data_2DVI
# 
_entry.id   2DVI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DVI         
NDB   PR0226       
RCSB  RCSB025893   
WWPDB D_1000025893 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DVI 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-31 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tomita, K.'   1 
'Ishitani, R.' 2 
'Fukai, S.'    3 
'Nureki, O.'   4 
# 
_citation.id                        primary 
_citation.title                     'Complete crystallographic analysis of the dynamics of CCA sequence addition' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            443 
_citation.page_first                956 
_citation.page_last                 960 
_citation.year                      2006 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17051158 
_citation.pdbx_database_id_DOI      10.1038/nature05204 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tomita, K.'   1 
primary 'Ishitani, R.' 2 
primary 'Fukai, S.'    3 
primary 'Nureki, O.'   4 
# 
_cell.entry_id           2DVI 
_cell.length_a           58.004 
_cell.length_b           58.004 
_cell.length_c           431.498 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2DVI 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'tRNA (34-MER)'            10904.503 1   ?                    ? ? ? 
2 polymer     man 'CCA-adding enzyme'        51469.137 1   '2.7.7.25, 2.7.7.21' ? ? ? 
3 non-polymer syn 'SULFATE ION'              96.063    1   ?                    ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'            24.305    1   ?                    ? ? ? 
5 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE" 483.156   1   ?                    ? ? ? 
6 water       nat water                      18.015    174 ?                    ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl-transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCACC GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCACC B ? 
2 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   G   n 
1 3   C   n 
1 4   C   n 
1 5   C   n 
1 6   G   n 
1 7   G   n 
1 8   G   n 
1 9   G   n 
1 10  C   n 
1 11  G   n 
1 12  G   n 
1 13  U   n 
1 14  U   n 
1 15  C   n 
1 16  G   n 
1 17  A   n 
1 18  U   n 
1 19  U   n 
1 20  C   n 
1 21  C   n 
1 22  G   n 
1 23  C   n 
1 24  C   n 
1 25  C   n 
1 26  U   n 
1 27  G   n 
1 28  G   n 
1 29  G   n 
1 30  C   n 
1 31  C   n 
1 32  A   n 
1 33  C   n 
1 34  C   n 
2 1   MET n 
2 2   LYS n 
2 3   VAL n 
2 4   GLU n 
2 5   GLU n 
2 6   ILE n 
2 7   LEU n 
2 8   GLU n 
2 9   LYS n 
2 10  ALA n 
2 11  LEU n 
2 12  GLU n 
2 13  LEU n 
2 14  VAL n 
2 15  ILE n 
2 16  PRO n 
2 17  ASP n 
2 18  GLU n 
2 19  GLU n 
2 20  GLU n 
2 21  VAL n 
2 22  ARG n 
2 23  LYS n 
2 24  GLY n 
2 25  ARG n 
2 26  GLU n 
2 27  ALA n 
2 28  GLU n 
2 29  GLU n 
2 30  GLU n 
2 31  LEU n 
2 32  ARG n 
2 33  ARG n 
2 34  ARG n 
2 35  LEU n 
2 36  ASP n 
2 37  GLU n 
2 38  LEU n 
2 39  GLY n 
2 40  VAL n 
2 41  GLU n 
2 42  TYR n 
2 43  VAL n 
2 44  PHE n 
2 45  VAL n 
2 46  GLY n 
2 47  SER n 
2 48  TYR n 
2 49  ALA n 
2 50  ARG n 
2 51  ASN n 
2 52  THR n 
2 53  TRP n 
2 54  LEU n 
2 55  LYS n 
2 56  GLY n 
2 57  SER n 
2 58  LEU n 
2 59  GLU n 
2 60  ILE n 
2 61  ASP n 
2 62  VAL n 
2 63  PHE n 
2 64  LEU n 
2 65  LEU n 
2 66  PHE n 
2 67  PRO n 
2 68  GLU n 
2 69  GLU n 
2 70  PHE n 
2 71  SER n 
2 72  LYS n 
2 73  GLU n 
2 74  GLU n 
2 75  LEU n 
2 76  ARG n 
2 77  GLU n 
2 78  ARG n 
2 79  GLY n 
2 80  LEU n 
2 81  GLU n 
2 82  ILE n 
2 83  GLY n 
2 84  LYS n 
2 85  ALA n 
2 86  VAL n 
2 87  LEU n 
2 88  ASP n 
2 89  SER n 
2 90  TYR n 
2 91  GLU n 
2 92  ILE n 
2 93  ARG n 
2 94  TYR n 
2 95  ALA n 
2 96  GLU n 
2 97  HIS n 
2 98  PRO n 
2 99  TYR n 
2 100 VAL n 
2 101 HIS n 
2 102 GLY n 
2 103 VAL n 
2 104 VAL n 
2 105 LYS n 
2 106 GLY n 
2 107 VAL n 
2 108 GLU n 
2 109 VAL n 
2 110 ASP n 
2 111 VAL n 
2 112 VAL n 
2 113 PRO n 
2 114 CYS n 
2 115 TYR n 
2 116 LYS n 
2 117 LEU n 
2 118 LYS n 
2 119 GLU n 
2 120 PRO n 
2 121 LYS n 
2 122 ASN n 
2 123 ILE n 
2 124 LYS n 
2 125 SER n 
2 126 ALA n 
2 127 VAL n 
2 128 ASP n 
2 129 ARG n 
2 130 THR n 
2 131 PRO n 
2 132 PHE n 
2 133 HIS n 
2 134 HIS n 
2 135 LYS n 
2 136 TRP n 
2 137 LEU n 
2 138 GLU n 
2 139 GLY n 
2 140 ARG n 
2 141 ILE n 
2 142 LYS n 
2 143 GLY n 
2 144 LYS n 
2 145 GLU n 
2 146 ASN n 
2 147 GLU n 
2 148 VAL n 
2 149 ARG n 
2 150 LEU n 
2 151 LEU n 
2 152 LYS n 
2 153 GLY n 
2 154 PHE n 
2 155 LEU n 
2 156 LYS n 
2 157 ALA n 
2 158 ASN n 
2 159 GLY n 
2 160 ILE n 
2 161 TYR n 
2 162 GLY n 
2 163 ALA n 
2 164 GLU n 
2 165 TYR n 
2 166 LYS n 
2 167 VAL n 
2 168 ARG n 
2 169 GLY n 
2 170 PHE n 
2 171 SER n 
2 172 GLY n 
2 173 TYR n 
2 174 LEU n 
2 175 CYS n 
2 176 GLU n 
2 177 LEU n 
2 178 LEU n 
2 179 ILE n 
2 180 VAL n 
2 181 PHE n 
2 182 TYR n 
2 183 GLY n 
2 184 SER n 
2 185 PHE n 
2 186 LEU n 
2 187 GLU n 
2 188 THR n 
2 189 VAL n 
2 190 LYS n 
2 191 ASN n 
2 192 ALA n 
2 193 ARG n 
2 194 ARG n 
2 195 TRP n 
2 196 THR n 
2 197 ARG n 
2 198 ARG n 
2 199 THR n 
2 200 VAL n 
2 201 ILE n 
2 202 ASP n 
2 203 VAL n 
2 204 ALA n 
2 205 LYS n 
2 206 GLY n 
2 207 GLU n 
2 208 VAL n 
2 209 ARG n 
2 210 LYS n 
2 211 GLY n 
2 212 GLU n 
2 213 GLU n 
2 214 PHE n 
2 215 PHE n 
2 216 VAL n 
2 217 VAL n 
2 218 ASP n 
2 219 PRO n 
2 220 VAL n 
2 221 ASP n 
2 222 GLU n 
2 223 LYS n 
2 224 ARG n 
2 225 ASN n 
2 226 VAL n 
2 227 ALA n 
2 228 ALA n 
2 229 ASN n 
2 230 LEU n 
2 231 SER n 
2 232 LEU n 
2 233 ASP n 
2 234 ASN n 
2 235 LEU n 
2 236 ALA n 
2 237 ARG n 
2 238 PHE n 
2 239 VAL n 
2 240 HIS n 
2 241 LEU n 
2 242 CYS n 
2 243 ARG n 
2 244 GLU n 
2 245 PHE n 
2 246 MET n 
2 247 GLU n 
2 248 ALA n 
2 249 PRO n 
2 250 SER n 
2 251 LEU n 
2 252 GLY n 
2 253 PHE n 
2 254 PHE n 
2 255 LYS n 
2 256 PRO n 
2 257 LYS n 
2 258 HIS n 
2 259 PRO n 
2 260 LEU n 
2 261 GLU n 
2 262 ILE n 
2 263 GLU n 
2 264 PRO n 
2 265 GLU n 
2 266 ARG n 
2 267 LEU n 
2 268 ARG n 
2 269 LYS n 
2 270 ILE n 
2 271 VAL n 
2 272 GLU n 
2 273 GLU n 
2 274 ARG n 
2 275 GLY n 
2 276 THR n 
2 277 ALA n 
2 278 VAL n 
2 279 PHE n 
2 280 ALA n 
2 281 VAL n 
2 282 LYS n 
2 283 PHE n 
2 284 ARG n 
2 285 LYS n 
2 286 PRO n 
2 287 ASP n 
2 288 ILE n 
2 289 VAL n 
2 290 ASP n 
2 291 ASP n 
2 292 ASN n 
2 293 LEU n 
2 294 TYR n 
2 295 PRO n 
2 296 GLN n 
2 297 LEU n 
2 298 GLU n 
2 299 ARG n 
2 300 ALA n 
2 301 SER n 
2 302 ARG n 
2 303 LYS n 
2 304 ILE n 
2 305 PHE n 
2 306 GLU n 
2 307 PHE n 
2 308 LEU n 
2 309 GLU n 
2 310 ARG n 
2 311 GLU n 
2 312 ASN n 
2 313 PHE n 
2 314 MET n 
2 315 PRO n 
2 316 LEU n 
2 317 ARG n 
2 318 SER n 
2 319 ALA n 
2 320 PHE n 
2 321 LYS n 
2 322 ALA n 
2 323 SER n 
2 324 GLU n 
2 325 GLU n 
2 326 PHE n 
2 327 CYS n 
2 328 TYR n 
2 329 LEU n 
2 330 LEU n 
2 331 PHE n 
2 332 GLU n 
2 333 CYS n 
2 334 GLN n 
2 335 ILE n 
2 336 LYS n 
2 337 GLU n 
2 338 ILE n 
2 339 SER n 
2 340 ARG n 
2 341 VAL n 
2 342 PHE n 
2 343 ARG n 
2 344 ARG n 
2 345 MET n 
2 346 GLY n 
2 347 PRO n 
2 348 GLN n 
2 349 PHE n 
2 350 GLU n 
2 351 ASP n 
2 352 GLU n 
2 353 ARG n 
2 354 ASN n 
2 355 VAL n 
2 356 LYS n 
2 357 LYS n 
2 358 PHE n 
2 359 LEU n 
2 360 SER n 
2 361 ARG n 
2 362 ASN n 
2 363 ARG n 
2 364 ALA n 
2 365 PHE n 
2 366 ARG n 
2 367 PRO n 
2 368 PHE n 
2 369 ILE n 
2 370 GLU n 
2 371 ASN n 
2 372 GLY n 
2 373 ARG n 
2 374 TRP n 
2 375 TRP n 
2 376 ALA n 
2 377 PHE n 
2 378 GLU n 
2 379 MET n 
2 380 ARG n 
2 381 LYS n 
2 382 PHE n 
2 383 THR n 
2 384 THR n 
2 385 PRO n 
2 386 GLU n 
2 387 GLU n 
2 388 GLY n 
2 389 VAL n 
2 390 ARG n 
2 391 SER n 
2 392 TYR n 
2 393 ALA n 
2 394 SER n 
2 395 THR n 
2 396 HIS n 
2 397 TRP n 
2 398 HIS n 
2 399 THR n 
2 400 LEU n 
2 401 GLY n 
2 402 LYS n 
2 403 ASN n 
2 404 VAL n 
2 405 GLY n 
2 406 GLU n 
2 407 SER n 
2 408 ILE n 
2 409 ARG n 
2 410 GLU n 
2 411 TYR n 
2 412 PHE n 
2 413 GLU n 
2 414 ILE n 
2 415 ILE n 
2 416 SER n 
2 417 GLY n 
2 418 GLU n 
2 419 LYS n 
2 420 LEU n 
2 421 PHE n 
2 422 LYS n 
2 423 GLU n 
2 424 PRO n 
2 425 VAL n 
2 426 THR n 
2 427 ALA n 
2 428 GLU n 
2 429 LEU n 
2 430 CYS n 
2 431 GLU n 
2 432 MET n 
2 433 MET n 
2 434 GLY n 
2 435 VAL n 
2 436 LYS n 
2 437 ASP n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Archaeoglobus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Archaeoglobus fulgidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2234 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP CCA_ARCFU O28126 2 1 ? ? 
2 PDB 2DVI      2DVI   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2DVI A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 2 2DVI B 1 ? 34  ? 2DVI   1 ? 34  ? 1 34  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'  347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'       133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'   323.197 
CTP non-polymer         . "CYTIDINE-5'-TRIPHOSPHATE"   ? 'C9 H16 N3 O14 P3' 483.156 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'     121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P'  363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                        ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                ? 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'      181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'   324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2DVI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.91 
_exptl_crystal.density_percent_sol   57.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'50mM HEPES, 20% PEG 3550, 0.2M Tri-Lithium citrate, 80mM (NH4)2SO4, pH 7.5, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 HEPES                 ? ? ? 
1 2  1 'PEG 3550'            ? ? ? 
1 3  1 'Tri-lithium citrate' ? ? ? 
1 4  1 'ammonium sulphate'   ? ? ? 
1 5  1 water                 ? ? ? 
1 6  2 HEPES                 ? ? ? 
1 7  2 'PEG 3550'            ? ? ? 
1 8  2 'Tri-lithium citrate' ? ? ? 
1 9  2 'ammonium sulphate'   ? ? ? 
1 10 2 water                 ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-05-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     2DVI 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   23070 
_reflns.number_all                   23070 
_reflns.percent_possible_obs         96.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        34.7 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.6 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   95.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2DVI 
_refine.ls_number_reflns_obs                     22537 
_refine.ls_number_reflns_all                     22537 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1934818.03 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             9.99 
_refine.ls_d_res_high                            2.61 
_refine.ls_percent_reflns_obs                    96.2 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.207 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1083 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               45.3 
_refine.aniso_B[1][1]                            -0.38 
_refine.aniso_B[2][2]                            -0.38 
_refine.aniso_B[3][3]                            0.75 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.406663 
_refine.solvent_model_param_bsol                 41.8752 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2DR9 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2DVI 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.26 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.38 
_refine_analyze.Luzzati_sigma_a_free            0.36 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3579 
_refine_hist.pdbx_number_atoms_nucleic_acid   724 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             174 
_refine_hist.number_atoms_total               4512 
_refine_hist.d_res_high                       2.61 
_refine_hist.d_res_low                        9.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      20.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.00  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.37  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.31  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.15  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.33  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             3305 
_refine_ls_shell.R_factor_R_work                  0.239 
_refine_ls_shell.percent_reflns_obs               89.7 
_refine_ls_shell.R_factor_R_free                  0.296 
_refine_ls_shell.R_factor_R_free_error            0.023 
_refine_ls_shell.percent_reflns_R_free            4.7 
_refine_ls_shell.number_reflns_R_free             164 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
5 atp2.param        atp2.top    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2DVI 
_struct.title                     'Complex structure of CCA-adding enzyme, mini-DCC and CTP' 
_struct.pdbx_descriptor           'CCA-adding enzyme (E.C.2.7.7.25, 2.7.7.21)/tRNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DVI 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            'protein-rna complex, TRANSFERASE-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL B 3   ? ILE B 15  ? VAL A 3   ILE A 15  1 ? 13 
HELX_P HELX_P2  2  ASP B 17  ? GLY B 39  ? ASP A 17  GLY A 39  1 ? 23 
HELX_P HELX_P3  3  GLY B 46  ? ARG B 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER B 71  ? LEU B 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  ARG B 129 ? LYS B 142 ? ARG A 129 LYS A 142 1 ? 14 
HELX_P HELX_P6  6  LYS B 144 ? ASN B 158 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  7  SER B 171 ? GLY B 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  8  SER B 184 ? ARG B 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  9  SER B 231 ? ALA B 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P10 10 SER B 250 ? LYS B 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P11 11 GLU B 263 ? GLY B 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P12 12 VAL B 289 ? GLU B 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P13 13 ASP B 351 ? ARG B 361 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P14 14 THR B 384 ? HIS B 396 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P15 15 TRP B 397 ? LEU B 400 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P16 16 GLY B 401 ? TYR B 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P17 17 SER B 416 ? PHE B 421 ? SER A 416 PHE A 421 1 ? 6  
HELX_P HELX_P18 18 VAL B 425 ? GLY B 434 ? VAL A 425 GLY A 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D MG .  MG ? ? ? 1_555 B GLU 59 O   ? ? A MG 602 A GLU 59  1_555 ? ? ? ? ? ? ?                    2.787 ? 
metalc2  metalc ? ? D MG .  MG ? ? ? 1_555 E CTP .  O1G ? ? A MG 602 A CTP 504 1_555 ? ? ? ? ? ? ?                    2.607 ? 
metalc3  metalc ? ? D MG .  MG ? ? ? 1_555 E CTP .  O1A ? ? A MG 602 A CTP 504 1_555 ? ? ? ? ? ? ?                    2.925 ? 
metalc4  metalc ? ? D MG .  MG ? ? ? 1_555 B ASP 61 OD2 ? ? A MG 602 A ASP 61  1_555 ? ? ? ? ? ? ?                    2.903 ? 
hydrog1  hydrog ? ? A G  1  N1 ? ? ? 1_555 A C   31 N3  ? ? B G  1   B C   31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2  hydrog ? ? A G  1  N2 ? ? ? 1_555 A C   31 O2  ? ? B G  1   B C   31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3  hydrog ? ? A G  1  O6 ? ? ? 1_555 A C   31 N4  ? ? B G  1   B C   31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4  hydrog ? ? A G  2  N1 ? ? ? 1_555 A C   30 N3  ? ? B G  2   B C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog5  hydrog ? ? A G  2  N2 ? ? ? 1_555 A C   30 O2  ? ? B G  2   B C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog6  hydrog ? ? A G  2  O6 ? ? ? 1_555 A C   30 N4  ? ? B G  2   B C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7  hydrog ? ? A C  3  N3 ? ? ? 1_555 A G   29 N1  ? ? B C  3   B G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8  hydrog ? ? A C  3  N4 ? ? ? 1_555 A G   29 O6  ? ? B C  3   B G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9  hydrog ? ? A C  3  O2 ? ? ? 1_555 A G   29 N2  ? ? B C  3   B G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog10 hydrog ? ? A C  4  N3 ? ? ? 1_555 A G   28 N1  ? ? B C  4   B G   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11 hydrog ? ? A C  4  N4 ? ? ? 1_555 A G   28 O6  ? ? B C  4   B G   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog12 hydrog ? ? A C  4  O2 ? ? ? 1_555 A G   28 N2  ? ? B C  4   B G   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog13 hydrog ? ? A C  5  N3 ? ? ? 1_555 A G   27 N1  ? ? B C  5   B G   27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog14 hydrog ? ? A C  5  N4 ? ? ? 1_555 A G   27 O6  ? ? B C  5   B G   27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog15 hydrog ? ? A C  5  O2 ? ? ? 1_555 A G   27 N2  ? ? B C  5   B G   27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog16 hydrog ? ? A G  6  N1 ? ? ? 1_555 A U   26 O2  ? ? B G  6   B U   26  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog17 hydrog ? ? A G  6  O6 ? ? ? 1_555 A U   26 N3  ? ? B G  6   B U   26  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog18 hydrog ? ? A G  7  N1 ? ? ? 1_555 A C   25 N3  ? ? B G  7   B C   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog19 hydrog ? ? A G  7  N2 ? ? ? 1_555 A C   25 O2  ? ? B G  7   B C   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20 hydrog ? ? A G  7  O6 ? ? ? 1_555 A C   25 N4  ? ? B G  7   B C   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21 hydrog ? ? A G  8  N1 ? ? ? 1_555 A C   24 N3  ? ? B G  8   B C   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog22 hydrog ? ? A G  8  N2 ? ? ? 1_555 A C   24 O2  ? ? B G  8   B C   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog23 hydrog ? ? A G  8  O6 ? ? ? 1_555 A C   24 N4  ? ? B G  8   B C   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog24 hydrog ? ? A G  9  N1 ? ? ? 1_555 A C   23 N3  ? ? B G  9   B C   23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog25 hydrog ? ? A G  9  N2 ? ? ? 1_555 A C   23 O2  ? ? B G  9   B C   23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog26 hydrog ? ? A G  9  O6 ? ? ? 1_555 A C   23 N4  ? ? B G  9   B C   23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog27 hydrog ? ? A C  10 N3 ? ? ? 1_555 A G   22 N1  ? ? B C  10  B G   22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog28 hydrog ? ? A C  10 N4 ? ? ? 1_555 A G   22 O6  ? ? B C  10  B G   22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog29 hydrog ? ? A C  10 O2 ? ? ? 1_555 A G   22 N2  ? ? B C  10  B G   22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog30 hydrog ? ? A G  11 N1 ? ? ? 1_555 A C   21 N3  ? ? B G  11  B C   21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog31 hydrog ? ? A G  11 N2 ? ? ? 1_555 A C   21 O2  ? ? B G  11  B C   21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog32 hydrog ? ? A G  11 O6 ? ? ? 1_555 A C   21 N4  ? ? B G  11  B C   21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog33 hydrog ? ? A G  12 N1 ? ? ? 1_555 A C   20 N3  ? ? B G  12  B C   20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog34 hydrog ? ? A G  12 N2 ? ? ? 1_555 A C   20 O2  ? ? B G  12  B C   20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog35 hydrog ? ? A G  12 O6 ? ? ? 1_555 A C   20 N4  ? ? B G  12  B C   20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog36 hydrog ? ? A U  13 N3 ? ? ? 1_555 A A   17 N7  ? ? B U  13  B A   17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog37 hydrog ? ? A U  13 O2 ? ? ? 1_555 A A   17 N6  ? ? B U  13  B A   17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR B 42  ? VAL B 45  ? TYR A 42  VAL A 45  
A 2 GLU B 59  ? PHE B 66  ? GLU A 59  PHE A 66  
A 3 VAL B 107 ? TYR B 115 ? VAL A 107 TYR A 115 
A 4 VAL B 100 ? VAL B 104 ? VAL A 100 VAL A 104 
A 5 SER B 89  ? GLU B 91  ? SER A 89  GLU A 91  
B 1 GLU B 207 ? LYS B 210 ? GLU A 207 LYS A 210 
B 2 THR B 199 ? ASP B 202 ? THR A 199 ASP A 202 
B 3 PHE B 215 ? VAL B 217 ? PHE A 215 VAL A 217 
C 1 PRO B 315 ? ALA B 322 ? PRO A 315 ALA A 322 
C 2 PHE B 326 ? CYS B 333 ? PHE A 326 CYS A 333 
C 3 ALA B 277 ? ARG B 284 ? ALA A 277 ARG A 284 
C 4 GLU B 413 ? ILE B 415 ? GLU A 413 ILE A 415 
D 1 VAL B 341 ? GLN B 348 ? VAL A 341 GLN A 348 
D 2 ARG B 373 ? MET B 379 ? ARG A 373 MET A 379 
D 3 PHE B 368 ? GLU B 370 ? PHE A 368 GLU A 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL B 43  ? N VAL A 43  O PHE B 63  ? O PHE A 63  
A 2 3 N VAL B 62  ? N VAL A 62  O VAL B 112 ? O VAL A 112 
A 3 4 O VAL B 109 ? O VAL A 109 N GLY B 102 ? N GLY A 102 
A 4 5 O HIS B 101 ? O HIS A 101 N GLU B 91  ? N GLU A 91  
B 1 2 O ARG B 209 ? O ARG A 209 N VAL B 200 ? N VAL A 200 
B 2 3 N ILE B 201 ? N ILE A 201 O PHE B 215 ? O PHE A 215 
C 1 2 N LEU B 316 ? N LEU A 316 O GLU B 332 ? O GLU A 332 
C 2 3 O CYS B 333 ? O CYS A 333 N ALA B 277 ? N ALA A 277 
C 3 4 N LYS B 282 ? N LYS A 282 O GLU B 413 ? O GLU A 413 
D 1 2 N ARG B 344 ? N ARG A 344 O ALA B 376 ? O ALA A 376 
D 2 3 O ARG B 373 ? O ARG A 373 N GLU B 370 ? N GLU A 370 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 601' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 602'  
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE CTP A 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  ARG B 299 ? ARG A 299 . ? 1_555 ? 
2  AC1 3  ARG B 302 ? ARG A 302 . ? 1_555 ? 
3  AC1 3  LYS B 303 ? LYS A 303 . ? 1_555 ? 
4  AC2 3  GLU B 59  ? GLU A 59  . ? 1_555 ? 
5  AC2 3  ASP B 61  ? ASP A 61  . ? 1_555 ? 
6  AC2 3  CTP E .   ? CTP A 504 . ? 1_555 ? 
7  AC3 16 GLY B 46  ? GLY A 46  . ? 1_555 ? 
8  AC3 16 SER B 47  ? SER A 47  . ? 1_555 ? 
9  AC3 16 ARG B 50  ? ARG A 50  . ? 1_555 ? 
10 AC3 16 ASP B 61  ? ASP A 61  . ? 1_555 ? 
11 AC3 16 THR B 130 ? THR A 130 . ? 1_555 ? 
12 AC3 16 HIS B 133 ? HIS A 133 . ? 1_555 ? 
13 AC3 16 LYS B 152 ? LYS A 152 . ? 1_555 ? 
14 AC3 16 TYR B 161 ? TYR A 161 . ? 1_555 ? 
15 AC3 16 TYR B 173 ? TYR A 173 . ? 1_555 ? 
16 AC3 16 MG  D .   ? MG  A 602 . ? 1_555 ? 
17 AC3 16 HOH G .   ? HOH A 692 . ? 1_555 ? 
18 AC3 16 HOH G .   ? HOH A 704 . ? 1_555 ? 
19 AC3 16 HOH G .   ? HOH A 732 . ? 1_555 ? 
20 AC3 16 A   A 32  ? A   B 32  . ? 1_555 ? 
21 AC3 16 C   A 33  ? C   B 33  . ? 1_555 ? 
22 AC3 16 C   A 34  ? C   B 34  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2DVI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DVI 
_atom_sites.fract_transf_matrix[1][1]   0.017240 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017240 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002318 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  OP3   . G   A 1 1   ? -3.824  -10.273 -36.124 1.00 56.99 ? 1   G   B OP3   1 
ATOM   2    P  P     . G   A 1 1   ? -3.654  -11.700 -36.638 1.00 59.85 ? 1   G   B P     1 
ATOM   3    O  OP1   . G   A 1 1   ? -2.599  -11.812 -37.738 1.00 56.16 ? 1   G   B OP1   1 
ATOM   4    O  OP2   . G   A 1 1   ? -4.964  -12.392 -37.022 1.00 56.06 ? 1   G   B OP2   1 
ATOM   5    O  "O5'" . G   A 1 1   ? -3.076  -12.523 -35.353 1.00 53.76 ? 1   G   B "O5'" 1 
ATOM   6    C  "C5'" . G   A 1 1   ? -3.964  -13.083 -34.371 1.00 45.86 ? 1   G   B "C5'" 1 
ATOM   7    C  "C4'" . G   A 1 1   ? -3.192  -13.951 -33.401 1.00 41.94 ? 1   G   B "C4'" 1 
ATOM   8    O  "O4'" . G   A 1 1   ? -2.001  -14.461 -34.057 1.00 39.91 ? 1   G   B "O4'" 1 
ATOM   9    C  "C3'" . G   A 1 1   ? -2.678  -13.264 -32.141 1.00 37.92 ? 1   G   B "C3'" 1 
ATOM   10   O  "O3'" . G   A 1 1   ? -3.690  -13.301 -31.131 1.00 37.96 ? 1   G   B "O3'" 1 
ATOM   11   C  "C2'" . G   A 1 1   ? -1.510  -14.160 -31.753 1.00 37.56 ? 1   G   B "C2'" 1 
ATOM   12   O  "O2'" . G   A 1 1   ? -1.937  -15.337 -31.101 1.00 36.47 ? 1   G   B "O2'" 1 
ATOM   13   C  "C1'" . G   A 1 1   ? -0.943  -14.538 -33.122 1.00 37.75 ? 1   G   B "C1'" 1 
ATOM   14   N  N9    . G   A 1 1   ? 0.138   -13.670 -33.579 1.00 36.91 ? 1   G   B N9    1 
ATOM   15   C  C8    . G   A 1 1   ? 0.108   -12.791 -34.634 1.00 34.64 ? 1   G   B C8    1 
ATOM   16   N  N7    . G   A 1 1   ? 1.252   -12.194 -34.836 1.00 34.94 ? 1   G   B N7    1 
ATOM   17   C  C5    . G   A 1 1   ? 2.086   -12.699 -33.846 1.00 34.65 ? 1   G   B C5    1 
ATOM   18   C  C6    . G   A 1 1   ? 3.459   -12.439 -33.569 1.00 33.01 ? 1   G   B C6    1 
ATOM   19   O  O6    . G   A 1 1   ? 4.245   -11.703 -34.176 1.00 32.67 ? 1   G   B O6    1 
ATOM   20   N  N1    . G   A 1 1   ? 3.900   -13.159 -32.465 1.00 33.43 ? 1   G   B N1    1 
ATOM   21   C  C2    . G   A 1 1   ? 3.132   -14.027 -31.726 1.00 32.59 ? 1   G   B C2    1 
ATOM   22   N  N2    . G   A 1 1   ? 3.738   -14.621 -30.693 1.00 32.48 ? 1   G   B N2    1 
ATOM   23   N  N3    . G   A 1 1   ? 1.863   -14.290 -31.981 1.00 34.60 ? 1   G   B N3    1 
ATOM   24   C  C4    . G   A 1 1   ? 1.406   -13.597 -33.048 1.00 35.96 ? 1   G   B C4    1 
ATOM   25   P  P     . G   A 1 2   ? -3.854  -12.080 -30.094 1.00 32.82 ? 2   G   B P     1 
ATOM   26   O  OP1   . G   A 1 2   ? -5.137  -12.280 -29.381 1.00 35.97 ? 2   G   B OP1   1 
ATOM   27   O  OP2   . G   A 1 2   ? -3.605  -10.808 -30.808 1.00 35.33 ? 2   G   B OP2   1 
ATOM   28   O  "O5'" . G   A 1 2   ? -2.677  -12.287 -29.046 1.00 35.91 ? 2   G   B "O5'" 1 
ATOM   29   C  "C5'" . G   A 1 2   ? -2.681  -13.386 -28.145 1.00 36.02 ? 2   G   B "C5'" 1 
ATOM   30   C  "C4'" . G   A 1 2   ? -1.329  -13.520 -27.491 1.00 38.03 ? 2   G   B "C4'" 1 
ATOM   31   O  "O4'" . G   A 1 2   ? -0.332  -13.810 -28.508 1.00 38.27 ? 2   G   B "O4'" 1 
ATOM   32   C  "C3'" . G   A 1 2   ? -0.796  -12.264 -26.823 1.00 37.97 ? 2   G   B "C3'" 1 
ATOM   33   O  "O3'" . G   A 1 2   ? -1.302  -12.130 -25.506 1.00 41.05 ? 2   G   B "O3'" 1 
ATOM   34   C  "C2'" . G   A 1 2   ? 0.697   -12.540 -26.789 1.00 37.07 ? 2   G   B "C2'" 1 
ATOM   35   O  "O2'" . G   A 1 2   ? 1.034   -13.433 -25.750 1.00 36.02 ? 2   G   B "O2'" 1 
ATOM   36   C  "C1'" . G   A 1 2   ? 0.905   -13.223 -28.140 1.00 35.99 ? 2   G   B "C1'" 1 
ATOM   37   N  N9    . G   A 1 2   ? 1.309   -12.289 -29.185 1.00 33.96 ? 2   G   B N9    1 
ATOM   38   C  C8    . G   A 1 2   ? 0.534   -11.765 -30.193 1.00 33.23 ? 2   G   B C8    1 
ATOM   39   N  N7    . G   A 1 2   ? 1.193   -10.957 -30.978 1.00 31.48 ? 2   G   B N7    1 
ATOM   40   C  C5    . G   A 1 2   ? 2.478   -10.950 -30.455 1.00 32.51 ? 2   G   B C5    1 
ATOM   41   C  C6    . G   A 1 2   ? 3.641   -10.267 -30.884 1.00 33.10 ? 2   G   B C6    1 
ATOM   42   O  O6    . G   A 1 2   ? 3.776   -9.511  -31.852 1.00 35.81 ? 2   G   B O6    1 
ATOM   43   N  N1    . G   A 1 2   ? 4.728   -10.540 -30.059 1.00 32.26 ? 2   G   B N1    1 
ATOM   44   C  C2    . G   A 1 2   ? 4.701   -11.374 -28.968 1.00 32.53 ? 2   G   B C2    1 
ATOM   45   N  N2    . G   A 1 2   ? 5.852   -11.517 -28.293 1.00 32.97 ? 2   G   B N2    1 
ATOM   46   N  N3    . G   A 1 2   ? 3.626   -12.022 -28.565 1.00 32.86 ? 2   G   B N3    1 
ATOM   47   C  C4    . G   A 1 2   ? 2.560   -11.765 -29.347 1.00 32.13 ? 2   G   B C4    1 
ATOM   48   P  P     . C   A 1 3   ? -1.411  -10.673 -24.846 1.00 39.52 ? 3   C   B P     1 
ATOM   49   O  OP1   . C   A 1 3   ? -2.146  -10.819 -23.565 1.00 41.04 ? 3   C   B OP1   1 
ATOM   50   O  OP2   . C   A 1 3   ? -1.944  -9.785  -25.907 1.00 42.54 ? 3   C   B OP2   1 
ATOM   51   O  "O5'" . C   A 1 3   ? 0.100   -10.254 -24.542 1.00 40.57 ? 3   C   B "O5'" 1 
ATOM   52   C  "C5'" . C   A 1 3   ? 0.841   -10.898 -23.508 1.00 39.69 ? 3   C   B "C5'" 1 
ATOM   53   C  "C4'" . C   A 1 3   ? 2.280   -10.433 -23.508 1.00 40.53 ? 3   C   B "C4'" 1 
ATOM   54   O  "O4'" . C   A 1 3   ? 2.906   -10.745 -24.783 1.00 40.40 ? 3   C   B "O4'" 1 
ATOM   55   C  "C3'" . C   A 1 3   ? 2.525   -8.944  -23.339 1.00 40.96 ? 3   C   B "C3'" 1 
ATOM   56   O  "O3'" . C   A 1 3   ? 2.466   -8.590  -21.964 1.00 43.87 ? 3   C   B "O3'" 1 
ATOM   57   C  "C2'" . C   A 1 3   ? 3.939   -8.809  -23.888 1.00 40.47 ? 3   C   B "C2'" 1 
ATOM   58   O  "O2'" . C   A 1 3   ? 4.911   -9.284  -22.976 1.00 40.97 ? 3   C   B "O2'" 1 
ATOM   59   C  "C1'" . C   A 1 3   ? 3.884   -9.761  -25.084 1.00 40.28 ? 3   C   B "C1'" 1 
ATOM   60   N  N1    . C   A 1 3   ? 3.486   -9.076  -26.321 1.00 41.08 ? 3   C   B N1    1 
ATOM   61   C  C2    . C   A 1 3   ? 4.460   -8.412  -27.061 1.00 40.26 ? 3   C   B C2    1 
ATOM   62   O  O2    . C   A 1 3   ? 5.626   -8.415  -26.647 1.00 40.52 ? 3   C   B O2    1 
ATOM   63   N  N3    . C   A 1 3   ? 4.105   -7.778  -28.201 1.00 39.22 ? 3   C   B N3    1 
ATOM   64   C  C4    . C   A 1 3   ? 2.829   -7.780  -28.594 1.00 40.31 ? 3   C   B C4    1 
ATOM   65   N  N4    . C   A 1 3   ? 2.518   -7.128  -29.717 1.00 42.00 ? 3   C   B N4    1 
ATOM   66   C  C5    . C   A 1 3   ? 1.814   -8.447  -27.855 1.00 38.40 ? 3   C   B C5    1 
ATOM   67   C  C6    . C   A 1 3   ? 2.183   -9.080  -26.738 1.00 41.24 ? 3   C   B C6    1 
ATOM   68   P  P     . C   A 1 4   ? 2.010   -7.107  -21.534 1.00 47.92 ? 4   C   B P     1 
ATOM   69   O  OP1   . C   A 1 4   ? 1.808   -7.128  -20.064 1.00 46.49 ? 4   C   B OP1   1 
ATOM   70   O  OP2   . C   A 1 4   ? 0.902   -6.675  -22.422 1.00 45.82 ? 4   C   B OP2   1 
ATOM   71   O  "O5'" . C   A 1 4   ? 3.275   -6.196  -21.871 1.00 47.03 ? 4   C   B "O5'" 1 
ATOM   72   C  "C5'" . C   A 1 4   ? 4.536   -6.447  -21.260 1.00 47.32 ? 4   C   B "C5'" 1 
ATOM   73   C  "C4'" . C   A 1 4   ? 5.602   -5.579  -21.884 1.00 49.42 ? 4   C   B "C4'" 1 
ATOM   74   O  "O4'" . C   A 1 4   ? 5.828   -5.988  -23.257 1.00 47.66 ? 4   C   B "O4'" 1 
ATOM   75   C  "C3'" . C   A 1 4   ? 5.270   -4.100  -21.995 1.00 51.38 ? 4   C   B "C3'" 1 
ATOM   76   O  "O3'" . C   A 1 4   ? 5.530   -3.430  -20.769 1.00 55.77 ? 4   C   B "O3'" 1 
ATOM   77   C  "C2'" . C   A 1 4   ? 6.214   -3.643  -23.101 1.00 50.49 ? 4   C   B "C2'" 1 
ATOM   78   O  "O2'" . C   A 1 4   ? 7.532   -3.406  -22.637 1.00 51.00 ? 4   C   B "O2'" 1 
ATOM   79   C  "C1'" . C   A 1 4   ? 6.200   -4.860  -24.032 1.00 46.68 ? 4   C   B "C1'" 1 
ATOM   80   N  N1    . C   A 1 4   ? 5.256   -4.738  -25.153 1.00 42.04 ? 4   C   B N1    1 
ATOM   81   C  C2    . C   A 1 4   ? 5.641   -4.006  -26.274 1.00 40.57 ? 4   C   B C2    1 
ATOM   82   O  O2    . C   A 1 4   ? 6.747   -3.455  -26.272 1.00 41.30 ? 4   C   B O2    1 
ATOM   83   N  N3    . C   A 1 4   ? 4.799   -3.913  -27.328 1.00 38.30 ? 4   C   B N3    1 
ATOM   84   C  C4    . C   A 1 4   ? 3.607   -4.512  -27.280 1.00 37.76 ? 4   C   B C4    1 
ATOM   85   N  N4    . C   A 1 4   ? 2.809   -4.408  -28.345 1.00 38.94 ? 4   C   B N4    1 
ATOM   86   C  C5    . C   A 1 4   ? 3.181   -5.249  -26.141 1.00 36.96 ? 4   C   B C5    1 
ATOM   87   C  C6    . C   A 1 4   ? 4.030   -5.337  -25.108 1.00 39.96 ? 4   C   B C6    1 
ATOM   88   P  P     . C   A 1 5   ? 4.659   -2.140  -20.364 1.00 59.69 ? 5   C   B P     1 
ATOM   89   O  OP1   . C   A 1 5   ? 5.055   -1.764  -18.982 1.00 57.83 ? 5   C   B OP1   1 
ATOM   90   O  OP2   . C   A 1 5   ? 3.231   -2.415  -20.668 1.00 58.01 ? 5   C   B OP2   1 
ATOM   91   O  "O5'" . C   A 1 5   ? 5.167   -1.018  -21.377 1.00 60.62 ? 5   C   B "O5'" 1 
ATOM   92   C  "C5'" . C   A 1 5   ? 6.508   -0.542  -21.321 1.00 61.96 ? 5   C   B "C5'" 1 
ATOM   93   C  "C4'" . C   A 1 5   ? 6.776   0.428   -22.450 1.00 64.68 ? 5   C   B "C4'" 1 
ATOM   94   O  "O4'" . C   A 1 5   ? 6.781   -0.262  -23.730 1.00 63.09 ? 5   C   B "O4'" 1 
ATOM   95   C  "C3'" . C   A 1 5   ? 5.745   1.521   -22.665 1.00 67.61 ? 5   C   B "C3'" 1 
ATOM   96   O  "O3'" . C   A 1 5   ? 5.862   2.573   -21.712 1.00 72.65 ? 5   C   B "O3'" 1 
ATOM   97   C  "C2'" . C   A 1 5   ? 6.083   1.983   -24.078 1.00 65.09 ? 5   C   B "C2'" 1 
ATOM   98   O  "O2'" . C   A 1 5   ? 7.211   2.833   -24.122 1.00 67.39 ? 5   C   B "O2'" 1 
ATOM   99   C  "C1'" . C   A 1 5   ? 6.421   0.655   -24.757 1.00 61.93 ? 5   C   B "C1'" 1 
ATOM   100  N  N1    . C   A 1 5   ? 5.272   0.120   -25.501 1.00 58.44 ? 5   C   B N1    1 
ATOM   101  C  C2    . C   A 1 5   ? 5.019   0.614   -26.783 1.00 55.95 ? 5   C   B C2    1 
ATOM   102  O  O2    . C   A 1 5   ? 5.787   1.469   -27.257 1.00 52.64 ? 5   C   B O2    1 
ATOM   103  N  N3    . C   A 1 5   ? 3.948   0.148   -27.471 1.00 54.55 ? 5   C   B N3    1 
ATOM   104  C  C4    . C   A 1 5   ? 3.153   -0.776  -26.923 1.00 54.65 ? 5   C   B C4    1 
ATOM   105  N  N4    . C   A 1 5   ? 2.106   -1.210  -27.635 1.00 53.65 ? 5   C   B N4    1 
ATOM   106  C  C5    . C   A 1 5   ? 3.394   -1.300  -25.620 1.00 54.15 ? 5   C   B C5    1 
ATOM   107  C  C6    . C   A 1 5   ? 4.454   -0.830  -24.952 1.00 57.17 ? 5   C   B C6    1 
ATOM   108  P  P     . G   A 1 6   ? 4.577   3.479   -21.375 1.00 76.12 ? 6   G   B P     1 
ATOM   109  O  OP1   . G   A 1 6   ? 4.987   4.483   -20.363 1.00 76.12 ? 6   G   B OP1   1 
ATOM   110  O  OP2   . G   A 1 6   ? 3.429   2.576   -21.088 1.00 76.76 ? 6   G   B OP2   1 
ATOM   111  O  "O5'" . G   A 1 6   ? 4.275   4.218   -22.753 1.00 76.38 ? 6   G   B "O5'" 1 
ATOM   112  C  "C5'" . G   A 1 6   ? 5.277   5.015   -23.368 1.00 78.82 ? 6   G   B "C5'" 1 
ATOM   113  C  "C4'" . G   A 1 6   ? 4.780   5.601   -24.669 1.00 80.34 ? 6   G   B "C4'" 1 
ATOM   114  O  "O4'" . G   A 1 6   ? 4.660   4.585   -25.696 1.00 79.59 ? 6   G   B "O4'" 1 
ATOM   115  C  "C3'" . G   A 1 6   ? 3.400   6.225   -24.677 1.00 81.15 ? 6   G   B "C3'" 1 
ATOM   116  O  "O3'" . G   A 1 6   ? 3.397   7.499   -24.051 1.00 84.30 ? 6   G   B "O3'" 1 
ATOM   117  C  "C2'" . G   A 1 6   ? 3.137   6.343   -26.175 1.00 80.15 ? 6   G   B "C2'" 1 
ATOM   118  O  "O2'" . G   A 1 6   ? 3.782   7.458   -26.756 1.00 80.79 ? 6   G   B "O2'" 1 
ATOM   119  C  "C1'" . G   A 1 6   ? 3.782   5.060   -26.703 1.00 78.51 ? 6   G   B "C1'" 1 
ATOM   120  N  N9    . G   A 1 6   ? 2.785   4.041   -27.002 1.00 76.69 ? 6   G   B N9    1 
ATOM   121  C  C8    . G   A 1 6   ? 2.355   3.016   -26.195 1.00 76.00 ? 6   G   B C8    1 
ATOM   122  N  N7    . G   A 1 6   ? 1.408   2.301   -26.742 1.00 76.03 ? 6   G   B N7    1 
ATOM   123  C  C5    . G   A 1 6   ? 1.212   2.884   -27.988 1.00 74.97 ? 6   G   B C5    1 
ATOM   124  C  C6    . G   A 1 6   ? 0.306   2.551   -29.030 1.00 74.63 ? 6   G   B C6    1 
ATOM   125  O  O6    . G   A 1 6   ? -0.538  1.649   -29.059 1.00 76.44 ? 6   G   B O6    1 
ATOM   126  N  N1    . G   A 1 6   ? 0.448   3.401   -30.122 1.00 73.71 ? 6   G   B N1    1 
ATOM   127  C  C2    . G   A 1 6   ? 1.341   4.439   -30.203 1.00 74.18 ? 6   G   B C2    1 
ATOM   128  N  N2    . G   A 1 6   ? 1.334   5.143   -31.345 1.00 73.44 ? 6   G   B N2    1 
ATOM   129  N  N3    . G   A 1 6   ? 2.183   4.764   -29.237 1.00 74.60 ? 6   G   B N3    1 
ATOM   130  C  C4    . G   A 1 6   ? 2.063   3.949   -28.167 1.00 75.44 ? 6   G   B C4    1 
ATOM   131  P  P     . G   A 1 7   ? 2.026   8.332   -23.961 1.00 86.53 ? 7   G   B P     1 
ATOM   132  O  OP1   . G   A 1 7   ? 2.256   9.535   -23.118 1.00 85.68 ? 7   G   B OP1   1 
ATOM   133  O  OP2   . G   A 1 7   ? 0.926   7.388   -23.616 1.00 85.22 ? 7   G   B OP2   1 
ATOM   134  O  "O5'" . G   A 1 7   ? 1.792   8.804   -25.459 1.00 83.10 ? 7   G   B "O5'" 1 
ATOM   135  C  "C5'" . G   A 1 7   ? 0.512   9.211   -25.883 1.00 81.45 ? 7   G   B "C5'" 1 
ATOM   136  C  "C4'" . G   A 1 7   ? 0.529   9.514   -27.352 1.00 80.49 ? 7   G   B "C4'" 1 
ATOM   137  O  "O4'" . G   A 1 7   ? 0.900   8.320   -28.092 1.00 79.67 ? 7   G   B "O4'" 1 
ATOM   138  C  "C3'" . G   A 1 7   ? -0.840  9.880   -27.883 1.00 81.39 ? 7   G   B "C3'" 1 
ATOM   139  O  "O3'" . G   A 1 7   ? -1.091  11.258  -27.661 1.00 82.10 ? 7   G   B "O3'" 1 
ATOM   140  C  "C2'" . G   A 1 7   ? -0.734  9.477   -29.344 1.00 80.38 ? 7   G   B "C2'" 1 
ATOM   141  O  "O2'" . G   A 1 7   ? 0.003   10.410  -30.111 1.00 79.96 ? 7   G   B "O2'" 1 
ATOM   142  C  "C1'" . G   A 1 7   ? 0.040   8.163   -29.212 1.00 78.44 ? 7   G   B "C1'" 1 
ATOM   143  N  N9    . G   A 1 7   ? -0.823  7.017   -28.936 1.00 75.78 ? 7   G   B N9    1 
ATOM   144  C  C8    . G   A 1 7   ? -0.828  6.254   -27.792 1.00 74.74 ? 7   G   B C8    1 
ATOM   145  N  N7    . G   A 1 7   ? -1.707  5.289   -27.822 1.00 74.14 ? 7   G   B N7    1 
ATOM   146  C  C5    . G   A 1 7   ? -2.320  5.420   -29.061 1.00 72.91 ? 7   G   B C5    1 
ATOM   147  C  C6    . G   A 1 7   ? -3.354  4.653   -29.661 1.00 71.53 ? 7   G   B C6    1 
ATOM   148  O  O6    . G   A 1 7   ? -3.945  3.667   -29.208 1.00 69.60 ? 7   G   B O6    1 
ATOM   149  N  N1    . G   A 1 7   ? -3.683  5.138   -30.920 1.00 71.17 ? 7   G   B N1    1 
ATOM   150  C  C2    . G   A 1 7   ? -3.094  6.218   -31.530 1.00 72.26 ? 7   G   B C2    1 
ATOM   151  N  N2    . G   A 1 7   ? -3.560  6.532   -32.747 1.00 73.36 ? 7   G   B N2    1 
ATOM   152  N  N3    . G   A 1 7   ? -2.123  6.937   -30.987 1.00 72.66 ? 7   G   B N3    1 
ATOM   153  C  C4    . G   A 1 7   ? -1.789  6.486   -29.760 1.00 73.83 ? 7   G   B C4    1 
ATOM   154  P  P     . G   A 1 8   ? -2.422  11.696  -26.880 1.00 82.44 ? 8   G   B P     1 
ATOM   155  O  OP1   . G   A 1 8   ? -2.295  13.127  -26.513 1.00 83.32 ? 8   G   B OP1   1 
ATOM   156  O  OP2   . G   A 1 8   ? -2.695  10.686  -25.821 1.00 81.12 ? 8   G   B OP2   1 
ATOM   157  O  "O5'" . G   A 1 8   ? -3.541  11.554  -27.999 1.00 79.91 ? 8   G   B "O5'" 1 
ATOM   158  C  "C5'" . G   A 1 8   ? -3.361  12.151  -29.274 1.00 77.04 ? 8   G   B "C5'" 1 
ATOM   159  C  "C4'" . G   A 1 8   ? -4.409  11.650  -30.228 1.00 75.85 ? 8   G   B "C4'" 1 
ATOM   160  O  "O4'" . G   A 1 8   ? -4.112  10.281  -30.615 1.00 75.24 ? 8   G   B "O4'" 1 
ATOM   161  C  "C3'" . G   A 1 8   ? -5.801  11.544  -29.640 1.00 76.70 ? 8   G   B "C3'" 1 
ATOM   162  O  "O3'" . G   A 1 8   ? -6.454  12.800  -29.547 1.00 78.68 ? 8   G   B "O3'" 1 
ATOM   163  C  "C2'" . G   A 1 8   ? -6.466  10.568  -30.602 1.00 75.69 ? 8   G   B "C2'" 1 
ATOM   164  O  "O2'" . G   A 1 8   ? -6.867  11.139  -31.835 1.00 76.51 ? 8   G   B "O2'" 1 
ATOM   165  C  "C1'" . G   A 1 8   ? -5.327  9.573   -30.827 1.00 73.46 ? 8   G   B "C1'" 1 
ATOM   166  N  N9    . G   A 1 8   ? -5.412  8.484   -29.858 1.00 69.07 ? 8   G   B N9    1 
ATOM   167  C  C8    . G   A 1 8   ? -4.739  8.362   -28.666 1.00 67.37 ? 8   G   B C8    1 
ATOM   168  N  N7    . G   A 1 8   ? -5.081  7.298   -27.993 1.00 65.20 ? 8   G   B N7    1 
ATOM   169  C  C5    . G   A 1 8   ? -6.025  6.676   -28.797 1.00 65.40 ? 8   G   B C5    1 
ATOM   170  C  C6    . G   A 1 8   ? -6.762  5.483   -28.593 1.00 65.49 ? 8   G   B C6    1 
ATOM   171  O  O6    . G   A 1 8   ? -6.725  4.710   -27.625 1.00 65.75 ? 8   G   B O6    1 
ATOM   172  N  N1    . G   A 1 8   ? -7.615  5.221   -29.663 1.00 65.06 ? 8   G   B N1    1 
ATOM   173  C  C2    . G   A 1 8   ? -7.743  6.008   -30.785 1.00 65.30 ? 8   G   B C2    1 
ATOM   174  N  N2    . G   A 1 8   ? -8.626  5.595   -31.714 1.00 62.99 ? 8   G   B N2    1 
ATOM   175  N  N3    . G   A 1 8   ? -7.058  7.120   -30.983 1.00 64.65 ? 8   G   B N3    1 
ATOM   176  C  C4    . G   A 1 8   ? -6.228  7.390   -29.957 1.00 65.82 ? 8   G   B C4    1 
ATOM   177  P  P     . G   A 1 9   ? -7.789  12.929  -28.664 1.00 80.47 ? 9   G   B P     1 
ATOM   178  O  OP1   . G   A 1 9   ? -8.121  14.371  -28.527 1.00 81.17 ? 9   G   B OP1   1 
ATOM   179  O  OP2   . G   A 1 9   ? -7.630  12.096  -27.443 1.00 79.14 ? 9   G   B OP2   1 
ATOM   180  O  "O5'" . G   A 1 9   ? -8.890  12.250  -29.590 1.00 78.08 ? 9   G   B "O5'" 1 
ATOM   181  C  "C5'" . G   A 1 9   ? -10.157 11.906  -29.070 1.00 76.15 ? 9   G   B "C5'" 1 
ATOM   182  C  "C4'" . G   A 1 9   ? -10.903 11.043  -30.051 1.00 74.54 ? 9   G   B "C4'" 1 
ATOM   183  O  "O4'" . G   A 1 9   ? -10.064 9.931   -30.464 1.00 73.22 ? 9   G   B "O4'" 1 
ATOM   184  C  "C3'" . G   A 1 9   ? -12.138 10.407  -29.446 1.00 74.65 ? 9   G   B "C3'" 1 
ATOM   185  O  "O3'" . G   A 1 9   ? -13.249 11.297  -29.534 1.00 77.19 ? 9   G   B "O3'" 1 
ATOM   186  C  "C2'" . G   A 1 9   ? -12.277 9.130   -30.265 1.00 72.76 ? 9   G   B "C2'" 1 
ATOM   187  O  "O2'" . G   A 1 9   ? -12.844 9.350   -31.542 1.00 71.32 ? 9   G   B "O2'" 1 
ATOM   188  C  "C1'" . G   A 1 9   ? -10.808 8.723   -30.415 1.00 70.63 ? 9   G   B "C1'" 1 
ATOM   189  N  N9    . G   A 1 9   ? -10.294 7.934   -29.296 1.00 67.50 ? 9   G   B N9    1 
ATOM   190  C  C8    . G   A 1 9   ? -9.277  8.291   -28.440 1.00 65.67 ? 9   G   B C8    1 
ATOM   191  N  N7    . G   A 1 9   ? -9.032  7.391   -27.528 1.00 64.09 ? 9   G   B N7    1 
ATOM   192  C  C5    . G   A 1 9   ? -9.938  6.374   -27.796 1.00 63.63 ? 9   G   B C5    1 
ATOM   193  C  C6    . G   A 1 9   ? -10.144 5.130   -27.138 1.00 63.25 ? 9   G   B C6    1 
ATOM   194  O  O6    . G   A 1 9   ? -9.537  4.662   -26.163 1.00 61.49 ? 9   G   B O6    1 
ATOM   195  N  N1    . G   A 1 9   ? -11.174 4.405   -27.730 1.00 62.31 ? 9   G   B N1    1 
ATOM   196  C  C2    . G   A 1 9   ? -11.908 4.816   -28.818 1.00 62.69 ? 9   G   B C2    1 
ATOM   197  N  N2    . G   A 1 9   ? -12.866 3.977   -29.240 1.00 60.96 ? 9   G   B N2    1 
ATOM   198  N  N3    . G   A 1 9   ? -11.718 5.967   -29.446 1.00 63.84 ? 9   G   B N3    1 
ATOM   199  C  C4    . G   A 1 9   ? -10.725 6.692   -28.883 1.00 64.94 ? 9   G   B C4    1 
ATOM   200  P  P     . C   A 1 10  ? -13.903 11.892  -28.184 1.00 79.17 ? 10  C   B P     1 
ATOM   201  O  OP1   . C   A 1 10  ? -14.764 13.045  -28.561 1.00 80.06 ? 10  C   B OP1   1 
ATOM   202  O  OP2   . C   A 1 10  ? -12.806 12.081  -27.190 1.00 75.75 ? 10  C   B OP2   1 
ATOM   203  O  "O5'" . C   A 1 10  ? -14.837 10.711  -27.662 1.00 76.04 ? 10  C   B "O5'" 1 
ATOM   204  C  "C5'" . C   A 1 10  ? -14.276 9.434   -27.418 1.00 72.94 ? 10  C   B "C5'" 1 
ATOM   205  C  "C4'" . C   A 1 10  ? -15.248 8.335   -27.760 1.00 69.30 ? 10  C   B "C4'" 1 
ATOM   206  O  "O4'" . C   A 1 10  ? -14.458 7.157   -28.062 1.00 66.89 ? 10  C   B "O4'" 1 
ATOM   207  C  "C3'" . C   A 1 10  ? -16.179 7.938   -26.620 1.00 68.25 ? 10  C   B "C3'" 1 
ATOM   208  O  "O3'" . C   A 1 10  ? -17.427 8.630   -26.666 1.00 67.52 ? 10  C   B "O3'" 1 
ATOM   209  C  "C2'" . C   A 1 10  ? -16.320 6.430   -26.807 1.00 66.32 ? 10  C   B "C2'" 1 
ATOM   210  O  "O2'" . C   A 1 10  ? -17.294 6.044   -27.757 1.00 66.21 ? 10  C   B "O2'" 1 
ATOM   211  C  "C1'" . C   A 1 10  ? -14.922 6.061   -27.303 1.00 64.08 ? 10  C   B "C1'" 1 
ATOM   212  N  N1    . C   A 1 10  ? -13.955 5.839   -26.220 1.00 59.38 ? 10  C   B N1    1 
ATOM   213  C  C2    . C   A 1 10  ? -13.934 4.608   -25.590 1.00 58.14 ? 10  C   B C2    1 
ATOM   214  O  O2    . C   A 1 10  ? -14.728 3.738   -25.967 1.00 56.94 ? 10  C   B O2    1 
ATOM   215  N  N3    . C   A 1 10  ? -13.053 4.392   -24.586 1.00 58.19 ? 10  C   B N3    1 
ATOM   216  C  C4    . C   A 1 10  ? -12.219 5.362   -24.213 1.00 57.04 ? 10  C   B C4    1 
ATOM   217  N  N4    . C   A 1 10  ? -11.369 5.109   -23.217 1.00 55.76 ? 10  C   B N4    1 
ATOM   218  C  C5    . C   A 1 10  ? -12.218 6.635   -24.846 1.00 56.95 ? 10  C   B C5    1 
ATOM   219  C  C6    . C   A 1 10  ? -13.093 6.828   -25.836 1.00 57.94 ? 10  C   B C6    1 
ATOM   220  P  P     . G   A 1 11  ? -18.286 8.817   -25.314 1.00 68.34 ? 11  G   B P     1 
ATOM   221  O  OP1   . G   A 1 11  ? -19.517 9.578   -25.652 1.00 68.14 ? 11  G   B OP1   1 
ATOM   222  O  OP2   . G   A 1 11  ? -17.360 9.345   -24.275 1.00 65.96 ? 11  G   B OP2   1 
ATOM   223  O  "O5'" . G   A 1 11  ? -18.728 7.331   -24.919 1.00 65.86 ? 11  G   B "O5'" 1 
ATOM   224  C  "C5'" . G   A 1 11  ? -19.685 6.626   -25.712 1.00 61.49 ? 11  G   B "C5'" 1 
ATOM   225  C  "C4'" . G   A 1 11  ? -19.793 5.175   -25.281 1.00 59.87 ? 11  G   B "C4'" 1 
ATOM   226  O  "O4'" . G   A 1 11  ? -18.503 4.519   -25.431 1.00 58.85 ? 11  G   B "O4'" 1 
ATOM   227  C  "C3'" . G   A 1 11  ? -20.157 4.884   -23.833 1.00 59.76 ? 11  G   B "C3'" 1 
ATOM   228  O  "O3'" . G   A 1 11  ? -21.552 4.986   -23.576 1.00 60.20 ? 11  G   B "O3'" 1 
ATOM   229  C  "C2'" . G   A 1 11  ? -19.699 3.440   -23.692 1.00 57.74 ? 11  G   B "C2'" 1 
ATOM   230  O  "O2'" . G   A 1 11  ? -20.593 2.528   -24.298 1.00 57.01 ? 11  G   B "O2'" 1 
ATOM   231  C  "C1'" . G   A 1 11  ? -18.387 3.473   -24.472 1.00 55.35 ? 11  G   B "C1'" 1 
ATOM   232  N  N9    . G   A 1 11  ? -17.257 3.768   -23.597 1.00 50.30 ? 11  G   B N9    1 
ATOM   233  C  C8    . G   A 1 11  ? -16.537 4.936   -23.536 1.00 48.73 ? 11  G   B C8    1 
ATOM   234  N  N7    . G   A 1 11  ? -15.579 4.901   -22.651 1.00 47.49 ? 11  G   B N7    1 
ATOM   235  C  C5    . G   A 1 11  ? -15.672 3.634   -22.092 1.00 44.83 ? 11  G   B C5    1 
ATOM   236  C  C6    . G   A 1 11  ? -14.898 3.023   -21.081 1.00 43.31 ? 11  G   B C6    1 
ATOM   237  O  O6    . G   A 1 11  ? -13.934 3.490   -20.464 1.00 44.00 ? 11  G   B O6    1 
ATOM   238  N  N1    . G   A 1 11  ? -15.339 1.731   -20.807 1.00 41.11 ? 11  G   B N1    1 
ATOM   239  C  C2    . G   A 1 11  ? -16.388 1.107   -21.433 1.00 40.75 ? 11  G   B C2    1 
ATOM   240  N  N2    . G   A 1 11  ? -16.661 -0.136  -21.023 1.00 37.32 ? 11  G   B N2    1 
ATOM   241  N  N3    . G   A 1 11  ? -17.116 1.664   -22.388 1.00 42.01 ? 11  G   B N3    1 
ATOM   242  C  C4    . G   A 1 11  ? -16.705 2.922   -22.664 1.00 46.14 ? 11  G   B C4    1 
ATOM   243  P  P     . G   A 1 12  ? -22.057 5.358   -22.092 1.00 61.35 ? 12  G   B P     1 
ATOM   244  O  OP1   . G   A 1 12  ? -23.536 5.514   -22.155 1.00 61.21 ? 12  G   B OP1   1 
ATOM   245  O  OP2   . G   A 1 12  ? -21.214 6.482   -21.594 1.00 58.10 ? 12  G   B OP2   1 
ATOM   246  O  "O5'" . G   A 1 12  ? -21.725 4.066   -21.218 1.00 58.64 ? 12  G   B "O5'" 1 
ATOM   247  C  "C5'" . G   A 1 12  ? -22.435 2.849   -21.426 1.00 58.48 ? 12  G   B "C5'" 1 
ATOM   248  C  "C4'" . G   A 1 12  ? -21.890 1.760   -20.532 1.00 58.47 ? 12  G   B "C4'" 1 
ATOM   249  O  "O4'" . G   A 1 12  ? -20.476 1.577   -20.816 1.00 56.67 ? 12  G   B "O4'" 1 
ATOM   250  C  "C3'" . G   A 1 12  ? -21.928 2.022   -19.033 1.00 58.69 ? 12  G   B "C3'" 1 
ATOM   251  O  "O3'" . G   A 1 12  ? -23.206 1.707   -18.483 1.00 61.48 ? 12  G   B "O3'" 1 
ATOM   252  C  "C2'" . G   A 1 12  ? -20.853 1.065   -18.530 1.00 57.07 ? 12  G   B "C2'" 1 
ATOM   253  O  "O2'" . G   A 1 12  ? -21.300 -0.274  -18.474 1.00 56.75 ? 12  G   B "O2'" 1 
ATOM   254  C  "C1'" . G   A 1 12  ? -19.800 1.192   -19.632 1.00 54.94 ? 12  G   B "C1'" 1 
ATOM   255  N  N9    . G   A 1 12  ? -18.799 2.208   -19.333 1.00 51.93 ? 12  G   B N9    1 
ATOM   256  C  C8    . G   A 1 12  ? -18.688 3.456   -19.893 1.00 50.71 ? 12  G   B C8    1 
ATOM   257  N  N7    . G   A 1 12  ? -17.685 4.140   -19.416 1.00 50.90 ? 12  G   B N7    1 
ATOM   258  C  C5    . G   A 1 12  ? -17.100 3.290   -18.486 1.00 49.18 ? 12  G   B C5    1 
ATOM   259  C  C6    . G   A 1 12  ? -15.973 3.482   -17.643 1.00 49.24 ? 12  G   B C6    1 
ATOM   260  O  O6    . G   A 1 12  ? -15.242 4.476   -17.545 1.00 49.84 ? 12  G   B O6    1 
ATOM   261  N  N1    . G   A 1 12  ? -15.729 2.363   -16.854 1.00 48.53 ? 12  G   B N1    1 
ATOM   262  C  C2    . G   A 1 12  ? -16.472 1.211   -16.868 1.00 49.03 ? 12  G   B C2    1 
ATOM   263  N  N2    . G   A 1 12  ? -16.081 0.241   -16.030 1.00 48.31 ? 12  G   B N2    1 
ATOM   264  N  N3    . G   A 1 12  ? -17.524 1.021   -17.647 1.00 50.12 ? 12  G   B N3    1 
ATOM   265  C  C4    . G   A 1 12  ? -17.777 2.095   -18.424 1.00 50.23 ? 12  G   B C4    1 
ATOM   266  P  P     . U   A 1 13  ? -23.739 2.501   -17.184 1.00 62.19 ? 13  U   B P     1 
ATOM   267  O  OP1   . U   A 1 13  ? -25.102 1.999   -16.875 1.00 60.81 ? 13  U   B OP1   1 
ATOM   268  O  OP2   . U   A 1 13  ? -23.524 3.954   -17.424 1.00 60.76 ? 13  U   B OP2   1 
ATOM   269  O  "O5'" . U   A 1 13  ? -22.764 2.032   -16.015 1.00 60.95 ? 13  U   B "O5'" 1 
ATOM   270  C  "C5'" . U   A 1 13  ? -22.730 0.671   -15.599 1.00 57.74 ? 13  U   B "C5'" 1 
ATOM   271  C  "C4'" . U   A 1 13  ? -21.601 0.449   -14.621 1.00 57.34 ? 13  U   B "C4'" 1 
ATOM   272  O  "O4'" . U   A 1 13  ? -20.323 0.709   -15.265 1.00 56.94 ? 13  U   B "O4'" 1 
ATOM   273  C  "C3'" . U   A 1 13  ? -21.567 1.382   -13.426 1.00 57.38 ? 13  U   B "C3'" 1 
ATOM   274  O  "O3'" . U   A 1 13  ? -22.497 0.992   -12.427 1.00 58.57 ? 13  U   B "O3'" 1 
ATOM   275  C  "C2'" . U   A 1 13  ? -20.124 1.233   -12.962 1.00 55.92 ? 13  U   B "C2'" 1 
ATOM   276  O  "O2'" . U   A 1 13  ? -19.895 0.024   -12.266 1.00 53.26 ? 13  U   B "O2'" 1 
ATOM   277  C  "C1'" . U   A 1 13  ? -19.391 1.187   -14.303 1.00 54.44 ? 13  U   B "C1'" 1 
ATOM   278  N  N1    . U   A 1 13  ? -18.908 2.508   -14.732 1.00 52.13 ? 13  U   B N1    1 
ATOM   279  C  C2    . U   A 1 13  ? -17.709 2.968   -14.196 1.00 49.83 ? 13  U   B C2    1 
ATOM   280  O  O2    . U   A 1 13  ? -17.059 2.340   -13.372 1.00 46.50 ? 13  U   B O2    1 
ATOM   281  N  N3    . U   A 1 13  ? -17.306 4.195   -14.654 1.00 48.12 ? 13  U   B N3    1 
ATOM   282  C  C4    . U   A 1 13  ? -17.966 5.001   -15.558 1.00 49.01 ? 13  U   B C4    1 
ATOM   283  O  O4    . U   A 1 13  ? -17.472 6.084   -15.870 1.00 50.35 ? 13  U   B O4    1 
ATOM   284  C  C5    . U   A 1 13  ? -19.200 4.466   -16.053 1.00 49.52 ? 13  U   B C5    1 
ATOM   285  C  C6    . U   A 1 13  ? -19.616 3.268   -15.636 1.00 50.82 ? 13  U   B C6    1 
ATOM   286  P  P     . U   A 1 14  ? -23.207 2.119   -11.532 1.00 60.08 ? 14  U   B P     1 
ATOM   287  O  OP1   . U   A 1 14  ? -23.977 1.423   -10.463 1.00 59.77 ? 14  U   B OP1   1 
ATOM   288  O  OP2   . U   A 1 14  ? -23.903 3.068   -12.449 1.00 56.10 ? 14  U   B OP2   1 
ATOM   289  O  "O5'" . U   A 1 14  ? -21.982 2.873   -10.847 1.00 56.38 ? 14  U   B "O5'" 1 
ATOM   290  C  "C5'" . U   A 1 14  ? -21.201 2.219   -9.854  1.00 54.21 ? 14  U   B "C5'" 1 
ATOM   291  C  "C4'" . U   A 1 14  ? -20.152 3.157   -9.314  1.00 52.97 ? 14  U   B "C4'" 1 
ATOM   292  O  "O4'" . U   A 1 14  ? -19.190 3.470   -10.357 1.00 51.70 ? 14  U   B "O4'" 1 
ATOM   293  C  "C3'" . U   A 1 14  ? -20.651 4.523   -8.879  1.00 52.79 ? 14  U   B "C3'" 1 
ATOM   294  O  "O3'" . U   A 1 14  ? -21.239 4.491   -7.585  1.00 52.40 ? 14  U   B "O3'" 1 
ATOM   295  C  "C2'" . U   A 1 14  ? -19.365 5.331   -8.897  1.00 52.15 ? 14  U   B "C2'" 1 
ATOM   296  O  "O2'" . U   A 1 14  ? -18.569 5.051   -7.764  1.00 53.23 ? 14  U   B "O2'" 1 
ATOM   297  C  "C1'" . U   A 1 14  ? -18.689 4.784   -10.159 1.00 51.28 ? 14  U   B "C1'" 1 
ATOM   298  N  N1    . U   A 1 14  ? -19.012 5.597   -11.342 1.00 49.18 ? 14  U   B N1    1 
ATOM   299  C  C2    . U   A 1 14  ? -18.184 6.670   -11.626 1.00 48.63 ? 14  U   B C2    1 
ATOM   300  O  O2    . U   A 1 14  ? -17.175 6.917   -10.988 1.00 50.28 ? 14  U   B O2    1 
ATOM   301  N  N3    . U   A 1 14  ? -18.578 7.439   -12.691 1.00 47.57 ? 14  U   B N3    1 
ATOM   302  C  C4    . U   A 1 14  ? -19.684 7.245   -13.491 1.00 46.76 ? 14  U   B C4    1 
ATOM   303  O  O4    . U   A 1 14  ? -19.963 8.087   -14.342 1.00 47.13 ? 14  U   B O4    1 
ATOM   304  C  C5    . U   A 1 14  ? -20.467 6.091   -13.162 1.00 45.45 ? 14  U   B C5    1 
ATOM   305  C  C6    . U   A 1 14  ? -20.111 5.325   -12.124 1.00 48.31 ? 14  U   B C6    1 
ATOM   306  P  P     . C   A 1 15  ? -22.608 5.289   -7.323  1.00 50.53 ? 15  C   B P     1 
ATOM   307  O  OP1   . C   A 1 15  ? -23.366 4.597   -6.249  1.00 52.01 ? 15  C   B OP1   1 
ATOM   308  O  OP2   . C   A 1 15  ? -23.238 5.487   -8.647  1.00 53.17 ? 15  C   B OP2   1 
ATOM   309  O  "O5'" . C   A 1 15  ? -22.120 6.714   -6.810  1.00 49.36 ? 15  C   B "O5'" 1 
ATOM   310  C  "C5'" . C   A 1 15  ? -23.004 7.833   -6.771  1.00 46.47 ? 15  C   B "C5'" 1 
ATOM   311  C  "C4'" . C   A 1 15  ? -22.220 9.115   -6.558  1.00 47.06 ? 15  C   B "C4'" 1 
ATOM   312  O  "O4'" . C   A 1 15  ? -21.619 9.151   -5.229  1.00 45.99 ? 15  C   B "O4'" 1 
ATOM   313  C  "C3'" . C   A 1 15  ? -21.037 9.315   -7.491  1.00 46.30 ? 15  C   B "C3'" 1 
ATOM   314  O  "O3'" . C   A 1 15  ? -21.470 9.847   -8.736  1.00 48.23 ? 15  C   B "O3'" 1 
ATOM   315  C  "C2'" . C   A 1 15  ? -20.196 10.334  -6.732  1.00 45.43 ? 15  C   B "C2'" 1 
ATOM   316  O  "O2'" . C   A 1 15  ? -20.704 11.645  -6.875  1.00 44.35 ? 15  C   B "O2'" 1 
ATOM   317  C  "C1'" . C   A 1 15  ? -20.419 9.902   -5.286  1.00 44.17 ? 15  C   B "C1'" 1 
ATOM   318  N  N1    . C   A 1 15  ? -19.333 9.147   -4.634  1.00 43.43 ? 15  C   B N1    1 
ATOM   319  C  C2    . C   A 1 15  ? -19.310 7.753   -4.756  1.00 43.77 ? 15  C   B C2    1 
ATOM   320  O  O2    . C   A 1 15  ? -20.205 7.198   -5.396  1.00 47.02 ? 15  C   B O2    1 
ATOM   321  N  N3    . C   A 1 15  ? -18.317 7.049   -4.169  1.00 41.29 ? 15  C   B N3    1 
ATOM   322  C  C4    . C   A 1 15  ? -17.364 7.686   -3.490  1.00 40.50 ? 15  C   B C4    1 
ATOM   323  N  N4    . C   A 1 15  ? -16.410 6.945   -2.926  1.00 40.52 ? 15  C   B N4    1 
ATOM   324  C  C5    . C   A 1 15  ? -17.352 9.110   -3.358  1.00 38.99 ? 15  C   B C5    1 
ATOM   325  C  C6    . C   A 1 15  ? -18.350 9.794   -3.936  1.00 38.86 ? 15  C   B C6    1 
ATOM   326  P  P     . G   A 1 16  ? -20.669 9.484   -10.081 1.00 48.20 ? 16  G   B P     1 
ATOM   327  O  OP1   . G   A 1 16  ? -21.205 10.346  -11.167 1.00 50.12 ? 16  G   B OP1   1 
ATOM   328  O  OP2   . G   A 1 16  ? -20.696 8.007   -10.234 1.00 48.15 ? 16  G   B OP2   1 
ATOM   329  O  "O5'" . G   A 1 16  ? -19.171 9.941   -9.779  1.00 48.64 ? 16  G   B "O5'" 1 
ATOM   330  C  "C5'" . G   A 1 16  ? -18.839 11.322  -9.701  1.00 50.02 ? 16  G   B "C5'" 1 
ATOM   331  C  "C4'" . G   A 1 16  ? -17.401 11.491  -9.284  1.00 52.88 ? 16  G   B "C4'" 1 
ATOM   332  O  "O4'" . G   A 1 16  ? -17.211 10.972  -7.945  1.00 53.10 ? 16  G   B "O4'" 1 
ATOM   333  C  "C3'" . G   A 1 16  ? -16.397 10.735  -10.131 1.00 54.54 ? 16  G   B "C3'" 1 
ATOM   334  O  "O3'" . G   A 1 16  ? -16.073 11.515  -11.275 1.00 59.43 ? 16  G   B "O3'" 1 
ATOM   335  C  "C2'" . G   A 1 16  ? -15.214 10.585  -9.181  1.00 54.11 ? 16  G   B "C2'" 1 
ATOM   336  O  "O2'" . G   A 1 16  ? -14.368 11.713  -9.132  1.00 54.25 ? 16  G   B "O2'" 1 
ATOM   337  C  "C1'" . G   A 1 16  ? -15.917 10.406  -7.833  1.00 53.02 ? 16  G   B "C1'" 1 
ATOM   338  N  N9    . G   A 1 16  ? -16.068 9.004   -7.458  1.00 51.85 ? 16  G   B N9    1 
ATOM   339  C  C8    . G   A 1 16  ? -17.065 8.144   -7.853  1.00 50.76 ? 16  G   B C8    1 
ATOM   340  N  N7    . G   A 1 16  ? -16.922 6.941   -7.367  1.00 50.34 ? 16  G   B N7    1 
ATOM   341  C  C5    . G   A 1 16  ? -15.764 7.014   -6.604  1.00 50.40 ? 16  G   B C5    1 
ATOM   342  C  C6    . G   A 1 16  ? -15.102 6.017   -5.840  1.00 50.01 ? 16  G   B C6    1 
ATOM   343  O  O6    . G   A 1 16  ? -15.418 4.835   -5.681  1.00 52.72 ? 16  G   B O6    1 
ATOM   344  N  N1    . G   A 1 16  ? -13.958 6.518   -5.225  1.00 49.19 ? 16  G   B N1    1 
ATOM   345  C  C2    . G   A 1 16  ? -13.509 7.813   -5.329  1.00 50.77 ? 16  G   B C2    1 
ATOM   346  N  N2    . G   A 1 16  ? -12.383 8.110   -4.663  1.00 48.06 ? 16  G   B N2    1 
ATOM   347  N  N3    . G   A 1 16  ? -14.121 8.750   -6.038  1.00 51.85 ? 16  G   B N3    1 
ATOM   348  C  C4    . G   A 1 16  ? -15.231 8.283   -6.645  1.00 50.12 ? 16  G   B C4    1 
ATOM   349  P  P     . A   A 1 17  ? -15.892 10.806  -12.703 1.00 62.49 ? 17  A   B P     1 
ATOM   350  O  OP1   . A   A 1 17  ? -15.623 11.878  -13.697 1.00 60.99 ? 17  A   B OP1   1 
ATOM   351  O  OP2   . A   A 1 17  ? -17.027 9.865   -12.920 1.00 60.58 ? 17  A   B OP2   1 
ATOM   352  O  "O5'" . A   A 1 17  ? -14.554 9.969   -12.521 1.00 63.35 ? 17  A   B "O5'" 1 
ATOM   353  C  "C5'" . A   A 1 17  ? -13.319 10.641  -12.347 1.00 67.92 ? 17  A   B "C5'" 1 
ATOM   354  C  "C4'" . A   A 1 17  ? -12.239 9.930   -13.111 1.00 71.45 ? 17  A   B "C4'" 1 
ATOM   355  O  "O4'" . A   A 1 17  ? -11.999 8.648   -12.478 1.00 71.23 ? 17  A   B "O4'" 1 
ATOM   356  C  "C3'" . A   A 1 17  ? -12.578 9.589   -14.554 1.00 74.32 ? 17  A   B "C3'" 1 
ATOM   357  O  "O3'" . A   A 1 17  ? -12.474 10.730  -15.430 1.00 80.56 ? 17  A   B "O3'" 1 
ATOM   358  C  "C2'" . A   A 1 17  ? -11.696 8.377   -14.819 1.00 73.36 ? 17  A   B "C2'" 1 
ATOM   359  O  "O2'" . A   A 1 17  ? -10.346 8.700   -15.069 1.00 74.61 ? 17  A   B "O2'" 1 
ATOM   360  C  "C1'" . A   A 1 17  ? -11.754 7.664   -13.465 1.00 71.36 ? 17  A   B "C1'" 1 
ATOM   361  N  N9    . A   A 1 17  ? -12.772 6.621   -13.328 1.00 68.77 ? 17  A   B N9    1 
ATOM   362  C  C8    . A   A 1 17  ? -14.024 6.550   -13.892 1.00 68.70 ? 17  A   B C8    1 
ATOM   363  N  N7    . A   A 1 17  ? -14.701 5.480   -13.542 1.00 66.36 ? 17  A   B N7    1 
ATOM   364  C  C5    . A   A 1 17  ? -13.836 4.802   -12.695 1.00 66.18 ? 17  A   B C5    1 
ATOM   365  C  C6    . A   A 1 17  ? -13.960 3.594   -11.988 1.00 66.84 ? 17  A   B C6    1 
ATOM   366  N  N6    . A   A 1 17  ? -15.055 2.832   -12.011 1.00 66.83 ? 17  A   B N6    1 
ATOM   367  N  N1    . A   A 1 17  ? -12.906 3.192   -11.242 1.00 66.71 ? 17  A   B N1    1 
ATOM   368  C  C2    . A   A 1 17  ? -11.809 3.965   -11.212 1.00 66.88 ? 17  A   B C2    1 
ATOM   369  N  N3    . A   A 1 17  ? -11.576 5.123   -11.828 1.00 65.42 ? 17  A   B N3    1 
ATOM   370  C  C4    . A   A 1 17  ? -12.641 5.488   -12.563 1.00 66.74 ? 17  A   B C4    1 
ATOM   371  P  P     . U   A 1 18  ? -11.047 11.200  -16.037 1.00 84.22 ? 18  U   B P     1 
ATOM   372  O  OP1   . U   A 1 18  ? -10.110 11.444  -14.909 1.00 84.13 ? 18  U   B OP1   1 
ATOM   373  O  OP2   . U   A 1 18  ? -11.347 12.306  -16.985 1.00 83.82 ? 18  U   B OP2   1 
ATOM   374  O  "O5'" . U   A 1 18  ? -10.526 9.950   -16.879 1.00 85.22 ? 18  U   B "O5'" 1 
ATOM   375  C  "C5'" . U   A 1 18  ? -9.765  10.121  -18.073 1.00 88.20 ? 18  U   B "C5'" 1 
ATOM   376  C  "C4'" . U   A 1 18  ? -8.383  9.516   -17.916 1.00 90.61 ? 18  U   B "C4'" 1 
ATOM   377  O  "O4'" . U   A 1 18  ? -7.481  10.451  -17.270 1.00 92.03 ? 18  U   B "O4'" 1 
ATOM   378  C  "C3'" . U   A 1 18  ? -8.278  8.256   -17.070 1.00 91.44 ? 18  U   B "C3'" 1 
ATOM   379  O  "O3'" . U   A 1 18  ? -8.649  7.102   -17.822 1.00 90.97 ? 18  U   B "O3'" 1 
ATOM   380  C  "C2'" . U   A 1 18  ? -6.796  8.234   -16.693 1.00 91.96 ? 18  U   B "C2'" 1 
ATOM   381  O  "O2'" . U   A 1 18  ? -5.977  7.644   -17.682 1.00 92.05 ? 18  U   B "O2'" 1 
ATOM   382  C  "C1'" . U   A 1 18  ? -6.466  9.728   -16.590 1.00 93.08 ? 18  U   B "C1'" 1 
ATOM   383  N  N1    . U   A 1 18  ? -6.346  10.253  -15.220 1.00 95.56 ? 18  U   B N1    1 
ATOM   384  C  C2    . U   A 1 18  ? -5.308  9.775   -14.431 1.00 96.33 ? 18  U   B C2    1 
ATOM   385  O  O2    . U   A 1 18  ? -4.520  8.927   -14.815 1.00 96.57 ? 18  U   B O2    1 
ATOM   386  N  N3    . U   A 1 18  ? -5.231  10.327  -13.175 1.00 97.15 ? 18  U   B N3    1 
ATOM   387  C  C4    . U   A 1 18  ? -6.071  11.283  -12.633 1.00 98.00 ? 18  U   B C4    1 
ATOM   388  O  O4    . U   A 1 18  ? -5.869  11.689  -11.486 1.00 97.85 ? 18  U   B O4    1 
ATOM   389  C  C5    . U   A 1 18  ? -7.124  11.717  -13.504 1.00 97.54 ? 18  U   B C5    1 
ATOM   390  C  C6    . U   A 1 18  ? -7.224  11.199  -14.736 1.00 96.63 ? 18  U   B C6    1 
ATOM   391  P  P     . U   A 1 19  ? -9.446  5.901   -17.107 1.00 89.15 ? 19  U   B P     1 
ATOM   392  O  OP1   . U   A 1 19  ? -9.597  4.798   -18.094 1.00 90.08 ? 19  U   B OP1   1 
ATOM   393  O  OP2   . U   A 1 19  ? -10.649 6.475   -16.464 1.00 89.45 ? 19  U   B OP2   1 
ATOM   394  O  "O5'" . U   A 1 19  ? -8.450  5.405   -15.971 1.00 88.13 ? 19  U   B "O5'" 1 
ATOM   395  C  "C5'" . U   A 1 19  ? -7.198  4.832   -16.319 1.00 87.97 ? 19  U   B "C5'" 1 
ATOM   396  C  "C4'" . U   A 1 19  ? -6.337  4.676   -15.093 1.00 87.73 ? 19  U   B "C4'" 1 
ATOM   397  O  "O4'" . U   A 1 19  ? -6.096  5.977   -14.511 1.00 88.92 ? 19  U   B "O4'" 1 
ATOM   398  C  "C3'" . U   A 1 19  ? -6.923  3.843   -13.964 1.00 87.33 ? 19  U   B "C3'" 1 
ATOM   399  O  "O3'" . U   A 1 19  ? -6.685  2.464   -14.287 1.00 83.64 ? 19  U   B "O3'" 1 
ATOM   400  C  "C2'" . U   A 1 19  ? -6.167  4.375   -12.743 1.00 88.68 ? 19  U   B "C2'" 1 
ATOM   401  O  "O2'" . U   A 1 19  ? -4.891  3.791   -12.569 1.00 91.02 ? 19  U   B "O2'" 1 
ATOM   402  C  "C1'" . U   A 1 19  ? -5.960  5.849   -13.110 1.00 89.46 ? 19  U   B "C1'" 1 
ATOM   403  N  N1    . U   A 1 19  ? -6.845  6.829   -12.464 1.00 90.18 ? 19  U   B N1    1 
ATOM   404  C  C2    . U   A 1 19  ? -6.675  7.063   -11.109 1.00 90.45 ? 19  U   B C2    1 
ATOM   405  O  O2    . U   A 1 19  ? -5.859  6.463   -10.430 1.00 90.12 ? 19  U   B O2    1 
ATOM   406  N  N3    . U   A 1 19  ? -7.498  8.026   -10.580 1.00 91.11 ? 19  U   B N3    1 
ATOM   407  C  C4    . U   A 1 19  ? -8.458  8.760   -11.251 1.00 91.45 ? 19  U   B C4    1 
ATOM   408  O  O4    . U   A 1 19  ? -9.102  9.616   -10.641 1.00 92.22 ? 19  U   B O4    1 
ATOM   409  C  C5    . U   A 1 19  ? -8.585  8.447   -12.641 1.00 90.88 ? 19  U   B C5    1 
ATOM   410  C  C6    . U   A 1 19  ? -7.797  7.513   -13.186 1.00 90.35 ? 19  U   B C6    1 
ATOM   411  P  P     . C   A 1 20  ? -6.616  1.340   -13.134 1.00 81.00 ? 20  C   B P     1 
ATOM   412  O  OP1   . C   A 1 20  ? -6.256  1.934   -11.821 1.00 82.87 ? 20  C   B OP1   1 
ATOM   413  O  OP2   . C   A 1 20  ? -5.777  0.250   -13.695 1.00 81.43 ? 20  C   B OP2   1 
ATOM   414  O  "O5'" . C   A 1 20  ? -8.097  0.770   -12.992 1.00 76.81 ? 20  C   B "O5'" 1 
ATOM   415  C  "C5'" . C   A 1 20  ? -8.404  -0.158  -11.951 1.00 67.20 ? 20  C   B "C5'" 1 
ATOM   416  C  "C4'" . C   A 1 20  ? -9.777  -0.753  -12.150 1.00 61.79 ? 20  C   B "C4'" 1 
ATOM   417  O  "O4'" . C   A 1 20  ? -10.785 0.280   -11.996 1.00 59.84 ? 20  C   B "O4'" 1 
ATOM   418  C  "C3'" . C   A 1 20  ? -10.059 -1.356  -13.516 1.00 57.73 ? 20  C   B "C3'" 1 
ATOM   419  O  "O3'" . C   A 1 20  ? -9.563  -2.688  -13.590 1.00 53.69 ? 20  C   B "O3'" 1 
ATOM   420  C  "C2'" . C   A 1 20  ? -11.579 -1.325  -13.557 1.00 57.18 ? 20  C   B "C2'" 1 
ATOM   421  O  "O2'" . C   A 1 20  ? -12.150 -2.380  -12.809 1.00 57.93 ? 20  C   B "O2'" 1 
ATOM   422  C  "C1'" . C   A 1 20  ? -11.875 0.007   -12.860 1.00 57.09 ? 20  C   B "C1'" 1 
ATOM   423  N  N1    . C   A 1 20  ? -12.029 1.142   -13.790 1.00 54.33 ? 20  C   B N1    1 
ATOM   424  C  C2    . C   A 1 20  ? -13.250 1.300   -14.455 1.00 52.81 ? 20  C   B C2    1 
ATOM   425  O  O2    . C   A 1 20  ? -14.151 0.475   -14.255 1.00 55.06 ? 20  C   B O2    1 
ATOM   426  N  N3    . C   A 1 20  ? -13.417 2.343   -15.300 1.00 50.64 ? 20  C   B N3    1 
ATOM   427  C  C4    . C   A 1 20  ? -12.419 3.205   -15.496 1.00 48.58 ? 20  C   B C4    1 
ATOM   428  N  N4    . C   A 1 20  ? -12.633 4.219   -16.333 1.00 44.97 ? 20  C   B N4    1 
ATOM   429  C  C5    . C   A 1 20  ? -11.158 3.062   -14.841 1.00 48.64 ? 20  C   B C5    1 
ATOM   430  C  C6    . C   A 1 20  ? -11.009 2.028   -14.003 1.00 50.64 ? 20  C   B C6    1 
ATOM   431  P  P     . C   A 1 21  ? -9.166  -3.315  -15.015 1.00 52.88 ? 21  C   B P     1 
ATOM   432  O  OP1   . C   A 1 21  ? -8.457  -4.595  -14.788 1.00 52.84 ? 21  C   B OP1   1 
ATOM   433  O  OP2   . C   A 1 21  ? -8.508  -2.248  -15.814 1.00 53.09 ? 21  C   B OP2   1 
ATOM   434  O  "O5'" . C   A 1 21  ? -10.569 -3.633  -15.698 1.00 50.60 ? 21  C   B "O5'" 1 
ATOM   435  C  "C5'" . C   A 1 21  ? -11.489 -4.540  -15.098 1.00 48.28 ? 21  C   B "C5'" 1 
ATOM   436  C  "C4'" . C   A 1 21  ? -12.764 -4.595  -15.905 1.00 47.09 ? 21  C   B "C4'" 1 
ATOM   437  O  "O4'" . C   A 1 21  ? -13.430 -3.305  -15.849 1.00 47.94 ? 21  C   B "O4'" 1 
ATOM   438  C  "C3'" . C   A 1 21  ? -12.572 -4.851  -17.391 1.00 46.84 ? 21  C   B "C3'" 1 
ATOM   439  O  "O3'" . C   A 1 21  ? -12.446 -6.244  -17.640 1.00 46.05 ? 21  C   B "O3'" 1 
ATOM   440  C  "C2'" . C   A 1 21  ? -13.843 -4.258  -17.993 1.00 46.04 ? 21  C   B "C2'" 1 
ATOM   441  O  "O2'" . C   A 1 21  ? -14.961 -5.115  -17.891 1.00 43.86 ? 21  C   B "O2'" 1 
ATOM   442  C  "C1'" . C   A 1 21  ? -14.070 -3.045  -17.088 1.00 46.75 ? 21  C   B "C1'" 1 
ATOM   443  N  N1    . C   A 1 21  ? -13.569 -1.765  -17.619 1.00 44.89 ? 21  C   B N1    1 
ATOM   444  C  C2    . C   A 1 21  ? -14.351 -1.078  -18.550 1.00 45.03 ? 21  C   B C2    1 
ATOM   445  O  O2    . C   A 1 21  ? -15.407 -1.601  -18.942 1.00 47.34 ? 21  C   B O2    1 
ATOM   446  N  N3    . C   A 1 21  ? -13.941 0.133   -19.001 1.00 43.69 ? 21  C   B N3    1 
ATOM   447  C  C4    . C   A 1 21  ? -12.795 0.654   -18.557 1.00 44.61 ? 21  C   B C4    1 
ATOM   448  N  N4    . C   A 1 21  ? -12.450 1.869   -18.990 1.00 41.90 ? 21  C   B N4    1 
ATOM   449  C  C5    . C   A 1 21  ? -11.956 -0.046  -17.636 1.00 44.64 ? 21  C   B C5    1 
ATOM   450  C  C6    . C   A 1 21  ? -12.379 -1.242  -17.197 1.00 44.50 ? 21  C   B C6    1 
ATOM   451  P  P     . G   A 1 22  ? -11.588 -6.752  -18.897 1.00 47.58 ? 22  G   B P     1 
ATOM   452  O  OP1   . G   A 1 22  ? -11.535 -8.231  -18.829 1.00 48.84 ? 22  G   B OP1   1 
ATOM   453  O  OP2   . G   A 1 22  ? -10.326 -5.973  -18.943 1.00 47.36 ? 22  G   B OP2   1 
ATOM   454  O  "O5'" . G   A 1 22  ? -12.491 -6.347  -20.143 1.00 47.94 ? 22  G   B "O5'" 1 
ATOM   455  C  "C5'" . G   A 1 22  ? -11.943 -5.707  -21.290 1.00 46.38 ? 22  G   B "C5'" 1 
ATOM   456  C  "C4'" . G   A 1 22  ? -13.043 -4.999  -22.040 1.00 46.35 ? 22  G   B "C4'" 1 
ATOM   457  O  "O4'" . G   A 1 22  ? -13.465 -3.842  -21.271 1.00 48.24 ? 22  G   B "O4'" 1 
ATOM   458  C  "C3'" . G   A 1 22  ? -12.684 -4.408  -23.392 1.00 46.65 ? 22  G   B "C3'" 1 
ATOM   459  O  "O3'" . G   A 1 22  ? -12.728 -5.414  -24.397 1.00 48.03 ? 22  G   B "O3'" 1 
ATOM   460  C  "C2'" . G   A 1 22  ? -13.790 -3.375  -23.576 1.00 46.80 ? 22  G   B "C2'" 1 
ATOM   461  O  "O2'" . G   A 1 22  ? -15.021 -3.929  -23.993 1.00 46.09 ? 22  G   B "O2'" 1 
ATOM   462  C  "C1'" . G   A 1 22  ? -13.934 -2.832  -22.152 1.00 46.85 ? 22  G   B "C1'" 1 
ATOM   463  N  N9    . G   A 1 22  ? -13.130 -1.627  -21.979 1.00 46.01 ? 22  G   B N9    1 
ATOM   464  C  C8    . G   A 1 22  ? -12.039 -1.430  -21.161 1.00 45.05 ? 22  G   B C8    1 
ATOM   465  N  N7    . G   A 1 22  ? -11.512 -0.240  -21.291 1.00 43.51 ? 22  G   B N7    1 
ATOM   466  C  C5    . G   A 1 22  ? -12.312 0.388   -22.239 1.00 43.39 ? 22  G   B C5    1 
ATOM   467  C  C6    . G   A 1 22  ? -12.235 1.695   -22.805 1.00 43.41 ? 22  G   B C6    1 
ATOM   468  O  O6    . G   A 1 22  ? -11.420 2.594   -22.562 1.00 43.25 ? 22  G   B O6    1 
ATOM   469  N  N1    . G   A 1 22  ? -13.244 1.907   -23.744 1.00 40.61 ? 22  G   B N1    1 
ATOM   470  C  C2    . G   A 1 22  ? -14.207 0.987   -24.092 1.00 40.80 ? 22  G   B C2    1 
ATOM   471  N  N2    . G   A 1 22  ? -15.090 1.359   -25.026 1.00 41.12 ? 22  G   B N2    1 
ATOM   472  N  N3    . G   A 1 22  ? -14.296 -0.218  -23.566 1.00 42.82 ? 22  G   B N3    1 
ATOM   473  C  C4    . G   A 1 22  ? -13.321 -0.451  -22.660 1.00 44.94 ? 22  G   B C4    1 
ATOM   474  P  P     . C   A 1 23  ? -11.766 -5.308  -25.678 1.00 46.34 ? 23  C   B P     1 
ATOM   475  O  OP1   . C   A 1 23  ? -11.810 -6.600  -26.405 1.00 49.16 ? 23  C   B OP1   1 
ATOM   476  O  OP2   . C   A 1 23  ? -10.463 -4.761  -25.226 1.00 45.84 ? 23  C   B OP2   1 
ATOM   477  O  "O5'" . C   A 1 23  ? -12.489 -4.230  -26.590 1.00 49.40 ? 23  C   B "O5'" 1 
ATOM   478  C  "C5'" . C   A 1 23  ? -13.868 -4.357  -26.903 1.00 50.45 ? 23  C   B "C5'" 1 
ATOM   479  C  "C4'" . C   A 1 23  ? -14.316 -3.166  -27.703 1.00 53.75 ? 23  C   B "C4'" 1 
ATOM   480  O  "O4'" . C   A 1 23  ? -14.366 -1.980  -26.868 1.00 54.67 ? 23  C   B "O4'" 1 
ATOM   481  C  "C3'" . C   A 1 23  ? -13.356 -2.784  -28.805 1.00 54.87 ? 23  C   B "C3'" 1 
ATOM   482  O  "O3'" . C   A 1 23  ? -13.551 -3.639  -29.916 1.00 58.29 ? 23  C   B "O3'" 1 
ATOM   483  C  "C2'" . C   A 1 23  ? -13.728 -1.329  -29.057 1.00 54.53 ? 23  C   B "C2'" 1 
ATOM   484  O  "O2'" . C   A 1 23  ? -14.918 -1.178  -29.801 1.00 53.42 ? 23  C   B "O2'" 1 
ATOM   485  C  "C1'" . C   A 1 23  ? -13.993 -0.844  -27.632 1.00 53.99 ? 23  C   B "C1'" 1 
ATOM   486  N  N1    . C   A 1 23  ? -12.826 -0.213  -26.990 1.00 53.93 ? 23  C   B N1    1 
ATOM   487  C  C2    . C   A 1 23  ? -12.579 1.147   -27.231 1.00 53.56 ? 23  C   B C2    1 
ATOM   488  O  O2    . C   A 1 23  ? -13.341 1.772   -27.986 1.00 54.16 ? 23  C   B O2    1 
ATOM   489  N  N3    . C   A 1 23  ? -11.522 1.743   -26.635 1.00 52.45 ? 23  C   B N3    1 
ATOM   490  C  C4    . C   A 1 23  ? -10.727 1.039   -25.828 1.00 52.48 ? 23  C   B C4    1 
ATOM   491  N  N4    . C   A 1 23  ? -9.699  1.675   -25.252 1.00 50.85 ? 23  C   B N4    1 
ATOM   492  C  C5    . C   A 1 23  ? -10.951 -0.349  -25.572 1.00 52.62 ? 23  C   B C5    1 
ATOM   493  C  C6    . C   A 1 23  ? -12.000 -0.929  -26.170 1.00 51.92 ? 23  C   B C6    1 
ATOM   494  P  P     . C   A 1 24  ? -12.423 -3.731  -31.050 1.00 62.42 ? 24  C   B P     1 
ATOM   495  O  OP1   . C   A 1 24  ? -12.635 -4.977  -31.834 1.00 62.33 ? 24  C   B OP1   1 
ATOM   496  O  OP2   . C   A 1 24  ? -11.089 -3.460  -30.445 1.00 60.69 ? 24  C   B OP2   1 
ATOM   497  O  "O5'" . C   A 1 24  ? -12.786 -2.494  -31.972 1.00 63.85 ? 24  C   B "O5'" 1 
ATOM   498  C  "C5'" . C   A 1 24  ? -11.790 -1.859  -32.733 1.00 65.89 ? 24  C   B "C5'" 1 
ATOM   499  C  "C4'" . C   A 1 24  ? -12.301 -0.554  -33.265 1.00 65.97 ? 24  C   B "C4'" 1 
ATOM   500  O  "O4'" . C   A 1 24  ? -12.736 0.291   -32.167 1.00 65.74 ? 24  C   B "O4'" 1 
ATOM   501  C  "C3'" . C   A 1 24  ? -11.206 0.230   -33.953 1.00 66.97 ? 24  C   B "C3'" 1 
ATOM   502  O  "O3'" . C   A 1 24  ? -11.086 -0.219  -35.290 1.00 69.70 ? 24  C   B "O3'" 1 
ATOM   503  C  "C2'" . C   A 1 24  ? -11.677 1.664   -33.775 1.00 65.42 ? 24  C   B "C2'" 1 
ATOM   504  O  "O2'" . C   A 1 24  ? -12.708 2.025   -34.668 1.00 65.24 ? 24  C   B "O2'" 1 
ATOM   505  C  "C1'" . C   A 1 24  ? -12.215 1.600   -32.343 1.00 64.03 ? 24  C   B "C1'" 1 
ATOM   506  N  N1    . C   A 1 24  ? -11.159 1.793   -31.337 1.00 60.79 ? 24  C   B N1    1 
ATOM   507  C  C2    . C   A 1 24  ? -10.516 3.026   -31.268 1.00 59.96 ? 24  C   B C2    1 
ATOM   508  O  O2    . C   A 1 24  ? -10.852 3.918   -32.062 1.00 61.18 ? 24  C   B O2    1 
ATOM   509  N  N3    . C   A 1 24  ? -9.546  3.217   -30.342 1.00 58.55 ? 24  C   B N3    1 
ATOM   510  C  C4    . C   A 1 24  ? -9.219  2.229   -29.507 1.00 58.73 ? 24  C   B C4    1 
ATOM   511  N  N4    . C   A 1 24  ? -8.269  2.465   -28.600 1.00 59.22 ? 24  C   B N4    1 
ATOM   512  C  C5    . C   A 1 24  ? -9.855  0.955   -29.562 1.00 58.08 ? 24  C   B C5    1 
ATOM   513  C  C6    . C   A 1 24  ? -10.811 0.782   -30.483 1.00 58.97 ? 24  C   B C6    1 
ATOM   514  P  P     . C   A 1 25  ? -9.732  -0.944  -35.753 1.00 70.63 ? 25  C   B P     1 
ATOM   515  O  OP1   . C   A 1 25  ? -10.027 -1.781  -36.946 1.00 69.06 ? 25  C   B OP1   1 
ATOM   516  O  OP2   . C   A 1 25  ? -9.129  -1.570  -34.549 1.00 70.46 ? 25  C   B OP2   1 
ATOM   517  O  "O5'" . C   A 1 25  ? -8.814  0.287   -36.170 1.00 71.65 ? 25  C   B "O5'" 1 
ATOM   518  C  "C5'" . C   A 1 25  ? -9.364  1.365   -36.922 1.00 72.59 ? 25  C   B "C5'" 1 
ATOM   519  C  "C4'" . C   A 1 25  ? -8.540  2.611   -36.729 1.00 73.33 ? 25  C   B "C4'" 1 
ATOM   520  O  "O4'" . C   A 1 25  ? -8.766  3.169   -35.409 1.00 72.78 ? 25  C   B "O4'" 1 
ATOM   521  C  "C3'" . C   A 1 25  ? -7.039  2.399   -36.771 1.00 74.47 ? 25  C   B "C3'" 1 
ATOM   522  O  "O3'" . C   A 1 25  ? -6.572  2.261   -38.105 1.00 75.84 ? 25  C   B "O3'" 1 
ATOM   523  C  "C2'" . C   A 1 25  ? -6.533  3.652   -36.065 1.00 73.58 ? 25  C   B "C2'" 1 
ATOM   524  O  "O2'" . C   A 1 25  ? -6.544  4.810   -36.880 1.00 73.86 ? 25  C   B "O2'" 1 
ATOM   525  C  "C1'" . C   A 1 25  ? -7.577  3.802   -34.957 1.00 72.19 ? 25  C   B "C1'" 1 
ATOM   526  N  N1    . C   A 1 25  ? -7.161  3.164   -33.702 1.00 70.47 ? 25  C   B N1    1 
ATOM   527  C  C2    . C   A 1 25  ? -6.161  3.776   -32.937 1.00 69.38 ? 25  C   B C2    1 
ATOM   528  O  O2    . C   A 1 25  ? -5.650  4.832   -33.349 1.00 67.47 ? 25  C   B O2    1 
ATOM   529  N  N3    . C   A 1 25  ? -5.778  3.203   -31.773 1.00 69.08 ? 25  C   B N3    1 
ATOM   530  C  C4    . C   A 1 25  ? -6.349  2.065   -31.370 1.00 68.97 ? 25  C   B C4    1 
ATOM   531  N  N4    . C   A 1 25  ? -5.940  1.536   -30.215 1.00 70.18 ? 25  C   B N4    1 
ATOM   532  C  C5    . C   A 1 25  ? -7.365  1.418   -32.134 1.00 68.44 ? 25  C   B C5    1 
ATOM   533  C  C6    . C   A 1 25  ? -7.736  1.997   -33.282 1.00 69.39 ? 25  C   B C6    1 
ATOM   534  P  P     . U   A 1 26  ? -5.309  1.315   -38.404 1.00 75.95 ? 26  U   B P     1 
ATOM   535  O  OP1   . U   A 1 26  ? -5.098  1.270   -39.874 1.00 75.95 ? 26  U   B OP1   1 
ATOM   536  O  OP2   . U   A 1 26  ? -5.506  0.051   -37.648 1.00 76.76 ? 26  U   B OP2   1 
ATOM   537  O  "O5'" . U   A 1 26  ? -4.103  2.118   -37.751 1.00 75.06 ? 26  U   B "O5'" 1 
ATOM   538  C  "C5'" . U   A 1 26  ? -3.854  3.461   -38.138 1.00 74.69 ? 26  U   B "C5'" 1 
ATOM   539  C  "C4'" . U   A 1 26  ? -2.851  4.090   -37.214 1.00 74.93 ? 26  U   B "C4'" 1 
ATOM   540  O  "O4'" . U   A 1 26  ? -3.419  4.217   -35.884 1.00 75.17 ? 26  U   B "O4'" 1 
ATOM   541  C  "C3'" . U   A 1 26  ? -1.594  3.281   -36.978 1.00 75.80 ? 26  U   B "C3'" 1 
ATOM   542  O  "O3'" . U   A 1 26  ? -0.682  3.409   -38.061 1.00 77.48 ? 26  U   B "O3'" 1 
ATOM   543  C  "C2'" . U   A 1 26  ? -1.075  3.904   -35.690 1.00 76.15 ? 26  U   B "C2'" 1 
ATOM   544  O  "O2'" . U   A 1 26  ? -0.452  5.157   -35.914 1.00 75.76 ? 26  U   B "O2'" 1 
ATOM   545  C  "C1'" . U   A 1 26  ? -2.383  4.107   -34.917 1.00 75.28 ? 26  U   B "C1'" 1 
ATOM   546  N  N1    . U   A 1 26  ? -2.704  2.993   -34.010 1.00 73.83 ? 26  U   B N1    1 
ATOM   547  C  C2    . U   A 1 26  ? -2.130  3.003   -32.746 1.00 73.61 ? 26  U   B C2    1 
ATOM   548  O  O2    . U   A 1 26  ? -1.377  3.884   -32.364 1.00 73.15 ? 26  U   B O2    1 
ATOM   549  N  N3    . U   A 1 26  ? -2.469  1.940   -31.947 1.00 73.38 ? 26  U   B N3    1 
ATOM   550  C  C4    . U   A 1 26  ? -3.304  0.888   -32.271 1.00 73.88 ? 26  U   B C4    1 
ATOM   551  O  O4    . U   A 1 26  ? -3.525  0.009   -31.431 1.00 72.82 ? 26  U   B O4    1 
ATOM   552  C  C5    . U   A 1 26  ? -3.853  0.948   -33.596 1.00 72.92 ? 26  U   B C5    1 
ATOM   553  C  C6    . U   A 1 26  ? -3.543  1.972   -34.398 1.00 72.89 ? 26  U   B C6    1 
ATOM   554  P  P     . G   A 1 27  ? 0.509   2.342   -38.221 1.00 77.41 ? 27  G   B P     1 
ATOM   555  O  OP1   . G   A 1 27  ? 1.017   2.389   -39.615 1.00 76.99 ? 27  G   B OP1   1 
ATOM   556  O  OP2   . G   A 1 27  ? 0.020   1.056   -37.660 1.00 77.41 ? 27  G   B OP2   1 
ATOM   557  O  "O5'" . G   A 1 27  ? 1.638   2.917   -37.259 1.00 75.45 ? 27  G   B "O5'" 1 
ATOM   558  C  "C5'" . G   A 1 27  ? 2.158   4.222   -37.470 1.00 74.68 ? 27  G   B "C5'" 1 
ATOM   559  C  "C4'" . G   A 1 27  ? 3.229   4.524   -36.458 1.00 74.39 ? 27  G   B "C4'" 1 
ATOM   560  O  "O4'" . G   A 1 27  ? 2.631   4.721   -35.147 1.00 75.22 ? 27  G   B "O4'" 1 
ATOM   561  C  "C3'" . G   A 1 27  ? 4.226   3.408   -36.217 1.00 75.23 ? 27  G   B "C3'" 1 
ATOM   562  O  "O3'" . G   A 1 27  ? 5.195   3.303   -37.255 1.00 75.83 ? 27  G   B "O3'" 1 
ATOM   563  C  "C2'" . G   A 1 27  ? 4.800   3.815   -34.866 1.00 74.83 ? 27  G   B "C2'" 1 
ATOM   564  O  "O2'" . G   A 1 27  ? 5.703   4.902   -34.948 1.00 73.85 ? 27  G   B "O2'" 1 
ATOM   565  C  "C1'" . G   A 1 27  ? 3.529   4.263   -34.142 1.00 73.75 ? 27  G   B "C1'" 1 
ATOM   566  N  N9    . G   A 1 27  ? 2.899   3.159   -33.422 1.00 71.73 ? 27  G   B N9    1 
ATOM   567  C  C8    . G   A 1 27  ? 1.818   2.407   -33.823 1.00 70.89 ? 27  G   B C8    1 
ATOM   568  N  N7    . G   A 1 27  ? 1.500   1.470   -32.971 1.00 69.96 ? 27  G   B N7    1 
ATOM   569  C  C5    . G   A 1 27  ? 2.423   1.613   -31.942 1.00 70.22 ? 27  G   B C5    1 
ATOM   570  C  C6    . G   A 1 27  ? 2.584   0.874   -30.734 1.00 70.50 ? 27  G   B C6    1 
ATOM   571  O  O6    . G   A 1 27  ? 1.921   -0.091  -30.321 1.00 69.82 ? 27  G   B O6    1 
ATOM   572  N  N1    . G   A 1 27  ? 3.648   1.361   -29.977 1.00 70.10 ? 27  G   B N1    1 
ATOM   573  C  C2    . G   A 1 27  ? 4.455   2.417   -30.332 1.00 69.73 ? 27  G   B C2    1 
ATOM   574  N  N2    . G   A 1 27  ? 5.429   2.739   -29.463 1.00 68.56 ? 27  G   B N2    1 
ATOM   575  N  N3    . G   A 1 27  ? 4.318   3.108   -31.453 1.00 69.49 ? 27  G   B N3    1 
ATOM   576  C  C4    . G   A 1 27  ? 3.290   2.655   -32.204 1.00 70.43 ? 27  G   B C4    1 
ATOM   577  P  P     . G   A 1 28  ? 5.891   1.880   -37.548 1.00 76.68 ? 28  G   B P     1 
ATOM   578  O  OP1   . G   A 1 28  ? 6.750   2.029   -38.753 1.00 75.60 ? 28  G   B OP1   1 
ATOM   579  O  OP2   . G   A 1 28  ? 4.841   0.828   -37.522 1.00 75.65 ? 28  G   B OP2   1 
ATOM   580  O  "O5'" . G   A 1 28  ? 6.830   1.673   -36.277 1.00 73.82 ? 28  G   B "O5'" 1 
ATOM   581  C  "C5'" . G   A 1 28  ? 7.709   2.715   -35.863 1.00 70.78 ? 28  G   B "C5'" 1 
ATOM   582  C  "C4'" . G   A 1 28  ? 8.381   2.360   -34.559 1.00 69.76 ? 28  G   B "C4'" 1 
ATOM   583  O  "O4'" . G   A 1 28  ? 7.451   2.448   -33.442 1.00 68.51 ? 28  G   B "O4'" 1 
ATOM   584  C  "C3'" . G   A 1 28  ? 8.899   0.943   -34.451 1.00 69.08 ? 28  G   B "C3'" 1 
ATOM   585  O  "O3'" . G   A 1 28  ? 10.091  0.747   -35.191 1.00 68.75 ? 28  G   B "O3'" 1 
ATOM   586  C  "C2'" . G   A 1 28  ? 9.093   0.820   -32.947 1.00 68.02 ? 28  G   B "C2'" 1 
ATOM   587  O  "O2'" . G   A 1 28  ? 10.223  1.538   -32.485 1.00 67.24 ? 28  G   B "O2'" 1 
ATOM   588  C  "C1'" . G   A 1 28  ? 7.819   1.500   -32.444 1.00 65.58 ? 28  G   B "C1'" 1 
ATOM   589  N  N9    . G   A 1 28  ? 6.729   0.541   -32.294 1.00 61.92 ? 28  G   B N9    1 
ATOM   590  C  C8    . G   A 1 28  ? 5.751   0.245   -33.215 1.00 60.03 ? 28  G   B C8    1 
ATOM   591  N  N7    . G   A 1 28  ? 4.913   -0.666  -32.800 1.00 58.09 ? 28  G   B N7    1 
ATOM   592  C  C5    . G   A 1 28  ? 5.362   -0.991  -31.525 1.00 57.94 ? 28  G   B C5    1 
ATOM   593  C  C6    . G   A 1 28  ? 4.850   -1.918  -30.578 1.00 56.52 ? 28  G   B C6    1 
ATOM   594  O  O6    . G   A 1 28  ? 3.860   -2.654  -30.678 1.00 55.08 ? 28  G   B O6    1 
ATOM   595  N  N1    . G   A 1 28  ? 5.614   -1.935  -29.413 1.00 54.89 ? 28  G   B N1    1 
ATOM   596  C  C2    . G   A 1 28  ? 6.724   -1.158  -29.185 1.00 56.73 ? 28  G   B C2    1 
ATOM   597  N  N2    . G   A 1 28  ? 7.327   -1.320  -27.996 1.00 54.67 ? 28  G   B N2    1 
ATOM   598  N  N3    . G   A 1 28  ? 7.209   -0.286  -30.058 1.00 57.75 ? 28  G   B N3    1 
ATOM   599  C  C4    . G   A 1 28  ? 6.483   -0.255  -31.198 1.00 59.41 ? 28  G   B C4    1 
ATOM   600  P  P     . G   A 1 29  ? 10.599  -0.748  -35.470 1.00 68.88 ? 29  G   B P     1 
ATOM   601  O  OP1   . G   A 1 29  ? 11.711  -0.689  -36.455 1.00 69.30 ? 29  G   B OP1   1 
ATOM   602  O  OP2   . G   A 1 29  ? 9.414   -1.611  -35.742 1.00 66.96 ? 29  G   B OP2   1 
ATOM   603  O  "O5'" . G   A 1 29  ? 11.189  -1.161  -34.055 1.00 64.70 ? 29  G   B "O5'" 1 
ATOM   604  C  "C5'" . G   A 1 29  ? 11.340  -2.513  -33.701 1.00 59.55 ? 29  G   B "C5'" 1 
ATOM   605  C  "C4'" . G   A 1 29  ? 11.517  -2.627  -32.215 1.00 56.76 ? 29  G   B "C4'" 1 
ATOM   606  O  "O4'" . G   A 1 29  ? 10.342  -2.103  -31.540 1.00 56.29 ? 29  G   B "O4'" 1 
ATOM   607  C  "C3'" . G   A 1 29  ? 11.635  -4.060  -31.748 1.00 55.31 ? 29  G   B "C3'" 1 
ATOM   608  O  "O3'" . G   A 1 29  ? 12.989  -4.477  -31.860 1.00 52.56 ? 29  G   B "O3'" 1 
ATOM   609  C  "C2'" . G   A 1 29  ? 11.100  -3.984  -30.324 1.00 54.12 ? 29  G   B "C2'" 1 
ATOM   610  O  "O2'" . G   A 1 29  ? 12.040  -3.475  -29.402 1.00 54.31 ? 29  G   B "O2'" 1 
ATOM   611  C  "C1'" . G   A 1 29  ? 9.952   -2.986  -30.500 1.00 53.26 ? 29  G   B "C1'" 1 
ATOM   612  N  N9    . G   A 1 29  ? 8.696   -3.611  -30.907 1.00 49.85 ? 29  G   B N9    1 
ATOM   613  C  C8    . G   A 1 29  ? 8.038   -3.424  -32.101 1.00 48.66 ? 29  G   B C8    1 
ATOM   614  N  N7    . G   A 1 29  ? 6.929   -4.107  -32.189 1.00 46.97 ? 29  G   B N7    1 
ATOM   615  C  C5    . G   A 1 29  ? 6.850   -4.788  -30.981 1.00 46.31 ? 29  G   B C5    1 
ATOM   616  C  C6    . G   A 1 29  ? 5.865   -5.682  -30.497 1.00 43.76 ? 29  G   B C6    1 
ATOM   617  O  O6    . G   A 1 29  ? 4.838   -6.060  -31.053 1.00 42.43 ? 29  G   B O6    1 
ATOM   618  N  N1    . G   A 1 29  ? 6.171   -6.143  -29.222 1.00 43.62 ? 29  G   B N1    1 
ATOM   619  C  C2    . G   A 1 29  ? 7.281   -5.786  -28.502 1.00 44.31 ? 29  G   B C2    1 
ATOM   620  N  N2    . G   A 1 29  ? 7.391   -6.324  -27.278 1.00 41.86 ? 29  G   B N2    1 
ATOM   621  N  N3    . G   A 1 29  ? 8.213   -4.956  -28.944 1.00 46.01 ? 29  G   B N3    1 
ATOM   622  C  C4    . G   A 1 29  ? 7.934   -4.496  -30.180 1.00 46.72 ? 29  G   B C4    1 
ATOM   623  P  P     . C   A 1 30  ? 13.323  -5.878  -32.566 1.00 54.02 ? 30  C   B P     1 
ATOM   624  O  OP1   . C   A 1 30  ? 14.799  -6.010  -32.695 1.00 52.54 ? 30  C   B OP1   1 
ATOM   625  O  OP2   . C   A 1 30  ? 12.462  -5.997  -33.776 1.00 49.77 ? 30  C   B OP2   1 
ATOM   626  O  "O5'" . C   A 1 30  ? 12.816  -6.938  -31.492 1.00 49.72 ? 30  C   B "O5'" 1 
ATOM   627  C  "C5'" . C   A 1 30  ? 13.277  -6.871  -30.152 1.00 44.28 ? 30  C   B "C5'" 1 
ATOM   628  C  "C4'" . C   A 1 30  ? 12.441  -7.754  -29.264 1.00 43.13 ? 30  C   B "C4'" 1 
ATOM   629  O  "O4'" . C   A 1 30  ? 11.099  -7.210  -29.147 1.00 42.14 ? 30  C   B "O4'" 1 
ATOM   630  C  "C3'" . C   A 1 30  ? 12.200  -9.174  -29.751 1.00 39.78 ? 30  C   B "C3'" 1 
ATOM   631  O  "O3'" . C   A 1 30  ? 13.330  -10.001 -29.500 1.00 37.27 ? 30  C   B "O3'" 1 
ATOM   632  C  "C2'" . C   A 1 30  ? 11.005  -9.563  -28.897 1.00 39.83 ? 30  C   B "C2'" 1 
ATOM   633  O  "O2'" . C   A 1 30  ? 11.374  -9.833  -27.563 1.00 38.67 ? 30  C   B "O2'" 1 
ATOM   634  C  "C1'" . C   A 1 30  ? 10.187  -8.268  -28.921 1.00 41.02 ? 30  C   B "C1'" 1 
ATOM   635  N  N1    . C   A 1 30  ? 9.177   -8.268  -29.995 1.00 41.88 ? 30  C   B N1    1 
ATOM   636  C  C2    . C   A 1 30  ? 7.998   -8.993  -29.794 1.00 39.49 ? 30  C   B C2    1 
ATOM   637  O  O2    . C   A 1 30  ? 7.830   -9.574  -28.705 1.00 40.58 ? 30  C   B O2    1 
ATOM   638  N  N3    . C   A 1 30  ? 7.077   -9.044  -30.777 1.00 37.67 ? 30  C   B N3    1 
ATOM   639  C  C4    . C   A 1 30  ? 7.286   -8.399  -31.921 1.00 39.04 ? 30  C   B C4    1 
ATOM   640  N  N4    . C   A 1 30  ? 6.343   -8.488  -32.865 1.00 39.04 ? 30  C   B N4    1 
ATOM   641  C  C5    . C   A 1 30  ? 8.471   -7.636  -32.152 1.00 40.14 ? 30  C   B C5    1 
ATOM   642  C  C6    . C   A 1 30  ? 9.381   -7.595  -31.168 1.00 40.89 ? 30  C   B C6    1 
ATOM   643  P  P     . C   A 1 31  ? 13.565  -11.333 -30.375 1.00 35.48 ? 31  C   B P     1 
ATOM   644  O  OP1   . C   A 1 31  ? 14.892  -11.883 -30.005 1.00 36.73 ? 31  C   B OP1   1 
ATOM   645  O  OP2   . C   A 1 31  ? 13.267  -11.052 -31.797 1.00 37.46 ? 31  C   B OP2   1 
ATOM   646  O  "O5'" . C   A 1 31  ? 12.455  -12.342 -29.841 1.00 36.70 ? 31  C   B "O5'" 1 
ATOM   647  C  "C5'" . C   A 1 31  ? 12.526  -12.852 -28.518 1.00 32.78 ? 31  C   B "C5'" 1 
ATOM   648  C  "C4'" . C   A 1 31  ? 11.281  -13.624 -28.194 1.00 33.31 ? 31  C   B "C4'" 1 
ATOM   649  O  "O4'" . C   A 1 31  ? 10.125  -12.771 -28.400 1.00 33.78 ? 31  C   B "O4'" 1 
ATOM   650  C  "C3'" . C   A 1 31  ? 11.013  -14.830 -29.075 1.00 32.44 ? 31  C   B "C3'" 1 
ATOM   651  O  "O3'" . C   A 1 31  ? 11.757  -15.943 -28.595 1.00 30.63 ? 31  C   B "O3'" 1 
ATOM   652  C  "C2'" . C   A 1 31  ? 9.504   -15.010 -28.911 1.00 32.69 ? 31  C   B "C2'" 1 
ATOM   653  O  "O2'" . C   A 1 31  ? 9.154   -15.648 -27.699 1.00 29.76 ? 31  C   B "O2'" 1 
ATOM   654  C  "C1'" . C   A 1 31  ? 9.032   -13.554 -28.855 1.00 33.20 ? 31  C   B "C1'" 1 
ATOM   655  N  N1    . C   A 1 31  ? 8.596   -13.020 -30.153 1.00 32.45 ? 31  C   B N1    1 
ATOM   656  C  C2    . C   A 1 31  ? 7.332   -13.375 -30.631 1.00 32.35 ? 31  C   B C2    1 
ATOM   657  O  O2    . C   A 1 31  ? 6.646   -14.169 -29.972 1.00 34.21 ? 31  C   B O2    1 
ATOM   658  N  N3    . C   A 1 31  ? 6.893   -12.849 -31.800 1.00 30.33 ? 31  C   B N3    1 
ATOM   659  C  C4    . C   A 1 31  ? 7.674   -12.014 -32.490 1.00 30.13 ? 31  C   B C4    1 
ATOM   660  N  N4    . C   A 1 31  ? 7.188   -11.495 -33.616 1.00 28.79 ? 31  C   B N4    1 
ATOM   661  C  C5    . C   A 1 31  ? 8.988   -11.665 -32.044 1.00 30.51 ? 31  C   B C5    1 
ATOM   662  C  C6    . C   A 1 31  ? 9.402   -12.183 -30.878 1.00 31.90 ? 31  C   B C6    1 
ATOM   663  P  P     . A   A 1 32  ? 12.232  -17.085 -29.616 1.00 32.12 ? 32  A   B P     1 
ATOM   664  O  OP1   . A   A 1 32  ? 13.187  -17.979 -28.913 1.00 32.43 ? 32  A   B OP1   1 
ATOM   665  O  OP2   . A   A 1 32  ? 12.629  -16.435 -30.887 1.00 34.69 ? 32  A   B OP2   1 
ATOM   666  O  "O5'" . A   A 1 32  ? 10.907  -17.908 -29.928 1.00 32.82 ? 32  A   B "O5'" 1 
ATOM   667  C  "C5'" . A   A 1 32  ? 10.291  -18.693 -28.924 1.00 29.46 ? 32  A   B "C5'" 1 
ATOM   668  C  "C4'" . A   A 1 32  ? 8.973   -19.220 -29.419 1.00 31.23 ? 32  A   B "C4'" 1 
ATOM   669  O  "O4'" . A   A 1 32  ? 8.057   -18.121 -29.680 1.00 30.35 ? 32  A   B "O4'" 1 
ATOM   670  C  "C3'" . A   A 1 32  ? 8.996   -19.941 -30.751 1.00 30.41 ? 32  A   B "C3'" 1 
ATOM   671  O  "O3'" . A   A 1 32  ? 9.498   -21.252 -30.588 1.00 32.60 ? 32  A   B "O3'" 1 
ATOM   672  C  "C2'" . A   A 1 32  ? 7.510   -19.931 -31.097 1.00 30.07 ? 32  A   B "C2'" 1 
ATOM   673  O  "O2'" . A   A 1 32  ? 6.759   -20.800 -30.270 1.00 29.34 ? 32  A   B "O2'" 1 
ATOM   674  C  "C1'" . A   A 1 32  ? 7.131   -18.514 -30.683 1.00 28.33 ? 32  A   B "C1'" 1 
ATOM   675  N  N9    . A   A 1 32  ? 7.172   -17.545 -31.771 1.00 27.63 ? 32  A   B N9    1 
ATOM   676  C  C8    . A   A 1 32  ? 8.245   -16.837 -32.258 1.00 30.24 ? 32  A   B C8    1 
ATOM   677  N  N7    . A   A 1 32  ? 7.937   -16.006 -33.225 1.00 28.42 ? 32  A   B N7    1 
ATOM   678  C  C5    . A   A 1 32  ? 6.572   -16.182 -33.388 1.00 28.43 ? 32  A   B C5    1 
ATOM   679  C  C6    . A   A 1 32  ? 5.636   -15.571 -34.238 1.00 29.14 ? 32  A   B C6    1 
ATOM   680  N  N6    . A   A 1 32  ? 5.942   -14.609 -35.114 1.00 28.45 ? 32  A   B N6    1 
ATOM   681  N  N1    . A   A 1 32  ? 4.351   -15.981 -34.148 1.00 28.87 ? 32  A   B N1    1 
ATOM   682  C  C2    . A   A 1 32  ? 4.037   -16.928 -33.253 1.00 26.33 ? 32  A   B C2    1 
ATOM   683  N  N3    . A   A 1 32  ? 4.823   -17.565 -32.392 1.00 26.07 ? 32  A   B N3    1 
ATOM   684  C  C4    . A   A 1 32  ? 6.092   -17.140 -32.511 1.00 28.22 ? 32  A   B C4    1 
ATOM   685  P  P     . C   A 1 33  ? 10.433  -21.894 -31.720 1.00 32.53 ? 33  C   B P     1 
ATOM   686  O  OP1   . C   A 1 33  ? 10.884  -23.210 -31.191 1.00 35.62 ? 33  C   B OP1   1 
ATOM   687  O  OP2   . C   A 1 33  ? 11.430  -20.883 -32.131 1.00 32.78 ? 33  C   B OP2   1 
ATOM   688  O  "O5'" . C   A 1 33  ? 9.461   -22.143 -32.957 1.00 35.13 ? 33  C   B "O5'" 1 
ATOM   689  C  "C5'" . C   A 1 33  ? 8.315   -22.985 -32.839 1.00 31.95 ? 33  C   B "C5'" 1 
ATOM   690  C  "C4'" . C   A 1 33  ? 7.536   -22.987 -34.129 1.00 30.37 ? 33  C   B "C4'" 1 
ATOM   691  O  "O4'" . C   A 1 33  ? 6.955   -21.678 -34.349 1.00 31.11 ? 33  C   B "O4'" 1 
ATOM   692  C  "C3'" . C   A 1 33  ? 8.368   -23.223 -35.375 1.00 32.35 ? 33  C   B "C3'" 1 
ATOM   693  O  "O3'" . C   A 1 33  ? 8.562   -24.614 -35.582 1.00 35.67 ? 33  C   B "O3'" 1 
ATOM   694  C  "C2'" . C   A 1 33  ? 7.497   -22.613 -36.467 1.00 31.02 ? 33  C   B "C2'" 1 
ATOM   695  O  "O2'" . C   A 1 33  ? 6.455   -23.475 -36.860 1.00 33.42 ? 33  C   B "O2'" 1 
ATOM   696  C  "C1'" . C   A 1 33  ? 6.897   -21.410 -35.744 1.00 31.29 ? 33  C   B "C1'" 1 
ATOM   697  N  N1    . C   A 1 33  ? 7.614   -20.153 -36.011 1.00 31.75 ? 33  C   B N1    1 
ATOM   698  C  C2    . C   A 1 33  ? 7.245   -19.393 -37.122 1.00 30.43 ? 33  C   B C2    1 
ATOM   699  O  O2    . C   A 1 33  ? 6.352   -19.808 -37.870 1.00 30.36 ? 33  C   B O2    1 
ATOM   700  N  N3    . C   A 1 33  ? 7.870   -18.225 -37.353 1.00 31.58 ? 33  C   B N3    1 
ATOM   701  C  C4    . C   A 1 33  ? 8.834   -17.808 -36.535 1.00 30.95 ? 33  C   B C4    1 
ATOM   702  N  N4    . C   A 1 33  ? 9.399   -16.635 -36.800 1.00 34.50 ? 33  C   B N4    1 
ATOM   703  C  C5    . C   A 1 33  ? 9.252   -18.571 -35.410 1.00 30.12 ? 33  C   B C5    1 
ATOM   704  C  C6    . C   A 1 33  ? 8.619   -19.726 -35.185 1.00 31.73 ? 33  C   B C6    1 
ATOM   705  P  P     . C   A 1 34  ? 10.052  -25.207 -35.617 1.00 35.43 ? 34  C   B P     1 
ATOM   706  O  OP1   . C   A 1 34  ? 9.974   -26.641 -35.990 1.00 35.35 ? 34  C   B OP1   1 
ATOM   707  O  OP2   . C   A 1 34  ? 10.712  -24.808 -34.339 1.00 37.47 ? 34  C   B OP2   1 
ATOM   708  O  "O5'" . C   A 1 34  ? 10.754  -24.399 -36.796 1.00 36.33 ? 34  C   B "O5'" 1 
ATOM   709  C  "C5'" . C   A 1 34  ? 11.149  -25.050 -37.997 1.00 35.42 ? 34  C   B "C5'" 1 
ATOM   710  C  "C4'" . C   A 1 34  ? 12.621  -24.837 -38.231 1.00 36.53 ? 34  C   B "C4'" 1 
ATOM   711  O  "O4'" . C   A 1 34  ? 12.883  -23.420 -38.410 1.00 34.13 ? 34  C   B "O4'" 1 
ATOM   712  C  "C3'" . C   A 1 34  ? 13.514  -25.216 -37.060 1.00 35.20 ? 34  C   B "C3'" 1 
ATOM   713  O  "O3'" . C   A 1 34  ? 13.696  -26.622 -36.934 1.00 36.56 ? 34  C   B "O3'" 1 
ATOM   714  C  "C2'" . C   A 1 34  ? 14.776  -24.411 -37.341 1.00 35.10 ? 34  C   B "C2'" 1 
ATOM   715  O  "O2'" . C   A 1 34  ? 15.636  -25.034 -38.275 1.00 35.08 ? 34  C   B "O2'" 1 
ATOM   716  C  "C1'" . C   A 1 34  ? 14.188  -23.126 -37.936 1.00 35.22 ? 34  C   B "C1'" 1 
ATOM   717  N  N1    . C   A 1 34  ? 14.104  -22.030 -36.962 1.00 35.59 ? 34  C   B N1    1 
ATOM   718  C  C2    . C   A 1 34  ? 15.170  -21.151 -36.884 1.00 34.76 ? 34  C   B C2    1 
ATOM   719  O  O2    . C   A 1 34  ? 16.123  -21.322 -37.639 1.00 36.83 ? 34  C   B O2    1 
ATOM   720  N  N3    . C   A 1 34  ? 15.140  -20.137 -35.991 1.00 35.97 ? 34  C   B N3    1 
ATOM   721  C  C4    . C   A 1 34  ? 14.086  -19.992 -35.190 1.00 36.20 ? 34  C   B C4    1 
ATOM   722  N  N4    . C   A 1 34  ? 14.111  -18.989 -34.314 1.00 35.86 ? 34  C   B N4    1 
ATOM   723  C  C5    . C   A 1 34  ? 12.964  -20.876 -35.251 1.00 34.80 ? 34  C   B C5    1 
ATOM   724  C  C6    . C   A 1 34  ? 13.015  -21.873 -36.146 1.00 34.86 ? 34  C   B C6    1 
ATOM   725  N  N     . VAL B 2 3   ? 26.951  -39.478 -8.547  1.00 78.52 ? 3   VAL A N     1 
ATOM   726  C  CA    . VAL B 2 3   ? 26.898  -38.687 -9.809  1.00 79.71 ? 3   VAL A CA    1 
ATOM   727  C  C     . VAL B 2 3   ? 27.691  -39.367 -10.910 1.00 80.53 ? 3   VAL A C     1 
ATOM   728  O  O     . VAL B 2 3   ? 27.112  -39.942 -11.829 1.00 81.37 ? 3   VAL A O     1 
ATOM   729  C  CB    . VAL B 2 3   ? 27.457  -37.260 -9.614  1.00 79.32 ? 3   VAL A CB    1 
ATOM   730  C  CG1   . VAL B 2 3   ? 26.423  -36.387 -8.925  1.00 79.59 ? 3   VAL A CG1   1 
ATOM   731  C  CG2   . VAL B 2 3   ? 28.740  -37.309 -8.792  1.00 79.30 ? 3   VAL A CG2   1 
ATOM   732  N  N     . GLU B 2 4   ? 29.016  -39.288 -10.810 1.00 81.05 ? 4   GLU A N     1 
ATOM   733  C  CA    . GLU B 2 4   ? 29.928  -39.899 -11.774 1.00 81.14 ? 4   GLU A CA    1 
ATOM   734  C  C     . GLU B 2 4   ? 29.301  -41.128 -12.431 1.00 80.18 ? 4   GLU A C     1 
ATOM   735  O  O     . GLU B 2 4   ? 29.250  -41.234 -13.658 1.00 79.78 ? 4   GLU A O     1 
ATOM   736  C  CB    . GLU B 2 4   ? 31.227  -40.295 -11.057 1.00 83.64 ? 4   GLU A CB    1 
ATOM   737  C  CG    . GLU B 2 4   ? 32.176  -41.206 -11.844 1.00 86.53 ? 4   GLU A CG    1 
ATOM   738  C  CD    . GLU B 2 4   ? 33.332  -41.733 -10.989 1.00 87.76 ? 4   GLU A CD    1 
ATOM   739  O  OE1   . GLU B 2 4   ? 33.064  -42.374 -9.950  1.00 88.22 ? 4   GLU A OE1   1 
ATOM   740  O  OE2   . GLU B 2 4   ? 34.506  -41.509 -11.354 1.00 88.42 ? 4   GLU A OE2   1 
ATOM   741  N  N     . GLU B 2 5   ? 28.813  -42.045 -11.599 1.00 78.77 ? 5   GLU A N     1 
ATOM   742  C  CA    . GLU B 2 5   ? 28.196  -43.278 -12.070 1.00 76.98 ? 5   GLU A CA    1 
ATOM   743  C  C     . GLU B 2 5   ? 26.864  -42.980 -12.753 1.00 74.02 ? 5   GLU A C     1 
ATOM   744  O  O     . GLU B 2 5   ? 26.626  -43.427 -13.875 1.00 74.50 ? 5   GLU A O     1 
ATOM   745  C  CB    . GLU B 2 5   ? 27.948  -44.243 -10.897 1.00 79.76 ? 5   GLU A CB    1 
ATOM   746  C  CG    . GLU B 2 5   ? 28.858  -44.058 -9.667  1.00 83.77 ? 5   GLU A CG    1 
ATOM   747  C  CD    . GLU B 2 5   ? 30.226  -44.722 -9.798  1.00 85.80 ? 5   GLU A CD    1 
ATOM   748  O  OE1   . GLU B 2 5   ? 31.003  -44.338 -10.702 1.00 87.17 ? 5   GLU A OE1   1 
ATOM   749  O  OE2   . GLU B 2 5   ? 30.525  -45.629 -8.988  1.00 85.95 ? 5   GLU A OE2   1 
ATOM   750  N  N     . ILE B 2 6   ? 26.000  -42.231 -12.068 1.00 70.37 ? 6   ILE A N     1 
ATOM   751  C  CA    . ILE B 2 6   ? 24.677  -41.877 -12.592 1.00 66.99 ? 6   ILE A CA    1 
ATOM   752  C  C     . ILE B 2 6   ? 24.744  -41.291 -14.000 1.00 64.41 ? 6   ILE A C     1 
ATOM   753  O  O     . ILE B 2 6   ? 23.941  -41.638 -14.867 1.00 62.86 ? 6   ILE A O     1 
ATOM   754  C  CB    . ILE B 2 6   ? 23.952  -40.851 -11.675 1.00 66.90 ? 6   ILE A CB    1 
ATOM   755  C  CG1   . ILE B 2 6   ? 23.806  -41.414 -10.263 1.00 66.24 ? 6   ILE A CG1   1 
ATOM   756  C  CG2   . ILE B 2 6   ? 22.561  -40.538 -12.227 1.00 65.74 ? 6   ILE A CG2   1 
ATOM   757  C  CD1   . ILE B 2 6   ? 22.926  -42.636 -10.186 1.00 66.86 ? 6   ILE A CD1   1 
ATOM   758  N  N     . LEU B 2 7   ? 25.705  -40.403 -14.222 1.00 61.29 ? 7   LEU A N     1 
ATOM   759  C  CA    . LEU B 2 7   ? 25.864  -39.772 -15.520 1.00 59.80 ? 7   LEU A CA    1 
ATOM   760  C  C     . LEU B 2 7   ? 26.318  -40.765 -16.586 1.00 60.51 ? 7   LEU A C     1 
ATOM   761  O  O     . LEU B 2 7   ? 26.014  -40.602 -17.769 1.00 59.44 ? 7   LEU A O     1 
ATOM   762  C  CB    . LEU B 2 7   ? 26.852  -38.610 -15.414 1.00 57.33 ? 7   LEU A CB    1 
ATOM   763  C  CG    . LEU B 2 7   ? 26.454  -37.540 -14.391 1.00 54.97 ? 7   LEU A CG    1 
ATOM   764  C  CD1   . LEU B 2 7   ? 27.474  -36.424 -14.411 1.00 53.32 ? 7   LEU A CD1   1 
ATOM   765  C  CD2   . LEU B 2 7   ? 25.062  -37.001 -14.694 1.00 52.79 ? 7   LEU A CD2   1 
ATOM   766  N  N     . GLU B 2 8   ? 27.044  -41.796 -16.170 1.00 61.77 ? 8   GLU A N     1 
ATOM   767  C  CA    . GLU B 2 8   ? 27.505  -42.805 -17.111 1.00 63.55 ? 8   GLU A CA    1 
ATOM   768  C  C     . GLU B 2 8   ? 26.287  -43.565 -17.626 1.00 63.26 ? 8   GLU A C     1 
ATOM   769  O  O     . GLU B 2 8   ? 26.143  -43.790 -18.829 1.00 63.53 ? 8   GLU A O     1 
ATOM   770  C  CB    . GLU B 2 8   ? 28.464  -43.782 -16.433 1.00 66.52 ? 8   GLU A CB    1 
ATOM   771  C  CG    . GLU B 2 8   ? 28.932  -44.904 -17.356 1.00 71.01 ? 8   GLU A CG    1 
ATOM   772  C  CD    . GLU B 2 8   ? 29.167  -46.217 -16.621 1.00 73.91 ? 8   GLU A CD    1 
ATOM   773  O  OE1   . GLU B 2 8   ? 29.493  -47.227 -17.288 1.00 75.05 ? 8   GLU A OE1   1 
ATOM   774  O  OE2   . GLU B 2 8   ? 29.023  -46.239 -15.377 1.00 75.81 ? 8   GLU A OE2   1 
ATOM   775  N  N     . LYS B 2 9   ? 25.412  -43.964 -16.709 1.00 62.56 ? 9   LYS A N     1 
ATOM   776  C  CA    . LYS B 2 9   ? 24.204  -44.688 -17.086 1.00 62.00 ? 9   LYS A CA    1 
ATOM   777  C  C     . LYS B 2 9   ? 23.294  -43.765 -17.889 1.00 59.45 ? 9   LYS A C     1 
ATOM   778  O  O     . LYS B 2 9   ? 22.596  -44.207 -18.799 1.00 58.79 ? 9   LYS A O     1 
ATOM   779  C  CB    . LYS B 2 9   ? 23.453  -45.175 -15.842 1.00 64.58 ? 9   LYS A CB    1 
ATOM   780  C  CG    . LYS B 2 9   ? 24.250  -46.102 -14.937 1.00 68.53 ? 9   LYS A CG    1 
ATOM   781  C  CD    . LYS B 2 9   ? 23.421  -46.536 -13.730 1.00 70.34 ? 9   LYS A CD    1 
ATOM   782  C  CE    . LYS B 2 9   ? 24.244  -47.367 -12.746 1.00 72.20 ? 9   LYS A CE    1 
ATOM   783  N  NZ    . LYS B 2 9   ? 23.447  -47.752 -11.540 1.00 72.47 ? 9   LYS A NZ    1 
ATOM   784  N  N     . ALA B 2 10  ? 23.313  -42.480 -17.541 1.00 57.04 ? 10  ALA A N     1 
ATOM   785  C  CA    . ALA B 2 10  ? 22.485  -41.479 -18.212 1.00 55.37 ? 10  ALA A CA    1 
ATOM   786  C  C     . ALA B 2 10  ? 22.799  -41.371 -19.701 1.00 53.13 ? 10  ALA A C     1 
ATOM   787  O  O     . ALA B 2 10  ? 21.900  -41.132 -20.509 1.00 51.40 ? 10  ALA A O     1 
ATOM   788  C  CB    . ALA B 2 10  ? 22.651  -40.113 -17.536 1.00 53.95 ? 10  ALA A CB    1 
ATOM   789  N  N     . LEU B 2 11  ? 24.071  -41.549 -20.055 1.00 50.75 ? 11  LEU A N     1 
ATOM   790  C  CA    . LEU B 2 11  ? 24.499  -41.480 -21.447 1.00 49.15 ? 11  LEU A CA    1 
ATOM   791  C  C     . LEU B 2 11  ? 23.758  -42.496 -22.310 1.00 49.52 ? 11  LEU A C     1 
ATOM   792  O  O     . LEU B 2 11  ? 23.560  -42.277 -23.506 1.00 50.81 ? 11  LEU A O     1 
ATOM   793  C  CB    . LEU B 2 11  ? 26.007  -41.724 -21.558 1.00 46.55 ? 11  LEU A CB    1 
ATOM   794  C  CG    . LEU B 2 11  ? 26.933  -40.656 -20.971 1.00 47.44 ? 11  LEU A CG    1 
ATOM   795  C  CD1   . LEU B 2 11  ? 28.363  -41.154 -21.008 1.00 46.30 ? 11  LEU A CD1   1 
ATOM   796  C  CD2   . LEU B 2 11  ? 26.796  -39.354 -21.747 1.00 44.21 ? 11  LEU A CD2   1 
ATOM   797  N  N     . GLU B 2 12  ? 23.341  -43.602 -21.702 1.00 49.44 ? 12  GLU A N     1 
ATOM   798  C  CA    . GLU B 2 12  ? 22.629  -44.650 -22.426 1.00 50.38 ? 12  GLU A CA    1 
ATOM   799  C  C     . GLU B 2 12  ? 21.206  -44.242 -22.805 1.00 49.46 ? 12  GLU A C     1 
ATOM   800  O  O     . GLU B 2 12  ? 20.575  -44.878 -23.652 1.00 49.99 ? 12  GLU A O     1 
ATOM   801  C  CB    . GLU B 2 12  ? 22.599  -45.927 -21.587 1.00 53.20 ? 12  GLU A CB    1 
ATOM   802  C  CG    . GLU B 2 12  ? 23.983  -46.420 -21.179 1.00 59.26 ? 12  GLU A CG    1 
ATOM   803  C  CD    . GLU B 2 12  ? 23.935  -47.639 -20.272 1.00 62.47 ? 12  GLU A CD    1 
ATOM   804  O  OE1   . GLU B 2 12  ? 23.296  -47.565 -19.198 1.00 65.09 ? 12  GLU A OE1   1 
ATOM   805  O  OE2   . GLU B 2 12  ? 24.540  -48.672 -20.628 1.00 64.44 ? 12  GLU A OE2   1 
ATOM   806  N  N     . LEU B 2 13  ? 20.704  -43.178 -22.185 1.00 48.00 ? 13  LEU A N     1 
ATOM   807  C  CA    . LEU B 2 13  ? 19.355  -42.700 -22.469 1.00 46.14 ? 13  LEU A CA    1 
ATOM   808  C  C     . LEU B 2 13  ? 19.343  -41.461 -23.373 1.00 46.10 ? 13  LEU A C     1 
ATOM   809  O  O     . LEU B 2 13  ? 18.312  -41.126 -23.960 1.00 46.97 ? 13  LEU A O     1 
ATOM   810  C  CB    . LEU B 2 13  ? 18.629  -42.358 -21.166 1.00 45.40 ? 13  LEU A CB    1 
ATOM   811  C  CG    . LEU B 2 13  ? 18.608  -43.348 -19.998 1.00 45.88 ? 13  LEU A CG    1 
ATOM   812  C  CD1   . LEU B 2 13  ? 17.861  -42.716 -18.840 1.00 42.90 ? 13  LEU A CD1   1 
ATOM   813  C  CD2   . LEU B 2 13  ? 17.946  -44.653 -20.409 1.00 45.51 ? 13  LEU A CD2   1 
ATOM   814  N  N     . VAL B 2 14  ? 20.484  -40.787 -23.493 1.00 44.59 ? 14  VAL A N     1 
ATOM   815  C  CA    . VAL B 2 14  ? 20.561  -39.571 -24.295 1.00 42.25 ? 14  VAL A CA    1 
ATOM   816  C  C     . VAL B 2 14  ? 21.351  -39.710 -25.577 1.00 42.12 ? 14  VAL A C     1 
ATOM   817  O  O     . VAL B 2 14  ? 21.084  -39.006 -26.539 1.00 42.81 ? 14  VAL A O     1 
ATOM   818  C  CB    . VAL B 2 14  ? 21.175  -38.403 -23.480 1.00 42.86 ? 14  VAL A CB    1 
ATOM   819  C  CG1   . VAL B 2 14  ? 20.338  -38.141 -22.231 1.00 42.32 ? 14  VAL A CG1   1 
ATOM   820  C  CG2   . VAL B 2 14  ? 22.619  -38.735 -23.086 1.00 41.01 ? 14  VAL A CG2   1 
ATOM   821  N  N     . ILE B 2 15  ? 22.324  -40.614 -25.594 1.00 43.29 ? 15  ILE A N     1 
ATOM   822  C  CA    . ILE B 2 15  ? 23.158  -40.812 -26.776 1.00 44.50 ? 15  ILE A CA    1 
ATOM   823  C  C     . ILE B 2 15  ? 22.536  -41.789 -27.773 1.00 47.16 ? 15  ILE A C     1 
ATOM   824  O  O     . ILE B 2 15  ? 22.171  -42.906 -27.417 1.00 49.02 ? 15  ILE A O     1 
ATOM   825  C  CB    . ILE B 2 15  ? 24.562  -41.321 -26.378 1.00 43.90 ? 15  ILE A CB    1 
ATOM   826  C  CG1   . ILE B 2 15  ? 25.211  -40.330 -25.409 1.00 43.76 ? 15  ILE A CG1   1 
ATOM   827  C  CG2   . ILE B 2 15  ? 25.431  -41.497 -27.619 1.00 41.01 ? 15  ILE A CG2   1 
ATOM   828  C  CD1   . ILE B 2 15  ? 26.588  -40.740 -24.932 1.00 45.44 ? 15  ILE A CD1   1 
ATOM   829  N  N     . PRO B 2 16  ? 22.404  -41.373 -29.041 1.00 48.65 ? 16  PRO A N     1 
ATOM   830  C  CA    . PRO B 2 16  ? 21.819  -42.227 -30.082 1.00 50.34 ? 16  PRO A CA    1 
ATOM   831  C  C     . PRO B 2 16  ? 22.667  -43.464 -30.354 1.00 52.11 ? 16  PRO A C     1 
ATOM   832  O  O     . PRO B 2 16  ? 23.893  -43.395 -30.353 1.00 51.16 ? 16  PRO A O     1 
ATOM   833  C  CB    . PRO B 2 16  ? 21.765  -41.308 -31.305 1.00 48.04 ? 16  PRO A CB    1 
ATOM   834  C  CG    . PRO B 2 16  ? 21.716  -39.946 -30.717 1.00 48.52 ? 16  PRO A CG    1 
ATOM   835  C  CD    . PRO B 2 16  ? 22.682  -40.028 -29.567 1.00 47.60 ? 16  PRO A CD    1 
ATOM   836  N  N     . ASP B 2 17  ? 22.004  -44.592 -30.587 1.00 56.25 ? 17  ASP A N     1 
ATOM   837  C  CA    . ASP B 2 17  ? 22.697  -45.841 -30.886 1.00 60.31 ? 17  ASP A CA    1 
ATOM   838  C  C     . ASP B 2 17  ? 23.227  -45.801 -32.316 1.00 62.35 ? 17  ASP A C     1 
ATOM   839  O  O     . ASP B 2 17  ? 22.852  -44.931 -33.106 1.00 62.38 ? 17  ASP A O     1 
ATOM   840  C  CB    . ASP B 2 17  ? 21.751  -47.029 -30.725 1.00 62.53 ? 17  ASP A CB    1 
ATOM   841  C  CG    . ASP B 2 17  ? 20.380  -46.759 -31.305 1.00 66.50 ? 17  ASP A CG    1 
ATOM   842  O  OD1   . ASP B 2 17  ? 19.607  -46.009 -30.668 1.00 68.83 ? 17  ASP A OD1   1 
ATOM   843  O  OD2   . ASP B 2 17  ? 20.078  -47.281 -32.401 1.00 68.98 ? 17  ASP A OD2   1 
ATOM   844  N  N     . GLU B 2 18  ? 24.092  -46.753 -32.646 1.00 64.19 ? 18  GLU A N     1 
ATOM   845  C  CA    . GLU B 2 18  ? 24.688  -46.817 -33.973 1.00 65.64 ? 18  GLU A CA    1 
ATOM   846  C  C     . GLU B 2 18  ? 23.669  -47.006 -35.098 1.00 64.29 ? 18  GLU A C     1 
ATOM   847  O  O     . GLU B 2 18  ? 23.923  -46.617 -36.237 1.00 63.80 ? 18  GLU A O     1 
ATOM   848  C  CB    . GLU B 2 18  ? 25.758  -47.918 -34.001 1.00 68.47 ? 18  GLU A CB    1 
ATOM   849  C  CG    . GLU B 2 18  ? 26.997  -47.571 -33.150 1.00 73.28 ? 18  GLU A CG    1 
ATOM   850  C  CD    . GLU B 2 18  ? 27.923  -48.763 -32.897 1.00 76.75 ? 18  GLU A CD    1 
ATOM   851  O  OE1   . GLU B 2 18  ? 27.494  -49.726 -32.219 1.00 78.40 ? 18  GLU A OE1   1 
ATOM   852  O  OE2   . GLU B 2 18  ? 29.082  -48.736 -33.371 1.00 77.53 ? 18  GLU A OE2   1 
ATOM   853  N  N     . GLU B 2 19  ? 22.512  -47.580 -34.780 1.00 63.09 ? 19  GLU A N     1 
ATOM   854  C  CA    . GLU B 2 19  ? 21.479  -47.792 -35.789 1.00 62.30 ? 19  GLU A CA    1 
ATOM   855  C  C     . GLU B 2 19  ? 20.746  -46.503 -36.149 1.00 60.34 ? 19  GLU A C     1 
ATOM   856  O  O     . GLU B 2 19  ? 20.395  -46.286 -37.311 1.00 60.19 ? 19  GLU A O     1 
ATOM   857  C  CB    . GLU B 2 19  ? 20.465  -48.844 -35.318 1.00 64.30 ? 19  GLU A CB    1 
ATOM   858  C  CG    . GLU B 2 19  ? 21.023  -50.263 -35.254 1.00 68.74 ? 19  GLU A CG    1 
ATOM   859  C  CD    . GLU B 2 19  ? 21.614  -50.731 -36.582 1.00 71.26 ? 19  GLU A CD    1 
ATOM   860  O  OE1   . GLU B 2 19  ? 20.899  -50.680 -37.610 1.00 72.00 ? 19  GLU A OE1   1 
ATOM   861  O  OE2   . GLU B 2 19  ? 22.794  -51.152 -36.595 1.00 71.99 ? 19  GLU A OE2   1 
ATOM   862  N  N     . GLU B 2 20  ? 20.509  -45.652 -35.153 1.00 57.40 ? 20  GLU A N     1 
ATOM   863  C  CA    . GLU B 2 20  ? 19.822  -44.383 -35.382 1.00 53.90 ? 20  GLU A CA    1 
ATOM   864  C  C     . GLU B 2 20  ? 20.758  -43.399 -36.087 1.00 50.20 ? 20  GLU A C     1 
ATOM   865  O  O     . GLU B 2 20  ? 20.328  -42.590 -36.903 1.00 47.88 ? 20  GLU A O     1 
ATOM   866  C  CB    . GLU B 2 20  ? 19.343  -43.791 -34.051 1.00 54.76 ? 20  GLU A CB    1 
ATOM   867  C  CG    . GLU B 2 20  ? 18.370  -42.634 -34.204 1.00 57.02 ? 20  GLU A CG    1 
ATOM   868  C  CD    . GLU B 2 20  ? 17.929  -42.054 -32.871 1.00 60.23 ? 20  GLU A CD    1 
ATOM   869  O  OE1   . GLU B 2 20  ? 17.239  -42.757 -32.098 1.00 59.77 ? 20  GLU A OE1   1 
ATOM   870  O  OE2   . GLU B 2 20  ? 18.277  -40.886 -32.595 1.00 63.18 ? 20  GLU A OE2   1 
ATOM   871  N  N     . VAL B 2 21  ? 22.042  -43.468 -35.766 1.00 48.22 ? 21  VAL A N     1 
ATOM   872  C  CA    . VAL B 2 21  ? 23.019  -42.588 -36.392 1.00 48.18 ? 21  VAL A CA    1 
ATOM   873  C  C     . VAL B 2 21  ? 23.107  -42.902 -37.888 1.00 49.56 ? 21  VAL A C     1 
ATOM   874  O  O     . VAL B 2 21  ? 23.096  -41.998 -38.732 1.00 48.57 ? 21  VAL A O     1 
ATOM   875  C  CB    . VAL B 2 21  ? 24.415  -42.772 -35.769 1.00 45.18 ? 21  VAL A CB    1 
ATOM   876  C  CG1   . VAL B 2 21  ? 25.427  -41.899 -36.495 1.00 42.41 ? 21  VAL A CG1   1 
ATOM   877  C  CG2   . VAL B 2 21  ? 24.367  -42.434 -34.288 1.00 43.03 ? 21  VAL A CG2   1 
ATOM   878  N  N     . ARG B 2 22  ? 23.189  -44.196 -38.196 1.00 49.71 ? 22  ARG A N     1 
ATOM   879  C  CA    . ARG B 2 22  ? 23.287  -44.672 -39.568 1.00 50.22 ? 22  ARG A CA    1 
ATOM   880  C  C     . ARG B 2 22  ? 22.072  -44.203 -40.348 1.00 48.18 ? 22  ARG A C     1 
ATOM   881  O  O     . ARG B 2 22  ? 22.184  -43.706 -41.470 1.00 46.90 ? 22  ARG A O     1 
ATOM   882  C  CB    . ARG B 2 22  ? 23.350  -46.202 -39.591 1.00 53.03 ? 22  ARG A CB    1 
ATOM   883  C  CG    . ARG B 2 22  ? 23.676  -46.793 -40.954 1.00 56.85 ? 22  ARG A CG    1 
ATOM   884  C  CD    . ARG B 2 22  ? 23.543  -48.312 -40.940 1.00 63.12 ? 22  ARG A CD    1 
ATOM   885  N  NE    . ARG B 2 22  ? 22.179  -48.763 -41.223 1.00 67.41 ? 22  ARG A NE    1 
ATOM   886  C  CZ    . ARG B 2 22  ? 21.631  -48.801 -42.439 1.00 69.75 ? 22  ARG A CZ    1 
ATOM   887  N  NH1   . ARG B 2 22  ? 22.327  -48.415 -43.507 1.00 68.58 ? 22  ARG A NH1   1 
ATOM   888  N  NH2   . ARG B 2 22  ? 20.382  -49.232 -42.589 1.00 69.24 ? 22  ARG A NH2   1 
ATOM   889  N  N     . LYS B 2 23  ? 20.909  -44.377 -39.737 1.00 45.99 ? 23  LYS A N     1 
ATOM   890  C  CA    . LYS B 2 23  ? 19.652  -43.979 -40.345 1.00 46.31 ? 23  LYS A CA    1 
ATOM   891  C  C     . LYS B 2 23  ? 19.695  -42.481 -40.673 1.00 46.42 ? 23  LYS A C     1 
ATOM   892  O  O     . LYS B 2 23  ? 19.229  -42.051 -41.731 1.00 46.65 ? 23  LYS A O     1 
ATOM   893  C  CB    . LYS B 2 23  ? 18.519  -44.295 -39.377 1.00 46.17 ? 23  LYS A CB    1 
ATOM   894  C  CG    . LYS B 2 23  ? 17.135  -44.012 -39.884 1.00 49.40 ? 23  LYS A CG    1 
ATOM   895  C  CD    . LYS B 2 23  ? 16.142  -44.239 -38.758 1.00 53.05 ? 23  LYS A CD    1 
ATOM   896  C  CE    . LYS B 2 23  ? 14.744  -43.771 -39.122 1.00 56.12 ? 23  LYS A CE    1 
ATOM   897  N  NZ    . LYS B 2 23  ? 13.857  -43.793 -37.920 1.00 59.66 ? 23  LYS A NZ    1 
ATOM   898  N  N     . GLY B 2 24  ? 20.271  -41.697 -39.764 1.00 44.99 ? 24  GLY A N     1 
ATOM   899  C  CA    . GLY B 2 24  ? 20.382  -40.265 -39.972 1.00 43.39 ? 24  GLY A CA    1 
ATOM   900  C  C     . GLY B 2 24  ? 21.375  -39.918 -41.065 1.00 43.49 ? 24  GLY A C     1 
ATOM   901  O  O     . GLY B 2 24  ? 21.156  -38.976 -41.821 1.00 42.34 ? 24  GLY A O     1 
ATOM   902  N  N     . ARG B 2 25  ? 22.468  -40.677 -41.146 1.00 43.70 ? 25  ARG A N     1 
ATOM   903  C  CA    . ARG B 2 25  ? 23.501  -40.461 -42.159 1.00 44.40 ? 25  ARG A CA    1 
ATOM   904  C  C     . ARG B 2 25  ? 22.962  -40.831 -43.538 1.00 45.16 ? 25  ARG A C     1 
ATOM   905  O  O     . ARG B 2 25  ? 23.190  -40.127 -44.528 1.00 44.26 ? 25  ARG A O     1 
ATOM   906  C  CB    . ARG B 2 25  ? 24.726  -41.322 -41.850 1.00 44.65 ? 25  ARG A CB    1 
ATOM   907  C  CG    . ARG B 2 25  ? 25.431  -40.972 -40.547 1.00 48.59 ? 25  ARG A CG    1 
ATOM   908  C  CD    . ARG B 2 25  ? 26.344  -39.760 -40.712 1.00 50.32 ? 25  ARG A CD    1 
ATOM   909  N  NE    . ARG B 2 25  ? 26.965  -39.341 -39.454 1.00 52.62 ? 25  ARG A NE    1 
ATOM   910  C  CZ    . ARG B 2 25  ? 26.351  -38.644 -38.498 1.00 54.14 ? 25  ARG A CZ    1 
ATOM   911  N  NH1   . ARG B 2 25  ? 25.083  -38.274 -38.644 1.00 54.63 ? 25  ARG A NH1   1 
ATOM   912  N  NH2   . ARG B 2 25  ? 27.010  -38.304 -37.395 1.00 52.79 ? 25  ARG A NH2   1 
ATOM   913  N  N     . GLU B 2 26  ? 22.239  -41.948 -43.579 1.00 46.61 ? 26  GLU A N     1 
ATOM   914  C  CA    . GLU B 2 26  ? 21.634  -42.474 -44.801 1.00 46.24 ? 26  GLU A CA    1 
ATOM   915  C  C     . GLU B 2 26  ? 20.635  -41.463 -45.363 1.00 43.56 ? 26  GLU A C     1 
ATOM   916  O  O     . GLU B 2 26  ? 20.521  -41.297 -46.578 1.00 41.79 ? 26  GLU A O     1 
ATOM   917  C  CB    . GLU B 2 26  ? 20.934  -43.804 -44.481 1.00 50.06 ? 26  GLU A CB    1 
ATOM   918  C  CG    . GLU B 2 26  ? 20.503  -44.622 -45.686 1.00 58.18 ? 26  GLU A CG    1 
ATOM   919  C  CD    . GLU B 2 26  ? 19.823  -45.947 -45.303 1.00 63.17 ? 26  GLU A CD    1 
ATOM   920  O  OE1   . GLU B 2 26  ? 19.448  -46.719 -46.228 1.00 63.14 ? 26  GLU A OE1   1 
ATOM   921  O  OE2   . GLU B 2 26  ? 19.665  -46.213 -44.084 1.00 64.09 ? 26  GLU A OE2   1 
ATOM   922  N  N     . ALA B 2 27  ? 19.919  -40.786 -44.465 1.00 42.10 ? 27  ALA A N     1 
ATOM   923  C  CA    . ALA B 2 27  ? 18.934  -39.781 -44.850 1.00 40.13 ? 27  ALA A CA    1 
ATOM   924  C  C     . ALA B 2 27  ? 19.643  -38.502 -45.267 1.00 39.64 ? 27  ALA A C     1 
ATOM   925  O  O     . ALA B 2 27  ? 19.197  -37.792 -46.166 1.00 38.69 ? 27  ALA A O     1 
ATOM   926  C  CB    . ALA B 2 27  ? 17.991  -39.502 -43.689 1.00 40.46 ? 27  ALA A CB    1 
ATOM   927  N  N     . GLU B 2 28  ? 20.755  -38.213 -44.607 1.00 39.70 ? 28  GLU A N     1 
ATOM   928  C  CA    . GLU B 2 28  ? 21.534  -37.027 -44.916 1.00 41.26 ? 28  GLU A CA    1 
ATOM   929  C  C     . GLU B 2 28  ? 22.024  -37.089 -46.359 1.00 42.25 ? 28  GLU A C     1 
ATOM   930  O  O     . GLU B 2 28  ? 21.817  -36.164 -47.141 1.00 41.72 ? 28  GLU A O     1 
ATOM   931  C  CB    . GLU B 2 28  ? 22.739  -36.943 -43.988 1.00 42.36 ? 28  GLU A CB    1 
ATOM   932  C  CG    . GLU B 2 28  ? 23.509  -35.653 -44.115 1.00 42.74 ? 28  GLU A CG    1 
ATOM   933  C  CD    . GLU B 2 28  ? 24.906  -35.755 -43.552 1.00 43.04 ? 28  GLU A CD    1 
ATOM   934  O  OE1   . GLU B 2 28  ? 25.081  -36.324 -42.452 1.00 43.59 ? 28  GLU A OE1   1 
ATOM   935  O  OE2   . GLU B 2 28  ? 25.834  -35.254 -44.213 1.00 45.18 ? 28  GLU A OE2   1 
ATOM   936  N  N     . GLU B 2 29  ? 22.682  -38.191 -46.701 1.00 43.89 ? 29  GLU A N     1 
ATOM   937  C  CA    . GLU B 2 29  ? 23.211  -38.378 -48.043 1.00 45.96 ? 29  GLU A CA    1 
ATOM   938  C  C     . GLU B 2 29  ? 22.117  -38.248 -49.091 1.00 44.86 ? 29  GLU A C     1 
ATOM   939  O  O     . GLU B 2 29  ? 22.322  -37.635 -50.143 1.00 44.99 ? 29  GLU A O     1 
ATOM   940  C  CB    . GLU B 2 29  ? 23.889  -39.747 -48.168 1.00 48.90 ? 29  GLU A CB    1 
ATOM   941  C  CG    . GLU B 2 29  ? 24.505  -39.989 -49.539 1.00 56.36 ? 29  GLU A CG    1 
ATOM   942  C  CD    . GLU B 2 29  ? 25.397  -41.223 -49.590 1.00 61.70 ? 29  GLU A CD    1 
ATOM   943  O  OE1   . GLU B 2 29  ? 24.908  -42.338 -49.280 1.00 63.79 ? 29  GLU A OE1   1 
ATOM   944  O  OE2   . GLU B 2 29  ? 26.592  -41.073 -49.947 1.00 62.83 ? 29  GLU A OE2   1 
ATOM   945  N  N     . GLU B 2 30  ? 20.955  -38.823 -48.798 1.00 43.65 ? 30  GLU A N     1 
ATOM   946  C  CA    . GLU B 2 30  ? 19.819  -38.770 -49.715 1.00 42.52 ? 30  GLU A CA    1 
ATOM   947  C  C     . GLU B 2 30  ? 19.367  -37.327 -49.966 1.00 40.63 ? 30  GLU A C     1 
ATOM   948  O  O     . GLU B 2 30  ? 19.064  -36.961 -51.098 1.00 39.73 ? 30  GLU A O     1 
ATOM   949  C  CB    . GLU B 2 30  ? 18.658  -39.613 -49.165 1.00 41.86 ? 30  GLU A CB    1 
ATOM   950  C  CG    . GLU B 2 30  ? 17.450  -39.701 -50.091 1.00 41.82 ? 30  GLU A CG    1 
ATOM   951  C  CD    . GLU B 2 30  ? 17.819  -40.101 -51.516 1.00 42.74 ? 30  GLU A CD    1 
ATOM   952  O  OE1   . GLU B 2 30  ? 18.976  -40.524 -51.745 1.00 43.37 ? 30  GLU A OE1   1 
ATOM   953  O  OE2   . GLU B 2 30  ? 16.944  -40.002 -52.406 1.00 41.56 ? 30  GLU A OE2   1 
ATOM   954  N  N     . LEU B 2 31  ? 19.321  -36.516 -48.911 1.00 40.46 ? 31  LEU A N     1 
ATOM   955  C  CA    . LEU B 2 31  ? 18.930  -35.113 -49.045 1.00 40.02 ? 31  LEU A CA    1 
ATOM   956  C  C     . LEU B 2 31  ? 19.888  -34.377 -49.974 1.00 38.12 ? 31  LEU A C     1 
ATOM   957  O  O     . LEU B 2 31  ? 19.460  -33.615 -50.833 1.00 38.35 ? 31  LEU A O     1 
ATOM   958  C  CB    . LEU B 2 31  ? 18.935  -34.404 -47.687 1.00 41.48 ? 31  LEU A CB    1 
ATOM   959  C  CG    . LEU B 2 31  ? 17.646  -34.246 -46.881 1.00 41.56 ? 31  LEU A CG    1 
ATOM   960  C  CD1   . LEU B 2 31  ? 16.530  -33.745 -47.795 1.00 41.02 ? 31  LEU A CD1   1 
ATOM   961  C  CD2   . LEU B 2 31  ? 17.275  -35.559 -46.245 1.00 42.56 ? 31  LEU A CD2   1 
ATOM   962  N  N     . ARG B 2 32  ? 21.185  -34.596 -49.785 1.00 38.31 ? 32  ARG A N     1 
ATOM   963  C  CA    . ARG B 2 32  ? 22.194  -33.949 -50.620 1.00 39.31 ? 32  ARG A CA    1 
ATOM   964  C  C     . ARG B 2 32  ? 22.024  -34.361 -52.071 1.00 36.70 ? 32  ARG A C     1 
ATOM   965  O  O     . ARG B 2 32  ? 22.038  -33.524 -52.966 1.00 37.11 ? 32  ARG A O     1 
ATOM   966  C  CB    . ARG B 2 32  ? 23.611  -34.298 -50.134 1.00 42.46 ? 32  ARG A CB    1 
ATOM   967  C  CG    . ARG B 2 32  ? 24.044  -33.540 -48.884 1.00 44.87 ? 32  ARG A CG    1 
ATOM   968  C  CD    . ARG B 2 32  ? 25.457  -33.915 -48.441 1.00 47.96 ? 32  ARG A CD    1 
ATOM   969  N  NE    . ARG B 2 32  ? 26.118  -32.799 -47.754 1.00 51.69 ? 32  ARG A NE    1 
ATOM   970  C  CZ    . ARG B 2 32  ? 25.929  -32.468 -46.480 1.00 52.45 ? 32  ARG A CZ    1 
ATOM   971  N  NH1   . ARG B 2 32  ? 25.102  -33.165 -45.714 1.00 53.30 ? 32  ARG A NH1   1 
ATOM   972  N  NH2   . ARG B 2 32  ? 26.557  -31.419 -45.975 1.00 54.91 ? 32  ARG A NH2   1 
ATOM   973  N  N     . ARG B 2 33  ? 21.850  -35.654 -52.302 1.00 35.85 ? 33  ARG A N     1 
ATOM   974  C  CA    . ARG B 2 33  ? 21.660  -36.160 -53.656 1.00 36.64 ? 33  ARG A CA    1 
ATOM   975  C  C     . ARG B 2 33  ? 20.430  -35.552 -54.346 1.00 37.08 ? 33  ARG A C     1 
ATOM   976  O  O     . ARG B 2 33  ? 20.474  -35.243 -55.541 1.00 37.77 ? 33  ARG A O     1 
ATOM   977  C  CB    . ARG B 2 33  ? 21.540  -37.683 -53.630 1.00 34.86 ? 33  ARG A CB    1 
ATOM   978  C  CG    . ARG B 2 33  ? 22.844  -38.397 -53.340 1.00 36.66 ? 33  ARG A CG    1 
ATOM   979  C  CD    . ARG B 2 33  ? 22.633  -39.878 -53.071 1.00 37.25 ? 33  ARG A CD    1 
ATOM   980  N  NE    . ARG B 2 33  ? 23.904  -40.589 -53.067 1.00 41.33 ? 33  ARG A NE    1 
ATOM   981  C  CZ    . ARG B 2 33  ? 24.043  -41.895 -52.853 1.00 43.49 ? 33  ARG A CZ    1 
ATOM   982  N  NH1   . ARG B 2 33  ? 22.980  -42.658 -52.613 1.00 42.71 ? 33  ARG A NH1   1 
ATOM   983  N  NH2   . ARG B 2 33  ? 25.252  -42.444 -52.904 1.00 42.78 ? 33  ARG A NH2   1 
ATOM   984  N  N     . ARG B 2 34  ? 19.340  -35.376 -53.599 1.00 35.61 ? 34  ARG A N     1 
ATOM   985  C  CA    . ARG B 2 34  ? 18.120  -34.813 -54.166 1.00 36.48 ? 34  ARG A CA    1 
ATOM   986  C  C     . ARG B 2 34  ? 18.270  -33.320 -54.429 1.00 37.45 ? 34  ARG A C     1 
ATOM   987  O  O     . ARG B 2 34  ? 17.800  -32.805 -55.447 1.00 36.60 ? 34  ARG A O     1 
ATOM   988  C  CB    . ARG B 2 34  ? 16.926  -35.049 -53.230 1.00 36.05 ? 34  ARG A CB    1 
ATOM   989  C  CG    . ARG B 2 34  ? 16.577  -36.511 -53.011 1.00 34.08 ? 34  ARG A CG    1 
ATOM   990  C  CD    . ARG B 2 34  ? 15.332  -36.674 -52.148 1.00 33.04 ? 34  ARG A CD    1 
ATOM   991  N  NE    . ARG B 2 34  ? 15.110  -38.076 -51.801 1.00 33.59 ? 34  ARG A NE    1 
ATOM   992  C  CZ    . ARG B 2 34  ? 14.001  -38.557 -51.240 1.00 34.10 ? 34  ARG A CZ    1 
ATOM   993  N  NH1   . ARG B 2 34  ? 12.987  -37.753 -50.951 1.00 33.49 ? 34  ARG A NH1   1 
ATOM   994  N  NH2   . ARG B 2 34  ? 13.904  -39.852 -50.969 1.00 33.48 ? 34  ARG A NH2   1 
ATOM   995  N  N     . LEU B 2 35  ? 18.932  -32.634 -53.503 1.00 38.55 ? 35  LEU A N     1 
ATOM   996  C  CA    . LEU B 2 35  ? 19.148  -31.199 -53.617 1.00 39.15 ? 35  LEU A CA    1 
ATOM   997  C  C     . LEU B 2 35  ? 20.212  -30.848 -54.654 1.00 40.22 ? 35  LEU A C     1 
ATOM   998  O  O     . LEU B 2 35  ? 20.141  -29.788 -55.275 1.00 40.39 ? 35  LEU A O     1 
ATOM   999  C  CB    . LEU B 2 35  ? 19.520  -30.615 -52.245 1.00 38.31 ? 35  LEU A CB    1 
ATOM   1000 C  CG    . LEU B 2 35  ? 18.370  -30.509 -51.234 1.00 35.88 ? 35  LEU A CG    1 
ATOM   1001 C  CD1   . LEU B 2 35  ? 18.924  -30.345 -49.843 1.00 36.13 ? 35  LEU A CD1   1 
ATOM   1002 C  CD2   . LEU B 2 35  ? 17.460  -29.338 -51.600 1.00 34.11 ? 35  LEU A CD2   1 
ATOM   1003 N  N     . ASP B 2 36  ? 21.200  -31.724 -54.842 1.00 41.86 ? 36  ASP A N     1 
ATOM   1004 C  CA    . ASP B 2 36  ? 22.244  -31.463 -55.836 1.00 43.26 ? 36  ASP A CA    1 
ATOM   1005 C  C     . ASP B 2 36  ? 21.645  -31.576 -57.234 1.00 44.51 ? 36  ASP A C     1 
ATOM   1006 O  O     . ASP B 2 36  ? 22.020  -30.829 -58.141 1.00 45.23 ? 36  ASP A O     1 
ATOM   1007 C  CB    . ASP B 2 36  ? 23.407  -32.452 -55.716 1.00 43.59 ? 36  ASP A CB    1 
ATOM   1008 C  CG    . ASP B 2 36  ? 24.172  -32.314 -54.411 1.00 45.22 ? 36  ASP A CG    1 
ATOM   1009 O  OD1   . ASP B 2 36  ? 24.333  -31.175 -53.915 1.00 44.48 ? 36  ASP A OD1   1 
ATOM   1010 O  OD2   . ASP B 2 36  ? 24.628  -33.358 -53.894 1.00 44.51 ? 36  ASP A OD2   1 
ATOM   1011 N  N     . GLU B 2 37  ? 20.720  -32.518 -57.401 1.00 44.27 ? 37  GLU A N     1 
ATOM   1012 C  CA    . GLU B 2 37  ? 20.050  -32.722 -58.677 1.00 44.67 ? 37  GLU A CA    1 
ATOM   1013 C  C     . GLU B 2 37  ? 19.293  -31.448 -59.061 1.00 43.62 ? 37  GLU A C     1 
ATOM   1014 O  O     . GLU B 2 37  ? 19.136  -31.149 -60.237 1.00 44.18 ? 37  GLU A O     1 
ATOM   1015 C  CB    . GLU B 2 37  ? 19.079  -33.904 -58.578 1.00 47.36 ? 37  GLU A CB    1 
ATOM   1016 C  CG    . GLU B 2 37  ? 18.320  -34.225 -59.867 1.00 51.57 ? 37  GLU A CG    1 
ATOM   1017 C  CD    . GLU B 2 37  ? 19.239  -34.616 -61.026 1.00 55.26 ? 37  GLU A CD    1 
ATOM   1018 O  OE1   . GLU B 2 37  ? 20.115  -35.487 -60.828 1.00 56.98 ? 37  GLU A OE1   1 
ATOM   1019 O  OE2   . GLU B 2 37  ? 19.079  -34.063 -62.139 1.00 55.94 ? 37  GLU A OE2   1 
ATOM   1020 N  N     . LEU B 2 38  ? 18.824  -30.701 -58.065 1.00 42.16 ? 38  LEU A N     1 
ATOM   1021 C  CA    . LEU B 2 38  ? 18.106  -29.454 -58.315 1.00 40.34 ? 38  LEU A CA    1 
ATOM   1022 C  C     . LEU B 2 38  ? 19.108  -28.305 -58.428 1.00 40.46 ? 38  LEU A C     1 
ATOM   1023 O  O     . LEU B 2 38  ? 18.771  -27.207 -58.871 1.00 39.67 ? 38  LEU A O     1 
ATOM   1024 C  CB    . LEU B 2 38  ? 17.116  -29.165 -57.177 1.00 38.38 ? 38  LEU A CB    1 
ATOM   1025 C  CG    . LEU B 2 38  ? 15.966  -30.160 -56.968 1.00 38.02 ? 38  LEU A CG    1 
ATOM   1026 C  CD1   . LEU B 2 38  ? 15.237  -29.842 -55.665 1.00 35.96 ? 38  LEU A CD1   1 
ATOM   1027 C  CD2   . LEU B 2 38  ? 15.005  -30.099 -58.149 1.00 36.21 ? 38  LEU A CD2   1 
ATOM   1028 N  N     . GLY B 2 39  ? 20.345  -28.562 -58.021 1.00 41.09 ? 39  GLY A N     1 
ATOM   1029 C  CA    . GLY B 2 39  ? 21.368  -27.535 -58.096 1.00 43.19 ? 39  GLY A CA    1 
ATOM   1030 C  C     . GLY B 2 39  ? 21.064  -26.353 -57.197 1.00 43.72 ? 39  GLY A C     1 
ATOM   1031 O  O     . GLY B 2 39  ? 21.279  -25.198 -57.559 1.00 43.46 ? 39  GLY A O     1 
ATOM   1032 N  N     . VAL B 2 40  ? 20.562  -26.653 -56.008 1.00 43.93 ? 40  VAL A N     1 
ATOM   1033 C  CA    . VAL B 2 40  ? 20.211  -25.633 -55.033 1.00 43.90 ? 40  VAL A CA    1 
ATOM   1034 C  C     . VAL B 2 40  ? 21.361  -25.349 -54.065 1.00 42.36 ? 40  VAL A C     1 
ATOM   1035 O  O     . VAL B 2 40  ? 22.243  -26.179 -53.877 1.00 41.84 ? 40  VAL A O     1 
ATOM   1036 C  CB    . VAL B 2 40  ? 18.955  -26.086 -54.242 1.00 45.19 ? 40  VAL A CB    1 
ATOM   1037 C  CG1   . VAL B 2 40  ? 18.788  -25.272 -52.971 1.00 46.02 ? 40  VAL A CG1   1 
ATOM   1038 C  CG2   . VAL B 2 40  ? 17.723  -25.940 -55.130 1.00 46.83 ? 40  VAL A CG2   1 
ATOM   1039 N  N     . GLU B 2 41  ? 21.359  -24.158 -53.473 1.00 42.31 ? 41  GLU A N     1 
ATOM   1040 C  CA    . GLU B 2 41  ? 22.382  -23.795 -52.495 1.00 41.58 ? 41  GLU A CA    1 
ATOM   1041 C  C     . GLU B 2 41  ? 21.758  -24.048 -51.109 1.00 38.56 ? 41  GLU A C     1 
ATOM   1042 O  O     . GLU B 2 41  ? 20.739  -23.451 -50.752 1.00 35.29 ? 41  GLU A O     1 
ATOM   1043 C  CB    . GLU B 2 41  ? 22.782  -22.318 -52.641 1.00 43.36 ? 41  GLU A CB    1 
ATOM   1044 C  CG    . GLU B 2 41  ? 24.212  -22.027 -52.191 1.00 48.22 ? 41  GLU A CG    1 
ATOM   1045 C  CD    . GLU B 2 41  ? 24.524  -20.536 -52.098 1.00 50.68 ? 41  GLU A CD    1 
ATOM   1046 O  OE1   . GLU B 2 41  ? 24.166  -19.781 -53.029 1.00 52.37 ? 41  GLU A OE1   1 
ATOM   1047 O  OE2   . GLU B 2 41  ? 25.141  -20.121 -51.091 1.00 51.61 ? 41  GLU A OE2   1 
ATOM   1048 N  N     . TYR B 2 42  ? 22.375  -24.939 -50.343 1.00 36.23 ? 42  TYR A N     1 
ATOM   1049 C  CA    . TYR B 2 42  ? 21.873  -25.291 -49.026 1.00 35.85 ? 42  TYR A CA    1 
ATOM   1050 C  C     . TYR B 2 42  ? 22.997  -25.506 -48.020 1.00 34.11 ? 42  TYR A C     1 
ATOM   1051 O  O     . TYR B 2 42  ? 24.160  -25.620 -48.394 1.00 33.86 ? 42  TYR A O     1 
ATOM   1052 C  CB    . TYR B 2 42  ? 21.049  -26.575 -49.139 1.00 37.29 ? 42  TYR A CB    1 
ATOM   1053 C  CG    . TYR B 2 42  ? 21.859  -27.741 -49.647 1.00 38.25 ? 42  TYR A CG    1 
ATOM   1054 C  CD1   . TYR B 2 42  ? 22.608  -28.533 -48.775 1.00 36.99 ? 42  TYR A CD1   1 
ATOM   1055 C  CD2   . TYR B 2 42  ? 21.910  -28.034 -51.011 1.00 38.37 ? 42  TYR A CD2   1 
ATOM   1056 C  CE1   . TYR B 2 42  ? 23.384  -29.587 -49.251 1.00 36.09 ? 42  TYR A CE1   1 
ATOM   1057 C  CE2   . TYR B 2 42  ? 22.686  -29.087 -51.495 1.00 36.40 ? 42  TYR A CE2   1 
ATOM   1058 C  CZ    . TYR B 2 42  ? 23.416  -29.858 -50.612 1.00 35.18 ? 42  TYR A CZ    1 
ATOM   1059 O  OH    . TYR B 2 42  ? 24.160  -30.911 -51.094 1.00 36.16 ? 42  TYR A OH    1 
ATOM   1060 N  N     . VAL B 2 43  ? 22.635  -25.574 -46.742 1.00 32.51 ? 43  VAL A N     1 
ATOM   1061 C  CA    . VAL B 2 43  ? 23.595  -25.807 -45.675 1.00 30.14 ? 43  VAL A CA    1 
ATOM   1062 C  C     . VAL B 2 43  ? 22.899  -26.561 -44.536 1.00 31.91 ? 43  VAL A C     1 
ATOM   1063 O  O     . VAL B 2 43  ? 21.747  -26.286 -44.214 1.00 32.64 ? 43  VAL A O     1 
ATOM   1064 C  CB    . VAL B 2 43  ? 24.194  -24.464 -45.149 1.00 30.21 ? 43  VAL A CB    1 
ATOM   1065 C  CG1   . VAL B 2 43  ? 23.116  -23.604 -44.524 1.00 27.14 ? 43  VAL A CG1   1 
ATOM   1066 C  CG2   . VAL B 2 43  ? 25.292  -24.740 -44.143 1.00 28.29 ? 43  VAL A CG2   1 
ATOM   1067 N  N     . PHE B 2 44  ? 23.580  -27.542 -43.953 1.00 32.41 ? 44  PHE A N     1 
ATOM   1068 C  CA    . PHE B 2 44  ? 22.997  -28.288 -42.848 1.00 31.73 ? 44  PHE A CA    1 
ATOM   1069 C  C     . PHE B 2 44  ? 23.342  -27.574 -41.542 1.00 32.12 ? 44  PHE A C     1 
ATOM   1070 O  O     . PHE B 2 44  ? 24.481  -27.152 -41.337 1.00 32.66 ? 44  PHE A O     1 
ATOM   1071 C  CB    . PHE B 2 44  ? 23.537  -29.720 -42.804 1.00 32.07 ? 44  PHE A CB    1 
ATOM   1072 C  CG    . PHE B 2 44  ? 22.932  -30.635 -43.834 1.00 33.93 ? 44  PHE A CG    1 
ATOM   1073 C  CD1   . PHE B 2 44  ? 23.359  -30.600 -45.160 1.00 34.45 ? 44  PHE A CD1   1 
ATOM   1074 C  CD2   . PHE B 2 44  ? 21.926  -31.536 -43.477 1.00 30.75 ? 44  PHE A CD2   1 
ATOM   1075 C  CE1   . PHE B 2 44  ? 22.788  -31.454 -46.118 1.00 33.20 ? 44  PHE A CE1   1 
ATOM   1076 C  CE2   . PHE B 2 44  ? 21.356  -32.384 -44.419 1.00 28.94 ? 44  PHE A CE2   1 
ATOM   1077 C  CZ    . PHE B 2 44  ? 21.786  -32.346 -45.744 1.00 30.31 ? 44  PHE A CZ    1 
ATOM   1078 N  N     . VAL B 2 45  ? 22.360  -27.437 -40.659 1.00 30.76 ? 45  VAL A N     1 
ATOM   1079 C  CA    . VAL B 2 45  ? 22.590  -26.772 -39.387 1.00 30.87 ? 45  VAL A CA    1 
ATOM   1080 C  C     . VAL B 2 45  ? 21.830  -27.522 -38.302 1.00 30.57 ? 45  VAL A C     1 
ATOM   1081 O  O     . VAL B 2 45  ? 21.307  -28.611 -38.552 1.00 30.93 ? 45  VAL A O     1 
ATOM   1082 C  CB    . VAL B 2 45  ? 22.118  -25.294 -39.430 1.00 31.84 ? 45  VAL A CB    1 
ATOM   1083 C  CG1   . VAL B 2 45  ? 22.669  -24.615 -40.679 1.00 32.73 ? 45  VAL A CG1   1 
ATOM   1084 C  CG2   . VAL B 2 45  ? 20.582  -25.212 -39.408 1.00 34.26 ? 45  VAL A CG2   1 
ATOM   1085 N  N     . GLY B 2 46  ? 21.772  -26.943 -37.106 1.00 28.87 ? 46  GLY A N     1 
ATOM   1086 C  CA    . GLY B 2 46  ? 21.063  -27.583 -36.013 1.00 28.69 ? 46  GLY A CA    1 
ATOM   1087 C  C     . GLY B 2 46  ? 21.788  -28.736 -35.327 1.00 28.12 ? 46  GLY A C     1 
ATOM   1088 O  O     . GLY B 2 46  ? 22.959  -29.020 -35.613 1.00 25.37 ? 46  GLY A O     1 
ATOM   1089 N  N     . SER B 2 47  ? 21.075  -29.397 -34.415 1.00 27.89 ? 47  SER A N     1 
ATOM   1090 C  CA    . SER B 2 47  ? 21.628  -30.513 -33.660 1.00 30.12 ? 47  SER A CA    1 
ATOM   1091 C  C     . SER B 2 47  ? 22.100  -31.676 -34.535 1.00 31.30 ? 47  SER A C     1 
ATOM   1092 O  O     . SER B 2 47  ? 23.044  -32.378 -34.173 1.00 33.16 ? 47  SER A O     1 
ATOM   1093 C  CB    . SER B 2 47  ? 20.622  -31.008 -32.610 1.00 27.98 ? 47  SER A CB    1 
ATOM   1094 O  OG    . SER B 2 47  ? 19.367  -31.317 -33.183 1.00 26.69 ? 47  SER A OG    1 
ATOM   1095 N  N     . TYR B 2 48  ? 21.470  -31.887 -35.684 1.00 30.73 ? 48  TYR A N     1 
ATOM   1096 C  CA    . TYR B 2 48  ? 21.926  -32.976 -36.526 1.00 31.57 ? 48  TYR A CA    1 
ATOM   1097 C  C     . TYR B 2 48  ? 23.314  -32.650 -37.054 1.00 31.29 ? 48  TYR A C     1 
ATOM   1098 O  O     . TYR B 2 48  ? 24.200  -33.503 -37.054 1.00 31.87 ? 48  TYR A O     1 
ATOM   1099 C  CB    . TYR B 2 48  ? 20.993  -33.238 -37.721 1.00 31.70 ? 48  TYR A CB    1 
ATOM   1100 C  CG    . TYR B 2 48  ? 21.535  -34.363 -38.573 1.00 31.86 ? 48  TYR A CG    1 
ATOM   1101 C  CD1   . TYR B 2 48  ? 21.601  -35.660 -38.071 1.00 33.37 ? 48  TYR A CD1   1 
ATOM   1102 C  CD2   . TYR B 2 48  ? 22.110  -34.112 -39.818 1.00 34.13 ? 48  TYR A CD2   1 
ATOM   1103 C  CE1   . TYR B 2 48  ? 22.234  -36.676 -38.770 1.00 34.35 ? 48  TYR A CE1   1 
ATOM   1104 C  CE2   . TYR B 2 48  ? 22.749  -35.121 -40.535 1.00 33.77 ? 48  TYR A CE2   1 
ATOM   1105 C  CZ    . TYR B 2 48  ? 22.812  -36.405 -40.001 1.00 37.34 ? 48  TYR A CZ    1 
ATOM   1106 O  OH    . TYR B 2 48  ? 23.474  -37.418 -40.679 1.00 37.98 ? 48  TYR A OH    1 
ATOM   1107 N  N     . ALA B 2 49  ? 23.497  -31.416 -37.512 1.00 31.31 ? 49  ALA A N     1 
ATOM   1108 C  CA    . ALA B 2 49  ? 24.787  -30.981 -38.048 1.00 32.86 ? 49  ALA A CA    1 
ATOM   1109 C  C     . ALA B 2 49  ? 25.915  -30.967 -37.003 1.00 33.49 ? 49  ALA A C     1 
ATOM   1110 O  O     . ALA B 2 49  ? 27.066  -31.221 -37.332 1.00 32.39 ? 49  ALA A O     1 
ATOM   1111 C  CB    . ALA B 2 49  ? 24.648  -29.601 -38.680 1.00 29.88 ? 49  ALA A CB    1 
ATOM   1112 N  N     . ARG B 2 50  ? 25.587  -30.671 -35.748 1.00 34.93 ? 50  ARG A N     1 
ATOM   1113 C  CA    . ARG B 2 50  ? 26.600  -30.619 -34.693 1.00 36.15 ? 50  ARG A CA    1 
ATOM   1114 C  C     . ARG B 2 50  ? 26.649  -31.905 -33.869 1.00 38.03 ? 50  ARG A C     1 
ATOM   1115 O  O     . ARG B 2 50  ? 27.384  -31.984 -32.880 1.00 38.01 ? 50  ARG A O     1 
ATOM   1116 C  CB    . ARG B 2 50  ? 26.320  -29.451 -33.747 1.00 34.26 ? 50  ARG A CB    1 
ATOM   1117 C  CG    . ARG B 2 50  ? 26.165  -28.106 -34.415 1.00 34.39 ? 50  ARG A CG    1 
ATOM   1118 C  CD    . ARG B 2 50  ? 25.458  -27.134 -33.474 1.00 37.27 ? 50  ARG A CD    1 
ATOM   1119 N  NE    . ARG B 2 50  ? 24.653  -26.177 -34.228 1.00 40.31 ? 50  ARG A NE    1 
ATOM   1120 C  CZ    . ARG B 2 50  ? 23.518  -25.638 -33.797 1.00 41.57 ? 50  ARG A CZ    1 
ATOM   1121 N  NH1   . ARG B 2 50  ? 23.025  -25.947 -32.608 1.00 40.95 ? 50  ARG A NH1   1 
ATOM   1122 N  NH2   . ARG B 2 50  ? 22.869  -24.787 -34.567 1.00 46.57 ? 50  ARG A NH2   1 
ATOM   1123 N  N     . ASN B 2 51  ? 25.860  -32.902 -34.270 1.00 38.81 ? 51  ASN A N     1 
ATOM   1124 C  CA    . ASN B 2 51  ? 25.803  -34.169 -33.553 1.00 39.46 ? 51  ASN A CA    1 
ATOM   1125 C  C     . ASN B 2 51  ? 25.475  -33.959 -32.083 1.00 39.28 ? 51  ASN A C     1 
ATOM   1126 O  O     . ASN B 2 51  ? 26.147  -34.496 -31.202 1.00 40.31 ? 51  ASN A O     1 
ATOM   1127 C  CB    . ASN B 2 51  ? 27.130  -34.920 -33.674 1.00 42.60 ? 51  ASN A CB    1 
ATOM   1128 C  CG    . ASN B 2 51  ? 27.246  -35.685 -34.977 1.00 46.51 ? 51  ASN A CG    1 
ATOM   1129 O  OD1   . ASN B 2 51  ? 27.352  -35.095 -36.055 1.00 48.20 ? 51  ASN A OD1   1 
ATOM   1130 N  ND2   . ASN B 2 51  ? 27.211  -37.010 -34.885 1.00 47.89 ? 51  ASN A ND2   1 
ATOM   1131 N  N     . THR B 2 52  ? 24.434  -33.181 -31.822 1.00 38.15 ? 52  THR A N     1 
ATOM   1132 C  CA    . THR B 2 52  ? 24.027  -32.902 -30.455 1.00 38.47 ? 52  THR A CA    1 
ATOM   1133 C  C     . THR B 2 52  ? 22.560  -33.223 -30.242 1.00 38.00 ? 52  THR A C     1 
ATOM   1134 O  O     . THR B 2 52  ? 21.998  -32.874 -29.210 1.00 37.94 ? 52  THR A O     1 
ATOM   1135 C  CB    . THR B 2 52  ? 24.251  -31.416 -30.089 1.00 39.22 ? 52  THR A CB    1 
ATOM   1136 O  OG1   . THR B 2 52  ? 23.476  -30.585 -30.963 1.00 41.51 ? 52  THR A OG1   1 
ATOM   1137 C  CG2   . THR B 2 52  ? 25.720  -31.046 -30.219 1.00 36.20 ? 52  THR A CG2   1 
ATOM   1138 N  N     . TRP B 2 53  ? 21.945  -33.891 -31.214 1.00 38.10 ? 53  TRP A N     1 
ATOM   1139 C  CA    . TRP B 2 53  ? 20.538  -34.238 -31.117 1.00 37.77 ? 53  TRP A CA    1 
ATOM   1140 C  C     . TRP B 2 53  ? 20.353  -35.340 -30.086 1.00 38.17 ? 53  TRP A C     1 
ATOM   1141 O  O     . TRP B 2 53  ? 21.200  -36.218 -29.935 1.00 36.51 ? 53  TRP A O     1 
ATOM   1142 C  CB    . TRP B 2 53  ? 19.997  -34.661 -32.486 1.00 39.29 ? 53  TRP A CB    1 
ATOM   1143 C  CG    . TRP B 2 53  ? 20.085  -36.136 -32.803 1.00 42.32 ? 53  TRP A CG    1 
ATOM   1144 C  CD1   . TRP B 2 53  ? 19.188  -37.116 -32.446 1.00 42.83 ? 53  TRP A CD1   1 
ATOM   1145 C  CD2   . TRP B 2 53  ? 21.086  -36.784 -33.589 1.00 40.70 ? 53  TRP A CD2   1 
ATOM   1146 N  NE1   . TRP B 2 53  ? 19.568  -38.325 -32.974 1.00 40.75 ? 53  TRP A NE1   1 
ATOM   1147 C  CE2   . TRP B 2 53  ? 20.728  -38.152 -33.682 1.00 41.27 ? 53  TRP A CE2   1 
ATOM   1148 C  CE3   . TRP B 2 53  ? 22.246  -36.341 -34.233 1.00 41.06 ? 53  TRP A CE3   1 
ATOM   1149 C  CZ2   . TRP B 2 53  ? 21.493  -39.080 -34.389 1.00 41.80 ? 53  TRP A CZ2   1 
ATOM   1150 C  CZ3   . TRP B 2 53  ? 23.010  -37.266 -34.939 1.00 43.81 ? 53  TRP A CZ3   1 
ATOM   1151 C  CH2   . TRP B 2 53  ? 22.627  -38.620 -35.013 1.00 44.05 ? 53  TRP A CH2   1 
ATOM   1152 N  N     . LEU B 2 54  ? 19.231  -35.270 -29.381 1.00 39.88 ? 54  LEU A N     1 
ATOM   1153 C  CA    . LEU B 2 54  ? 18.889  -36.200 -28.315 1.00 40.70 ? 54  LEU A CA    1 
ATOM   1154 C  C     . LEU B 2 54  ? 18.311  -37.503 -28.852 1.00 42.31 ? 54  LEU A C     1 
ATOM   1155 O  O     . LEU B 2 54  ? 17.467  -37.493 -29.746 1.00 43.43 ? 54  LEU A O     1 
ATOM   1156 C  CB    . LEU B 2 54  ? 17.895  -35.518 -27.368 1.00 37.93 ? 54  LEU A CB    1 
ATOM   1157 C  CG    . LEU B 2 54  ? 17.503  -36.196 -26.056 1.00 38.54 ? 54  LEU A CG    1 
ATOM   1158 C  CD1   . LEU B 2 54  ? 18.726  -36.353 -25.168 1.00 35.74 ? 54  LEU A CD1   1 
ATOM   1159 C  CD2   . LEU B 2 54  ? 16.435  -35.355 -25.354 1.00 35.33 ? 54  LEU A CD2   1 
ATOM   1160 N  N     . LYS B 2 55  ? 18.779  -38.623 -28.303 1.00 43.54 ? 55  LYS A N     1 
ATOM   1161 C  CA    . LYS B 2 55  ? 18.323  -39.949 -28.714 1.00 44.70 ? 55  LYS A CA    1 
ATOM   1162 C  C     . LYS B 2 55  ? 16.804  -40.031 -28.850 1.00 43.73 ? 55  LYS A C     1 
ATOM   1163 O  O     . LYS B 2 55  ? 16.069  -39.772 -27.896 1.00 44.19 ? 55  LYS A O     1 
ATOM   1164 C  CB    . LYS B 2 55  ? 18.796  -41.001 -27.709 1.00 47.10 ? 55  LYS A CB    1 
ATOM   1165 C  CG    . LYS B 2 55  ? 18.256  -42.394 -27.994 1.00 52.00 ? 55  LYS A CG    1 
ATOM   1166 C  CD    . LYS B 2 55  ? 18.664  -43.405 -26.928 1.00 54.08 ? 55  LYS A CD    1 
ATOM   1167 C  CE    . LYS B 2 55  ? 18.155  -44.800 -27.280 1.00 54.22 ? 55  LYS A CE    1 
ATOM   1168 N  NZ    . LYS B 2 55  ? 18.570  -45.806 -26.264 1.00 56.89 ? 55  LYS A NZ    1 
ATOM   1169 N  N     . GLY B 2 56  ? 16.342  -40.394 -30.041 1.00 43.58 ? 56  GLY A N     1 
ATOM   1170 C  CA    . GLY B 2 56  ? 14.916  -40.503 -30.285 1.00 42.49 ? 56  GLY A CA    1 
ATOM   1171 C  C     . GLY B 2 56  ? 14.276  -39.196 -30.715 1.00 43.81 ? 56  GLY A C     1 
ATOM   1172 O  O     . GLY B 2 56  ? 13.055  -39.122 -30.846 1.00 43.74 ? 56  GLY A O     1 
ATOM   1173 N  N     . SER B 2 57  ? 15.090  -38.164 -30.931 1.00 43.85 ? 57  SER A N     1 
ATOM   1174 C  CA    . SER B 2 57  ? 14.588  -36.854 -31.353 1.00 44.75 ? 57  SER A CA    1 
ATOM   1175 C  C     . SER B 2 57  ? 15.326  -36.337 -32.581 1.00 45.17 ? 57  SER A C     1 
ATOM   1176 O  O     . SER B 2 57  ? 15.548  -35.132 -32.721 1.00 46.32 ? 57  SER A O     1 
ATOM   1177 C  CB    . SER B 2 57  ? 14.738  -35.833 -30.225 1.00 43.99 ? 57  SER A CB    1 
ATOM   1178 O  OG    . SER B 2 57  ? 13.834  -36.091 -29.175 1.00 46.24 ? 57  SER A OG    1 
ATOM   1179 N  N     . LEU B 2 58  ? 15.701  -37.249 -33.470 1.00 45.16 ? 58  LEU A N     1 
ATOM   1180 C  CA    . LEU B 2 58  ? 16.422  -36.883 -34.679 1.00 44.01 ? 58  LEU A CA    1 
ATOM   1181 C  C     . LEU B 2 58  ? 15.553  -36.094 -35.638 1.00 44.68 ? 58  LEU A C     1 
ATOM   1182 O  O     . LEU B 2 58  ? 14.520  -36.580 -36.096 1.00 47.46 ? 58  LEU A O     1 
ATOM   1183 C  CB    . LEU B 2 58  ? 16.934  -38.130 -35.387 1.00 41.64 ? 58  LEU A CB    1 
ATOM   1184 C  CG    . LEU B 2 58  ? 17.565  -37.839 -36.743 1.00 42.56 ? 58  LEU A CG    1 
ATOM   1185 C  CD1   . LEU B 2 58  ? 18.767  -36.922 -36.551 1.00 40.98 ? 58  LEU A CD1   1 
ATOM   1186 C  CD2   . LEU B 2 58  ? 17.971  -39.144 -37.424 1.00 43.39 ? 58  LEU A CD2   1 
ATOM   1187 N  N     . GLU B 2 59  ? 15.976  -34.872 -35.939 1.00 44.42 ? 59  GLU A N     1 
ATOM   1188 C  CA    . GLU B 2 59  ? 15.249  -34.014 -36.864 1.00 43.95 ? 59  GLU A CA    1 
ATOM   1189 C  C     . GLU B 2 59  ? 16.274  -33.161 -37.593 1.00 42.48 ? 59  GLU A C     1 
ATOM   1190 O  O     . GLU B 2 59  ? 16.870  -32.251 -37.010 1.00 43.86 ? 59  GLU A O     1 
ATOM   1191 C  CB    . GLU B 2 59  ? 14.264  -33.119 -36.116 1.00 45.15 ? 59  GLU A CB    1 
ATOM   1192 C  CG    . GLU B 2 59  ? 13.251  -32.455 -37.028 1.00 51.05 ? 59  GLU A CG    1 
ATOM   1193 C  CD    . GLU B 2 59  ? 12.369  -31.456 -36.301 1.00 55.34 ? 59  GLU A CD    1 
ATOM   1194 O  OE1   . GLU B 2 59  ? 12.849  -30.335 -36.011 1.00 58.07 ? 59  GLU A OE1   1 
ATOM   1195 O  OE2   . GLU B 2 59  ? 11.200  -31.796 -36.012 1.00 56.48 ? 59  GLU A OE2   1 
ATOM   1196 N  N     . ILE B 2 60  ? 16.479  -33.469 -38.867 1.00 39.16 ? 60  ILE A N     1 
ATOM   1197 C  CA    . ILE B 2 60  ? 17.443  -32.764 -39.694 1.00 36.23 ? 60  ILE A CA    1 
ATOM   1198 C  C     . ILE B 2 60  ? 16.954  -31.388 -40.155 1.00 37.32 ? 60  ILE A C     1 
ATOM   1199 O  O     . ILE B 2 60  ? 15.801  -31.220 -40.557 1.00 38.95 ? 60  ILE A O     1 
ATOM   1200 C  CB    . ILE B 2 60  ? 17.804  -33.620 -40.932 1.00 34.42 ? 60  ILE A CB    1 
ATOM   1201 C  CG1   . ILE B 2 60  ? 18.452  -34.930 -40.474 1.00 33.67 ? 60  ILE A CG1   1 
ATOM   1202 C  CG2   . ILE B 2 60  ? 18.721  -32.840 -41.880 1.00 32.29 ? 60  ILE A CG2   1 
ATOM   1203 C  CD1   . ILE B 2 60  ? 18.865  -35.849 -41.610 1.00 32.08 ? 60  ILE A CD1   1 
ATOM   1204 N  N     . ASP B 2 61  ? 17.842  -30.404 -40.087 1.00 35.64 ? 61  ASP A N     1 
ATOM   1205 C  CA    . ASP B 2 61  ? 17.525  -29.050 -40.517 1.00 34.98 ? 61  ASP A CA    1 
ATOM   1206 C  C     . ASP B 2 61  ? 18.373  -28.716 -41.732 1.00 35.09 ? 61  ASP A C     1 
ATOM   1207 O  O     . ASP B 2 61  ? 19.607  -28.720 -41.660 1.00 35.73 ? 61  ASP A O     1 
ATOM   1208 C  CB    . ASP B 2 61  ? 17.829  -28.030 -39.413 1.00 34.52 ? 61  ASP A CB    1 
ATOM   1209 C  CG    . ASP B 2 61  ? 16.968  -28.224 -38.178 1.00 37.34 ? 61  ASP A CG    1 
ATOM   1210 O  OD1   . ASP B 2 61  ? 15.737  -27.997 -38.254 1.00 36.76 ? 61  ASP A OD1   1 
ATOM   1211 O  OD2   . ASP B 2 61  ? 17.529  -28.604 -37.124 1.00 39.71 ? 61  ASP A OD2   1 
ATOM   1212 N  N     . VAL B 2 62  ? 17.706  -28.450 -42.850 1.00 33.32 ? 62  VAL A N     1 
ATOM   1213 C  CA    . VAL B 2 62  ? 18.385  -28.074 -44.080 1.00 31.62 ? 62  VAL A CA    1 
ATOM   1214 C  C     . VAL B 2 62  ? 17.962  -26.638 -44.390 1.00 31.72 ? 62  VAL A C     1 
ATOM   1215 O  O     . VAL B 2 62  ? 16.768  -26.327 -44.423 1.00 30.64 ? 62  VAL A O     1 
ATOM   1216 C  CB    . VAL B 2 62  ? 17.984  -28.977 -45.260 1.00 30.96 ? 62  VAL A CB    1 
ATOM   1217 C  CG1   . VAL B 2 62  ? 18.790  -28.608 -46.486 1.00 29.78 ? 62  VAL A CG1   1 
ATOM   1218 C  CG2   . VAL B 2 62  ? 18.216  -30.427 -44.908 1.00 32.35 ? 62  VAL A CG2   1 
ATOM   1219 N  N     . PHE B 2 63  ? 18.941  -25.764 -44.593 1.00 30.16 ? 63  PHE A N     1 
ATOM   1220 C  CA    . PHE B 2 63  ? 18.659  -24.373 -44.897 1.00 29.97 ? 63  PHE A CA    1 
ATOM   1221 C  C     . PHE B 2 63  ? 18.973  -24.034 -46.342 1.00 31.86 ? 63  PHE A C     1 
ATOM   1222 O  O     . PHE B 2 63  ? 20.047  -24.362 -46.861 1.00 32.05 ? 63  PHE A O     1 
ATOM   1223 C  CB    . PHE B 2 63  ? 19.437  -23.445 -43.957 1.00 29.75 ? 63  PHE A CB    1 
ATOM   1224 C  CG    . PHE B 2 63  ? 18.668  -23.053 -42.715 1.00 29.35 ? 63  PHE A CG    1 
ATOM   1225 C  CD1   . PHE B 2 63  ? 18.054  -24.020 -41.922 1.00 29.97 ? 63  PHE A CD1   1 
ATOM   1226 C  CD2   . PHE B 2 63  ? 18.553  -21.720 -42.347 1.00 27.72 ? 63  PHE A CD2   1 
ATOM   1227 C  CE1   . PHE B 2 63  ? 17.332  -23.667 -40.779 1.00 29.60 ? 63  PHE A CE1   1 
ATOM   1228 C  CE2   . PHE B 2 63  ? 17.836  -21.356 -41.212 1.00 30.98 ? 63  PHE A CE2   1 
ATOM   1229 C  CZ    . PHE B 2 63  ? 17.224  -22.332 -40.425 1.00 29.59 ? 63  PHE A CZ    1 
ATOM   1230 N  N     . LEU B 2 64  ? 18.008  -23.390 -46.990 1.00 31.28 ? 64  LEU A N     1 
ATOM   1231 C  CA    . LEU B 2 64  ? 18.137  -22.979 -48.376 1.00 30.99 ? 64  LEU A CA    1 
ATOM   1232 C  C     . LEU B 2 64  ? 18.615  -21.525 -48.394 1.00 31.19 ? 64  LEU A C     1 
ATOM   1233 O  O     . LEU B 2 64  ? 17.912  -20.638 -47.927 1.00 31.88 ? 64  LEU A O     1 
ATOM   1234 C  CB    . LEU B 2 64  ? 16.782  -23.115 -49.079 1.00 28.92 ? 64  LEU A CB    1 
ATOM   1235 C  CG    . LEU B 2 64  ? 16.127  -24.501 -48.999 1.00 30.47 ? 64  LEU A CG    1 
ATOM   1236 C  CD1   . LEU B 2 64  ? 14.753  -24.434 -49.642 1.00 30.60 ? 64  LEU A CD1   1 
ATOM   1237 C  CD2   . LEU B 2 64  ? 16.987  -25.558 -49.691 1.00 27.95 ? 64  LEU A CD2   1 
ATOM   1238 N  N     . LEU B 2 65  ? 19.808  -21.285 -48.931 1.00 31.66 ? 65  LEU A N     1 
ATOM   1239 C  CA    . LEU B 2 65  ? 20.362  -19.935 -48.977 1.00 33.81 ? 65  LEU A CA    1 
ATOM   1240 C  C     . LEU B 2 65  ? 19.947  -19.104 -50.190 1.00 33.89 ? 65  LEU A C     1 
ATOM   1241 O  O     . LEU B 2 65  ? 20.196  -19.487 -51.337 1.00 34.96 ? 65  LEU A O     1 
ATOM   1242 C  CB    . LEU B 2 65  ? 21.888  -20.000 -48.886 1.00 33.93 ? 65  LEU A CB    1 
ATOM   1243 C  CG    . LEU B 2 65  ? 22.536  -20.209 -47.510 1.00 34.41 ? 65  LEU A CG    1 
ATOM   1244 C  CD1   . LEU B 2 65  ? 21.557  -20.769 -46.510 1.00 35.65 ? 65  LEU A CD1   1 
ATOM   1245 C  CD2   . LEU B 2 65  ? 23.720  -21.150 -47.675 1.00 36.31 ? 65  LEU A CD2   1 
ATOM   1246 N  N     . PHE B 2 66  ? 19.318  -17.962 -49.916 1.00 33.94 ? 66  PHE A N     1 
ATOM   1247 C  CA    . PHE B 2 66  ? 18.844  -17.038 -50.950 1.00 35.58 ? 66  PHE A CA    1 
ATOM   1248 C  C     . PHE B 2 66  ? 19.507  -15.661 -50.850 1.00 35.95 ? 66  PHE A C     1 
ATOM   1249 O  O     . PHE B 2 66  ? 19.807  -15.183 -49.760 1.00 34.68 ? 66  PHE A O     1 
ATOM   1250 C  CB    . PHE B 2 66  ? 17.332  -16.805 -50.839 1.00 35.03 ? 66  PHE A CB    1 
ATOM   1251 C  CG    . PHE B 2 66  ? 16.492  -17.978 -51.219 1.00 33.27 ? 66  PHE A CG    1 
ATOM   1252 C  CD1   . PHE B 2 66  ? 16.219  -18.979 -50.301 1.00 34.30 ? 66  PHE A CD1   1 
ATOM   1253 C  CD2   . PHE B 2 66  ? 15.930  -18.056 -52.489 1.00 34.45 ? 66  PHE A CD2   1 
ATOM   1254 C  CE1   . PHE B 2 66  ? 15.395  -20.048 -50.637 1.00 35.13 ? 66  PHE A CE1   1 
ATOM   1255 C  CE2   . PHE B 2 66  ? 15.108  -19.116 -52.842 1.00 35.90 ? 66  PHE A CE2   1 
ATOM   1256 C  CZ    . PHE B 2 66  ? 14.835  -20.118 -51.909 1.00 36.53 ? 66  PHE A CZ    1 
ATOM   1257 N  N     . PRO B 2 67  ? 19.708  -14.992 -51.993 1.00 37.40 ? 67  PRO A N     1 
ATOM   1258 C  CA    . PRO B 2 67  ? 20.329  -13.659 -52.016 1.00 38.07 ? 67  PRO A CA    1 
ATOM   1259 C  C     . PRO B 2 67  ? 19.417  -12.704 -51.256 1.00 39.43 ? 67  PRO A C     1 
ATOM   1260 O  O     . PRO B 2 67  ? 18.198  -12.797 -51.383 1.00 40.01 ? 67  PRO A O     1 
ATOM   1261 C  CB    . PRO B 2 67  ? 20.380  -13.323 -53.507 1.00 35.50 ? 67  PRO A CB    1 
ATOM   1262 C  CG    . PRO B 2 67  ? 20.411  -14.680 -54.173 1.00 36.70 ? 67  PRO A CG    1 
ATOM   1263 C  CD    . PRO B 2 67  ? 19.408  -15.462 -53.358 1.00 37.01 ? 67  PRO A CD    1 
ATOM   1264 N  N     . GLU B 2 68  ? 19.977  -11.782 -50.479 1.00 40.43 ? 68  GLU A N     1 
ATOM   1265 C  CA    . GLU B 2 68  ? 19.114  -10.876 -49.734 1.00 43.95 ? 68  GLU A CA    1 
ATOM   1266 C  C     . GLU B 2 68  ? 18.198  -9.975  -50.549 1.00 42.56 ? 68  GLU A C     1 
ATOM   1267 O  O     . GLU B 2 68  ? 17.229  -9.451  -50.009 1.00 43.55 ? 68  GLU A O     1 
ATOM   1268 C  CB    . GLU B 2 68  ? 19.912  -10.024 -48.730 1.00 47.79 ? 68  GLU A CB    1 
ATOM   1269 C  CG    . GLU B 2 68  ? 21.282  -9.552  -49.178 1.00 55.25 ? 68  GLU A CG    1 
ATOM   1270 C  CD    . GLU B 2 68  ? 21.999  -8.761  -48.081 1.00 59.75 ? 68  GLU A CD    1 
ATOM   1271 O  OE1   . GLU B 2 68  ? 23.241  -8.616  -48.162 1.00 61.24 ? 68  GLU A OE1   1 
ATOM   1272 O  OE2   . GLU B 2 68  ? 21.315  -8.281  -47.143 1.00 58.90 ? 68  GLU A OE2   1 
ATOM   1273 N  N     . GLU B 2 69  ? 18.476  -9.791  -51.834 1.00 42.59 ? 69  GLU A N     1 
ATOM   1274 C  CA    . GLU B 2 69  ? 17.617  -8.934  -52.653 1.00 43.40 ? 69  GLU A CA    1 
ATOM   1275 C  C     . GLU B 2 69  ? 16.236  -9.552  -52.840 1.00 42.81 ? 69  GLU A C     1 
ATOM   1276 O  O     . GLU B 2 69  ? 15.252  -8.843  -53.017 1.00 42.57 ? 69  GLU A O     1 
ATOM   1277 C  CB    . GLU B 2 69  ? 18.240  -8.667  -54.026 1.00 44.45 ? 69  GLU A CB    1 
ATOM   1278 C  CG    . GLU B 2 69  ? 19.554  -7.934  -53.957 1.00 47.05 ? 69  GLU A CG    1 
ATOM   1279 C  CD    . GLU B 2 69  ? 20.697  -8.849  -53.574 1.00 48.61 ? 69  GLU A CD    1 
ATOM   1280 O  OE1   . GLU B 2 69  ? 21.665  -8.365  -52.951 1.00 49.73 ? 69  GLU A OE1   1 
ATOM   1281 O  OE2   . GLU B 2 69  ? 20.631  -10.052 -53.910 1.00 49.85 ? 69  GLU A OE2   1 
ATOM   1282 N  N     . PHE B 2 70  ? 16.170  -10.876 -52.790 1.00 43.11 ? 70  PHE A N     1 
ATOM   1283 C  CA    . PHE B 2 70  ? 14.911  -11.584 -52.953 1.00 43.48 ? 70  PHE A CA    1 
ATOM   1284 C  C     . PHE B 2 70  ? 13.796  -11.130 -52.008 1.00 44.10 ? 70  PHE A C     1 
ATOM   1285 O  O     . PHE B 2 70  ? 14.021  -10.771 -50.852 1.00 44.19 ? 70  PHE A O     1 
ATOM   1286 C  CB    . PHE B 2 70  ? 15.134  -13.087 -52.791 1.00 43.94 ? 70  PHE A CB    1 
ATOM   1287 C  CG    . PHE B 2 70  ? 15.673  -13.763 -54.024 1.00 45.80 ? 70  PHE A CG    1 
ATOM   1288 C  CD1   . PHE B 2 70  ? 16.643  -13.147 -54.811 1.00 45.97 ? 70  PHE A CD1   1 
ATOM   1289 C  CD2   . PHE B 2 70  ? 15.237  -15.038 -54.378 1.00 46.32 ? 70  PHE A CD2   1 
ATOM   1290 C  CE1   . PHE B 2 70  ? 17.173  -13.792 -55.931 1.00 46.62 ? 70  PHE A CE1   1 
ATOM   1291 C  CE2   . PHE B 2 70  ? 15.763  -15.692 -55.499 1.00 46.58 ? 70  PHE A CE2   1 
ATOM   1292 C  CZ    . PHE B 2 70  ? 16.731  -15.068 -56.274 1.00 45.51 ? 70  PHE A CZ    1 
ATOM   1293 N  N     . SER B 2 71  ? 12.582  -11.161 -52.537 1.00 43.55 ? 71  SER A N     1 
ATOM   1294 C  CA    . SER B 2 71  ? 11.379  -10.789 -51.820 1.00 42.92 ? 71  SER A CA    1 
ATOM   1295 C  C     . SER B 2 71  ? 11.054  -11.884 -50.802 1.00 43.74 ? 71  SER A C     1 
ATOM   1296 O  O     . SER B 2 71  ? 11.419  -13.046 -50.998 1.00 43.67 ? 71  SER A O     1 
ATOM   1297 C  CB    . SER B 2 71  ? 10.242  -10.666 -52.835 1.00 42.49 ? 71  SER A CB    1 
ATOM   1298 O  OG    . SER B 2 71  ? 9.124   -10.020 -52.282 1.00 47.63 ? 71  SER A OG    1 
ATOM   1299 N  N     . LYS B 2 72  ? 10.371  -11.528 -49.717 1.00 44.61 ? 72  LYS A N     1 
ATOM   1300 C  CA    . LYS B 2 72  ? 10.006  -12.530 -48.721 1.00 46.26 ? 72  LYS A CA    1 
ATOM   1301 C  C     . LYS B 2 72  ? 8.997   -13.487 -49.352 1.00 46.16 ? 72  LYS A C     1 
ATOM   1302 O  O     . LYS B 2 72  ? 8.950   -14.671 -49.015 1.00 46.90 ? 72  LYS A O     1 
ATOM   1303 C  CB    . LYS B 2 72  ? 9.395   -11.881 -47.471 1.00 48.18 ? 72  LYS A CB    1 
ATOM   1304 C  CG    . LYS B 2 72  ? 10.276  -10.823 -46.812 1.00 52.85 ? 72  LYS A CG    1 
ATOM   1305 C  CD    . LYS B 2 72  ? 9.951   -10.623 -45.327 1.00 54.30 ? 72  LYS A CD    1 
ATOM   1306 C  CE    . LYS B 2 72  ? 10.609  -11.696 -44.426 1.00 55.77 ? 72  LYS A CE    1 
ATOM   1307 N  NZ    . LYS B 2 72  ? 10.087  -13.093 -44.592 1.00 54.96 ? 72  LYS A NZ    1 
ATOM   1308 N  N     . GLU B 2 73  ? 8.193   -12.969 -50.276 1.00 45.50 ? 73  GLU A N     1 
ATOM   1309 C  CA    . GLU B 2 73  ? 7.196   -13.784 -50.962 1.00 45.35 ? 73  GLU A CA    1 
ATOM   1310 C  C     . GLU B 2 73  ? 7.904   -14.808 -51.830 1.00 44.69 ? 73  GLU A C     1 
ATOM   1311 O  O     . GLU B 2 73  ? 7.478   -15.954 -51.933 1.00 45.64 ? 73  GLU A O     1 
ATOM   1312 C  CB    . GLU B 2 73  ? 6.287   -12.916 -51.836 1.00 45.69 ? 73  GLU A CB    1 
ATOM   1313 C  CG    . GLU B 2 73  ? 5.344   -11.989 -51.069 1.00 48.90 ? 73  GLU A CG    1 
ATOM   1314 C  CD    . GLU B 2 73  ? 5.980   -10.670 -50.628 1.00 50.91 ? 73  GLU A CD    1 
ATOM   1315 O  OE1   . GLU B 2 73  ? 5.258   -9.841  -50.033 1.00 53.22 ? 73  GLU A OE1   1 
ATOM   1316 O  OE2   . GLU B 2 73  ? 7.185   -10.449 -50.870 1.00 50.41 ? 73  GLU A OE2   1 
ATOM   1317 N  N     . GLU B 2 74  ? 8.992   -14.383 -52.458 1.00 44.09 ? 74  GLU A N     1 
ATOM   1318 C  CA    . GLU B 2 74  ? 9.770   -15.270 -53.310 1.00 42.82 ? 74  GLU A CA    1 
ATOM   1319 C  C     . GLU B 2 74  ? 10.367  -16.394 -52.463 1.00 41.67 ? 74  GLU A C     1 
ATOM   1320 O  O     . GLU B 2 74  ? 10.338  -17.557 -52.859 1.00 41.11 ? 74  GLU A O     1 
ATOM   1321 C  CB    . GLU B 2 74  ? 10.885  -14.482 -53.997 1.00 44.10 ? 74  GLU A CB    1 
ATOM   1322 C  CG    . GLU B 2 74  ? 11.669  -15.261 -55.041 1.00 47.24 ? 74  GLU A CG    1 
ATOM   1323 C  CD    . GLU B 2 74  ? 10.819  -15.658 -56.235 1.00 48.86 ? 74  GLU A CD    1 
ATOM   1324 O  OE1   . GLU B 2 74  ? 9.932   -14.872 -56.630 1.00 51.38 ? 74  GLU A OE1   1 
ATOM   1325 O  OE2   . GLU B 2 74  ? 11.048  -16.750 -56.791 1.00 50.80 ? 74  GLU A OE2   1 
ATOM   1326 N  N     . LEU B 2 75  ? 10.905  -16.045 -51.296 1.00 40.41 ? 75  LEU A N     1 
ATOM   1327 C  CA    . LEU B 2 75  ? 11.496  -17.047 -50.416 1.00 40.10 ? 75  LEU A CA    1 
ATOM   1328 C  C     . LEU B 2 75  ? 10.453  -18.086 -50.057 1.00 39.44 ? 75  LEU A C     1 
ATOM   1329 O  O     . LEU B 2 75  ? 10.735  -19.281 -50.038 1.00 38.95 ? 75  LEU A O     1 
ATOM   1330 C  CB    . LEU B 2 75  ? 12.033  -16.409 -49.131 1.00 40.46 ? 75  LEU A CB    1 
ATOM   1331 C  CG    . LEU B 2 75  ? 13.543  -16.580 -48.945 1.00 41.19 ? 75  LEU A CG    1 
ATOM   1332 C  CD1   . LEU B 2 75  ? 14.255  -15.701 -49.969 1.00 42.81 ? 75  LEU A CD1   1 
ATOM   1333 C  CD2   . LEU B 2 75  ? 13.970  -16.206 -47.543 1.00 38.48 ? 75  LEU A CD2   1 
ATOM   1334 N  N     . ARG B 2 76  ? 9.242   -17.620 -49.776 1.00 39.98 ? 76  ARG A N     1 
ATOM   1335 C  CA    . ARG B 2 76  ? 8.151   -18.515 -49.427 1.00 40.54 ? 76  ARG A CA    1 
ATOM   1336 C  C     . ARG B 2 76  ? 7.774   -19.441 -50.586 1.00 40.54 ? 76  ARG A C     1 
ATOM   1337 O  O     . ARG B 2 76  ? 7.643   -20.651 -50.400 1.00 39.32 ? 76  ARG A O     1 
ATOM   1338 C  CB    . ARG B 2 76  ? 6.929   -17.706 -48.977 1.00 39.85 ? 76  ARG A CB    1 
ATOM   1339 C  CG    . ARG B 2 76  ? 5.699   -18.550 -48.705 1.00 41.10 ? 76  ARG A CG    1 
ATOM   1340 C  CD    . ARG B 2 76  ? 4.625   -17.771 -47.954 1.00 46.18 ? 76  ARG A CD    1 
ATOM   1341 N  NE    . ARG B 2 76  ? 4.170   -16.574 -48.658 1.00 48.55 ? 76  ARG A NE    1 
ATOM   1342 C  CZ    . ARG B 2 76  ? 3.650   -16.583 -49.880 1.00 50.89 ? 76  ARG A CZ    1 
ATOM   1343 N  NH1   . ARG B 2 76  ? 3.524   -17.734 -50.534 1.00 52.52 ? 76  ARG A NH1   1 
ATOM   1344 N  NH2   . ARG B 2 76  ? 3.250   -15.450 -50.444 1.00 48.99 ? 76  ARG A NH2   1 
ATOM   1345 N  N     . GLU B 2 77  ? 7.615   -18.875 -51.782 1.00 41.72 ? 77  GLU A N     1 
ATOM   1346 C  CA    . GLU B 2 77  ? 7.230   -19.659 -52.953 1.00 42.32 ? 77  GLU A CA    1 
ATOM   1347 C  C     . GLU B 2 77  ? 8.315   -20.630 -53.414 1.00 42.65 ? 77  GLU A C     1 
ATOM   1348 O  O     . GLU B 2 77  ? 8.041   -21.815 -53.624 1.00 41.49 ? 77  GLU A O     1 
ATOM   1349 C  CB    . GLU B 2 77  ? 6.829   -18.729 -54.102 1.00 42.95 ? 77  GLU A CB    1 
ATOM   1350 C  CG    . GLU B 2 77  ? 5.622   -17.849 -53.789 1.00 47.00 ? 77  GLU A CG    1 
ATOM   1351 C  CD    . GLU B 2 77  ? 5.258   -16.900 -54.931 1.00 50.66 ? 77  GLU A CD    1 
ATOM   1352 O  OE1   . GLU B 2 77  ? 4.322   -16.089 -54.756 1.00 50.16 ? 77  GLU A OE1   1 
ATOM   1353 O  OE2   . GLU B 2 77  ? 5.902   -16.963 -56.005 1.00 53.13 ? 77  GLU A OE2   1 
ATOM   1354 N  N     . ARG B 2 78  ? 9.540   -20.137 -53.581 1.00 43.39 ? 78  ARG A N     1 
ATOM   1355 C  CA    . ARG B 2 78  ? 10.640  -20.999 -54.007 1.00 43.74 ? 78  ARG A CA    1 
ATOM   1356 C  C     . ARG B 2 78  ? 10.977  -22.012 -52.924 1.00 43.06 ? 78  ARG A C     1 
ATOM   1357 O  O     . ARG B 2 78  ? 11.199  -23.183 -53.211 1.00 43.05 ? 78  ARG A O     1 
ATOM   1358 C  CB    . ARG B 2 78  ? 11.886  -20.174 -54.341 1.00 45.74 ? 78  ARG A CB    1 
ATOM   1359 C  CG    . ARG B 2 78  ? 11.891  -19.602 -55.747 1.00 48.51 ? 78  ARG A CG    1 
ATOM   1360 C  CD    . ARG B 2 78  ? 11.715  -20.717 -56.779 1.00 52.41 ? 78  ARG A CD    1 
ATOM   1361 N  NE    . ARG B 2 78  ? 12.806  -21.693 -56.758 1.00 54.37 ? 78  ARG A NE    1 
ATOM   1362 C  CZ    . ARG B 2 78  ? 12.760  -22.877 -57.366 1.00 57.17 ? 78  ARG A CZ    1 
ATOM   1363 N  NH1   . ARG B 2 78  ? 11.675  -23.239 -58.035 1.00 57.35 ? 78  ARG A NH1   1 
ATOM   1364 N  NH2   . ARG B 2 78  ? 13.804  -23.699 -57.325 1.00 58.50 ? 78  ARG A NH2   1 
ATOM   1365 N  N     . GLY B 2 79  ? 11.005  -21.551 -51.677 1.00 42.27 ? 79  GLY A N     1 
ATOM   1366 C  CA    . GLY B 2 79  ? 11.314  -22.429 -50.566 1.00 41.77 ? 79  GLY A CA    1 
ATOM   1367 C  C     . GLY B 2 79  ? 10.384  -23.621 -50.480 1.00 41.15 ? 79  GLY A C     1 
ATOM   1368 O  O     . GLY B 2 79  ? 10.835  -24.762 -50.424 1.00 40.46 ? 79  GLY A O     1 
ATOM   1369 N  N     . LEU B 2 80  ? 9.082   -23.363 -50.471 1.00 41.30 ? 80  LEU A N     1 
ATOM   1370 C  CA    . LEU B 2 80  ? 8.112   -24.445 -50.395 1.00 42.75 ? 80  LEU A CA    1 
ATOM   1371 C  C     . LEU B 2 80  ? 8.173   -25.303 -51.656 1.00 43.57 ? 80  LEU A C     1 
ATOM   1372 O  O     . LEU B 2 80  ? 7.898   -26.498 -51.614 1.00 44.32 ? 80  LEU A O     1 
ATOM   1373 C  CB    . LEU B 2 80  ? 6.699   -23.888 -50.190 1.00 42.01 ? 80  LEU A CB    1 
ATOM   1374 C  CG    . LEU B 2 80  ? 6.458   -23.025 -48.940 1.00 42.89 ? 80  LEU A CG    1 
ATOM   1375 C  CD1   . LEU B 2 80  ? 4.979   -22.672 -48.867 1.00 44.49 ? 80  LEU A CD1   1 
ATOM   1376 C  CD2   . LEU B 2 80  ? 6.884   -23.756 -47.670 1.00 40.47 ? 80  LEU A CD2   1 
ATOM   1377 N  N     . GLU B 2 81  ? 8.554   -24.692 -52.771 1.00 45.22 ? 81  GLU A N     1 
ATOM   1378 C  CA    . GLU B 2 81  ? 8.666   -25.404 -54.044 1.00 47.00 ? 81  GLU A CA    1 
ATOM   1379 C  C     . GLU B 2 81  ? 9.747   -26.487 -53.916 1.00 45.60 ? 81  GLU A C     1 
ATOM   1380 O  O     . GLU B 2 81  ? 9.528   -27.654 -54.236 1.00 44.63 ? 81  GLU A O     1 
ATOM   1381 C  CB    . GLU B 2 81  ? 9.049   -24.414 -55.151 1.00 51.19 ? 81  GLU A CB    1 
ATOM   1382 C  CG    . GLU B 2 81  ? 8.389   -24.665 -56.503 1.00 57.24 ? 81  GLU A CG    1 
ATOM   1383 C  CD    . GLU B 2 81  ? 8.801   -23.640 -57.569 1.00 61.99 ? 81  GLU A CD    1 
ATOM   1384 O  OE1   . GLU B 2 81  ? 8.613   -22.417 -57.349 1.00 63.54 ? 81  GLU A OE1   1 
ATOM   1385 O  OE2   . GLU B 2 81  ? 9.310   -24.059 -58.634 1.00 63.67 ? 81  GLU A OE2   1 
ATOM   1386 N  N     . ILE B 2 82  ? 10.913  -26.076 -53.432 1.00 44.44 ? 82  ILE A N     1 
ATOM   1387 C  CA    . ILE B 2 82  ? 12.054  -26.959 -53.241 1.00 41.91 ? 82  ILE A CA    1 
ATOM   1388 C  C     . ILE B 2 82  ? 11.814  -27.983 -52.134 1.00 42.24 ? 82  ILE A C     1 
ATOM   1389 O  O     . ILE B 2 82  ? 12.175  -29.152 -52.268 1.00 40.24 ? 82  ILE A O     1 
ATOM   1390 C  CB    . ILE B 2 82  ? 13.299  -26.132 -52.903 1.00 42.17 ? 82  ILE A CB    1 
ATOM   1391 C  CG1   . ILE B 2 82  ? 13.647  -25.243 -54.099 1.00 42.81 ? 82  ILE A CG1   1 
ATOM   1392 C  CG2   . ILE B 2 82  ? 14.447  -27.043 -52.505 1.00 42.62 ? 82  ILE A CG2   1 
ATOM   1393 C  CD1   . ILE B 2 82  ? 14.780  -24.265 -53.843 1.00 43.64 ? 82  ILE A CD1   1 
ATOM   1394 N  N     . GLY B 2 83  ? 11.206  -27.538 -51.038 1.00 41.89 ? 83  GLY A N     1 
ATOM   1395 C  CA    . GLY B 2 83  ? 10.930  -28.438 -49.939 1.00 41.90 ? 83  GLY A CA    1 
ATOM   1396 C  C     . GLY B 2 83  ? 10.047  -29.595 -50.363 1.00 43.26 ? 83  GLY A C     1 
ATOM   1397 O  O     . GLY B 2 83  ? 10.352  -30.754 -50.080 1.00 45.32 ? 83  GLY A O     1 
ATOM   1398 N  N     . LYS B 2 84  ? 8.955   -29.286 -51.056 1.00 42.44 ? 84  LYS A N     1 
ATOM   1399 C  CA    . LYS B 2 84  ? 8.021   -30.310 -51.510 1.00 42.65 ? 84  LYS A CA    1 
ATOM   1400 C  C     . LYS B 2 84  ? 8.600   -31.308 -52.515 1.00 42.31 ? 84  LYS A C     1 
ATOM   1401 O  O     . LYS B 2 84  ? 8.250   -32.491 -52.503 1.00 42.48 ? 84  LYS A O     1 
ATOM   1402 C  CB    . LYS B 2 84  ? 6.776   -29.649 -52.108 1.00 42.47 ? 84  LYS A CB    1 
ATOM   1403 C  CG    . LYS B 2 84  ? 5.919   -28.916 -51.084 1.00 43.72 ? 84  LYS A CG    1 
ATOM   1404 C  CD    . LYS B 2 84  ? 4.617   -28.416 -51.684 1.00 44.96 ? 84  LYS A CD    1 
ATOM   1405 C  CE    . LYS B 2 84  ? 4.867   -27.454 -52.831 1.00 48.16 ? 84  LYS A CE    1 
ATOM   1406 N  NZ    . LYS B 2 84  ? 3.603   -26.811 -53.287 1.00 52.28 ? 84  LYS A NZ    1 
ATOM   1407 N  N     . ALA B 2 85  ? 9.482   -30.828 -53.380 1.00 41.89 ? 85  ALA A N     1 
ATOM   1408 C  CA    . ALA B 2 85  ? 10.094  -31.665 -54.403 1.00 41.61 ? 85  ALA A CA    1 
ATOM   1409 C  C     . ALA B 2 85  ? 11.174  -32.593 -53.866 1.00 41.81 ? 85  ALA A C     1 
ATOM   1410 O  O     . ALA B 2 85  ? 11.597  -33.518 -54.551 1.00 44.56 ? 85  ALA A O     1 
ATOM   1411 C  CB    . ALA B 2 85  ? 10.688  -30.779 -55.487 1.00 41.17 ? 85  ALA A CB    1 
ATOM   1412 N  N     . VAL B 2 86  ? 11.592  -32.359 -52.631 1.00 40.88 ? 86  VAL A N     1 
ATOM   1413 C  CA    . VAL B 2 86  ? 12.672  -33.111 -52.017 1.00 38.12 ? 86  VAL A CA    1 
ATOM   1414 C  C     . VAL B 2 86  ? 12.311  -34.076 -50.880 1.00 39.63 ? 86  VAL A C     1 
ATOM   1415 O  O     . VAL B 2 86  ? 13.144  -34.869 -50.436 1.00 38.79 ? 86  VAL A O     1 
ATOM   1416 C  CB    . VAL B 2 86  ? 13.737  -32.087 -51.558 1.00 36.83 ? 86  VAL A CB    1 
ATOM   1417 C  CG1   . VAL B 2 86  ? 14.495  -32.574 -50.362 1.00 37.66 ? 86  VAL A CG1   1 
ATOM   1418 C  CG2   . VAL B 2 86  ? 14.676  -31.793 -52.725 1.00 35.19 ? 86  VAL A CG2   1 
ATOM   1419 N  N     . LEU B 2 87  ? 11.067  -34.035 -50.421 1.00 39.11 ? 87  LEU A N     1 
ATOM   1420 C  CA    . LEU B 2 87  ? 10.654  -34.903 -49.333 1.00 37.97 ? 87  LEU A CA    1 
ATOM   1421 C  C     . LEU B 2 87  ? 9.768   -36.062 -49.809 1.00 39.73 ? 87  LEU A C     1 
ATOM   1422 O  O     . LEU B 2 87  ? 9.105   -35.960 -50.836 1.00 38.45 ? 87  LEU A O     1 
ATOM   1423 C  CB    . LEU B 2 87  ? 9.931   -34.057 -48.281 1.00 36.73 ? 87  LEU A CB    1 
ATOM   1424 C  CG    . LEU B 2 87  ? 10.746  -32.865 -47.746 1.00 34.88 ? 87  LEU A CG    1 
ATOM   1425 C  CD1   . LEU B 2 87  ? 9.889   -32.027 -46.807 1.00 36.88 ? 87  LEU A CD1   1 
ATOM   1426 C  CD2   . LEU B 2 87  ? 11.983  -33.363 -47.013 1.00 32.85 ? 87  LEU A CD2   1 
ATOM   1427 N  N     . ASP B 2 88  ? 9.779   -37.172 -49.072 1.00 41.17 ? 88  ASP A N     1 
ATOM   1428 C  CA    . ASP B 2 88  ? 8.962   -38.327 -49.429 1.00 43.09 ? 88  ASP A CA    1 
ATOM   1429 C  C     . ASP B 2 88  ? 7.487   -37.948 -49.260 1.00 44.86 ? 88  ASP A C     1 
ATOM   1430 O  O     . ASP B 2 88  ? 6.639   -38.267 -50.096 1.00 45.86 ? 88  ASP A O     1 
ATOM   1431 C  CB    . ASP B 2 88  ? 9.290   -39.535 -48.536 1.00 44.35 ? 88  ASP A CB    1 
ATOM   1432 C  CG    . ASP B 2 88  ? 10.669  -40.141 -48.824 1.00 47.95 ? 88  ASP A CG    1 
ATOM   1433 O  OD1   . ASP B 2 88  ? 11.160  -40.030 -49.970 1.00 48.72 ? 88  ASP A OD1   1 
ATOM   1434 O  OD2   . ASP B 2 88  ? 11.255  -40.758 -47.905 1.00 47.70 ? 88  ASP A OD2   1 
ATOM   1435 N  N     . SER B 2 89  ? 7.193   -37.278 -48.154 1.00 45.04 ? 89  SER A N     1 
ATOM   1436 C  CA    . SER B 2 89  ? 5.848   -36.817 -47.848 1.00 44.99 ? 89  SER A CA    1 
ATOM   1437 C  C     . SER B 2 89  ? 6.074   -35.564 -47.026 1.00 45.22 ? 89  SER A C     1 
ATOM   1438 O  O     . SER B 2 89  ? 7.065   -35.464 -46.309 1.00 46.72 ? 89  SER A O     1 
ATOM   1439 C  CB    . SER B 2 89  ? 5.076   -37.866 -47.047 1.00 44.02 ? 89  SER A CB    1 
ATOM   1440 O  OG    . SER B 2 89  ? 5.758   -38.218 -45.863 1.00 45.51 ? 89  SER A OG    1 
ATOM   1441 N  N     . TYR B 2 90  ? 5.167   -34.605 -47.132 1.00 45.47 ? 90  TYR A N     1 
ATOM   1442 C  CA    . TYR B 2 90  ? 5.334   -33.353 -46.417 1.00 45.17 ? 90  TYR A CA    1 
ATOM   1443 C  C     . TYR B 2 90  ? 4.047   -32.761 -45.843 1.00 45.60 ? 90  TYR A C     1 
ATOM   1444 O  O     . TYR B 2 90  ? 2.934   -33.166 -46.181 1.00 44.94 ? 90  TYR A O     1 
ATOM   1445 C  CB    . TYR B 2 90  ? 5.974   -32.339 -47.360 1.00 44.33 ? 90  TYR A CB    1 
ATOM   1446 C  CG    . TYR B 2 90  ? 5.079   -31.974 -48.526 1.00 44.85 ? 90  TYR A CG    1 
ATOM   1447 C  CD1   . TYR B 2 90  ? 4.026   -31.070 -48.365 1.00 44.99 ? 90  TYR A CD1   1 
ATOM   1448 C  CD2   . TYR B 2 90  ? 5.252   -32.567 -49.779 1.00 44.39 ? 90  TYR A CD2   1 
ATOM   1449 C  CE1   . TYR B 2 90  ? 3.166   -30.766 -49.419 1.00 46.47 ? 90  TYR A CE1   1 
ATOM   1450 C  CE2   . TYR B 2 90  ? 4.398   -32.272 -50.839 1.00 45.37 ? 90  TYR A CE2   1 
ATOM   1451 C  CZ    . TYR B 2 90  ? 3.357   -31.369 -50.653 1.00 46.98 ? 90  TYR A CZ    1 
ATOM   1452 O  OH    . TYR B 2 90  ? 2.517   -31.050 -51.699 1.00 47.36 ? 90  TYR A OH    1 
ATOM   1453 N  N     . GLU B 2 91  ? 4.235   -31.768 -44.985 1.00 46.00 ? 91  GLU A N     1 
ATOM   1454 C  CA    . GLU B 2 91  ? 3.153   -31.054 -44.333 1.00 46.95 ? 91  GLU A CA    1 
ATOM   1455 C  C     . GLU B 2 91  ? 3.639   -29.619 -44.273 1.00 45.20 ? 91  GLU A C     1 
ATOM   1456 O  O     . GLU B 2 91  ? 4.828   -29.383 -44.096 1.00 46.89 ? 91  GLU A O     1 
ATOM   1457 C  CB    . GLU B 2 91  ? 2.954   -31.594 -42.918 1.00 50.23 ? 91  GLU A CB    1 
ATOM   1458 C  CG    . GLU B 2 91  ? 1.966   -30.822 -42.068 1.00 56.26 ? 91  GLU A CG    1 
ATOM   1459 C  CD    . GLU B 2 91  ? 2.058   -31.197 -40.594 1.00 61.32 ? 91  GLU A CD    1 
ATOM   1460 O  OE1   . GLU B 2 91  ? 1.930   -32.404 -40.272 1.00 62.13 ? 91  GLU A OE1   1 
ATOM   1461 O  OE2   . GLU B 2 91  ? 2.260   -30.283 -39.757 1.00 64.24 ? 91  GLU A OE2   1 
ATOM   1462 N  N     . ILE B 2 92  ? 2.737   -28.663 -44.444 1.00 42.86 ? 92  ILE A N     1 
ATOM   1463 C  CA    . ILE B 2 92  ? 3.110   -27.255 -44.384 1.00 40.84 ? 92  ILE A CA    1 
ATOM   1464 C  C     . ILE B 2 92  ? 2.202   -26.574 -43.364 1.00 42.05 ? 92  ILE A C     1 
ATOM   1465 O  O     . ILE B 2 92  ? 1.000   -26.418 -43.588 1.00 42.23 ? 92  ILE A O     1 
ATOM   1466 C  CB    . ILE B 2 92  ? 2.976   -26.590 -45.769 1.00 38.69 ? 92  ILE A CB    1 
ATOM   1467 C  CG1   . ILE B 2 92  ? 4.009   -27.196 -46.724 1.00 38.43 ? 92  ILE A CG1   1 
ATOM   1468 C  CG2   . ILE B 2 92  ? 3.188   -25.092 -45.662 1.00 37.28 ? 92  ILE A CG2   1 
ATOM   1469 C  CD1   . ILE B 2 92  ? 3.881   -26.709 -48.157 1.00 37.52 ? 92  ILE A CD1   1 
ATOM   1470 N  N     . ARG B 2 93  ? 2.782   -26.171 -42.238 1.00 42.61 ? 93  ARG A N     1 
ATOM   1471 C  CA    . ARG B 2 93  ? 2.010   -25.547 -41.176 1.00 44.30 ? 93  ARG A CA    1 
ATOM   1472 C  C     . ARG B 2 93  ? 2.933   -24.706 -40.292 1.00 42.56 ? 93  ARG A C     1 
ATOM   1473 O  O     . ARG B 2 93  ? 3.644   -25.242 -39.447 1.00 44.31 ? 93  ARG A O     1 
ATOM   1474 C  CB    . ARG B 2 93  ? 1.332   -26.662 -40.363 1.00 48.75 ? 93  ARG A CB    1 
ATOM   1475 C  CG    . ARG B 2 93  ? 0.093   -26.265 -39.561 1.00 56.06 ? 93  ARG A CG    1 
ATOM   1476 C  CD    . ARG B 2 93  ? -0.666  -27.522 -39.092 1.00 60.81 ? 93  ARG A CD    1 
ATOM   1477 N  NE    . ARG B 2 93  ? -1.766  -27.245 -38.161 1.00 63.70 ? 93  ARG A NE    1 
ATOM   1478 C  CZ    . ARG B 2 93  ? -2.818  -26.471 -38.429 1.00 64.74 ? 93  ARG A CZ    1 
ATOM   1479 N  NH1   . ARG B 2 93  ? -2.936  -25.873 -39.611 1.00 64.94 ? 93  ARG A NH1   1 
ATOM   1480 N  NH2   . ARG B 2 93  ? -3.761  -26.299 -37.509 1.00 64.48 ? 93  ARG A NH2   1 
ATOM   1481 N  N     . TYR B 2 94  ? 2.927   -23.391 -40.491 1.00 40.52 ? 94  TYR A N     1 
ATOM   1482 C  CA    . TYR B 2 94  ? 3.777   -22.494 -39.706 1.00 39.01 ? 94  TYR A CA    1 
ATOM   1483 C  C     . TYR B 2 94  ? 3.015   -21.249 -39.259 1.00 38.94 ? 94  TYR A C     1 
ATOM   1484 O  O     . TYR B 2 94  ? 1.903   -21.000 -39.719 1.00 39.00 ? 94  TYR A O     1 
ATOM   1485 C  CB    . TYR B 2 94  ? 4.996   -22.083 -40.534 1.00 38.20 ? 94  TYR A CB    1 
ATOM   1486 C  CG    . TYR B 2 94  ? 4.631   -21.479 -41.868 1.00 36.71 ? 94  TYR A CG    1 
ATOM   1487 C  CD1   . TYR B 2 94  ? 4.271   -20.138 -41.982 1.00 37.25 ? 94  TYR A CD1   1 
ATOM   1488 C  CD2   . TYR B 2 94  ? 4.596   -22.264 -43.010 1.00 38.11 ? 94  TYR A CD2   1 
ATOM   1489 C  CE1   . TYR B 2 94  ? 3.884   -19.597 -43.212 1.00 37.13 ? 94  TYR A CE1   1 
ATOM   1490 C  CE2   . TYR B 2 94  ? 4.210   -21.742 -44.237 1.00 37.82 ? 94  TYR A CE2   1 
ATOM   1491 C  CZ    . TYR B 2 94  ? 3.857   -20.412 -44.338 1.00 37.77 ? 94  TYR A CZ    1 
ATOM   1492 O  OH    . TYR B 2 94  ? 3.494   -19.913 -45.574 1.00 39.46 ? 94  TYR A OH    1 
ATOM   1493 N  N     . ALA B 2 95  ? 3.621   -20.459 -38.374 1.00 38.61 ? 95  ALA A N     1 
ATOM   1494 C  CA    . ALA B 2 95  ? 2.981   -19.242 -37.873 1.00 38.36 ? 95  ALA A CA    1 
ATOM   1495 C  C     . ALA B 2 95  ? 3.405   -17.966 -38.609 1.00 38.70 ? 95  ALA A C     1 
ATOM   1496 O  O     . ALA B 2 95  ? 2.578   -17.099 -38.874 1.00 38.98 ? 95  ALA A O     1 
ATOM   1497 C  CB    . ALA B 2 95  ? 3.257   -19.090 -36.386 1.00 39.86 ? 95  ALA A CB    1 
ATOM   1498 N  N     . GLU B 2 96  ? 4.691   -17.845 -38.929 1.00 37.84 ? 96  GLU A N     1 
ATOM   1499 C  CA    . GLU B 2 96  ? 5.185   -16.662 -39.629 1.00 35.93 ? 96  GLU A CA    1 
ATOM   1500 C  C     . GLU B 2 96  ? 6.221   -17.047 -40.688 1.00 36.43 ? 96  GLU A C     1 
ATOM   1501 O  O     . GLU B 2 96  ? 5.947   -16.971 -41.890 1.00 35.52 ? 96  GLU A O     1 
ATOM   1502 C  CB    . GLU B 2 96  ? 5.774   -15.676 -38.615 1.00 36.18 ? 96  GLU A CB    1 
ATOM   1503 C  CG    . GLU B 2 96  ? 6.256   -14.349 -39.193 1.00 36.54 ? 96  GLU A CG    1 
ATOM   1504 C  CD    . GLU B 2 96  ? 7.672   -14.431 -39.742 1.00 39.79 ? 96  GLU A CD    1 
ATOM   1505 O  OE1   . GLU B 2 96  ? 8.601   -14.752 -38.964 1.00 39.00 ? 96  GLU A OE1   1 
ATOM   1506 O  OE2   . GLU B 2 96  ? 7.855   -14.176 -40.952 1.00 41.39 ? 96  GLU A OE2   1 
ATOM   1507 N  N     . HIS B 2 97  ? 7.406   -17.464 -40.254 1.00 36.34 ? 97  HIS A N     1 
ATOM   1508 C  CA    . HIS B 2 97  ? 8.435   -17.865 -41.204 1.00 36.78 ? 97  HIS A CA    1 
ATOM   1509 C  C     . HIS B 2 97  ? 8.036   -19.184 -41.857 1.00 35.75 ? 97  HIS A C     1 
ATOM   1510 O  O     . HIS B 2 97  ? 7.757   -20.159 -41.176 1.00 37.16 ? 97  HIS A O     1 
ATOM   1511 C  CB    . HIS B 2 97  ? 9.789   -18.037 -40.524 1.00 36.59 ? 97  HIS A CB    1 
ATOM   1512 C  CG    . HIS B 2 97  ? 10.913  -18.216 -41.495 1.00 38.21 ? 97  HIS A CG    1 
ATOM   1513 N  ND1   . HIS B 2 97  ? 11.447  -17.167 -42.213 1.00 38.01 ? 97  HIS A ND1   1 
ATOM   1514 C  CD2   . HIS B 2 97  ? 11.546  -19.331 -41.931 1.00 36.90 ? 97  HIS A CD2   1 
ATOM   1515 C  CE1   . HIS B 2 97  ? 12.359  -17.627 -43.049 1.00 38.17 ? 97  HIS A CE1   1 
ATOM   1516 N  NE2   . HIS B 2 97  ? 12.438  -18.938 -42.898 1.00 39.67 ? 97  HIS A NE2   1 
ATOM   1517 N  N     . PRO B 2 98  ? 8.031   -19.235 -43.194 1.00 35.56 ? 98  PRO A N     1 
ATOM   1518 C  CA    . PRO B 2 98  ? 7.653   -20.447 -43.932 1.00 35.36 ? 98  PRO A CA    1 
ATOM   1519 C  C     . PRO B 2 98  ? 8.733   -21.525 -44.035 1.00 35.22 ? 98  PRO A C     1 
ATOM   1520 O  O     . PRO B 2 98  ? 9.931   -21.233 -44.055 1.00 37.12 ? 98  PRO A O     1 
ATOM   1521 C  CB    . PRO B 2 98  ? 7.273   -19.893 -45.298 1.00 34.30 ? 98  PRO A CB    1 
ATOM   1522 C  CG    . PRO B 2 98  ? 8.327   -18.833 -45.487 1.00 35.16 ? 98  PRO A CG    1 
ATOM   1523 C  CD    . PRO B 2 98  ? 8.398   -18.146 -44.119 1.00 32.97 ? 98  PRO A CD    1 
ATOM   1524 N  N     . TYR B 2 99  ? 8.291   -22.774 -44.108 1.00 34.49 ? 99  TYR A N     1 
ATOM   1525 C  CA    . TYR B 2 99  ? 9.185   -23.920 -44.242 1.00 32.12 ? 99  TYR A CA    1 
ATOM   1526 C  C     . TYR B 2 99  ? 8.357   -25.178 -44.482 1.00 31.15 ? 99  TYR A C     1 
ATOM   1527 O  O     . TYR B 2 99  ? 7.144   -25.186 -44.267 1.00 30.74 ? 99  TYR A O     1 
ATOM   1528 C  CB    . TYR B 2 99  ? 10.055  -24.085 -42.985 1.00 31.48 ? 99  TYR A CB    1 
ATOM   1529 C  CG    . TYR B 2 99  ? 9.310   -24.544 -41.752 1.00 29.60 ? 99  TYR A CG    1 
ATOM   1530 C  CD1   . TYR B 2 99  ? 9.308   -25.887 -41.375 1.00 27.33 ? 99  TYR A CD1   1 
ATOM   1531 C  CD2   . TYR B 2 99  ? 8.611   -23.633 -40.958 1.00 28.43 ? 99  TYR A CD2   1 
ATOM   1532 C  CE1   . TYR B 2 99  ? 8.631   -26.311 -40.238 1.00 27.14 ? 99  TYR A CE1   1 
ATOM   1533 C  CE2   . TYR B 2 99  ? 7.935   -24.040 -39.828 1.00 28.18 ? 99  TYR A CE2   1 
ATOM   1534 C  CZ    . TYR B 2 99  ? 7.945   -25.379 -39.468 1.00 30.04 ? 99  TYR A CZ    1 
ATOM   1535 O  OH    . TYR B 2 99  ? 7.264   -25.781 -38.339 1.00 32.66 ? 99  TYR A OH    1 
ATOM   1536 N  N     . VAL B 2 100 ? 9.019   -26.239 -44.922 1.00 30.37 ? 100 VAL A N     1 
ATOM   1537 C  CA    . VAL B 2 100 ? 8.349   -27.497 -45.190 1.00 30.14 ? 100 VAL A CA    1 
ATOM   1538 C  C     . VAL B 2 100 ? 8.825   -28.598 -44.242 1.00 32.28 ? 100 VAL A C     1 
ATOM   1539 O  O     . VAL B 2 100 ? 10.026  -28.753 -44.005 1.00 33.05 ? 100 VAL A O     1 
ATOM   1540 C  CB    . VAL B 2 100 ? 8.612   -27.955 -46.638 1.00 30.00 ? 100 VAL A CB    1 
ATOM   1541 C  CG1   . VAL B 2 100 ? 7.854   -29.239 -46.924 1.00 29.19 ? 100 VAL A CG1   1 
ATOM   1542 C  CG2   . VAL B 2 100 ? 8.205   -26.866 -47.612 1.00 29.14 ? 100 VAL A CG2   1 
ATOM   1543 N  N     . HIS B 2 101 ? 7.882   -29.362 -43.700 1.00 33.18 ? 101 HIS A N     1 
ATOM   1544 C  CA    . HIS B 2 101 ? 8.228   -30.460 -42.809 1.00 34.41 ? 101 HIS A CA    1 
ATOM   1545 C  C     . HIS B 2 101 ? 7.968   -31.790 -43.514 1.00 35.72 ? 101 HIS A C     1 
ATOM   1546 O  O     . HIS B 2 101 ? 6.946   -31.976 -44.166 1.00 36.14 ? 101 HIS A O     1 
ATOM   1547 C  CB    . HIS B 2 101 ? 7.411   -30.406 -41.527 1.00 36.29 ? 101 HIS A CB    1 
ATOM   1548 C  CG    . HIS B 2 101 ? 7.790   -31.467 -40.544 1.00 41.70 ? 101 HIS A CG    1 
ATOM   1549 N  ND1   . HIS B 2 101 ? 8.967   -31.428 -39.826 1.00 41.34 ? 101 HIS A ND1   1 
ATOM   1550 C  CD2   . HIS B 2 101 ? 7.185   -32.635 -40.214 1.00 41.70 ? 101 HIS A CD2   1 
ATOM   1551 C  CE1   . HIS B 2 101 ? 9.071   -32.527 -39.098 1.00 42.59 ? 101 HIS A CE1   1 
ATOM   1552 N  NE2   . HIS B 2 101 ? 8.004   -33.276 -39.316 1.00 41.83 ? 101 HIS A NE2   1 
ATOM   1553 N  N     . GLY B 2 102 ? 8.893   -32.727 -43.385 1.00 36.36 ? 102 GLY A N     1 
ATOM   1554 C  CA    . GLY B 2 102 ? 8.691   -33.994 -44.055 1.00 36.40 ? 102 GLY A CA    1 
ATOM   1555 C  C     . GLY B 2 102 ? 9.574   -35.118 -43.565 1.00 35.51 ? 102 GLY A C     1 
ATOM   1556 O  O     . GLY B 2 102 ? 10.142  -35.052 -42.473 1.00 34.10 ? 102 GLY A O     1 
ATOM   1557 N  N     . VAL B 2 103 ? 9.681   -36.153 -44.393 1.00 34.93 ? 103 VAL A N     1 
ATOM   1558 C  CA    . VAL B 2 103 ? 10.478  -37.327 -44.081 1.00 34.45 ? 103 VAL A CA    1 
ATOM   1559 C  C     . VAL B 2 103 ? 11.314  -37.749 -45.281 1.00 36.03 ? 103 VAL A C     1 
ATOM   1560 O  O     . VAL B 2 103 ? 10.882  -37.648 -46.430 1.00 36.83 ? 103 VAL A O     1 
ATOM   1561 C  CB    . VAL B 2 103 ? 9.577   -38.534 -43.700 1.00 35.48 ? 103 VAL A CB    1 
ATOM   1562 C  CG1   . VAL B 2 103 ? 10.442  -39.722 -43.282 1.00 34.43 ? 103 VAL A CG1   1 
ATOM   1563 C  CG2   . VAL B 2 103 ? 8.613   -38.151 -42.577 1.00 34.76 ? 103 VAL A CG2   1 
ATOM   1564 N  N     . VAL B 2 104 ? 12.523  -38.214 -45.014 1.00 36.02 ? 104 VAL A N     1 
ATOM   1565 C  CA    . VAL B 2 104 ? 13.385  -38.700 -46.071 1.00 37.59 ? 104 VAL A CA    1 
ATOM   1566 C  C     . VAL B 2 104 ? 13.982  -39.973 -45.508 1.00 38.83 ? 104 VAL A C     1 
ATOM   1567 O  O     . VAL B 2 104 ? 14.742  -39.943 -44.546 1.00 39.80 ? 104 VAL A O     1 
ATOM   1568 C  CB    . VAL B 2 104 ? 14.506  -37.693 -46.426 1.00 39.27 ? 104 VAL A CB    1 
ATOM   1569 C  CG1   . VAL B 2 104 ? 15.447  -38.307 -47.451 1.00 40.03 ? 104 VAL A CG1   1 
ATOM   1570 C  CG2   . VAL B 2 104 ? 13.900  -36.410 -46.980 1.00 37.49 ? 104 VAL A CG2   1 
ATOM   1571 N  N     . LYS B 2 105 ? 13.605  -41.096 -46.098 1.00 40.91 ? 105 LYS A N     1 
ATOM   1572 C  CA    . LYS B 2 105 ? 14.084  -42.396 -45.658 1.00 41.89 ? 105 LYS A CA    1 
ATOM   1573 C  C     . LYS B 2 105 ? 13.787  -42.651 -44.186 1.00 42.26 ? 105 LYS A C     1 
ATOM   1574 O  O     . LYS B 2 105 ? 14.629  -43.160 -43.449 1.00 43.86 ? 105 LYS A O     1 
ATOM   1575 C  CB    . LYS B 2 105 ? 15.584  -42.531 -45.945 1.00 42.24 ? 105 LYS A CB    1 
ATOM   1576 C  CG    . LYS B 2 105 ? 15.897  -42.511 -47.436 1.00 43.23 ? 105 LYS A CG    1 
ATOM   1577 C  CD    . LYS B 2 105 ? 17.383  -42.631 -47.720 1.00 45.34 ? 105 LYS A CD    1 
ATOM   1578 C  CE    . LYS B 2 105 ? 17.884  -44.047 -47.528 1.00 46.51 ? 105 LYS A CE    1 
ATOM   1579 N  NZ    . LYS B 2 105 ? 17.253  -44.980 -48.496 1.00 50.04 ? 105 LYS A NZ    1 
ATOM   1580 N  N     . GLY B 2 106 ? 12.580  -42.286 -43.763 1.00 42.47 ? 106 GLY A N     1 
ATOM   1581 C  CA    . GLY B 2 106 ? 12.174  -42.508 -42.385 1.00 41.84 ? 106 GLY A CA    1 
ATOM   1582 C  C     . GLY B 2 106 ? 12.633  -41.500 -41.344 1.00 41.56 ? 106 GLY A C     1 
ATOM   1583 O  O     . GLY B 2 106 ? 12.463  -41.719 -40.140 1.00 41.29 ? 106 GLY A O     1 
ATOM   1584 N  N     . VAL B 2 107 ? 13.204  -40.389 -41.787 1.00 40.33 ? 107 VAL A N     1 
ATOM   1585 C  CA    . VAL B 2 107 ? 13.675  -39.389 -40.840 1.00 39.34 ? 107 VAL A CA    1 
ATOM   1586 C  C     . VAL B 2 107 ? 12.985  -38.044 -41.017 1.00 39.46 ? 107 VAL A C     1 
ATOM   1587 O  O     . VAL B 2 107 ? 12.748  -37.590 -42.145 1.00 39.45 ? 107 VAL A O     1 
ATOM   1588 C  CB    . VAL B 2 107 ? 15.207  -39.198 -40.950 1.00 38.46 ? 107 VAL A CB    1 
ATOM   1589 C  CG1   . VAL B 2 107 ? 15.669  -38.120 -39.996 1.00 38.23 ? 107 VAL A CG1   1 
ATOM   1590 C  CG2   . VAL B 2 107 ? 15.918  -40.509 -40.632 1.00 39.22 ? 107 VAL A CG2   1 
ATOM   1591 N  N     . GLU B 2 108 ? 12.658  -37.420 -39.887 1.00 38.59 ? 108 GLU A N     1 
ATOM   1592 C  CA    . GLU B 2 108 ? 12.014  -36.110 -39.872 1.00 38.72 ? 108 GLU A CA    1 
ATOM   1593 C  C     . GLU B 2 108 ? 12.976  -35.081 -40.461 1.00 34.35 ? 108 GLU A C     1 
ATOM   1594 O  O     . GLU B 2 108 ? 14.156  -35.064 -40.117 1.00 32.80 ? 108 GLU A O     1 
ATOM   1595 C  CB    . GLU B 2 108 ? 11.699  -35.701 -38.436 1.00 43.17 ? 108 GLU A CB    1 
ATOM   1596 C  CG    . GLU B 2 108 ? 11.076  -36.796 -37.607 1.00 51.37 ? 108 GLU A CG    1 
ATOM   1597 C  CD    . GLU B 2 108 ? 9.596   -36.926 -37.850 1.00 54.81 ? 108 GLU A CD    1 
ATOM   1598 O  OE1   . GLU B 2 108 ? 8.853   -35.996 -37.462 1.00 55.44 ? 108 GLU A OE1   1 
ATOM   1599 O  OE2   . GLU B 2 108 ? 9.180   -37.956 -38.431 1.00 60.38 ? 108 GLU A OE2   1 
ATOM   1600 N  N     . VAL B 2 109 ? 12.472  -34.218 -41.331 1.00 31.40 ? 109 VAL A N     1 
ATOM   1601 C  CA    . VAL B 2 109 ? 13.309  -33.188 -41.935 1.00 32.01 ? 109 VAL A CA    1 
ATOM   1602 C  C     . VAL B 2 109 ? 12.606  -31.830 -42.060 1.00 31.47 ? 109 VAL A C     1 
ATOM   1603 O  O     . VAL B 2 109 ? 11.430  -31.752 -42.412 1.00 32.14 ? 109 VAL A O     1 
ATOM   1604 C  CB    . VAL B 2 109 ? 13.799  -33.615 -43.354 1.00 31.13 ? 109 VAL A CB    1 
ATOM   1605 C  CG1   . VAL B 2 109 ? 14.611  -32.493 -43.985 1.00 28.13 ? 109 VAL A CG1   1 
ATOM   1606 C  CG2   . VAL B 2 109 ? 14.638  -34.893 -43.266 1.00 30.54 ? 109 VAL A CG2   1 
ATOM   1607 N  N     . ASP B 2 110 ? 13.328  -30.762 -41.747 1.00 31.51 ? 110 ASP A N     1 
ATOM   1608 C  CA    . ASP B 2 110 ? 12.782  -29.419 -41.889 1.00 32.15 ? 110 ASP A CA    1 
ATOM   1609 C  C     . ASP B 2 110 ? 13.557  -28.697 -42.983 1.00 30.58 ? 110 ASP A C     1 
ATOM   1610 O  O     . ASP B 2 110 ? 14.741  -28.434 -42.824 1.00 28.28 ? 110 ASP A O     1 
ATOM   1611 C  CB    . ASP B 2 110 ? 12.900  -28.620 -40.586 1.00 33.74 ? 110 ASP A CB    1 
ATOM   1612 C  CG    . ASP B 2 110 ? 11.702  -28.807 -39.666 1.00 35.86 ? 110 ASP A CG    1 
ATOM   1613 O  OD1   . ASP B 2 110 ? 10.636  -29.246 -40.136 1.00 37.61 ? 110 ASP A OD1   1 
ATOM   1614 O  OD2   . ASP B 2 110 ? 11.821  -28.495 -38.468 1.00 39.31 ? 110 ASP A OD2   1 
ATOM   1615 N  N     . VAL B 2 111 ? 12.901  -28.407 -44.103 1.00 31.30 ? 111 VAL A N     1 
ATOM   1616 C  CA    . VAL B 2 111 ? 13.552  -27.676 -45.189 1.00 31.73 ? 111 VAL A CA    1 
ATOM   1617 C  C     . VAL B 2 111 ? 13.166  -26.223 -44.963 1.00 32.25 ? 111 VAL A C     1 
ATOM   1618 O  O     . VAL B 2 111 ? 12.009  -25.835 -45.154 1.00 30.33 ? 111 VAL A O     1 
ATOM   1619 C  CB    . VAL B 2 111 ? 13.066  -28.136 -46.578 1.00 31.64 ? 111 VAL A CB    1 
ATOM   1620 C  CG1   . VAL B 2 111 ? 13.817  -27.381 -47.663 1.00 30.03 ? 111 VAL A CG1   1 
ATOM   1621 C  CG2   . VAL B 2 111 ? 13.294  -29.625 -46.741 1.00 30.55 ? 111 VAL A CG2   1 
ATOM   1622 N  N     . VAL B 2 112 ? 14.147  -25.428 -44.543 1.00 33.41 ? 112 VAL A N     1 
ATOM   1623 C  CA    . VAL B 2 112 ? 13.913  -24.026 -44.222 1.00 34.08 ? 112 VAL A CA    1 
ATOM   1624 C  C     . VAL B 2 112 ? 14.611  -23.013 -45.135 1.00 36.37 ? 112 VAL A C     1 
ATOM   1625 O  O     . VAL B 2 112 ? 15.813  -23.105 -45.372 1.00 37.36 ? 112 VAL A O     1 
ATOM   1626 C  CB    . VAL B 2 112 ? 14.367  -23.741 -42.766 1.00 32.44 ? 112 VAL A CB    1 
ATOM   1627 C  CG1   . VAL B 2 112 ? 13.868  -22.387 -42.312 1.00 29.13 ? 112 VAL A CG1   1 
ATOM   1628 C  CG2   . VAL B 2 112 ? 13.893  -24.858 -41.838 1.00 30.17 ? 112 VAL A CG2   1 
ATOM   1629 N  N     . PRO B 2 113 ? 13.858  -22.028 -45.655 1.00 38.19 ? 113 PRO A N     1 
ATOM   1630 C  CA    . PRO B 2 113 ? 14.403  -20.982 -46.535 1.00 38.49 ? 113 PRO A CA    1 
ATOM   1631 C  C     . PRO B 2 113 ? 14.949  -19.842 -45.670 1.00 38.91 ? 113 PRO A C     1 
ATOM   1632 O  O     . PRO B 2 113 ? 14.391  -19.559 -44.614 1.00 38.54 ? 113 PRO A O     1 
ATOM   1633 C  CB    . PRO B 2 113 ? 13.178  -20.502 -47.325 1.00 37.47 ? 113 PRO A CB    1 
ATOM   1634 C  CG    . PRO B 2 113 ? 12.148  -21.583 -47.124 1.00 39.13 ? 113 PRO A CG    1 
ATOM   1635 C  CD    . PRO B 2 113 ? 12.388  -22.027 -45.711 1.00 37.85 ? 113 PRO A CD    1 
ATOM   1636 N  N     . CYS B 2 114 ? 16.021  -19.191 -46.111 1.00 39.44 ? 114 CYS A N     1 
ATOM   1637 C  CA    . CYS B 2 114 ? 16.580  -18.059 -45.369 1.00 40.65 ? 114 CYS A CA    1 
ATOM   1638 C  C     . CYS B 2 114 ? 17.537  -17.238 -46.225 1.00 41.01 ? 114 CYS A C     1 
ATOM   1639 O  O     . CYS B 2 114 ? 18.108  -17.734 -47.199 1.00 39.70 ? 114 CYS A O     1 
ATOM   1640 C  CB    . CYS B 2 114 ? 17.313  -18.524 -44.108 1.00 42.73 ? 114 CYS A CB    1 
ATOM   1641 S  SG    . CYS B 2 114 ? 19.068  -18.902 -44.330 1.00 48.34 ? 114 CYS A SG    1 
ATOM   1642 N  N     . TYR B 2 115 ? 17.714  -15.976 -45.854 1.00 41.60 ? 115 TYR A N     1 
ATOM   1643 C  CA    . TYR B 2 115 ? 18.605  -15.096 -46.589 1.00 42.82 ? 115 TYR A CA    1 
ATOM   1644 C  C     . TYR B 2 115 ? 20.059  -15.295 -46.186 1.00 44.67 ? 115 TYR A C     1 
ATOM   1645 O  O     . TYR B 2 115 ? 20.413  -15.164 -45.019 1.00 43.11 ? 115 TYR A O     1 
ATOM   1646 C  CB    . TYR B 2 115 ? 18.214  -13.637 -46.369 1.00 42.08 ? 115 TYR A CB    1 
ATOM   1647 C  CG    . TYR B 2 115 ? 16.866  -13.284 -46.942 1.00 40.11 ? 115 TYR A CG    1 
ATOM   1648 C  CD1   . TYR B 2 115 ? 15.730  -13.237 -46.136 1.00 38.34 ? 115 TYR A CD1   1 
ATOM   1649 C  CD2   . TYR B 2 115 ? 16.726  -13.008 -48.297 1.00 38.52 ? 115 TYR A CD2   1 
ATOM   1650 C  CE1   . TYR B 2 115 ? 14.486  -12.921 -46.670 1.00 38.75 ? 115 TYR A CE1   1 
ATOM   1651 C  CE2   . TYR B 2 115 ? 15.500  -12.693 -48.838 1.00 39.53 ? 115 TYR A CE2   1 
ATOM   1652 C  CZ    . TYR B 2 115 ? 14.382  -12.649 -48.025 1.00 39.36 ? 115 TYR A CZ    1 
ATOM   1653 O  OH    . TYR B 2 115 ? 13.172  -12.319 -48.578 1.00 40.00 ? 115 TYR A OH    1 
ATOM   1654 N  N     . LYS B 2 116 ? 20.903  -15.619 -47.158 1.00 47.91 ? 116 LYS A N     1 
ATOM   1655 C  CA    . LYS B 2 116 ? 22.303  -15.808 -46.860 1.00 52.29 ? 116 LYS A CA    1 
ATOM   1656 C  C     . LYS B 2 116 ? 22.910  -14.418 -46.762 1.00 54.76 ? 116 LYS A C     1 
ATOM   1657 O  O     . LYS B 2 116 ? 23.010  -13.691 -47.747 1.00 54.70 ? 116 LYS A O     1 
ATOM   1658 C  CB    . LYS B 2 116 ? 22.970  -16.680 -47.935 1.00 52.75 ? 116 LYS A CB    1 
ATOM   1659 C  CG    . LYS B 2 116 ? 23.824  -15.999 -48.967 1.00 53.73 ? 116 LYS A CG    1 
ATOM   1660 C  CD    . LYS B 2 116 ? 24.632  -17.072 -49.679 1.00 57.37 ? 116 LYS A CD    1 
ATOM   1661 C  CE    . LYS B 2 116 ? 25.349  -16.549 -50.915 1.00 60.85 ? 116 LYS A CE    1 
ATOM   1662 N  NZ    . LYS B 2 116 ? 26.034  -17.653 -51.666 1.00 60.49 ? 116 LYS A NZ    1 
ATOM   1663 N  N     . LEU B 2 117 ? 23.275  -14.052 -45.539 1.00 57.40 ? 117 LEU A N     1 
ATOM   1664 C  CA    . LEU B 2 117 ? 23.841  -12.745 -45.248 1.00 60.64 ? 117 LEU A CA    1 
ATOM   1665 C  C     . LEU B 2 117 ? 25.287  -12.840 -44.786 1.00 63.69 ? 117 LEU A C     1 
ATOM   1666 O  O     . LEU B 2 117 ? 25.917  -13.903 -44.809 1.00 63.97 ? 117 LEU A O     1 
ATOM   1667 C  CB    . LEU B 2 117 ? 23.042  -12.070 -44.127 1.00 59.11 ? 117 LEU A CB    1 
ATOM   1668 C  CG    . LEU B 2 117 ? 21.516  -12.004 -44.190 1.00 58.95 ? 117 LEU A CG    1 
ATOM   1669 C  CD1   . LEU B 2 117 ? 20.975  -11.674 -42.814 1.00 59.12 ? 117 LEU A CD1   1 
ATOM   1670 C  CD2   . LEU B 2 117 ? 21.073  -10.963 -45.201 1.00 59.12 ? 117 LEU A CD2   1 
ATOM   1671 N  N     . LYS B 2 118 ? 25.785  -11.687 -44.361 1.00 66.79 ? 118 LYS A N     1 
ATOM   1672 C  CA    . LYS B 2 118 ? 27.118  -11.510 -43.805 1.00 69.50 ? 118 LYS A CA    1 
ATOM   1673 C  C     . LYS B 2 118 ? 26.758  -10.614 -42.629 1.00 70.71 ? 118 LYS A C     1 
ATOM   1674 O  O     . LYS B 2 118 ? 25.979  -9.678  -42.799 1.00 72.21 ? 118 LYS A O     1 
ATOM   1675 C  CB    . LYS B 2 118 ? 28.013  -10.773 -44.802 1.00 70.79 ? 118 LYS A CB    1 
ATOM   1676 C  CG    . LYS B 2 118 ? 27.324  -9.609  -45.488 1.00 72.46 ? 118 LYS A CG    1 
ATOM   1677 C  CD    . LYS B 2 118 ? 28.221  -8.953  -46.524 1.00 75.14 ? 118 LYS A CD    1 
ATOM   1678 C  CE    . LYS B 2 118 ? 27.447  -7.921  -47.338 1.00 76.58 ? 118 LYS A CE    1 
ATOM   1679 N  NZ    . LYS B 2 118 ? 26.756  -6.926  -46.462 1.00 78.18 ? 118 LYS A NZ    1 
ATOM   1680 N  N     . GLU B 2 119 ? 27.280  -10.895 -41.441 1.00 71.81 ? 119 GLU A N     1 
ATOM   1681 C  CA    . GLU B 2 119 ? 26.936  -10.085 -40.266 1.00 73.69 ? 119 GLU A CA    1 
ATOM   1682 C  C     . GLU B 2 119 ? 25.455  -10.296 -39.917 1.00 73.28 ? 119 GLU A C     1 
ATOM   1683 O  O     . GLU B 2 119 ? 24.563  -9.853  -40.645 1.00 72.62 ? 119 GLU A O     1 
ATOM   1684 C  CB    . GLU B 2 119 ? 27.180  -8.591  -40.535 1.00 74.86 ? 119 GLU A CB    1 
ATOM   1685 C  CG    . GLU B 2 119 ? 28.636  -8.141  -40.485 1.00 78.96 ? 119 GLU A CG    1 
ATOM   1686 C  CD    . GLU B 2 119 ? 29.179  -8.047  -39.065 1.00 81.33 ? 119 GLU A CD    1 
ATOM   1687 O  OE1   . GLU B 2 119 ? 28.552  -7.355  -38.230 1.00 81.82 ? 119 GLU A OE1   1 
ATOM   1688 O  OE2   . GLU B 2 119 ? 30.237  -8.658  -38.784 1.00 82.73 ? 119 GLU A OE2   1 
ATOM   1689 N  N     . PRO B 2 120 ? 25.178  -10.980 -38.796 1.00 72.65 ? 120 PRO A N     1 
ATOM   1690 C  CA    . PRO B 2 120 ? 23.801  -11.243 -38.366 1.00 73.17 ? 120 PRO A CA    1 
ATOM   1691 C  C     . PRO B 2 120 ? 23.158  -10.056 -37.656 1.00 73.57 ? 120 PRO A C     1 
ATOM   1692 O  O     . PRO B 2 120 ? 22.125  -10.212 -37.012 1.00 73.77 ? 120 PRO A O     1 
ATOM   1693 C  CB    . PRO B 2 120 ? 23.945  -12.440 -37.421 1.00 72.47 ? 120 PRO A CB    1 
ATOM   1694 C  CG    . PRO B 2 120 ? 25.325  -12.976 -37.697 1.00 71.73 ? 120 PRO A CG    1 
ATOM   1695 C  CD    . PRO B 2 120 ? 26.124  -11.756 -37.984 1.00 71.87 ? 120 PRO A CD    1 
ATOM   1696 N  N     . LYS B 2 121 ? 23.774  -8.881  -37.763 1.00 74.72 ? 121 LYS A N     1 
ATOM   1697 C  CA    . LYS B 2 121 ? 23.254  -7.678  -37.111 1.00 75.70 ? 121 LYS A CA    1 
ATOM   1698 C  C     . LYS B 2 121 ? 21.785  -7.392  -37.428 1.00 74.46 ? 121 LYS A C     1 
ATOM   1699 O  O     . LYS B 2 121 ? 20.932  -7.448  -36.538 1.00 73.98 ? 121 LYS A O     1 
ATOM   1700 C  CB    . LYS B 2 121 ? 24.109  -6.460  -37.486 1.00 78.40 ? 121 LYS A CB    1 
ATOM   1701 C  CG    . LYS B 2 121 ? 25.430  -6.354  -36.725 1.00 80.81 ? 121 LYS A CG    1 
ATOM   1702 C  CD    . LYS B 2 121 ? 25.207  -6.058  -35.242 1.00 82.25 ? 121 LYS A CD    1 
ATOM   1703 C  CE    . LYS B 2 121 ? 26.532  -5.830  -34.517 1.00 83.95 ? 121 LYS A CE    1 
ATOM   1704 N  NZ    . LYS B 2 121 ? 26.355  -5.414  -33.094 1.00 83.78 ? 121 LYS A NZ    1 
ATOM   1705 N  N     . ASN B 2 122 ? 21.493  -7.075  -38.687 1.00 72.61 ? 122 ASN A N     1 
ATOM   1706 C  CA    . ASN B 2 122 ? 20.121  -6.792  -39.093 1.00 70.89 ? 122 ASN A CA    1 
ATOM   1707 C  C     . ASN B 2 122 ? 19.564  -7.966  -39.894 1.00 68.30 ? 122 ASN A C     1 
ATOM   1708 O  O     . ASN B 2 122 ? 19.848  -8.128  -41.081 1.00 68.30 ? 122 ASN A O     1 
ATOM   1709 C  CB    . ASN B 2 122 ? 20.056  -5.503  -39.924 1.00 73.58 ? 122 ASN A CB    1 
ATOM   1710 C  CG    . ASN B 2 122 ? 18.621  -5.066  -40.219 1.00 76.56 ? 122 ASN A CG    1 
ATOM   1711 O  OD1   . ASN B 2 122 ? 17.848  -5.804  -40.835 1.00 78.81 ? 122 ASN A OD1   1 
ATOM   1712 N  ND2   . ASN B 2 122 ? 18.263  -3.861  -39.781 1.00 77.24 ? 122 ASN A ND2   1 
ATOM   1713 N  N     . ILE B 2 123 ? 18.773  -8.787  -39.217 1.00 64.70 ? 123 ILE A N     1 
ATOM   1714 C  CA    . ILE B 2 123 ? 18.151  -9.961  -39.808 1.00 60.38 ? 123 ILE A CA    1 
ATOM   1715 C  C     . ILE B 2 123 ? 16.972  -9.554  -40.691 1.00 56.44 ? 123 ILE A C     1 
ATOM   1716 O  O     . ILE B 2 123 ? 16.263  -8.606  -40.369 1.00 56.24 ? 123 ILE A O     1 
ATOM   1717 C  CB    . ILE B 2 123 ? 17.701  -10.914 -38.669 1.00 60.98 ? 123 ILE A CB    1 
ATOM   1718 C  CG1   . ILE B 2 123 ? 18.600  -12.143 -38.668 1.00 62.26 ? 123 ILE A CG1   1 
ATOM   1719 C  CG2   . ILE B 2 123 ? 16.234  -11.275 -38.789 1.00 60.99 ? 123 ILE A CG2   1 
ATOM   1720 C  CD1   . ILE B 2 123 ? 20.080  -11.806 -38.602 1.00 62.20 ? 123 ILE A CD1   1 
ATOM   1721 N  N     . LYS B 2 124 ? 16.770  -10.257 -41.805 1.00 51.91 ? 124 LYS A N     1 
ATOM   1722 C  CA    . LYS B 2 124 ? 15.665  -9.935  -42.713 1.00 48.54 ? 124 LYS A CA    1 
ATOM   1723 C  C     . LYS B 2 124 ? 14.504  -10.920 -42.586 1.00 47.51 ? 124 LYS A C     1 
ATOM   1724 O  O     . LYS B 2 124 ? 13.347  -10.554 -42.770 1.00 47.63 ? 124 LYS A O     1 
ATOM   1725 C  CB    . LYS B 2 124 ? 16.143  -9.894  -44.166 1.00 46.70 ? 124 LYS A CB    1 
ATOM   1726 C  CG    . LYS B 2 124 ? 15.050  -9.476  -45.130 1.00 44.73 ? 124 LYS A CG    1 
ATOM   1727 C  CD    . LYS B 2 124 ? 15.556  -9.385  -46.545 1.00 44.33 ? 124 LYS A CD    1 
ATOM   1728 C  CE    . LYS B 2 124 ? 14.468  -8.902  -47.482 1.00 45.16 ? 124 LYS A CE    1 
ATOM   1729 N  NZ    . LYS B 2 124 ? 14.973  -8.756  -48.885 1.00 47.64 ? 124 LYS A NZ    1 
ATOM   1730 N  N     . SER B 2 125 ? 14.825  -12.175 -42.292 1.00 45.56 ? 125 SER A N     1 
ATOM   1731 C  CA    . SER B 2 125 ? 13.818  -13.209 -42.091 1.00 42.30 ? 125 SER A CA    1 
ATOM   1732 C  C     . SER B 2 125 ? 14.089  -13.655 -40.665 1.00 40.24 ? 125 SER A C     1 
ATOM   1733 O  O     . SER B 2 125 ? 15.224  -13.558 -40.195 1.00 38.04 ? 125 SER A O     1 
ATOM   1734 C  CB    . SER B 2 125 ? 14.023  -14.392 -43.037 1.00 42.50 ? 125 SER A CB    1 
ATOM   1735 O  OG    . SER B 2 125 ? 15.007  -15.280 -42.531 1.00 43.00 ? 125 SER A OG    1 
ATOM   1736 N  N     . ALA B 2 126 ? 13.058  -14.153 -39.989 1.00 37.54 ? 126 ALA A N     1 
ATOM   1737 C  CA    . ALA B 2 126 ? 13.182  -14.583 -38.600 1.00 35.37 ? 126 ALA A CA    1 
ATOM   1738 C  C     . ALA B 2 126 ? 14.309  -15.575 -38.304 1.00 33.79 ? 126 ALA A C     1 
ATOM   1739 O  O     . ALA B 2 126 ? 14.825  -15.602 -37.184 1.00 32.18 ? 126 ALA A O     1 
ATOM   1740 C  CB    . ALA B 2 126 ? 11.846  -15.163 -38.119 1.00 32.61 ? 126 ALA A CB    1 
ATOM   1741 N  N     . VAL B 2 127 ? 14.702  -16.369 -39.298 1.00 31.72 ? 127 VAL A N     1 
ATOM   1742 C  CA    . VAL B 2 127 ? 15.727  -17.387 -39.080 1.00 32.46 ? 127 VAL A CA    1 
ATOM   1743 C  C     . VAL B 2 127 ? 17.127  -17.122 -39.628 1.00 32.91 ? 127 VAL A C     1 
ATOM   1744 O  O     . VAL B 2 127 ? 17.928  -18.049 -39.695 1.00 33.35 ? 127 VAL A O     1 
ATOM   1745 C  CB    . VAL B 2 127 ? 15.257  -18.774 -39.657 1.00 32.25 ? 127 VAL A CB    1 
ATOM   1746 C  CG1   . VAL B 2 127 ? 13.827  -19.058 -39.248 1.00 27.99 ? 127 VAL A CG1   1 
ATOM   1747 C  CG2   . VAL B 2 127 ? 15.381  -18.793 -41.185 1.00 31.12 ? 127 VAL A CG2   1 
ATOM   1748 N  N     . ASP B 2 128 ? 17.448  -15.883 -39.994 1.00 34.45 ? 128 ASP A N     1 
ATOM   1749 C  CA    . ASP B 2 128 ? 18.766  -15.614 -40.584 1.00 35.77 ? 128 ASP A CA    1 
ATOM   1750 C  C     . ASP B 2 128 ? 19.977  -15.800 -39.682 1.00 35.31 ? 128 ASP A C     1 
ATOM   1751 O  O     . ASP B 2 128 ? 21.098  -15.941 -40.181 1.00 37.17 ? 128 ASP A O     1 
ATOM   1752 C  CB    . ASP B 2 128 ? 18.827  -14.213 -41.219 1.00 35.69 ? 128 ASP A CB    1 
ATOM   1753 C  CG    . ASP B 2 128 ? 17.874  -14.057 -42.395 1.00 36.77 ? 128 ASP A CG    1 
ATOM   1754 O  OD1   . ASP B 2 128 ? 17.650  -15.040 -43.121 1.00 36.87 ? 128 ASP A OD1   1 
ATOM   1755 O  OD2   . ASP B 2 128 ? 17.358  -12.944 -42.606 1.00 38.85 ? 128 ASP A OD2   1 
ATOM   1756 N  N     . ARG B 2 129 ? 19.770  -15.807 -38.371 1.00 33.99 ? 129 ARG A N     1 
ATOM   1757 C  CA    . ARG B 2 129 ? 20.887  -15.989 -37.451 1.00 34.30 ? 129 ARG A CA    1 
ATOM   1758 C  C     . ARG B 2 129 ? 21.383  -17.425 -37.444 1.00 34.27 ? 129 ARG A C     1 
ATOM   1759 O  O     . ARG B 2 129 ? 22.581  -17.681 -37.270 1.00 33.41 ? 129 ARG A O     1 
ATOM   1760 C  CB    . ARG B 2 129 ? 20.491  -15.649 -36.014 1.00 34.39 ? 129 ARG A CB    1 
ATOM   1761 C  CG    . ARG B 2 129 ? 20.334  -14.197 -35.708 1.00 34.80 ? 129 ARG A CG    1 
ATOM   1762 C  CD    . ARG B 2 129 ? 20.050  -14.007 -34.229 1.00 36.89 ? 129 ARG A CD    1 
ATOM   1763 N  NE    . ARG B 2 129 ? 19.095  -12.916 -34.040 1.00 43.65 ? 129 ARG A NE    1 
ATOM   1764 C  CZ    . ARG B 2 129 ? 17.775  -13.068 -34.052 1.00 42.18 ? 129 ARG A CZ    1 
ATOM   1765 N  NH1   . ARG B 2 129 ? 17.244  -14.272 -34.225 1.00 42.78 ? 129 ARG A NH1   1 
ATOM   1766 N  NH2   . ARG B 2 129 ? 16.987  -12.012 -33.928 1.00 44.07 ? 129 ARG A NH2   1 
ATOM   1767 N  N     . THR B 2 130 ? 20.456  -18.358 -37.630 1.00 32.61 ? 130 THR A N     1 
ATOM   1768 C  CA    . THR B 2 130 ? 20.778  -19.773 -37.565 1.00 32.30 ? 130 THR A CA    1 
ATOM   1769 C  C     . THR B 2 130 ? 22.076  -20.247 -38.209 1.00 31.00 ? 130 THR A C     1 
ATOM   1770 O  O     . THR B 2 130 ? 22.872  -20.906 -37.558 1.00 29.65 ? 130 THR A O     1 
ATOM   1771 C  CB    . THR B 2 130 ? 19.602  -20.589 -38.057 1.00 31.76 ? 130 THR A CB    1 
ATOM   1772 O  OG1   . THR B 2 130 ? 18.466  -20.245 -37.259 1.00 34.97 ? 130 THR A OG1   1 
ATOM   1773 C  CG2   . THR B 2 130 ? 19.874  -22.078 -37.901 1.00 28.64 ? 130 THR A CG2   1 
ATOM   1774 N  N     . PRO B 2 131 ? 22.319  -19.911 -39.480 1.00 31.07 ? 131 PRO A N     1 
ATOM   1775 C  CA    . PRO B 2 131 ? 23.578  -20.380 -40.069 1.00 31.40 ? 131 PRO A CA    1 
ATOM   1776 C  C     . PRO B 2 131 ? 24.798  -19.835 -39.315 1.00 30.93 ? 131 PRO A C     1 
ATOM   1777 O  O     . PRO B 2 131 ? 25.832  -20.482 -39.254 1.00 32.33 ? 131 PRO A O     1 
ATOM   1778 C  CB    . PRO B 2 131 ? 23.497  -19.865 -41.505 1.00 30.87 ? 131 PRO A CB    1 
ATOM   1779 C  CG    . PRO B 2 131 ? 22.031  -19.845 -41.775 1.00 30.95 ? 131 PRO A CG    1 
ATOM   1780 C  CD    . PRO B 2 131 ? 21.479  -19.255 -40.494 1.00 31.71 ? 131 PRO A CD    1 
ATOM   1781 N  N     . PHE B 2 132 ? 24.670  -18.641 -38.745 1.00 32.60 ? 132 PHE A N     1 
ATOM   1782 C  CA    . PHE B 2 132 ? 25.761  -18.032 -37.991 1.00 31.31 ? 132 PHE A CA    1 
ATOM   1783 C  C     . PHE B 2 132 ? 25.945  -18.671 -36.634 1.00 31.78 ? 132 PHE A C     1 
ATOM   1784 O  O     . PHE B 2 132 ? 27.036  -18.626 -36.077 1.00 32.42 ? 132 PHE A O     1 
ATOM   1785 C  CB    . PHE B 2 132 ? 25.524  -16.539 -37.796 1.00 30.75 ? 132 PHE A CB    1 
ATOM   1786 C  CG    . PHE B 2 132 ? 25.638  -15.742 -39.052 1.00 31.30 ? 132 PHE A CG    1 
ATOM   1787 C  CD1   . PHE B 2 132 ? 24.506  -15.407 -39.782 1.00 29.92 ? 132 PHE A CD1   1 
ATOM   1788 C  CD2   . PHE B 2 132 ? 26.888  -15.308 -39.503 1.00 31.93 ? 132 PHE A CD2   1 
ATOM   1789 C  CE1   . PHE B 2 132 ? 24.610  -14.647 -40.940 1.00 30.89 ? 132 PHE A CE1   1 
ATOM   1790 C  CE2   . PHE B 2 132 ? 27.004  -14.547 -40.666 1.00 30.83 ? 132 PHE A CE2   1 
ATOM   1791 C  CZ    . PHE B 2 132 ? 25.864  -14.216 -41.384 1.00 31.55 ? 132 PHE A CZ    1 
ATOM   1792 N  N     . HIS B 2 133 ? 24.870  -19.231 -36.083 1.00 34.31 ? 133 HIS A N     1 
ATOM   1793 C  CA    . HIS B 2 133 ? 24.949  -19.907 -34.788 1.00 35.97 ? 133 HIS A CA    1 
ATOM   1794 C  C     . HIS B 2 133 ? 25.721  -21.174 -35.041 1.00 35.21 ? 133 HIS A C     1 
ATOM   1795 O  O     . HIS B 2 133 ? 26.479  -21.640 -34.192 1.00 36.49 ? 133 HIS A O     1 
ATOM   1796 C  CB    . HIS B 2 133 ? 23.568  -20.310 -34.269 1.00 35.25 ? 133 HIS A CB    1 
ATOM   1797 C  CG    . HIS B 2 133 ? 22.742  -19.166 -33.788 1.00 35.24 ? 133 HIS A CG    1 
ATOM   1798 N  ND1   . HIS B 2 133 ? 21.376  -19.247 -33.646 1.00 35.47 ? 133 HIS A ND1   1 
ATOM   1799 C  CD2   . HIS B 2 133 ? 23.088  -17.918 -33.396 1.00 35.43 ? 133 HIS A CD2   1 
ATOM   1800 C  CE1   . HIS B 2 133 ? 20.914  -18.098 -33.188 1.00 35.94 ? 133 HIS A CE1   1 
ATOM   1801 N  NE2   . HIS B 2 133 ? 21.934  -17.275 -33.027 1.00 34.99 ? 133 HIS A NE2   1 
ATOM   1802 N  N     . HIS B 2 134 ? 25.515  -21.728 -36.226 1.00 35.61 ? 134 HIS A N     1 
ATOM   1803 C  CA    . HIS B 2 134 ? 26.178  -22.959 -36.587 1.00 37.36 ? 134 HIS A CA    1 
ATOM   1804 C  C     . HIS B 2 134 ? 27.682  -22.807 -36.687 1.00 37.87 ? 134 HIS A C     1 
ATOM   1805 O  O     . HIS B 2 134 ? 28.421  -23.643 -36.177 1.00 37.84 ? 134 HIS A O     1 
ATOM   1806 C  CB    . HIS B 2 134 ? 25.661  -23.506 -37.910 1.00 37.10 ? 134 HIS A CB    1 
ATOM   1807 C  CG    . HIS B 2 134 ? 26.273  -24.819 -38.270 1.00 38.29 ? 134 HIS A CG    1 
ATOM   1808 N  ND1   . HIS B 2 134 ? 25.960  -25.987 -37.606 1.00 38.38 ? 134 HIS A ND1   1 
ATOM   1809 C  CD2   . HIS B 2 134 ? 27.260  -25.134 -39.141 1.00 38.53 ? 134 HIS A CD2   1 
ATOM   1810 C  CE1   . HIS B 2 134 ? 26.731  -26.962 -38.049 1.00 39.99 ? 134 HIS A CE1   1 
ATOM   1811 N  NE2   . HIS B 2 134 ? 27.530  -26.471 -38.980 1.00 41.39 ? 134 HIS A NE2   1 
ATOM   1812 N  N     . LYS B 2 135 ? 28.135  -21.750 -37.353 1.00 38.16 ? 135 LYS A N     1 
ATOM   1813 C  CA    . LYS B 2 135 ? 29.567  -21.534 -37.512 1.00 40.07 ? 135 LYS A CA    1 
ATOM   1814 C  C     . LYS B 2 135 ? 30.251  -21.237 -36.188 1.00 38.42 ? 135 LYS A C     1 
ATOM   1815 O  O     . LYS B 2 135 ? 31.373  -21.678 -35.949 1.00 37.79 ? 135 LYS A O     1 
ATOM   1816 C  CB    . LYS B 2 135 ? 29.833  -20.396 -38.505 1.00 43.08 ? 135 LYS A CB    1 
ATOM   1817 C  CG    . LYS B 2 135 ? 29.364  -20.708 -39.925 1.00 48.89 ? 135 LYS A CG    1 
ATOM   1818 C  CD    . LYS B 2 135 ? 29.998  -22.001 -40.471 1.00 52.59 ? 135 LYS A CD    1 
ATOM   1819 C  CE    . LYS B 2 135 ? 29.323  -22.473 -41.773 1.00 55.71 ? 135 LYS A CE    1 
ATOM   1820 N  NZ    . LYS B 2 135 ? 29.435  -21.487 -42.902 1.00 57.10 ? 135 LYS A NZ    1 
ATOM   1821 N  N     . TRP B 2 136 ? 29.567  -20.498 -35.325 1.00 36.90 ? 136 TRP A N     1 
ATOM   1822 C  CA    . TRP B 2 136 ? 30.128  -20.141 -34.035 1.00 35.47 ? 136 TRP A CA    1 
ATOM   1823 C  C     . TRP B 2 136 ? 30.323  -21.365 -33.149 1.00 36.79 ? 136 TRP A C     1 
ATOM   1824 O  O     . TRP B 2 136 ? 31.329  -21.484 -32.441 1.00 35.69 ? 136 TRP A O     1 
ATOM   1825 C  CB    . TRP B 2 136 ? 29.214  -19.164 -33.312 1.00 32.49 ? 136 TRP A CB    1 
ATOM   1826 C  CG    . TRP B 2 136 ? 29.904  -18.501 -32.171 1.00 30.83 ? 136 TRP A CG    1 
ATOM   1827 C  CD1   . TRP B 2 136 ? 30.707  -17.405 -32.235 1.00 28.23 ? 136 TRP A CD1   1 
ATOM   1828 C  CD2   . TRP B 2 136 ? 29.884  -18.907 -30.796 1.00 30.00 ? 136 TRP A CD2   1 
ATOM   1829 N  NE1   . TRP B 2 136 ? 31.189  -17.100 -30.993 1.00 29.43 ? 136 TRP A NE1   1 
ATOM   1830 C  CE2   . TRP B 2 136 ? 30.703  -18.002 -30.086 1.00 27.75 ? 136 TRP A CE2   1 
ATOM   1831 C  CE3   . TRP B 2 136 ? 29.253  -19.946 -30.095 1.00 30.46 ? 136 TRP A CE3   1 
ATOM   1832 C  CZ2   . TRP B 2 136 ? 30.910  -18.096 -28.704 1.00 26.45 ? 136 TRP A CZ2   1 
ATOM   1833 C  CZ3   . TRP B 2 136 ? 29.457  -20.045 -28.715 1.00 30.60 ? 136 TRP A CZ3   1 
ATOM   1834 C  CH2   . TRP B 2 136 ? 30.282  -19.118 -28.036 1.00 29.62 ? 136 TRP A CH2   1 
ATOM   1835 N  N     . LEU B 2 137 ? 29.345  -22.264 -33.196 1.00 36.84 ? 137 LEU A N     1 
ATOM   1836 C  CA    . LEU B 2 137 ? 29.350  -23.478 -32.402 1.00 37.23 ? 137 LEU A CA    1 
ATOM   1837 C  C     . LEU B 2 137 ? 30.243  -24.592 -32.941 1.00 38.95 ? 137 LEU A C     1 
ATOM   1838 O  O     . LEU B 2 137 ? 30.949  -25.234 -32.173 1.00 40.47 ? 137 LEU A O     1 
ATOM   1839 C  CB    . LEU B 2 137 ? 27.912  -23.992 -32.271 1.00 37.59 ? 137 LEU A CB    1 
ATOM   1840 C  CG    . LEU B 2 137 ? 27.189  -23.979 -30.915 1.00 39.31 ? 137 LEU A CG    1 
ATOM   1841 C  CD1   . LEU B 2 137 ? 27.735  -22.909 -29.992 1.00 40.37 ? 137 LEU A CD1   1 
ATOM   1842 C  CD2   . LEU B 2 137 ? 25.706  -23.758 -31.157 1.00 37.46 ? 137 LEU A CD2   1 
ATOM   1843 N  N     . GLU B 2 138 ? 30.225  -24.809 -34.254 1.00 41.06 ? 138 GLU A N     1 
ATOM   1844 C  CA    . GLU B 2 138 ? 30.997  -25.888 -34.882 1.00 42.56 ? 138 GLU A CA    1 
ATOM   1845 C  C     . GLU B 2 138 ? 32.350  -26.188 -34.256 1.00 40.67 ? 138 GLU A C     1 
ATOM   1846 O  O     . GLU B 2 138 ? 32.634  -27.339 -33.923 1.00 37.54 ? 138 GLU A O     1 
ATOM   1847 C  CB    . GLU B 2 138 ? 31.191  -25.626 -36.379 1.00 45.81 ? 138 GLU A CB    1 
ATOM   1848 C  CG    . GLU B 2 138 ? 31.763  -24.265 -36.686 1.00 54.18 ? 138 GLU A CG    1 
ATOM   1849 C  CD    . GLU B 2 138 ? 32.218  -24.118 -38.129 1.00 59.79 ? 138 GLU A CD    1 
ATOM   1850 O  OE1   . GLU B 2 138 ? 31.544  -24.675 -39.032 1.00 62.77 ? 138 GLU A OE1   1 
ATOM   1851 O  OE2   . GLU B 2 138 ? 33.245  -23.429 -38.355 1.00 60.41 ? 138 GLU A OE2   1 
ATOM   1852 N  N     . GLY B 2 139 ? 33.173  -25.157 -34.092 1.00 39.32 ? 139 GLY A N     1 
ATOM   1853 C  CA    . GLY B 2 139 ? 34.492  -25.354 -33.521 1.00 38.75 ? 139 GLY A CA    1 
ATOM   1854 C  C     . GLY B 2 139 ? 34.579  -25.373 -32.006 1.00 39.96 ? 139 GLY A C     1 
ATOM   1855 O  O     . GLY B 2 139 ? 35.590  -25.806 -31.458 1.00 39.51 ? 139 GLY A O     1 
ATOM   1856 N  N     . ARG B 2 140 ? 33.531  -24.927 -31.318 1.00 40.08 ? 140 ARG A N     1 
ATOM   1857 C  CA    . ARG B 2 140 ? 33.559  -24.893 -29.859 1.00 41.04 ? 140 ARG A CA    1 
ATOM   1858 C  C     . ARG B 2 140 ? 32.877  -26.065 -29.161 1.00 41.21 ? 140 ARG A C     1 
ATOM   1859 O  O     . ARG B 2 140 ? 33.284  -26.463 -28.077 1.00 43.19 ? 140 ARG A O     1 
ATOM   1860 C  CB    . ARG B 2 140 ? 32.945  -23.584 -29.355 1.00 39.16 ? 140 ARG A CB    1 
ATOM   1861 C  CG    . ARG B 2 140 ? 33.659  -22.332 -29.829 1.00 37.91 ? 140 ARG A CG    1 
ATOM   1862 C  CD    . ARG B 2 140 ? 32.873  -21.097 -29.450 1.00 38.90 ? 140 ARG A CD    1 
ATOM   1863 N  NE    . ARG B 2 140 ? 33.054  -20.033 -30.428 1.00 43.57 ? 140 ARG A NE    1 
ATOM   1864 C  CZ    . ARG B 2 140 ? 34.052  -19.162 -30.404 1.00 45.02 ? 140 ARG A CZ    1 
ATOM   1865 N  NH1   . ARG B 2 140 ? 34.959  -19.226 -29.439 1.00 47.88 ? 140 ARG A NH1   1 
ATOM   1866 N  NH2   . ARG B 2 140 ? 34.153  -18.243 -31.352 1.00 41.73 ? 140 ARG A NH2   1 
ATOM   1867 N  N     . ILE B 2 141 ? 31.844  -26.614 -29.779 1.00 41.82 ? 141 ILE A N     1 
ATOM   1868 C  CA    . ILE B 2 141 ? 31.103  -27.716 -29.185 1.00 42.17 ? 141 ILE A CA    1 
ATOM   1869 C  C     . ILE B 2 141 ? 31.705  -29.096 -29.540 1.00 43.87 ? 141 ILE A C     1 
ATOM   1870 O  O     . ILE B 2 141 ? 31.354  -30.109 -28.943 1.00 43.39 ? 141 ILE A O     1 
ATOM   1871 C  CB    . ILE B 2 141 ? 29.602  -27.633 -29.622 1.00 42.07 ? 141 ILE A CB    1 
ATOM   1872 C  CG1   . ILE B 2 141 ? 28.700  -28.241 -28.546 1.00 43.40 ? 141 ILE A CG1   1 
ATOM   1873 C  CG2   . ILE B 2 141 ? 29.388  -28.350 -30.952 1.00 40.23 ? 141 ILE A CG2   1 
ATOM   1874 C  CD1   . ILE B 2 141 ? 28.592  -27.397 -27.282 1.00 42.78 ? 141 ILE A CD1   1 
ATOM   1875 N  N     . LYS B 2 142 ? 32.622  -29.121 -30.505 1.00 45.78 ? 142 LYS A N     1 
ATOM   1876 C  CA    . LYS B 2 142 ? 33.280  -30.357 -30.944 1.00 46.79 ? 142 LYS A CA    1 
ATOM   1877 C  C     . LYS B 2 142 ? 33.973  -31.035 -29.755 1.00 46.58 ? 142 LYS A C     1 
ATOM   1878 O  O     . LYS B 2 142 ? 34.896  -30.469 -29.162 1.00 47.18 ? 142 LYS A O     1 
ATOM   1879 C  CB    . LYS B 2 142 ? 34.314  -30.022 -32.030 1.00 49.07 ? 142 LYS A CB    1 
ATOM   1880 C  CG    . LYS B 2 142 ? 34.774  -31.188 -32.877 1.00 51.18 ? 142 LYS A CG    1 
ATOM   1881 C  CD    . LYS B 2 142 ? 33.700  -31.602 -33.869 1.00 54.45 ? 142 LYS A CD    1 
ATOM   1882 C  CE    . LYS B 2 142 ? 34.103  -32.858 -34.637 1.00 54.99 ? 142 LYS A CE    1 
ATOM   1883 N  NZ    . LYS B 2 142 ? 33.052  -33.285 -35.607 1.00 56.22 ? 142 LYS A NZ    1 
ATOM   1884 N  N     . GLY B 2 143 ? 33.527  -32.241 -29.408 1.00 45.86 ? 143 GLY A N     1 
ATOM   1885 C  CA    . GLY B 2 143 ? 34.107  -32.960 -28.283 1.00 42.85 ? 143 GLY A CA    1 
ATOM   1886 C  C     . GLY B 2 143 ? 33.241  -32.958 -27.026 1.00 43.41 ? 143 GLY A C     1 
ATOM   1887 O  O     . GLY B 2 143 ? 33.394  -33.815 -26.155 1.00 43.43 ? 143 GLY A O     1 
ATOM   1888 N  N     . LYS B 2 144 ? 32.322  -32.003 -26.927 1.00 42.96 ? 144 LYS A N     1 
ATOM   1889 C  CA    . LYS B 2 144 ? 31.445  -31.900 -25.764 1.00 43.17 ? 144 LYS A CA    1 
ATOM   1890 C  C     . LYS B 2 144 ? 29.977  -32.165 -26.088 1.00 41.10 ? 144 LYS A C     1 
ATOM   1891 O  O     . LYS B 2 144 ? 29.088  -31.786 -25.326 1.00 38.27 ? 144 LYS A O     1 
ATOM   1892 C  CB    . LYS B 2 144 ? 31.594  -30.509 -25.127 1.00 45.88 ? 144 LYS A CB    1 
ATOM   1893 C  CG    . LYS B 2 144 ? 32.910  -30.310 -24.369 1.00 50.38 ? 144 LYS A CG    1 
ATOM   1894 C  CD    . LYS B 2 144 ? 33.151  -28.855 -23.985 1.00 54.86 ? 144 LYS A CD    1 
ATOM   1895 C  CE    . LYS B 2 144 ? 33.406  -27.996 -25.223 1.00 57.42 ? 144 LYS A CE    1 
ATOM   1896 N  NZ    . LYS B 2 144 ? 33.621  -26.541 -24.918 1.00 59.03 ? 144 LYS A NZ    1 
ATOM   1897 N  N     . GLU B 2 145 ? 29.715  -32.832 -27.207 1.00 41.59 ? 145 GLU A N     1 
ATOM   1898 C  CA    . GLU B 2 145 ? 28.332  -33.100 -27.582 1.00 43.30 ? 145 GLU A CA    1 
ATOM   1899 C  C     . GLU B 2 145 ? 27.566  -34.041 -26.635 1.00 43.29 ? 145 GLU A C     1 
ATOM   1900 O  O     . GLU B 2 145 ? 26.340  -33.953 -26.529 1.00 42.85 ? 145 GLU A O     1 
ATOM   1901 C  CB    . GLU B 2 145 ? 28.236  -33.574 -29.048 1.00 42.38 ? 145 GLU A CB    1 
ATOM   1902 C  CG    . GLU B 2 145 ? 29.311  -34.530 -29.559 1.00 44.09 ? 145 GLU A CG    1 
ATOM   1903 C  CD    . GLU B 2 145 ? 30.670  -33.868 -29.820 1.00 43.27 ? 145 GLU A CD    1 
ATOM   1904 O  OE1   . GLU B 2 145 ? 31.511  -33.873 -28.898 1.00 42.20 ? 145 GLU A OE1   1 
ATOM   1905 O  OE2   . GLU B 2 145 ? 30.900  -33.352 -30.944 1.00 41.32 ? 145 GLU A OE2   1 
ATOM   1906 N  N     . ASN B 2 146 ? 28.265  -34.927 -25.935 1.00 42.85 ? 146 ASN A N     1 
ATOM   1907 C  CA    . ASN B 2 146 ? 27.567  -35.797 -24.994 1.00 43.18 ? 146 ASN A CA    1 
ATOM   1908 C  C     . ASN B 2 146 ? 27.090  -34.958 -23.806 1.00 42.85 ? 146 ASN A C     1 
ATOM   1909 O  O     . ASN B 2 146 ? 26.065  -35.264 -23.193 1.00 42.68 ? 146 ASN A O     1 
ATOM   1910 C  CB    . ASN B 2 146 ? 28.472  -36.919 -24.478 1.00 45.45 ? 146 ASN A CB    1 
ATOM   1911 C  CG    . ASN B 2 146 ? 28.802  -37.950 -25.545 1.00 48.17 ? 146 ASN A CG    1 
ATOM   1912 O  OD1   . ASN B 2 146 ? 28.067  -38.112 -26.534 1.00 50.26 ? 146 ASN A OD1   1 
ATOM   1913 N  ND2   . ASN B 2 146 ? 29.903  -38.671 -25.341 1.00 45.48 ? 146 ASN A ND2   1 
ATOM   1914 N  N     . GLU B 2 147 ? 27.839  -33.907 -23.477 1.00 40.73 ? 147 GLU A N     1 
ATOM   1915 C  CA    . GLU B 2 147 ? 27.462  -33.042 -22.368 1.00 40.41 ? 147 GLU A CA    1 
ATOM   1916 C  C     . GLU B 2 147 ? 26.152  -32.327 -22.709 1.00 39.84 ? 147 GLU A C     1 
ATOM   1917 O  O     . GLU B 2 147 ? 25.251  -32.235 -21.875 1.00 38.28 ? 147 GLU A O     1 
ATOM   1918 C  CB    . GLU B 2 147 ? 28.561  -32.017 -22.075 1.00 42.35 ? 147 GLU A CB    1 
ATOM   1919 C  CG    . GLU B 2 147 ? 29.877  -32.594 -21.533 1.00 43.64 ? 147 GLU A CG    1 
ATOM   1920 C  CD    . GLU B 2 147 ? 29.699  -33.449 -20.279 1.00 45.28 ? 147 GLU A CD    1 
ATOM   1921 O  OE1   . GLU B 2 147 ? 28.858  -33.106 -19.420 1.00 44.73 ? 147 GLU A OE1   1 
ATOM   1922 O  OE2   . GLU B 2 147 ? 30.423  -34.462 -20.145 1.00 47.66 ? 147 GLU A OE2   1 
ATOM   1923 N  N     . VAL B 2 148 ? 26.054  -31.826 -23.938 1.00 38.21 ? 148 VAL A N     1 
ATOM   1924 C  CA    . VAL B 2 148 ? 24.841  -31.154 -24.392 1.00 36.03 ? 148 VAL A CA    1 
ATOM   1925 C  C     . VAL B 2 148 ? 23.663  -32.125 -24.294 1.00 35.59 ? 148 VAL A C     1 
ATOM   1926 O  O     . VAL B 2 148 ? 22.567  -31.758 -23.848 1.00 34.59 ? 148 VAL A O     1 
ATOM   1927 C  CB    . VAL B 2 148 ? 24.972  -30.684 -25.866 1.00 35.92 ? 148 VAL A CB    1 
ATOM   1928 C  CG1   . VAL B 2 148 ? 23.636  -30.162 -26.376 1.00 32.39 ? 148 VAL A CG1   1 
ATOM   1929 C  CG2   . VAL B 2 148 ? 26.035  -29.602 -25.971 1.00 34.43 ? 148 VAL A CG2   1 
ATOM   1930 N  N     . ARG B 2 149 ? 23.891  -33.367 -24.707 1.00 34.63 ? 149 ARG A N     1 
ATOM   1931 C  CA    . ARG B 2 149 ? 22.835  -34.371 -24.662 1.00 33.90 ? 149 ARG A CA    1 
ATOM   1932 C  C     . ARG B 2 149 ? 22.336  -34.645 -23.246 1.00 32.84 ? 149 ARG A C     1 
ATOM   1933 O  O     . ARG B 2 149 ? 21.137  -34.795 -23.030 1.00 34.59 ? 149 ARG A O     1 
ATOM   1934 C  CB    . ARG B 2 149 ? 23.306  -35.657 -25.345 1.00 33.13 ? 149 ARG A CB    1 
ATOM   1935 C  CG    . ARG B 2 149 ? 23.193  -35.578 -26.860 1.00 33.28 ? 149 ARG A CG    1 
ATOM   1936 C  CD    . ARG B 2 149 ? 24.017  -36.629 -27.580 1.00 32.63 ? 149 ARG A CD    1 
ATOM   1937 N  NE    . ARG B 2 149 ? 23.715  -36.634 -29.009 1.00 33.86 ? 149 ARG A NE    1 
ATOM   1938 C  CZ    . ARG B 2 149 ? 24.512  -37.128 -29.950 1.00 34.31 ? 149 ARG A CZ    1 
ATOM   1939 N  NH1   . ARG B 2 149 ? 25.677  -37.667 -29.620 1.00 35.64 ? 149 ARG A NH1   1 
ATOM   1940 N  NH2   . ARG B 2 149 ? 24.151  -37.066 -31.225 1.00 32.69 ? 149 ARG A NH2   1 
ATOM   1941 N  N     . LEU B 2 150 ? 23.238  -34.704 -22.275 1.00 32.16 ? 150 LEU A N     1 
ATOM   1942 C  CA    . LEU B 2 150 ? 22.802  -34.939 -20.903 1.00 31.17 ? 150 LEU A CA    1 
ATOM   1943 C  C     . LEU B 2 150 ? 21.873  -33.784 -20.533 1.00 30.83 ? 150 LEU A C     1 
ATOM   1944 O  O     . LEU B 2 150 ? 20.764  -34.005 -20.049 1.00 31.77 ? 150 LEU A O     1 
ATOM   1945 C  CB    . LEU B 2 150 ? 24.003  -35.001 -19.942 1.00 30.26 ? 150 LEU A CB    1 
ATOM   1946 C  CG    . LEU B 2 150 ? 24.849  -36.294 -19.900 1.00 31.51 ? 150 LEU A CG    1 
ATOM   1947 C  CD1   . LEU B 2 150 ? 26.165  -36.036 -19.185 1.00 30.34 ? 150 LEU A CD1   1 
ATOM   1948 C  CD2   . LEU B 2 150 ? 24.088  -37.405 -19.197 1.00 28.13 ? 150 LEU A CD2   1 
ATOM   1949 N  N     . LEU B 2 151 ? 22.319  -32.558 -20.806 1.00 30.21 ? 151 LEU A N     1 
ATOM   1950 C  CA    . LEU B 2 151 ? 21.544  -31.355 -20.509 1.00 30.14 ? 151 LEU A CA    1 
ATOM   1951 C  C     . LEU B 2 151 ? 20.172  -31.361 -21.179 1.00 31.74 ? 151 LEU A C     1 
ATOM   1952 O  O     . LEU B 2 151 ? 19.177  -31.002 -20.554 1.00 32.15 ? 151 LEU A O     1 
ATOM   1953 C  CB    . LEU B 2 151 ? 22.306  -30.096 -20.939 1.00 28.49 ? 151 LEU A CB    1 
ATOM   1954 C  CG    . LEU B 2 151 ? 21.630  -28.779 -20.526 1.00 26.81 ? 151 LEU A CG    1 
ATOM   1955 C  CD1   . LEU B 2 151 ? 21.299  -28.808 -19.024 1.00 22.10 ? 151 LEU A CD1   1 
ATOM   1956 C  CD2   . LEU B 2 151 ? 22.546  -27.607 -20.845 1.00 24.97 ? 151 LEU A CD2   1 
ATOM   1957 N  N     . LYS B 2 152 ? 20.123  -31.760 -22.450 1.00 32.28 ? 152 LYS A N     1 
ATOM   1958 C  CA    . LYS B 2 152 ? 18.858  -31.824 -23.176 1.00 31.15 ? 152 LYS A CA    1 
ATOM   1959 C  C     . LYS B 2 152 ? 17.976  -32.928 -22.601 1.00 31.10 ? 152 LYS A C     1 
ATOM   1960 O  O     . LYS B 2 152 ? 16.769  -32.742 -22.419 1.00 31.53 ? 152 LYS A O     1 
ATOM   1961 C  CB    . LYS B 2 152 ? 19.085  -32.108 -24.668 1.00 29.25 ? 152 LYS A CB    1 
ATOM   1962 C  CG    . LYS B 2 152 ? 19.769  -31.010 -25.446 1.00 27.47 ? 152 LYS A CG    1 
ATOM   1963 C  CD    . LYS B 2 152 ? 19.684  -31.289 -26.938 1.00 25.83 ? 152 LYS A CD    1 
ATOM   1964 C  CE    . LYS B 2 152 ? 20.351  -30.189 -27.738 1.00 27.06 ? 152 LYS A CE    1 
ATOM   1965 N  NZ    . LYS B 2 152 ? 20.151  -30.354 -29.215 1.00 28.24 ? 152 LYS A NZ    1 
ATOM   1966 N  N     . GLY B 2 153 ? 18.578  -34.081 -22.321 1.00 29.39 ? 153 GLY A N     1 
ATOM   1967 C  CA    . GLY B 2 153 ? 17.806  -35.189 -21.787 1.00 30.70 ? 153 GLY A CA    1 
ATOM   1968 C  C     . GLY B 2 153 ? 17.207  -34.872 -20.433 1.00 31.06 ? 153 GLY A C     1 
ATOM   1969 O  O     . GLY B 2 153 ? 16.127  -35.343 -20.086 1.00 30.86 ? 153 GLY A O     1 
ATOM   1970 N  N     . PHE B 2 154 ? 17.933  -34.061 -19.672 1.00 31.74 ? 154 PHE A N     1 
ATOM   1971 C  CA    . PHE B 2 154 ? 17.538  -33.642 -18.336 1.00 31.50 ? 154 PHE A CA    1 
ATOM   1972 C  C     . PHE B 2 154 ? 16.328  -32.709 -18.409 1.00 32.22 ? 154 PHE A C     1 
ATOM   1973 O  O     . PHE B 2 154 ? 15.345  -32.889 -17.695 1.00 31.78 ? 154 PHE A O     1 
ATOM   1974 C  CB    . PHE B 2 154 ? 18.723  -32.923 -17.693 1.00 32.20 ? 154 PHE A CB    1 
ATOM   1975 C  CG    . PHE B 2 154 ? 18.567  -32.649 -16.224 1.00 34.26 ? 154 PHE A CG    1 
ATOM   1976 C  CD1   . PHE B 2 154 ? 18.564  -33.695 -15.299 1.00 33.91 ? 154 PHE A CD1   1 
ATOM   1977 C  CD2   . PHE B 2 154 ? 18.500  -31.338 -15.754 1.00 33.16 ? 154 PHE A CD2   1 
ATOM   1978 C  CE1   . PHE B 2 154 ? 18.505  -33.435 -13.925 1.00 32.81 ? 154 PHE A CE1   1 
ATOM   1979 C  CE2   . PHE B 2 154 ? 18.441  -31.070 -14.386 1.00 33.48 ? 154 PHE A CE2   1 
ATOM   1980 C  CZ    . PHE B 2 154 ? 18.446  -32.122 -13.469 1.00 31.96 ? 154 PHE A CZ    1 
ATOM   1981 N  N     . LEU B 2 155 ? 16.408  -31.716 -19.288 1.00 32.51 ? 155 LEU A N     1 
ATOM   1982 C  CA    . LEU B 2 155 ? 15.343  -30.736 -19.452 1.00 32.77 ? 155 LEU A CA    1 
ATOM   1983 C  C     . LEU B 2 155 ? 14.104  -31.354 -20.079 1.00 33.67 ? 155 LEU A C     1 
ATOM   1984 O  O     . LEU B 2 155 ? 12.974  -30.983 -19.753 1.00 34.20 ? 155 LEU A O     1 
ATOM   1985 C  CB    . LEU B 2 155 ? 15.843  -29.582 -20.315 1.00 32.16 ? 155 LEU A CB    1 
ATOM   1986 C  CG    . LEU B 2 155 ? 16.967  -28.725 -19.724 1.00 29.05 ? 155 LEU A CG    1 
ATOM   1987 C  CD1   . LEU B 2 155 ? 17.660  -27.956 -20.833 1.00 26.51 ? 155 LEU A CD1   1 
ATOM   1988 C  CD2   . LEU B 2 155 ? 16.392  -27.777 -18.683 1.00 28.20 ? 155 LEU A CD2   1 
ATOM   1989 N  N     . LYS B 2 156 ? 14.328  -32.301 -20.980 1.00 33.92 ? 156 LYS A N     1 
ATOM   1990 C  CA    . LYS B 2 156 ? 13.250  -32.992 -21.667 1.00 34.59 ? 156 LYS A CA    1 
ATOM   1991 C  C     . LYS B 2 156 ? 12.468  -33.876 -20.697 1.00 36.16 ? 156 LYS A C     1 
ATOM   1992 O  O     . LYS B 2 156 ? 11.234  -33.821 -20.634 1.00 35.79 ? 156 LYS A O     1 
ATOM   1993 C  CB    . LYS B 2 156 ? 13.835  -33.840 -22.791 1.00 35.43 ? 156 LYS A CB    1 
ATOM   1994 C  CG    . LYS B 2 156 ? 12.843  -34.716 -23.527 1.00 36.87 ? 156 LYS A CG    1 
ATOM   1995 C  CD    . LYS B 2 156 ? 11.892  -33.897 -24.359 1.00 39.47 ? 156 LYS A CD    1 
ATOM   1996 C  CE    . LYS B 2 156 ? 11.227  -34.756 -25.420 1.00 39.87 ? 156 LYS A CE    1 
ATOM   1997 N  NZ    . LYS B 2 156 ? 12.256  -35.229 -26.389 1.00 41.04 ? 156 LYS A NZ    1 
ATOM   1998 N  N     . ALA B 2 157 ? 13.191  -34.687 -19.934 1.00 36.60 ? 157 ALA A N     1 
ATOM   1999 C  CA    . ALA B 2 157 ? 12.566  -35.593 -18.975 1.00 38.63 ? 157 ALA A CA    1 
ATOM   2000 C  C     . ALA B 2 157 ? 11.777  -34.858 -17.886 1.00 39.85 ? 157 ALA A C     1 
ATOM   2001 O  O     . ALA B 2 157 ? 10.955  -35.458 -17.187 1.00 40.41 ? 157 ALA A O     1 
ATOM   2002 C  CB    . ALA B 2 157 ? 13.632  -36.479 -18.337 1.00 37.50 ? 157 ALA A CB    1 
ATOM   2003 N  N     . ASN B 2 158 ? 12.027  -33.560 -17.745 1.00 40.02 ? 158 ASN A N     1 
ATOM   2004 C  CA    . ASN B 2 158 ? 11.350  -32.771 -16.726 1.00 39.90 ? 158 ASN A CA    1 
ATOM   2005 C  C     . ASN B 2 158 ? 10.410  -31.697 -17.255 1.00 40.09 ? 158 ASN A C     1 
ATOM   2006 O  O     . ASN B 2 158 ? 10.044  -30.782 -16.521 1.00 39.50 ? 158 ASN A O     1 
ATOM   2007 C  CB    . ASN B 2 158 ? 12.383  -32.151 -15.792 1.00 39.98 ? 158 ASN A CB    1 
ATOM   2008 C  CG    . ASN B 2 158 ? 13.045  -33.182 -14.904 1.00 40.80 ? 158 ASN A CG    1 
ATOM   2009 O  OD1   . ASN B 2 158 ? 12.455  -33.642 -13.931 1.00 42.14 ? 158 ASN A OD1   1 
ATOM   2010 N  ND2   . ASN B 2 158 ? 14.267  -33.567 -15.246 1.00 41.52 ? 158 ASN A ND2   1 
ATOM   2011 N  N     . GLY B 2 159 ? 10.040  -31.806 -18.531 1.00 39.65 ? 159 GLY A N     1 
ATOM   2012 C  CA    . GLY B 2 159 ? 9.098   -30.875 -19.135 1.00 37.79 ? 159 GLY A CA    1 
ATOM   2013 C  C     . GLY B 2 159 ? 9.495   -29.447 -19.471 1.00 38.83 ? 159 GLY A C     1 
ATOM   2014 O  O     . GLY B 2 159 ? 8.623   -28.626 -19.765 1.00 38.51 ? 159 GLY A O     1 
ATOM   2015 N  N     . ILE B 2 160 ? 10.784  -29.127 -19.455 1.00 37.36 ? 160 ILE A N     1 
ATOM   2016 C  CA    . ILE B 2 160 ? 11.175  -27.765 -19.769 1.00 37.59 ? 160 ILE A CA    1 
ATOM   2017 C  C     . ILE B 2 160 ? 12.155  -27.654 -20.930 1.00 37.99 ? 160 ILE A C     1 
ATOM   2018 O  O     . ILE B 2 160 ? 12.867  -26.658 -21.056 1.00 39.43 ? 160 ILE A O     1 
ATOM   2019 C  CB    . ILE B 2 160 ? 11.752  -27.049 -18.519 1.00 37.35 ? 160 ILE A CB    1 
ATOM   2020 C  CG1   . ILE B 2 160 ? 12.874  -27.884 -17.892 1.00 39.43 ? 160 ILE A CG1   1 
ATOM   2021 C  CG2   . ILE B 2 160 ? 10.636  -26.816 -17.507 1.00 37.88 ? 160 ILE A CG2   1 
ATOM   2022 C  CD1   . ILE B 2 160 ? 13.519  -27.245 -16.669 1.00 36.29 ? 160 ILE A CD1   1 
ATOM   2023 N  N     . TYR B 2 161 ? 12.172  -28.653 -21.805 1.00 37.61 ? 161 TYR A N     1 
ATOM   2024 C  CA    . TYR B 2 161 ? 13.096  -28.602 -22.920 1.00 36.47 ? 161 TYR A CA    1 
ATOM   2025 C  C     . TYR B 2 161 ? 12.744  -27.650 -24.060 1.00 38.87 ? 161 TYR A C     1 
ATOM   2026 O  O     . TYR B 2 161 ? 13.570  -26.837 -24.451 1.00 42.01 ? 161 TYR A O     1 
ATOM   2027 C  CB    . TYR B 2 161 ? 13.349  -29.985 -23.503 1.00 33.69 ? 161 TYR A CB    1 
ATOM   2028 C  CG    . TYR B 2 161 ? 14.344  -29.929 -24.640 1.00 32.68 ? 161 TYR A CG    1 
ATOM   2029 C  CD1   . TYR B 2 161 ? 15.522  -29.183 -24.523 1.00 30.49 ? 161 TYR A CD1   1 
ATOM   2030 C  CD2   . TYR B 2 161 ? 14.090  -30.574 -25.850 1.00 33.21 ? 161 TYR A CD2   1 
ATOM   2031 C  CE1   . TYR B 2 161 ? 16.412  -29.075 -25.578 1.00 31.55 ? 161 TYR A CE1   1 
ATOM   2032 C  CE2   . TYR B 2 161 ? 14.980  -30.475 -26.919 1.00 33.63 ? 161 TYR A CE2   1 
ATOM   2033 C  CZ    . TYR B 2 161 ? 16.137  -29.722 -26.778 1.00 33.70 ? 161 TYR A CZ    1 
ATOM   2034 O  OH    . TYR B 2 161 ? 17.003  -29.600 -27.843 1.00 33.39 ? 161 TYR A OH    1 
ATOM   2035 N  N     . GLY B 2 162 ? 11.548  -27.718 -24.619 1.00 35.93 ? 162 GLY A N     1 
ATOM   2036 C  CA    . GLY B 2 162 ? 11.286  -26.794 -25.711 1.00 36.84 ? 162 GLY A CA    1 
ATOM   2037 C  C     . GLY B 2 162 ? 11.209  -25.293 -25.415 1.00 34.91 ? 162 GLY A C     1 
ATOM   2038 O  O     . GLY B 2 162 ? 10.790  -24.867 -24.335 1.00 33.19 ? 162 GLY A O     1 
ATOM   2039 N  N     . ALA B 2 163 ? 11.609  -24.478 -26.387 1.00 34.08 ? 163 ALA A N     1 
ATOM   2040 C  CA    . ALA B 2 163 ? 11.515  -23.023 -26.234 1.00 34.30 ? 163 ALA A CA    1 
ATOM   2041 C  C     . ALA B 2 163 ? 10.188  -22.507 -26.830 1.00 32.45 ? 163 ALA A C     1 
ATOM   2042 O  O     . ALA B 2 163 ? 9.828   -21.344 -26.652 1.00 31.84 ? 163 ALA A O     1 
ATOM   2043 C  CB    . ALA B 2 163 ? 12.688  -22.336 -26.925 1.00 34.03 ? 163 ALA A CB    1 
ATOM   2044 N  N     . GLU B 2 164 ? 9.472   -23.369 -27.543 1.00 31.11 ? 164 GLU A N     1 
ATOM   2045 C  CA    . GLU B 2 164 ? 8.203   -22.974 -28.140 1.00 33.23 ? 164 GLU A CA    1 
ATOM   2046 C  C     . GLU B 2 164 ? 7.182   -22.635 -27.044 1.00 32.88 ? 164 GLU A C     1 
ATOM   2047 O  O     . GLU B 2 164 ? 7.313   -23.086 -25.906 1.00 32.54 ? 164 GLU A O     1 
ATOM   2048 C  CB    . GLU B 2 164 ? 7.670   -24.086 -29.050 1.00 33.86 ? 164 GLU A CB    1 
ATOM   2049 C  CG    . GLU B 2 164 ? 7.304   -25.383 -28.349 1.00 38.83 ? 164 GLU A CG    1 
ATOM   2050 C  CD    . GLU B 2 164 ? 8.442   -26.403 -28.309 1.00 44.21 ? 164 GLU A CD    1 
ATOM   2051 O  OE1   . GLU B 2 164 ? 8.135   -27.621 -28.226 1.00 46.53 ? 164 GLU A OE1   1 
ATOM   2052 O  OE2   . GLU B 2 164 ? 9.628   -26.002 -28.354 1.00 44.08 ? 164 GLU A OE2   1 
ATOM   2053 N  N     . TYR B 2 165 ? 6.169   -21.841 -27.385 1.00 32.06 ? 165 TYR A N     1 
ATOM   2054 C  CA    . TYR B 2 165 ? 5.163   -21.422 -26.409 1.00 31.47 ? 165 TYR A CA    1 
ATOM   2055 C  C     . TYR B 2 165 ? 4.454   -22.507 -25.604 1.00 32.21 ? 165 TYR A C     1 
ATOM   2056 O  O     . TYR B 2 165 ? 4.037   -22.272 -24.474 1.00 31.35 ? 165 TYR A O     1 
ATOM   2057 C  CB    . TYR B 2 165 ? 4.122   -20.529 -27.081 1.00 30.55 ? 165 TYR A CB    1 
ATOM   2058 C  CG    . TYR B 2 165 ? 4.563   -19.092 -27.192 1.00 30.67 ? 165 TYR A CG    1 
ATOM   2059 C  CD1   . TYR B 2 165 ? 4.618   -18.447 -28.430 1.00 31.35 ? 165 TYR A CD1   1 
ATOM   2060 C  CD2   . TYR B 2 165 ? 4.957   -18.381 -26.058 1.00 29.32 ? 165 TYR A CD2   1 
ATOM   2061 C  CE1   . TYR B 2 165 ? 5.065   -17.121 -28.529 1.00 33.19 ? 165 TYR A CE1   1 
ATOM   2062 C  CE2   . TYR B 2 165 ? 5.401   -17.069 -26.145 1.00 29.53 ? 165 TYR A CE2   1 
ATOM   2063 C  CZ    . TYR B 2 165 ? 5.456   -16.445 -27.375 1.00 31.05 ? 165 TYR A CZ    1 
ATOM   2064 O  OH    . TYR B 2 165 ? 5.914   -15.156 -27.449 1.00 32.19 ? 165 TYR A OH    1 
ATOM   2065 N  N     . LYS B 2 166 ? 4.302   -23.691 -26.171 1.00 33.55 ? 166 LYS A N     1 
ATOM   2066 C  CA    . LYS B 2 166 ? 3.635   -24.747 -25.434 1.00 34.18 ? 166 LYS A CA    1 
ATOM   2067 C  C     . LYS B 2 166 ? 4.483   -25.145 -24.224 1.00 32.73 ? 166 LYS A C     1 
ATOM   2068 O  O     . LYS B 2 166 ? 3.968   -25.654 -23.231 1.00 33.93 ? 166 LYS A O     1 
ATOM   2069 C  CB    . LYS B 2 166 ? 3.408   -25.958 -26.340 1.00 33.50 ? 166 LYS A CB    1 
ATOM   2070 C  CG    . LYS B 2 166 ? 2.472   -26.984 -25.743 1.00 36.73 ? 166 LYS A CG    1 
ATOM   2071 C  CD    . LYS B 2 166 ? 2.446   -28.258 -26.588 1.00 41.42 ? 166 LYS A CD    1 
ATOM   2072 C  CE    . LYS B 2 166 ? 1.563   -29.334 -25.955 1.00 40.00 ? 166 LYS A CE    1 
ATOM   2073 N  NZ    . LYS B 2 166 ? 1.714   -30.641 -26.642 1.00 40.90 ? 166 LYS A NZ    1 
ATOM   2074 N  N     . VAL B 2 167 ? 5.781   -24.886 -24.303 1.00 30.73 ? 167 VAL A N     1 
ATOM   2075 C  CA    . VAL B 2 167 ? 6.701   -25.250 -23.235 1.00 29.91 ? 167 VAL A CA    1 
ATOM   2076 C  C     . VAL B 2 167 ? 7.250   -24.067 -22.441 1.00 30.34 ? 167 VAL A C     1 
ATOM   2077 O  O     . VAL B 2 167 ? 7.185   -24.058 -21.212 1.00 30.93 ? 167 VAL A O     1 
ATOM   2078 C  CB    . VAL B 2 167 ? 7.920   -26.046 -23.798 1.00 30.69 ? 167 VAL A CB    1 
ATOM   2079 C  CG1   . VAL B 2 167 ? 8.819   -26.507 -22.655 1.00 28.70 ? 167 VAL A CG1   1 
ATOM   2080 C  CG2   . VAL B 2 167 ? 7.445   -27.229 -24.627 1.00 26.81 ? 167 VAL A CG2   1 
ATOM   2081 N  N     . ARG B 2 168 ? 7.783   -23.075 -23.150 1.00 30.51 ? 168 ARG A N     1 
ATOM   2082 C  CA    . ARG B 2 168 ? 8.401   -21.899 -22.532 1.00 31.20 ? 168 ARG A CA    1 
ATOM   2083 C  C     . ARG B 2 168 ? 9.589   -22.384 -21.702 1.00 30.75 ? 168 ARG A C     1 
ATOM   2084 O  O     . ARG B 2 168 ? 9.731   -22.043 -20.529 1.00 30.44 ? 168 ARG A O     1 
ATOM   2085 C  CB    . ARG B 2 168 ? 7.412   -21.145 -21.639 1.00 31.82 ? 168 ARG A CB    1 
ATOM   2086 C  CG    . ARG B 2 168 ? 6.221   -20.583 -22.383 1.00 36.78 ? 168 ARG A CG    1 
ATOM   2087 C  CD    . ARG B 2 168 ? 5.963   -19.126 -22.016 1.00 40.98 ? 168 ARG A CD    1 
ATOM   2088 N  NE    . ARG B 2 168 ? 4.722   -18.651 -22.622 1.00 46.75 ? 168 ARG A NE    1 
ATOM   2089 C  CZ    . ARG B 2 168 ? 4.444   -17.374 -22.881 1.00 48.63 ? 168 ARG A CZ    1 
ATOM   2090 N  NH1   . ARG B 2 168 ? 5.332   -16.430 -22.583 1.00 48.63 ? 168 ARG A NH1   1 
ATOM   2091 N  NH2   . ARG B 2 168 ? 3.286   -17.043 -23.448 1.00 45.49 ? 168 ARG A NH2   1 
ATOM   2092 N  N     . GLY B 2 169 ? 10.435  -23.193 -22.331 1.00 30.99 ? 169 GLY A N     1 
ATOM   2093 C  CA    . GLY B 2 169 ? 11.600  -23.737 -21.655 1.00 29.42 ? 169 GLY A CA    1 
ATOM   2094 C  C     . GLY B 2 169 ? 12.905  -23.372 -22.329 1.00 27.54 ? 169 GLY A C     1 
ATOM   2095 O  O     . GLY B 2 169 ? 13.038  -22.278 -22.885 1.00 27.79 ? 169 GLY A O     1 
ATOM   2096 N  N     . PHE B 2 170 ? 13.852  -24.306 -22.307 1.00 26.29 ? 170 PHE A N     1 
ATOM   2097 C  CA    . PHE B 2 170 ? 15.186  -24.097 -22.872 1.00 27.58 ? 170 PHE A CA    1 
ATOM   2098 C  C     . PHE B 2 170 ? 15.373  -24.612 -24.297 1.00 28.31 ? 170 PHE A C     1 
ATOM   2099 O  O     . PHE B 2 170 ? 15.284  -25.809 -24.530 1.00 30.17 ? 170 PHE A O     1 
ATOM   2100 C  CB    . PHE B 2 170 ? 16.239  -24.779 -21.987 1.00 27.23 ? 170 PHE A CB    1 
ATOM   2101 C  CG    . PHE B 2 170 ? 16.232  -24.322 -20.559 1.00 28.67 ? 170 PHE A CG    1 
ATOM   2102 C  CD1   . PHE B 2 170 ? 15.125  -24.561 -19.738 1.00 28.40 ? 170 PHE A CD1   1 
ATOM   2103 C  CD2   . PHE B 2 170 ? 17.334  -23.645 -20.028 1.00 28.64 ? 170 PHE A CD2   1 
ATOM   2104 C  CE1   . PHE B 2 170 ? 15.115  -24.127 -18.404 1.00 29.87 ? 170 PHE A CE1   1 
ATOM   2105 C  CE2   . PHE B 2 170 ? 17.335  -23.208 -18.694 1.00 29.69 ? 170 PHE A CE2   1 
ATOM   2106 C  CZ    . PHE B 2 170 ? 16.225  -23.447 -17.883 1.00 30.57 ? 170 PHE A CZ    1 
ATOM   2107 N  N     . SER B 2 171 ? 15.684  -23.733 -25.245 1.00 27.93 ? 171 SER A N     1 
ATOM   2108 C  CA    . SER B 2 171 ? 15.889  -24.189 -26.612 1.00 28.57 ? 171 SER A CA    1 
ATOM   2109 C  C     . SER B 2 171 ? 17.187  -25.000 -26.720 1.00 30.43 ? 171 SER A C     1 
ATOM   2110 O  O     . SER B 2 171 ? 18.068  -24.902 -25.866 1.00 31.16 ? 171 SER A O     1 
ATOM   2111 C  CB    . SER B 2 171 ? 15.942  -23.000 -27.568 1.00 28.52 ? 171 SER A CB    1 
ATOM   2112 O  OG    . SER B 2 171 ? 17.143  -22.272 -27.416 1.00 32.40 ? 171 SER A OG    1 
ATOM   2113 N  N     . GLY B 2 172 ? 17.298  -25.803 -27.774 1.00 32.07 ? 172 GLY A N     1 
ATOM   2114 C  CA    . GLY B 2 172 ? 18.484  -26.620 -27.971 1.00 32.37 ? 172 GLY A CA    1 
ATOM   2115 C  C     . GLY B 2 172 ? 19.750  -25.793 -28.058 1.00 32.00 ? 172 GLY A C     1 
ATOM   2116 O  O     . GLY B 2 172 ? 20.770  -26.152 -27.472 1.00 31.41 ? 172 GLY A O     1 
ATOM   2117 N  N     . TYR B 2 173 ? 19.673  -24.683 -28.791 1.00 31.80 ? 173 TYR A N     1 
ATOM   2118 C  CA    . TYR B 2 173 ? 20.792  -23.769 -28.968 1.00 29.99 ? 173 TYR A CA    1 
ATOM   2119 C  C     . TYR B 2 173 ? 21.244  -23.205 -27.623 1.00 32.19 ? 173 TYR A C     1 
ATOM   2120 O  O     . TYR B 2 173 ? 22.446  -23.042 -27.387 1.00 31.83 ? 173 TYR A O     1 
ATOM   2121 C  CB    . TYR B 2 173 ? 20.395  -22.625 -29.909 1.00 30.08 ? 173 TYR A CB    1 
ATOM   2122 C  CG    . TYR B 2 173 ? 21.471  -21.569 -30.114 1.00 30.86 ? 173 TYR A CG    1 
ATOM   2123 C  CD1   . TYR B 2 173 ? 22.784  -21.928 -30.430 1.00 28.41 ? 173 TYR A CD1   1 
ATOM   2124 C  CD2   . TYR B 2 173 ? 21.166  -20.209 -30.018 1.00 29.16 ? 173 TYR A CD2   1 
ATOM   2125 C  CE1   . TYR B 2 173 ? 23.763  -20.957 -30.648 1.00 31.90 ? 173 TYR A CE1   1 
ATOM   2126 C  CE2   . TYR B 2 173 ? 22.132  -19.229 -30.233 1.00 29.75 ? 173 TYR A CE2   1 
ATOM   2127 C  CZ    . TYR B 2 173 ? 23.431  -19.605 -30.548 1.00 32.18 ? 173 TYR A CZ    1 
ATOM   2128 O  OH    . TYR B 2 173 ? 24.393  -18.637 -30.752 1.00 26.57 ? 173 TYR A OH    1 
ATOM   2129 N  N     . LEU B 2 174 ? 20.285  -22.904 -26.746 1.00 32.39 ? 174 LEU A N     1 
ATOM   2130 C  CA    . LEU B 2 174 ? 20.618  -22.383 -25.426 1.00 31.20 ? 174 LEU A CA    1 
ATOM   2131 C  C     . LEU B 2 174 ? 21.386  -23.445 -24.644 1.00 30.60 ? 174 LEU A C     1 
ATOM   2132 O  O     . LEU B 2 174 ? 22.320  -23.123 -23.913 1.00 31.29 ? 174 LEU A O     1 
ATOM   2133 C  CB    . LEU B 2 174 ? 19.357  -21.977 -24.645 1.00 30.08 ? 174 LEU A CB    1 
ATOM   2134 C  CG    . LEU B 2 174 ? 19.621  -21.590 -23.170 1.00 29.95 ? 174 LEU A CG    1 
ATOM   2135 C  CD1   . LEU B 2 174 ? 20.630  -20.453 -23.105 1.00 28.32 ? 174 LEU A CD1   1 
ATOM   2136 C  CD2   . LEU B 2 174 ? 18.332  -21.179 -22.475 1.00 28.25 ? 174 LEU A CD2   1 
ATOM   2137 N  N     . CYS B 2 175 ? 20.995  -24.707 -24.796 1.00 30.14 ? 175 CYS A N     1 
ATOM   2138 C  CA    . CYS B 2 175 ? 21.683  -25.791 -24.098 1.00 32.84 ? 175 CYS A CA    1 
ATOM   2139 C  C     . CYS B 2 175 ? 23.144  -25.860 -24.527 1.00 34.87 ? 175 CYS A C     1 
ATOM   2140 O  O     . CYS B 2 175 ? 24.034  -26.079 -23.706 1.00 36.42 ? 175 CYS A O     1 
ATOM   2141 C  CB    . CYS B 2 175 ? 21.019  -27.135 -24.384 1.00 30.96 ? 175 CYS A CB    1 
ATOM   2142 S  SG    . CYS B 2 175 ? 19.397  -27.318 -23.637 1.00 36.41 ? 175 CYS A SG    1 
ATOM   2143 N  N     . GLU B 2 176 ? 23.387  -25.663 -25.819 1.00 35.21 ? 176 GLU A N     1 
ATOM   2144 C  CA    . GLU B 2 176 ? 24.738  -25.713 -26.350 1.00 35.24 ? 176 GLU A CA    1 
ATOM   2145 C  C     . GLU B 2 176 ? 25.599  -24.536 -25.875 1.00 34.38 ? 176 GLU A C     1 
ATOM   2146 O  O     . GLU B 2 176 ? 26.795  -24.692 -25.648 1.00 33.00 ? 176 GLU A O     1 
ATOM   2147 C  CB    . GLU B 2 176 ? 24.679  -25.784 -27.877 1.00 36.38 ? 176 GLU A CB    1 
ATOM   2148 C  CG    . GLU B 2 176 ? 23.881  -26.985 -28.375 1.00 37.84 ? 176 GLU A CG    1 
ATOM   2149 C  CD    . GLU B 2 176 ? 23.644  -26.962 -29.871 1.00 39.64 ? 176 GLU A CD    1 
ATOM   2150 O  OE1   . GLU B 2 176 ? 24.515  -27.437 -30.630 1.00 42.84 ? 176 GLU A OE1   1 
ATOM   2151 O  OE2   . GLU B 2 176 ? 22.586  -26.456 -30.292 1.00 38.91 ? 176 GLU A OE2   1 
ATOM   2152 N  N     . LEU B 2 177 ? 24.994  -23.363 -25.714 1.00 33.83 ? 177 LEU A N     1 
ATOM   2153 C  CA    . LEU B 2 177 ? 25.738  -22.201 -25.242 1.00 32.63 ? 177 LEU A CA    1 
ATOM   2154 C  C     . LEU B 2 177 ? 26.126  -22.424 -23.781 1.00 32.50 ? 177 LEU A C     1 
ATOM   2155 O  O     . LEU B 2 177 ? 27.220  -22.063 -23.346 1.00 30.64 ? 177 LEU A O     1 
ATOM   2156 C  CB    . LEU B 2 177 ? 24.897  -20.923 -25.375 1.00 31.40 ? 177 LEU A CB    1 
ATOM   2157 C  CG    . LEU B 2 177 ? 24.579  -20.458 -26.805 1.00 34.25 ? 177 LEU A CG    1 
ATOM   2158 C  CD1   . LEU B 2 177 ? 23.852  -19.119 -26.743 1.00 32.54 ? 177 LEU A CD1   1 
ATOM   2159 C  CD2   . LEU B 2 177 ? 25.868  -20.320 -27.631 1.00 32.31 ? 177 LEU A CD2   1 
ATOM   2160 N  N     . LEU B 2 178 ? 25.223  -23.034 -23.024 1.00 32.29 ? 178 LEU A N     1 
ATOM   2161 C  CA    . LEU B 2 178 ? 25.499  -23.303 -21.623 1.00 32.90 ? 178 LEU A CA    1 
ATOM   2162 C  C     . LEU B 2 178 ? 26.673  -24.261 -21.485 1.00 32.66 ? 178 LEU A C     1 
ATOM   2163 O  O     . LEU B 2 178 ? 27.540  -24.065 -20.642 1.00 33.95 ? 178 LEU A O     1 
ATOM   2164 C  CB    . LEU B 2 178 ? 24.263  -23.886 -20.944 1.00 32.03 ? 178 LEU A CB    1 
ATOM   2165 C  CG    . LEU B 2 178 ? 23.130  -22.872 -20.816 1.00 32.17 ? 178 LEU A CG    1 
ATOM   2166 C  CD1   . LEU B 2 178 ? 21.932  -23.547 -20.190 1.00 31.65 ? 178 LEU A CD1   1 
ATOM   2167 C  CD2   . LEU B 2 178 ? 23.593  -21.671 -19.968 1.00 30.16 ? 178 LEU A CD2   1 
ATOM   2168 N  N     . ILE B 2 179 ? 26.705  -25.291 -22.321 1.00 30.96 ? 179 ILE A N     1 
ATOM   2169 C  CA    . ILE B 2 179 ? 27.790  -26.256 -22.265 1.00 31.26 ? 179 ILE A CA    1 
ATOM   2170 C  C     . ILE B 2 179 ? 29.116  -25.608 -22.665 1.00 32.06 ? 179 ILE A C     1 
ATOM   2171 O  O     . ILE B 2 179 ? 30.166  -25.933 -22.107 1.00 32.72 ? 179 ILE A O     1 
ATOM   2172 C  CB    . ILE B 2 179 ? 27.497  -27.473 -23.171 1.00 29.29 ? 179 ILE A CB    1 
ATOM   2173 C  CG1   . ILE B 2 179 ? 26.272  -28.226 -22.638 1.00 28.74 ? 179 ILE A CG1   1 
ATOM   2174 C  CG2   . ILE B 2 179 ? 28.713  -28.384 -23.245 1.00 27.57 ? 179 ILE A CG2   1 
ATOM   2175 C  CD1   . ILE B 2 179 ? 26.355  -28.636 -21.172 1.00 23.14 ? 179 ILE A CD1   1 
ATOM   2176 N  N     . VAL B 2 180 ? 29.065  -24.687 -23.623 1.00 31.54 ? 180 VAL A N     1 
ATOM   2177 C  CA    . VAL B 2 180 ? 30.263  -23.993 -24.062 1.00 31.46 ? 180 VAL A CA    1 
ATOM   2178 C  C     . VAL B 2 180 ? 30.757  -23.054 -22.967 1.00 32.62 ? 180 VAL A C     1 
ATOM   2179 O  O     . VAL B 2 180 ? 31.956  -22.875 -22.787 1.00 32.89 ? 180 VAL A O     1 
ATOM   2180 C  CB    . VAL B 2 180 ? 29.990  -23.182 -25.332 1.00 32.75 ? 180 VAL A CB    1 
ATOM   2181 C  CG1   . VAL B 2 180 ? 31.184  -22.273 -25.657 1.00 31.33 ? 180 VAL A CG1   1 
ATOM   2182 C  CG2   . VAL B 2 180 ? 29.714  -24.131 -26.486 1.00 33.55 ? 180 VAL A CG2   1 
ATOM   2183 N  N     . PHE B 2 181 ? 29.820  -22.478 -22.223 1.00 33.21 ? 181 PHE A N     1 
ATOM   2184 C  CA    . PHE B 2 181 ? 30.142  -21.541 -21.151 1.00 34.64 ? 181 PHE A CA    1 
ATOM   2185 C  C     . PHE B 2 181 ? 30.694  -22.205 -19.876 1.00 35.34 ? 181 PHE A C     1 
ATOM   2186 O  O     . PHE B 2 181 ? 31.720  -21.785 -19.347 1.00 36.52 ? 181 PHE A O     1 
ATOM   2187 C  CB    . PHE B 2 181 ? 28.893  -20.725 -20.802 1.00 34.10 ? 181 PHE A CB    1 
ATOM   2188 C  CG    . PHE B 2 181 ? 29.151  -19.598 -19.857 1.00 34.65 ? 181 PHE A CG    1 
ATOM   2189 C  CD1   . PHE B 2 181 ? 29.702  -18.403 -20.313 1.00 36.45 ? 181 PHE A CD1   1 
ATOM   2190 C  CD2   . PHE B 2 181 ? 28.869  -19.735 -18.499 1.00 35.68 ? 181 PHE A CD2   1 
ATOM   2191 C  CE1   . PHE B 2 181 ? 29.970  -17.356 -19.431 1.00 35.25 ? 181 PHE A CE1   1 
ATOM   2192 C  CE2   . PHE B 2 181 ? 29.133  -18.696 -17.605 1.00 34.06 ? 181 PHE A CE2   1 
ATOM   2193 C  CZ    . PHE B 2 181 ? 29.686  -17.504 -18.073 1.00 35.72 ? 181 PHE A CZ    1 
ATOM   2194 N  N     . TYR B 2 182 ? 30.009  -23.236 -19.392 1.00 34.24 ? 182 TYR A N     1 
ATOM   2195 C  CA    . TYR B 2 182 ? 30.407  -23.934 -18.179 1.00 32.92 ? 182 TYR A CA    1 
ATOM   2196 C  C     . TYR B 2 182 ? 31.347  -25.128 -18.401 1.00 33.70 ? 182 TYR A C     1 
ATOM   2197 O  O     . TYR B 2 182 ? 32.066  -25.546 -17.484 1.00 32.67 ? 182 TYR A O     1 
ATOM   2198 C  CB    . TYR B 2 182 ? 29.156  -24.381 -17.425 1.00 33.40 ? 182 TYR A CB    1 
ATOM   2199 C  CG    . TYR B 2 182 ? 28.355  -23.243 -16.819 1.00 34.82 ? 182 TYR A CG    1 
ATOM   2200 C  CD1   . TYR B 2 182 ? 28.872  -22.488 -15.765 1.00 34.78 ? 182 TYR A CD1   1 
ATOM   2201 C  CD2   . TYR B 2 182 ? 27.075  -22.927 -17.293 1.00 35.52 ? 182 TYR A CD2   1 
ATOM   2202 C  CE1   . TYR B 2 182 ? 28.139  -21.444 -15.190 1.00 37.28 ? 182 TYR A CE1   1 
ATOM   2203 C  CE2   . TYR B 2 182 ? 26.328  -21.884 -16.728 1.00 36.65 ? 182 TYR A CE2   1 
ATOM   2204 C  CZ    . TYR B 2 182 ? 26.869  -21.147 -15.676 1.00 39.18 ? 182 TYR A CZ    1 
ATOM   2205 O  OH    . TYR B 2 182 ? 26.151  -20.117 -15.108 1.00 39.76 ? 182 TYR A OH    1 
ATOM   2206 N  N     . GLY B 2 183 ? 31.334  -25.686 -19.607 1.00 32.77 ? 183 GLY A N     1 
ATOM   2207 C  CA    . GLY B 2 183 ? 32.217  -26.796 -19.899 1.00 31.41 ? 183 GLY A CA    1 
ATOM   2208 C  C     . GLY B 2 183 ? 31.630  -28.188 -19.812 1.00 32.90 ? 183 GLY A C     1 
ATOM   2209 O  O     . GLY B 2 183 ? 32.130  -29.106 -20.463 1.00 33.65 ? 183 GLY A O     1 
ATOM   2210 N  N     . SER B 2 184 ? 30.577  -28.370 -19.023 1.00 33.47 ? 184 SER A N     1 
ATOM   2211 C  CA    . SER B 2 184 ? 29.986  -29.697 -18.901 1.00 33.72 ? 184 SER A CA    1 
ATOM   2212 C  C     . SER B 2 184 ? 28.599  -29.666 -18.283 1.00 34.43 ? 184 SER A C     1 
ATOM   2213 O  O     . SER B 2 184 ? 28.210  -28.684 -17.646 1.00 34.77 ? 184 SER A O     1 
ATOM   2214 C  CB    . SER B 2 184 ? 30.882  -30.586 -18.036 1.00 33.40 ? 184 SER A CB    1 
ATOM   2215 O  OG    . SER B 2 184 ? 30.855  -30.149 -16.684 1.00 30.41 ? 184 SER A OG    1 
ATOM   2216 N  N     . PHE B 2 185 ? 27.860  -30.757 -18.458 1.00 35.06 ? 185 PHE A N     1 
ATOM   2217 C  CA    . PHE B 2 185 ? 26.526  -30.859 -17.884 1.00 38.10 ? 185 PHE A CA    1 
ATOM   2218 C  C     . PHE B 2 185 ? 26.560  -30.632 -16.376 1.00 39.29 ? 185 PHE A C     1 
ATOM   2219 O  O     . PHE B 2 185 ? 25.752  -29.879 -15.835 1.00 39.58 ? 185 PHE A O     1 
ATOM   2220 C  CB    . PHE B 2 185 ? 25.917  -32.237 -18.165 1.00 38.00 ? 185 PHE A CB    1 
ATOM   2221 C  CG    . PHE B 2 185 ? 24.717  -32.549 -17.316 1.00 36.62 ? 185 PHE A CG    1 
ATOM   2222 C  CD1   . PHE B 2 185 ? 24.835  -33.375 -16.202 1.00 37.08 ? 185 PHE A CD1   1 
ATOM   2223 C  CD2   . PHE B 2 185 ? 23.479  -31.973 -17.598 1.00 35.51 ? 185 PHE A CD2   1 
ATOM   2224 C  CE1   . PHE B 2 185 ? 23.732  -33.623 -15.370 1.00 37.78 ? 185 PHE A CE1   1 
ATOM   2225 C  CE2   . PHE B 2 185 ? 22.373  -32.212 -16.780 1.00 35.79 ? 185 PHE A CE2   1 
ATOM   2226 C  CZ    . PHE B 2 185 ? 22.498  -33.037 -15.662 1.00 37.36 ? 185 PHE A CZ    1 
ATOM   2227 N  N     . LEU B 2 186 ? 27.502  -31.291 -15.709 1.00 40.75 ? 186 LEU A N     1 
ATOM   2228 C  CA    . LEU B 2 186 ? 27.645  -31.190 -14.263 1.00 41.66 ? 186 LEU A CA    1 
ATOM   2229 C  C     . LEU B 2 186 ? 27.978  -29.781 -13.776 1.00 41.36 ? 186 LEU A C     1 
ATOM   2230 O  O     . LEU B 2 186 ? 27.464  -29.351 -12.747 1.00 42.52 ? 186 LEU A O     1 
ATOM   2231 C  CB    . LEU B 2 186 ? 28.709  -32.178 -13.772 1.00 42.35 ? 186 LEU A CB    1 
ATOM   2232 C  CG    . LEU B 2 186 ? 28.902  -32.315 -12.257 1.00 43.91 ? 186 LEU A CG    1 
ATOM   2233 C  CD1   . LEU B 2 186 ? 27.640  -32.882 -11.587 1.00 42.76 ? 186 LEU A CD1   1 
ATOM   2234 C  CD2   . LEU B 2 186 ? 30.088  -33.219 -12.002 1.00 42.47 ? 186 LEU A CD2   1 
ATOM   2235 N  N     . GLU B 2 187 ? 28.832  -29.065 -14.501 1.00 41.65 ? 187 GLU A N     1 
ATOM   2236 C  CA    . GLU B 2 187 ? 29.195  -27.703 -14.103 1.00 40.83 ? 187 GLU A CA    1 
ATOM   2237 C  C     . GLU B 2 187 ? 28.028  -26.752 -14.294 1.00 39.90 ? 187 GLU A C     1 
ATOM   2238 O  O     . GLU B 2 187 ? 27.839  -25.807 -13.520 1.00 39.87 ? 187 GLU A O     1 
ATOM   2239 C  CB    . GLU B 2 187 ? 30.387  -27.200 -14.906 1.00 42.10 ? 187 GLU A CB    1 
ATOM   2240 C  CG    . GLU B 2 187 ? 31.704  -27.571 -14.295 1.00 48.27 ? 187 GLU A CG    1 
ATOM   2241 C  CD    . GLU B 2 187 ? 31.844  -27.054 -12.878 1.00 51.91 ? 187 GLU A CD    1 
ATOM   2242 O  OE1   . GLU B 2 187 ? 31.710  -25.822 -12.674 1.00 53.09 ? 187 GLU A OE1   1 
ATOM   2243 O  OE2   . GLU B 2 187 ? 32.090  -27.883 -11.972 1.00 53.00 ? 187 GLU A OE2   1 
ATOM   2244 N  N     . THR B 2 188 ? 27.257  -26.998 -15.345 1.00 37.52 ? 188 THR A N     1 
ATOM   2245 C  CA    . THR B 2 188 ? 26.087  -26.192 -15.631 1.00 35.12 ? 188 THR A CA    1 
ATOM   2246 C  C     . THR B 2 188 ? 25.109  -26.362 -14.472 1.00 34.33 ? 188 THR A C     1 
ATOM   2247 O  O     . THR B 2 188 ? 24.645  -25.386 -13.880 1.00 33.99 ? 188 THR A O     1 
ATOM   2248 C  CB    . THR B 2 188 ? 25.427  -26.658 -16.923 1.00 34.79 ? 188 THR A CB    1 
ATOM   2249 O  OG1   . THR B 2 188 ? 26.322  -26.408 -18.010 1.00 34.86 ? 188 THR A OG1   1 
ATOM   2250 C  CG2   . THR B 2 188 ? 24.101  -25.938 -17.151 1.00 32.88 ? 188 THR A CG2   1 
ATOM   2251 N  N     . VAL B 2 189 ? 24.822  -27.610 -14.134 1.00 32.80 ? 189 VAL A N     1 
ATOM   2252 C  CA    . VAL B 2 189 ? 23.903  -27.895 -13.052 1.00 34.35 ? 189 VAL A CA    1 
ATOM   2253 C  C     . VAL B 2 189 ? 24.390  -27.348 -11.715 1.00 35.48 ? 189 VAL A C     1 
ATOM   2254 O  O     . VAL B 2 189 ? 23.592  -26.845 -10.921 1.00 35.77 ? 189 VAL A O     1 
ATOM   2255 C  CB    . VAL B 2 189 ? 23.641  -29.413 -12.947 1.00 34.82 ? 189 VAL A CB    1 
ATOM   2256 C  CG1   . VAL B 2 189 ? 23.041  -29.760 -11.594 1.00 34.43 ? 189 VAL A CG1   1 
ATOM   2257 C  CG2   . VAL B 2 189 ? 22.687  -29.838 -14.065 1.00 34.85 ? 189 VAL A CG2   1 
ATOM   2258 N  N     . LYS B 2 190 ? 25.691  -27.430 -11.461 1.00 36.03 ? 190 LYS A N     1 
ATOM   2259 C  CA    . LYS B 2 190 ? 26.215  -26.926 -10.197 1.00 37.49 ? 190 LYS A CA    1 
ATOM   2260 C  C     . LYS B 2 190 ? 25.988  -25.423 -10.024 1.00 36.28 ? 190 LYS A C     1 
ATOM   2261 O  O     . LYS B 2 190 ? 25.525  -24.968 -8.975  1.00 36.31 ? 190 LYS A O     1 
ATOM   2262 C  CB    . LYS B 2 190 ? 27.710  -27.250 -10.062 1.00 40.79 ? 190 LYS A CB    1 
ATOM   2263 C  CG    . LYS B 2 190 ? 27.985  -28.712 -9.751  1.00 42.48 ? 190 LYS A CG    1 
ATOM   2264 C  CD    . LYS B 2 190 ? 29.444  -28.954 -9.415  1.00 46.66 ? 190 LYS A CD    1 
ATOM   2265 C  CE    . LYS B 2 190 ? 29.667  -30.434 -9.105  1.00 51.64 ? 190 LYS A CE    1 
ATOM   2266 N  NZ    . LYS B 2 190 ? 31.042  -30.770 -8.615  1.00 53.93 ? 190 LYS A NZ    1 
ATOM   2267 N  N     . ASN B 2 191 ? 26.297  -24.661 -11.065 1.00 35.45 ? 191 ASN A N     1 
ATOM   2268 C  CA    . ASN B 2 191 ? 26.143  -23.214 -11.033 1.00 33.51 ? 191 ASN A CA    1 
ATOM   2269 C  C     . ASN B 2 191 ? 24.710  -22.712 -11.156 1.00 32.29 ? 191 ASN A C     1 
ATOM   2270 O  O     . ASN B 2 191 ? 24.363  -21.695 -10.564 1.00 30.99 ? 191 ASN A O     1 
ATOM   2271 C  CB    . ASN B 2 191 ? 27.019  -22.600 -12.124 1.00 34.73 ? 191 ASN A CB    1 
ATOM   2272 C  CG    . ASN B 2 191 ? 28.503  -22.713 -11.801 1.00 34.88 ? 191 ASN A CG    1 
ATOM   2273 O  OD1   . ASN B 2 191 ? 29.061  -21.859 -11.111 1.00 35.05 ? 191 ASN A OD1   1 
ATOM   2274 N  ND2   . ASN B 2 191 ? 29.141  -23.784 -12.274 1.00 33.79 ? 191 ASN A ND2   1 
ATOM   2275 N  N     . ALA B 2 192 ? 23.877  -23.428 -11.908 1.00 33.59 ? 192 ALA A N     1 
ATOM   2276 C  CA    . ALA B 2 192 ? 22.481  -23.033 -12.104 1.00 33.21 ? 192 ALA A CA    1 
ATOM   2277 C  C     . ALA B 2 192 ? 21.756  -22.925 -10.768 1.00 34.25 ? 192 ALA A C     1 
ATOM   2278 O  O     . ALA B 2 192 ? 20.765  -22.201 -10.640 1.00 31.87 ? 192 ALA A O     1 
ATOM   2279 C  CB    . ALA B 2 192 ? 21.772  -24.031 -13.005 1.00 33.43 ? 192 ALA A CB    1 
ATOM   2280 N  N     . ARG B 2 193 ? 22.247  -23.656 -9.775  1.00 34.99 ? 193 ARG A N     1 
ATOM   2281 C  CA    . ARG B 2 193 ? 21.651  -23.604 -8.448  1.00 37.84 ? 193 ARG A CA    1 
ATOM   2282 C  C     . ARG B 2 193 ? 21.710  -22.173 -7.892  1.00 37.91 ? 193 ARG A C     1 
ATOM   2283 O  O     . ARG B 2 193 ? 20.906  -21.794 -7.039  1.00 36.80 ? 193 ARG A O     1 
ATOM   2284 C  CB    . ARG B 2 193 ? 22.393  -24.543 -7.499  1.00 38.97 ? 193 ARG A CB    1 
ATOM   2285 C  CG    . ARG B 2 193 ? 22.212  -26.019 -7.785  1.00 40.65 ? 193 ARG A CG    1 
ATOM   2286 C  CD    . ARG B 2 193 ? 22.979  -26.842 -6.772  1.00 38.97 ? 193 ARG A CD    1 
ATOM   2287 N  NE    . ARG B 2 193 ? 24.403  -26.540 -6.835  1.00 38.79 ? 193 ARG A NE    1 
ATOM   2288 C  CZ    . ARG B 2 193 ? 25.327  -27.106 -6.065  1.00 38.73 ? 193 ARG A CZ    1 
ATOM   2289 N  NH1   . ARG B 2 193 ? 24.986  -28.011 -5.159  1.00 40.49 ? 193 ARG A NH1   1 
ATOM   2290 N  NH2   . ARG B 2 193 ? 26.599  -26.777 -6.213  1.00 35.89 ? 193 ARG A NH2   1 
ATOM   2291 N  N     . ARG B 2 194 ? 22.657  -21.380 -8.390  1.00 39.11 ? 194 ARG A N     1 
ATOM   2292 C  CA    . ARG B 2 194 ? 22.822  -20.007 -7.923  1.00 39.83 ? 194 ARG A CA    1 
ATOM   2293 C  C     . ARG B 2 194 ? 22.278  -18.937 -8.871  1.00 38.24 ? 194 ARG A C     1 
ATOM   2294 O  O     . ARG B 2 194 ? 22.482  -17.742 -8.651  1.00 38.98 ? 194 ARG A O     1 
ATOM   2295 C  CB    . ARG B 2 194 ? 24.301  -19.747 -7.604  1.00 41.57 ? 194 ARG A CB    1 
ATOM   2296 C  CG    . ARG B 2 194 ? 24.846  -20.699 -6.537  1.00 49.05 ? 194 ARG A CG    1 
ATOM   2297 C  CD    . ARG B 2 194 ? 26.259  -20.337 -6.076  1.00 56.51 ? 194 ARG A CD    1 
ATOM   2298 N  NE    . ARG B 2 194 ? 27.280  -20.499 -7.117  1.00 62.51 ? 194 ARG A NE    1 
ATOM   2299 C  CZ    . ARG B 2 194 ? 27.731  -21.670 -7.570  1.00 64.76 ? 194 ARG A CZ    1 
ATOM   2300 N  NH1   . ARG B 2 194 ? 27.261  -22.813 -7.083  1.00 65.66 ? 194 ARG A NH1   1 
ATOM   2301 N  NH2   . ARG B 2 194 ? 28.663  -21.699 -8.517  1.00 66.06 ? 194 ARG A NH2   1 
ATOM   2302 N  N     . TRP B 2 195 ? 21.586  -19.360 -9.924  1.00 36.55 ? 195 TRP A N     1 
ATOM   2303 C  CA    . TRP B 2 195 ? 21.004  -18.413 -10.864 1.00 33.79 ? 195 TRP A CA    1 
ATOM   2304 C  C     . TRP B 2 195 ? 19.838  -17.713 -10.183 1.00 34.88 ? 195 TRP A C     1 
ATOM   2305 O  O     . TRP B 2 195 ? 19.218  -18.253 -9.257  1.00 33.07 ? 195 TRP A O     1 
ATOM   2306 C  CB    . TRP B 2 195 ? 20.458  -19.116 -12.109 1.00 33.83 ? 195 TRP A CB    1 
ATOM   2307 C  CG    . TRP B 2 195 ? 21.473  -19.654 -13.082 1.00 32.17 ? 195 TRP A CG    1 
ATOM   2308 C  CD1   . TRP B 2 195 ? 22.819  -19.418 -13.094 1.00 30.90 ? 195 TRP A CD1   1 
ATOM   2309 C  CD2   . TRP B 2 195 ? 21.198  -20.464 -14.231 1.00 30.24 ? 195 TRP A CD2   1 
ATOM   2310 N  NE1   . TRP B 2 195 ? 23.399  -20.027 -14.179 1.00 30.34 ? 195 TRP A NE1   1 
ATOM   2311 C  CE2   . TRP B 2 195 ? 22.427  -20.678 -14.895 1.00 31.86 ? 195 TRP A CE2   1 
ATOM   2312 C  CE3   . TRP B 2 195 ? 20.030  -21.029 -14.766 1.00 27.11 ? 195 TRP A CE3   1 
ATOM   2313 C  CZ2   . TRP B 2 195 ? 22.521  -21.436 -16.076 1.00 30.49 ? 195 TRP A CZ2   1 
ATOM   2314 C  CZ3   . TRP B 2 195 ? 20.121  -21.780 -15.935 1.00 26.74 ? 195 TRP A CZ3   1 
ATOM   2315 C  CH2   . TRP B 2 195 ? 21.359  -21.976 -16.576 1.00 29.37 ? 195 TRP A CH2   1 
ATOM   2316 N  N     . THR B 2 196 ? 19.527  -16.512 -10.658 1.00 34.09 ? 196 THR A N     1 
ATOM   2317 C  CA    . THR B 2 196 ? 18.418  -15.749 -10.109 1.00 32.54 ? 196 THR A CA    1 
ATOM   2318 C  C     . THR B 2 196 ? 17.597  -15.236 -11.283 1.00 33.18 ? 196 THR A C     1 
ATOM   2319 O  O     . THR B 2 196 ? 17.978  -15.423 -12.438 1.00 32.54 ? 196 THR A O     1 
ATOM   2320 C  CB    . THR B 2 196 ? 18.920  -14.553 -9.267  1.00 31.80 ? 196 THR A CB    1 
ATOM   2321 O  OG1   . THR B 2 196 ? 19.329  -13.485 -10.133 1.00 28.41 ? 196 THR A OG1   1 
ATOM   2322 C  CG2   . THR B 2 196 ? 20.104  -14.987 -8.402  1.00 28.16 ? 196 THR A CG2   1 
ATOM   2323 N  N     . ARG B 2 197 ? 16.476  -14.586 -10.993 1.00 33.77 ? 197 ARG A N     1 
ATOM   2324 C  CA    . ARG B 2 197 ? 15.626  -14.058 -12.048 1.00 34.23 ? 197 ARG A CA    1 
ATOM   2325 C  C     . ARG B 2 197 ? 16.254  -12.840 -12.718 1.00 35.28 ? 197 ARG A C     1 
ATOM   2326 O  O     . ARG B 2 197 ? 15.660  -12.254 -13.625 1.00 35.72 ? 197 ARG A O     1 
ATOM   2327 C  CB    . ARG B 2 197 ? 14.254  -13.685 -11.484 1.00 34.91 ? 197 ARG A CB    1 
ATOM   2328 C  CG    . ARG B 2 197 ? 14.243  -12.450 -10.605 1.00 32.88 ? 197 ARG A CG    1 
ATOM   2329 C  CD    . ARG B 2 197 ? 12.949  -12.372 -9.866  1.00 30.27 ? 197 ARG A CD    1 
ATOM   2330 N  NE    . ARG B 2 197 ? 12.786  -13.514 -8.977  1.00 32.06 ? 197 ARG A NE    1 
ATOM   2331 C  CZ    . ARG B 2 197 ? 11.638  -13.840 -8.385  1.00 34.19 ? 197 ARG A CZ    1 
ATOM   2332 N  NH1   . ARG B 2 197 ? 10.555  -13.103 -8.602  1.00 33.06 ? 197 ARG A NH1   1 
ATOM   2333 N  NH2   . ARG B 2 197 ? 11.572  -14.892 -7.573  1.00 30.30 ? 197 ARG A NH2   1 
ATOM   2334 N  N     . ARG B 2 198 ? 17.448  -12.458 -12.271 1.00 36.94 ? 198 ARG A N     1 
ATOM   2335 C  CA    . ARG B 2 198 ? 18.142  -11.311 -12.852 1.00 38.75 ? 198 ARG A CA    1 
ATOM   2336 C  C     . ARG B 2 198 ? 19.553  -11.660 -13.323 1.00 37.62 ? 198 ARG A C     1 
ATOM   2337 O  O     . ARG B 2 198 ? 20.362  -10.777 -13.616 1.00 36.66 ? 198 ARG A O     1 
ATOM   2338 C  CB    . ARG B 2 198 ? 18.171  -10.148 -11.854 1.00 40.63 ? 198 ARG A CB    1 
ATOM   2339 C  CG    . ARG B 2 198 ? 16.774  -9.720  -11.442 1.00 46.61 ? 198 ARG A CG    1 
ATOM   2340 C  CD    . ARG B 2 198 ? 16.753  -8.457  -10.602 1.00 52.34 ? 198 ARG A CD    1 
ATOM   2341 N  NE    . ARG B 2 198 ? 15.465  -8.278  -9.920  1.00 59.38 ? 198 ARG A NE    1 
ATOM   2342 C  CZ    . ARG B 2 198 ? 14.291  -8.092  -10.529 1.00 60.82 ? 198 ARG A CZ    1 
ATOM   2343 N  NH1   . ARG B 2 198 ? 14.213  -8.050  -11.855 1.00 60.81 ? 198 ARG A NH1   1 
ATOM   2344 N  NH2   . ARG B 2 198 ? 13.186  -7.960  -9.803  1.00 60.17 ? 198 ARG A NH2   1 
ATOM   2345 N  N     . THR B 2 199 ? 19.833  -12.957 -13.413 1.00 36.21 ? 199 THR A N     1 
ATOM   2346 C  CA    . THR B 2 199 ? 21.132  -13.431 -13.867 1.00 34.42 ? 199 THR A CA    1 
ATOM   2347 C  C     . THR B 2 199 ? 21.297  -13.198 -15.370 1.00 33.99 ? 199 THR A C     1 
ATOM   2348 O  O     . THR B 2 199 ? 20.400  -13.506 -16.155 1.00 32.16 ? 199 THR A O     1 
ATOM   2349 C  CB    . THR B 2 199 ? 21.312  -14.946 -13.593 1.00 34.91 ? 199 THR A CB    1 
ATOM   2350 O  OG1   . THR B 2 199 ? 21.413  -15.183 -12.184 1.00 34.53 ? 199 THR A OG1   1 
ATOM   2351 C  CG2   . THR B 2 199 ? 22.560  -15.467 -14.268 1.00 35.23 ? 199 THR A CG2   1 
ATOM   2352 N  N     . VAL B 2 200 ? 22.449  -12.647 -15.752 1.00 33.27 ? 200 VAL A N     1 
ATOM   2353 C  CA    . VAL B 2 200 ? 22.776  -12.402 -17.151 1.00 32.49 ? 200 VAL A CA    1 
ATOM   2354 C  C     . VAL B 2 200 ? 24.026  -13.209 -17.495 1.00 33.84 ? 200 VAL A C     1 
ATOM   2355 O  O     . VAL B 2 200 ? 25.066  -13.061 -16.857 1.00 35.12 ? 200 VAL A O     1 
ATOM   2356 C  CB    . VAL B 2 200 ? 23.083  -10.920 -17.431 1.00 33.12 ? 200 VAL A CB    1 
ATOM   2357 C  CG1   . VAL B 2 200 ? 23.534  -10.763 -18.874 1.00 31.01 ? 200 VAL A CG1   1 
ATOM   2358 C  CG2   . VAL B 2 200 ? 21.858  -10.065 -17.165 1.00 31.51 ? 200 VAL A CG2   1 
ATOM   2359 N  N     . ILE B 2 201 ? 23.918  -14.067 -18.501 1.00 34.05 ? 201 ILE A N     1 
ATOM   2360 C  CA    . ILE B 2 201 ? 25.035  -14.893 -18.927 1.00 33.75 ? 201 ILE A CA    1 
ATOM   2361 C  C     . ILE B 2 201 ? 25.522  -14.434 -20.297 1.00 35.26 ? 201 ILE A C     1 
ATOM   2362 O  O     . ILE B 2 201 ? 24.844  -14.629 -21.300 1.00 36.91 ? 201 ILE A O     1 
ATOM   2363 C  CB    . ILE B 2 201 ? 24.617  -16.381 -18.991 1.00 32.10 ? 201 ILE A CB    1 
ATOM   2364 C  CG1   . ILE B 2 201 ? 24.222  -16.861 -17.590 1.00 31.04 ? 201 ILE A CG1   1 
ATOM   2365 C  CG2   . ILE B 2 201 ? 25.756  -17.227 -19.532 1.00 31.85 ? 201 ILE A CG2   1 
ATOM   2366 C  CD1   . ILE B 2 201 ? 23.622  -18.253 -17.556 1.00 24.58 ? 201 ILE A CD1   1 
ATOM   2367 N  N     . ASP B 2 202 ? 26.697  -13.815 -20.327 1.00 36.35 ? 202 ASP A N     1 
ATOM   2368 C  CA    . ASP B 2 202 ? 27.282  -13.321 -21.569 1.00 38.22 ? 202 ASP A CA    1 
ATOM   2369 C  C     . ASP B 2 202 ? 28.358  -14.295 -22.072 1.00 39.89 ? 202 ASP A C     1 
ATOM   2370 O  O     . ASP B 2 202 ? 29.542  -14.160 -21.746 1.00 39.86 ? 202 ASP A O     1 
ATOM   2371 C  CB    . ASP B 2 202 ? 27.901  -11.958 -21.315 1.00 39.17 ? 202 ASP A CB    1 
ATOM   2372 C  CG    . ASP B 2 202 ? 28.115  -11.174 -22.582 1.00 40.90 ? 202 ASP A CG    1 
ATOM   2373 O  OD1   . ASP B 2 202 ? 28.425  -11.785 -23.635 1.00 41.14 ? 202 ASP A OD1   1 
ATOM   2374 O  OD2   . ASP B 2 202 ? 27.983  -9.933  -22.510 1.00 42.55 ? 202 ASP A OD2   1 
ATOM   2375 N  N     . VAL B 2 203 ? 27.943  -15.267 -22.876 1.00 40.94 ? 203 VAL A N     1 
ATOM   2376 C  CA    . VAL B 2 203 ? 28.852  -16.289 -23.394 1.00 42.50 ? 203 VAL A CA    1 
ATOM   2377 C  C     . VAL B 2 203 ? 30.119  -15.780 -24.077 1.00 41.45 ? 203 VAL A C     1 
ATOM   2378 O  O     . VAL B 2 203 ? 31.206  -16.314 -23.852 1.00 40.92 ? 203 VAL A O     1 
ATOM   2379 C  CB    . VAL B 2 203 ? 28.114  -17.227 -24.382 1.00 44.02 ? 203 VAL A CB    1 
ATOM   2380 C  CG1   . VAL B 2 203 ? 28.920  -18.506 -24.595 1.00 43.79 ? 203 VAL A CG1   1 
ATOM   2381 C  CG2   . VAL B 2 203 ? 26.727  -17.549 -23.845 1.00 46.25 ? 203 VAL A CG2   1 
ATOM   2382 N  N     . ALA B 2 204 ? 29.981  -14.759 -24.914 1.00 41.35 ? 204 ALA A N     1 
ATOM   2383 C  CA    . ALA B 2 204 ? 31.126  -14.212 -25.639 1.00 42.15 ? 204 ALA A CA    1 
ATOM   2384 C  C     . ALA B 2 204 ? 32.131  -13.503 -24.726 1.00 42.38 ? 204 ALA A C     1 
ATOM   2385 O  O     . ALA B 2 204 ? 33.335  -13.495 -25.005 1.00 42.16 ? 204 ALA A O     1 
ATOM   2386 C  CB    . ALA B 2 204 ? 30.647  -13.264 -26.731 1.00 41.37 ? 204 ALA A CB    1 
ATOM   2387 N  N     . LYS B 2 205 ? 31.638  -12.906 -23.646 1.00 40.52 ? 205 LYS A N     1 
ATOM   2388 C  CA    . LYS B 2 205 ? 32.508  -12.221 -22.704 1.00 40.01 ? 205 LYS A CA    1 
ATOM   2389 C  C     . LYS B 2 205 ? 32.994  -13.155 -21.597 1.00 37.81 ? 205 LYS A C     1 
ATOM   2390 O  O     . LYS B 2 205 ? 33.835  -12.769 -20.787 1.00 35.43 ? 205 LYS A O     1 
ATOM   2391 C  CB    . LYS B 2 205 ? 31.783  -11.029 -22.081 1.00 41.98 ? 205 LYS A CB    1 
ATOM   2392 C  CG    . LYS B 2 205 ? 31.695  -9.809  -22.977 1.00 46.68 ? 205 LYS A CG    1 
ATOM   2393 C  CD    . LYS B 2 205 ? 31.029  -8.636  -22.249 1.00 50.18 ? 205 LYS A CD    1 
ATOM   2394 C  CE    . LYS B 2 205 ? 31.096  -7.349  -23.072 1.00 51.05 ? 205 LYS A CE    1 
ATOM   2395 N  NZ    . LYS B 2 205 ? 30.546  -7.527  -24.452 1.00 52.81 ? 205 LYS A NZ    1 
ATOM   2396 N  N     . GLY B 2 206 ? 32.467  -14.380 -21.576 1.00 36.35 ? 206 GLY A N     1 
ATOM   2397 C  CA    . GLY B 2 206 ? 32.845  -15.342 -20.550 1.00 35.71 ? 206 GLY A CA    1 
ATOM   2398 C  C     . GLY B 2 206 ? 32.529  -14.781 -19.173 1.00 35.91 ? 206 GLY A C     1 
ATOM   2399 O  O     . GLY B 2 206 ? 33.266  -14.978 -18.219 1.00 33.37 ? 206 GLY A O     1 
ATOM   2400 N  N     . GLU B 2 207 ? 31.396  -14.097 -19.070 1.00 36.74 ? 207 GLU A N     1 
ATOM   2401 C  CA    . GLU B 2 207 ? 31.012  -13.454 -17.831 1.00 38.05 ? 207 GLU A CA    1 
ATOM   2402 C  C     . GLU B 2 207 ? 29.547  -13.633 -17.437 1.00 37.15 ? 207 GLU A C     1 
ATOM   2403 O  O     . GLU B 2 207 ? 28.675  -13.842 -18.281 1.00 36.85 ? 207 GLU A O     1 
ATOM   2404 C  CB    . GLU B 2 207 ? 31.337  -11.966 -17.957 1.00 38.68 ? 207 GLU A CB    1 
ATOM   2405 C  CG    . GLU B 2 207 ? 30.874  -11.107 -16.810 1.00 46.93 ? 207 GLU A CG    1 
ATOM   2406 C  CD    . GLU B 2 207 ? 31.061  -9.626  -17.094 1.00 50.62 ? 207 GLU A CD    1 
ATOM   2407 O  OE1   . GLU B 2 207 ? 30.568  -9.160  -18.145 1.00 53.77 ? 207 GLU A OE1   1 
ATOM   2408 O  OE2   . GLU B 2 207 ? 31.693  -8.929  -16.269 1.00 51.81 ? 207 GLU A OE2   1 
ATOM   2409 N  N     . VAL B 2 208 ? 29.297  -13.555 -16.135 1.00 36.35 ? 208 VAL A N     1 
ATOM   2410 C  CA    . VAL B 2 208 ? 27.954  -13.654 -15.574 1.00 36.40 ? 208 VAL A CA    1 
ATOM   2411 C  C     . VAL B 2 208 ? 27.770  -12.400 -14.728 1.00 37.79 ? 208 VAL A C     1 
ATOM   2412 O  O     . VAL B 2 208 ? 28.524  -12.166 -13.786 1.00 39.37 ? 208 VAL A O     1 
ATOM   2413 C  CB    . VAL B 2 208 ? 27.783  -14.912 -14.665 1.00 34.48 ? 208 VAL A CB    1 
ATOM   2414 C  CG1   . VAL B 2 208 ? 26.486  -14.813 -13.878 1.00 33.54 ? 208 VAL A CG1   1 
ATOM   2415 C  CG2   . VAL B 2 208 ? 27.759  -16.172 -15.507 1.00 30.88 ? 208 VAL A CG2   1 
ATOM   2416 N  N     . ARG B 2 209 ? 26.790  -11.579 -15.082 1.00 39.80 ? 209 ARG A N     1 
ATOM   2417 C  CA    . ARG B 2 209 ? 26.523  -10.351 -14.340 1.00 41.65 ? 209 ARG A CA    1 
ATOM   2418 C  C     . ARG B 2 209 ? 25.050  -10.225 -13.942 1.00 43.32 ? 209 ARG A C     1 
ATOM   2419 O  O     . ARG B 2 209 ? 24.224  -11.070 -14.292 1.00 42.20 ? 209 ARG A O     1 
ATOM   2420 C  CB    . ARG B 2 209 ? 26.953  -9.133  -15.162 1.00 42.38 ? 209 ARG A CB    1 
ATOM   2421 C  CG    . ARG B 2 209 ? 26.491  -9.150  -16.605 1.00 43.80 ? 209 ARG A CG    1 
ATOM   2422 C  CD    . ARG B 2 209 ? 26.680  -7.784  -17.256 1.00 45.44 ? 209 ARG A CD    1 
ATOM   2423 N  NE    . ARG B 2 209 ? 26.179  -7.754  -18.631 1.00 46.18 ? 209 ARG A NE    1 
ATOM   2424 C  CZ    . ARG B 2 209 ? 26.816  -8.281  -19.673 1.00 47.88 ? 209 ARG A CZ    1 
ATOM   2425 N  NH1   . ARG B 2 209 ? 27.992  -8.882  -19.515 1.00 47.97 ? 209 ARG A NH1   1 
ATOM   2426 N  NH2   . ARG B 2 209 ? 26.275  -8.209  -20.879 1.00 49.04 ? 209 ARG A NH2   1 
ATOM   2427 N  N     . LYS B 2 210 ? 24.732  -9.167  -13.203 1.00 45.62 ? 210 LYS A N     1 
ATOM   2428 C  CA    . LYS B 2 210 ? 23.369  -8.930  -12.741 1.00 48.11 ? 210 LYS A CA    1 
ATOM   2429 C  C     . LYS B 2 210 ? 22.668  -7.988  -13.724 1.00 49.29 ? 210 LYS A C     1 
ATOM   2430 O  O     . LYS B 2 210 ? 23.272  -7.029  -14.211 1.00 49.33 ? 210 LYS A O     1 
ATOM   2431 C  CB    . LYS B 2 210 ? 23.420  -8.323  -11.336 1.00 51.15 ? 210 LYS A CB    1 
ATOM   2432 C  CG    . LYS B 2 210 ? 22.284  -8.710  -10.394 1.00 54.43 ? 210 LYS A CG    1 
ATOM   2433 C  CD    . LYS B 2 210 ? 21.091  -7.769  -10.518 1.00 56.76 ? 210 LYS A CD    1 
ATOM   2434 C  CE    . LYS B 2 210 ? 20.122  -7.966  -9.355  1.00 58.72 ? 210 LYS A CE    1 
ATOM   2435 N  NZ    . LYS B 2 210 ? 18.945  -7.045  -9.425  1.00 59.92 ? 210 LYS A NZ    1 
ATOM   2436 N  N     . GLY B 2 211 ? 21.405  -8.278  -14.032 1.00 49.55 ? 211 GLY A N     1 
ATOM   2437 C  CA    . GLY B 2 211 ? 20.657  -7.453  -14.963 1.00 49.54 ? 211 GLY A CA    1 
ATOM   2438 C  C     . GLY B 2 211 ? 19.208  -7.252  -14.563 1.00 51.05 ? 211 GLY A C     1 
ATOM   2439 O  O     . GLY B 2 211 ? 18.830  -7.484  -13.419 1.00 51.37 ? 211 GLY A O     1 
ATOM   2440 N  N     . GLU B 2 212 ? 18.389  -6.823  -15.514 1.00 53.02 ? 212 GLU A N     1 
ATOM   2441 C  CA    . GLU B 2 212 ? 16.972  -6.580  -15.264 1.00 54.89 ? 212 GLU A CA    1 
ATOM   2442 C  C     . GLU B 2 212 ? 16.090  -7.823  -15.413 1.00 53.47 ? 212 GLU A C     1 
ATOM   2443 O  O     . GLU B 2 212 ? 14.940  -7.822  -14.975 1.00 53.98 ? 212 GLU A O     1 
ATOM   2444 C  CB    . GLU B 2 212 ? 16.461  -5.467  -16.194 1.00 58.72 ? 212 GLU A CB    1 
ATOM   2445 C  CG    . GLU B 2 212 ? 16.958  -4.060  -15.827 1.00 64.03 ? 212 GLU A CG    1 
ATOM   2446 C  CD    . GLU B 2 212 ? 16.588  -2.994  -16.866 1.00 68.60 ? 212 GLU A CD    1 
ATOM   2447 O  OE1   . GLU B 2 212 ? 16.850  -1.794  -16.610 1.00 68.37 ? 212 GLU A OE1   1 
ATOM   2448 O  OE2   . GLU B 2 212 ? 16.043  -3.355  -17.939 1.00 70.11 ? 212 GLU A OE2   1 
ATOM   2449 N  N     . GLU B 2 213 ? 16.628  -8.876  -16.025 1.00 51.42 ? 213 GLU A N     1 
ATOM   2450 C  CA    . GLU B 2 213 ? 15.883  -10.118 -16.228 1.00 48.96 ? 213 GLU A CA    1 
ATOM   2451 C  C     . GLU B 2 213 ? 16.836  -11.225 -16.665 1.00 47.18 ? 213 GLU A C     1 
ATOM   2452 O  O     . GLU B 2 213 ? 17.944  -10.938 -17.112 1.00 46.93 ? 213 GLU A O     1 
ATOM   2453 C  CB    . GLU B 2 213 ? 14.820  -9.922  -17.304 1.00 49.34 ? 213 GLU A CB    1 
ATOM   2454 C  CG    . GLU B 2 213 ? 15.387  -9.607  -18.673 1.00 54.24 ? 213 GLU A CG    1 
ATOM   2455 C  CD    . GLU B 2 213 ? 14.306  -9.427  -19.725 1.00 58.49 ? 213 GLU A CD    1 
ATOM   2456 O  OE1   . GLU B 2 213 ? 13.527  -8.450  -19.624 1.00 59.95 ? 213 GLU A OE1   1 
ATOM   2457 O  OE2   . GLU B 2 213 ? 14.230  -10.266 -20.653 1.00 60.56 ? 213 GLU A OE2   1 
ATOM   2458 N  N     . PHE B 2 214 ? 16.413  -12.485 -16.538 1.00 44.52 ? 214 PHE A N     1 
ATOM   2459 C  CA    . PHE B 2 214 ? 17.265  -13.600 -16.950 1.00 41.08 ? 214 PHE A CA    1 
ATOM   2460 C  C     . PHE B 2 214 ? 17.573  -13.378 -18.424 1.00 38.93 ? 214 PHE A C     1 
ATOM   2461 O  O     . PHE B 2 214 ? 16.666  -13.357 -19.264 1.00 38.76 ? 214 PHE A O     1 
ATOM   2462 C  CB    . PHE B 2 214 ? 16.564  -14.947 -16.757 1.00 39.75 ? 214 PHE A CB    1 
ATOM   2463 C  CG    . PHE B 2 214 ? 17.476  -16.124 -16.956 1.00 39.26 ? 214 PHE A CG    1 
ATOM   2464 C  CD1   . PHE B 2 214 ? 18.497  -16.390 -16.049 1.00 38.19 ? 214 PHE A CD1   1 
ATOM   2465 C  CD2   . PHE B 2 214 ? 17.343  -16.949 -18.068 1.00 37.12 ? 214 PHE A CD2   1 
ATOM   2466 C  CE1   . PHE B 2 214 ? 19.373  -17.460 -16.254 1.00 37.09 ? 214 PHE A CE1   1 
ATOM   2467 C  CE2   . PHE B 2 214 ? 18.221  -18.018 -18.272 1.00 35.48 ? 214 PHE A CE2   1 
ATOM   2468 C  CZ    . PHE B 2 214 ? 19.229  -18.273 -17.371 1.00 31.55 ? 214 PHE A CZ    1 
ATOM   2469 N  N     . PHE B 2 215 ? 18.858  -13.227 -18.730 1.00 34.98 ? 215 PHE A N     1 
ATOM   2470 C  CA    . PHE B 2 215 ? 19.287  -12.924 -20.083 1.00 32.61 ? 215 PHE A CA    1 
ATOM   2471 C  C     . PHE B 2 215 ? 20.544  -13.688 -20.501 1.00 32.83 ? 215 PHE A C     1 
ATOM   2472 O  O     . PHE B 2 215 ? 21.573  -13.610 -19.830 1.00 33.55 ? 215 PHE A O     1 
ATOM   2473 C  CB    . PHE B 2 215 ? 19.541  -11.418 -20.150 1.00 29.83 ? 215 PHE A CB    1 
ATOM   2474 C  CG    . PHE B 2 215 ? 19.547  -10.849 -21.531 1.00 30.43 ? 215 PHE A CG    1 
ATOM   2475 C  CD1   . PHE B 2 215 ? 18.558  -9.953  -21.922 1.00 30.72 ? 215 PHE A CD1   1 
ATOM   2476 C  CD2   . PHE B 2 215 ? 20.560  -11.169 -22.432 1.00 31.90 ? 215 PHE A CD2   1 
ATOM   2477 C  CE1   . PHE B 2 215 ? 18.576  -9.376  -23.193 1.00 31.94 ? 215 PHE A CE1   1 
ATOM   2478 C  CE2   . PHE B 2 215 ? 20.590  -10.598 -23.708 1.00 32.99 ? 215 PHE A CE2   1 
ATOM   2479 C  CZ    . PHE B 2 215 ? 19.595  -9.698  -24.089 1.00 31.41 ? 215 PHE A CZ    1 
ATOM   2480 N  N     . VAL B 2 216 ? 20.462  -14.423 -21.609 1.00 32.09 ? 216 VAL A N     1 
ATOM   2481 C  CA    . VAL B 2 216 ? 21.608  -15.176 -22.123 1.00 30.47 ? 216 VAL A CA    1 
ATOM   2482 C  C     . VAL B 2 216 ? 21.982  -14.587 -23.474 1.00 31.04 ? 216 VAL A C     1 
ATOM   2483 O  O     . VAL B 2 216 ? 21.392  -14.920 -24.495 1.00 31.32 ? 216 VAL A O     1 
ATOM   2484 C  CB    . VAL B 2 216 ? 21.278  -16.676 -22.286 1.00 30.89 ? 216 VAL A CB    1 
ATOM   2485 C  CG1   . VAL B 2 216 ? 22.469  -17.416 -22.883 1.00 28.08 ? 216 VAL A CG1   1 
ATOM   2486 C  CG2   . VAL B 2 216 ? 20.907  -17.271 -20.932 1.00 28.79 ? 216 VAL A CG2   1 
ATOM   2487 N  N     . VAL B 2 217 ? 22.974  -13.705 -23.461 1.00 32.83 ? 217 VAL A N     1 
ATOM   2488 C  CA    . VAL B 2 217 ? 23.442  -13.011 -24.653 1.00 32.34 ? 217 VAL A CA    1 
ATOM   2489 C  C     . VAL B 2 217 ? 23.936  -13.938 -25.748 1.00 33.08 ? 217 VAL A C     1 
ATOM   2490 O  O     . VAL B 2 217 ? 24.740  -14.832 -25.504 1.00 34.54 ? 217 VAL A O     1 
ATOM   2491 C  CB    . VAL B 2 217 ? 24.577  -12.014 -24.291 1.00 32.20 ? 217 VAL A CB    1 
ATOM   2492 C  CG1   . VAL B 2 217 ? 24.845  -11.064 -25.458 1.00 28.46 ? 217 VAL A CG1   1 
ATOM   2493 C  CG2   . VAL B 2 217 ? 24.200  -11.239 -23.044 1.00 29.09 ? 217 VAL A CG2   1 
ATOM   2494 N  N     . ASP B 2 218 ? 23.441  -13.710 -26.959 1.00 35.55 ? 218 ASP A N     1 
ATOM   2495 C  CA    . ASP B 2 218 ? 23.810  -14.497 -28.131 1.00 35.19 ? 218 ASP A CA    1 
ATOM   2496 C  C     . ASP B 2 218 ? 25.217  -14.060 -28.542 1.00 35.57 ? 218 ASP A C     1 
ATOM   2497 O  O     . ASP B 2 218 ? 25.500  -12.866 -28.626 1.00 35.64 ? 218 ASP A O     1 
ATOM   2498 C  CB    . ASP B 2 218 ? 22.831  -14.210 -29.274 1.00 34.11 ? 218 ASP A CB    1 
ATOM   2499 C  CG    . ASP B 2 218 ? 22.839  -15.287 -30.350 1.00 35.33 ? 218 ASP A CG    1 
ATOM   2500 O  OD1   . ASP B 2 218 ? 23.915  -15.857 -30.633 1.00 33.80 ? 218 ASP A OD1   1 
ATOM   2501 O  OD2   . ASP B 2 218 ? 21.758  -15.553 -30.928 1.00 34.30 ? 218 ASP A OD2   1 
ATOM   2502 N  N     . PRO B 2 219 ? 26.123  -15.021 -28.787 1.00 35.60 ? 219 PRO A N     1 
ATOM   2503 C  CA    . PRO B 2 219 ? 27.495  -14.681 -29.189 1.00 34.88 ? 219 PRO A CA    1 
ATOM   2504 C  C     . PRO B 2 219 ? 27.472  -14.003 -30.554 1.00 36.30 ? 219 PRO A C     1 
ATOM   2505 O  O     . PRO B 2 219 ? 28.362  -13.220 -30.910 1.00 36.85 ? 219 PRO A O     1 
ATOM   2506 C  CB    . PRO B 2 219 ? 28.183  -16.035 -29.266 1.00 33.09 ? 219 PRO A CB    1 
ATOM   2507 C  CG    . PRO B 2 219 ? 27.368  -16.903 -28.354 1.00 36.01 ? 219 PRO A CG    1 
ATOM   2508 C  CD    . PRO B 2 219 ? 25.964  -16.474 -28.609 1.00 33.88 ? 219 PRO A CD    1 
ATOM   2509 N  N     . VAL B 2 220 ? 26.429  -14.320 -31.305 1.00 37.04 ? 220 VAL A N     1 
ATOM   2510 C  CA    . VAL B 2 220 ? 26.237  -13.813 -32.652 1.00 39.98 ? 220 VAL A CA    1 
ATOM   2511 C  C     . VAL B 2 220 ? 25.573  -12.440 -32.706 1.00 40.83 ? 220 VAL A C     1 
ATOM   2512 O  O     . VAL B 2 220 ? 25.764  -11.699 -33.665 1.00 42.17 ? 220 VAL A O     1 
ATOM   2513 C  CB    . VAL B 2 220 ? 25.415  -14.852 -33.476 1.00 40.10 ? 220 VAL A CB    1 
ATOM   2514 C  CG1   . VAL B 2 220 ? 24.683  -14.193 -34.612 1.00 42.12 ? 220 VAL A CG1   1 
ATOM   2515 C  CG2   . VAL B 2 220 ? 26.346  -15.915 -34.014 1.00 40.49 ? 220 VAL A CG2   1 
ATOM   2516 N  N     . ASP B 2 221 ? 24.805  -12.104 -31.673 1.00 42.87 ? 221 ASP A N     1 
ATOM   2517 C  CA    . ASP B 2 221 ? 24.100  -10.826 -31.613 1.00 44.96 ? 221 ASP A CA    1 
ATOM   2518 C  C     . ASP B 2 221 ? 23.822  -10.452 -30.160 1.00 45.56 ? 221 ASP A C     1 
ATOM   2519 O  O     . ASP B 2 221 ? 22.939  -11.023 -29.531 1.00 45.95 ? 221 ASP A O     1 
ATOM   2520 C  CB    . ASP B 2 221 ? 22.768  -10.932 -32.372 1.00 46.46 ? 221 ASP A CB    1 
ATOM   2521 C  CG    . ASP B 2 221 ? 22.040  -9.599  -32.482 1.00 46.89 ? 221 ASP A CG    1 
ATOM   2522 O  OD1   . ASP B 2 221 ? 22.359  -8.670  -31.705 1.00 47.65 ? 221 ASP A OD1   1 
ATOM   2523 O  OD2   . ASP B 2 221 ? 21.138  -9.484  -33.341 1.00 46.04 ? 221 ASP A OD2   1 
ATOM   2524 N  N     . GLU B 2 222 ? 24.569  -9.486  -29.640 1.00 46.64 ? 222 GLU A N     1 
ATOM   2525 C  CA    . GLU B 2 222 ? 24.421  -9.027  -28.254 1.00 49.17 ? 222 GLU A CA    1 
ATOM   2526 C  C     . GLU B 2 222 ? 23.020  -8.541  -27.852 1.00 48.21 ? 222 GLU A C     1 
ATOM   2527 O  O     . GLU B 2 222 ? 22.694  -8.493  -26.668 1.00 48.06 ? 222 GLU A O     1 
ATOM   2528 C  CB    . GLU B 2 222 ? 25.428  -7.915  -27.990 1.00 51.29 ? 222 GLU A CB    1 
ATOM   2529 C  CG    . GLU B 2 222 ? 25.523  -6.964  -29.168 1.00 59.49 ? 222 GLU A CG    1 
ATOM   2530 C  CD    . GLU B 2 222 ? 26.404  -5.768  -28.902 1.00 63.51 ? 222 GLU A CD    1 
ATOM   2531 O  OE1   . GLU B 2 222 ? 26.688  -5.029  -29.872 1.00 65.68 ? 222 GLU A OE1   1 
ATOM   2532 O  OE2   . GLU B 2 222 ? 26.802  -5.563  -27.730 1.00 65.60 ? 222 GLU A OE2   1 
ATOM   2533 N  N     . LYS B 2 223 ? 22.191  -8.172  -28.819 1.00 47.55 ? 223 LYS A N     1 
ATOM   2534 C  CA    . LYS B 2 223 ? 20.849  -7.702  -28.490 1.00 48.13 ? 223 LYS A CA    1 
ATOM   2535 C  C     . LYS B 2 223 ? 19.858  -8.866  -28.355 1.00 47.28 ? 223 LYS A C     1 
ATOM   2536 O  O     . LYS B 2 223 ? 18.746  -8.693  -27.859 1.00 46.56 ? 223 LYS A O     1 
ATOM   2537 C  CB    . LYS B 2 223 ? 20.355  -6.716  -29.559 1.00 49.91 ? 223 LYS A CB    1 
ATOM   2538 C  CG    . LYS B 2 223 ? 21.262  -5.500  -29.821 1.00 54.05 ? 223 LYS A CG    1 
ATOM   2539 C  CD    . LYS B 2 223 ? 21.487  -4.626  -28.576 1.00 57.46 ? 223 LYS A CD    1 
ATOM   2540 C  CE    . LYS B 2 223 ? 22.543  -5.226  -27.633 1.00 61.05 ? 223 LYS A CE    1 
ATOM   2541 N  NZ    . LYS B 2 223 ? 22.769  -4.464  -26.361 1.00 60.53 ? 223 LYS A NZ    1 
ATOM   2542 N  N     . ARG B 2 224 ? 20.279  -10.052 -28.784 1.00 45.63 ? 224 ARG A N     1 
ATOM   2543 C  CA    . ARG B 2 224 ? 19.438  -11.242 -28.739 1.00 43.56 ? 224 ARG A CA    1 
ATOM   2544 C  C     . ARG B 2 224 ? 19.527  -12.014 -27.429 1.00 41.69 ? 224 ARG A C     1 
ATOM   2545 O  O     . ARG B 2 224 ? 20.601  -12.477 -27.050 1.00 41.73 ? 224 ARG A O     1 
ATOM   2546 C  CB    . ARG B 2 224 ? 19.825  -12.184 -29.881 1.00 45.07 ? 224 ARG A CB    1 
ATOM   2547 C  CG    . ARG B 2 224 ? 18.650  -12.815 -30.608 1.00 49.29 ? 224 ARG A CG    1 
ATOM   2548 C  CD    . ARG B 2 224 ? 18.026  -14.007 -29.897 1.00 50.06 ? 224 ARG A CD    1 
ATOM   2549 N  NE    . ARG B 2 224 ? 16.683  -14.222 -30.432 1.00 55.57 ? 224 ARG A NE    1 
ATOM   2550 C  CZ    . ARG B 2 224 ? 15.948  -15.321 -30.275 1.00 57.96 ? 224 ARG A CZ    1 
ATOM   2551 N  NH1   . ARG B 2 224 ? 16.405  -16.364 -29.591 1.00 60.03 ? 224 ARG A NH1   1 
ATOM   2552 N  NH2   . ARG B 2 224 ? 14.734  -15.365 -30.799 1.00 57.12 ? 224 ARG A NH2   1 
ATOM   2553 N  N     . ASN B 2 225 ? 18.398  -12.151 -26.740 1.00 38.81 ? 225 ASN A N     1 
ATOM   2554 C  CA    . ASN B 2 225 ? 18.357  -12.921 -25.502 1.00 35.92 ? 225 ASN A CA    1 
ATOM   2555 C  C     . ASN B 2 225 ? 17.962  -14.331 -25.921 1.00 35.71 ? 225 ASN A C     1 
ATOM   2556 O  O     . ASN B 2 225 ? 16.796  -14.589 -26.223 1.00 36.86 ? 225 ASN A O     1 
ATOM   2557 C  CB    . ASN B 2 225 ? 17.303  -12.369 -24.539 1.00 35.52 ? 225 ASN A CB    1 
ATOM   2558 C  CG    . ASN B 2 225 ? 17.143  -13.234 -23.298 1.00 33.53 ? 225 ASN A CG    1 
ATOM   2559 O  OD1   . ASN B 2 225 ? 17.852  -14.221 -23.130 1.00 34.69 ? 225 ASN A OD1   1 
ATOM   2560 N  ND2   . ASN B 2 225 ? 16.215  -12.867 -22.427 1.00 31.63 ? 225 ASN A ND2   1 
ATOM   2561 N  N     . VAL B 2 226 ? 18.930  -15.238 -25.950 1.00 33.71 ? 226 VAL A N     1 
ATOM   2562 C  CA    . VAL B 2 226 ? 18.670  -16.610 -26.362 1.00 32.25 ? 226 VAL A CA    1 
ATOM   2563 C  C     . VAL B 2 226 ? 17.602  -17.281 -25.505 1.00 31.60 ? 226 VAL A C     1 
ATOM   2564 O  O     . VAL B 2 226 ? 16.915  -18.187 -25.970 1.00 33.14 ? 226 VAL A O     1 
ATOM   2565 C  CB    . VAL B 2 226 ? 19.978  -17.454 -26.345 1.00 31.27 ? 226 VAL A CB    1 
ATOM   2566 C  CG1   . VAL B 2 226 ? 19.685  -18.888 -26.720 1.00 29.20 ? 226 VAL A CG1   1 
ATOM   2567 C  CG2   . VAL B 2 226 ? 20.982  -16.863 -27.321 1.00 30.08 ? 226 VAL A CG2   1 
ATOM   2568 N  N     . ALA B 2 227 ? 17.450  -16.820 -24.267 1.00 30.83 ? 227 ALA A N     1 
ATOM   2569 C  CA    . ALA B 2 227 ? 16.457  -17.383 -23.347 1.00 31.28 ? 227 ALA A CA    1 
ATOM   2570 C  C     . ALA B 2 227 ? 15.231  -16.477 -23.176 1.00 30.27 ? 227 ALA A C     1 
ATOM   2571 O  O     . ALA B 2 227 ? 14.592  -16.470 -22.125 1.00 30.44 ? 227 ALA A O     1 
ATOM   2572 C  CB    . ALA B 2 227 ? 17.107  -17.648 -21.977 1.00 28.82 ? 227 ALA A CB    1 
ATOM   2573 N  N     . ALA B 2 228 ? 14.896  -15.735 -24.222 1.00 30.58 ? 228 ALA A N     1 
ATOM   2574 C  CA    . ALA B 2 228 ? 13.774  -14.809 -24.190 1.00 31.50 ? 228 ALA A CA    1 
ATOM   2575 C  C     . ALA B 2 228 ? 12.407  -15.401 -23.828 1.00 32.51 ? 228 ALA A C     1 
ATOM   2576 O  O     . ALA B 2 228 ? 11.619  -14.773 -23.113 1.00 33.02 ? 228 ALA A O     1 
ATOM   2577 C  CB    . ALA B 2 228 ? 13.677  -14.091 -25.527 1.00 31.35 ? 228 ALA A CB    1 
ATOM   2578 N  N     . ASN B 2 229 ? 12.119  -16.602 -24.309 1.00 32.04 ? 229 ASN A N     1 
ATOM   2579 C  CA    . ASN B 2 229 ? 10.826  -17.197 -24.041 1.00 31.79 ? 229 ASN A CA    1 
ATOM   2580 C  C     . ASN B 2 229 ? 10.804  -18.208 -22.904 1.00 32.78 ? 229 ASN A C     1 
ATOM   2581 O  O     . ASN B 2 229 ? 9.862   -19.002 -22.779 1.00 34.01 ? 229 ASN A O     1 
ATOM   2582 C  CB    . ASN B 2 229 ? 10.271  -17.829 -25.319 1.00 32.63 ? 229 ASN A CB    1 
ATOM   2583 C  CG    . ASN B 2 229 ? 8.763   -17.869 -25.325 1.00 31.87 ? 229 ASN A CG    1 
ATOM   2584 O  OD1   . ASN B 2 229 ? 8.126   -16.885 -24.967 1.00 32.05 ? 229 ASN A OD1   1 
ATOM   2585 N  ND2   . ASN B 2 229 ? 8.181   -18.999 -25.732 1.00 29.00 ? 229 ASN A ND2   1 
ATOM   2586 N  N     . LEU B 2 230 ? 11.842  -18.172 -22.075 1.00 32.16 ? 230 LEU A N     1 
ATOM   2587 C  CA    . LEU B 2 230 ? 11.947  -19.062 -20.927 1.00 32.00 ? 230 LEU A CA    1 
ATOM   2588 C  C     . LEU B 2 230 ? 11.179  -18.350 -19.830 1.00 32.43 ? 230 LEU A C     1 
ATOM   2589 O  O     . LEU B 2 230 ? 11.546  -17.245 -19.446 1.00 34.85 ? 230 LEU A O     1 
ATOM   2590 C  CB    . LEU B 2 230 ? 13.419  -19.230 -20.527 1.00 32.33 ? 230 LEU A CB    1 
ATOM   2591 C  CG    . LEU B 2 230 ? 13.707  -19.928 -19.197 1.00 32.81 ? 230 LEU A CG    1 
ATOM   2592 C  CD1   . LEU B 2 230 ? 13.179  -21.350 -19.247 1.00 32.13 ? 230 LEU A CD1   1 
ATOM   2593 C  CD2   . LEU B 2 230 ? 15.209  -19.916 -18.914 1.00 34.43 ? 230 LEU A CD2   1 
ATOM   2594 N  N     . SER B 2 231 ? 10.114  -18.962 -19.327 1.00 31.54 ? 231 SER A N     1 
ATOM   2595 C  CA    . SER B 2 231 ? 9.310   -18.310 -18.296 1.00 30.18 ? 231 SER A CA    1 
ATOM   2596 C  C     . SER B 2 231 ? 9.990   -18.359 -16.948 1.00 29.80 ? 231 SER A C     1 
ATOM   2597 O  O     . SER B 2 231 ? 10.793  -19.248 -16.688 1.00 29.94 ? 231 SER A O     1 
ATOM   2598 C  CB    . SER B 2 231 ? 7.935   -18.974 -18.182 1.00 29.95 ? 231 SER A CB    1 
ATOM   2599 O  OG    . SER B 2 231 ? 8.058   -20.299 -17.698 1.00 28.53 ? 231 SER A OG    1 
ATOM   2600 N  N     . LEU B 2 232 ? 9.650   -17.404 -16.090 1.00 29.77 ? 232 LEU A N     1 
ATOM   2601 C  CA    . LEU B 2 232 ? 10.213  -17.342 -14.750 1.00 31.09 ? 232 LEU A CA    1 
ATOM   2602 C  C     . LEU B 2 232 ? 9.980   -18.641 -13.978 1.00 33.01 ? 232 LEU A C     1 
ATOM   2603 O  O     . LEU B 2 232 ? 10.871  -19.130 -13.279 1.00 33.17 ? 232 LEU A O     1 
ATOM   2604 C  CB    . LEU B 2 232 ? 9.589   -16.184 -13.972 1.00 32.27 ? 232 LEU A CB    1 
ATOM   2605 C  CG    . LEU B 2 232 ? 10.086  -15.995 -12.534 1.00 32.40 ? 232 LEU A CG    1 
ATOM   2606 C  CD1   . LEU B 2 232 ? 11.546  -15.589 -12.537 1.00 29.90 ? 232 LEU A CD1   1 
ATOM   2607 C  CD2   . LEU B 2 232 ? 9.241   -14.930 -11.844 1.00 32.22 ? 232 LEU A CD2   1 
ATOM   2608 N  N     . ASP B 2 233 ? 8.785   -19.207 -14.110 1.00 33.06 ? 233 ASP A N     1 
ATOM   2609 C  CA    . ASP B 2 233 ? 8.476   -20.423 -13.395 1.00 33.88 ? 233 ASP A CA    1 
ATOM   2610 C  C     . ASP B 2 233 ? 9.255   -21.629 -13.889 1.00 34.24 ? 233 ASP A C     1 
ATOM   2611 O  O     . ASP B 2 233 ? 9.568   -22.529 -13.108 1.00 33.29 ? 233 ASP A O     1 
ATOM   2612 C  CB    . ASP B 2 233 ? 6.971   -20.671 -13.418 1.00 39.37 ? 233 ASP A CB    1 
ATOM   2613 C  CG    . ASP B 2 233 ? 6.207   -19.602 -12.654 1.00 43.73 ? 233 ASP A CG    1 
ATOM   2614 O  OD1   . ASP B 2 233 ? 6.759   -19.106 -11.648 1.00 47.71 ? 233 ASP A OD1   1 
ATOM   2615 O  OD2   . ASP B 2 233 ? 5.068   -19.258 -13.042 1.00 45.84 ? 233 ASP A OD2   1 
ATOM   2616 N  N     . ASN B 2 234 ? 9.580   -21.659 -15.176 1.00 33.79 ? 234 ASN A N     1 
ATOM   2617 C  CA    . ASN B 2 234 ? 10.377  -22.764 -15.696 1.00 34.52 ? 234 ASN A CA    1 
ATOM   2618 C  C     . ASN B 2 234 ? 11.851  -22.563 -15.309 1.00 34.45 ? 234 ASN A C     1 
ATOM   2619 O  O     . ASN B 2 234 ? 12.582  -23.527 -15.089 1.00 33.22 ? 234 ASN A O     1 
ATOM   2620 C  CB    . ASN B 2 234 ? 10.208  -22.880 -17.206 1.00 33.98 ? 234 ASN A CB    1 
ATOM   2621 C  CG    . ASN B 2 234 ? 8.958   -23.660 -17.583 1.00 35.68 ? 234 ASN A CG    1 
ATOM   2622 O  OD1   . ASN B 2 234 ? 8.491   -23.598 -18.723 1.00 36.59 ? 234 ASN A OD1   1 
ATOM   2623 N  ND2   . ASN B 2 234 ? 8.415   -24.411 -16.624 1.00 32.49 ? 234 ASN A ND2   1 
ATOM   2624 N  N     . LEU B 2 235 ? 12.280  -21.306 -15.216 1.00 33.50 ? 235 LEU A N     1 
ATOM   2625 C  CA    . LEU B 2 235 ? 13.644  -21.018 -14.800 1.00 33.83 ? 235 LEU A CA    1 
ATOM   2626 C  C     . LEU B 2 235 ? 13.767  -21.498 -13.350 1.00 34.58 ? 235 LEU A C     1 
ATOM   2627 O  O     . LEU B 2 235 ? 14.769  -22.106 -12.959 1.00 34.13 ? 235 LEU A O     1 
ATOM   2628 C  CB    . LEU B 2 235 ? 13.924  -19.513 -14.864 1.00 32.78 ? 235 LEU A CB    1 
ATOM   2629 C  CG    . LEU B 2 235 ? 15.174  -19.056 -14.103 1.00 30.90 ? 235 LEU A CG    1 
ATOM   2630 C  CD1   . LEU B 2 235 ? 16.416  -19.685 -14.707 1.00 27.71 ? 235 LEU A CD1   1 
ATOM   2631 C  CD2   . LEU B 2 235 ? 15.265  -17.544 -14.151 1.00 30.18 ? 235 LEU A CD2   1 
ATOM   2632 N  N     . ALA B 2 236 ? 12.722  -21.230 -12.568 1.00 34.21 ? 236 ALA A N     1 
ATOM   2633 C  CA    . ALA B 2 236 ? 12.678  -21.620 -11.162 1.00 34.35 ? 236 ALA A CA    1 
ATOM   2634 C  C     . ALA B 2 236 ? 12.641  -23.134 -10.993 1.00 34.28 ? 236 ALA A C     1 
ATOM   2635 O  O     . ALA B 2 236 ? 13.273  -23.676 -10.091 1.00 34.07 ? 236 ALA A O     1 
ATOM   2636 C  CB    . ALA B 2 236 ? 11.470  -20.983 -10.481 1.00 33.92 ? 236 ALA A CB    1 
ATOM   2637 N  N     . ARG B 2 237 ? 11.903  -23.822 -11.859 1.00 35.82 ? 237 ARG A N     1 
ATOM   2638 C  CA    . ARG B 2 237 ? 11.829  -25.279 -11.770 1.00 37.08 ? 237 ARG A CA    1 
ATOM   2639 C  C     . ARG B 2 237 ? 13.188  -25.909 -12.060 1.00 37.17 ? 237 ARG A C     1 
ATOM   2640 O  O     . ARG B 2 237 ? 13.593  -26.868 -11.401 1.00 37.79 ? 237 ARG A O     1 
ATOM   2641 C  CB    . ARG B 2 237 ? 10.773  -25.816 -12.733 1.00 37.01 ? 237 ARG A CB    1 
ATOM   2642 C  CG    . ARG B 2 237 ? 9.373   -25.368 -12.343 1.00 41.60 ? 237 ARG A CG    1 
ATOM   2643 C  CD    . ARG B 2 237 ? 8.285   -26.024 -13.169 1.00 42.74 ? 237 ARG A CD    1 
ATOM   2644 N  NE    . ARG B 2 237 ? 6.958   -25.643 -12.688 1.00 46.78 ? 237 ARG A NE    1 
ATOM   2645 C  CZ    . ARG B 2 237 ? 6.270   -24.582 -13.105 1.00 48.33 ? 237 ARG A CZ    1 
ATOM   2646 N  NH1   . ARG B 2 237 ? 6.775   -23.773 -14.029 1.00 48.17 ? 237 ARG A NH1   1 
ATOM   2647 N  NH2   . ARG B 2 237 ? 5.069   -24.330 -12.594 1.00 48.86 ? 237 ARG A NH2   1 
ATOM   2648 N  N     . PHE B 2 238 ? 13.891  -25.355 -13.045 1.00 36.37 ? 238 PHE A N     1 
ATOM   2649 C  CA    . PHE B 2 238 ? 15.212  -25.845 -13.410 1.00 35.43 ? 238 PHE A CA    1 
ATOM   2650 C  C     . PHE B 2 238 ? 16.188  -25.664 -12.242 1.00 35.96 ? 238 PHE A C     1 
ATOM   2651 O  O     . PHE B 2 238 ? 16.872  -26.608 -11.832 1.00 33.76 ? 238 PHE A O     1 
ATOM   2652 C  CB    . PHE B 2 238 ? 15.740  -25.085 -14.621 1.00 34.23 ? 238 PHE A CB    1 
ATOM   2653 C  CG    . PHE B 2 238 ? 17.117  -25.508 -15.039 1.00 33.93 ? 238 PHE A CG    1 
ATOM   2654 C  CD1   . PHE B 2 238 ? 17.346  -26.803 -15.508 1.00 31.36 ? 238 PHE A CD1   1 
ATOM   2655 C  CD2   . PHE B 2 238 ? 18.187  -24.620 -14.949 1.00 32.87 ? 238 PHE A CD2   1 
ATOM   2656 C  CE1   . PHE B 2 238 ? 18.614  -27.209 -15.878 1.00 30.91 ? 238 PHE A CE1   1 
ATOM   2657 C  CE2   . PHE B 2 238 ? 19.467  -25.012 -15.317 1.00 33.41 ? 238 PHE A CE2   1 
ATOM   2658 C  CZ    . PHE B 2 238 ? 19.683  -26.314 -15.785 1.00 35.00 ? 238 PHE A CZ    1 
ATOM   2659 N  N     . VAL B 2 239 ? 16.252  -24.440 -11.721 1.00 34.97 ? 239 VAL A N     1 
ATOM   2660 C  CA    . VAL B 2 239 ? 17.127  -24.140 -10.604 1.00 34.45 ? 239 VAL A CA    1 
ATOM   2661 C  C     . VAL B 2 239 ? 16.819  -25.072 -9.430  1.00 35.72 ? 239 VAL A C     1 
ATOM   2662 O  O     . VAL B 2 239 ? 17.730  -25.614 -8.796  1.00 36.40 ? 239 VAL A O     1 
ATOM   2663 C  CB    . VAL B 2 239 ? 16.966  -22.666 -10.159 1.00 34.50 ? 239 VAL A CB    1 
ATOM   2664 C  CG1   . VAL B 2 239 ? 17.678  -22.435 -8.833  1.00 31.99 ? 239 VAL A CG1   1 
ATOM   2665 C  CG2   . VAL B 2 239 ? 17.530  -21.740 -11.232 1.00 32.24 ? 239 VAL A CG2   1 
ATOM   2666 N  N     . HIS B 2 240 ? 15.535  -25.280 -9.153  1.00 36.06 ? 240 HIS A N     1 
ATOM   2667 C  CA    . HIS B 2 240 ? 15.158  -26.147 -8.046  1.00 36.36 ? 240 HIS A CA    1 
ATOM   2668 C  C     . HIS B 2 240 ? 15.489  -27.598 -8.350  1.00 35.76 ? 240 HIS A C     1 
ATOM   2669 O  O     . HIS B 2 240 ? 15.810  -28.364 -7.444  1.00 36.25 ? 240 HIS A O     1 
ATOM   2670 C  CB    . HIS B 2 240 ? 13.672  -25.994 -7.704  1.00 37.10 ? 240 HIS A CB    1 
ATOM   2671 C  CG    . HIS B 2 240 ? 13.249  -26.788 -6.506  1.00 38.19 ? 240 HIS A CG    1 
ATOM   2672 N  ND1   . HIS B 2 240 ? 12.626  -28.015 -6.605  1.00 38.05 ? 240 HIS A ND1   1 
ATOM   2673 C  CD2   . HIS B 2 240 ? 13.402  -26.550 -5.182  1.00 36.54 ? 240 HIS A CD2   1 
ATOM   2674 C  CE1   . HIS B 2 240 ? 12.413  -28.499 -5.394  1.00 35.92 ? 240 HIS A CE1   1 
ATOM   2675 N  NE2   . HIS B 2 240 ? 12.875  -27.630 -4.514  1.00 37.24 ? 240 HIS A NE2   1 
ATOM   2676 N  N     . LEU B 2 241 ? 15.420  -27.969 -9.624  1.00 36.29 ? 241 LEU A N     1 
ATOM   2677 C  CA    . LEU B 2 241 ? 15.750  -29.329 -10.033 1.00 37.95 ? 241 LEU A CA    1 
ATOM   2678 C  C     . LEU B 2 241 ? 17.244  -29.575 -9.879  1.00 38.22 ? 241 LEU A C     1 
ATOM   2679 O  O     . LEU B 2 241 ? 17.662  -30.662 -9.484  1.00 37.86 ? 241 LEU A O     1 
ATOM   2680 C  CB    . LEU B 2 241 ? 15.355  -29.573 -11.492 1.00 40.19 ? 241 LEU A CB    1 
ATOM   2681 C  CG    . LEU B 2 241 ? 13.991  -30.211 -11.758 1.00 40.29 ? 241 LEU A CG    1 
ATOM   2682 C  CD1   . LEU B 2 241 ? 13.731  -30.242 -13.250 1.00 42.94 ? 241 LEU A CD1   1 
ATOM   2683 C  CD2   . LEU B 2 241 ? 13.962  -31.610 -11.188 1.00 38.47 ? 241 LEU A CD2   1 
ATOM   2684 N  N     . CYS B 2 242 ? 18.043  -28.558 -10.194 1.00 37.51 ? 242 CYS A N     1 
ATOM   2685 C  CA    . CYS B 2 242 ? 19.486  -28.673 -10.094 1.00 37.73 ? 242 CYS A CA    1 
ATOM   2686 C  C     . CYS B 2 242 ? 19.924  -28.874 -8.643  1.00 39.41 ? 242 CYS A C     1 
ATOM   2687 O  O     . CYS B 2 242 ? 20.851  -29.641 -8.362  1.00 39.68 ? 242 CYS A O     1 
ATOM   2688 C  CB    . CYS B 2 242 ? 20.158  -27.429 -10.688 1.00 37.17 ? 242 CYS A CB    1 
ATOM   2689 S  SG    . CYS B 2 242 ? 20.204  -27.365 -12.515 1.00 34.30 ? 242 CYS A SG    1 
ATOM   2690 N  N     . ARG B 2 243 ? 19.257  -28.187 -7.722  1.00 40.30 ? 243 ARG A N     1 
ATOM   2691 C  CA    . ARG B 2 243 ? 19.583  -28.303 -6.304  1.00 40.01 ? 243 ARG A CA    1 
ATOM   2692 C  C     . ARG B 2 243 ? 19.240  -29.690 -5.785  1.00 40.71 ? 243 ARG A C     1 
ATOM   2693 O  O     . ARG B 2 243 ? 19.951  -30.237 -4.947  1.00 40.73 ? 243 ARG A O     1 
ATOM   2694 C  CB    . ARG B 2 243 ? 18.817  -27.255 -5.496  1.00 39.53 ? 243 ARG A CB    1 
ATOM   2695 C  CG    . ARG B 2 243 ? 19.234  -25.825 -5.788  1.00 38.15 ? 243 ARG A CG    1 
ATOM   2696 C  CD    . ARG B 2 243 ? 18.299  -24.831 -5.119  1.00 36.53 ? 243 ARG A CD    1 
ATOM   2697 N  NE    . ARG B 2 243 ? 18.728  -23.448 -5.325  1.00 34.96 ? 243 ARG A NE    1 
ATOM   2698 C  CZ    . ARG B 2 243 ? 17.986  -22.384 -5.035  1.00 31.59 ? 243 ARG A CZ    1 
ATOM   2699 N  NH1   . ARG B 2 243 ? 16.771  -22.548 -4.524  1.00 28.72 ? 243 ARG A NH1   1 
ATOM   2700 N  NH2   . ARG B 2 243 ? 18.456  -21.163 -5.262  1.00 27.06 ? 243 ARG A NH2   1 
ATOM   2701 N  N     . GLU B 2 244 ? 18.146  -30.254 -6.287  1.00 42.36 ? 244 GLU A N     1 
ATOM   2702 C  CA    . GLU B 2 244 ? 17.715  -31.581 -5.866  1.00 43.62 ? 244 GLU A CA    1 
ATOM   2703 C  C     . GLU B 2 244 ? 18.635  -32.648 -6.431  1.00 41.94 ? 244 GLU A C     1 
ATOM   2704 O  O     . GLU B 2 244 ? 19.030  -33.570 -5.728  1.00 42.57 ? 244 GLU A O     1 
ATOM   2705 C  CB    . GLU B 2 244 ? 16.281  -31.876 -6.330  1.00 46.79 ? 244 GLU A CB    1 
ATOM   2706 C  CG    . GLU B 2 244 ? 15.206  -31.005 -5.706  1.00 53.09 ? 244 GLU A CG    1 
ATOM   2707 C  CD    . GLU B 2 244 ? 13.810  -31.613 -5.835  1.00 57.60 ? 244 GLU A CD    1 
ATOM   2708 O  OE1   . GLU B 2 244 ? 13.428  -32.029 -6.952  1.00 59.90 ? 244 GLU A OE1   1 
ATOM   2709 O  OE2   . GLU B 2 244 ? 13.088  -31.671 -4.815  1.00 60.85 ? 244 GLU A OE2   1 
ATOM   2710 N  N     . PHE B 2 245 ? 18.966  -32.527 -7.708  1.00 41.06 ? 245 PHE A N     1 
ATOM   2711 C  CA    . PHE B 2 245 ? 19.835  -33.504 -8.344  1.00 40.45 ? 245 PHE A CA    1 
ATOM   2712 C  C     . PHE B 2 245 ? 21.190  -33.588 -7.653  1.00 41.49 ? 245 PHE A C     1 
ATOM   2713 O  O     . PHE B 2 245 ? 21.740  -34.671 -7.490  1.00 41.02 ? 245 PHE A O     1 
ATOM   2714 C  CB    . PHE B 2 245 ? 20.049  -33.167 -9.816  1.00 37.78 ? 245 PHE A CB    1 
ATOM   2715 C  CG    . PHE B 2 245 ? 20.886  -34.176 -10.538 1.00 37.05 ? 245 PHE A CG    1 
ATOM   2716 C  CD1   . PHE B 2 245 ? 20.347  -35.402 -10.917 1.00 35.25 ? 245 PHE A CD1   1 
ATOM   2717 C  CD2   . PHE B 2 245 ? 22.230  -33.929 -10.789 1.00 34.15 ? 245 PHE A CD2   1 
ATOM   2718 C  CE1   . PHE B 2 245 ? 21.138  -36.371 -11.534 1.00 33.45 ? 245 PHE A CE1   1 
ATOM   2719 C  CE2   . PHE B 2 245 ? 23.027  -34.896 -11.404 1.00 34.16 ? 245 PHE A CE2   1 
ATOM   2720 C  CZ    . PHE B 2 245 ? 22.477  -36.117 -11.776 1.00 32.32 ? 245 PHE A CZ    1 
ATOM   2721 N  N     . MET B 2 246 ? 21.734  -32.442 -7.257  1.00 43.19 ? 246 MET A N     1 
ATOM   2722 C  CA    . MET B 2 246 ? 23.025  -32.423 -6.584  1.00 45.07 ? 246 MET A CA    1 
ATOM   2723 C  C     . MET B 2 246 ? 22.914  -33.061 -5.209  1.00 47.12 ? 246 MET A C     1 
ATOM   2724 O  O     . MET B 2 246 ? 23.787  -33.814 -4.783  1.00 47.41 ? 246 MET A O     1 
ATOM   2725 C  CB    . MET B 2 246 ? 23.518  -30.988 -6.459  1.00 46.21 ? 246 MET A CB    1 
ATOM   2726 C  CG    . MET B 2 246 ? 23.996  -30.415 -7.769  1.00 49.86 ? 246 MET A CG    1 
ATOM   2727 S  SD    . MET B 2 246 ? 25.459  -31.295 -8.346  1.00 53.61 ? 246 MET A SD    1 
ATOM   2728 C  CE    . MET B 2 246 ? 24.756  -32.565 -9.319  1.00 52.86 ? 246 MET A CE    1 
ATOM   2729 N  N     . GLU B 2 247 ? 21.819  -32.748 -4.528  1.00 48.73 ? 247 GLU A N     1 
ATOM   2730 C  CA    . GLU B 2 247 ? 21.534  -33.256 -3.200  1.00 50.02 ? 247 GLU A CA    1 
ATOM   2731 C  C     . GLU B 2 247 ? 21.306  -34.775 -3.219  1.00 50.05 ? 247 GLU A C     1 
ATOM   2732 O  O     . GLU B 2 247 ? 21.835  -35.497 -2.375  1.00 50.15 ? 247 GLU A O     1 
ATOM   2733 C  CB    . GLU B 2 247 ? 20.309  -32.503 -2.665  1.00 53.38 ? 247 GLU A CB    1 
ATOM   2734 C  CG    . GLU B 2 247 ? 19.709  -32.984 -1.356  1.00 58.44 ? 247 GLU A CG    1 
ATOM   2735 C  CD    . GLU B 2 247 ? 18.558  -32.080 -0.885  1.00 62.82 ? 247 GLU A CD    1 
ATOM   2736 O  OE1   . GLU B 2 247 ? 17.713  -32.542 -0.079  1.00 65.48 ? 247 GLU A OE1   1 
ATOM   2737 O  OE2   . GLU B 2 247 ? 18.501  -30.902 -1.312  1.00 61.53 ? 247 GLU A OE2   1 
ATOM   2738 N  N     . ALA B 2 248 ? 20.541  -35.261 -4.195  1.00 49.56 ? 248 ALA A N     1 
ATOM   2739 C  CA    . ALA B 2 248 ? 20.245  -36.690 -4.301  1.00 48.64 ? 248 ALA A CA    1 
ATOM   2740 C  C     . ALA B 2 248 ? 20.276  -37.178 -5.755  1.00 48.16 ? 248 ALA A C     1 
ATOM   2741 O  O     . ALA B 2 248 ? 19.237  -37.463 -6.350  1.00 45.63 ? 248 ALA A O     1 
ATOM   2742 C  CB    . ALA B 2 248 ? 18.881  -36.982 -3.677  1.00 46.54 ? 248 ALA A CB    1 
ATOM   2743 N  N     . PRO B 2 249 ? 21.484  -37.296 -6.332  1.00 48.83 ? 249 PRO A N     1 
ATOM   2744 C  CA    . PRO B 2 249 ? 21.758  -37.737 -7.705  1.00 49.42 ? 249 PRO A CA    1 
ATOM   2745 C  C     . PRO B 2 249 ? 21.078  -39.033 -8.108  1.00 50.23 ? 249 PRO A C     1 
ATOM   2746 O  O     . PRO B 2 249 ? 21.579  -40.114 -7.815  1.00 52.19 ? 249 PRO A O     1 
ATOM   2747 C  CB    . PRO B 2 249 ? 23.277  -37.869 -7.723  1.00 50.12 ? 249 PRO A CB    1 
ATOM   2748 C  CG    . PRO B 2 249 ? 23.710  -36.795 -6.775  1.00 50.34 ? 249 PRO A CG    1 
ATOM   2749 C  CD    . PRO B 2 249 ? 22.740  -36.967 -5.633  1.00 49.32 ? 249 PRO A CD    1 
ATOM   2750 N  N     . SER B 2 250 ? 19.952  -38.928 -8.803  1.00 50.71 ? 250 SER A N     1 
ATOM   2751 C  CA    . SER B 2 250 ? 19.213  -40.111 -9.241  1.00 51.14 ? 250 SER A CA    1 
ATOM   2752 C  C     . SER B 2 250 ? 19.116  -40.199 -10.762 1.00 50.95 ? 250 SER A C     1 
ATOM   2753 O  O     . SER B 2 250 ? 19.210  -39.189 -11.457 1.00 51.03 ? 250 SER A O     1 
ATOM   2754 C  CB    . SER B 2 250 ? 17.805  -40.091 -8.649  1.00 52.48 ? 250 SER A CB    1 
ATOM   2755 O  OG    . SER B 2 250 ? 17.048  -41.204 -9.090  1.00 56.72 ? 250 SER A OG    1 
ATOM   2756 N  N     . LEU B 2 251 ? 18.932  -41.411 -11.276 1.00 50.06 ? 251 LEU A N     1 
ATOM   2757 C  CA    . LEU B 2 251 ? 18.802  -41.608 -12.713 1.00 49.33 ? 251 LEU A CA    1 
ATOM   2758 C  C     . LEU B 2 251 ? 17.367  -41.301 -13.107 1.00 49.37 ? 251 LEU A C     1 
ATOM   2759 O  O     . LEU B 2 251 ? 17.044  -41.177 -14.286 1.00 48.24 ? 251 LEU A O     1 
ATOM   2760 C  CB    . LEU B 2 251 ? 19.142  -43.047 -13.102 1.00 49.11 ? 251 LEU A CB    1 
ATOM   2761 C  CG    . LEU B 2 251 ? 19.168  -43.317 -14.608 1.00 48.62 ? 251 LEU A CG    1 
ATOM   2762 C  CD1   . LEU B 2 251 ? 20.182  -42.404 -15.271 1.00 47.58 ? 251 LEU A CD1   1 
ATOM   2763 C  CD2   . LEU B 2 251 ? 19.516  -44.767 -14.871 1.00 47.56 ? 251 LEU A CD2   1 
ATOM   2764 N  N     . GLY B 2 252 ? 16.507  -41.180 -12.101 1.00 50.47 ? 252 GLY A N     1 
ATOM   2765 C  CA    . GLY B 2 252 ? 15.110  -40.873 -12.350 1.00 50.51 ? 252 GLY A CA    1 
ATOM   2766 C  C     . GLY B 2 252 ? 14.936  -39.478 -12.920 1.00 50.72 ? 252 GLY A C     1 
ATOM   2767 O  O     . GLY B 2 252 ? 13.875  -39.154 -13.456 1.00 51.81 ? 252 GLY A O     1 
ATOM   2768 N  N     . PHE B 2 253 ? 15.976  -38.652 -12.800 1.00 49.62 ? 253 PHE A N     1 
ATOM   2769 C  CA    . PHE B 2 253 ? 15.949  -37.287 -13.317 1.00 47.85 ? 253 PHE A CA    1 
ATOM   2770 C  C     . PHE B 2 253 ? 16.046  -37.245 -14.844 1.00 47.74 ? 253 PHE A C     1 
ATOM   2771 O  O     . PHE B 2 253 ? 15.822  -36.199 -15.448 1.00 49.08 ? 253 PHE A O     1 
ATOM   2772 C  CB    . PHE B 2 253 ? 17.092  -36.455 -12.722 1.00 47.92 ? 253 PHE A CB    1 
ATOM   2773 C  CG    . PHE B 2 253 ? 16.878  -36.055 -11.285 1.00 48.16 ? 253 PHE A CG    1 
ATOM   2774 C  CD1   . PHE B 2 253 ? 17.247  -36.903 -10.244 1.00 48.22 ? 253 PHE A CD1   1 
ATOM   2775 C  CD2   . PHE B 2 253 ? 16.312  -34.820 -10.972 1.00 47.13 ? 253 PHE A CD2   1 
ATOM   2776 C  CE1   . PHE B 2 253 ? 17.058  -36.525 -8.909  1.00 46.37 ? 253 PHE A CE1   1 
ATOM   2777 C  CE2   . PHE B 2 253 ? 16.117  -34.435 -9.642  1.00 46.59 ? 253 PHE A CE2   1 
ATOM   2778 C  CZ    . PHE B 2 253 ? 16.494  -35.290 -8.610  1.00 46.19 ? 253 PHE A CZ    1 
ATOM   2779 N  N     . PHE B 2 254 ? 16.395  -38.371 -15.463 1.00 46.70 ? 254 PHE A N     1 
ATOM   2780 C  CA    . PHE B 2 254 ? 16.499  -38.447 -16.919 1.00 45.82 ? 254 PHE A CA    1 
ATOM   2781 C  C     . PHE B 2 254 ? 15.401  -39.328 -17.504 1.00 47.91 ? 254 PHE A C     1 
ATOM   2782 O  O     . PHE B 2 254 ? 15.307  -39.483 -18.718 1.00 46.90 ? 254 PHE A O     1 
ATOM   2783 C  CB    . PHE B 2 254 ? 17.858  -39.004 -17.357 1.00 41.00 ? 254 PHE A CB    1 
ATOM   2784 C  CG    . PHE B 2 254 ? 19.017  -38.160 -16.952 1.00 39.00 ? 254 PHE A CG    1 
ATOM   2785 C  CD1   . PHE B 2 254 ? 19.504  -38.204 -15.646 1.00 37.70 ? 254 PHE A CD1   1 
ATOM   2786 C  CD2   . PHE B 2 254 ? 19.604  -37.287 -17.864 1.00 38.27 ? 254 PHE A CD2   1 
ATOM   2787 C  CE1   . PHE B 2 254 ? 20.561  -37.394 -15.255 1.00 35.12 ? 254 PHE A CE1   1 
ATOM   2788 C  CE2   . PHE B 2 254 ? 20.662  -36.471 -17.487 1.00 36.37 ? 254 PHE A CE2   1 
ATOM   2789 C  CZ    . PHE B 2 254 ? 21.140  -36.523 -16.177 1.00 37.60 ? 254 PHE A CZ    1 
ATOM   2790 N  N     . LYS B 2 255 ? 14.590  -39.927 -16.640 1.00 51.20 ? 255 LYS A N     1 
ATOM   2791 C  CA    . LYS B 2 255 ? 13.499  -40.770 -17.105 1.00 55.01 ? 255 LYS A CA    1 
ATOM   2792 C  C     . LYS B 2 255 ? 12.248  -39.917 -17.128 1.00 57.54 ? 255 LYS A C     1 
ATOM   2793 O  O     . LYS B 2 255 ? 11.982  -39.171 -16.189 1.00 58.71 ? 255 LYS A O     1 
ATOM   2794 C  CB    . LYS B 2 255 ? 13.252  -41.947 -16.161 1.00 56.13 ? 255 LYS A CB    1 
ATOM   2795 C  CG    . LYS B 2 255 ? 14.271  -43.074 -16.190 1.00 59.62 ? 255 LYS A CG    1 
ATOM   2796 C  CD    . LYS B 2 255 ? 13.837  -44.131 -15.174 1.00 62.64 ? 255 LYS A CD    1 
ATOM   2797 C  CE    . LYS B 2 255 ? 14.870  -45.224 -14.942 1.00 64.31 ? 255 LYS A CE    1 
ATOM   2798 N  NZ    . LYS B 2 255 ? 14.436  -46.122 -13.813 1.00 64.80 ? 255 LYS A NZ    1 
ATOM   2799 N  N     . PRO B 2 256 ? 11.472  -39.997 -18.210 1.00 59.87 ? 256 PRO A N     1 
ATOM   2800 C  CA    . PRO B 2 256 ? 10.246  -39.202 -18.281 1.00 63.08 ? 256 PRO A CA    1 
ATOM   2801 C  C     . PRO B 2 256 ? 9.306   -39.644 -17.165 1.00 65.69 ? 256 PRO A C     1 
ATOM   2802 O  O     . PRO B 2 256 ? 9.172   -40.836 -16.889 1.00 66.25 ? 256 PRO A O     1 
ATOM   2803 C  CB    . PRO B 2 256 ? 9.708   -39.533 -19.664 1.00 63.62 ? 256 PRO A CB    1 
ATOM   2804 C  CG    . PRO B 2 256 ? 10.977  -39.768 -20.455 1.00 64.05 ? 256 PRO A CG    1 
ATOM   2805 C  CD    . PRO B 2 256 ? 11.780  -40.617 -19.509 1.00 60.98 ? 256 PRO A CD    1 
ATOM   2806 N  N     . LYS B 2 257 ? 8.659   -38.680 -16.524 1.00 68.81 ? 257 LYS A N     1 
ATOM   2807 C  CA    . LYS B 2 257 ? 7.750   -38.965 -15.422 1.00 71.14 ? 257 LYS A CA    1 
ATOM   2808 C  C     . LYS B 2 257 ? 6.551   -39.795 -15.864 1.00 72.54 ? 257 LYS A C     1 
ATOM   2809 O  O     . LYS B 2 257 ? 6.551   -40.372 -16.953 1.00 73.48 ? 257 LYS A O     1 
ATOM   2810 C  CB    . LYS B 2 257 ? 7.282   -37.644 -14.802 1.00 73.46 ? 257 LYS A CB    1 
ATOM   2811 C  CG    . LYS B 2 257 ? 8.419   -36.639 -14.614 1.00 74.51 ? 257 LYS A CG    1 
ATOM   2812 C  CD    . LYS B 2 257 ? 9.604   -37.285 -13.896 1.00 75.47 ? 257 LYS A CD    1 
ATOM   2813 C  CE    . LYS B 2 257 ? 10.876  -36.469 -14.057 1.00 75.49 ? 257 LYS A CE    1 
ATOM   2814 N  NZ    . LYS B 2 257 ? 12.052  -37.182 -13.490 1.00 74.50 ? 257 LYS A NZ    1 
ATOM   2815 N  N     . ILE B 2 262 ? -4.775  -41.889 -13.491 1.00 89.39 ? 262 ILE A N     1 
ATOM   2816 C  CA    . ILE B 2 262 ? -5.381  -41.839 -12.164 1.00 89.19 ? 262 ILE A CA    1 
ATOM   2817 C  C     . ILE B 2 262 ? -6.889  -42.079 -12.246 1.00 88.23 ? 262 ILE A C     1 
ATOM   2818 O  O     . ILE B 2 262 ? -7.526  -41.777 -13.258 1.00 87.12 ? 262 ILE A O     1 
ATOM   2819 C  CB    . ILE B 2 262 ? -5.135  -40.463 -11.479 1.00 89.62 ? 262 ILE A CB    1 
ATOM   2820 C  CG1   . ILE B 2 262 ? -5.640  -40.498 -10.027 1.00 89.45 ? 262 ILE A CG1   1 
ATOM   2821 C  CG2   . ILE B 2 262 ? -5.831  -39.355 -12.274 1.00 89.81 ? 262 ILE A CG2   1 
ATOM   2822 C  CD1   . ILE B 2 262 ? -5.493  -39.185 -9.269  1.00 87.96 ? 262 ILE A CD1   1 
ATOM   2823 N  N     . GLU B 2 263 ? -7.449  -42.628 -11.173 1.00 87.13 ? 263 GLU A N     1 
ATOM   2824 C  CA    . GLU B 2 263 ? -8.876  -42.903 -11.106 1.00 86.61 ? 263 GLU A CA    1 
ATOM   2825 C  C     . GLU B 2 263 ? -9.693  -41.618 -11.144 1.00 84.59 ? 263 GLU A C     1 
ATOM   2826 O  O     . GLU B 2 263 ? -9.450  -40.695 -10.365 1.00 85.60 ? 263 GLU A O     1 
ATOM   2827 C  CB    . GLU B 2 263 ? -9.210  -43.671 -9.820  1.00 88.64 ? 263 GLU A CB    1 
ATOM   2828 C  CG    . GLU B 2 263 ? -9.224  -45.186 -9.973  1.00 91.31 ? 263 GLU A CG    1 
ATOM   2829 C  CD    . GLU B 2 263 ? -10.249 -45.652 -10.997 1.00 92.69 ? 263 GLU A CD    1 
ATOM   2830 O  OE1   . GLU B 2 263 ? -11.450 -45.335 -10.826 1.00 92.38 ? 263 GLU A OE1   1 
ATOM   2831 O  OE2   . GLU B 2 263 ? -9.850  -46.332 -11.971 1.00 92.94 ? 263 GLU A OE2   1 
ATOM   2832 N  N     . PRO B 2 264 ? -10.673 -41.537 -12.058 1.00 82.02 ? 264 PRO A N     1 
ATOM   2833 C  CA    . PRO B 2 264 ? -11.507 -40.337 -12.152 1.00 79.58 ? 264 PRO A CA    1 
ATOM   2834 C  C     . PRO B 2 264 ? -12.427 -40.254 -10.936 1.00 77.16 ? 264 PRO A C     1 
ATOM   2835 O  O     . PRO B 2 264 ? -12.959 -39.192 -10.617 1.00 77.57 ? 264 PRO A O     1 
ATOM   2836 C  CB    . PRO B 2 264 ? -12.271 -40.553 -13.452 1.00 79.81 ? 264 PRO A CB    1 
ATOM   2837 C  CG    . PRO B 2 264 ? -12.442 -42.037 -13.476 1.00 81.47 ? 264 PRO A CG    1 
ATOM   2838 C  CD    . PRO B 2 264 ? -11.072 -42.532 -13.068 1.00 81.69 ? 264 PRO A CD    1 
ATOM   2839 N  N     . GLU B 2 265 ? -12.605 -41.390 -10.266 1.00 73.64 ? 265 GLU A N     1 
ATOM   2840 C  CA    . GLU B 2 265 ? -13.439 -41.464 -9.073  1.00 69.66 ? 265 GLU A CA    1 
ATOM   2841 C  C     . GLU B 2 265 ? -12.662 -40.960 -7.860  1.00 67.50 ? 265 GLU A C     1 
ATOM   2842 O  O     . GLU B 2 265 ? -13.251 -40.423 -6.924  1.00 67.74 ? 265 GLU A O     1 
ATOM   2843 C  CB    . GLU B 2 265 ? -13.895 -42.905 -8.832  1.00 69.51 ? 265 GLU A CB    1 
ATOM   2844 C  CG    . GLU B 2 265 ? -14.591 -43.137 -7.494  1.00 69.08 ? 265 GLU A CG    1 
ATOM   2845 C  CD    . GLU B 2 265 ? -15.904 -42.389 -7.373  1.00 69.36 ? 265 GLU A CD    1 
ATOM   2846 O  OE1   . GLU B 2 265 ? -16.790 -42.600 -8.224  1.00 70.43 ? 265 GLU A OE1   1 
ATOM   2847 O  OE2   . GLU B 2 265 ? -16.054 -41.593 -6.424  1.00 69.32 ? 265 GLU A OE2   1 
ATOM   2848 N  N     . ARG B 2 266 ? -11.344 -41.138 -7.871  1.00 64.78 ? 266 ARG A N     1 
ATOM   2849 C  CA    . ARG B 2 266 ? -10.516 -40.672 -6.761  1.00 62.80 ? 266 ARG A CA    1 
ATOM   2850 C  C     . ARG B 2 266 ? -10.488 -39.149 -6.807  1.00 61.51 ? 266 ARG A C     1 
ATOM   2851 O  O     . ARG B 2 266 ? -10.622 -38.473 -5.786  1.00 59.91 ? 266 ARG A O     1 
ATOM   2852 C  CB    . ARG B 2 266 ? -9.092  -41.211 -6.885  1.00 63.69 ? 266 ARG A CB    1 
ATOM   2853 C  CG    . ARG B 2 266 ? -8.197  -40.836 -5.713  1.00 65.07 ? 266 ARG A CG    1 
ATOM   2854 C  CD    . ARG B 2 266 ? -6.723  -41.069 -6.026  1.00 67.31 ? 266 ARG A CD    1 
ATOM   2855 N  NE    . ARG B 2 266 ? -5.864  -40.532 -4.971  1.00 68.73 ? 266 ARG A NE    1 
ATOM   2856 C  CZ    . ARG B 2 266 ? -4.566  -40.272 -5.111  1.00 69.03 ? 266 ARG A CZ    1 
ATOM   2857 N  NH1   . ARG B 2 266 ? -3.955  -40.499 -6.271  1.00 68.40 ? 266 ARG A NH1   1 
ATOM   2858 N  NH2   . ARG B 2 266 ? -3.878  -39.778 -4.088  1.00 68.67 ? 266 ARG A NH2   1 
ATOM   2859 N  N     . LEU B 2 267 ? -10.317 -38.620 -8.014  1.00 59.95 ? 267 LEU A N     1 
ATOM   2860 C  CA    . LEU B 2 267 ? -10.288 -37.183 -8.237  1.00 58.90 ? 267 LEU A CA    1 
ATOM   2861 C  C     . LEU B 2 267 ? -11.568 -36.515 -7.708  1.00 57.88 ? 267 LEU A C     1 
ATOM   2862 O  O     . LEU B 2 267 ? -11.532 -35.385 -7.227  1.00 57.01 ? 267 LEU A O     1 
ATOM   2863 C  CB    . LEU B 2 267 ? -10.134 -36.904 -9.732  1.00 59.37 ? 267 LEU A CB    1 
ATOM   2864 C  CG    . LEU B 2 267 ? -10.107 -35.436 -10.155 1.00 59.55 ? 267 LEU A CG    1 
ATOM   2865 C  CD1   . LEU B 2 267 ? -8.894  -34.759 -9.536  1.00 58.92 ? 267 LEU A CD1   1 
ATOM   2866 C  CD2   . LEU B 2 267 ? -10.069 -35.336 -11.672 1.00 59.27 ? 267 LEU A CD2   1 
ATOM   2867 N  N     . ARG B 2 268 ? -12.694 -37.218 -7.799  1.00 57.11 ? 268 ARG A N     1 
ATOM   2868 C  CA    . ARG B 2 268 ? -13.973 -36.691 -7.320  1.00 57.24 ? 268 ARG A CA    1 
ATOM   2869 C  C     . ARG B 2 268 ? -13.947 -36.543 -5.797  1.00 54.84 ? 268 ARG A C     1 
ATOM   2870 O  O     . ARG B 2 268 ? -14.392 -35.532 -5.256  1.00 54.05 ? 268 ARG A O     1 
ATOM   2871 C  CB    . ARG B 2 268 ? -15.122 -37.623 -7.734  1.00 60.19 ? 268 ARG A CB    1 
ATOM   2872 C  CG    . ARG B 2 268 ? -16.512 -37.069 -7.445  1.00 63.99 ? 268 ARG A CG    1 
ATOM   2873 C  CD    . ARG B 2 268 ? -17.607 -38.097 -7.741  1.00 68.04 ? 268 ARG A CD    1 
ATOM   2874 N  NE    . ARG B 2 268 ? -17.554 -39.261 -6.851  1.00 69.82 ? 268 ARG A NE    1 
ATOM   2875 C  CZ    . ARG B 2 268 ? -17.736 -39.215 -5.532  1.00 70.42 ? 268 ARG A CZ    1 
ATOM   2876 N  NH1   . ARG B 2 268 ? -17.986 -38.060 -4.929  1.00 70.71 ? 268 ARG A NH1   1 
ATOM   2877 N  NH2   . ARG B 2 268 ? -17.670 -40.325 -4.812  1.00 71.47 ? 268 ARG A NH2   1 
ATOM   2878 N  N     . LYS B 2 269 ? -13.422 -37.561 -5.120  1.00 52.76 ? 269 LYS A N     1 
ATOM   2879 C  CA    . LYS B 2 269 ? -13.314 -37.565 -3.666  1.00 50.73 ? 269 LYS A CA    1 
ATOM   2880 C  C     . LYS B 2 269 ? -12.420 -36.426 -3.191  1.00 49.00 ? 269 LYS A C     1 
ATOM   2881 O  O     . LYS B 2 269 ? -12.716 -35.759 -2.203  1.00 47.27 ? 269 LYS A O     1 
ATOM   2882 C  CB    . LYS B 2 269 ? -12.719 -38.888 -3.182  1.00 51.78 ? 269 LYS A CB    1 
ATOM   2883 C  CG    . LYS B 2 269 ? -13.660 -40.079 -3.191  1.00 54.50 ? 269 LYS A CG    1 
ATOM   2884 C  CD    . LYS B 2 269 ? -12.905 -41.344 -2.767  1.00 56.38 ? 269 LYS A CD    1 
ATOM   2885 C  CE    . LYS B 2 269 ? -13.842 -42.508 -2.463  1.00 59.23 ? 269 LYS A CE    1 
ATOM   2886 N  NZ    . LYS B 2 269 ? -14.708 -42.871 -3.623  1.00 60.69 ? 269 LYS A NZ    1 
ATOM   2887 N  N     . ILE B 2 270 ? -11.313 -36.224 -3.897  1.00 47.66 ? 270 ILE A N     1 
ATOM   2888 C  CA    . ILE B 2 270 ? -10.363 -35.171 -3.565  1.00 46.32 ? 270 ILE A CA    1 
ATOM   2889 C  C     . ILE B 2 270 ? -11.012 -33.790 -3.633  1.00 46.58 ? 270 ILE A C     1 
ATOM   2890 O  O     . ILE B 2 270 ? -10.871 -32.995 -2.708  1.00 45.53 ? 270 ILE A O     1 
ATOM   2891 C  CB    . ILE B 2 270 ? -9.155  -35.214 -4.523  1.00 46.32 ? 270 ILE A CB    1 
ATOM   2892 C  CG1   . ILE B 2 270 ? -8.316  -36.460 -4.223  1.00 45.76 ? 270 ILE A CG1   1 
ATOM   2893 C  CG2   . ILE B 2 270 ? -8.333  -33.935 -4.404  1.00 44.40 ? 270 ILE A CG2   1 
ATOM   2894 C  CD1   . ILE B 2 270 ? -7.218  -36.724 -5.231  1.00 46.61 ? 270 ILE A CD1   1 
ATOM   2895 N  N     . VAL B 2 271 ? -11.722 -33.515 -4.727  1.00 46.42 ? 271 VAL A N     1 
ATOM   2896 C  CA    . VAL B 2 271 ? -12.393 -32.232 -4.916  1.00 46.46 ? 271 VAL A CA    1 
ATOM   2897 C  C     . VAL B 2 271 ? -13.464 -32.024 -3.851  1.00 48.25 ? 271 VAL A C     1 
ATOM   2898 O  O     . VAL B 2 271 ? -13.695 -30.905 -3.386  1.00 49.22 ? 271 VAL A O     1 
ATOM   2899 C  CB    . VAL B 2 271 ? -13.045 -32.148 -6.317  1.00 46.33 ? 271 VAL A CB    1 
ATOM   2900 C  CG1   . VAL B 2 271 ? -13.858 -30.870 -6.442  1.00 46.08 ? 271 VAL A CG1   1 
ATOM   2901 C  CG2   . VAL B 2 271 ? -11.972 -32.177 -7.395  1.00 44.97 ? 271 VAL A CG2   1 
ATOM   2902 N  N     . GLU B 2 272 ? -14.120 -33.112 -3.476  1.00 49.46 ? 272 GLU A N     1 
ATOM   2903 C  CA    . GLU B 2 272 ? -15.163 -33.090 -2.459  1.00 50.61 ? 272 GLU A CA    1 
ATOM   2904 C  C     . GLU B 2 272 ? -14.543 -32.707 -1.109  1.00 49.74 ? 272 GLU A C     1 
ATOM   2905 O  O     . GLU B 2 272 ? -15.120 -31.937 -0.340  1.00 47.36 ? 272 GLU A O     1 
ATOM   2906 C  CB    . GLU B 2 272 ? -15.797 -34.478 -2.399  1.00 54.73 ? 272 GLU A CB    1 
ATOM   2907 C  CG    . GLU B 2 272 ? -16.792 -34.733 -1.292  1.00 61.53 ? 272 GLU A CG    1 
ATOM   2908 C  CD    . GLU B 2 272 ? -17.133 -36.220 -1.188  1.00 67.42 ? 272 GLU A CD    1 
ATOM   2909 O  OE1   . GLU B 2 272 ? -17.594 -36.798 -2.205  1.00 68.98 ? 272 GLU A OE1   1 
ATOM   2910 O  OE2   . GLU B 2 272 ? -16.931 -36.811 -0.096  1.00 68.77 ? 272 GLU A OE2   1 
ATOM   2911 N  N     . GLU B 2 273 ? -13.352 -33.240 -0.846  1.00 49.85 ? 273 GLU A N     1 
ATOM   2912 C  CA    . GLU B 2 273 ? -12.619 -32.977 0.393   1.00 50.59 ? 273 GLU A CA    1 
ATOM   2913 C  C     . GLU B 2 273 ? -12.045 -31.559 0.447   1.00 48.81 ? 273 GLU A C     1 
ATOM   2914 O  O     . GLU B 2 273 ? -11.914 -30.975 1.524   1.00 48.48 ? 273 GLU A O     1 
ATOM   2915 C  CB    . GLU B 2 273 ? -11.469 -33.979 0.545   1.00 53.93 ? 273 GLU A CB    1 
ATOM   2916 C  CG    . GLU B 2 273 ? -11.894 -35.449 0.535   1.00 60.14 ? 273 GLU A CG    1 
ATOM   2917 C  CD    . GLU B 2 273 ? -10.707 -36.409 0.449   1.00 62.42 ? 273 GLU A CD    1 
ATOM   2918 O  OE1   . GLU B 2 273 ? -9.835  -36.371 1.347   1.00 63.22 ? 273 GLU A OE1   1 
ATOM   2919 O  OE2   . GLU B 2 273 ? -10.648 -37.201 -0.519  1.00 64.44 ? 273 GLU A OE2   1 
ATOM   2920 N  N     . ARG B 2 274 ? -11.687 -31.013 -0.712  1.00 46.26 ? 274 ARG A N     1 
ATOM   2921 C  CA    . ARG B 2 274 ? -11.127 -29.667 -0.775  1.00 44.61 ? 274 ARG A CA    1 
ATOM   2922 C  C     . ARG B 2 274 ? -12.215 -28.611 -0.566  1.00 44.51 ? 274 ARG A C     1 
ATOM   2923 O  O     . ARG B 2 274 ? -11.937 -27.503 -0.100  1.00 43.35 ? 274 ARG A O     1 
ATOM   2924 C  CB    . ARG B 2 274 ? -10.444 -29.432 -2.119  1.00 43.26 ? 274 ARG A CB    1 
ATOM   2925 C  CG    . ARG B 2 274 ? -9.392  -30.457 -2.493  1.00 41.08 ? 274 ARG A CG    1 
ATOM   2926 C  CD    . ARG B 2 274 ? -8.621  -30.002 -3.732  1.00 41.32 ? 274 ARG A CD    1 
ATOM   2927 N  NE    . ARG B 2 274 ? -7.347  -29.397 -3.359  1.00 41.73 ? 274 ARG A NE    1 
ATOM   2928 C  CZ    . ARG B 2 274 ? -6.718  -28.465 -4.059  1.00 39.10 ? 274 ARG A CZ    1 
ATOM   2929 N  NH1   . ARG B 2 274 ? -7.233  -28.008 -5.180  1.00 41.59 ? 274 ARG A NH1   1 
ATOM   2930 N  NH2   . ARG B 2 274 ? -5.570  -27.986 -3.630  1.00 40.75 ? 274 ARG A NH2   1 
ATOM   2931 N  N     . GLY B 2 275 ? -13.449 -28.970 -0.920  1.00 43.09 ? 275 GLY A N     1 
ATOM   2932 C  CA    . GLY B 2 275 ? -14.579 -28.075 -0.758  1.00 40.24 ? 275 GLY A CA    1 
ATOM   2933 C  C     . GLY B 2 275 ? -14.603 -26.904 -1.716  1.00 40.00 ? 275 GLY A C     1 
ATOM   2934 O  O     . GLY B 2 275 ? -15.322 -25.927 -1.503  1.00 39.56 ? 275 GLY A O     1 
ATOM   2935 N  N     . THR B 2 276 ? -13.840 -27.010 -2.793  1.00 39.58 ? 276 THR A N     1 
ATOM   2936 C  CA    . THR B 2 276 ? -13.754 -25.931 -3.768  1.00 38.88 ? 276 THR A CA    1 
ATOM   2937 C  C     . THR B 2 276 ? -14.745 -25.974 -4.921  1.00 38.35 ? 276 THR A C     1 
ATOM   2938 O  O     . THR B 2 276 ? -15.518 -26.920 -5.079  1.00 38.43 ? 276 THR A O     1 
ATOM   2939 C  CB    . THR B 2 276 ? -12.359 -25.882 -4.373  1.00 37.76 ? 276 THR A CB    1 
ATOM   2940 O  OG1   . THR B 2 276 ? -11.917 -27.224 -4.619  1.00 39.13 ? 276 THR A OG1   1 
ATOM   2941 C  CG2   . THR B 2 276 ? -11.395 -25.181 -3.439  1.00 36.67 ? 276 THR A CG2   1 
ATOM   2942 N  N     . ALA B 2 277 ? -14.711 -24.911 -5.715  1.00 36.81 ? 277 ALA A N     1 
ATOM   2943 C  CA    . ALA B 2 277 ? -15.546 -24.791 -6.896  1.00 35.39 ? 277 ALA A CA    1 
ATOM   2944 C  C     . ALA B 2 277 ? -14.618 -25.094 -8.079  1.00 34.56 ? 277 ALA A C     1 
ATOM   2945 O  O     . ALA B 2 277 ? -13.711 -24.312 -8.388  1.00 32.47 ? 277 ALA A O     1 
ATOM   2946 C  CB    . ALA B 2 277 ? -16.111 -23.370 -7.002  1.00 32.74 ? 277 ALA A CB    1 
ATOM   2947 N  N     . VAL B 2 278 ? -14.826 -26.245 -8.717  1.00 35.61 ? 278 VAL A N     1 
ATOM   2948 C  CA    . VAL B 2 278 ? -14.005 -26.648 -9.862  1.00 35.03 ? 278 VAL A CA    1 
ATOM   2949 C  C     . VAL B 2 278 ? -14.861 -26.732 -11.107 1.00 34.80 ? 278 VAL A C     1 
ATOM   2950 O  O     . VAL B 2 278 ? -15.800 -27.518 -11.170 1.00 36.08 ? 278 VAL A O     1 
ATOM   2951 C  CB    . VAL B 2 278 ? -13.350 -28.034 -9.658  1.00 34.50 ? 278 VAL A CB    1 
ATOM   2952 C  CG1   . VAL B 2 278 ? -12.369 -28.310 -10.792 1.00 32.17 ? 278 VAL A CG1   1 
ATOM   2953 C  CG2   . VAL B 2 278 ? -12.646 -28.095 -8.315  1.00 33.27 ? 278 VAL A CG2   1 
ATOM   2954 N  N     . PHE B 2 279 ? -14.539 -25.919 -12.101 1.00 35.02 ? 279 PHE A N     1 
ATOM   2955 C  CA    . PHE B 2 279 ? -15.300 -25.928 -13.338 1.00 34.53 ? 279 PHE A CA    1 
ATOM   2956 C  C     . PHE B 2 279 ? -14.410 -25.665 -14.540 1.00 34.51 ? 279 PHE A C     1 
ATOM   2957 O  O     . PHE B 2 279 ? -13.236 -25.303 -14.403 1.00 34.36 ? 279 PHE A O     1 
ATOM   2958 C  CB    . PHE B 2 279 ? -16.421 -24.887 -13.274 1.00 36.17 ? 279 PHE A CB    1 
ATOM   2959 C  CG    . PHE B 2 279 ? -15.939 -23.468 -13.110 1.00 36.66 ? 279 PHE A CG    1 
ATOM   2960 C  CD1   . PHE B 2 279 ? -15.574 -22.711 -14.214 1.00 38.46 ? 279 PHE A CD1   1 
ATOM   2961 C  CD2   . PHE B 2 279 ? -15.866 -22.888 -11.851 1.00 37.86 ? 279 PHE A CD2   1 
ATOM   2962 C  CE1   . PHE B 2 279 ? -15.146 -21.392 -14.071 1.00 38.68 ? 279 PHE A CE1   1 
ATOM   2963 C  CE2   . PHE B 2 279 ? -15.439 -21.571 -11.695 1.00 40.23 ? 279 PHE A CE2   1 
ATOM   2964 C  CZ    . PHE B 2 279 ? -15.078 -20.820 -12.812 1.00 39.33 ? 279 PHE A CZ    1 
ATOM   2965 N  N     . ALA B 2 280 ? -14.966 -25.853 -15.727 1.00 32.81 ? 280 ALA A N     1 
ATOM   2966 C  CA    . ALA B 2 280 ? -14.194 -25.624 -16.927 1.00 32.84 ? 280 ALA A CA    1 
ATOM   2967 C  C     . ALA B 2 280 ? -15.023 -24.922 -17.980 1.00 31.81 ? 280 ALA A C     1 
ATOM   2968 O  O     . ALA B 2 280 ? -16.246 -25.071 -18.026 1.00 30.56 ? 280 ALA A O     1 
ATOM   2969 C  CB    . ALA B 2 280 ? -13.664 -26.950 -17.476 1.00 31.31 ? 280 ALA A CB    1 
ATOM   2970 N  N     . VAL B 2 281 ? -14.343 -24.136 -18.805 1.00 30.70 ? 281 VAL A N     1 
ATOM   2971 C  CA    . VAL B 2 281 ? -14.987 -23.445 -19.903 1.00 31.25 ? 281 VAL A CA    1 
ATOM   2972 C  C     . VAL B 2 281 ? -14.536 -24.258 -21.115 1.00 32.12 ? 281 VAL A C     1 
ATOM   2973 O  O     . VAL B 2 281 ? -13.343 -24.346 -21.405 1.00 32.46 ? 281 VAL A O     1 
ATOM   2974 C  CB    . VAL B 2 281 ? -14.496 -21.998 -20.030 1.00 30.73 ? 281 VAL A CB    1 
ATOM   2975 C  CG1   . VAL B 2 281 ? -15.272 -21.282 -21.113 1.00 31.00 ? 281 VAL A CG1   1 
ATOM   2976 C  CG2   . VAL B 2 281 ? -14.655 -21.285 -18.713 1.00 31.15 ? 281 VAL A CG2   1 
ATOM   2977 N  N     . LYS B 2 282 ? -15.499 -24.885 -21.785 1.00 33.38 ? 282 LYS A N     1 
ATOM   2978 C  CA    . LYS B 2 282 ? -15.238 -25.716 -22.953 1.00 32.14 ? 282 LYS A CA    1 
ATOM   2979 C  C     . LYS B 2 282 ? -15.684 -25.048 -24.250 1.00 31.93 ? 282 LYS A C     1 
ATOM   2980 O  O     . LYS B 2 282 ? -16.776 -24.480 -24.331 1.00 31.91 ? 282 LYS A O     1 
ATOM   2981 C  CB    . LYS B 2 282 ? -15.957 -27.049 -22.788 1.00 33.39 ? 282 LYS A CB    1 
ATOM   2982 C  CG    . LYS B 2 282 ? -15.906 -27.952 -23.998 1.00 38.50 ? 282 LYS A CG    1 
ATOM   2983 C  CD    . LYS B 2 282 ? -16.460 -29.323 -23.646 1.00 43.69 ? 282 LYS A CD    1 
ATOM   2984 C  CE    . LYS B 2 282 ? -16.518 -30.249 -24.856 1.00 46.95 ? 282 LYS A CE    1 
ATOM   2985 N  NZ    . LYS B 2 282 ? -16.931 -31.629 -24.456 1.00 48.73 ? 282 LYS A NZ    1 
ATOM   2986 N  N     . PHE B 2 283 ? -14.826 -25.109 -25.259 1.00 31.37 ? 283 PHE A N     1 
ATOM   2987 C  CA    . PHE B 2 283 ? -15.136 -24.538 -26.560 1.00 32.74 ? 283 PHE A CA    1 
ATOM   2988 C  C     . PHE B 2 283 ? -14.361 -25.276 -27.635 1.00 33.52 ? 283 PHE A C     1 
ATOM   2989 O  O     . PHE B 2 283 ? -13.402 -25.981 -27.339 1.00 33.47 ? 283 PHE A O     1 
ATOM   2990 C  CB    . PHE B 2 283 ? -14.810 -23.042 -26.586 1.00 33.49 ? 283 PHE A CB    1 
ATOM   2991 C  CG    . PHE B 2 283 ? -13.390 -22.714 -26.218 1.00 35.61 ? 283 PHE A CG    1 
ATOM   2992 C  CD1   . PHE B 2 283 ? -12.450 -22.428 -27.204 1.00 34.37 ? 283 PHE A CD1   1 
ATOM   2993 C  CD2   . PHE B 2 283 ? -12.996 -22.671 -24.884 1.00 35.33 ? 283 PHE A CD2   1 
ATOM   2994 C  CE1   . PHE B 2 283 ? -11.141 -22.101 -26.867 1.00 35.41 ? 283 PHE A CE1   1 
ATOM   2995 C  CE2   . PHE B 2 283 ? -11.686 -22.344 -24.536 1.00 36.14 ? 283 PHE A CE2   1 
ATOM   2996 C  CZ    . PHE B 2 283 ? -10.757 -22.058 -25.530 1.00 35.21 ? 283 PHE A CZ    1 
ATOM   2997 N  N     . ARG B 2 284 ? -14.786 -25.138 -28.884 1.00 36.38 ? 284 ARG A N     1 
ATOM   2998 C  CA    . ARG B 2 284 ? -14.095 -25.809 -29.975 1.00 37.80 ? 284 ARG A CA    1 
ATOM   2999 C  C     . ARG B 2 284 ? -12.729 -25.185 -30.232 1.00 38.29 ? 284 ARG A C     1 
ATOM   3000 O  O     . ARG B 2 284 ? -12.556 -23.962 -30.207 1.00 36.43 ? 284 ARG A O     1 
ATOM   3001 C  CB    . ARG B 2 284 ? -14.944 -25.782 -31.247 1.00 40.87 ? 284 ARG A CB    1 
ATOM   3002 C  CG    . ARG B 2 284 ? -16.114 -26.747 -31.194 1.00 48.43 ? 284 ARG A CG    1 
ATOM   3003 C  CD    . ARG B 2 284 ? -16.887 -26.782 -32.503 1.00 54.54 ? 284 ARG A CD    1 
ATOM   3004 N  NE    . ARG B 2 284 ? -17.874 -27.862 -32.519 1.00 60.28 ? 284 ARG A NE    1 
ATOM   3005 C  CZ    . ARG B 2 284 ? -17.567 -29.159 -32.525 1.00 63.17 ? 284 ARG A CZ    1 
ATOM   3006 N  NH1   . ARG B 2 284 ? -16.295 -29.547 -32.518 1.00 63.83 ? 284 ARG A NH1   1 
ATOM   3007 N  NH2   . ARG B 2 284 ? -18.534 -30.074 -32.538 1.00 64.09 ? 284 ARG A NH2   1 
ATOM   3008 N  N     . LYS B 2 285 ? -11.753 -26.047 -30.467 1.00 38.08 ? 285 LYS A N     1 
ATOM   3009 C  CA    . LYS B 2 285 ? -10.397 -25.608 -30.720 1.00 38.84 ? 285 LYS A CA    1 
ATOM   3010 C  C     . LYS B 2 285 ? -10.227 -24.975 -32.093 1.00 37.71 ? 285 LYS A C     1 
ATOM   3011 O  O     . LYS B 2 285 ? -10.610 -25.554 -33.102 1.00 35.55 ? 285 LYS A O     1 
ATOM   3012 C  CB    . LYS B 2 285 ? -9.455  -26.799 -30.572 1.00 41.18 ? 285 LYS A CB    1 
ATOM   3013 C  CG    . LYS B 2 285 ? -8.076  -26.626 -31.167 1.00 42.93 ? 285 LYS A CG    1 
ATOM   3014 C  CD    . LYS B 2 285 ? -7.262  -27.847 -30.821 1.00 46.04 ? 285 LYS A CD    1 
ATOM   3015 C  CE    . LYS B 2 285 ? -6.126  -28.087 -31.791 1.00 48.84 ? 285 LYS A CE    1 
ATOM   3016 N  NZ    . LYS B 2 285 ? -5.425  -29.363 -31.431 1.00 52.42 ? 285 LYS A NZ    1 
ATOM   3017 N  N     . PRO B 2 286 ? -9.668  -23.757 -32.137 1.00 38.37 ? 286 PRO A N     1 
ATOM   3018 C  CA    . PRO B 2 286 ? -9.447  -23.061 -33.407 1.00 38.99 ? 286 PRO A CA    1 
ATOM   3019 C  C     . PRO B 2 286 ? -8.454  -23.885 -34.220 1.00 41.22 ? 286 PRO A C     1 
ATOM   3020 O  O     . PRO B 2 286 ? -7.521  -24.472 -33.657 1.00 41.32 ? 286 PRO A O     1 
ATOM   3021 C  CB    . PRO B 2 286 ? -8.839  -21.730 -32.974 1.00 37.05 ? 286 PRO A CB    1 
ATOM   3022 C  CG    . PRO B 2 286 ? -9.408  -21.519 -31.612 1.00 36.99 ? 286 PRO A CG    1 
ATOM   3023 C  CD    . PRO B 2 286 ? -9.338  -22.883 -30.996 1.00 38.17 ? 286 PRO A CD    1 
ATOM   3024 N  N     . ASP B 2 287 ? -8.653  -23.946 -35.533 1.00 41.75 ? 287 ASP A N     1 
ATOM   3025 C  CA    . ASP B 2 287 ? -7.735  -24.694 -36.381 1.00 41.23 ? 287 ASP A CA    1 
ATOM   3026 C  C     . ASP B 2 287 ? -6.544  -23.798 -36.709 1.00 39.08 ? 287 ASP A C     1 
ATOM   3027 O  O     . ASP B 2 287 ? -6.486  -23.181 -37.773 1.00 37.65 ? 287 ASP A O     1 
ATOM   3028 C  CB    . ASP B 2 287 ? -8.435  -25.146 -37.663 1.00 43.79 ? 287 ASP A CB    1 
ATOM   3029 C  CG    . ASP B 2 287 ? -7.486  -25.824 -38.629 1.00 45.69 ? 287 ASP A CG    1 
ATOM   3030 O  OD1   . ASP B 2 287 ? -6.593  -26.561 -38.161 1.00 46.12 ? 287 ASP A OD1   1 
ATOM   3031 O  OD2   . ASP B 2 287 ? -7.635  -25.625 -39.852 1.00 48.37 ? 287 ASP A OD2   1 
ATOM   3032 N  N     . ILE B 2 288 ? -5.608  -23.722 -35.766 1.00 36.02 ? 288 ILE A N     1 
ATOM   3033 C  CA    . ILE B 2 288 ? -4.424  -22.898 -35.916 1.00 33.42 ? 288 ILE A CA    1 
ATOM   3034 C  C     . ILE B 2 288 ? -3.216  -23.524 -35.235 1.00 34.02 ? 288 ILE A C     1 
ATOM   3035 O  O     . ILE B 2 288 ? -3.349  -24.428 -34.404 1.00 33.56 ? 288 ILE A O     1 
ATOM   3036 C  CB    . ILE B 2 288 ? -4.638  -21.486 -35.330 1.00 32.33 ? 288 ILE A CB    1 
ATOM   3037 C  CG1   . ILE B 2 288 ? -4.947  -21.574 -33.836 1.00 31.24 ? 288 ILE A CG1   1 
ATOM   3038 C  CG2   . ILE B 2 288 ? -5.778  -20.790 -36.054 1.00 31.30 ? 288 ILE A CG2   1 
ATOM   3039 C  CD1   . ILE B 2 288 ? -5.058  -20.230 -33.157 1.00 29.39 ? 288 ILE A CD1   1 
ATOM   3040 N  N     . VAL B 2 289 ? -2.040  -23.026 -35.610 1.00 34.32 ? 289 VAL A N     1 
ATOM   3041 C  CA    . VAL B 2 289 ? -0.752  -23.484 -35.096 1.00 35.27 ? 289 VAL A CA    1 
ATOM   3042 C  C     . VAL B 2 289 ? -0.641  -23.385 -33.569 1.00 34.32 ? 289 VAL A C     1 
ATOM   3043 O  O     . VAL B 2 289 ? -1.183  -22.463 -32.958 1.00 32.83 ? 289 VAL A O     1 
ATOM   3044 C  CB    . VAL B 2 289 ? 0.399   -22.668 -35.787 1.00 36.17 ? 289 VAL A CB    1 
ATOM   3045 C  CG1   . VAL B 2 289 ? 1.721   -22.892 -35.095 1.00 37.69 ? 289 VAL A CG1   1 
ATOM   3046 C  CG2   . VAL B 2 289 ? 0.521   -23.106 -37.245 1.00 38.13 ? 289 VAL A CG2   1 
ATOM   3047 N  N     . ASP B 2 290 ? 0.053   -24.349 -32.961 1.00 35.84 ? 290 ASP A N     1 
ATOM   3048 C  CA    . ASP B 2 290 ? 0.253   -24.378 -31.504 1.00 37.69 ? 290 ASP A CA    1 
ATOM   3049 C  C     . ASP B 2 290 ? 0.838   -23.060 -31.021 1.00 37.09 ? 290 ASP A C     1 
ATOM   3050 O  O     . ASP B 2 290 ? 0.512   -22.569 -29.938 1.00 36.77 ? 290 ASP A O     1 
ATOM   3051 C  CB    . ASP B 2 290 ? 1.236   -25.482 -31.100 1.00 39.73 ? 290 ASP A CB    1 
ATOM   3052 C  CG    . ASP B 2 290 ? 0.583   -26.849 -30.975 1.00 42.79 ? 290 ASP A CG    1 
ATOM   3053 O  OD1   . ASP B 2 290 ? -0.660  -26.944 -31.068 1.00 44.66 ? 290 ASP A OD1   1 
ATOM   3054 O  OD2   . ASP B 2 290 ? 1.329   -27.833 -30.769 1.00 43.85 ? 290 ASP A OD2   1 
ATOM   3055 N  N     . ASP B 2 291 ? 1.705   -22.494 -31.846 1.00 34.95 ? 291 ASP A N     1 
ATOM   3056 C  CA    . ASP B 2 291 ? 2.377   -21.259 -31.505 1.00 35.65 ? 291 ASP A CA    1 
ATOM   3057 C  C     . ASP B 2 291 ? 1.453   -20.053 -31.458 1.00 35.29 ? 291 ASP A C     1 
ATOM   3058 O  O     . ASP B 2 291 ? 1.813   -19.023 -30.891 1.00 35.22 ? 291 ASP A O     1 
ATOM   3059 C  CB    . ASP B 2 291 ? 3.550   -21.064 -32.465 1.00 35.04 ? 291 ASP A CB    1 
ATOM   3060 C  CG    . ASP B 2 291 ? 4.410   -22.323 -32.566 1.00 35.84 ? 291 ASP A CG    1 
ATOM   3061 O  OD1   . ASP B 2 291 ? 5.120   -22.662 -31.585 1.00 32.58 ? 291 ASP A OD1   1 
ATOM   3062 O  OD2   . ASP B 2 291 ? 4.345   -22.994 -33.620 1.00 35.78 ? 291 ASP A OD2   1 
ATOM   3063 N  N     . ASN B 2 292 ? 0.261   -20.182 -32.035 1.00 34.54 ? 292 ASN A N     1 
ATOM   3064 C  CA    . ASN B 2 292 ? -0.718  -19.096 -31.986 1.00 34.06 ? 292 ASN A CA    1 
ATOM   3065 C  C     . ASN B 2 292 ? -1.783  -19.431 -30.937 1.00 34.47 ? 292 ASN A C     1 
ATOM   3066 O  O     . ASN B 2 292 ? -2.244  -18.558 -30.202 1.00 32.66 ? 292 ASN A O     1 
ATOM   3067 C  CB    . ASN B 2 292 ? -1.406  -18.895 -33.335 1.00 33.59 ? 292 ASN A CB    1 
ATOM   3068 C  CG    . ASN B 2 292 ? -0.549  -18.142 -34.328 1.00 34.52 ? 292 ASN A CG    1 
ATOM   3069 O  OD1   . ASN B 2 292 ? 0.241   -17.267 -33.960 1.00 37.54 ? 292 ASN A OD1   1 
ATOM   3070 N  ND2   . ASN B 2 292 ? -0.718  -18.461 -35.603 1.00 32.45 ? 292 ASN A ND2   1 
ATOM   3071 N  N     . LEU B 2 293 ? -2.151  -20.710 -30.865 1.00 33.67 ? 293 LEU A N     1 
ATOM   3072 C  CA    . LEU B 2 293 ? -3.166  -21.168 -29.931 1.00 32.51 ? 293 LEU A CA    1 
ATOM   3073 C  C     . LEU B 2 293 ? -2.843  -20.930 -28.459 1.00 33.39 ? 293 LEU A C     1 
ATOM   3074 O  O     . LEU B 2 293 ? -3.634  -20.319 -27.740 1.00 33.16 ? 293 LEU A O     1 
ATOM   3075 C  CB    . LEU B 2 293 ? -3.435  -22.663 -30.122 1.00 32.09 ? 293 LEU A CB    1 
ATOM   3076 C  CG    . LEU B 2 293 ? -4.478  -23.203 -29.129 1.00 32.82 ? 293 LEU A CG    1 
ATOM   3077 C  CD1   . LEU B 2 293 ? -5.839  -22.623 -29.465 1.00 32.28 ? 293 LEU A CD1   1 
ATOM   3078 C  CD2   . LEU B 2 293 ? -4.537  -24.708 -29.169 1.00 33.14 ? 293 LEU A CD2   1 
ATOM   3079 N  N     . TYR B 2 294 ? -1.680  -21.408 -28.018 1.00 32.68 ? 294 TYR A N     1 
ATOM   3080 C  CA    . TYR B 2 294 ? -1.289  -21.294 -26.622 1.00 31.66 ? 294 TYR A CA    1 
ATOM   3081 C  C     . TYR B 2 294 ? -1.193  -19.906 -26.000 1.00 31.55 ? 294 TYR A C     1 
ATOM   3082 O  O     . TYR B 2 294 ? -1.624  -19.704 -24.860 1.00 31.08 ? 294 TYR A O     1 
ATOM   3083 C  CB    . TYR B 2 294 ? -0.010  -22.084 -26.383 1.00 32.87 ? 294 TYR A CB    1 
ATOM   3084 C  CG    . TYR B 2 294 ? -0.284  -23.564 -26.349 1.00 35.56 ? 294 TYR A CG    1 
ATOM   3085 C  CD1   . TYR B 2 294 ? -0.367  -24.307 -27.525 1.00 36.44 ? 294 TYR A CD1   1 
ATOM   3086 C  CD2   . TYR B 2 294 ? -0.533  -24.214 -25.142 1.00 36.51 ? 294 TYR A CD2   1 
ATOM   3087 C  CE1   . TYR B 2 294 ? -0.694  -25.660 -27.501 1.00 37.63 ? 294 TYR A CE1   1 
ATOM   3088 C  CE2   . TYR B 2 294 ? -0.861  -25.571 -25.108 1.00 38.10 ? 294 TYR A CE2   1 
ATOM   3089 C  CZ    . TYR B 2 294 ? -0.939  -26.283 -26.292 1.00 38.03 ? 294 TYR A CZ    1 
ATOM   3090 O  OH    . TYR B 2 294 ? -1.262  -27.618 -26.268 1.00 40.35 ? 294 TYR A OH    1 
ATOM   3091 N  N     . PRO B 2 295 ? -0.605  -18.938 -26.710 1.00 31.37 ? 295 PRO A N     1 
ATOM   3092 C  CA    . PRO B 2 295 ? -0.558  -17.622 -26.061 1.00 32.27 ? 295 PRO A CA    1 
ATOM   3093 C  C     . PRO B 2 295 ? -1.992  -17.093 -25.824 1.00 32.04 ? 295 PRO A C     1 
ATOM   3094 O  O     . PRO B 2 295 ? -2.243  -16.284 -24.925 1.00 30.94 ? 295 PRO A O     1 
ATOM   3095 C  CB    . PRO B 2 295 ? 0.232   -16.781 -27.065 1.00 32.87 ? 295 PRO A CB    1 
ATOM   3096 C  CG    . PRO B 2 295 ? 1.200   -17.809 -27.653 1.00 30.00 ? 295 PRO A CG    1 
ATOM   3097 C  CD    . PRO B 2 295 ? 0.296   -18.996 -27.879 1.00 31.20 ? 295 PRO A CD    1 
ATOM   3098 N  N     . GLN B 2 296 ? -2.930  -17.579 -26.628 1.00 31.19 ? 296 GLN A N     1 
ATOM   3099 C  CA    . GLN B 2 296 ? -4.319  -17.165 -26.516 1.00 31.86 ? 296 GLN A CA    1 
ATOM   3100 C  C     . GLN B 2 296 ? -5.029  -17.840 -25.353 1.00 32.37 ? 296 GLN A C     1 
ATOM   3101 O  O     . GLN B 2 296 ? -5.819  -17.207 -24.643 1.00 31.17 ? 296 GLN A O     1 
ATOM   3102 C  CB    . GLN B 2 296 ? -5.048  -17.442 -27.827 1.00 30.33 ? 296 GLN A CB    1 
ATOM   3103 C  CG    . GLN B 2 296 ? -4.695  -16.423 -28.900 1.00 31.68 ? 296 GLN A CG    1 
ATOM   3104 C  CD    . GLN B 2 296 ? -5.412  -16.671 -30.210 1.00 32.61 ? 296 GLN A CD    1 
ATOM   3105 O  OE1   . GLN B 2 296 ? -6.642  -16.776 -30.252 1.00 35.13 ? 296 GLN A OE1   1 
ATOM   3106 N  NE2   . GLN B 2 296 ? -4.648  -16.757 -31.293 1.00 31.21 ? 296 GLN A NE2   1 
ATOM   3107 N  N     . LEU B 2 297 ? -4.749  -19.124 -25.162 1.00 33.02 ? 297 LEU A N     1 
ATOM   3108 C  CA    . LEU B 2 297 ? -5.340  -19.861 -24.062 1.00 32.70 ? 297 LEU A CA    1 
ATOM   3109 C  C     . LEU B 2 297 ? -4.788  -19.288 -22.752 1.00 33.99 ? 297 LEU A C     1 
ATOM   3110 O  O     . LEU B 2 297 ? -5.488  -19.261 -21.738 1.00 32.18 ? 297 LEU A O     1 
ATOM   3111 C  CB    . LEU B 2 297 ? -5.013  -21.351 -24.188 1.00 33.40 ? 297 LEU A CB    1 
ATOM   3112 C  CG    . LEU B 2 297 ? -5.620  -22.086 -25.389 1.00 33.53 ? 297 LEU A CG    1 
ATOM   3113 C  CD1   . LEU B 2 297 ? -5.305  -23.577 -25.292 1.00 32.37 ? 297 LEU A CD1   1 
ATOM   3114 C  CD2   . LEU B 2 297 ? -7.122  -21.873 -25.428 1.00 30.25 ? 297 LEU A CD2   1 
ATOM   3115 N  N     . GLU B 2 298 ? -3.533  -18.829 -22.778 1.00 35.62 ? 298 GLU A N     1 
ATOM   3116 C  CA    . GLU B 2 298 ? -2.916  -18.221 -21.598 1.00 37.16 ? 298 GLU A CA    1 
ATOM   3117 C  C     . GLU B 2 298 ? -3.594  -16.882 -21.282 1.00 36.00 ? 298 GLU A C     1 
ATOM   3118 O  O     . GLU B 2 298 ? -3.831  -16.563 -20.118 1.00 35.81 ? 298 GLU A O     1 
ATOM   3119 C  CB    . GLU B 2 298 ? -1.417  -17.999 -21.814 1.00 41.12 ? 298 GLU A CB    1 
ATOM   3120 C  CG    . GLU B 2 298 ? -0.594  -19.278 -21.758 1.00 50.23 ? 298 GLU A CG    1 
ATOM   3121 C  CD    . GLU B 2 298 ? 0.889   -19.058 -22.052 1.00 55.74 ? 298 GLU A CD    1 
ATOM   3122 O  OE1   . GLU B 2 298 ? 1.630   -20.068 -22.152 1.00 58.26 ? 298 GLU A OE1   1 
ATOM   3123 O  OE2   . GLU B 2 298 ? 1.313   -17.885 -22.182 1.00 58.02 ? 298 GLU A OE2   1 
ATOM   3124 N  N     . ARG B 2 299 ? -3.918  -16.108 -22.317 1.00 33.62 ? 299 ARG A N     1 
ATOM   3125 C  CA    . ARG B 2 299 ? -4.579  -14.826 -22.116 1.00 32.72 ? 299 ARG A CA    1 
ATOM   3126 C  C     . ARG B 2 299 ? -5.997  -15.078 -21.622 1.00 32.99 ? 299 ARG A C     1 
ATOM   3127 O  O     . ARG B 2 299 ? -6.431  -14.501 -20.619 1.00 32.87 ? 299 ARG A O     1 
ATOM   3128 C  CB    . ARG B 2 299 ? -4.636  -14.028 -23.417 1.00 32.65 ? 299 ARG A CB    1 
ATOM   3129 C  CG    . ARG B 2 299 ? -5.134  -12.607 -23.241 1.00 32.31 ? 299 ARG A CG    1 
ATOM   3130 C  CD    . ARG B 2 299 ? -5.573  -11.986 -24.561 1.00 35.22 ? 299 ARG A CD    1 
ATOM   3131 N  NE    . ARG B 2 299 ? -5.627  -10.523 -24.523 1.00 40.60 ? 299 ARG A NE    1 
ATOM   3132 C  CZ    . ARG B 2 299 ? -6.388  -9.813  -23.697 1.00 42.74 ? 299 ARG A CZ    1 
ATOM   3133 N  NH1   . ARG B 2 299 ? -7.170  -10.424 -22.825 1.00 48.81 ? 299 ARG A NH1   1 
ATOM   3134 N  NH2   . ARG B 2 299 ? -6.380  -8.491  -23.746 1.00 43.43 ? 299 ARG A NH2   1 
ATOM   3135 N  N     . ALA B 2 300 ? -6.707  -15.955 -22.325 1.00 31.25 ? 300 ALA A N     1 
ATOM   3136 C  CA    . ALA B 2 300 ? -8.084  -16.290 -21.976 1.00 31.58 ? 300 ALA A CA    1 
ATOM   3137 C  C     . ALA B 2 300 ? -8.174  -16.784 -20.538 1.00 32.40 ? 300 ALA A C     1 
ATOM   3138 O  O     . ALA B 2 300 ? -9.041  -16.365 -19.769 1.00 33.05 ? 300 ALA A O     1 
ATOM   3139 C  CB    . ALA B 2 300 ? -8.622  -17.359 -22.930 1.00 29.18 ? 300 ALA A CB    1 
ATOM   3140 N  N     . SER B 2 301 ? -7.262  -17.681 -20.190 1.00 34.36 ? 301 SER A N     1 
ATOM   3141 C  CA    . SER B 2 301 ? -7.196  -18.265 -18.859 1.00 33.85 ? 301 SER A CA    1 
ATOM   3142 C  C     . SER B 2 301 ? -6.932  -17.177 -17.816 1.00 34.37 ? 301 SER A C     1 
ATOM   3143 O  O     . SER B 2 301 ? -7.577  -17.145 -16.771 1.00 33.37 ? 301 SER A O     1 
ATOM   3144 C  CB    . SER B 2 301 ? -6.080  -19.317 -18.836 1.00 33.44 ? 301 SER A CB    1 
ATOM   3145 O  OG    . SER B 2 301 ? -6.090  -20.074 -17.642 1.00 36.95 ? 301 SER A OG    1 
ATOM   3146 N  N     . ARG B 2 302 ? -5.990  -16.281 -18.113 1.00 34.38 ? 302 ARG A N     1 
ATOM   3147 C  CA    . ARG B 2 302 ? -5.630  -15.188 -17.203 1.00 35.02 ? 302 ARG A CA    1 
ATOM   3148 C  C     . ARG B 2 302 ? -6.744  -14.144 -17.044 1.00 34.57 ? 302 ARG A C     1 
ATOM   3149 O  O     . ARG B 2 302 ? -6.996  -13.656 -15.942 1.00 31.87 ? 302 ARG A O     1 
ATOM   3150 C  CB    . ARG B 2 302 ? -4.363  -14.478 -17.706 1.00 36.45 ? 302 ARG A CB    1 
ATOM   3151 C  CG    . ARG B 2 302 ? -3.842  -13.385 -16.775 1.00 37.59 ? 302 ARG A CG    1 
ATOM   3152 C  CD    . ARG B 2 302 ? -2.812  -12.496 -17.468 1.00 41.30 ? 302 ARG A CD    1 
ATOM   3153 N  NE    . ARG B 2 302 ? -3.427  -11.333 -18.105 1.00 44.41 ? 302 ARG A NE    1 
ATOM   3154 C  CZ    . ARG B 2 302 ? -3.276  -11.006 -19.386 1.00 46.99 ? 302 ARG A CZ    1 
ATOM   3155 N  NH1   . ARG B 2 302 ? -2.527  -11.752 -20.193 1.00 48.76 ? 302 ARG A NH1   1 
ATOM   3156 N  NH2   . ARG B 2 302 ? -3.880  -9.927  -19.866 1.00 49.32 ? 302 ARG A NH2   1 
ATOM   3157 N  N     . LYS B 2 303 ? -7.386  -13.795 -18.158 1.00 33.74 ? 303 LYS A N     1 
ATOM   3158 C  CA    . LYS B 2 303 ? -8.457  -12.803 -18.164 1.00 33.81 ? 303 LYS A CA    1 
ATOM   3159 C  C     . LYS B 2 303 ? -9.655  -13.213 -17.312 1.00 33.70 ? 303 LYS A C     1 
ATOM   3160 O  O     . LYS B 2 303 ? -10.252 -12.384 -16.613 1.00 31.60 ? 303 LYS A O     1 
ATOM   3161 C  CB    . LYS B 2 303 ? -8.908  -12.535 -19.602 1.00 35.88 ? 303 LYS A CB    1 
ATOM   3162 C  CG    . LYS B 2 303 ? -8.130  -11.429 -20.293 1.00 36.78 ? 303 LYS A CG    1 
ATOM   3163 C  CD    . LYS B 2 303 ? -8.430  -10.117 -19.599 1.00 40.71 ? 303 LYS A CD    1 
ATOM   3164 C  CE    . LYS B 2 303 ? -7.568  -8.984  -20.096 1.00 41.76 ? 303 LYS A CE    1 
ATOM   3165 N  NZ    . LYS B 2 303 ? -7.751  -7.777  -19.231 1.00 43.99 ? 303 LYS A NZ    1 
ATOM   3166 N  N     . ILE B 2 304 ? -10.003 -14.494 -17.380 1.00 31.88 ? 304 ILE A N     1 
ATOM   3167 C  CA    . ILE B 2 304 ? -11.120 -15.016 -16.609 1.00 32.86 ? 304 ILE A CA    1 
ATOM   3168 C  C     . ILE B 2 304 ? -10.718 -15.134 -15.135 1.00 32.20 ? 304 ILE A C     1 
ATOM   3169 O  O     . ILE B 2 304 ? -11.521 -14.855 -14.241 1.00 31.29 ? 304 ILE A O     1 
ATOM   3170 C  CB    . ILE B 2 304 ? -11.571 -16.394 -17.165 1.00 34.03 ? 304 ILE A CB    1 
ATOM   3171 C  CG1   . ILE B 2 304 ? -12.173 -16.206 -18.558 1.00 35.00 ? 304 ILE A CG1   1 
ATOM   3172 C  CG2   . ILE B 2 304 ? -12.588 -17.039 -16.244 1.00 31.93 ? 304 ILE A CG2   1 
ATOM   3173 C  CD1   . ILE B 2 304 ? -12.493 -17.511 -19.261 1.00 37.93 ? 304 ILE A CD1   1 
ATOM   3174 N  N     . PHE B 2 305 ? -9.470  -15.532 -14.892 1.00 30.88 ? 305 PHE A N     1 
ATOM   3175 C  CA    . PHE B 2 305 ? -8.954  -15.670 -13.532 1.00 29.91 ? 305 PHE A CA    1 
ATOM   3176 C  C     . PHE B 2 305 ? -8.968  -14.316 -12.809 1.00 30.73 ? 305 PHE A C     1 
ATOM   3177 O  O     . PHE B 2 305 ? -9.287  -14.243 -11.624 1.00 29.51 ? 305 PHE A O     1 
ATOM   3178 C  CB    . PHE B 2 305 ? -7.522  -16.213 -13.560 1.00 28.91 ? 305 PHE A CB    1 
ATOM   3179 C  CG    . PHE B 2 305 ? -6.946  -16.480 -12.194 1.00 27.59 ? 305 PHE A CG    1 
ATOM   3180 C  CD1   . PHE B 2 305 ? -7.051  -17.741 -11.615 1.00 24.36 ? 305 PHE A CD1   1 
ATOM   3181 C  CD2   . PHE B 2 305 ? -6.315  -15.457 -11.476 1.00 26.40 ? 305 PHE A CD2   1 
ATOM   3182 C  CE1   . PHE B 2 305 ? -6.535  -17.986 -10.344 1.00 24.98 ? 305 PHE A CE1   1 
ATOM   3183 C  CE2   . PHE B 2 305 ? -5.797  -15.689 -10.204 1.00 23.78 ? 305 PHE A CE2   1 
ATOM   3184 C  CZ    . PHE B 2 305 ? -5.905  -16.954 -9.634  1.00 24.61 ? 305 PHE A CZ    1 
ATOM   3185 N  N     . GLU B 2 306 ? -8.615  -13.247 -13.518 1.00 30.93 ? 306 GLU A N     1 
ATOM   3186 C  CA    . GLU B 2 306 ? -8.614  -11.913 -12.915 1.00 32.28 ? 306 GLU A CA    1 
ATOM   3187 C  C     . GLU B 2 306 ? -10.058 -11.467 -12.670 1.00 31.25 ? 306 GLU A C     1 
ATOM   3188 O  O     . GLU B 2 306 ? -10.358 -10.776 -11.692 1.00 31.83 ? 306 GLU A O     1 
ATOM   3189 C  CB    . GLU B 2 306 ? -7.882  -10.910 -13.821 1.00 32.73 ? 306 GLU A CB    1 
ATOM   3190 C  CG    . GLU B 2 306 ? -6.439  -11.305 -14.106 1.00 37.31 ? 306 GLU A CG    1 
ATOM   3191 C  CD    . GLU B 2 306 ? -5.704  -10.322 -14.998 1.00 41.09 ? 306 GLU A CD    1 
ATOM   3192 O  OE1   . GLU B 2 306 ? -6.347  -9.684  -15.868 1.00 45.12 ? 306 GLU A OE1   1 
ATOM   3193 O  OE2   . GLU B 2 306 ? -4.470  -10.202 -14.841 1.00 43.55 ? 306 GLU A OE2   1 
ATOM   3194 N  N     . PHE B 2 307 ? -10.955 -11.862 -13.563 1.00 29.82 ? 307 PHE A N     1 
ATOM   3195 C  CA    . PHE B 2 307 ? -12.353 -11.527 -13.385 1.00 30.05 ? 307 PHE A CA    1 
ATOM   3196 C  C     . PHE B 2 307 ? -12.852 -12.181 -12.085 1.00 30.51 ? 307 PHE A C     1 
ATOM   3197 O  O     . PHE B 2 307 ? -13.523 -11.539 -11.266 1.00 30.07 ? 307 PHE A O     1 
ATOM   3198 C  CB    . PHE B 2 307 ? -13.179 -12.039 -14.558 1.00 27.99 ? 307 PHE A CB    1 
ATOM   3199 C  CG    . PHE B 2 307 ? -14.642 -12.099 -14.270 1.00 28.16 ? 307 PHE A CG    1 
ATOM   3200 C  CD1   . PHE B 2 307 ? -15.412 -10.935 -14.255 1.00 27.12 ? 307 PHE A CD1   1 
ATOM   3201 C  CD2   . PHE B 2 307 ? -15.249 -13.319 -13.962 1.00 25.80 ? 307 PHE A CD2   1 
ATOM   3202 C  CE1   . PHE B 2 307 ? -16.767 -10.988 -13.935 1.00 28.03 ? 307 PHE A CE1   1 
ATOM   3203 C  CE2   . PHE B 2 307 ? -16.595 -13.382 -13.641 1.00 26.40 ? 307 PHE A CE2   1 
ATOM   3204 C  CZ    . PHE B 2 307 ? -17.363 -12.218 -13.625 1.00 27.00 ? 307 PHE A CZ    1 
ATOM   3205 N  N     . LEU B 2 308 ? -12.518 -13.455 -11.899 1.00 28.65 ? 308 LEU A N     1 
ATOM   3206 C  CA    . LEU B 2 308 ? -12.925 -14.176 -10.702 1.00 28.62 ? 308 LEU A CA    1 
ATOM   3207 C  C     . LEU B 2 308 ? -12.336 -13.570 -9.432  1.00 29.33 ? 308 LEU A C     1 
ATOM   3208 O  O     . LEU B 2 308 ? -12.954 -13.631 -8.375  1.00 28.74 ? 308 LEU A O     1 
ATOM   3209 C  CB    . LEU B 2 308 ? -12.514 -15.643 -10.800 1.00 27.57 ? 308 LEU A CB    1 
ATOM   3210 C  CG    . LEU B 2 308 ? -13.256 -16.502 -11.822 1.00 27.85 ? 308 LEU A CG    1 
ATOM   3211 C  CD1   . LEU B 2 308 ? -12.571 -17.870 -11.951 1.00 26.98 ? 308 LEU A CD1   1 
ATOM   3212 C  CD2   . LEU B 2 308 ? -14.703 -16.652 -11.386 1.00 26.54 ? 308 LEU A CD2   1 
ATOM   3213 N  N     . GLU B 2 309 ? -11.146 -12.983 -9.522  1.00 31.17 ? 309 GLU A N     1 
ATOM   3214 C  CA    . GLU B 2 309 ? -10.561 -12.394 -8.331  1.00 34.49 ? 309 GLU A CA    1 
ATOM   3215 C  C     . GLU B 2 309 ? -11.271 -11.089 -7.950  1.00 33.58 ? 309 GLU A C     1 
ATOM   3216 O  O     . GLU B 2 309 ? -11.614 -10.905 -6.783  1.00 31.85 ? 309 GLU A O     1 
ATOM   3217 C  CB    . GLU B 2 309 ? -9.049  -12.183 -8.500  1.00 38.66 ? 309 GLU A CB    1 
ATOM   3218 C  CG    . GLU B 2 309 ? -8.639  -10.945 -9.284  1.00 50.58 ? 309 GLU A CG    1 
ATOM   3219 C  CD    . GLU B 2 309 ? -7.171  -10.988 -9.723  1.00 55.91 ? 309 GLU A CD    1 
ATOM   3220 O  OE1   . GLU B 2 309 ? -6.696  -9.981  -10.309 1.00 56.90 ? 309 GLU A OE1   1 
ATOM   3221 O  OE2   . GLU B 2 309 ? -6.505  -12.030 -9.486  1.00 56.67 ? 309 GLU A OE2   1 
ATOM   3222 N  N     . ARG B 2 310 ? -11.527 -10.199 -8.909  1.00 32.09 ? 310 ARG A N     1 
ATOM   3223 C  CA    . ARG B 2 310 ? -12.207 -8.960  -8.550  1.00 33.77 ? 310 ARG A CA    1 
ATOM   3224 C  C     . ARG B 2 310 ? -13.680 -9.175  -8.184  1.00 35.60 ? 310 ARG A C     1 
ATOM   3225 O  O     . ARG B 2 310 ? -14.302 -8.304  -7.570  1.00 36.41 ? 310 ARG A O     1 
ATOM   3226 C  CB    . ARG B 2 310 ? -12.063 -7.883  -9.644  1.00 33.63 ? 310 ARG A CB    1 
ATOM   3227 C  CG    . ARG B 2 310 ? -12.608 -8.215  -11.004 1.00 34.09 ? 310 ARG A CG    1 
ATOM   3228 C  CD    . ARG B 2 310 ? -12.475 -7.037  -11.980 1.00 32.55 ? 310 ARG A CD    1 
ATOM   3229 N  NE    . ARG B 2 310 ? -12.980 -7.425  -13.298 1.00 34.58 ? 310 ARG A NE    1 
ATOM   3230 C  CZ    . ARG B 2 310 ? -12.266 -8.054  -14.232 1.00 32.43 ? 310 ARG A CZ    1 
ATOM   3231 N  NH1   . ARG B 2 310 ? -10.990 -8.356  -14.020 1.00 33.12 ? 310 ARG A NH1   1 
ATOM   3232 N  NH2   . ARG B 2 310 ? -12.849 -8.438  -15.362 1.00 30.55 ? 310 ARG A NH2   1 
ATOM   3233 N  N     . GLU B 2 311 ? -14.239 -10.330 -8.539  1.00 35.61 ? 311 GLU A N     1 
ATOM   3234 C  CA    . GLU B 2 311 ? -15.619 -10.621 -8.171  1.00 35.30 ? 311 GLU A CA    1 
ATOM   3235 C  C     . GLU B 2 311 ? -15.663 -11.386 -6.850  1.00 35.83 ? 311 GLU A C     1 
ATOM   3236 O  O     . GLU B 2 311 ? -16.719 -11.859 -6.424  1.00 37.04 ? 311 GLU A O     1 
ATOM   3237 C  CB    . GLU B 2 311 ? -16.341 -11.409 -9.265  1.00 37.77 ? 311 GLU A CB    1 
ATOM   3238 C  CG    . GLU B 2 311 ? -16.672 -10.578 -10.500 1.00 39.57 ? 311 GLU A CG    1 
ATOM   3239 C  CD    . GLU B 2 311 ? -17.340 -9.248  -10.166 1.00 40.93 ? 311 GLU A CD    1 
ATOM   3240 O  OE1   . GLU B 2 311 ? -17.442 -8.393  -11.070 1.00 41.60 ? 311 GLU A OE1   1 
ATOM   3241 O  OE2   . GLU B 2 311 ? -17.766 -9.050  -9.006  1.00 42.99 ? 311 GLU A OE2   1 
ATOM   3242 N  N     . ASN B 2 312 ? -14.502 -11.498 -6.210  1.00 34.71 ? 312 ASN A N     1 
ATOM   3243 C  CA    . ASN B 2 312 ? -14.361 -12.153 -4.914  1.00 34.95 ? 312 ASN A CA    1 
ATOM   3244 C  C     . ASN B 2 312 ? -14.652 -13.641 -4.795  1.00 36.10 ? 312 ASN A C     1 
ATOM   3245 O  O     . ASN B 2 312 ? -15.054 -14.105 -3.724  1.00 36.11 ? 312 ASN A O     1 
ATOM   3246 C  CB    . ASN B 2 312 ? -15.198 -11.419 -3.874  1.00 34.82 ? 312 ASN A CB    1 
ATOM   3247 C  CG    . ASN B 2 312 ? -14.713 -10.011 -3.636  1.00 34.83 ? 312 ASN A CG    1 
ATOM   3248 O  OD1   . ASN B 2 312 ? -15.350 -9.046  -4.050  1.00 34.91 ? 312 ASN A OD1   1 
ATOM   3249 N  ND2   . ASN B 2 312 ? -13.570 -9.887  -2.974  1.00 33.49 ? 312 ASN A ND2   1 
ATOM   3250 N  N     . PHE B 2 313 ? -14.453 -14.399 -5.867  1.00 35.97 ? 313 PHE A N     1 
ATOM   3251 C  CA    . PHE B 2 313 ? -14.699 -15.832 -5.788  1.00 35.02 ? 313 PHE A CA    1 
ATOM   3252 C  C     . PHE B 2 313 ? -13.462 -16.574 -5.274  1.00 35.27 ? 313 PHE A C     1 
ATOM   3253 O  O     . PHE B 2 313 ? -13.467 -17.795 -5.124  1.00 34.06 ? 313 PHE A O     1 
ATOM   3254 C  CB    . PHE B 2 313 ? -15.159 -16.347 -7.144  1.00 33.79 ? 313 PHE A CB    1 
ATOM   3255 C  CG    . PHE B 2 313 ? -16.532 -15.874 -7.515  1.00 35.46 ? 313 PHE A CG    1 
ATOM   3256 C  CD1   . PHE B 2 313 ? -17.652 -16.356 -6.837  1.00 34.68 ? 313 PHE A CD1   1 
ATOM   3257 C  CD2   . PHE B 2 313 ? -16.713 -14.918 -8.515  1.00 36.84 ? 313 PHE A CD2   1 
ATOM   3258 C  CE1   . PHE B 2 313 ? -18.930 -15.897 -7.140  1.00 33.48 ? 313 PHE A CE1   1 
ATOM   3259 C  CE2   . PHE B 2 313 ? -17.994 -14.449 -8.829  1.00 37.51 ? 313 PHE A CE2   1 
ATOM   3260 C  CZ    . PHE B 2 313 ? -19.105 -14.945 -8.135  1.00 36.51 ? 313 PHE A CZ    1 
ATOM   3261 N  N     . MET B 2 314 ? -12.415 -15.802 -4.981  1.00 36.00 ? 314 MET A N     1 
ATOM   3262 C  CA    . MET B 2 314 ? -11.157 -16.315 -4.441  1.00 36.27 ? 314 MET A CA    1 
ATOM   3263 C  C     . MET B 2 314 ? -10.561 -17.489 -5.210  1.00 35.50 ? 314 MET A C     1 
ATOM   3264 O  O     . MET B 2 314 ? -10.408 -18.593 -4.681  1.00 35.38 ? 314 MET A O     1 
ATOM   3265 C  CB    . MET B 2 314 ? -11.354 -16.685 -2.970  1.00 37.60 ? 314 MET A CB    1 
ATOM   3266 C  CG    . MET B 2 314 ? -11.744 -15.501 -2.104  1.00 38.55 ? 314 MET A CG    1 
ATOM   3267 S  SD    . MET B 2 314 ? -12.013 -15.927 -0.365  1.00 45.41 ? 314 MET A SD    1 
ATOM   3268 C  CE    . MET B 2 314 ? -10.299 -16.189 0.206   1.00 41.67 ? 314 MET A CE    1 
ATOM   3269 N  N     . PRO B 2 315 ? -10.186 -17.248 -6.472  1.00 35.60 ? 315 PRO A N     1 
ATOM   3270 C  CA    . PRO B 2 315 ? -9.598  -18.257 -7.358  1.00 35.27 ? 315 PRO A CA    1 
ATOM   3271 C  C     . PRO B 2 315 ? -8.283  -18.817 -6.802  1.00 35.69 ? 315 PRO A C     1 
ATOM   3272 O  O     . PRO B 2 315 ? -7.444  -18.073 -6.294  1.00 32.20 ? 315 PRO A O     1 
ATOM   3273 C  CB    . PRO B 2 315 ? -9.368  -17.488 -8.663  1.00 35.21 ? 315 PRO A CB    1 
ATOM   3274 C  CG    . PRO B 2 315 ? -10.227 -16.264 -8.535  1.00 35.58 ? 315 PRO A CG    1 
ATOM   3275 C  CD    . PRO B 2 315 ? -10.140 -15.917 -7.095  1.00 34.15 ? 315 PRO A CD    1 
ATOM   3276 N  N     . LEU B 2 316 ? -8.108  -20.130 -6.896  1.00 37.17 ? 316 LEU A N     1 
ATOM   3277 C  CA    . LEU B 2 316 ? -6.881  -20.760 -6.421  1.00 38.34 ? 316 LEU A CA    1 
ATOM   3278 C  C     . LEU B 2 316 ? -5.910  -20.840 -7.606  1.00 39.02 ? 316 LEU A C     1 
ATOM   3279 O  O     . LEU B 2 316 ? -4.894  -20.152 -7.637  1.00 40.34 ? 316 LEU A O     1 
ATOM   3280 C  CB    . LEU B 2 316 ? -7.184  -22.153 -5.856  1.00 37.26 ? 316 LEU A CB    1 
ATOM   3281 C  CG    . LEU B 2 316 ? -7.930  -22.201 -4.518  1.00 38.27 ? 316 LEU A CG    1 
ATOM   3282 C  CD1   . LEU B 2 316 ? -8.410  -23.609 -4.263  1.00 38.39 ? 316 LEU A CD1   1 
ATOM   3283 C  CD2   . LEU B 2 316 ? -7.018  -21.745 -3.383  1.00 38.36 ? 316 LEU A CD2   1 
ATOM   3284 N  N     . ARG B 2 317 ? -6.226  -21.673 -8.587  1.00 39.04 ? 317 ARG A N     1 
ATOM   3285 C  CA    . ARG B 2 317 ? -5.379  -21.785 -9.760  1.00 39.18 ? 317 ARG A CA    1 
ATOM   3286 C  C     . ARG B 2 317 ? -6.203  -21.971 -11.024 1.00 39.52 ? 317 ARG A C     1 
ATOM   3287 O  O     . ARG B 2 317 ? -7.409  -22.236 -10.984 1.00 36.87 ? 317 ARG A O     1 
ATOM   3288 C  CB    . ARG B 2 317 ? -4.404  -22.956 -9.627  1.00 38.83 ? 317 ARG A CB    1 
ATOM   3289 C  CG    . ARG B 2 317 ? -3.418  -22.820 -8.499  1.00 38.98 ? 317 ARG A CG    1 
ATOM   3290 C  CD    . ARG B 2 317 ? -2.451  -23.986 -8.501  1.00 39.68 ? 317 ARG A CD    1 
ATOM   3291 N  NE    . ARG B 2 317 ? -1.419  -23.863 -9.528  1.00 37.77 ? 317 ARG A NE    1 
ATOM   3292 C  CZ    . ARG B 2 317 ? -0.523  -24.807 -9.802  1.00 36.20 ? 317 ARG A CZ    1 
ATOM   3293 N  NH1   . ARG B 2 317 ? -0.528  -25.957 -9.138  1.00 36.90 ? 317 ARG A NH1   1 
ATOM   3294 N  NH2   . ARG B 2 317 ? 0.399   -24.592 -10.722 1.00 34.70 ? 317 ARG A NH2   1 
ATOM   3295 N  N     . SER B 2 318 ? -5.529  -21.813 -12.152 1.00 40.16 ? 318 SER A N     1 
ATOM   3296 C  CA    . SER B 2 318 ? -6.149  -21.988 -13.445 1.00 41.02 ? 318 SER A CA    1 
ATOM   3297 C  C     . SER B 2 318 ? -5.194  -22.849 -14.255 1.00 41.49 ? 318 SER A C     1 
ATOM   3298 O  O     . SER B 2 318 ? -4.021  -22.993 -13.897 1.00 41.69 ? 318 SER A O     1 
ATOM   3299 C  CB    . SER B 2 318 ? -6.352  -20.631 -14.127 1.00 41.96 ? 318 SER A CB    1 
ATOM   3300 O  OG    . SER B 2 318 ? -5.116  -19.972 -14.354 1.00 45.13 ? 318 SER A OG    1 
ATOM   3301 N  N     . ALA B 2 319 ? -5.703  -23.436 -15.330 1.00 40.59 ? 319 ALA A N     1 
ATOM   3302 C  CA    . ALA B 2 319 ? -4.894  -24.259 -16.216 1.00 40.13 ? 319 ALA A CA    1 
ATOM   3303 C  C     . ALA B 2 319 ? -5.676  -24.390 -17.514 1.00 40.51 ? 319 ALA A C     1 
ATOM   3304 O  O     . ALA B 2 319 ? -6.770  -23.837 -17.641 1.00 40.03 ? 319 ALA A O     1 
ATOM   3305 C  CB    . ALA B 2 319 ? -4.649  -25.636 -15.591 1.00 38.50 ? 319 ALA A CB    1 
ATOM   3306 N  N     . PHE B 2 320 ? -5.115  -25.105 -18.480 1.00 40.53 ? 320 PHE A N     1 
ATOM   3307 C  CA    . PHE B 2 320 ? -5.800  -25.306 -19.740 1.00 40.81 ? 320 PHE A CA    1 
ATOM   3308 C  C     . PHE B 2 320 ? -5.319  -26.543 -20.496 1.00 42.58 ? 320 PHE A C     1 
ATOM   3309 O  O     . PHE B 2 320 ? -4.156  -26.935 -20.411 1.00 43.66 ? 320 PHE A O     1 
ATOM   3310 C  CB    . PHE B 2 320 ? -5.699  -24.044 -20.606 1.00 39.07 ? 320 PHE A CB    1 
ATOM   3311 C  CG    . PHE B 2 320 ? -4.300  -23.550 -20.827 1.00 36.84 ? 320 PHE A CG    1 
ATOM   3312 C  CD1   . PHE B 2 320 ? -3.418  -24.247 -21.651 1.00 36.20 ? 320 PHE A CD1   1 
ATOM   3313 C  CD2   . PHE B 2 320 ? -3.879  -22.355 -20.258 1.00 35.03 ? 320 PHE A CD2   1 
ATOM   3314 C  CE1   . PHE B 2 320 ? -2.139  -23.753 -21.910 1.00 34.00 ? 320 PHE A CE1   1 
ATOM   3315 C  CE2   . PHE B 2 320 ? -2.598  -21.853 -20.512 1.00 34.43 ? 320 PHE A CE2   1 
ATOM   3316 C  CZ    . PHE B 2 320 ? -1.730  -22.554 -21.340 1.00 31.46 ? 320 PHE A CZ    1 
ATOM   3317 N  N     . LYS B 2 321 ? -6.241  -27.170 -21.217 1.00 44.58 ? 321 LYS A N     1 
ATOM   3318 C  CA    . LYS B 2 321 ? -5.937  -28.370 -21.982 1.00 46.09 ? 321 LYS A CA    1 
ATOM   3319 C  C     . LYS B 2 321 ? -6.468  -28.172 -23.390 1.00 45.94 ? 321 LYS A C     1 
ATOM   3320 O  O     . LYS B 2 321 ? -7.543  -27.611 -23.584 1.00 45.12 ? 321 LYS A O     1 
ATOM   3321 C  CB    . LYS B 2 321 ? -6.612  -29.591 -21.342 1.00 49.49 ? 321 LYS A CB    1 
ATOM   3322 C  CG    . LYS B 2 321 ? -5.938  -30.924 -21.643 1.00 51.02 ? 321 LYS A CG    1 
ATOM   3323 C  CD    . LYS B 2 321 ? -6.039  -31.305 -23.102 1.00 54.99 ? 321 LYS A CD    1 
ATOM   3324 C  CE    . LYS B 2 321 ? -5.150  -32.502 -23.421 1.00 57.35 ? 321 LYS A CE    1 
ATOM   3325 N  NZ    . LYS B 2 321 ? -5.494  -33.680 -22.579 1.00 58.47 ? 321 LYS A NZ    1 
ATOM   3326 N  N     . ALA B 2 322 ? -5.709  -28.629 -24.373 1.00 46.12 ? 322 ALA A N     1 
ATOM   3327 C  CA    . ALA B 2 322 ? -6.130  -28.497 -25.750 1.00 46.87 ? 322 ALA A CA    1 
ATOM   3328 C  C     . ALA B 2 322 ? -6.040  -29.834 -26.446 1.00 48.04 ? 322 ALA A C     1 
ATOM   3329 O  O     . ALA B 2 322 ? -4.953  -30.235 -26.849 1.00 50.80 ? 322 ALA A O     1 
ATOM   3330 C  CB    . ALA B 2 322 ? -5.254  -27.486 -26.464 1.00 46.64 ? 322 ALA A CB    1 
ATOM   3331 N  N     . SER B 2 323 ? -7.161  -30.540 -26.568 1.00 49.70 ? 323 SER A N     1 
ATOM   3332 C  CA    . SER B 2 323 ? -7.155  -31.819 -27.278 1.00 52.28 ? 323 SER A CA    1 
ATOM   3333 C  C     . SER B 2 323 ? -7.290  -31.454 -28.758 1.00 53.89 ? 323 SER A C     1 
ATOM   3334 O  O     . SER B 2 323 ? -7.174  -30.278 -29.111 1.00 54.54 ? 323 SER A O     1 
ATOM   3335 C  CB    . SER B 2 323 ? -8.322  -32.706 -26.832 1.00 52.95 ? 323 SER A CB    1 
ATOM   3336 O  OG    . SER B 2 323 ? -9.572  -32.132 -27.172 1.00 55.38 ? 323 SER A OG    1 
ATOM   3337 N  N     . GLU B 2 324 ? -7.527  -32.428 -29.632 1.00 55.79 ? 324 GLU A N     1 
ATOM   3338 C  CA    . GLU B 2 324 ? -7.656  -32.111 -31.059 1.00 57.16 ? 324 GLU A CA    1 
ATOM   3339 C  C     . GLU B 2 324 ? -9.026  -31.553 -31.403 1.00 55.12 ? 324 GLU A C     1 
ATOM   3340 O  O     . GLU B 2 324 ? -9.207  -30.884 -32.416 1.00 55.32 ? 324 GLU A O     1 
ATOM   3341 C  CB    . GLU B 2 324 ? -7.392  -33.350 -31.916 1.00 60.47 ? 324 GLU A CB    1 
ATOM   3342 C  CG    . GLU B 2 324 ? -5.923  -33.729 -32.011 1.00 66.91 ? 324 GLU A CG    1 
ATOM   3343 C  CD    . GLU B 2 324 ? -5.692  -34.950 -32.883 1.00 70.12 ? 324 GLU A CD    1 
ATOM   3344 O  OE1   . GLU B 2 324 ? -6.301  -36.008 -32.593 1.00 71.34 ? 324 GLU A OE1   1 
ATOM   3345 O  OE2   . GLU B 2 324 ? -4.902  -34.852 -33.854 1.00 70.39 ? 324 GLU A OE2   1 
ATOM   3346 N  N     . GLU B 2 325 ? -9.982  -31.818 -30.532 1.00 54.07 ? 325 GLU A N     1 
ATOM   3347 C  CA    . GLU B 2 325 ? -11.350 -31.388 -30.728 1.00 53.16 ? 325 GLU A CA    1 
ATOM   3348 C  C     . GLU B 2 325 ? -11.620 -30.050 -30.045 1.00 50.82 ? 325 GLU A C     1 
ATOM   3349 O  O     . GLU B 2 325 ? -11.897 -29.036 -30.693 1.00 49.71 ? 325 GLU A O     1 
ATOM   3350 C  CB    . GLU B 2 325 ? -12.279 -32.453 -30.137 1.00 57.39 ? 325 GLU A CB    1 
ATOM   3351 C  CG    . GLU B 2 325 ? -11.571 -33.798 -29.875 1.00 61.91 ? 325 GLU A CG    1 
ATOM   3352 C  CD    . GLU B 2 325 ? -12.196 -34.611 -28.744 1.00 64.61 ? 325 GLU A CD    1 
ATOM   3353 O  OE1   . GLU B 2 325 ? -12.092 -34.185 -27.564 1.00 65.59 ? 325 GLU A OE1   1 
ATOM   3354 O  OE2   . GLU B 2 325 ? -12.788 -35.676 -29.040 1.00 64.05 ? 325 GLU A OE2   1 
ATOM   3355 N  N     . PHE B 2 326 ? -11.524 -30.068 -28.720 1.00 47.23 ? 326 PHE A N     1 
ATOM   3356 C  CA    . PHE B 2 326 ? -11.803 -28.898 -27.906 1.00 42.90 ? 326 PHE A CA    1 
ATOM   3357 C  C     . PHE B 2 326 ? -10.634 -28.380 -27.108 1.00 40.91 ? 326 PHE A C     1 
ATOM   3358 O  O     . PHE B 2 326 ? -9.542  -28.952 -27.109 1.00 40.58 ? 326 PHE A O     1 
ATOM   3359 C  CB    . PHE B 2 326 ? -12.946 -29.208 -26.928 1.00 40.46 ? 326 PHE A CB    1 
ATOM   3360 C  CG    . PHE B 2 326 ? -14.149 -29.794 -27.586 1.00 38.18 ? 326 PHE A CG    1 
ATOM   3361 C  CD1   . PHE B 2 326 ? -14.252 -31.164 -27.772 1.00 37.28 ? 326 PHE A CD1   1 
ATOM   3362 C  CD2   . PHE B 2 326 ? -15.136 -28.968 -28.111 1.00 36.12 ? 326 PHE A CD2   1 
ATOM   3363 C  CE1   . PHE B 2 326 ? -15.325 -31.707 -28.478 1.00 36.07 ? 326 PHE A CE1   1 
ATOM   3364 C  CE2   . PHE B 2 326 ? -16.206 -29.499 -28.817 1.00 36.53 ? 326 PHE A CE2   1 
ATOM   3365 C  CZ    . PHE B 2 326 ? -16.298 -30.875 -29.003 1.00 34.42 ? 326 PHE A CZ    1 
ATOM   3366 N  N     . CYS B 2 327 ? -10.908 -27.277 -26.424 1.00 38.72 ? 327 CYS A N     1 
ATOM   3367 C  CA    . CYS B 2 327 ? -9.967  -26.603 -25.551 1.00 37.57 ? 327 CYS A CA    1 
ATOM   3368 C  C     . CYS B 2 327 ? -10.688 -26.461 -24.226 1.00 36.80 ? 327 CYS A C     1 
ATOM   3369 O  O     . CYS B 2 327 ? -11.916 -26.351 -24.176 1.00 36.21 ? 327 CYS A O     1 
ATOM   3370 C  CB    . CYS B 2 327 ? -9.621  -25.213 -26.077 1.00 36.02 ? 327 CYS A CB    1 
ATOM   3371 S  SG    . CYS B 2 327 ? -8.549  -25.205 -27.509 1.00 39.29 ? 327 CYS A SG    1 
ATOM   3372 N  N     . TYR B 2 328 ? -9.926  -26.466 -23.148 1.00 35.94 ? 328 TYR A N     1 
ATOM   3373 C  CA    . TYR B 2 328 ? -10.523 -26.325 -21.841 1.00 35.58 ? 328 TYR A CA    1 
ATOM   3374 C  C     . TYR B 2 328 ? -9.729  -25.343 -21.007 1.00 35.32 ? 328 TYR A C     1 
ATOM   3375 O  O     . TYR B 2 328 ? -8.497  -25.376 -20.993 1.00 35.29 ? 328 TYR A O     1 
ATOM   3376 C  CB    . TYR B 2 328 ? -10.571 -27.671 -21.116 1.00 35.40 ? 328 TYR A CB    1 
ATOM   3377 C  CG    . TYR B 2 328 ? -11.282 -28.769 -21.867 1.00 35.61 ? 328 TYR A CG    1 
ATOM   3378 C  CD1   . TYR B 2 328 ? -10.639 -29.471 -22.891 1.00 37.02 ? 328 TYR A CD1   1 
ATOM   3379 C  CD2   . TYR B 2 328 ? -12.588 -29.131 -21.540 1.00 35.82 ? 328 TYR A CD2   1 
ATOM   3380 C  CE1   . TYR B 2 328 ? -11.276 -30.509 -23.563 1.00 35.25 ? 328 TYR A CE1   1 
ATOM   3381 C  CE2   . TYR B 2 328 ? -13.237 -30.167 -22.211 1.00 36.28 ? 328 TYR A CE2   1 
ATOM   3382 C  CZ    . TYR B 2 328 ? -12.571 -30.850 -23.219 1.00 36.13 ? 328 TYR A CZ    1 
ATOM   3383 O  OH    . TYR B 2 328 ? -13.201 -31.870 -23.890 1.00 38.84 ? 328 TYR A OH    1 
ATOM   3384 N  N     . LEU B 2 329 ? -10.449 -24.448 -20.342 1.00 32.93 ? 329 LEU A N     1 
ATOM   3385 C  CA    . LEU B 2 329 ? -9.841  -23.479 -19.451 1.00 29.73 ? 329 LEU A CA    1 
ATOM   3386 C  C     . LEU B 2 329 ? -10.365 -23.949 -18.093 1.00 30.07 ? 329 LEU A C     1 
ATOM   3387 O  O     . LEU B 2 329 ? -11.578 -23.973 -17.875 1.00 27.36 ? 329 LEU A O     1 
ATOM   3388 C  CB    . LEU B 2 329 ? -10.333 -22.066 -19.780 1.00 29.07 ? 329 LEU A CB    1 
ATOM   3389 C  CG    . LEU B 2 329 ? -10.155 -21.586 -21.228 1.00 28.17 ? 329 LEU A CG    1 
ATOM   3390 C  CD1   . LEU B 2 329 ? -10.626 -20.137 -21.341 1.00 27.57 ? 329 LEU A CD1   1 
ATOM   3391 C  CD2   . LEU B 2 329 ? -8.703  -21.687 -21.649 1.00 25.46 ? 329 LEU A CD2   1 
ATOM   3392 N  N     . LEU B 2 330 ? -9.454  -24.348 -17.204 1.00 30.93 ? 330 LEU A N     1 
ATOM   3393 C  CA    . LEU B 2 330 ? -9.815  -24.868 -15.881 1.00 32.69 ? 330 LEU A CA    1 
ATOM   3394 C  C     . LEU B 2 330 ? -9.695  -23.871 -14.735 1.00 32.76 ? 330 LEU A C     1 
ATOM   3395 O  O     . LEU B 2 330 ? -8.802  -23.030 -14.718 1.00 31.38 ? 330 LEU A O     1 
ATOM   3396 C  CB    . LEU B 2 330 ? -8.960  -26.096 -15.566 1.00 34.46 ? 330 LEU A CB    1 
ATOM   3397 C  CG    . LEU B 2 330 ? -8.966  -27.131 -16.691 1.00 37.93 ? 330 LEU A CG    1 
ATOM   3398 C  CD1   . LEU B 2 330 ? -7.859  -28.145 -16.459 1.00 39.53 ? 330 LEU A CD1   1 
ATOM   3399 C  CD2   . LEU B 2 330 ? -10.338 -27.803 -16.769 1.00 37.57 ? 330 LEU A CD2   1 
ATOM   3400 N  N     . PHE B 2 331 ? -10.596 -23.989 -13.763 1.00 33.82 ? 331 PHE A N     1 
ATOM   3401 C  CA    . PHE B 2 331 ? -10.598 -23.090 -12.614 1.00 34.29 ? 331 PHE A CA    1 
ATOM   3402 C  C     . PHE B 2 331 ? -11.016 -23.773 -11.317 1.00 34.50 ? 331 PHE A C     1 
ATOM   3403 O  O     . PHE B 2 331 ? -11.783 -24.733 -11.317 1.00 35.05 ? 331 PHE A O     1 
ATOM   3404 C  CB    . PHE B 2 331 ? -11.534 -21.903 -12.870 1.00 31.27 ? 331 PHE A CB    1 
ATOM   3405 C  CG    . PHE B 2 331 ? -11.155 -21.082 -14.066 1.00 33.38 ? 331 PHE A CG    1 
ATOM   3406 C  CD1   . PHE B 2 331 ? -10.143 -20.125 -13.980 1.00 32.84 ? 331 PHE A CD1   1 
ATOM   3407 C  CD2   . PHE B 2 331 ? -11.782 -21.293 -15.296 1.00 32.65 ? 331 PHE A CD2   1 
ATOM   3408 C  CE1   . PHE B 2 331 ? -9.757  -19.393 -15.102 1.00 31.88 ? 331 PHE A CE1   1 
ATOM   3409 C  CE2   . PHE B 2 331 ? -11.403 -20.568 -16.423 1.00 33.07 ? 331 PHE A CE2   1 
ATOM   3410 C  CZ    . PHE B 2 331 ? -10.384 -19.613 -16.325 1.00 33.18 ? 331 PHE A CZ    1 
ATOM   3411 N  N     . GLU B 2 332 ? -10.486 -23.260 -10.215 1.00 35.47 ? 332 GLU A N     1 
ATOM   3412 C  CA    . GLU B 2 332 ? -10.802 -23.746 -8.888  1.00 36.44 ? 332 GLU A CA    1 
ATOM   3413 C  C     . GLU B 2 332 ? -10.910 -22.503 -8.020  1.00 36.35 ? 332 GLU A C     1 
ATOM   3414 O  O     . GLU B 2 332 ? -10.014 -21.658 -8.026  1.00 35.84 ? 332 GLU A O     1 
ATOM   3415 C  CB    . GLU B 2 332 ? -9.704  -24.669 -8.352  1.00 37.60 ? 332 GLU A CB    1 
ATOM   3416 C  CG    . GLU B 2 332 ? -9.986  -25.146 -6.921  1.00 40.83 ? 332 GLU A CG    1 
ATOM   3417 C  CD    . GLU B 2 332 ? -9.056  -26.263 -6.450  1.00 42.07 ? 332 GLU A CD    1 
ATOM   3418 O  OE1   . GLU B 2 332 ? -7.819  -26.124 -6.602  1.00 44.08 ? 332 GLU A OE1   1 
ATOM   3419 O  OE2   . GLU B 2 332 ? -9.566  -27.273 -5.911  1.00 39.50 ? 332 GLU A OE2   1 
ATOM   3420 N  N     . CYS B 2 333 ? -12.018 -22.384 -7.298  1.00 36.14 ? 333 CYS A N     1 
ATOM   3421 C  CA    . CYS B 2 333 ? -12.258 -21.240 -6.427  1.00 36.69 ? 333 CYS A CA    1 
ATOM   3422 C  C     . CYS B 2 333 ? -12.644 -21.706 -5.039  1.00 37.53 ? 333 CYS A C     1 
ATOM   3423 O  O     . CYS B 2 333 ? -13.228 -22.778 -4.869  1.00 38.72 ? 333 CYS A O     1 
ATOM   3424 C  CB    . CYS B 2 333 ? -13.385 -20.369 -6.985  1.00 35.96 ? 333 CYS A CB    1 
ATOM   3425 S  SG    . CYS B 2 333 ? -13.054 -19.689 -8.604  1.00 38.50 ? 333 CYS A SG    1 
ATOM   3426 N  N     . GLN B 2 334 ? -12.336 -20.890 -4.042  1.00 38.54 ? 334 GLN A N     1 
ATOM   3427 C  CA    . GLN B 2 334 ? -12.663 -21.249 -2.669  1.00 38.37 ? 334 GLN A CA    1 
ATOM   3428 C  C     . GLN B 2 334 ? -14.133 -20.971 -2.407  1.00 36.40 ? 334 GLN A C     1 
ATOM   3429 O  O     . GLN B 2 334 ? -14.747 -21.609 -1.551  1.00 36.57 ? 334 GLN A O     1 
ATOM   3430 C  CB    . GLN B 2 334 ? -11.805 -20.448 -1.685  1.00 38.15 ? 334 GLN A CB    1 
ATOM   3431 C  CG    . GLN B 2 334 ? -10.327 -20.443 -2.025  1.00 39.35 ? 334 GLN A CG    1 
ATOM   3432 C  CD    . GLN B 2 334 ? -9.469  -19.872 -0.914  1.00 40.09 ? 334 GLN A CD    1 
ATOM   3433 O  OE1   . GLN B 2 334 ? -8.315  -19.507 -1.138  1.00 43.65 ? 334 GLN A OE1   1 
ATOM   3434 N  NE2   . GLN B 2 334 ? -10.022 -19.803 0.292   1.00 39.67 ? 334 GLN A NE2   1 
ATOM   3435 N  N     . ILE B 2 335 ? -14.689 -20.016 -3.150  1.00 33.72 ? 335 ILE A N     1 
ATOM   3436 C  CA    . ILE B 2 335 ? -16.082 -19.640 -2.976  1.00 32.52 ? 335 ILE A CA    1 
ATOM   3437 C  C     . ILE B 2 335 ? -16.979 -20.299 -4.007  1.00 33.31 ? 335 ILE A C     1 
ATOM   3438 O  O     . ILE B 2 335 ? -16.872 -20.018 -5.194  1.00 34.31 ? 335 ILE A O     1 
ATOM   3439 C  CB    . ILE B 2 335 ? -16.273 -18.113 -3.081  1.00 31.09 ? 335 ILE A CB    1 
ATOM   3440 C  CG1   . ILE B 2 335 ? -15.292 -17.395 -2.158  1.00 31.11 ? 335 ILE A CG1   1 
ATOM   3441 C  CG2   . ILE B 2 335 ? -17.706 -17.738 -2.701  1.00 32.22 ? 335 ILE A CG2   1 
ATOM   3442 C  CD1   . ILE B 2 335 ? -15.398 -17.789 -0.715  1.00 31.09 ? 335 ILE A CD1   1 
ATOM   3443 N  N     . LYS B 2 336 ? -17.869 -21.173 -3.552  1.00 33.88 ? 336 LYS A N     1 
ATOM   3444 C  CA    . LYS B 2 336 ? -18.785 -21.852 -4.458  1.00 35.37 ? 336 LYS A CA    1 
ATOM   3445 C  C     . LYS B 2 336 ? -20.058 -21.035 -4.587  1.00 35.29 ? 336 LYS A C     1 
ATOM   3446 O  O     . LYS B 2 336 ? -20.823 -21.204 -5.540  1.00 35.39 ? 336 LYS A O     1 
ATOM   3447 C  CB    . LYS B 2 336 ? -19.109 -23.251 -3.924  1.00 35.70 ? 336 LYS A CB    1 
ATOM   3448 C  CG    . LYS B 2 336 ? -17.862 -24.097 -3.747  1.00 42.86 ? 336 LYS A CG    1 
ATOM   3449 C  CD    . LYS B 2 336 ? -18.083 -25.301 -2.851  1.00 45.73 ? 336 LYS A CD    1 
ATOM   3450 C  CE    . LYS B 2 336 ? -18.872 -26.391 -3.537  1.00 47.47 ? 336 LYS A CE    1 
ATOM   3451 N  NZ    . LYS B 2 336 ? -18.852 -27.619 -2.684  1.00 51.45 ? 336 LYS A NZ    1 
ATOM   3452 N  N     . GLU B 2 337 ? -20.265 -20.134 -3.629  1.00 35.38 ? 337 GLU A N     1 
ATOM   3453 C  CA    . GLU B 2 337 ? -21.456 -19.296 -3.596  1.00 35.79 ? 337 GLU A CA    1 
ATOM   3454 C  C     . GLU B 2 337 ? -21.283 -18.133 -2.622  1.00 35.00 ? 337 GLU A C     1 
ATOM   3455 O  O     . GLU B 2 337 ? -20.916 -18.330 -1.463  1.00 35.26 ? 337 GLU A O     1 
ATOM   3456 C  CB    . GLU B 2 337 ? -22.655 -20.150 -3.180  1.00 37.82 ? 337 GLU A CB    1 
ATOM   3457 C  CG    . GLU B 2 337 ? -23.950 -19.402 -2.985  1.00 43.16 ? 337 GLU A CG    1 
ATOM   3458 C  CD    . GLU B 2 337 ? -25.143 -20.342 -2.805  1.00 48.39 ? 337 GLU A CD    1 
ATOM   3459 O  OE1   . GLU B 2 337 ? -25.025 -21.333 -2.043  1.00 50.27 ? 337 GLU A OE1   1 
ATOM   3460 O  OE2   . GLU B 2 337 ? -26.204 -20.082 -3.418  1.00 49.31 ? 337 GLU A OE2   1 
ATOM   3461 N  N     . ILE B 2 338 ? -21.541 -16.921 -3.102  1.00 33.60 ? 338 ILE A N     1 
ATOM   3462 C  CA    . ILE B 2 338 ? -21.424 -15.730 -2.273  1.00 33.28 ? 338 ILE A CA    1 
ATOM   3463 C  C     . ILE B 2 338 ? -22.803 -15.081 -2.141  1.00 33.83 ? 338 ILE A C     1 
ATOM   3464 O  O     . ILE B 2 338 ? -23.705 -15.365 -2.935  1.00 34.86 ? 338 ILE A O     1 
ATOM   3465 C  CB    . ILE B 2 338 ? -20.396 -14.735 -2.878  1.00 32.02 ? 338 ILE A CB    1 
ATOM   3466 C  CG1   . ILE B 2 338 ? -20.055 -13.652 -1.856  1.00 32.88 ? 338 ILE A CG1   1 
ATOM   3467 C  CG2   . ILE B 2 338 ? -20.936 -14.113 -4.157  1.00 29.48 ? 338 ILE A CG2   1 
ATOM   3468 C  CD1   . ILE B 2 338 ? -18.782 -12.894 -2.185  1.00 28.74 ? 338 ILE A CD1   1 
ATOM   3469 N  N     . SER B 2 339 ? -22.972 -14.229 -1.134  1.00 32.73 ? 339 SER A N     1 
ATOM   3470 C  CA    . SER B 2 339 ? -24.253 -13.569 -0.902  1.00 33.00 ? 339 SER A CA    1 
ATOM   3471 C  C     . SER B 2 339 ? -24.623 -12.601 -2.026  1.00 33.85 ? 339 SER A C     1 
ATOM   3472 O  O     . SER B 2 339 ? -23.766 -12.143 -2.785  1.00 33.76 ? 339 SER A O     1 
ATOM   3473 C  CB    . SER B 2 339 ? -24.218 -12.804 0.420   1.00 34.51 ? 339 SER A CB    1 
ATOM   3474 O  OG    . SER B 2 339 ? -23.418 -11.637 0.307   1.00 32.67 ? 339 SER A OG    1 
ATOM   3475 N  N     . ARG B 2 340 ? -25.909 -12.288 -2.119  1.00 33.60 ? 340 ARG A N     1 
ATOM   3476 C  CA    . ARG B 2 340 ? -26.393 -11.381 -3.142  1.00 35.77 ? 340 ARG A CA    1 
ATOM   3477 C  C     . ARG B 2 340 ? -25.970 -9.948  -2.828  1.00 36.40 ? 340 ARG A C     1 
ATOM   3478 O  O     . ARG B 2 340 ? -25.644 -9.184  -3.738  1.00 34.94 ? 340 ARG A O     1 
ATOM   3479 C  CB    . ARG B 2 340 ? -27.914 -11.466 -3.239  1.00 37.89 ? 340 ARG A CB    1 
ATOM   3480 C  CG    . ARG B 2 340 ? -28.498 -10.709 -4.410  1.00 41.04 ? 340 ARG A CG    1 
ATOM   3481 C  CD    . ARG B 2 340 ? -28.958 -11.674 -5.470  1.00 45.22 ? 340 ARG A CD    1 
ATOM   3482 N  NE    . ARG B 2 340 ? -28.149 -11.619 -6.683  1.00 48.04 ? 340 ARG A NE    1 
ATOM   3483 C  CZ    . ARG B 2 340 ? -28.232 -12.517 -7.661  1.00 50.87 ? 340 ARG A CZ    1 
ATOM   3484 N  NH1   . ARG B 2 340 ? -29.086 -13.535 -7.563  1.00 51.29 ? 340 ARG A NH1   1 
ATOM   3485 N  NH2   . ARG B 2 340 ? -27.461 -12.407 -8.735  1.00 51.68 ? 340 ARG A NH2   1 
ATOM   3486 N  N     . VAL B 2 341 ? -25.981 -9.582  -1.545  1.00 36.79 ? 341 VAL A N     1 
ATOM   3487 C  CA    . VAL B 2 341 ? -25.570 -8.233  -1.142  1.00 38.38 ? 341 VAL A CA    1 
ATOM   3488 C  C     . VAL B 2 341 ? -24.076 -8.124  -0.870  1.00 37.87 ? 341 VAL A C     1 
ATOM   3489 O  O     . VAL B 2 341 ? -23.397 -9.106  -0.576  1.00 36.30 ? 341 VAL A O     1 
ATOM   3490 C  CB    . VAL B 2 341 ? -26.260 -7.741  0.164   1.00 38.58 ? 341 VAL A CB    1 
ATOM   3491 C  CG1   . VAL B 2 341 ? -27.758 -7.848  0.048   1.00 41.88 ? 341 VAL A CG1   1 
ATOM   3492 C  CG2   . VAL B 2 341 ? -25.745 -8.532  1.347   1.00 37.92 ? 341 VAL A CG2   1 
ATOM   3493 N  N     . PHE B 2 342 ? -23.590 -6.895  -0.966  1.00 38.91 ? 342 PHE A N     1 
ATOM   3494 C  CA    . PHE B 2 342 ? -22.200 -6.564  -0.695  1.00 39.71 ? 342 PHE A CA    1 
ATOM   3495 C  C     . PHE B 2 342 ? -22.241 -5.075  -0.362  1.00 40.21 ? 342 PHE A C     1 
ATOM   3496 O  O     . PHE B 2 342 ? -23.271 -4.428  -0.561  1.00 38.45 ? 342 PHE A O     1 
ATOM   3497 C  CB    . PHE B 2 342 ? -21.314 -6.872  -1.915  1.00 38.03 ? 342 PHE A CB    1 
ATOM   3498 C  CG    . PHE B 2 342 ? -21.624 -6.051  -3.133  1.00 38.36 ? 342 PHE A CG    1 
ATOM   3499 C  CD1   . PHE B 2 342 ? -20.996 -4.825  -3.344  1.00 40.11 ? 342 PHE A CD1   1 
ATOM   3500 C  CD2   . PHE B 2 342 ? -22.514 -6.517  -4.090  1.00 39.36 ? 342 PHE A CD2   1 
ATOM   3501 C  CE1   . PHE B 2 342 ? -21.250 -4.079  -4.500  1.00 39.92 ? 342 PHE A CE1   1 
ATOM   3502 C  CE2   . PHE B 2 342 ? -22.776 -5.775  -5.252  1.00 40.09 ? 342 PHE A CE2   1 
ATOM   3503 C  CZ    . PHE B 2 342 ? -22.142 -4.558  -5.454  1.00 39.20 ? 342 PHE A CZ    1 
ATOM   3504 N  N     . ARG B 2 343 ? -21.157 -4.530  0.172   1.00 42.15 ? 343 ARG A N     1 
ATOM   3505 C  CA    . ARG B 2 343 ? -21.160 -3.113  0.515   1.00 45.47 ? 343 ARG A CA    1 
ATOM   3506 C  C     . ARG B 2 343 ? -20.252 -2.260  -0.356  1.00 46.03 ? 343 ARG A C     1 
ATOM   3507 O  O     . ARG B 2 343 ? -19.067 -2.552  -0.502  1.00 47.32 ? 343 ARG A O     1 
ATOM   3508 C  CB    . ARG B 2 343 ? -20.802 -2.919  1.999   1.00 46.13 ? 343 ARG A CB    1 
ATOM   3509 C  CG    . ARG B 2 343 ? -19.687 -3.818  2.525   1.00 47.59 ? 343 ARG A CG    1 
ATOM   3510 C  CD    . ARG B 2 343 ? -19.495 -3.628  4.029   1.00 48.06 ? 343 ARG A CD    1 
ATOM   3511 N  NE    . ARG B 2 343 ? -18.773 -2.399  4.354   1.00 49.03 ? 343 ARG A NE    1 
ATOM   3512 C  CZ    . ARG B 2 343 ? -18.711 -1.855  5.569   1.00 49.77 ? 343 ARG A CZ    1 
ATOM   3513 N  NH1   . ARG B 2 343 ? -19.337 -2.418  6.596   1.00 46.95 ? 343 ARG A NH1   1 
ATOM   3514 N  NH2   . ARG B 2 343 ? -18.004 -0.749  5.763   1.00 49.44 ? 343 ARG A NH2   1 
ATOM   3515 N  N     . ARG B 2 344 ? -20.821 -1.213  -0.950  1.00 47.25 ? 344 ARG A N     1 
ATOM   3516 C  CA    . ARG B 2 344 ? -20.042 -0.305  -1.782  1.00 48.05 ? 344 ARG A CA    1 
ATOM   3517 C  C     . ARG B 2 344 ? -19.645 0.906   -0.949  1.00 47.08 ? 344 ARG A C     1 
ATOM   3518 O  O     . ARG B 2 344 ? -20.479 1.518   -0.278  1.00 47.38 ? 344 ARG A O     1 
ATOM   3519 C  CB    . ARG B 2 344 ? -20.834 0.166   -3.008  1.00 50.47 ? 344 ARG A CB    1 
ATOM   3520 C  CG    . ARG B 2 344 ? -20.041 1.167   -3.866  1.00 55.07 ? 344 ARG A CG    1 
ATOM   3521 C  CD    . ARG B 2 344 ? -20.787 1.672   -5.101  1.00 58.33 ? 344 ARG A CD    1 
ATOM   3522 N  NE    . ARG B 2 344 ? -20.847 0.679   -6.173  1.00 61.53 ? 344 ARG A NE    1 
ATOM   3523 C  CZ    . ARG B 2 344 ? -21.958 0.052   -6.555  1.00 63.34 ? 344 ARG A CZ    1 
ATOM   3524 N  NH1   . ARG B 2 344 ? -23.112 0.314   -5.949  1.00 63.54 ? 344 ARG A NH1   1 
ATOM   3525 N  NH2   . ARG B 2 344 ? -21.918 -0.837  -7.544  1.00 62.80 ? 344 ARG A NH2   1 
ATOM   3526 N  N     . MET B 2 345 ? -18.365 1.247   -0.997  1.00 46.49 ? 345 MET A N     1 
ATOM   3527 C  CA    . MET B 2 345 ? -17.856 2.384   -0.251  1.00 46.04 ? 345 MET A CA    1 
ATOM   3528 C  C     . MET B 2 345 ? -18.369 3.690   -0.842  1.00 45.28 ? 345 MET A C     1 
ATOM   3529 O  O     . MET B 2 345 ? -18.407 3.861   -2.061  1.00 44.84 ? 345 MET A O     1 
ATOM   3530 C  CB    . MET B 2 345 ? -16.328 2.373   -0.267  1.00 47.02 ? 345 MET A CB    1 
ATOM   3531 C  CG    . MET B 2 345 ? -15.683 3.445   0.590   1.00 50.61 ? 345 MET A CG    1 
ATOM   3532 S  SD    . MET B 2 345 ? -13.878 3.393   0.501   1.00 54.48 ? 345 MET A SD    1 
ATOM   3533 C  CE    . MET B 2 345 ? -13.612 4.213   -1.075  1.00 52.01 ? 345 MET A CE    1 
ATOM   3534 N  N     . GLY B 2 346 ? -18.773 4.601   0.040   1.00 44.98 ? 346 GLY A N     1 
ATOM   3535 C  CA    . GLY B 2 346 ? -19.266 5.903   -0.378  1.00 42.71 ? 346 GLY A CA    1 
ATOM   3536 C  C     . GLY B 2 346 ? -18.326 7.007   0.077   1.00 40.20 ? 346 GLY A C     1 
ATOM   3537 O  O     . GLY B 2 346 ? -17.256 6.718   0.608   1.00 41.09 ? 346 GLY A O     1 
ATOM   3538 N  N     . PRO B 2 347 ? -18.694 8.284   -0.115  1.00 39.61 ? 347 PRO A N     1 
ATOM   3539 C  CA    . PRO B 2 347 ? -17.857 9.423   0.285   1.00 38.83 ? 347 PRO A CA    1 
ATOM   3540 C  C     . PRO B 2 347 ? -17.830 9.697   1.787   1.00 39.23 ? 347 PRO A C     1 
ATOM   3541 O  O     . PRO B 2 347 ? -18.607 9.129   2.551   1.00 38.77 ? 347 PRO A O     1 
ATOM   3542 C  CB    . PRO B 2 347 ? -18.485 10.582  -0.476  1.00 38.67 ? 347 PRO A CB    1 
ATOM   3543 C  CG    . PRO B 2 347 ? -19.955 10.218  -0.439  1.00 37.39 ? 347 PRO A CG    1 
ATOM   3544 C  CD    . PRO B 2 347 ? -19.924 8.747   -0.790  1.00 38.86 ? 347 PRO A CD    1 
ATOM   3545 N  N     . GLN B 2 348 ? -16.930 10.579  2.206   1.00 40.05 ? 348 GLN A N     1 
ATOM   3546 C  CA    . GLN B 2 348 ? -16.850 10.948  3.612   1.00 42.27 ? 348 GLN A CA    1 
ATOM   3547 C  C     . GLN B 2 348 ? -18.015 11.910  3.872   1.00 42.42 ? 348 GLN A C     1 
ATOM   3548 O  O     . GLN B 2 348 ? -18.349 12.716  3.003   1.00 43.98 ? 348 GLN A O     1 
ATOM   3549 C  CB    . GLN B 2 348 ? -15.514 11.628  3.905   1.00 41.64 ? 348 GLN A CB    1 
ATOM   3550 C  CG    . GLN B 2 348 ? -14.308 10.741  3.662   1.00 44.96 ? 348 GLN A CG    1 
ATOM   3551 C  CD    . GLN B 2 348 ? -13.001 11.417  4.046   1.00 48.22 ? 348 GLN A CD    1 
ATOM   3552 O  OE1   . GLN B 2 348 ? -12.697 12.522  3.583   1.00 47.93 ? 348 GLN A OE1   1 
ATOM   3553 N  NE2   . GLN B 2 348 ? -12.217 10.754  4.895   1.00 47.78 ? 348 GLN A NE2   1 
ATOM   3554 N  N     . PHE B 2 349 ? -18.636 11.819  5.049   1.00 42.04 ? 349 PHE A N     1 
ATOM   3555 C  CA    . PHE B 2 349 ? -19.782 12.673  5.400   1.00 42.19 ? 349 PHE A CA    1 
ATOM   3556 C  C     . PHE B 2 349 ? -19.516 14.164  5.197   1.00 43.79 ? 349 PHE A C     1 
ATOM   3557 O  O     . PHE B 2 349 ? -20.441 14.960  5.054   1.00 43.69 ? 349 PHE A O     1 
ATOM   3558 C  CB    . PHE B 2 349 ? -20.216 12.421  6.861   1.00 38.69 ? 349 PHE A CB    1 
ATOM   3559 C  CG    . PHE B 2 349 ? -19.355 13.111  7.902   1.00 35.30 ? 349 PHE A CG    1 
ATOM   3560 C  CD1   . PHE B 2 349 ? -19.646 14.409  8.321   1.00 33.53 ? 349 PHE A CD1   1 
ATOM   3561 C  CD2   . PHE B 2 349 ? -18.268 12.453  8.480   1.00 34.35 ? 349 PHE A CD2   1 
ATOM   3562 C  CE1   . PHE B 2 349 ? -18.866 15.039  9.304   1.00 30.84 ? 349 PHE A CE1   1 
ATOM   3563 C  CE2   . PHE B 2 349 ? -17.482 13.073  9.464   1.00 30.21 ? 349 PHE A CE2   1 
ATOM   3564 C  CZ    . PHE B 2 349 ? -17.783 14.365  9.874   1.00 30.39 ? 349 PHE A CZ    1 
ATOM   3565 N  N     . GLU B 2 350 ? -18.241 14.522  5.177   1.00 45.34 ? 350 GLU A N     1 
ATOM   3566 C  CA    . GLU B 2 350 ? -17.803 15.898  5.016   1.00 47.92 ? 350 GLU A CA    1 
ATOM   3567 C  C     . GLU B 2 350 ? -18.358 16.612  3.772   1.00 49.42 ? 350 GLU A C     1 
ATOM   3568 O  O     . GLU B 2 350 ? -19.099 17.584  3.895   1.00 49.02 ? 350 GLU A O     1 
ATOM   3569 C  CB    . GLU B 2 350 ? -16.276 15.916  4.989   1.00 50.84 ? 350 GLU A CB    1 
ATOM   3570 C  CG    . GLU B 2 350 ? -15.623 14.910  5.952   1.00 50.04 ? 350 GLU A CG    1 
ATOM   3571 C  CD    . GLU B 2 350 ? -15.603 15.405  7.368   1.00 49.84 ? 350 GLU A CD    1 
ATOM   3572 O  OE1   . GLU B 2 350 ? -14.990 14.745  8.228   1.00 49.79 ? 350 GLU A OE1   1 
ATOM   3573 O  OE2   . GLU B 2 350 ? -16.201 16.469  7.620   1.00 53.55 ? 350 GLU A OE2   1 
ATOM   3574 N  N     . ASP B 2 351 ? -18.004 16.153  2.576   1.00 50.85 ? 351 ASP A N     1 
ATOM   3575 C  CA    . ASP B 2 351 ? -18.496 16.828  1.382   1.00 54.18 ? 351 ASP A CA    1 
ATOM   3576 C  C     . ASP B 2 351 ? -19.893 16.353  1.030   1.00 54.25 ? 351 ASP A C     1 
ATOM   3577 O  O     . ASP B 2 351 ? -20.088 15.228  0.570   1.00 54.69 ? 351 ASP A O     1 
ATOM   3578 C  CB    . ASP B 2 351 ? -17.534 16.630  0.197   1.00 57.70 ? 351 ASP A CB    1 
ATOM   3579 C  CG    . ASP B 2 351 ? -17.550 15.218  -0.349  1.00 59.38 ? 351 ASP A CG    1 
ATOM   3580 O  OD1   . ASP B 2 351 ? -17.500 14.270  0.466   1.00 60.65 ? 351 ASP A OD1   1 
ATOM   3581 O  OD2   . ASP B 2 351 ? -17.600 15.067  -1.591  1.00 58.69 ? 351 ASP A OD2   1 
ATOM   3582 N  N     . GLU B 2 352 ? -20.864 17.234  1.246   1.00 53.99 ? 352 GLU A N     1 
ATOM   3583 C  CA    . GLU B 2 352 ? -22.258 16.910  1.000   1.00 55.42 ? 352 GLU A CA    1 
ATOM   3584 C  C     . GLU B 2 352 ? -22.632 16.752  -0.463  1.00 53.84 ? 352 GLU A C     1 
ATOM   3585 O  O     . GLU B 2 352 ? -23.545 15.999  -0.790  1.00 53.56 ? 352 GLU A O     1 
ATOM   3586 C  CB    . GLU B 2 352 ? -23.169 17.953  1.663   1.00 57.17 ? 352 GLU A CB    1 
ATOM   3587 C  CG    . GLU B 2 352 ? -23.011 19.372  1.153   1.00 60.98 ? 352 GLU A CG    1 
ATOM   3588 C  CD    . GLU B 2 352 ? -23.974 20.336  1.834   1.00 64.55 ? 352 GLU A CD    1 
ATOM   3589 O  OE1   . GLU B 2 352 ? -25.193 20.041  1.847   1.00 65.98 ? 352 GLU A OE1   1 
ATOM   3590 O  OE2   . GLU B 2 352 ? -23.515 21.383  2.354   1.00 64.86 ? 352 GLU A OE2   1 
ATOM   3591 N  N     . ARG B 2 353 ? -21.931 17.449  -1.345  1.00 52.99 ? 353 ARG A N     1 
ATOM   3592 C  CA    . ARG B 2 353 ? -22.243 17.347  -2.762  1.00 53.01 ? 353 ARG A CA    1 
ATOM   3593 C  C     . ARG B 2 353 ? -22.260 15.887  -3.206  1.00 51.02 ? 353 ARG A C     1 
ATOM   3594 O  O     . ARG B 2 353 ? -23.254 15.416  -3.763  1.00 50.27 ? 353 ARG A O     1 
ATOM   3595 C  CB    . ARG B 2 353 ? -21.236 18.152  -3.593  1.00 55.56 ? 353 ARG A CB    1 
ATOM   3596 C  CG    . ARG B 2 353 ? -21.527 18.153  -5.089  1.00 58.20 ? 353 ARG A CG    1 
ATOM   3597 C  CD    . ARG B 2 353 ? -20.786 19.268  -5.834  1.00 62.92 ? 353 ARG A CD    1 
ATOM   3598 N  NE    . ARG B 2 353 ? -21.522 20.540  -5.863  1.00 67.65 ? 353 ARG A NE    1 
ATOM   3599 C  CZ    . ARG B 2 353 ? -21.584 21.427  -4.867  1.00 68.73 ? 353 ARG A CZ    1 
ATOM   3600 N  NH1   . ARG B 2 353 ? -20.946 21.214  -3.720  1.00 68.23 ? 353 ARG A NH1   1 
ATOM   3601 N  NH2   . ARG B 2 353 ? -22.297 22.538  -5.021  1.00 69.06 ? 353 ARG A NH2   1 
ATOM   3602 N  N     . ASN B 2 354 ? -21.172 15.166  -2.949  1.00 48.70 ? 354 ASN A N     1 
ATOM   3603 C  CA    . ASN B 2 354 ? -21.097 13.763  -3.341  1.00 47.45 ? 354 ASN A CA    1 
ATOM   3604 C  C     . ASN B 2 354 ? -22.004 12.862  -2.511  1.00 46.16 ? 354 ASN A C     1 
ATOM   3605 O  O     . ASN B 2 354 ? -22.533 11.866  -3.014  1.00 44.78 ? 354 ASN A O     1 
ATOM   3606 C  CB    . ASN B 2 354 ? -19.658 13.264  -3.263  1.00 47.82 ? 354 ASN A CB    1 
ATOM   3607 C  CG    . ASN B 2 354 ? -18.785 13.848  -4.355  1.00 49.75 ? 354 ASN A CG    1 
ATOM   3608 O  OD1   . ASN B 2 354 ? -17.857 14.612  -4.080  1.00 50.58 ? 354 ASN A OD1   1 
ATOM   3609 N  ND2   . ASN B 2 354 ? -19.082 13.495  -5.609  1.00 48.32 ? 354 ASN A ND2   1 
ATOM   3610 N  N     . VAL B 2 355 ? -22.178 13.205  -1.239  1.00 44.07 ? 355 VAL A N     1 
ATOM   3611 C  CA    . VAL B 2 355 ? -23.048 12.426  -0.378  1.00 41.95 ? 355 VAL A CA    1 
ATOM   3612 C  C     . VAL B 2 355 ? -24.455 12.485  -0.971  1.00 41.39 ? 355 VAL A C     1 
ATOM   3613 O  O     . VAL B 2 355 ? -25.151 11.476  -1.030  1.00 40.50 ? 355 VAL A O     1 
ATOM   3614 C  CB    . VAL B 2 355 ? -23.065 12.988  1.062   1.00 41.74 ? 355 VAL A CB    1 
ATOM   3615 C  CG1   . VAL B 2 355 ? -24.171 12.316  1.872   1.00 39.91 ? 355 VAL A CG1   1 
ATOM   3616 C  CG2   . VAL B 2 355 ? -21.716 12.759  1.718   1.00 39.07 ? 355 VAL A CG2   1 
ATOM   3617 N  N     . LYS B 2 356 ? -24.865 13.669  -1.421  1.00 41.63 ? 356 LYS A N     1 
ATOM   3618 C  CA    . LYS B 2 356 ? -26.185 13.833  -2.023  1.00 44.15 ? 356 LYS A CA    1 
ATOM   3619 C  C     . LYS B 2 356 ? -26.329 12.953  -3.257  1.00 44.59 ? 356 LYS A C     1 
ATOM   3620 O  O     . LYS B 2 356 ? -27.332 12.257  -3.418  1.00 44.12 ? 356 LYS A O     1 
ATOM   3621 C  CB    . LYS B 2 356 ? -26.431 15.293  -2.408  1.00 44.75 ? 356 LYS A CB    1 
ATOM   3622 C  CG    . LYS B 2 356 ? -26.816 16.182  -1.242  1.00 50.27 ? 356 LYS A CG    1 
ATOM   3623 C  CD    . LYS B 2 356 ? -27.090 17.616  -1.693  1.00 54.54 ? 356 LYS A CD    1 
ATOM   3624 C  CE    . LYS B 2 356 ? -28.272 17.690  -2.658  1.00 57.06 ? 356 LYS A CE    1 
ATOM   3625 N  NZ    . LYS B 2 356 ? -28.464 19.069  -3.209  1.00 58.11 ? 356 LYS A NZ    1 
ATOM   3626 N  N     . LYS B 2 357 ? -25.329 12.989  -4.132  1.00 45.25 ? 357 LYS A N     1 
ATOM   3627 C  CA    . LYS B 2 357 ? -25.368 12.174  -5.337  1.00 47.28 ? 357 LYS A CA    1 
ATOM   3628 C  C     . LYS B 2 357 ? -25.409 10.702  -4.950  1.00 46.53 ? 357 LYS A C     1 
ATOM   3629 O  O     . LYS B 2 357 ? -26.155 9.926   -5.532  1.00 46.55 ? 357 LYS A O     1 
ATOM   3630 C  CB    . LYS B 2 357 ? -24.147 12.452  -6.222  1.00 49.43 ? 357 LYS A CB    1 
ATOM   3631 C  CG    . LYS B 2 357 ? -24.134 13.852  -6.820  1.00 51.19 ? 357 LYS A CG    1 
ATOM   3632 C  CD    . LYS B 2 357 ? -22.949 14.058  -7.747  1.00 53.69 ? 357 LYS A CD    1 
ATOM   3633 C  CE    . LYS B 2 357 ? -23.041 13.157  -8.976  1.00 56.49 ? 357 LYS A CE    1 
ATOM   3634 N  NZ    . LYS B 2 357 ? -21.887 13.344  -9.905  1.00 56.25 ? 357 LYS A NZ    1 
ATOM   3635 N  N     . PHE B 2 358 ? -24.620 10.331  -3.949  1.00 46.16 ? 358 PHE A N     1 
ATOM   3636 C  CA    . PHE B 2 358 ? -24.570 8.954   -3.489  1.00 46.63 ? 358 PHE A CA    1 
ATOM   3637 C  C     . PHE B 2 358 ? -25.917 8.446   -2.981  1.00 48.47 ? 358 PHE A C     1 
ATOM   3638 O  O     . PHE B 2 358 ? -26.328 7.329   -3.301  1.00 48.64 ? 358 PHE A O     1 
ATOM   3639 C  CB    . PHE B 2 358 ? -23.544 8.816   -2.372  1.00 44.83 ? 358 PHE A CB    1 
ATOM   3640 C  CG    . PHE B 2 358 ? -23.283 7.395   -1.961  1.00 45.18 ? 358 PHE A CG    1 
ATOM   3641 C  CD1   . PHE B 2 358 ? -22.557 6.540   -2.786  1.00 43.64 ? 358 PHE A CD1   1 
ATOM   3642 C  CD2   . PHE B 2 358 ? -23.728 6.917   -0.727  1.00 44.32 ? 358 PHE A CD2   1 
ATOM   3643 C  CE1   . PHE B 2 358 ? -22.270 5.226   -2.382  1.00 42.93 ? 358 PHE A CE1   1 
ATOM   3644 C  CE2   . PHE B 2 358 ? -23.444 5.606   -0.320  1.00 42.73 ? 358 PHE A CE2   1 
ATOM   3645 C  CZ    . PHE B 2 358 ? -22.713 4.763   -1.149  1.00 40.67 ? 358 PHE A CZ    1 
ATOM   3646 N  N     . LEU B 2 359 ? -26.601 9.270   -2.193  1.00 49.30 ? 359 LEU A N     1 
ATOM   3647 C  CA    . LEU B 2 359 ? -27.885 8.890   -1.617  1.00 49.67 ? 359 LEU A CA    1 
ATOM   3648 C  C     . LEU B 2 359 ? -29.078 9.006   -2.562  1.00 51.32 ? 359 LEU A C     1 
ATOM   3649 O  O     . LEU B 2 359 ? -30.119 8.398   -2.317  1.00 51.44 ? 359 LEU A O     1 
ATOM   3650 C  CB    . LEU B 2 359 ? -28.162 9.722   -0.364  1.00 49.17 ? 359 LEU A CB    1 
ATOM   3651 C  CG    . LEU B 2 359 ? -27.093 9.805   0.728   1.00 47.79 ? 359 LEU A CG    1 
ATOM   3652 C  CD1   . LEU B 2 359 ? -27.648 10.626  1.875   1.00 46.56 ? 359 LEU A CD1   1 
ATOM   3653 C  CD2   . LEU B 2 359 ? -26.689 8.419   1.209   1.00 47.34 ? 359 LEU A CD2   1 
ATOM   3654 N  N     . SER B 2 360 ? -28.939 9.783   -3.632  1.00 54.05 ? 360 SER A N     1 
ATOM   3655 C  CA    . SER B 2 360 ? -30.039 9.956   -4.583  1.00 56.32 ? 360 SER A CA    1 
ATOM   3656 C  C     . SER B 2 360 ? -30.224 8.702   -5.418  1.00 57.42 ? 360 SER A C     1 
ATOM   3657 O  O     . SER B 2 360 ? -31.241 8.534   -6.086  1.00 58.40 ? 360 SER A O     1 
ATOM   3658 C  CB    . SER B 2 360 ? -29.769 11.140  -5.513  1.00 56.51 ? 360 SER A CB    1 
ATOM   3659 O  OG    . SER B 2 360 ? -28.659 10.882  -6.359  1.00 56.74 ? 360 SER A OG    1 
ATOM   3660 N  N     . ARG B 2 361 ? -29.228 7.827   -5.368  1.00 59.82 ? 361 ARG A N     1 
ATOM   3661 C  CA    . ARG B 2 361 ? -29.241 6.578   -6.118  1.00 61.92 ? 361 ARG A CA    1 
ATOM   3662 C  C     . ARG B 2 361 ? -30.354 5.654   -5.623  1.00 61.74 ? 361 ARG A C     1 
ATOM   3663 O  O     . ARG B 2 361 ? -30.491 5.412   -4.423  1.00 60.88 ? 361 ARG A O     1 
ATOM   3664 C  CB    . ARG B 2 361 ? -27.879 5.890   -5.970  1.00 64.60 ? 361 ARG A CB    1 
ATOM   3665 C  CG    . ARG B 2 361 ? -27.286 5.348   -7.256  1.00 69.99 ? 361 ARG A CG    1 
ATOM   3666 C  CD    . ARG B 2 361 ? -27.991 4.078   -7.725  1.00 75.28 ? 361 ARG A CD    1 
ATOM   3667 N  NE    . ARG B 2 361 ? -27.393 3.550   -8.953  1.00 78.95 ? 361 ARG A NE    1 
ATOM   3668 C  CZ    . ARG B 2 361 ? -27.387 4.191   -10.120 1.00 81.04 ? 361 ARG A CZ    1 
ATOM   3669 N  NH1   . ARG B 2 361 ? -27.953 5.390   -10.226 1.00 81.80 ? 361 ARG A NH1   1 
ATOM   3670 N  NH2   . ARG B 2 361 ? -26.794 3.645   -11.176 1.00 81.47 ? 361 ARG A NH2   1 
ATOM   3671 N  N     . ASN B 2 362 ? -31.162 5.156   -6.554  1.00 62.03 ? 362 ASN A N     1 
ATOM   3672 C  CA    . ASN B 2 362 ? -32.248 4.239   -6.217  1.00 61.66 ? 362 ASN A CA    1 
ATOM   3673 C  C     . ASN B 2 362 ? -31.609 2.957   -5.684  1.00 58.98 ? 362 ASN A C     1 
ATOM   3674 O  O     . ASN B 2 362 ? -30.880 2.269   -6.402  1.00 58.69 ? 362 ASN A O     1 
ATOM   3675 C  CB    . ASN B 2 362 ? -33.105 3.957   -7.462  1.00 64.66 ? 362 ASN A CB    1 
ATOM   3676 C  CG    . ASN B 2 362 ? -32.264 3.786   -8.742  1.00 69.92 ? 362 ASN A CG    1 
ATOM   3677 O  OD1   . ASN B 2 362 ? -31.515 4.692   -9.149  1.00 70.70 ? 362 ASN A OD1   1 
ATOM   3678 N  ND2   . ASN B 2 362 ? -32.396 2.623   -9.382  1.00 71.33 ? 362 ASN A ND2   1 
ATOM   3679 N  N     . ARG B 2 363 ? -31.870 2.647   -4.419  1.00 55.80 ? 363 ARG A N     1 
ATOM   3680 C  CA    . ARG B 2 363 ? -31.280 1.470   -3.789  1.00 52.70 ? 363 ARG A CA    1 
ATOM   3681 C  C     . ARG B 2 363 ? -32.334 0.691   -2.998  1.00 50.34 ? 363 ARG A C     1 
ATOM   3682 O  O     . ARG B 2 363 ? -33.361 1.238   -2.613  1.00 50.33 ? 363 ARG A O     1 
ATOM   3683 C  CB    . ARG B 2 363 ? -30.145 1.919   -2.865  1.00 52.43 ? 363 ARG A CB    1 
ATOM   3684 C  CG    . ARG B 2 363 ? -28.959 0.975   -2.782  1.00 52.15 ? 363 ARG A CG    1 
ATOM   3685 C  CD    . ARG B 2 363 ? -27.726 1.590   -3.438  1.00 50.43 ? 363 ARG A CD    1 
ATOM   3686 N  NE    . ARG B 2 363 ? -27.470 2.941   -2.951  1.00 48.33 ? 363 ARG A NE    1 
ATOM   3687 C  CZ    . ARG B 2 363 ? -26.453 3.699   -3.344  1.00 47.08 ? 363 ARG A CZ    1 
ATOM   3688 N  NH1   . ARG B 2 363 ? -25.585 3.243   -4.229  1.00 48.70 ? 363 ARG A NH1   1 
ATOM   3689 N  NH2   . ARG B 2 363 ? -26.310 4.919   -2.860  1.00 47.45 ? 363 ARG A NH2   1 
ATOM   3690 N  N     . ALA B 2 364 ? -32.072 -0.582  -2.740  1.00 48.51 ? 364 ALA A N     1 
ATOM   3691 C  CA    . ALA B 2 364 ? -33.029 -1.413  -2.017  1.00 47.39 ? 364 ALA A CA    1 
ATOM   3692 C  C     . ALA B 2 364 ? -32.901 -1.439  -0.501  1.00 46.38 ? 364 ALA A C     1 
ATOM   3693 O  O     . ALA B 2 364 ? -33.844 -1.835  0.178   1.00 45.65 ? 364 ALA A O     1 
ATOM   3694 C  CB    . ALA B 2 364 ? -32.973 -2.845  -2.544  1.00 47.67 ? 364 ALA A CB    1 
ATOM   3695 N  N     . PHE B 2 365 ? -31.763 -1.019  0.046   1.00 46.09 ? 365 PHE A N     1 
ATOM   3696 C  CA    . PHE B 2 365 ? -31.612 -1.078  1.492   1.00 45.86 ? 365 PHE A CA    1 
ATOM   3697 C  C     . PHE B 2 365 ? -31.306 0.168   2.322   1.00 47.75 ? 365 PHE A C     1 
ATOM   3698 O  O     . PHE B 2 365 ? -31.342 0.096   3.544   1.00 50.22 ? 365 PHE A O     1 
ATOM   3699 C  CB    . PHE B 2 365 ? -30.593 -2.159  1.856   1.00 44.31 ? 365 PHE A CB    1 
ATOM   3700 C  CG    . PHE B 2 365 ? -31.092 -3.553  1.639   1.00 42.37 ? 365 PHE A CG    1 
ATOM   3701 C  CD1   . PHE B 2 365 ? -30.736 -4.265  0.500   1.00 42.74 ? 365 PHE A CD1   1 
ATOM   3702 C  CD2   . PHE B 2 365 ? -31.939 -4.150  2.563   1.00 40.98 ? 365 PHE A CD2   1 
ATOM   3703 C  CE1   . PHE B 2 365 ? -31.218 -5.557  0.286   1.00 41.74 ? 365 PHE A CE1   1 
ATOM   3704 C  CE2   . PHE B 2 365 ? -32.425 -5.440  2.355   1.00 41.08 ? 365 PHE A CE2   1 
ATOM   3705 C  CZ    . PHE B 2 365 ? -32.062 -6.142  1.215   1.00 40.23 ? 365 PHE A CZ    1 
ATOM   3706 N  N     . ARG B 2 366 ? -31.005 1.305   1.715   1.00 47.94 ? 366 ARG A N     1 
ATOM   3707 C  CA    . ARG B 2 366 ? -30.711 2.486   2.541   1.00 49.51 ? 366 ARG A CA    1 
ATOM   3708 C  C     . ARG B 2 366 ? -29.302 2.442   3.124   1.00 47.21 ? 366 ARG A C     1 
ATOM   3709 O  O     . ARG B 2 366 ? -28.977 1.582   3.951   1.00 44.54 ? 366 ARG A O     1 
ATOM   3710 C  CB    . ARG B 2 366 ? -31.714 2.625   3.705   1.00 51.98 ? 366 ARG A CB    1 
ATOM   3711 C  CG    . ARG B 2 366 ? -31.383 3.769   4.671   1.00 59.53 ? 366 ARG A CG    1 
ATOM   3712 C  CD    . ARG B 2 366 ? -31.218 5.098   3.905   1.00 65.60 ? 366 ARG A CD    1 
ATOM   3713 N  NE    . ARG B 2 366 ? -30.709 6.202   4.724   1.00 68.73 ? 366 ARG A NE    1 
ATOM   3714 C  CZ    . ARG B 2 366 ? -30.380 7.402   4.242   1.00 69.90 ? 366 ARG A CZ    1 
ATOM   3715 N  NH1   . ARG B 2 366 ? -30.504 7.654   2.942   1.00 69.36 ? 366 ARG A NH1   1 
ATOM   3716 N  NH2   . ARG B 2 366 ? -29.931 8.352   5.058   1.00 68.95 ? 366 ARG A NH2   1 
ATOM   3717 N  N     . PRO B 2 367 ? -28.447 3.382   2.699   1.00 46.22 ? 367 PRO A N     1 
ATOM   3718 C  CA    . PRO B 2 367 ? -27.056 3.484   3.155   1.00 45.32 ? 367 PRO A CA    1 
ATOM   3719 C  C     . PRO B 2 367 ? -26.880 3.904   4.612   1.00 43.19 ? 367 PRO A C     1 
ATOM   3720 O  O     . PRO B 2 367 ? -27.719 4.587   5.187   1.00 43.60 ? 367 PRO A O     1 
ATOM   3721 C  CB    . PRO B 2 367 ? -26.441 4.484   2.171   1.00 46.65 ? 367 PRO A CB    1 
ATOM   3722 C  CG    . PRO B 2 367 ? -27.606 5.330   1.770   1.00 47.08 ? 367 PRO A CG    1 
ATOM   3723 C  CD    . PRO B 2 367 ? -28.714 4.327   1.602   1.00 45.46 ? 367 PRO A CD    1 
ATOM   3724 N  N     . PHE B 2 368 ? -25.771 3.479   5.198   1.00 40.92 ? 368 PHE A N     1 
ATOM   3725 C  CA    . PHE B 2 368 ? -25.468 3.783   6.581   1.00 39.76 ? 368 PHE A CA    1 
ATOM   3726 C  C     . PHE B 2 368 ? -24.121 4.486   6.666   1.00 39.83 ? 368 PHE A C     1 
ATOM   3727 O  O     . PHE B 2 368 ? -23.393 4.570   5.675   1.00 38.96 ? 368 PHE A O     1 
ATOM   3728 C  CB    . PHE B 2 368 ? -25.407 2.487   7.394   1.00 38.16 ? 368 PHE A CB    1 
ATOM   3729 C  CG    . PHE B 2 368 ? -24.474 1.454   6.812   1.00 36.02 ? 368 PHE A CG    1 
ATOM   3730 C  CD1   . PHE B 2 368 ? -24.869 0.667   5.732   1.00 35.57 ? 368 PHE A CD1   1 
ATOM   3731 C  CD2   . PHE B 2 368 ? -23.185 1.296   7.317   1.00 34.47 ? 368 PHE A CD2   1 
ATOM   3732 C  CE1   . PHE B 2 368 ? -23.994 -0.263  5.158   1.00 33.93 ? 368 PHE A CE1   1 
ATOM   3733 C  CE2   . PHE B 2 368 ? -22.298 0.368   6.748   1.00 34.65 ? 368 PHE A CE2   1 
ATOM   3734 C  CZ    . PHE B 2 368 ? -22.707 -0.412  5.667   1.00 33.47 ? 368 PHE A CZ    1 
ATOM   3735 N  N     . ILE B 2 369 ? -23.800 4.977   7.860   1.00 39.87 ? 369 ILE A N     1 
ATOM   3736 C  CA    . ILE B 2 369 ? -22.533 5.646   8.117   1.00 41.36 ? 369 ILE A CA    1 
ATOM   3737 C  C     . ILE B 2 369 ? -21.690 4.729   8.996   1.00 42.60 ? 369 ILE A C     1 
ATOM   3738 O  O     . ILE B 2 369 ? -22.204 4.104   9.922   1.00 43.00 ? 369 ILE A O     1 
ATOM   3739 C  CB    . ILE B 2 369 ? -22.729 6.984   8.859   1.00 40.99 ? 369 ILE A CB    1 
ATOM   3740 C  CG1   . ILE B 2 369 ? -23.408 8.001   7.938   1.00 40.36 ? 369 ILE A CG1   1 
ATOM   3741 C  CG2   . ILE B 2 369 ? -21.377 7.505   9.351   1.00 40.75 ? 369 ILE A CG2   1 
ATOM   3742 C  CD1   . ILE B 2 369 ? -23.776 9.313   8.636   1.00 39.33 ? 369 ILE A CD1   1 
ATOM   3743 N  N     . GLU B 2 370 ? -20.399 4.650   8.690   1.00 44.06 ? 370 GLU A N     1 
ATOM   3744 C  CA    . GLU B 2 370 ? -19.462 3.818   9.434   1.00 44.55 ? 370 GLU A CA    1 
ATOM   3745 C  C     . GLU B 2 370 ? -18.076 4.427   9.299   1.00 45.03 ? 370 GLU A C     1 
ATOM   3746 O  O     . GLU B 2 370 ? -17.520 4.479   8.204   1.00 44.85 ? 370 GLU A O     1 
ATOM   3747 C  CB    . GLU B 2 370 ? -19.451 2.390   8.876   1.00 45.81 ? 370 GLU A CB    1 
ATOM   3748 C  CG    . GLU B 2 370 ? -18.479 1.434   9.569   1.00 46.88 ? 370 GLU A CG    1 
ATOM   3749 C  CD    . GLU B 2 370 ? -18.388 0.080   8.872   1.00 50.52 ? 370 GLU A CD    1 
ATOM   3750 O  OE1   . GLU B 2 370 ? -19.398 -0.658  8.863   1.00 51.75 ? 370 GLU A OE1   1 
ATOM   3751 O  OE2   . GLU B 2 370 ? -17.306 -0.247  8.324   1.00 51.16 ? 370 GLU A OE2   1 
ATOM   3752 N  N     . ASN B 2 371 ? -17.537 4.894   10.421  1.00 45.56 ? 371 ASN A N     1 
ATOM   3753 C  CA    . ASN B 2 371 ? -16.214 5.504   10.478  1.00 46.85 ? 371 ASN A CA    1 
ATOM   3754 C  C     . ASN B 2 371 ? -16.041 6.813   9.728   1.00 47.23 ? 371 ASN A C     1 
ATOM   3755 O  O     . ASN B 2 371 ? -14.969 7.096   9.188   1.00 46.85 ? 371 ASN A O     1 
ATOM   3756 C  CB    . ASN B 2 371 ? -15.162 4.505   10.020  1.00 48.71 ? 371 ASN A CB    1 
ATOM   3757 C  CG    . ASN B 2 371 ? -14.907 3.449   11.051  1.00 50.90 ? 371 ASN A CG    1 
ATOM   3758 O  OD1   . ASN B 2 371 ? -14.444 3.755   12.150  1.00 52.99 ? 371 ASN A OD1   1 
ATOM   3759 N  ND2   . ASN B 2 371 ? -15.221 2.199   10.722  1.00 51.54 ? 371 ASN A ND2   1 
ATOM   3760 N  N     . GLY B 2 372 ? -17.096 7.618   9.703   1.00 47.73 ? 372 GLY A N     1 
ATOM   3761 C  CA    . GLY B 2 372 ? -17.010 8.903   9.040   1.00 47.57 ? 372 GLY A CA    1 
ATOM   3762 C  C     . GLY B 2 372 ? -17.339 8.898   7.566   1.00 47.36 ? 372 GLY A C     1 
ATOM   3763 O  O     . GLY B 2 372 ? -17.237 9.932   6.904   1.00 48.44 ? 372 GLY A O     1 
ATOM   3764 N  N     . ARG B 2 373 ? -17.722 7.748   7.028   1.00 45.95 ? 373 ARG A N     1 
ATOM   3765 C  CA    . ARG B 2 373 ? -18.062 7.720   5.620   1.00 46.24 ? 373 ARG A CA    1 
ATOM   3766 C  C     . ARG B 2 373 ? -19.297 6.894   5.329   1.00 44.95 ? 373 ARG A C     1 
ATOM   3767 O  O     . ARG B 2 373 ? -19.656 6.000   6.089   1.00 46.12 ? 373 ARG A O     1 
ATOM   3768 C  CB    . ARG B 2 373 ? -16.873 7.239   4.784   1.00 47.68 ? 373 ARG A CB    1 
ATOM   3769 C  CG    . ARG B 2 373 ? -16.499 5.784   4.919   1.00 48.36 ? 373 ARG A CG    1 
ATOM   3770 C  CD    . ARG B 2 373 ? -15.204 5.533   4.148   1.00 49.77 ? 373 ARG A CD    1 
ATOM   3771 N  NE    . ARG B 2 373 ? -15.210 6.205   2.848   1.00 49.63 ? 373 ARG A NE    1 
ATOM   3772 C  CZ    . ARG B 2 373 ? -14.254 7.029   2.422   1.00 48.66 ? 373 ARG A CZ    1 
ATOM   3773 N  NH1   . ARG B 2 373 ? -13.203 7.287   3.191   1.00 48.40 ? 373 ARG A NH1   1 
ATOM   3774 N  NH2   . ARG B 2 373 ? -14.358 7.609   1.233   1.00 46.56 ? 373 ARG A NH2   1 
ATOM   3775 N  N     . TRP B 2 374 ? -19.964 7.225   4.232   1.00 43.15 ? 374 TRP A N     1 
ATOM   3776 C  CA    . TRP B 2 374 ? -21.169 6.520   3.843   1.00 41.37 ? 374 TRP A CA    1 
ATOM   3777 C  C     . TRP B 2 374 ? -20.839 5.194   3.168   1.00 40.57 ? 374 TRP A C     1 
ATOM   3778 O  O     . TRP B 2 374 ? -19.774 5.037   2.562   1.00 38.03 ? 374 TRP A O     1 
ATOM   3779 C  CB    . TRP B 2 374 ? -22.020 7.392   2.904   1.00 40.79 ? 374 TRP A CB    1 
ATOM   3780 C  CG    . TRP B 2 374 ? -22.730 8.521   3.599   1.00 41.61 ? 374 TRP A CG    1 
ATOM   3781 C  CD1   . TRP B 2 374 ? -22.268 9.799   3.794   1.00 40.62 ? 374 TRP A CD1   1 
ATOM   3782 C  CD2   . TRP B 2 374 ? -24.016 8.459   4.234   1.00 41.86 ? 374 TRP A CD2   1 
ATOM   3783 N  NE1   . TRP B 2 374 ? -23.189 10.531  4.510   1.00 39.61 ? 374 TRP A NE1   1 
ATOM   3784 C  CE2   . TRP B 2 374 ? -24.270 9.737   4.792   1.00 40.99 ? 374 TRP A CE2   1 
ATOM   3785 C  CE3   . TRP B 2 374 ? -24.980 7.449   4.384   1.00 40.83 ? 374 TRP A CE3   1 
ATOM   3786 C  CZ2   . TRP B 2 374 ? -25.446 10.028  5.494   1.00 42.01 ? 374 TRP A CZ2   1 
ATOM   3787 C  CZ3   . TRP B 2 374 ? -26.152 7.737   5.084   1.00 41.31 ? 374 TRP A CZ3   1 
ATOM   3788 C  CH2   . TRP B 2 374 ? -26.374 9.020   5.629   1.00 42.23 ? 374 TRP A CH2   1 
ATOM   3789 N  N     . TRP B 2 375 ? -21.755 4.239   3.313   1.00 39.49 ? 375 TRP A N     1 
ATOM   3790 C  CA    . TRP B 2 375 ? -21.626 2.916   2.714   1.00 39.54 ? 375 TRP A CA    1 
ATOM   3791 C  C     . TRP B 2 375 ? -23.009 2.508   2.273   1.00 39.30 ? 375 TRP A C     1 
ATOM   3792 O  O     . TRP B 2 375 ? -24.001 2.942   2.848   1.00 40.22 ? 375 TRP A O     1 
ATOM   3793 C  CB    . TRP B 2 375 ? -21.118 1.875   3.714   1.00 38.62 ? 375 TRP A CB    1 
ATOM   3794 C  CG    . TRP B 2 375 ? -19.743 2.119   4.217   1.00 37.40 ? 375 TRP A CG    1 
ATOM   3795 C  CD1   . TRP B 2 375 ? -19.381 2.925   5.255   1.00 35.67 ? 375 TRP A CD1   1 
ATOM   3796 C  CD2   . TRP B 2 375 ? -18.531 1.570   3.688   1.00 37.07 ? 375 TRP A CD2   1 
ATOM   3797 N  NE1   . TRP B 2 375 ? -18.015 2.913   5.407   1.00 38.18 ? 375 TRP A NE1   1 
ATOM   3798 C  CE2   . TRP B 2 375 ? -17.467 2.091   4.458   1.00 36.94 ? 375 TRP A CE2   1 
ATOM   3799 C  CE3   . TRP B 2 375 ? -18.239 0.690   2.637   1.00 36.34 ? 375 TRP A CE3   1 
ATOM   3800 C  CZ2   . TRP B 2 375 ? -16.128 1.761   4.211   1.00 36.68 ? 375 TRP A CZ2   1 
ATOM   3801 C  CZ3   . TRP B 2 375 ? -16.904 0.359   2.388   1.00 35.63 ? 375 TRP A CZ3   1 
ATOM   3802 C  CH2   . TRP B 2 375 ? -15.867 0.895   3.172   1.00 36.35 ? 375 TRP A CH2   1 
ATOM   3803 N  N     . ALA B 2 376 ? -23.086 1.671   1.252   1.00 40.12 ? 376 ALA A N     1 
ATOM   3804 C  CA    . ALA B 2 376 ? -24.389 1.232   0.785   1.00 40.41 ? 376 ALA A CA    1 
ATOM   3805 C  C     . ALA B 2 376 ? -24.353 -0.240  0.418   1.00 40.88 ? 376 ALA A C     1 
ATOM   3806 O  O     . ALA B 2 376 ? -23.334 -0.740  -0.069  1.00 40.59 ? 376 ALA A O     1 
ATOM   3807 C  CB    . ALA B 2 376 ? -24.825 2.066   -0.413  1.00 38.08 ? 376 ALA A CB    1 
ATOM   3808 N  N     . PHE B 2 377 ? -25.459 -0.930  0.690   1.00 41.45 ? 377 PHE A N     1 
ATOM   3809 C  CA    . PHE B 2 377 ? -25.593 -2.344  0.359   1.00 41.91 ? 377 PHE A CA    1 
ATOM   3810 C  C     . PHE B 2 377 ? -26.091 -2.411  -1.084  1.00 44.84 ? 377 PHE A C     1 
ATOM   3811 O  O     . PHE B 2 377 ? -27.143 -1.854  -1.420  1.00 45.33 ? 377 PHE A O     1 
ATOM   3812 C  CB    . PHE B 2 377 ? -26.605 -3.036  1.282   1.00 37.86 ? 377 PHE A CB    1 
ATOM   3813 C  CG    . PHE B 2 377 ? -26.118 -3.231  2.695   1.00 36.32 ? 377 PHE A CG    1 
ATOM   3814 C  CD1   . PHE B 2 377 ? -26.869 -2.768  3.774   1.00 35.49 ? 377 PHE A CD1   1 
ATOM   3815 C  CD2   . PHE B 2 377 ? -24.929 -3.909  2.949   1.00 34.50 ? 377 PHE A CD2   1 
ATOM   3816 C  CE1   . PHE B 2 377 ? -26.445 -2.982  5.082   1.00 35.59 ? 377 PHE A CE1   1 
ATOM   3817 C  CE2   . PHE B 2 377 ? -24.496 -4.127  4.246   1.00 33.26 ? 377 PHE A CE2   1 
ATOM   3818 C  CZ    . PHE B 2 377 ? -25.252 -3.666  5.317   1.00 35.30 ? 377 PHE A CZ    1 
ATOM   3819 N  N     . GLU B 2 378 ? -25.322 -3.084  -1.933  1.00 47.46 ? 378 GLU A N     1 
ATOM   3820 C  CA    . GLU B 2 378 ? -25.670 -3.225  -3.334  1.00 50.03 ? 378 GLU A CA    1 
ATOM   3821 C  C     . GLU B 2 378 ? -25.911 -4.705  -3.608  1.00 50.00 ? 378 GLU A C     1 
ATOM   3822 O  O     . GLU B 2 378 ? -25.518 -5.557  -2.806  1.00 50.38 ? 378 GLU A O     1 
ATOM   3823 C  CB    . GLU B 2 378 ? -24.523 -2.696  -4.199  1.00 53.83 ? 378 GLU A CB    1 
ATOM   3824 C  CG    . GLU B 2 378 ? -24.966 -2.074  -5.523  1.00 59.67 ? 378 GLU A CG    1 
ATOM   3825 C  CD    . GLU B 2 378 ? -25.880 -0.865  -5.334  1.00 62.53 ? 378 GLU A CD    1 
ATOM   3826 O  OE1   . GLU B 2 378 ? -25.438 0.128   -4.704  1.00 61.78 ? 378 GLU A OE1   1 
ATOM   3827 O  OE2   . GLU B 2 378 ? -27.038 -0.914  -5.818  1.00 63.68 ? 378 GLU A OE2   1 
ATOM   3828 N  N     . MET B 2 379 ? -26.563 -5.010  -4.728  1.00 49.27 ? 379 MET A N     1 
ATOM   3829 C  CA    . MET B 2 379 ? -26.848 -6.396  -5.094  1.00 48.72 ? 379 MET A CA    1 
ATOM   3830 C  C     . MET B 2 379 ? -25.971 -6.867  -6.252  1.00 47.53 ? 379 MET A C     1 
ATOM   3831 O  O     . MET B 2 379 ? -25.730 -6.125  -7.199  1.00 47.16 ? 379 MET A O     1 
ATOM   3832 C  CB    . MET B 2 379 ? -28.324 -6.557  -5.482  1.00 50.66 ? 379 MET A CB    1 
ATOM   3833 C  CG    . MET B 2 379 ? -29.315 -6.311  -4.348  1.00 53.71 ? 379 MET A CG    1 
ATOM   3834 S  SD    . MET B 2 379 ? -29.197 -7.556  -3.027  1.00 60.93 ? 379 MET A SD    1 
ATOM   3835 C  CE    . MET B 2 379 ? -30.866 -8.263  -3.045  1.00 59.21 ? 379 MET A CE    1 
ATOM   3836 N  N     . ARG B 2 380 ? -25.482 -8.100  -6.156  1.00 47.21 ? 380 ARG A N     1 
ATOM   3837 C  CA    . ARG B 2 380 ? -24.656 -8.694  -7.208  1.00 45.96 ? 380 ARG A CA    1 
ATOM   3838 C  C     . ARG B 2 380 ? -25.572 -9.188  -8.321  1.00 45.72 ? 380 ARG A C     1 
ATOM   3839 O  O     . ARG B 2 380 ? -26.769 -9.371  -8.112  1.00 45.27 ? 380 ARG A O     1 
ATOM   3840 C  CB    . ARG B 2 380 ? -23.875 -9.906  -6.689  1.00 43.64 ? 380 ARG A CB    1 
ATOM   3841 C  CG    . ARG B 2 380 ? -22.771 -9.611  -5.716  1.00 41.03 ? 380 ARG A CG    1 
ATOM   3842 C  CD    . ARG B 2 380 ? -21.886 -10.832 -5.536  1.00 39.15 ? 380 ARG A CD    1 
ATOM   3843 N  NE    . ARG B 2 380 ? -20.638 -10.466 -4.874  1.00 41.68 ? 380 ARG A NE    1 
ATOM   3844 C  CZ    . ARG B 2 380 ? -20.527 -10.191 -3.578  1.00 42.17 ? 380 ARG A CZ    1 
ATOM   3845 N  NH1   . ARG B 2 380 ? -21.596 -10.256 -2.785  1.00 41.93 ? 380 ARG A NH1   1 
ATOM   3846 N  NH2   . ARG B 2 380 ? -19.353 -9.807  -3.084  1.00 41.27 ? 380 ARG A NH2   1 
ATOM   3847 N  N     . LYS B 2 381 ? -25.004 -9.422  -9.497  1.00 47.48 ? 381 LYS A N     1 
ATOM   3848 C  CA    . LYS B 2 381 ? -25.787 -9.926  -10.615 1.00 48.43 ? 381 LYS A CA    1 
ATOM   3849 C  C     . LYS B 2 381 ? -25.643 -11.447 -10.696 1.00 46.21 ? 381 LYS A C     1 
ATOM   3850 O  O     . LYS B 2 381 ? -26.396 -12.112 -11.405 1.00 46.68 ? 381 LYS A O     1 
ATOM   3851 C  CB    . LYS B 2 381 ? -25.351 -9.253  -11.928 1.00 52.11 ? 381 LYS A CB    1 
ATOM   3852 C  CG    . LYS B 2 381 ? -25.477 -7.717  -11.901 1.00 56.62 ? 381 LYS A CG    1 
ATOM   3853 C  CD    . LYS B 2 381 ? -26.845 -7.273  -11.343 1.00 60.08 ? 381 LYS A CD    1 
ATOM   3854 C  CE    . LYS B 2 381 ? -26.936 -5.758  -11.108 1.00 60.98 ? 381 LYS A CE    1 
ATOM   3855 N  NZ    . LYS B 2 381 ? -28.202 -5.393  -10.380 1.00 60.35 ? 381 LYS A NZ    1 
ATOM   3856 N  N     . PHE B 2 382 ? -24.675 -11.990 -9.961  1.00 43.48 ? 382 PHE A N     1 
ATOM   3857 C  CA    . PHE B 2 382 ? -24.457 -13.440 -9.914  1.00 43.22 ? 382 PHE A CA    1 
ATOM   3858 C  C     . PHE B 2 382 ? -23.827 -13.864 -8.591  1.00 41.30 ? 382 PHE A C     1 
ATOM   3859 O  O     . PHE B 2 382 ? -22.968 -13.174 -8.046  1.00 41.68 ? 382 PHE A O     1 
ATOM   3860 C  CB    . PHE B 2 382 ? -23.591 -13.912 -11.090 1.00 42.34 ? 382 PHE A CB    1 
ATOM   3861 C  CG    . PHE B 2 382 ? -22.445 -13.014 -11.391 1.00 42.84 ? 382 PHE A CG    1 
ATOM   3862 C  CD1   . PHE B 2 382 ? -21.385 -12.892 -10.498 1.00 43.10 ? 382 PHE A CD1   1 
ATOM   3863 C  CD2   . PHE B 2 382 ? -22.444 -12.244 -12.551 1.00 43.32 ? 382 PHE A CD2   1 
ATOM   3864 C  CE1   . PHE B 2 382 ? -20.339 -12.008 -10.755 1.00 43.95 ? 382 PHE A CE1   1 
ATOM   3865 C  CE2   . PHE B 2 382 ? -21.399 -11.354 -12.817 1.00 42.71 ? 382 PHE A CE2   1 
ATOM   3866 C  CZ    . PHE B 2 382 ? -20.349 -11.237 -11.919 1.00 42.59 ? 382 PHE A CZ    1 
ATOM   3867 N  N     . THR B 2 383 ? -24.258 -15.015 -8.087  1.00 39.65 ? 383 THR A N     1 
ATOM   3868 C  CA    . THR B 2 383 ? -23.775 -15.523 -6.814  1.00 37.19 ? 383 THR A CA    1 
ATOM   3869 C  C     . THR B 2 383 ? -22.863 -16.755 -6.876  1.00 36.85 ? 383 THR A C     1 
ATOM   3870 O  O     . THR B 2 383 ? -22.452 -17.275 -5.839  1.00 37.03 ? 383 THR A O     1 
ATOM   3871 C  CB    . THR B 2 383 ? -24.959 -15.847 -5.911  1.00 37.25 ? 383 THR A CB    1 
ATOM   3872 O  OG1   . THR B 2 383 ? -25.700 -16.938 -6.472  1.00 36.17 ? 383 THR A OG1   1 
ATOM   3873 C  CG2   . THR B 2 383 ? -25.869 -14.639 -5.793  1.00 35.12 ? 383 THR A CG2   1 
ATOM   3874 N  N     . THR B 2 384 ? -22.558 -17.242 -8.074  1.00 35.56 ? 384 THR A N     1 
ATOM   3875 C  CA    . THR B 2 384 ? -21.669 -18.396 -8.183  1.00 33.93 ? 384 THR A CA    1 
ATOM   3876 C  C     . THR B 2 384 ? -20.590 -18.126 -9.228  1.00 32.98 ? 384 THR A C     1 
ATOM   3877 O  O     . THR B 2 384 ? -20.795 -17.336 -10.157 1.00 32.72 ? 384 THR A O     1 
ATOM   3878 C  CB    . THR B 2 384 ? -22.438 -19.694 -8.557  1.00 33.69 ? 384 THR A CB    1 
ATOM   3879 O  OG1   . THR B 2 384 ? -22.782 -19.678 -9.946  1.00 35.39 ? 384 THR A OG1   1 
ATOM   3880 C  CG2   . THR B 2 384 ? -23.703 -19.820 -7.726  1.00 30.62 ? 384 THR A CG2   1 
ATOM   3881 N  N     . PRO B 2 385 ? -19.416 -18.762 -9.077  1.00 31.25 ? 385 PRO A N     1 
ATOM   3882 C  CA    . PRO B 2 385 ? -18.300 -18.592 -10.012 1.00 31.11 ? 385 PRO A CA    1 
ATOM   3883 C  C     . PRO B 2 385 ? -18.714 -18.913 -11.450 1.00 31.37 ? 385 PRO A C     1 
ATOM   3884 O  O     . PRO B 2 385 ? -18.369 -18.193 -12.385 1.00 29.86 ? 385 PRO A O     1 
ATOM   3885 C  CB    . PRO B 2 385 ? -17.260 -19.583 -9.493  1.00 28.90 ? 385 PRO A CB    1 
ATOM   3886 C  CG    . PRO B 2 385 ? -17.545 -19.658 -8.069  1.00 29.86 ? 385 PRO A CG    1 
ATOM   3887 C  CD    . PRO B 2 385 ? -19.043 -19.686 -7.993  1.00 30.05 ? 385 PRO A CD    1 
ATOM   3888 N  N     . GLU B 2 386 ? -19.455 -20.007 -11.606 1.00 33.25 ? 386 GLU A N     1 
ATOM   3889 C  CA    . GLU B 2 386 ? -19.923 -20.454 -12.912 1.00 34.50 ? 386 GLU A CA    1 
ATOM   3890 C  C     . GLU B 2 386 ? -20.879 -19.448 -13.543 1.00 34.63 ? 386 GLU A C     1 
ATOM   3891 O  O     . GLU B 2 386 ? -20.809 -19.192 -14.740 1.00 35.56 ? 386 GLU A O     1 
ATOM   3892 C  CB    . GLU B 2 386 ? -20.593 -21.831 -12.786 1.00 34.60 ? 386 GLU A CB    1 
ATOM   3893 C  CG    . GLU B 2 386 ? -19.656 -22.921 -12.247 1.00 37.15 ? 386 GLU A CG    1 
ATOM   3894 C  CD    . GLU B 2 386 ? -19.738 -23.119 -10.723 1.00 40.69 ? 386 GLU A CD    1 
ATOM   3895 O  OE1   . GLU B 2 386 ? -19.931 -22.126 -9.978  1.00 39.08 ? 386 GLU A OE1   1 
ATOM   3896 O  OE2   . GLU B 2 386 ? -19.594 -24.282 -10.271 1.00 39.58 ? 386 GLU A OE2   1 
ATOM   3897 N  N     . GLU B 2 387 ? -21.762 -18.870 -12.735 1.00 35.95 ? 387 GLU A N     1 
ATOM   3898 C  CA    . GLU B 2 387 ? -22.713 -17.882 -13.231 1.00 37.21 ? 387 GLU A CA    1 
ATOM   3899 C  C     . GLU B 2 387 ? -21.995 -16.657 -13.769 1.00 36.64 ? 387 GLU A C     1 
ATOM   3900 O  O     . GLU B 2 387 ? -22.348 -16.145 -14.827 1.00 38.33 ? 387 GLU A O     1 
ATOM   3901 C  CB    . GLU B 2 387 ? -23.670 -17.450 -12.123 1.00 39.04 ? 387 GLU A CB    1 
ATOM   3902 C  CG    . GLU B 2 387 ? -24.865 -18.368 -11.914 1.00 47.58 ? 387 GLU A CG    1 
ATOM   3903 C  CD    . GLU B 2 387 ? -25.659 -18.029 -10.644 1.00 51.78 ? 387 GLU A CD    1 
ATOM   3904 O  OE1   . GLU B 2 387 ? -25.810 -16.815 -10.336 1.00 51.98 ? 387 GLU A OE1   1 
ATOM   3905 O  OE2   . GLU B 2 387 ? -26.136 -18.979 -9.969  1.00 50.98 ? 387 GLU A OE2   1 
ATOM   3906 N  N     . GLY B 2 388 ? -20.991 -16.187 -13.033 1.00 36.24 ? 388 GLY A N     1 
ATOM   3907 C  CA    . GLY B 2 388 ? -20.240 -15.016 -13.451 1.00 33.82 ? 388 GLY A CA    1 
ATOM   3908 C  C     . GLY B 2 388 ? -19.421 -15.261 -14.707 1.00 34.12 ? 388 GLY A C     1 
ATOM   3909 O  O     . GLY B 2 388 ? -19.388 -14.419 -15.608 1.00 33.95 ? 388 GLY A O     1 
ATOM   3910 N  N     . VAL B 2 389 ? -18.753 -16.410 -14.779 1.00 32.49 ? 389 VAL A N     1 
ATOM   3911 C  CA    . VAL B 2 389 ? -17.949 -16.723 -15.952 1.00 31.79 ? 389 VAL A CA    1 
ATOM   3912 C  C     . VAL B 2 389 ? -18.843 -16.867 -17.184 1.00 32.92 ? 389 VAL A C     1 
ATOM   3913 O  O     . VAL B 2 389 ? -18.472 -16.450 -18.284 1.00 32.02 ? 389 VAL A O     1 
ATOM   3914 C  CB    . VAL B 2 389 ? -17.128 -18.023 -15.749 1.00 31.25 ? 389 VAL A CB    1 
ATOM   3915 C  CG1   . VAL B 2 389 ? -16.477 -18.445 -17.059 1.00 29.85 ? 389 VAL A CG1   1 
ATOM   3916 C  CG2   . VAL B 2 389 ? -16.057 -17.798 -14.700 1.00 27.22 ? 389 VAL A CG2   1 
ATOM   3917 N  N     . ARG B 2 390 ? -20.028 -17.445 -17.002 1.00 34.10 ? 390 ARG A N     1 
ATOM   3918 C  CA    . ARG B 2 390 ? -20.943 -17.615 -18.126 1.00 35.34 ? 390 ARG A CA    1 
ATOM   3919 C  C     . ARG B 2 390 ? -21.249 -16.243 -18.687 1.00 34.36 ? 390 ARG A C     1 
ATOM   3920 O  O     . ARG B 2 390 ? -21.312 -16.050 -19.903 1.00 35.57 ? 390 ARG A O     1 
ATOM   3921 C  CB    . ARG B 2 390 ? -22.248 -18.270 -17.683 1.00 36.73 ? 390 ARG A CB    1 
ATOM   3922 C  CG    . ARG B 2 390 ? -23.238 -18.451 -18.810 1.00 39.24 ? 390 ARG A CG    1 
ATOM   3923 C  CD    . ARG B 2 390 ? -24.667 -18.359 -18.303 1.00 46.18 ? 390 ARG A CD    1 
ATOM   3924 N  NE    . ARG B 2 390 ? -25.045 -19.494 -17.462 1.00 51.64 ? 390 ARG A NE    1 
ATOM   3925 C  CZ    . ARG B 2 390 ? -25.582 -19.385 -16.248 1.00 52.70 ? 390 ARG A CZ    1 
ATOM   3926 N  NH1   . ARG B 2 390 ? -25.804 -18.185 -15.719 1.00 50.78 ? 390 ARG A NH1   1 
ATOM   3927 N  NH2   . ARG B 2 390 ? -25.904 -20.480 -15.564 1.00 52.70 ? 390 ARG A NH2   1 
ATOM   3928 N  N     . SER B 2 391 ? -21.421 -15.292 -17.781 1.00 31.46 ? 391 SER A N     1 
ATOM   3929 C  CA    . SER B 2 391 ? -21.731 -13.922 -18.151 1.00 32.28 ? 391 SER A CA    1 
ATOM   3930 C  C     . SER B 2 391 ? -20.532 -13.221 -18.765 1.00 33.07 ? 391 SER A C     1 
ATOM   3931 O  O     . SER B 2 391 ? -20.652 -12.551 -19.806 1.00 32.87 ? 391 SER A O     1 
ATOM   3932 C  CB    . SER B 2 391 ? -22.202 -13.143 -16.918 1.00 33.89 ? 391 SER A CB    1 
ATOM   3933 O  OG    . SER B 2 391 ? -22.403 -11.782 -17.229 1.00 32.99 ? 391 SER A OG    1 
ATOM   3934 N  N     . TYR B 2 392 ? -19.377 -13.372 -18.117 1.00 31.57 ? 392 TYR A N     1 
ATOM   3935 C  CA    . TYR B 2 392 ? -18.149 -12.748 -18.595 1.00 31.71 ? 392 TYR A CA    1 
ATOM   3936 C  C     . TYR B 2 392 ? -17.795 -13.241 -19.997 1.00 31.70 ? 392 TYR A C     1 
ATOM   3937 O  O     . TYR B 2 392 ? -17.642 -12.446 -20.919 1.00 29.68 ? 392 TYR A O     1 
ATOM   3938 C  CB    . TYR B 2 392 ? -16.989 -13.044 -17.632 1.00 33.11 ? 392 TYR A CB    1 
ATOM   3939 C  CG    . TYR B 2 392 ? -15.683 -12.397 -18.033 1.00 32.79 ? 392 TYR A CG    1 
ATOM   3940 C  CD1   . TYR B 2 392 ? -15.521 -11.009 -17.979 1.00 33.31 ? 392 TYR A CD1   1 
ATOM   3941 C  CD2   . TYR B 2 392 ? -14.620 -13.166 -18.506 1.00 35.28 ? 392 TYR A CD2   1 
ATOM   3942 C  CE1   . TYR B 2 392 ? -14.337 -10.402 -18.390 1.00 31.58 ? 392 TYR A CE1   1 
ATOM   3943 C  CE2   . TYR B 2 392 ? -13.426 -12.569 -18.921 1.00 33.87 ? 392 TYR A CE2   1 
ATOM   3944 C  CZ    . TYR B 2 392 ? -13.296 -11.189 -18.859 1.00 32.99 ? 392 TYR A CZ    1 
ATOM   3945 O  OH    . TYR B 2 392 ? -12.122 -10.606 -19.257 1.00 31.94 ? 392 TYR A OH    1 
ATOM   3946 N  N     . ALA B 2 393 ? -17.689 -14.558 -20.154 1.00 31.29 ? 393 ALA A N     1 
ATOM   3947 C  CA    . ALA B 2 393 ? -17.334 -15.147 -21.436 1.00 32.00 ? 393 ALA A CA    1 
ATOM   3948 C  C     . ALA B 2 393 ? -18.318 -14.831 -22.559 1.00 32.96 ? 393 ALA A C     1 
ATOM   3949 O  O     . ALA B 2 393 ? -17.956 -14.903 -23.731 1.00 35.54 ? 393 ALA A O     1 
ATOM   3950 C  CB    . ALA B 2 393 ? -17.173 -16.661 -21.292 1.00 31.50 ? 393 ALA A CB    1 
ATOM   3951 N  N     . SER B 2 394 ? -19.554 -14.485 -22.219 1.00 31.52 ? 394 SER A N     1 
ATOM   3952 C  CA    . SER B 2 394 ? -20.540 -14.172 -23.247 1.00 32.34 ? 394 SER A CA    1 
ATOM   3953 C  C     . SER B 2 394 ? -20.438 -12.747 -23.777 1.00 32.83 ? 394 SER A C     1 
ATOM   3954 O  O     . SER B 2 394 ? -20.674 -12.499 -24.961 1.00 31.98 ? 394 SER A O     1 
ATOM   3955 C  CB    . SER B 2 394 ? -21.962 -14.392 -22.723 1.00 31.66 ? 394 SER A CB    1 
ATOM   3956 O  OG    . SER B 2 394 ? -22.251 -15.768 -22.594 1.00 31.95 ? 394 SER A OG    1 
ATOM   3957 N  N     . THR B 2 395 ? -20.089 -11.814 -22.898 1.00 34.27 ? 395 THR A N     1 
ATOM   3958 C  CA    . THR B 2 395 ? -19.996 -10.414 -23.286 1.00 35.51 ? 395 THR A CA    1 
ATOM   3959 C  C     . THR B 2 395 ? -18.585 -9.925  -23.549 1.00 35.04 ? 395 THR A C     1 
ATOM   3960 O  O     . THR B 2 395 ? -18.403 -8.950  -24.263 1.00 36.22 ? 395 THR A O     1 
ATOM   3961 C  CB    . THR B 2 395 ? -20.630 -9.501  -22.222 1.00 35.85 ? 395 THR A CB    1 
ATOM   3962 O  OG1   . THR B 2 395 ? -19.989 -9.726  -20.964 1.00 38.29 ? 395 THR A OG1   1 
ATOM   3963 C  CG2   . THR B 2 395 ? -22.114 -9.793  -22.084 1.00 36.22 ? 395 THR A CG2   1 
ATOM   3964 N  N     . HIS B 2 396 ? -17.588 -10.595 -22.982 1.00 35.99 ? 396 HIS A N     1 
ATOM   3965 C  CA    . HIS B 2 396 ? -16.203 -10.181 -23.186 1.00 36.35 ? 396 HIS A CA    1 
ATOM   3966 C  C     . HIS B 2 396 ? -15.364 -11.165 -23.984 1.00 36.07 ? 396 HIS A C     1 
ATOM   3967 O  O     . HIS B 2 396 ? -14.142 -11.175 -23.853 1.00 35.80 ? 396 HIS A O     1 
ATOM   3968 C  CB    . HIS B 2 396 ? -15.508 -9.928  -21.849 1.00 37.31 ? 396 HIS A CB    1 
ATOM   3969 C  CG    . HIS B 2 396 ? -16.096 -8.803  -21.059 1.00 40.88 ? 396 HIS A CG    1 
ATOM   3970 N  ND1   . HIS B 2 396 ? -15.319 -7.891  -20.375 1.00 40.20 ? 396 HIS A ND1   1 
ATOM   3971 C  CD2   . HIS B 2 396 ? -17.383 -8.480  -20.786 1.00 41.78 ? 396 HIS A CD2   1 
ATOM   3972 C  CE1   . HIS B 2 396 ? -16.102 -7.060  -19.713 1.00 40.11 ? 396 HIS A CE1   1 
ATOM   3973 N  NE2   . HIS B 2 396 ? -17.358 -7.396  -19.944 1.00 42.74 ? 396 HIS A NE2   1 
ATOM   3974 N  N     . TRP B 2 397 ? -16.009 -11.988 -24.807 1.00 36.70 ? 397 TRP A N     1 
ATOM   3975 C  CA    . TRP B 2 397 ? -15.288 -12.965 -25.621 1.00 36.20 ? 397 TRP A CA    1 
ATOM   3976 C  C     . TRP B 2 397 ? -14.237 -12.287 -26.488 1.00 36.14 ? 397 TRP A C     1 
ATOM   3977 O  O     . TRP B 2 397 ? -13.196 -12.870 -26.776 1.00 36.92 ? 397 TRP A O     1 
ATOM   3978 C  CB    . TRP B 2 397 ? -16.248 -13.734 -26.538 1.00 36.31 ? 397 TRP A CB    1 
ATOM   3979 C  CG    . TRP B 2 397 ? -17.091 -12.823 -27.364 1.00 38.02 ? 397 TRP A CG    1 
ATOM   3980 C  CD1   . TRP B 2 397 ? -18.292 -12.274 -27.006 1.00 37.41 ? 397 TRP A CD1   1 
ATOM   3981 C  CD2   . TRP B 2 397 ? -16.738 -12.231 -28.625 1.00 37.54 ? 397 TRP A CD2   1 
ATOM   3982 N  NE1   . TRP B 2 397 ? -18.702 -11.372 -27.959 1.00 38.20 ? 397 TRP A NE1   1 
ATOM   3983 C  CE2   . TRP B 2 397 ? -17.770 -11.322 -28.962 1.00 38.21 ? 397 TRP A CE2   1 
ATOM   3984 C  CE3   . TRP B 2 397 ? -15.649 -12.372 -29.496 1.00 36.84 ? 397 TRP A CE3   1 
ATOM   3985 C  CZ2   . TRP B 2 397 ? -17.744 -10.553 -30.137 1.00 37.73 ? 397 TRP A CZ2   1 
ATOM   3986 C  CZ3   . TRP B 2 397 ? -15.622 -11.605 -30.668 1.00 38.30 ? 397 TRP A CZ3   1 
ATOM   3987 C  CH2   . TRP B 2 397 ? -16.667 -10.706 -30.974 1.00 38.22 ? 397 TRP A CH2   1 
ATOM   3988 N  N     . HIS B 2 398 ? -14.497 -11.055 -26.907 1.00 36.37 ? 398 HIS A N     1 
ATOM   3989 C  CA    . HIS B 2 398 ? -13.540 -10.384 -27.770 1.00 38.10 ? 398 HIS A CA    1 
ATOM   3990 C  C     . HIS B 2 398 ? -12.182 -10.153 -27.135 1.00 36.86 ? 398 HIS A C     1 
ATOM   3991 O  O     . HIS B 2 398 ? -11.182 -10.045 -27.831 1.00 38.51 ? 398 HIS A O     1 
ATOM   3992 C  CB    . HIS B 2 398 ? -14.088 -9.056  -28.287 1.00 39.26 ? 398 HIS A CB    1 
ATOM   3993 C  CG    . HIS B 2 398 ? -13.153 -8.363  -29.230 1.00 46.33 ? 398 HIS A CG    1 
ATOM   3994 N  ND1   . HIS B 2 398 ? -12.160 -7.505  -28.802 1.00 48.72 ? 398 HIS A ND1   1 
ATOM   3995 C  CD2   . HIS B 2 398 ? -13.009 -8.461  -30.575 1.00 47.03 ? 398 HIS A CD2   1 
ATOM   3996 C  CE1   . HIS B 2 398 ? -11.447 -7.104  -29.840 1.00 47.95 ? 398 HIS A CE1   1 
ATOM   3997 N  NE2   . HIS B 2 398 ? -11.941 -7.670  -30.928 1.00 47.37 ? 398 HIS A NE2   1 
ATOM   3998 N  N     . THR B 2 399 ? -12.136 -10.095 -25.814 1.00 36.32 ? 399 THR A N     1 
ATOM   3999 C  CA    . THR B 2 399 ? -10.875 -9.859  -25.124 1.00 35.41 ? 399 THR A CA    1 
ATOM   4000 C  C     . THR B 2 399 ? -10.190 -11.164 -24.711 1.00 35.32 ? 399 THR A C     1 
ATOM   4001 O  O     . THR B 2 399 ? -9.214  -11.143 -23.974 1.00 36.70 ? 399 THR A O     1 
ATOM   4002 C  CB    . THR B 2 399 ? -11.101 -8.965  -23.864 1.00 35.07 ? 399 THR A CB    1 
ATOM   4003 O  OG1   . THR B 2 399 ? -9.856  -8.411  -23.445 1.00 34.24 ? 399 THR A OG1   1 
ATOM   4004 C  CG2   . THR B 2 399 ? -11.695 -9.773  -22.708 1.00 32.95 ? 399 THR A CG2   1 
ATOM   4005 N  N     . LEU B 2 400 ? -10.692 -12.293 -25.198 1.00 34.99 ? 400 LEU A N     1 
ATOM   4006 C  CA    . LEU B 2 400 ? -10.128 -13.588 -24.842 1.00 36.76 ? 400 LEU A CA    1 
ATOM   4007 C  C     . LEU B 2 400 ? -9.229  -14.182 -25.919 1.00 39.50 ? 400 LEU A C     1 
ATOM   4008 O  O     . LEU B 2 400 ? -9.138  -15.409 -26.054 1.00 42.16 ? 400 LEU A O     1 
ATOM   4009 C  CB    . LEU B 2 400 ? -11.253 -14.576 -24.544 1.00 35.59 ? 400 LEU A CB    1 
ATOM   4010 C  CG    . LEU B 2 400 ? -12.292 -14.137 -23.513 1.00 35.99 ? 400 LEU A CG    1 
ATOM   4011 C  CD1   . LEU B 2 400 ? -13.254 -15.291 -23.228 1.00 34.09 ? 400 LEU A CD1   1 
ATOM   4012 C  CD2   . LEU B 2 400 ? -11.587 -13.692 -22.247 1.00 33.36 ? 400 LEU A CD2   1 
ATOM   4013 N  N     . GLY B 2 401 ? -8.555  -13.328 -26.680 1.00 39.69 ? 401 GLY A N     1 
ATOM   4014 C  CA    . GLY B 2 401 ? -7.703  -13.834 -27.739 1.00 38.00 ? 401 GLY A CA    1 
ATOM   4015 C  C     . GLY B 2 401 ? -8.445  -13.800 -29.064 1.00 39.37 ? 401 GLY A C     1 
ATOM   4016 O  O     . GLY B 2 401 ? -9.641  -14.112 -29.149 1.00 36.85 ? 401 GLY A O     1 
ATOM   4017 N  N     . LYS B 2 402 ? -7.721  -13.421 -30.109 1.00 38.65 ? 402 LYS A N     1 
ATOM   4018 C  CA    . LYS B 2 402 ? -8.274  -13.309 -31.445 1.00 38.58 ? 402 LYS A CA    1 
ATOM   4019 C  C     . LYS B 2 402 ? -9.061  -14.539 -31.914 1.00 38.34 ? 402 LYS A C     1 
ATOM   4020 O  O     . LYS B 2 402 ? -10.223 -14.429 -32.307 1.00 38.37 ? 402 LYS A O     1 
ATOM   4021 C  CB    . LYS B 2 402 ? -7.136  -13.005 -32.419 1.00 40.49 ? 402 LYS A CB    1 
ATOM   4022 C  CG    . LYS B 2 402 ? -7.537  -12.851 -33.868 1.00 42.04 ? 402 LYS A CG    1 
ATOM   4023 C  CD    . LYS B 2 402 ? -8.324  -11.583 -34.103 1.00 45.95 ? 402 LYS A CD    1 
ATOM   4024 C  CE    . LYS B 2 402 ? -8.370  -11.288 -35.591 1.00 46.87 ? 402 LYS A CE    1 
ATOM   4025 N  NZ    . LYS B 2 402 ? -8.679  -12.542 -36.341 1.00 48.07 ? 402 LYS A NZ    1 
ATOM   4026 N  N     . ASN B 2 403 ? -8.439  -15.710 -31.868 1.00 36.13 ? 403 ASN A N     1 
ATOM   4027 C  CA    . ASN B 2 403 ? -9.102  -16.922 -32.333 1.00 35.25 ? 403 ASN A CA    1 
ATOM   4028 C  C     . ASN B 2 403 ? -9.886  -17.635 -31.245 1.00 34.69 ? 403 ASN A C     1 
ATOM   4029 O  O     . ASN B 2 403 ? -11.008 -18.079 -31.473 1.00 33.57 ? 403 ASN A O     1 
ATOM   4030 C  CB    . ASN B 2 403 ? -8.063  -17.854 -32.947 1.00 35.14 ? 403 ASN A CB    1 
ATOM   4031 C  CG    . ASN B 2 403 ? -7.282  -17.179 -34.044 1.00 36.52 ? 403 ASN A CG    1 
ATOM   4032 O  OD1   . ASN B 2 403 ? -7.810  -16.919 -35.120 1.00 38.96 ? 403 ASN A OD1   1 
ATOM   4033 N  ND2   . ASN B 2 403 ? -6.026  -16.862 -33.771 1.00 38.91 ? 403 ASN A ND2   1 
ATOM   4034 N  N     . VAL B 2 404 ? -9.296  -17.745 -30.062 1.00 33.84 ? 404 VAL A N     1 
ATOM   4035 C  CA    . VAL B 2 404 ? -9.976  -18.395 -28.953 1.00 33.88 ? 404 VAL A CA    1 
ATOM   4036 C  C     . VAL B 2 404 ? -11.248 -17.614 -28.603 1.00 34.77 ? 404 VAL A C     1 
ATOM   4037 O  O     . VAL B 2 404 ? -12.270 -18.195 -28.237 1.00 34.57 ? 404 VAL A O     1 
ATOM   4038 C  CB    . VAL B 2 404 ? -9.040  -18.480 -27.715 1.00 31.81 ? 404 VAL A CB    1 
ATOM   4039 C  CG1   . VAL B 2 404 ? -9.839  -18.771 -26.454 1.00 29.87 ? 404 VAL A CG1   1 
ATOM   4040 C  CG2   . VAL B 2 404 ? -8.013  -19.574 -27.933 1.00 27.92 ? 404 VAL A CG2   1 
ATOM   4041 N  N     . GLY B 2 405 ? -11.177 -16.295 -28.742 1.00 36.48 ? 405 GLY A N     1 
ATOM   4042 C  CA    . GLY B 2 405 ? -12.309 -15.446 -28.421 1.00 38.13 ? 405 GLY A CA    1 
ATOM   4043 C  C     . GLY B 2 405 ? -13.466 -15.536 -29.388 1.00 39.37 ? 405 GLY A C     1 
ATOM   4044 O  O     . GLY B 2 405 ? -14.615 -15.461 -28.969 1.00 41.91 ? 405 GLY A O     1 
ATOM   4045 N  N     . GLU B 2 406 ? -13.171 -15.676 -30.677 1.00 40.37 ? 406 GLU A N     1 
ATOM   4046 C  CA    . GLU B 2 406 ? -14.205 -15.783 -31.698 1.00 41.27 ? 406 GLU A CA    1 
ATOM   4047 C  C     . GLU B 2 406 ? -14.882 -17.149 -31.606 1.00 39.47 ? 406 GLU A C     1 
ATOM   4048 O  O     . GLU B 2 406 ? -16.080 -17.279 -31.873 1.00 39.58 ? 406 GLU A O     1 
ATOM   4049 C  CB    . GLU B 2 406 ? -13.598 -15.582 -33.094 1.00 44.61 ? 406 GLU A CB    1 
ATOM   4050 C  CG    . GLU B 2 406 ? -13.183 -14.136 -33.376 1.00 51.26 ? 406 GLU A CG    1 
ATOM   4051 C  CD    . GLU B 2 406 ? -12.330 -13.966 -34.643 1.00 55.66 ? 406 GLU A CD    1 
ATOM   4052 O  OE1   . GLU B 2 406 ? -12.029 -12.801 -34.993 1.00 56.87 ? 406 GLU A OE1   1 
ATOM   4053 O  OE2   . GLU B 2 406 ? -11.955 -14.980 -35.283 1.00 56.94 ? 406 GLU A OE2   1 
ATOM   4054 N  N     . SER B 2 407 ? -14.107 -18.160 -31.224 1.00 35.69 ? 407 SER A N     1 
ATOM   4055 C  CA    . SER B 2 407 ? -14.616 -19.518 -31.078 1.00 33.64 ? 407 SER A CA    1 
ATOM   4056 C  C     . SER B 2 407 ? -15.591 -19.578 -29.899 1.00 33.28 ? 407 SER A C     1 
ATOM   4057 O  O     . SER B 2 407 ? -16.647 -20.206 -29.973 1.00 31.94 ? 407 SER A O     1 
ATOM   4058 C  CB    . SER B 2 407 ? -13.455 -20.484 -30.840 1.00 33.52 ? 407 SER A CB    1 
ATOM   4059 O  OG    . SER B 2 407 ? -13.920 -21.809 -30.625 1.00 36.86 ? 407 SER A OG    1 
ATOM   4060 N  N     . ILE B 2 408 ? -15.218 -18.919 -28.807 1.00 32.29 ? 408 ILE A N     1 
ATOM   4061 C  CA    . ILE B 2 408 ? -16.047 -18.864 -27.612 1.00 31.23 ? 408 ILE A CA    1 
ATOM   4062 C  C     . ILE B 2 408 ? -17.312 -18.073 -27.922 1.00 32.17 ? 408 ILE A C     1 
ATOM   4063 O  O     . ILE B 2 408 ? -18.362 -18.307 -27.321 1.00 30.42 ? 408 ILE A O     1 
ATOM   4064 C  CB    . ILE B 2 408 ? -15.254 -18.227 -26.434 1.00 30.95 ? 408 ILE A CB    1 
ATOM   4065 C  CG1   . ILE B 2 408 ? -14.245 -19.263 -25.905 1.00 31.47 ? 408 ILE A CG1   1 
ATOM   4066 C  CG2   . ILE B 2 408 ? -16.204 -17.732 -25.340 1.00 28.65 ? 408 ILE A CG2   1 
ATOM   4067 C  CD1   . ILE B 2 408 ? -13.276 -18.754 -24.864 1.00 31.73 ? 408 ILE A CD1   1 
ATOM   4068 N  N     . ARG B 2 409 ? -17.204 -17.144 -28.873 1.00 33.13 ? 409 ARG A N     1 
ATOM   4069 C  CA    . ARG B 2 409 ? -18.340 -16.340 -29.298 1.00 35.60 ? 409 ARG A CA    1 
ATOM   4070 C  C     . ARG B 2 409 ? -19.372 -17.269 -29.952 1.00 37.20 ? 409 ARG A C     1 
ATOM   4071 O  O     . ARG B 2 409 ? -20.556 -17.228 -29.624 1.00 38.90 ? 409 ARG A O     1 
ATOM   4072 C  CB    . ARG B 2 409 ? -17.899 -15.278 -30.308 1.00 37.35 ? 409 ARG A CB    1 
ATOM   4073 C  CG    . ARG B 2 409 ? -18.990 -14.267 -30.699 1.00 41.33 ? 409 ARG A CG    1 
ATOM   4074 C  CD    . ARG B 2 409 ? -18.650 -13.485 -31.985 1.00 45.72 ? 409 ARG A CD    1 
ATOM   4075 N  NE    . ARG B 2 409 ? -18.641 -14.353 -33.169 1.00 54.18 ? 409 ARG A NE    1 
ATOM   4076 C  CZ    . ARG B 2 409 ? -17.573 -14.618 -33.932 1.00 58.13 ? 409 ARG A CZ    1 
ATOM   4077 N  NH1   . ARG B 2 409 ? -16.385 -14.079 -33.664 1.00 58.52 ? 409 ARG A NH1   1 
ATOM   4078 N  NH2   . ARG B 2 409 ? -17.686 -15.451 -34.962 1.00 58.66 ? 409 ARG A NH2   1 
ATOM   4079 N  N     . GLU B 2 410 ? -18.919 -18.124 -30.865 1.00 37.23 ? 410 GLU A N     1 
ATOM   4080 C  CA    . GLU B 2 410 ? -19.833 -19.031 -31.548 1.00 38.69 ? 410 GLU A CA    1 
ATOM   4081 C  C     . GLU B 2 410 ? -20.302 -20.225 -30.718 1.00 37.99 ? 410 GLU A C     1 
ATOM   4082 O  O     . GLU B 2 410 ? -21.286 -20.874 -31.071 1.00 38.25 ? 410 GLU A O     1 
ATOM   4083 C  CB    . GLU B 2 410 ? -19.220 -19.504 -32.873 1.00 39.61 ? 410 GLU A CB    1 
ATOM   4084 C  CG    . GLU B 2 410 ? -17.804 -20.005 -32.772 1.00 44.71 ? 410 GLU A CG    1 
ATOM   4085 C  CD    . GLU B 2 410 ? -17.182 -20.277 -34.135 1.00 47.25 ? 410 GLU A CD    1 
ATOM   4086 O  OE1   . GLU B 2 410 ? -17.037 -19.313 -34.932 1.00 43.39 ? 410 GLU A OE1   1 
ATOM   4087 O  OE2   . GLU B 2 410 ? -16.837 -21.457 -34.400 1.00 47.99 ? 410 GLU A OE2   1 
ATOM   4088 N  N     . TYR B 2 411 ? -19.612 -20.514 -29.619 1.00 36.87 ? 411 TYR A N     1 
ATOM   4089 C  CA    . TYR B 2 411 ? -20.003 -21.615 -28.742 1.00 34.62 ? 411 TYR A CA    1 
ATOM   4090 C  C     . TYR B 2 411 ? -19.045 -21.908 -27.583 1.00 34.40 ? 411 TYR A C     1 
ATOM   4091 O  O     . TYR B 2 411 ? -17.829 -21.964 -27.754 1.00 33.53 ? 411 TYR A O     1 
ATOM   4092 C  CB    . TYR B 2 411 ? -20.228 -22.915 -29.545 1.00 34.05 ? 411 TYR A CB    1 
ATOM   4093 C  CG    . TYR B 2 411 ? -20.010 -24.183 -28.728 1.00 33.94 ? 411 TYR A CG    1 
ATOM   4094 C  CD1   . TYR B 2 411 ? -18.789 -24.867 -28.778 1.00 36.68 ? 411 TYR A CD1   1 
ATOM   4095 C  CD2   . TYR B 2 411 ? -20.978 -24.635 -27.827 1.00 32.53 ? 411 TYR A CD2   1 
ATOM   4096 C  CE1   . TYR B 2 411 ? -18.533 -25.966 -27.944 1.00 37.09 ? 411 TYR A CE1   1 
ATOM   4097 C  CE2   . TYR B 2 411 ? -20.737 -25.727 -26.992 1.00 33.48 ? 411 TYR A CE2   1 
ATOM   4098 C  CZ    . TYR B 2 411 ? -19.512 -26.386 -27.055 1.00 37.45 ? 411 TYR A CZ    1 
ATOM   4099 O  OH    . TYR B 2 411 ? -19.259 -27.457 -26.232 1.00 38.91 ? 411 TYR A OH    1 
ATOM   4100 N  N     . PHE B 2 412 ? -19.626 -22.104 -26.403 1.00 33.26 ? 412 PHE A N     1 
ATOM   4101 C  CA    . PHE B 2 412 ? -18.879 -22.452 -25.209 1.00 33.21 ? 412 PHE A CA    1 
ATOM   4102 C  C     . PHE B 2 412 ? -19.868 -22.912 -24.145 1.00 34.31 ? 412 PHE A C     1 
ATOM   4103 O  O     . PHE B 2 412 ? -21.054 -22.598 -24.196 1.00 33.61 ? 412 PHE A O     1 
ATOM   4104 C  CB    . PHE B 2 412 ? -18.074 -21.255 -24.692 1.00 30.23 ? 412 PHE A CB    1 
ATOM   4105 C  CG    . PHE B 2 412 ? -18.821 -20.388 -23.725 1.00 28.19 ? 412 PHE A CG    1 
ATOM   4106 C  CD1   . PHE B 2 412 ? -18.898 -20.729 -22.376 1.00 26.40 ? 412 PHE A CD1   1 
ATOM   4107 C  CD2   . PHE B 2 412 ? -19.440 -19.217 -24.155 1.00 28.15 ? 412 PHE A CD2   1 
ATOM   4108 C  CE1   . PHE B 2 412 ? -19.579 -19.915 -21.470 1.00 26.01 ? 412 PHE A CE1   1 
ATOM   4109 C  CE2   . PHE B 2 412 ? -20.122 -18.399 -23.256 1.00 25.47 ? 412 PHE A CE2   1 
ATOM   4110 C  CZ    . PHE B 2 412 ? -20.192 -18.746 -21.914 1.00 24.76 ? 412 PHE A CZ    1 
ATOM   4111 N  N     . GLU B 2 413 ? -19.381 -23.673 -23.184 1.00 36.65 ? 413 GLU A N     1 
ATOM   4112 C  CA    . GLU B 2 413 ? -20.240 -24.128 -22.109 1.00 39.39 ? 413 GLU A CA    1 
ATOM   4113 C  C     . GLU B 2 413 ? -19.412 -24.305 -20.852 1.00 40.06 ? 413 GLU A C     1 
ATOM   4114 O  O     . GLU B 2 413 ? -18.184 -24.460 -20.916 1.00 40.00 ? 413 GLU A O     1 
ATOM   4115 C  CB    . GLU B 2 413 ? -20.907 -25.447 -22.476 1.00 40.33 ? 413 GLU A CB    1 
ATOM   4116 C  CG    . GLU B 2 413 ? -19.934 -26.569 -22.735 1.00 42.96 ? 413 GLU A CG    1 
ATOM   4117 C  CD    . GLU B 2 413 ? -20.638 -27.834 -23.150 1.00 46.31 ? 413 GLU A CD    1 
ATOM   4118 O  OE1   . GLU B 2 413 ? -21.270 -28.481 -22.281 1.00 47.70 ? 413 GLU A OE1   1 
ATOM   4119 O  OE2   . GLU B 2 413 ? -20.572 -28.174 -24.353 1.00 46.66 ? 413 GLU A OE2   1 
ATOM   4120 N  N     . ILE B 2 414 ? -20.089 -24.265 -19.711 1.00 39.72 ? 414 ILE A N     1 
ATOM   4121 C  CA    . ILE B 2 414 ? -19.428 -24.442 -18.435 1.00 39.62 ? 414 ILE A CA    1 
ATOM   4122 C  C     . ILE B 2 414 ? -19.713 -25.848 -17.932 1.00 40.36 ? 414 ILE A C     1 
ATOM   4123 O  O     . ILE B 2 414 ? -20.848 -26.176 -17.614 1.00 40.41 ? 414 ILE A O     1 
ATOM   4124 C  CB    . ILE B 2 414 ? -19.921 -23.404 -17.405 1.00 38.72 ? 414 ILE A CB    1 
ATOM   4125 C  CG1   . ILE B 2 414 ? -19.427 -22.009 -17.804 1.00 38.76 ? 414 ILE A CG1   1 
ATOM   4126 C  CG2   . ILE B 2 414 ? -19.430 -23.776 -16.011 1.00 38.63 ? 414 ILE A CG2   1 
ATOM   4127 C  CD1   . ILE B 2 414 ? -19.918 -20.891 -16.903 1.00 38.66 ? 414 ILE A CD1   1 
ATOM   4128 N  N     . ILE B 2 415 ? -18.677 -26.680 -17.900 1.00 43.02 ? 415 ILE A N     1 
ATOM   4129 C  CA    . ILE B 2 415 ? -18.792 -28.053 -17.419 1.00 46.27 ? 415 ILE A CA    1 
ATOM   4130 C  C     . ILE B 2 415 ? -18.365 -28.058 -15.948 1.00 47.88 ? 415 ILE A C     1 
ATOM   4131 O  O     . ILE B 2 415 ? -17.258 -27.637 -15.612 1.00 47.06 ? 415 ILE A O     1 
ATOM   4132 C  CB    . ILE B 2 415 ? -17.863 -29.018 -18.191 1.00 47.21 ? 415 ILE A CB    1 
ATOM   4133 C  CG1   . ILE B 2 415 ? -18.163 -28.978 -19.691 1.00 48.24 ? 415 ILE A CG1   1 
ATOM   4134 C  CG2   . ILE B 2 415 ? -18.049 -30.420 -17.662 1.00 48.17 ? 415 ILE A CG2   1 
ATOM   4135 C  CD1   . ILE B 2 415 ? -19.494 -29.577 -20.076 1.00 51.00 ? 415 ILE A CD1   1 
ATOM   4136 N  N     . SER B 2 416 ? -19.254 -28.536 -15.085 1.00 51.54 ? 416 SER A N     1 
ATOM   4137 C  CA    . SER B 2 416 ? -19.005 -28.590 -13.653 1.00 54.87 ? 416 SER A CA    1 
ATOM   4138 C  C     . SER B 2 416 ? -19.270 -29.976 -13.069 1.00 57.20 ? 416 SER A C     1 
ATOM   4139 O  O     . SER B 2 416 ? -19.522 -30.935 -13.789 1.00 57.36 ? 416 SER A O     1 
ATOM   4140 C  CB    . SER B 2 416 ? -19.892 -27.564 -12.939 1.00 54.85 ? 416 SER A CB    1 
ATOM   4141 O  OG    . SER B 2 416 ? -19.613 -27.533 -11.559 1.00 57.78 ? 416 SER A OG    1 
ATOM   4142 N  N     . GLY B 2 417 ? -19.201 -30.073 -11.748 1.00 60.43 ? 417 GLY A N     1 
ATOM   4143 C  CA    . GLY B 2 417 ? -19.467 -31.331 -11.065 1.00 63.10 ? 417 GLY A CA    1 
ATOM   4144 C  C     . GLY B 2 417 ? -19.132 -32.663 -11.723 1.00 65.17 ? 417 GLY A C     1 
ATOM   4145 O  O     . GLY B 2 417 ? -18.058 -32.839 -12.308 1.00 64.58 ? 417 GLY A O     1 
ATOM   4146 N  N     . GLU B 2 418 ? -20.067 -33.605 -11.627 1.00 67.78 ? 418 GLU A N     1 
ATOM   4147 C  CA    . GLU B 2 418 ? -19.886 -34.949 -12.166 1.00 69.39 ? 418 GLU A CA    1 
ATOM   4148 C  C     . GLU B 2 418 ? -19.422 -35.062 -13.617 1.00 69.23 ? 418 GLU A C     1 
ATOM   4149 O  O     . GLU B 2 418 ? -18.464 -35.777 -13.926 1.00 70.31 ? 418 GLU A O     1 
ATOM   4150 C  CB    . GLU B 2 418 ? -21.185 -35.736 -11.995 1.00 71.37 ? 418 GLU A CB    1 
ATOM   4151 C  CG    . GLU B 2 418 ? -21.883 -35.529 -10.658 1.00 75.73 ? 418 GLU A CG    1 
ATOM   4152 C  CD    . GLU B 2 418 ? -22.736 -34.270 -10.617 1.00 77.53 ? 418 GLU A CD    1 
ATOM   4153 O  OE1   . GLU B 2 418 ? -23.388 -34.027 -9.579  1.00 79.52 ? 418 GLU A OE1   1 
ATOM   4154 O  OE2   . GLU B 2 418 ? -22.770 -33.530 -11.620 1.00 77.82 ? 418 GLU A OE2   1 
ATOM   4155 N  N     . LYS B 2 419 ? -20.113 -34.354 -14.502 1.00 68.24 ? 419 LYS A N     1 
ATOM   4156 C  CA    . LYS B 2 419 ? -19.819 -34.387 -15.932 1.00 68.12 ? 419 LYS A CA    1 
ATOM   4157 C  C     . LYS B 2 419 ? -18.417 -33.927 -16.329 1.00 67.51 ? 419 LYS A C     1 
ATOM   4158 O  O     . LYS B 2 419 ? -17.895 -34.312 -17.381 1.00 67.88 ? 419 LYS A O     1 
ATOM   4159 C  CB    . LYS B 2 419 ? -20.888 -33.580 -16.691 1.00 68.69 ? 419 LYS A CB    1 
ATOM   4160 C  CG    . LYS B 2 419 ? -22.197 -34.347 -16.866 1.00 70.03 ? 419 LYS A CG    1 
ATOM   4161 C  CD    . LYS B 2 419 ? -23.159 -33.633 -17.802 1.00 71.20 ? 419 LYS A CD    1 
ATOM   4162 C  CE    . LYS B 2 419 ? -24.173 -34.617 -18.406 1.00 71.33 ? 419 LYS A CE    1 
ATOM   4163 N  NZ    . LYS B 2 419 ? -24.927 -35.487 -17.438 1.00 70.73 ? 419 LYS A NZ    1 
ATOM   4164 N  N     . LEU B 2 420 ? -17.798 -33.119 -15.476 1.00 66.62 ? 420 LEU A N     1 
ATOM   4165 C  CA    . LEU B 2 420 ? -16.461 -32.604 -15.754 1.00 64.79 ? 420 LEU A CA    1 
ATOM   4166 C  C     . LEU B 2 420 ? -15.362 -33.659 -15.688 1.00 64.47 ? 420 LEU A C     1 
ATOM   4167 O  O     . LEU B 2 420 ? -14.375 -33.567 -16.411 1.00 64.02 ? 420 LEU A O     1 
ATOM   4168 C  CB    . LEU B 2 420 ? -16.126 -31.463 -14.786 1.00 64.01 ? 420 LEU A CB    1 
ATOM   4169 C  CG    . LEU B 2 420 ? -14.692 -30.937 -14.769 1.00 62.86 ? 420 LEU A CG    1 
ATOM   4170 C  CD1   . LEU B 2 420 ? -14.366 -30.284 -16.092 1.00 62.05 ? 420 LEU A CD1   1 
ATOM   4171 C  CD2   . LEU B 2 420 ? -14.535 -29.949 -13.628 1.00 62.75 ? 420 LEU A CD2   1 
ATOM   4172 N  N     . PHE B 2 421 ? -15.528 -34.661 -14.830 1.00 64.05 ? 421 PHE A N     1 
ATOM   4173 C  CA    . PHE B 2 421 ? -14.500 -35.687 -14.707 1.00 64.04 ? 421 PHE A CA    1 
ATOM   4174 C  C     . PHE B 2 421 ? -14.502 -36.690 -15.856 1.00 63.52 ? 421 PHE A C     1 
ATOM   4175 O  O     . PHE B 2 421 ? -13.630 -37.551 -15.936 1.00 63.01 ? 421 PHE A O     1 
ATOM   4176 C  CB    . PHE B 2 421 ? -14.617 -36.399 -13.359 1.00 63.54 ? 421 PHE A CB    1 
ATOM   4177 C  CG    . PHE B 2 421 ? -14.581 -35.457 -12.186 1.00 63.44 ? 421 PHE A CG    1 
ATOM   4178 C  CD1   . PHE B 2 421 ? -15.742 -35.157 -11.474 1.00 62.73 ? 421 PHE A CD1   1 
ATOM   4179 C  CD2   . PHE B 2 421 ? -13.394 -34.823 -11.830 1.00 61.89 ? 421 PHE A CD2   1 
ATOM   4180 C  CE1   . PHE B 2 421 ? -15.719 -34.235 -10.426 1.00 61.36 ? 421 PHE A CE1   1 
ATOM   4181 C  CE2   . PHE B 2 421 ? -13.359 -33.903 -10.790 1.00 61.25 ? 421 PHE A CE2   1 
ATOM   4182 C  CZ    . PHE B 2 421 ? -14.524 -33.607 -10.086 1.00 61.12 ? 421 PHE A CZ    1 
ATOM   4183 N  N     . LYS B 2 422 ? -15.476 -36.564 -16.754 1.00 63.08 ? 422 LYS A N     1 
ATOM   4184 C  CA    . LYS B 2 422 ? -15.570 -37.445 -17.913 1.00 61.18 ? 422 LYS A CA    1 
ATOM   4185 C  C     . LYS B 2 422 ? -14.797 -36.869 -19.098 1.00 59.91 ? 422 LYS A C     1 
ATOM   4186 O  O     . LYS B 2 422 ? -14.579 -37.558 -20.097 1.00 59.68 ? 422 LYS A O     1 
ATOM   4187 C  CB    . LYS B 2 422 ? -17.032 -37.648 -18.322 1.00 63.32 ? 422 LYS A CB    1 
ATOM   4188 C  CG    . LYS B 2 422 ? -17.784 -38.718 -17.534 1.00 65.99 ? 422 LYS A CG    1 
ATOM   4189 C  CD    . LYS B 2 422 ? -19.263 -38.742 -17.918 1.00 67.90 ? 422 LYS A CD    1 
ATOM   4190 C  CE    . LYS B 2 422 ? -19.957 -40.006 -17.423 1.00 69.56 ? 422 LYS A CE    1 
ATOM   4191 N  NZ    . LYS B 2 422 ? -19.485 -41.230 -18.140 1.00 69.63 ? 422 LYS A NZ    1 
ATOM   4192 N  N     . GLU B 2 423 ? -14.389 -35.606 -18.985 1.00 57.41 ? 423 GLU A N     1 
ATOM   4193 C  CA    . GLU B 2 423 ? -13.639 -34.933 -20.046 1.00 53.66 ? 423 GLU A CA    1 
ATOM   4194 C  C     . GLU B 2 423 ? -12.139 -35.244 -19.946 1.00 50.40 ? 423 GLU A C     1 
ATOM   4195 O  O     . GLU B 2 423 ? -11.662 -35.726 -18.923 1.00 48.36 ? 423 GLU A O     1 
ATOM   4196 C  CB    . GLU B 2 423 ? -13.866 -33.419 -19.970 1.00 54.67 ? 423 GLU A CB    1 
ATOM   4197 C  CG    . GLU B 2 423 ? -15.329 -32.969 -20.067 1.00 55.69 ? 423 GLU A CG    1 
ATOM   4198 C  CD    . GLU B 2 423 ? -15.959 -33.227 -21.432 1.00 56.41 ? 423 GLU A CD    1 
ATOM   4199 O  OE1   . GLU B 2 423 ? -15.298 -32.974 -22.459 1.00 56.21 ? 423 GLU A OE1   1 
ATOM   4200 O  OE2   . GLU B 2 423 ? -17.128 -33.666 -21.479 1.00 57.47 ? 423 GLU A OE2   1 
ATOM   4201 N  N     . PRO B 2 424 ? -11.383 -34.978 -21.022 1.00 49.35 ? 424 PRO A N     1 
ATOM   4202 C  CA    . PRO B 2 424 ? -9.935  -35.205 -21.122 1.00 48.50 ? 424 PRO A CA    1 
ATOM   4203 C  C     . PRO B 2 424 ? -9.102  -34.215 -20.311 1.00 48.10 ? 424 PRO A C     1 
ATOM   4204 O  O     . PRO B 2 424 ? -8.018  -33.818 -20.746 1.00 48.88 ? 424 PRO A O     1 
ATOM   4205 C  CB    . PRO B 2 424 ? -9.661  -35.039 -22.616 1.00 48.09 ? 424 PRO A CB    1 
ATOM   4206 C  CG    . PRO B 2 424 ? -10.982 -35.285 -23.255 1.00 49.28 ? 424 PRO A CG    1 
ATOM   4207 C  CD    . PRO B 2 424 ? -11.924 -34.592 -22.333 1.00 49.31 ? 424 PRO A CD    1 
ATOM   4208 N  N     . VAL B 2 425 ? -9.595  -33.826 -19.139 1.00 46.63 ? 425 VAL A N     1 
ATOM   4209 C  CA    . VAL B 2 425 ? -8.900  -32.856 -18.305 1.00 44.12 ? 425 VAL A CA    1 
ATOM   4210 C  C     . VAL B 2 425 ? -8.477  -33.377 -16.935 1.00 45.41 ? 425 VAL A C     1 
ATOM   4211 O  O     . VAL B 2 425 ? -7.922  -32.624 -16.133 1.00 46.26 ? 425 VAL A O     1 
ATOM   4212 C  CB    . VAL B 2 425 ? -9.782  -31.613 -18.074 1.00 43.33 ? 425 VAL A CB    1 
ATOM   4213 C  CG1   . VAL B 2 425 ? -10.090 -30.923 -19.402 1.00 40.78 ? 425 VAL A CG1   1 
ATOM   4214 C  CG2   . VAL B 2 425 ? -11.069 -32.024 -17.365 1.00 40.68 ? 425 VAL A CG2   1 
ATOM   4215 N  N     . THR B 2 426 ? -8.726  -34.652 -16.663 1.00 45.57 ? 426 THR A N     1 
ATOM   4216 C  CA    . THR B 2 426 ? -8.382  -35.217 -15.362 1.00 46.38 ? 426 THR A CA    1 
ATOM   4217 C  C     . THR B 2 426 ? -6.916  -35.090 -14.982 1.00 46.38 ? 426 THR A C     1 
ATOM   4218 O  O     . THR B 2 426 ? -6.597  -34.796 -13.832 1.00 48.24 ? 426 THR A O     1 
ATOM   4219 C  CB    . THR B 2 426 ? -8.786  -36.690 -15.269 1.00 47.01 ? 426 THR A CB    1 
ATOM   4220 O  OG1   . THR B 2 426 ? -8.283  -37.396 -16.409 1.00 50.08 ? 426 THR A OG1   1 
ATOM   4221 C  CG2   . THR B 2 426 ? -10.295 -36.817 -15.210 1.00 46.04 ? 426 THR A CG2   1 
ATOM   4222 N  N     . ALA B 2 427 ? -6.018  -35.308 -15.934 1.00 45.38 ? 427 ALA A N     1 
ATOM   4223 C  CA    . ALA B 2 427 ? -4.594  -35.191 -15.637 1.00 44.58 ? 427 ALA A CA    1 
ATOM   4224 C  C     . ALA B 2 427 ? -4.255  -33.750 -15.261 1.00 44.64 ? 427 ALA A C     1 
ATOM   4225 O  O     . ALA B 2 427 ? -3.533  -33.510 -14.295 1.00 44.57 ? 427 ALA A O     1 
ATOM   4226 C  CB    . ALA B 2 427 ? -3.764  -35.631 -16.841 1.00 43.82 ? 427 ALA A CB    1 
ATOM   4227 N  N     . GLU B 2 428 ? -4.783  -32.798 -16.031 1.00 45.02 ? 428 GLU A N     1 
ATOM   4228 C  CA    . GLU B 2 428 ? -4.542  -31.375 -15.795 1.00 45.38 ? 428 GLU A CA    1 
ATOM   4229 C  C     . GLU B 2 428 ? -5.025  -30.913 -14.420 1.00 45.01 ? 428 GLU A C     1 
ATOM   4230 O  O     . GLU B 2 428 ? -4.350  -30.116 -13.763 1.00 43.88 ? 428 GLU A O     1 
ATOM   4231 C  CB    . GLU B 2 428 ? -5.227  -30.524 -16.873 1.00 47.68 ? 428 GLU A CB    1 
ATOM   4232 C  CG    . GLU B 2 428 ? -4.525  -30.455 -18.238 1.00 48.57 ? 428 GLU A CG    1 
ATOM   4233 C  CD    . GLU B 2 428 ? -4.406  -31.807 -18.942 1.00 51.45 ? 428 GLU A CD    1 
ATOM   4234 O  OE1   . GLU B 2 428 ? -5.303  -32.672 -18.781 1.00 49.71 ? 428 GLU A OE1   1 
ATOM   4235 O  OE2   . GLU B 2 428 ? -3.411  -31.993 -19.679 1.00 52.49 ? 428 GLU A OE2   1 
ATOM   4236 N  N     . LEU B 2 429 ? -6.189  -31.408 -13.997 1.00 44.38 ? 429 LEU A N     1 
ATOM   4237 C  CA    . LEU B 2 429 ? -6.764  -31.047 -12.702 1.00 45.11 ? 429 LEU A CA    1 
ATOM   4238 C  C     . LEU B 2 429 ? -5.899  -31.534 -11.545 1.00 46.84 ? 429 LEU A C     1 
ATOM   4239 O  O     . LEU B 2 429 ? -5.665  -30.802 -10.578 1.00 44.39 ? 429 LEU A O     1 
ATOM   4240 C  CB    . LEU B 2 429 ? -8.170  -31.634 -12.546 1.00 44.95 ? 429 LEU A CB    1 
ATOM   4241 C  CG    . LEU B 2 429 ? -9.294  -31.181 -13.486 1.00 47.07 ? 429 LEU A CG    1 
ATOM   4242 C  CD1   . LEU B 2 429 ? -10.572 -31.920 -13.110 1.00 47.52 ? 429 LEU A CD1   1 
ATOM   4243 C  CD2   . LEU B 2 429 ? -9.506  -29.678 -13.393 1.00 46.05 ? 429 LEU A CD2   1 
ATOM   4244 N  N     . CYS B 2 430 ? -5.439  -32.779 -11.644 1.00 48.89 ? 430 CYS A N     1 
ATOM   4245 C  CA    . CYS B 2 430 ? -4.599  -33.362 -10.611 1.00 51.52 ? 430 CYS A CA    1 
ATOM   4246 C  C     . CYS B 2 430 ? -3.345  -32.532 -10.436 1.00 50.46 ? 430 CYS A C     1 
ATOM   4247 O  O     . CYS B 2 430 ? -2.931  -32.243 -9.315  1.00 50.87 ? 430 CYS A O     1 
ATOM   4248 C  CB    . CYS B 2 430 ? -4.213  -34.798 -10.974 1.00 54.43 ? 430 CYS A CB    1 
ATOM   4249 S  SG    . CYS B 2 430 ? -5.571  -35.972 -10.816 1.00 65.20 ? 430 CYS A SG    1 
ATOM   4250 N  N     . GLU B 2 431 ? -2.740  -32.156 -11.555 1.00 49.69 ? 431 GLU A N     1 
ATOM   4251 C  CA    . GLU B 2 431 ? -1.530  -31.358 -11.530 1.00 49.81 ? 431 GLU A CA    1 
ATOM   4252 C  C     . GLU B 2 431 ? -1.830  -30.006 -10.891 1.00 48.49 ? 431 GLU A C     1 
ATOM   4253 O  O     . GLU B 2 431 ? -1.085  -29.529 -10.033 1.00 47.90 ? 431 GLU A O     1 
ATOM   4254 C  CB    . GLU B 2 431 ? -1.011  -31.175 -12.956 1.00 53.26 ? 431 GLU A CB    1 
ATOM   4255 C  CG    . GLU B 2 431 ? 0.210   -30.295 -13.067 1.00 61.21 ? 431 GLU A CG    1 
ATOM   4256 C  CD    . GLU B 2 431 ? 1.241   -30.611 -11.999 1.00 66.96 ? 431 GLU A CD    1 
ATOM   4257 O  OE1   . GLU B 2 431 ? 1.571   -31.807 -11.822 1.00 67.91 ? 431 GLU A OE1   1 
ATOM   4258 O  OE2   . GLU B 2 431 ? 1.723   -29.659 -11.337 1.00 70.75 ? 431 GLU A OE2   1 
ATOM   4259 N  N     . MET B 2 432 ? -2.942  -29.411 -11.307 1.00 46.37 ? 432 MET A N     1 
ATOM   4260 C  CA    . MET B 2 432 ? -3.377  -28.114 -10.811 1.00 45.56 ? 432 MET A CA    1 
ATOM   4261 C  C     . MET B 2 432 ? -3.688  -28.108 -9.313  1.00 43.61 ? 432 MET A C     1 
ATOM   4262 O  O     . MET B 2 432 ? -3.450  -27.106 -8.635  1.00 42.15 ? 432 MET A O     1 
ATOM   4263 C  CB    . MET B 2 432 ? -4.607  -27.660 -11.606 1.00 47.78 ? 432 MET A CB    1 
ATOM   4264 C  CG    . MET B 2 432 ? -5.149  -26.290 -11.249 1.00 50.63 ? 432 MET A CG    1 
ATOM   4265 S  SD    . MET B 2 432 ? -6.563  -25.847 -12.290 1.00 54.64 ? 432 MET A SD    1 
ATOM   4266 C  CE    . MET B 2 432 ? -7.905  -26.569 -11.366 1.00 55.55 ? 432 MET A CE    1 
ATOM   4267 N  N     . MET B 2 433 ? -4.201  -29.224 -8.800  1.00 41.37 ? 433 MET A N     1 
ATOM   4268 C  CA    . MET B 2 433 ? -4.559  -29.328 -7.384  1.00 42.02 ? 433 MET A CA    1 
ATOM   4269 C  C     . MET B 2 433 ? -3.452  -29.887 -6.492  1.00 41.62 ? 433 MET A C     1 
ATOM   4270 O  O     . MET B 2 433 ? -3.613  -29.987 -5.273  1.00 38.93 ? 433 MET A O     1 
ATOM   4271 C  CB    . MET B 2 433 ? -5.816  -30.188 -7.221  1.00 43.15 ? 433 MET A CB    1 
ATOM   4272 C  CG    . MET B 2 433 ? -6.972  -29.742 -8.095  1.00 45.48 ? 433 MET A CG    1 
ATOM   4273 S  SD    . MET B 2 433 ? -8.563  -30.316 -7.513  1.00 48.06 ? 433 MET A SD    1 
ATOM   4274 C  CE    . MET B 2 433 ? -8.529  -32.030 -8.006  1.00 49.24 ? 433 MET A CE    1 
ATOM   4275 N  N     . GLY B 2 434 ? -2.330  -30.246 -7.102  1.00 41.95 ? 434 GLY A N     1 
ATOM   4276 C  CA    . GLY B 2 434 ? -1.226  -30.791 -6.339  1.00 43.15 ? 434 GLY A CA    1 
ATOM   4277 C  C     . GLY B 2 434 ? -1.506  -32.186 -5.816  1.00 44.45 ? 434 GLY A C     1 
ATOM   4278 O  O     . GLY B 2 434 ? -0.953  -32.586 -4.806  1.00 42.20 ? 434 GLY A O     1 
ATOM   4279 N  N     . VAL B 2 435 ? -2.370  -32.941 -6.484  1.00 48.35 ? 435 VAL A N     1 
ATOM   4280 C  CA    . VAL B 2 435 ? -2.646  -34.296 -6.014  1.00 52.63 ? 435 VAL A CA    1 
ATOM   4281 C  C     . VAL B 2 435 ? -1.335  -35.055 -6.168  1.00 55.30 ? 435 VAL A C     1 
ATOM   4282 O  O     . VAL B 2 435 ? -0.750  -35.061 -7.252  1.00 56.05 ? 435 VAL A O     1 
ATOM   4283 C  CB    . VAL B 2 435 ? -3.741  -34.987 -6.856  1.00 52.94 ? 435 VAL A CB    1 
ATOM   4284 C  CG1   . VAL B 2 435 ? -3.966  -36.402 -6.347  1.00 52.80 ? 435 VAL A CG1   1 
ATOM   4285 C  CG2   . VAL B 2 435 ? -5.038  -34.190 -6.785  1.00 52.69 ? 435 VAL A CG2   1 
ATOM   4286 N  N     . LYS B 2 436 ? -0.864  -35.678 -5.092  1.00 58.75 ? 436 LYS A N     1 
ATOM   4287 C  CA    . LYS B 2 436 ? 0.401   -36.404 -5.154  1.00 63.56 ? 436 LYS A CA    1 
ATOM   4288 C  C     . LYS B 2 436 ? 0.290   -37.910 -5.030  1.00 66.13 ? 436 LYS A C     1 
ATOM   4289 O  O     . LYS B 2 436 ? -0.763  -38.438 -4.684  1.00 66.35 ? 436 LYS A O     1 
ATOM   4290 C  CB    . LYS B 2 436 ? 1.366   -35.886 -4.081  1.00 63.96 ? 436 LYS A CB    1 
ATOM   4291 C  CG    . LYS B 2 436 ? 0.895   -36.068 -2.651  1.00 61.53 ? 436 LYS A CG    1 
ATOM   4292 C  CD    . LYS B 2 436 ? 1.850   -35.377 -1.696  1.00 61.32 ? 436 LYS A CD    1 
ATOM   4293 C  CE    . LYS B 2 436 ? 1.355   -35.461 -0.268  1.00 62.15 ? 436 LYS A CE    1 
ATOM   4294 N  NZ    . LYS B 2 436 ? 2.228   -34.688 0.641   1.00 61.48 ? 436 LYS A NZ    1 
ATOM   4295 N  N     . ASP B 2 437 ? 1.407   -38.576 -5.328  1.00 70.63 ? 437 ASP A N     1 
ATOM   4296 C  CA    . ASP B 2 437 ? 1.567   -40.035 -5.278  1.00 74.28 ? 437 ASP A CA    1 
ATOM   4297 C  C     . ASP B 2 437 ? 2.553   -40.496 -6.356  1.00 75.67 ? 437 ASP A C     1 
ATOM   4298 O  O     . ASP B 2 437 ? 3.677   -40.904 -5.985  1.00 76.55 ? 437 ASP A O     1 
ATOM   4299 C  CB    . ASP B 2 437 ? 0.223   -40.751 -5.470  1.00 75.50 ? 437 ASP A CB    1 
ATOM   4300 C  CG    . ASP B 2 437 ? -0.140  -41.632 -4.283  1.00 77.44 ? 437 ASP A CG    1 
ATOM   4301 O  OD1   . ASP B 2 437 ? 0.135   -41.223 -3.131  1.00 77.16 ? 437 ASP A OD1   1 
ATOM   4302 O  OD2   . ASP B 2 437 ? -0.709  -42.726 -4.501  1.00 78.80 ? 437 ASP A OD2   1 
ATOM   4303 O  OXT   . ASP B 2 437 ? 2.201   -40.430 -7.557  1.00 77.07 ? 437 ASP A OXT   1 
HETATM 4304 S  S     . SO4 C 3 .   ? -5.072  -6.604  -20.856 1.00 79.28 ? 601 SO4 A S     1 
HETATM 4305 O  O1    . SO4 C 3 .   ? -4.307  -7.659  -21.645 1.00 79.15 ? 601 SO4 A O1    1 
HETATM 4306 O  O2    . SO4 C 3 .   ? -5.180  -7.129  -19.428 1.00 77.53 ? 601 SO4 A O2    1 
HETATM 4307 O  O3    . SO4 C 3 .   ? -4.267  -5.434  -20.814 1.00 78.49 ? 601 SO4 A O3    1 
HETATM 4308 O  O4    . SO4 C 3 .   ? -6.395  -6.642  -21.379 1.00 78.79 ? 601 SO4 A O4    1 
HETATM 4309 MG MG    . MG  D 4 .   ? 15.999  -30.246 -35.282 1.00 54.96 ? 602 MG  A MG    1 
HETATM 4310 N  N1    . CTP E 5 .   ? 16.824  -21.459 -33.112 1.00 40.59 ? 504 CTP A N1    1 
HETATM 4311 C  C2    . CTP E 5 .   ? 16.972  -20.391 -32.220 1.00 39.04 ? 504 CTP A C2    1 
HETATM 4312 N  N3    . CTP E 5 .   ? 15.966  -20.098 -31.363 1.00 40.03 ? 504 CTP A N3    1 
HETATM 4313 C  C4    . CTP E 5 .   ? 14.846  -20.834 -31.369 1.00 41.75 ? 504 CTP A C4    1 
HETATM 4314 C  C5    . CTP E 5 .   ? 14.673  -21.935 -32.262 1.00 40.14 ? 504 CTP A C5    1 
HETATM 4315 C  C6    . CTP E 5 .   ? 15.677  -22.208 -33.109 1.00 40.19 ? 504 CTP A C6    1 
HETATM 4316 O  O2    . CTP E 5 .   ? 18.025  -19.742 -32.238 1.00 37.47 ? 504 CTP A O2    1 
HETATM 4317 N  N4    . CTP E 5 .   ? 13.874  -20.509 -30.505 1.00 39.80 ? 504 CTP A N4    1 
HETATM 4318 C  "C1'" . CTP E 5 .   ? 17.920  -21.756 -34.050 1.00 40.57 ? 504 CTP A "C1'" 1 
HETATM 4319 C  "C2'" . CTP E 5 .   ? 19.201  -22.253 -33.374 1.00 40.73 ? 504 CTP A "C2'" 1 
HETATM 4320 O  "O2'" . CTP E 5 .   ? 20.330  -21.778 -34.076 1.00 41.24 ? 504 CTP A "O2'" 1 
HETATM 4321 C  "C3'" . CTP E 5 .   ? 19.034  -23.764 -33.482 1.00 40.34 ? 504 CTP A "C3'" 1 
HETATM 4322 C  "C4'" . CTP E 5 .   ? 18.377  -23.918 -34.843 1.00 40.52 ? 504 CTP A "C4'" 1 
HETATM 4323 O  "O4'" . CTP E 5 .   ? 17.483  -22.775 -34.936 1.00 41.41 ? 504 CTP A "O4'" 1 
HETATM 4324 O  "O3'" . CTP E 5 .   ? 20.282  -24.442 -33.433 1.00 41.42 ? 504 CTP A "O3'" 1 
HETATM 4325 C  "C5'" . CTP E 5 .   ? 17.574  -25.180 -35.015 1.00 39.08 ? 504 CTP A "C5'" 1 
HETATM 4326 O  "O5'" . CTP E 5 .   ? 16.654  -25.310 -33.936 1.00 39.31 ? 504 CTP A "O5'" 1 
HETATM 4327 P  PA    . CTP E 5 .   ? 15.686  -26.568 -33.831 1.00 39.67 ? 504 CTP A PA    1 
HETATM 4328 O  O1A   . CTP E 5 .   ? 15.766  -27.336 -35.100 1.00 36.11 ? 504 CTP A O1A   1 
HETATM 4329 O  O2A   . CTP E 5 .   ? 14.365  -26.068 -33.360 1.00 43.91 ? 504 CTP A O2A   1 
HETATM 4330 O  O3A   . CTP E 5 .   ? 16.303  -27.454 -32.652 1.00 39.73 ? 504 CTP A O3A   1 
HETATM 4331 P  PB    . CTP E 5 .   ? 17.851  -27.839 -32.597 1.00 37.88 ? 504 CTP A PB    1 
HETATM 4332 O  O1B   . CTP E 5 .   ? 18.571  -26.638 -32.116 1.00 40.02 ? 504 CTP A O1B   1 
HETATM 4333 O  O2B   . CTP E 5 .   ? 18.257  -28.456 -33.891 1.00 36.92 ? 504 CTP A O2B   1 
HETATM 4334 O  O3B   . CTP E 5 .   ? 17.925  -28.946 -31.437 1.00 41.51 ? 504 CTP A O3B   1 
HETATM 4335 P  PG    . CTP E 5 .   ? 16.914  -30.192 -31.364 1.00 41.13 ? 504 CTP A PG    1 
HETATM 4336 O  O1G   . CTP E 5 .   ? 16.416  -30.521 -32.723 1.00 44.62 ? 504 CTP A O1G   1 
HETATM 4337 O  O2G   . CTP E 5 .   ? 17.545  -31.259 -30.555 1.00 41.00 ? 504 CTP A O2G   1 
HETATM 4338 O  O3G   . CTP E 5 .   ? 15.664  -29.623 -30.556 1.00 42.63 ? 504 CTP A O3G   1 
HETATM 4339 O  O     . HOH F 6 .   ? 12.862  -24.225 -29.174 1.00 33.98 ? 35  HOH B O     1 
HETATM 4340 O  O     . HOH F 6 .   ? 15.895  -11.011 -27.559 1.00 27.48 ? 36  HOH B O     1 
HETATM 4341 O  O     . HOH F 6 .   ? -0.753  -4.617  -28.055 1.00 28.84 ? 37  HOH B O     1 
HETATM 4342 O  O     . HOH F 6 .   ? -25.382 5.529   -9.651  1.00 57.04 ? 38  HOH B O     1 
HETATM 4343 O  O     . HOH F 6 .   ? 2.021   -15.537 -35.723 1.00 20.75 ? 39  HOH B O     1 
HETATM 4344 O  O     . HOH F 6 .   ? 4.039   -12.669 -36.934 1.00 33.04 ? 40  HOH B O     1 
HETATM 4345 O  O     . HOH F 6 .   ? -17.701 0.374   -26.995 1.00 34.73 ? 41  HOH B O     1 
HETATM 4346 O  O     . HOH F 6 .   ? 13.860  -18.211 -26.198 1.00 23.44 ? 42  HOH B O     1 
HETATM 4347 O  O     . HOH F 6 .   ? -10.766 7.208   -9.619  1.00 40.77 ? 43  HOH B O     1 
HETATM 4348 O  O     . HOH F 6 .   ? -17.896 -0.183  -10.176 1.00 45.68 ? 44  HOH B O     1 
HETATM 4349 O  O     . HOH F 6 .   ? 11.795  -18.490 -32.981 1.00 30.39 ? 45  HOH B O     1 
HETATM 4350 O  O     . HOH F 6 .   ? 17.393  -17.947 -35.247 1.00 33.54 ? 46  HOH B O     1 
HETATM 4351 O  O     . HOH F 6 .   ? 0.892   -16.335 -30.473 1.00 30.31 ? 47  HOH B O     1 
HETATM 4352 O  O     . HOH F 6 .   ? 1.955   -8.478  -33.439 1.00 35.57 ? 48  HOH B O     1 
HETATM 4353 O  O     . HOH F 6 .   ? 11.921  -27.917 -34.087 1.00 52.09 ? 49  HOH B O     1 
HETATM 4354 O  O     . HOH F 6 .   ? -0.603  -6.189  -30.098 1.00 40.01 ? 50  HOH B O     1 
HETATM 4355 O  O     . HOH F 6 .   ? 10.122  0.980   -29.560 1.00 51.92 ? 51  HOH B O     1 
HETATM 4356 O  O     . HOH F 6 .   ? -14.937 -7.660  -25.584 1.00 44.25 ? 52  HOH B O     1 
HETATM 4357 O  O     . HOH F 6 .   ? -9.642  -2.706  -23.140 1.00 47.13 ? 53  HOH B O     1 
HETATM 4358 O  O     . HOH F 6 .   ? -6.087  -9.123  -36.105 1.00 53.86 ? 54  HOH B O     1 
HETATM 4359 O  O     . HOH F 6 .   ? -8.184  -6.813  -26.504 1.00 48.75 ? 55  HOH B O     1 
HETATM 4360 O  O     . HOH F 6 .   ? 9.445   -28.939 -37.112 1.00 48.62 ? 56  HOH B O     1 
HETATM 4361 O  O     . HOH F 6 .   ? 11.052  -25.965 -31.764 1.00 51.53 ? 57  HOH B O     1 
HETATM 4362 O  O     . HOH F 6 .   ? -6.833  -0.086  -27.248 1.00 44.33 ? 58  HOH B O     1 
HETATM 4363 O  O     . HOH F 6 .   ? -8.002  -0.510  -24.153 1.00 51.38 ? 59  HOH B O     1 
HETATM 4364 O  O     . HOH F 6 .   ? -15.944 6.503   -19.046 1.00 49.34 ? 60  HOH B O     1 
HETATM 4365 O  O     . HOH F 6 .   ? -7.992  1.908   -9.005  1.00 49.99 ? 61  HOH B O     1 
HETATM 4366 O  O     . HOH F 6 .   ? -4.031  6.036   -25.342 1.00 51.55 ? 62  HOH B O     1 
HETATM 4367 O  O     . HOH F 6 .   ? 10.402  -7.024  -25.195 1.00 43.81 ? 63  HOH B O     1 
HETATM 4368 O  O     . HOH F 6 .   ? 0.136   -3.081  -26.151 1.00 56.63 ? 64  HOH B O     1 
HETATM 4369 O  O     . HOH F 6 .   ? -12.563 4.334   -3.938  1.00 49.10 ? 65  HOH B O     1 
HETATM 4370 O  O     . HOH F 6 .   ? -16.465 0.870   -7.727  1.00 46.58 ? 66  HOH B O     1 
HETATM 4371 O  O     . HOH F 6 .   ? 4.810   -10.322 -19.863 1.00 41.18 ? 67  HOH B O     1 
HETATM 4372 O  O     . HOH F 6 .   ? -18.963 -1.362  -17.743 1.00 55.99 ? 68  HOH B O     1 
HETATM 4373 O  O     . HOH F 6 .   ? -2.021  -8.645  -29.431 1.00 48.75 ? 69  HOH B O     1 
HETATM 4374 O  O     . HOH F 6 .   ? -3.319  1.123   -27.591 1.00 41.36 ? 70  HOH B O     1 
HETATM 4375 O  O     . HOH F 6 .   ? 9.988   -10.914 -25.636 1.00 52.87 ? 71  HOH B O     1 
HETATM 4376 O  O     . HOH F 6 .   ? 6.521   -2.317  -36.782 1.00 61.73 ? 72  HOH B O     1 
HETATM 4377 O  O     . HOH G 6 .   ? 26.905  -28.680 -45.283 1.00 16.92 ? 603 HOH A O     1 
HETATM 4378 O  O     . HOH G 6 .   ? -10.446 -9.616  -16.593 1.00 30.69 ? 604 HOH A O     1 
HETATM 4379 O  O     . HOH G 6 .   ? -2.341  -20.811 -37.769 1.00 21.92 ? 605 HOH A O     1 
HETATM 4380 O  O     . HOH G 6 .   ? -16.612 -23.085 -29.867 1.00 31.66 ? 606 HOH A O     1 
HETATM 4381 O  O     . HOH G 6 .   ? 7.495   -15.430 -17.507 1.00 32.29 ? 607 HOH A O     1 
HETATM 4382 O  O     . HOH G 6 .   ? 35.718  -19.192 -27.005 1.00 24.86 ? 608 HOH A O     1 
HETATM 4383 O  O     . HOH G 6 .   ? 19.207  -30.673 -37.309 1.00 26.12 ? 609 HOH A O     1 
HETATM 4384 O  O     . HOH G 6 .   ? 14.891  -26.857 -29.200 1.00 34.71 ? 610 HOH A O     1 
HETATM 4385 O  O     . HOH G 6 .   ? 5.985   -17.943 -15.507 1.00 36.94 ? 611 HOH A O     1 
HETATM 4386 O  O     . HOH G 6 .   ? 2.062   -35.073 -48.764 1.00 36.15 ? 612 HOH A O     1 
HETATM 4387 O  O     . HOH G 6 .   ? -1.894  -25.298 -18.118 1.00 35.28 ? 613 HOH A O     1 
HETATM 4388 O  O     . HOH G 6 .   ? -11.236 -12.973 -4.994  1.00 22.16 ? 614 HOH A O     1 
HETATM 4389 O  O     . HOH G 6 .   ? -6.195  -18.283 0.005   1.00 35.70 ? 615 HOH A O     1 
HETATM 4390 O  O     . HOH G 6 .   ? -9.456  -6.827  -12.712 1.00 41.29 ? 616 HOH A O     1 
HETATM 4391 O  O     . HOH G 6 .   ? 20.879  -30.788 -40.283 1.00 34.56 ? 617 HOH A O     1 
HETATM 4392 O  O     . HOH G 6 .   ? -19.440 -7.018  -7.282  1.00 46.07 ? 618 HOH A O     1 
HETATM 4393 O  O     . HOH G 6 .   ? 4.065   -23.954 -29.313 1.00 25.49 ? 619 HOH A O     1 
HETATM 4394 O  O     . HOH G 6 .   ? -16.094 -29.148 -3.748  1.00 35.74 ? 620 HOH A O     1 
HETATM 4395 O  O     . HOH G 6 .   ? 4.717   -26.022 -10.183 1.00 43.45 ? 621 HOH A O     1 
HETATM 4396 O  O     . HOH G 6 .   ? 5.621   -26.047 -42.180 1.00 36.86 ? 622 HOH A O     1 
HETATM 4397 O  O     . HOH G 6 .   ? -1.160  -21.314 -10.424 1.00 33.39 ? 623 HOH A O     1 
HETATM 4398 O  O     . HOH G 6 .   ? -20.324 -23.493 -7.590  1.00 33.57 ? 624 HOH A O     1 
HETATM 4399 O  O     . HOH G 6 .   ? 8.734   -19.466 -57.536 1.00 35.36 ? 625 HOH A O     1 
HETATM 4400 O  O     . HOH G 6 .   ? 9.391   -29.442 -26.901 1.00 41.17 ? 626 HOH A O     1 
HETATM 4401 O  O     . HOH G 6 .   ? -13.937 -23.273 -34.221 1.00 40.04 ? 627 HOH A O     1 
HETATM 4402 O  O     . HOH G 6 .   ? -3.947  -16.969 -35.888 1.00 36.50 ? 628 HOH A O     1 
HETATM 4403 O  O     . HOH G 6 .   ? 9.815   -8.444  -49.292 1.00 39.56 ? 629 HOH A O     1 
HETATM 4404 O  O     . HOH G 6 .   ? 13.752  -12.905 -19.459 1.00 42.37 ? 630 HOH A O     1 
HETATM 4405 O  O     . HOH G 6 .   ? 17.477  -15.637 -37.155 1.00 27.61 ? 631 HOH A O     1 
HETATM 4406 O  O     . HOH G 6 .   ? -2.874  -20.181 -11.961 1.00 36.61 ? 632 HOH A O     1 
HETATM 4407 O  O     . HOH G 6 .   ? 10.214  -42.174 -45.646 1.00 35.99 ? 633 HOH A O     1 
HETATM 4408 O  O     . HOH G 6 .   ? -30.134 -2.386  -5.124  1.00 47.33 ? 634 HOH A O     1 
HETATM 4409 O  O     . HOH G 6 .   ? -22.936 -21.170 0.251   1.00 51.90 ? 635 HOH A O     1 
HETATM 4410 O  O     . HOH G 6 .   ? 29.772  -31.178 -33.277 1.00 42.29 ? 636 HOH A O     1 
HETATM 4411 O  O     . HOH G 6 .   ? 36.352  -41.247 -13.114 1.00 49.42 ? 637 HOH A O     1 
HETATM 4412 O  O     . HOH G 6 .   ? 5.198   -21.005 -17.302 1.00 32.74 ? 638 HOH A O     1 
HETATM 4413 O  O     . HOH G 6 .   ? 7.422   -28.693 -55.868 1.00 27.03 ? 639 HOH A O     1 
HETATM 4414 O  O     . HOH G 6 .   ? 15.957  -34.367 -56.964 1.00 24.17 ? 640 HOH A O     1 
HETATM 4415 O  O     . HOH G 6 .   ? -0.213  -14.957 -23.593 1.00 43.95 ? 641 HOH A O     1 
HETATM 4416 O  O     . HOH G 6 .   ? -22.099 -21.361 -33.454 1.00 34.31 ? 642 HOH A O     1 
HETATM 4417 O  O     . HOH G 6 .   ? -24.762 -15.664 -15.524 1.00 42.68 ? 643 HOH A O     1 
HETATM 4418 O  O     . HOH G 6 .   ? -14.880 0.681   7.830   1.00 42.23 ? 644 HOH A O     1 
HETATM 4419 O  O     . HOH G 6 .   ? 4.651   -23.237 -19.465 1.00 41.19 ? 645 HOH A O     1 
HETATM 4420 O  O     . HOH G 6 .   ? -22.686 13.469  5.438   1.00 32.03 ? 646 HOH A O     1 
HETATM 4421 O  O     . HOH G 6 .   ? 2.251   -16.899 -45.712 1.00 47.11 ? 647 HOH A O     1 
HETATM 4422 O  O     . HOH G 6 .   ? 1.100   -17.621 -41.970 1.00 48.61 ? 648 HOH A O     1 
HETATM 4423 O  O     . HOH G 6 .   ? -14.180 8.380   6.436   1.00 39.72 ? 649 HOH A O     1 
HETATM 4424 O  O     . HOH G 6 .   ? 12.220  -7.842  -50.128 1.00 46.48 ? 650 HOH A O     1 
HETATM 4425 O  O     . HOH G 6 .   ? 13.844  -15.443 -19.807 1.00 42.54 ? 651 HOH A O     1 
HETATM 4426 O  O     . HOH G 6 .   ? 35.282  -21.571 -26.544 1.00 43.32 ? 652 HOH A O     1 
HETATM 4427 O  O     . HOH G 6 .   ? 32.885  -28.586 -16.681 1.00 44.70 ? 653 HOH A O     1 
HETATM 4428 O  O     . HOH G 6 .   ? 18.633  -21.958 -53.335 1.00 40.19 ? 654 HOH A O     1 
HETATM 4429 O  O     . HOH G 6 .   ? 12.998  -13.874 -16.277 1.00 43.99 ? 655 HOH A O     1 
HETATM 4430 O  O     . HOH G 6 .   ? 8.472   -13.794 -24.924 1.00 48.56 ? 656 HOH A O     1 
HETATM 4431 O  O     . HOH G 6 .   ? 15.161  -6.087  -52.749 1.00 26.94 ? 657 HOH A O     1 
HETATM 4432 O  O     . HOH G 6 .   ? 27.157  -8.546  -31.347 1.00 43.06 ? 658 HOH A O     1 
HETATM 4433 O  O     . HOH G 6 .   ? -11.262 7.646   5.947   1.00 46.46 ? 659 HOH A O     1 
HETATM 4434 O  O     . HOH G 6 .   ? -15.739 -7.405  -15.680 1.00 41.71 ? 660 HOH A O     1 
HETATM 4435 O  O     . HOH G 6 .   ? 34.195  -21.094 -21.831 1.00 49.33 ? 661 HOH A O     1 
HETATM 4436 O  O     . HOH G 6 .   ? 30.142  -36.701 -5.985  1.00 49.11 ? 662 HOH A O     1 
HETATM 4437 O  O     . HOH G 6 .   ? 23.572  -28.274 -55.451 1.00 39.51 ? 663 HOH A O     1 
HETATM 4438 O  O     . HOH G 6 .   ? -7.117  -17.109 2.004   1.00 42.86 ? 664 HOH A O     1 
HETATM 4439 O  O     . HOH G 6 .   ? 12.044  -27.888 -29.684 1.00 45.02 ? 665 HOH A O     1 
HETATM 4440 O  O     . HOH G 6 .   ? 5.020   -28.544 -39.297 1.00 47.61 ? 666 HOH A O     1 
HETATM 4441 O  O     . HOH G 6 .   ? 26.987  -19.083 -12.544 1.00 39.91 ? 667 HOH A O     1 
HETATM 4442 O  O     . HOH G 6 .   ? -2.593  -28.754 -23.932 1.00 27.62 ? 668 HOH A O     1 
HETATM 4443 O  O     . HOH G 6 .   ? 14.554  -20.584 -24.475 1.00 45.42 ? 669 HOH A O     1 
HETATM 4444 O  O     . HOH G 6 .   ? -11.264 -22.076 -36.778 1.00 48.17 ? 670 HOH A O     1 
HETATM 4445 O  O     . HOH G 6 .   ? 27.208  -14.802 -52.770 1.00 40.97 ? 671 HOH A O     1 
HETATM 4446 O  O     . HOH G 6 .   ? -20.484 -28.971 -9.274  1.00 42.45 ? 672 HOH A O     1 
HETATM 4447 O  O     . HOH G 6 .   ? -6.386  -35.492 -25.043 1.00 49.95 ? 673 HOH A O     1 
HETATM 4448 O  O     . HOH G 6 .   ? 28.715  -15.111 -45.387 1.00 45.02 ? 674 HOH A O     1 
HETATM 4449 O  O     . HOH G 6 .   ? 14.434  -18.952 -57.639 1.00 53.43 ? 675 HOH A O     1 
HETATM 4450 O  O     . HOH G 6 .   ? 1.065   -15.057 -41.566 1.00 45.71 ? 676 HOH A O     1 
HETATM 4451 O  O     . HOH G 6 .   ? 29.323  -16.765 -36.663 1.00 52.23 ? 677 HOH A O     1 
HETATM 4452 O  O     . HOH G 6 .   ? -8.143  -37.844 -18.925 1.00 46.16 ? 678 HOH A O     1 
HETATM 4453 O  O     . HOH G 6 .   ? 17.083  -43.399 -43.437 1.00 46.90 ? 679 HOH A O     1 
HETATM 4454 O  O     . HOH G 6 .   ? -3.008  -29.222 -29.428 1.00 38.76 ? 680 HOH A O     1 
HETATM 4455 O  O     . HOH G 6 .   ? 25.882  -37.543 -50.695 1.00 53.87 ? 681 HOH A O     1 
HETATM 4456 O  O     . HOH G 6 .   ? 0.619   -29.613 -46.435 1.00 39.08 ? 682 HOH A O     1 
HETATM 4457 O  O     . HOH G 6 .   ? 15.609  -6.371  -38.500 1.00 45.32 ? 683 HOH A O     1 
HETATM 4458 O  O     . HOH G 6 .   ? 27.104  -6.619  -12.359 1.00 56.99 ? 684 HOH A O     1 
HETATM 4459 O  O     . HOH G 6 .   ? 24.203  -8.296  -44.964 1.00 44.41 ? 685 HOH A O     1 
HETATM 4460 O  O     . HOH G 6 .   ? 19.631  -34.308 1.715   1.00 54.30 ? 686 HOH A O     1 
HETATM 4461 O  O     . HOH G 6 .   ? -6.033  -15.933 -37.414 1.00 48.15 ? 687 HOH A O     1 
HETATM 4462 O  O     . HOH G 6 .   ? 23.935  -6.029  -16.881 1.00 50.12 ? 688 HOH A O     1 
HETATM 4463 O  O     . HOH G 6 .   ? 10.791  -21.939 -60.428 1.00 49.63 ? 689 HOH A O     1 
HETATM 4464 O  O     . HOH G 6 .   ? 3.418   -21.628 -14.575 1.00 56.04 ? 690 HOH A O     1 
HETATM 4465 O  O     . HOH G 6 .   ? -16.759 -30.069 -10.151 1.00 38.48 ? 691 HOH A O     1 
HETATM 4466 O  O     . HOH G 6 .   ? 20.594  -27.962 -30.386 1.00 36.25 ? 692 HOH A O     1 
HETATM 4467 O  O     . HOH G 6 .   ? 1.192   -26.832 -34.422 1.00 43.08 ? 693 HOH A O     1 
HETATM 4468 O  O     . HOH G 6 .   ? 15.572  -24.836 -3.708  1.00 44.69 ? 694 HOH A O     1 
HETATM 4469 O  O     . HOH G 6 .   ? 26.316  -41.305 -6.161  1.00 51.69 ? 695 HOH A O     1 
HETATM 4470 O  O     . HOH G 6 .   ? 10.727  -14.761 -41.499 1.00 39.49 ? 696 HOH A O     1 
HETATM 4471 O  O     . HOH G 6 .   ? 33.425  -22.368 -33.952 1.00 24.80 ? 697 HOH A O     1 
HETATM 4472 O  O     . HOH G 6 .   ? 25.203  -25.907 -51.736 1.00 37.57 ? 698 HOH A O     1 
HETATM 4473 O  O     . HOH G 6 .   ? -20.674 -15.357 -33.717 1.00 42.88 ? 699 HOH A O     1 
HETATM 4474 O  O     . HOH G 6 .   ? 22.333  -28.870 -4.136  1.00 41.10 ? 700 HOH A O     1 
HETATM 4475 O  O     . HOH G 6 .   ? -1.532  -31.737 -24.921 1.00 45.73 ? 701 HOH A O     1 
HETATM 4476 O  O     . HOH G 6 .   ? -13.024 4.953   6.009   1.00 49.11 ? 702 HOH A O     1 
HETATM 4477 O  O     . HOH G 6 .   ? 15.381  -40.905 -33.615 1.00 53.53 ? 703 HOH A O     1 
HETATM 4478 O  O     . HOH G 6 .   ? 21.773  -23.367 -35.954 1.00 32.69 ? 704 HOH A O     1 
HETATM 4479 O  O     . HOH G 6 .   ? -1.240  -23.998 -14.201 1.00 46.25 ? 705 HOH A O     1 
HETATM 4480 O  O     . HOH G 6 .   ? 4.367   -28.388 -22.006 1.00 35.25 ? 706 HOH A O     1 
HETATM 4481 O  O     . HOH G 6 .   ? 13.552  -38.923 -37.440 1.00 40.04 ? 707 HOH A O     1 
HETATM 4482 O  O     . HOH G 6 .   ? 30.253  -8.026  -13.959 1.00 56.69 ? 708 HOH A O     1 
HETATM 4483 O  O     . HOH G 6 .   ? 27.510  -13.777 -25.866 1.00 39.19 ? 709 HOH A O     1 
HETATM 4484 O  O     . HOH G 6 .   ? -17.190 -6.302  -6.216  1.00 52.45 ? 710 HOH A O     1 
HETATM 4485 O  O     . HOH G 6 .   ? -33.012 7.620   -3.352  1.00 55.04 ? 711 HOH A O     1 
HETATM 4486 O  O     . HOH G 6 .   ? 26.553  -34.804 -39.442 1.00 54.08 ? 712 HOH A O     1 
HETATM 4487 O  O     . HOH G 6 .   ? 13.504  -32.082 -32.590 1.00 50.54 ? 713 HOH A O     1 
HETATM 4488 O  O     . HOH G 6 .   ? 27.269  -17.006 -7.310  1.00 52.61 ? 714 HOH A O     1 
HETATM 4489 O  O     . HOH G 6 .   ? -15.298 12.065  -0.104  1.00 49.77 ? 715 HOH A O     1 
HETATM 4490 O  O     . HOH G 6 .   ? 2.012   -21.310 -47.743 1.00 43.92 ? 716 HOH A O     1 
HETATM 4491 O  O     . HOH G 6 .   ? 26.383  -36.713 -47.035 1.00 45.59 ? 717 HOH A O     1 
HETATM 4492 O  O     . HOH G 6 .   ? -17.681 -23.504 -32.295 1.00 41.08 ? 718 HOH A O     1 
HETATM 4493 O  O     . HOH G 6 .   ? 17.366  -27.968 -1.901  1.00 50.11 ? 719 HOH A O     1 
HETATM 4494 O  O     . HOH G 6 .   ? 19.674  -10.285 -35.354 1.00 37.94 ? 720 HOH A O     1 
HETATM 4495 O  O     . HOH G 6 .   ? 2.506   -27.009 -11.202 1.00 63.64 ? 721 HOH A O     1 
HETATM 4496 O  O     . HOH G 6 .   ? -16.265 -2.515  -0.282  1.00 57.56 ? 722 HOH A O     1 
HETATM 4497 O  O     . HOH G 6 .   ? -17.035 -28.669 -7.765  1.00 51.50 ? 723 HOH A O     1 
HETATM 4498 O  O     . HOH G 6 .   ? -23.124 -24.038 -19.968 1.00 50.04 ? 724 HOH A O     1 
HETATM 4499 O  O     . HOH G 6 .   ? 15.504  -45.373 -11.108 1.00 68.75 ? 725 HOH A O     1 
HETATM 4500 O  O     . HOH G 6 .   ? -8.897  -36.551 -25.714 1.00 42.90 ? 726 HOH A O     1 
HETATM 4501 O  O     . HOH G 6 .   ? 4.786   -36.162 -43.373 1.00 50.84 ? 727 HOH A O     1 
HETATM 4502 O  O     . HOH G 6 .   ? 22.796  -12.205 -50.966 1.00 50.03 ? 728 HOH A O     1 
HETATM 4503 O  O     . HOH G 6 .   ? 21.249  -32.343 2.895   1.00 47.62 ? 729 HOH A O     1 
HETATM 4504 O  O     . HOH G 6 .   ? 30.329  -36.798 -18.419 1.00 38.58 ? 730 HOH A O     1 
HETATM 4505 O  O     . HOH G 6 .   ? 24.113  -5.941  -49.643 1.00 49.86 ? 731 HOH A O     1 
HETATM 4506 O  O     . HOH G 6 .   ? 17.108  -33.601 -29.960 1.00 42.57 ? 732 HOH A O     1 
HETATM 4507 O  O     . HOH G 6 .   ? -25.360 2.384   -7.271  1.00 49.74 ? 733 HOH A O     1 
HETATM 4508 O  O     . HOH G 6 .   ? 16.063  -22.256 -56.932 1.00 40.44 ? 734 HOH A O     1 
HETATM 4509 O  O     . HOH G 6 .   ? 27.044  -32.571 -52.382 1.00 56.39 ? 735 HOH A O     1 
HETATM 4510 O  O     . HOH G 6 .   ? 17.698  -33.317 -34.132 1.00 46.39 ? 736 HOH A O     1 
HETATM 4511 O  O     . HOH G 6 .   ? 24.377  -16.858 -44.181 1.00 44.82 ? 737 HOH A O     1 
HETATM 4512 O  O     . HOH G 6 .   ? 33.507  -31.918 -9.611  1.00 48.85 ? 738 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   GUA B . n 
A 1 2   G   2   2   2   G   GUA B . n 
A 1 3   C   3   3   3   C   CYT B . n 
A 1 4   C   4   4   4   C   CYT B . n 
A 1 5   C   5   5   5   C   CYT B . n 
A 1 6   G   6   6   6   G   GUA B . n 
A 1 7   G   7   7   7   G   GUA B . n 
A 1 8   G   8   8   8   G   GUA B . n 
A 1 9   G   9   9   9   G   GUA B . n 
A 1 10  C   10  10  10  C   CYT B . n 
A 1 11  G   11  11  11  G   GUA B . n 
A 1 12  G   12  12  12  G   GUA B . n 
A 1 13  U   13  13  13  U   URI B . n 
A 1 14  U   14  14  14  U   URI B . n 
A 1 15  C   15  15  15  C   CYT B . n 
A 1 16  G   16  16  16  G   GUA B . n 
A 1 17  A   17  17  17  A   ADE B . n 
A 1 18  U   18  18  18  U   URI B . n 
A 1 19  U   19  19  19  U   URI B . n 
A 1 20  C   20  20  20  C   CYT B . n 
A 1 21  C   21  21  21  C   CYT B . n 
A 1 22  G   22  22  22  G   GUA B . n 
A 1 23  C   23  23  23  C   CYT B . n 
A 1 24  C   24  24  24  C   CYT B . n 
A 1 25  C   25  25  25  C   CYT B . n 
A 1 26  U   26  26  26  U   URI B . n 
A 1 27  G   27  27  27  G   GUA B . n 
A 1 28  G   28  28  28  G   GUA B . n 
A 1 29  G   29  29  29  G   GUA B . n 
A 1 30  C   30  30  30  C   CYT B . n 
A 1 31  C   31  31  31  C   CYT B . n 
A 1 32  A   32  32  32  A   ADE B . n 
A 1 33  C   33  33  33  C   CYT B . n 
A 1 34  C   34  34  34  C   CYT B . n 
B 2 1   MET 1   1   ?   ?   ?   A . n 
B 2 2   LYS 2   2   ?   ?   ?   A . n 
B 2 3   VAL 3   3   3   VAL VAL A . n 
B 2 4   GLU 4   4   4   GLU GLU A . n 
B 2 5   GLU 5   5   5   GLU GLU A . n 
B 2 6   ILE 6   6   6   ILE ILE A . n 
B 2 7   LEU 7   7   7   LEU LEU A . n 
B 2 8   GLU 8   8   8   GLU GLU A . n 
B 2 9   LYS 9   9   9   LYS LYS A . n 
B 2 10  ALA 10  10  10  ALA ALA A . n 
B 2 11  LEU 11  11  11  LEU LEU A . n 
B 2 12  GLU 12  12  12  GLU GLU A . n 
B 2 13  LEU 13  13  13  LEU LEU A . n 
B 2 14  VAL 14  14  14  VAL VAL A . n 
B 2 15  ILE 15  15  15  ILE ILE A . n 
B 2 16  PRO 16  16  16  PRO PRO A . n 
B 2 17  ASP 17  17  17  ASP ASP A . n 
B 2 18  GLU 18  18  18  GLU GLU A . n 
B 2 19  GLU 19  19  19  GLU GLU A . n 
B 2 20  GLU 20  20  20  GLU GLU A . n 
B 2 21  VAL 21  21  21  VAL VAL A . n 
B 2 22  ARG 22  22  22  ARG ARG A . n 
B 2 23  LYS 23  23  23  LYS LYS A . n 
B 2 24  GLY 24  24  24  GLY GLY A . n 
B 2 25  ARG 25  25  25  ARG ARG A . n 
B 2 26  GLU 26  26  26  GLU GLU A . n 
B 2 27  ALA 27  27  27  ALA ALA A . n 
B 2 28  GLU 28  28  28  GLU GLU A . n 
B 2 29  GLU 29  29  29  GLU GLU A . n 
B 2 30  GLU 30  30  30  GLU GLU A . n 
B 2 31  LEU 31  31  31  LEU LEU A . n 
B 2 32  ARG 32  32  32  ARG ARG A . n 
B 2 33  ARG 33  33  33  ARG ARG A . n 
B 2 34  ARG 34  34  34  ARG ARG A . n 
B 2 35  LEU 35  35  35  LEU LEU A . n 
B 2 36  ASP 36  36  36  ASP ASP A . n 
B 2 37  GLU 37  37  37  GLU GLU A . n 
B 2 38  LEU 38  38  38  LEU LEU A . n 
B 2 39  GLY 39  39  39  GLY GLY A . n 
B 2 40  VAL 40  40  40  VAL VAL A . n 
B 2 41  GLU 41  41  41  GLU GLU A . n 
B 2 42  TYR 42  42  42  TYR TYR A . n 
B 2 43  VAL 43  43  43  VAL VAL A . n 
B 2 44  PHE 44  44  44  PHE PHE A . n 
B 2 45  VAL 45  45  45  VAL VAL A . n 
B 2 46  GLY 46  46  46  GLY GLY A . n 
B 2 47  SER 47  47  47  SER SER A . n 
B 2 48  TYR 48  48  48  TYR TYR A . n 
B 2 49  ALA 49  49  49  ALA ALA A . n 
B 2 50  ARG 50  50  50  ARG ARG A . n 
B 2 51  ASN 51  51  51  ASN ASN A . n 
B 2 52  THR 52  52  52  THR THR A . n 
B 2 53  TRP 53  53  53  TRP TRP A . n 
B 2 54  LEU 54  54  54  LEU LEU A . n 
B 2 55  LYS 55  55  55  LYS LYS A . n 
B 2 56  GLY 56  56  56  GLY GLY A . n 
B 2 57  SER 57  57  57  SER SER A . n 
B 2 58  LEU 58  58  58  LEU LEU A . n 
B 2 59  GLU 59  59  59  GLU GLU A . n 
B 2 60  ILE 60  60  60  ILE ILE A . n 
B 2 61  ASP 61  61  61  ASP ASP A . n 
B 2 62  VAL 62  62  62  VAL VAL A . n 
B 2 63  PHE 63  63  63  PHE PHE A . n 
B 2 64  LEU 64  64  64  LEU LEU A . n 
B 2 65  LEU 65  65  65  LEU LEU A . n 
B 2 66  PHE 66  66  66  PHE PHE A . n 
B 2 67  PRO 67  67  67  PRO PRO A . n 
B 2 68  GLU 68  68  68  GLU GLU A . n 
B 2 69  GLU 69  69  69  GLU GLU A . n 
B 2 70  PHE 70  70  70  PHE PHE A . n 
B 2 71  SER 71  71  71  SER SER A . n 
B 2 72  LYS 72  72  72  LYS LYS A . n 
B 2 73  GLU 73  73  73  GLU GLU A . n 
B 2 74  GLU 74  74  74  GLU GLU A . n 
B 2 75  LEU 75  75  75  LEU LEU A . n 
B 2 76  ARG 76  76  76  ARG ARG A . n 
B 2 77  GLU 77  77  77  GLU GLU A . n 
B 2 78  ARG 78  78  78  ARG ARG A . n 
B 2 79  GLY 79  79  79  GLY GLY A . n 
B 2 80  LEU 80  80  80  LEU LEU A . n 
B 2 81  GLU 81  81  81  GLU GLU A . n 
B 2 82  ILE 82  82  82  ILE ILE A . n 
B 2 83  GLY 83  83  83  GLY GLY A . n 
B 2 84  LYS 84  84  84  LYS LYS A . n 
B 2 85  ALA 85  85  85  ALA ALA A . n 
B 2 86  VAL 86  86  86  VAL VAL A . n 
B 2 87  LEU 87  87  87  LEU LEU A . n 
B 2 88  ASP 88  88  88  ASP ASP A . n 
B 2 89  SER 89  89  89  SER SER A . n 
B 2 90  TYR 90  90  90  TYR TYR A . n 
B 2 91  GLU 91  91  91  GLU GLU A . n 
B 2 92  ILE 92  92  92  ILE ILE A . n 
B 2 93  ARG 93  93  93  ARG ARG A . n 
B 2 94  TYR 94  94  94  TYR TYR A . n 
B 2 95  ALA 95  95  95  ALA ALA A . n 
B 2 96  GLU 96  96  96  GLU GLU A . n 
B 2 97  HIS 97  97  97  HIS HIS A . n 
B 2 98  PRO 98  98  98  PRO PRO A . n 
B 2 99  TYR 99  99  99  TYR TYR A . n 
B 2 100 VAL 100 100 100 VAL VAL A . n 
B 2 101 HIS 101 101 101 HIS HIS A . n 
B 2 102 GLY 102 102 102 GLY GLY A . n 
B 2 103 VAL 103 103 103 VAL VAL A . n 
B 2 104 VAL 104 104 104 VAL VAL A . n 
B 2 105 LYS 105 105 105 LYS LYS A . n 
B 2 106 GLY 106 106 106 GLY GLY A . n 
B 2 107 VAL 107 107 107 VAL VAL A . n 
B 2 108 GLU 108 108 108 GLU GLU A . n 
B 2 109 VAL 109 109 109 VAL VAL A . n 
B 2 110 ASP 110 110 110 ASP ASP A . n 
B 2 111 VAL 111 111 111 VAL VAL A . n 
B 2 112 VAL 112 112 112 VAL VAL A . n 
B 2 113 PRO 113 113 113 PRO PRO A . n 
B 2 114 CYS 114 114 114 CYS CYS A . n 
B 2 115 TYR 115 115 115 TYR TYR A . n 
B 2 116 LYS 116 116 116 LYS LYS A . n 
B 2 117 LEU 117 117 117 LEU LEU A . n 
B 2 118 LYS 118 118 118 LYS LYS A . n 
B 2 119 GLU 119 119 119 GLU GLU A . n 
B 2 120 PRO 120 120 120 PRO PRO A . n 
B 2 121 LYS 121 121 121 LYS LYS A . n 
B 2 122 ASN 122 122 122 ASN ASN A . n 
B 2 123 ILE 123 123 123 ILE ILE A . n 
B 2 124 LYS 124 124 124 LYS LYS A . n 
B 2 125 SER 125 125 125 SER SER A . n 
B 2 126 ALA 126 126 126 ALA ALA A . n 
B 2 127 VAL 127 127 127 VAL VAL A . n 
B 2 128 ASP 128 128 128 ASP ASP A . n 
B 2 129 ARG 129 129 129 ARG ARG A . n 
B 2 130 THR 130 130 130 THR THR A . n 
B 2 131 PRO 131 131 131 PRO PRO A . n 
B 2 132 PHE 132 132 132 PHE PHE A . n 
B 2 133 HIS 133 133 133 HIS HIS A . n 
B 2 134 HIS 134 134 134 HIS HIS A . n 
B 2 135 LYS 135 135 135 LYS LYS A . n 
B 2 136 TRP 136 136 136 TRP TRP A . n 
B 2 137 LEU 137 137 137 LEU LEU A . n 
B 2 138 GLU 138 138 138 GLU GLU A . n 
B 2 139 GLY 139 139 139 GLY GLY A . n 
B 2 140 ARG 140 140 140 ARG ARG A . n 
B 2 141 ILE 141 141 141 ILE ILE A . n 
B 2 142 LYS 142 142 142 LYS LYS A . n 
B 2 143 GLY 143 143 143 GLY GLY A . n 
B 2 144 LYS 144 144 144 LYS LYS A . n 
B 2 145 GLU 145 145 145 GLU GLU A . n 
B 2 146 ASN 146 146 146 ASN ASN A . n 
B 2 147 GLU 147 147 147 GLU GLU A . n 
B 2 148 VAL 148 148 148 VAL VAL A . n 
B 2 149 ARG 149 149 149 ARG ARG A . n 
B 2 150 LEU 150 150 150 LEU LEU A . n 
B 2 151 LEU 151 151 151 LEU LEU A . n 
B 2 152 LYS 152 152 152 LYS LYS A . n 
B 2 153 GLY 153 153 153 GLY GLY A . n 
B 2 154 PHE 154 154 154 PHE PHE A . n 
B 2 155 LEU 155 155 155 LEU LEU A . n 
B 2 156 LYS 156 156 156 LYS LYS A . n 
B 2 157 ALA 157 157 157 ALA ALA A . n 
B 2 158 ASN 158 158 158 ASN ASN A . n 
B 2 159 GLY 159 159 159 GLY GLY A . n 
B 2 160 ILE 160 160 160 ILE ILE A . n 
B 2 161 TYR 161 161 161 TYR TYR A . n 
B 2 162 GLY 162 162 162 GLY GLY A . n 
B 2 163 ALA 163 163 163 ALA ALA A . n 
B 2 164 GLU 164 164 164 GLU GLU A . n 
B 2 165 TYR 165 165 165 TYR TYR A . n 
B 2 166 LYS 166 166 166 LYS LYS A . n 
B 2 167 VAL 167 167 167 VAL VAL A . n 
B 2 168 ARG 168 168 168 ARG ARG A . n 
B 2 169 GLY 169 169 169 GLY GLY A . n 
B 2 170 PHE 170 170 170 PHE PHE A . n 
B 2 171 SER 171 171 171 SER SER A . n 
B 2 172 GLY 172 172 172 GLY GLY A . n 
B 2 173 TYR 173 173 173 TYR TYR A . n 
B 2 174 LEU 174 174 174 LEU LEU A . n 
B 2 175 CYS 175 175 175 CYS CYS A . n 
B 2 176 GLU 176 176 176 GLU GLU A . n 
B 2 177 LEU 177 177 177 LEU LEU A . n 
B 2 178 LEU 178 178 178 LEU LEU A . n 
B 2 179 ILE 179 179 179 ILE ILE A . n 
B 2 180 VAL 180 180 180 VAL VAL A . n 
B 2 181 PHE 181 181 181 PHE PHE A . n 
B 2 182 TYR 182 182 182 TYR TYR A . n 
B 2 183 GLY 183 183 183 GLY GLY A . n 
B 2 184 SER 184 184 184 SER SER A . n 
B 2 185 PHE 185 185 185 PHE PHE A . n 
B 2 186 LEU 186 186 186 LEU LEU A . n 
B 2 187 GLU 187 187 187 GLU GLU A . n 
B 2 188 THR 188 188 188 THR THR A . n 
B 2 189 VAL 189 189 189 VAL VAL A . n 
B 2 190 LYS 190 190 190 LYS LYS A . n 
B 2 191 ASN 191 191 191 ASN ASN A . n 
B 2 192 ALA 192 192 192 ALA ALA A . n 
B 2 193 ARG 193 193 193 ARG ARG A . n 
B 2 194 ARG 194 194 194 ARG ARG A . n 
B 2 195 TRP 195 195 195 TRP TRP A . n 
B 2 196 THR 196 196 196 THR THR A . n 
B 2 197 ARG 197 197 197 ARG ARG A . n 
B 2 198 ARG 198 198 198 ARG ARG A . n 
B 2 199 THR 199 199 199 THR THR A . n 
B 2 200 VAL 200 200 200 VAL VAL A . n 
B 2 201 ILE 201 201 201 ILE ILE A . n 
B 2 202 ASP 202 202 202 ASP ASP A . n 
B 2 203 VAL 203 203 203 VAL VAL A . n 
B 2 204 ALA 204 204 204 ALA ALA A . n 
B 2 205 LYS 205 205 205 LYS LYS A . n 
B 2 206 GLY 206 206 206 GLY GLY A . n 
B 2 207 GLU 207 207 207 GLU GLU A . n 
B 2 208 VAL 208 208 208 VAL VAL A . n 
B 2 209 ARG 209 209 209 ARG ARG A . n 
B 2 210 LYS 210 210 210 LYS LYS A . n 
B 2 211 GLY 211 211 211 GLY GLY A . n 
B 2 212 GLU 212 212 212 GLU GLU A . n 
B 2 213 GLU 213 213 213 GLU GLU A . n 
B 2 214 PHE 214 214 214 PHE PHE A . n 
B 2 215 PHE 215 215 215 PHE PHE A . n 
B 2 216 VAL 216 216 216 VAL VAL A . n 
B 2 217 VAL 217 217 217 VAL VAL A . n 
B 2 218 ASP 218 218 218 ASP ASP A . n 
B 2 219 PRO 219 219 219 PRO PRO A . n 
B 2 220 VAL 220 220 220 VAL VAL A . n 
B 2 221 ASP 221 221 221 ASP ASP A . n 
B 2 222 GLU 222 222 222 GLU GLU A . n 
B 2 223 LYS 223 223 223 LYS LYS A . n 
B 2 224 ARG 224 224 224 ARG ARG A . n 
B 2 225 ASN 225 225 225 ASN ASN A . n 
B 2 226 VAL 226 226 226 VAL VAL A . n 
B 2 227 ALA 227 227 227 ALA ALA A . n 
B 2 228 ALA 228 228 228 ALA ALA A . n 
B 2 229 ASN 229 229 229 ASN ASN A . n 
B 2 230 LEU 230 230 230 LEU LEU A . n 
B 2 231 SER 231 231 231 SER SER A . n 
B 2 232 LEU 232 232 232 LEU LEU A . n 
B 2 233 ASP 233 233 233 ASP ASP A . n 
B 2 234 ASN 234 234 234 ASN ASN A . n 
B 2 235 LEU 235 235 235 LEU LEU A . n 
B 2 236 ALA 236 236 236 ALA ALA A . n 
B 2 237 ARG 237 237 237 ARG ARG A . n 
B 2 238 PHE 238 238 238 PHE PHE A . n 
B 2 239 VAL 239 239 239 VAL VAL A . n 
B 2 240 HIS 240 240 240 HIS HIS A . n 
B 2 241 LEU 241 241 241 LEU LEU A . n 
B 2 242 CYS 242 242 242 CYS CYS A . n 
B 2 243 ARG 243 243 243 ARG ARG A . n 
B 2 244 GLU 244 244 244 GLU GLU A . n 
B 2 245 PHE 245 245 245 PHE PHE A . n 
B 2 246 MET 246 246 246 MET MET A . n 
B 2 247 GLU 247 247 247 GLU GLU A . n 
B 2 248 ALA 248 248 248 ALA ALA A . n 
B 2 249 PRO 249 249 249 PRO PRO A . n 
B 2 250 SER 250 250 250 SER SER A . n 
B 2 251 LEU 251 251 251 LEU LEU A . n 
B 2 252 GLY 252 252 252 GLY GLY A . n 
B 2 253 PHE 253 253 253 PHE PHE A . n 
B 2 254 PHE 254 254 254 PHE PHE A . n 
B 2 255 LYS 255 255 255 LYS LYS A . n 
B 2 256 PRO 256 256 256 PRO PRO A . n 
B 2 257 LYS 257 257 257 LYS LYS A . n 
B 2 258 HIS 258 258 ?   ?   ?   A . n 
B 2 259 PRO 259 259 ?   ?   ?   A . n 
B 2 260 LEU 260 260 ?   ?   ?   A . n 
B 2 261 GLU 261 261 ?   ?   ?   A . n 
B 2 262 ILE 262 262 262 ILE ILE A . n 
B 2 263 GLU 263 263 263 GLU GLU A . n 
B 2 264 PRO 264 264 264 PRO PRO A . n 
B 2 265 GLU 265 265 265 GLU GLU A . n 
B 2 266 ARG 266 266 266 ARG ARG A . n 
B 2 267 LEU 267 267 267 LEU LEU A . n 
B 2 268 ARG 268 268 268 ARG ARG A . n 
B 2 269 LYS 269 269 269 LYS LYS A . n 
B 2 270 ILE 270 270 270 ILE ILE A . n 
B 2 271 VAL 271 271 271 VAL VAL A . n 
B 2 272 GLU 272 272 272 GLU GLU A . n 
B 2 273 GLU 273 273 273 GLU GLU A . n 
B 2 274 ARG 274 274 274 ARG ARG A . n 
B 2 275 GLY 275 275 275 GLY GLY A . n 
B 2 276 THR 276 276 276 THR THR A . n 
B 2 277 ALA 277 277 277 ALA ALA A . n 
B 2 278 VAL 278 278 278 VAL VAL A . n 
B 2 279 PHE 279 279 279 PHE PHE A . n 
B 2 280 ALA 280 280 280 ALA ALA A . n 
B 2 281 VAL 281 281 281 VAL VAL A . n 
B 2 282 LYS 282 282 282 LYS LYS A . n 
B 2 283 PHE 283 283 283 PHE PHE A . n 
B 2 284 ARG 284 284 284 ARG ARG A . n 
B 2 285 LYS 285 285 285 LYS LYS A . n 
B 2 286 PRO 286 286 286 PRO PRO A . n 
B 2 287 ASP 287 287 287 ASP ASP A . n 
B 2 288 ILE 288 288 288 ILE ILE A . n 
B 2 289 VAL 289 289 289 VAL VAL A . n 
B 2 290 ASP 290 290 290 ASP ASP A . n 
B 2 291 ASP 291 291 291 ASP ASP A . n 
B 2 292 ASN 292 292 292 ASN ASN A . n 
B 2 293 LEU 293 293 293 LEU LEU A . n 
B 2 294 TYR 294 294 294 TYR TYR A . n 
B 2 295 PRO 295 295 295 PRO PRO A . n 
B 2 296 GLN 296 296 296 GLN GLN A . n 
B 2 297 LEU 297 297 297 LEU LEU A . n 
B 2 298 GLU 298 298 298 GLU GLU A . n 
B 2 299 ARG 299 299 299 ARG ARG A . n 
B 2 300 ALA 300 300 300 ALA ALA A . n 
B 2 301 SER 301 301 301 SER SER A . n 
B 2 302 ARG 302 302 302 ARG ARG A . n 
B 2 303 LYS 303 303 303 LYS LYS A . n 
B 2 304 ILE 304 304 304 ILE ILE A . n 
B 2 305 PHE 305 305 305 PHE PHE A . n 
B 2 306 GLU 306 306 306 GLU GLU A . n 
B 2 307 PHE 307 307 307 PHE PHE A . n 
B 2 308 LEU 308 308 308 LEU LEU A . n 
B 2 309 GLU 309 309 309 GLU GLU A . n 
B 2 310 ARG 310 310 310 ARG ARG A . n 
B 2 311 GLU 311 311 311 GLU GLU A . n 
B 2 312 ASN 312 312 312 ASN ASN A . n 
B 2 313 PHE 313 313 313 PHE PHE A . n 
B 2 314 MET 314 314 314 MET MET A . n 
B 2 315 PRO 315 315 315 PRO PRO A . n 
B 2 316 LEU 316 316 316 LEU LEU A . n 
B 2 317 ARG 317 317 317 ARG ARG A . n 
B 2 318 SER 318 318 318 SER SER A . n 
B 2 319 ALA 319 319 319 ALA ALA A . n 
B 2 320 PHE 320 320 320 PHE PHE A . n 
B 2 321 LYS 321 321 321 LYS LYS A . n 
B 2 322 ALA 322 322 322 ALA ALA A . n 
B 2 323 SER 323 323 323 SER SER A . n 
B 2 324 GLU 324 324 324 GLU GLU A . n 
B 2 325 GLU 325 325 325 GLU GLU A . n 
B 2 326 PHE 326 326 326 PHE PHE A . n 
B 2 327 CYS 327 327 327 CYS CYS A . n 
B 2 328 TYR 328 328 328 TYR TYR A . n 
B 2 329 LEU 329 329 329 LEU LEU A . n 
B 2 330 LEU 330 330 330 LEU LEU A . n 
B 2 331 PHE 331 331 331 PHE PHE A . n 
B 2 332 GLU 332 332 332 GLU GLU A . n 
B 2 333 CYS 333 333 333 CYS CYS A . n 
B 2 334 GLN 334 334 334 GLN GLN A . n 
B 2 335 ILE 335 335 335 ILE ILE A . n 
B 2 336 LYS 336 336 336 LYS LYS A . n 
B 2 337 GLU 337 337 337 GLU GLU A . n 
B 2 338 ILE 338 338 338 ILE ILE A . n 
B 2 339 SER 339 339 339 SER SER A . n 
B 2 340 ARG 340 340 340 ARG ARG A . n 
B 2 341 VAL 341 341 341 VAL VAL A . n 
B 2 342 PHE 342 342 342 PHE PHE A . n 
B 2 343 ARG 343 343 343 ARG ARG A . n 
B 2 344 ARG 344 344 344 ARG ARG A . n 
B 2 345 MET 345 345 345 MET MET A . n 
B 2 346 GLY 346 346 346 GLY GLY A . n 
B 2 347 PRO 347 347 347 PRO PRO A . n 
B 2 348 GLN 348 348 348 GLN GLN A . n 
B 2 349 PHE 349 349 349 PHE PHE A . n 
B 2 350 GLU 350 350 350 GLU GLU A . n 
B 2 351 ASP 351 351 351 ASP ASP A . n 
B 2 352 GLU 352 352 352 GLU GLU A . n 
B 2 353 ARG 353 353 353 ARG ARG A . n 
B 2 354 ASN 354 354 354 ASN ASN A . n 
B 2 355 VAL 355 355 355 VAL VAL A . n 
B 2 356 LYS 356 356 356 LYS LYS A . n 
B 2 357 LYS 357 357 357 LYS LYS A . n 
B 2 358 PHE 358 358 358 PHE PHE A . n 
B 2 359 LEU 359 359 359 LEU LEU A . n 
B 2 360 SER 360 360 360 SER SER A . n 
B 2 361 ARG 361 361 361 ARG ARG A . n 
B 2 362 ASN 362 362 362 ASN ASN A . n 
B 2 363 ARG 363 363 363 ARG ARG A . n 
B 2 364 ALA 364 364 364 ALA ALA A . n 
B 2 365 PHE 365 365 365 PHE PHE A . n 
B 2 366 ARG 366 366 366 ARG ARG A . n 
B 2 367 PRO 367 367 367 PRO PRO A . n 
B 2 368 PHE 368 368 368 PHE PHE A . n 
B 2 369 ILE 369 369 369 ILE ILE A . n 
B 2 370 GLU 370 370 370 GLU GLU A . n 
B 2 371 ASN 371 371 371 ASN ASN A . n 
B 2 372 GLY 372 372 372 GLY GLY A . n 
B 2 373 ARG 373 373 373 ARG ARG A . n 
B 2 374 TRP 374 374 374 TRP TRP A . n 
B 2 375 TRP 375 375 375 TRP TRP A . n 
B 2 376 ALA 376 376 376 ALA ALA A . n 
B 2 377 PHE 377 377 377 PHE PHE A . n 
B 2 378 GLU 378 378 378 GLU GLU A . n 
B 2 379 MET 379 379 379 MET MET A . n 
B 2 380 ARG 380 380 380 ARG ARG A . n 
B 2 381 LYS 381 381 381 LYS LYS A . n 
B 2 382 PHE 382 382 382 PHE PHE A . n 
B 2 383 THR 383 383 383 THR THR A . n 
B 2 384 THR 384 384 384 THR THR A . n 
B 2 385 PRO 385 385 385 PRO PRO A . n 
B 2 386 GLU 386 386 386 GLU GLU A . n 
B 2 387 GLU 387 387 387 GLU GLU A . n 
B 2 388 GLY 388 388 388 GLY GLY A . n 
B 2 389 VAL 389 389 389 VAL VAL A . n 
B 2 390 ARG 390 390 390 ARG ARG A . n 
B 2 391 SER 391 391 391 SER SER A . n 
B 2 392 TYR 392 392 392 TYR TYR A . n 
B 2 393 ALA 393 393 393 ALA ALA A . n 
B 2 394 SER 394 394 394 SER SER A . n 
B 2 395 THR 395 395 395 THR THR A . n 
B 2 396 HIS 396 396 396 HIS HIS A . n 
B 2 397 TRP 397 397 397 TRP TRP A . n 
B 2 398 HIS 398 398 398 HIS HIS A . n 
B 2 399 THR 399 399 399 THR THR A . n 
B 2 400 LEU 400 400 400 LEU LEU A . n 
B 2 401 GLY 401 401 401 GLY GLY A . n 
B 2 402 LYS 402 402 402 LYS LYS A . n 
B 2 403 ASN 403 403 403 ASN ASN A . n 
B 2 404 VAL 404 404 404 VAL VAL A . n 
B 2 405 GLY 405 405 405 GLY GLY A . n 
B 2 406 GLU 406 406 406 GLU GLU A . n 
B 2 407 SER 407 407 407 SER SER A . n 
B 2 408 ILE 408 408 408 ILE ILE A . n 
B 2 409 ARG 409 409 409 ARG ARG A . n 
B 2 410 GLU 410 410 410 GLU GLU A . n 
B 2 411 TYR 411 411 411 TYR TYR A . n 
B 2 412 PHE 412 412 412 PHE PHE A . n 
B 2 413 GLU 413 413 413 GLU GLU A . n 
B 2 414 ILE 414 414 414 ILE ILE A . n 
B 2 415 ILE 415 415 415 ILE ILE A . n 
B 2 416 SER 416 416 416 SER SER A . n 
B 2 417 GLY 417 417 417 GLY GLY A . n 
B 2 418 GLU 418 418 418 GLU GLU A . n 
B 2 419 LYS 419 419 419 LYS LYS A . n 
B 2 420 LEU 420 420 420 LEU LEU A . n 
B 2 421 PHE 421 421 421 PHE PHE A . n 
B 2 422 LYS 422 422 422 LYS LYS A . n 
B 2 423 GLU 423 423 423 GLU GLU A . n 
B 2 424 PRO 424 424 424 PRO PRO A . n 
B 2 425 VAL 425 425 425 VAL VAL A . n 
B 2 426 THR 426 426 426 THR THR A . n 
B 2 427 ALA 427 427 427 ALA ALA A . n 
B 2 428 GLU 428 428 428 GLU GLU A . n 
B 2 429 LEU 429 429 429 LEU LEU A . n 
B 2 430 CYS 430 430 430 CYS CYS A . n 
B 2 431 GLU 431 431 431 GLU GLU A . n 
B 2 432 MET 432 432 432 MET MET A . n 
B 2 433 MET 433 433 433 MET MET A . n 
B 2 434 GLY 434 434 434 GLY GLY A . n 
B 2 435 VAL 435 435 435 VAL VAL A . n 
B 2 436 LYS 436 436 436 LYS LYS A . n 
B 2 437 ASP 437 437 437 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1   601 601 SO4 SO4 A . 
D 4 MG  1   602 602 MG  MG2 A . 
E 5 CTP 1   504 504 CTP CTP A . 
F 6 HOH 1   35  7   HOH TIP B . 
F 6 HOH 2   36  9   HOH TIP B . 
F 6 HOH 3   37  10  HOH TIP B . 
F 6 HOH 4   38  12  HOH TIP B . 
F 6 HOH 5   39  15  HOH TIP B . 
F 6 HOH 6   40  18  HOH TIP B . 
F 6 HOH 7   41  20  HOH TIP B . 
F 6 HOH 8   42  21  HOH TIP B . 
F 6 HOH 9   43  28  HOH TIP B . 
F 6 HOH 10  44  39  HOH TIP B . 
F 6 HOH 11  45  42  HOH TIP B . 
F 6 HOH 12  46  44  HOH TIP B . 
F 6 HOH 13  47  46  HOH TIP B . 
F 6 HOH 14  48  54  HOH TIP B . 
F 6 HOH 15  49  61  HOH TIP B . 
F 6 HOH 16  50  81  HOH TIP B . 
F 6 HOH 17  51  90  HOH TIP B . 
F 6 HOH 18  52  113 HOH TIP B . 
F 6 HOH 19  53  114 HOH TIP B . 
F 6 HOH 20  54  127 HOH TIP B . 
F 6 HOH 21  55  148 HOH TIP B . 
F 6 HOH 22  56  180 HOH TIP B . 
F 6 HOH 23  57  182 HOH TIP B . 
F 6 HOH 24  58  183 HOH TIP B . 
F 6 HOH 25  59  189 HOH TIP B . 
F 6 HOH 26  60  191 HOH TIP B . 
F 6 HOH 27  61  200 HOH TIP B . 
F 6 HOH 28  62  202 HOH TIP B . 
F 6 HOH 29  63  204 HOH TIP B . 
F 6 HOH 30  64  211 HOH TIP B . 
F 6 HOH 31  65  212 HOH TIP B . 
F 6 HOH 32  66  213 HOH TIP B . 
F 6 HOH 33  67  214 HOH TIP B . 
F 6 HOH 34  68  223 HOH TIP B . 
F 6 HOH 35  69  232 HOH TIP B . 
F 6 HOH 36  70  244 HOH TIP B . 
F 6 HOH 37  71  257 HOH TIP B . 
F 6 HOH 38  72  260 HOH TIP B . 
G 6 HOH 1   603 1   HOH TIP A . 
G 6 HOH 2   604 3   HOH TIP A . 
G 6 HOH 3   605 4   HOH TIP A . 
G 6 HOH 4   606 5   HOH TIP A . 
G 6 HOH 5   607 6   HOH TIP A . 
G 6 HOH 6   608 8   HOH TIP A . 
G 6 HOH 7   609 13  HOH TIP A . 
G 6 HOH 8   610 14  HOH TIP A . 
G 6 HOH 9   611 16  HOH TIP A . 
G 6 HOH 10  612 17  HOH TIP A . 
G 6 HOH 11  613 19  HOH TIP A . 
G 6 HOH 12  614 22  HOH TIP A . 
G 6 HOH 13  615 24  HOH TIP A . 
G 6 HOH 14  616 25  HOH TIP A . 
G 6 HOH 15  617 26  HOH TIP A . 
G 6 HOH 16  618 27  HOH TIP A . 
G 6 HOH 17  619 29  HOH TIP A . 
G 6 HOH 18  620 30  HOH TIP A . 
G 6 HOH 19  621 31  HOH TIP A . 
G 6 HOH 20  622 32  HOH TIP A . 
G 6 HOH 21  623 33  HOH TIP A . 
G 6 HOH 22  624 34  HOH TIP A . 
G 6 HOH 23  625 35  HOH TIP A . 
G 6 HOH 24  626 36  HOH TIP A . 
G 6 HOH 25  627 37  HOH TIP A . 
G 6 HOH 26  628 38  HOH TIP A . 
G 6 HOH 27  629 40  HOH TIP A . 
G 6 HOH 28  630 41  HOH TIP A . 
G 6 HOH 29  631 43  HOH TIP A . 
G 6 HOH 30  632 45  HOH TIP A . 
G 6 HOH 31  633 47  HOH TIP A . 
G 6 HOH 32  634 48  HOH TIP A . 
G 6 HOH 33  635 49  HOH TIP A . 
G 6 HOH 34  636 50  HOH TIP A . 
G 6 HOH 35  637 51  HOH TIP A . 
G 6 HOH 36  638 52  HOH TIP A . 
G 6 HOH 37  639 53  HOH TIP A . 
G 6 HOH 38  640 55  HOH TIP A . 
G 6 HOH 39  641 56  HOH TIP A . 
G 6 HOH 40  642 58  HOH TIP A . 
G 6 HOH 41  643 60  HOH TIP A . 
G 6 HOH 42  644 62  HOH TIP A . 
G 6 HOH 43  645 65  HOH TIP A . 
G 6 HOH 44  646 66  HOH TIP A . 
G 6 HOH 45  647 67  HOH TIP A . 
G 6 HOH 46  648 70  HOH TIP A . 
G 6 HOH 47  649 76  HOH TIP A . 
G 6 HOH 48  650 79  HOH TIP A . 
G 6 HOH 49  651 82  HOH TIP A . 
G 6 HOH 50  652 83  HOH TIP A . 
G 6 HOH 51  653 84  HOH TIP A . 
G 6 HOH 52  654 85  HOH TIP A . 
G 6 HOH 53  655 86  HOH TIP A . 
G 6 HOH 54  656 87  HOH TIP A . 
G 6 HOH 55  657 89  HOH TIP A . 
G 6 HOH 56  658 91  HOH TIP A . 
G 6 HOH 57  659 93  HOH TIP A . 
G 6 HOH 58  660 94  HOH TIP A . 
G 6 HOH 59  661 96  HOH TIP A . 
G 6 HOH 60  662 98  HOH TIP A . 
G 6 HOH 61  663 99  HOH TIP A . 
G 6 HOH 62  664 100 HOH TIP A . 
G 6 HOH 63  665 104 HOH TIP A . 
G 6 HOH 64  666 106 HOH TIP A . 
G 6 HOH 65  667 107 HOH TIP A . 
G 6 HOH 66  668 108 HOH TIP A . 
G 6 HOH 67  669 109 HOH TIP A . 
G 6 HOH 68  670 115 HOH TIP A . 
G 6 HOH 69  671 118 HOH TIP A . 
G 6 HOH 70  672 125 HOH TIP A . 
G 6 HOH 71  673 130 HOH TIP A . 
G 6 HOH 72  674 136 HOH TIP A . 
G 6 HOH 73  675 140 HOH TIP A . 
G 6 HOH 74  676 143 HOH TIP A . 
G 6 HOH 75  677 144 HOH TIP A . 
G 6 HOH 76  678 146 HOH TIP A . 
G 6 HOH 77  679 149 HOH TIP A . 
G 6 HOH 78  680 154 HOH TIP A . 
G 6 HOH 79  681 156 HOH TIP A . 
G 6 HOH 80  682 160 HOH TIP A . 
G 6 HOH 81  683 165 HOH TIP A . 
G 6 HOH 82  684 166 HOH TIP A . 
G 6 HOH 83  685 170 HOH TIP A . 
G 6 HOH 84  686 172 HOH TIP A . 
G 6 HOH 85  687 173 HOH TIP A . 
G 6 HOH 86  688 175 HOH TIP A . 
G 6 HOH 87  689 176 HOH TIP A . 
G 6 HOH 88  690 177 HOH TIP A . 
G 6 HOH 89  691 178 HOH TIP A . 
G 6 HOH 90  692 179 HOH TIP A . 
G 6 HOH 91  693 181 HOH TIP A . 
G 6 HOH 92  694 184 HOH TIP A . 
G 6 HOH 93  695 185 HOH TIP A . 
G 6 HOH 94  696 186 HOH TIP A . 
G 6 HOH 95  697 188 HOH TIP A . 
G 6 HOH 96  698 192 HOH TIP A . 
G 6 HOH 97  699 195 HOH TIP A . 
G 6 HOH 98  700 196 HOH TIP A . 
G 6 HOH 99  701 197 HOH TIP A . 
G 6 HOH 100 702 199 HOH TIP A . 
G 6 HOH 101 703 201 HOH TIP A . 
G 6 HOH 102 704 203 HOH TIP A . 
G 6 HOH 103 705 207 HOH TIP A . 
G 6 HOH 104 706 210 HOH TIP A . 
G 6 HOH 105 707 215 HOH TIP A . 
G 6 HOH 106 708 216 HOH TIP A . 
G 6 HOH 107 709 220 HOH TIP A . 
G 6 HOH 108 710 221 HOH TIP A . 
G 6 HOH 109 711 222 HOH TIP A . 
G 6 HOH 110 712 224 HOH TIP A . 
G 6 HOH 111 713 226 HOH TIP A . 
G 6 HOH 112 714 228 HOH TIP A . 
G 6 HOH 113 715 229 HOH TIP A . 
G 6 HOH 114 716 231 HOH TIP A . 
G 6 HOH 115 717 233 HOH TIP A . 
G 6 HOH 116 718 234 HOH TIP A . 
G 6 HOH 117 719 235 HOH TIP A . 
G 6 HOH 118 720 236 HOH TIP A . 
G 6 HOH 119 721 237 HOH TIP A . 
G 6 HOH 120 722 240 HOH TIP A . 
G 6 HOH 121 723 242 HOH TIP A . 
G 6 HOH 122 724 243 HOH TIP A . 
G 6 HOH 123 725 245 HOH TIP A . 
G 6 HOH 124 726 247 HOH TIP A . 
G 6 HOH 125 727 250 HOH TIP A . 
G 6 HOH 126 728 251 HOH TIP A . 
G 6 HOH 127 729 252 HOH TIP A . 
G 6 HOH 128 730 254 HOH TIP A . 
G 6 HOH 129 731 255 HOH TIP A . 
G 6 HOH 130 732 256 HOH TIP A . 
G 6 HOH 131 733 258 HOH TIP A . 
G 6 HOH 132 734 262 HOH TIP A . 
G 6 HOH 133 735 263 HOH TIP A . 
G 6 HOH 134 736 265 HOH TIP A . 
G 6 HOH 135 737 267 HOH TIP A . 
G 6 HOH 136 738 268 HOH TIP A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O   ? B GLU 59 ? A GLU 59  ? 1_555 MG ? D MG . ? A MG 602 ? 1_555 O1G ? E CTP .  ? A CTP 504 ? 1_555 118.9 ? 
2 O   ? B GLU 59 ? A GLU 59  ? 1_555 MG ? D MG . ? A MG 602 ? 1_555 O1A ? E CTP .  ? A CTP 504 ? 1_555 141.2 ? 
3 O1G ? E CTP .  ? A CTP 504 ? 1_555 MG ? D MG . ? A MG 602 ? 1_555 O1A ? E CTP .  ? A CTP 504 ? 1_555 93.2  ? 
4 O   ? B GLU 59 ? A GLU 59  ? 1_555 MG ? D MG . ? A MG 602 ? 1_555 OD2 ? B ASP 61 ? A ASP 61  ? 1_555 81.3  ? 
5 O1G ? E CTP .  ? A CTP 504 ? 1_555 MG ? D MG . ? A MG 602 ? 1_555 OD2 ? B ASP 61 ? A ASP 61  ? 1_555 126.7 ? 
6 O1A ? E CTP .  ? A CTP 504 ? 1_555 MG ? D MG . ? A MG 602 ? 1_555 OD2 ? B ASP 61 ? A ASP 61  ? 1_555 61.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-11-14 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
MOLREP    phasing          .   ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    161 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   PHE 
_pdbx_validate_close_contact.auth_seq_id_2    170 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.00 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    PHE 
_pdbx_validate_symm_contact.auth_seq_id_1     365 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    GLY 
_pdbx_validate_symm_contact.auth_seq_id_2     434 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   7_555 
_pdbx_validate_symm_contact.dist              2.06 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            G 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            G 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.526 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.081 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 4   ? ? -28.15  -52.37 
2 1 GLU A 96  ? ? -140.05 -70.91 
3 1 GLU A 119 ? ? 67.19   109.76 
4 1 PRO A 249 ? ? -50.37  98.35  
5 1 LEU A 316 ? ? -92.35  -68.75 
6 1 GLU A 325 ? ? -93.71  -64.58 
7 1 ARG A 366 ? ? 77.97   114.55 
8 1 TYR A 411 ? ? 174.79  134.98 
9 1 PRO A 424 ? ? -72.66  36.73  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? B MET 1   
2 1 Y 1 A LYS 2   ? B LYS 2   
3 1 Y 1 A HIS 258 ? B HIS 258 
4 1 Y 1 A PRO 259 ? B PRO 259 
5 1 Y 1 A LEU 260 ? B LEU 260 
6 1 Y 1 A GLU 261 ? B GLU 261 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2DVI 'double helix'         
2DVI 'a-form double helix'  
2DVI 'hairpin loop'         
2DVI 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1  1_555 A C 31 1_555 -0.167 0.018  0.560  8.360   -4.369  -2.144  1  B_G1:C31_B  B 1  ? B 31 ? 19 1 
1 A G 2  1_555 A C 30 1_555 -0.342 -0.178 0.236  8.751   -14.212 0.661   2  B_G2:C30_B  B 2  ? B 30 ? 19 1 
1 A C 3  1_555 A G 29 1_555 0.439  -0.251 -0.102 9.252   -18.823 -0.039  3  B_C3:G29_B  B 3  ? B 29 ? 19 1 
1 A C 4  1_555 A G 28 1_555 0.312  -0.033 -0.270 4.924   -11.458 3.163   4  B_C4:G28_B  B 4  ? B 28 ? 19 1 
1 A C 5  1_555 A G 27 1_555 0.345  -0.222 0.067  4.488   -5.605  2.676   5  B_C5:G27_B  B 5  ? B 27 ? 19 1 
1 A G 6  1_555 A U 26 1_555 -2.104 -0.020 -0.636 -4.441  -7.131  13.167  6  B_G6:U26_B  B 6  ? B 26 ? 28 1 
1 A G 7  1_555 A C 25 1_555 -1.028 -0.280 0.105  0.584   -6.760  2.579   7  B_G7:C25_B  B 7  ? B 25 ? 19 1 
1 A G 8  1_555 A C 24 1_555 0.829  -0.171 -0.114 -6.774  -15.123 0.233   8  B_G8:C24_B  B 8  ? B 24 ? 19 1 
1 A G 9  1_555 A C 23 1_555 -0.535 -0.109 -0.124 -10.894 -11.460 5.682   9  B_G9:C23_B  B 9  ? B 23 ? 19 1 
1 A C 10 1_555 A G 22 1_555 0.458  -0.491 0.204  -1.729  -5.748  -1.081  10 B_C10:G22_B B 10 ? B 22 ? 19 1 
1 A G 11 1_555 A C 21 1_555 0.173  -0.245 0.144  -2.886  -10.164 -4.456  11 B_G11:C21_B B 11 ? B 21 ? 19 1 
1 A G 12 1_555 A C 20 1_555 -0.180 -0.199 -0.086 -11.593 -14.655 1.918   12 B_G12:C20_B B 12 ? B 20 ? 19 1 
1 A U 13 1_555 A A 17 1_555 4.079  -2.055 -0.125 -5.986  5.311   -85.112 13 B_U13:A17_B B 13 ? B 17 ? 24 4 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1  1_555 A C 31 1_555 A G 2  1_555 A C 30 1_555 -0.114 -1.402 3.191 -0.931 4.026  33.630 -3.022  0.054  3.010 6.926  1.601   
33.875 1  BB_G1G2:C30C31_BB   B 1  ? B 31 ? B 2  ? B 30 ? 
1 A G 2  1_555 A C 30 1_555 A C 3  1_555 A G 29 1_555 -0.258 -1.602 3.307 1.109  0.869  36.670 -2.664  0.563  3.261 1.380  -1.761  
36.697 2  BB_G2C3:G29C30_BB   B 2  ? B 30 ? B 3  ? B 29 ? 
1 A C 3  1_555 A G 29 1_555 A C 4  1_555 A G 28 1_555 -0.357 -1.879 3.337 -1.470 9.818  28.302 -5.519  0.409  2.570 19.342 2.897   
29.960 3  BB_C3C4:G28G29_BB   B 3  ? B 29 ? B 4  ? B 28 ? 
1 A C 4  1_555 A G 28 1_555 A C 5  1_555 A G 27 1_555 -0.234 -1.779 3.300 -3.954 7.440  29.500 -4.757  -0.297 2.786 14.248 7.572   
30.654 4  BB_C4C5:G27G28_BB   B 4  ? B 28 ? B 5  ? B 27 ? 
1 A C 5  1_555 A G 27 1_555 A G 6  1_555 A U 26 1_555 1.429  -2.345 3.526 4.999  9.764  17.995 -10.354 -1.897 2.277 28.082 -14.377 
21.051 5  BB_C5G6:U26G27_BB   B 5  ? B 27 ? B 6  ? B 26 ? 
1 A G 6  1_555 A U 26 1_555 A G 7  1_555 A C 25 1_555 -0.507 -1.885 3.236 -5.031 0.984  30.783 -3.691  -0.007 3.216 1.838  9.395   
31.196 6  BB_G6G7:C25U26_BB   B 6  ? B 26 ? B 7  ? B 25 ? 
1 A G 7  1_555 A C 25 1_555 A G 8  1_555 A C 24 1_555 -0.057 -1.768 3.486 3.504  9.711  40.626 -3.496  0.449  2.990 13.720 -4.951  
41.863 7  BB_G7G8:C24C25_BB   B 7  ? B 25 ? B 8  ? B 24 ? 
1 A G 8  1_555 A C 24 1_555 A G 9  1_555 A C 23 1_555 0.594  -2.179 3.178 2.348  10.586 24.661 -6.985  -0.767 2.124 23.393 -5.188  
26.906 8  BB_G8G9:C23C24_BB   B 8  ? B 24 ? B 9  ? B 23 ? 
1 A G 9  1_555 A C 23 1_555 A C 10 1_555 A G 22 1_555 0.386  -2.529 3.148 0.055  -0.706 32.154 -4.443  -0.687 3.201 -1.274 -0.099  
32.161 9  BB_G9C10:G22C23_BB  B 9  ? B 23 ? B 10 ? B 22 ? 
1 A C 10 1_555 A G 22 1_555 A G 11 1_555 A C 21 1_555 -0.993 -1.976 3.104 -0.340 6.145  23.379 -6.432  2.277  2.522 14.838 0.821   
24.165 10 BB_C10G11:C21G22_BB B 10 ? B 22 ? B 11 ? B 21 ? 
1 A G 11 1_555 A C 21 1_555 A G 12 1_555 A C 20 1_555 0.509  -1.746 3.498 2.150  6.116  33.628 -3.957  -0.516 3.166 10.451 -3.674  
34.229 11 BB_G11G12:C20C21_BB B 11 ? B 21 ? B 12 ? B 20 ? 
1 A G 12 1_555 A C 20 1_555 A U 13 1_555 A A 17 1_555 -1.856 -2.012 3.187 1.921  -1.640 81.060 -1.506  1.476  3.184 -1.261 -1.478  
81.092 12 BB_G12U13:A17C20_BB B 12 ? B 20 ? B 13 ? B 17 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION'              SO4 
4 'MAGNESIUM ION'            MG  
5 "CYTIDINE-5'-TRIPHOSPHATE" CTP 
6 water                      HOH 
#