844  1.00 53.10 ? 136 LEU A C    4  
ATOM 9525  O O    . LEU A 1 141 ? 4.720   -13.456 14.942  1.00 1.24  ? 136 LEU A O    4  
ATOM 9526  C CB   . LEU A 1 141 ? 6.046   -10.736 14.085  1.00 13.43 ? 136 LEU A CB   4  
ATOM 9527  C CG   . LEU A 1 141 ? 5.972   -10.673 15.611  1.00 65.41 ? 136 LEU A CG   4  
ATOM 9528  C CD1  . LEU A 1 141 ? 4.535   -10.837 16.083  1.00 23.20 ? 136 LEU A CD1  4  
ATOM 9529  C CD2  . LEU A 1 141 ? 6.864   -11.735 16.234  1.00 54.31 ? 136 LEU A CD2  4  
ATOM 9530  H H    . LEU A 1 141 ? 5.827   -11.304 11.546  1.00 41.34 ? 136 LEU A H    4  
ATOM 9531  H HA   . LEU A 1 141 ? 6.946   -12.666 13.865  1.00 44.05 ? 136 LEU A HA   4  
ATOM 9532  H HB3  . LEU A 1 141 ? 5.177   -10.230 13.689  1.00 23.10 ? 136 LEU A HB3  4  
ATOM 9533  H HG   . LEU A 1 141 ? 6.322   -9.704  15.942  1.00 12.34 ? 136 LEU A HG   4  
ATOM 9534  H HD11 . LEU A 1 141 ? 3.880   -10.900 15.227  1.00 53.40 ? 136 LEU A HD11 4  
ATOM 9535  H HD12 . LEU A 1 141 ? 4.256   -9.987  16.687  1.00 20.44 ? 136 LEU A HD12 4  
ATOM 9536  H HD13 . LEU A 1 141 ? 4.451   -11.738 16.670  1.00 14.35 ? 136 LEU A HD13 4  
ATOM 9537  H HD21 . LEU A 1 141 ? 7.246   -11.376 17.178  1.00 34.43 ? 136 LEU A HD21 4  
ATOM 9538  H HD22 . LEU A 1 141 ? 7.690   -11.946 15.569  1.00 73.33 ? 136 LEU A HD22 4  
ATOM 9539  H HD23 . LEU A 1 141 ? 6.292   -12.636 16.395  1.00 35.12 ? 136 LEU A HD23 4  
ATOM 9540  N N    . LEU A 1 142 ? 3.870   -12.943 12.923  1.00 4.34  ? 137 LEU A N    4  
ATOM 9541  C CA   . LEU A 1 142 ? 2.613   -13.648 13.152  1.00 4.12  ? 137 LEU A CA   4  
ATOM 9542  C C    . LEU A 1 142 ? 2.766   -15.139 12.873  1.00 42.51 ? 137 LEU A C    4  
ATOM 9543  O O    . LEU A 1 142 ? 2.841   -15.563 11.719  1.00 63.23 ? 137 LEU A O    4  
ATOM 9544  C CB   . LEU A 1 142 ? 1.510   -13.062 12.269  1.00 2.41  ? 137 LEU A CB   4  
ATOM 9545  C CG   . LEU A 1 142 ? 0.733   -11.884 12.856  1.00 61.04 ? 137 LEU A CG   4  
ATOM 9546  C CD1  . LEU A 1 142 ? 0.051   -12.288 14.154  1.00 44.03 ? 137 LEU A CD1  4  
ATOM 9547  C CD2  . LEU A 1 142 ? 1.658   -10.697 13.085  1.00 1.42  ? 137 LEU A CD2  4  
ATOM 9548  H H    . LEU A 1 142 ? 4.012   -12.487 12.068  1.00 63.02 ? 137 LEU A H    4  
ATOM 9549  H HA   . LEU A 1 142 ? 2.343   -13.513 14.188  1.00 34.35 ? 137 LEU A HA   4  
ATOM 9550  H HB3  . LEU A 1 142 ? 0.803   -13.853 12.057  1.00 5.24  ? 137 LEU A HB3  4  
ATOM 9551  H HG   . LEU A 1 142 ? -0.034  -11.581 12.157  1.00 44.32 ? 137 LEU A HG   4  
ATOM 9552  H HD11 . LEU A 1 142 ? -0.925  -11.831 14.205  1.00 33.24 ? 137 LEU A HD11 4  
ATOM 9553  H HD12 . LEU A 1 142 ? 0.647   -11.957 14.992  1.00 43.33 ? 137 LEU A HD12 4  
ATOM 9554  H HD13 . LEU A 1 142 ? -0.051  -13.363 14.187  1.00 65.35 ? 137 LEU A HD13 4  
ATOM 9555  H HD21 . LEU A 1 142 ? 1.974   -10.299 12.132  1.00 65.54 ? 137 LEU A HD21 4  
ATOM 9556  H HD22 . LEU A 1 142 ? 2.524   -11.018 13.646  1.00 5.40  ? 137 LEU A HD22 4  
ATOM 9557  H HD23 . LEU A 1 142 ? 1.134   -9.933  13.639  1.00 23.41 ? 137 LEU A HD23 4  
ATOM 9558  N N    . THR A 1 143 ? 2.809   -15.934 13.938  1.00 43.32 ? 138 THR A N    4  
ATOM 9559  C CA   . THR A 1 143 ? 2.953   -17.379 13.809  1.00 23.52 ? 138 THR A CA   4  
ATOM 9560  C C    . THR A 1 143 ? 1.861   -17.962 12.918  1.00 63.42 ? 138 THR A C    4  
ATOM 9561  O O    . THR A 1 143 ? 2.049   -19.001 12.288  1.00 65.21 ? 138 THR A O    4  
ATOM 9562  C CB   . THR A 1 143 ? 2.904   -18.073 15.183  1.00 31.44 ? 138 THR A CB   4  
ATOM 9563  O OG1  . THR A 1 143 ? 2.879   -19.495 15.012  1.00 64.34 ? 138 THR A OG1  4  
ATOM 9564  C CG2  . THR A 1 143 ? 1.679   -17.631 15.970  1.00 4.13  ? 138 THR A CG2  4  
ATOM 9565  H H    . THR A 1 143 ? 2.745   -15.537 14.832  1.00 51.32 ? 138 THR A H    4  
ATOM 9566  H HA   . THR A 1 143 ? 3.915   -17.580 13.360  1.00 72.44 ? 138 THR A HA   4  
ATOM 9567  H HB   . THR A 1 143 ? 3.788   -17.800 15.739  1.00 3.41  ? 138 THR A HB   4  
ATOM 9568  H HG1  . THR A 1 143 ? 2.010   -19.765 14.704  1.00 50.24 ? 138 THR A HG1  4  
ATOM 9569  H HG21 . THR A 1 143 ? 1.221   -18.490 16.437  1.00 1.25  ? 138 THR A HG21 4  
ATOM 9570  H HG22 . THR A 1 143 ? 0.972   -17.163 15.301  1.00 33.24 ? 138 THR A HG22 4  
ATOM 9571  H HG23 . THR A 1 143 ? 1.976   -16.924 16.730  1.00 41.25 ? 138 THR A HG23 4  
ATOM 9572  N N    . GLY A 1 144 ? 0.718   -17.284 12.870  1.00 62.52 ? 139 GLY A N    4  
ATOM 9573  C CA   . GLY A 1 144 ? -0.387  -17.749 12.053  1.00 31.22 ? 139 GLY A CA   4  
ATOM 9574  C C    . GLY A 1 144 ? -1.252  -16.613 11.544  1.00 62.12 ? 139 GLY A C    4  
ATOM 9575  O O    . GLY A 1 144 ? -1.203  -15.492 12.051  1.00 74.23 ? 139 GLY A O    4  
ATOM 9576  H H    . GLY A 1 144 ? 0.624   -16.461 13.394  1.00 25.13 ? 139 GLY A H    4  
ATOM 9577  H HA2  . GLY A 1 144 ? 0.008   -18.293 11.208  1.00 52.03 ? 139 GLY A HA2  4  
ATOM 9578  H HA3  . GLY A 1 144 ? -1.000  -18.416 12.643  1.00 5.43  ? 139 GLY A HA3  4  
ATOM 9579  N N    . PRO A 1 145 ? -2.063  -16.897 10.515  1.00 11.05 ? 140 PRO A N    4  
ATOM 9580  C CA   . PRO A 1 145 ? -2.957  -15.903 9.913   1.00 62.21 ? 140 PRO A CA   4  
ATOM 9581  C C    . PRO A 1 145 ? -4.105  -15.519 10.840  1.00 43.03 ? 140 PRO A C    4  
ATOM 9582  O O    . PRO A 1 145 ? -4.745  -16.381 11.440  1.00 51.23 ? 140 PRO A O    4  
ATOM 9583  C CB   . PRO A 1 145 ? -3.491  -16.614 8.668   1.00 25.15 ? 140 PRO A CB   4  
ATOM 9584  C CG   . PRO A 1 145 ? -3.387  -18.065 8.985   1.00 51.31 ? 140 PRO A CG   4  
ATOM 9585  C CD   . PRO A 1 145 ? -2.173  -18.211 9.860   1.00 1.21  ? 140 PRO A CD   4  
ATOM 9586  H HA   . PRO A 1 145 ? -2.419  -15.013 9.619   1.00 63.32 ? 140 PRO A HA   4  
ATOM 9587  H HB3  . PRO A 1 145 ? -2.885  -16.352 7.812   1.00 32.12 ? 140 PRO A HB3  4  
ATOM 9588  H HG3  . PRO A 1 145 ? -3.263  -18.632 8.075   1.00 1.12  ? 140 PRO A HG3  4  
ATOM 9589  H HD3  . PRO A 1 145 ? -1.298  -18.416 9.260   1.00 40.02 ? 140 PRO A HD3  4  
ATOM 9590  N N    . GLU A 1 146 ? -4.359  -14.219 10.953  1.00 22.33 ? 141 GLU A N    4  
ATOM 9591  C CA   . GLU A 1 146 ? -5.431  -13.721 11.808  1.00 41.20 ? 141 GLU A CA   4  
ATOM 9592  C C    . GLU A 1 146 ? -6.672  -13.386 10.986  1.00 3.32  ? 141 GLU A C    4  
ATOM 9593  O O    . GLU A 1 146 ? -6.668  -12.449 10.188  1.00 44.41 ? 141 GLU A O    4  
ATOM 9594  C CB   . GLU A 1 146 ? -4.965  -12.483 12.577  1.00 34.31 ? 141 GLU A CB   4  
ATOM 9595  C CG   . GLU A 1 146 ? -5.292  -12.531 14.061  1.00 52.33 ? 141 GLU A CG   4  
ATOM 9596  C CD   . GLU A 1 146 ? -4.379  -11.646 14.888  1.00 24.05 ? 141 GLU A CD   4  
ATOM 9597  O OE1  . GLU A 1 146 ? -4.304  -10.434 14.597  1.00 34.23 ? 141 GLU A OE1  4  
ATOM 9598  O OE2  . GLU A 1 146 ? -3.739  -12.166 15.826  1.00 21.41 ? 141 GLU A OE2  4  
ATOM 9599  H H    . GLU A 1 146 ? -3.813  -13.579 10.449  1.00 72.42 ? 141 GLU A H    4  
ATOM 9600  H HA   . GLU A 1 146 ? -5.680  -14.499 12.513  1.00 72.25 ? 141 GLU A HA   4  
ATOM 9601  H HB3  . GLU A 1 146 ? -5.442  -11.612 12.154  1.00 32.44 ? 141 GLU A HB3  4  
ATOM 9602  H HG3  . GLU A 1 146 ? -5.190  -13.550 14.406  1.00 22.15 ? 141 GLU A HG3  4  
ATOM 9603  N N    . LEU A 1 147 ? -7.733  -14.160 11.187  1.00 2.31  ? 142 LEU A N    4  
ATOM 9604  C CA   . LEU A 1 147 ? -8.982  -13.947 10.464  1.00 24.32 ? 142 LEU A CA   4  
ATOM 9605  C C    . LEU A 1 147 ? -9.653  -12.650 10.907  1.00 2.23  ? 142 LEU A C    4  
ATOM 9606  O O    . LEU A 1 147 ? -9.846  -12.416 12.100  1.00 43.21 ? 142 LEU A O    4  
ATOM 9607  C CB   . LEU A 1 147 ? -9.931  -15.126 10.687  1.00 42.23 ? 142 LEU A CB   4  
ATOM 9608  C CG   . LEU A 1 147 ? -10.618 -15.187 12.051  1.00 22.30 ? 142 LEU A CG   4  
ATOM 9609  C CD1  . LEU A 1 147 ? -11.984 -14.521 11.990  1.00 60.20 ? 142 LEU A CD1  4  
ATOM 9610  C CD2  . LEU A 1 147 ? -10.747 -16.628 12.520  1.00 33.01 ? 142 LEU A CD2  4  
ATOM 9611  H H    . LEU A 1 147 ? -7.676  -14.892 11.835  1.00 22.20 ? 142 LEU A H    4  
ATOM 9612  H HA   . LEU A 1 147 ? -8.749  -13.876 9.412   1.00 62.00 ? 142 LEU A HA   4  
ATOM 9613  H HB3  . LEU A 1 147 ? -9.360  -16.036 10.563  1.00 4.25  ? 142 LEU A HB3  4  
ATOM 9614  H HG   . LEU A 1 147 ? -10.019 -14.650 12.773  1.00 40.22 ? 142 LEU A HG   4  
ATOM 9615  H HD11 . LEU A 1 147 ? -11.955 -13.703 11.285  1.00 33.25 ? 142 LEU A HD11 4  
ATOM 9616  H HD12 . LEU A 1 147 ? -12.246 -14.144 12.968  1.00 3.54  ? 142 LEU A HD12 4  
ATOM 9617  H HD13 . LEU A 1 147 ? -12.723 -15.243 11.674  1.00 30.13 ? 142 LEU A HD13 4  
ATOM 9618  H HD21 . LEU A 1 147 ? -10.856 -17.277 11.664  1.00 43.43 ? 142 LEU A HD21 4  
ATOM 9619  H HD22 . LEU A 1 147 ? -11.615 -16.724 13.157  1.00 23.13 ? 142 LEU A HD22 4  
ATOM 9620  H HD23 . LEU A 1 147 ? -9.862  -16.906 13.074  1.00 11.14 ? 142 LEU A HD23 4  
ATOM 9621  N N    . ILE A 1 148 ? -10.008 -11.813 9.938   1.00 4.12  ? 143 ILE A N    4  
ATOM 9622  C CA   . ILE A 1 148 ? -10.660 -10.542 10.228  1.00 12.34 ? 143 ILE A CA   4  
ATOM 9623  C C    . ILE A 1 148 ? -11.824 -10.292 9.275   1.00 23.44 ? 143 ILE A C    4  
ATOM 9624  O O    . ILE A 1 148 ? -11.687 -10.435 8.060   1.00 15.43 ? 143 ILE A O    4  
ATOM 9625  C CB   . ILE A 1 148 ? -9.670  -9.367  10.132  1.00 24.03 ? 143 ILE A CB   4  
ATOM 9626  C CG1  . ILE A 1 148 ? -8.522  -9.556  11.124  1.00 2.31  ? 143 ILE A CG1  4  
ATOM 9627  C CG2  . ILE A 1 148 ? -10.387 -8.048  10.387  1.00 53.40 ? 143 ILE A CG2  4  
ATOM 9628  C CD1  . ILE A 1 148 ? -7.357  -8.620  10.887  1.00 62.51 ? 143 ILE A CD1  4  
ATOM 9629  H H    . ILE A 1 148 ? -9.828  -12.056 9.007   1.00 10.43 ? 143 ILE A H    4  
ATOM 9630  H HA   . ILE A 1 148 ? -11.039 -10.585 11.239  1.00 11.05 ? 143 ILE A HA   4  
ATOM 9631  H HB   . ILE A 1 148 ? -9.271  -9.343  9.129   1.00 52.02 ? 143 ILE A HB   4  
ATOM 9632  H HG13 . ILE A 1 148 ? -8.155  -10.569 11.049  1.00 44.22 ? 143 ILE A HG13 4  
ATOM 9633  H HG21 . ILE A 1 148 ? -11.165 -7.914  9.651   1.00 25.10 ? 143 ILE A HG21 4  
ATOM 9634  H HG22 . ILE A 1 148 ? -10.825 -8.063  11.374  1.00 24.10 ? 143 ILE A HG22 4  
ATOM 9635  H HG23 . ILE A 1 148 ? -9.680  -7.236  10.318  1.00 62.35 ? 143 ILE A HG23 4  
ATOM 9636  H HD11 . ILE A 1 148 ? -6.430  -9.144  11.069  1.00 63.32 ? 143 ILE A HD11 4  
ATOM 9637  H HD12 . ILE A 1 148 ? -7.378  -8.269  9.866   1.00 31.32 ? 143 ILE A HD12 4  
ATOM 9638  H HD13 . ILE A 1 148 ? -7.431  -7.776  11.558  1.00 21.20 ? 143 ILE A HD13 4  
ATOM 9639  N N    . SER A 1 149 ? -12.969 -9.914  9.835   1.00 20.55 ? 144 SER A N    4  
ATOM 9640  C CA   . SER A 1 149 ? -14.158 -9.645  9.035   1.00 12.01 ? 144 SER A CA   4  
ATOM 9641  C C    . SER A 1 149 ? -14.132 -8.222  8.485   1.00 24.22 ? 144 SER A C    4  
ATOM 9642  O O    . SER A 1 149 ? -13.329 -7.394  8.913   1.00 42.25 ? 144 SER A O    4  
ATOM 9643  C CB   . SER A 1 149 ? -15.421 -9.856  9.873   1.00 74.34 ? 144 SER A CB   4  
ATOM 9644  O OG   . SER A 1 149 ? -15.313 -11.021 10.673  1.00 62.30 ? 144 SER A OG   4  
ATOM 9645  H H    . SER A 1 149 ? -13.016 -9.817  10.809  1.00 62.53 ? 144 SER A H    4  
ATOM 9646  H HA   . SER A 1 149 ? -14.166 -10.338 8.208   1.00 41.25 ? 144 SER A HA   4  
ATOM 9647  H HB3  . SER A 1 149 ? -16.272 -9.963  9.216   1.00 70.14 ? 144 SER A HB3  4  
ATOM 9648  H HG   . SER A 1 149 ? -16.046 -11.054 11.292  1.00 21.41 ? 144 SER A HG   4  
ATOM 9649  N N    . ASP A 1 150 ? -15.018 -7.947  7.533   1.00 61.02 ? 145 ASP A N    4  
ATOM 9650  C CA   . ASP A 1 150 ? -15.098 -6.624  6.924   1.00 10.51 ? 145 ASP A CA   4  
ATOM 9651  C C    . ASP A 1 150 ? -15.585 -5.589  7.933   1.00 42.32 ? 145 ASP A C    4  
ATOM 9652  O O    . ASP A 1 150 ? -15.075 -4.470  7.985   1.00 64.21 ? 145 ASP A O    4  
ATOM 9653  C CB   . ASP A 1 150 ? -16.032 -6.653  5.713   1.00 75.03 ? 145 ASP A CB   4  
ATOM 9654  C CG   . ASP A 1 150 ? -17.324 -7.394  5.997   1.00 62.32 ? 145 ASP A CG   4  
ATOM 9655  O OD1  . ASP A 1 150 ? -17.291 -8.641  6.064   1.00 12.05 ? 145 ASP A OD1  4  
ATOM 9656  O OD2  . ASP A 1 150 ? -18.368 -6.727  6.152   1.00 72.15 ? 145 ASP A OD2  4  
ATOM 9657  H H    . ASP A 1 150 ? -15.632 -8.649  7.234   1.00 30.14 ? 145 ASP A H    4  
ATOM 9658  H HA   . ASP A 1 150 ? -14.107 -6.350  6.595   1.00 13.02 ? 145 ASP A HA   4  
ATOM 9659  H HB3  . ASP A 1 150 ? -15.531 -7.143  4.891   1.00 65.41 ? 145 ASP A HB3  4  
ATOM 9660  N N    . THR A 1 151 ? -16.575 -5.971  8.733   1.00 62.35 ? 146 THR A N    4  
ATOM 9661  C CA   . THR A 1 151 ? -17.133 -5.076  9.739   1.00 42.44 ? 146 THR A CA   4  
ATOM 9662  C C    . THR A 1 151 ? -16.098 -4.735  10.806  1.00 2.54  ? 146 THR A C    4  
ATOM 9663  O O    . THR A 1 151 ? -16.152 -3.668  11.419  1.00 42.12 ? 146 THR A O    4  
ATOM 9664  C CB   . THR A 1 151 ? -18.368 -5.695  10.419  1.00 25.42 ? 146 THR A CB   4  
ATOM 9665  O OG1  . THR A 1 151 ? -18.808 -4.856  11.494  1.00 40.43 ? 146 THR A OG1  4  
ATOM 9666  C CG2  . THR A 1 151 ? -18.054 -7.085  10.949  1.00 34.24 ? 146 THR A CG2  4  
ATOM 9667  H H    . THR A 1 151 ? -16.939 -6.876  8.643   1.00 62.13 ? 146 THR A H    4  
ATOM 9668  H HA   . THR A 1 151 ? -17.437 -4.165  9.244   1.00 32.11 ? 146 THR A HA   4  
ATOM 9669  H HB   . THR A 1 151 ? -19.160 -5.774  9.688   1.00 22.01 ? 146 THR A HB   4  
ATOM 9670  H HG1  . THR A 1 151 ? -19.495 -4.265  11.178  1.00 3.35  ? 146 THR A HG1  4  
ATOM 9671  H HG21 . THR A 1 151 ? -18.259 -7.121  12.009  1.00 12.01 ? 146 THR A HG21 4  
ATOM 9672  H HG22 . THR A 1 151 ? -17.013 -7.310  10.775  1.00 12.42 ? 146 THR A HG22 4  
ATOM 9673  H HG23 . THR A 1 151 ? -18.670 -7.811  10.440  1.00 20.34 ? 146 THR A HG23 4  
ATOM 9674  N N    . TYR A 1 152 ? -15.155 -5.647  11.022  1.00 31.54 ? 147 TYR A N    4  
ATOM 9675  C CA   . TYR A 1 152 ? -14.109 -5.442  12.016  1.00 52.22 ? 147 TYR A CA   4  
ATOM 9676  C C    . TYR A 1 152 ? -12.886 -4.777  11.392  1.00 14.52 ? 147 TYR A C    4  
ATOM 9677  O O    . TYR A 1 152 ? -12.154 -4.045  12.059  1.00 11.20 ? 147 TYR A O    4  
ATOM 9678  C CB   . TYR A 1 152 ? -13.711 -6.777  12.649  1.00 51.23 ? 147 TYR A CB   4  
ATOM 9679  C CG   . TYR A 1 152 ? -12.700 -6.640  13.765  1.00 73.31 ? 147 TYR A CG   4  
ATOM 9680  C CD1  . TYR A 1 152 ? -12.781 -5.595  14.677  1.00 53.32 ? 147 TYR A CD1  4  
ATOM 9681  C CD2  . TYR A 1 152 ? -11.664 -7.555  13.907  1.00 12.21 ? 147 TYR A CD2  4  
ATOM 9682  C CE1  . TYR A 1 152 ? -11.859 -5.466  15.698  1.00 71.34 ? 147 TYR A CE1  4  
ATOM 9683  C CE2  . TYR A 1 152 ? -10.739 -7.434  14.926  1.00 11.33 ? 147 TYR A CE2  4  
ATOM 9684  C CZ   . TYR A 1 152 ? -10.840 -6.388  15.819  1.00 24.11 ? 147 TYR A CZ   4  
ATOM 9685  O OH   . TYR A 1 152 ? -9.920  -6.263  16.834  1.00 13.44 ? 147 TYR A OH   4  
ATOM 9686  H H    . TYR A 1 152 ? -15.166 -6.477  10.502  1.00 54.14 ? 147 TYR A H    4  
ATOM 9687  H HA   . TYR A 1 152 ? -14.503 -4.795  12.785  1.00 32.52 ? 147 TYR A HA   4  
ATOM 9688  H HB3  . TYR A 1 152 ? -13.282 -7.414  11.889  1.00 61.11 ? 147 TYR A HB3  4  
ATOM 9689  H HD1  . TYR A 1 152 ? -13.580 -4.874  14.581  1.00 3.32  ? 147 TYR A HD1  4  
ATOM 9690  H HD2  . TYR A 1 152 ? -11.587 -8.373  13.205  1.00 74.12 ? 147 TYR A HD2  4  
ATOM 9691  H HE1  . TYR A 1 152 ? -11.938 -4.647  16.398  1.00 71.14 ? 147 TYR A HE1  4  
ATOM 9692  H HE2  . TYR A 1 152 ? -9.941  -8.156  15.019  1.00 72.44 ? 147 TYR A HE2  4  
ATOM 9693  H HH   . TYR A 1 152 ? -9.691  -7.134  17.167  1.00 13.32 ? 147 TYR A HH   4  
ATOM 9694  N N    . LEU A 1 153 ? -12.672 -5.038  10.107  1.00 51.44 ? 148 LEU A N    4  
ATOM 9695  C CA   . LEU A 1 153 ? -11.537 -4.466  9.390   1.00 23.42 ? 148 LEU A CA   4  
ATOM 9696  C C    . LEU A 1 153 ? -11.681 -2.953  9.263   1.00 73.22 ? 148 LEU A C    4  
ATOM 9697  O O    . LEU A 1 153 ? -10.740 -2.205  9.528   1.00 13.55 ? 148 LEU A O    4  
ATOM 9698  C CB   . LEU A 1 153 ? -11.417 -5.096  8.001   1.00 44.40 ? 148 LEU A CB   4  
ATOM 9699  C CG   . LEU A 1 153 ? -10.358 -4.490  7.079   1.00 11.51 ? 148 LEU A CG   4  
ATOM 9700  C CD1  . LEU A 1 153 ? -9.081  -5.315  7.117   1.00 70.21 ? 148 LEU A CD1  4  
ATOM 9701  C CD2  . LEU A 1 153 ? -10.887 -4.388  5.655   1.00 63.02 ? 148 LEU A CD2  4  
ATOM 9702  H H    . LEU A 1 153 ? -13.289 -5.630  9.629   1.00 53.12 ? 148 LEU A H    4  
ATOM 9703  H HA   . LEU A 1 153 ? -10.644 -4.684  9.954   1.00 50.51 ? 148 LEU A HA   4  
ATOM 9704  H HB3  . LEU A 1 153 ? -12.376 -5.002  7.512   1.00 54.30 ? 148 LEU A HB3  4  
ATOM 9705  H HG   . LEU A 1 153 ? -10.120 -3.492  7.421   1.00 13.12 ? 148 LEU A HG   4  
ATOM 9706  H HD11 . LEU A 1 153 ? -8.400  -4.889  7.837   1.00 41.53 ? 148 LEU A HD11 4  
ATOM 9707  H HD12 . LEU A 1 153 ? -8.622  -5.312  6.140   1.00 14.42 ? 148 LEU A HD12 4  
ATOM 9708  H HD13 . LEU A 1 153 ? -9.317  -6.331  7.401   1.00 64.41 ? 148 LEU A HD13 4  
ATOM 9709  H HD21 . LEU A 1 153 ? -11.067 -3.351  5.412   1.00 55.03 ? 148 LEU A HD21 4  
ATOM 9710  H HD22 . LEU A 1 153 ? -11.810 -4.942  5.573   1.00 12.12 ? 148 LEU A HD22 4  
ATOM 9711  H HD23 . LEU A 1 153 ? -10.159 -4.797  4.971   1.00 52.31 ? 148 LEU A HD23 4  
ATOM 9712  N N    . ALA A 1 154 ? -12.867 -2.508  8.859   1.00 20.01 ? 149 ALA A N    4  
ATOM 9713  C CA   . ALA A 1 154 ? -13.135 -1.083  8.702   1.00 53.21 ? 149 ALA A CA   4  
ATOM 9714  C C    . ALA A 1 154 ? -12.830 -0.323  9.987   1.00 72.43 ? 149 ALA A C    4  
ATOM 9715  O O    . ALA A 1 154 ? -12.149 0.704   9.967   1.00 23.30 ? 149 ALA A O    4  
ATOM 9716  C CB   . ALA A 1 154 ? -14.581 -0.863  8.287   1.00 24.54 ? 149 ALA A CB   4  
ATOM 9717  H H    . ALA A 1 154 ? -13.578 -3.153  8.664   1.00 62.05 ? 149 ALA A H    4  
ATOM 9718  H HA   . ALA A 1 154 ? -12.498 -0.709  7.914   1.00 4.22  ? 149 ALA A HA   4  
ATOM 9719  H HB1  . ALA A 1 154 ? -14.983 -0.014  8.822   1.00 23.23 ? 149 ALA A HB1  4  
ATOM 9720  H HB2  . ALA A 1 154 ? -14.626 -0.672  7.224   1.00 74.05 ? 149 ALA A HB2  4  
ATOM 9721  H HB3  . ALA A 1 154 ? -15.162 -1.742  8.520   1.00 22.42 ? 149 ALA A HB3  4  
ATOM 9722  N N    . LEU A 1 155 ? -13.337 -0.831  11.106  1.00 64.10 ? 150 LEU A N    4  
ATOM 9723  C CA   . LEU A 1 155 ? -13.119 -0.198  12.402  1.00 45.14 ? 150 LEU A CA   4  
ATOM 9724  C C    . LEU A 1 155 ? -11.676 -0.383  12.862  1.00 1.41  ? 150 LEU A C    4  
ATOM 9725  O O    . LEU A 1 155 ? -11.079 0.522   13.446  1.00 2.11  ? 150 LEU A O    4  
ATOM 9726  C CB   . LEU A 1 155 ? -14.077 -0.779  13.443  1.00 43.42 ? 150 LEU A CB   4  
ATOM 9727  C CG   . LEU A 1 155 ? -15.264 0.103   13.829  1.00 20.12 ? 150 LEU A CG   4  
ATOM 9728  C CD1  . LEU A 1 155 ? -16.126 0.401   12.612  1.00 62.03 ? 150 LEU A CD1  4  
ATOM 9729  C CD2  . LEU A 1 155 ? -16.090 -0.562  14.920  1.00 64.21 ? 150 LEU A CD2  4  
ATOM 9730  H H    . LEU A 1 155 ? -13.870 -1.651  11.059  1.00 22.13 ? 150 LEU A H    4  
ATOM 9731  H HA   . LEU A 1 155 ? -13.317 0.858   12.292  1.00 42.43 ? 150 LEU A HA   4  
ATOM 9732  H HB3  . LEU A 1 155 ? -13.507 -0.981  14.339  1.00 42.12 ? 150 LEU A HB3  4  
ATOM 9733  H HG   . LEU A 1 155 ? -14.895 1.044   14.215  1.00 10.13 ? 150 LEU A HG   4  
ATOM 9734  H HD11 . LEU A 1 155 ? -15.736 1.266   12.098  1.00 44.35 ? 150 LEU A HD11 4  
ATOM 9735  H HD12 . LEU A 1 155 ? -17.139 0.597   12.928  1.00 30.31 ? 150 LEU A HD12 4  
ATOM 9736  H HD13 . LEU A 1 155 ? -16.115 -0.450  11.947  1.00 65.21 ? 150 LEU A HD13 4  
ATOM 9737  H HD21 . LEU A 1 155 ? -15.446 -0.830  15.745  1.00 21.21 ? 150 LEU A HD21 4  
ATOM 9738  H HD22 . LEU A 1 155 ? -16.558 -1.452  14.525  1.00 20.43 ? 150 LEU A HD22 4  
ATOM 9739  H HD23 . LEU A 1 155 ? -16.850 0.123   15.264  1.00 2.22  ? 150 LEU A HD23 4  
ATOM 9740  N N    . PHE A 1 156 ? -11.121 -1.560  12.593  1.00 72.44 ? 151 PHE A N    4  
ATOM 9741  C CA   . PHE A 1 156 ? -9.748  -1.863  12.979  1.00 1.31  ? 151 PHE A CA   4  
ATOM 9742  C C    . PHE A 1 156 ? -8.782  -0.827  12.411  1.00 1.51  ? 151 PHE A C    4  
ATOM 9743  O O    . PHE A 1 156 ? -8.007  -0.214  13.146  1.00 72.33 ? 151 PHE A O    4  
ATOM 9744  C CB   . PHE A 1 156 ? -9.357  -3.261  12.494  1.00 61.13 ? 151 PHE A CB   4  
ATOM 9745  C CG   . PHE A 1 156 ? -7.915  -3.373  12.087  1.00 21.32 ? 151 PHE A CG   4  
ATOM 9746  C CD1  . PHE A 1 156 ? -6.912  -3.408  13.042  1.00 2.44  ? 151 PHE A CD1  4  
ATOM 9747  C CD2  . PHE A 1 156 ? -7.564  -3.442  10.748  1.00 63.40 ? 151 PHE A CD2  4  
ATOM 9748  C CE1  . PHE A 1 156 ? -5.585  -3.512  12.670  1.00 3.11  ? 151 PHE A CE1  4  
ATOM 9749  C CE2  . PHE A 1 156 ? -6.239  -3.545  10.370  1.00 13.31 ? 151 PHE A CE2  4  
ATOM 9750  C CZ   . PHE A 1 156 ? -5.248  -3.579  11.332  1.00 0.13  ? 151 PHE A CZ   4  
ATOM 9751  H H    . PHE A 1 156 ? -11.648 -2.241  12.125  1.00 42.51 ? 151 PHE A H    4  
ATOM 9752  H HA   . PHE A 1 156 ? -9.693  -1.836  14.056  1.00 54.21 ? 151 PHE A HA   4  
ATOM 9753  H HB3  . PHE A 1 156 ? -9.965  -3.522  11.642  1.00 11.32 ? 151 PHE A HB3  4  
ATOM 9754  H HD1  . PHE A 1 156 ? -7.175  -3.356  14.089  1.00 23.33 ? 151 PHE A HD1  4  
ATOM 9755  H HD2  . PHE A 1 156 ? -8.338  -3.415  9.995   1.00 42.11 ? 151 PHE A HD2  4  
ATOM 9756  H HE1  . PHE A 1 156 ? -4.813  -3.538  13.424  1.00 1.21  ? 151 PHE A HE1  4  
ATOM 9757  H HE2  . PHE A 1 156 ? -5.978  -3.598  9.324   1.00 41.12 ? 151 PHE A HE2  4  
ATOM 9758  H HZ   . PHE A 1 156 ? -4.212  -3.660  11.039  1.00 13.20 ? 151 PHE A HZ   4  
ATOM 9759  N N    . LEU A 1 157 ? -8.832  -0.638  11.097  1.00 34.13 ? 152 LEU A N    4  
ATOM 9760  C CA   . LEU A 1 157 ? -7.963  0.323   10.428  1.00 43.05 ? 152 LEU A CA   4  
ATOM 9761  C C    . LEU A 1 157 ? -8.339  1.752   10.803  1.00 74.40 ? 152 LEU A C    4  
ATOM 9762  O O    . LEU A 1 157 ? -7.472  2.602   11.005  1.00 14.24 ? 152 LEU A O    4  
ATOM 9763  C CB   . LEU A 1 157 ? -8.043  0.144   8.911   1.00 11.24 ? 152 LEU A CB   4  
ATOM 9764  C CG   . LEU A 1 157 ? -9.440  0.238   8.297   1.00 11.03 ? 152 LEU A CG   4  
ATOM 9765  C CD1  . LEU A 1 157 ? -9.733  1.662   7.853   1.00 2.41  ? 152 LEU A CD1  4  
ATOM 9766  C CD2  . LEU A 1 157 ? -9.575  -0.726  7.128   1.00 12.33 ? 152 LEU A CD2  4  
ATOM 9767  H H    . LEU A 1 157 ? -9.470  -1.157  10.563  1.00 25.40 ? 152 LEU A H    4  
ATOM 9768  H HA   . LEU A 1 157 ? -6.950  0.134   10.751  1.00 70.12 ? 152 LEU A HA   4  
ATOM 9769  H HB3  . LEU A 1 157 ? -7.640  -0.830  8.672   1.00 31.04 ? 152 LEU A HB3  4  
ATOM 9770  H HG   . LEU A 1 157 ? -10.173 -0.036  9.043   1.00 72.21 ? 152 LEU A HG   4  
ATOM 9771  H HD11 . LEU A 1 157 ? -9.553  1.753   6.792   1.00 42.51 ? 152 LEU A HD11 4  
ATOM 9772  H HD12 . LEU A 1 157 ? -9.090  2.346   8.387   1.00 20.23 ? 152 LEU A HD12 4  
ATOM 9773  H HD13 . LEU A 1 157 ? -10.766 1.900   8.063   1.00 72.44 ? 152 LEU A HD13 4  
ATOM 9774  H HD21 . LEU A 1 157 ? -9.226  -1.704  7.426   1.00 22.20 ? 152 LEU A HD21 4  
ATOM 9775  H HD22 . LEU A 1 157 ? -8.981  -0.371  6.298   1.00 2.11  ? 152 LEU A HD22 4  
ATOM 9776  H HD23 . LEU A 1 157 ? -10.610 -0.789  6.830   1.00 31.21 ? 152 LEU A HD23 4  
ATOM 9777  N N    . ALA A 1 158 ? -9.640  2.010   10.899  1.00 10.23 ? 153 ALA A N    4  
ATOM 9778  C CA   . ALA A 1 158 ? -10.132 3.336   11.254  1.00 54.10 ? 153 ALA A CA   4  
ATOM 9779  C C    . ALA A 1 158 ? -9.566  3.789   12.595  1.00 33.20 ? 153 ALA A C    4  
ATOM 9780  O O    . ALA A 1 158 ? -9.350  4.981   12.816  1.00 0.31  ? 153 ALA A O    4  
ATOM 9781  C CB   . ALA A 1 158 ? -11.654 3.341   11.292  1.00 41.24 ? 153 ALA A CB   4  
ATOM 9782  H H    . ALA A 1 158 ? -10.283 1.292   10.726  1.00 33.35 ? 153 ALA A H    4  
ATOM 9783  H HA   . ALA A 1 158 ? -9.813  4.027   10.488  1.00 12.32 ? 153 ALA A HA   4  
ATOM 9784  H HB1  . ALA A 1 158 ? -11.994 4.165   11.903  1.00 2.42  ? 153 ALA A HB1  4  
ATOM 9785  H HB2  . ALA A 1 158 ? -12.037 3.453   10.289  1.00 14.23 ? 153 ALA A HB2  4  
ATOM 9786  H HB3  . ALA A 1 158 ? -12.006 2.411   11.712  1.00 22.02 ? 153 ALA A HB3  4  
ATOM 9787  N N    . GLN A 1 159 ? -9.329  2.832   13.487  1.00 21.44 ? 154 GLN A N    4  
ATOM 9788  C CA   . GLN A 1 159 ? -8.790  3.136   14.807  1.00 74.12 ? 154 GLN A CA   4  
ATOM 9789  C C    . GLN A 1 159 ? -7.323  3.540   14.716  1.00 64.13 ? 154 GLN A C    4  
ATOM 9790  O O    . GLN A 1 159 ? -6.853  4.388   15.476  1.00 64.32 ? 154 GLN A O    4  
ATOM 9791  C CB   . GLN A 1 159 ? -8.940  1.927   15.733  1.00 32.15 ? 154 GLN A CB   4  
ATOM 9792  C CG   . GLN A 1 159 ? -10.217 1.949   16.558  1.00 14.24 ? 154 GLN A CG   4  
ATOM 9793  C CD   . GLN A 1 159 ? -9.949  1.943   18.050  1.00 40.32 ? 154 GLN A CD   4  
ATOM 9794  O OE1  . GLN A 1 159 ? -9.381  2.891   18.593  1.00 54.22 ? 154 GLN A OE1  4  
ATOM 9795  N NE2  . GLN A 1 159 ? -10.356 0.872   18.720  1.00 75.52 ? 154 GLN A NE2  4  
ATOM 9796  H H    . GLN A 1 159 ? -9.523  1.901   13.252  1.00 4.41  ? 154 GLN A H    4  
ATOM 9797  H HA   . GLN A 1 159 ? -9.354  3.961   15.214  1.00 42.03 ? 154 GLN A HA   4  
ATOM 9798  H HB3  . GLN A 1 159 ? -8.101  1.901   16.411  1.00 25.32 ? 154 GLN A HB3  4  
ATOM 9799  H HG3  . GLN A 1 159 ? -10.806 1.078   16.310  1.00 43.30 ? 154 GLN A HG3  4  
ATOM 9800  H HE21 . GLN A 1 159 ? -10.801 0.155   18.222  1.00 65.01 ? 154 GLN A HE21 4  
ATOM 9801  H HE22 . GLN A 1 159 ? -10.195 0.842   19.687  1.00 3.31  ? 154 GLN A HE22 4  
ATOM 9802  N N    . LEU A 1 160 ? -6.602  2.929   13.781  1.00 63.50 ? 155 LEU A N    4  
ATOM 9803  C CA   . LEU A 1 160 ? -5.187  3.226   13.591  1.00 2.55  ? 155 LEU A CA   4  
ATOM 9804  C C    . LEU A 1 160 ? -4.999  4.600   12.955  1.00 13.45 ? 155 LEU A C    4  
ATOM 9805  O O    . LEU A 1 160 ? -4.211  5.414   13.435  1.00 34.22 ? 155 LEU A O    4  
ATOM 9806  C CB   . LEU A 1 160 ? -4.535  2.153   12.717  1.00 5.12  ? 155 LEU A CB   4  
ATOM 9807  C CG   . LEU A 1 160 ? -5.045  0.725   12.914  1.00 4.53  ? 155 LEU A CG   4  
ATOM 9808  C CD1  . LEU A 1 160 ? -4.168  -0.263  12.159  1.00 34.53 ? 155 LEU A CD1  4  
ATOM 9809  C CD2  . LEU A 1 160 ? -5.093  0.376   14.393  1.00 53.14 ? 155 LEU A CD2  4  
ATOM 9810  H H    . LEU A 1 160 ? -7.032  2.263   13.206  1.00 63.00 ? 155 LEU A H    4  
ATOM 9811  H HA   . LEU A 1 160 ? -4.714  3.224   14.561  1.00 22.55 ? 155 LEU A HA   4  
ATOM 9812  H HB3  . LEU A 1 160 ? -3.474  2.159   12.924  1.00 73.22 ? 155 LEU A HB3  4  
ATOM 9813  H HG   . LEU A 1 160 ? -6.048  0.651   12.518  1.00 51.21 ? 155 LEU A HG   4  
ATOM 9814  H HD11 . LEU A 1 160 ? -4.100  -1.184  12.719  1.00 22.21 ? 155 LEU A HD11 4  
ATOM 9815  H HD12 . LEU A 1 160 ? -3.181  0.156   12.031  1.00 12.35 ? 155 LEU A HD12 4  
ATOM 9816  H HD13 . LEU A 1 160 ? -4.603  -0.462  11.190  1.00 71.42 ? 155 LEU A HD13 4  
ATOM 9817  H HD21 . LEU A 1 160 ? -4.408  1.011   14.936  1.00 42.33 ? 155 LEU A HD21 4  
ATOM 9818  H HD22 . LEU A 1 160 ? -4.808  -0.658  14.529  1.00 13.12 ? 155 LEU A HD22 4  
ATOM 9819  H HD23 . LEU A 1 160 ? -6.094  0.526   14.766  1.00 72.20 ? 155 LEU A HD23 4  
ATOM 9820  N N    . GLN A 1 161 ? -5.730  4.850   11.872  1.00 34.22 ? 156 GLN A N    4  
ATOM 9821  C CA   . GLN A 1 161 ? -5.644  6.126   11.172  1.00 31.23 ? 156 GLN A CA   4  
ATOM 9822  C C    . GLN A 1 161 ? -6.104  7.271   12.069  1.00 22.11 ? 156 GLN A C    4  
ATOM 9823  O O    . GLN A 1 161 ? -5.473  8.326   12.114  1.00 60.33 ? 156 GLN A O    4  
ATOM 9824  C CB   . GLN A 1 161 ? -6.490  6.090   9.898   1.00 24.02 ? 156 GLN A CB   4  
ATOM 9825  C CG   . GLN A 1 161 ? -7.952  5.756   10.147  1.00 13.21 ? 156 GLN A CG   4  
ATOM 9826  C CD   . GLN A 1 161 ? -8.809  6.992   10.342  1.00 43.33 ? 156 GLN A CD   4  
ATOM 9827  O OE1  . GLN A 1 161 ? -8.331  8.119   10.212  1.00 44.43 ? 156 GLN A OE1  4  
ATOM 9828  N NE2  . GLN A 1 161 ? -10.082 6.787   10.656  1.00 71.32 ? 156 GLN A NE2  4  
ATOM 9829  H H    . GLN A 1 161 ? -6.340  4.160   11.538  1.00 3.03  ? 156 GLN A H    4  
ATOM 9830  H HA   . GLN A 1 161 ? -4.612  6.288   10.903  1.00 75.33 ? 156 GLN A HA   4  
ATOM 9831  H HB3  . GLN A 1 161 ? -6.082  5.345   9.230   1.00 72.12 ? 156 GLN A HB3  4  
ATOM 9832  H HG3  . GLN A 1 161 ? -8.022  5.144   11.035  1.00 4.13  ? 156 GLN A HG3  4  
ATOM 9833  H HE21 . GLN A 1 161 ? -10.393 5.861   10.745  1.00 43.04 ? 156 GLN A HE21 4  
ATOM 9834  H HE22 . GLN A 1 161 ? -10.658 7.568   10.789  1.00 53.11 ? 156 GLN A HE22 4  
ATOM 9835  N N    . GLN A 1 162 ? -7.206  7.053   12.780  1.00 63.55 ? 157 GLN A N    4  
ATOM 9836  C CA   . GLN A 1 162 ? -7.749  8.069   13.675  1.00 55.20 ? 157 GLN A CA   4  
ATOM 9837  C C    . GLN A 1 162 ? -6.833  8.283   14.875  1.00 73.44 ? 157 GLN A C    4  
ATOM 9838  O O    . GLN A 1 162 ? -6.906  9.312   15.547  1.00 13.21 ? 157 GLN A O    4  
ATOM 9839  C CB   . GLN A 1 162 ? -9.146  7.665   14.150  1.00 20.34 ? 157 GLN A CB   4  
ATOM 9840  C CG   . GLN A 1 162 ? -9.136  6.598   15.233  1.00 23.12 ? 157 GLN A CG   4  
ATOM 9841  C CD   . GLN A 1 162 ? -10.527 6.102   15.577  1.00 62.54 ? 157 GLN A CD   4  
ATOM 9842  O OE1  . GLN A 1 162 ? -11.384 5.968   14.704  1.00 61.01 ? 157 GLN A OE1  4  
ATOM 9843  N NE2  . GLN A 1 162 ? -10.757 5.828   16.856  1.00 21.42 ? 157 GLN A NE2  4  
ATOM 9844  H H    . GLN A 1 162 ? -7.663  6.192   12.701  1.00 34.34 ? 157 GLN A H    4  
ATOM 9845  H HA   . GLN A 1 162 ? -7.820  8.993   13.123  1.00 44.22 ? 157 GLN A HA   4  
ATOM 9846  H HB3  . GLN A 1 162 ? -9.704  7.286   13.306  1.00 55.31 ? 157 GLN A HB3  4  
ATOM 9847  H HG3  . GLN A 1 162 ? -8.686  7.013   16.123  1.00 61.21 ? 157 GLN A HG3  4  
ATOM 9848  H HE21 . GLN A 1 162 ? -10.027 5.961   17.496  1.00 52.23 ? 157 GLN A HE21 4  
ATOM 9849  H HE22 . GLN A 1 162 ? -11.648 5.507   17.107  1.00 24.31 ? 157 GLN A HE22 4  
ATOM 9850  N N    . GLU A 1 163 ? -5.973  7.304   15.139  1.00 44.20 ? 158 GLU A N    4  
ATOM 9851  C CA   . GLU A 1 163 ? -5.044  7.387   16.260  1.00 52.21 ? 158 GLU A CA   4  
ATOM 9852  C C    . GLU A 1 163 ? -3.735  8.046   15.835  1.00 44.42 ? 158 GLU A C    4  
ATOM 9853  O O    . GLU A 1 163 ? -3.373  9.112   16.333  1.00 12.41 ? 158 GLU A O    4  
ATOM 9854  C CB   . GLU A 1 163 ? -4.765  5.992   16.824  1.00 10.23 ? 158 GLU A CB   4  
ATOM 9855  C CG   . GLU A 1 163 ? -5.738  5.570   17.911  1.00 55.52 ? 158 GLU A CG   4  
ATOM 9856  C CD   . GLU A 1 163 ? -5.365  6.119   19.274  1.00 73.52 ? 158 GLU A CD   4  
ATOM 9857  O OE1  . GLU A 1 163 ? -4.155  6.179   19.578  1.00 22.43 ? 158 GLU A OE1  4  
ATOM 9858  O OE2  . GLU A 1 163 ? -6.282  6.489   20.037  1.00 21.32 ? 158 GLU A OE2  4  
ATOM 9859  H H    . GLU A 1 163 ? -5.963  6.509   14.567  1.00 44.14 ? 158 GLU A H    4  
ATOM 9860  H HA   . GLU A 1 163 ? -5.504  7.990   17.029  1.00 4.41  ? 158 GLU A HA   4  
ATOM 9861  H HB3  . GLU A 1 163 ? -3.767  5.978   17.237  1.00 54.14 ? 158 GLU A HB3  4  
ATOM 9862  H HG3  . GLU A 1 163 ? -5.751  4.490   17.966  1.00 63.21 ? 158 GLU A HG3  4  
ATOM 9863  N N    . GLY A 1 164 ? -3.028  7.404   14.909  1.00 70.22 ? 159 GLY A N    4  
ATOM 9864  C CA   . GLY A 1 164 ? -1.767  7.941   14.433  1.00 21.12 ? 159 GLY A CA   4  
ATOM 9865  C C    . GLY A 1 164 ? -0.858  6.870   13.865  1.00 22.22 ? 159 GLY A C    4  
ATOM 9866  O O    . GLY A 1 164 ? 0.323   6.804   14.207  1.00 51.42 ? 159 GLY A O    4  
ATOM 9867  H H    . GLY A 1 164 ? -3.366  6.558   14.548  1.00 52.43 ? 159 GLY A H    4  
ATOM 9868  H HA2  . GLY A 1 164 ? -1.968  8.673   13.665  1.00 23.34 ? 159 GLY A HA2  4  
ATOM 9869  H HA3  . GLY A 1 164 ? -1.262  8.427   15.255  1.00 31.13 ? 159 GLY A HA3  4  
ATOM 9870  N N    . TYR A 1 165 ? -1.408  6.029   12.997  1.00 54.54 ? 160 TYR A N    4  
ATOM 9871  C CA   . TYR A 1 165 ? -0.639  4.952   12.385  1.00 11.12 ? 160 TYR A CA   4  
ATOM 9872  C C    . TYR A 1 165 ? -0.497  5.171   10.882  1.00 43.01 ? 160 TYR A C    4  
ATOM 9873  O O    . TYR A 1 165 ? -0.920  6.197   10.350  1.00 61.51 ? 160 TYR A O    4  
ATOM 9874  C CB   . TYR A 1 165 ? -1.307  3.602   12.653  1.00 21.35 ? 160 TYR A CB   4  
ATOM 9875  C CG   . TYR A 1 165 ? -1.255  3.178   14.103  1.00 54.30 ? 160 TYR A CG   4  
ATOM 9876  C CD1  . TYR A 1 165 ? -1.926  3.898   15.083  1.00 74.12 ? 160 TYR A CD1  4  
ATOM 9877  C CD2  . TYR A 1 165 ? -0.534  2.056   14.492  1.00 75.55 ? 160 TYR A CD2  4  
ATOM 9878  C CE1  . TYR A 1 165 ? -1.880  3.514   16.409  1.00 13.20 ? 160 TYR A CE1  4  
ATOM 9879  C CE2  . TYR A 1 165 ? -0.484  1.663   15.816  1.00 63.04 ? 160 TYR A CE2  4  
ATOM 9880  C CZ   . TYR A 1 165 ? -1.158  2.396   16.771  1.00 42.23 ? 160 TYR A CZ   4  
ATOM 9881  O OH   . TYR A 1 165 ? -1.110  2.009   18.091  1.00 62.12 ? 160 TYR A OH   4  
ATOM 9882  H H    . TYR A 1 165 ? -2.354  6.132   12.764  1.00 74.35 ? 160 TYR A H    4  
ATOM 9883  H HA   . TYR A 1 165 ? 0.344   4.950   12.831  1.00 34.00 ? 160 TYR A HA   4  
ATOM 9884  H HB3  . TYR A 1 165 ? -0.815  2.841   12.066  1.00 2.44  ? 160 TYR A HB3  4  
ATOM 9885  H HD1  . TYR A 1 165 ? -2.492  4.772   14.796  1.00 24.32 ? 160 TYR A HD1  4  
ATOM 9886  H HD2  . TYR A 1 165 ? -0.006  1.484   13.743  1.00 20.03 ? 160 TYR A HD2  4  
ATOM 9887  H HE1  . TYR A 1 165 ? -2.409  4.087   17.157  1.00 2.45  ? 160 TYR A HE1  4  
ATOM 9888  H HE2  . TYR A 1 165 ? 0.083   0.788   16.100  1.00 3.00  ? 160 TYR A HE2  4  
ATOM 9889  H HH   . TYR A 1 165 ? -0.362  1.423   18.225  1.00 12.33 ? 160 TYR A HH   4  
ATOM 9890  N N    . SER A 1 166 ? 0.104   4.199   10.203  1.00 5.51  ? 161 SER A N    4  
ATOM 9891  C CA   . SER A 1 166 ? 0.307   4.286   8.761   1.00 32.34 ? 161 SER A CA   4  
ATOM 9892  C C    . SER A 1 166 ? -0.481  3.199   8.035   1.00 64.00 ? 161 SER A C    4  
ATOM 9893  O O    . SER A 1 166 ? -0.411  2.023   8.394   1.00 71.33 ? 161 SER A O    4  
ATOM 9894  C CB   . SER A 1 166 ? 1.794   4.164   8.425   1.00 25.23 ? 161 SER A CB   4  
ATOM 9895  O OG   . SER A 1 166 ? 2.298   5.379   7.896   1.00 52.14 ? 161 SER A OG   4  
ATOM 9896  H H    . SER A 1 166 ? 0.421   3.406   10.683  1.00 14.23 ? 161 SER A H    4  
ATOM 9897  H HA   . SER A 1 166 ? -0.050  5.252   8.433   1.00 54.32 ? 161 SER A HA   4  
ATOM 9898  H HB3  . SER A 1 166 ? 1.932   3.382   7.693   1.00 52.25 ? 161 SER A HB3  4  
ATOM 9899  H HG   . SER A 1 166 ? 1.769   5.644   7.141   1.00 31.52 ? 161 SER A HG   4  
ATOM 9900  N N    . ILE A 1 167 ? -1.228  3.601   7.013   1.00 11.14 ? 162 ILE A N    4  
ATOM 9901  C CA   . ILE A 1 167 ? -2.028  2.662   6.236   1.00 60.11 ? 162 ILE A CA   4  
ATOM 9902  C C    . ILE A 1 167 ? -1.767  2.823   4.742   1.00 72.44 ? 162 ILE A C    4  
ATOM 9903  O O    . ILE A 1 167 ? -1.862  3.924   4.200   1.00 22.33 ? 162 ILE A O    4  
ATOM 9904  C CB   . ILE A 1 167 ? -3.533  2.846   6.506   1.00 30.25 ? 162 ILE A CB   4  
ATOM 9905  C CG1  . ILE A 1 167 ? -3.863  2.471   7.952   1.00 70.31 ? 162 ILE A CG1  4  
ATOM 9906  C CG2  . ILE A 1 167 ? -4.352  2.008   5.535   1.00 61.45 ? 162 ILE A CG2  4  
ATOM 9907  C CD1  . ILE A 1 167 ? -4.141  3.667   8.838   1.00 13.45 ? 162 ILE A CD1  4  
ATOM 9908  H H    . ILE A 1 167 ? -1.242  4.552   6.776   1.00 31.34 ? 162 ILE A H    4  
ATOM 9909  H HA   . ILE A 1 167 ? -1.749  1.661   6.534   1.00 22.32 ? 162 ILE A HA   4  
ATOM 9910  H HB   . ILE A 1 167 ? -3.780  3.885   6.345   1.00 15.43 ? 162 ILE A HB   4  
ATOM 9911  H HG13 . ILE A 1 167 ? -3.029  1.930   8.375   1.00 71.00 ? 162 ILE A HG13 4  
ATOM 9912  H HG21 . ILE A 1 167 ? -5.231  1.633   6.038   1.00 13.30 ? 162 ILE A HG21 4  
ATOM 9913  H HG22 . ILE A 1 167 ? -4.650  2.618   4.697   1.00 64.30 ? 162 ILE A HG22 4  
ATOM 9914  H HG23 . ILE A 1 167 ? -3.756  1.179   5.184   1.00 53.12 ? 162 ILE A HG23 4  
ATOM 9915  H HD11 . ILE A 1 167 ? -3.226  3.978   9.320   1.00 51.13 ? 162 ILE A HD11 4  
ATOM 9916  H HD12 . ILE A 1 167 ? -4.528  4.477   8.239   1.00 55.21 ? 162 ILE A HD12 4  
ATOM 9917  H HD13 . ILE A 1 167 ? -4.869  3.395   9.590   1.00 45.35 ? 162 ILE A HD13 4  
ATOM 9918  N N    . PHE A 1 168 ? -1.441  1.717   4.081   1.00 62.40 ? 163 PHE A N    4  
ATOM 9919  C CA   . PHE A 1 168 ? -1.168  1.736   2.649   1.00 55.34 ? 163 PHE A CA   4  
ATOM 9920  C C    . PHE A 1 168 ? -2.097  0.780   1.907   1.00 4.51  ? 163 PHE A C    4  
ATOM 9921  O O    . PHE A 1 168 ? -2.283  -0.366  2.315   1.00 43.23 ? 163 PHE A O    4  
ATOM 9922  C CB   . PHE A 1 168 ? 0.291   1.358   2.382   1.00 51.10 ? 163 PHE A CB   4  
ATOM 9923  C CG   . PHE A 1 168 ? 1.271   2.416   2.799   1.00 71.42 ? 163 PHE A CG   4  
ATOM 9924  C CD1  . PHE A 1 168 ? 1.424   2.750   4.136   1.00 0.12  ? 163 PHE A CD1  4  
ATOM 9925  C CD2  . PHE A 1 168 ? 2.039   3.079   1.855   1.00 32.42 ? 163 PHE A CD2  4  
ATOM 9926  C CE1  . PHE A 1 168 ? 2.325   3.724   4.523   1.00 40.10 ? 163 PHE A CE1  4  
ATOM 9927  C CE2  . PHE A 1 168 ? 2.941   4.054   2.237   1.00 41.35 ? 163 PHE A CE2  4  
ATOM 9928  C CZ   . PHE A 1 168 ? 3.084   4.378   3.572   1.00 53.12 ? 163 PHE A CZ   4  
ATOM 9929  H H    . PHE A 1 168 ? -1.381  0.870   4.569   1.00 34.22 ? 163 PHE A H    4  
ATOM 9930  H HA   . PHE A 1 168 ? -1.341  2.739   2.292   1.00 33.51 ? 163 PHE A HA   4  
ATOM 9931  H HB3  . PHE A 1 168 ? 0.422   1.181   1.325   1.00 13.43 ? 163 PHE A HB3  4  
ATOM 9932  H HD1  . PHE A 1 168 ? 0.830   2.239   4.880   1.00 32.41 ? 163 PHE A HD1  4  
ATOM 9933  H HD2  . PHE A 1 168 ? 1.928   2.828   0.810   1.00 21.40 ? 163 PHE A HD2  4  
ATOM 9934  H HE1  . PHE A 1 168 ? 2.433   3.974   5.568   1.00 42.03 ? 163 PHE A HE1  4  
ATOM 9935  H HE2  . PHE A 1 168 ? 3.534   4.563   1.492   1.00 1.45  ? 163 PHE A HE2  4  
ATOM 9936  H HZ   . PHE A 1 168 ? 3.789   5.137   3.872   1.00 63.24 ? 163 PHE A HZ   4  
ATOM 9937  N N    . VAL A 1 169 ? -2.679  1.261   0.812   1.00 52.31 ? 164 VAL A N    4  
ATOM 9938  C CA   . VAL A 1 169 ? -3.588  0.451   0.011   1.00 3.24  ? 164 VAL A CA   4  
ATOM 9939  C C    . VAL A 1 169 ? -2.847  -0.249  -1.123  1.00 55.32 ? 164 VAL A C    4  
ATOM 9940  O O    . VAL A 1 169 ? -2.202  0.396   -1.949  1.00 24.02 ? 164 VAL A O    4  
ATOM 9941  C CB   . VAL A 1 169 ? -4.724  1.304   -0.583  1.00 11.21 ? 164 VAL A CB   4  
ATOM 9942  C CG1  . VAL A 1 169 ? -5.756  0.419   -1.265  1.00 30.15 ? 164 VAL A CG1  4  
ATOM 9943  C CG2  . VAL A 1 169 ? -5.371  2.157   0.498   1.00 42.30 ? 164 VAL A CG2  4  
ATOM 9944  H H    . VAL A 1 169 ? -2.491  2.183   0.537   1.00 3.34  ? 164 VAL A H    4  
ATOM 9945  H HA   . VAL A 1 169 ? -4.027  -0.296  0.657   1.00 21.22 ? 164 VAL A HA   4  
ATOM 9946  H HB   . VAL A 1 169 ? -4.301  1.964   -1.327  1.00 13.21 ? 164 VAL A HB   4  
ATOM 9947  H HG11 . VAL A 1 169 ? -5.823  -0.523  -0.742  1.00 15.13 ? 164 VAL A HG11 4  
ATOM 9948  H HG12 . VAL A 1 169 ? -6.719  0.910   -1.250  1.00 54.45 ? 164 VAL A HG12 4  
ATOM 9949  H HG13 . VAL A 1 169 ? -5.459  0.242   -2.288  1.00 5.30  ? 164 VAL A HG13 4  
ATOM 9950  H HG21 . VAL A 1 169 ? -4.950  1.899   1.458   1.00 52.32 ? 164 VAL A HG21 4  
ATOM 9951  H HG22 . VAL A 1 169 ? -5.187  3.201   0.293   1.00 51.41 ? 164 VAL A HG22 4  
ATOM 9952  H HG23 . VAL A 1 169 ? -6.435  1.976   0.510   1.00 34.53 ? 164 VAL A HG23 4  
ATOM 9953  N N    . VAL A 1 170 ? -2.943  -1.574  -1.156  1.00 11.53 ? 165 VAL A N    4  
ATOM 9954  C CA   . VAL A 1 170 ? -2.283  -2.364  -2.189  1.00 32.42 ? 165 VAL A CA   4  
ATOM 9955  C C    . VAL A 1 170 ? -3.291  -2.894  -3.203  1.00 53.12 ? 165 VAL A C    4  
ATOM 9956  O O    . VAL A 1 170 ? -4.117  -3.751  -2.885  1.00 75.54 ? 165 VAL A O    4  
ATOM 9957  C CB   . VAL A 1 170 ? -1.509  -3.548  -1.582  1.00 34.51 ? 165 VAL A CB   4  
ATOM 9958  C CG1  . VAL A 1 170 ? -0.726  -4.283  -2.659  1.00 22.11 ? 165 VAL A CG1  4  
ATOM 9959  C CG2  . VAL A 1 170 ? -0.584  -3.068  -0.473  1.00 33.13 ? 165 VAL A CG2  4  
ATOM 9960  H H    . VAL A 1 170 ? -3.472  -2.033  -0.470  1.00 70.14 ? 165 VAL A H    4  
ATOM 9961  H HA   . VAL A 1 170 ? -1.578  -1.723  -2.699  1.00 72.41 ? 165 VAL A HA   4  
ATOM 9962  H HB   . VAL A 1 170 ? -2.223  -4.238  -1.154  1.00 62.34 ? 165 VAL A HB   4  
ATOM 9963  H HG11 . VAL A 1 170 ? 0.107   -4.801  -2.208  1.00 43.43 ? 165 VAL A HG11 4  
ATOM 9964  H HG12 . VAL A 1 170 ? -1.372  -4.996  -3.151  1.00 42.44 ? 165 VAL A HG12 4  
ATOM 9965  H HG13 . VAL A 1 170 ? -0.357  -3.572  -3.384  1.00 41.24 ? 165 VAL A HG13 4  
ATOM 9966  H HG21 . VAL A 1 170 ? 0.241   -3.757  -0.370  1.00 11.04 ? 165 VAL A HG21 4  
ATOM 9967  H HG22 . VAL A 1 170 ? -0.206  -2.087  -0.719  1.00 42.51 ? 165 VAL A HG22 4  
ATOM 9968  H HG23 . VAL A 1 170 ? -1.132  -3.020  0.456   1.00 64.13 ? 165 VAL A HG23 4  
ATOM 9969  N N    . LYS A 1 171 ? -3.218  -2.382  -4.426  1.00 60.31 ? 166 LYS A N    4  
ATOM 9970  C CA   . LYS A 1 171 ? -4.122  -2.805  -5.489  1.00 63.23 ? 166 LYS A CA   4  
ATOM 9971  C C    . LYS A 1 171 ? -3.347  -3.157  -6.755  1.00 70.21 ? 166 LYS A C    4  
ATOM 9972  O O    . LYS A 1 171 ? -2.379  -2.483  -7.109  1.00 13.33 ? 166 LYS A O    4  
ATOM 9973  C CB   . LYS A 1 171 ? -5.139  -1.702  -5.791  1.00 54.05 ? 166 LYS A CB   4  
ATOM 9974  C CG   . LYS A 1 171 ? -6.405  -2.208  -6.461  1.00 71.34 ? 166 LYS A CG   4  
ATOM 9975  C CD   . LYS A 1 171 ? -7.158  -3.179  -5.566  1.00 23.14 ? 166 LYS A CD   4  
ATOM 9976  C CE   . LYS A 1 171 ? -8.550  -2.662  -5.233  1.00 15.10 ? 166 LYS A CE   4  
ATOM 9977  N NZ   . LYS A 1 171 ? -9.379  -2.474  -6.455  1.00 44.01 ? 166 LYS A NZ   4  
ATOM 9978  H H    . LYS A 1 171 ? -2.538  -1.702  -4.619  1.00 45.44 ? 166 LYS A H    4  
ATOM 9979  H HA   . LYS A 1 171 ? -4.647  -3.684  -5.147  1.00 72.10 ? 166 LYS A HA   4  
ATOM 9980  H HB3  . LYS A 1 171 ? -4.679  -0.973  -6.443  1.00 61.13 ? 166 LYS A HB3  4  
ATOM 9981  H HG3  . LYS A 1 171 ? -6.138  -2.712  -7.379  1.00 21.02 ? 166 LYS A HG3  4  
ATOM 9982  H HD3  . LYS A 1 171 ? -6.604  -3.314  -4.649  1.00 63.34 ? 166 LYS A HD3  4  
ATOM 9983  H HE3  . LYS A 1 171 ? -8.456  -1.716  -4.722  1.00 44.44 ? 166 LYS A HE3  4  
ATOM 9984  H HZ1  . LYS A 1 171 ? -8.853  -2.789  -7.296  1.00 73.31 ? 166 LYS A HZ1  4  
ATOM 9985  H HZ2  . LYS A 1 171 ? -9.623  -1.469  -6.569  1.00 33.24 ? 166 LYS A HZ2  4  
ATOM 9986  H HZ3  . LYS A 1 171 ? -10.256 -3.027  -6.381  1.00 10.13 ? 166 LYS A HZ3  4  
ATOM 9987  N N    . GLY A 1 172 ? -3.779  -4.215  -7.434  1.00 33.02 ? 167 GLY A N    4  
ATOM 9988  C CA   . GLY A 1 172 ? -3.114  -4.636  -8.653  1.00 23.35 ? 167 GLY A CA   4  
ATOM 9989  C C    . GLY A 1 172 ? -3.349  -6.100  -8.965  1.00 14.33 ? 167 GLY A C    4  
ATOM 9990  O O    . GLY A 1 172 ? -4.323  -6.693  -8.501  1.00 75.00 ? 167 GLY A O    4  
ATOM 9991  H H    . GLY A 1 172 ? -4.555  -4.714  -7.103  1.00 2.12  ? 167 GLY A H    4  
ATOM 9992  H HA2  . GLY A 1 172 ? -3.483  -4.040  -9.475  1.00 55.32 ? 167 GLY A HA2  4  
ATOM 9993  H HA3  . GLY A 1 172 ? -2.053  -4.468  -8.547  1.00 0.31  ? 167 GLY A HA3  4  
ATOM 9994  N N    . ASP A 1 173 ? -2.455  -6.686  -9.754  1.00 13.32 ? 168 ASP A N    4  
ATOM 9995  C CA   . ASP A 1 173 ? -2.569  -8.091  -10.128 1.00 61.41 ? 168 ASP A CA   4  
ATOM 9996  C C    . ASP A 1 173 ? -1.421  -8.905  -9.540  1.00 33.23 ? 168 ASP A C    4  
ATOM 9997  O O    . ASP A 1 173 ? -0.334  -8.380  -9.298  1.00 71.14 ? 168 ASP A O    4  
ATOM 9998  C CB   . ASP A 1 173 ? -2.586  -8.235  -11.651 1.00 11.41 ? 168 ASP A CB   4  
ATOM 9999  C CG   . ASP A 1 173 ? -3.523  -9.332  -12.118 1.00 13.01 ? 168 ASP A CG   4  
ATOM 10000 O OD1  . ASP A 1 173 ? -3.398  -10.471 -11.620 1.00 44.53 ? 168 ASP A OD1  4  
ATOM 10001 O OD2  . ASP A 1 173 ? -4.380  -9.053  -12.982 1.00 21.22 ? 168 ASP A OD2  4  
ATOM 10002 H H    . ASP A 1 173 ? -1.699  -6.161  -10.092 1.00 21.13 ? 168 ASP A H    4  
ATOM 10003 H HA   . ASP A 1 173 ? -3.500  -8.466  -9.730  1.00 25.23 ? 168 ASP A HA   4  
ATOM 10004 H HB3  . ASP A 1 173 ? -1.589  -8.467  -11.995 1.00 72.05 ? 168 ASP A HB3  4  
ATOM 10005 N N    . LEU A 1 174 ? -1.669  -10.190 -9.313  1.00 33.50 ? 169 LEU A N    4  
ATOM 10006 C CA   . LEU A 1 174 ? -0.657  -11.077 -8.751  1.00 13.53 ? 169 LEU A CA   4  
ATOM 10007 C C    . LEU A 1 174 ? -0.067  -11.981 -9.830  1.00 14.33 ? 169 LEU A C    4  
ATOM 10008 O O    . LEU A 1 174 ? -0.674  -12.221 -10.874 1.00 23.13 ? 169 LEU A O    4  
ATOM 10009 C CB   . LEU A 1 174 ? -1.259  -11.927 -7.631  1.00 62.44 ? 169 LEU A CB   4  
ATOM 10010 C CG   . LEU A 1 174 ? -1.462  -11.222 -6.289  1.00 52.41 ? 169 LEU A CG   4  
ATOM 10011 C CD1  . LEU A 1 174 ? -2.245  -12.108 -5.333  1.00 2.43  ? 169 LEU A CD1  4  
ATOM 10012 C CD2  . LEU A 1 174 ? -0.120  -10.834 -5.682  1.00 13.23 ? 169 LEU A CD2  4  
ATOM 10013 H H    . LEU A 1 174 ? -2.554  -10.551 -9.526  1.00 34.25 ? 169 LEU A H    4  
ATOM 10014 H HA   . LEU A 1 174 ? 0.132   -10.464 -8.342  1.00 2.34  ? 169 LEU A HA   4  
ATOM 10015 H HB3  . LEU A 1 174 ? -0.603  -12.770 -7.467  1.00 42.01 ? 169 LEU A HB3  4  
ATOM 10016 H HG   . LEU A 1 174 ? -2.032  -10.316 -6.448  1.00 53.40 ? 169 LEU A HG   4  
ATOM 10017 H HD11 . LEU A 1 174 ? -2.238  -11.669 -4.347  1.00 25.23 ? 169 LEU A HD11 4  
ATOM 10018 H HD12 . LEU A 1 174 ? -1.790  -13.087 -5.295  1.00 12.11 ? 169 LEU A HD12 4  
ATOM 10019 H HD13 . LEU A 1 174 ? -3.264  -12.199 -5.681  1.00 14.30 ? 169 LEU A HD13 4  
ATOM 10020 H HD21 . LEU A 1 174 ? 0.639   -10.853 -6.449  1.00 53.43 ? 169 LEU A HD21 4  
ATOM 10021 H HD22 . LEU A 1 174 ? 0.138   -11.537 -4.903  1.00 34.40 ? 169 LEU A HD22 4  
ATOM 10022 H HD23 . LEU A 1 174 ? -0.188  -9.841  -5.266  1.00 62.45 ? 169 LEU A HD23 4  
ATOM 10023 N N    . PRO A 1 175 ? 1.142   -12.499 -9.572  1.00 44.43 ? 170 PRO A N    4  
ATOM 10024 C CA   . PRO A 1 175 ? 1.840   -13.387 -10.507 1.00 32.04 ? 170 PRO A CA   4  
ATOM 10025 C C    . PRO A 1 175 ? 1.171   -14.753 -10.617 1.00 32.43 ? 170 PRO A C    4  
ATOM 10026 O O    . PRO A 1 175 ? 1.341   -15.460 -11.609 1.00 1.45  ? 170 PRO A O    4  
ATOM 10027 C CB   . PRO A 1 175 ? 3.236   -13.523 -9.895  1.00 74.40 ? 170 PRO A CB   4  
ATOM 10028 C CG   . PRO A 1 175 ? 3.038   -13.263 -8.440  1.00 5.52  ? 170 PRO A CG   4  
ATOM 10029 C CD   . PRO A 1 175 ? 1.925   -12.257 -8.348  1.00 13.02 ? 170 PRO A CD   4  
ATOM 10030 H HA   . PRO A 1 175 ? 1.917   -12.947 -11.490 1.00 63.52 ? 170 PRO A HA   4  
ATOM 10031 H HB3  . PRO A 1 175 ? 3.899   -12.796 -10.339 1.00 53.54 ? 170 PRO A HB3  4  
ATOM 10032 H HG3  . PRO A 1 175 ? 3.944   -12.858 -8.014  1.00 50.23 ? 170 PRO A HG3  4  
ATOM 10033 H HD3  . PRO A 1 175 ? 2.322   -11.253 -8.337  1.00 42.31 ? 170 PRO A HD3  4  
ATOM 10034 N N    . ASP A 1 176 ? 0.410   -15.118 -9.591  1.00 70.10 ? 171 ASP A N    4  
ATOM 10035 C CA   . ASP A 1 176 ? -0.286  -16.400 -9.572  1.00 25.32 ? 171 ASP A CA   4  
ATOM 10036 C C    . ASP A 1 176 ? -1.348  -16.456 -10.666 1.00 35.03 ? 171 ASP A C    4  
ATOM 10037 O O    . ASP A 1 176 ? -1.690  -15.437 -11.267 1.00 73.33 ? 171 ASP A O    4  
ATOM 10038 C CB   . ASP A 1 176 ? -0.930  -16.634 -8.205  1.00 51.30 ? 171 ASP A CB   4  
ATOM 10039 C CG   . ASP A 1 176 ? -1.491  -18.036 -8.063  1.00 32.32 ? 171 ASP A CG   4  
ATOM 10040 O OD1  . ASP A 1 176 ? -0.804  -18.995 -8.471  1.00 60.23 ? 171 ASP A OD1  4  
ATOM 10041 O OD2  . ASP A 1 176 ? -2.620  -18.173 -7.545  1.00 4.30  ? 171 ASP A OD2  4  
ATOM 10042 H H    . ASP A 1 176 ? 0.313   -14.510 -8.827  1.00 45.52 ? 171 ASP A H    4  
ATOM 10043 H HA   . ASP A 1 176 ? 0.443   -17.175 -9.755  1.00 24.45 ? 171 ASP A HA   4  
ATOM 10044 H HB3  . ASP A 1 176 ? -1.734  -15.927 -8.067  1.00 32.10 ? 171 ASP A HB3  4  
ATOM 10045 N N    . MET A 1 6   ? -9.138  -19.194 5.894   1.00 74.44 ? 1   MET A N    5  
ATOM 10046 C CA   . MET A 1 6   ? -7.845  -19.685 6.359   1.00 71.02 ? 1   MET A CA   5  
ATOM 10047 C C    . MET A 1 6   ? -7.584  -21.097 5.848   1.00 13.55 ? 1   MET A C    5  
ATOM 10048 O O    . MET A 1 6   ? -8.270  -21.577 4.945   1.00 25.13 ? 1   MET A O    5  
ATOM 10049 C CB   . MET A 1 6   ? -7.788  -19.664 7.888   1.00 3.41  ? 1   MET A CB   5  
ATOM 10050 C CG   . MET A 1 6   ? -8.377  -18.405 8.502   1.00 24.40 ? 1   MET A CG   5  
ATOM 10051 S SD   . MET A 1 6   ? -10.077 -18.633 9.057   1.00 30.12 ? 1   MET A SD   5  
ATOM 10052 C CE   . MET A 1 6   ? -9.819  -19.575 10.558  1.00 12.23 ? 1   MET A CE   5  
ATOM 10053 H H    . MET A 1 6   ? -9.377  -19.299 4.949   1.00 73.53 ? 1   MET A H    5  
ATOM 10054 H HA   . MET A 1 6   ? -7.083  -19.027 5.970   1.00 64.32 ? 1   MET A HA   5  
ATOM 10055 H HB3  . MET A 1 6   ? -6.757  -19.742 8.199   1.00 2.21  ? 1   MET A HB3  5  
ATOM 10056 H HG3  . MET A 1 6   ? -8.356  -17.618 7.762   1.00 32.43 ? 1   MET A HG3  5  
ATOM 10057 H HE1  . MET A 1 6   ? -9.152  -20.400 10.356  1.00 13.15 ? 1   MET A HE1  5  
ATOM 10058 H HE2  . MET A 1 6   ? -9.383  -18.937 11.312  1.00 74.44 ? 1   MET A HE2  5  
ATOM 10059 H HE3  . MET A 1 6   ? -10.767 -19.956 10.911  1.00 44.03 ? 1   MET A HE3  5  
ATOM 10060 N N    . GLU A 1 7   ? -6.589  -21.759 6.430   1.00 33.44 ? 2   GLU A N    5  
ATOM 10061 C CA   . GLU A 1 7   ? -6.239  -23.117 6.031   1.00 43.51 ? 2   GLU A CA   5  
ATOM 10062 C C    . GLU A 1 7   ? -5.527  -23.120 4.681   1.00 50.14 ? 2   GLU A C    5  
ATOM 10063 O O    . GLU A 1 7   ? -4.376  -23.545 4.575   1.00 52.41 ? 2   GLU A O    5  
ATOM 10064 C CB   . GLU A 1 7   ? -7.492  -23.992 5.961   1.00 43.43 ? 2   GLU A CB   5  
ATOM 10065 C CG   . GLU A 1 7   ? -8.456  -23.766 7.112   1.00 73.51 ? 2   GLU A CG   5  
ATOM 10066 C CD   . GLU A 1 7   ? -9.276  -24.999 7.437   1.00 55.40 ? 2   GLU A CD   5  
ATOM 10067 O OE1  . GLU A 1 7   ? -9.926  -25.539 6.517   1.00 4.24  ? 2   GLU A OE1  5  
ATOM 10068 O OE2  . GLU A 1 7   ? -9.268  -25.427 8.610   1.00 60.14 ? 2   GLU A OE2  5  
ATOM 10069 H H    . GLU A 1 7   ? -6.080  -21.323 7.144   1.00 54.35 ? 2   GLU A H    5  
ATOM 10070 H HA   . GLU A 1 7   ? -5.571  -23.520 6.777   1.00 61.14 ? 2   GLU A HA   5  
ATOM 10071 H HB3  . GLU A 1 7   ? -7.193  -25.029 5.968   1.00 41.51 ? 2   GLU A HB3  5  
ATOM 10072 H HG3  . GLU A 1 7   ? -9.130  -22.964 6.849   1.00 73.33 ? 2   GLU A HG3  5  
ATOM 10073 N N    . SER A 1 8   ? -6.219  -22.644 3.652   1.00 64.31 ? 3   SER A N    5  
ATOM 10074 C CA   . SER A 1 8   ? -5.655  -22.596 2.308   1.00 23.54 ? 3   SER A CA   5  
ATOM 10075 C C    . SER A 1 8   ? -4.496  -21.606 2.240   1.00 54.35 ? 3   SER A C    5  
ATOM 10076 O O    . SER A 1 8   ? -3.753  -21.571 1.259   1.00 51.13 ? 3   SER A O    5  
ATOM 10077 C CB   . SER A 1 8   ? -6.733  -22.205 1.294   1.00 40.11 ? 3   SER A CB   5  
ATOM 10078 O OG   . SER A 1 8   ? -7.278  -23.350 0.663   1.00 13.11 ? 3   SER A OG   5  
ATOM 10079 H H    . SER A 1 8   ? -7.132  -22.318 3.800   1.00 15.02 ? 3   SER A H    5  
ATOM 10080 H HA   . SER A 1 8   ? -5.287  -23.581 2.067   1.00 75.42 ? 3   SER A HA   5  
ATOM 10081 H HB3  . SER A 1 8   ? -6.298  -21.565 0.540   1.00 51.10 ? 3   SER A HB3  5  
ATOM 10082 H HG   . SER A 1 8   ? -8.215  -23.214 0.507   1.00 20.04 ? 3   SER A HG   5  
ATOM 10083 N N    . ILE A 1 9   ? -4.347  -20.805 3.290   1.00 71.20 ? 4   ILE A N    5  
ATOM 10084 C CA   . ILE A 1 9   ? -3.278  -19.817 3.351   1.00 73.23 ? 4   ILE A CA   5  
ATOM 10085 C C    . ILE A 1 9   ? -1.940  -20.473 3.677   1.00 14.04 ? 4   ILE A C    5  
ATOM 10086 O O    . ILE A 1 9   ? -1.830  -21.239 4.635   1.00 42.34 ? 4   ILE A O    5  
ATOM 10087 C CB   . ILE A 1 9   ? -3.575  -18.731 4.402   1.00 42.35 ? 4   ILE A CB   5  
ATOM 10088 C CG1  . ILE A 1 9   ? -5.047  -18.322 4.344   1.00 21.45 ? 4   ILE A CG1  5  
ATOM 10089 C CG2  . ILE A 1 9   ? -2.674  -17.524 4.185   1.00 51.00 ? 4   ILE A CG2  5  
ATOM 10090 C CD1  . ILE A 1 9   ? -5.395  -17.180 5.273   1.00 12.31 ? 4   ILE A CD1  5  
ATOM 10091 H H    . ILE A 1 9   ? -4.972  -20.882 4.042   1.00 45.44 ? 4   ILE A H    5  
ATOM 10092 H HA   . ILE A 1 9   ? -3.208  -19.342 2.382   1.00 71.14 ? 4   ILE A HA   5  
ATOM 10093 H HB   . ILE A 1 9   ? -3.360  -19.139 5.379   1.00 20.24 ? 4   ILE A HB   5  
ATOM 10094 H HG13 . ILE A 1 9   ? -5.660  -19.169 4.615   1.00 13.33 ? 4   ILE A HG13 5  
ATOM 10095 H HG21 . ILE A 1 9   ? -3.148  -16.841 3.496   1.00 2.21  ? 4   ILE A HG21 5  
ATOM 10096 H HG22 . ILE A 1 9   ? -2.509  -17.024 5.128   1.00 11.04 ? 4   ILE A HG22 5  
ATOM 10097 H HG23 . ILE A 1 9   ? -1.729  -17.848 3.779   1.00 41.23 ? 4   ILE A HG23 5  
ATOM 10098 H HD11 . ILE A 1 9   ? -4.864  -17.300 6.206   1.00 4.31  ? 4   ILE A HD11 5  
ATOM 10099 H HD12 . ILE A 1 9   ? -5.113  -16.243 4.815   1.00 14.03 ? 4   ILE A HD12 5  
ATOM 10100 H HD13 . ILE A 1 9   ? -6.459  -17.182 5.463   1.00 43.52 ? 4   ILE A HD13 5  
ATOM 10101 N N    . PHE A 1 10  ? -0.926  -20.167 2.874   1.00 73.40 ? 5   PHE A N    5  
ATOM 10102 C CA   . PHE A 1 10  ? 0.405   -20.726 3.078   1.00 64.11 ? 5   PHE A CA   5  
ATOM 10103 C C    . PHE A 1 10  ? 1.110   -20.040 4.244   1.00 42.13 ? 5   PHE A C    5  
ATOM 10104 O O    . PHE A 1 10  ? 1.229   -18.814 4.278   1.00 61.31 ? 5   PHE A O    5  
ATOM 10105 C CB   . PHE A 1 10  ? 1.241   -20.582 1.805   1.00 12.52 ? 5   PHE A CB   5  
ATOM 10106 C CG   . PHE A 1 10  ? 2.510   -21.385 1.828   1.00 51.34 ? 5   PHE A CG   5  
ATOM 10107 C CD1  . PHE A 1 10  ? 3.657   -20.878 2.419   1.00 24.42 ? 5   PHE A CD1  5  
ATOM 10108 C CD2  . PHE A 1 10  ? 2.558   -22.647 1.258   1.00 33.52 ? 5   PHE A CD2  5  
ATOM 10109 C CE1  . PHE A 1 10  ? 4.826   -21.614 2.442   1.00 61.10 ? 5   PHE A CE1  5  
ATOM 10110 C CE2  . PHE A 1 10  ? 3.724   -23.389 1.279   1.00 4.00  ? 5   PHE A CE2  5  
ATOM 10111 C CZ   . PHE A 1 10  ? 4.860   -22.870 1.870   1.00 13.32 ? 5   PHE A CZ   5  
ATOM 10112 H H    . PHE A 1 10  ? -1.077  -19.550 2.127   1.00 73.33 ? 5   PHE A H    5  
ATOM 10113 H HA   . PHE A 1 10  ? 0.292   -21.774 3.308   1.00 23.12 ? 5   PHE A HA   5  
ATOM 10114 H HB3  . PHE A 1 10  ? 1.505   -19.545 1.672   1.00 64.15 ? 5   PHE A HB3  5  
ATOM 10115 H HD1  . PHE A 1 10  ? 3.631   -19.893 2.866   1.00 11.01 ? 5   PHE A HD1  5  
ATOM 10116 H HD2  . PHE A 1 10  ? 1.671   -23.053 0.794   1.00 34.25 ? 5   PHE A HD2  5  
ATOM 10117 H HE1  . PHE A 1 10  ? 5.712   -21.205 2.905   1.00 33.23 ? 5   PHE A HE1  5  
ATOM 10118 H HE2  . PHE A 1 10  ? 3.749   -24.370 0.831   1.00 32.11 ? 5   PHE A HE2  5  
ATOM 10119 H HZ   . PHE A 1 10  ? 5.772   -23.447 1.888   1.00 11.42 ? 5   PHE A HZ   5  
ATOM 10120 N N    . HIS A 1 11  ? 1.578   -20.838 5.198   1.00 43.32 ? 6   HIS A N    5  
ATOM 10121 C CA   . HIS A 1 11  ? 2.273   -20.308 6.366   1.00 12.40 ? 6   HIS A CA   5  
ATOM 10122 C C    . HIS A 1 11  ? 3.712   -20.812 6.417   1.00 52.40 ? 6   HIS A C    5  
ATOM 10123 O O    . HIS A 1 11  ? 3.963   -22.014 6.323   1.00 71.51 ? 6   HIS A O    5  
ATOM 10124 C CB   . HIS A 1 11  ? 1.536   -20.705 7.646   1.00 63.05 ? 6   HIS A CB   5  
ATOM 10125 C CG   . HIS A 1 11  ? 1.531   -22.180 7.902   1.00 53.01 ? 6   HIS A CG   5  
ATOM 10126 N ND1  . HIS A 1 11  ? 2.144   -22.757 8.994   1.00 43.20 ? 6   HIS A ND1  5  
ATOM 10127 C CD2  . HIS A 1 11  ? 0.980   -23.198 7.200   1.00 41.24 ? 6   HIS A CD2  5  
ATOM 10128 C CE1  . HIS A 1 11  ? 1.972   -24.066 8.953   1.00 1.34  ? 6   HIS A CE1  5  
ATOM 10129 N NE2  . HIS A 1 11  ? 1.268   -24.360 7.873   1.00 53.25 ? 6   HIS A NE2  5  
ATOM 10130 H H    . HIS A 1 11  ? 1.453   -21.807 5.114   1.00 40.14 ? 6   HIS A H    5  
ATOM 10131 H HA   . HIS A 1 11  ? 2.285   -19.233 6.286   1.00 20.44 ? 6   HIS A HA   5  
ATOM 10132 H HB3  . HIS A 1 11  ? 0.510   -20.374 7.580   1.00 75.33 ? 6   HIS A HB3  5  
ATOM 10133 H HD1  . HIS A 1 11  ? 2.634   -22.278 9.694   1.00 74.14 ? 6   HIS A HD1  5  
ATOM 10134 H HD2  . HIS A 1 11  ? 0.418   -23.114 6.281   1.00 60.32 ? 6   HIS A HD2  5  
ATOM 10135 H HE1  . HIS A 1 11  ? 2.343   -24.777 9.676   1.00 64.32 ? 6   HIS A HE1  5  
ATOM 10136 N N    . GLU A 1 12  ? 4.654   -19.886 6.565   1.00 24.41 ? 7   GLU A N    5  
ATOM 10137 C CA   . GLU A 1 12  ? 6.068   -20.236 6.625   1.00 15.11 ? 7   GLU A CA   5  
ATOM 10138 C C    . GLU A 1 12  ? 6.597   -20.118 8.052   1.00 64.21 ? 7   GLU A C    5  
ATOM 10139 O O    . GLU A 1 12  ? 7.343   -20.976 8.523   1.00 40.15 ? 7   GLU A O    5  
ATOM 10140 C CB   . GLU A 1 12  ? 6.880   -19.336 5.692   1.00 30.11 ? 7   GLU A CB   5  
ATOM 10141 C CG   . GLU A 1 12  ? 8.325   -19.776 5.528   1.00 55.15 ? 7   GLU A CG   5  
ATOM 10142 C CD   . GLU A 1 12  ? 8.935   -19.302 4.223   1.00 51.11 ? 7   GLU A CD   5  
ATOM 10143 O OE1  . GLU A 1 12  ? 8.185   -19.167 3.234   1.00 5.02  ? 7   GLU A OE1  5  
ATOM 10144 O OE2  . GLU A 1 12  ? 10.161  -19.068 4.191   1.00 14.40 ? 7   GLU A OE2  5  
ATOM 10145 H H    . GLU A 1 12  ? 4.391   -18.944 6.633   1.00 44.14 ? 7   GLU A H    5  
ATOM 10146 H HA   . GLU A 1 12  ? 6.170   -21.261 6.301   1.00 73.42 ? 7   GLU A HA   5  
ATOM 10147 H HB3  . GLU A 1 12  ? 6.875   -18.331 6.087   1.00 21.32 ? 7   GLU A HB3  5  
ATOM 10148 H HG3  . GLU A 1 12  ? 8.366   -20.856 5.557   1.00 21.42 ? 7   GLU A HG3  5  
ATOM 10149 N N    . LYS A 1 13  ? 6.204   -19.048 8.735   1.00 74.43 ? 8   LYS A N    5  
ATOM 10150 C CA   . LYS A 1 13  ? 6.637   -18.815 10.108  1.00 0.22  ? 8   LYS A CA   5  
ATOM 10151 C C    . LYS A 1 13  ? 8.146   -18.607 10.175  1.00 53.32 ? 8   LYS A C    5  
ATOM 10152 O O    . LYS A 1 13  ? 8.919   -19.542 9.973   1.00 41.33 ? 8   LYS A O    5  
ATOM 10153 C CB   . LYS A 1 13  ? 6.233   -19.993 10.998  1.00 64.31 ? 8   LYS A CB   5  
ATOM 10154 C CG   . LYS A 1 13  ? 4.807   -20.464 10.774  1.00 61.00 ? 8   LYS A CG   5  
ATOM 10155 C CD   . LYS A 1 13  ? 4.020   -20.499 12.074  1.00 62.43 ? 8   LYS A CD   5  
ATOM 10156 C CE   . LYS A 1 13  ? 4.634   -21.470 13.071  1.00 61.25 ? 8   LYS A CE   5  
ATOM 10157 N NZ   . LYS A 1 13  ? 3.662   -22.513 13.500  1.00 21.30 ? 8   LYS A NZ   5  
ATOM 10158 H H    . LYS A 1 13  ? 5.607   -18.399 8.305   1.00 44.44 ? 8   LYS A H    5  
ATOM 10159 H HA   . LYS A 1 13  ? 6.146   -17.922 10.463  1.00 23.51 ? 8   LYS A HA   5  
ATOM 10160 H HB3  . LYS A 1 13  ? 6.334   -19.697 12.033  1.00 51.33 ? 8   LYS A HB3  5  
ATOM 10161 H HG3  . LYS A 1 13  ? 4.828   -21.458 10.350  1.00 70.22 ? 8   LYS A HG3  5  
ATOM 10162 H HD3  . LYS A 1 13  ? 3.006   -20.807 11.863  1.00 64.14 ? 8   LYS A HD3  5  
ATOM 10163 H HE3  . LYS A 1 13  ? 4.962   -20.915 13.938  1.00 53.22 ? 8   LYS A HE3  5  
ATOM 10164 H HZ1  . LYS A 1 13  ? 2.785   -22.066 13.837  1.00 23.15 ? 8   LYS A HZ1  5  
ATOM 10165 H HZ2  . LYS A 1 13  ? 4.065   -23.081 14.272  1.00 12.40 ? 8   LYS A HZ2  5  
ATOM 10166 H HZ3  . LYS A 1 13  ? 3.435   -23.139 12.703  1.00 14.25 ? 8   LYS A HZ3  5  
ATOM 10167 N N    . GLN A 1 14  ? 8.557   -17.376 10.462  1.00 51.34 ? 9   GLN A N    5  
ATOM 10168 C CA   . GLN A 1 14  ? 9.975   -17.047 10.556  1.00 15.24 ? 9   GLN A CA   5  
ATOM 10169 C C    . GLN A 1 14  ? 10.259  -16.220 11.805  1.00 63.54 ? 9   GLN A C    5  
ATOM 10170 O O    . GLN A 1 14  ? 9.357   -15.609 12.375  1.00 32.32 ? 9   GLN A O    5  
ATOM 10171 C CB   . GLN A 1 14  ? 10.427  -16.283 9.311   1.00 3.24  ? 9   GLN A CB   5  
ATOM 10172 C CG   . GLN A 1 14  ? 10.252  -17.067 8.019   1.00 53.33 ? 9   GLN A CG   5  
ATOM 10173 C CD   . GLN A 1 14  ? 11.481  -17.878 7.659   1.00 42.24 ? 9   GLN A CD   5  
ATOM 10174 O OE1  . GLN A 1 14  ? 12.312  -17.447 6.859   1.00 60.52 ? 9   GLN A OE1  5  
ATOM 10175 N NE2  . GLN A 1 14  ? 11.605  -19.061 8.250   1.00 30.31 ? 9   GLN A NE2  5  
ATOM 10176 H H    . GLN A 1 14  ? 7.892   -16.673 10.614  1.00 3.35  ? 9   GLN A H    5  
ATOM 10177 H HA   . GLN A 1 14  ? 10.526  -17.973 10.619  1.00 70.14 ? 9   GLN A HA   5  
ATOM 10178 H HB3  . GLN A 1 14  ? 11.472  -16.033 9.416   1.00 60.42 ? 9   GLN A HB3  5  
ATOM 10179 H HG3  . GLN A 1 14  ? 10.049  -16.374 7.218   1.00 23.03 ? 9   GLN A HG3  5  
ATOM 10180 H HE21 . GLN A 1 14  ? 10.903  -19.341 8.876   1.00 61.34 ? 9   GLN A HE21 5  
ATOM 10181 H HE22 . GLN A 1 14  ? 12.389  -19.607 8.035   1.00 34.10 ? 9   GLN A HE22 5  
ATOM 10182 N N    . GLU A 1 15  ? 11.521  -16.206 12.226  1.00 0.14  ? 10  GLU A N    5  
ATOM 10183 C CA   . GLU A 1 15  ? 11.923  -15.454 13.408  1.00 73.34 ? 10  GLU A CA   5  
ATOM 10184 C C    . GLU A 1 15  ? 12.102  -13.975 13.078  1.00 43.22 ? 10  GLU A C    5  
ATOM 10185 O O    . GLU A 1 15  ? 12.696  -13.623 12.061  1.00 25.04 ? 10  GLU A O    5  
ATOM 10186 C CB   . GLU A 1 15  ? 13.223  -16.021 13.982  1.00 71.12 ? 10  GLU A CB   5  
ATOM 10187 C CG   . GLU A 1 15  ? 13.170  -16.272 15.480  1.00 34.31 ? 10  GLU A CG   5  
ATOM 10188 C CD   . GLU A 1 15  ? 14.015  -17.457 15.904  1.00 40.00 ? 10  GLU A CD   5  
ATOM 10189 O OE1  . GLU A 1 15  ? 13.537  -18.604 15.776  1.00 62.22 ? 10  GLU A OE1  5  
ATOM 10190 O OE2  . GLU A 1 15  ? 15.156  -17.237 16.362  1.00 74.52 ? 10  GLU A OE2  5  
ATOM 10191 H H    . GLU A 1 15  ? 12.196  -16.713 11.728  1.00 55.31 ? 10  GLU A H    5  
ATOM 10192 H HA   . GLU A 1 15  ? 11.142  -15.554 14.146  1.00 32.15 ? 10  GLU A HA   5  
ATOM 10193 H HB3  . GLU A 1 15  ? 14.024  -15.324 13.785  1.00 2.30  ? 10  GLU A HB3  5  
ATOM 10194 H HG3  . GLU A 1 15  ? 12.145  -16.461 15.763  1.00 73.31 ? 10  GLU A HG3  5  
ATOM 10195 N N    . GLY A 1 16  ? 11.584  -13.114 13.948  1.00 70.10 ? 11  GLY A N    5  
ATOM 10196 C CA   . GLY A 1 16  ? 11.696  -11.683 13.732  1.00 24.25 ? 11  GLY A CA   5  
ATOM 10197 C C    . GLY A 1 16  ? 10.362  -10.973 13.850  1.00 65.12 ? 11  GLY A C    5  
ATOM 10198 O O    . GLY A 1 16  ? 9.357   -11.582 14.213  1.00 34.53 ? 11  GLY A O    5  
ATOM 10199 H H    . GLY A 1 16  ? 11.122  -13.452 14.743  1.00 32.45 ? 11  GLY A H    5  
ATOM 10200 H HA2  . GLY A 1 16  ? 12.377  -11.272 14.462  1.00 62.02 ? 11  GLY A HA2  5  
ATOM 10201 H HA3  . GLY A 1 16  ? 12.095  -11.510 12.743  1.00 54.34 ? 11  GLY A HA3  5  
ATOM 10202 N N    . SER A 1 17  ? 10.353  -9.679  13.544  1.00 51.52 ? 12  SER A N    5  
ATOM 10203 C CA   . SER A 1 17  ? 9.134   -8.883  13.623  1.00 12.12 ? 12  SER A CA   5  
ATOM 10204 C C    . SER A 1 17  ? 8.629   -8.522  12.230  1.00 42.01 ? 12  SER A C    5  
ATOM 10205 O O    . SER A 1 17  ? 7.651   -9.089  11.744  1.00 35.45 ? 12  SER A O    5  
ATOM 10206 C CB   . SER A 1 17  ? 9.382   -7.610  14.434  1.00 14.14 ? 12  SER A CB   5  
ATOM 10207 O OG   . SER A 1 17  ? 9.772   -7.918  15.761  1.00 14.23 ? 12  SER A OG   5  
ATOM 10208 H H    . SER A 1 17  ? 11.187  -9.250  13.261  1.00 63.31 ? 12  SER A H    5  
ATOM 10209 H HA   . SER A 1 17  ? 8.382   -9.476  14.123  1.00 12.43 ? 12  SER A HA   5  
ATOM 10210 H HB3  . SER A 1 17  ? 8.476   -7.023  14.464  1.00 34.42 ? 12  SER A HB3  5  
ATOM 10211 H HG   . SER A 1 17  ? 10.434  -8.614  15.747  1.00 60.51 ? 12  SER A HG   5  
ATOM 10212 N N    . LEU A 1 18  ? 9.305   -7.574  11.591  1.00 24.21 ? 13  LEU A N    5  
ATOM 10213 C CA   . LEU A 1 18  ? 8.928   -7.135  10.252  1.00 0.34  ? 13  LEU A CA   5  
ATOM 10214 C C    . LEU A 1 18  ? 9.927   -7.633  9.213   1.00 13.42 ? 13  LEU A C    5  
ATOM 10215 O O    . LEU A 1 18  ? 11.046  -7.128  9.121   1.00 22.21 ? 13  LEU A O    5  
ATOM 10216 C CB   . LEU A 1 18  ? 8.839   -5.609  10.200  1.00 65.41 ? 13  LEU A CB   5  
ATOM 10217 C CG   . LEU A 1 18  ? 9.947   -4.847  10.928  1.00 43.15 ? 13  LEU A CG   5  
ATOM 10218 C CD1  . LEU A 1 18  ? 10.203  -3.506  10.257  1.00 51.44 ? 13  LEU A CD1  5  
ATOM 10219 C CD2  . LEU A 1 18  ? 9.585   -4.651  12.393  1.00 71.44 ? 13  LEU A CD2  5  
ATOM 10220 H H    . LEU A 1 18  ? 10.077  -7.159  12.029  1.00 24.13 ? 13  LEU A H    5  
ATOM 10221 H HA   . LEU A 1 18  ? 7.957   -7.551  10.028  1.00 11.20 ? 13  LEU A HA   5  
ATOM 10222 H HB3  . LEU A 1 18  ? 7.894   -5.318  10.636  1.00 41.13 ? 13  LEU A HB3  5  
ATOM 10223 H HG   . LEU A 1 18  ? 10.861  -5.423  10.883  1.00 5.04  ? 13  LEU A HG   5  
ATOM 10224 H HD11 . LEU A 1 18  ? 9.803   -2.714  10.870  1.00 52.13 ? 13  LEU A HD11 5  
ATOM 10225 H HD12 . LEU A 1 18  ? 9.724   -3.491  9.289   1.00 32.52 ? 13  LEU A HD12 5  
ATOM 10226 H HD13 . LEU A 1 18  ? 11.267  -3.364  10.132  1.00 75.12 ? 13  LEU A HD13 5  
ATOM 10227 H HD21 . LEU A 1 18  ? 8.826   -5.366  12.675  1.00 41.43 ? 13  LEU A HD21 5  
ATOM 10228 H HD22 . LEU A 1 18  ? 9.208   -3.649  12.540  1.00 53.12 ? 13  LEU A HD22 5  
ATOM 10229 H HD23 . LEU A 1 18  ? 10.463  -4.799  13.003  1.00 50.34 ? 13  LEU A HD23 5  
ATOM 10230 N N    . CYS A 1 19  ? 9.515   -8.626  8.431   1.00 65.24 ? 14  CYS A N    5  
ATOM 10231 C CA   . CYS A 1 19  ? 10.374  -9.191  7.397   1.00 40.40 ? 14  CYS A CA   5  
ATOM 10232 C C    . CYS A 1 19  ? 9.792   -8.942  6.010   1.00 1.05  ? 14  CYS A C    5  
ATOM 10233 O O    . CYS A 1 19  ? 8.590   -9.099  5.793   1.00 4.33  ? 14  CYS A O    5  
ATOM 10234 C CB   . CYS A 1 19  ? 10.558  -10.693 7.624   1.00 64.24 ? 14  CYS A CB   5  
ATOM 10235 S SG   . CYS A 1 19  ? 12.277  -11.248 7.524   1.00 13.53 ? 14  CYS A SG   5  
ATOM 10236 H H    . CYS A 1 19  ? 8.612   -8.987  8.553   1.00 45.02 ? 14  CYS A H    5  
ATOM 10237 H HA   . CYS A 1 19  ? 11.335  -8.704  7.463   1.00 15.43 ? 14  CYS A HA   5  
ATOM 10238 H HB3  . CYS A 1 19  ? 9.993   -11.234 6.880   1.00 60.24 ? 14  CYS A HB3  5  
ATOM 10239 H HG   . CYS A 1 19  ? 12.345  -12.459 8.056   1.00 40.43 ? 14  CYS A HG   5  
ATOM 10240 N N    . ALA A 1 20  ? 10.651  -8.551  5.074   1.00 35.32 ? 15  ALA A N    5  
ATOM 10241 C CA   . ALA A 1 20  ? 10.221  -8.281  3.708   1.00 70.01 ? 15  ALA A CA   5  
ATOM 10242 C C    . ALA A 1 20  ? 9.824   -9.567  2.993   1.00 22.55 ? 15  ALA A C    5  
ATOM 10243 O O    . ALA A 1 20  ? 8.776   -9.631  2.350   1.00 21.23 ? 15  ALA A O    5  
ATOM 10244 C CB   . ALA A 1 20  ? 11.325  -7.567  2.940   1.00 21.03 ? 15  ALA A CB   5  
ATOM 10245 H H    . ALA A 1 20  ? 11.596  -8.444  5.308   1.00 54.33 ? 15  ALA A H    5  
ATOM 10246 H HA   . ALA A 1 20  ? 9.364   -7.624  3.751   1.00 40.42 ? 15  ALA A HA   5  
ATOM 10247 H HB1  . ALA A 1 20  ? 11.427  -8.014  1.962   1.00 43.41 ? 15  ALA A HB1  5  
ATOM 10248 H HB2  . ALA A 1 20  ? 11.072  -6.523  2.835   1.00 71.44 ? 15  ALA A HB2  5  
ATOM 10249 H HB3  . ALA A 1 20  ? 12.256  -7.661  3.479   1.00 3.32  ? 15  ALA A HB3  5  
ATOM 10250 N N    . GLN A 1 21  ? 10.665  -10.588 3.108   1.00 51.10 ? 16  GLN A N    5  
ATOM 10251 C CA   . GLN A 1 21  ? 10.401  -11.873 2.471   1.00 30.11 ? 16  GLN A CA   5  
ATOM 10252 C C    . GLN A 1 21  ? 9.088   -12.469 2.971   1.00 44.32 ? 16  GLN A C    5  
ATOM 10253 O O    . GLN A 1 21  ? 8.336   -13.071 2.205   1.00 4.23  ? 16  GLN A O    5  
ATOM 10254 C CB   . GLN A 1 21  ? 11.551  -12.846 2.738   1.00 24.53 ? 16  GLN A CB   5  
ATOM 10255 C CG   . GLN A 1 21  ? 11.278  -14.258 2.248   1.00 75.12 ? 16  GLN A CG   5  
ATOM 10256 C CD   . GLN A 1 21  ? 12.300  -15.258 2.754   1.00 74.30 ? 16  GLN A CD   5  
ATOM 10257 O OE1  . GLN A 1 21  ? 12.891  -16.006 1.975   1.00 41.13 ? 16  GLN A OE1  5  
ATOM 10258 N NE2  . GLN A 1 21  ? 12.511  -15.277 4.064   1.00 72.55 ? 16  GLN A NE2  5  
ATOM 10259 H H    . GLN A 1 21  ? 11.484  -10.476 3.634   1.00 41.24 ? 16  GLN A H    5  
ATOM 10260 H HA   . GLN A 1 21  ? 10.322  -11.705 1.408   1.00 43.44 ? 16  GLN A HA   5  
ATOM 10261 H HB3  . GLN A 1 21  ? 11.733  -12.885 3.801   1.00 14.14 ? 16  GLN A HB3  5  
ATOM 10262 H HG3  . GLN A 1 21  ? 11.297  -14.262 1.169   1.00 24.44 ? 16  GLN A HG3  5  
ATOM 10263 H HE21 . GLN A 1 21  ? 12.002  -14.653 4.624   1.00 72.11 ? 16  GLN A HE21 5  
ATOM 10264 H HE22 . GLN A 1 21  ? 13.165  -15.914 4.418   1.00 60.44 ? 16  GLN A HE22 5  
ATOM 10265 N N    . HIS A 1 22  ? 8.821   -12.297 4.262   1.00 34.01 ? 17  HIS A N    5  
ATOM 10266 C CA   . HIS A 1 22  ? 7.599   -12.818 4.864   1.00 21.30 ? 17  HIS A CA   5  
ATOM 10267 C C    . HIS A 1 22  ? 6.367   -12.161 4.250   1.00 62.10 ? 17  HIS A C    5  
ATOM 10268 O O    . HIS A 1 22  ? 5.356   -12.821 4.005   1.00 2.13  ? 17  HIS A O    5  
ATOM 10269 C CB   . HIS A 1 22  ? 7.613   -12.588 6.376   1.00 14.33 ? 17  HIS A CB   5  
ATOM 10270 C CG   . HIS A 1 22  ? 6.784   -13.576 7.139   1.00 32.04 ? 17  HIS A CG   5  
ATOM 10271 N ND1  . HIS A 1 22  ? 7.300   -14.735 7.679   1.00 44.20 ? 17  HIS A ND1  5  
ATOM 10272 C CD2  . HIS A 1 22  ? 5.468   -13.570 7.454   1.00 52.12 ? 17  HIS A CD2  5  
ATOM 10273 C CE1  . HIS A 1 22  ? 6.337   -15.401 8.290   1.00 2.21  ? 17  HIS A CE1  5  
ATOM 10274 N NE2  . HIS A 1 22  ? 5.215   -14.715 8.169   1.00 21.21 ? 17  HIS A NE2  5  
ATOM 10275 H H    . HIS A 1 22  ? 9.459   -11.809 4.821   1.00 72.34 ? 17  HIS A H    5  
ATOM 10276 H HA   . HIS A 1 22  ? 7.559   -13.880 4.670   1.00 62.23 ? 17  HIS A HA   5  
ATOM 10277 H HB3  . HIS A 1 22  ? 7.232   -11.601 6.588   1.00 23.30 ? 17  HIS A HB3  5  
ATOM 10278 H HD1  . HIS A 1 22  ? 8.234   -15.027 7.620   1.00 1.14  ? 17  HIS A HD1  5  
ATOM 10279 H HD2  . HIS A 1 22  ? 4.748   -12.808 7.191   1.00 61.11 ? 17  HIS A HD2  5  
ATOM 10280 H HE1  . HIS A 1 22  ? 6.448   -16.344 8.802   1.00 52.54 ? 17  HIS A HE1  5  
ATOM 10281 N N    . CYS A 1 23  ? 6.457   -10.859 4.005   1.00 44.23 ? 18  CYS A N    5  
ATOM 10282 C CA   . CYS A 1 23  ? 5.350   -10.111 3.420   1.00 74.22 ? 18  CYS A CA   5  
ATOM 10283 C C    . CYS A 1 23  ? 5.128   -10.516 1.967   1.00 23.35 ? 18  CYS A C    5  
ATOM 10284 O O    . CYS A 1 23  ? 3.997   -10.763 1.544   1.00 65.44 ? 18  CYS A O    5  
ATOM 10285 C CB   . CYS A 1 23  ? 5.617   -8.608  3.509   1.00 42.12 ? 18  CYS A CB   5  
ATOM 10286 S SG   . CYS A 1 23  ? 4.394   -7.588  2.653   1.00 1.23  ? 18  CYS A SG   5  
ATOM 10287 H H    . CYS A 1 23  ? 7.289   -10.387 4.222   1.00 12.45 ? 18  CYS A H    5  
ATOM 10288 H HA   . CYS A 1 23  ? 4.460   -10.343 3.985   1.00 14.42 ? 18  CYS A HA   5  
ATOM 10289 H HB3  . CYS A 1 23  ? 6.585   -8.396  3.077   1.00 32.45 ? 18  CYS A HB3  5  
ATOM 10290 H HG   . CYS A 1 23  ? 4.455   -7.875  1.361   1.00 44.04 ? 18  CYS A HG   5  
ATOM 10291 N N    . LEU A 1 24  ? 6.214   -10.581 1.204   1.00 23.30 ? 19  LEU A N    5  
ATOM 10292 C CA   . LEU A 1 24  ? 6.139   -10.953 -0.204  1.00 11.43 ? 19  LEU A CA   5  
ATOM 10293 C C    . LEU A 1 24  ? 5.686   -12.401 -0.360  1.00 1.44  ? 19  LEU A C    5  
ATOM 10294 O O    . LEU A 1 24  ? 4.790   -12.700 -1.150  1.00 72.14 ? 19  LEU A O    5  
ATOM 10295 C CB   . LEU A 1 24  ? 7.498   -10.757 -0.878  1.00 55.42 ? 19  LEU A CB   5  
ATOM 10296 C CG   . LEU A 1 24  ? 7.735   -9.394  -1.528  1.00 21.24 ? 19  LEU A CG   5  
ATOM 10297 C CD1  . LEU A 1 24  ? 7.265   -8.275  -0.610  1.00 14.22 ? 19  LEU A CD1  5  
ATOM 10298 C CD2  . LEU A 1 24  ? 9.205   -9.217  -1.877  1.00 44.34 ? 19  LEU A CD2  5  
ATOM 10299 H H    . LEU A 1 24  ? 7.088   -10.373 1.596   1.00 35.24 ? 19  LEU A H    5  
ATOM 10300 H HA   . LEU A 1 24  ? 5.414   -10.309 -0.680  1.00 53.25 ? 19  LEU A HA   5  
ATOM 10301 H HB3  . LEU A 1 24  ? 7.599   -11.512 -1.644  1.00 53.10 ? 19  LEU A HB3  5  
ATOM 10302 H HG   . LEU A 1 24  ? 7.163   -9.335  -2.444  1.00 71.15 ? 19  LEU A HG   5  
ATOM 10303 H HD11 . LEU A 1 24  ? 7.783   -8.343  0.334   1.00 13.50 ? 19  LEU A HD11 5  
ATOM 10304 H HD12 . LEU A 1 24  ? 6.201   -8.369  -0.445  1.00 60.23 ? 19  LEU A HD12 5  
ATOM 10305 H HD13 . LEU A 1 24  ? 7.475   -7.321  -1.069  1.00 3.42  ? 19  LEU A HD13 5  
ATOM 10306 H HD21 . LEU A 1 24  ? 9.405   -9.673  -2.836  1.00 31.53 ? 19  LEU A HD21 5  
ATOM 10307 H HD22 . LEU A 1 24  ? 9.814   -9.690  -1.120  1.00 22.12 ? 19  LEU A HD22 5  
ATOM 10308 H HD23 . LEU A 1 24  ? 9.440   -8.165  -1.923  1.00 63.45 ? 19  LEU A HD23 5  
ATOM 10309 N N    . ASN A 1 25  ? 6.309   -13.297 0.398   1.00 73.45 ? 20  ASN A N    5  
ATOM 10310 C CA   . ASN A 1 25  ? 5.969   -14.714 0.345   1.00 71.13 ? 20  ASN A CA   5  
ATOM 10311 C C    . ASN A 1 25  ? 4.510   -14.938 0.730   1.00 21.42 ? 20  ASN A C    5  
ATOM 10312 O O    . ASN A 1 25  ? 3.796   -15.704 0.083   1.00 44.42 ? 20  ASN A O    5  
ATOM 10313 C CB   . ASN A 1 25  ? 6.881   -15.514 1.277   1.00 41.55 ? 20  ASN A CB   5  
ATOM 10314 C CG   . ASN A 1 25  ? 8.240   -15.788 0.660   1.00 34.12 ? 20  ASN A CG   5  
ATOM 10315 O OD1  . ASN A 1 25  ? 8.754   -16.904 0.735   1.00 61.44 ? 20  ASN A OD1  5  
ATOM 10316 N ND2  . ASN A 1 25  ? 8.827   -14.767 0.046   1.00 14.20 ? 20  ASN A ND2  5  
ATOM 10317 H H    . ASN A 1 25  ? 7.015   -12.998 1.009   1.00 4.24  ? 20  ASN A H    5  
ATOM 10318 H HA   . ASN A 1 25  ? 6.118   -15.052 -0.669  1.00 75.14 ? 20  ASN A HA   5  
ATOM 10319 H HB3  . ASN A 1 25  ? 6.413   -16.459 1.506   1.00 71.41 ? 20  ASN A HB3  5  
ATOM 10320 H HD21 . ASN A 1 25  ? 8.359   -13.907 0.025   1.00 35.50 ? 20  ASN A HD21 5  
ATOM 10321 H HD22 . ASN A 1 25  ? 9.705   -14.918 -0.362  1.00 65.32 ? 20  ASN A HD22 5  
ATOM 10322 N N    . ASN A 1 26  ? 4.071   -14.262 1.787   1.00 72.33 ? 21  ASN A N    5  
ATOM 10323 C CA   . ASN A 1 26  ? 2.696   -14.386 2.258   1.00 55.15 ? 21  ASN A CA   5  
ATOM 10324 C C    . ASN A 1 26  ? 1.719   -13.799 1.245   1.00 63.04 ? 21  ASN A C    5  
ATOM 10325 O O    . ASN A 1 26  ? 0.666   -14.376 0.975   1.00 11.24 ? 21  ASN A O    5  
ATOM 10326 C CB   . ASN A 1 26  ? 2.533   -13.685 3.608   1.00 12.43 ? 21  ASN A CB   5  
ATOM 10327 C CG   . ASN A 1 26  ? 1.081   -13.397 3.937   1.00 2.15  ? 21  ASN A CG   5  
ATOM 10328 O OD1  . ASN A 1 26  ? 0.740   -12.303 4.389   1.00 5.31  ? 21  ASN A OD1  5  
ATOM 10329 N ND2  . ASN A 1 26  ? 0.216   -14.379 3.712   1.00 52.40 ? 21  ASN A ND2  5  
ATOM 10330 H H    . ASN A 1 26  ? 4.687   -13.666 2.263   1.00 63.14 ? 21  ASN A H    5  
ATOM 10331 H HA   . ASN A 1 26  ? 2.482   -15.437 2.380   1.00 53.02 ? 21  ASN A HA   5  
ATOM 10332 H HB3  . ASN A 1 26  ? 3.071   -12.750 3.590   1.00 3.32  ? 21  ASN A HB3  5  
ATOM 10333 H HD21 . ASN A 1 26  ? 0.559   -15.224 3.352   1.00 4.51  ? 21  ASN A HD21 5  
ATOM 10334 H HD22 . ASN A 1 26  ? -0.729  -14.220 3.916   1.00 5.24  ? 21  ASN A HD22 5  
ATOM 10335 N N    . LEU A 1 27  ? 2.076   -12.647 0.686   1.00 34.01 ? 22  LEU A N    5  
ATOM 10336 C CA   . LEU A 1 27  ? 1.231   -11.980 -0.298  1.00 55.24 ? 22  LEU A CA   5  
ATOM 10337 C C    . LEU A 1 27  ? 0.966   -12.890 -1.493  1.00 32.23 ? 22  LEU A C    5  
ATOM 10338 O O    . LEU A 1 27  ? -0.164  -12.987 -1.975  1.00 23.10 ? 22  LEU A O    5  
ATOM 10339 C CB   . LEU A 1 27  ? 1.889   -10.681 -0.767  1.00 3.42  ? 22  LEU A CB   5  
ATOM 10340 C CG   . LEU A 1 27  ? 1.370   -10.104 -2.084  1.00 0.35  ? 22  LEU A CG   5  
ATOM 10341 C CD1  . LEU A 1 27  ? -0.150  -10.054 -2.084  1.00 64.33 ? 22  LEU A CD1  5  
ATOM 10342 C CD2  . LEU A 1 27  ? 1.952   -8.719  -2.326  1.00 32.21 ? 22  LEU A CD2  5  
ATOM 10343 H H    . LEU A 1 27  ? 2.928   -12.235 0.942   1.00 31.34 ? 22  LEU A H    5  
ATOM 10344 H HA   . LEU A 1 27  ? 0.290   -11.746 0.177   1.00 12.53 ? 22  LEU A HA   5  
ATOM 10345 H HB3  . LEU A 1 27  ? 2.947   -10.870 -0.881  1.00 62.30 ? 22  LEU A HB3  5  
ATOM 10346 H HG   . LEU A 1 27  ? 1.682   -10.745 -2.898  1.00 24.34 ? 22  LEU A HG   5  
ATOM 10347 H HD11 . LEU A 1 27  ? -0.536  -10.838 -2.715  1.00 14.21 ? 22  LEU A HD11 5  
ATOM 10348 H HD12 . LEU A 1 27  ? -0.478  -9.096  -2.459  1.00 25.50 ? 22  LEU A HD12 5  
ATOM 10349 H HD13 . LEU A 1 27  ? -0.514  -10.189 -1.076  1.00 71.25 ? 22  LEU A HD13 5  
ATOM 10350 H HD21 . LEU A 1 27  ? 2.832   -8.587  -1.713  1.00 24.52 ? 22  LEU A HD21 5  
ATOM 10351 H HD22 . LEU A 1 27  ? 1.218   -7.970  -2.067  1.00 35.53 ? 22  LEU A HD22 5  
ATOM 10352 H HD23 . LEU A 1 27  ? 2.218   -8.617  -3.367  1.00 43.24 ? 22  LEU A HD23 5  
ATOM 10353 N N    . LEU A 1 28  ? 2.013   -13.556 -1.967  1.00 61.11 ? 23  LEU A N    5  
ATOM 10354 C CA   . LEU A 1 28  ? 1.893   -14.461 -3.106  1.00 75.42 ? 23  LEU A CA   5  
ATOM 10355 C C    . LEU A 1 28  ? 1.316   -15.806 -2.674  1.00 65.41 ? 23  LEU A C    5  
ATOM 10356 O O    . LEU A 1 28  ? 1.098   -16.691 -3.500  1.00 43.23 ? 23  LEU A O    5  
ATOM 10357 C CB   . LEU A 1 28  ? 3.258   -14.667 -3.763  1.00 44.50 ? 23  LEU A CB   5  
ATOM 10358 C CG   . LEU A 1 28  ? 3.855   -13.447 -4.466  1.00 4.12  ? 23  LEU A CG   5  
ATOM 10359 C CD1  . LEU A 1 28  ? 5.207   -13.790 -5.075  1.00 25.51 ? 23  LEU A CD1  5  
ATOM 10360 C CD2  . LEU A 1 28  ? 2.903   -12.928 -5.534  1.00 45.23 ? 23  LEU A CD2  5  
ATOM 10361 H H    . LEU A 1 28  ? 2.888   -13.438 -1.542  1.00 73.42 ? 23  LEU A H    5  
ATOM 10362 H HA   . LEU A 1 28  ? 1.222   -14.007 -3.819  1.00 14.21 ? 23  LEU A HA   5  
ATOM 10363 H HB3  . LEU A 1 28  ? 3.156   -15.455 -4.496  1.00 31.15 ? 23  LEU A HB3  5  
ATOM 10364 H HG   . LEU A 1 28  ? 4.006   -12.659 -3.741  1.00 12.10 ? 23  LEU A HG   5  
ATOM 10365 H HD11 . LEU A 1 28  ? 5.989   -13.541 -4.374  1.00 4.12  ? 23  LEU A HD11 5  
ATOM 10366 H HD12 . LEU A 1 28  ? 5.345   -13.225 -5.985  1.00 31.34 ? 23  LEU A HD12 5  
ATOM 10367 H HD13 . LEU A 1 28  ? 5.243   -14.846 -5.298  1.00 65.31 ? 23  LEU A HD13 5  
ATOM 10368 H HD21 . LEU A 1 28  ? 2.059   -13.595 -5.617  1.00 1.35  ? 23  LEU A HD21 5  
ATOM 10369 H HD22 . LEU A 1 28  ? 3.419   -12.880 -6.483  1.00 11.22 ? 23  LEU A HD22 5  
ATOM 10370 H HD23 . LEU A 1 28  ? 2.558   -11.943 -5.261  1.00 64.04 ? 23  LEU A HD23 5  
ATOM 10371 N N    . GLN A 1 29  ? 1.068   -15.949 -1.375  1.00 45.24 ? 24  GLN A N    5  
ATOM 10372 C CA   . GLN A 1 29  ? 0.515   -17.185 -0.835  1.00 43.11 ? 24  GLN A CA   5  
ATOM 10373 C C    . GLN A 1 29  ? 1.427   -18.368 -1.142  1.00 12.01 ? 24  GLN A C    5  
ATOM 10374 O O    . GLN A 1 29  ? 0.957   -19.463 -1.449  1.00 3.15  ? 24  GLN A O    5  
ATOM 10375 C CB   . GLN A 1 29  ? -0.880  -17.437 -1.409  1.00 24.13 ? 24  GLN A CB   5  
ATOM 10376 C CG   . GLN A 1 29  ? -1.779  -16.212 -1.383  1.00 21.14 ? 24  GLN A CG   5  
ATOM 10377 C CD   . GLN A 1 29  ? -3.185  -16.509 -1.867  1.00 14.34 ? 24  GLN A CD   5  
ATOM 10378 O OE1  . GLN A 1 29  ? -4.153  -16.371 -1.119  1.00 61.31 ? 24  GLN A OE1  5  
ATOM 10379 N NE2  . GLN A 1 29  ? -3.304  -16.923 -3.123  1.00 23.23 ? 24  GLN A NE2  5  
ATOM 10380 H H    . GLN A 1 29  ? 1.263   -15.206 -0.768  1.00 72.14 ? 24  GLN A H    5  
ATOM 10381 H HA   . GLN A 1 29  ? 0.439   -17.073 0.235   1.00 63.14 ? 24  GLN A HA   5  
ATOM 10382 H HB3  . GLN A 1 29  ? -1.356  -18.219 -0.837  1.00 71.15 ? 24  GLN A HB3  5  
ATOM 10383 H HG3  . GLN A 1 29  ? -1.349  -15.452 -2.019  1.00 43.21 ? 24  GLN A HG3  5  
ATOM 10384 H HE21 . GLN A 1 29  ? -2.489  -17.012 -3.661  1.00 61.32 ? 24  GLN A HE21 5  
ATOM 10385 H HE22 . GLN A 1 29  ? -4.201  -17.122 -3.462  1.00 54.21 ? 24  GLN A HE22 5  
ATOM 10386 N N    . GLY A 1 30  ? 2.734   -18.141 -1.056  1.00 5.01  ? 25  GLY A N    5  
ATOM 10387 C CA   . GLY A 1 30  ? 3.690   -19.199 -1.328  1.00 24.33 ? 25  GLY A CA   5  
ATOM 10388 C C    . GLY A 1 30  ? 5.103   -18.674 -1.489  1.00 12.52 ? 25  GLY A C    5  
ATOM 10389 O O    . GLY A 1 30  ? 5.305   -17.531 -1.897  1.00 14.22 ? 25  GLY A O    5  
ATOM 10390 H H    . GLY A 1 30  ? 3.051   -17.248 -0.807  1.00 54.35 ? 25  GLY A H    5  
ATOM 10391 H HA2  . GLY A 1 30  ? 3.670   -19.906 -0.512  1.00 5.12  ? 25  GLY A HA2  5  
ATOM 10392 H HA3  . GLY A 1 30  ? 3.400   -19.705 -2.238  1.00 64.05 ? 25  GLY A HA3  5  
ATOM 10393 N N    . GLU A 1 31  ? 6.084   -19.512 -1.165  1.00 25.22 ? 26  GLU A N    5  
ATOM 10394 C CA   . GLU A 1 31  ? 7.486   -19.125 -1.274  1.00 31.13 ? 26  GLU A CA   5  
ATOM 10395 C C    . GLU A 1 31  ? 7.904   -19.004 -2.737  1.00 62.13 ? 26  GLU A C    5  
ATOM 10396 O O    . GLU A 1 31  ? 8.256   -19.995 -3.377  1.00 32.22 ? 26  GLU A O    5  
ATOM 10397 C CB   . GLU A 1 31  ? 8.376   -20.144 -0.560  1.00 70.21 ? 26  GLU A CB   5  
ATOM 10398 C CG   . GLU A 1 31  ? 8.105   -21.581 -0.969  1.00 72.01 ? 26  GLU A CG   5  
ATOM 10399 C CD   . GLU A 1 31  ? 9.366   -22.321 -1.369  1.00 54.23 ? 26  GLU A CD   5  
ATOM 10400 O OE1  . GLU A 1 31  ? 10.303  -22.383 -0.545  1.00 11.00 ? 26  GLU A OE1  5  
ATOM 10401 O OE2  . GLU A 1 31  ? 9.418   -22.839 -2.504  1.00 35.55 ? 26  GLU A OE2  5  
ATOM 10402 H H    . GLU A 1 31  ? 5.859   -20.411 -0.847  1.00 60.44 ? 26  GLU A H    5  
ATOM 10403 H HA   . GLU A 1 31  ? 7.601   -18.162 -0.798  1.00 13.41 ? 26  GLU A HA   5  
ATOM 10404 H HB3  . GLU A 1 31  ? 8.216   -20.058 0.505   1.00 72.42 ? 26  GLU A HB3  5  
ATOM 10405 H HG3  . GLU A 1 31  ? 7.424   -21.582 -1.807  1.00 52.12 ? 26  GLU A HG3  5  
ATOM 10406 N N    . TYR A 1 32  ? 7.864   -17.783 -3.258  1.00 32.13 ? 27  TYR A N    5  
ATOM 10407 C CA   . TYR A 1 32  ? 8.236   -17.531 -4.646  1.00 55.34 ? 27  TYR A CA   5  
ATOM 10408 C C    . TYR A 1 32  ? 9.572   -16.799 -4.726  1.00 4.04  ? 27  TYR A C    5  
ATOM 10409 O O    . TYR A 1 32  ? 10.248  -16.828 -5.755  1.00 11.41 ? 27  TYR A O    5  
ATOM 10410 C CB   . TYR A 1 32  ? 7.150   -16.715 -5.347  1.00 11.12 ? 27  TYR A CB   5  
ATOM 10411 C CG   . TYR A 1 32  ? 5.978   -17.544 -5.819  1.00 55.30 ? 27  TYR A CG   5  
ATOM 10412 C CD1  . TYR A 1 32  ? 6.020   -18.213 -7.036  1.00 24.23 ? 27  TYR A CD1  5  
ATOM 10413 C CD2  . TYR A 1 32  ? 4.827   -17.660 -5.049  1.00 60.35 ? 27  TYR A CD2  5  
ATOM 10414 C CE1  . TYR A 1 32  ? 4.951   -18.972 -7.472  1.00 41.01 ? 27  TYR A CE1  5  
ATOM 10415 C CE2  . TYR A 1 32  ? 3.755   -18.418 -5.475  1.00 60.20 ? 27  TYR A CE2  5  
ATOM 10416 C CZ   . TYR A 1 32  ? 3.821   -19.072 -6.688  1.00 74.32 ? 27  TYR A CZ   5  
ATOM 10417 O OH   . TYR A 1 32  ? 2.753   -19.826 -7.117  1.00 3.42  ? 27  TYR A OH   5  
ATOM 10418 H H    . TYR A 1 32  ? 7.575   -17.032 -2.698  1.00 74.02 ? 27  TYR A H    5  
ATOM 10419 H HA   . TYR A 1 32  ? 8.332   -18.487 -5.141  1.00 2.14  ? 27  TYR A HA   5  
ATOM 10420 H HB3  . TYR A 1 32  ? 7.579   -16.224 -6.210  1.00 34.11 ? 27  TYR A HB3  5  
ATOM 10421 H HD1  . TYR A 1 32  ? 6.907   -18.134 -7.649  1.00 65.40 ? 27  TYR A HD1  5  
ATOM 10422 H HD2  . TYR A 1 32  ? 4.778   -17.146 -4.099  1.00 54.44 ? 27  TYR A HD2  5  
ATOM 10423 H HE1  . TYR A 1 32  ? 5.002   -19.484 -8.422  1.00 54.23 ? 27  TYR A HE1  5  
ATOM 10424 H HE2  . TYR A 1 32  ? 2.869   -18.496 -4.862  1.00 60.32 ? 27  TYR A HE2  5  
ATOM 10425 H HH   . TYR A 1 32  ? 2.820   -19.964 -8.065  1.00 53.10 ? 27  TYR A HH   5  
ATOM 10426 N N    . PHE A 1 33  ? 9.947   -16.142 -3.634  1.00 14.12 ? 28  PHE A N    5  
ATOM 10427 C CA   . PHE A 1 33  ? 11.202  -15.401 -3.580  1.00 13.13 ? 28  PHE A CA   5  
ATOM 10428 C C    . PHE A 1 33  ? 12.131  -15.981 -2.518  1.00 15.42 ? 28  PHE A C    5  
ATOM 10429 O O    . PHE A 1 33  ? 11.678  -16.585 -1.545  1.00 62.34 ? 28  PHE A O    5  
ATOM 10430 C CB   . PHE A 1 33  ? 10.933  -13.924 -3.287  1.00 63.01 ? 28  PHE A CB   5  
ATOM 10431 C CG   . PHE A 1 33  ? 10.843  -13.074 -4.523  1.00 33.20 ? 28  PHE A CG   5  
ATOM 10432 C CD1  . PHE A 1 33  ? 10.008  -13.434 -5.567  1.00 72.40 ? 28  PHE A CD1  5  
ATOM 10433 C CD2  . PHE A 1 33  ? 11.595  -11.916 -4.639  1.00 75.04 ? 28  PHE A CD2  5  
ATOM 10434 C CE1  . PHE A 1 33  ? 9.922   -12.654 -6.705  1.00 11.30 ? 28  PHE A CE1  5  
ATOM 10435 C CE2  . PHE A 1 33  ? 11.513  -11.132 -5.774  1.00 2.22  ? 28  PHE A CE2  5  
ATOM 10436 C CZ   . PHE A 1 33  ? 10.677  -11.502 -6.809  1.00 33.24 ? 28  PHE A CZ   5  
ATOM 10437 H H    . PHE A 1 33  ? 9.365   -16.156 -2.845  1.00 32.31 ? 28  PHE A H    5  
ATOM 10438 H HA   . PHE A 1 33  ? 11.678  -15.488 -4.544  1.00 60.40 ? 28  PHE A HA   5  
ATOM 10439 H HB3  . PHE A 1 33  ? 11.732  -13.536 -2.673  1.00 31.31 ? 28  PHE A HB3  5  
ATOM 10440 H HD1  . PHE A 1 33  ? 9.416   -14.336 -5.487  1.00 41.14 ? 28  PHE A HD1  5  
ATOM 10441 H HD2  . PHE A 1 33  ? 12.251  -11.626 -3.831  1.00 32.04 ? 28  PHE A HD2  5  
ATOM 10442 H HE1  . PHE A 1 33  ? 9.267   -12.947 -7.513  1.00 35.30 ? 28  PHE A HE1  5  
ATOM 10443 H HE2  . PHE A 1 33  ? 12.104  -10.232 -5.853  1.00 41.52 ? 28  PHE A HE2  5  
ATOM 10444 H HZ   . PHE A 1 33  ? 10.611  -10.892 -7.697  1.00 61.32 ? 28  PHE A HZ   5  
ATOM 10445 N N    . SER A 1 34  ? 13.432  -15.795 -2.714  1.00 73.42 ? 29  SER A N    5  
ATOM 10446 C CA   . SER A 1 34  ? 14.426  -16.303 -1.776  1.00 75.32 ? 29  SER A CA   5  
ATOM 10447 C C    . SER A 1 34  ? 14.772  -15.250 -0.727  1.00 54.24 ? 29  SER A C    5  
ATOM 10448 O O    . SER A 1 34  ? 14.688  -14.046 -0.969  1.00 74.44 ? 29  SER A O    5  
ATOM 10449 C CB   . SER A 1 34  ? 15.691  -16.731 -2.522  1.00 4.14  ? 29  SER A CB   5  
ATOM 10450 O OG   . SER A 1 34  ? 15.967  -18.105 -2.313  1.00 35.15 ? 29  SER A OG   5  
ATOM 10451 H H    . SER A 1 34  ? 13.731  -15.306 -3.509  1.00 70.33 ? 29  SER A H    5  
ATOM 10452 H HA   . SER A 1 34  ? 14.004  -17.164 -1.278  1.00 1.21  ? 29  SER A HA   5  
ATOM 10453 H HB3  . SER A 1 34  ? 16.530  -16.150 -2.167  1.00 24.41 ? 29  SER A HB3  5  
ATOM 10454 H HG   . SER A 1 34  ? 16.524  -18.432 -3.023  1.00 73.12 ? 29  SER A HG   5  
ATOM 10455 N N    . PRO A 1 35  ? 15.172  -15.714 0.467   1.00 2.24  ? 30  PRO A N    5  
ATOM 10456 C CA   . PRO A 1 35  ? 15.540  -14.829 1.577   1.00 20.03 ? 30  PRO A CA   5  
ATOM 10457 C C    . PRO A 1 35  ? 16.846  -14.087 1.318   1.00 2.51  ? 30  PRO A C    5  
ATOM 10458 O O    . PRO A 1 35  ? 16.987  -12.916 1.670   1.00 40.13 ? 30  PRO A O    5  
ATOM 10459 C CB   . PRO A 1 35  ? 15.695  -15.789 2.758   1.00 32.23 ? 30  PRO A CB   5  
ATOM 10460 C CG   . PRO A 1 35  ? 16.026  -17.103 2.139   1.00 51.21 ? 30  PRO A CG   5  
ATOM 10461 C CD   . PRO A 1 35  ? 15.295  -17.136 0.825   1.00 52.51 ? 30  PRO A CD   5  
ATOM 10462 H HA   . PRO A 1 35  ? 14.758  -14.116 1.791   1.00 43.13 ? 30  PRO A HA   5  
ATOM 10463 H HB3  . PRO A 1 35  ? 14.769  -15.837 3.313   1.00 64.00 ? 30  PRO A HB3  5  
ATOM 10464 H HG3  . PRO A 1 35  ? 15.686  -17.906 2.776   1.00 41.12 ? 30  PRO A HG3  5  
ATOM 10465 H HD3  . PRO A 1 35  ? 14.322  -17.589 0.945   1.00 12.01 ? 30  PRO A HD3  5  
ATOM 10466 N N    . VAL A 1 36  ? 17.801  -14.776 0.700   1.00 33.33 ? 31  VAL A N    5  
ATOM 10467 C CA   . VAL A 1 36  ? 19.096  -14.182 0.392   1.00 72.12 ? 31  VAL A CA   5  
ATOM 10468 C C    . VAL A 1 36  ? 18.974  -13.140 -0.714  1.00 61.52 ? 31  VAL A C    5  
ATOM 10469 O O    . VAL A 1 36  ? 19.605  -12.086 -0.659  1.00 62.34 ? 31  VAL A O    5  
ATOM 10470 C CB   . VAL A 1 36  ? 20.118  -15.252 -0.036  1.00 33.15 ? 31  VAL A CB   5  
ATOM 10471 C CG1  . VAL A 1 36  ? 20.423  -16.193 1.120   1.00 64.44 ? 31  VAL A CG1  5  
ATOM 10472 C CG2  . VAL A 1 36  ? 19.604  -16.025 -1.242  1.00 73.42 ? 31  VAL A CG2  5  
ATOM 10473 H H    . VAL A 1 36  ? 17.629  -15.706 0.444   1.00 14.42 ? 31  VAL A H    5  
ATOM 10474 H HA   . VAL A 1 36  ? 19.463  -13.701 1.288   1.00 45.22 ? 31  VAL A HA   5  
ATOM 10475 H HB   . VAL A 1 36  ? 21.033  -14.754 -0.318  1.00 45.15 ? 31  VAL A HB   5  
ATOM 10476 H HG11 . VAL A 1 36  ? 20.648  -15.613 2.004   1.00 1.43  ? 31  VAL A HG11 5  
ATOM 10477 H HG12 . VAL A 1 36  ? 19.566  -16.822 1.308   1.00 33.42 ? 31  VAL A HG12 5  
ATOM 10478 H HG13 . VAL A 1 36  ? 21.274  -16.808 0.867   1.00 11.01 ? 31  VAL A HG13 5  
ATOM 10479 H HG21 . VAL A 1 36  ? 19.933  -17.052 -1.177  1.00 62.51 ? 31  VAL A HG21 5  
ATOM 10480 H HG22 . VAL A 1 36  ? 18.524  -15.994 -1.257  1.00 71.01 ? 31  VAL A HG22 5  
ATOM 10481 H HG23 . VAL A 1 36  ? 19.990  -15.579 -2.146  1.00 32.34 ? 31  VAL A HG23 5  
ATOM 10482 N N    . GLU A 1 37  ? 18.156  -13.443 -1.717  1.00 63.21 ? 32  GLU A N    5  
ATOM 10483 C CA   . GLU A 1 37  ? 17.952  -12.532 -2.837  1.00 65.21 ? 32  GLU A CA   5  
ATOM 10484 C C    . GLU A 1 37  ? 17.250  -11.256 -2.379  1.00 11.42 ? 32  GLU A C    5  
ATOM 10485 O O    . GLU A 1 37  ? 17.699  -10.147 -2.671  1.00 43.42 ? 32  GLU A O    5  
ATOM 10486 C CB   . GLU A 1 37  ? 17.131  -13.213 -3.935  1.00 60.33 ? 32  GLU A CB   5  
ATOM 10487 C CG   . GLU A 1 37  ? 17.684  -12.993 -5.332  1.00 45.30 ? 32  GLU A CG   5  
ATOM 10488 C CD   . GLU A 1 37  ? 16.931  -13.779 -6.388  1.00 60.14 ? 32  GLU A CD   5  
ATOM 10489 O OE1  . GLU A 1 37  ? 16.632  -14.966 -6.141  1.00 20.21 ? 32  GLU A OE1  5  
ATOM 10490 O OE2  . GLU A 1 37  ? 16.642  -13.208 -7.460  1.00 33.03 ? 32  GLU A OE2  5  
ATOM 10491 H H    . GLU A 1 37  ? 17.680  -14.300 -1.705  1.00 60.11 ? 32  GLU A H    5  
ATOM 10492 H HA   . GLU A 1 37  ? 18.921  -12.271 -3.234  1.00 51.20 ? 32  GLU A HA   5  
ATOM 10493 H HB3  . GLU A 1 37  ? 16.123  -12.828 -3.904  1.00 65.13 ? 32  GLU A HB3  5  
ATOM 10494 H HG3  . GLU A 1 37  ? 18.720  -13.297 -5.349  1.00 31.32 ? 32  GLU A HG3  5  
ATOM 10495 N N    . LEU A 1 38  ? 16.145  -11.422 -1.662  1.00 74.45 ? 33  LEU A N    5  
ATOM 10496 C CA   . LEU A 1 38  ? 15.378  -10.285 -1.162  1.00 42.30 ? 33  LEU A CA   5  
ATOM 10497 C C    . LEU A 1 38  ? 16.191  -9.482  -0.151  1.00 3.32  ? 33  LEU A C    5  
ATOM 10498 O O    . LEU A 1 38  ? 16.134  -8.252  -0.131  1.00 32.34 ? 33  LEU A O    5  
ATOM 10499 C CB   . LEU A 1 38  ? 14.076  -10.764 -0.520  1.00 33.41 ? 33  LEU A CB   5  
ATOM 10500 C CG   . LEU A 1 38  ? 12.784  -10.276 -1.177  1.00 54.23 ? 33  LEU A CG   5  
ATOM 10501 C CD1  . LEU A 1 38  ? 11.751  -11.391 -1.214  1.00 2.14  ? 33  LEU A CD1  5  
ATOM 10502 C CD2  . LEU A 1 38  ? 12.236  -9.063  -0.440  1.00 3.21  ? 33  LEU A CD2  5  
ATOM 10503 H H    . LEU A 1 38  ? 15.836  -12.329 -1.460  1.00 11.42 ? 33  LEU A H    5  
ATOM 10504 H HA   . LEU A 1 38  ? 15.143  -9.650  -2.004  1.00 63.55 ? 33  LEU A HA   5  
ATOM 10505 H HB3  . LEU A 1 38  ? 14.072  -10.430 0.508   1.00 51.45 ? 33  LEU A HB3  5  
ATOM 10506 H HG   . LEU A 1 38  ? 12.995  -9.983  -2.196  1.00 51.40 ? 33  LEU A HG   5  
ATOM 10507 H HD11 . LEU A 1 38  ? 11.072  -11.282 -0.382  1.00 21.11 ? 33  LEU A HD11 5  
ATOM 10508 H HD12 . LEU A 1 38  ? 12.249  -12.347 -1.149  1.00 11.41 ? 33  LEU A HD12 5  
ATOM 10509 H HD13 . LEU A 1 38  ? 11.197  -11.338 -2.141  1.00 62.45 ? 33  LEU A HD13 5  
ATOM 10510 H HD21 . LEU A 1 38  ? 11.581  -8.510  -1.096  1.00 20.22 ? 33  LEU A HD21 5  
ATOM 10511 H HD22 . LEU A 1 38  ? 13.055  -8.430  -0.132  1.00 40.02 ? 33  LEU A HD22 5  
ATOM 10512 H HD23 . LEU A 1 38  ? 11.685  -9.389  0.430   1.00 0.32  ? 33  LEU A HD23 5  
ATOM 10513 N N    . SER A 1 39  ? 16.950  -10.185 0.683   1.00 32.33 ? 34  SER A N    5  
ATOM 10514 C CA   . SER A 1 39  ? 17.774  -9.538  1.697   1.00 50.31 ? 34  SER A CA   5  
ATOM 10515 C C    . SER A 1 39  ? 18.828  -8.644  1.051   1.00 11.51 ? 34  SER A C    5  
ATOM 10516 O O    . SER A 1 39  ? 19.083  -7.532  1.513   1.00 23.14 ? 34  SER A O    5  
ATOM 10517 C CB   . SER A 1 39  ? 18.451  -10.587 2.581   1.00 20.45 ? 34  SER A CB   5  
ATOM 10518 O OG   . SER A 1 39  ? 17.543  -11.114 3.533   1.00 54.31 ? 34  SER A OG   5  
ATOM 10519 H H    . SER A 1 39  ? 16.954  -11.162 0.616   1.00 14.35 ? 34  SER A H    5  
ATOM 10520 H HA   . SER A 1 39  ? 17.127  -8.927  2.309   1.00 52.33 ? 34  SER A HA   5  
ATOM 10521 H HB3  . SER A 1 39  ? 19.279  -10.133 3.105   1.00 1.33  ? 34  SER A HB3  5  
ATOM 10522 H HG   . SER A 1 39  ? 18.024  -11.635 4.180   1.00 71.41 ? 34  SER A HG   5  
ATOM 10523 N N    . SER A 1 40  ? 19.439  -9.140  -0.021  1.00 71.13 ? 35  SER A N    5  
ATOM 10524 C CA   . SER A 1 40  ? 20.469  -8.389  -0.729  1.00 12.10 ? 35  SER A CA   5  
ATOM 10525 C C    . SER A 1 40  ? 19.862  -7.208  -1.479  1.00 22.12 ? 35  SER A C    5  
ATOM 10526 O O    . SER A 1 40  ? 20.430  -6.116  -1.506  1.00 4.52  ? 35  SER A O    5  
ATOM 10527 C CB   . SER A 1 40  ? 21.214  -9.301  -1.706  1.00 31.42 ? 35  SER A CB   5  
ATOM 10528 O OG   . SER A 1 40  ? 22.371  -8.664  -2.217  1.00 52.44 ? 35  SER A OG   5  
ATOM 10529 H H    . SER A 1 40  ? 19.192  -10.033 -0.340  1.00 50.32 ? 35  SER A H    5  
ATOM 10530 H HA   . SER A 1 40  ? 21.168  -8.013  0.004   1.00 50.43 ? 35  SER A HA   5  
ATOM 10531 H HB3  . SER A 1 40  ? 20.561  -9.549  -2.530  1.00 31.35 ? 35  SER A HB3  5  
ATOM 10532 H HG   . SER A 1 40  ? 23.116  -8.840  -1.636  1.00 24.13 ? 35  SER A HG   5  
ATOM 10533 N N    . ILE A 1 41  ? 18.702  -7.436  -2.088  1.00 64.20 ? 36  ILE A N    5  
ATOM 10534 C CA   . ILE A 1 41  ? 18.016  -6.391  -2.838  1.00 24.20 ? 36  ILE A CA   5  
ATOM 10535 C C    . ILE A 1 41  ? 17.538  -5.276  -1.915  1.00 24.02 ? 36  ILE A C    5  
ATOM 10536 O O    . ILE A 1 41  ? 17.766  -4.096  -2.181  1.00 24.50 ? 36  ILE A O    5  
ATOM 10537 C CB   . ILE A 1 41  ? 16.810  -6.954  -3.613  1.00 20.32 ? 36  ILE A CB   5  
ATOM 10538 C CG1  . ILE A 1 41  ? 17.272  -8.002  -4.628  1.00 70.13 ? 36  ILE A CG1  5  
ATOM 10539 C CG2  . ILE A 1 41  ? 16.056  -5.831  -4.309  1.00 2.50  ? 36  ILE A CG2  5  
ATOM 10540 C CD1  . ILE A 1 41  ? 16.206  -9.015  -4.979  1.00 33.34 ? 36  ILE A CD1  5  
ATOM 10541 H H    . ILE A 1 41  ? 18.298  -8.326  -2.030  1.00 43.51 ? 36  ILE A H    5  
ATOM 10542 H HA   . ILE A 1 41  ? 18.716  -5.978  -3.551  1.00 53.41 ? 36  ILE A HA   5  
ATOM 10543 H HB   . ILE A 1 41  ? 16.142  -7.420  -2.905  1.00 30.41 ? 36  ILE A HB   5  
ATOM 10544 H HG13 . ILE A 1 41  ? 18.118  -8.537  -4.222  1.00 14.01 ? 36  ILE A HG13 5  
ATOM 10545 H HG21 . ILE A 1 41  ? 15.118  -5.659  -3.802  1.00 0.44  ? 36  ILE A HG21 5  
ATOM 10546 H HG22 . ILE A 1 41  ? 16.649  -4.928  -4.281  1.00 53.31 ? 36  ILE A HG22 5  
ATOM 10547 H HG23 . ILE A 1 41  ? 15.866  -6.106  -5.335  1.00 41.44 ? 36  ILE A HG23 5  
ATOM 10548 H HD11 . ILE A 1 41  ? 15.566  -9.175  -4.124  1.00 15.22 ? 36  ILE A HD11 5  
ATOM 10549 H HD12 . ILE A 1 41  ? 15.617  -8.647  -5.806  1.00 51.31 ? 36  ILE A HD12 5  
ATOM 10550 H HD13 . ILE A 1 41  ? 16.673  -9.949  -5.258  1.00 61.40 ? 36  ILE A HD13 5  
ATOM 10551 N N    . ALA A 1 42  ? 16.874  -5.657  -0.829  1.00 61.11 ? 37  ALA A N    5  
ATOM 10552 C CA   . ALA A 1 42  ? 16.366  -4.690  0.135   1.00 61.42 ? 37  ALA A CA   5  
ATOM 10553 C C    . ALA A 1 42  ? 17.507  -3.940  0.813   1.00 44.14 ? 37  ALA A C    5  
ATOM 10554 O O    . ALA A 1 42  ? 17.474  -2.714  0.933   1.00 54.05 ? 37  ALA A O    5  
ATOM 10555 C CB   . ALA A 1 42  ? 15.499  -5.385  1.174   1.00 21.10 ? 37  ALA A CB   5  
ATOM 10556 H H    . ALA A 1 42  ? 16.723  -6.613  -0.673  1.00 41.03 ? 37  ALA A H    5  
ATOM 10557 H HA   . ALA A 1 42  ? 15.748  -3.980  -0.397  1.00 53.51 ? 37  ALA A HA   5  
ATOM 10558 H HB1  . ALA A 1 42  ? 14.607  -4.800  1.347   1.00 34.43 ? 37  ALA A HB1  5  
ATOM 10559 H HB2  . ALA A 1 42  ? 15.223  -6.365  0.815   1.00 22.12 ? 37  ALA A HB2  5  
ATOM 10560 H HB3  . ALA A 1 42  ? 16.050  -5.482  2.097   1.00 52.14 ? 37  ALA A HB3  5  
ATOM 10561 N N    . HIS A 1 43  ? 18.517  -4.683  1.256   1.00 23.44 ? 38  HIS A N    5  
ATOM 10562 C CA   . HIS A 1 43  ? 19.669  -4.087  1.922   1.00 53.45 ? 38  HIS A CA   5  
ATOM 10563 C C    . HIS A 1 43  ? 20.365  -3.081  1.010   1.00 55.00 ? 38  HIS A C    5  
ATOM 10564 O O    . HIS A 1 43  ? 20.704  -1.976  1.434   1.00 53.34 ? 38  HIS A O    5  
ATOM 10565 C CB   . HIS A 1 43  ? 20.657  -5.174  2.349   1.00 54.01 ? 38  HIS A CB   5  
ATOM 10566 C CG   . HIS A 1 43  ? 21.771  -4.666  3.211   1.00 54.55 ? 38  HIS A CG   5  
ATOM 10567 N ND1  . HIS A 1 43  ? 22.892  -5.412  3.510   1.00 32.15 ? 38  HIS A ND1  5  
ATOM 10568 C CD2  . HIS A 1 43  ? 21.934  -3.479  3.840   1.00 24.44 ? 38  HIS A CD2  5  
ATOM 10569 C CE1  . HIS A 1 43  ? 23.695  -4.706  4.285   1.00 74.24 ? 38  HIS A CE1  5  
ATOM 10570 N NE2  . HIS A 1 43  ? 23.136  -3.529  4.500   1.00 62.32 ? 38  HIS A NE2  5  
ATOM 10571 H H    . HIS A 1 43  ? 18.486  -5.654  1.131   1.00 62.24 ? 38  HIS A H    5  
ATOM 10572 H HA   . HIS A 1 43  ? 19.315  -3.571  2.802   1.00 34.42 ? 38  HIS A HA   5  
ATOM 10573 H HB3  . HIS A 1 43  ? 21.095  -5.619  1.467   1.00 74.23 ? 38  HIS A HB3  5  
ATOM 10574 H HD1  . HIS A 1 43  ? 23.071  -6.325  3.201   1.00 4.25  ? 38  HIS A HD1  5  
ATOM 10575 H HD2  . HIS A 1 43  ? 21.245  -2.645  3.824   1.00 73.34 ? 38  HIS A HD2  5  
ATOM 10576 H HE1  . HIS A 1 43  ? 24.645  -5.035  4.678   1.00 5.43  ? 38  HIS A HE1  5  
ATOM 10577 N N    . GLN A 1 44  ? 20.574  -3.472  -0.242  1.00 5.12  ? 39  GLN A N    5  
ATOM 10578 C CA   . GLN A 1 44  ? 21.231  -2.604  -1.213  1.00 35.14 ? 39  GLN A CA   5  
ATOM 10579 C C    . GLN A 1 44  ? 20.403  -1.348  -1.468  1.00 50.23 ? 39  GLN A C    5  
ATOM 10580 O O    . GLN A 1 44  ? 20.943  -0.244  -1.554  1.00 35.41 ? 39  GLN A O    5  
ATOM 10581 C CB   . GLN A 1 44  ? 21.458  -3.354  -2.527  1.00 61.14 ? 39  GLN A CB   5  
ATOM 10582 C CG   . GLN A 1 44  ? 22.636  -4.314  -2.483  1.00 4.12  ? 39  GLN A CG   5  
ATOM 10583 C CD   . GLN A 1 44  ? 23.897  -3.717  -3.076  1.00 13.41 ? 39  GLN A CD   5  
ATOM 10584 O OE1  . GLN A 1 44  ? 23.899  -3.242  -4.212  1.00 33.11 ? 39  GLN A OE1  5  
ATOM 10585 N NE2  . GLN A 1 44  ? 24.980  -3.738  -2.308  1.00 41.33 ? 39  GLN A NE2  5  
ATOM 10586 H H    . GLN A 1 44  ? 20.281  -4.364  -0.521  1.00 33.21 ? 39  GLN A H    5  
ATOM 10587 H HA   . GLN A 1 44  ? 22.187  -2.314  -0.805  1.00 35.41 ? 39  GLN A HA   5  
ATOM 10588 H HB3  . GLN A 1 44  ? 21.638  -2.634  -3.312  1.00 10.04 ? 39  GLN A HB3  5  
ATOM 10589 H HG3  . GLN A 1 44  ? 22.380  -5.203  -3.039  1.00 1.54  ? 39  GLN A HG3  5  
ATOM 10590 H HE21 . GLN A 1 44  ? 24.905  -4.134  -1.414  1.00 41.14 ? 39  GLN A HE21 5  
ATOM 10591 H HE22 . GLN A 1 44  ? 25.809  -3.360  -2.666  1.00 43.21 ? 39  GLN A HE22 5  
ATOM 10592 N N    . LEU A 1 45  ? 19.092  -1.524  -1.588  1.00 23.22 ? 40  LEU A N    5  
ATOM 10593 C CA   . LEU A 1 45  ? 18.189  -0.405  -1.833  1.00 41.04 ? 40  LEU A CA   5  
ATOM 10594 C C    . LEU A 1 45  ? 18.257  0.610   -0.695  1.00 15.41 ? 40  LEU A C    5  
ATOM 10595 O O    . LEU A 1 45  ? 18.329  1.816   -0.928  1.00 4.51  ? 40  LEU A O    5  
ATOM 10596 C CB   . LEU A 1 45  ? 16.755  -0.907  -1.998  1.00 13.04 ? 40  LEU A CB   5  
ATOM 10597 C CG   . LEU A 1 45  ? 16.241  -1.013  -3.434  1.00 33.03 ? 40  LEU A CG   5  
ATOM 10598 C CD1  . LEU A 1 45  ? 14.971  -1.848  -3.488  1.00 63.41 ? 40  LEU A CD1  5  
ATOM 10599 C CD2  . LEU A 1 45  ? 15.996  0.372   -4.016  1.00 31.21 ? 40  LEU A CD2  5  
ATOM 10600 H H    . LEU A 1 45  ? 18.721  -2.427  -1.510  1.00 31.51 ? 40  LEU A H    5  
ATOM 10601 H HA   . LEU A 1 45  ? 18.500  0.078   -2.748  1.00 43.05 ? 40  LEU A HA   5  
ATOM 10602 H HB3  . LEU A 1 45  ? 16.104  -0.231  -1.461  1.00 24.34 ? 40  LEU A HB3  5  
ATOM 10603 H HG   . LEU A 1 45  ? 16.988  -1.504  -4.042  1.00 55.42 ? 40  LEU A HG   5  
ATOM 10604 H HD11 . LEU A 1 45  ? 15.135  -2.785  -2.978  1.00 70.31 ? 40  LEU A HD11 5  
ATOM 10605 H HD12 . LEU A 1 45  ? 14.709  -2.039  -4.518  1.00 10.40 ? 40  LEU A HD12 5  
ATOM 10606 H HD13 . LEU A 1 45  ? 14.167  -1.310  -3.006  1.00 53.51 ? 40  LEU A HD13 5  
ATOM 10607 H HD21 . LEU A 1 45  ? 15.151  0.826   -3.519  1.00 1.25  ? 40  LEU A HD21 5  
ATOM 10608 H HD22 . LEU A 1 45  ? 15.789  0.287   -5.073  1.00 31.40 ? 40  LEU A HD22 5  
ATOM 10609 H HD23 . LEU A 1 45  ? 16.873  0.985   -3.868  1.00 15.25 ? 40  LEU A HD23 5  
ATOM 10610 N N    . ASP A 1 46  ? 18.236  0.110   0.536   1.00 63.41 ? 41  ASP A N    5  
ATOM 10611 C CA   . ASP A 1 46  ? 18.299  0.972   1.712   1.00 25.35 ? 41  ASP A CA   5  
ATOM 10612 C C    . ASP A 1 46  ? 19.630  1.713   1.771   1.00 71.22 ? 41  ASP A C    5  
ATOM 10613 O O    . ASP A 1 46  ? 19.671  2.915   2.032   1.00 75.42 ? 41  ASP A O    5  
ATOM 10614 C CB   . ASP A 1 46  ? 18.101  0.149   2.985   1.00 1.24  ? 41  ASP A CB   5  
ATOM 10615 C CG   . ASP A 1 46  ? 16.845  -0.699  2.938   1.00 65.13 ? 41  ASP A CG   5  
ATOM 10616 O OD1  . ASP A 1 46  ? 16.011  -0.474  2.037   1.00 23.12 ? 41  ASP A OD1  5  
ATOM 10617 O OD2  . ASP A 1 46  ? 16.697  -1.588  3.801   1.00 50.03 ? 41  ASP A OD2  5  
ATOM 10618 H H    . ASP A 1 46  ? 18.178  -0.861  0.658   1.00 62.31 ? 41  ASP A H    5  
ATOM 10619 H HA   . ASP A 1 46  ? 17.501  1.696   1.635   1.00 0.01  ? 41  ASP A HA   5  
ATOM 10620 H HB3  . ASP A 1 46  ? 18.032  0.817   3.830   1.00 54.41 ? 41  ASP A HB3  5  
ATOM 10621 N N    . GLU A 1 47  ? 20.717  0.988   1.528   1.00 75.12 ? 42  GLU A N    5  
ATOM 10622 C CA   . GLU A 1 47  ? 22.051  1.578   1.556   1.00 74.31 ? 42  GLU A CA   5  
ATOM 10623 C C    . GLU A 1 47  ? 22.203  2.630   0.462   1.00 61.04 ? 42  GLU A C    5  
ATOM 10624 O O    . GLU A 1 47  ? 22.627  3.755   0.725   1.00 60.15 ? 42  GLU A O    5  
ATOM 10625 C CB   . GLU A 1 47  ? 23.116  0.492   1.387   1.00 65.41 ? 42  GLU A CB   5  
ATOM 10626 C CG   . GLU A 1 47  ? 24.455  0.851   2.012   1.00 32.35 ? 42  GLU A CG   5  
ATOM 10627 C CD   . GLU A 1 47  ? 25.060  2.105   1.415   1.00 22.33 ? 42  GLU A CD   5  
ATOM 10628 O OE1  . GLU A 1 47  ? 25.550  2.040   0.268   1.00 54.41 ? 42  GLU A OE1  5  
ATOM 10629 O OE2  . GLU A 1 47  ? 25.044  3.153   2.093   1.00 63.21 ? 42  GLU A OE2  5  
ATOM 10630 H H    . GLU A 1 47  ? 20.620  0.034   1.326   1.00 42.11 ? 42  GLU A H    5  
ATOM 10631 H HA   . GLU A 1 47  ? 22.183  2.052   2.517   1.00 31.41 ? 42  GLU A HA   5  
ATOM 10632 H HB3  . GLU A 1 47  ? 23.271  0.319   0.333   1.00 12.14 ? 42  GLU A HB3  5  
ATOM 10633 H HG3  . GLU A 1 47  ? 25.139  0.030   1.859   1.00 74.23 ? 42  GLU A HG3  5  
ATOM 10634 N N    . GLU A 1 48  ? 21.855  2.256   -0.764  1.00 0.55  ? 43  GLU A N    5  
ATOM 10635 C CA   . GLU A 1 48  ? 21.955  3.167   -1.898  1.00 12.12 ? 43  GLU A CA   5  
ATOM 10636 C C    . GLU A 1 48  ? 21.081  4.399   -1.685  1.00 73.54 ? 43  GLU A C    5  
ATOM 10637 O O    . GLU A 1 48  ? 21.443  5.506   -2.080  1.00 64.11 ? 43  GLU A O    5  
ATOM 10638 C CB   . GLU A 1 48  ? 21.547  2.456   -3.190  1.00 35.32 ? 43  GLU A CB   5  
ATOM 10639 C CG   . GLU A 1 48  ? 21.935  3.213   -4.450  1.00 55.02 ? 43  GLU A CG   5  
ATOM 10640 C CD   . GLU A 1 48  ? 21.744  2.388   -5.708  1.00 54.41 ? 43  GLU A CD   5  
ATOM 10641 O OE1  . GLU A 1 48  ? 22.651  1.596   -6.040  1.00 10.04 ? 43  GLU A OE1  5  
ATOM 10642 O OE2  . GLU A 1 48  ? 20.689  2.533   -6.359  1.00 51.04 ? 43  GLU A OE2  5  
ATOM 10643 H H    . GLU A 1 48  ? 21.525  1.345   -0.910  1.00 22.42 ? 43  GLU A H    5  
ATOM 10644 H HA   . GLU A 1 48  ? 22.985  3.482   -1.981  1.00 51.20 ? 43  GLU A HA   5  
ATOM 10645 H HB3  . GLU A 1 48  ? 20.475  2.325   -3.191  1.00 52.11 ? 43  GLU A HB3  5  
ATOM 10646 H HG3  . GLU A 1 48  ? 22.974  3.497   -4.378  1.00 23.51 ? 43  GLU A HG3  5  
ATOM 10647 N N    . GLU A 1 49  ? 19.927  4.196   -1.056  1.00 64.32 ? 44  GLU A N    5  
ATOM 10648 C CA   . GLU A 1 49  ? 19.000  5.290   -0.791  1.00 24.42 ? 44  GLU A CA   5  
ATOM 10649 C C    . GLU A 1 49  ? 19.500  6.162   0.358   1.00 53.34 ? 44  GLU A C    5  
ATOM 10650 O O    . GLU A 1 49  ? 19.298  7.376   0.364   1.00 54.34 ? 44  GLU A O    5  
ATOM 10651 C CB   . GLU A 1 49  ? 17.610  4.743   -0.462  1.00 4.22  ? 44  GLU A CB   5  
ATOM 10652 C CG   . GLU A 1 49  ? 16.646  5.798   0.054   1.00 5.23  ? 44  GLU A CG   5  
ATOM 10653 C CD   . GLU A 1 49  ? 16.690  5.939   1.563   1.00 32.33 ? 44  GLU A CD   5  
ATOM 10654 O OE1  . GLU A 1 49  ? 16.811  4.904   2.252   1.00 34.53 ? 44  GLU A OE1  5  
ATOM 10655 O OE2  . GLU A 1 49  ? 16.603  7.083   2.055   1.00 21.44 ? 44  GLU A OE2  5  
ATOM 10656 H H    . GLU A 1 49  ? 19.693  3.291   -0.764  1.00 42.04 ? 44  GLU A H    5  
ATOM 10657 H HA   . GLU A 1 49  ? 18.937  5.895   -1.683  1.00 4.11  ? 44  GLU A HA   5  
ATOM 10658 H HB3  . GLU A 1 49  ? 17.708  3.975   0.292   1.00 4.42  ? 44  GLU A HB3  5  
ATOM 10659 H HG3  . GLU A 1 49  ? 15.643  5.525   -0.239  1.00 32.10 ? 44  GLU A HG3  5  
ATOM 10660 N N    . ARG A 1 50  ? 20.152  5.531   1.330   1.00 5.21  ? 45  ARG A N    5  
ATOM 10661 C CA   . ARG A 1 50  ? 20.680  6.247   2.485   1.00 35.35 ? 45  ARG A CA   5  
ATOM 10662 C C    . ARG A 1 50  ? 21.893  7.088   2.097   1.00 15.13 ? 45  ARG A C    5  
ATOM 10663 O O    . ARG A 1 50  ? 22.014  8.243   2.503   1.00 2.33  ? 45  ARG A O    5  
ATOM 10664 C CB   . ARG A 1 50  ? 21.062  5.261   3.592   1.00 1.13  ? 45  ARG A CB   5  
ATOM 10665 C CG   . ARG A 1 50  ? 19.927  4.960   4.557   1.00 12.55 ? 45  ARG A CG   5  
ATOM 10666 C CD   . ARG A 1 50  ? 19.991  5.850   5.788   1.00 42.01 ? 45  ARG A CD   5  
ATOM 10667 N NE   . ARG A 1 50  ? 21.180  5.585   6.593   1.00 65.02 ? 45  ARG A NE   5  
ATOM 10668 C CZ   . ARG A 1 50  ? 21.614  6.396   7.551   1.00 73.13 ? 45  ARG A CZ   5  
ATOM 10669 N NH1  . ARG A 1 50  ? 20.960  7.516   7.824   1.00 41.10 ? 45  ARG A NH1  5  
ATOM 10670 N NH2  . ARG A 1 50  ? 22.705  6.086   8.241   1.00 34.11 ? 45  ARG A NH2  5  
ATOM 10671 H H    . ARG A 1 50  ? 20.281  4.561   1.268   1.00 70.25 ? 45  ARG A H    5  
ATOM 10672 H HA   . ARG A 1 50  ? 19.905  6.902   2.852   1.00 23.33 ? 45  ARG A HA   5  
ATOM 10673 H HB3  . ARG A 1 50  ? 21.885  5.673   4.155   1.00 22.54 ? 45  ARG A HB3  5  
ATOM 10674 H HG3  . ARG A 1 50  ? 19.995  3.927   4.865   1.00 34.11 ? 45  ARG A HG3  5  
ATOM 10675 H HD3  . ARG A 1 50  ? 19.113  5.672   6.390   1.00 30.21 ? 45  ARG A HD3  5  
ATOM 10676 H HE   . ARG A 1 50  ? 21.680  4.763   6.409   1.00 11.22 ? 45  ARG A HE   5  
ATOM 10677 H HH11 . ARG A 1 50  ? 20.137  7.752   7.307   1.00 53.31 ? 45  ARG A HH11 5  
ATOM 10678 H HH12 . ARG A 1 50  ? 21.288  8.124   8.547   1.00 0.03  ? 45  ARG A HH12 5  
ATOM 10679 H HH21 . ARG A 1 50  ? 23.201  5.242   8.039   1.00 10.10 ? 45  ARG A HH21 5  
ATOM 10680 H HH22 . ARG A 1 50  ? 23.031  6.697   8.962   1.00 31.30 ? 45  ARG A HH22 5  
ATOM 10681 N N    . MET A 1 51  ? 22.787  6.498   1.311   1.00 4.12  ? 46  MET A N    5  
ATOM 10682 C CA   . MET A 1 51  ? 23.990  7.193   0.867   1.00 31.33 ? 46  MET A CA   5  
ATOM 10683 C C    . MET A 1 51  ? 23.643  8.306   -0.117  1.00 64.43 ? 46  MET A C    5  
ATOM 10684 O O    . MET A 1 51  ? 24.178  9.412   -0.030  1.00 64.41 ? 46  MET A O    5  
ATOM 10685 C CB   . MET A 1 51  ? 24.964  6.208   0.218   1.00 22.14 ? 46  MET A CB   5  
ATOM 10686 C CG   . MET A 1 51  ? 24.346  5.394   -0.908  1.00 70.33 ? 46  MET A CG   5  
ATOM 10687 S SD   . MET A 1 51  ? 24.797  6.011   -2.540  1.00 64.34 ? 46  MET A SD   5  
ATOM 10688 C CE   . MET A 1 51  ? 26.080  4.850   -2.999  1.00 54.50 ? 46  MET A CE   5  
ATOM 10689 H H    . MET A 1 51  ? 22.635  5.574   1.020   1.00 50.21 ? 46  MET A H    5  
ATOM 10690 H HA   . MET A 1 51  ? 24.459  7.630   1.736   1.00 35.12 ? 46  MET A HA   5  
ATOM 10691 H HB3  . MET A 1 51  ? 25.322  5.524   0.972   1.00 42.34 ? 46  MET A HB3  5  
ATOM 10692 H HG3  . MET A 1 51  ? 23.271  5.428   -0.808  1.00 3.04  ? 46  MET A HG3  5  
ATOM 10693 H HE1  . MET A 1 51  ? 26.484  5.121   -3.963  1.00 61.21 ? 46  MET A HE1  5  
ATOM 10694 H HE2  . MET A 1 51  ? 26.867  4.872   -2.260  1.00 32.11 ? 46  MET A HE2  5  
ATOM 10695 H HE3  . MET A 1 51  ? 25.662  3.854   -3.051  1.00 60.43 ? 46  MET A HE3  5  
ATOM 10696 N N    . ARG A 1 52  ? 22.747  8.007   -1.051  1.00 53.21 ? 47  ARG A N    5  
ATOM 10697 C CA   . ARG A 1 52  ? 22.330  8.982   -2.051  1.00 11.50 ? 47  ARG A CA   5  
ATOM 10698 C C    . ARG A 1 52  ? 21.562  10.131  -1.404  1.00 5.41  ? 47  ARG A C    5  
ATOM 10699 O O    . ARG A 1 52  ? 21.667  11.279  -1.833  1.00 64.21 ? 47  ARG A O    5  
ATOM 10700 C CB   . ARG A 1 52  ? 21.463  8.311   -3.118  1.00 64.43 ? 47  ARG A CB   5  
ATOM 10701 C CG   . ARG A 1 52  ? 20.017  8.117   -2.693  1.00 4.34  ? 47  ARG A CG   5  
ATOM 10702 C CD   . ARG A 1 52  ? 19.213  7.399   -3.766  1.00 53.53 ? 47  ARG A CD   5  
ATOM 10703 N NE   . ARG A 1 52  ? 18.897  8.273   -4.891  1.00 4.54  ? 47  ARG A NE   5  
ATOM 10704 C CZ   . ARG A 1 52  ? 18.011  7.968   -5.833  1.00 12.21 ? 47  ARG A CZ   5  
ATOM 10705 N NH1  . ARG A 1 52  ? 17.357  6.815   -5.784  1.00 52.32 ? 47  ARG A NH1  5  
ATOM 10706 N NH2  . ARG A 1 52  ? 17.778  8.816   -6.826  1.00 62.22 ? 47  ARG A NH2  5  
ATOM 10707 H H    . ARG A 1 52  ? 22.357  7.108   -1.068  1.00 35.25 ? 47  ARG A H    5  
ATOM 10708 H HA   . ARG A 1 52  ? 23.220  9.377   -2.519  1.00 33.21 ? 47  ARG A HA   5  
ATOM 10709 H HB3  . ARG A 1 52  ? 21.881  7.343   -3.348  1.00 50.22 ? 47  ARG A HB3  5  
ATOM 10710 H HG3  . ARG A 1 52  ? 19.573  9.085   -2.510  1.00 12.44 ? 47  ARG A HG3  5  
ATOM 10711 H HD3  . ARG A 1 52  ? 18.292  7.042   -3.328  1.00 63.31 ? 47  ARG A HD3  5  
ATOM 10712 H HE   . ARG A 1 52  ? 19.368  9.130   -4.947  1.00 71.10 ? 47  ARG A HE   5  
ATOM 10713 H HH11 . ARG A 1 52  ? 17.530  6.174   -5.036  1.00 1.20  ? 47  ARG A HH11 5  
ATOM 10714 H HH12 . ARG A 1 52  ? 16.690  6.588   -6.494  1.00 12.22 ? 47  ARG A HH12 5  
ATOM 10715 H HH21 . ARG A 1 52  ? 18.268  9.685   -6.866  1.00 64.34 ? 47  ARG A HH21 5  
ATOM 10716 H HH22 . ARG A 1 52  ? 17.112  8.585   -7.534  1.00 31.13 ? 47  ARG A HH22 5  
ATOM 10717 N N    . MET A 1 53  ? 20.792  9.811   -0.370  1.00 64.23 ? 48  MET A N    5  
ATOM 10718 C CA   . MET A 1 53  ? 20.007  10.817  0.337   1.00 22.42 ? 48  MET A CA   5  
ATOM 10719 C C    . MET A 1 53  ? 20.902  11.694  1.206   1.00 40.25 ? 48  MET A C    5  
ATOM 10720 O O    . MET A 1 53  ? 20.837  12.922  1.143   1.00 13.40 ? 48  MET A O    5  
ATOM 10721 C CB   . MET A 1 53  ? 18.937  10.146  1.200   1.00 73.45 ? 48  MET A CB   5  
ATOM 10722 C CG   . MET A 1 53  ? 17.686  9.760   0.427   1.00 64.01 ? 48  MET A CG   5  
ATOM 10723 S SD   . MET A 1 53  ? 16.289  10.843  0.780   1.00 53.00 ? 48  MET A SD   5  
ATOM 10724 C CE   . MET A 1 53  ? 17.055  12.453  0.602   1.00 73.23 ? 48  MET A CE   5  
ATOM 10725 H H    . MET A 1 53  ? 20.750  8.879   -0.073  1.00 51.11 ? 48  MET A H    5  
ATOM 10726 H HA   . MET A 1 53  ? 19.523  11.439  -0.402  1.00 31.03 ? 48  MET A HA   5  
ATOM 10727 H HB3  . MET A 1 53  ? 18.650  10.825  1.989   1.00 32.23 ? 48  MET A HB3  5  
ATOM 10728 H HG3  . MET A 1 53  ? 17.416  8.748   0.690   1.00 51.42 ? 48  MET A HG3  5  
ATOM 10729 H HE1  . MET A 1 53  ? 16.294  13.219  0.635   1.00 53.34 ? 48  MET A HE1  5  
ATOM 10730 H HE2  . MET A 1 53  ? 17.757  12.608  1.407   1.00 52.30 ? 48  MET A HE2  5  
ATOM 10731 H HE3  . MET A 1 53  ? 17.574  12.501  -0.344  1.00 65.03 ? 48  MET A HE3  5  
ATOM 10732 N N    . ALA A 1 54  ? 21.739  11.055  2.019   1.00 22.32 ? 49  ALA A N    5  
ATOM 10733 C CA   . ALA A 1 54  ? 22.648  11.778  2.899   1.00 54.33 ? 49  ALA A CA   5  
ATOM 10734 C C    . ALA A 1 54  ? 23.553  12.714  2.106   1.00 73.13 ? 49  ALA A C    5  
ATOM 10735 O O    . ALA A 1 54  ? 23.738  13.873  2.476   1.00 71.11 ? 49  ALA A O    5  
ATOM 10736 C CB   . ALA A 1 54  ? 23.481  10.799  3.714   1.00 44.44 ? 49  ALA A CB   5  
ATOM 10737 H H    . ALA A 1 54  ? 21.744  10.076  2.024   1.00 53.44 ? 49  ALA A H    5  
ATOM 10738 H HA   . ALA A 1 54  ? 22.054  12.364  3.586   1.00 13.24 ? 49  ALA A HA   5  
ATOM 10739 H HB1  . ALA A 1 54  ? 22.843  10.016  4.098   1.00 44.21 ? 49  ALA A HB1  5  
ATOM 10740 H HB2  . ALA A 1 54  ? 24.245  10.366  3.084   1.00 32.23 ? 49  ALA A HB2  5  
ATOM 10741 H HB3  . ALA A 1 54  ? 23.947  11.321  4.536   1.00 74.14 ? 49  ALA A HB3  5  
ATOM 10742 N N    . GLU A 1 55  ? 24.115  12.203  1.015   1.00 73.32 ? 50  GLU A N    5  
ATOM 10743 C CA   . GLU A 1 55  ? 25.002  12.995  0.171   1.00 54.04 ? 50  GLU A CA   5  
ATOM 10744 C C    . GLU A 1 55  ? 24.219  14.059  -0.594  1.00 41.41 ? 50  GLU A C    5  
ATOM 10745 O O    . GLU A 1 55  ? 24.802  14.944  -1.219  1.00 34.34 ? 50  GLU A O    5  
ATOM 10746 C CB   . GLU A 1 55  ? 25.749  12.090  -0.812  1.00 63.22 ? 50  GLU A CB   5  
ATOM 10747 C CG   . GLU A 1 55  ? 24.885  11.594  -1.959  1.00 45.43 ? 50  GLU A CG   5  
ATOM 10748 C CD   . GLU A 1 55  ? 25.330  12.139  -3.302  1.00 12.42 ? 50  GLU A CD   5  
ATOM 10749 O OE1  . GLU A 1 55  ? 26.467  11.832  -3.719  1.00 10.11 ? 50  GLU A OE1  5  
ATOM 10750 O OE2  . GLU A 1 55  ? 24.544  12.872  -3.937  1.00 13.34 ? 50  GLU A OE2  5  
ATOM 10751 H H    . GLU A 1 55  ? 23.929  11.272  0.773   1.00 2.12  ? 50  GLU A H    5  
ATOM 10752 H HA   . GLU A 1 55  ? 25.719  13.485  0.812   1.00 40.54 ? 50  GLU A HA   5  
ATOM 10753 H HB3  . GLU A 1 55  ? 26.127  11.232  -0.276  1.00 25.32 ? 50  GLU A HB3  5  
ATOM 10754 H HG3  . GLU A 1 55  ? 23.864  11.901  -1.783  1.00 1.32  ? 50  GLU A HG3  5  
ATOM 10755 N N    . GLY A 1 56  ? 22.894  13.964  -0.539  1.00 55.43 ? 51  GLY A N    5  
ATOM 10756 C CA   . GLY A 1 56  ? 22.052  14.922  -1.230  1.00 62.22 ? 51  GLY A CA   5  
ATOM 10757 C C    . GLY A 1 56  ? 21.519  14.385  -2.543  1.00 1.03  ? 51  GLY A C    5  
ATOM 10758 O O    . GLY A 1 56  ? 22.108  13.483  -3.138  1.00 23.40 ? 51  GLY A O    5  
ATOM 10759 H H    . GLY A 1 56  ? 22.485  13.237  -0.024  1.00 1.31  ? 51  GLY A H    5  
ATOM 10760 H HA2  . GLY A 1 56  ? 21.220  15.179  -0.593  1.00 3.15  ? 51  GLY A HA2  5  
ATOM 10761 H HA3  . GLY A 1 56  ? 22.629  15.814  -1.428  1.00 43.04 ? 51  GLY A HA3  5  
ATOM 10762 N N    . GLY A 1 57  ? 20.398  14.939  -2.997  1.00 51.15 ? 52  GLY A N    5  
ATOM 10763 C CA   . GLY A 1 57  ? 19.804  14.495  -4.243  1.00 23.04 ? 52  GLY A CA   5  
ATOM 10764 C C    . GLY A 1 57  ? 19.144  15.627  -5.006  1.00 34.23 ? 52  GLY A C    5  
ATOM 10765 O O    . GLY A 1 57  ? 18.999  16.735  -4.487  1.00 53.52 ? 52  GLY A O    5  
ATOM 10766 H H    . GLY A 1 57  ? 19.973  15.655  -2.480  1.00 14.13 ? 52  GLY A H    5  
ATOM 10767 H HA2  . GLY A 1 57  ? 20.574  14.060  -4.862  1.00 23.42 ? 52  GLY A HA2  5  
ATOM 10768 H HA3  . GLY A 1 57  ? 19.061  13.742  -4.027  1.00 53.05 ? 52  GLY A HA3  5  
ATOM 10769 N N    . VAL A 1 58  ? 18.742  15.351  -6.242  1.00 34.15 ? 53  VAL A N    5  
ATOM 10770 C CA   . VAL A 1 58  ? 18.092  16.354  -7.078  1.00 65.24 ? 53  VAL A CA   5  
ATOM 10771 C C    . VAL A 1 58  ? 16.857  15.783  -7.764  1.00 32.43 ? 53  VAL A C    5  
ATOM 10772 O O    . VAL A 1 58  ? 16.517  14.614  -7.582  1.00 33.20 ? 53  VAL A O    5  
ATOM 10773 C CB   . VAL A 1 58  ? 19.055  16.899  -8.149  1.00 4.22  ? 53  VAL A CB   5  
ATOM 10774 C CG1  . VAL A 1 58  ? 20.128  17.770  -7.512  1.00 33.13 ? 53  VAL A CG1  5  
ATOM 10775 C CG2  . VAL A 1 58  ? 19.682  15.756  -8.934  1.00 72.23 ? 53  VAL A CG2  5  
ATOM 10776 H H    . VAL A 1 58  ? 18.883  14.450  -6.601  1.00 2.31  ? 53  VAL A H    5  
ATOM 10777 H HA   . VAL A 1 58  ? 17.793  17.175  -6.442  1.00 33.03 ? 53  VAL A HA   5  
ATOM 10778 H HB   . VAL A 1 58  ? 18.488  17.511  -8.836  1.00 3.21  ? 53  VAL A HB   5  
ATOM 10779 H HG11 . VAL A 1 58  ? 20.649  18.319  -8.281  1.00 43.23 ? 53  VAL A HG11 5  
ATOM 10780 H HG12 . VAL A 1 58  ? 19.666  18.463  -6.823  1.00 20.42 ? 53  VAL A HG12 5  
ATOM 10781 H HG13 . VAL A 1 58  ? 20.828  17.145  -6.978  1.00 51.12 ? 53  VAL A HG13 5  
ATOM 10782 H HG21 . VAL A 1 58  ? 19.153  14.840  -8.716  1.00 61.15 ? 53  VAL A HG21 5  
ATOM 10783 H HG22 . VAL A 1 58  ? 19.618  15.967  -9.992  1.00 55.14 ? 53  VAL A HG22 5  
ATOM 10784 H HG23 . VAL A 1 58  ? 20.719  15.650  -8.650  1.00 61.34 ? 53  VAL A HG23 5  
ATOM 10785 N N    . THR A 1 59  ? 16.187  16.616  -8.555  1.00 71.15 ? 54  THR A N    5  
ATOM 10786 C CA   . THR A 1 59  ? 14.988  16.195  -9.268  1.00 52.21 ? 54  THR A CA   5  
ATOM 10787 C C    . THR A 1 59  ? 13.867  15.840  -8.297  1.00 25.35 ? 54  THR A C    5  
ATOM 10788 O O    . THR A 1 59  ? 14.106  15.626  -7.110  1.00 73.22 ? 54  THR A O    5  
ATOM 10789 C CB   . THR A 1 59  ? 15.271  14.982  -10.174 1.00 34.13 ? 54  THR A CB   5  
ATOM 10790 O OG1  . THR A 1 59  ? 16.658  14.945  -10.524 1.00 12.53 ? 54  THR A OG1  5  
ATOM 10791 C CG2  . THR A 1 59  ? 14.424  15.040  -11.436 1.00 61.23 ? 54  THR A CG2  5  
ATOM 10792 H H    . THR A 1 59  ? 16.508  17.537  -8.659  1.00 14.42 ? 54  THR A H    5  
ATOM 10793 H HA   . THR A 1 59  ? 14.666  17.016  -9.892  1.00 34.12 ? 54  THR A HA   5  
ATOM 10794 H HB   . THR A 1 59  ? 15.020  14.081  -9.631  1.00 41.53 ? 54  THR A HB   5  
ATOM 10795 H HG1  . THR A 1 59  ? 16.830  14.174  -11.072 1.00 34.20 ? 54  THR A HG1  5  
ATOM 10796 H HG21 . THR A 1 59  ? 14.886  14.441  -12.207 1.00 45.10 ? 54  THR A HG21 5  
ATOM 10797 H HG22 . THR A 1 59  ? 14.348  16.064  -11.772 1.00 74.33 ? 54  THR A HG22 5  
ATOM 10798 H HG23 . THR A 1 59  ? 13.437  14.655  -11.226 1.00 64.14 ? 54  THR A HG23 5  
ATOM 10799 N N    . SER A 1 60  ? 12.643  15.781  -8.811  1.00 12.44 ? 55  SER A N    5  
ATOM 10800 C CA   . SER A 1 60  ? 11.483  15.454  -7.989  1.00 42.34 ? 55  SER A CA   5  
ATOM 10801 C C    . SER A 1 60  ? 11.662  14.100  -7.310  1.00 4.42  ? 55  SER A C    5  
ATOM 10802 O O    . SER A 1 60  ? 11.051  13.826  -6.279  1.00 72.21 ? 55  SER A O    5  
ATOM 10803 C CB   . SER A 1 60  ? 10.213  15.447  -8.841  1.00 45.32 ? 55  SER A CB   5  
ATOM 10804 O OG   . SER A 1 60  ? 9.083   15.826  -8.074  1.00 3.20  ? 55  SER A OG   5  
ATOM 10805 H H    . SER A 1 60  ? 12.516  15.962  -9.767  1.00 15.32 ? 55  SER A H    5  
ATOM 10806 H HA   . SER A 1 60  ? 11.393  16.215  -7.229  1.00 30.42 ? 55  SER A HA   5  
ATOM 10807 H HB3  . SER A 1 60  ? 10.051  14.454  -9.233  1.00 14.53 ? 55  SER A HB3  5  
ATOM 10808 H HG   . SER A 1 60  ? 8.282   15.545  -8.524  1.00 51.21 ? 55  SER A HG   5  
ATOM 10809 N N    . GLU A 1 61  ? 12.505  13.256  -7.900  1.00 23.41 ? 56  GLU A N    5  
ATOM 10810 C CA   . GLU A 1 61  ? 12.762  11.930  -7.353  1.00 54.45 ? 56  GLU A CA   5  
ATOM 10811 C C    . GLU A 1 61  ? 13.183  12.017  -5.889  1.00 45.43 ? 56  GLU A C    5  
ATOM 10812 O O    . GLU A 1 61  ? 12.768  11.206  -5.063  1.00 14.31 ? 56  GLU A O    5  
ATOM 10813 C CB   . GLU A 1 61  ? 13.849  11.222  -8.165  1.00 2.24  ? 56  GLU A CB   5  
ATOM 10814 C CG   . GLU A 1 61  ? 13.333  10.044  -8.974  1.00 15.43 ? 56  GLU A CG   5  
ATOM 10815 C CD   . GLU A 1 61  ? 14.095  8.763   -8.690  1.00 2.14  ? 56  GLU A CD   5  
ATOM 10816 O OE1  . GLU A 1 61  ? 13.854  8.152   -7.628  1.00 40.54 ? 56  GLU A OE1  5  
ATOM 10817 O OE2  . GLU A 1 61  ? 14.930  8.372   -9.533  1.00 75.04 ? 56  GLU A OE2  5  
ATOM 10818 H H    . GLU A 1 61  ? 12.962  13.533  -8.721  1.00 33.33 ? 56  GLU A H    5  
ATOM 10819 H HA   . GLU A 1 61  ? 11.848  11.359  -7.419  1.00 63.42 ? 56  GLU A HA   5  
ATOM 10820 H HB3  . GLU A 1 61  ? 14.610  10.861  -7.490  1.00 60.50 ? 56  GLU A HB3  5  
ATOM 10821 H HG3  . GLU A 1 61  ? 13.426  10.275  -10.025 1.00 43.15 ? 56  GLU A HG3  5  
ATOM 10822 N N    . ASP A 1 62  ? 14.013  13.007  -5.576  1.00 22.33 ? 57  ASP A N    5  
ATOM 10823 C CA   . ASP A 1 62  ? 14.490  13.202  -4.212  1.00 62.24 ? 57  ASP A CA   5  
ATOM 10824 C C    . ASP A 1 62  ? 13.325  13.457  -3.260  1.00 43.55 ? 57  ASP A C    5  
ATOM 10825 O O    . ASP A 1 62  ? 13.262  12.882  -2.173  1.00 42.15 ? 57  ASP A O    5  
ATOM 10826 C CB   . ASP A 1 62  ? 15.476  14.370  -4.156  1.00 22.04 ? 57  ASP A CB   5  
ATOM 10827 C CG   . ASP A 1 62  ? 15.973  14.643  -2.750  1.00 12.03 ? 57  ASP A CG   5  
ATOM 10828 O OD1  . ASP A 1 62  ? 15.799  13.764  -1.880  1.00 30.11 ? 57  ASP A OD1  5  
ATOM 10829 O OD2  . ASP A 1 62  ? 16.534  15.734  -2.519  1.00 41.23 ? 57  ASP A OD2  5  
ATOM 10830 H H    . ASP A 1 62  ? 14.309  13.623  -6.279  1.00 11.04 ? 57  ASP A H    5  
ATOM 10831 H HA   . ASP A 1 62  ? 14.998  12.300  -3.907  1.00 53.03 ? 57  ASP A HA   5  
ATOM 10832 H HB3  . ASP A 1 62  ? 14.990  15.261  -4.526  1.00 3.22  ? 57  ASP A HB3  5  
ATOM 10833 N N    . TYR A 1 63  ? 12.408  14.323  -3.674  1.00 64.31 ? 58  TYR A N    5  
ATOM 10834 C CA   . TYR A 1 63  ? 11.248  14.657  -2.857  1.00 74.41 ? 58  TYR A CA   5  
ATOM 10835 C C    . TYR A 1 63  ? 10.377  13.428  -2.619  1.00 31.12 ? 58  TYR A C    5  
ATOM 10836 O O    . TYR A 1 63  ? 10.008  13.124  -1.484  1.00 4.43  ? 58  TYR A O    5  
ATOM 10837 C CB   . TYR A 1 63  ? 10.424  15.758  -3.528  1.00 62.12 ? 58  TYR A CB   5  
ATOM 10838 C CG   . TYR A 1 63  ? 11.052  17.130  -3.427  1.00 35.44 ? 58  TYR A CG   5  
ATOM 10839 C CD1  . TYR A 1 63  ? 11.548  17.601  -2.217  1.00 44.44 ? 58  TYR A CD1  5  
ATOM 10840 C CD2  . TYR A 1 63  ? 11.146  17.956  -4.540  1.00 52.54 ? 58  TYR A CD2  5  
ATOM 10841 C CE1  . TYR A 1 63  ? 12.121  18.854  -2.120  1.00 10.03 ? 58  TYR A CE1  5  
ATOM 10842 C CE2  . TYR A 1 63  ? 11.719  19.210  -4.453  1.00 73.23 ? 58  TYR A CE2  5  
ATOM 10843 C CZ   . TYR A 1 63  ? 12.204  19.655  -3.241  1.00 53.10 ? 58  TYR A CZ   5  
ATOM 10844 O OH   . TYR A 1 63  ? 12.775  20.904  -3.148  1.00 1.01  ? 58  TYR A OH   5  
ATOM 10845 H H    . TYR A 1 63  ? 12.514  14.750  -4.550  1.00 23.04 ? 58  TYR A H    5  
ATOM 10846 H HA   . TYR A 1 63  ? 11.606  15.020  -1.904  1.00 53.41 ? 58  TYR A HA   5  
ATOM 10847 H HB3  . TYR A 1 63  ? 9.450   15.802  -3.064  1.00 43.24 ? 58  TYR A HB3  5  
ATOM 10848 H HD1  . TYR A 1 63  ? 11.483  16.971  -1.342  1.00 35.15 ? 58  TYR A HD1  5  
ATOM 10849 H HD2  . TYR A 1 63  ? 10.765  17.604  -5.489  1.00 72.55 ? 58  TYR A HD2  5  
ATOM 10850 H HE1  . TYR A 1 63  ? 12.502  19.203  -1.171  1.00 42.21 ? 58  TYR A HE1  5  
ATOM 10851 H HE2  . TYR A 1 63  ? 11.784  19.838  -5.329  1.00 22.31 ? 58  TYR A HE2  5  
ATOM 10852 H HH   . TYR A 1 63  ? 13.502  20.877  -2.521  1.00 44.13 ? 58  TYR A HH   5  
ATOM 10853 N N    . ARG A 1 64  ? 10.052  12.724  -3.699  1.00 35.04 ? 59  ARG A N    5  
ATOM 10854 C CA   . ARG A 1 64  ? 9.223   11.527  -3.609  1.00 43.42 ? 59  ARG A CA   5  
ATOM 10855 C C    . ARG A 1 64  ? 9.909   10.453  -2.770  1.00 23.22 ? 59  ARG A C    5  
ATOM 10856 O O    . ARG A 1 64  ? 9.284   9.825   -1.914  1.00 0.03  ? 59  ARG A O    5  
ATOM 10857 C CB   . ARG A 1 64  ? 8.924   10.983  -5.008  1.00 35.20 ? 59  ARG A CB   5  
ATOM 10858 C CG   . ARG A 1 64  ? 7.941   11.834  -5.794  1.00 22.12 ? 59  ARG A CG   5  
ATOM 10859 C CD   . ARG A 1 64  ? 6.890   10.977  -6.483  1.00 30.31 ? 59  ARG A CD   5  
ATOM 10860 N NE   . ARG A 1 64  ? 5.998   10.330  -5.525  1.00 12.11 ? 59  ARG A NE   5  
ATOM 10861 C CZ   . ARG A 1 64  ? 4.909   9.654   -5.874  1.00 23.34 ? 59  ARG A CZ   5  
ATOM 10862 N NH1  . ARG A 1 64  ? 4.579   9.538   -7.154  1.00 71.53 ? 59  ARG A NH1  5  
ATOM 10863 N NH2  . ARG A 1 64  ? 4.147   9.093   -4.944  1.00 60.25 ? 59  ARG A NH2  5  
ATOM 10864 H H    . ARG A 1 64  ? 10.376  13.017  -4.576  1.00 13.44 ? 59  ARG A H    5  
ATOM 10865 H HA   . ARG A 1 64  ? 8.294   11.802  -3.133  1.00 15.33 ? 59  ARG A HA   5  
ATOM 10866 H HB3  . ARG A 1 64  ? 8.512   9.990   -4.914  1.00 74.23 ? 59  ARG A HB3  5  
ATOM 10867 H HG3  . ARG A 1 64  ? 8.482   12.394  -6.542  1.00 63.44 ? 59  ARG A HG3  5  
ATOM 10868 H HD3  . ARG A 1 64  ? 7.389   10.218  -7.066  1.00 42.02 ? 59  ARG A HD3  5  
ATOM 10869 H HE   . ARG A 1 64  ? 6.222   10.403  -4.574  1.00 23.11 ? 59  ARG A HE   5  
ATOM 10870 H HH11 . ARG A 1 64  ? 5.151   9.959   -7.857  1.00 52.43 ? 59  ARG A HH11 5  
ATOM 10871 H HH12 . ARG A 1 64  ? 3.759   9.027   -7.414  1.00 4.22  ? 59  ARG A HH12 5  
ATOM 10872 H HH21 . ARG A 1 64  ? 4.392   9.179   -3.979  1.00 54.15 ? 59  ARG A HH21 5  
ATOM 10873 H HH22 . ARG A 1 64  ? 3.328   8.585   -5.208  1.00 24.13 ? 59  ARG A HH22 5  
ATOM 10874 N N    . THR A 1 65  ? 11.198  10.246  -3.020  1.00 22.13 ? 60  THR A N    5  
ATOM 10875 C CA   . THR A 1 65  ? 11.967  9.247   -2.290  1.00 43.22 ? 60  THR A CA   5  
ATOM 10876 C C    . THR A 1 65  ? 11.930  9.514   -0.790  1.00 34.12 ? 60  THR A C    5  
ATOM 10877 O O    . THR A 1 65  ? 11.663  8.611   0.005   1.00 44.13 ? 60  THR A O    5  
ATOM 10878 C CB   . THR A 1 65  ? 13.435  9.216   -2.758  1.00 63.11 ? 60  THR A CB   5  
ATOM 10879 O OG1  . THR A 1 65  ? 13.498  8.884   -4.149  1.00 11.53 ? 60  THR A OG1  5  
ATOM 10880 C CG2  . THR A 1 65  ? 14.238  8.206   -1.953  1.00 31.15 ? 60  THR A CG2  5  
ATOM 10881 H H    . THR A 1 65  ? 11.640  10.778  -3.715  1.00 73.32 ? 60  THR A H    5  
ATOM 10882 H HA   . THR A 1 65  ? 11.528  8.280   -2.485  1.00 52.45 ? 60  THR A HA   5  
ATOM 10883 H HB   . THR A 1 65  ? 13.865  10.196  -2.609  1.00 53.31 ? 60  THR A HB   5  
ATOM 10884 H HG1  . THR A 1 65  ? 14.358  9.132   -4.499  1.00 32.34 ? 60  THR A HG1  5  
ATOM 10885 H HG21 . THR A 1 65  ? 13.659  7.303   -1.826  1.00 31.32 ? 60  THR A HG21 5  
ATOM 10886 H HG22 . THR A 1 65  ? 14.473  8.622   -0.984  1.00 1.40  ? 60  THR A HG22 5  
ATOM 10887 H HG23 . THR A 1 65  ? 15.153  7.974   -2.477  1.00 53.12 ? 60  THR A HG23 5  
ATOM 10888 N N    . PHE A 1 66  ? 12.197  10.757  -0.408  1.00 64.55 ? 61  PHE A N    5  
ATOM 10889 C CA   . PHE A 1 66  ? 12.195  11.143  1.000   1.00 10.54 ? 61  PHE A CA   5  
ATOM 10890 C C    . PHE A 1 66  ? 10.789  11.052  1.585   1.00 1.05  ? 61  PHE A C    5  
ATOM 10891 O O    . PHE A 1 66  ? 10.598  10.562  2.699   1.00 2.02  ? 61  PHE A O    5  
ATOM 10892 C CB   . PHE A 1 66  ? 12.736  12.565  1.162   1.00 42.40 ? 61  PHE A CB   5  
ATOM 10893 C CG   . PHE A 1 66  ? 12.966  12.959  2.593   1.00 20.03 ? 61  PHE A CG   5  
ATOM 10894 C CD1  . PHE A 1 66  ? 11.902  13.318  3.405   1.00 53.12 ? 61  PHE A CD1  5  
ATOM 10895 C CD2  . PHE A 1 66  ? 14.245  12.971  3.126   1.00 34.04 ? 61  PHE A CD2  5  
ATOM 10896 C CE1  . PHE A 1 66  ? 12.110  13.681  4.722   1.00 70.32 ? 61  PHE A CE1  5  
ATOM 10897 C CE2  . PHE A 1 66  ? 14.458  13.333  4.442   1.00 42.44 ? 61  PHE A CE2  5  
ATOM 10898 C CZ   . PHE A 1 66  ? 13.389  13.688  5.242   1.00 2.53  ? 61  PHE A CZ   5  
ATOM 10899 H H    . PHE A 1 66  ? 12.402  11.433  -1.088  1.00 43.23 ? 61  PHE A H    5  
ATOM 10900 H HA   . PHE A 1 66  ? 12.838  10.459  1.530   1.00 71.41 ? 61  PHE A HA   5  
ATOM 10901 H HB3  . PHE A 1 66  ? 12.032  13.262  0.732   1.00 54.34 ? 61  PHE A HB3  5  
ATOM 10902 H HD1  . PHE A 1 66  ? 10.900  13.312  3.001   1.00 3.01  ? 61  PHE A HD1  5  
ATOM 10903 H HD2  . PHE A 1 66  ? 15.081  12.693  2.501   1.00 12.53 ? 61  PHE A HD2  5  
ATOM 10904 H HE1  . PHE A 1 66  ? 11.273  13.959  5.345   1.00 31.35 ? 61  PHE A HE1  5  
ATOM 10905 H HE2  . PHE A 1 66  ? 15.460  13.336  4.845   1.00 65.45 ? 61  PHE A HE2  5  
ATOM 10906 H HZ   . PHE A 1 66  ? 13.555  13.972  6.270   1.00 74.31 ? 61  PHE A HZ   5  
ATOM 10907 N N    . LEU A 1 67  ? 9.807   11.528  0.827   1.00 1.11  ? 62  LEU A N    5  
ATOM 10908 C CA   . LEU A 1 67  ? 8.418   11.502  1.270   1.00 33.50 ? 62  LEU A CA   5  
ATOM 10909 C C    . LEU A 1 67  ? 7.972   10.077  1.582   1.00 70.33 ? 62  LEU A C    5  
ATOM 10910 O O    . LEU A 1 67  ? 7.234   9.843   2.539   1.00 24.34 ? 62  LEU A O    5  
ATOM 10911 C CB   . LEU A 1 67  ? 7.509   12.110  0.200   1.00 53.12 ? 62  LEU A CB   5  
ATOM 10912 C CG   . LEU A 1 67  ? 7.304   13.623  0.274   1.00 23.51 ? 62  LEU A CG   5  
ATOM 10913 C CD1  . LEU A 1 67  ? 6.757   14.153  -1.043  1.00 44.32 ? 62  LEU A CD1  5  
ATOM 10914 C CD2  . LEU A 1 67  ? 6.371   13.979  1.423   1.00 3.14  ? 62  LEU A CD2  5  
ATOM 10915 H H    . LEU A 1 67  ? 10.020  11.907  -0.051  1.00 52.13 ? 62  LEU A H    5  
ATOM 10916 H HA   . LEU A 1 67  ? 8.346   12.094  2.170   1.00 21.44 ? 62  LEU A HA   5  
ATOM 10917 H HB3  . LEU A 1 67  ? 6.539   11.639  0.283   1.00 63.22 ? 62  LEU A HB3  5  
ATOM 10918 H HG   . LEU A 1 67  ? 8.256   14.101  0.456   1.00 41.01 ? 62  LEU A HG   5  
ATOM 10919 H HD11 . LEU A 1 67  ? 7.217   13.623  -1.862  1.00 42.51 ? 62  LEU A HD11 5  
ATOM 10920 H HD12 . LEU A 1 67  ? 6.977   15.207  -1.126  1.00 65.13 ? 62  LEU A HD12 5  
ATOM 10921 H HD13 . LEU A 1 67  ? 5.687   14.006  -1.074  1.00 62.34 ? 62  LEU A HD13 5  
ATOM 10922 H HD21 . LEU A 1 67  ? 6.940   14.053  2.338   1.00 21.53 ? 62  LEU A HD21 5  
ATOM 10923 H HD22 . LEU A 1 67  ? 5.619   13.210  1.526   1.00 63.53 ? 62  LEU A HD22 5  
ATOM 10924 H HD23 . LEU A 1 67  ? 5.893   14.926  1.218   1.00 43.32 ? 62  LEU A HD23 5  
ATOM 10925 N N    . GLN A 1 68  ? 8.427   9.129   0.769   1.00 31.44 ? 63  GLN A N    5  
ATOM 10926 C CA   . GLN A 1 68  ? 8.076   7.727   0.960   1.00 50.13 ? 63  GLN A CA   5  
ATOM 10927 C C    . GLN A 1 68  ? 8.520   7.237   2.334   1.00 41.25 ? 63  GLN A C    5  
ATOM 10928 O O    . GLN A 1 68  ? 7.995   6.251   2.851   1.00 40.42 ? 63  GLN A O    5  
ATOM 10929 C CB   . GLN A 1 68  ? 8.713   6.867   -0.133  1.00 55.24 ? 63  GLN A CB   5  
ATOM 10930 C CG   . GLN A 1 68  ? 7.963   6.906   -1.453  1.00 22.13 ? 63  GLN A CG   5  
ATOM 10931 C CD   . GLN A 1 68  ? 7.306   5.582   -1.791  1.00 22.23 ? 63  GLN A CD   5  
ATOM 10932 O OE1  . GLN A 1 68  ? 6.256   5.239   -1.246  1.00 43.02 ? 63  GLN A OE1  5  
ATOM 10933 N NE2  . GLN A 1 68  ? 7.922   4.828   -2.695  1.00 61.23 ? 63  GLN A NE2  5  
ATOM 10934 H H    . GLN A 1 68  ? 9.011   9.379   0.024   1.00 55.40 ? 63  GLN A H    5  
ATOM 10935 H HA   . GLN A 1 68  ? 7.002   7.642   0.892   1.00 1.12  ? 63  GLN A HA   5  
ATOM 10936 H HB3  . GLN A 1 68  ? 8.747   5.842   0.207   1.00 34.11 ? 63  GLN A HB3  5  
ATOM 10937 H HG3  . GLN A 1 68  ? 8.658   7.157   -2.241  1.00 62.34 ? 63  GLN A HG3  5  
ATOM 10938 H HE21 . GLN A 1 68  ? 8.756   5.164   -3.086  1.00 70.42 ? 63  GLN A HE21 5  
ATOM 10939 H HE22 . GLN A 1 68  ? 7.521   3.968   -2.931  1.00 33.23 ? 63  GLN A HE22 5  
ATOM 10940 N N    . GLN A 1 69  ? 9.491   7.931   2.919   1.00 32.23 ? 64  GLN A N    5  
ATOM 10941 C CA   . GLN A 1 69  ? 10.006  7.565   4.233   1.00 21.10 ? 64  GLN A CA   5  
ATOM 10942 C C    . GLN A 1 69  ? 10.595  6.159   4.214   1.00 52.54 ? 64  GLN A C    5  
ATOM 10943 O O    . GLN A 1 69  ? 10.047  5.222   4.796   1.00 54.42 ? 64  GLN A O    5  
ATOM 10944 C CB   . GLN A 1 69  ? 8.897   7.652   5.283   1.00 24.13 ? 64  GLN A CB   5  
ATOM 10945 C CG   . GLN A 1 69  ? 8.822   9.001   5.979   1.00 72.11 ? 64  GLN A CG   5  
ATOM 10946 C CD   . GLN A 1 69  ? 7.561   9.162   6.805   1.00 60.34 ? 64  GLN A CD   5  
ATOM 10947 O OE1  . GLN A 1 69  ? 7.338   8.429   7.768   1.00 53.11 ? 64  GLN A OE1  5  
ATOM 10948 N NE2  . GLN A 1 69  ? 6.728   10.126  6.432   1.00 61.42 ? 64  GLN A NE2  5  
ATOM 10949 H H    . GLN A 1 69  ? 9.869   8.708   2.457   1.00 50.31 ? 64  GLN A H    5  
ATOM 10950 H HA   . GLN A 1 69  ? 10.787  8.265   4.490   1.00 23.22 ? 64  GLN A HA   5  
ATOM 10951 H HB3  . GLN A 1 69  ? 9.066   6.893   6.031   1.00 73.23 ? 64  GLN A HB3  5  
ATOM 10952 H HG3  . GLN A 1 69  ? 8.848   9.780   5.232   1.00 11.23 ? 64  GLN A HG3  5  
ATOM 10953 H HE21 . GLN A 1 69  ? 6.971   10.671  5.653   1.00 33.50 ? 64  GLN A HE21 5  
ATOM 10954 H HE22 . GLN A 1 69  ? 5.905   10.253  6.947   1.00 51.22 ? 64  GLN A HE22 5  
ATOM 10955 N N    . PRO A 1 70  ? 11.738  6.004   3.530   1.00 2.42  ? 65  PRO A N    5  
ATOM 10956 C CA   . PRO A 1 70  ? 12.427  4.716   3.418   1.00 15.43 ? 65  PRO A CA   5  
ATOM 10957 C C    . PRO A 1 70  ? 13.044  4.271   4.740   1.00 65.13 ? 65  PRO A C    5  
ATOM 10958 O O    . PRO A 1 70  ? 12.800  4.876   5.784   1.00 1.34  ? 65  PRO A O    5  
ATOM 10959 C CB   . PRO A 1 70  ? 13.519  4.985   2.381   1.00 41.21 ? 65  PRO A CB   5  
ATOM 10960 C CG   . PRO A 1 70  ? 13.770  6.450   2.467   1.00 24.35 ? 65  PRO A CG   5  
ATOM 10961 C CD   . PRO A 1 70  ? 12.447  7.077   2.811   1.00 63.31 ? 65  PRO A CD   5  
ATOM 10962 H HA   . PRO A 1 70  ? 11.765  3.942   3.054   1.00 43.42 ? 65  PRO A HA   5  
ATOM 10963 H HB3  . PRO A 1 70  ? 13.168  4.701   1.400   1.00 61.24 ? 65  PRO A HB3  5  
ATOM 10964 H HG3  . PRO A 1 70  ? 14.121  6.819   1.514   1.00 52.15 ? 65  PRO A HG3  5  
ATOM 10965 H HD3  . PRO A 1 70  ? 11.916  7.355   1.913   1.00 32.50 ? 65  PRO A HD3  5  
ATOM 10966 N N    . SER A 1 71  ? 13.847  3.213   4.688   1.00 4.34  ? 66  SER A N    5  
ATOM 10967 C CA   . SER A 1 71  ? 14.497  2.687   5.881   1.00 71.44 ? 66  SER A CA   5  
ATOM 10968 C C    . SER A 1 71  ? 13.464  2.182   6.885   1.00 71.21 ? 66  SER A C    5  
ATOM 10969 O O    . SER A 1 71  ? 12.285  2.520   6.802   1.00 21.24 ? 66  SER A O    5  
ATOM 10970 C CB   . SER A 1 71  ? 15.370  3.764   6.529   1.00 13.12 ? 66  SER A CB   5  
ATOM 10971 O OG   . SER A 1 71  ? 16.710  3.322   6.663   1.00 11.42 ? 66  SER A OG   5  
ATOM 10972 H H    . SER A 1 71  ? 14.003  2.774   3.825   1.00 61.32 ? 66  SER A H    5  
ATOM 10973 H HA   . SER A 1 71  ? 15.124  1.860   5.581   1.00 73.32 ? 66  SER A HA   5  
ATOM 10974 H HB3  . SER A 1 71  ? 14.981  3.997   7.509   1.00 73.44 ? 66  SER A HB3  5  
ATOM 10975 H HG   . SER A 1 71  ? 17.178  3.898   7.272   1.00 14.24 ? 66  SER A HG   5  
ATOM 10976 N N    . GLY A 1 72  ? 13.919  1.370   7.835   1.00 2.23  ? 67  GLY A N    5  
ATOM 10977 C CA   . GLY A 1 72  ? 13.023  0.830   8.840   1.00 73.32 ? 67  GLY A CA   5  
ATOM 10978 C C    . GLY A 1 72  ? 13.639  0.829   10.226  1.00 24.31 ? 67  GLY A C    5  
ATOM 10979 O O    . GLY A 1 72  ? 14.861  0.797   10.369  1.00 0.35  ? 67  GLY A O    5  
ATOM 10980 H H    . GLY A 1 72  ? 14.870  1.135   7.852   1.00 14.55 ? 67  GLY A H    5  
ATOM 10981 H HA2  . GLY A 1 72  ? 12.121  1.425   8.859   1.00 72.13 ? 67  GLY A HA2  5  
ATOM 10982 H HA3  . GLY A 1 72  ? 12.767  -0.185  8.572   1.00 62.30 ? 67  GLY A HA3  5  
ATOM 10983 N N    . ASN A 1 73  ? 12.792  0.866   11.249  1.00 32.33 ? 68  ASN A N    5  
ATOM 10984 C CA   . ASN A 1 73  ? 13.261  0.872   12.629  1.00 74.04 ? 68  ASN A CA   5  
ATOM 10985 C C    . ASN A 1 73  ? 13.225  -0.534  13.222  1.00 4.14  ? 68  ASN A C    5  
ATOM 10986 O O    . ASN A 1 73  ? 13.018  -1.515  12.508  1.00 4.32  ? 68  ASN A O    5  
ATOM 10987 C CB   . ASN A 1 73  ? 12.406  1.816   13.478  1.00 4.51  ? 68  ASN A CB   5  
ATOM 10988 C CG   . ASN A 1 73  ? 12.315  3.207   12.880  1.00 41.13 ? 68  ASN A CG   5  
ATOM 10989 O OD1  . ASN A 1 73  ? 11.260  3.622   12.401  1.00 71.14 ? 68  ASN A OD1  5  
ATOM 10990 N ND2  . ASN A 1 73  ? 13.426  3.934   12.904  1.00 74.11 ? 68  ASN A ND2  5  
ATOM 10991 H H    . ASN A 1 73  ? 11.828  0.891   11.072  1.00 13.31 ? 68  ASN A H    5  
ATOM 10992 H HA   . ASN A 1 73  ? 14.281  1.225   12.631  1.00 53.14 ? 68  ASN A HA   5  
ATOM 10993 H HB3  . ASN A 1 73  ? 12.837  1.894   14.464  1.00 11.11 ? 68  ASN A HB3  5  
ATOM 10994 H HD21 . ASN A 1 73  ? 14.231  3.539   13.301  1.00 34.32 ? 68  ASN A HD21 5  
ATOM 10995 H HD22 . ASN A 1 73  ? 13.396  4.838   12.526  1.00 52.33 ? 68  ASN A HD22 5  
ATOM 10996 N N    . MET A 1 74  ? 13.429  -0.624  14.532  1.00 61.33 ? 69  MET A N    5  
ATOM 10997 C CA   . MET A 1 74  ? 13.418  -1.909  15.221  1.00 2.53  ? 69  MET A CA   5  
ATOM 10998 C C    . MET A 1 74  ? 14.493  -2.835  14.660  1.00 70.14 ? 69  MET A C    5  
ATOM 10999 O O    . MET A 1 74  ? 14.295  -3.481  13.632  1.00 2.54  ? 69  MET A O    5  
ATOM 11000 C CB   . MET A 1 74  ? 12.043  -2.569  15.093  1.00 1.32  ? 69  MET A CB   5  
ATOM 11001 C CG   . MET A 1 74  ? 11.546  -3.192  16.386  1.00 15.23 ? 69  MET A CG   5  
ATOM 11002 S SD   . MET A 1 74  ? 10.212  -4.376  16.119  1.00 22.21 ? 69  MET A SD   5  
ATOM 11003 C CE   . MET A 1 74  ? 10.588  -5.600  17.371  1.00 42.04 ? 69  MET A CE   5  
ATOM 11004 H H    . MET A 1 74  ? 13.589  0.193   15.049  1.00 11.20 ? 69  MET A H    5  
ATOM 11005 H HA   . MET A 1 74  ? 13.624  -1.728  16.264  1.00 73.23 ? 69  MET A HA   5  
ATOM 11006 H HB3  . MET A 1 74  ? 12.097  -3.344  14.343  1.00 45.30 ? 69  MET A HB3  5  
ATOM 11007 H HG3  . MET A 1 74  ? 11.186  -2.406  17.033  1.00 40.54 ? 69  MET A HG3  5  
ATOM 11008 H HE1  . MET A 1 74  ? 9.668   -5.978  17.794  1.00 43.30 ? 69  MET A HE1  5  
ATOM 11009 H HE2  . MET A 1 74  ? 11.140  -6.413  16.925  1.00 42.51 ? 69  MET A HE2  5  
ATOM 11010 H HE3  . MET A 1 74  ? 11.183  -5.145  18.151  1.00 34.13 ? 69  MET A HE3  5  
ATOM 11011 N N    . ASP A 1 75  ? 15.631  -2.893  15.343  1.00 13.11 ? 70  ASP A N    5  
ATOM 11012 C CA   . ASP A 1 75  ? 16.738  -3.741  14.914  1.00 72.51 ? 70  ASP A CA   5  
ATOM 11013 C C    . ASP A 1 75  ? 16.285  -5.190  14.761  1.00 72.15 ? 70  ASP A C    5  
ATOM 11014 O O    . ASP A 1 75  ? 15.143  -5.529  15.069  1.00 32.13 ? 70  ASP A O    5  
ATOM 11015 C CB   . ASP A 1 75  ? 17.891  -3.657  15.916  1.00 64.20 ? 70  ASP A CB   5  
ATOM 11016 C CG   . ASP A 1 75  ? 18.170  -2.234  16.358  1.00 53.14 ? 70  ASP A CG   5  
ATOM 11017 O OD1  . ASP A 1 75  ? 18.634  -1.433  15.520  1.00 21.51 ? 70  ASP A OD1  5  
ATOM 11018 O OD2  . ASP A 1 75  ? 17.927  -1.922  17.543  1.00 42.14 ? 70  ASP A OD2  5  
ATOM 11019 H H    . ASP A 1 75  ? 15.729  -2.355  16.157  1.00 24.45 ? 70  ASP A H    5  
ATOM 11020 H HA   . ASP A 1 75  ? 17.079  -3.380  13.956  1.00 14.43 ? 70  ASP A HA   5  
ATOM 11021 H HB3  . ASP A 1 75  ? 18.785  -4.056  15.460  1.00 52.22 ? 70  ASP A HB3  5  
ATOM 11022 N N    . ASP A 1 76  ? 17.188  -6.038  14.284  1.00 53.40 ? 71  ASP A N    5  
ATOM 11023 C CA   . ASP A 1 76  ? 16.883  -7.452  14.090  1.00 63.31 ? 71  ASP A CA   5  
ATOM 11024 C C    . ASP A 1 76  ? 15.757  -7.628  13.075  1.00 13.52 ? 71  ASP A C    5  
ATOM 11025 O O    . ASP A 1 76  ? 15.128  -8.685  13.010  1.00 44.53 ? 71  ASP A O    5  
ATOM 11026 C CB   . ASP A 1 76  ? 16.494  -8.099  15.420  1.00 22.43 ? 71  ASP A CB   5  
ATOM 11027 C CG   . ASP A 1 76  ? 16.785  -9.586  15.447  1.00 43.33 ? 71  ASP A CG   5  
ATOM 11028 O OD1  . ASP A 1 76  ? 17.158  -10.138 14.390  1.00 64.43 ? 71  ASP A OD1  5  
ATOM 11029 O OD2  . ASP A 1 76  ? 16.642  -10.198 16.526  1.00 44.34 ? 71  ASP A OD2  5  
ATOM 11030 H H    . ASP A 1 76  ? 18.083  -5.708  14.057  1.00 23.10 ? 71  ASP A H    5  
ATOM 11031 H HA   . ASP A 1 76  ? 17.770  -7.934  13.712  1.00 4.53  ? 71  ASP A HA   5  
ATOM 11032 H HB3  . ASP A 1 76  ? 15.437  -7.954  15.587  1.00 34.22 ? 71  ASP A HB3  5  
ATOM 11033 N N    . SER A 1 77  ? 15.509  -6.588  12.287  1.00 30.15 ? 72  SER A N    5  
ATOM 11034 C CA   . SER A 1 77  ? 14.456  -6.628  11.278  1.00 63.41 ? 72  SER A CA   5  
ATOM 11035 C C    . SER A 1 77  ? 14.391  -5.312  10.508  1.00 52.32 ? 72  SER A C    5  
ATOM 11036 O O    . SER A 1 77  ? 13.318  -4.868  10.105  1.00 61.22 ? 72  SER A O    5  
ATOM 11037 C CB   . SER A 1 77  ? 13.103  -6.915  11.934  1.00 63.24 ? 72  SER A CB   5  
ATOM 11038 O OG   . SER A 1 77  ? 12.885  -6.064  13.046  1.00 61.20 ? 72  SER A OG   5  
ATOM 11039 H H    . SER A 1 77  ? 16.044  -5.774  12.387  1.00 4.01  ? 72  SER A H    5  
ATOM 11040 H HA   . SER A 1 77  ? 14.687  -7.425  10.588  1.00 2.02  ? 72  SER A HA   5  
ATOM 11041 H HB3  . SER A 1 77  ? 13.080  -7.941  12.270  1.00 31.54 ? 72  SER A HB3  5  
ATOM 11042 H HG   . SER A 1 77  ? 12.258  -6.475  13.646  1.00 51.42 ? 72  SER A HG   5  
ATOM 11043 N N    . GLY A 1 78  ? 15.552  -4.694  10.307  1.00 11.04 ? 73  GLY A N    5  
ATOM 11044 C CA   . GLY A 1 78  ? 15.607  -3.436  9.586   1.00 72.10 ? 73  GLY A CA   5  
ATOM 11045 C C    . GLY A 1 78  ? 16.510  -3.504  8.370   1.00 75.51 ? 73  GLY A C    5  
ATOM 11046 O O    . GLY A 1 78  ? 17.392  -2.662  8.195   1.00 54.34 ? 73  GLY A O    5  
ATOM 11047 H H    . GLY A 1 78  ? 16.377  -5.096  10.652  1.00 4.22  ? 73  GLY A H    5  
ATOM 11048 H HA2  . GLY A 1 78  ? 14.610  -3.173  9.266   1.00 12.10 ? 73  GLY A HA2  5  
ATOM 11049 H HA3  . GLY A 1 78  ? 15.975  -2.669  10.251  1.00 41.51 ? 73  GLY A HA3  5  
ATOM 11050 N N    . PHE A 1 79  ? 16.292  -4.508  7.528   1.00 54.54 ? 74  PHE A N    5  
ATOM 11051 C CA   . PHE A 1 79  ? 17.095  -4.684  6.324   1.00 71.02 ? 74  PHE A CA   5  
ATOM 11052 C C    . PHE A 1 79  ? 16.278  -4.369  5.074   1.00 70.23 ? 74  PHE A C    5  
ATOM 11053 O O    . PHE A 1 79  ? 16.829  -4.178  3.991   1.00 5.34  ? 74  PHE A O    5  
ATOM 11054 C CB   . PHE A 1 79  ? 17.632  -6.115  6.248   1.00 44.54 ? 74  PHE A CB   5  
ATOM 11055 C CG   . PHE A 1 79  ? 18.678  -6.419  7.283   1.00 34.51 ? 74  PHE A CG   5  
ATOM 11056 C CD1  . PHE A 1 79  ? 20.018  -6.186  7.022   1.00 43.51 ? 74  PHE A CD1  5  
ATOM 11057 C CD2  . PHE A 1 79  ? 18.319  -6.936  8.517   1.00 72.34 ? 74  PHE A CD2  5  
ATOM 11058 C CE1  . PHE A 1 79  ? 20.982  -6.467  7.972   1.00 64.54 ? 74  PHE A CE1  5  
ATOM 11059 C CE2  . PHE A 1 79  ? 19.278  -7.216  9.472   1.00 53.20 ? 74  PHE A CE2  5  
ATOM 11060 C CZ   . PHE A 1 79  ? 20.611  -6.980  9.199   1.00 33.11 ? 74  PHE A CZ   5  
ATOM 11061 H H    . PHE A 1 79  ? 15.574  -5.147  7.722   1.00 43.22 ? 74  PHE A H    5  
ATOM 11062 H HA   . PHE A 1 79  ? 17.927  -3.999  6.378   1.00 41.10 ? 74  PHE A HA   5  
ATOM 11063 H HB3  . PHE A 1 79  ? 18.071  -6.276  5.274   1.00 73.54 ? 74  PHE A HB3  5  
ATOM 11064 H HD1  . PHE A 1 79  ? 20.309  -5.783  6.063   1.00 61.25 ? 74  PHE A HD1  5  
ATOM 11065 H HD2  . PHE A 1 79  ? 17.275  -7.120  8.732   1.00 2.50  ? 74  PHE A HD2  5  
ATOM 11066 H HE1  . PHE A 1 79  ? 22.024  -6.280  7.757   1.00 73.41 ? 74  PHE A HE1  5  
ATOM 11067 H HE2  . PHE A 1 79  ? 18.984  -7.619  10.431  1.00 64.11 ? 74  PHE A HE2  5  
ATOM 11068 H HZ   . PHE A 1 79  ? 21.362  -7.200  9.944   1.00 25.20 ? 74  PHE A HZ   5  
ATOM 11069 N N    . PHE A 1 80  ? 14.960  -4.316  5.234   1.00 54.15 ? 75  PHE A N    5  
ATOM 11070 C CA   . PHE A 1 80  ? 14.065  -4.025  4.120   1.00 53.33 ? 75  PHE A CA   5  
ATOM 11071 C C    . PHE A 1 80  ? 13.466  -2.628  4.253   1.00 53.20 ? 75  PHE A C    5  
ATOM 11072 O O    . PHE A 1 80  ? 13.708  -1.929  5.237   1.00 34.30 ? 75  PHE A O    5  
ATOM 11073 C CB   . PHE A 1 80  ? 12.948  -5.068  4.050   1.00 62.41 ? 75  PHE A CB   5  
ATOM 11074 C CG   . PHE A 1 80  ? 11.832  -4.817  5.026   1.00 43.44 ? 75  PHE A CG   5  
ATOM 11075 C CD1  . PHE A 1 80  ? 12.019  -5.033  6.381   1.00 62.54 ? 75  PHE A CD1  5  
ATOM 11076 C CD2  . PHE A 1 80  ? 10.598  -4.365  4.586   1.00 52.14 ? 75  PHE A CD2  5  
ATOM 11077 C CE1  . PHE A 1 80  ? 10.995  -4.803  7.281   1.00 5.34  ? 75  PHE A CE1  5  
ATOM 11078 C CE2  . PHE A 1 80  ? 9.570   -4.134  5.480   1.00 42.14 ? 75  PHE A CE2  5  
ATOM 11079 C CZ   . PHE A 1 80  ? 9.769   -4.352  6.829   1.00 21.10 ? 75  PHE A CZ   5  
ATOM 11080 H H    . PHE A 1 80  ? 14.580  -4.477  6.124   1.00 2.11  ? 75  PHE A H    5  
ATOM 11081 H HA   . PHE A 1 80  ? 14.645  -4.070  3.211   1.00 51.04 ? 75  PHE A HA   5  
ATOM 11082 H HB3  . PHE A 1 80  ? 13.361  -6.042  4.260   1.00 53.31 ? 75  PHE A HB3  5  
ATOM 11083 H HD1  . PHE A 1 80  ? 12.977  -5.383  6.736   1.00 32.12 ? 75  PHE A HD1  5  
ATOM 11084 H HD2  . PHE A 1 80  ? 10.443  -4.195  3.530   1.00 31.43 ? 75  PHE A HD2  5  
ATOM 11085 H HE1  . PHE A 1 80  ? 11.152  -4.974  8.335   1.00 50.25 ? 75  PHE A HE1  5  
ATOM 11086 H HE2  . PHE A 1 80  ? 8.614   -3.782  5.124   1.00 32.21 ? 75  PHE A HE2  5  
ATOM 11087 H HZ   . PHE A 1 80  ? 8.967   -4.173  7.530   1.00 64.20 ? 75  PHE A HZ   5  
ATOM 11088 N N    . SER A 1 81  ? 12.684  -2.229  3.256   1.00 74.23 ? 76  SER A N    5  
ATOM 11089 C CA   . SER A 1 81  ? 12.053  -0.914  3.259   1.00 61.15 ? 76  SER A CA   5  
ATOM 11090 C C    . SER A 1 81  ? 10.945  -0.841  2.213   1.00 11.03 ? 76  SER A C    5  
ATOM 11091 O O    . SER A 1 81  ? 10.814  -1.729  1.369   1.00 60.30 ? 76  SER A O    5  
ATOM 11092 C CB   . SER A 1 81  ? 13.093  0.175   2.992   1.00 42.15 ? 76  SER A CB   5  
ATOM 11093 O OG   . SER A 1 81  ? 13.880  0.422   4.145   1.00 11.50 ? 76  SER A OG   5  
ATOM 11094 H H    . SER A 1 81  ? 12.529  -2.832  2.499   1.00 11.43 ? 76  SER A H    5  
ATOM 11095 H HA   . SER A 1 81  ? 11.621  -0.756  4.236   1.00 31.10 ? 76  SER A HA   5  
ATOM 11096 H HB3  . SER A 1 81  ? 12.590  1.089   2.712   1.00 52.44 ? 76  SER A HB3  5  
ATOM 11097 H HG   . SER A 1 81  ? 14.573  -0.240  4.207   1.00 74.02 ? 76  SER A HG   5  
ATOM 11098 N N    . ILE A 1 82  ? 10.150  0.222   2.276   1.00 30.15 ? 77  ILE A N    5  
ATOM 11099 C CA   . ILE A 1 82  ? 9.054   0.412   1.334   1.00 51.14 ? 77  ILE A CA   5  
ATOM 11100 C C    . ILE A 1 82  ? 9.544   0.321   -0.107  1.00 50.04 ? 77  ILE A C    5  
ATOM 11101 O O    . ILE A 1 82  ? 8.799   -0.073  -1.002  1.00 11.14 ? 77  ILE A O    5  
ATOM 11102 C CB   . ILE A 1 82  ? 8.361   1.771   1.544   1.00 60.22 ? 77  ILE A CB   5  
ATOM 11103 C CG1  . ILE A 1 82  ? 7.456   1.722   2.777   1.00 50.44 ? 77  ILE A CG1  5  
ATOM 11104 C CG2  . ILE A 1 82  ? 7.561   2.154   0.308   1.00 22.21 ? 77  ILE A CG2  5  
ATOM 11105 C CD1  . ILE A 1 82  ? 6.229   0.856   2.592   1.00 63.42 ? 77  ILE A CD1  5  
ATOM 11106 H H    . ILE A 1 82  ? 10.305  0.894   2.971   1.00 64.13 ? 77  ILE A H    5  
ATOM 11107 H HA   . ILE A 1 82  ? 8.328   -0.370  1.506   1.00 21.21 ? 77  ILE A HA   5  
ATOM 11108 H HB   . ILE A 1 82  ? 9.124   2.520   1.696   1.00 11.14 ? 77  ILE A HB   5  
ATOM 11109 H HG13 . ILE A 1 82  ? 7.124   2.724   3.011   1.00 3.34  ? 77  ILE A HG13 5  
ATOM 11110 H HG21 . ILE A 1 82  ? 8.238   2.403   -0.496  1.00 2.34  ? 77  ILE A HG21 5  
ATOM 11111 H HG22 . ILE A 1 82  ? 6.940   1.323   0.010   1.00 22.15 ? 77  ILE A HG22 5  
ATOM 11112 H HG23 . ILE A 1 82  ? 6.938   3.007   0.531   1.00 73.43 ? 77  ILE A HG23 5  
ATOM 11113 H HD11 . ILE A 1 82  ? 5.977   0.384   3.530   1.00 23.13 ? 77  ILE A HD11 5  
ATOM 11114 H HD12 . ILE A 1 82  ? 5.403   1.468   2.262   1.00 20.12 ? 77  ILE A HD12 5  
ATOM 11115 H HD13 . ILE A 1 82  ? 6.434   0.096   1.851   1.00 22.32 ? 77  ILE A HD13 5  
ATOM 11116 N N    . GLN A 1 83  ? 10.804  0.688   -0.321  1.00 73.10 ? 78  GLN A N    5  
ATOM 11117 C CA   . GLN A 1 83  ? 11.395  0.647   -1.654  1.00 40.13 ? 78  GLN A CA   5  
ATOM 11118 C C    . GLN A 1 83  ? 11.421  -0.779  -2.193  1.00 52.40 ? 78  GLN A C    5  
ATOM 11119 O O    . GLN A 1 83  ? 11.008  -1.034  -3.325  1.00 22.01 ? 78  GLN A O    5  
ATOM 11120 C CB   . GLN A 1 83  ? 12.813  1.220   -1.623  1.00 1.42  ? 78  GLN A CB   5  
ATOM 11121 C CG   . GLN A 1 83  ? 12.894  2.666   -2.086  1.00 40.13 ? 78  GLN A CG   5  
ATOM 11122 C CD   . GLN A 1 83  ? 12.848  2.800   -3.594  1.00 2.31  ? 78  GLN A CD   5  
ATOM 11123 O OE1  . GLN A 1 83  ? 12.878  1.805   -4.319  1.00 12.22 ? 78  GLN A OE1  5  
ATOM 11124 N NE2  . GLN A 1 83  ? 12.775  4.035   -4.077  1.00 41.42 ? 78  GLN A NE2  5  
ATOM 11125 H H    . GLN A 1 83  ? 11.348  0.994   0.434   1.00 32.01 ? 78  GLN A H    5  
ATOM 11126 H HA   . GLN A 1 83  ? 10.784  1.254   -2.306  1.00 51.55 ? 78  GLN A HA   5  
ATOM 11127 H HB3  . GLN A 1 83  ? 13.443  0.623   -2.267  1.00 31.21 ? 78  GLN A HB3  5  
ATOM 11128 H HG3  . GLN A 1 83  ? 13.820  3.092   -1.728  1.00 43.42 ? 78  GLN A HG3  5  
ATOM 11129 H HE21 . GLN A 1 83  ? 12.757  4.780   -3.440  1.00 24.44 ? 78  GLN A HE21 5  
ATOM 11130 H HE22 . GLN A 1 83  ? 12.744  4.151   -5.049  1.00 53.14 ? 78  GLN A HE22 5  
ATOM 11131 N N    . VAL A 1 84  ? 11.909  -1.708  -1.377  1.00 45.34 ? 79  VAL A N    5  
ATOM 11132 C CA   . VAL A 1 84  ? 11.989  -3.108  -1.772  1.00 54.42 ? 79  VAL A CA   5  
ATOM 11133 C C    . VAL A 1 84  ? 10.601  -3.728  -1.881  1.00 13.34 ? 79  VAL A C    5  
ATOM 11134 O O    . VAL A 1 84  ? 10.357  -4.583  -2.734  1.00 22.23 ? 79  VAL A O    5  
ATOM 11135 C CB   . VAL A 1 84  ? 12.828  -3.927  -0.773  1.00 74.25 ? 79  VAL A CB   5  
ATOM 11136 C CG1  . VAL A 1 84  ? 11.935  -4.553  0.288   1.00 22.14 ? 79  VAL A CG1  5  
ATOM 11137 C CG2  . VAL A 1 84  ? 13.633  -4.993  -1.500  1.00 62.15 ? 79  VAL A CG2  5  
ATOM 11138 H H    . VAL A 1 84  ? 12.224  -1.444  -0.486  1.00 25.33 ? 79  VAL A H    5  
ATOM 11139 H HA   . VAL A 1 84  ? 12.472  -3.156  -2.737  1.00 12.24 ? 79  VAL A HA   5  
ATOM 11140 H HB   . VAL A 1 84  ? 13.518  -3.258  -0.279  1.00 3.31  ? 79  VAL A HB   5  
ATOM 11141 H HG11 . VAL A 1 84  ? 11.333  -5.329  -0.162  1.00 12.32 ? 79  VAL A HG11 5  
ATOM 11142 H HG12 . VAL A 1 84  ? 12.546  -4.977  1.070   1.00 13.21 ? 79  VAL A HG12 5  
ATOM 11143 H HG13 . VAL A 1 84  ? 11.288  -3.796  0.706   1.00 60.24 ? 79  VAL A HG13 5  
ATOM 11144 H HG21 . VAL A 1 84  ? 14.543  -4.556  -1.882  1.00 41.45 ? 79  VAL A HG21 5  
ATOM 11145 H HG22 . VAL A 1 84  ? 13.878  -5.791  -0.813  1.00 4.22  ? 79  VAL A HG22 5  
ATOM 11146 H HG23 . VAL A 1 84  ? 13.051  -5.388  -2.319  1.00 65.13 ? 79  VAL A HG23 5  
ATOM 11147 N N    . ILE A 1 85  ? 9.695   -3.293  -1.013  1.00 55.15 ? 80  ILE A N    5  
ATOM 11148 C CA   . ILE A 1 85  ? 8.330   -3.804  -1.012  1.00 54.51 ? 80  ILE A CA   5  
ATOM 11149 C C    . ILE A 1 85  ? 7.561   -3.319  -2.236  1.00 44.33 ? 80  ILE A C    5  
ATOM 11150 O O    . ILE A 1 85  ? 7.028   -4.119  -3.004  1.00 1.42  ? 80  ILE A O    5  
ATOM 11151 C CB   . ILE A 1 85  ? 7.570   -3.381  0.259   1.00 41.33 ? 80  ILE A CB   5  
ATOM 11152 C CG1  . ILE A 1 85  ? 8.291   -3.896  1.506   1.00 60.42 ? 80  ILE A CG1  5  
ATOM 11153 C CG2  . ILE A 1 85  ? 6.139   -3.896  0.217   1.00 41.42 ? 80  ILE A CG2  5  
ATOM 11154 C CD1  . ILE A 1 85  ? 8.495   -5.395  1.510   1.00 63.22 ? 80  ILE A CD1  5  
ATOM 11155 H H    . ILE A 1 85  ? 9.950   -2.612  -0.356  1.00 62.01 ? 80  ILE A H    5  
ATOM 11156 H HA   . ILE A 1 85  ? 8.379   -4.883  -1.036  1.00 75.31 ? 80  ILE A HA   5  
ATOM 11157 H HB   . ILE A 1 85  ? 7.539   -2.302  0.289   1.00 73.40 ? 80  ILE A HB   5  
ATOM 11158 H HG13 . ILE A 1 85  ? 7.712   -3.636  2.380   1.00 52.42 ? 80  ILE A HG13 5  
ATOM 11159 H HG21 . ILE A 1 85  ? 6.097   -4.791  -0.387  1.00 71.54 ? 80  ILE A HG21 5  
ATOM 11160 H HG22 . ILE A 1 85  ? 5.809   -4.123  1.219   1.00 52.31 ? 80  ILE A HG22 5  
ATOM 11161 H HG23 . ILE A 1 85  ? 5.496   -3.142  -0.212  1.00 41.15 ? 80  ILE A HG23 5  
ATOM 11162 H HD11 . ILE A 1 85  ? 7.539   -5.889  1.423   1.00 45.50 ? 80  ILE A HD11 5  
ATOM 11163 H HD12 . ILE A 1 85  ? 9.125   -5.675  0.679   1.00 32.25 ? 80  ILE A HD12 5  
ATOM 11164 H HD13 . ILE A 1 85  ? 8.969   -5.691  2.435   1.00 65.23 ? 80  ILE A HD13 5  
ATOM 11165 N N    . SER A 1 86  ? 7.510   -2.002  -2.412  1.00 13.23 ? 81  SER A N    5  
ATOM 11166 C CA   . SER A 1 86  ? 6.804   -1.409  -3.543  1.00 70.34 ? 81  SER A CA   5  
ATOM 11167 C C    . SER A 1 86  ? 7.349   -1.944  -4.864  1.00 33.54 ? 81  SER A C    5  
ATOM 11168 O O    . SER A 1 86  ? 6.596   -2.168  -5.811  1.00 11.32 ? 81  SER A O    5  
ATOM 11169 C CB   . SER A 1 86  ? 6.930   0.115   -3.506  1.00 31.12 ? 81  SER A CB   5  
ATOM 11170 O OG   . SER A 1 86  ? 6.338   0.703   -4.651  1.00 3.12  ? 81  SER A OG   5  
ATOM 11171 H H    . SER A 1 86  ? 7.954   -1.417  -1.765  1.00 63.22 ? 81  SER A H    5  
ATOM 11172 H HA   . SER A 1 86  ? 5.762   -1.678  -3.460  1.00 34.33 ? 81  SER A HA   5  
ATOM 11173 H HB3  . SER A 1 86  ? 7.975   0.387   -3.475  1.00 14.40 ? 81  SER A HB3  5  
ATOM 11174 H HG   . SER A 1 86  ? 5.438   0.384   -4.746  1.00 61.34 ? 81  SER A HG   5  
ATOM 11175 N N    . ASN A 1 87  ? 8.660   -2.147  -4.917  1.00 5.21  ? 82  ASN A N    5  
ATOM 11176 C CA   . ASN A 1 87  ? 9.307   -2.655  -6.122  1.00 31.43 ? 82  ASN A CA   5  
ATOM 11177 C C    . ASN A 1 87  ? 8.897   -4.100  -6.390  1.00 4.35  ? 82  ASN A C    5  
ATOM 11178 O O    . ASN A 1 87  ? 8.592   -4.468  -7.524  1.00 33.03 ? 82  ASN A O    5  
ATOM 11179 C CB   . ASN A 1 87  ? 10.828  -2.560  -5.989  1.00 72.02 ? 82  ASN A CB   5  
ATOM 11180 C CG   . ASN A 1 87  ? 11.540  -2.802  -7.305  1.00 11.42 ? 82  ASN A CG   5  
ATOM 11181 O OD1  . ASN A 1 87  ? 12.001  -1.864  -7.956  1.00 71.24 ? 82  ASN A OD1  5  
ATOM 11182 N ND2  . ASN A 1 87  ? 11.633  -4.066  -7.705  1.00 72.54 ? 82  ASN A ND2  5  
ATOM 11183 H H    . ASN A 1 87  ? 9.208   -1.949  -4.129  1.00 60.31 ? 82  ASN A H    5  
ATOM 11184 H HA   . ASN A 1 87  ? 8.988   -2.042  -6.952  1.00 43.24 ? 82  ASN A HA   5  
ATOM 11185 H HB3  . ASN A 1 87  ? 11.168  -3.296  -5.275  1.00 21.14 ? 82  ASN A HB3  5  
ATOM 11186 H HD21 . ASN A 1 87  ? 11.242  -4.761  -7.134  1.00 41.01 ? 82  ASN A HD21 5  
ATOM 11187 H HD22 . ASN A 1 87  ? 12.089  -4.250  -8.551  1.00 14.43 ? 82  ASN A HD22 5  
ATOM 11188 N N    . ALA A 1 88  ? 8.894   -4.912  -5.339  1.00 14.14 ? 83  ALA A N    5  
ATOM 11189 C CA   . ALA A 1 88  ? 8.520   -6.317  -5.461  1.00 21.43 ? 83  ALA A CA   5  
ATOM 11190 C C    . ALA A 1 88  ? 7.082   -6.461  -5.949  1.00 71.34 ? 83  ALA A C    5  
ATOM 11191 O O    . ALA A 1 88  ? 6.768   -7.358  -6.733  1.00 4.20  ? 83  ALA A O    5  
ATOM 11192 C CB   . ALA A 1 88  ? 8.701   -7.028  -4.128  1.00 11.31 ? 83  ALA A CB   5  
ATOM 11193 H H    . ALA A 1 88  ? 9.147   -4.559  -4.462  1.00 53.43 ? 83  ALA A H    5  
ATOM 11194 H HA   . ALA A 1 88  ? 9.181   -6.777  -6.181  1.00 21.40 ? 83  ALA A HA   5  
ATOM 11195 H HB1  . ALA A 1 88  ? 8.978   -8.057  -4.306  1.00 34.12 ? 83  ALA A HB1  5  
ATOM 11196 H HB2  . ALA A 1 88  ? 9.478   -6.538  -3.562  1.00 44.52 ? 83  ALA A HB2  5  
ATOM 11197 H HB3  . ALA A 1 88  ? 7.775   -6.995  -3.574  1.00 43.01 ? 83  ALA A HB3  5  
ATOM 11198 N N    . LEU A 1 89  ? 6.211   -5.575  -5.480  1.00 61.24 ? 84  LEU A N    5  
ATOM 11199 C CA   . LEU A 1 89  ? 4.805   -5.604  -5.867  1.00 41.31 ? 84  LEU A CA   5  
ATOM 11200 C C    . LEU A 1 89  ? 4.607   -4.976  -7.243  1.00 13.54 ? 84  LEU A C    5  
ATOM 11201 O O    . LEU A 1 89  ? 3.802   -5.452  -8.045  1.00 53.53 ? 84  LEU A O    5  
ATOM 11202 C CB   . LEU A 1 89  ? 3.954   -4.867  -4.831  1.00 0.24  ? 84  LEU A CB   5  
ATOM 11203 C CG   . LEU A 1 89  ? 4.136   -5.308  -3.378  1.00 64.11 ? 84  LEU A CG   5  
ATOM 11204 C CD1  . LEU A 1 89  ? 2.883   -5.011  -2.569  1.00 22.22 ? 84  LEU A CD1  5  
ATOM 11205 C CD2  . LEU A 1 89  ? 4.478   -6.789  -3.309  1.00 63.03 ? 84  LEU A CD2  5  
ATOM 11206 H H    . LEU A 1 89  ? 6.519   -4.884  -4.857  1.00 65.15 ? 84  LEU A H    5  
ATOM 11207 H HA   . LEU A 1 89  ? 4.494   -6.637  -5.907  1.00 4.23  ? 84  LEU A HA   5  
ATOM 11208 H HB3  . LEU A 1 89  ? 2.915   -5.012  -5.095  1.00 61.15 ? 84  LEU A HB3  5  
ATOM 11209 H HG   . LEU A 1 89  ? 4.954   -4.753  -2.940  1.00 0.24  ? 84  LEU A HG   5  
ATOM 11210 H HD11 . LEU A 1 89  ? 2.188   -4.448  -3.175  1.00 10.22 ? 84  LEU A HD11 5  
ATOM 11211 H HD12 . LEU A 1 89  ? 3.146   -4.433  -1.695  1.00 15.52 ? 84  LEU A HD12 5  
ATOM 11212 H HD13 . LEU A 1 89  ? 2.423   -5.939  -2.262  1.00 4.20  ? 84  LEU A HD13 5  
ATOM 11213 H HD21 . LEU A 1 89  ? 3.970   -7.313  -4.104  1.00 42.52 ? 84  LEU A HD21 5  
ATOM 11214 H HD22 . LEU A 1 89  ? 4.161   -7.187  -2.356  1.00 11.12 ? 84  LEU A HD22 5  
ATOM 11215 H HD23 . LEU A 1 89  ? 5.546   -6.917  -3.416  1.00 34.20 ? 84  LEU A HD23 5  
ATOM 11216 N N    . LYS A 1 90  ? 5.347   -3.907  -7.512  1.00 4.11  ? 85  LYS A N    5  
ATOM 11217 C CA   . LYS A 1 90  ? 5.256   -3.215  -8.792  1.00 3.41  ? 85  LYS A CA   5  
ATOM 11218 C C    . LYS A 1 90  ? 5.575   -4.161  -9.946  1.00 42.15 ? 85  LYS A C    5  
ATOM 11219 O O    . LYS A 1 90  ? 4.859   -4.201  -10.947 1.00 62.55 ? 85  LYS A O    5  
ATOM 11220 C CB   . LYS A 1 90  ? 6.213   -2.020  -8.819  1.00 14.23 ? 85  LYS A CB   5  
ATOM 11221 C CG   . LYS A 1 90  ? 6.255   -1.305  -10.159 1.00 40.54 ? 85  LYS A CG   5  
ATOM 11222 C CD   . LYS A 1 90  ? 4.933   -0.623  -10.469 1.00 43.23 ? 85  LYS A CD   5  
ATOM 11223 C CE   . LYS A 1 90  ? 4.406   -1.028  -11.837 1.00 34.54 ? 85  LYS A CE   5  
ATOM 11224 N NZ   . LYS A 1 90  ? 3.026   -0.517  -12.072 1.00 0.31  ? 85  LYS A NZ   5  
ATOM 11225 H H    . LYS A 1 90  ? 5.971   -3.574  -6.833  1.00 42.42 ? 85  LYS A H    5  
ATOM 11226 H HA   . LYS A 1 90  ? 4.244   -2.858  -8.906  1.00 61.24 ? 85  LYS A HA   5  
ATOM 11227 H HB3  . LYS A 1 90  ? 7.209   -2.368  -8.588  1.00 44.53 ? 85  LYS A HB3  5  
ATOM 11228 H HG3  . LYS A 1 90  ? 6.468   -2.027  -10.935 1.00 43.44 ? 85  LYS A HG3  5  
ATOM 11229 H HD3  . LYS A 1 90  ? 5.079   0.448   -10.451 1.00 12.34 ? 85  LYS A HD3  5  
ATOM 11230 H HE3  . LYS A 1 90  ? 4.396   -2.106  -11.900 1.00 54.12 ? 85  LYS A HE3  5  
ATOM 11231 H HZ1  . LYS A 1 90  ? 2.802   0.233   -11.386 1.00 5.25  ? 85  LYS A HZ1  5  
ATOM 11232 H HZ2  . LYS A 1 90  ? 2.337   -1.288  -11.964 1.00 24.43 ? 85  LYS A HZ2  5  
ATOM 11233 H HZ3  . LYS A 1 90  ? 2.949   -0.127  -13.033 1.00 10.53 ? 85  LYS A HZ3  5  
ATOM 11234 N N    . VAL A 1 91  ? 6.655   -4.922  -9.799  1.00 1.33  ? 86  VAL A N    5  
ATOM 11235 C CA   . VAL A 1 91  ? 7.068   -5.870  -10.828 1.00 34.43 ? 86  VAL A CA   5  
ATOM 11236 C C    . VAL A 1 91  ? 6.026   -6.968  -11.012 1.00 54.44 ? 86  VAL A C    5  
ATOM 11237 O O    . VAL A 1 91  ? 5.989   -7.635  -12.046 1.00 53.13 ? 86  VAL A O    5  
ATOM 11238 C CB   . VAL A 1 91  ? 8.424   -6.516  -10.485 1.00 34.41 ? 86  VAL A CB   5  
ATOM 11239 C CG1  . VAL A 1 91  ? 9.527   -5.469  -10.476 1.00 21.45 ? 86  VAL A CG1  5  
ATOM 11240 C CG2  . VAL A 1 91  ? 8.349   -7.233  -9.145  1.00 32.44 ? 86  VAL A CG2  5  
ATOM 11241 H H    . VAL A 1 91  ? 7.186   -4.845  -8.980  1.00 54.43 ? 86  VAL A H    5  
ATOM 11242 H HA   . VAL A 1 91  ? 7.175   -5.329  -11.757 1.00 55.25 ? 86  VAL A HA   5  
ATOM 11243 H HB   . VAL A 1 91  ? 8.655   -7.245  -11.247 1.00 62.34 ? 86  VAL A HB   5  
ATOM 11244 H HG11 . VAL A 1 91  ? 10.204  -5.665  -9.657  1.00 34.55 ? 86  VAL A HG11 5  
ATOM 11245 H HG12 . VAL A 1 91  ? 10.069  -5.508  -11.410 1.00 13.22 ? 86  VAL A HG12 5  
ATOM 11246 H HG13 . VAL A 1 91  ? 9.091   -4.488  -10.355 1.00 70.21 ? 86  VAL A HG13 5  
ATOM 11247 H HG21 . VAL A 1 91  ? 7.321   -7.484  -8.929  1.00 24.50 ? 86  VAL A HG21 5  
ATOM 11248 H HG22 . VAL A 1 91  ? 8.938   -8.137  -9.187  1.00 54.41 ? 86  VAL A HG22 5  
ATOM 11249 H HG23 . VAL A 1 91  ? 8.734   -6.589  -8.369  1.00 31.52 ? 86  VAL A HG23 5  
ATOM 11250 N N    . TRP A 1 92  ? 5.183   -7.151  -10.003 1.00 55.33 ? 87  TRP A N    5  
ATOM 11251 C CA   . TRP A 1 92  ? 4.140   -8.169  -10.054 1.00 13.01 ? 87  TRP A CA   5  
ATOM 11252 C C    . TRP A 1 92  ? 2.842   -7.592  -10.607 1.00 72.41 ? 87  TRP A C    5  
ATOM 11253 O O    . TRP A 1 92  ? 1.987   -8.324  -11.101 1.00 21.34 ? 87  TRP A O    5  
ATOM 11254 C CB   . TRP A 1 92  ? 3.899   -8.754  -8.661  1.00 42.45 ? 87  TRP A CB   5  
ATOM 11255 C CG   . TRP A 1 92  ? 5.101   -9.447  -8.092  1.00 23.10 ? 87  TRP A CG   5  
ATOM 11256 C CD1  . TRP A 1 92  ? 6.229   -9.818  -8.767  1.00 23.31 ? 87  TRP A CD1  5  
ATOM 11257 C CD2  . TRP A 1 92  ? 5.293   -9.852  -6.733  1.00 21.40 ? 87  TRP A CD2  5  
ATOM 11258 N NE1  . TRP A 1 92  ? 7.111   -10.430 -7.909  1.00 34.12 ? 87  TRP A NE1  5  
ATOM 11259 C CE2  . TRP A 1 92  ? 6.560   -10.463 -6.655  1.00 61.22 ? 87  TRP A CE2  5  
ATOM 11260 C CE3  . TRP A 1 92  ? 4.520   -9.756  -5.573  1.00 13.44 ? 87  TRP A CE3  5  
ATOM 11261 C CZ2  . TRP A 1 92  ? 7.067   -10.975 -5.464  1.00 53.55 ? 87  TRP A CZ2  5  
ATOM 11262 C CZ3  . TRP A 1 92  ? 5.024   -10.267 -4.392  1.00 75.02 ? 87  TRP A CZ3  5  
ATOM 11263 C CH2  . TRP A 1 92  ? 6.288   -10.869 -4.345  1.00 75.53 ? 87  TRP A CH2  5  
ATOM 11264 H H    . TRP A 1 92  ? 5.263   -6.589  -9.204  1.00 23.32 ? 87  TRP A H    5  
ATOM 11265 H HA   . TRP A 1 92  ? 4.478   -8.956  -10.711 1.00 14.30 ? 87  TRP A HA   5  
ATOM 11266 H HB3  . TRP A 1 92  ? 3.094   -9.471  -8.713  1.00 13.40 ? 87  TRP A HB3  5  
ATOM 11267 H HD1  . TRP A 1 92  ? 6.389   -9.651  -9.822  1.00 71.22 ? 87  TRP A HD1  5  
ATOM 11268 H HE1  . TRP A 1 92  ? 7.991   -10.785 -8.156  1.00 23.41 ? 87  TRP A HE1  5  
ATOM 11269 H HE3  . TRP A 1 92  ? 3.543   -9.296  -5.590  1.00 70.22 ? 87  TRP A HE3  5  
ATOM 11270 H HZ2  . TRP A 1 92  ? 8.040   -11.442 -5.411  1.00 62.12 ? 87  TRP A HZ2  5  
ATOM 11271 H HZ3  . TRP A 1 92  ? 4.440   -10.203 -3.485  1.00 4.21  ? 87  TRP A HZ3  5  
ATOM 11272 H HH2  . TRP A 1 92  ? 6.642   -11.254 -3.401  1.00 74.03 ? 87  TRP A HH2  5  
ATOM 11273 N N    . GLY A 1 93  ? 2.701   -6.273  -10.518 1.00 24.10 ? 88  GLY A N    5  
ATOM 11274 C CA   . GLY A 1 93  ? 1.504   -5.619  -11.015 1.00 75.22 ? 88  GLY A CA   5  
ATOM 11275 C C    . GLY A 1 93  ? 0.736   -4.907  -9.919  1.00 61.34 ? 88  GLY A C    5  
ATOM 11276 O O    . GLY A 1 93  ? -0.206  -4.162  -10.193 1.00 3.32  ? 88  GLY A O    5  
ATOM 11277 H H    . GLY A 1 93  ? 3.416   -5.739  -10.114 1.00 64.44 ? 88  GLY A H    5  
ATOM 11278 H HA2  . GLY A 1 93  ? 1.786   -4.900  -11.769 1.00 30.42 ? 88  GLY A HA2  5  
ATOM 11279 H HA3  . GLY A 1 93  ? 0.861   -6.363  -11.463 1.00 73.21 ? 88  GLY A HA3  5  
ATOM 11280 N N    . LEU A 1 94  ? 1.137   -5.135  -8.673  1.00 55.22 ? 89  LEU A N    5  
ATOM 11281 C CA   . LEU A 1 94  ? 0.479   -4.511  -7.530  1.00 24.45 ? 89  LEU A CA   5  
ATOM 11282 C C    . LEU A 1 94  ? 1.158   -3.196  -7.163  1.00 32.31 ? 89  LEU A C    5  
ATOM 11283 O O    . LEU A 1 94  ? 2.384   -3.107  -7.135  1.00 43.30 ? 89  LEU A O    5  
ATOM 11284 C CB   . LEU A 1 94  ? 0.491   -5.458  -6.329  1.00 1.02  ? 89  LEU A CB   5  
ATOM 11285 C CG   . LEU A 1 94  ? -0.444  -6.664  -6.415  1.00 11.34 ? 89  LEU A CG   5  
ATOM 11286 C CD1  . LEU A 1 94  ? 0.339   -7.959  -6.262  1.00 33.13 ? 89  LEU A CD1  5  
ATOM 11287 C CD2  . LEU A 1 94  ? -1.535  -6.570  -5.359  1.00 33.53 ? 89  LEU A CD2  5  
ATOM 11288 H H    . LEU A 1 94  ? 1.893   -5.738  -8.517  1.00 72.31 ? 89  LEU A H    5  
ATOM 11289 H HA   . LEU A 1 94  ? -0.545  -4.309  -7.809  1.00 63.45 ? 89  LEU A HA   5  
ATOM 11290 H HB3  . LEU A 1 94  ? 0.216   -4.885  -5.455  1.00 13.15 ? 89  LEU A HB3  5  
ATOM 11291 H HG   . LEU A 1 94  ? -0.919  -6.675  -7.388  1.00 52.34 ? 89  LEU A HG   5  
ATOM 11292 H HD11 . LEU A 1 94  ? -0.098  -8.720  -6.891  1.00 12.11 ? 89  LEU A HD11 5  
ATOM 11293 H HD12 . LEU A 1 94  ? 0.304   -8.280  -5.231  1.00 1.20  ? 89  LEU A HD12 5  
ATOM 11294 H HD13 . LEU A 1 94  ? 1.366   -7.795  -6.553  1.00 11.33 ? 89  LEU A HD13 5  
ATOM 11295 H HD21 . LEU A 1 94  ? -1.925  -7.556  -5.156  1.00 33.40 ? 89  LEU A HD21 5  
ATOM 11296 H HD22 . LEU A 1 94  ? -2.332  -5.936  -5.720  1.00 64.32 ? 89  LEU A HD22 5  
ATOM 11297 H HD23 . LEU A 1 94  ? -1.123  -6.151  -4.453  1.00 50.21 ? 89  LEU A HD23 5  
ATOM 11298 N N    . GLU A 1 95  ? 0.351   -2.178  -6.880  1.00 30.34 ? 90  GLU A N    5  
ATOM 11299 C CA   . GLU A 1 95  ? 0.875   -0.868  -6.512  1.00 41.54 ? 90  GLU A CA   5  
ATOM 11300 C C    . GLU A 1 95  ? 0.355   -0.438  -5.144  1.00 31.30 ? 90  GLU A C    5  
ATOM 11301 O O    . GLU A 1 95  ? -0.791  -0.713  -4.788  1.00 13.42 ? 90  GLU A O    5  
ATOM 11302 C CB   . GLU A 1 95  ? 0.491   0.174   -7.566  1.00 51.23 ? 90  GLU A CB   5  
ATOM 11303 C CG   . GLU A 1 95  ? -1.002  0.445   -7.637  1.00 5.21  ? 90  GLU A CG   5  
ATOM 11304 C CD   . GLU A 1 95  ? -1.359  1.462   -8.705  1.00 53.02 ? 90  GLU A CD   5  
ATOM 11305 O OE1  . GLU A 1 95  ? -0.435  1.973   -9.372  1.00 75.02 ? 90  GLU A OE1  5  
ATOM 11306 O OE2  . GLU A 1 95  ? -2.564  1.748   -8.872  1.00 54.42 ? 90  GLU A OE2  5  
ATOM 11307 H H    . GLU A 1 95  ? -0.619  -2.311  -6.919  1.00 24.02 ? 90  GLU A H    5  
ATOM 11308 H HA   . GLU A 1 95  ? 1.951   -0.942  -6.468  1.00 3.02  ? 90  GLU A HA   5  
ATOM 11309 H HB3  . GLU A 1 95  ? 0.819   -0.174  -8.534  1.00 14.21 ? 90  GLU A HB3  5  
ATOM 11310 H HG3  . GLU A 1 95  ? -1.333  0.819   -6.680  1.00 62.52 ? 90  GLU A HG3  5  
ATOM 11311 N N    . LEU A 1 96  ? 1.206   0.239   -4.380  1.00 14.14 ? 91  LEU A N    5  
ATOM 11312 C CA   . LEU A 1 96  ? 0.833   0.706   -3.049  1.00 44.44 ? 91  LEU A CA   5  
ATOM 11313 C C    . LEU A 1 96  ? 0.492   2.193   -3.071  1.00 74.11 ? 91  LEU A C    5  
ATOM 11314 O O    . LEU A 1 96  ? 1.048   2.956   -3.863  1.00 73.42 ? 91  LEU A O    5  
ATOM 11315 C CB   . LEU A 1 96  ? 1.971   0.448   -2.059  1.00 11.22 ? 91  LEU A CB   5  
ATOM 11316 C CG   . LEU A 1 96  ? 2.178   -1.009  -1.641  1.00 1.13  ? 91  LEU A CG   5  
ATOM 11317 C CD1  . LEU A 1 96  ? 3.474   -1.553  -2.222  1.00 24.32 ? 91  LEU A CD1  5  
ATOM 11318 C CD2  . LEU A 1 96  ? 2.178   -1.133  -0.125  1.00 54.31 ? 91  LEU A CD2  5  
ATOM 11319 H H    . LEU A 1 96  ? 2.106   0.428   -4.718  1.00 52.14 ? 91  LEU A H    5  
ATOM 11320 H HA   . LEU A 1 96  ? -0.039  0.154   -2.736  1.00 15.11 ? 91  LEU A HA   5  
ATOM 11321 H HB3  . LEU A 1 96  ? 1.770   1.024   -1.168  1.00 55.14 ? 91  LEU A HB3  5  
ATOM 11322 H HG   . LEU A 1 96  ? 1.363   -1.606  -2.026  1.00 11.42 ? 91  LEU A HG   5  
ATOM 11323 H HD11 . LEU A 1 96  ? 3.906   -2.263  -1.535  1.00 3.31  ? 91  LEU A HD11 5  
ATOM 11324 H HD12 . LEU A 1 96  ? 4.166   -0.739  -2.382  1.00 61.11 ? 91  LEU A HD12 5  
ATOM 11325 H HD13 . LEU A 1 96  ? 3.269   -2.040  -3.164  1.00 23.00 ? 91  LEU A HD13 5  
ATOM 11326 H HD21 . LEU A 1 96  ? 1.170   -1.017  0.246   1.00 41.52 ? 91  LEU A HD21 5  
ATOM 11327 H HD22 . LEU A 1 96  ? 2.807   -0.364  0.299   1.00 61.13 ? 91  LEU A HD22 5  
ATOM 11328 H HD23 . LEU A 1 96  ? 2.557   -2.104  0.157   1.00 34.14 ? 91  LEU A HD23 5  
ATOM 11329 N N    . ILE A 1 97  ? -0.422  2.597   -2.196  1.00 20.30 ? 92  ILE A N    5  
ATOM 11330 C CA   . ILE A 1 97  ? -0.835  3.993   -2.113  1.00 32.35 ? 92  ILE A CA   5  
ATOM 11331 C C    . ILE A 1 97  ? -1.086  4.407   -0.667  1.00 54.00 ? 92  ILE A C    5  
ATOM 11332 O O    . ILE A 1 97  ? -1.635  3.639   0.124   1.00 31.05 ? 92  ILE A O    5  
ATOM 11333 C CB   . ILE A 1 97  ? -2.109  4.253   -2.938  1.00 0.01  ? 92  ILE A CB   5  
ATOM 11334 C CG1  . ILE A 1 97  ? -1.879  3.881   -4.404  1.00 12.44 ? 92  ILE A CG1  5  
ATOM 11335 C CG2  . ILE A 1 97  ? -2.532  5.709   -2.816  1.00 45.45 ? 92  ILE A CG2  5  
ATOM 11336 C CD1  . ILE A 1 97  ? -3.072  4.156   -5.292  1.00 34.25 ? 92  ILE A CD1  5  
ATOM 11337 H H    . ILE A 1 97  ? -0.829  1.942   -1.592  1.00 40.21 ? 92  ILE A H    5  
ATOM 11338 H HA   . ILE A 1 97  ? -0.039  4.600   -2.518  1.00 70.24 ? 92  ILE A HA   5  
ATOM 11339 H HB   . ILE A 1 97  ? -2.902  3.639   -2.538  1.00 23.22 ? 92  ILE A HB   5  
ATOM 11340 H HG13 . ILE A 1 97  ? -1.653  2.826   -4.468  1.00 44.44 ? 92  ILE A HG13 5  
ATOM 11341 H HG21 . ILE A 1 97  ? -3.439  5.869   -3.378  1.00 64.41 ? 92  ILE A HG21 5  
ATOM 11342 H HG22 . ILE A 1 97  ? -2.705  5.947   -1.777  1.00 32.23 ? 92  ILE A HG22 5  
ATOM 11343 H HG23 . ILE A 1 97  ? -1.750  6.345   -3.205  1.00 52.25 ? 92  ILE A HG23 5  
ATOM 11344 H HD11 . ILE A 1 97  ? -3.919  4.434   -4.682  1.00 2.01  ? 92  ILE A HD11 5  
ATOM 11345 H HD12 . ILE A 1 97  ? -2.838  4.959   -5.973  1.00 20.01 ? 92  ILE A HD12 5  
ATOM 11346 H HD13 . ILE A 1 97  ? -3.314  3.265   -5.856  1.00 42.21 ? 92  ILE A HD13 5  
ATOM 11347 N N    . LEU A 1 98  ? -0.681  5.626   -0.328  1.00 52.32 ? 93  LEU A N    5  
ATOM 11348 C CA   . LEU A 1 98  ? -0.864  6.144   1.024   1.00 1.41  ? 93  LEU A CA   5  
ATOM 11349 C C    . LEU A 1 98  ? -2.296  6.624   1.234   1.00 55.22 ? 93  LEU A C    5  
ATOM 11350 O O    . LEU A 1 98  ? -2.796  7.464   0.486   1.00 73.41 ? 93  LEU A O    5  
ATOM 11351 C CB   . LEU A 1 98  ? 0.115   7.290   1.288   1.00 11.10 ? 93  LEU A CB   5  
ATOM 11352 C CG   . LEU A 1 98  ? 0.260   7.725   2.746   1.00 62.33 ? 93  LEU A CG   5  
ATOM 11353 C CD1  . LEU A 1 98  ? 1.462   7.050   3.388   1.00 41.32 ? 93  LEU A CD1  5  
ATOM 11354 C CD2  . LEU A 1 98  ? 0.383   9.239   2.840   1.00 60.32 ? 93  LEU A CD2  5  
ATOM 11355 H H    . LEU A 1 98  ? -0.250  6.191   -1.001  1.00 43.52 ? 93  LEU A H    5  
ATOM 11356 H HA   . LEU A 1 98  ? -0.660  5.341   1.716   1.00 40.13 ? 93  LEU A HA   5  
ATOM 11357 H HB3  . LEU A 1 98  ? -0.218  8.146   0.718   1.00 3.54  ? 93  LEU A HB3  5  
ATOM 11358 H HG   . LEU A 1 98  ? -0.622  7.426   3.295   1.00 20.35 ? 93  LEU A HG   5  
ATOM 11359 H HD11 . LEU A 1 98  ? 1.943   7.740   4.065   1.00 13.25 ? 93  LEU A HD11 5  
ATOM 11360 H HD12 . LEU A 1 98  ? 2.161   6.754   2.620   1.00 12.50 ? 93  LEU A HD12 5  
ATOM 11361 H HD13 . LEU A 1 98  ? 1.136   6.177   3.934   1.00 25.31 ? 93  LEU A HD13 5  
ATOM 11362 H HD21 . LEU A 1 98  ? 0.250   9.548   3.868   1.00 11.50 ? 93  LEU A HD21 5  
ATOM 11363 H HD22 . LEU A 1 98  ? -0.377  9.702   2.226   1.00 55.33 ? 93  LEU A HD22 5  
ATOM 11364 H HD23 . LEU A 1 98  ? 1.360   9.543   2.496   1.00 61.23 ? 93  LEU A HD23 5  
ATOM 11365 N N    . PHE A 1 99  ? -2.950  6.086   2.259   1.00 20.03 ? 94  PHE A N    5  
ATOM 11366 C CA   . PHE A 1 99  ? -4.324  6.461   2.569   1.00 31.53 ? 94  PHE A CA   5  
ATOM 11367 C C    . PHE A 1 99  ? -4.413  7.935   2.953   1.00 32.23 ? 94  PHE A C    5  
ATOM 11368 O O    . PHE A 1 99  ? -5.468  8.556   2.832   1.00 24.04 ? 94  PHE A O    5  
ATOM 11369 C CB   . PHE A 1 99  ? -4.868  5.592   3.705   1.00 72.51 ? 94  PHE A CB   5  
ATOM 11370 C CG   . PHE A 1 99  ? -5.803  6.324   4.624   1.00 34.51 ? 94  PHE A CG   5  
ATOM 11371 C CD1  . PHE A 1 99  ? -7.166  6.350   4.371   1.00 4.12  ? 94  PHE A CD1  5  
ATOM 11372 C CD2  . PHE A 1 99  ? -5.321  6.986   5.742   1.00 64.44 ? 94  PHE A CD2  5  
ATOM 11373 C CE1  . PHE A 1 99  ? -8.029  7.023   5.215   1.00 32.34 ? 94  PHE A CE1  5  
ATOM 11374 C CE2  . PHE A 1 99  ? -6.180  7.660   6.589   1.00 61.24 ? 94  PHE A CE2  5  
ATOM 11375 C CZ   . PHE A 1 99  ? -7.536  7.679   6.325   1.00 63.30 ? 94  PHE A CZ   5  
ATOM 11376 H H    . PHE A 1 99  ? -2.497  5.422   2.819   1.00 74.23 ? 94  PHE A H    5  
ATOM 11377 H HA   . PHE A 1 99  ? -4.920  6.295   1.685   1.00 42.00 ? 94  PHE A HA   5  
ATOM 11378 H HB3  . PHE A 1 99  ? -4.041  5.225   4.295   1.00 21.13 ? 94  PHE A HB3  5  
ATOM 11379 H HD1  . PHE A 1 99  ? -7.553  5.837   3.502   1.00 55.32 ? 94  PHE A HD1  5  
ATOM 11380 H HD2  . PHE A 1 99  ? -4.261  6.974   5.950   1.00 1.33  ? 94  PHE A HD2  5  
ATOM 11381 H HE1  . PHE A 1 99  ? -9.088  7.036   5.004   1.00 75.41 ? 94  PHE A HE1  5  
ATOM 11382 H HE2  . PHE A 1 99  ? -5.791  8.173   7.457   1.00 20.55 ? 94  PHE A HE2  5  
ATOM 11383 H HZ   . PHE A 1 99  ? -8.209  8.205   6.986   1.00 54.44 ? 94  PHE A HZ   5  
ATOM 11384 N N    . ASN A 1 100 ? -3.298  8.488   3.418   1.00 52.44 ? 95  ASN A N    5  
ATOM 11385 C CA   . ASN A 1 100 ? -3.249  9.888   3.821   1.00 40.34 ? 95  ASN A CA   5  
ATOM 11386 C C    . ASN A 1 100 ? -3.037  10.795  2.613   1.00 41.23 ? 95  ASN A C    5  
ATOM 11387 O O    . ASN A 1 100 ? -3.201  12.011  2.701   1.00 63.51 ? 95  ASN A O    5  
ATOM 11388 C CB   . ASN A 1 100 ? -2.130  10.108  4.841   1.00 61.00 ? 95  ASN A CB   5  
ATOM 11389 C CG   . ASN A 1 100 ? -2.650  10.633  6.166   1.00 24.13 ? 95  ASN A CG   5  
ATOM 11390 O OD1  . ASN A 1 100 ? -3.636  10.128  6.703   1.00 23.24 ? 95  ASN A OD1  5  
ATOM 11391 N ND2  . ASN A 1 100 ? -1.987  11.652  6.699   1.00 40.13 ? 95  ASN A ND2  5  
ATOM 11392 H H    . ASN A 1 100 ? -2.488  7.941   3.492   1.00 13.24 ? 95  ASN A H    5  
ATOM 11393 H HA   . ASN A 1 100 ? -4.195  10.134  4.280   1.00 13.35 ? 95  ASN A HA   5  
ATOM 11394 H HB3  . ASN A 1 100 ? -1.423  10.821  4.444   1.00 54.23 ? 95  ASN A HB3  5  
ATOM 11395 H HD21 . ASN A 1 100 ? -1.209  12.004  6.215   1.00 75.52 ? 95  ASN A HD21 5  
ATOM 11396 H HD22 . ASN A 1 100 ? -2.300  12.012  7.556   1.00 11.25 ? 95  ASN A HD22 5  
ATOM 11397 N N    . SER A 1 101 ? -2.669  10.193  1.486   1.00 23.23 ? 96  SER A N    5  
ATOM 11398 C CA   . SER A 1 101 ? -2.431  10.947  0.261   1.00 4.41  ? 96  SER A CA   5  
ATOM 11399 C C    . SER A 1 101 ? -3.741  11.220  -0.473  1.00 61.34 ? 96  SER A C    5  
ATOM 11400 O O    . SER A 1 101 ? -4.727  10.498  -0.326  1.00 21.31 ? 96  SER A O    5  
ATOM 11401 C CB   . SER A 1 101 ? -1.472  10.182  -0.654  1.00 64.40 ? 96  SER A CB   5  
ATOM 11402 O OG   . SER A 1 101 ? -1.814  10.365  -2.018  1.00 53.04 ? 96  SER A OG   5  
ATOM 11403 H H    . SER A 1 101 ? -2.554  9.220   1.479   1.00 61.44 ? 96  SER A H    5  
ATOM 11404 H HA   . SER A 1 101 ? -1.981  11.890  0.533   1.00 55.30 ? 96  SER A HA   5  
ATOM 11405 H HB3  . SER A 1 101 ? -1.518  9.129   -0.421  1.00 20.31 ? 96  SER A HB3  5  
ATOM 11406 H HG   . SER A 1 101 ? -1.018  10.536  -2.527  1.00 61.34 ? 96  SER A HG   5  
ATOM 11407 N N    . PRO A 1 102 ? -3.753  12.291  -1.282  1.00 55.14 ? 97  PRO A N    5  
ATOM 11408 C CA   . PRO A 1 102 ? -4.934  12.685  -2.054  1.00 25.02 ? 97  PRO A CA   5  
ATOM 11409 C C    . PRO A 1 102 ? -5.243  11.706  -3.183  1.00 74.14 ? 97  PRO A C    5  
ATOM 11410 O O