data_2E1O
# 
_entry.id   2E1O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2E1O         
RCSB  RCSB026114   
WWPDB D_1000026114 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2006-11-14 
_pdbx_database_PDB_obs_spr.pdb_id           2E1O 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1WQI 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001000069.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E1O 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-27 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, A.'                                           1  
'Ohnishi, S.'                                            2  
'Abe, T.'                                                3  
'Nameki, N.'                                             4  
'Tochio, N.'                                             5  
'Koshiba, S.'                                            6  
'Kigawa, T.'                                             7  
'Yokoyama, S.'                                           8  
'Kawaii, S.'                                             9  
'Hirota, H.'                                             10 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of RSGI RUH-028, a homeobox domain from human cDNA' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, A.' 1  
primary 'Ohnishi, S.'  2  
primary 'Abe, T.'      3  
primary 'Nameki, N.'   4  
primary 'Tochio, N.'   5  
primary 'Koshiba, S.'  6  
primary 'Kigawa, T.'   7  
primary 'Yokoyama, S.' 8  
primary 'Kawaii, S.'   9  
primary 'Hirota, H.'   10 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Homeobox protein PRH' 
_entity.formula_weight             8059.108 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'homeobox domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Hematopoietically expressed homeobox, Homeobox protein HEX' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001000069.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  LYS n 
1 9  GLY n 
1 10 GLY n 
1 11 GLN n 
1 12 VAL n 
1 13 ARG n 
1 14 PHE n 
1 15 SER n 
1 16 ASN n 
1 17 ASP n 
1 18 GLN n 
1 19 THR n 
1 20 ILE n 
1 21 GLU n 
1 22 LEU n 
1 23 GLU n 
1 24 LYS n 
1 25 LYS n 
1 26 PHE n 
1 27 GLU n 
1 28 THR n 
1 29 GLN n 
1 30 LYS n 
1 31 TYR n 
1 32 LEU n 
1 33 SER n 
1 34 PRO n 
1 35 PRO n 
1 36 GLU n 
1 37 ARG n 
1 38 LYS n 
1 39 ARG n 
1 40 LEU n 
1 41 ALA n 
1 42 LYS n 
1 43 MET n 
1 44 LEU n 
1 45 GLN n 
1 46 LEU n 
1 47 SER n 
1 48 GLU n 
1 49 ARG n 
1 50 GLN n 
1 51 VAL n 
1 52 LYS n 
1 53 THR n 
1 54 TRP n 
1 55 PHE n 
1 56 GLN n 
1 57 ASN n 
1 58 ARG n 
1 59 ARG n 
1 60 ALA n 
1 61 LYS n 
1 62 TRP n 
1 63 ARG n 
1 64 ARG n 
1 65 SER n 
1 66 GLY n 
1 67 PRO n 
1 68 SER n 
1 69 SER n 
1 70 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'HHEX, HEX, PRH, PRHX' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell free synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040315-39 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HHEX_HUMAN 
_struct_ref.pdbx_db_accession          Q03014 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   KGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR 
_struct_ref.pdbx_align_begin           138 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2E1O 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 64 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q03014 
_struct_ref_seq.db_align_beg                  138 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  194 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       64 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2E1O GLY A 1  ? UNP Q03014 ? ? 'CLONING ARTIFACT' 1  1  
1 2E1O SER A 2  ? UNP Q03014 ? ? 'CLONING ARTIFACT' 2  2  
1 2E1O SER A 3  ? UNP Q03014 ? ? 'CLONING ARTIFACT' 3  3  
1 2E1O GLY A 4  ? UNP Q03014 ? ? 'CLONING ARTIFACT' 4  4  
1 2E1O SER A 5  ? UNP Q03014 ? ? 'CLONING ARTIFACT' 5  5  
1 2E1O SER A 6  ? UNP Q03014 ? ? 'CLONING ARTIFACT' 6  6  
1 2E1O GLY A 7  ? UNP Q03014 ? ? 'CLONING ARTIFACT' 7  7  
1 2E1O SER A 65 ? UNP Q03014 ? ? 'CLONING ARTIFACT' 65 8  
1 2E1O GLY A 66 ? UNP Q03014 ? ? 'CLONING ARTIFACT' 66 9  
1 2E1O PRO A 67 ? UNP Q03014 ? ? 'CLONING ARTIFACT' 67 10 
1 2E1O SER A 68 ? UNP Q03014 ? ? 'CLONING ARTIFACT' 68 11 
1 2E1O SER A 69 ? UNP Q03014 ? ? 'CLONING ARTIFACT' 69 12 
1 2E1O GLY A 70 ? UNP Q03014 ? ? 'CLONING ARTIFACT' 70 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'0.92mM RSGI RUH-028 U-15N,13C, 20mM d-Tris-HCl(pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2E1O 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2E1O 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations,structures with the lowest energy,target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2E1O 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy and target function' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection      XWINNMR 3.6            Bruker           1 
processing      NMRPipe 2003.316.09.03 'Delaglio, F.'   2 
'data analysis' NMRView 5.0.4          'Johnson, B. A.' 3 
'data analysis' Kujira  2.0.172        'Kobayashi, N.'  4 
refinement      CYANA   2.0.17         'Guntert, P.'    5 
# 
_exptl.entry_id          2E1O 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2E1O 
_struct.title                     'Solution structure of RSGI RUH-028, a homeobox domain from human cDNA' 
_struct.pdbx_descriptor           'Homeobox protein PRH' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E1O 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
;DNA binding protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 15 ? GLN A 29 ? SER A 15 GLN A 29 1 ? 15 
HELX_P HELX_P2 2 SER A 33 ? LEU A 44 ? SER A 33 LEU A 44 1 ? 12 
HELX_P HELX_P3 3 SER A 47 ? GLY A 66 ? SER A 47 GLY A 66 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2E1O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E1O 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? -14.056 18.477  7.195   1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? -14.171 18.825  5.791   1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? -12.853 18.705  5.053   1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? -12.726 17.913  4.120   1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? -13.964 17.537  7.459   1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1  ? -14.893 18.170  5.327   1.00 0.00 ? 1  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1  ? -14.522 19.844  5.713   1.00 0.00 ? 1  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2  ? -11.868 19.494  5.471   1.00 0.00 ? 2  SER A N    1  
ATOM 9     C CA   . SER A 1 2  ? -10.554 19.476  4.840   1.00 0.00 ? 2  SER A CA   1  
ATOM 10    C C    . SER A 1 2  ? -10.070 18.044  4.634   1.00 0.00 ? 2  SER A C    1  
ATOM 11    O O    . SER A 1 2  ? -9.544  17.702  3.575   1.00 0.00 ? 2  SER A O    1  
ATOM 12    C CB   . SER A 1 2  ? -9.545  20.250  5.692   1.00 0.00 ? 2  SER A CB   1  
ATOM 13    O OG   . SER A 1 2  ? -9.543  19.783  7.030   1.00 0.00 ? 2  SER A OG   1  
ATOM 14    H H    . SER A 1 2  ? -12.031 20.105  6.221   1.00 0.00 ? 2  SER A H    1  
ATOM 15    H HA   . SER A 1 2  ? -10.642 19.956  3.877   1.00 0.00 ? 2  SER A HA   1  
ATOM 16    H HB2  . SER A 1 2  ? -8.557  20.124  5.278   1.00 0.00 ? 2  SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2  ? -9.806  21.299  5.689   1.00 0.00 ? 2  SER A HB3  1  
ATOM 18    H HG   . SER A 1 2  ? -9.002  18.992  7.092   1.00 0.00 ? 2  SER A HG   1  
ATOM 19    N N    . SER A 1 3  ? -10.250 17.212  5.654   1.00 0.00 ? 3  SER A N    1  
ATOM 20    C CA   . SER A 1 3  ? -9.829  15.818  5.588   1.00 0.00 ? 3  SER A CA   1  
ATOM 21    C C    . SER A 1 3  ? -10.015 15.261  4.180   1.00 0.00 ? 3  SER A C    1  
ATOM 22    O O    . SER A 1 3  ? -10.952 15.629  3.473   1.00 0.00 ? 3  SER A O    1  
ATOM 23    C CB   . SER A 1 3  ? -10.620 14.975  6.590   1.00 0.00 ? 3  SER A CB   1  
ATOM 24    O OG   . SER A 1 3  ? -10.277 13.604  6.487   1.00 0.00 ? 3  SER A OG   1  
ATOM 25    H H    . SER A 1 3  ? -10.675 17.545  6.473   1.00 0.00 ? 3  SER A H    1  
ATOM 26    H HA   . SER A 1 3  ? -8.781  15.776  5.843   1.00 0.00 ? 3  SER A HA   1  
ATOM 27    H HB2  . SER A 1 3  ? -10.403 15.314  7.592   1.00 0.00 ? 3  SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3  ? -11.677 15.086  6.394   1.00 0.00 ? 3  SER A HB3  1  
ATOM 29    H HG   . SER A 1 3  ? -10.601 13.134  7.259   1.00 0.00 ? 3  SER A HG   1  
ATOM 30    N N    . GLY A 1 4  ? -9.113  14.370  3.779   1.00 0.00 ? 4  GLY A N    1  
ATOM 31    C CA   . GLY A 1 4  ? -9.194  13.776  2.457   1.00 0.00 ? 4  GLY A CA   1  
ATOM 32    C C    . GLY A 1 4  ? -8.315  12.549  2.318   1.00 0.00 ? 4  GLY A C    1  
ATOM 33    O O    . GLY A 1 4  ? -7.439  12.307  3.148   1.00 0.00 ? 4  GLY A O    1  
ATOM 34    H H    . GLY A 1 4  ? -8.387  14.114  4.385   1.00 0.00 ? 4  GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4  ? -10.219 13.496  2.262   1.00 0.00 ? 4  GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4  ? -8.887  14.509  1.726   1.00 0.00 ? 4  GLY A HA3  1  
ATOM 37    N N    . SER A 1 5  ? -8.549  11.771  1.266   1.00 0.00 ? 5  SER A N    1  
ATOM 38    C CA   . SER A 1 5  ? -7.775  10.559  1.024   1.00 0.00 ? 5  SER A CA   1  
ATOM 39    C C    . SER A 1 5  ? -7.638  10.292  -0.472  1.00 0.00 ? 5  SER A C    1  
ATOM 40    O O    . SER A 1 5  ? -8.230  10.989  -1.295  1.00 0.00 ? 5  SER A O    1  
ATOM 41    C CB   . SER A 1 5  ? -8.436  9.361   1.709   1.00 0.00 ? 5  SER A CB   1  
ATOM 42    O OG   . SER A 1 5  ? -8.247  9.408   3.112   1.00 0.00 ? 5  SER A OG   1  
ATOM 43    H H    . SER A 1 5  ? -9.262  12.017  0.639   1.00 0.00 ? 5  SER A H    1  
ATOM 44    H HA   . SER A 1 5  ? -6.791  10.705  1.443   1.00 0.00 ? 5  SER A HA   1  
ATOM 45    H HB2  . SER A 1 5  ? -9.495  9.369   1.500   1.00 0.00 ? 5  SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5  ? -8.001  8.448   1.329   1.00 0.00 ? 5  SER A HB3  1  
ATOM 47    H HG   . SER A 1 5  ? -8.226  10.323  3.402   1.00 0.00 ? 5  SER A HG   1  
ATOM 48    N N    . SER A 1 6  ? -6.852  9.276   -0.816  1.00 0.00 ? 6  SER A N    1  
ATOM 49    C CA   . SER A 1 6  ? -6.633  8.918   -2.212  1.00 0.00 ? 6  SER A CA   1  
ATOM 50    C C    . SER A 1 6  ? -5.827  7.628   -2.322  1.00 0.00 ? 6  SER A C    1  
ATOM 51    O O    . SER A 1 6  ? -5.297  7.127   -1.330  1.00 0.00 ? 6  SER A O    1  
ATOM 52    C CB   . SER A 1 6  ? -5.908  10.050  -2.943  1.00 0.00 ? 6  SER A CB   1  
ATOM 53    O OG   . SER A 1 6  ? -6.169  10.006  -4.336  1.00 0.00 ? 6  SER A OG   1  
ATOM 54    H H    . SER A 1 6  ? -6.407  8.757   -0.113  1.00 0.00 ? 6  SER A H    1  
ATOM 55    H HA   . SER A 1 6  ? -7.599  8.765   -2.671  1.00 0.00 ? 6  SER A HA   1  
ATOM 56    H HB2  . SER A 1 6  ? -6.245  10.999  -2.556  1.00 0.00 ? 6  SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6  ? -4.844  9.953   -2.785  1.00 0.00 ? 6  SER A HB3  1  
ATOM 58    H HG   . SER A 1 6  ? -7.091  10.219  -4.496  1.00 0.00 ? 6  SER A HG   1  
ATOM 59    N N    . GLY A 1 7  ? -5.738  7.093   -3.536  1.00 0.00 ? 7  GLY A N    1  
ATOM 60    C CA   . GLY A 1 7  ? -4.995  5.866   -3.754  1.00 0.00 ? 7  GLY A CA   1  
ATOM 61    C C    . GLY A 1 7  ? -5.825  4.801   -4.444  1.00 0.00 ? 7  GLY A C    1  
ATOM 62    O O    . GLY A 1 7  ? -6.058  4.869   -5.651  1.00 0.00 ? 7  GLY A O    1  
ATOM 63    H H    . GLY A 1 7  ? -6.181  7.536   -4.290  1.00 0.00 ? 7  GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7  ? -4.131  6.085   -4.363  1.00 0.00 ? 7  GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7  ? -4.664  5.485   -2.800  1.00 0.00 ? 7  GLY A HA3  1  
ATOM 66    N N    . LYS A 1 8  ? -6.271  3.812   -3.677  1.00 0.00 ? 8  LYS A N    1  
ATOM 67    C CA   . LYS A 1 8  ? -7.079  2.727   -4.220  1.00 0.00 ? 8  LYS A CA   1  
ATOM 68    C C    . LYS A 1 8  ? -6.572  2.308   -5.597  1.00 0.00 ? 8  LYS A C    1  
ATOM 69    O O    . LYS A 1 8  ? -7.359  1.991   -6.489  1.00 0.00 ? 8  LYS A O    1  
ATOM 70    C CB   . LYS A 1 8  ? -8.546  3.153   -4.313  1.00 0.00 ? 8  LYS A CB   1  
ATOM 71    C CG   . LYS A 1 8  ? -9.506  1.991   -4.499  1.00 0.00 ? 8  LYS A CG   1  
ATOM 72    C CD   . LYS A 1 8  ? -9.781  1.279   -3.185  1.00 0.00 ? 8  LYS A CD   1  
ATOM 73    C CE   . LYS A 1 8  ? -10.877 1.974   -2.392  1.00 0.00 ? 8  LYS A CE   1  
ATOM 74    N NZ   . LYS A 1 8  ? -10.397 3.243   -1.778  1.00 0.00 ? 8  LYS A NZ   1  
ATOM 75    H H    . LYS A 1 8  ? -6.052  3.813   -2.721  1.00 0.00 ? 8  LYS A H    1  
ATOM 76    H HA   . LYS A 1 8  ? -6.999  1.885   -3.549  1.00 0.00 ? 8  LYS A HA   1  
ATOM 77    H HB2  . LYS A 1 8  ? -8.815  3.674   -3.406  1.00 0.00 ? 8  LYS A HB2  1  
ATOM 78    H HB3  . LYS A 1 8  ? -8.661  3.825   -5.152  1.00 0.00 ? 8  LYS A HB3  1  
ATOM 79    H HG2  . LYS A 1 8  ? -10.439 2.365   -4.894  1.00 0.00 ? 8  LYS A HG2  1  
ATOM 80    H HG3  . LYS A 1 8  ? -9.074  1.287   -5.196  1.00 0.00 ? 8  LYS A HG3  1  
ATOM 81    H HD2  . LYS A 1 8  ? -10.090 0.265   -3.392  1.00 0.00 ? 8  LYS A HD2  1  
ATOM 82    H HD3  . LYS A 1 8  ? -8.874  1.267   -2.596  1.00 0.00 ? 8  LYS A HD3  1  
ATOM 83    H HE2  . LYS A 1 8  ? -11.699 2.194   -3.056  1.00 0.00 ? 8  LYS A HE2  1  
ATOM 84    H HE3  . LYS A 1 8  ? -11.214 1.310   -1.610  1.00 0.00 ? 8  LYS A HE3  1  
ATOM 85    H HZ1  . LYS A 1 8  ? -9.387  3.165   -1.541  1.00 0.00 ? 8  LYS A HZ1  1  
ATOM 86    H HZ2  . LYS A 1 8  ? -10.930 3.443   -0.908  1.00 0.00 ? 8  LYS A HZ2  1  
ATOM 87    H HZ3  . LYS A 1 8  ? -10.526 4.033   -2.441  1.00 0.00 ? 8  LYS A HZ3  1  
ATOM 88    N N    . GLY A 1 9  ? -5.253  2.306   -5.762  1.00 0.00 ? 9  GLY A N    1  
ATOM 89    C CA   . GLY A 1 9  ? -4.665  1.923   -7.032  1.00 0.00 ? 9  GLY A CA   1  
ATOM 90    C C    . GLY A 1 9  ? -3.703  0.758   -6.897  1.00 0.00 ? 9  GLY A C    1  
ATOM 91    O O    . GLY A 1 9  ? -3.080  0.576   -5.852  1.00 0.00 ? 9  GLY A O    1  
ATOM 92    H H    . GLY A 1 9  ? -4.674  2.568   -5.015  1.00 0.00 ? 9  GLY A H    1  
ATOM 93    H HA2  . GLY A 1 9  ? -5.455  1.647   -7.713  1.00 0.00 ? 9  GLY A HA2  1  
ATOM 94    H HA3  . GLY A 1 9  ? -4.131  2.769   -7.439  1.00 0.00 ? 9  GLY A HA3  1  
ATOM 95    N N    . GLY A 1 10 ? -3.584  -0.034  -7.958  1.00 0.00 ? 10 GLY A N    1  
ATOM 96    C CA   . GLY A 1 10 ? -2.691  -1.178  -7.932  1.00 0.00 ? 10 GLY A CA   1  
ATOM 97    C C    . GLY A 1 10 ? -3.356  -2.444  -8.437  1.00 0.00 ? 10 GLY A C    1  
ATOM 98    O O    . GLY A 1 10 ? -4.546  -2.659  -8.212  1.00 0.00 ? 10 GLY A O    1  
ATOM 99    H H    . GLY A 1 10 ? -4.106  0.159   -8.765  1.00 0.00 ? 10 GLY A H    1  
ATOM 100   H HA2  . GLY A 1 10 ? -1.832  -0.964  -8.550  1.00 0.00 ? 10 GLY A HA2  1  
ATOM 101   H HA3  . GLY A 1 10 ? -2.361  -1.340  -6.917  1.00 0.00 ? 10 GLY A HA3  1  
ATOM 102   N N    . GLN A 1 11 ? -2.585  -3.282  -9.124  1.00 0.00 ? 11 GLN A N    1  
ATOM 103   C CA   . GLN A 1 11 ? -3.108  -4.531  -9.664  1.00 0.00 ? 11 GLN A CA   1  
ATOM 104   C C    . GLN A 1 11 ? -2.827  -5.693  -8.718  1.00 0.00 ? 11 GLN A C    1  
ATOM 105   O O    . GLN A 1 11 ? -2.451  -6.783  -9.151  1.00 0.00 ? 11 GLN A O    1  
ATOM 106   C CB   . GLN A 1 11 ? -2.495  -4.814  -11.036 1.00 0.00 ? 11 GLN A CB   1  
ATOM 107   C CG   . GLN A 1 11 ? -3.071  -3.955  -12.150 1.00 0.00 ? 11 GLN A CG   1  
ATOM 108   C CD   . GLN A 1 11 ? -4.394  -4.484  -12.669 1.00 0.00 ? 11 GLN A CD   1  
ATOM 109   O OE1  . GLN A 1 11 ? -5.105  -5.206  -11.970 1.00 0.00 ? 11 GLN A OE1  1  
ATOM 110   N NE2  . GLN A 1 11 ? -4.731  -4.126  -13.903 1.00 0.00 ? 11 GLN A NE2  1  
ATOM 111   H H    . GLN A 1 11 ? -1.644  -3.054  -9.270  1.00 0.00 ? 11 GLN A H    1  
ATOM 112   H HA   . GLN A 1 11 ? -4.177  -4.423  -9.773  1.00 0.00 ? 11 GLN A HA   1  
ATOM 113   H HB2  . GLN A 1 11 ? -1.431  -4.634  -10.986 1.00 0.00 ? 11 GLN A HB2  1  
ATOM 114   H HB3  . GLN A 1 11 ? -2.665  -5.851  -11.286 1.00 0.00 ? 11 GLN A HB3  1  
ATOM 115   H HG2  . GLN A 1 11 ? -3.225  -2.955  -11.773 1.00 0.00 ? 11 GLN A HG2  1  
ATOM 116   H HG3  . GLN A 1 11 ? -2.366  -3.927  -12.967 1.00 0.00 ? 11 GLN A HG3  1  
ATOM 117   H HE21 . GLN A 1 11 ? -4.115  -3.549  -14.402 1.00 0.00 ? 11 GLN A HE21 1  
ATOM 118   H HE22 . GLN A 1 11 ? -5.580  -4.453  -14.264 1.00 0.00 ? 11 GLN A HE22 1  
ATOM 119   N N    . VAL A 1 12 ? -3.011  -5.454  -7.423  1.00 0.00 ? 12 VAL A N    1  
ATOM 120   C CA   . VAL A 1 12 ? -2.777  -6.482  -6.415  1.00 0.00 ? 12 VAL A CA   1  
ATOM 121   C C    . VAL A 1 12 ? -4.053  -7.263  -6.121  1.00 0.00 ? 12 VAL A C    1  
ATOM 122   O O    . VAL A 1 12 ? -5.153  -6.712  -6.161  1.00 0.00 ? 12 VAL A O    1  
ATOM 123   C CB   . VAL A 1 12 ? -2.248  -5.871  -5.104  1.00 0.00 ? 12 VAL A CB   1  
ATOM 124   C CG1  . VAL A 1 12 ? -0.919  -5.170  -5.339  1.00 0.00 ? 12 VAL A CG1  1  
ATOM 125   C CG2  . VAL A 1 12 ? -3.269  -4.911  -4.513  1.00 0.00 ? 12 VAL A CG2  1  
ATOM 126   H H    . VAL A 1 12 ? -3.311  -4.566  -7.139  1.00 0.00 ? 12 VAL A H    1  
ATOM 127   H HA   . VAL A 1 12 ? -2.030  -7.161  -6.798  1.00 0.00 ? 12 VAL A HA   1  
ATOM 128   H HB   . VAL A 1 12 ? -2.087  -6.672  -4.397  1.00 0.00 ? 12 VAL A HB   1  
ATOM 129   H HG11 . VAL A 1 12 ? -1.028  -4.115  -5.136  1.00 0.00 ? 12 VAL A HG11 1  
ATOM 130   H HG12 . VAL A 1 12 ? -0.169  -5.589  -4.684  1.00 0.00 ? 12 VAL A HG12 1  
ATOM 131   H HG13 . VAL A 1 12 ? -0.616  -5.308  -6.367  1.00 0.00 ? 12 VAL A HG13 1  
ATOM 132   H HG21 . VAL A 1 12 ? -2.756  -4.112  -4.000  1.00 0.00 ? 12 VAL A HG21 1  
ATOM 133   H HG22 . VAL A 1 12 ? -3.876  -4.498  -5.306  1.00 0.00 ? 12 VAL A HG22 1  
ATOM 134   H HG23 . VAL A 1 12 ? -3.901  -5.441  -3.816  1.00 0.00 ? 12 VAL A HG23 1  
ATOM 135   N N    . ARG A 1 13 ? -3.897  -8.549  -5.825  1.00 0.00 ? 13 ARG A N    1  
ATOM 136   C CA   . ARG A 1 13 ? -5.037  -9.407  -5.524  1.00 0.00 ? 13 ARG A CA   1  
ATOM 137   C C    . ARG A 1 13 ? -4.912  -10.006 -4.126  1.00 0.00 ? 13 ARG A C    1  
ATOM 138   O O    . ARG A 1 13 ? -4.203  -10.991 -3.922  1.00 0.00 ? 13 ARG A O    1  
ATOM 139   C CB   . ARG A 1 13 ? -5.148  -10.526 -6.562  1.00 0.00 ? 13 ARG A CB   1  
ATOM 140   C CG   . ARG A 1 13 ? -5.964  -10.143 -7.785  1.00 0.00 ? 13 ARG A CG   1  
ATOM 141   C CD   . ARG A 1 13 ? -5.102  -9.473  -8.843  1.00 0.00 ? 13 ARG A CD   1  
ATOM 142   N NE   . ARG A 1 13 ? -4.057  -10.364 -9.341  1.00 0.00 ? 13 ARG A NE   1  
ATOM 143   C CZ   . ARG A 1 13 ? -3.260  -10.064 -10.361 1.00 0.00 ? 13 ARG A CZ   1  
ATOM 144   N NH1  . ARG A 1 13 ? -3.389  -8.903  -10.988 1.00 0.00 ? 13 ARG A NH1  1  
ATOM 145   N NH2  . ARG A 1 13 ? -2.332  -10.926 -10.756 1.00 0.00 ? 13 ARG A NH2  1  
ATOM 146   H H    . ARG A 1 13 ? -2.994  -8.931  -5.809  1.00 0.00 ? 13 ARG A H    1  
ATOM 147   H HA   . ARG A 1 13 ? -5.929  -8.800  -5.565  1.00 0.00 ? 13 ARG A HA   1  
ATOM 148   H HB2  . ARG A 1 13 ? -4.155  -10.797 -6.890  1.00 0.00 ? 13 ARG A HB2  1  
ATOM 149   H HB3  . ARG A 1 13 ? -5.612  -11.384 -6.100  1.00 0.00 ? 13 ARG A HB3  1  
ATOM 150   H HG2  . ARG A 1 13 ? -6.404  -11.035 -8.206  1.00 0.00 ? 13 ARG A HG2  1  
ATOM 151   H HG3  . ARG A 1 13 ? -6.746  -9.461  -7.485  1.00 0.00 ? 13 ARG A HG3  1  
ATOM 152   H HD2  . ARG A 1 13 ? -5.733  -9.178  -9.669  1.00 0.00 ? 13 ARG A HD2  1  
ATOM 153   H HD3  . ARG A 1 13 ? -4.641  -8.598  -8.412  1.00 0.00 ? 13 ARG A HD3  1  
ATOM 154   H HE   . ARG A 1 13 ? -3.944  -11.227 -8.892  1.00 0.00 ? 13 ARG A HE   1  
ATOM 155   H HH11 . ARG A 1 13 ? -4.087  -8.251  -10.693 1.00 0.00 ? 13 ARG A HH11 1  
ATOM 156   H HH12 . ARG A 1 13 ? -2.788  -8.679  -11.756 1.00 0.00 ? 13 ARG A HH12 1  
ATOM 157   H HH21 . ARG A 1 13 ? -2.232  -11.802 -10.285 1.00 0.00 ? 13 ARG A HH21 1  
ATOM 158   H HH22 . ARG A 1 13 ? -1.734  -10.700 -11.524 1.00 0.00 ? 13 ARG A HH22 1  
ATOM 159   N N    . PHE A 1 14 ? -5.607  -9.404  -3.166  1.00 0.00 ? 14 PHE A N    1  
ATOM 160   C CA   . PHE A 1 14 ? -5.573  -9.876  -1.787  1.00 0.00 ? 14 PHE A CA   1  
ATOM 161   C C    . PHE A 1 14 ? -6.920  -9.655  -1.104  1.00 0.00 ? 14 PHE A C    1  
ATOM 162   O O    . PHE A 1 14 ? -7.746  -8.874  -1.575  1.00 0.00 ? 14 PHE A O    1  
ATOM 163   C CB   . PHE A 1 14 ? -4.469  -9.160  -1.007  1.00 0.00 ? 14 PHE A CB   1  
ATOM 164   C CG   . PHE A 1 14 ? -3.087  -9.465  -1.509  1.00 0.00 ? 14 PHE A CG   1  
ATOM 165   C CD1  . PHE A 1 14 ? -2.521  -8.707  -2.522  1.00 0.00 ? 14 PHE A CD1  1  
ATOM 166   C CD2  . PHE A 1 14 ? -2.353  -10.509 -0.969  1.00 0.00 ? 14 PHE A CD2  1  
ATOM 167   C CE1  . PHE A 1 14 ? -1.248  -8.984  -2.986  1.00 0.00 ? 14 PHE A CE1  1  
ATOM 168   C CE2  . PHE A 1 14 ? -1.081  -10.790 -1.429  1.00 0.00 ? 14 PHE A CE2  1  
ATOM 169   C CZ   . PHE A 1 14 ? -0.528  -10.028 -2.439  1.00 0.00 ? 14 PHE A CZ   1  
ATOM 170   H H    . PHE A 1 14 ? -6.155  -8.623  -3.391  1.00 0.00 ? 14 PHE A H    1  
ATOM 171   H HA   . PHE A 1 14 ? -5.362  -10.934 -1.805  1.00 0.00 ? 14 PHE A HA   1  
ATOM 172   H HB2  . PHE A 1 14 ? -4.620  -8.094  -1.080  1.00 0.00 ? 14 PHE A HB2  1  
ATOM 173   H HB3  . PHE A 1 14 ? -4.520  -9.458  0.029   1.00 0.00 ? 14 PHE A HB3  1  
ATOM 174   H HD1  . PHE A 1 14 ? -3.084  -7.890  -2.950  1.00 0.00 ? 14 PHE A HD1  1  
ATOM 175   H HD2  . PHE A 1 14 ? -2.784  -11.107 -0.180  1.00 0.00 ? 14 PHE A HD2  1  
ATOM 176   H HE1  . PHE A 1 14 ? -0.819  -8.386  -3.776  1.00 0.00 ? 14 PHE A HE1  1  
ATOM 177   H HE2  . PHE A 1 14 ? -0.520  -11.607 -1.000  1.00 0.00 ? 14 PHE A HE2  1  
ATOM 178   H HZ   . PHE A 1 14 ? 0.466   -10.246 -2.800  1.00 0.00 ? 14 PHE A HZ   1  
ATOM 179   N N    . SER A 1 15 ? -7.133  -10.350 0.009   1.00 0.00 ? 15 SER A N    1  
ATOM 180   C CA   . SER A 1 15 ? -8.380  -10.234 0.756   1.00 0.00 ? 15 SER A CA   1  
ATOM 181   C C    . SER A 1 15 ? -8.255  -9.192  1.863   1.00 0.00 ? 15 SER A C    1  
ATOM 182   O O    . SER A 1 15 ? -7.158  -8.732  2.176   1.00 0.00 ? 15 SER A O    1  
ATOM 183   C CB   . SER A 1 15 ? -8.768  -11.587 1.355   1.00 0.00 ? 15 SER A CB   1  
ATOM 184   O OG   . SER A 1 15 ? -10.151 -11.631 1.662   1.00 0.00 ? 15 SER A OG   1  
ATOM 185   H H    . SER A 1 15 ? -6.435  -10.957 0.334   1.00 0.00 ? 15 SER A H    1  
ATOM 186   H HA   . SER A 1 15 ? -9.150  -9.920  0.068   1.00 0.00 ? 15 SER A HA   1  
ATOM 187   H HB2  . SER A 1 15 ? -8.544  -12.369 0.646   1.00 0.00 ? 15 SER A HB2  1  
ATOM 188   H HB3  . SER A 1 15 ? -8.204  -11.751 2.262   1.00 0.00 ? 15 SER A HB3  1  
ATOM 189   H HG   . SER A 1 15 ? -10.359 -12.469 2.082   1.00 0.00 ? 15 SER A HG   1  
ATOM 190   N N    . ASN A 1 16 ? -9.389  -8.824  2.452   1.00 0.00 ? 16 ASN A N    1  
ATOM 191   C CA   . ASN A 1 16 ? -9.407  -7.836  3.524   1.00 0.00 ? 16 ASN A CA   1  
ATOM 192   C C    . ASN A 1 16 ? -8.430  -8.216  4.632   1.00 0.00 ? 16 ASN A C    1  
ATOM 193   O O    . ASN A 1 16 ? -7.432  -7.532  4.855   1.00 0.00 ? 16 ASN A O    1  
ATOM 194   C CB   . ASN A 1 16 ? -10.820 -7.702  4.097   1.00 0.00 ? 16 ASN A CB   1  
ATOM 195   C CG   . ASN A 1 16 ? -11.499 -9.045  4.279   1.00 0.00 ? 16 ASN A CG   1  
ATOM 196   O OD1  . ASN A 1 16 ? -11.988 -9.641  3.319   1.00 0.00 ? 16 ASN A OD1  1  
ATOM 197   N ND2  . ASN A 1 16 ? -11.534 -9.528  5.516   1.00 0.00 ? 16 ASN A ND2  1  
ATOM 198   H H    . ASN A 1 16 ? -10.232 -9.227  2.158   1.00 0.00 ? 16 ASN A H    1  
ATOM 199   H HA   . ASN A 1 16 ? -9.107  -6.887  3.105   1.00 0.00 ? 16 ASN A HA   1  
ATOM 200   H HB2  . ASN A 1 16 ? -10.766 -7.214  5.060   1.00 0.00 ? 16 ASN A HB2  1  
ATOM 201   H HB3  . ASN A 1 16 ? -11.419 -7.103  3.428   1.00 0.00 ? 16 ASN A HB3  1  
ATOM 202   H HD21 . ASN A 1 16 ? -11.125 -8.998  6.232   1.00 0.00 ? 16 ASN A HD21 1  
ATOM 203   H HD22 . ASN A 1 16 ? -11.967 -10.395 5.662   1.00 0.00 ? 16 ASN A HD22 1  
ATOM 204   N N    . ASP A 1 17 ? -8.725  -9.312  5.322   1.00 0.00 ? 17 ASP A N    1  
ATOM 205   C CA   . ASP A 1 17 ? -7.872  -9.786  6.406   1.00 0.00 ? 17 ASP A CA   1  
ATOM 206   C C    . ASP A 1 17 ? -6.453  -10.040 5.909   1.00 0.00 ? 17 ASP A C    1  
ATOM 207   O O    . ASP A 1 17 ? -5.480  -9.689  6.576   1.00 0.00 ? 17 ASP A O    1  
ATOM 208   C CB   . ASP A 1 17 ? -8.449  -11.064 7.016   1.00 0.00 ? 17 ASP A CB   1  
ATOM 209   C CG   . ASP A 1 17 ? -8.862  -12.073 5.963   1.00 0.00 ? 17 ASP A CG   1  
ATOM 210   O OD1  . ASP A 1 17 ? -9.797  -11.775 5.190   1.00 0.00 ? 17 ASP A OD1  1  
ATOM 211   O OD2  . ASP A 1 17 ? -8.251  -13.160 5.911   1.00 0.00 ? 17 ASP A OD2  1  
ATOM 212   H H    . ASP A 1 17 ? -9.536  -9.816  5.097   1.00 0.00 ? 17 ASP A H    1  
ATOM 213   H HA   . ASP A 1 17 ? -7.843  -9.018  7.165   1.00 0.00 ? 17 ASP A HA   1  
ATOM 214   H HB2  . ASP A 1 17 ? -7.704  -11.520 7.652   1.00 0.00 ? 17 ASP A HB2  1  
ATOM 215   H HB3  . ASP A 1 17 ? -9.316  -10.813 7.609   1.00 0.00 ? 17 ASP A HB3  1  
ATOM 216   N N    . GLN A 1 18 ? -6.343  -10.653 4.735   1.00 0.00 ? 18 GLN A N    1  
ATOM 217   C CA   . GLN A 1 18 ? -5.042  -10.956 4.151   1.00 0.00 ? 18 GLN A CA   1  
ATOM 218   C C    . GLN A 1 18 ? -4.170  -9.707  4.088   1.00 0.00 ? 18 GLN A C    1  
ATOM 219   O O    . GLN A 1 18 ? -3.036  -9.703  4.569   1.00 0.00 ? 18 GLN A O    1  
ATOM 220   C CB   . GLN A 1 18 ? -5.214  -11.544 2.749   1.00 0.00 ? 18 GLN A CB   1  
ATOM 221   C CG   . GLN A 1 18 ? -5.484  -13.039 2.745   1.00 0.00 ? 18 GLN A CG   1  
ATOM 222   C CD   . GLN A 1 18 ? -5.669  -13.596 1.347   1.00 0.00 ? 18 GLN A CD   1  
ATOM 223   O OE1  . GLN A 1 18 ? -5.747  -12.846 0.373   1.00 0.00 ? 18 GLN A OE1  1  
ATOM 224   N NE2  . GLN A 1 18 ? -5.739  -14.917 1.240   1.00 0.00 ? 18 GLN A NE2  1  
ATOM 225   H H    . GLN A 1 18 ? -7.156  -10.908 4.252   1.00 0.00 ? 18 GLN A H    1  
ATOM 226   H HA   . GLN A 1 18 ? -4.558  -11.687 4.780   1.00 0.00 ? 18 GLN A HA   1  
ATOM 227   H HB2  . GLN A 1 18 ? -6.041  -11.048 2.262   1.00 0.00 ? 18 GLN A HB2  1  
ATOM 228   H HB3  . GLN A 1 18 ? -4.312  -11.362 2.182   1.00 0.00 ? 18 GLN A HB3  1  
ATOM 229   H HG2  . GLN A 1 18 ? -4.650  -13.544 3.209   1.00 0.00 ? 18 GLN A HG2  1  
ATOM 230   H HG3  . GLN A 1 18 ? -6.382  -13.231 3.315   1.00 0.00 ? 18 GLN A HG3  1  
ATOM 231   H HE21 . GLN A 1 18 ? -5.670  -15.452 2.059   1.00 0.00 ? 18 GLN A HE21 1  
ATOM 232   H HE22 . GLN A 1 18 ? -5.859  -15.304 0.348   1.00 0.00 ? 18 GLN A HE22 1  
ATOM 233   N N    . THR A 1 19 ? -4.705  -8.646  3.491   1.00 0.00 ? 19 THR A N    1  
ATOM 234   C CA   . THR A 1 19 ? -3.975  -7.391  3.364   1.00 0.00 ? 19 THR A CA   1  
ATOM 235   C C    . THR A 1 19 ? -3.581  -6.843  4.731   1.00 0.00 ? 19 THR A C    1  
ATOM 236   O O    . THR A 1 19 ? -2.425  -6.483  4.955   1.00 0.00 ? 19 THR A O    1  
ATOM 237   C CB   . THR A 1 19 ? -4.807  -6.330  2.619   1.00 0.00 ? 19 THR A CB   1  
ATOM 238   O OG1  . THR A 1 19 ? -5.244  -6.847  1.357   1.00 0.00 ? 19 THR A OG1  1  
ATOM 239   C CG2  . THR A 1 19 ? -3.996  -5.062  2.400   1.00 0.00 ? 19 THR A CG2  1  
ATOM 240   H H    . THR A 1 19 ? -5.613  -8.711  3.128   1.00 0.00 ? 19 THR A H    1  
ATOM 241   H HA   . THR A 1 19 ? -3.079  -7.583  2.791   1.00 0.00 ? 19 THR A HA   1  
ATOM 242   H HB   . THR A 1 19 ? -5.673  -6.087  3.219   1.00 0.00 ? 19 THR A HB   1  
ATOM 243   H HG1  . THR A 1 19 ? -5.423  -7.787  1.441   1.00 0.00 ? 19 THR A HG1  1  
ATOM 244   H HG21 . THR A 1 19 ? -3.049  -5.147  2.912   1.00 0.00 ? 19 THR A HG21 1  
ATOM 245   H HG22 . THR A 1 19 ? -4.541  -4.215  2.789   1.00 0.00 ? 19 THR A HG22 1  
ATOM 246   H HG23 . THR A 1 19 ? -3.822  -4.924  1.344   1.00 0.00 ? 19 THR A HG23 1  
ATOM 247   N N    . ILE A 1 20 ? -4.547  -6.784  5.641   1.00 0.00 ? 20 ILE A N    1  
ATOM 248   C CA   . ILE A 1 20 ? -4.299  -6.282  6.986   1.00 0.00 ? 20 ILE A CA   1  
ATOM 249   C C    . ILE A 1 20 ? -3.018  -6.872  7.566   1.00 0.00 ? 20 ILE A C    1  
ATOM 250   O O    . ILE A 1 20 ? -2.080  -6.145  7.891   1.00 0.00 ? 20 ILE A O    1  
ATOM 251   C CB   . ILE A 1 20 ? -5.472  -6.602  7.932   1.00 0.00 ? 20 ILE A CB   1  
ATOM 252   C CG1  . ILE A 1 20 ? -6.750  -5.915  7.445   1.00 0.00 ? 20 ILE A CG1  1  
ATOM 253   C CG2  . ILE A 1 20 ? -5.141  -6.169  9.352   1.00 0.00 ? 20 ILE A CG2  1  
ATOM 254   C CD1  . ILE A 1 20 ? -8.007  -6.448  8.094   1.00 0.00 ? 20 ILE A CD1  1  
ATOM 255   H H    . ILE A 1 20 ? -5.448  -7.086  5.401   1.00 0.00 ? 20 ILE A H    1  
ATOM 256   H HA   . ILE A 1 20 ? -4.193  -5.208  6.927   1.00 0.00 ? 20 ILE A HA   1  
ATOM 257   H HB   . ILE A 1 20 ? -5.624  -7.670  7.932   1.00 0.00 ? 20 ILE A HB   1  
ATOM 258   H HG12 . ILE A 1 20 ? -6.688  -4.860  7.659   1.00 0.00 ? 20 ILE A HG12 1  
ATOM 259   H HG13 . ILE A 1 20 ? -6.841  -6.057  6.377   1.00 0.00 ? 20 ILE A HG13 1  
ATOM 260   H HG21 . ILE A 1 20 ? -4.576  -6.948  9.843   1.00 0.00 ? 20 ILE A HG21 1  
ATOM 261   H HG22 . ILE A 1 20 ? -4.554  -5.263  9.324   1.00 0.00 ? 20 ILE A HG22 1  
ATOM 262   H HG23 . ILE A 1 20 ? -6.055  -5.990  9.897   1.00 0.00 ? 20 ILE A HG23 1  
ATOM 263   H HD11 . ILE A 1 20 ? -8.339  -5.759  8.857   1.00 0.00 ? 20 ILE A HD11 1  
ATOM 264   H HD12 . ILE A 1 20 ? -8.779  -6.561  7.348   1.00 0.00 ? 20 ILE A HD12 1  
ATOM 265   H HD13 . ILE A 1 20 ? -7.800  -7.409  8.545   1.00 0.00 ? 20 ILE A HD13 1  
ATOM 266   N N    . GLU A 1 21 ? -2.986  -8.195  7.690   1.00 0.00 ? 21 GLU A N    1  
ATOM 267   C CA   . GLU A 1 21 ? -1.819  -8.883  8.230   1.00 0.00 ? 21 GLU A CA   1  
ATOM 268   C C    . GLU A 1 21 ? -0.600  -8.670  7.336   1.00 0.00 ? 21 GLU A C    1  
ATOM 269   O O    . GLU A 1 21 ? 0.479   -8.317  7.813   1.00 0.00 ? 21 GLU A O    1  
ATOM 270   C CB   . GLU A 1 21 ? -2.103  -10.379 8.375   1.00 0.00 ? 21 GLU A CB   1  
ATOM 271   C CG   . GLU A 1 21 ? -2.710  -10.757 9.716   1.00 0.00 ? 21 GLU A CG   1  
ATOM 272   C CD   . GLU A 1 21 ? -1.661  -11.092 10.758  1.00 0.00 ? 21 GLU A CD   1  
ATOM 273   O OE1  . GLU A 1 21 ? -0.792  -11.943 10.472  1.00 0.00 ? 21 GLU A OE1  1  
ATOM 274   O OE2  . GLU A 1 21 ? -1.708  -10.504 11.858  1.00 0.00 ? 21 GLU A OE2  1  
ATOM 275   H H    . GLU A 1 21 ? -3.765  -8.721  7.413   1.00 0.00 ? 21 GLU A H    1  
ATOM 276   H HA   . GLU A 1 21 ? -1.612  -8.469  9.205   1.00 0.00 ? 21 GLU A HA   1  
ATOM 277   H HB2  . GLU A 1 21 ? -2.787  -10.681 7.595   1.00 0.00 ? 21 GLU A HB2  1  
ATOM 278   H HB3  . GLU A 1 21 ? -1.176  -10.922 8.258   1.00 0.00 ? 21 GLU A HB3  1  
ATOM 279   H HG2  . GLU A 1 21 ? -3.300  -9.927  10.075  1.00 0.00 ? 21 GLU A HG2  1  
ATOM 280   H HG3  . GLU A 1 21 ? -3.348  -11.618 9.578   1.00 0.00 ? 21 GLU A HG3  1  
ATOM 281   N N    . LEU A 1 22 ? -0.781  -8.886  6.038   1.00 0.00 ? 22 LEU A N    1  
ATOM 282   C CA   . LEU A 1 22 ? 0.303   -8.718  5.077   1.00 0.00 ? 22 LEU A CA   1  
ATOM 283   C C    . LEU A 1 22 ? 1.099   -7.451  5.369   1.00 0.00 ? 22 LEU A C    1  
ATOM 284   O O    . LEU A 1 22 ? 2.310   -7.403  5.153   1.00 0.00 ? 22 LEU A O    1  
ATOM 285   C CB   . LEU A 1 22 ? -0.255  -8.667  3.653   1.00 0.00 ? 22 LEU A CB   1  
ATOM 286   C CG   . LEU A 1 22 ? -0.508  -10.017 2.982   1.00 0.00 ? 22 LEU A CG   1  
ATOM 287   C CD1  . LEU A 1 22 ? -1.334  -9.839  1.718   1.00 0.00 ? 22 LEU A CD1  1  
ATOM 288   C CD2  . LEU A 1 22 ? 0.809   -10.712 2.668   1.00 0.00 ? 22 LEU A CD2  1  
ATOM 289   H H    . LEU A 1 22 ? -1.663  -9.165  5.718   1.00 0.00 ? 22 LEU A H    1  
ATOM 290   H HA   . LEU A 1 22 ? 0.960   -9.570  5.166   1.00 0.00 ? 22 LEU A HA   1  
ATOM 291   H HB2  . LEU A 1 22 ? -1.192  -8.133  3.685   1.00 0.00 ? 22 LEU A HB2  1  
ATOM 292   H HB3  . LEU A 1 22 ? 0.449   -8.120  3.042   1.00 0.00 ? 22 LEU A HB3  1  
ATOM 293   H HG   . LEU A 1 22 ? -1.067  -10.649 3.659   1.00 0.00 ? 22 LEU A HG   1  
ATOM 294   H HD11 . LEU A 1 22 ? -2.373  -10.036 1.936   1.00 0.00 ? 22 LEU A HD11 1  
ATOM 295   H HD12 . LEU A 1 22 ? -0.988  -10.528 0.962   1.00 0.00 ? 22 LEU A HD12 1  
ATOM 296   H HD13 . LEU A 1 22 ? -1.227  -8.826  1.358   1.00 0.00 ? 22 LEU A HD13 1  
ATOM 297   H HD21 . LEU A 1 22 ? 0.801   -11.706 3.091   1.00 0.00 ? 22 LEU A HD21 1  
ATOM 298   H HD22 . LEU A 1 22 ? 1.625   -10.146 3.094   1.00 0.00 ? 22 LEU A HD22 1  
ATOM 299   H HD23 . LEU A 1 22 ? 0.935   -10.777 1.597   1.00 0.00 ? 22 LEU A HD23 1  
ATOM 300   N N    . GLU A 1 23 ? 0.411   -6.427  5.864   1.00 0.00 ? 23 GLU A N    1  
ATOM 301   C CA   . GLU A 1 23 ? 1.055   -5.159  6.187   1.00 0.00 ? 23 GLU A CA   1  
ATOM 302   C C    . GLU A 1 23 ? 1.653   -5.195  7.591   1.00 0.00 ? 23 GLU A C    1  
ATOM 303   O O    . GLU A 1 23 ? 2.846   -4.951  7.777   1.00 0.00 ? 23 GLU A O    1  
ATOM 304   C CB   . GLU A 1 23 ? 0.052   -4.009  6.078   1.00 0.00 ? 23 GLU A CB   1  
ATOM 305   C CG   . GLU A 1 23 ? -0.599  -3.897  4.710   1.00 0.00 ? 23 GLU A CG   1  
ATOM 306   C CD   . GLU A 1 23 ? -0.979  -2.472  4.359   1.00 0.00 ? 23 GLU A CD   1  
ATOM 307   O OE1  . GLU A 1 23 ? -1.247  -1.684  5.291   1.00 0.00 ? 23 GLU A OE1  1  
ATOM 308   O OE2  . GLU A 1 23 ? -1.009  -2.144  3.155   1.00 0.00 ? 23 GLU A OE2  1  
ATOM 309   H H    . GLU A 1 23 ? -0.552  -6.526  6.014   1.00 0.00 ? 23 GLU A H    1  
ATOM 310   H HA   . GLU A 1 23 ? 1.850   -5.000  5.475   1.00 0.00 ? 23 GLU A HA   1  
ATOM 311   H HB2  . GLU A 1 23 ? -0.726  -4.154  6.814   1.00 0.00 ? 23 GLU A HB2  1  
ATOM 312   H HB3  . GLU A 1 23 ? 0.563   -3.081  6.287   1.00 0.00 ? 23 GLU A HB3  1  
ATOM 313   H HG2  . GLU A 1 23 ? 0.092   -4.262  3.965   1.00 0.00 ? 23 GLU A HG2  1  
ATOM 314   H HG3  . GLU A 1 23 ? -1.492  -4.505  4.699   1.00 0.00 ? 23 GLU A HG3  1  
ATOM 315   N N    . LYS A 1 24 ? 0.816   -5.501  8.576   1.00 0.00 ? 24 LYS A N    1  
ATOM 316   C CA   . LYS A 1 24 ? 1.260   -5.570  9.964   1.00 0.00 ? 24 LYS A CA   1  
ATOM 317   C C    . LYS A 1 24 ? 2.592   -6.304  10.073  1.00 0.00 ? 24 LYS A C    1  
ATOM 318   O O    . LYS A 1 24 ? 3.335   -6.124  11.038  1.00 0.00 ? 24 LYS A O    1  
ATOM 319   C CB   . LYS A 1 24 ? 0.207   -6.273  10.823  1.00 0.00 ? 24 LYS A CB   1  
ATOM 320   C CG   . LYS A 1 24 ? -1.115  -5.528  10.896  1.00 0.00 ? 24 LYS A CG   1  
ATOM 321   C CD   . LYS A 1 24 ? -2.159  -6.319  11.666  1.00 0.00 ? 24 LYS A CD   1  
ATOM 322   C CE   . LYS A 1 24 ? -3.151  -5.401  12.364  1.00 0.00 ? 24 LYS A CE   1  
ATOM 323   N NZ   . LYS A 1 24 ? -3.901  -6.109  13.438  1.00 0.00 ? 24 LYS A NZ   1  
ATOM 324   H H    . LYS A 1 24 ? -0.124  -5.685  8.365   1.00 0.00 ? 24 LYS A H    1  
ATOM 325   H HA   . LYS A 1 24 ? 1.388   -4.560  10.322  1.00 0.00 ? 24 LYS A HA   1  
ATOM 326   H HB2  . LYS A 1 24 ? 0.020   -7.254  10.412  1.00 0.00 ? 24 LYS A HB2  1  
ATOM 327   H HB3  . LYS A 1 24 ? 0.591   -6.380  11.827  1.00 0.00 ? 24 LYS A HB3  1  
ATOM 328   H HG2  . LYS A 1 24 ? -0.958  -4.582  11.392  1.00 0.00 ? 24 LYS A HG2  1  
ATOM 329   H HG3  . LYS A 1 24 ? -1.476  -5.355  9.892   1.00 0.00 ? 24 LYS A HG3  1  
ATOM 330   H HD2  . LYS A 1 24 ? -2.697  -6.954  10.978  1.00 0.00 ? 24 LYS A HD2  1  
ATOM 331   H HD3  . LYS A 1 24 ? -1.662  -6.928  12.408  1.00 0.00 ? 24 LYS A HD3  1  
ATOM 332   H HE2  . LYS A 1 24 ? -2.612  -4.573  12.798  1.00 0.00 ? 24 LYS A HE2  1  
ATOM 333   H HE3  . LYS A 1 24 ? -3.853  -5.029  11.632  1.00 0.00 ? 24 LYS A HE3  1  
ATOM 334   H HZ1  . LYS A 1 24 ? -4.676  -5.509  13.787  1.00 0.00 ? 24 LYS A HZ1  1  
ATOM 335   H HZ2  . LYS A 1 24 ? -3.266  -6.330  14.231  1.00 0.00 ? 24 LYS A HZ2  1  
ATOM 336   H HZ3  . LYS A 1 24 ? -4.301  -6.995  13.071  1.00 0.00 ? 24 LYS A HZ3  1  
ATOM 337   N N    . LYS A 1 25 ? 2.891   -7.130  9.076   1.00 0.00 ? 25 LYS A N    1  
ATOM 338   C CA   . LYS A 1 25 ? 4.135   -7.890  9.058   1.00 0.00 ? 25 LYS A CA   1  
ATOM 339   C C    . LYS A 1 25 ? 5.280   -7.046  8.506   1.00 0.00 ? 25 LYS A C    1  
ATOM 340   O O    . LYS A 1 25 ? 6.276   -6.809  9.190   1.00 0.00 ? 25 LYS A O    1  
ATOM 341   C CB   . LYS A 1 25 ? 3.971   -9.158  8.217   1.00 0.00 ? 25 LYS A CB   1  
ATOM 342   C CG   . LYS A 1 25 ? 5.147   -10.113 8.320   1.00 0.00 ? 25 LYS A CG   1  
ATOM 343   C CD   . LYS A 1 25 ? 5.262   -10.708 9.714   1.00 0.00 ? 25 LYS A CD   1  
ATOM 344   C CE   . LYS A 1 25 ? 6.100   -11.977 9.711   1.00 0.00 ? 25 LYS A CE   1  
ATOM 345   N NZ   . LYS A 1 25 ? 5.905   -12.773 10.955  1.00 0.00 ? 25 LYS A NZ   1  
ATOM 346   H H    . LYS A 1 25 ? 2.258   -7.232  8.334   1.00 0.00 ? 25 LYS A H    1  
ATOM 347   H HA   . LYS A 1 25 ? 4.368   -8.170  10.074  1.00 0.00 ? 25 LYS A HA   1  
ATOM 348   H HB2  . LYS A 1 25 ? 3.082   -9.678  8.542   1.00 0.00 ? 25 LYS A HB2  1  
ATOM 349   H HB3  . LYS A 1 25 ? 3.854   -8.875  7.181   1.00 0.00 ? 25 LYS A HB3  1  
ATOM 350   H HG2  . LYS A 1 25 ? 5.013   -10.914 7.609   1.00 0.00 ? 25 LYS A HG2  1  
ATOM 351   H HG3  . LYS A 1 25 ? 6.057   -9.576  8.092   1.00 0.00 ? 25 LYS A HG3  1  
ATOM 352   H HD2  . LYS A 1 25 ? 5.727   -9.985  10.368  1.00 0.00 ? 25 LYS A HD2  1  
ATOM 353   H HD3  . LYS A 1 25 ? 4.271   -10.941 10.079  1.00 0.00 ? 25 LYS A HD3  1  
ATOM 354   H HE2  . LYS A 1 25 ? 5.816   -12.578 8.861   1.00 0.00 ? 25 LYS A HE2  1  
ATOM 355   H HE3  . LYS A 1 25 ? 7.142   -11.704 9.627   1.00 0.00 ? 25 LYS A HE3  1  
ATOM 356   H HZ1  . LYS A 1 25 ? 6.688   -13.448 11.073  1.00 0.00 ? 25 LYS A HZ1  1  
ATOM 357   H HZ2  . LYS A 1 25 ? 5.011   -13.301 10.905  1.00 0.00 ? 25 LYS A HZ2  1  
ATOM 358   H HZ3  . LYS A 1 25 ? 5.878   -12.143 11.782  1.00 0.00 ? 25 LYS A HZ3  1  
ATOM 359   N N    . PHE A 1 26 ? 5.130   -6.593  7.265   1.00 0.00 ? 26 PHE A N    1  
ATOM 360   C CA   . PHE A 1 26 ? 6.151   -5.774  6.622   1.00 0.00 ? 26 PHE A CA   1  
ATOM 361   C C    . PHE A 1 26 ? 6.647   -4.682  7.565   1.00 0.00 ? 26 PHE A C    1  
ATOM 362   O O    . PHE A 1 26 ? 7.781   -4.219  7.452   1.00 0.00 ? 26 PHE A O    1  
ATOM 363   C CB   . PHE A 1 26 ? 5.598   -5.145  5.341   1.00 0.00 ? 26 PHE A CB   1  
ATOM 364   C CG   . PHE A 1 26 ? 6.383   -3.955  4.871   1.00 0.00 ? 26 PHE A CG   1  
ATOM 365   C CD1  . PHE A 1 26 ? 6.133   -2.694  5.389   1.00 0.00 ? 26 PHE A CD1  1  
ATOM 366   C CD2  . PHE A 1 26 ? 7.372   -4.096  3.911   1.00 0.00 ? 26 PHE A CD2  1  
ATOM 367   C CE1  . PHE A 1 26 ? 6.854   -1.597  4.957   1.00 0.00 ? 26 PHE A CE1  1  
ATOM 368   C CE2  . PHE A 1 26 ? 8.097   -3.002  3.475   1.00 0.00 ? 26 PHE A CE2  1  
ATOM 369   C CZ   . PHE A 1 26 ? 7.837   -1.751  4.000   1.00 0.00 ? 26 PHE A CZ   1  
ATOM 370   H H    . PHE A 1 26 ? 4.313   -6.815  6.771   1.00 0.00 ? 26 PHE A H    1  
ATOM 371   H HA   . PHE A 1 26 ? 6.979   -6.418  6.368   1.00 0.00 ? 26 PHE A HA   1  
ATOM 372   H HB2  . PHE A 1 26 ? 5.610   -5.883  4.553   1.00 0.00 ? 26 PHE A HB2  1  
ATOM 373   H HB3  . PHE A 1 26 ? 4.581   -4.827  5.515   1.00 0.00 ? 26 PHE A HB3  1  
ATOM 374   H HD1  . PHE A 1 26 ? 5.365   -2.572  6.138   1.00 0.00 ? 26 PHE A HD1  1  
ATOM 375   H HD2  . PHE A 1 26 ? 7.576   -5.075  3.499   1.00 0.00 ? 26 PHE A HD2  1  
ATOM 376   H HE1  . PHE A 1 26 ? 6.649   -0.620  5.369   1.00 0.00 ? 26 PHE A HE1  1  
ATOM 377   H HE2  . PHE A 1 26 ? 8.865   -3.126  2.727   1.00 0.00 ? 26 PHE A HE2  1  
ATOM 378   H HZ   . PHE A 1 26 ? 8.401   -0.895  3.661   1.00 0.00 ? 26 PHE A HZ   1  
ATOM 379   N N    . GLU A 1 27 ? 5.787   -4.276  8.495   1.00 0.00 ? 27 GLU A N    1  
ATOM 380   C CA   . GLU A 1 27 ? 6.138   -3.238  9.456   1.00 0.00 ? 27 GLU A CA   1  
ATOM 381   C C    . GLU A 1 27 ? 7.272   -3.699  10.367  1.00 0.00 ? 27 GLU A C    1  
ATOM 382   O O    . GLU A 1 27 ? 8.271   -3.000  10.537  1.00 0.00 ? 27 GLU A O    1  
ATOM 383   C CB   . GLU A 1 27 ? 4.917   -2.857  10.297  1.00 0.00 ? 27 GLU A CB   1  
ATOM 384   C CG   . GLU A 1 27 ? 3.693   -2.504  9.468   1.00 0.00 ? 27 GLU A CG   1  
ATOM 385   C CD   . GLU A 1 27 ? 3.642   -1.034  9.100   1.00 0.00 ? 27 GLU A CD   1  
ATOM 386   O OE1  . GLU A 1 27 ? 4.439   -0.611  8.236   1.00 0.00 ? 27 GLU A OE1  1  
ATOM 387   O OE2  . GLU A 1 27 ? 2.806   -0.307  9.676   1.00 0.00 ? 27 GLU A OE2  1  
ATOM 388   H H    . GLU A 1 27 ? 4.897   -4.684  8.534   1.00 0.00 ? 27 GLU A H    1  
ATOM 389   H HA   . GLU A 1 27 ? 6.466   -2.371  8.904   1.00 0.00 ? 27 GLU A HA   1  
ATOM 390   H HB2  . GLU A 1 27 ? 4.664   -3.688  10.939  1.00 0.00 ? 27 GLU A HB2  1  
ATOM 391   H HB3  . GLU A 1 27 ? 5.169   -2.004  10.909  1.00 0.00 ? 27 GLU A HB3  1  
ATOM 392   H HG2  . GLU A 1 27 ? 3.710   -3.086  8.559   1.00 0.00 ? 27 GLU A HG2  1  
ATOM 393   H HG3  . GLU A 1 27 ? 2.807   -2.750  10.035  1.00 0.00 ? 27 GLU A HG3  1  
ATOM 394   N N    . THR A 1 28 ? 7.109   -4.883  10.951  1.00 0.00 ? 28 THR A N    1  
ATOM 395   C CA   . THR A 1 28 ? 8.117   -5.438  11.846  1.00 0.00 ? 28 THR A CA   1  
ATOM 396   C C    . THR A 1 28 ? 9.347   -5.896  11.071  1.00 0.00 ? 28 THR A C    1  
ATOM 397   O O    . THR A 1 28 ? 10.455  -5.918  11.606  1.00 0.00 ? 28 THR A O    1  
ATOM 398   C CB   . THR A 1 28 ? 7.559   -6.627  12.651  1.00 0.00 ? 28 THR A CB   1  
ATOM 399   O OG1  . THR A 1 28 ? 7.054   -7.628  11.760  1.00 0.00 ? 28 THR A OG1  1  
ATOM 400   C CG2  . THR A 1 28 ? 6.453   -6.173  13.591  1.00 0.00 ? 28 THR A CG2  1  
ATOM 401   H H    . THR A 1 28 ? 6.291   -5.393  10.776  1.00 0.00 ? 28 THR A H    1  
ATOM 402   H HA   . THR A 1 28 ? 8.409   -4.664  12.541  1.00 0.00 ? 28 THR A HA   1  
ATOM 403   H HB   . THR A 1 28 ? 8.361   -7.051  13.239  1.00 0.00 ? 28 THR A HB   1  
ATOM 404   H HG1  . THR A 1 28 ? 6.793   -7.217  10.932  1.00 0.00 ? 28 THR A HG1  1  
ATOM 405   H HG21 . THR A 1 28 ? 6.885   -5.627  14.417  1.00 0.00 ? 28 THR A HG21 1  
ATOM 406   H HG22 . THR A 1 28 ? 5.923   -7.035  13.966  1.00 0.00 ? 28 THR A HG22 1  
ATOM 407   H HG23 . THR A 1 28 ? 5.768   -5.533  13.057  1.00 0.00 ? 28 THR A HG23 1  
ATOM 408   N N    . GLN A 1 29 ? 9.145   -6.260  9.809   1.00 0.00 ? 29 GLN A N    1  
ATOM 409   C CA   . GLN A 1 29 ? 10.239  -6.717  8.961   1.00 0.00 ? 29 GLN A CA   1  
ATOM 410   C C    . GLN A 1 29 ? 9.915   -6.496  7.487   1.00 0.00 ? 29 GLN A C    1  
ATOM 411   O O    . GLN A 1 29 ? 8.996   -7.108  6.943   1.00 0.00 ? 29 GLN A O    1  
ATOM 412   C CB   . GLN A 1 29 ? 10.525  -8.198  9.216   1.00 0.00 ? 29 GLN A CB   1  
ATOM 413   C CG   . GLN A 1 29 ? 11.980  -8.582  9.003   1.00 0.00 ? 29 GLN A CG   1  
ATOM 414   C CD   . GLN A 1 29 ? 12.159  -10.062 8.727   1.00 0.00 ? 29 GLN A CD   1  
ATOM 415   O OE1  . GLN A 1 29 ? 11.433  -10.898 9.266   1.00 0.00 ? 29 GLN A OE1  1  
ATOM 416   N NE2  . GLN A 1 29 ? 13.129  -10.394 7.883   1.00 0.00 ? 29 GLN A NE2  1  
ATOM 417   H H    . GLN A 1 29 ? 8.238   -6.220  9.439   1.00 0.00 ? 29 GLN A H    1  
ATOM 418   H HA   . GLN A 1 29 ? 11.117  -6.142  9.214   1.00 0.00 ? 29 GLN A HA   1  
ATOM 419   H HB2  . GLN A 1 29 ? 10.258  -8.434  10.235  1.00 0.00 ? 29 GLN A HB2  1  
ATOM 420   H HB3  . GLN A 1 29 ? 9.918   -8.790  8.546   1.00 0.00 ? 29 GLN A HB3  1  
ATOM 421   H HG2  . GLN A 1 29 ? 12.367  -8.026  8.162   1.00 0.00 ? 29 GLN A HG2  1  
ATOM 422   H HG3  . GLN A 1 29 ? 12.540  -8.326  9.891   1.00 0.00 ? 29 GLN A HG3  1  
ATOM 423   H HE21 . GLN A 1 29 ? 13.668  -9.674  7.492   1.00 0.00 ? 29 GLN A HE21 1  
ATOM 424   H HE22 . GLN A 1 29 ? 13.267  -11.343 7.687   1.00 0.00 ? 29 GLN A HE22 1  
ATOM 425   N N    . LYS A 1 30 ? 10.676  -5.616  6.845   1.00 0.00 ? 30 LYS A N    1  
ATOM 426   C CA   . LYS A 1 30 ? 10.472  -5.313  5.433   1.00 0.00 ? 30 LYS A CA   1  
ATOM 427   C C    . LYS A 1 30 ? 10.587  -6.575  4.584   1.00 0.00 ? 30 LYS A C    1  
ATOM 428   O O    . LYS A 1 30 ? 9.952   -6.689  3.536   1.00 0.00 ? 30 LYS A O    1  
ATOM 429   C CB   . LYS A 1 30 ? 11.490  -4.273  4.961   1.00 0.00 ? 30 LYS A CB   1  
ATOM 430   C CG   . LYS A 1 30 ? 11.507  -3.011  5.807   1.00 0.00 ? 30 LYS A CG   1  
ATOM 431   C CD   . LYS A 1 30 ? 10.276  -2.156  5.559   1.00 0.00 ? 30 LYS A CD   1  
ATOM 432   C CE   . LYS A 1 30 ? 10.005  -1.217  6.724   1.00 0.00 ? 30 LYS A CE   1  
ATOM 433   N NZ   . LYS A 1 30 ? 9.537   -1.953  7.932   1.00 0.00 ? 30 LYS A NZ   1  
ATOM 434   H H    . LYS A 1 30 ? 11.394  -5.159  7.333   1.00 0.00 ? 30 LYS A H    1  
ATOM 435   H HA   . LYS A 1 30 ? 9.477   -4.908  5.321   1.00 0.00 ? 30 LYS A HA   1  
ATOM 436   H HB2  . LYS A 1 30 ? 12.475  -4.713  4.988   1.00 0.00 ? 30 LYS A HB2  1  
ATOM 437   H HB3  . LYS A 1 30 ? 11.257  -3.995  3.943   1.00 0.00 ? 30 LYS A HB3  1  
ATOM 438   H HG2  . LYS A 1 30 ? 11.535  -3.288  6.850   1.00 0.00 ? 30 LYS A HG2  1  
ATOM 439   H HG3  . LYS A 1 30 ? 12.389  -2.436  5.561   1.00 0.00 ? 30 LYS A HG3  1  
ATOM 440   H HD2  . LYS A 1 30 ? 10.430  -1.568  4.666   1.00 0.00 ? 30 LYS A HD2  1  
ATOM 441   H HD3  . LYS A 1 30 ? 9.421   -2.803  5.422   1.00 0.00 ? 30 LYS A HD3  1  
ATOM 442   H HE2  . LYS A 1 30 ? 10.915  -0.691  6.964   1.00 0.00 ? 30 LYS A HE2  1  
ATOM 443   H HE3  . LYS A 1 30 ? 9.246   -0.508  6.429   1.00 0.00 ? 30 LYS A HE3  1  
ATOM 444   H HZ1  . LYS A 1 30 ? 9.704   -2.973  7.815   1.00 0.00 ? 30 LYS A HZ1  1  
ATOM 445   H HZ2  . LYS A 1 30 ? 8.520   -1.794  8.076   1.00 0.00 ? 30 LYS A HZ2  1  
ATOM 446   H HZ3  . LYS A 1 30 ? 10.051  -1.623  8.773   1.00 0.00 ? 30 LYS A HZ3  1  
ATOM 447   N N    . TYR A 1 31 ? 11.400  -7.519  5.044   1.00 0.00 ? 31 TYR A N    1  
ATOM 448   C CA   . TYR A 1 31 ? 11.599  -8.772  4.325   1.00 0.00 ? 31 TYR A CA   1  
ATOM 449   C C    . TYR A 1 31 ? 11.245  -9.967  5.206   1.00 0.00 ? 31 TYR A C    1  
ATOM 450   O O    . TYR A 1 31 ? 10.951  -9.814  6.392   1.00 0.00 ? 31 TYR A O    1  
ATOM 451   C CB   . TYR A 1 31 ? 13.049  -8.887  3.850   1.00 0.00 ? 31 TYR A CB   1  
ATOM 452   C CG   . TYR A 1 31 ? 13.289  -8.276  2.488   1.00 0.00 ? 31 TYR A CG   1  
ATOM 453   C CD1  . TYR A 1 31 ? 12.958  -6.951  2.231   1.00 0.00 ? 31 TYR A CD1  1  
ATOM 454   C CD2  . TYR A 1 31 ? 13.850  -9.023  1.459   1.00 0.00 ? 31 TYR A CD2  1  
ATOM 455   C CE1  . TYR A 1 31 ? 13.176  -6.389  0.988   1.00 0.00 ? 31 TYR A CE1  1  
ATOM 456   C CE2  . TYR A 1 31 ? 14.072  -8.468  0.214   1.00 0.00 ? 31 TYR A CE2  1  
ATOM 457   C CZ   . TYR A 1 31 ? 13.733  -7.151  -0.017  1.00 0.00 ? 31 TYR A CZ   1  
ATOM 458   O OH   . TYR A 1 31 ? 13.953  -6.594  -1.256  1.00 0.00 ? 31 TYR A OH   1  
ATOM 459   H H    . TYR A 1 31 ? 11.879  -7.370  5.885   1.00 0.00 ? 31 TYR A H    1  
ATOM 460   H HA   . TYR A 1 31 ? 10.947  -8.768  3.464   1.00 0.00 ? 31 TYR A HA   1  
ATOM 461   H HB2  . TYR A 1 31 ? 13.693  -8.387  4.556   1.00 0.00 ? 31 TYR A HB2  1  
ATOM 462   H HB3  . TYR A 1 31 ? 13.322  -9.931  3.798   1.00 0.00 ? 31 TYR A HB3  1  
ATOM 463   H HD1  . TYR A 1 31 ? 12.522  -6.357  3.021   1.00 0.00 ? 31 TYR A HD1  1  
ATOM 464   H HD2  . TYR A 1 31 ? 14.114  -10.054 1.643   1.00 0.00 ? 31 TYR A HD2  1  
ATOM 465   H HE1  . TYR A 1 31 ? 12.911  -5.358  0.808   1.00 0.00 ? 31 TYR A HE1  1  
ATOM 466   H HE2  . TYR A 1 31 ? 14.509  -9.065  -0.574  1.00 0.00 ? 31 TYR A HE2  1  
ATOM 467   H HH   . TYR A 1 31 ? 13.860  -7.270  -1.932  1.00 0.00 ? 31 TYR A HH   1  
ATOM 468   N N    . LEU A 1 32 ? 11.274  -11.157 4.616   1.00 0.00 ? 32 LEU A N    1  
ATOM 469   C CA   . LEU A 1 32 ? 10.957  -12.380 5.345   1.00 0.00 ? 32 LEU A CA   1  
ATOM 470   C C    . LEU A 1 32 ? 11.673  -13.580 4.733   1.00 0.00 ? 32 LEU A C    1  
ATOM 471   O O    . LEU A 1 32 ? 11.519  -13.869 3.547   1.00 0.00 ? 32 LEU A O    1  
ATOM 472   C CB   . LEU A 1 32 ? 9.446   -12.620 5.345   1.00 0.00 ? 32 LEU A CB   1  
ATOM 473   C CG   . LEU A 1 32 ? 8.594   -11.527 5.992   1.00 0.00 ? 32 LEU A CG   1  
ATOM 474   C CD1  . LEU A 1 32 ? 7.155   -11.616 5.508   1.00 0.00 ? 32 LEU A CD1  1  
ATOM 475   C CD2  . LEU A 1 32 ? 8.655   -11.631 7.509   1.00 0.00 ? 32 LEU A CD2  1  
ATOM 476   H H    . LEU A 1 32 ? 11.515  -11.216 3.668   1.00 0.00 ? 32 LEU A H    1  
ATOM 477   H HA   . LEU A 1 32 ? 11.294  -12.256 6.363   1.00 0.00 ? 32 LEU A HA   1  
ATOM 478   H HB2  . LEU A 1 32 ? 9.128   -12.723 4.320   1.00 0.00 ? 32 LEU A HB2  1  
ATOM 479   H HB3  . LEU A 1 32 ? 9.259   -13.544 5.874   1.00 0.00 ? 32 LEU A HB3  1  
ATOM 480   H HG   . LEU A 1 32 ? 8.982   -10.560 5.706   1.00 0.00 ? 32 LEU A HG   1  
ATOM 481   H HD11 . LEU A 1 32 ? 6.487   -11.357 6.315   1.00 0.00 ? 32 LEU A HD11 1  
ATOM 482   H HD12 . LEU A 1 32 ? 6.948   -12.624 5.179   1.00 0.00 ? 32 LEU A HD12 1  
ATOM 483   H HD13 . LEU A 1 32 ? 7.009   -10.932 4.685   1.00 0.00 ? 32 LEU A HD13 1  
ATOM 484   H HD21 . LEU A 1 32 ? 9.648   -11.374 7.847   1.00 0.00 ? 32 LEU A HD21 1  
ATOM 485   H HD22 . LEU A 1 32 ? 8.424   -12.643 7.810   1.00 0.00 ? 32 LEU A HD22 1  
ATOM 486   H HD23 . LEU A 1 32 ? 7.938   -10.952 7.946   1.00 0.00 ? 32 LEU A HD23 1  
ATOM 487   N N    . SER A 1 33 ? 12.456  -14.276 5.552   1.00 0.00 ? 33 SER A N    1  
ATOM 488   C CA   . SER A 1 33 ? 13.198  -15.444 5.091   1.00 0.00 ? 33 SER A CA   1  
ATOM 489   C C    . SER A 1 33 ? 12.248  -16.526 4.586   1.00 0.00 ? 33 SER A C    1  
ATOM 490   O O    . SER A 1 33 ? 11.086  -16.604 4.986   1.00 0.00 ? 33 SER A O    1  
ATOM 491   C CB   . SER A 1 33 ? 14.067  -16.000 6.220   1.00 0.00 ? 33 SER A CB   1  
ATOM 492   O OG   . SER A 1 33 ? 14.659  -14.954 6.971   1.00 0.00 ? 33 SER A OG   1  
ATOM 493   H H    . SER A 1 33 ? 12.538  -13.995 6.488   1.00 0.00 ? 33 SER A H    1  
ATOM 494   H HA   . SER A 1 33 ? 13.835  -15.132 4.277   1.00 0.00 ? 33 SER A HA   1  
ATOM 495   H HB2  . SER A 1 33 ? 13.458  -16.599 6.879   1.00 0.00 ? 33 SER A HB2  1  
ATOM 496   H HB3  . SER A 1 33 ? 14.851  -16.612 5.799   1.00 0.00 ? 33 SER A HB3  1  
ATOM 497   H HG   . SER A 1 33 ? 15.153  -14.378 6.383   1.00 0.00 ? 33 SER A HG   1  
ATOM 498   N N    . PRO A 1 34 ? 12.753  -17.381 3.684   1.00 0.00 ? 34 PRO A N    1  
ATOM 499   C CA   . PRO A 1 34 ? 11.967  -18.474 3.104   1.00 0.00 ? 34 PRO A CA   1  
ATOM 500   C C    . PRO A 1 34 ? 11.221  -19.277 4.163   1.00 0.00 ? 34 PRO A C    1  
ATOM 501   O O    . PRO A 1 34 ? 10.046  -19.612 4.009   1.00 0.00 ? 34 PRO A O    1  
ATOM 502   C CB   . PRO A 1 34 ? 13.024  -19.345 2.419   1.00 0.00 ? 34 PRO A CB   1  
ATOM 503   C CG   . PRO A 1 34 ? 14.141  -18.410 2.107   1.00 0.00 ? 34 PRO A CG   1  
ATOM 504   C CD   . PRO A 1 34 ? 14.129  -17.346 3.161   1.00 0.00 ? 34 PRO A CD   1  
ATOM 505   H HA   . PRO A 1 34 ? 11.265  -18.111 2.367   1.00 0.00 ? 34 PRO A HA   1  
ATOM 506   H HB2  . PRO A 1 34 ? 13.340  -20.129 3.092   1.00 0.00 ? 34 PRO A HB2  1  
ATOM 507   H HB3  . PRO A 1 34 ? 12.611  -19.779 1.521   1.00 0.00 ? 34 PRO A HB3  1  
ATOM 508   H HG2  . PRO A 1 34 ? 15.081  -18.940 2.133   1.00 0.00 ? 34 PRO A HG2  1  
ATOM 509   H HG3  . PRO A 1 34 ? 13.986  -17.964 1.136   1.00 0.00 ? 34 PRO A HG3  1  
ATOM 510   H HD2  . PRO A 1 34 ? 14.842  -17.582 3.937   1.00 0.00 ? 34 PRO A HD2  1  
ATOM 511   H HD3  . PRO A 1 34 ? 14.350  -16.384 2.723   1.00 0.00 ? 34 PRO A HD3  1  
ATOM 512   N N    . PRO A 1 35 ? 11.916  -19.594 5.266   1.00 0.00 ? 35 PRO A N    1  
ATOM 513   C CA   . PRO A 1 35 ? 11.337  -20.361 6.373   1.00 0.00 ? 35 PRO A CA   1  
ATOM 514   C C    . PRO A 1 35 ? 9.975   -19.825 6.800   1.00 0.00 ? 35 PRO A C    1  
ATOM 515   O O    . PRO A 1 35 ? 9.055   -20.594 7.078   1.00 0.00 ? 35 PRO A O    1  
ATOM 516   C CB   . PRO A 1 35 ? 12.359  -20.183 7.499   1.00 0.00 ? 35 PRO A CB   1  
ATOM 517   C CG   . PRO A 1 35 ? 13.649  -19.922 6.802   1.00 0.00 ? 35 PRO A CG   1  
ATOM 518   C CD   . PRO A 1 35 ? 13.320  -19.228 5.516   1.00 0.00 ? 35 PRO A CD   1  
ATOM 519   H HA   . PRO A 1 35 ? 11.249  -21.409 6.126   1.00 0.00 ? 35 PRO A HA   1  
ATOM 520   H HB2  . PRO A 1 35 ? 12.069  -19.350 8.123   1.00 0.00 ? 35 PRO A HB2  1  
ATOM 521   H HB3  . PRO A 1 35 ? 12.406  -21.084 8.092   1.00 0.00 ? 35 PRO A HB3  1  
ATOM 522   H HG2  . PRO A 1 35 ? 14.273  -19.286 7.412   1.00 0.00 ? 35 PRO A HG2  1  
ATOM 523   H HG3  . PRO A 1 35 ? 14.150  -20.856 6.596   1.00 0.00 ? 35 PRO A HG3  1  
ATOM 524   H HD2  . PRO A 1 35 ? 13.425  -18.159 5.632   1.00 0.00 ? 35 PRO A HD2  1  
ATOM 525   H HD3  . PRO A 1 35 ? 13.959  -19.588 4.724   1.00 0.00 ? 35 PRO A HD3  1  
ATOM 526   N N    . GLU A 1 36 ? 9.853   -18.502 6.849   1.00 0.00 ? 36 GLU A N    1  
ATOM 527   C CA   . GLU A 1 36 ? 8.602   -17.865 7.243   1.00 0.00 ? 36 GLU A CA   1  
ATOM 528   C C    . GLU A 1 36 ? 7.670   -17.709 6.045   1.00 0.00 ? 36 GLU A C    1  
ATOM 529   O O    . GLU A 1 36 ? 6.609   -18.329 5.986   1.00 0.00 ? 36 GLU A O    1  
ATOM 530   C CB   . GLU A 1 36 ? 8.877   -16.497 7.871   1.00 0.00 ? 36 GLU A CB   1  
ATOM 531   C CG   . GLU A 1 36 ? 10.027  -16.502 8.864   1.00 0.00 ? 36 GLU A CG   1  
ATOM 532   C CD   . GLU A 1 36 ? 9.573   -16.798 10.280  1.00 0.00 ? 36 GLU A CD   1  
ATOM 533   O OE1  . GLU A 1 36 ? 8.472   -16.347 10.657  1.00 0.00 ? 36 GLU A OE1  1  
ATOM 534   O OE2  . GLU A 1 36 ? 10.321  -17.481 11.012  1.00 0.00 ? 36 GLU A OE2  1  
ATOM 535   H H    . GLU A 1 36 ? 10.623  -17.942 6.616   1.00 0.00 ? 36 GLU A H    1  
ATOM 536   H HA   . GLU A 1 36 ? 8.124   -18.497 7.976   1.00 0.00 ? 36 GLU A HA   1  
ATOM 537   H HB2  . GLU A 1 36 ? 9.110   -15.794 7.085   1.00 0.00 ? 36 GLU A HB2  1  
ATOM 538   H HB3  . GLU A 1 36 ? 7.987   -16.166 8.385   1.00 0.00 ? 36 GLU A HB3  1  
ATOM 539   H HG2  . GLU A 1 36 ? 10.739  -17.257 8.566   1.00 0.00 ? 36 GLU A HG2  1  
ATOM 540   H HG3  . GLU A 1 36 ? 10.503  -15.533 8.849   1.00 0.00 ? 36 GLU A HG3  1  
ATOM 541   N N    . ARG A 1 37 ? 8.076   -16.876 5.092   1.00 0.00 ? 37 ARG A N    1  
ATOM 542   C CA   . ARG A 1 37 ? 7.277   -16.637 3.896   1.00 0.00 ? 37 ARG A CA   1  
ATOM 543   C C    . ARG A 1 37 ? 6.526   -17.899 3.482   1.00 0.00 ? 37 ARG A C    1  
ATOM 544   O O    . ARG A 1 37 ? 5.384   -17.835 3.028   1.00 0.00 ? 37 ARG A O    1  
ATOM 545   C CB   . ARG A 1 37 ? 8.169   -16.162 2.747   1.00 0.00 ? 37 ARG A CB   1  
ATOM 546   C CG   . ARG A 1 37 ? 7.412   -15.434 1.649   1.00 0.00 ? 37 ARG A CG   1  
ATOM 547   C CD   . ARG A 1 37 ? 8.195   -15.423 0.345   1.00 0.00 ? 37 ARG A CD   1  
ATOM 548   N NE   . ARG A 1 37 ? 8.410   -16.770 -0.176  1.00 0.00 ? 37 ARG A NE   1  
ATOM 549   C CZ   . ARG A 1 37 ? 9.085   -17.028 -1.290  1.00 0.00 ? 37 ARG A CZ   1  
ATOM 550   N NH1  . ARG A 1 37 ? 9.608   -16.036 -1.997  1.00 0.00 ? 37 ARG A NH1  1  
ATOM 551   N NH2  . ARG A 1 37 ? 9.238   -18.281 -1.700  1.00 0.00 ? 37 ARG A NH2  1  
ATOM 552   H H    . ARG A 1 37 ? 8.932   -16.411 5.195   1.00 0.00 ? 37 ARG A H    1  
ATOM 553   H HA   . ARG A 1 37 ? 6.559   -15.864 4.125   1.00 0.00 ? 37 ARG A HA   1  
ATOM 554   H HB2  . ARG A 1 37 ? 8.918   -15.491 3.143   1.00 0.00 ? 37 ARG A HB2  1  
ATOM 555   H HB3  . ARG A 1 37 ? 8.660   -17.019 2.310   1.00 0.00 ? 37 ARG A HB3  1  
ATOM 556   H HG2  . ARG A 1 37 ? 6.468   -15.933 1.484   1.00 0.00 ? 37 ARG A HG2  1  
ATOM 557   H HG3  . ARG A 1 37 ? 7.234   -14.416 1.961   1.00 0.00 ? 37 ARG A HG3  1  
ATOM 558   H HD2  . ARG A 1 37 ? 7.645   -14.849 -0.385  1.00 0.00 ? 37 ARG A HD2  1  
ATOM 559   H HD3  . ARG A 1 37 ? 9.154   -14.958 0.521   1.00 0.00 ? 37 ARG A HD3  1  
ATOM 560   H HE   . ARG A 1 37 ? 8.032   -17.519 0.331   1.00 0.00 ? 37 ARG A HE   1  
ATOM 561   H HH11 . ARG A 1 37 ? 9.495   -15.091 -1.691  1.00 0.00 ? 37 ARG A HH11 1  
ATOM 562   H HH12 . ARG A 1 37 ? 10.116  -16.233 -2.836  1.00 0.00 ? 37 ARG A HH12 1  
ATOM 563   H HH21 . ARG A 1 37 ? 8.846   -19.032 -1.170  1.00 0.00 ? 37 ARG A HH21 1  
ATOM 564   H HH22 . ARG A 1 37 ? 9.746   -18.474 -2.539  1.00 0.00 ? 37 ARG A HH22 1  
ATOM 565   N N    . LYS A 1 38 ? 7.177   -19.047 3.641   1.00 0.00 ? 38 LYS A N    1  
ATOM 566   C CA   . LYS A 1 38 ? 6.572   -20.325 3.285   1.00 0.00 ? 38 LYS A CA   1  
ATOM 567   C C    . LYS A 1 38 ? 5.363   -20.620 4.167   1.00 0.00 ? 38 LYS A C    1  
ATOM 568   O O    . LYS A 1 38 ? 4.290   -20.963 3.671   1.00 0.00 ? 38 LYS A O    1  
ATOM 569   C CB   . LYS A 1 38 ? 7.599   -21.453 3.416   1.00 0.00 ? 38 LYS A CB   1  
ATOM 570   C CG   . LYS A 1 38 ? 8.587   -21.512 2.264   1.00 0.00 ? 38 LYS A CG   1  
ATOM 571   C CD   . LYS A 1 38 ? 9.898   -22.153 2.686   1.00 0.00 ? 38 LYS A CD   1  
ATOM 572   C CE   . LYS A 1 38 ? 9.810   -23.671 2.660   1.00 0.00 ? 38 LYS A CE   1  
ATOM 573   N NZ   . LYS A 1 38 ? 10.790  -24.300 3.589   1.00 0.00 ? 38 LYS A NZ   1  
ATOM 574   H H    . LYS A 1 38 ? 8.086   -19.034 4.008   1.00 0.00 ? 38 LYS A H    1  
ATOM 575   H HA   . LYS A 1 38 ? 6.246   -20.264 2.258   1.00 0.00 ? 38 LYS A HA   1  
ATOM 576   H HB2  . LYS A 1 38 ? 8.154   -21.313 4.332   1.00 0.00 ? 38 LYS A HB2  1  
ATOM 577   H HB3  . LYS A 1 38 ? 7.075   -22.397 3.462   1.00 0.00 ? 38 LYS A HB3  1  
ATOM 578   H HG2  . LYS A 1 38 ? 8.156   -22.094 1.462   1.00 0.00 ? 38 LYS A HG2  1  
ATOM 579   H HG3  . LYS A 1 38 ? 8.783   -20.507 1.917   1.00 0.00 ? 38 LYS A HG3  1  
ATOM 580   H HD2  . LYS A 1 38 ? 10.678  -21.837 2.010   1.00 0.00 ? 38 LYS A HD2  1  
ATOM 581   H HD3  . LYS A 1 38 ? 10.138  -21.832 3.690   1.00 0.00 ? 38 LYS A HD3  1  
ATOM 582   H HE2  . LYS A 1 38 ? 8.813   -23.967 2.948   1.00 0.00 ? 38 LYS A HE2  1  
ATOM 583   H HE3  . LYS A 1 38 ? 10.010  -24.013 1.655   1.00 0.00 ? 38 LYS A HE3  1  
ATOM 584   H HZ1  . LYS A 1 38 ? 10.751  -25.336 3.502   1.00 0.00 ? 38 LYS A HZ1  1  
ATOM 585   H HZ2  . LYS A 1 38 ? 10.569  -24.038 4.571   1.00 0.00 ? 38 LYS A HZ2  1  
ATOM 586   H HZ3  . LYS A 1 38 ? 11.753  -23.979 3.364   1.00 0.00 ? 38 LYS A HZ3  1  
ATOM 587   N N    . ARG A 1 39 ? 5.544   -20.482 5.477   1.00 0.00 ? 39 ARG A N    1  
ATOM 588   C CA   . ARG A 1 39 ? 4.468   -20.733 6.427   1.00 0.00 ? 39 ARG A CA   1  
ATOM 589   C C    . ARG A 1 39 ? 3.388   -19.660 6.321   1.00 0.00 ? 39 ARG A C    1  
ATOM 590   O O    . ARG A 1 39 ? 2.194   -19.960 6.362   1.00 0.00 ? 39 ARG A O    1  
ATOM 591   C CB   . ARG A 1 39 ? 5.018   -20.778 7.854   1.00 0.00 ? 39 ARG A CB   1  
ATOM 592   C CG   . ARG A 1 39 ? 6.230   -21.683 8.011   1.00 0.00 ? 39 ARG A CG   1  
ATOM 593   C CD   . ARG A 1 39 ? 7.138   -21.208 9.134   1.00 0.00 ? 39 ARG A CD   1  
ATOM 594   N NE   . ARG A 1 39 ? 6.753   -21.773 10.425  1.00 0.00 ? 39 ARG A NE   1  
ATOM 595   C CZ   . ARG A 1 39 ? 6.916   -23.052 10.744  1.00 0.00 ? 39 ARG A CZ   1  
ATOM 596   N NH1  . ARG A 1 39 ? 7.454   -23.894 9.872   1.00 0.00 ? 39 ARG A NH1  1  
ATOM 597   N NH2  . ARG A 1 39 ? 6.541   -23.492 11.939  1.00 0.00 ? 39 ARG A NH2  1  
ATOM 598   H H    . ARG A 1 39 ? 6.423   -20.206 5.812   1.00 0.00 ? 39 ARG A H    1  
ATOM 599   H HA   . ARG A 1 39 ? 4.031   -21.691 6.189   1.00 0.00 ? 39 ARG A HA   1  
ATOM 600   H HB2  . ARG A 1 39 ? 5.302   -19.779 8.150   1.00 0.00 ? 39 ARG A HB2  1  
ATOM 601   H HB3  . ARG A 1 39 ? 4.243   -21.134 8.515   1.00 0.00 ? 39 ARG A HB3  1  
ATOM 602   H HG2  . ARG A 1 39 ? 5.893   -22.684 8.234   1.00 0.00 ? 39 ARG A HG2  1  
ATOM 603   H HG3  . ARG A 1 39 ? 6.787   -21.686 7.086   1.00 0.00 ? 39 ARG A HG3  1  
ATOM 604   H HD2  . ARG A 1 39 ? 8.152   -21.505 8.910   1.00 0.00 ? 39 ARG A HD2  1  
ATOM 605   H HD3  . ARG A 1 39 ? 7.083   -20.131 9.192   1.00 0.00 ? 39 ARG A HD3  1  
ATOM 606   H HE   . ARG A 1 39 ? 6.354   -21.169 11.084  1.00 0.00 ? 39 ARG A HE   1  
ATOM 607   H HH11 . ARG A 1 39 ? 7.738   -23.566 8.972   1.00 0.00 ? 39 ARG A HH11 1  
ATOM 608   H HH12 . ARG A 1 39 ? 7.576   -24.856 10.116  1.00 0.00 ? 39 ARG A HH12 1  
ATOM 609   H HH21 . ARG A 1 39 ? 6.136   -22.860 12.599  1.00 0.00 ? 39 ARG A HH21 1  
ATOM 610   H HH22 . ARG A 1 39 ? 6.664   -24.454 12.179  1.00 0.00 ? 39 ARG A HH22 1  
ATOM 611   N N    . LEU A 1 40 ? 3.815   -18.410 6.186   1.00 0.00 ? 40 LEU A N    1  
ATOM 612   C CA   . LEU A 1 40 ? 2.884   -17.291 6.075   1.00 0.00 ? 40 LEU A CA   1  
ATOM 613   C C    . LEU A 1 40 ? 1.874   -17.533 4.958   1.00 0.00 ? 40 LEU A C    1  
ATOM 614   O O    . LEU A 1 40 ? 0.667   -17.403 5.161   1.00 0.00 ? 40 LEU A O    1  
ATOM 615   C CB   . LEU A 1 40 ? 3.648   -15.992 5.814   1.00 0.00 ? 40 LEU A CB   1  
ATOM 616   C CG   . LEU A 1 40 ? 2.892   -14.697 6.117   1.00 0.00 ? 40 LEU A CG   1  
ATOM 617   C CD1  . LEU A 1 40 ? 2.617   -14.575 7.608   1.00 0.00 ? 40 LEU A CD1  1  
ATOM 618   C CD2  . LEU A 1 40 ? 3.676   -13.493 5.616   1.00 0.00 ? 40 LEU A CD2  1  
ATOM 619   H H    . LEU A 1 40 ? 4.778   -18.233 6.160   1.00 0.00 ? 40 LEU A H    1  
ATOM 620   H HA   . LEU A 1 40 ? 2.354   -17.207 7.012   1.00 0.00 ? 40 LEU A HA   1  
ATOM 621   H HB2  . LEU A 1 40 ? 4.539   -16.004 6.423   1.00 0.00 ? 40 LEU A HB2  1  
ATOM 622   H HB3  . LEU A 1 40 ? 3.927   -15.977 4.770   1.00 0.00 ? 40 LEU A HB3  1  
ATOM 623   H HG   . LEU A 1 40 ? 1.940   -14.715 5.603   1.00 0.00 ? 40 LEU A HG   1  
ATOM 624   H HD11 . LEU A 1 40 ? 3.541   -14.692 8.154   1.00 0.00 ? 40 LEU A HD11 1  
ATOM 625   H HD12 . LEU A 1 40 ? 1.921   -15.343 7.909   1.00 0.00 ? 40 LEU A HD12 1  
ATOM 626   H HD13 . LEU A 1 40 ? 2.195   -13.604 7.817   1.00 0.00 ? 40 LEU A HD13 1  
ATOM 627   H HD21 . LEU A 1 40 ? 4.470   -13.826 4.965   1.00 0.00 ? 40 LEU A HD21 1  
ATOM 628   H HD22 . LEU A 1 40 ? 4.098   -12.964 6.458   1.00 0.00 ? 40 LEU A HD22 1  
ATOM 629   H HD23 . LEU A 1 40 ? 3.015   -12.835 5.072   1.00 0.00 ? 40 LEU A HD23 1  
ATOM 630   N N    . ALA A 1 41 ? 2.375   -17.887 3.780   1.00 0.00 ? 41 ALA A N    1  
ATOM 631   C CA   . ALA A 1 41 ? 1.516   -18.152 2.632   1.00 0.00 ? 41 ALA A CA   1  
ATOM 632   C C    . ALA A 1 41 ? 0.434   -19.170 2.979   1.00 0.00 ? 41 ALA A C    1  
ATOM 633   O O    . ALA A 1 41 ? -0.615  -19.220 2.337   1.00 0.00 ? 41 ALA A O    1  
ATOM 634   C CB   . ALA A 1 41 ? 2.344   -18.640 1.453   1.00 0.00 ? 41 ALA A CB   1  
ATOM 635   H H    . ALA A 1 41 ? 3.346   -17.975 3.680   1.00 0.00 ? 41 ALA A H    1  
ATOM 636   H HA   . ALA A 1 41 ? 1.043   -17.222 2.348   1.00 0.00 ? 41 ALA A HA   1  
ATOM 637   H HB1  . ALA A 1 41 ? 1.952   -19.585 1.105   1.00 0.00 ? 41 ALA A HB1  1  
ATOM 638   H HB2  . ALA A 1 41 ? 2.297   -17.914 0.655   1.00 0.00 ? 41 ALA A HB2  1  
ATOM 639   H HB3  . ALA A 1 41 ? 3.370   -18.769 1.764   1.00 0.00 ? 41 ALA A HB3  1  
ATOM 640   N N    . LYS A 1 42 ? 0.697   -19.981 3.998   1.00 0.00 ? 42 LYS A N    1  
ATOM 641   C CA   . LYS A 1 42 ? -0.253  -20.998 4.431   1.00 0.00 ? 42 LYS A CA   1  
ATOM 642   C C    . LYS A 1 42 ? -1.207  -20.439 5.482   1.00 0.00 ? 42 LYS A C    1  
ATOM 643   O O    . LYS A 1 42 ? -2.360  -20.861 5.574   1.00 0.00 ? 42 LYS A O    1  
ATOM 644   C CB   . LYS A 1 42 ? 0.489   -22.212 4.995   1.00 0.00 ? 42 LYS A CB   1  
ATOM 645   C CG   . LYS A 1 42 ? -0.429  -23.257 5.606   1.00 0.00 ? 42 LYS A CG   1  
ATOM 646   C CD   . LYS A 1 42 ? -0.968  -24.209 4.552   1.00 0.00 ? 42 LYS A CD   1  
ATOM 647   C CE   . LYS A 1 42 ? -1.961  -25.195 5.148   1.00 0.00 ? 42 LYS A CE   1  
ATOM 648   N NZ   . LYS A 1 42 ? -3.256  -24.542 5.485   1.00 0.00 ? 42 LYS A NZ   1  
ATOM 649   H H    . LYS A 1 42 ? 1.552   -19.893 4.471   1.00 0.00 ? 42 LYS A H    1  
ATOM 650   H HA   . LYS A 1 42 ? -0.826  -21.306 3.570   1.00 0.00 ? 42 LYS A HA   1  
ATOM 651   H HB2  . LYS A 1 42 ? 1.051   -22.677 4.199   1.00 0.00 ? 42 LYS A HB2  1  
ATOM 652   H HB3  . LYS A 1 42 ? 1.175   -21.876 5.760   1.00 0.00 ? 42 LYS A HB3  1  
ATOM 653   H HG2  . LYS A 1 42 ? 0.124   -23.824 6.340   1.00 0.00 ? 42 LYS A HG2  1  
ATOM 654   H HG3  . LYS A 1 42 ? -1.259  -22.757 6.085   1.00 0.00 ? 42 LYS A HG3  1  
ATOM 655   H HD2  . LYS A 1 42 ? -1.464  -23.638 3.782   1.00 0.00 ? 42 LYS A HD2  1  
ATOM 656   H HD3  . LYS A 1 42 ? -0.143  -24.759 4.120   1.00 0.00 ? 42 LYS A HD3  1  
ATOM 657   H HE2  . LYS A 1 42 ? -2.140  -25.982 4.432   1.00 0.00 ? 42 LYS A HE2  1  
ATOM 658   H HE3  . LYS A 1 42 ? -1.535  -25.617 6.046   1.00 0.00 ? 42 LYS A HE3  1  
ATOM 659   H HZ1  . LYS A 1 42 ? -3.794  -24.346 4.617   1.00 0.00 ? 42 LYS A HZ1  1  
ATOM 660   H HZ2  . LYS A 1 42 ? -3.085  -23.646 5.983   1.00 0.00 ? 42 LYS A HZ2  1  
ATOM 661   H HZ3  . LYS A 1 42 ? -3.822  -25.165 6.097   1.00 0.00 ? 42 LYS A HZ3  1  
ATOM 662   N N    . MET A 1 43 ? -0.720  -19.487 6.271   1.00 0.00 ? 43 MET A N    1  
ATOM 663   C CA   . MET A 1 43 ? -1.531  -18.869 7.313   1.00 0.00 ? 43 MET A CA   1  
ATOM 664   C C    . MET A 1 43 ? -2.548  -17.905 6.710   1.00 0.00 ? 43 MET A C    1  
ATOM 665   O O    . MET A 1 43 ? -3.725  -17.920 7.075   1.00 0.00 ? 43 MET A O    1  
ATOM 666   C CB   . MET A 1 43 ? -0.639  -18.128 8.311   1.00 0.00 ? 43 MET A CB   1  
ATOM 667   C CG   . MET A 1 43 ? -1.407  -17.209 9.247   1.00 0.00 ? 43 MET A CG   1  
ATOM 668   S SD   . MET A 1 43 ? -0.571  -16.968 10.826  1.00 0.00 ? 43 MET A SD   1  
ATOM 669   C CE   . MET A 1 43 ? 0.880   -16.055 10.304  1.00 0.00 ? 43 MET A CE   1  
ATOM 670   H H    . MET A 1 43 ? 0.207   -19.192 6.149   1.00 0.00 ? 43 MET A H    1  
ATOM 671   H HA   . MET A 1 43 ? -2.060  -19.655 7.830   1.00 0.00 ? 43 MET A HA   1  
ATOM 672   H HB2  . MET A 1 43 ? -0.110  -18.854 8.910   1.00 0.00 ? 43 MET A HB2  1  
ATOM 673   H HB3  . MET A 1 43 ? 0.077   -17.533 7.765   1.00 0.00 ? 43 MET A HB3  1  
ATOM 674   H HG2  . MET A 1 43 ? -1.526  -16.248 8.769   1.00 0.00 ? 43 MET A HG2  1  
ATOM 675   H HG3  . MET A 1 43 ? -2.380  -17.638 9.432   1.00 0.00 ? 43 MET A HG3  1  
ATOM 676   H HE1  . MET A 1 43 ? 1.568   -16.725 9.811   1.00 0.00 ? 43 MET A HE1  1  
ATOM 677   H HE2  . MET A 1 43 ? 0.586   -15.273 9.621   1.00 0.00 ? 43 MET A HE2  1  
ATOM 678   H HE3  . MET A 1 43 ? 1.360   -15.619 11.168  1.00 0.00 ? 43 MET A HE3  1  
ATOM 679   N N    . LEU A 1 44 ? -2.088  -17.068 5.786   1.00 0.00 ? 44 LEU A N    1  
ATOM 680   C CA   . LEU A 1 44 ? -2.958  -16.097 5.133   1.00 0.00 ? 44 LEU A CA   1  
ATOM 681   C C    . LEU A 1 44 ? -3.594  -16.691 3.880   1.00 0.00 ? 44 LEU A C    1  
ATOM 682   O O    . LEU A 1 44 ? -4.382  -16.033 3.201   1.00 0.00 ? 44 LEU A O    1  
ATOM 683   C CB   . LEU A 1 44 ? -2.168  -14.838 4.770   1.00 0.00 ? 44 LEU A CB   1  
ATOM 684   C CG   . LEU A 1 44 ? -1.390  -14.182 5.910   1.00 0.00 ? 44 LEU A CG   1  
ATOM 685   C CD1  . LEU A 1 44 ? -0.425  -13.140 5.367   1.00 0.00 ? 44 LEU A CD1  1  
ATOM 686   C CD2  . LEU A 1 44 ? -2.345  -13.555 6.916   1.00 0.00 ? 44 LEU A CD2  1  
ATOM 687   H H    . LEU A 1 44 ? -1.142  -17.104 5.537   1.00 0.00 ? 44 LEU A H    1  
ATOM 688   H HA   . LEU A 1 44 ? -3.741  -15.833 5.828   1.00 0.00 ? 44 LEU A HA   1  
ATOM 689   H HB2  . LEU A 1 44 ? -1.463  -15.102 3.997   1.00 0.00 ? 44 LEU A HB2  1  
ATOM 690   H HB3  . LEU A 1 44 ? -2.867  -14.110 4.383   1.00 0.00 ? 44 LEU A HB3  1  
ATOM 691   H HG   . LEU A 1 44 ? -0.811  -14.937 6.424   1.00 0.00 ? 44 LEU A HG   1  
ATOM 692   H HD11 . LEU A 1 44 ? -0.026  -12.558 6.185   1.00 0.00 ? 44 LEU A HD11 1  
ATOM 693   H HD12 . LEU A 1 44 ? -0.946  -12.488 4.682   1.00 0.00 ? 44 LEU A HD12 1  
ATOM 694   H HD13 . LEU A 1 44 ? 0.384   -13.634 4.848   1.00 0.00 ? 44 LEU A HD13 1  
ATOM 695   H HD21 . LEU A 1 44 ? -1.838  -12.762 7.447   1.00 0.00 ? 44 LEU A HD21 1  
ATOM 696   H HD22 . LEU A 1 44 ? -2.672  -14.307 7.619   1.00 0.00 ? 44 LEU A HD22 1  
ATOM 697   H HD23 . LEU A 1 44 ? -3.200  -13.150 6.396   1.00 0.00 ? 44 LEU A HD23 1  
ATOM 698   N N    . GLN A 1 45 ? -3.247  -17.939 3.582   1.00 0.00 ? 45 GLN A N    1  
ATOM 699   C CA   . GLN A 1 45 ? -3.786  -18.622 2.412   1.00 0.00 ? 45 GLN A CA   1  
ATOM 700   C C    . GLN A 1 45 ? -3.307  -17.958 1.125   1.00 0.00 ? 45 GLN A C    1  
ATOM 701   O O    . GLN A 1 45 ? -3.999  -17.983 0.106   1.00 0.00 ? 45 GLN A O    1  
ATOM 702   C CB   . GLN A 1 45 ? -5.315  -18.630 2.458   1.00 0.00 ? 45 GLN A CB   1  
ATOM 703   C CG   . GLN A 1 45 ? -5.881  -18.979 3.825   1.00 0.00 ? 45 GLN A CG   1  
ATOM 704   C CD   . GLN A 1 45 ? -7.396  -19.028 3.834   1.00 0.00 ? 45 GLN A CD   1  
ATOM 705   O OE1  . GLN A 1 45 ? -8.050  -18.543 2.910   1.00 0.00 ? 45 GLN A OE1  1  
ATOM 706   N NE2  . GLN A 1 45 ? -7.963  -19.615 4.881   1.00 0.00 ? 45 GLN A NE2  1  
ATOM 707   H H    . GLN A 1 45 ? -2.615  -18.411 4.162   1.00 0.00 ? 45 GLN A H    1  
ATOM 708   H HA   . GLN A 1 45 ? -3.429  -19.641 2.430   1.00 0.00 ? 45 GLN A HA   1  
ATOM 709   H HB2  . GLN A 1 45 ? -5.676  -17.650 2.182   1.00 0.00 ? 45 GLN A HB2  1  
ATOM 710   H HB3  . GLN A 1 45 ? -5.681  -19.354 1.745   1.00 0.00 ? 45 GLN A HB3  1  
ATOM 711   H HG2  . GLN A 1 45 ? -5.504  -19.947 4.119   1.00 0.00 ? 45 GLN A HG2  1  
ATOM 712   H HG3  . GLN A 1 45 ? -5.554  -18.235 4.536   1.00 0.00 ? 45 GLN A HG3  1  
ATOM 713   H HE21 . GLN A 1 45 ? -7.379  -19.978 5.580   1.00 0.00 ? 45 GLN A HE21 1  
ATOM 714   H HE22 . GLN A 1 45 ? -8.941  -19.659 4.913   1.00 0.00 ? 45 GLN A HE22 1  
ATOM 715   N N    . LEU A 1 46 ? -2.121  -17.363 1.179   1.00 0.00 ? 46 LEU A N    1  
ATOM 716   C CA   . LEU A 1 46 ? -1.549  -16.690 0.018   1.00 0.00 ? 46 LEU A CA   1  
ATOM 717   C C    . LEU A 1 46 ? -0.499  -17.567 -0.658  1.00 0.00 ? 46 LEU A C    1  
ATOM 718   O O    . LEU A 1 46 ? -0.229  -18.683 -0.213  1.00 0.00 ? 46 LEU A O    1  
ATOM 719   C CB   . LEU A 1 46 ? -0.925  -15.356 0.432   1.00 0.00 ? 46 LEU A CB   1  
ATOM 720   C CG   . LEU A 1 46 ? -1.818  -14.424 1.251   1.00 0.00 ? 46 LEU A CG   1  
ATOM 721   C CD1  . LEU A 1 46 ? -0.991  -13.319 1.890   1.00 0.00 ? 46 LEU A CD1  1  
ATOM 722   C CD2  . LEU A 1 46 ? -2.916  -13.834 0.378   1.00 0.00 ? 46 LEU A CD2  1  
ATOM 723   H H    . LEU A 1 46 ? -1.616  -17.375 2.019   1.00 0.00 ? 46 LEU A H    1  
ATOM 724   H HA   . LEU A 1 46 ? -2.348  -16.502 -0.683  1.00 0.00 ? 46 LEU A HA   1  
ATOM 725   H HB2  . LEU A 1 46 ? -0.045  -15.571 1.018   1.00 0.00 ? 46 LEU A HB2  1  
ATOM 726   H HB3  . LEU A 1 46 ? -0.637  -14.833 -0.469  1.00 0.00 ? 46 LEU A HB3  1  
ATOM 727   H HG   . LEU A 1 46 ? -2.287  -14.990 2.044   1.00 0.00 ? 46 LEU A HG   1  
ATOM 728   H HD11 . LEU A 1 46 ? -1.499  -12.953 2.770   1.00 0.00 ? 46 LEU A HD11 1  
ATOM 729   H HD12 . LEU A 1 46 ? -0.865  -12.510 1.185   1.00 0.00 ? 46 LEU A HD12 1  
ATOM 730   H HD13 . LEU A 1 46 ? -0.023  -13.708 2.168   1.00 0.00 ? 46 LEU A HD13 1  
ATOM 731   H HD21 . LEU A 1 46 ? -2.516  -13.607 -0.599  1.00 0.00 ? 46 LEU A HD21 1  
ATOM 732   H HD22 . LEU A 1 46 ? -3.290  -12.928 0.833   1.00 0.00 ? 46 LEU A HD22 1  
ATOM 733   H HD23 . LEU A 1 46 ? -3.721  -14.547 0.281   1.00 0.00 ? 46 LEU A HD23 1  
ATOM 734   N N    . SER A 1 47 ? 0.090   -17.054 -1.733  1.00 0.00 ? 47 SER A N    1  
ATOM 735   C CA   . SER A 1 47 ? 1.110   -17.791 -2.470  1.00 0.00 ? 47 SER A CA   1  
ATOM 736   C C    . SER A 1 47 ? 2.493   -17.195 -2.229  1.00 0.00 ? 47 SER A C    1  
ATOM 737   O O    . SER A 1 47 ? 2.631   -15.992 -2.007  1.00 0.00 ? 47 SER A O    1  
ATOM 738   C CB   . SER A 1 47 ? 0.792   -17.783 -3.967  1.00 0.00 ? 47 SER A CB   1  
ATOM 739   O OG   . SER A 1 47 ? -0.066  -18.857 -4.312  1.00 0.00 ? 47 SER A OG   1  
ATOM 740   H H    . SER A 1 47 ? -0.168  -16.160 -2.038  1.00 0.00 ? 47 SER A H    1  
ATOM 741   H HA   . SER A 1 47 ? 1.104   -18.811 -2.115  1.00 0.00 ? 47 SER A HA   1  
ATOM 742   H HB2  . SER A 1 47 ? 0.307   -16.854 -4.224  1.00 0.00 ? 47 SER A HB2  1  
ATOM 743   H HB3  . SER A 1 47 ? 1.711   -17.877 -4.527  1.00 0.00 ? 47 SER A HB3  1  
ATOM 744   H HG   . SER A 1 47 ? 0.400   -19.689 -4.198  1.00 0.00 ? 47 SER A HG   1  
ATOM 745   N N    . GLU A 1 48 ? 3.514   -18.045 -2.275  1.00 0.00 ? 48 GLU A N    1  
ATOM 746   C CA   . GLU A 1 48 ? 4.886   -17.602 -2.061  1.00 0.00 ? 48 GLU A CA   1  
ATOM 747   C C    . GLU A 1 48 ? 5.196   -16.365 -2.899  1.00 0.00 ? 48 GLU A C    1  
ATOM 748   O O    . GLU A 1 48 ? 5.749   -15.386 -2.399  1.00 0.00 ? 48 GLU A O    1  
ATOM 749   C CB   . GLU A 1 48 ? 5.868   -18.724 -2.406  1.00 0.00 ? 48 GLU A CB   1  
ATOM 750   C CG   . GLU A 1 48 ? 6.086   -19.712 -1.273  1.00 0.00 ? 48 GLU A CG   1  
ATOM 751   C CD   . GLU A 1 48 ? 6.951   -20.888 -1.682  1.00 0.00 ? 48 GLU A CD   1  
ATOM 752   O OE1  . GLU A 1 48 ? 6.394   -21.891 -2.176  1.00 0.00 ? 48 GLU A OE1  1  
ATOM 753   O OE2  . GLU A 1 48 ? 8.185   -20.805 -1.509  1.00 0.00 ? 48 GLU A OE2  1  
ATOM 754   H H    . GLU A 1 48 ? 3.340   -18.992 -2.457  1.00 0.00 ? 48 GLU A H    1  
ATOM 755   H HA   . GLU A 1 48 ? 4.995   -17.351 -1.017  1.00 0.00 ? 48 GLU A HA   1  
ATOM 756   H HB2  . GLU A 1 48 ? 5.490   -19.266 -3.261  1.00 0.00 ? 48 GLU A HB2  1  
ATOM 757   H HB3  . GLU A 1 48 ? 6.821   -18.286 -2.663  1.00 0.00 ? 48 GLU A HB3  1  
ATOM 758   H HG2  . GLU A 1 48 ? 6.568   -19.199 -0.454  1.00 0.00 ? 48 GLU A HG2  1  
ATOM 759   H HG3  . GLU A 1 48 ? 5.127   -20.085 -0.947  1.00 0.00 ? 48 GLU A HG3  1  
ATOM 760   N N    . ARG A 1 49 ? 4.836   -16.418 -4.178  1.00 0.00 ? 49 ARG A N    1  
ATOM 761   C CA   . ARG A 1 49 ? 5.077   -15.304 -5.086  1.00 0.00 ? 49 ARG A CA   1  
ATOM 762   C C    . ARG A 1 49 ? 4.277   -14.075 -4.663  1.00 0.00 ? 49 ARG A C    1  
ATOM 763   O O    . ARG A 1 49 ? 4.686   -12.941 -4.911  1.00 0.00 ? 49 ARG A O    1  
ATOM 764   C CB   . ARG A 1 49 ? 4.708   -15.697 -6.518  1.00 0.00 ? 49 ARG A CB   1  
ATOM 765   C CG   . ARG A 1 49 ? 4.678   -14.523 -7.483  1.00 0.00 ? 49 ARG A CG   1  
ATOM 766   C CD   . ARG A 1 49 ? 4.262   -14.960 -8.879  1.00 0.00 ? 49 ARG A CD   1  
ATOM 767   N NE   . ARG A 1 49 ? 2.811   -15.059 -9.012  1.00 0.00 ? 49 ARG A NE   1  
ATOM 768   C CZ   . ARG A 1 49 ? 2.205   -15.641 -10.041 1.00 0.00 ? 49 ARG A CZ   1  
ATOM 769   N NH1  . ARG A 1 49 ? 2.921   -16.174 -11.021 1.00 0.00 ? 49 ARG A NH1  1  
ATOM 770   N NH2  . ARG A 1 49 ? 0.880   -15.691 -10.090 1.00 0.00 ? 49 ARG A NH2  1  
ATOM 771   H H    . ARG A 1 49 ? 4.399   -17.227 -4.518  1.00 0.00 ? 49 ARG A H    1  
ATOM 772   H HA   . ARG A 1 49 ? 6.129   -15.065 -5.047  1.00 0.00 ? 49 ARG A HA   1  
ATOM 773   H HB2  . ARG A 1 49 ? 5.431   -16.413 -6.880  1.00 0.00 ? 49 ARG A HB2  1  
ATOM 774   H HB3  . ARG A 1 49 ? 3.731   -16.155 -6.512  1.00 0.00 ? 49 ARG A HB3  1  
ATOM 775   H HG2  . ARG A 1 49 ? 3.971   -13.790 -7.122  1.00 0.00 ? 49 ARG A HG2  1  
ATOM 776   H HG3  . ARG A 1 49 ? 5.663   -14.083 -7.531  1.00 0.00 ? 49 ARG A HG3  1  
ATOM 777   H HD2  . ARG A 1 49 ? 4.631   -14.238 -9.592  1.00 0.00 ? 49 ARG A HD2  1  
ATOM 778   H HD3  . ARG A 1 49 ? 4.700   -15.925 -9.084  1.00 0.00 ? 49 ARG A HD3  1  
ATOM 779   H HE   . ARG A 1 49 ? 2.262   -14.671 -8.299  1.00 0.00 ? 49 ARG A HE   1  
ATOM 780   H HH11 . ARG A 1 49 ? 3.920   -16.138 -10.986 1.00 0.00 ? 49 ARG A HH11 1  
ATOM 781   H HH12 . ARG A 1 49 ? 2.463   -16.613 -11.794 1.00 0.00 ? 49 ARG A HH12 1  
ATOM 782   H HH21 . ARG A 1 49 ? 0.337   -15.291 -9.353  1.00 0.00 ? 49 ARG A HH21 1  
ATOM 783   H HH22 . ARG A 1 49 ? 0.425   -16.129 -10.865 1.00 0.00 ? 49 ARG A HH22 1  
ATOM 784   N N    . GLN A 1 50 ? 3.136   -14.309 -4.023  1.00 0.00 ? 50 GLN A N    1  
ATOM 785   C CA   . GLN A 1 50 ? 2.279   -13.221 -3.567  1.00 0.00 ? 50 GLN A CA   1  
ATOM 786   C C    . GLN A 1 50 ? 2.853   -12.564 -2.316  1.00 0.00 ? 50 GLN A C    1  
ATOM 787   O O    . GLN A 1 50 ? 2.738   -11.352 -2.131  1.00 0.00 ? 50 GLN A O    1  
ATOM 788   C CB   . GLN A 1 50 ? 0.868   -13.740 -3.283  1.00 0.00 ? 50 GLN A CB   1  
ATOM 789   C CG   . GLN A 1 50 ? 0.070   -14.051 -4.539  1.00 0.00 ? 50 GLN A CG   1  
ATOM 790   C CD   . GLN A 1 50 ? -1.404  -14.265 -4.255  1.00 0.00 ? 50 GLN A CD   1  
ATOM 791   O OE1  . GLN A 1 50 ? -1.810  -15.332 -3.792  1.00 0.00 ? 50 GLN A OE1  1  
ATOM 792   N NE2  . GLN A 1 50 ? -2.214  -13.250 -4.531  1.00 0.00 ? 50 GLN A NE2  1  
ATOM 793   H H    . GLN A 1 50 ? 2.864   -15.235 -3.855  1.00 0.00 ? 50 GLN A H    1  
ATOM 794   H HA   . GLN A 1 50 ? 2.230   -12.486 -4.355  1.00 0.00 ? 50 GLN A HA   1  
ATOM 795   H HB2  . GLN A 1 50 ? 0.941   -14.643 -2.695  1.00 0.00 ? 50 GLN A HB2  1  
ATOM 796   H HB3  . GLN A 1 50 ? 0.331   -12.994 -2.716  1.00 0.00 ? 50 GLN A HB3  1  
ATOM 797   H HG2  . GLN A 1 50 ? 0.171   -13.225 -5.228  1.00 0.00 ? 50 GLN A HG2  1  
ATOM 798   H HG3  . GLN A 1 50 ? 0.469   -14.946 -4.991  1.00 0.00 ? 50 GLN A HG3  1  
ATOM 799   H HE21 . GLN A 1 50 ? -1.820  -12.431 -4.899  1.00 0.00 ? 50 GLN A HE21 1  
ATOM 800   H HE22 . GLN A 1 50 ? -3.172  -13.362 -4.358  1.00 0.00 ? 50 GLN A HE22 1  
ATOM 801   N N    . VAL A 1 51 ? 3.473   -13.371 -1.461  1.00 0.00 ? 51 VAL A N    1  
ATOM 802   C CA   . VAL A 1 51 ? 4.066   -12.868 -0.228  1.00 0.00 ? 51 VAL A CA   1  
ATOM 803   C C    . VAL A 1 51 ? 5.475   -12.341 -0.471  1.00 0.00 ? 51 VAL A C    1  
ATOM 804   O O    . VAL A 1 51 ? 6.014   -11.581 0.334   1.00 0.00 ? 51 VAL A O    1  
ATOM 805   C CB   . VAL A 1 51 ? 4.118   -13.960 0.857   1.00 0.00 ? 51 VAL A CB   1  
ATOM 806   C CG1  . VAL A 1 51 ? 4.715   -13.408 2.142   1.00 0.00 ? 51 VAL A CG1  1  
ATOM 807   C CG2  . VAL A 1 51 ? 2.730   -14.530 1.106   1.00 0.00 ? 51 VAL A CG2  1  
ATOM 808   H H    . VAL A 1 51 ? 3.532   -14.328 -1.664  1.00 0.00 ? 51 VAL A H    1  
ATOM 809   H HA   . VAL A 1 51 ? 3.447   -12.059 0.135   1.00 0.00 ? 51 VAL A HA   1  
ATOM 810   H HB   . VAL A 1 51 ? 4.754   -14.759 0.504   1.00 0.00 ? 51 VAL A HB   1  
ATOM 811   H HG11 . VAL A 1 51 ? 5.733   -13.095 1.961   1.00 0.00 ? 51 VAL A HG11 1  
ATOM 812   H HG12 . VAL A 1 51 ? 4.132   -12.564 2.478   1.00 0.00 ? 51 VAL A HG12 1  
ATOM 813   H HG13 . VAL A 1 51 ? 4.707   -14.177 2.902   1.00 0.00 ? 51 VAL A HG13 1  
ATOM 814   H HG21 . VAL A 1 51 ? 1.991   -13.760 0.941   1.00 0.00 ? 51 VAL A HG21 1  
ATOM 815   H HG22 . VAL A 1 51 ? 2.550   -15.352 0.428   1.00 0.00 ? 51 VAL A HG22 1  
ATOM 816   H HG23 . VAL A 1 51 ? 2.662   -14.883 2.124   1.00 0.00 ? 51 VAL A HG23 1  
ATOM 817   N N    . LYS A 1 52 ? 6.069   -12.749 -1.588  1.00 0.00 ? 52 LYS A N    1  
ATOM 818   C CA   . LYS A 1 52 ? 7.416   -12.318 -1.940  1.00 0.00 ? 52 LYS A CA   1  
ATOM 819   C C    . LYS A 1 52 ? 7.377   -11.051 -2.790  1.00 0.00 ? 52 LYS A C    1  
ATOM 820   O O    . LYS A 1 52 ? 8.249   -10.188 -2.677  1.00 0.00 ? 52 LYS A O    1  
ATOM 821   C CB   . LYS A 1 52 ? 8.148   -13.429 -2.696  1.00 0.00 ? 52 LYS A CB   1  
ATOM 822   C CG   . LYS A 1 52 ? 7.953   -13.371 -4.201  1.00 0.00 ? 52 LYS A CG   1  
ATOM 823   C CD   . LYS A 1 52 ? 8.987   -12.476 -4.864  1.00 0.00 ? 52 LYS A CD   1  
ATOM 824   C CE   . LYS A 1 52 ? 9.278   -12.921 -6.289  1.00 0.00 ? 52 LYS A CE   1  
ATOM 825   N NZ   . LYS A 1 52 ? 8.149   -12.608 -7.209  1.00 0.00 ? 52 LYS A NZ   1  
ATOM 826   H H    . LYS A 1 52 ? 5.588   -13.355 -2.190  1.00 0.00 ? 52 LYS A H    1  
ATOM 827   H HA   . LYS A 1 52 ? 7.947   -12.106 -1.025  1.00 0.00 ? 52 LYS A HA   1  
ATOM 828   H HB2  . LYS A 1 52 ? 9.206   -13.353 -2.488  1.00 0.00 ? 52 LYS A HB2  1  
ATOM 829   H HB3  . LYS A 1 52 ? 7.788   -14.385 -2.344  1.00 0.00 ? 52 LYS A HB3  1  
ATOM 830   H HG2  . LYS A 1 52 ? 8.044   -14.368 -4.606  1.00 0.00 ? 52 LYS A HG2  1  
ATOM 831   H HG3  . LYS A 1 52 ? 6.967   -12.983 -4.413  1.00 0.00 ? 52 LYS A HG3  1  
ATOM 832   H HD2  . LYS A 1 52 ? 8.614   -11.463 -4.884  1.00 0.00 ? 52 LYS A HD2  1  
ATOM 833   H HD3  . LYS A 1 52 ? 9.903   -12.514 -4.291  1.00 0.00 ? 52 LYS A HD3  1  
ATOM 834   H HE2  . LYS A 1 52 ? 10.165  -12.414 -6.637  1.00 0.00 ? 52 LYS A HE2  1  
ATOM 835   H HE3  . LYS A 1 52 ? 9.448   -13.988 -6.292  1.00 0.00 ? 52 LYS A HE3  1  
ATOM 836   H HZ1  . LYS A 1 52 ? 7.678   -13.486 -7.508  1.00 0.00 ? 52 LYS A HZ1  1  
ATOM 837   H HZ2  . LYS A 1 52 ? 8.502   -12.113 -8.052  1.00 0.00 ? 52 LYS A HZ2  1  
ATOM 838   H HZ3  . LYS A 1 52 ? 7.455   -12.001 -6.729  1.00 0.00 ? 52 LYS A HZ3  1  
ATOM 839   N N    . THR A 1 53 ? 6.360   -10.945 -3.639  1.00 0.00 ? 53 THR A N    1  
ATOM 840   C CA   . THR A 1 53 ? 6.208   -9.784  -4.507  1.00 0.00 ? 53 THR A CA   1  
ATOM 841   C C    . THR A 1 53 ? 5.677   -8.583  -3.731  1.00 0.00 ? 53 THR A C    1  
ATOM 842   O O    . THR A 1 53 ? 6.229   -7.486  -3.814  1.00 0.00 ? 53 THR A O    1  
ATOM 843   C CB   . THR A 1 53 ? 5.257   -10.081 -5.682  1.00 0.00 ? 53 THR A CB   1  
ATOM 844   O OG1  . THR A 1 53 ? 5.858   -11.031 -6.569  1.00 0.00 ? 53 THR A OG1  1  
ATOM 845   C CG2  . THR A 1 53 ? 4.924   -8.808  -6.444  1.00 0.00 ? 53 THR A CG2  1  
ATOM 846   H H    . THR A 1 53 ? 5.698   -11.665 -3.683  1.00 0.00 ? 53 THR A H    1  
ATOM 847   H HA   . THR A 1 53 ? 7.179   -9.539  -4.910  1.00 0.00 ? 53 THR A HA   1  
ATOM 848   H HB   . THR A 1 53 ? 4.341   -10.498 -5.288  1.00 0.00 ? 53 THR A HB   1  
ATOM 849   H HG1  . THR A 1 53 ? 5.171   -11.500 -7.049  1.00 0.00 ? 53 THR A HG1  1  
ATOM 850   H HG21 . THR A 1 53 ? 3.861   -8.624  -6.391  1.00 0.00 ? 53 THR A HG21 1  
ATOM 851   H HG22 . THR A 1 53 ? 5.219   -8.919  -7.477  1.00 0.00 ? 53 THR A HG22 1  
ATOM 852   H HG23 . THR A 1 53 ? 5.455   -7.977  -6.006  1.00 0.00 ? 53 THR A HG23 1  
ATOM 853   N N    . TRP A 1 54 ? 4.606   -8.799  -2.977  1.00 0.00 ? 54 TRP A N    1  
ATOM 854   C CA   . TRP A 1 54 ? 4.001   -7.734  -2.185  1.00 0.00 ? 54 TRP A CA   1  
ATOM 855   C C    . TRP A 1 54 ? 5.056   -7.000  -1.365  1.00 0.00 ? 54 TRP A C    1  
ATOM 856   O O    . TRP A 1 54 ? 5.293   -5.808  -1.563  1.00 0.00 ? 54 TRP A O    1  
ATOM 857   C CB   . TRP A 1 54 ? 2.925   -8.305  -1.261  1.00 0.00 ? 54 TRP A CB   1  
ATOM 858   C CG   . TRP A 1 54 ? 2.047   -7.254  -0.651  1.00 0.00 ? 54 TRP A CG   1  
ATOM 859   C CD1  . TRP A 1 54 ? 0.862   -6.788  -1.145  1.00 0.00 ? 54 TRP A CD1  1  
ATOM 860   C CD2  . TRP A 1 54 ? 2.286   -6.538  0.565   1.00 0.00 ? 54 TRP A CD2  1  
ATOM 861   N NE1  . TRP A 1 54 ? 0.350   -5.826  -0.309  1.00 0.00 ? 54 TRP A NE1  1  
ATOM 862   C CE2  . TRP A 1 54 ? 1.204   -5.655  0.748   1.00 0.00 ? 54 TRP A CE2  1  
ATOM 863   C CE3  . TRP A 1 54 ? 3.307   -6.559  1.519   1.00 0.00 ? 54 TRP A CE3  1  
ATOM 864   C CZ2  . TRP A 1 54 ? 1.118   -4.801  1.844   1.00 0.00 ? 54 TRP A CZ2  1  
ATOM 865   C CZ3  . TRP A 1 54 ? 3.220   -5.711  2.607   1.00 0.00 ? 54 TRP A CZ3  1  
ATOM 866   C CH2  . TRP A 1 54 ? 2.132   -4.842  2.763   1.00 0.00 ? 54 TRP A CH2  1  
ATOM 867   H H    . TRP A 1 54 ? 4.211   -9.696  -2.952  1.00 0.00 ? 54 TRP A H    1  
ATOM 868   H HA   . TRP A 1 54 ? 3.542   -7.034  -2.868  1.00 0.00 ? 54 TRP A HA   1  
ATOM 869   H HB2  . TRP A 1 54 ? 2.296   -8.979  -1.824  1.00 0.00 ? 54 TRP A HB2  1  
ATOM 870   H HB3  . TRP A 1 54 ? 3.402   -8.849  -0.459  1.00 0.00 ? 54 TRP A HB3  1  
ATOM 871   H HD1  . TRP A 1 54 ? 0.407   -7.134  -2.061  1.00 0.00 ? 54 TRP A HD1  1  
ATOM 872   H HE1  . TRP A 1 54 ? -0.491  -5.342  -0.447  1.00 0.00 ? 54 TRP A HE1  1  
ATOM 873   H HE3  . TRP A 1 54 ? 4.154   -7.222  1.417   1.00 0.00 ? 54 TRP A HE3  1  
ATOM 874   H HZ2  . TRP A 1 54 ? 0.285   -4.126  1.979   1.00 0.00 ? 54 TRP A HZ2  1  
ATOM 875   H HZ3  . TRP A 1 54 ? 4.000   -5.712  3.354   1.00 0.00 ? 54 TRP A HZ3  1  
ATOM 876   H HH2  . TRP A 1 54 ? 2.105   -4.197  3.627   1.00 0.00 ? 54 TRP A HH2  1  
ATOM 877   N N    . PHE A 1 55 ? 5.688   -7.719  -0.443  1.00 0.00 ? 55 PHE A N    1  
ATOM 878   C CA   . PHE A 1 55 ? 6.718   -7.135  0.409   1.00 0.00 ? 55 PHE A CA   1  
ATOM 879   C C    . PHE A 1 55 ? 7.756   -6.390  -0.426  1.00 0.00 ? 55 PHE A C    1  
ATOM 880   O O    . PHE A 1 55 ? 7.957   -5.188  -0.256  1.00 0.00 ? 55 PHE A O    1  
ATOM 881   C CB   . PHE A 1 55 ? 7.401   -8.224  1.239   1.00 0.00 ? 55 PHE A CB   1  
ATOM 882   C CG   . PHE A 1 55 ? 6.597   -8.662  2.430   1.00 0.00 ? 55 PHE A CG   1  
ATOM 883   C CD1  . PHE A 1 55 ? 5.477   -9.461  2.271   1.00 0.00 ? 55 PHE A CD1  1  
ATOM 884   C CD2  . PHE A 1 55 ? 6.962   -8.274  3.709   1.00 0.00 ? 55 PHE A CD2  1  
ATOM 885   C CE1  . PHE A 1 55 ? 4.735   -9.866  3.364   1.00 0.00 ? 55 PHE A CE1  1  
ATOM 886   C CE2  . PHE A 1 55 ? 6.225   -8.676  4.807   1.00 0.00 ? 55 PHE A CE2  1  
ATOM 887   C CZ   . PHE A 1 55 ? 5.109   -9.472  4.634   1.00 0.00 ? 55 PHE A CZ   1  
ATOM 888   H H    . PHE A 1 55 ? 5.456   -8.665  -0.332  1.00 0.00 ? 55 PHE A H    1  
ATOM 889   H HA   . PHE A 1 55 ? 6.239   -6.434  1.074   1.00 0.00 ? 55 PHE A HA   1  
ATOM 890   H HB2  . PHE A 1 55 ? 7.569   -9.090  0.616   1.00 0.00 ? 55 PHE A HB2  1  
ATOM 891   H HB3  . PHE A 1 55 ? 8.350   -7.852  1.596   1.00 0.00 ? 55 PHE A HB3  1  
ATOM 892   H HD1  . PHE A 1 55 ? 5.183   -9.770  1.277   1.00 0.00 ? 55 PHE A HD1  1  
ATOM 893   H HD2  . PHE A 1 55 ? 7.833   -7.650  3.846   1.00 0.00 ? 55 PHE A HD2  1  
ATOM 894   H HE1  . PHE A 1 55 ? 3.864   -10.488 3.226   1.00 0.00 ? 55 PHE A HE1  1  
ATOM 895   H HE2  . PHE A 1 55 ? 6.519   -8.366  5.798   1.00 0.00 ? 55 PHE A HE2  1  
ATOM 896   H HZ   . PHE A 1 55 ? 4.532   -9.788  5.490   1.00 0.00 ? 55 PHE A HZ   1  
ATOM 897   N N    . GLN A 1 56 ? 8.412   -7.114  -1.327  1.00 0.00 ? 56 GLN A N    1  
ATOM 898   C CA   . GLN A 1 56 ? 9.430   -6.523  -2.188  1.00 0.00 ? 56 GLN A CA   1  
ATOM 899   C C    . GLN A 1 56 ? 8.995   -5.145  -2.678  1.00 0.00 ? 56 GLN A C    1  
ATOM 900   O O    . GLN A 1 56 ? 9.673   -4.148  -2.437  1.00 0.00 ? 56 GLN A O    1  
ATOM 901   C CB   . GLN A 1 56 ? 9.712   -7.436  -3.381  1.00 0.00 ? 56 GLN A CB   1  
ATOM 902   C CG   . GLN A 1 56 ? 10.751  -8.508  -3.095  1.00 0.00 ? 56 GLN A CG   1  
ATOM 903   C CD   . GLN A 1 56 ? 11.179  -9.255  -4.343  1.00 0.00 ? 56 GLN A CD   1  
ATOM 904   O OE1  . GLN A 1 56 ? 10.349  -9.628  -5.172  1.00 0.00 ? 56 GLN A OE1  1  
ATOM 905   N NE2  . GLN A 1 56 ? 12.481  -9.477  -4.484  1.00 0.00 ? 56 GLN A NE2  1  
ATOM 906   H H    . GLN A 1 56 ? 8.206   -8.068  -1.416  1.00 0.00 ? 56 GLN A H    1  
ATOM 907   H HA   . GLN A 1 56 ? 10.333  -6.415  -1.606  1.00 0.00 ? 56 GLN A HA   1  
ATOM 908   H HB2  . GLN A 1 56 ? 8.794   -7.924  -3.672  1.00 0.00 ? 56 GLN A HB2  1  
ATOM 909   H HB3  . GLN A 1 56 ? 10.066  -6.833  -4.205  1.00 0.00 ? 56 GLN A HB3  1  
ATOM 910   H HG2  . GLN A 1 56 ? 11.622  -8.040  -2.659  1.00 0.00 ? 56 GLN A HG2  1  
ATOM 911   H HG3  . GLN A 1 56 ? 10.335  -9.216  -2.394  1.00 0.00 ? 56 GLN A HG3  1  
ATOM 912   H HE21 . GLN A 1 56 ? 13.084  -9.151  -3.782  1.00 0.00 ? 56 GLN A HE21 1  
ATOM 913   H HE22 . GLN A 1 56 ? 12.785  -9.958  -5.280  1.00 0.00 ? 56 GLN A HE22 1  
ATOM 914   N N    . ASN A 1 57 ? 7.859   -5.099  -3.366  1.00 0.00 ? 57 ASN A N    1  
ATOM 915   C CA   . ASN A 1 57 ? 7.334   -3.844  -3.891  1.00 0.00 ? 57 ASN A CA   1  
ATOM 916   C C    . ASN A 1 57 ? 7.057   -2.855  -2.762  1.00 0.00 ? 57 ASN A C    1  
ATOM 917   O O    . ASN A 1 57 ? 7.339   -1.663  -2.885  1.00 0.00 ? 57 ASN A O    1  
ATOM 918   C CB   . ASN A 1 57 ? 6.053   -4.096  -4.689  1.00 0.00 ? 57 ASN A CB   1  
ATOM 919   C CG   . ASN A 1 57 ? 6.282   -5.010  -5.877  1.00 0.00 ? 57 ASN A CG   1  
ATOM 920   O OD1  . ASN A 1 57 ? 7.403   -5.457  -6.124  1.00 0.00 ? 57 ASN A OD1  1  
ATOM 921   N ND2  . ASN A 1 57 ? 5.219   -5.292  -6.620  1.00 0.00 ? 57 ASN A ND2  1  
ATOM 922   H H    . ASN A 1 57 ? 7.362   -5.929  -3.526  1.00 0.00 ? 57 ASN A H    1  
ATOM 923   H HA   . ASN A 1 57 ? 8.080   -3.422  -4.549  1.00 0.00 ? 57 ASN A HA   1  
ATOM 924   H HB2  . ASN A 1 57 ? 5.319   -4.555  -4.043  1.00 0.00 ? 57 ASN A HB2  1  
ATOM 925   H HB3  . ASN A 1 57 ? 5.669   -3.154  -5.051  1.00 0.00 ? 57 ASN A HB3  1  
ATOM 926   H HD21 . ASN A 1 57 ? 4.358   -4.900  -6.364  1.00 0.00 ? 57 ASN A HD21 1  
ATOM 927   H HD22 . ASN A 1 57 ? 5.339   -5.881  -7.394  1.00 0.00 ? 57 ASN A HD22 1  
ATOM 928   N N    . ARG A 1 58 ? 6.505   -3.360  -1.664  1.00 0.00 ? 58 ARG A N    1  
ATOM 929   C CA   . ARG A 1 58 ? 6.189   -2.522  -0.514  1.00 0.00 ? 58 ARG A CA   1  
ATOM 930   C C    . ARG A 1 58 ? 7.384   -1.654  -0.129  1.00 0.00 ? 58 ARG A C    1  
ATOM 931   O O    . ARG A 1 58 ? 7.329   -0.428  -0.220  1.00 0.00 ? 58 ARG A O    1  
ATOM 932   C CB   . ARG A 1 58 ? 5.770   -3.388  0.676   1.00 0.00 ? 58 ARG A CB   1  
ATOM 933   C CG   . ARG A 1 58 ? 5.231   -2.589  1.851   1.00 0.00 ? 58 ARG A CG   1  
ATOM 934   C CD   . ARG A 1 58 ? 3.857   -2.011  1.547   1.00 0.00 ? 58 ARG A CD   1  
ATOM 935   N NE   . ARG A 1 58 ? 3.615   -0.767  2.274   1.00 0.00 ? 58 ARG A NE   1  
ATOM 936   C CZ   . ARG A 1 58 ? 3.335   -0.717  3.571   1.00 0.00 ? 58 ARG A CZ   1  
ATOM 937   N NH1  . ARG A 1 58 ? 3.264   -1.834  4.282   1.00 0.00 ? 58 ARG A NH1  1  
ATOM 938   N NH2  . ARG A 1 58 ? 3.127   0.453   4.162   1.00 0.00 ? 58 ARG A NH2  1  
ATOM 939   H H    . ARG A 1 58 ? 6.304   -4.318  -1.627  1.00 0.00 ? 58 ARG A H    1  
ATOM 940   H HA   . ARG A 1 58 ? 5.366   -1.879  -0.787  1.00 0.00 ? 58 ARG A HA   1  
ATOM 941   H HB2  . ARG A 1 58 ? 5.002   -4.075  0.353   1.00 0.00 ? 58 ARG A HB2  1  
ATOM 942   H HB3  . ARG A 1 58 ? 6.627   -3.951  1.014   1.00 0.00 ? 58 ARG A HB3  1  
ATOM 943   H HG2  . ARG A 1 58 ? 5.153   -3.239  2.710   1.00 0.00 ? 58 ARG A HG2  1  
ATOM 944   H HG3  . ARG A 1 58 ? 5.913   -1.781  2.068   1.00 0.00 ? 58 ARG A HG3  1  
ATOM 945   H HD2  . ARG A 1 58 ? 3.790   -1.816  0.487   1.00 0.00 ? 58 ARG A HD2  1  
ATOM 946   H HD3  . ARG A 1 58 ? 3.107   -2.734  1.829   1.00 0.00 ? 58 ARG A HD3  1  
ATOM 947   H HE   . ARG A 1 58 ? 3.662   0.070   1.768   1.00 0.00 ? 58 ARG A HE   1  
ATOM 948   H HH11 . ARG A 1 58 ? 3.422   -2.717  3.840   1.00 0.00 ? 58 ARG A HH11 1  
ATOM 949   H HH12 . ARG A 1 58 ? 3.054   -1.794  5.259   1.00 0.00 ? 58 ARG A HH12 1  
ATOM 950   H HH21 . ARG A 1 58 ? 3.180   1.298   3.630   1.00 0.00 ? 58 ARG A HH21 1  
ATOM 951   H HH22 . ARG A 1 58 ? 2.916   0.490   5.138   1.00 0.00 ? 58 ARG A HH22 1  
ATOM 952   N N    . ARG A 1 59 ? 8.463   -2.300  0.302   1.00 0.00 ? 59 ARG A N    1  
ATOM 953   C CA   . ARG A 1 59 ? 9.670   -1.587  0.703   1.00 0.00 ? 59 ARG A CA   1  
ATOM 954   C C    . ARG A 1 59 ? 10.062  -0.550  -0.345  1.00 0.00 ? 59 ARG A C    1  
ATOM 955   O O    . ARG A 1 59 ? 10.232  0.628   -0.034  1.00 0.00 ? 59 ARG A O    1  
ATOM 956   C CB   . ARG A 1 59 ? 10.822  -2.572  0.917   1.00 0.00 ? 59 ARG A CB   1  
ATOM 957   C CG   . ARG A 1 59 ? 11.853  -2.093  1.925   1.00 0.00 ? 59 ARG A CG   1  
ATOM 958   C CD   . ARG A 1 59 ? 13.090  -2.978  1.920   1.00 0.00 ? 59 ARG A CD   1  
ATOM 959   N NE   . ARG A 1 59 ? 14.256  -2.292  2.470   1.00 0.00 ? 59 ARG A NE   1  
ATOM 960   C CZ   . ARG A 1 59 ? 15.492  -2.775  2.404   1.00 0.00 ? 59 ARG A CZ   1  
ATOM 961   N NH1  . ARG A 1 59 ? 15.721  -3.941  1.815   1.00 0.00 ? 59 ARG A NH1  1  
ATOM 962   N NH2  . ARG A 1 59 ? 16.501  -2.092  2.927   1.00 0.00 ? 59 ARG A NH2  1  
ATOM 963   H H    . ARG A 1 59 ? 8.447   -3.278  0.353   1.00 0.00 ? 59 ARG A H    1  
ATOM 964   H HA   . ARG A 1 59 ? 9.464   -1.081  1.634   1.00 0.00 ? 59 ARG A HA   1  
ATOM 965   H HB2  . ARG A 1 59 ? 10.417  -3.510  1.267   1.00 0.00 ? 59 ARG A HB2  1  
ATOM 966   H HB3  . ARG A 1 59 ? 11.321  -2.734  -0.027  1.00 0.00 ? 59 ARG A HB3  1  
ATOM 967   H HG2  . ARG A 1 59 ? 12.146  -1.084  1.675   1.00 0.00 ? 59 ARG A HG2  1  
ATOM 968   H HG3  . ARG A 1 59 ? 11.413  -2.109  2.911   1.00 0.00 ? 59 ARG A HG3  1  
ATOM 969   H HD2  . ARG A 1 59 ? 12.889  -3.857  2.514   1.00 0.00 ? 59 ARG A HD2  1  
ATOM 970   H HD3  . ARG A 1 59 ? 13.302  -3.271  0.903   1.00 0.00 ? 59 ARG A HD3  1  
ATOM 971   H HE   . ARG A 1 59 ? 14.110  -1.429  2.909   1.00 0.00 ? 59 ARG A HE   1  
ATOM 972   H HH11 . ARG A 1 59 ? 14.962  -4.457  1.419   1.00 0.00 ? 59 ARG A HH11 1  
ATOM 973   H HH12 . ARG A 1 59 ? 16.652  -4.302  1.766   1.00 0.00 ? 59 ARG A HH12 1  
ATOM 974   H HH21 . ARG A 1 59 ? 16.333  -1.212  3.372   1.00 0.00 ? 59 ARG A HH21 1  
ATOM 975   H HH22 . ARG A 1 59 ? 17.431  -2.456  2.877   1.00 0.00 ? 59 ARG A HH22 1  
ATOM 976   N N    . ALA A 1 60 ? 10.205  -0.997  -1.589  1.00 0.00 ? 60 ALA A N    1  
ATOM 977   C CA   . ALA A 1 60 ? 10.575  -0.108  -2.683  1.00 0.00 ? 60 ALA A CA   1  
ATOM 978   C C    . ALA A 1 60 ? 9.840   1.224   -2.581  1.00 0.00 ? 60 ALA A C    1  
ATOM 979   O O    . ALA A 1 60 ? 10.371  2.269   -2.957  1.00 0.00 ? 60 ALA A O    1  
ATOM 980   C CB   . ALA A 1 60 ? 10.287  -0.770  -4.022  1.00 0.00 ? 60 ALA A CB   1  
ATOM 981   H H    . ALA A 1 60 ? 10.056  -1.948  -1.775  1.00 0.00 ? 60 ALA A H    1  
ATOM 982   H HA   . ALA A 1 60 ? 11.638  0.074   -2.620  1.00 0.00 ? 60 ALA A HA   1  
ATOM 983   H HB1  . ALA A 1 60 ? 10.280  -0.020  -4.799  1.00 0.00 ? 60 ALA A HB1  1  
ATOM 984   H HB2  . ALA A 1 60 ? 11.053  -1.502  -4.234  1.00 0.00 ? 60 ALA A HB2  1  
ATOM 985   H HB3  . ALA A 1 60 ? 9.325   -1.258  -3.983  1.00 0.00 ? 60 ALA A HB3  1  
ATOM 986   N N    . LYS A 1 61 ? 8.614   1.180   -2.069  1.00 0.00 ? 61 LYS A N    1  
ATOM 987   C CA   . LYS A 1 61 ? 7.804   2.383   -1.917  1.00 0.00 ? 61 LYS A CA   1  
ATOM 988   C C    . LYS A 1 61 ? 8.029   3.020   -0.549  1.00 0.00 ? 61 LYS A C    1  
ATOM 989   O O    . LYS A 1 61 ? 8.259   4.225   -0.446  1.00 0.00 ? 61 LYS A O    1  
ATOM 990   C CB   . LYS A 1 61 ? 6.322   2.051   -2.099  1.00 0.00 ? 61 LYS A CB   1  
ATOM 991   C CG   . LYS A 1 61 ? 5.425   3.276   -2.138  1.00 0.00 ? 61 LYS A CG   1  
ATOM 992   C CD   . LYS A 1 61 ? 4.091   2.971   -2.799  1.00 0.00 ? 61 LYS A CD   1  
ATOM 993   C CE   . LYS A 1 61 ? 3.519   4.197   -3.494  1.00 0.00 ? 61 LYS A CE   1  
ATOM 994   N NZ   . LYS A 1 61 ? 2.656   4.999   -2.582  1.00 0.00 ? 61 LYS A NZ   1  
ATOM 995   H H    . LYS A 1 61 ? 8.245   0.316   -1.787  1.00 0.00 ? 61 LYS A H    1  
ATOM 996   H HA   . LYS A 1 61 ? 8.104   3.084   -2.681  1.00 0.00 ? 61 LYS A HA   1  
ATOM 997   H HB2  . LYS A 1 61 ? 6.197   1.510   -3.026  1.00 0.00 ? 61 LYS A HB2  1  
ATOM 998   H HB3  . LYS A 1 61 ? 6.002   1.423   -1.280  1.00 0.00 ? 61 LYS A HB3  1  
ATOM 999   H HG2  . LYS A 1 61 ? 5.244   3.611   -1.127  1.00 0.00 ? 61 LYS A HG2  1  
ATOM 1000  H HG3  . LYS A 1 61 ? 5.922   4.058   -2.695  1.00 0.00 ? 61 LYS A HG3  1  
ATOM 1001  H HD2  . LYS A 1 61 ? 4.233   2.190   -3.531  1.00 0.00 ? 61 LYS A HD2  1  
ATOM 1002  H HD3  . LYS A 1 61 ? 3.393   2.637   -2.044  1.00 0.00 ? 61 LYS A HD3  1  
ATOM 1003  H HE2  . LYS A 1 61 ? 4.336   4.814   -3.837  1.00 0.00 ? 61 LYS A HE2  1  
ATOM 1004  H HE3  . LYS A 1 61 ? 2.932   3.874   -4.340  1.00 0.00 ? 61 LYS A HE3  1  
ATOM 1005  H HZ1  . LYS A 1 61 ? 3.189   5.811   -2.210  1.00 0.00 ? 61 LYS A HZ1  1  
ATOM 1006  H HZ2  . LYS A 1 61 ? 2.338   4.413   -1.785  1.00 0.00 ? 61 LYS A HZ2  1  
ATOM 1007  H HZ3  . LYS A 1 61 ? 1.823   5.350   -3.096  1.00 0.00 ? 61 LYS A HZ3  1  
ATOM 1008  N N    . TRP A 1 62 ? 7.963   2.204   0.496   1.00 0.00 ? 62 TRP A N    1  
ATOM 1009  C CA   . TRP A 1 62 ? 8.161   2.689   1.858   1.00 0.00 ? 62 TRP A CA   1  
ATOM 1010  C C    . TRP A 1 62 ? 9.418   3.546   1.953   1.00 0.00 ? 62 TRP A C    1  
ATOM 1011  O O    . TRP A 1 62 ? 9.416   4.598   2.592   1.00 0.00 ? 62 TRP A O    1  
ATOM 1012  C CB   . TRP A 1 62 ? 8.257   1.512   2.831   1.00 0.00 ? 62 TRP A CB   1  
ATOM 1013  C CG   . TRP A 1 62 ? 9.002   1.841   4.089   1.00 0.00 ? 62 TRP A CG   1  
ATOM 1014  C CD1  . TRP A 1 62 ? 8.501   2.451   5.203   1.00 0.00 ? 62 TRP A CD1  1  
ATOM 1015  C CD2  . TRP A 1 62 ? 10.383  1.579   4.360   1.00 0.00 ? 62 TRP A CD2  1  
ATOM 1016  N NE1  . TRP A 1 62 ? 9.487   2.585   6.151   1.00 0.00 ? 62 TRP A NE1  1  
ATOM 1017  C CE2  . TRP A 1 62 ? 10.651  2.057   5.658   1.00 0.00 ? 62 TRP A CE2  1  
ATOM 1018  C CE3  . TRP A 1 62 ? 11.419  0.986   3.634   1.00 0.00 ? 62 TRP A CE3  1  
ATOM 1019  C CZ2  . TRP A 1 62 ? 11.912  1.959   6.241   1.00 0.00 ? 62 TRP A CZ2  1  
ATOM 1020  C CZ3  . TRP A 1 62 ? 12.670  0.891   4.214   1.00 0.00 ? 62 TRP A CZ3  1  
ATOM 1021  C CH2  . TRP A 1 62 ? 12.907  1.374   5.507   1.00 0.00 ? 62 TRP A CH2  1  
ATOM 1022  H H    . TRP A 1 62 ? 7.777   1.253   0.350   1.00 0.00 ? 62 TRP A H    1  
ATOM 1023  H HA   . TRP A 1 62 ? 7.306   3.293   2.121   1.00 0.00 ? 62 TRP A HA   1  
ATOM 1024  H HB2  . TRP A 1 62 ? 7.261   1.199   3.106   1.00 0.00 ? 62 TRP A HB2  1  
ATOM 1025  H HB3  . TRP A 1 62 ? 8.767   0.693   2.345   1.00 0.00 ? 62 TRP A HB3  1  
ATOM 1026  H HD1  . TRP A 1 62 ? 7.477   2.778   5.309   1.00 0.00 ? 62 TRP A HD1  1  
ATOM 1027  H HE1  . TRP A 1 62 ? 9.374   2.990   7.036   1.00 0.00 ? 62 TRP A HE1  1  
ATOM 1028  H HE3  . TRP A 1 62 ? 11.256  0.608   2.635   1.00 0.00 ? 62 TRP A HE3  1  
ATOM 1029  H HZ2  . TRP A 1 62 ? 12.110  2.327   7.238   1.00 0.00 ? 62 TRP A HZ2  1  
ATOM 1030  H HZ3  . TRP A 1 62 ? 13.483  0.436   3.667   1.00 0.00 ? 62 TRP A HZ3  1  
ATOM 1031  H HH2  . TRP A 1 62 ? 13.900  1.279   5.921   1.00 0.00 ? 62 TRP A HH2  1  
ATOM 1032  N N    . ARG A 1 63 ? 10.490  3.090   1.313   1.00 0.00 ? 63 ARG A N    1  
ATOM 1033  C CA   . ARG A 1 63 ? 11.755  3.816   1.327   1.00 0.00 ? 63 ARG A CA   1  
ATOM 1034  C C    . ARG A 1 63 ? 11.530  5.304   1.074   1.00 0.00 ? 63 ARG A C    1  
ATOM 1035  O O    . ARG A 1 63 ? 11.943  6.148   1.869   1.00 0.00 ? 63 ARG A O    1  
ATOM 1036  C CB   . ARG A 1 63 ? 12.706  3.247   0.273   1.00 0.00 ? 63 ARG A CB   1  
ATOM 1037  C CG   . ARG A 1 63 ? 13.544  2.083   0.775   1.00 0.00 ? 63 ARG A CG   1  
ATOM 1038  C CD   . ARG A 1 63 ? 14.862  1.980   0.023   1.00 0.00 ? 63 ARG A CD   1  
ATOM 1039  N NE   . ARG A 1 63 ? 15.799  1.073   0.681   1.00 0.00 ? 63 ARG A NE   1  
ATOM 1040  C CZ   . ARG A 1 63 ? 16.896  0.602   0.100   1.00 0.00 ? 63 ARG A CZ   1  
ATOM 1041  N NH1  . ARG A 1 63 ? 17.193  0.950   -1.145  1.00 0.00 ? 63 ARG A NH1  1  
ATOM 1042  N NH2  . ARG A 1 63 ? 17.700  -0.219  0.764   1.00 0.00 ? 63 ARG A NH2  1  
ATOM 1043  H H    . ARG A 1 63 ? 10.430  2.245   0.821   1.00 0.00 ? 63 ARG A H    1  
ATOM 1044  H HA   . ARG A 1 63 ? 12.198  3.692   2.304   1.00 0.00 ? 63 ARG A HA   1  
ATOM 1045  H HB2  . ARG A 1 63 ? 12.126  2.906   -0.572  1.00 0.00 ? 63 ARG A HB2  1  
ATOM 1046  H HB3  . ARG A 1 63 ? 13.374  4.030   -0.051  1.00 0.00 ? 63 ARG A HB3  1  
ATOM 1047  H HG2  . ARG A 1 63 ? 13.752  2.227   1.825   1.00 0.00 ? 63 ARG A HG2  1  
ATOM 1048  H HG3  . ARG A 1 63 ? 12.989  1.166   0.638   1.00 0.00 ? 63 ARG A HG3  1  
ATOM 1049  H HD2  . ARG A 1 63 ? 14.665  1.616   -0.975  1.00 0.00 ? 63 ARG A HD2  1  
ATOM 1050  H HD3  . ARG A 1 63 ? 15.306  2.963   -0.034  1.00 0.00 ? 63 ARG A HD3  1  
ATOM 1051  H HE   . ARG A 1 63 ? 15.599  0.803   1.601   1.00 0.00 ? 63 ARG A HE   1  
ATOM 1052  H HH11 . ARG A 1 63 ? 16.590  1.569   -1.647  1.00 0.00 ? 63 ARG A HH11 1  
ATOM 1053  H HH12 . ARG A 1 63 ? 18.021  0.594   -1.580  1.00 0.00 ? 63 ARG A HH12 1  
ATOM 1054  H HH21 . ARG A 1 63 ? 17.479  -0.484  1.702   1.00 0.00 ? 63 ARG A HH21 1  
ATOM 1055  H HH22 . ARG A 1 63 ? 18.525  -0.574  0.326   1.00 0.00 ? 63 ARG A HH22 1  
ATOM 1056  N N    . ARG A 1 64 ? 10.873  5.617   -0.038  1.00 0.00 ? 64 ARG A N    1  
ATOM 1057  C CA   . ARG A 1 64 ? 10.595  7.003   -0.396  1.00 0.00 ? 64 ARG A CA   1  
ATOM 1058  C C    . ARG A 1 64 ? 9.735   7.678   0.669   1.00 0.00 ? 64 ARG A C    1  
ATOM 1059  O O    . ARG A 1 64 ? 9.904   8.863   0.958   1.00 0.00 ? 64 ARG A O    1  
ATOM 1060  C CB   . ARG A 1 64 ? 9.891   7.070   -1.753  1.00 0.00 ? 64 ARG A CB   1  
ATOM 1061  C CG   . ARG A 1 64 ? 10.608  6.300   -2.850  1.00 0.00 ? 64 ARG A CG   1  
ATOM 1062  C CD   . ARG A 1 64 ? 9.671   5.965   -3.999  1.00 0.00 ? 64 ARG A CD   1  
ATOM 1063  N NE   . ARG A 1 64 ? 9.592   7.049   -4.974  1.00 0.00 ? 64 ARG A NE   1  
ATOM 1064  C CZ   . ARG A 1 64 ? 9.023   6.924   -6.168  1.00 0.00 ? 64 ARG A CZ   1  
ATOM 1065  N NH1  . ARG A 1 64 ? 8.486   5.768   -6.533  1.00 0.00 ? 64 ARG A NH1  1  
ATOM 1066  N NH2  . ARG A 1 64 ? 8.990   7.957   -7.000  1.00 0.00 ? 64 ARG A NH2  1  
ATOM 1067  H H    . ARG A 1 64 ? 10.568  4.900   -0.632  1.00 0.00 ? 64 ARG A H    1  
ATOM 1068  H HA   . ARG A 1 64 ? 11.538  7.524   -0.464  1.00 0.00 ? 64 ARG A HA   1  
ATOM 1069  H HB2  . ARG A 1 64 ? 8.896   6.662   -1.650  1.00 0.00 ? 64 ARG A HB2  1  
ATOM 1070  H HB3  . ARG A 1 64 ? 9.818   8.103   -2.057  1.00 0.00 ? 64 ARG A HB3  1  
ATOM 1071  H HG2  . ARG A 1 64 ? 11.422  6.902   -3.227  1.00 0.00 ? 64 ARG A HG2  1  
ATOM 1072  H HG3  . ARG A 1 64 ? 10.999  5.382   -2.436  1.00 0.00 ? 64 ARG A HG3  1  
ATOM 1073  H HD2  . ARG A 1 64 ? 10.033  5.076   -4.494  1.00 0.00 ? 64 ARG A HD2  1  
ATOM 1074  H HD3  . ARG A 1 64 ? 8.686   5.779   -3.600  1.00 0.00 ? 64 ARG A HD3  1  
ATOM 1075  H HE   . ARG A 1 64 ? 9.982   7.913   -4.726  1.00 0.00 ? 64 ARG A HE   1  
ATOM 1076  H HH11 . ARG A 1 64 ? 8.509   4.988   -5.907  1.00 0.00 ? 64 ARG A HH11 1  
ATOM 1077  H HH12 . ARG A 1 64 ? 8.058   5.676   -7.432  1.00 0.00 ? 64 ARG A HH12 1  
ATOM 1078  H HH21 . ARG A 1 64 ? 9.393   8.830   -6.729  1.00 0.00 ? 64 ARG A HH21 1  
ATOM 1079  H HH22 . ARG A 1 64 ? 8.561   7.862   -7.899  1.00 0.00 ? 64 ARG A HH22 1  
ATOM 1080  N N    . SER A 1 65 ? 8.813   6.916   1.248   1.00 0.00 ? 65 SER A N    1  
ATOM 1081  C CA   . SER A 1 65 ? 7.924   7.442   2.277   1.00 0.00 ? 65 SER A CA   1  
ATOM 1082  C C    . SER A 1 65 ? 8.710   7.837   3.524   1.00 0.00 ? 65 SER A C    1  
ATOM 1083  O O    . SER A 1 65 ? 8.451   8.875   4.131   1.00 0.00 ? 65 SER A O    1  
ATOM 1084  C CB   . SER A 1 65 ? 6.859   6.404   2.640   1.00 0.00 ? 65 SER A CB   1  
ATOM 1085  O OG   . SER A 1 65 ? 5.907   6.943   3.540   1.00 0.00 ? 65 SER A OG   1  
ATOM 1086  H H    . SER A 1 65 ? 8.727   5.979   0.974   1.00 0.00 ? 65 SER A H    1  
ATOM 1087  H HA   . SER A 1 65 ? 7.437   8.319   1.879   1.00 0.00 ? 65 SER A HA   1  
ATOM 1088  H HB2  . SER A 1 65 ? 6.349   6.087   1.743   1.00 0.00 ? 65 SER A HB2  1  
ATOM 1089  H HB3  . SER A 1 65 ? 7.335   5.552   3.104   1.00 0.00 ? 65 SER A HB3  1  
ATOM 1090  H HG   . SER A 1 65 ? 5.382   7.609   3.090   1.00 0.00 ? 65 SER A HG   1  
ATOM 1091  N N    . GLY A 1 66 ? 9.672   7.001   3.899   1.00 0.00 ? 66 GLY A N    1  
ATOM 1092  C CA   . GLY A 1 66 ? 10.482  7.279   5.071   1.00 0.00 ? 66 GLY A CA   1  
ATOM 1093  C C    . GLY A 1 66 ? 11.597  8.265   4.784   1.00 0.00 ? 66 GLY A C    1  
ATOM 1094  O O    . GLY A 1 66 ? 12.150  8.307   3.685   1.00 0.00 ? 66 GLY A O    1  
ATOM 1095  H H    . GLY A 1 66 ? 9.834   6.187   3.376   1.00 0.00 ? 66 GLY A H    1  
ATOM 1096  H HA2  . GLY A 1 66 ? 9.848   7.684   5.845   1.00 0.00 ? 66 GLY A HA2  1  
ATOM 1097  H HA3  . GLY A 1 66 ? 10.917  6.355   5.422   1.00 0.00 ? 66 GLY A HA3  1  
ATOM 1098  N N    . PRO A 1 67 ? 11.941  9.084   5.789   1.00 0.00 ? 67 PRO A N    1  
ATOM 1099  C CA   . PRO A 1 67 ? 12.999  10.090  5.664   1.00 0.00 ? 67 PRO A CA   1  
ATOM 1100  C C    . PRO A 1 67 ? 14.387  9.464   5.568   1.00 0.00 ? 67 PRO A C    1  
ATOM 1101  O O    . PRO A 1 67 ? 15.306  10.053  4.998   1.00 0.00 ? 67 PRO A O    1  
ATOM 1102  C CB   . PRO A 1 67 ? 12.868  10.906  6.952   1.00 0.00 ? 67 PRO A CB   1  
ATOM 1103  C CG   . PRO A 1 67 ? 12.239  9.973   7.929   1.00 0.00 ? 67 PRO A CG   1  
ATOM 1104  C CD   . PRO A 1 67 ? 11.324  9.089   7.126   1.00 0.00 ? 67 PRO A CD   1  
ATOM 1105  H HA   . PRO A 1 67 ? 12.836  10.733  4.811   1.00 0.00 ? 67 PRO A HA   1  
ATOM 1106  H HB2  . PRO A 1 67 ? 13.848  11.223  7.282   1.00 0.00 ? 67 PRO A HB2  1  
ATOM 1107  H HB3  . PRO A 1 67 ? 12.246  11.770  6.774   1.00 0.00 ? 67 PRO A HB3  1  
ATOM 1108  H HG2  . PRO A 1 67 ? 13.000  9.382   8.415   1.00 0.00 ? 67 PRO A HG2  1  
ATOM 1109  H HG3  . PRO A 1 67 ? 11.674  10.533  8.659   1.00 0.00 ? 67 PRO A HG3  1  
ATOM 1110  H HD2  . PRO A 1 67 ? 11.300  8.094   7.544   1.00 0.00 ? 67 PRO A HD2  1  
ATOM 1111  H HD3  . PRO A 1 67 ? 10.330  9.510   7.090   1.00 0.00 ? 67 PRO A HD3  1  
ATOM 1112  N N    . SER A 1 68 ? 14.531  8.268   6.129   1.00 0.00 ? 68 SER A N    1  
ATOM 1113  C CA   . SER A 1 68 ? 15.807  7.564   6.110   1.00 0.00 ? 68 SER A CA   1  
ATOM 1114  C C    . SER A 1 68 ? 16.563  7.843   4.814   1.00 0.00 ? 68 SER A C    1  
ATOM 1115  O O    . SER A 1 68 ? 16.293  7.230   3.781   1.00 0.00 ? 68 SER A O    1  
ATOM 1116  C CB   . SER A 1 68 ? 15.586  6.058   6.269   1.00 0.00 ? 68 SER A CB   1  
ATOM 1117  O OG   . SER A 1 68 ? 14.876  5.527   5.164   1.00 0.00 ? 68 SER A OG   1  
ATOM 1118  H H    . SER A 1 68 ? 13.760  7.850   6.568   1.00 0.00 ? 68 SER A H    1  
ATOM 1119  H HA   . SER A 1 68 ? 16.397  7.922   6.940   1.00 0.00 ? 68 SER A HA   1  
ATOM 1120  H HB2  . SER A 1 68 ? 16.542  5.562   6.340   1.00 0.00 ? 68 SER A HB2  1  
ATOM 1121  H HB3  . SER A 1 68 ? 15.017  5.875   7.170   1.00 0.00 ? 68 SER A HB3  1  
ATOM 1122  H HG   . SER A 1 68 ? 15.076  6.040   4.378   1.00 0.00 ? 68 SER A HG   1  
ATOM 1123  N N    . SER A 1 69 ? 17.510  8.773   4.877   1.00 0.00 ? 69 SER A N    1  
ATOM 1124  C CA   . SER A 1 69 ? 18.303  9.138   3.709   1.00 0.00 ? 69 SER A CA   1  
ATOM 1125  C C    . SER A 1 69 ? 19.295  8.034   3.359   1.00 0.00 ? 69 SER A C    1  
ATOM 1126  O O    . SER A 1 69 ? 19.335  7.554   2.227   1.00 0.00 ? 69 SER A O    1  
ATOM 1127  C CB   . SER A 1 69 ? 19.049  10.449  3.962   1.00 0.00 ? 69 SER A CB   1  
ATOM 1128  O OG   . SER A 1 69 ? 19.464  11.043  2.744   1.00 0.00 ? 69 SER A OG   1  
ATOM 1129  H H    . SER A 1 69 ? 17.678  9.227   5.730   1.00 0.00 ? 69 SER A H    1  
ATOM 1130  H HA   . SER A 1 69 ? 17.626  9.274   2.878   1.00 0.00 ? 69 SER A HA   1  
ATOM 1131  H HB2  . SER A 1 69 ? 18.398  11.137  4.480   1.00 0.00 ? 69 SER A HB2  1  
ATOM 1132  H HB3  . SER A 1 69 ? 19.921  10.252  4.568   1.00 0.00 ? 69 SER A HB3  1  
ATOM 1133  H HG   . SER A 1 69 ? 18.742  11.558  2.376   1.00 0.00 ? 69 SER A HG   1  
ATOM 1134  N N    . GLY A 1 70 ? 20.097  7.634   4.342   1.00 0.00 ? 70 GLY A N    1  
ATOM 1135  C CA   . GLY A 1 70 ? 21.080  6.590   4.120   1.00 0.00 ? 70 GLY A CA   1  
ATOM 1136  C C    . GLY A 1 70 ? 22.160  6.574   5.184   1.00 0.00 ? 70 GLY A C    1  
ATOM 1137  O O    . GLY A 1 70 ? 23.296  6.183   4.917   1.00 0.00 ? 70 GLY A O    1  
ATOM 1138  H H    . GLY A 1 70 ? 20.021  8.053   5.225   1.00 0.00 ? 70 GLY A H    1  
ATOM 1139  H HA2  . GLY A 1 70 ? 20.578  5.634   4.117   1.00 0.00 ? 70 GLY A HA2  1  
ATOM 1140  H HA3  . GLY A 1 70 ? 21.542  6.745   3.156   1.00 0.00 ? 70 GLY A HA3  1  
ATOM 1141  N N    . GLY A 1 1  ? 16.318  10.477  -14.986 1.00 0.00 ? 1  GLY A N    2  
ATOM 1142  C CA   . GLY A 1 1  ? 17.347  10.027  -14.068 1.00 0.00 ? 1  GLY A CA   2  
ATOM 1143  C C    . GLY A 1 1  ? 17.186  8.569   -13.687 1.00 0.00 ? 1  GLY A C    2  
ATOM 1144  O O    . GLY A 1 1  ? 17.383  8.197   -12.530 1.00 0.00 ? 1  GLY A O    2  
ATOM 1145  H H1   . GLY A 1 1  ? 16.544  10.659  -15.922 1.00 0.00 ? 1  GLY A H1   2  
ATOM 1146  H HA2  . GLY A 1 1  ? 18.313  10.162  -14.532 1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1147  H HA3  . GLY A 1 1  ? 17.303  10.628  -13.172 1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1148  N N    . SER A 1 2  ? 16.825  7.740   -14.661 1.00 0.00 ? 2  SER A N    2  
ATOM 1149  C CA   . SER A 1 2  ? 16.632  6.315   -14.421 1.00 0.00 ? 2  SER A CA   2  
ATOM 1150  C C    . SER A 1 2  ? 16.652  5.535   -15.732 1.00 0.00 ? 2  SER A C    2  
ATOM 1151  O O    . SER A 1 2  ? 16.018  5.929   -16.711 1.00 0.00 ? 2  SER A O    2  
ATOM 1152  C CB   . SER A 1 2  ? 15.309  6.074   -13.691 1.00 0.00 ? 2  SER A CB   2  
ATOM 1153  O OG   . SER A 1 2  ? 15.294  4.800   -13.071 1.00 0.00 ? 2  SER A OG   2  
ATOM 1154  H H    . SER A 1 2  ? 16.683  8.097   -15.563 1.00 0.00 ? 2  SER A H    2  
ATOM 1155  H HA   . SER A 1 2  ? 17.445  5.971   -13.798 1.00 0.00 ? 2  SER A HA   2  
ATOM 1156  H HB2  . SER A 1 2  ? 15.176  6.831   -12.933 1.00 0.00 ? 2  SER A HB2  2  
ATOM 1157  H HB3  . SER A 1 2  ? 14.496  6.126   -14.400 1.00 0.00 ? 2  SER A HB3  2  
ATOM 1158  H HG   . SER A 1 2  ? 15.858  4.815   -12.294 1.00 0.00 ? 2  SER A HG   2  
ATOM 1159  N N    . SER A 1 3  ? 17.385  4.426   -15.742 1.00 0.00 ? 3  SER A N    2  
ATOM 1160  C CA   . SER A 1 3  ? 17.491  3.592   -16.933 1.00 0.00 ? 3  SER A CA   2  
ATOM 1161  C C    . SER A 1 3  ? 16.658  2.322   -16.784 1.00 0.00 ? 3  SER A C    2  
ATOM 1162  O O    . SER A 1 3  ? 17.052  1.386   -16.090 1.00 0.00 ? 3  SER A O    2  
ATOM 1163  C CB   . SER A 1 3  ? 18.954  3.227   -17.197 1.00 0.00 ? 3  SER A CB   2  
ATOM 1164  O OG   . SER A 1 3  ? 19.519  2.551   -16.088 1.00 0.00 ? 3  SER A OG   2  
ATOM 1165  H H    . SER A 1 3  ? 17.867  4.164   -14.930 1.00 0.00 ? 3  SER A H    2  
ATOM 1166  H HA   . SER A 1 3  ? 17.114  4.159   -17.771 1.00 0.00 ? 3  SER A HA   2  
ATOM 1167  H HB2  . SER A 1 3  ? 19.011  2.584   -18.062 1.00 0.00 ? 3  SER A HB2  2  
ATOM 1168  H HB3  . SER A 1 3  ? 19.519  4.129   -17.380 1.00 0.00 ? 3  SER A HB3  2  
ATOM 1169  H HG   . SER A 1 3  ? 19.802  1.674   -16.357 1.00 0.00 ? 3  SER A HG   2  
ATOM 1170  N N    . GLY A 1 4  ? 15.502  2.300   -17.441 1.00 0.00 ? 4  GLY A N    2  
ATOM 1171  C CA   . GLY A 1 4  ? 14.630  1.142   -17.369 1.00 0.00 ? 4  GLY A CA   2  
ATOM 1172  C C    . GLY A 1 4  ? 13.187  1.519   -17.100 1.00 0.00 ? 4  GLY A C    2  
ATOM 1173  O O    . GLY A 1 4  ? 12.674  2.484   -17.667 1.00 0.00 ? 4  GLY A O    2  
ATOM 1174  H H    . GLY A 1 4  ? 15.240  3.076   -17.980 1.00 0.00 ? 4  GLY A H    2  
ATOM 1175  H HA2  . GLY A 1 4  ? 14.683  0.606   -18.305 1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1176  H HA3  . GLY A 1 4  ? 14.975  0.495   -16.576 1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1177  N N    . SER A 1 5  ? 12.529  0.755   -16.233 1.00 0.00 ? 5  SER A N    2  
ATOM 1178  C CA   . SER A 1 5  ? 11.134  1.011   -15.894 1.00 0.00 ? 5  SER A CA   2  
ATOM 1179  C C    . SER A 1 5  ? 10.784  0.403   -14.540 1.00 0.00 ? 5  SER A C    2  
ATOM 1180  O O    . SER A 1 5  ? 11.498  -0.461  -14.032 1.00 0.00 ? 5  SER A O    2  
ATOM 1181  C CB   . SER A 1 5  ? 10.212  0.443   -16.975 1.00 0.00 ? 5  SER A CB   2  
ATOM 1182  O OG   . SER A 1 5  ? 10.370  -0.961  -17.093 1.00 0.00 ? 5  SER A OG   2  
ATOM 1183  H H    . SER A 1 5  ? 12.993  0.000   -15.814 1.00 0.00 ? 5  SER A H    2  
ATOM 1184  H HA   . SER A 1 5  ? 10.997  2.081   -15.842 1.00 0.00 ? 5  SER A HA   2  
ATOM 1185  H HB2  . SER A 1 5  ? 9.186   0.657   -16.718 1.00 0.00 ? 5  SER A HB2  2  
ATOM 1186  H HB3  . SER A 1 5  ? 10.450  0.901   -17.924 1.00 0.00 ? 5  SER A HB3  2  
ATOM 1187  H HG   . SER A 1 5  ? 11.212  -1.154  -17.511 1.00 0.00 ? 5  SER A HG   2  
ATOM 1188  N N    . SER A 1 6  ? 9.680   0.862   -13.960 1.00 0.00 ? 6  SER A N    2  
ATOM 1189  C CA   . SER A 1 6  ? 9.236   0.367   -12.662 1.00 0.00 ? 6  SER A CA   2  
ATOM 1190  C C    . SER A 1 6  ? 7.724   0.507   -12.516 1.00 0.00 ? 6  SER A C    2  
ATOM 1191  O O    . SER A 1 6  ? 7.168   1.588   -12.704 1.00 0.00 ? 6  SER A O    2  
ATOM 1192  C CB   . SER A 1 6  ? 9.941   1.125   -11.535 1.00 0.00 ? 6  SER A CB   2  
ATOM 1193  O OG   . SER A 1 6  ? 11.260  0.645   -11.346 1.00 0.00 ? 6  SER A OG   2  
ATOM 1194  H H    . SER A 1 6  ? 9.153   1.552   -14.415 1.00 0.00 ? 6  SER A H    2  
ATOM 1195  H HA   . SER A 1 6  ? 9.496   -0.679  -12.599 1.00 0.00 ? 6  SER A HA   2  
ATOM 1196  H HB2  . SER A 1 6  ? 9.984   2.174   -11.783 1.00 0.00 ? 6  SER A HB2  2  
ATOM 1197  H HB3  . SER A 1 6  ? 9.387   0.994   -10.616 1.00 0.00 ? 6  SER A HB3  2  
ATOM 1198  H HG   . SER A 1 6  ? 11.588  0.276   -12.169 1.00 0.00 ? 6  SER A HG   2  
ATOM 1199  N N    . GLY A 1 7  ? 7.063   -0.596  -12.178 1.00 0.00 ? 7  GLY A N    2  
ATOM 1200  C CA   . GLY A 1 7  ? 5.622   -0.577  -12.012 1.00 0.00 ? 7  GLY A CA   2  
ATOM 1201  C C    . GLY A 1 7  ? 4.891   -1.122  -13.224 1.00 0.00 ? 7  GLY A C    2  
ATOM 1202  O O    . GLY A 1 7  ? 4.819   -0.465  -14.262 1.00 0.00 ? 7  GLY A O    2  
ATOM 1203  H H    . GLY A 1 7  ? 7.559   -1.431  -12.040 1.00 0.00 ? 7  GLY A H    2  
ATOM 1204  H HA2  . GLY A 1 7  ? 5.361   -1.172  -11.150 1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1205  H HA3  . GLY A 1 7  ? 5.304   0.442   -11.843 1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1206  N N    . LYS A 1 8  ? 4.349   -2.328  -13.092 1.00 0.00 ? 8  LYS A N    2  
ATOM 1207  C CA   . LYS A 1 8  ? 3.621   -2.962  -14.184 1.00 0.00 ? 8  LYS A CA   2  
ATOM 1208  C C    . LYS A 1 8  ? 2.162   -3.193  -13.804 1.00 0.00 ? 8  LYS A C    2  
ATOM 1209  O O    . LYS A 1 8  ? 1.596   -4.249  -14.086 1.00 0.00 ? 8  LYS A O    2  
ATOM 1210  C CB   . LYS A 1 8  ? 4.278   -4.293  -14.558 1.00 0.00 ? 8  LYS A CB   2  
ATOM 1211  C CG   . LYS A 1 8  ? 5.593   -4.134  -15.301 1.00 0.00 ? 8  LYS A CG   2  
ATOM 1212  C CD   . LYS A 1 8  ? 6.764   -4.004  -14.341 1.00 0.00 ? 8  LYS A CD   2  
ATOM 1213  C CE   . LYS A 1 8  ? 8.000   -3.460  -15.041 1.00 0.00 ? 8  LYS A CE   2  
ATOM 1214  N NZ   . LYS A 1 8  ? 7.866   -2.011  -15.356 1.00 0.00 ? 8  LYS A NZ   2  
ATOM 1215  H H    . LYS A 1 8  ? 4.440   -2.803  -12.239 1.00 0.00 ? 8  LYS A H    2  
ATOM 1216  H HA   . LYS A 1 8  ? 3.657   -2.301  -15.037 1.00 0.00 ? 8  LYS A HA   2  
ATOM 1217  H HB2  . LYS A 1 8  ? 4.464   -4.855  -13.655 1.00 0.00 ? 8  LYS A HB2  2  
ATOM 1218  H HB3  . LYS A 1 8  ? 3.599   -4.852  -15.186 1.00 0.00 ? 8  LYS A HB3  2  
ATOM 1219  H HG2  . LYS A 1 8  ? 5.750   -5.001  -15.926 1.00 0.00 ? 8  LYS A HG2  2  
ATOM 1220  H HG3  . LYS A 1 8  ? 5.543   -3.248  -15.917 1.00 0.00 ? 8  LYS A HG3  2  
ATOM 1221  H HD2  . LYS A 1 8  ? 6.490   -3.330  -13.543 1.00 0.00 ? 8  LYS A HD2  2  
ATOM 1222  H HD3  . LYS A 1 8  ? 6.992   -4.977  -13.930 1.00 0.00 ? 8  LYS A HD3  2  
ATOM 1223  H HE2  . LYS A 1 8  ? 8.854   -3.602  -14.396 1.00 0.00 ? 8  LYS A HE2  2  
ATOM 1224  H HE3  . LYS A 1 8  ? 8.148   -4.008  -15.959 1.00 0.00 ? 8  LYS A HE3  2  
ATOM 1225  H HZ1  . LYS A 1 8  ? 6.996   -1.631  -14.931 1.00 0.00 ? 8  LYS A HZ1  2  
ATOM 1226  H HZ2  . LYS A 1 8  ? 7.824   -1.872  -16.386 1.00 0.00 ? 8  LYS A HZ2  2  
ATOM 1227  H HZ3  . LYS A 1 8  ? 8.681   -1.486  -14.980 1.00 0.00 ? 8  LYS A HZ3  2  
ATOM 1228  N N    . GLY A 1 9  ? 1.557   -2.198  -13.162 1.00 0.00 ? 9  GLY A N    2  
ATOM 1229  C CA   . GLY A 1 9  ? 0.169   -2.312  -12.755 1.00 0.00 ? 9  GLY A CA   2  
ATOM 1230  C C    . GLY A 1 9  ? -0.117  -3.611  -12.028 1.00 0.00 ? 9  GLY A C    2  
ATOM 1231  O O    . GLY A 1 9  ? 0.400   -3.846  -10.936 1.00 0.00 ? 9  GLY A O    2  
ATOM 1232  H H    . GLY A 1 9  ? 2.058   -1.379  -12.964 1.00 0.00 ? 9  GLY A H    2  
ATOM 1233  H HA2  . GLY A 1 9  ? -0.073  -1.486  -12.103 1.00 0.00 ? 9  GLY A HA2  2  
ATOM 1234  H HA3  . GLY A 1 9  ? -0.457  -2.259  -13.633 1.00 0.00 ? 9  GLY A HA3  2  
ATOM 1235  N N    . GLY A 1 10 ? -0.944  -4.457  -12.634 1.00 0.00 ? 10 GLY A N    2  
ATOM 1236  C CA   . GLY A 1 10 ? -1.285  -5.728  -12.022 1.00 0.00 ? 10 GLY A CA   2  
ATOM 1237  C C    . GLY A 1 10 ? -2.147  -5.563  -10.786 1.00 0.00 ? 10 GLY A C    2  
ATOM 1238  O O    . GLY A 1 10 ? -1.655  -5.173  -9.727  1.00 0.00 ? 10 GLY A O    2  
ATOM 1239  H H    . GLY A 1 10 ? -1.326  -4.217  -13.504 1.00 0.00 ? 10 GLY A H    2  
ATOM 1240  H HA2  . GLY A 1 10 ? -1.817  -6.331  -12.742 1.00 0.00 ? 10 GLY A HA2  2  
ATOM 1241  H HA3  . GLY A 1 10 ? -0.373  -6.237  -11.745 1.00 0.00 ? 10 GLY A HA3  2  
ATOM 1242  N N    . GLN A 1 11 ? -3.435  -5.860  -10.921 1.00 0.00 ? 11 GLN A N    2  
ATOM 1243  C CA   . GLN A 1 11 ? -4.367  -5.740  -9.806  1.00 0.00 ? 11 GLN A CA   2  
ATOM 1244  C C    . GLN A 1 11 ? -4.251  -6.938  -8.869  1.00 0.00 ? 11 GLN A C    2  
ATOM 1245  O O    . GLN A 1 11 ? -4.677  -8.044  -9.202  1.00 0.00 ? 11 GLN A O    2  
ATOM 1246  C CB   . GLN A 1 11 ? -5.802  -5.620  -10.324 1.00 0.00 ? 11 GLN A CB   2  
ATOM 1247  C CG   . GLN A 1 11 ? -6.068  -4.331  -11.084 1.00 0.00 ? 11 GLN A CG   2  
ATOM 1248  C CD   . GLN A 1 11 ? -7.357  -4.379  -11.881 1.00 0.00 ? 11 GLN A CD   2  
ATOM 1249  O OE1  . GLN A 1 11 ? -7.379  -4.846  -13.020 1.00 0.00 ? 11 GLN A OE1  2  
ATOM 1250  N NE2  . GLN A 1 11 ? -8.440  -3.895  -11.285 1.00 0.00 ? 11 GLN A NE2  2  
ATOM 1251  H H    . GLN A 1 11 ? -3.766  -6.166  -11.790 1.00 0.00 ? 11 GLN A H    2  
ATOM 1252  H HA   . GLN A 1 11 ? -4.115  -4.845  -9.259  1.00 0.00 ? 11 GLN A HA   2  
ATOM 1253  H HB2  . GLN A 1 11 ? -6.005  -6.451  -10.983 1.00 0.00 ? 11 GLN A HB2  2  
ATOM 1254  H HB3  . GLN A 1 11 ? -6.479  -5.663  -9.484  1.00 0.00 ? 11 GLN A HB3  2  
ATOM 1255  H HG2  . GLN A 1 11 ? -6.130  -3.517  -10.377 1.00 0.00 ? 11 GLN A HG2  2  
ATOM 1256  H HG3  . GLN A 1 11 ? -5.248  -4.154  -11.764 1.00 0.00 ? 11 GLN A HG3  2  
ATOM 1257  H HE21 . GLN A 1 11 ? -8.347  -3.537  -10.376 1.00 0.00 ? 11 GLN A HE21 2  
ATOM 1258  H HE22 . GLN A 1 11 ? -9.286  -3.912  -11.777 1.00 0.00 ? 11 GLN A HE22 2  
ATOM 1259  N N    . VAL A 1 12 ? -3.672  -6.709  -7.694  1.00 0.00 ? 12 VAL A N    2  
ATOM 1260  C CA   . VAL A 1 12 ? -3.500  -7.769  -6.707  1.00 0.00 ? 12 VAL A CA   2  
ATOM 1261  C C    . VAL A 1 12 ? -4.836  -8.415  -6.357  1.00 0.00 ? 12 VAL A C    2  
ATOM 1262  O O    . VAL A 1 12 ? -5.898  -7.882  -6.680  1.00 0.00 ? 12 VAL A O    2  
ATOM 1263  C CB   . VAL A 1 12 ? -2.846  -7.235  -5.419  1.00 0.00 ? 12 VAL A CB   2  
ATOM 1264  C CG1  . VAL A 1 12 ? -1.479  -6.641  -5.721  1.00 0.00 ? 12 VAL A CG1  2  
ATOM 1265  C CG2  . VAL A 1 12 ? -3.747  -6.209  -4.750  1.00 0.00 ? 12 VAL A CG2  2  
ATOM 1266  H H    . VAL A 1 12 ? -3.353  -5.806  -7.486  1.00 0.00 ? 12 VAL A H    2  
ATOM 1267  H HA   . VAL A 1 12 ? -2.849  -8.519  -7.133  1.00 0.00 ? 12 VAL A HA   2  
ATOM 1268  H HB   . VAL A 1 12 ? -2.712  -8.063  -4.738  1.00 0.00 ? 12 VAL A HB   2  
ATOM 1269  H HG11 . VAL A 1 12 ? -0.746  -7.433  -5.770  1.00 0.00 ? 12 VAL A HG11 2  
ATOM 1270  H HG12 . VAL A 1 12 ? -1.513  -6.121  -6.667  1.00 0.00 ? 12 VAL A HG12 2  
ATOM 1271  H HG13 . VAL A 1 12 ? -1.207  -5.948  -4.938  1.00 0.00 ? 12 VAL A HG13 2  
ATOM 1272  H HG21 . VAL A 1 12 ? -4.447  -6.713  -4.101  1.00 0.00 ? 12 VAL A HG21 2  
ATOM 1273  H HG22 . VAL A 1 12 ? -3.146  -5.525  -4.169  1.00 0.00 ? 12 VAL A HG22 2  
ATOM 1274  H HG23 . VAL A 1 12 ? -4.289  -5.658  -5.505  1.00 0.00 ? 12 VAL A HG23 2  
ATOM 1275  N N    . ARG A 1 13 ? -4.775  -9.564  -5.693  1.00 0.00 ? 13 ARG A N    2  
ATOM 1276  C CA   . ARG A 1 13 ? -5.980  -10.284 -5.298  1.00 0.00 ? 13 ARG A CA   2  
ATOM 1277  C C    . ARG A 1 13 ? -5.955  -10.610 -3.808  1.00 0.00 ? 13 ARG A C    2  
ATOM 1278  O O    . ARG A 1 13 ? -6.286  -11.723 -3.400  1.00 0.00 ? 13 ARG A O    2  
ATOM 1279  C CB   . ARG A 1 13 ? -6.120  -11.572 -6.111  1.00 0.00 ? 13 ARG A CB   2  
ATOM 1280  C CG   . ARG A 1 13 ? -4.970  -12.546 -5.912  1.00 0.00 ? 13 ARG A CG   2  
ATOM 1281  C CD   . ARG A 1 13 ? -5.358  -13.958 -6.320  1.00 0.00 ? 13 ARG A CD   2  
ATOM 1282  N NE   . ARG A 1 13 ? -5.953  -14.703 -5.214  1.00 0.00 ? 13 ARG A NE   2  
ATOM 1283  C CZ   . ARG A 1 13 ? -5.974  -16.030 -5.148  1.00 0.00 ? 13 ARG A CZ   2  
ATOM 1284  N NH1  . ARG A 1 13 ? -5.435  -16.753 -6.120  1.00 0.00 ? 13 ARG A NH1  2  
ATOM 1285  N NH2  . ARG A 1 13 ? -6.535  -16.635 -4.109  1.00 0.00 ? 13 ARG A NH2  2  
ATOM 1286  H H    . ARG A 1 13 ? -3.899  -9.939  -5.464  1.00 0.00 ? 13 ARG A H    2  
ATOM 1287  H HA   . ARG A 1 13 ? -6.828  -9.647  -5.501  1.00 0.00 ? 13 ARG A HA   2  
ATOM 1288  H HB2  . ARG A 1 13 ? -7.035  -12.068 -5.824  1.00 0.00 ? 13 ARG A HB2  2  
ATOM 1289  H HB3  . ARG A 1 13 ? -6.170  -11.319 -7.159  1.00 0.00 ? 13 ARG A HB3  2  
ATOM 1290  H HG2  . ARG A 1 13 ? -4.132  -12.227 -6.514  1.00 0.00 ? 13 ARG A HG2  2  
ATOM 1291  H HG3  . ARG A 1 13 ? -4.687  -12.546 -4.869  1.00 0.00 ? 13 ARG A HG3  2  
ATOM 1292  H HD2  . ARG A 1 13 ? -6.071  -13.902 -7.128  1.00 0.00 ? 13 ARG A HD2  2  
ATOM 1293  H HD3  . ARG A 1 13 ? -4.473  -14.477 -6.656  1.00 0.00 ? 13 ARG A HD3  2  
ATOM 1294  H HE   . ARG A 1 13 ? -6.358  -14.188 -4.485  1.00 0.00 ? 13 ARG A HE   2  
ATOM 1295  H HH11 . ARG A 1 13 ? -5.011  -16.300 -6.903  1.00 0.00 ? 13 ARG A HH11 2  
ATOM 1296  H HH12 . ARG A 1 13 ? -5.451  -17.752 -6.067  1.00 0.00 ? 13 ARG A HH12 2  
ATOM 1297  H HH21 . ARG A 1 13 ? -6.942  -16.093 -3.375  1.00 0.00 ? 13 ARG A HH21 2  
ATOM 1298  H HH22 . ARG A 1 13 ? -6.550  -17.633 -4.061  1.00 0.00 ? 13 ARG A HH22 2  
ATOM 1299  N N    . PHE A 1 14 ? -5.560  -9.632  -3.000  1.00 0.00 ? 14 PHE A N    2  
ATOM 1300  C CA   . PHE A 1 14 ? -5.490  -9.815  -1.555  1.00 0.00 ? 14 PHE A CA   2  
ATOM 1301  C C    . PHE A 1 14 ? -6.797  -9.394  -0.890  1.00 0.00 ? 14 PHE A C    2  
ATOM 1302  O O    . PHE A 1 14 ? -7.347  -8.334  -1.191  1.00 0.00 ? 14 PHE A O    2  
ATOM 1303  C CB   . PHE A 1 14 ? -4.326  -9.010  -0.973  1.00 0.00 ? 14 PHE A CB   2  
ATOM 1304  C CG   . PHE A 1 14 ? -2.979  -9.480  -1.441  1.00 0.00 ? 14 PHE A CG   2  
ATOM 1305  C CD1  . PHE A 1 14 ? -2.464  -10.691 -1.005  1.00 0.00 ? 14 PHE A CD1  2  
ATOM 1306  C CD2  . PHE A 1 14 ? -2.228  -8.713  -2.317  1.00 0.00 ? 14 PHE A CD2  2  
ATOM 1307  C CE1  . PHE A 1 14 ? -1.224  -11.126 -1.434  1.00 0.00 ? 14 PHE A CE1  2  
ATOM 1308  C CE2  . PHE A 1 14 ? -0.987  -9.143  -2.749  1.00 0.00 ? 14 PHE A CE2  2  
ATOM 1309  C CZ   . PHE A 1 14 ? -0.485  -10.351 -2.307  1.00 0.00 ? 14 PHE A CZ   2  
ATOM 1310  H H    . PHE A 1 14 ? -5.309  -8.766  -3.385  1.00 0.00 ? 14 PHE A H    2  
ATOM 1311  H HA   . PHE A 1 14 ? -5.324  -10.863 -1.362  1.00 0.00 ? 14 PHE A HA   2  
ATOM 1312  H HB2  . PHE A 1 14 ? -4.434  -7.975  -1.261  1.00 0.00 ? 14 PHE A HB2  2  
ATOM 1313  H HB3  . PHE A 1 14 ? -4.350  -9.084  0.104   1.00 0.00 ? 14 PHE A HB3  2  
ATOM 1314  H HD1  . PHE A 1 14 ? -3.040  -11.298 -0.323  1.00 0.00 ? 14 PHE A HD1  2  
ATOM 1315  H HD2  . PHE A 1 14 ? -2.620  -7.767  -2.663  1.00 0.00 ? 14 PHE A HD2  2  
ATOM 1316  H HE1  . PHE A 1 14 ? -0.834  -12.071 -1.087  1.00 0.00 ? 14 PHE A HE1  2  
ATOM 1317  H HE2  . PHE A 1 14 ? -0.413  -8.535  -3.432  1.00 0.00 ? 14 PHE A HE2  2  
ATOM 1318  H HZ   . PHE A 1 14 ? 0.484   -10.689 -2.643  1.00 0.00 ? 14 PHE A HZ   2  
ATOM 1319  N N    . SER A 1 15 ? -7.290  -10.232 0.016   1.00 0.00 ? 15 SER A N    2  
ATOM 1320  C CA   . SER A 1 15 ? -8.535  -9.950  0.722   1.00 0.00 ? 15 SER A CA   2  
ATOM 1321  C C    . SER A 1 15 ? -8.316  -8.907  1.813   1.00 0.00 ? 15 SER A C    2  
ATOM 1322  O O    . SER A 1 15 ? -7.184  -8.518  2.098   1.00 0.00 ? 15 SER A O    2  
ATOM 1323  C CB   . SER A 1 15 ? -9.101  -11.233 1.333   1.00 0.00 ? 15 SER A CB   2  
ATOM 1324  O OG   . SER A 1 15 ? -9.790  -12.001 0.361   1.00 0.00 ? 15 SER A OG   2  
ATOM 1325  H H    . SER A 1 15 ? -6.806  -11.061 0.213   1.00 0.00 ? 15 SER A H    2  
ATOM 1326  H HA   . SER A 1 15 ? -9.242  -9.561  0.004   1.00 0.00 ? 15 SER A HA   2  
ATOM 1327  H HB2  . SER A 1 15 ? -8.293  -11.825 1.735   1.00 0.00 ? 15 SER A HB2  2  
ATOM 1328  H HB3  . SER A 1 15 ? -9.789  -10.978 2.127   1.00 0.00 ? 15 SER A HB3  2  
ATOM 1329  H HG   . SER A 1 15 ? -10.432 -12.566 0.796   1.00 0.00 ? 15 SER A HG   2  
ATOM 1330  N N    . ASN A 1 16 ? -9.410  -8.457  2.420   1.00 0.00 ? 16 ASN A N    2  
ATOM 1331  C CA   . ASN A 1 16 ? -9.339  -7.457  3.480   1.00 0.00 ? 16 ASN A CA   2  
ATOM 1332  C C    . ASN A 1 16 ? -8.361  -7.888  4.569   1.00 0.00 ? 16 ASN A C    2  
ATOM 1333  O O    . ASN A 1 16 ? -7.400  -7.180  4.870   1.00 0.00 ? 16 ASN A O    2  
ATOM 1334  C CB   . ASN A 1 16 ? -10.725 -7.227  4.085   1.00 0.00 ? 16 ASN A CB   2  
ATOM 1335  C CG   . ASN A 1 16 ? -10.735 -6.093  5.092   1.00 0.00 ? 16 ASN A CG   2  
ATOM 1336  O OD1  . ASN A 1 16 ? -10.178 -5.024  4.845   1.00 0.00 ? 16 ASN A OD1  2  
ATOM 1337  N ND2  . ASN A 1 16 ? -11.371 -6.323  6.236   1.00 0.00 ? 16 ASN A ND2  2  
ATOM 1338  H H    . ASN A 1 16 ? -10.285 -8.804  2.149   1.00 0.00 ? 16 ASN A H    2  
ATOM 1339  H HA   . ASN A 1 16 ? -8.989  -6.535  3.043   1.00 0.00 ? 16 ASN A HA   2  
ATOM 1340  H HB2  . ASN A 1 16 ? -11.421 -6.986  3.295   1.00 0.00 ? 16 ASN A HB2  2  
ATOM 1341  H HB3  . ASN A 1 16 ? -11.049 -8.129  4.583   1.00 0.00 ? 16 ASN A HB3  2  
ATOM 1342  H HD21 . ASN A 1 16 ? -11.792 -7.199  6.364   1.00 0.00 ? 16 ASN A HD21 2  
ATOM 1343  H HD22 . ASN A 1 16 ? -11.393 -5.607  6.904   1.00 0.00 ? 16 ASN A HD22 2  
ATOM 1344  N N    . ASP A 1 17 ? -8.614  -9.052  5.156   1.00 0.00 ? 17 ASP A N    2  
ATOM 1345  C CA   . ASP A 1 17 ? -7.755  -9.579  6.211   1.00 0.00 ? 17 ASP A CA   2  
ATOM 1346  C C    . ASP A 1 17 ? -6.351  -9.855  5.682   1.00 0.00 ? 17 ASP A C    2  
ATOM 1347  O O    . ASP A 1 17 ? -5.361  -9.417  6.267   1.00 0.00 ? 17 ASP A O    2  
ATOM 1348  C CB   . ASP A 1 17 ? -8.355  -10.859 6.795   1.00 0.00 ? 17 ASP A CB   2  
ATOM 1349  C CG   . ASP A 1 17 ? -9.704  -10.623 7.445   1.00 0.00 ? 17 ASP A CG   2  
ATOM 1350  O OD1  . ASP A 1 17 ? -9.891  -9.546  8.050   1.00 0.00 ? 17 ASP A OD1  2  
ATOM 1351  O OD2  . ASP A 1 17 ? -10.573 -11.514 7.349   1.00 0.00 ? 17 ASP A OD2  2  
ATOM 1352  H H    . ASP A 1 17 ? -9.396  -9.571  4.873   1.00 0.00 ? 17 ASP A H    2  
ATOM 1353  H HA   . ASP A 1 17 ? -7.693  -8.834  6.990   1.00 0.00 ? 17 ASP A HA   2  
ATOM 1354  H HB2  . ASP A 1 17 ? -8.480  -11.584 6.003   1.00 0.00 ? 17 ASP A HB2  2  
ATOM 1355  H HB3  . ASP A 1 17 ? -7.681  -11.258 7.539   1.00 0.00 ? 17 ASP A HB3  2  
ATOM 1356  N N    . GLN A 1 18 ? -6.275  -10.585 4.574   1.00 0.00 ? 18 GLN A N    2  
ATOM 1357  C CA   . GLN A 1 18 ? -4.992  -10.920 3.968   1.00 0.00 ? 18 GLN A CA   2  
ATOM 1358  C C    . GLN A 1 18 ? -4.070  -9.706  3.937   1.00 0.00 ? 18 GLN A C    2  
ATOM 1359  O O    . GLN A 1 18 ? -2.935  -9.762  4.412   1.00 0.00 ? 18 GLN A O    2  
ATOM 1360  C CB   . GLN A 1 18 ? -5.199  -11.454 2.549   1.00 0.00 ? 18 GLN A CB   2  
ATOM 1361  C CG   . GLN A 1 18 ? -5.463  -12.950 2.495   1.00 0.00 ? 18 GLN A CG   2  
ATOM 1362  C CD   . GLN A 1 18 ? -5.714  -13.448 1.085   1.00 0.00 ? 18 GLN A CD   2  
ATOM 1363  O OE1  . GLN A 1 18 ? -5.704  -12.671 0.129   1.00 0.00 ? 18 GLN A OE1  2  
ATOM 1364  N NE2  . GLN A 1 18 ? -5.939  -14.749 0.947   1.00 0.00 ? 18 GLN A NE2  2  
ATOM 1365  H H    . GLN A 1 18 ? -7.100  -10.905 4.155   1.00 0.00 ? 18 GLN A H    2  
ATOM 1366  H HA   . GLN A 1 18 ? -4.533  -11.690 4.569   1.00 0.00 ? 18 GLN A HA   2  
ATOM 1367  H HB2  . GLN A 1 18 ? -6.040  -10.945 2.104   1.00 0.00 ? 18 GLN A HB2  2  
ATOM 1368  H HB3  . GLN A 1 18 ? -4.313  -11.246 1.967   1.00 0.00 ? 18 GLN A HB3  2  
ATOM 1369  H HG2  . GLN A 1 18 ? -4.606  -13.470 2.896   1.00 0.00 ? 18 GLN A HG2  2  
ATOM 1370  H HG3  . GLN A 1 18 ? -6.331  -13.171 3.098   1.00 0.00 ? 18 GLN A HG3  2  
ATOM 1371  H HE21 . GLN A 1 18 ? -5.933  -15.307 1.753   1.00 0.00 ? 18 GLN A HE21 2  
ATOM 1372  H HE22 . GLN A 1 18 ? -6.105  -15.098 0.047   1.00 0.00 ? 18 GLN A HE22 2  
ATOM 1373  N N    . THR A 1 19 ? -4.565  -8.607  3.376   1.00 0.00 ? 19 THR A N    2  
ATOM 1374  C CA   . THR A 1 19 ? -3.785  -7.379  3.282   1.00 0.00 ? 19 THR A CA   2  
ATOM 1375  C C    . THR A 1 19 ? -3.402  -6.864  4.665   1.00 0.00 ? 19 THR A C    2  
ATOM 1376  O O    . THR A 1 19 ? -2.244  -6.526  4.912   1.00 0.00 ? 19 THR A O    2  
ATOM 1377  C CB   . THR A 1 19 ? -4.559  -6.278  2.533   1.00 0.00 ? 19 THR A CB   2  
ATOM 1378  O OG1  . THR A 1 19 ? -4.998  -6.767  1.261   1.00 0.00 ? 19 THR A OG1  2  
ATOM 1379  C CG2  . THR A 1 19 ? -3.691  -5.045  2.336   1.00 0.00 ? 19 THR A CG2  2  
ATOM 1380  H H    . THR A 1 19 ? -5.476  -8.624  3.016   1.00 0.00 ? 19 THR A H    2  
ATOM 1381  H HA   . THR A 1 19 ? -2.884  -7.598  2.727   1.00 0.00 ? 19 THR A HA   2  
ATOM 1382  H HB   . THR A 1 19 ? -5.422  -6.002  3.122   1.00 0.00 ? 19 THR A HB   2  
ATOM 1383  H HG1  . THR A 1 19 ? -5.465  -6.069  0.794   1.00 0.00 ? 19 THR A HG1  2  
ATOM 1384  H HG21 . THR A 1 19 ? -3.141  -5.135  1.411   1.00 0.00 ? 19 THR A HG21 2  
ATOM 1385  H HG22 . THR A 1 19 ? -2.998  -4.957  3.160   1.00 0.00 ? 19 THR A HG22 2  
ATOM 1386  H HG23 . THR A 1 19 ? -4.317  -4.166  2.297   1.00 0.00 ? 19 THR A HG23 2  
ATOM 1387  N N    . ILE A 1 20 ? -4.380  -6.809  5.562   1.00 0.00 ? 20 ILE A N    2  
ATOM 1388  C CA   . ILE A 1 20 ? -4.143  -6.337  6.921   1.00 0.00 ? 20 ILE A CA   2  
ATOM 1389  C C    . ILE A 1 20 ? -2.866  -6.938  7.497   1.00 0.00 ? 20 ILE A C    2  
ATOM 1390  O O    . ILE A 1 20 ? -1.934  -6.217  7.852   1.00 0.00 ? 20 ILE A O    2  
ATOM 1391  C CB   . ILE A 1 20 ? -5.323  -6.680  7.850   1.00 0.00 ? 20 ILE A CB   2  
ATOM 1392  C CG1  . ILE A 1 20 ? -6.514  -5.766  7.556   1.00 0.00 ? 20 ILE A CG1  2  
ATOM 1393  C CG2  . ILE A 1 20 ? -4.902  -6.559  9.307   1.00 0.00 ? 20 ILE A CG2  2  
ATOM 1394  C CD1  . ILE A 1 20 ? -7.805  -6.231  8.193   1.00 0.00 ? 20 ILE A CD1  2  
ATOM 1395  H H    . ILE A 1 20 ? -5.281  -7.093  5.305   1.00 0.00 ? 20 ILE A H    2  
ATOM 1396  H HA   . ILE A 1 20 ? -4.039  -5.262  6.887   1.00 0.00 ? 20 ILE A HA   2  
ATOM 1397  H HB   . ILE A 1 20 ? -5.610  -7.704  7.667   1.00 0.00 ? 20 ILE A HB   2  
ATOM 1398  H HG12 . ILE A 1 20 ? -6.300  -4.776  7.927   1.00 0.00 ? 20 ILE A HG12 2  
ATOM 1399  H HG13 . ILE A 1 20 ? -6.668  -5.720  6.488   1.00 0.00 ? 20 ILE A HG13 2  
ATOM 1400  H HG21 . ILE A 1 20 ? -4.329  -5.654  9.442   1.00 0.00 ? 20 ILE A HG21 2  
ATOM 1401  H HG22 . ILE A 1 20 ? -5.781  -6.525  9.933   1.00 0.00 ? 20 ILE A HG22 2  
ATOM 1402  H HG23 . ILE A 1 20 ? -4.299  -7.412  9.579   1.00 0.00 ? 20 ILE A HG23 2  
ATOM 1403  H HD11 . ILE A 1 20 ? -8.182  -5.459  8.848   1.00 0.00 ? 20 ILE A HD11 2  
ATOM 1404  H HD12 . ILE A 1 20 ? -8.532  -6.440  7.423   1.00 0.00 ? 20 ILE A HD12 2  
ATOM 1405  H HD13 . ILE A 1 20 ? -7.620  -7.129  8.766   1.00 0.00 ? 20 ILE A HD13 2  
ATOM 1406  N N    . GLU A 1 21 ? -2.829  -8.264  7.585   1.00 0.00 ? 21 GLU A N    2  
ATOM 1407  C CA   . GLU A 1 21 ? -1.665  -8.962  8.117   1.00 0.00 ? 21 GLU A CA   2  
ATOM 1408  C C    . GLU A 1 21 ? -0.439  -8.722  7.241   1.00 0.00 ? 21 GLU A C    2  
ATOM 1409  O O    . GLU A 1 21 ? 0.628   -8.353  7.734   1.00 0.00 ? 21 GLU A O    2  
ATOM 1410  C CB   . GLU A 1 21 ? -1.946  -10.463 8.221   1.00 0.00 ? 21 GLU A CB   2  
ATOM 1411  C CG   . GLU A 1 21 ? -2.755  -10.848 9.448   1.00 0.00 ? 21 GLU A CG   2  
ATOM 1412  C CD   . GLU A 1 21 ? -2.458  -12.256 9.924   1.00 0.00 ? 21 GLU A CD   2  
ATOM 1413  O OE1  . GLU A 1 21 ? -1.285  -12.541 10.243  1.00 0.00 ? 21 GLU A OE1  2  
ATOM 1414  O OE2  . GLU A 1 21 ? -3.400  -13.074 9.978   1.00 0.00 ? 21 GLU A OE2  2  
ATOM 1415  H H    . GLU A 1 21 ? -3.604  -8.785  7.285   1.00 0.00 ? 21 GLU A H    2  
ATOM 1416  H HA   . GLU A 1 21 ? -1.468  -8.574  9.105   1.00 0.00 ? 21 GLU A HA   2  
ATOM 1417  H HB2  . GLU A 1 21 ? -2.490  -10.777 7.342   1.00 0.00 ? 21 GLU A HB2  2  
ATOM 1418  H HB3  . GLU A 1 21 ? -1.004  -10.991 8.256   1.00 0.00 ? 21 GLU A HB3  2  
ATOM 1419  H HG2  . GLU A 1 21 ? -2.524  -10.158 10.246  1.00 0.00 ? 21 GLU A HG2  2  
ATOM 1420  H HG3  . GLU A 1 21 ? -3.805  -10.779 9.207   1.00 0.00 ? 21 GLU A HG3  2  
ATOM 1421  N N    . LEU A 1 22 ? -0.599  -8.934  5.939   1.00 0.00 ? 22 LEU A N    2  
ATOM 1422  C CA   . LEU A 1 22 ? 0.494   -8.742  4.993   1.00 0.00 ? 22 LEU A CA   2  
ATOM 1423  C C    . LEU A 1 22 ? 1.275   -7.471  5.313   1.00 0.00 ? 22 LEU A C    2  
ATOM 1424  O O    . LEU A 1 22 ? 2.495   -7.427  5.161   1.00 0.00 ? 22 LEU A O    2  
ATOM 1425  C CB   . LEU A 1 22 ? -0.048  -8.674  3.564   1.00 0.00 ? 22 LEU A CB   2  
ATOM 1426  C CG   . LEU A 1 22 ? -0.306  -10.016 2.879   1.00 0.00 ? 22 LEU A CG   2  
ATOM 1427  C CD1  . LEU A 1 22 ? -1.118  -9.820  1.608   1.00 0.00 ? 22 LEU A CD1  2  
ATOM 1428  C CD2  . LEU A 1 22 ? 1.008   -10.720 2.572   1.00 0.00 ? 22 LEU A CD2  2  
ATOM 1429  H H    . LEU A 1 22 ? -1.472  -9.227  5.606   1.00 0.00 ? 22 LEU A H    2  
ATOM 1430  H HA   . LEU A 1 22 ? 1.158   -9.589  5.077   1.00 0.00 ? 22 LEU A HA   2  
ATOM 1431  H HB2  . LEU A 1 22 ? -0.981  -8.132  3.590   1.00 0.00 ? 22 LEU A HB2  2  
ATOM 1432  H HB3  . LEU A 1 22 ? 0.667   -8.128  2.965   1.00 0.00 ? 22 LEU A HB3  2  
ATOM 1433  H HG   . LEU A 1 22 ? -0.878  -10.649 3.545   1.00 0.00 ? 22 LEU A HG   2  
ATOM 1434  H HD11 . LEU A 1 22 ? -2.170  -9.889  1.838   1.00 0.00 ? 22 LEU A HD11 2  
ATOM 1435  H HD12 . LEU A 1 22 ? -0.855  -10.585 0.892   1.00 0.00 ? 22 LEU A HD12 2  
ATOM 1436  H HD13 . LEU A 1 22 ? -0.902  -8.847  1.190   1.00 0.00 ? 22 LEU A HD13 2  
ATOM 1437  H HD21 . LEU A 1 22 ? 1.152   -10.761 1.503   1.00 0.00 ? 22 LEU A HD21 2  
ATOM 1438  H HD22 . LEU A 1 22 ? 0.980   -11.723 2.971   1.00 0.00 ? 22 LEU A HD22 2  
ATOM 1439  H HD23 . LEU A 1 22 ? 1.822   -10.174 3.025   1.00 0.00 ? 22 LEU A HD23 2  
ATOM 1440  N N    . GLU A 1 23 ? 0.562   -6.442  5.760   1.00 0.00 ? 23 GLU A N    2  
ATOM 1441  C CA   . GLU A 1 23 ? 1.189   -5.171  6.103   1.00 0.00 ? 23 GLU A CA   2  
ATOM 1442  C C    . GLU A 1 23 ? 1.833   -5.238  7.485   1.00 0.00 ? 23 GLU A C    2  
ATOM 1443  O O    . GLU A 1 23 ? 3.051   -5.114  7.623   1.00 0.00 ? 23 GLU A O    2  
ATOM 1444  C CB   . GLU A 1 23 ? 0.159   -4.041  6.063   1.00 0.00 ? 23 GLU A CB   2  
ATOM 1445  C CG   . GLU A 1 23 ? -0.497  -3.863  4.704   1.00 0.00 ? 23 GLU A CG   2  
ATOM 1446  C CD   . GLU A 1 23 ? -0.986  -2.446  4.473   1.00 0.00 ? 23 GLU A CD   2  
ATOM 1447  O OE1  . GLU A 1 23 ? -1.789  -1.955  5.294   1.00 0.00 ? 23 GLU A OE1  2  
ATOM 1448  O OE2  . GLU A 1 23 ? -0.567  -1.829  3.472   1.00 0.00 ? 23 GLU A OE2  2  
ATOM 1449  H H    . GLU A 1 23 ? -0.408  -6.539  5.860   1.00 0.00 ? 23 GLU A H    2  
ATOM 1450  H HA   . GLU A 1 23 ? 1.957   -4.971  5.371   1.00 0.00 ? 23 GLU A HA   2  
ATOM 1451  H HB2  . GLU A 1 23 ? -0.613  -4.248  6.789   1.00 0.00 ? 23 GLU A HB2  2  
ATOM 1452  H HB3  . GLU A 1 23 ? 0.648   -3.115  6.327   1.00 0.00 ? 23 GLU A HB3  2  
ATOM 1453  H HG2  . GLU A 1 23 ? 0.222   -4.109  3.937   1.00 0.00 ? 23 GLU A HG2  2  
ATOM 1454  H HG3  . GLU A 1 23 ? -1.340  -4.535  4.635   1.00 0.00 ? 23 GLU A HG3  2  
ATOM 1455  N N    . LYS A 1 24 ? 1.008   -5.435  8.507   1.00 0.00 ? 24 LYS A N    2  
ATOM 1456  C CA   . LYS A 1 24 ? 1.494   -5.519  9.879   1.00 0.00 ? 24 LYS A CA   2  
ATOM 1457  C C    . LYS A 1 24 ? 2.812   -6.284  9.943   1.00 0.00 ? 24 LYS A C    2  
ATOM 1458  O O    . LYS A 1 24 ? 3.619   -6.077  10.850  1.00 0.00 ? 24 LYS A O    2  
ATOM 1459  C CB   . LYS A 1 24 ? 0.453   -6.201  10.770  1.00 0.00 ? 24 LYS A CB   2  
ATOM 1460  C CG   . LYS A 1 24 ? -0.859  -5.442  10.863  1.00 0.00 ? 24 LYS A CG   2  
ATOM 1461  C CD   . LYS A 1 24 ? -2.010  -6.361  11.239  1.00 0.00 ? 24 LYS A CD   2  
ATOM 1462  C CE   . LYS A 1 24 ? -2.040  -6.632  12.735  1.00 0.00 ? 24 LYS A CE   2  
ATOM 1463  N NZ   . LYS A 1 24 ? -3.384  -7.083  13.190  1.00 0.00 ? 24 LYS A NZ   2  
ATOM 1464  H H    . LYS A 1 24 ? 0.047   -5.526  8.334   1.00 0.00 ? 24 LYS A H    2  
ATOM 1465  H HA   . LYS A 1 24 ? 1.657   -4.514  10.236  1.00 0.00 ? 24 LYS A HA   2  
ATOM 1466  H HB2  . LYS A 1 24 ? 0.248   -7.186  10.375  1.00 0.00 ? 24 LYS A HB2  2  
ATOM 1467  H HB3  . LYS A 1 24 ? 0.859   -6.300  11.767  1.00 0.00 ? 24 LYS A HB3  2  
ATOM 1468  H HG2  . LYS A 1 24 ? -0.767  -4.672  11.615  1.00 0.00 ? 24 LYS A HG2  2  
ATOM 1469  H HG3  . LYS A 1 24 ? -1.071  -4.989  9.905   1.00 0.00 ? 24 LYS A HG3  2  
ATOM 1470  H HD2  . LYS A 1 24 ? -2.940  -5.895  10.950  1.00 0.00 ? 24 LYS A HD2  2  
ATOM 1471  H HD3  . LYS A 1 24 ? -1.896  -7.299  10.714  1.00 0.00 ? 24 LYS A HD3  2  
ATOM 1472  H HE2  . LYS A 1 24 ? -1.316  -7.399  12.964  1.00 0.00 ? 24 LYS A HE2  2  
ATOM 1473  H HE3  . LYS A 1 24 ? -1.779  -5.723  13.258  1.00 0.00 ? 24 LYS A HE3  2  
ATOM 1474  H HZ1  . LYS A 1 24 ? -4.034  -7.143  12.380  1.00 0.00 ? 24 LYS A HZ1  2  
ATOM 1475  H HZ2  . LYS A 1 24 ? -3.772  -6.411  13.881  1.00 0.00 ? 24 LYS A HZ2  2  
ATOM 1476  H HZ3  . LYS A 1 24 ? -3.315  -8.021  13.635  1.00 0.00 ? 24 LYS A HZ3  2  
ATOM 1477  N N    . LYS A 1 25 ? 3.026   -7.168  8.974   1.00 0.00 ? 25 LYS A N    2  
ATOM 1478  C CA   . LYS A 1 25 ? 4.247   -7.962  8.917   1.00 0.00 ? 25 LYS A CA   2  
ATOM 1479  C C    . LYS A 1 25 ? 5.409   -7.136  8.373   1.00 0.00 ? 25 LYS A C    2  
ATOM 1480  O O    . LYS A 1 25 ? 6.428   -6.963  9.042   1.00 0.00 ? 25 LYS A O    2  
ATOM 1481  C CB   . LYS A 1 25 ? 4.035   -9.200  8.044   1.00 0.00 ? 25 LYS A CB   2  
ATOM 1482  C CG   . LYS A 1 25 ? 5.149   -10.226 8.162   1.00 0.00 ? 25 LYS A CG   2  
ATOM 1483  C CD   . LYS A 1 25 ? 5.202   -10.833 9.554   1.00 0.00 ? 25 LYS A CD   2  
ATOM 1484  C CE   . LYS A 1 25 ? 6.032   -12.108 9.575   1.00 0.00 ? 25 LYS A CE   2  
ATOM 1485  N NZ   . LYS A 1 25 ? 5.866   -12.856 10.852  1.00 0.00 ? 25 LYS A NZ   2  
ATOM 1486  H H    . LYS A 1 25 ? 2.345   -7.288  8.278   1.00 0.00 ? 25 LYS A H    2  
ATOM 1487  H HA   . LYS A 1 25 ? 4.485   -8.277  9.922   1.00 0.00 ? 25 LYS A HA   2  
ATOM 1488  H HB2  . LYS A 1 25 ? 3.107   -9.672  8.329   1.00 0.00 ? 25 LYS A HB2  2  
ATOM 1489  H HB3  . LYS A 1 25 ? 3.969   -8.890  7.011   1.00 0.00 ? 25 LYS A HB3  2  
ATOM 1490  H HG2  . LYS A 1 25 ? 4.978   -11.014 7.444   1.00 0.00 ? 25 LYS A HG2  2  
ATOM 1491  H HG3  . LYS A 1 25 ? 6.093   -9.744  7.953   1.00 0.00 ? 25 LYS A HG3  2  
ATOM 1492  H HD2  . LYS A 1 25 ? 5.643   -10.119 10.233  1.00 0.00 ? 25 LYS A HD2  2  
ATOM 1493  H HD3  . LYS A 1 25 ? 4.196   -11.064 9.876   1.00 0.00 ? 25 LYS A HD3  2  
ATOM 1494  H HE2  . LYS A 1 25 ? 5.721   -12.738 8.756   1.00 0.00 ? 25 LYS A HE2  2  
ATOM 1495  H HE3  . LYS A 1 25 ? 7.073   -11.846 9.454   1.00 0.00 ? 25 LYS A HE3  2  
ATOM 1496  H HZ1  . LYS A 1 25 ? 6.797   -13.050 11.276  1.00 0.00 ? 25 LYS A HZ1  2  
ATOM 1497  H HZ2  . LYS A 1 25 ? 5.384   -13.760 10.676  1.00 0.00 ? 25 LYS A HZ2  2  
ATOM 1498  H HZ3  . LYS A 1 25 ? 5.301   -12.298 11.523  1.00 0.00 ? 25 LYS A HZ3  2  
ATOM 1499  N N    . PHE A 1 26 ? 5.247   -6.626  7.157   1.00 0.00 ? 26 PHE A N    2  
ATOM 1500  C CA   . PHE A 1 26 ? 6.283   -5.818  6.523   1.00 0.00 ? 26 PHE A CA   2  
ATOM 1501  C C    . PHE A 1 26 ? 6.785   -4.735  7.474   1.00 0.00 ? 26 PHE A C    2  
ATOM 1502  O O    . PHE A 1 26 ? 7.935   -4.306  7.389   1.00 0.00 ? 26 PHE A O    2  
ATOM 1503  C CB   . PHE A 1 26 ? 5.746   -5.177  5.241   1.00 0.00 ? 26 PHE A CB   2  
ATOM 1504  C CG   . PHE A 1 26 ? 6.541   -3.986  4.788   1.00 0.00 ? 26 PHE A CG   2  
ATOM 1505  C CD1  . PHE A 1 26 ? 6.306   -2.733  5.328   1.00 0.00 ? 26 PHE A CD1  2  
ATOM 1506  C CD2  . PHE A 1 26 ? 7.525   -4.121  3.822   1.00 0.00 ? 26 PHE A CD2  2  
ATOM 1507  C CE1  . PHE A 1 26 ? 7.036   -1.635  4.912   1.00 0.00 ? 26 PHE A CE1  2  
ATOM 1508  C CE2  . PHE A 1 26 ? 8.259   -3.028  3.402   1.00 0.00 ? 26 PHE A CE2  2  
ATOM 1509  C CZ   . PHE A 1 26 ? 8.014   -1.783  3.948   1.00 0.00 ? 26 PHE A CZ   2  
ATOM 1510  H H    . PHE A 1 26 ? 4.412   -6.799  6.673   1.00 0.00 ? 26 PHE A H    2  
ATOM 1511  H HA   . PHE A 1 26 ? 7.105   -6.470  6.273   1.00 0.00 ? 26 PHE A HA   2  
ATOM 1512  H HB2  . PHE A 1 26 ? 5.763   -5.908  4.448   1.00 0.00 ? 26 PHE A HB2  2  
ATOM 1513  H HB3  . PHE A 1 26 ? 4.729   -4.855  5.407   1.00 0.00 ? 26 PHE A HB3  2  
ATOM 1514  H HD1  . PHE A 1 26 ? 5.542   -2.615  6.083   1.00 0.00 ? 26 PHE A HD1  2  
ATOM 1515  H HD2  . PHE A 1 26 ? 7.717   -5.095  3.393   1.00 0.00 ? 26 PHE A HD2  2  
ATOM 1516  H HE1  . PHE A 1 26 ? 6.843   -0.663  5.341   1.00 0.00 ? 26 PHE A HE1  2  
ATOM 1517  H HE2  . PHE A 1 26 ? 9.023   -3.147  2.648   1.00 0.00 ? 26 PHE A HE2  2  
ATOM 1518  H HZ   . PHE A 1 26 ? 8.586   -0.927  3.621   1.00 0.00 ? 26 PHE A HZ   2  
ATOM 1519  N N    . GLU A 1 27 ? 5.914   -4.299  8.378   1.00 0.00 ? 27 GLU A N    2  
ATOM 1520  C CA   . GLU A 1 27 ? 6.269   -3.266  9.344   1.00 0.00 ? 27 GLU A CA   2  
ATOM 1521  C C    . GLU A 1 27 ? 7.323   -3.775  10.323  1.00 0.00 ? 27 GLU A C    2  
ATOM 1522  O O    . GLU A 1 27 ? 8.337   -3.118  10.560  1.00 0.00 ? 27 GLU A O    2  
ATOM 1523  C CB   . GLU A 1 27 ? 5.027   -2.803  10.109  1.00 0.00 ? 27 GLU A CB   2  
ATOM 1524  C CG   . GLU A 1 27 ? 3.842   -2.487  9.212   1.00 0.00 ? 27 GLU A CG   2  
ATOM 1525  C CD   . GLU A 1 27 ? 3.919   -1.096  8.613   1.00 0.00 ? 27 GLU A CD   2  
ATOM 1526  O OE1  . GLU A 1 27 ? 4.526   -0.208  9.248   1.00 0.00 ? 27 GLU A OE1  2  
ATOM 1527  O OE2  . GLU A 1 27 ? 3.373   -0.895  7.508   1.00 0.00 ? 27 GLU A OE2  2  
ATOM 1528  H H    . GLU A 1 27 ? 5.011   -4.680  8.396   1.00 0.00 ? 27 GLU A H    2  
ATOM 1529  H HA   . GLU A 1 27 ? 6.677   -2.428  8.799   1.00 0.00 ? 27 GLU A HA   2  
ATOM 1530  H HB2  . GLU A 1 27 ? 4.733   -3.581  10.799  1.00 0.00 ? 27 GLU A HB2  2  
ATOM 1531  H HB3  . GLU A 1 27 ? 5.275   -1.914  10.669  1.00 0.00 ? 27 GLU A HB3  2  
ATOM 1532  H HG2  . GLU A 1 27 ? 3.813   -3.207  8.408   1.00 0.00 ? 27 GLU A HG2  2  
ATOM 1533  H HG3  . GLU A 1 27 ? 2.936   -2.562  9.795   1.00 0.00 ? 27 GLU A HG3  2  
ATOM 1534  N N    . THR A 1 28 ? 7.075   -4.951  10.891  1.00 0.00 ? 28 THR A N    2  
ATOM 1535  C CA   . THR A 1 28 ? 7.999   -5.549  11.846  1.00 0.00 ? 28 THR A CA   2  
ATOM 1536  C C    . THR A 1 28 ? 9.240   -6.091  11.144  1.00 0.00 ? 28 THR A C    2  
ATOM 1537  O O    . THR A 1 28 ? 10.280  -6.289  11.771  1.00 0.00 ? 28 THR A O    2  
ATOM 1538  C CB   . THR A 1 28 ? 7.331   -6.690  12.636  1.00 0.00 ? 28 THR A CB   2  
ATOM 1539  O OG1  . THR A 1 28 ? 6.687   -7.598  11.736  1.00 0.00 ? 28 THR A OG1  2  
ATOM 1540  C CG2  . THR A 1 28 ? 6.314   -6.140  13.624  1.00 0.00 ? 28 THR A CG2  2  
ATOM 1541  H H    . THR A 1 28 ? 6.249   -5.427  10.662  1.00 0.00 ? 28 THR A H    2  
ATOM 1542  H HA   . THR A 1 28 ? 8.299   -4.782  12.545  1.00 0.00 ? 28 THR A HA   2  
ATOM 1543  H HB   . THR A 1 28 ? 8.095   -7.222  13.187  1.00 0.00 ? 28 THR A HB   2  
ATOM 1544  H HG1  . THR A 1 28 ? 7.344   -8.002  11.164  1.00 0.00 ? 28 THR A HG1  2  
ATOM 1545  H HG21 . THR A 1 28 ? 5.762   -5.335  13.162  1.00 0.00 ? 28 THR A HG21 2  
ATOM 1546  H HG22 . THR A 1 28 ? 6.826   -5.771  14.500  1.00 0.00 ? 28 THR A HG22 2  
ATOM 1547  H HG23 . THR A 1 28 ? 5.631   -6.925  13.911  1.00 0.00 ? 28 THR A HG23 2  
ATOM 1548  N N    . GLN A 1 29 ? 9.122   -6.327  9.842   1.00 0.00 ? 29 GLN A N    2  
ATOM 1549  C CA   . GLN A 1 29 ? 10.235  -6.846  9.056   1.00 0.00 ? 29 GLN A CA   2  
ATOM 1550  C C    . GLN A 1 29 ? 10.004  -6.615  7.566   1.00 0.00 ? 29 GLN A C    2  
ATOM 1551  O O    . GLN A 1 29 ? 9.076   -7.170  6.977   1.00 0.00 ? 29 GLN A O    2  
ATOM 1552  C CB   . GLN A 1 29 ? 10.427  -8.339  9.329   1.00 0.00 ? 29 GLN A CB   2  
ATOM 1553  C CG   . GLN A 1 29 ? 11.868  -8.802  9.190   1.00 0.00 ? 29 GLN A CG   2  
ATOM 1554  C CD   . GLN A 1 29 ? 11.997  -10.312 9.167   1.00 0.00 ? 29 GLN A CD   2  
ATOM 1555  O OE1  . GLN A 1 29 ? 11.298  -11.017 9.896   1.00 0.00 ? 29 GLN A OE1  2  
ATOM 1556  N NE2  . GLN A 1 29 ? 12.893  -10.818 8.328   1.00 0.00 ? 29 GLN A NE2  2  
ATOM 1557  H H    . GLN A 1 29 ? 8.266   -6.149  9.399   1.00 0.00 ? 29 GLN A H    2  
ATOM 1558  H HA   . GLN A 1 29 ? 11.127  -6.317  9.355   1.00 0.00 ? 29 GLN A HA   2  
ATOM 1559  H HB2  . GLN A 1 29 ? 10.097  -8.554  10.334  1.00 0.00 ? 29 GLN A HB2  2  
ATOM 1560  H HB3  . GLN A 1 29 ? 9.823   -8.901  8.632   1.00 0.00 ? 29 GLN A HB3  2  
ATOM 1561  H HG2  . GLN A 1 29 ? 12.273  -8.408  8.270   1.00 0.00 ? 29 GLN A HG2  2  
ATOM 1562  H HG3  . GLN A 1 29 ? 12.437  -8.419  10.025  1.00 0.00 ? 29 GLN A HG3  2  
ATOM 1563  H HE21 . GLN A 1 29 ? 13.415  -10.195 7.779   1.00 0.00 ? 29 GLN A HE21 2  
ATOM 1564  H HE22 . GLN A 1 29 ? 12.997  -11.791 8.293   1.00 0.00 ? 29 GLN A HE22 2  
ATOM 1565  N N    . LYS A 1 30 ? 10.854  -5.792  6.962   1.00 0.00 ? 30 LYS A N    2  
ATOM 1566  C CA   . LYS A 1 30 ? 10.744  -5.487  5.540   1.00 0.00 ? 30 LYS A CA   2  
ATOM 1567  C C    . LYS A 1 30 ? 10.861  -6.755  4.701   1.00 0.00 ? 30 LYS A C    2  
ATOM 1568  O O    . LYS A 1 30 ? 10.228  -6.877  3.651   1.00 0.00 ? 30 LYS A O    2  
ATOM 1569  C CB   . LYS A 1 30 ? 11.827  -4.488  5.126   1.00 0.00 ? 30 LYS A CB   2  
ATOM 1570  C CG   . LYS A 1 30 ? 11.876  -3.247  6.002   1.00 0.00 ? 30 LYS A CG   2  
ATOM 1571  C CD   . LYS A 1 30 ? 10.768  -2.270  5.647   1.00 0.00 ? 30 LYS A CD   2  
ATOM 1572  C CE   . LYS A 1 30 ? 10.708  -1.113  6.633   1.00 0.00 ? 30 LYS A CE   2  
ATOM 1573  N NZ   . LYS A 1 30 ? 10.448  -1.582  8.022   1.00 0.00 ? 30 LYS A NZ   2  
ATOM 1574  H H    . LYS A 1 30 ? 11.573  -5.379  7.485   1.00 0.00 ? 30 LYS A H    2  
ATOM 1575  H HA   . LYS A 1 30 ? 9.774   -5.045  5.369   1.00 0.00 ? 30 LYS A HA   2  
ATOM 1576  H HB2  . LYS A 1 30 ? 12.788  -4.976  5.176   1.00 0.00 ? 30 LYS A HB2  2  
ATOM 1577  H HB3  . LYS A 1 30 ? 11.643  -4.177  4.108   1.00 0.00 ? 30 LYS A HB3  2  
ATOM 1578  H HG2  . LYS A 1 30 ? 11.764  -3.542  7.035   1.00 0.00 ? 30 LYS A HG2  2  
ATOM 1579  H HG3  . LYS A 1 30 ? 12.831  -2.760  5.866   1.00 0.00 ? 30 LYS A HG3  2  
ATOM 1580  H HD2  . LYS A 1 30 ? 10.950  -1.876  4.658   1.00 0.00 ? 30 LYS A HD2  2  
ATOM 1581  H HD3  . LYS A 1 30 ? 9.822   -2.792  5.660   1.00 0.00 ? 30 LYS A HD3  2  
ATOM 1582  H HE2  . LYS A 1 30 ? 11.651  -0.589  6.610   1.00 0.00 ? 30 LYS A HE2  2  
ATOM 1583  H HE3  . LYS A 1 30 ? 9.916   -0.443  6.333   1.00 0.00 ? 30 LYS A HE3  2  
ATOM 1584  H HZ1  . LYS A 1 30 ? 11.193  -1.237  8.661   1.00 0.00 ? 30 LYS A HZ1  2  
ATOM 1585  H HZ2  . LYS A 1 30 ? 10.435  -2.621  8.052   1.00 0.00 ? 30 LYS A HZ2  2  
ATOM 1586  H HZ3  . LYS A 1 30 ? 9.529   -1.225  8.354   1.00 0.00 ? 30 LYS A HZ3  2  
ATOM 1587  N N    . TYR A 1 31 ? 11.671  -7.697  5.170   1.00 0.00 ? 31 TYR A N    2  
ATOM 1588  C CA   . TYR A 1 31 ? 11.871  -8.956  4.462   1.00 0.00 ? 31 TYR A CA   2  
ATOM 1589  C C    . TYR A 1 31 ? 11.493  -10.143 5.344   1.00 0.00 ? 31 TYR A C    2  
ATOM 1590  O O    . TYR A 1 31 ? 11.265  -9.991  6.545   1.00 0.00 ? 31 TYR A O    2  
ATOM 1591  C CB   . TYR A 1 31 ? 13.327  -9.085  4.010   1.00 0.00 ? 31 TYR A CB   2  
ATOM 1592  C CG   . TYR A 1 31 ? 13.642  -8.305  2.754   1.00 0.00 ? 31 TYR A CG   2  
ATOM 1593  C CD1  . TYR A 1 31 ? 13.925  -6.946  2.809   1.00 0.00 ? 31 TYR A CD1  2  
ATOM 1594  C CD2  . TYR A 1 31 ? 13.658  -8.928  1.512   1.00 0.00 ? 31 TYR A CD2  2  
ATOM 1595  C CE1  . TYR A 1 31 ? 14.213  -6.229  1.664   1.00 0.00 ? 31 TYR A CE1  2  
ATOM 1596  C CE2  . TYR A 1 31 ? 13.946  -8.219  0.361   1.00 0.00 ? 31 TYR A CE2  2  
ATOM 1597  C CZ   . TYR A 1 31 ? 14.222  -6.870  0.442   1.00 0.00 ? 31 TYR A CZ   2  
ATOM 1598  O OH   . TYR A 1 31 ? 14.510  -6.160  -0.701  1.00 0.00 ? 31 TYR A OH   2  
ATOM 1599  H H    . TYR A 1 31 ? 12.148  -7.542  6.012   1.00 0.00 ? 31 TYR A H    2  
ATOM 1600  H HA   . TYR A 1 31 ? 11.233  -8.952  3.591   1.00 0.00 ? 31 TYR A HA   2  
ATOM 1601  H HB2  . TYR A 1 31 ? 13.974  -8.725  4.795   1.00 0.00 ? 31 TYR A HB2  2  
ATOM 1602  H HB3  . TYR A 1 31 ? 13.546  -10.126 3.819   1.00 0.00 ? 31 TYR A HB3  2  
ATOM 1603  H HD1  . TYR A 1 31 ? 13.917  -6.447  3.767   1.00 0.00 ? 31 TYR A HD1  2  
ATOM 1604  H HD2  . TYR A 1 31 ? 13.441  -9.985  1.451   1.00 0.00 ? 31 TYR A HD2  2  
ATOM 1605  H HE1  . TYR A 1 31 ? 14.429  -5.173  1.727   1.00 0.00 ? 31 TYR A HE1  2  
ATOM 1606  H HE2  . TYR A 1 31 ? 13.954  -8.721  -0.595  1.00 0.00 ? 31 TYR A HE2  2  
ATOM 1607  H HH   . TYR A 1 31 ? 14.956  -5.343  -0.466  1.00 0.00 ? 31 TYR A HH   2  
ATOM 1608  N N    . LEU A 1 32 ? 11.431  -11.324 4.739   1.00 0.00 ? 32 LEU A N    2  
ATOM 1609  C CA   . LEU A 1 32 ? 11.081  -12.538 5.468   1.00 0.00 ? 32 LEU A CA   2  
ATOM 1610  C C    . LEU A 1 32 ? 11.772  -13.755 4.860   1.00 0.00 ? 32 LEU A C    2  
ATOM 1611  O O    . LEU A 1 32 ? 11.613  -14.044 3.674   1.00 0.00 ? 32 LEU A O    2  
ATOM 1612  C CB   . LEU A 1 32 ? 9.565   -12.742 5.462   1.00 0.00 ? 32 LEU A CB   2  
ATOM 1613  C CG   . LEU A 1 32 ? 8.736   -11.632 6.109   1.00 0.00 ? 32 LEU A CG   2  
ATOM 1614  C CD1  . LEU A 1 32 ? 7.302   -11.675 5.606   1.00 0.00 ? 32 LEU A CD1  2  
ATOM 1615  C CD2  . LEU A 1 32 ? 8.776   -11.753 7.626   1.00 0.00 ? 32 LEU A CD2  2  
ATOM 1616  H H    . LEU A 1 32 ? 11.623  -11.381 3.781   1.00 0.00 ? 32 LEU A H    2  
ATOM 1617  H HA   . LEU A 1 32 ? 11.417  -12.421 6.487   1.00 0.00 ? 32 LEU A HA   2  
ATOM 1618  H HB2  . LEU A 1 32 ? 9.248   -12.835 4.434   1.00 0.00 ? 32 LEU A HB2  2  
ATOM 1619  H HB3  . LEU A 1 32 ? 9.354   -13.663 5.986   1.00 0.00 ? 32 LEU A HB3  2  
ATOM 1620  H HG   . LEU A 1 32 ? 9.156   -10.673 5.838   1.00 0.00 ? 32 LEU A HG   2  
ATOM 1621  H HD11 . LEU A 1 32 ? 6.644   -11.270 6.360   1.00 0.00 ? 32 LEU A HD11 2  
ATOM 1622  H HD12 . LEU A 1 32 ? 7.024   -12.698 5.397   1.00 0.00 ? 32 LEU A HD12 2  
ATOM 1623  H HD13 . LEU A 1 32 ? 7.220   -11.088 4.703   1.00 0.00 ? 32 LEU A HD13 2  
ATOM 1624  H HD21 . LEU A 1 32 ? 8.201   -10.951 8.065   1.00 0.00 ? 32 LEU A HD21 2  
ATOM 1625  H HD22 . LEU A 1 32 ? 9.800   -11.690 7.965   1.00 0.00 ? 32 LEU A HD22 2  
ATOM 1626  H HD23 . LEU A 1 32 ? 8.355   -12.702 7.922   1.00 0.00 ? 32 LEU A HD23 2  
ATOM 1627  N N    . SER A 1 33 ? 12.537  -14.467 5.681   1.00 0.00 ? 33 SER A N    2  
ATOM 1628  C CA   . SER A 1 33 ? 13.253  -15.652 5.225   1.00 0.00 ? 33 SER A CA   2  
ATOM 1629  C C    . SER A 1 33 ? 12.282  -16.706 4.701   1.00 0.00 ? 33 SER A C    2  
ATOM 1630  O O    . SER A 1 33 ? 11.113  -16.755 5.086   1.00 0.00 ? 33 SER A O    2  
ATOM 1631  C CB   . SER A 1 33 ? 14.093  -16.236 6.362   1.00 0.00 ? 33 SER A CB   2  
ATOM 1632  O OG   . SER A 1 33 ? 14.703  -15.210 7.125   1.00 0.00 ? 33 SER A OG   2  
ATOM 1633  H H    . SER A 1 33 ? 12.624  -14.186 6.617   1.00 0.00 ? 33 SER A H    2  
ATOM 1634  H HA   . SER A 1 33 ? 13.909  -15.353 4.421   1.00 0.00 ? 33 SER A HA   2  
ATOM 1635  H HB2  . SER A 1 33 ? 13.459  -16.822 7.010   1.00 0.00 ? 33 SER A HB2  2  
ATOM 1636  H HB3  . SER A 1 33 ? 14.866  -16.868 5.948   1.00 0.00 ? 33 SER A HB3  2  
ATOM 1637  H HG   . SER A 1 33 ? 15.140  -14.590 6.537   1.00 0.00 ? 33 SER A HG   2  
ATOM 1638  N N    . PRO A 1 34 ? 12.776  -17.570 3.802   1.00 0.00 ? 34 PRO A N    2  
ATOM 1639  C CA   . PRO A 1 34 ? 11.969  -18.639 3.206   1.00 0.00 ? 34 PRO A CA   2  
ATOM 1640  C C    . PRO A 1 34 ? 11.187  -19.427 4.252   1.00 0.00 ? 34 PRO A C    2  
ATOM 1641  O O    . PRO A 1 34 ? 10.006  -19.729 4.081   1.00 0.00 ? 34 PRO A O    2  
ATOM 1642  C CB   . PRO A 1 34 ? 13.011  -19.535 2.531   1.00 0.00 ? 34 PRO A CB   2  
ATOM 1643  C CG   . PRO A 1 34 ? 14.157  -18.629 2.239   1.00 0.00 ? 34 PRO A CG   2  
ATOM 1644  C CD   . PRO A 1 34 ? 14.159  -17.570 3.298   1.00 0.00 ? 34 PRO A CD   2  
ATOM 1645  H HA   . PRO A 1 34 ? 11.287  -18.254 2.463   1.00 0.00 ? 34 PRO A HA   2  
ATOM 1646  H HB2  . PRO A 1 34 ? 13.296  -20.330 3.205   1.00 0.00 ? 34 PRO A HB2  2  
ATOM 1647  H HB3  . PRO A 1 34 ? 12.598  -19.954 1.626   1.00 0.00 ? 34 PRO A HB3  2  
ATOM 1648  H HG2  . PRO A 1 34 ? 15.082  -19.184 2.275   1.00 0.00 ? 34 PRO A HG2  2  
ATOM 1649  H HG3  . PRO A 1 34 ? 14.027  -18.175 1.268   1.00 0.00 ? 34 PRO A HG3  2  
ATOM 1650  H HD2  . PRO A 1 34 ? 14.855  -17.828 4.083   1.00 0.00 ? 34 PRO A HD2  2  
ATOM 1651  H HD3  . PRO A 1 34 ? 14.412  -16.612 2.867   1.00 0.00 ? 34 PRO A HD3  2  
ATOM 1652  N N    . PRO A 1 35 ? 11.859  -19.767 5.362   1.00 0.00 ? 35 PRO A N    2  
ATOM 1653  C CA   . PRO A 1 35 ? 11.245  -20.523 6.458   1.00 0.00 ? 35 PRO A CA   2  
ATOM 1654  C C    . PRO A 1 35 ? 9.892   -19.953 6.869   1.00 0.00 ? 35 PRO A C    2  
ATOM 1655  O O    . PRO A 1 35 ? 8.936   -20.696 7.089   1.00 0.00 ? 35 PRO A O    2  
ATOM 1656  C CB   . PRO A 1 35 ? 12.255  -20.378 7.599   1.00 0.00 ? 35 PRO A CB   2  
ATOM 1657  C CG   . PRO A 1 35 ? 13.562  -20.147 6.920   1.00 0.00 ? 35 PRO A CG   2  
ATOM 1658  C CD   . PRO A 1 35 ? 13.268  -19.439 5.633   1.00 0.00 ? 35 PRO A CD   2  
ATOM 1659  H HA   . PRO A 1 35 ? 11.132  -21.567 6.205   1.00 0.00 ? 35 PRO A HA   2  
ATOM 1660  H HB2  . PRO A 1 35 ? 11.980  -19.539 8.222   1.00 0.00 ? 35 PRO A HB2  2  
ATOM 1661  H HB3  . PRO A 1 35 ? 12.271  -21.282 8.188   1.00 0.00 ? 35 PRO A HB3  2  
ATOM 1662  H HG2  . PRO A 1 35 ? 14.194  -19.531 7.541   1.00 0.00 ? 35 PRO A HG2  2  
ATOM 1663  H HG3  . PRO A 1 35 ? 14.041  -21.094 6.716   1.00 0.00 ? 35 PRO A HG3  2  
ATOM 1664  H HD2  . PRO A 1 35 ? 13.400  -18.374 5.755   1.00 0.00 ? 35 PRO A HD2  2  
ATOM 1665  H HD3  . PRO A 1 35 ? 13.908  -19.813 4.848   1.00 0.00 ? 35 PRO A HD3  2  
ATOM 1666  N N    . GLU A 1 36 ? 9.819   -18.629 6.971   1.00 0.00 ? 36 GLU A N    2  
ATOM 1667  C CA   . GLU A 1 36 ? 8.581   -17.960 7.356   1.00 0.00 ? 36 GLU A CA   2  
ATOM 1668  C C    . GLU A 1 36 ? 7.661   -17.782 6.152   1.00 0.00 ? 36 GLU A C    2  
ATOM 1669  O O    . GLU A 1 36 ? 6.600   -18.401 6.072   1.00 0.00 ? 36 GLU A O    2  
ATOM 1670  C CB   . GLU A 1 36 ? 8.886   -16.599 7.985   1.00 0.00 ? 36 GLU A CB   2  
ATOM 1671  C CG   . GLU A 1 36 ? 10.034  -16.631 8.980   1.00 0.00 ? 36 GLU A CG   2  
ATOM 1672  C CD   . GLU A 1 36 ? 9.572   -16.922 10.395  1.00 0.00 ? 36 GLU A CD   2  
ATOM 1673  O OE1  . GLU A 1 36 ? 9.210   -15.965 11.111  1.00 0.00 ? 36 GLU A OE1  2  
ATOM 1674  O OE2  . GLU A 1 36 ? 9.571   -18.109 10.786  1.00 0.00 ? 36 GLU A OE2  2  
ATOM 1675  H H    . GLU A 1 36 ? 10.615  -18.090 6.783   1.00 0.00 ? 36 GLU A H    2  
ATOM 1676  H HA   . GLU A 1 36 ? 8.083   -18.580 8.086   1.00 0.00 ? 36 GLU A HA   2  
ATOM 1677  H HB2  . GLU A 1 36 ? 9.136   -15.901 7.200   1.00 0.00 ? 36 GLU A HB2  2  
ATOM 1678  H HB3  . GLU A 1 36 ? 8.003   -16.248 8.498   1.00 0.00 ? 36 GLU A HB3  2  
ATOM 1679  H HG2  . GLU A 1 36 ? 10.731  -17.399 8.681   1.00 0.00 ? 36 GLU A HG2  2  
ATOM 1680  H HG3  . GLU A 1 36 ? 10.530  -15.672 8.970   1.00 0.00 ? 36 GLU A HG3  2  
ATOM 1681  N N    . ARG A 1 37 ? 8.076   -16.932 5.219   1.00 0.00 ? 37 ARG A N    2  
ATOM 1682  C CA   . ARG A 1 37 ? 7.289   -16.670 4.020   1.00 0.00 ? 37 ARG A CA   2  
ATOM 1683  C C    . ARG A 1 37 ? 6.549   -17.926 3.571   1.00 0.00 ? 37 ARG A C    2  
ATOM 1684  O O    . ARG A 1 37 ? 5.434   -17.852 3.053   1.00 0.00 ? 37 ARG A O    2  
ATOM 1685  C CB   . ARG A 1 37 ? 8.191   -16.165 2.892   1.00 0.00 ? 37 ARG A CB   2  
ATOM 1686  C CG   . ARG A 1 37 ? 7.475   -15.270 1.894   1.00 0.00 ? 37 ARG A CG   2  
ATOM 1687  C CD   . ARG A 1 37 ? 8.372   -14.919 0.717   1.00 0.00 ? 37 ARG A CD   2  
ATOM 1688  N NE   . ARG A 1 37 ? 9.127   -16.075 0.241   1.00 0.00 ? 37 ARG A NE   2  
ATOM 1689  C CZ   . ARG A 1 37 ? 10.289  -16.458 0.760   1.00 0.00 ? 37 ARG A CZ   2  
ATOM 1690  N NH1  . ARG A 1 37 ? 10.825  -15.782 1.766   1.00 0.00 ? 37 ARG A NH1  2  
ATOM 1691  N NH2  . ARG A 1 37 ? 10.916  -17.521 0.272   1.00 0.00 ? 37 ARG A NH2  2  
ATOM 1692  H H    . ARG A 1 37 ? 8.931   -16.468 5.340   1.00 0.00 ? 37 ARG A H    2  
ATOM 1693  H HA   . ARG A 1 37 ? 6.564   -15.906 4.259   1.00 0.00 ? 37 ARG A HA   2  
ATOM 1694  H HB2  . ARG A 1 37 ? 9.008   -15.605 3.323   1.00 0.00 ? 37 ARG A HB2  2  
ATOM 1695  H HB3  . ARG A 1 37 ? 8.590   -17.015 2.359   1.00 0.00 ? 37 ARG A HB3  2  
ATOM 1696  H HG2  . ARG A 1 37 ? 6.601   -15.786 1.524   1.00 0.00 ? 37 ARG A HG2  2  
ATOM 1697  H HG3  . ARG A 1 37 ? 7.175   -14.360 2.392   1.00 0.00 ? 37 ARG A HG3  2  
ATOM 1698  H HD2  . ARG A 1 37 ? 7.757   -14.546 -0.088  1.00 0.00 ? 37 ARG A HD2  2  
ATOM 1699  H HD3  . ARG A 1 37 ? 9.065   -14.151 1.027   1.00 0.00 ? 37 ARG A HD3  2  
ATOM 1700  H HE   . ARG A 1 37 ? 8.750   -16.589 -0.502  1.00 0.00 ? 37 ARG A HE   2  
ATOM 1701  H HH11 . ARG A 1 37 ? 10.354  -14.982 2.136   1.00 0.00 ? 37 ARG A HH11 2  
ATOM 1702  H HH12 . ARG A 1 37 ? 11.699  -16.074 2.156   1.00 0.00 ? 37 ARG A HH12 2  
ATOM 1703  H HH21 . ARG A 1 37 ? 10.515  -18.033 -0.487  1.00 0.00 ? 37 ARG A HH21 2  
ATOM 1704  H HH22 . ARG A 1 37 ? 11.790  -17.809 0.662   1.00 0.00 ? 37 ARG A HH22 2  
ATOM 1705  N N    . LYS A 1 38 ? 7.177   -19.080 3.771   1.00 0.00 ? 38 LYS A N    2  
ATOM 1706  C CA   . LYS A 1 38 ? 6.579   -20.354 3.388   1.00 0.00 ? 38 LYS A CA   2  
ATOM 1707  C C    . LYS A 1 38 ? 5.316   -20.627 4.197   1.00 0.00 ? 38 LYS A C    2  
ATOM 1708  O O    . LYS A 1 38 ? 4.256   -20.906 3.637   1.00 0.00 ? 38 LYS A O    2  
ATOM 1709  C CB   . LYS A 1 38 ? 7.582   -21.492 3.587   1.00 0.00 ? 38 LYS A CB   2  
ATOM 1710  C CG   . LYS A 1 38 ? 8.647   -21.561 2.506   1.00 0.00 ? 38 LYS A CG   2  
ATOM 1711  C CD   . LYS A 1 38 ? 9.845   -22.381 2.955   1.00 0.00 ? 38 LYS A CD   2  
ATOM 1712  C CE   . LYS A 1 38 ? 9.495   -23.855 3.083   1.00 0.00 ? 38 LYS A CE   2  
ATOM 1713  N NZ   . LYS A 1 38 ? 10.371  -24.549 4.067   1.00 0.00 ? 38 LYS A NZ   2  
ATOM 1714  H H    . LYS A 1 38 ? 8.064   -19.075 4.188   1.00 0.00 ? 38 LYS A H    2  
ATOM 1715  H HA   . LYS A 1 38 ? 6.316   -20.296 2.342   1.00 0.00 ? 38 LYS A HA   2  
ATOM 1716  H HB2  . LYS A 1 38 ? 8.074   -21.359 4.540   1.00 0.00 ? 38 LYS A HB2  2  
ATOM 1717  H HB3  . LYS A 1 38 ? 7.046   -22.430 3.596   1.00 0.00 ? 38 LYS A HB3  2  
ATOM 1718  H HG2  . LYS A 1 38 ? 8.222   -22.017 1.624   1.00 0.00 ? 38 LYS A HG2  2  
ATOM 1719  H HG3  . LYS A 1 38 ? 8.975   -20.558 2.272   1.00 0.00 ? 38 LYS A HG3  2  
ATOM 1720  H HD2  . LYS A 1 38 ? 10.637  -22.272 2.229   1.00 0.00 ? 38 LYS A HD2  2  
ATOM 1721  H HD3  . LYS A 1 38 ? 10.181  -22.014 3.915   1.00 0.00 ? 38 LYS A HD3  2  
ATOM 1722  H HE2  . LYS A 1 38 ? 8.468   -23.942 3.404   1.00 0.00 ? 38 LYS A HE2  2  
ATOM 1723  H HE3  . LYS A 1 38 ? 9.611   -24.324 2.117   1.00 0.00 ? 38 LYS A HE3  2  
ATOM 1724  H HZ1  . LYS A 1 38 ? 10.809  -23.856 4.707   1.00 0.00 ? 38 LYS A HZ1  2  
ATOM 1725  H HZ2  . LYS A 1 38 ? 11.123  -25.070 3.572   1.00 0.00 ? 38 LYS A HZ2  2  
ATOM 1726  H HZ3  . LYS A 1 38 ? 9.812   -25.221 4.631   1.00 0.00 ? 38 LYS A HZ3  2  
ATOM 1727  N N    . ARG A 1 39 ? 5.435   -20.545 5.519   1.00 0.00 ? 39 ARG A N    2  
ATOM 1728  C CA   . ARG A 1 39 ? 4.303   -20.783 6.405   1.00 0.00 ? 39 ARG A CA   2  
ATOM 1729  C C    . ARG A 1 39 ? 3.258   -19.680 6.261   1.00 0.00 ? 39 ARG A C    2  
ATOM 1730  O O    . ARG A 1 39 ? 2.057   -19.949 6.221   1.00 0.00 ? 39 ARG A O    2  
ATOM 1731  C CB   . ARG A 1 39 ? 4.774   -20.868 7.858   1.00 0.00 ? 39 ARG A CB   2  
ATOM 1732  C CG   . ARG A 1 39 ? 5.892   -21.874 8.077   1.00 0.00 ? 39 ARG A CG   2  
ATOM 1733  C CD   . ARG A 1 39 ? 6.032   -22.240 9.547   1.00 0.00 ? 39 ARG A CD   2  
ATOM 1734  N NE   . ARG A 1 39 ? 6.593   -23.576 9.727   1.00 0.00 ? 39 ARG A NE   2  
ATOM 1735  C CZ   . ARG A 1 39 ? 7.232   -23.963 10.826  1.00 0.00 ? 39 ARG A CZ   2  
ATOM 1736  N NH1  . ARG A 1 39 ? 7.390   -23.119 11.836  1.00 0.00 ? 39 ARG A NH1  2  
ATOM 1737  N NH2  . ARG A 1 39 ? 7.713   -25.196 10.915  1.00 0.00 ? 39 ARG A NH2  2  
ATOM 1738  H H    . ARG A 1 39 ? 6.307   -20.318 5.907   1.00 0.00 ? 39 ARG A H    2  
ATOM 1739  H HA   . ARG A 1 39 ? 3.855   -21.725 6.125   1.00 0.00 ? 39 ARG A HA   2  
ATOM 1740  H HB2  . ARG A 1 39 ? 5.128   -19.896 8.167   1.00 0.00 ? 39 ARG A HB2  2  
ATOM 1741  H HB3  . ARG A 1 39 ? 3.937   -21.152 8.479   1.00 0.00 ? 39 ARG A HB3  2  
ATOM 1742  H HG2  . ARG A 1 39 ? 5.674   -22.770 7.514   1.00 0.00 ? 39 ARG A HG2  2  
ATOM 1743  H HG3  . ARG A 1 39 ? 6.821   -21.446 7.731   1.00 0.00 ? 39 ARG A HG3  2  
ATOM 1744  H HD2  . ARG A 1 39 ? 6.682   -21.520 10.023  1.00 0.00 ? 39 ARG A HD2  2  
ATOM 1745  H HD3  . ARG A 1 39 ? 5.056   -22.203 10.007  1.00 0.00 ? 39 ARG A HD3  2  
ATOM 1746  H HE   . ARG A 1 39 ? 6.487   -24.216 8.993   1.00 0.00 ? 39 ARG A HE   2  
ATOM 1747  H HH11 . ARG A 1 39 ? 7.028   -22.190 11.772  1.00 0.00 ? 39 ARG A HH11 2  
ATOM 1748  H HH12 . ARG A 1 39 ? 7.871   -23.413 12.663  1.00 0.00 ? 39 ARG A HH12 2  
ATOM 1749  H HH21 . ARG A 1 39 ? 7.596   -25.835 10.156  1.00 0.00 ? 39 ARG A HH21 2  
ATOM 1750  H HH22 . ARG A 1 39 ? 8.194   -25.486 11.742  1.00 0.00 ? 39 ARG A HH22 2  
ATOM 1751  N N    . LEU A 1 40 ? 3.724   -18.438 6.186   1.00 0.00 ? 40 LEU A N    2  
ATOM 1752  C CA   . LEU A 1 40 ? 2.831   -17.293 6.047   1.00 0.00 ? 40 LEU A CA   2  
ATOM 1753  C C    . LEU A 1 40 ? 1.854   -17.501 4.894   1.00 0.00 ? 40 LEU A C    2  
ATOM 1754  O O    . LEU A 1 40 ? 0.640   -17.401 5.069   1.00 0.00 ? 40 LEU A O    2  
ATOM 1755  C CB   . LEU A 1 40 ? 3.639   -16.015 5.822   1.00 0.00 ? 40 LEU A CB   2  
ATOM 1756  C CG   . LEU A 1 40 ? 2.898   -14.700 6.066   1.00 0.00 ? 40 LEU A CG   2  
ATOM 1757  C CD1  . LEU A 1 40 ? 2.605   -14.519 7.548   1.00 0.00 ? 40 LEU A CD1  2  
ATOM 1758  C CD2  . LEU A 1 40 ? 3.705   -13.525 5.533   1.00 0.00 ? 40 LEU A CD2  2  
ATOM 1759  H H    . LEU A 1 40 ? 4.691   -18.286 6.223   1.00 0.00 ? 40 LEU A H    2  
ATOM 1760  H HA   . LEU A 1 40 ? 2.269   -17.198 6.965   1.00 0.00 ? 40 LEU A HA   2  
ATOM 1761  H HB2  . LEU A 1 40 ? 4.491   -16.041 6.485   1.00 0.00 ? 40 LEU A HB2  2  
ATOM 1762  H HB3  . LEU A 1 40 ? 3.982   -16.017 4.798   1.00 0.00 ? 40 LEU A HB3  2  
ATOM 1763  H HG   . LEU A 1 40 ? 1.953   -14.724 5.541   1.00 0.00 ? 40 LEU A HG   2  
ATOM 1764  H HD11 . LEU A 1 40 ? 2.058   -13.601 7.697   1.00 0.00 ? 40 LEU A HD11 2  
ATOM 1765  H HD12 . LEU A 1 40 ? 3.535   -14.477 8.096   1.00 0.00 ? 40 LEU A HD12 2  
ATOM 1766  H HD13 . LEU A 1 40 ? 2.016   -15.352 7.903   1.00 0.00 ? 40 LEU A HD13 2  
ATOM 1767  H HD21 . LEU A 1 40 ? 3.058   -12.873 4.965   1.00 0.00 ? 40 LEU A HD21 2  
ATOM 1768  H HD22 . LEU A 1 40 ? 4.495   -13.892 4.894   1.00 0.00 ? 40 LEU A HD22 2  
ATOM 1769  H HD23 . LEU A 1 40 ? 4.133   -12.978 6.359   1.00 0.00 ? 40 LEU A HD23 2  
ATOM 1770  N N    . ALA A 1 41 ? 2.393   -17.792 3.714   1.00 0.00 ? 41 ALA A N    2  
ATOM 1771  C CA   . ALA A 1 41 ? 1.570   -18.018 2.533   1.00 0.00 ? 41 ALA A CA   2  
ATOM 1772  C C    . ALA A 1 41 ? 0.449   -19.009 2.826   1.00 0.00 ? 41 ALA A C    2  
ATOM 1773  O O    . ALA A 1 41 ? -0.597  -18.989 2.178   1.00 0.00 ? 41 ALA A O    2  
ATOM 1774  C CB   . ALA A 1 41 ? 2.428   -18.514 1.379   1.00 0.00 ? 41 ALA A CB   2  
ATOM 1775  H H    . ALA A 1 41 ? 3.368   -17.858 3.637   1.00 0.00 ? 41 ALA A H    2  
ATOM 1776  H HA   . ALA A 1 41 ? 1.134   -17.072 2.244   1.00 0.00 ? 41 ALA A HA   2  
ATOM 1777  H HB1  . ALA A 1 41 ? 1.916   -19.318 0.870   1.00 0.00 ? 41 ALA A HB1  2  
ATOM 1778  H HB2  . ALA A 1 41 ? 2.604   -17.704 0.686   1.00 0.00 ? 41 ALA A HB2  2  
ATOM 1779  H HB3  . ALA A 1 41 ? 3.372   -18.873 1.761   1.00 0.00 ? 41 ALA A HB3  2  
ATOM 1780  N N    . LYS A 1 42 ? 0.675   -19.877 3.806   1.00 0.00 ? 42 LYS A N    2  
ATOM 1781  C CA   . LYS A 1 42 ? -0.315  -20.877 4.187   1.00 0.00 ? 42 LYS A CA   2  
ATOM 1782  C C    . LYS A 1 42 ? -1.301  -20.308 5.202   1.00 0.00 ? 42 LYS A C    2  
ATOM 1783  O O    . LYS A 1 42 ? -2.481  -20.659 5.200   1.00 0.00 ? 42 LYS A O    2  
ATOM 1784  C CB   . LYS A 1 42 ? 0.375   -22.113 4.769   1.00 0.00 ? 42 LYS A CB   2  
ATOM 1785  C CG   . LYS A 1 42 ? -0.590  -23.133 5.347   1.00 0.00 ? 42 LYS A CG   2  
ATOM 1786  C CD   . LYS A 1 42 ? -1.080  -24.103 4.284   1.00 0.00 ? 42 LYS A CD   2  
ATOM 1787  C CE   . LYS A 1 42 ? -2.128  -25.055 4.839   1.00 0.00 ? 42 LYS A CE   2  
ATOM 1788  N NZ   . LYS A 1 42 ? -2.505  -26.103 3.850   1.00 0.00 ? 42 LYS A NZ   2  
ATOM 1789  H H    . LYS A 1 42 ? 1.530   -19.844 4.287   1.00 0.00 ? 42 LYS A H    2  
ATOM 1790  H HA   . LYS A 1 42 ? -0.857  -21.163 3.298   1.00 0.00 ? 42 LYS A HA   2  
ATOM 1791  H HB2  . LYS A 1 42 ? 0.947   -22.592 3.988   1.00 0.00 ? 42 LYS A HB2  2  
ATOM 1792  H HB3  . LYS A 1 42 ? 1.047   -21.799 5.554   1.00 0.00 ? 42 LYS A HB3  2  
ATOM 1793  H HG2  . LYS A 1 42 ? -0.088  -23.691 6.124   1.00 0.00 ? 42 LYS A HG2  2  
ATOM 1794  H HG3  . LYS A 1 42 ? -1.440  -22.614 5.767   1.00 0.00 ? 42 LYS A HG3  2  
ATOM 1795  H HD2  . LYS A 1 42 ? -1.515  -23.542 3.471   1.00 0.00 ? 42 LYS A HD2  2  
ATOM 1796  H HD3  . LYS A 1 42 ? -0.240  -24.677 3.920   1.00 0.00 ? 42 LYS A HD3  2  
ATOM 1797  H HE2  . LYS A 1 42 ? -1.730  -25.532 5.722   1.00 0.00 ? 42 LYS A HE2  2  
ATOM 1798  H HE3  . LYS A 1 42 ? -3.008  -24.487 5.103   1.00 0.00 ? 42 LYS A HE3  2  
ATOM 1799  H HZ1  . LYS A 1 42 ? -3.534  -26.249 3.860   1.00 0.00 ? 42 LYS A HZ1  2  
ATOM 1800  H HZ2  . LYS A 1 42 ? -2.036  -27.001 4.085   1.00 0.00 ? 42 LYS A HZ2  2  
ATOM 1801  H HZ3  . LYS A 1 42 ? -2.215  -25.813 2.895   1.00 0.00 ? 42 LYS A HZ3  2  
ATOM 1802  N N    . MET A 1 43 ? -0.811  -19.426 6.066   1.00 0.00 ? 43 MET A N    2  
ATOM 1803  C CA   . MET A 1 43 ? -1.650  -18.806 7.085   1.00 0.00 ? 43 MET A CA   2  
ATOM 1804  C C    . MET A 1 43 ? -2.654  -17.847 6.452   1.00 0.00 ? 43 MET A C    2  
ATOM 1805  O O    . MET A 1 43 ? -3.834  -17.847 6.803   1.00 0.00 ? 43 MET A O    2  
ATOM 1806  C CB   . MET A 1 43 ? -0.787  -18.060 8.104   1.00 0.00 ? 43 MET A CB   2  
ATOM 1807  C CG   . MET A 1 43 ? -1.565  -17.063 8.946   1.00 0.00 ? 43 MET A CG   2  
ATOM 1808  S SD   . MET A 1 43 ? -0.831  -16.805 10.573  1.00 0.00 ? 43 MET A SD   2  
ATOM 1809  C CE   . MET A 1 43 ? 0.571   -15.774 10.151  1.00 0.00 ? 43 MET A CE   2  
ATOM 1810  H H    . MET A 1 43 ? 0.138   -19.185 6.019   1.00 0.00 ? 43 MET A H    2  
ATOM 1811  H HA   . MET A 1 43 ? -2.191  -19.592 7.591   1.00 0.00 ? 43 MET A HA   2  
ATOM 1812  H HB2  . MET A 1 43 ? -0.330  -18.780 8.767   1.00 0.00 ? 43 MET A HB2  2  
ATOM 1813  H HB3  . MET A 1 43 ? -0.011  -17.525 7.577   1.00 0.00 ? 43 MET A HB3  2  
ATOM 1814  H HG2  . MET A 1 43 ? -1.594  -16.117 8.426   1.00 0.00 ? 43 MET A HG2  2  
ATOM 1815  H HG3  . MET A 1 43 ? -2.573  -17.431 9.075   1.00 0.00 ? 43 MET A HG3  2  
ATOM 1816  H HE1  . MET A 1 43 ? 0.250   -14.979 9.495   1.00 0.00 ? 43 MET A HE1  2  
ATOM 1817  H HE2  . MET A 1 43 ? 0.989   -15.350 11.052  1.00 0.00 ? 43 MET A HE2  2  
ATOM 1818  H HE3  . MET A 1 43 ? 1.320   -16.372 9.653   1.00 0.00 ? 43 MET A HE3  2  
ATOM 1819  N N    . LEU A 1 44 ? -2.177  -17.031 5.519   1.00 0.00 ? 44 LEU A N    2  
ATOM 1820  C CA   . LEU A 1 44 ? -3.033  -16.066 4.837   1.00 0.00 ? 44 LEU A CA   2  
ATOM 1821  C C    . LEU A 1 44 ? -3.635  -16.670 3.572   1.00 0.00 ? 44 LEU A C    2  
ATOM 1822  O O    . LEU A 1 44 ? -4.303  -15.981 2.802   1.00 0.00 ? 44 LEU A O    2  
ATOM 1823  C CB   . LEU A 1 44 ? -2.237  -14.807 4.486   1.00 0.00 ? 44 LEU A CB   2  
ATOM 1824  C CG   . LEU A 1 44 ? -1.410  -14.198 5.619   1.00 0.00 ? 44 LEU A CG   2  
ATOM 1825  C CD1  . LEU A 1 44 ? -0.384  -13.222 5.065   1.00 0.00 ? 44 LEU A CD1  2  
ATOM 1826  C CD2  . LEU A 1 44 ? -2.315  -13.508 6.629   1.00 0.00 ? 44 LEU A CD2  2  
ATOM 1827  H H    . LEU A 1 44 ? -1.228  -17.077 5.282   1.00 0.00 ? 44 LEU A H    2  
ATOM 1828  H HA   . LEU A 1 44 ? -3.834  -15.799 5.511   1.00 0.00 ? 44 LEU A HA   2  
ATOM 1829  H HB2  . LEU A 1 44 ? -1.563  -15.057 3.681   1.00 0.00 ? 44 LEU A HB2  2  
ATOM 1830  H HB3  . LEU A 1 44 ? -2.938  -14.058 4.147   1.00 0.00 ? 44 LEU A HB3  2  
ATOM 1831  H HG   . LEU A 1 44 ? -0.877  -14.987 6.131   1.00 0.00 ? 44 LEU A HG   2  
ATOM 1832  H HD11 . LEU A 1 44 ? 0.092   -12.699 5.881   1.00 0.00 ? 44 LEU A HD11 2  
ATOM 1833  H HD12 . LEU A 1 44 ? -0.877  -12.510 4.420   1.00 0.00 ? 44 LEU A HD12 2  
ATOM 1834  H HD13 . LEU A 1 44 ? 0.360   -13.764 4.500   1.00 0.00 ? 44 LEU A HD13 2  
ATOM 1835  H HD21 . LEU A 1 44 ? -1.764  -12.726 7.130   1.00 0.00 ? 44 LEU A HD21 2  
ATOM 1836  H HD22 . LEU A 1 44 ? -2.658  -14.230 7.356   1.00 0.00 ? 44 LEU A HD22 2  
ATOM 1837  H HD23 . LEU A 1 44 ? -3.164  -13.080 6.117   1.00 0.00 ? 44 LEU A HD23 2  
ATOM 1838  N N    . GLN A 1 45 ? -3.395  -17.961 3.368   1.00 0.00 ? 45 GLN A N    2  
ATOM 1839  C CA   . GLN A 1 45 ? -3.915  -18.658 2.197   1.00 0.00 ? 45 GLN A CA   2  
ATOM 1840  C C    . GLN A 1 45 ? -3.368  -18.046 0.912   1.00 0.00 ? 45 GLN A C    2  
ATOM 1841  O O    . GLN A 1 45 ? -4.001  -18.119 -0.142  1.00 0.00 ? 45 GLN A O    2  
ATOM 1842  C CB   . GLN A 1 45 ? -5.444  -18.611 2.187   1.00 0.00 ? 45 GLN A CB   2  
ATOM 1843  C CG   . GLN A 1 45 ? -6.087  -19.526 3.217   1.00 0.00 ? 45 GLN A CG   2  
ATOM 1844  C CD   . GLN A 1 45 ? -7.596  -19.583 3.086   1.00 0.00 ? 45 GLN A CD   2  
ATOM 1845  O OE1  . GLN A 1 45 ? -8.129  -19.803 1.997   1.00 0.00 ? 45 GLN A OE1  2  
ATOM 1846  N NE2  . GLN A 1 45 ? -8.295  -19.384 4.197   1.00 0.00 ? 45 GLN A NE2  2  
ATOM 1847  H H    . GLN A 1 45 ? -2.855  -18.456 4.018   1.00 0.00 ? 45 GLN A H    2  
ATOM 1848  H HA   . GLN A 1 45 ? -3.596  -19.687 2.255   1.00 0.00 ? 45 GLN A HA   2  
ATOM 1849  H HB2  . GLN A 1 45 ? -5.763  -17.599 2.387   1.00 0.00 ? 45 GLN A HB2  2  
ATOM 1850  H HB3  . GLN A 1 45 ? -5.795  -18.904 1.209   1.00 0.00 ? 45 GLN A HB3  2  
ATOM 1851  H HG2  . GLN A 1 45 ? -5.693  -20.524 3.089   1.00 0.00 ? 45 GLN A HG2  2  
ATOM 1852  H HG3  . GLN A 1 45 ? -5.839  -19.166 4.204   1.00 0.00 ? 45 GLN A HG3  2  
ATOM 1853  H HE21 . GLN A 1 45 ? -7.804  -19.213 5.028   1.00 0.00 ? 45 GLN A HE21 2  
ATOM 1854  H HE22 . GLN A 1 45 ? -9.272  -19.414 4.141   1.00 0.00 ? 45 GLN A HE22 2  
ATOM 1855  N N    . LEU A 1 46 ? -2.188  -17.442 1.005   1.00 0.00 ? 46 LEU A N    2  
ATOM 1856  C CA   . LEU A 1 46 ? -1.555  -16.817 -0.151  1.00 0.00 ? 46 LEU A CA   2  
ATOM 1857  C C    . LEU A 1 46 ? -0.441  -17.699 -0.705  1.00 0.00 ? 46 LEU A C    2  
ATOM 1858  O O    . LEU A 1 46 ? -0.183  -18.787 -0.190  1.00 0.00 ? 46 LEU A O    2  
ATOM 1859  C CB   . LEU A 1 46 ? -0.993  -15.446 0.230   1.00 0.00 ? 46 LEU A CB   2  
ATOM 1860  C CG   . LEU A 1 46 ? -1.945  -14.516 0.982   1.00 0.00 ? 46 LEU A CG   2  
ATOM 1861  C CD1  . LEU A 1 46 ? -1.166  -13.438 1.721   1.00 0.00 ? 46 LEU A CD1  2  
ATOM 1862  C CD2  . LEU A 1 46 ? -2.946  -13.889 0.022   1.00 0.00 ? 46 LEU A CD2  2  
ATOM 1863  H H    . LEU A 1 46 ? -1.731  -17.416 1.871   1.00 0.00 ? 46 LEU A H    2  
ATOM 1864  H HA   . LEU A 1 46 ? -2.309  -16.688 -0.913  1.00 0.00 ? 46 LEU A HA   2  
ATOM 1865  H HB2  . LEU A 1 46 ? -0.127  -15.606 0.854   1.00 0.00 ? 46 LEU A HB2  2  
ATOM 1866  H HB3  . LEU A 1 46 ? -0.692  -14.948 -0.680  1.00 0.00 ? 46 LEU A HB3  2  
ATOM 1867  H HG   . LEU A 1 46 ? -2.496  -15.090 1.714   1.00 0.00 ? 46 LEU A HG   2  
ATOM 1868  H HD11 . LEU A 1 46 ? -0.293  -13.876 2.180   1.00 0.00 ? 46 LEU A HD11 2  
ATOM 1869  H HD12 . LEU A 1 46 ? -1.793  -13.001 2.484   1.00 0.00 ? 46 LEU A HD12 2  
ATOM 1870  H HD13 . LEU A 1 46 ? -0.862  -12.672 1.023   1.00 0.00 ? 46 LEU A HD13 2  
ATOM 1871  H HD21 . LEU A 1 46 ? -3.452  -13.071 0.514   1.00 0.00 ? 46 LEU A HD21 2  
ATOM 1872  H HD22 . LEU A 1 46 ? -3.672  -14.632 -0.277  1.00 0.00 ? 46 LEU A HD22 2  
ATOM 1873  H HD23 . LEU A 1 46 ? -2.427  -13.520 -0.850  1.00 0.00 ? 46 LEU A HD23 2  
ATOM 1874  N N    . SER A 1 47 ? 0.216   -17.223 -1.758  1.00 0.00 ? 47 SER A N    2  
ATOM 1875  C CA   . SER A 1 47 ? 1.301   -17.969 -2.384  1.00 0.00 ? 47 SER A CA   2  
ATOM 1876  C C    . SER A 1 47 ? 2.646   -17.300 -2.117  1.00 0.00 ? 47 SER A C    2  
ATOM 1877  O O    . SER A 1 47 ? 2.753   -16.074 -2.128  1.00 0.00 ? 47 SER A O    2  
ATOM 1878  C CB   . SER A 1 47 ? 1.066   -18.084 -3.891  1.00 0.00 ? 47 SER A CB   2  
ATOM 1879  O OG   . SER A 1 47 ? 2.240   -18.514 -4.559  1.00 0.00 ? 47 SER A OG   2  
ATOM 1880  H H    . SER A 1 47 ? -0.037  -16.349 -2.124  1.00 0.00 ? 47 SER A H    2  
ATOM 1881  H HA   . SER A 1 47 ? 1.313   -18.959 -1.953  1.00 0.00 ? 47 SER A HA   2  
ATOM 1882  H HB2  . SER A 1 47 ? 0.279   -18.799 -4.077  1.00 0.00 ? 47 SER A HB2  2  
ATOM 1883  H HB3  . SER A 1 47 ? 0.776   -17.120 -4.282  1.00 0.00 ? 47 SER A HB3  2  
ATOM 1884  H HG   . SER A 1 47 ? 2.680   -19.186 -4.033  1.00 0.00 ? 47 SER A HG   2  
ATOM 1885  N N    . GLU A 1 48 ? 3.668   -18.114 -1.877  1.00 0.00 ? 48 GLU A N    2  
ATOM 1886  C CA   . GLU A 1 48 ? 5.006   -17.601 -1.607  1.00 0.00 ? 48 GLU A CA   2  
ATOM 1887  C C    . GLU A 1 48 ? 5.322   -16.406 -2.502  1.00 0.00 ? 48 GLU A C    2  
ATOM 1888  O O    . GLU A 1 48 ? 5.977   -15.455 -2.077  1.00 0.00 ? 48 GLU A O    2  
ATOM 1889  C CB   . GLU A 1 48 ? 6.050   -18.700 -1.816  1.00 0.00 ? 48 GLU A CB   2  
ATOM 1890  C CG   . GLU A 1 48 ? 6.230   -19.606 -0.610  1.00 0.00 ? 48 GLU A CG   2  
ATOM 1891  C CD   . GLU A 1 48 ? 7.223   -20.724 -0.864  1.00 0.00 ? 48 GLU A CD   2  
ATOM 1892  O OE1  . GLU A 1 48 ? 8.306   -20.441 -1.418  1.00 0.00 ? 48 GLU A OE1  2  
ATOM 1893  O OE2  . GLU A 1 48 ? 6.917   -21.882 -0.510  1.00 0.00 ? 48 GLU A OE2  2  
ATOM 1894  H H    . GLU A 1 48 ? 3.520   -19.083 -1.883  1.00 0.00 ? 48 GLU A H    2  
ATOM 1895  H HA   . GLU A 1 48 ? 5.036   -17.281 -0.576  1.00 0.00 ? 48 GLU A HA   2  
ATOM 1896  H HB2  . GLU A 1 48 ? 5.751   -19.308 -2.657  1.00 0.00 ? 48 GLU A HB2  2  
ATOM 1897  H HB3  . GLU A 1 48 ? 7.001   -18.238 -2.038  1.00 0.00 ? 48 GLU A HB3  2  
ATOM 1898  H HG2  . GLU A 1 48 ? 6.584   -19.013 0.220   1.00 0.00 ? 48 GLU A HG2  2  
ATOM 1899  H HG3  . GLU A 1 48 ? 5.275   -20.043 -0.358  1.00 0.00 ? 48 GLU A HG3  2  
ATOM 1900  N N    . ARG A 1 49 ? 4.851   -16.464 -3.744  1.00 0.00 ? 49 ARG A N    2  
ATOM 1901  C CA   . ARG A 1 49 ? 5.084   -15.389 -4.700  1.00 0.00 ? 49 ARG A CA   2  
ATOM 1902  C C    . ARG A 1 49 ? 4.343   -14.121 -4.284  1.00 0.00 ? 49 ARG A C    2  
ATOM 1903  O O    . ARG A 1 49 ? 4.884   -13.019 -4.371  1.00 0.00 ? 49 ARG A O    2  
ATOM 1904  C CB   . ARG A 1 49 ? 4.639   -15.817 -6.100  1.00 0.00 ? 49 ARG A CB   2  
ATOM 1905  C CG   . ARG A 1 49 ? 4.895   -14.766 -7.168  1.00 0.00 ? 49 ARG A CG   2  
ATOM 1906  C CD   . ARG A 1 49 ? 4.807   -15.360 -8.565  1.00 0.00 ? 49 ARG A CD   2  
ATOM 1907  N NE   . ARG A 1 49 ? 3.424   -15.502 -9.014  1.00 0.00 ? 49 ARG A NE   2  
ATOM 1908  C CZ   . ARG A 1 49 ? 3.080   -15.712 -10.279 1.00 0.00 ? 49 ARG A CZ   2  
ATOM 1909  N NH1  . ARG A 1 49 ? 4.012   -15.805 -11.217 1.00 0.00 ? 49 ARG A NH1  2  
ATOM 1910  N NH2  . ARG A 1 49 ? 1.800   -15.831 -10.609 1.00 0.00 ? 49 ARG A NH2  2  
ATOM 1911  H H    . ARG A 1 49 ? 4.335   -17.249 -4.024  1.00 0.00 ? 49 ARG A H    2  
ATOM 1912  H HA   . ARG A 1 49 ? 6.144   -15.183 -4.716  1.00 0.00 ? 49 ARG A HA   2  
ATOM 1913  H HB2  . ARG A 1 49 ? 5.171   -16.715 -6.375  1.00 0.00 ? 49 ARG A HB2  2  
ATOM 1914  H HB3  . ARG A 1 49 ? 3.580   -16.027 -6.079  1.00 0.00 ? 49 ARG A HB3  2  
ATOM 1915  H HG2  . ARG A 1 49 ? 4.156   -13.984 -7.074  1.00 0.00 ? 49 ARG A HG2  2  
ATOM 1916  H HG3  . ARG A 1 49 ? 5.881   -14.352 -7.023  1.00 0.00 ? 49 ARG A HG3  2  
ATOM 1917  H HD2  . ARG A 1 49 ? 5.332   -14.712 -9.251  1.00 0.00 ? 49 ARG A HD2  2  
ATOM 1918  H HD3  . ARG A 1 49 ? 5.275   -16.332 -8.558  1.00 0.00 ? 49 ARG A HD3  2  
ATOM 1919  H HE   . ARG A 1 49 ? 2.719   -15.436 -8.337  1.00 0.00 ? 49 ARG A HE   2  
ATOM 1920  H HH11 . ARG A 1 49 ? 4.978   -15.717 -10.971 1.00 0.00 ? 49 ARG A HH11 2  
ATOM 1921  H HH12 . ARG A 1 49 ? 3.751   -15.965 -12.169 1.00 0.00 ? 49 ARG A HH12 2  
ATOM 1922  H HH21 . ARG A 1 49 ? 1.094   -15.762 -9.905  1.00 0.00 ? 49 ARG A HH21 2  
ATOM 1923  H HH22 . ARG A 1 49 ? 1.542   -15.989 -11.561 1.00 0.00 ? 49 ARG A HH22 2  
ATOM 1924  N N    . GLN A 1 50 ? 3.104   -14.287 -3.834  1.00 0.00 ? 50 GLN A N    2  
ATOM 1925  C CA   . GLN A 1 50 ? 2.289   -13.156 -3.406  1.00 0.00 ? 50 GLN A CA   2  
ATOM 1926  C C    . GLN A 1 50 ? 2.875   -12.504 -2.158  1.00 0.00 ? 50 GLN A C    2  
ATOM 1927  O O    . GLN A 1 50 ? 2.687   -11.311 -1.922  1.00 0.00 ? 50 GLN A O    2  
ATOM 1928  C CB   . GLN A 1 50 ? 0.854   -13.609 -3.133  1.00 0.00 ? 50 GLN A CB   2  
ATOM 1929  C CG   . GLN A 1 50 ? 0.026   -13.799 -4.394  1.00 0.00 ? 50 GLN A CG   2  
ATOM 1930  C CD   . GLN A 1 50 ? -1.240  -14.597 -4.146  1.00 0.00 ? 50 GLN A CD   2  
ATOM 1931  O OE1  . GLN A 1 50 ? -1.351  -15.751 -4.561  1.00 0.00 ? 50 GLN A OE1  2  
ATOM 1932  N NE2  . GLN A 1 50 ? -2.202  -13.984 -3.466  1.00 0.00 ? 50 GLN A NE2  2  
ATOM 1933  H H    . GLN A 1 50 ? 2.729   -15.191 -3.788  1.00 0.00 ? 50 GLN A H    2  
ATOM 1934  H HA   . GLN A 1 50 ? 2.282   -12.432 -4.206  1.00 0.00 ? 50 GLN A HA   2  
ATOM 1935  H HB2  . GLN A 1 50 ? 0.880   -14.547 -2.600  1.00 0.00 ? 50 GLN A HB2  2  
ATOM 1936  H HB3  . GLN A 1 50 ? 0.366   -12.868 -2.517  1.00 0.00 ? 50 GLN A HB3  2  
ATOM 1937  H HG2  . GLN A 1 50 ? -0.249  -12.829 -4.779  1.00 0.00 ? 50 GLN A HG2  2  
ATOM 1938  H HG3  . GLN A 1 50 ? 0.624   -14.320 -5.126  1.00 0.00 ? 50 GLN A HG3  2  
ATOM 1939  H HE21 . GLN A 1 50 ? -2.043  -13.064 -3.167  1.00 0.00 ? 50 GLN A HE21 2  
ATOM 1940  H HE22 . GLN A 1 50 ? -3.030  -14.476 -3.292  1.00 0.00 ? 50 GLN A HE22 2  
ATOM 1941  N N    . VAL A 1 51 ? 3.587   -13.295 -1.361  1.00 0.00 ? 51 VAL A N    2  
ATOM 1942  C CA   . VAL A 1 51 ? 4.201   -12.795 -0.138  1.00 0.00 ? 51 VAL A CA   2  
ATOM 1943  C C    . VAL A 1 51 ? 5.603   -12.259 -0.406  1.00 0.00 ? 51 VAL A C    2  
ATOM 1944  O O    . VAL A 1 51 ? 6.090   -11.379 0.304   1.00 0.00 ? 51 VAL A O    2  
ATOM 1945  C CB   . VAL A 1 51 ? 4.281   -13.893 0.940   1.00 0.00 ? 51 VAL A CB   2  
ATOM 1946  C CG1  . VAL A 1 51 ? 4.741   -13.307 2.266   1.00 0.00 ? 51 VAL A CG1  2  
ATOM 1947  C CG2  . VAL A 1 51 ? 2.937   -14.588 1.092   1.00 0.00 ? 51 VAL A CG2  2  
ATOM 1948  H H    . VAL A 1 51 ? 3.702   -14.238 -1.603  1.00 0.00 ? 51 VAL A H    2  
ATOM 1949  H HA   . VAL A 1 51 ? 3.586   -11.992 0.241   1.00 0.00 ? 51 VAL A HA   2  
ATOM 1950  H HB   . VAL A 1 51 ? 5.008   -14.626 0.624   1.00 0.00 ? 51 VAL A HB   2  
ATOM 1951  H HG11 . VAL A 1 51 ? 3.911   -12.810 2.747   1.00 0.00 ? 51 VAL A HG11 2  
ATOM 1952  H HG12 . VAL A 1 51 ? 5.106   -14.100 2.903   1.00 0.00 ? 51 VAL A HG12 2  
ATOM 1953  H HG13 . VAL A 1 51 ? 5.532   -12.594 2.089   1.00 0.00 ? 51 VAL A HG13 2  
ATOM 1954  H HG21 . VAL A 1 51 ? 2.143   -13.878 0.915   1.00 0.00 ? 51 VAL A HG21 2  
ATOM 1955  H HG22 . VAL A 1 51 ? 2.864   -15.394 0.376   1.00 0.00 ? 51 VAL A HG22 2  
ATOM 1956  H HG23 . VAL A 1 51 ? 2.848   -14.987 2.092   1.00 0.00 ? 51 VAL A HG23 2  
ATOM 1957  N N    . LYS A 1 52 ? 6.248   -12.794 -1.437  1.00 0.00 ? 52 LYS A N    2  
ATOM 1958  C CA   . LYS A 1 52 ? 7.594   -12.369 -1.802  1.00 0.00 ? 52 LYS A CA   2  
ATOM 1959  C C    . LYS A 1 52 ? 7.550   -11.144 -2.710  1.00 0.00 ? 52 LYS A C    2  
ATOM 1960  O O    . LYS A 1 52 ? 8.477   -10.333 -2.721  1.00 0.00 ? 52 LYS A O    2  
ATOM 1961  C CB   . LYS A 1 52 ? 8.338   -13.509 -2.502  1.00 0.00 ? 52 LYS A CB   2  
ATOM 1962  C CG   . LYS A 1 52 ? 8.142   -13.530 -4.008  1.00 0.00 ? 52 LYS A CG   2  
ATOM 1963  C CD   . LYS A 1 52 ? 9.192   -12.692 -4.719  1.00 0.00 ? 52 LYS A CD   2  
ATOM 1964  C CE   . LYS A 1 52 ? 9.481   -13.227 -6.113  1.00 0.00 ? 52 LYS A CE   2  
ATOM 1965  N NZ   . LYS A 1 52 ? 10.532  -14.281 -6.096  1.00 0.00 ? 52 LYS A NZ   2  
ATOM 1966  H H    . LYS A 1 52 ? 5.807   -13.492 -1.966  1.00 0.00 ? 52 LYS A H    2  
ATOM 1967  H HA   . LYS A 1 52 ? 8.118   -12.112 -0.895  1.00 0.00 ? 52 LYS A HA   2  
ATOM 1968  H HB2  . LYS A 1 52 ? 9.395   -13.411 -2.299  1.00 0.00 ? 52 LYS A HB2  2  
ATOM 1969  H HB3  . LYS A 1 52 ? 7.990   -14.450 -2.101  1.00 0.00 ? 52 LYS A HB3  2  
ATOM 1970  H HG2  . LYS A 1 52 ? 8.213   -14.549 -4.357  1.00 0.00 ? 52 LYS A HG2  2  
ATOM 1971  H HG3  . LYS A 1 52 ? 7.162   -13.136 -4.239  1.00 0.00 ? 52 LYS A HG3  2  
ATOM 1972  H HD2  . LYS A 1 52 ? 8.834   -11.677 -4.802  1.00 0.00 ? 52 LYS A HD2  2  
ATOM 1973  H HD3  . LYS A 1 52 ? 10.105  -12.708 -4.140  1.00 0.00 ? 52 LYS A HD3  2  
ATOM 1974  H HE2  . LYS A 1 52 ? 8.572   -13.644 -6.520  1.00 0.00 ? 52 LYS A HE2  2  
ATOM 1975  H HE3  . LYS A 1 52 ? 9.812   -12.410 -6.736  1.00 0.00 ? 52 LYS A HE3  2  
ATOM 1976  H HZ1  . LYS A 1 52 ? 11.432  -13.883 -5.758  1.00 0.00 ? 52 LYS A HZ1  2  
ATOM 1977  H HZ2  . LYS A 1 52 ? 10.673  -14.662 -7.053  1.00 0.00 ? 52 LYS A HZ2  2  
ATOM 1978  H HZ3  . LYS A 1 52 ? 10.250  -15.058 -5.464  1.00 0.00 ? 52 LYS A HZ3  2  
ATOM 1979  N N    . THR A 1 53 ? 6.467   -11.014 -3.469  1.00 0.00 ? 53 THR A N    2  
ATOM 1980  C CA   . THR A 1 53 ? 6.302   -9.888  -4.379  1.00 0.00 ? 53 THR A CA   2  
ATOM 1981  C C    . THR A 1 53 ? 5.777   -8.660  -3.645  1.00 0.00 ? 53 THR A C    2  
ATOM 1982  O O    . THR A 1 53 ? 6.384   -7.590  -3.692  1.00 0.00 ? 53 THR A O    2  
ATOM 1983  C CB   . THR A 1 53 ? 5.341   -10.233 -5.532  1.00 0.00 ? 53 THR A CB   2  
ATOM 1984  O OG1  . THR A 1 53 ? 5.939   -11.207 -6.394  1.00 0.00 ? 53 THR A OG1  2  
ATOM 1985  C CG2  . THR A 1 53 ? 4.988   -8.989  -6.333  1.00 0.00 ? 53 THR A CG2  2  
ATOM 1986  H H    . THR A 1 53 ? 5.762   -11.693 -3.415  1.00 0.00 ? 53 THR A H    2  
ATOM 1987  H HA   . THR A 1 53 ? 7.269   -9.656  -4.802  1.00 0.00 ? 53 THR A HA   2  
ATOM 1988  H HB   . THR A 1 53 ? 4.433   -10.643 -5.113  1.00 0.00 ? 53 THR A HB   2  
ATOM 1989  H HG1  . THR A 1 53 ? 5.357   -11.378 -7.138  1.00 0.00 ? 53 THR A HG1  2  
ATOM 1990  H HG21 . THR A 1 53 ? 5.516   -8.138  -5.929  1.00 0.00 ? 53 THR A HG21 2  
ATOM 1991  H HG22 . THR A 1 53 ? 3.924   -8.813  -6.275  1.00 0.00 ? 53 THR A HG22 2  
ATOM 1992  H HG23 . THR A 1 53 ? 5.274   -9.132  -7.364  1.00 0.00 ? 53 THR A HG23 2  
ATOM 1993  N N    . TRP A 1 54 ? 4.646   -8.821  -2.967  1.00 0.00 ? 54 TRP A N    2  
ATOM 1994  C CA   . TRP A 1 54 ? 4.039   -7.724  -2.222  1.00 0.00 ? 54 TRP A CA   2  
ATOM 1995  C C    . TRP A 1 54 ? 5.089   -6.970  -1.411  1.00 0.00 ? 54 TRP A C    2  
ATOM 1996  O O    . TRP A 1 54 ? 5.326   -5.783  -1.636  1.00 0.00 ? 54 TRP A O    2  
ATOM 1997  C CB   . TRP A 1 54 ? 2.945   -8.254  -1.294  1.00 0.00 ? 54 TRP A CB   2  
ATOM 1998  C CG   . TRP A 1 54 ? 2.107   -7.171  -0.684  1.00 0.00 ? 54 TRP A CG   2  
ATOM 1999  C CD1  . TRP A 1 54 ? 0.937   -6.665  -1.175  1.00 0.00 ? 54 TRP A CD1  2  
ATOM 2000  C CD2  . TRP A 1 54 ? 2.376   -6.460  0.529   1.00 0.00 ? 54 TRP A CD2  2  
ATOM 2001  N NE1  . TRP A 1 54 ? 0.463   -5.682  -0.340  1.00 0.00 ? 54 TRP A NE1  2  
ATOM 2002  C CE2  . TRP A 1 54 ? 1.327   -5.539  0.713   1.00 0.00 ? 54 TRP A CE2  2  
ATOM 2003  C CE3  . TRP A 1 54 ? 3.399   -6.514  1.479   1.00 0.00 ? 54 TRP A CE3  2  
ATOM 2004  C CZ2  . TRP A 1 54 ? 1.275   -4.679  1.807   1.00 0.00 ? 54 TRP A CZ2  2  
ATOM 2005  C CZ3  . TRP A 1 54 ? 3.346   -5.660  2.564   1.00 0.00 ? 54 TRP A CZ3  2  
ATOM 2006  C CH2  . TRP A 1 54 ? 2.290   -4.753  2.722   1.00 0.00 ? 54 TRP A CH2  2  
ATOM 2007  H H    . TRP A 1 54 ? 4.209   -9.698  -2.967  1.00 0.00 ? 54 TRP A H    2  
ATOM 2008  H HA   . TRP A 1 54 ? 3.596   -7.044  -2.935  1.00 0.00 ? 54 TRP A HA   2  
ATOM 2009  H HB2  . TRP A 1 54 ? 2.291   -8.905  -1.855  1.00 0.00 ? 54 TRP A HB2  2  
ATOM 2010  H HB3  . TRP A 1 54 ? 3.403   -8.814  -0.492  1.00 0.00 ? 54 TRP A HB3  2  
ATOM 2011  H HD1  . TRP A 1 54 ? 0.467   -6.997  -2.088  1.00 0.00 ? 54 TRP A HD1  2  
ATOM 2012  H HE1  . TRP A 1 54 ? -0.361  -5.169  -0.476  1.00 0.00 ? 54 TRP A HE1  2  
ATOM 2013  H HE3  . TRP A 1 54 ? 4.222   -7.207  1.375   1.00 0.00 ? 54 TRP A HE3  2  
ATOM 2014  H HZ2  . TRP A 1 54 ? 0.467   -3.975  1.943   1.00 0.00 ? 54 TRP A HZ2  2  
ATOM 2015  H HZ3  . TRP A 1 54 ? 4.129   -5.688  3.309   1.00 0.00 ? 54 TRP A HZ3  2  
ATOM 2016  H HH2  . TRP A 1 54 ? 2.290   -4.105  3.585   1.00 0.00 ? 54 TRP A HH2  2  
ATOM 2017  N N    . PHE A 1 55 ? 5.714   -7.667  -0.468  1.00 0.00 ? 55 PHE A N    2  
ATOM 2018  C CA   . PHE A 1 55 ? 6.738   -7.062  0.376   1.00 0.00 ? 55 PHE A CA   2  
ATOM 2019  C C    . PHE A 1 55 ? 7.711   -6.234  -0.457  1.00 0.00 ? 55 PHE A C    2  
ATOM 2020  O O    . PHE A 1 55 ? 7.899   -5.044  -0.210  1.00 0.00 ? 55 PHE A O    2  
ATOM 2021  C CB   . PHE A 1 55 ? 7.499   -8.144  1.145   1.00 0.00 ? 55 PHE A CB   2  
ATOM 2022  C CG   . PHE A 1 55 ? 6.779   -8.627  2.372   1.00 0.00 ? 55 PHE A CG   2  
ATOM 2023  C CD1  . PHE A 1 55 ? 5.614   -9.368  2.261   1.00 0.00 ? 55 PHE A CD1  2  
ATOM 2024  C CD2  . PHE A 1 55 ? 7.268   -8.339  3.636   1.00 0.00 ? 55 PHE A CD2  2  
ATOM 2025  C CE1  . PHE A 1 55 ? 4.949   -9.814  3.388   1.00 0.00 ? 55 PHE A CE1  2  
ATOM 2026  C CE2  . PHE A 1 55 ? 6.608   -8.783  4.766   1.00 0.00 ? 55 PHE A CE2  2  
ATOM 2027  C CZ   . PHE A 1 55 ? 5.447   -9.520  4.642   1.00 0.00 ? 55 PHE A CZ   2  
ATOM 2028  H H    . PHE A 1 55 ? 5.481   -8.610  -0.336  1.00 0.00 ? 55 PHE A H    2  
ATOM 2029  H HA   . PHE A 1 55 ? 6.243   -6.412  1.082   1.00 0.00 ? 55 PHE A HA   2  
ATOM 2030  H HB2  . PHE A 1 55 ? 7.655   -8.994  0.497   1.00 0.00 ? 55 PHE A HB2  2  
ATOM 2031  H HB3  . PHE A 1 55 ? 8.456   -7.751  1.453   1.00 0.00 ? 55 PHE A HB3  2  
ATOM 2032  H HD1  . PHE A 1 55 ? 5.224   -9.598  1.279   1.00 0.00 ? 55 PHE A HD1  2  
ATOM 2033  H HD2  . PHE A 1 55 ? 8.176   -7.762  3.735   1.00 0.00 ? 55 PHE A HD2  2  
ATOM 2034  H HE1  . PHE A 1 55 ? 4.041   -10.390 3.287   1.00 0.00 ? 55 PHE A HE1  2  
ATOM 2035  H HE2  . PHE A 1 55 ? 6.999   -8.551  5.746   1.00 0.00 ? 55 PHE A HE2  2  
ATOM 2036  H HZ   . PHE A 1 55 ? 4.930   -9.868  5.524   1.00 0.00 ? 55 PHE A HZ   2  
ATOM 2037  N N    . GLN A 1 56 ? 8.328   -6.875  -1.445  1.00 0.00 ? 56 GLN A N    2  
ATOM 2038  C CA   . GLN A 1 56 ? 9.283   -6.198  -2.315  1.00 0.00 ? 56 GLN A CA   2  
ATOM 2039  C C    . GLN A 1 56 ? 8.743   -4.847  -2.770  1.00 0.00 ? 56 GLN A C    2  
ATOM 2040  O O    . GLN A 1 56 ? 9.325   -3.804  -2.476  1.00 0.00 ? 56 GLN A O    2  
ATOM 2041  C CB   . GLN A 1 56 ? 9.603   -7.069  -3.531  1.00 0.00 ? 56 GLN A CB   2  
ATOM 2042  C CG   . GLN A 1 56 ? 10.634  -8.151  -3.250  1.00 0.00 ? 56 GLN A CG   2  
ATOM 2043  C CD   . GLN A 1 56 ? 12.057  -7.668  -3.453  1.00 0.00 ? 56 GLN A CD   2  
ATOM 2044  O OE1  . GLN A 1 56 ? 12.499  -6.716  -2.810  1.00 0.00 ? 56 GLN A OE1  2  
ATOM 2045  N NE2  . GLN A 1 56 ? 12.783  -8.325  -4.349  1.00 0.00 ? 56 GLN A NE2  2  
ATOM 2046  H H    . GLN A 1 56 ? 8.137   -7.824  -1.592  1.00 0.00 ? 56 GLN A H    2  
ATOM 2047  H HA   . GLN A 1 56 ? 10.189  -6.038  -1.750  1.00 0.00 ? 56 GLN A HA   2  
ATOM 2048  H HB2  . GLN A 1 56 ? 8.695   -7.545  -3.867  1.00 0.00 ? 56 GLN A HB2  2  
ATOM 2049  H HB3  . GLN A 1 56 ? 9.983   -6.437  -4.321  1.00 0.00 ? 56 GLN A HB3  2  
ATOM 2050  H HG2  . GLN A 1 56 ? 10.524  -8.479  -2.227  1.00 0.00 ? 56 GLN A HG2  2  
ATOM 2051  H HG3  . GLN A 1 56 ? 10.453  -8.983  -3.915  1.00 0.00 ? 56 GLN A HG3  2  
ATOM 2052  H HE21 . GLN A 1 56 ? 12.364  -9.074  -4.825  1.00 0.00 ? 56 GLN A HE21 2  
ATOM 2053  H HE22 . GLN A 1 56 ? 13.706  -8.034  -4.501  1.00 0.00 ? 56 GLN A HE22 2  
ATOM 2054  N N    . ASN A 1 57 ? 7.626   -4.874  -3.490  1.00 0.00 ? 57 ASN A N    2  
ATOM 2055  C CA   . ASN A 1 57 ? 7.007   -3.650  -3.987  1.00 0.00 ? 57 ASN A CA   2  
ATOM 2056  C C    . ASN A 1 57 ? 6.794   -2.650  -2.855  1.00 0.00 ? 57 ASN A C    2  
ATOM 2057  O O    . ASN A 1 57 ? 7.082   -1.462  -3.001  1.00 0.00 ? 57 ASN A O    2  
ATOM 2058  C CB   . ASN A 1 57 ? 5.670   -3.967  -4.660  1.00 0.00 ? 57 ASN A CB   2  
ATOM 2059  C CG   . ASN A 1 57 ? 5.846   -4.558  -6.045  1.00 0.00 ? 57 ASN A CG   2  
ATOM 2060  O OD1  . ASN A 1 57 ? 6.885   -4.381  -6.680  1.00 0.00 ? 57 ASN A OD1  2  
ATOM 2061  N ND2  . ASN A 1 57 ? 4.827   -5.265  -6.521  1.00 0.00 ? 57 ASN A ND2  2  
ATOM 2062  H H    . ASN A 1 57 ? 7.208   -5.737  -3.692  1.00 0.00 ? 57 ASN A H    2  
ATOM 2063  H HA   . ASN A 1 57 ? 7.673   -3.215  -4.716  1.00 0.00 ? 57 ASN A HA   2  
ATOM 2064  H HB2  . ASN A 1 57 ? 5.128   -4.678  -4.053  1.00 0.00 ? 57 ASN A HB2  2  
ATOM 2065  H HB3  . ASN A 1 57 ? 5.092   -3.060  -4.746  1.00 0.00 ? 57 ASN A HB3  2  
ATOM 2066  H HD21 . ASN A 1 57 ? 4.030   -5.365  -5.959  1.00 0.00 ? 57 ASN A HD21 2  
ATOM 2067  H HD22 . ASN A 1 57 ? 4.914   -5.659  -7.414  1.00 0.00 ? 57 ASN A HD22 2  
ATOM 2068  N N    . ARG A 1 58 ? 6.290   -3.139  -1.727  1.00 0.00 ? 58 ARG A N    2  
ATOM 2069  C CA   . ARG A 1 58 ? 6.038   -2.288  -0.570  1.00 0.00 ? 58 ARG A CA   2  
ATOM 2070  C C    . ARG A 1 58 ? 7.277   -1.468  -0.218  1.00 0.00 ? 58 ARG A C    2  
ATOM 2071  O O    . ARG A 1 58 ? 7.235   -0.238  -0.202  1.00 0.00 ? 58 ARG A O    2  
ATOM 2072  C CB   . ARG A 1 58 ? 5.616   -3.135  0.632   1.00 0.00 ? 58 ARG A CB   2  
ATOM 2073  C CG   . ARG A 1 58 ? 5.111   -2.316  1.808   1.00 0.00 ? 58 ARG A CG   2  
ATOM 2074  C CD   . ARG A 1 58 ? 3.689   -1.830  1.577   1.00 0.00 ? 58 ARG A CD   2  
ATOM 2075  N NE   . ARG A 1 58 ? 3.201   -1.018  2.689   1.00 0.00 ? 58 ARG A NE   2  
ATOM 2076  C CZ   . ARG A 1 58 ? 3.624   0.216   2.938   1.00 0.00 ? 58 ARG A CZ   2  
ATOM 2077  N NH1  . ARG A 1 58 ? 4.538   0.778   2.159   1.00 0.00 ? 58 ARG A NH1  2  
ATOM 2078  N NH2  . ARG A 1 58 ? 3.132   0.892   3.969   1.00 0.00 ? 58 ARG A NH2  2  
ATOM 2079  H H    . ARG A 1 58 ? 6.081   -4.095  -1.671  1.00 0.00 ? 58 ARG A H    2  
ATOM 2080  H HA   . ARG A 1 58 ? 5.234   -1.613  -0.823  1.00 0.00 ? 58 ARG A HA   2  
ATOM 2081  H HB2  . ARG A 1 58 ? 4.829   -3.808  0.325   1.00 0.00 ? 58 ARG A HB2  2  
ATOM 2082  H HB3  . ARG A 1 58 ? 6.465   -3.715  0.963   1.00 0.00 ? 58 ARG A HB3  2  
ATOM 2083  H HG2  . ARG A 1 58 ? 5.130   -2.929  2.697   1.00 0.00 ? 58 ARG A HG2  2  
ATOM 2084  H HG3  . ARG A 1 58 ? 5.757   -1.462  1.943   1.00 0.00 ? 58 ARG A HG3  2  
ATOM 2085  H HD2  . ARG A 1 58 ? 3.667   -1.237  0.675   1.00 0.00 ? 58 ARG A HD2  2  
ATOM 2086  H HD3  . ARG A 1 58 ? 3.044   -2.688  1.460   1.00 0.00 ? 58 ARG A HD3  2  
ATOM 2087  H HE   . ARG A 1 58 ? 2.525   -1.413  3.278   1.00 0.00 ? 58 ARG A HE   2  
ATOM 2088  H HH11 . ARG A 1 58 ? 4.909   0.272   1.381   1.00 0.00 ? 58 ARG A HH11 2  
ATOM 2089  H HH12 . ARG A 1 58 ? 4.854   1.708   2.348   1.00 0.00 ? 58 ARG A HH12 2  
ATOM 2090  H HH21 . ARG A 1 58 ? 2.443   0.472   4.559   1.00 0.00 ? 58 ARG A HH21 2  
ATOM 2091  H HH22 . ARG A 1 58 ? 3.452   1.820   4.156   1.00 0.00 ? 58 ARG A HH22 2  
ATOM 2092  N N    . ARG A 1 59 ? 8.377   -2.159  0.063   1.00 0.00 ? 59 ARG A N    2  
ATOM 2093  C CA   . ARG A 1 59 ? 9.626   -1.496  0.416   1.00 0.00 ? 59 ARG A CA   2  
ATOM 2094  C C    . ARG A 1 59 ? 9.875   -0.291  -0.486  1.00 0.00 ? 59 ARG A C    2  
ATOM 2095  O O    . ARG A 1 59 ? 9.932   0.846   -0.019  1.00 0.00 ? 59 ARG A O    2  
ATOM 2096  C CB   . ARG A 1 59 ? 10.796  -2.476  0.311   1.00 0.00 ? 59 ARG A CB   2  
ATOM 2097  C CG   . ARG A 1 59 ? 11.930  -2.176  1.277   1.00 0.00 ? 59 ARG A CG   2  
ATOM 2098  C CD   . ARG A 1 59 ? 13.027  -3.225  1.191   1.00 0.00 ? 59 ARG A CD   2  
ATOM 2099  N NE   . ARG A 1 59 ? 14.024  -2.894  0.177   1.00 0.00 ? 59 ARG A NE   2  
ATOM 2100  C CZ   . ARG A 1 59 ? 13.895  -3.202  -1.109  1.00 0.00 ? 59 ARG A CZ   2  
ATOM 2101  N NH1  . ARG A 1 59 ? 12.816  -3.845  -1.535  1.00 0.00 ? 59 ARG A NH1  2  
ATOM 2102  N NH2  . ARG A 1 59 ? 14.845  -2.866  -1.972  1.00 0.00 ? 59 ARG A NH2  2  
ATOM 2103  H H    . ARG A 1 59 ? 8.347   -3.138  0.033   1.00 0.00 ? 59 ARG A H    2  
ATOM 2104  H HA   . ARG A 1 59 ? 9.544   -1.155  1.437   1.00 0.00 ? 59 ARG A HA   2  
ATOM 2105  H HB2  . ARG A 1 59 ? 10.434  -3.473  0.513   1.00 0.00 ? 59 ARG A HB2  2  
ATOM 2106  H HB3  . ARG A 1 59 ? 11.189  -2.441  -0.694  1.00 0.00 ? 59 ARG A HB3  2  
ATOM 2107  H HG2  . ARG A 1 59 ? 12.351  -1.211  1.035   1.00 0.00 ? 59 ARG A HG2  2  
ATOM 2108  H HG3  . ARG A 1 59 ? 11.538  -2.158  2.283   1.00 0.00 ? 59 ARG A HG3  2  
ATOM 2109  H HD2  . ARG A 1 59 ? 13.515  -3.296  2.152   1.00 0.00 ? 59 ARG A HD2  2  
ATOM 2110  H HD3  . ARG A 1 59 ? 12.578  -4.176  0.945   1.00 0.00 ? 59 ARG A HD3  2  
ATOM 2111  H HE   . ARG A 1 59 ? 14.829  -2.418  0.469   1.00 0.00 ? 59 ARG A HE   2  
ATOM 2112  H HH11 . ARG A 1 59 ? 12.098  -4.098  -0.887  1.00 0.00 ? 59 ARG A HH11 2  
ATOM 2113  H HH12 . ARG A 1 59 ? 12.721  -4.075  -2.504  1.00 0.00 ? 59 ARG A HH12 2  
ATOM 2114  H HH21 . ARG A 1 59 ? 15.659  -2.381  -1.655  1.00 0.00 ? 59 ARG A HH21 2  
ATOM 2115  H HH22 . ARG A 1 59 ? 14.747  -3.098  -2.939  1.00 0.00 ? 59 ARG A HH22 2  
ATOM 2116  N N    . ALA A 1 60 ? 10.024  -0.548  -1.782  1.00 0.00 ? 60 ALA A N    2  
ATOM 2117  C CA   . ALA A 1 60 ? 10.266  0.515   -2.749  1.00 0.00 ? 60 ALA A CA   2  
ATOM 2118  C C    . ALA A 1 60 ? 9.448   1.757   -2.416  1.00 0.00 ? 60 ALA A C    2  
ATOM 2119  O O    . ALA A 1 60 ? 9.918   2.884   -2.572  1.00 0.00 ? 60 ALA A O    2  
ATOM 2120  C CB   . ALA A 1 60 ? 9.946   0.031   -4.156  1.00 0.00 ? 60 ALA A CB   2  
ATOM 2121  H H    . ALA A 1 60 ? 9.969   -1.475  -2.094  1.00 0.00 ? 60 ALA A H    2  
ATOM 2122  H HA   . ALA A 1 60 ? 11.316  0.767   -2.712  1.00 0.00 ? 60 ALA A HA   2  
ATOM 2123  H HB1  . ALA A 1 60 ? 10.846  0.044   -4.753  1.00 0.00 ? 60 ALA A HB1  2  
ATOM 2124  H HB2  . ALA A 1 60 ? 9.558   -0.975  -4.110  1.00 0.00 ? 60 ALA A HB2  2  
ATOM 2125  H HB3  . ALA A 1 60 ? 9.208   0.682   -4.600  1.00 0.00 ? 60 ALA A HB3  2  
ATOM 2126  N N    . LYS A 1 61 ? 8.219   1.545   -1.956  1.00 0.00 ? 61 LYS A N    2  
ATOM 2127  C CA   . LYS A 1 61 ? 7.334   2.647   -1.599  1.00 0.00 ? 61 LYS A CA   2  
ATOM 2128  C C    . LYS A 1 61 ? 7.708   3.227   -0.239  1.00 0.00 ? 61 LYS A C    2  
ATOM 2129  O O    . LYS A 1 61 ? 7.787   4.444   -0.074  1.00 0.00 ? 61 LYS A O    2  
ATOM 2130  C CB   . LYS A 1 61 ? 5.878   2.174   -1.582  1.00 0.00 ? 61 LYS A CB   2  
ATOM 2131  C CG   . LYS A 1 61 ? 5.185   2.289   -2.928  1.00 0.00 ? 61 LYS A CG   2  
ATOM 2132  C CD   . LYS A 1 61 ? 3.995   1.349   -3.025  1.00 0.00 ? 61 LYS A CD   2  
ATOM 2133  C CE   . LYS A 1 61 ? 3.061   1.747   -4.157  1.00 0.00 ? 61 LYS A CE   2  
ATOM 2134  N NZ   . LYS A 1 61 ? 1.975   0.748   -4.358  1.00 0.00 ? 61 LYS A NZ   2  
ATOM 2135  H H    . LYS A 1 61 ? 7.900   0.623   -1.853  1.00 0.00 ? 61 LYS A H    2  
ATOM 2136  H HA   . LYS A 1 61 ? 7.444   3.417   -2.348  1.00 0.00 ? 61 LYS A HA   2  
ATOM 2137  H HB2  . LYS A 1 61 ? 5.852   1.139   -1.274  1.00 0.00 ? 61 LYS A HB2  2  
ATOM 2138  H HB3  . LYS A 1 61 ? 5.328   2.768   -0.866  1.00 0.00 ? 61 LYS A HB3  2  
ATOM 2139  H HG2  . LYS A 1 61 ? 4.840   3.304   -3.060  1.00 0.00 ? 61 LYS A HG2  2  
ATOM 2140  H HG3  . LYS A 1 61 ? 5.892   2.042   -3.709  1.00 0.00 ? 61 LYS A HG3  2  
ATOM 2141  H HD2  . LYS A 1 61 ? 4.353   0.346   -3.205  1.00 0.00 ? 61 LYS A HD2  2  
ATOM 2142  H HD3  . LYS A 1 61 ? 3.450   1.376   -2.092  1.00 0.00 ? 61 LYS A HD3  2  
ATOM 2143  H HE2  . LYS A 1 61 ? 2.619   2.703   -3.921  1.00 0.00 ? 61 LYS A HE2  2  
ATOM 2144  H HE3  . LYS A 1 61 ? 3.635   1.831   -5.068  1.00 0.00 ? 61 LYS A HE3  2  
ATOM 2145  H HZ1  . LYS A 1 61 ? 2.143   0.210   -5.232  1.00 0.00 ? 61 LYS A HZ1  2  
ATOM 2146  H HZ2  . LYS A 1 61 ? 1.056   1.228   -4.431  1.00 0.00 ? 61 LYS A HZ2  2  
ATOM 2147  H HZ3  . LYS A 1 61 ? 1.946   0.086   -3.556  1.00 0.00 ? 61 LYS A HZ3  2  
ATOM 2148  N N    . TRP A 1 62 ? 7.937   2.349   0.730   1.00 0.00 ? 62 TRP A N    2  
ATOM 2149  C CA   . TRP A 1 62 ? 8.303   2.774   2.076   1.00 0.00 ? 62 TRP A CA   2  
ATOM 2150  C C    . TRP A 1 62 ? 9.542   3.663   2.047   1.00 0.00 ? 62 TRP A C    2  
ATOM 2151  O O    . TRP A 1 62 ? 9.528   4.780   2.564   1.00 0.00 ? 62 TRP A O    2  
ATOM 2152  C CB   . TRP A 1 62 ? 8.554   1.557   2.968   1.00 0.00 ? 62 TRP A CB   2  
ATOM 2153  C CG   . TRP A 1 62 ? 9.435   1.853   4.144   1.00 0.00 ? 62 TRP A CG   2  
ATOM 2154  C CD1  . TRP A 1 62 ? 9.090   2.539   5.274   1.00 0.00 ? 62 TRP A CD1  2  
ATOM 2155  C CD2  . TRP A 1 62 ? 10.806  1.475   4.305   1.00 0.00 ? 62 TRP A CD2  2  
ATOM 2156  N NE1  . TRP A 1 62 ? 10.165  2.610   6.127   1.00 0.00 ? 62 TRP A NE1  2  
ATOM 2157  C CE2  . TRP A 1 62 ? 11.229  1.964   5.556   1.00 0.00 ? 62 TRP A CE2  2  
ATOM 2158  C CE3  . TRP A 1 62 ? 11.717  0.769   3.514   1.00 0.00 ? 62 TRP A CE3  2  
ATOM 2159  C CZ2  . TRP A 1 62 ? 12.523  1.769   6.032   1.00 0.00 ? 62 TRP A CZ2  2  
ATOM 2160  C CZ3  . TRP A 1 62 ? 13.001  0.578   3.988   1.00 0.00 ? 62 TRP A CZ3  2  
ATOM 2161  C CH2  . TRP A 1 62 ? 13.394  1.075   5.237   1.00 0.00 ? 62 TRP A CH2  2  
ATOM 2162  H H    . TRP A 1 62 ? 7.857   1.391   0.537   1.00 0.00 ? 62 TRP A H    2  
ATOM 2163  H HA   . TRP A 1 62 ? 7.478   3.341   2.480   1.00 0.00 ? 62 TRP A HA   2  
ATOM 2164  H HB2  . TRP A 1 62 ? 7.610   1.192   3.342   1.00 0.00 ? 62 TRP A HB2  2  
ATOM 2165  H HB3  . TRP A 1 62 ? 9.028   0.783   2.382   1.00 0.00 ? 62 TRP A HB3  2  
ATOM 2166  H HD1  . TRP A 1 62 ? 8.113   2.960   5.455   1.00 0.00 ? 62 TRP A HD1  2  
ATOM 2167  H HE1  . TRP A 1 62 ? 10.167  3.050   7.003   1.00 0.00 ? 62 TRP A HE1  2  
ATOM 2168  H HE3  . TRP A 1 62 ? 11.433  0.378   2.548   1.00 0.00 ? 62 TRP A HE3  2  
ATOM 2169  H HZ2  . TRP A 1 62 ? 12.841  2.146   6.993   1.00 0.00 ? 62 TRP A HZ2  2  
ATOM 2170  H HZ3  . TRP A 1 62 ? 13.719  0.035   3.391   1.00 0.00 ? 62 TRP A HZ3  2  
ATOM 2171  H HH2  . TRP A 1 62 ? 14.407  0.902   5.567   1.00 0.00 ? 62 TRP A HH2  2  
ATOM 2172  N N    . ARG A 1 63 ? 10.612  3.159   1.440   1.00 0.00 ? 63 ARG A N    2  
ATOM 2173  C CA   . ARG A 1 63 ? 11.860  3.908   1.346   1.00 0.00 ? 63 ARG A CA   2  
ATOM 2174  C C    . ARG A 1 63 ? 11.595  5.357   0.949   1.00 0.00 ? 63 ARG A C    2  
ATOM 2175  O O    . ARG A 1 63 ? 11.958  6.285   1.672   1.00 0.00 ? 63 ARG A O    2  
ATOM 2176  C CB   . ARG A 1 63 ? 12.796  3.253   0.329   1.00 0.00 ? 63 ARG A CB   2  
ATOM 2177  C CG   . ARG A 1 63 ? 13.415  1.954   0.820   1.00 0.00 ? 63 ARG A CG   2  
ATOM 2178  C CD   . ARG A 1 63 ? 14.780  1.716   0.194   1.00 0.00 ? 63 ARG A CD   2  
ATOM 2179  N NE   . ARG A 1 63 ? 15.702  2.818   0.457   1.00 0.00 ? 63 ARG A NE   2  
ATOM 2180  C CZ   . ARG A 1 63 ? 16.980  2.809   0.097   1.00 0.00 ? 63 ARG A CZ   2  
ATOM 2181  N NH1  . ARG A 1 63 ? 17.486  1.760   -0.538  1.00 0.00 ? 63 ARG A NH1  2  
ATOM 2182  N NH2  . ARG A 1 63 ? 17.756  3.850   0.371   1.00 0.00 ? 63 ARG A NH2  2  
ATOM 2183  H H    . ARG A 1 63 ? 10.562  2.263   1.047   1.00 0.00 ? 63 ARG A H    2  
ATOM 2184  H HA   . ARG A 1 63 ? 12.330  3.893   2.317   1.00 0.00 ? 63 ARG A HA   2  
ATOM 2185  H HB2  . ARG A 1 63 ? 12.240  3.042   -0.573  1.00 0.00 ? 63 ARG A HB2  2  
ATOM 2186  H HB3  . ARG A 1 63 ? 13.595  3.941   0.097   1.00 0.00 ? 63 ARG A HB3  2  
ATOM 2187  H HG2  . ARG A 1 63 ? 13.526  2.001   1.893   1.00 0.00 ? 63 ARG A HG2  2  
ATOM 2188  H HG3  . ARG A 1 63 ? 12.761  1.134   0.559   1.00 0.00 ? 63 ARG A HG3  2  
ATOM 2189  H HD2  . ARG A 1 63 ? 15.196  0.807   0.604   1.00 0.00 ? 63 ARG A HD2  2  
ATOM 2190  H HD3  . ARG A 1 63 ? 14.659  1.607   -0.873  1.00 0.00 ? 63 ARG A HD3  2  
ATOM 2191  H HE   . ARG A 1 63 ? 15.349  3.603   0.925   1.00 0.00 ? 63 ARG A HE   2  
ATOM 2192  H HH11 . ARG A 1 63 ? 16.904  0.975   -0.747  1.00 0.00 ? 63 ARG A HH11 2  
ATOM 2193  H HH12 . ARG A 1 63 ? 18.449  1.756   -0.809  1.00 0.00 ? 63 ARG A HH12 2  
ATOM 2194  H HH21 . ARG A 1 63 ? 17.378  4.642   0.850   1.00 0.00 ? 63 ARG A HH21 2  
ATOM 2195  H HH22 . ARG A 1 63 ? 18.718  3.842   0.100   1.00 0.00 ? 63 ARG A HH22 2  
ATOM 2196  N N    . ARG A 1 64 ? 10.962  5.544   -0.204  1.00 0.00 ? 64 ARG A N    2  
ATOM 2197  C CA   . ARG A 1 64 ? 10.651  6.880   -0.698  1.00 0.00 ? 64 ARG A CA   2  
ATOM 2198  C C    . ARG A 1 64 ? 9.947   7.706   0.375   1.00 0.00 ? 64 ARG A C    2  
ATOM 2199  O O    . ARG A 1 64 ? 10.290  8.866   0.604   1.00 0.00 ? 64 ARG A O    2  
ATOM 2200  C CB   . ARG A 1 64 ? 9.772   6.793   -1.947  1.00 0.00 ? 64 ARG A CB   2  
ATOM 2201  C CG   . ARG A 1 64 ? 9.547   8.134   -2.627  1.00 0.00 ? 64 ARG A CG   2  
ATOM 2202  C CD   . ARG A 1 64 ? 8.792   7.974   -3.938  1.00 0.00 ? 64 ARG A CD   2  
ATOM 2203  N NE   . ARG A 1 64 ? 8.248   9.242   -4.415  1.00 0.00 ? 64 ARG A NE   2  
ATOM 2204  C CZ   . ARG A 1 64 ? 7.223   9.333   -5.256  1.00 0.00 ? 64 ARG A CZ   2  
ATOM 2205  N NH1  . ARG A 1 64 ? 6.635   8.235   -5.709  1.00 0.00 ? 64 ARG A NH1  2  
ATOM 2206  N NH2  . ARG A 1 64 ? 6.786   10.524  -5.644  1.00 0.00 ? 64 ARG A NH2  2  
ATOM 2207  H H    . ARG A 1 64 ? 10.698  4.764   -0.737  1.00 0.00 ? 64 ARG A H    2  
ATOM 2208  H HA   . ARG A 1 64 ? 11.581  7.363   -0.956  1.00 0.00 ? 64 ARG A HA   2  
ATOM 2209  H HB2  . ARG A 1 64 ? 10.241  6.128   -2.658  1.00 0.00 ? 64 ARG A HB2  2  
ATOM 2210  H HB3  . ARG A 1 64 ? 8.810   6.389   -1.669  1.00 0.00 ? 64 ARG A HB3  2  
ATOM 2211  H HG2  . ARG A 1 64 ? 8.972   8.769   -1.969  1.00 0.00 ? 64 ARG A HG2  2  
ATOM 2212  H HG3  . ARG A 1 64 ? 10.504  8.591   -2.827  1.00 0.00 ? 64 ARG A HG3  2  
ATOM 2213  H HD2  . ARG A 1 64 ? 9.469   7.581   -4.682  1.00 0.00 ? 64 ARG A HD2  2  
ATOM 2214  H HD3  . ARG A 1 64 ? 7.980   7.278   -3.787  1.00 0.00 ? 64 ARG A HD3  2  
ATOM 2215  H HE   . ARG A 1 64 ? 8.668   10.066  -4.092  1.00 0.00 ? 64 ARG A HE   2  
ATOM 2216  H HH11 . ARG A 1 64 ? 6.962   7.336   -5.418  1.00 0.00 ? 64 ARG A HH11 2  
ATOM 2217  H HH12 . ARG A 1 64 ? 5.863   8.306   -6.342  1.00 0.00 ? 64 ARG A HH12 2  
ATOM 2218  H HH21 . ARG A 1 64 ? 7.227   11.354  -5.303  1.00 0.00 ? 64 ARG A HH21 2  
ATOM 2219  H HH22 . ARG A 1 64 ? 6.015   10.591  -6.276  1.00 0.00 ? 64 ARG A HH22 2  
ATOM 2220  N N    . SER A 1 65 ? 8.962   7.100   1.030   1.00 0.00 ? 65 SER A N    2  
ATOM 2221  C CA   . SER A 1 65 ? 8.208   7.780   2.076   1.00 0.00 ? 65 SER A CA   2  
ATOM 2222  C C    . SER A 1 65 ? 9.131   8.239   3.201   1.00 0.00 ? 65 SER A C    2  
ATOM 2223  O O    . SER A 1 65 ? 8.988   9.342   3.726   1.00 0.00 ? 65 SER A O    2  
ATOM 2224  C CB   . SER A 1 65 ? 7.124   6.857   2.636   1.00 0.00 ? 65 SER A CB   2  
ATOM 2225  O OG   . SER A 1 65 ? 6.164   7.588   3.378   1.00 0.00 ? 65 SER A OG   2  
ATOM 2226  H H    . SER A 1 65 ? 8.736   6.174   0.802   1.00 0.00 ? 65 SER A H    2  
ATOM 2227  H HA   . SER A 1 65 ? 7.738   8.647   1.636   1.00 0.00 ? 65 SER A HA   2  
ATOM 2228  H HB2  . SER A 1 65 ? 6.625   6.356   1.820   1.00 0.00 ? 65 SER A HB2  2  
ATOM 2229  H HB3  . SER A 1 65 ? 7.580   6.123   3.284   1.00 0.00 ? 65 SER A HB3  2  
ATOM 2230  H HG   . SER A 1 65 ? 5.423   7.017   3.594   1.00 0.00 ? 65 SER A HG   2  
ATOM 2231  N N    . GLY A 1 66 ? 10.080  7.382   3.567   1.00 0.00 ? 66 GLY A N    2  
ATOM 2232  C CA   . GLY A 1 66 ? 11.013  7.715   4.627   1.00 0.00 ? 66 GLY A CA   2  
ATOM 2233  C C    . GLY A 1 66 ? 12.246  8.430   4.110   1.00 0.00 ? 66 GLY A C    2  
ATOM 2234  O O    . GLY A 1 66 ? 12.259  8.969   3.003   1.00 0.00 ? 66 GLY A O    2  
ATOM 2235  H H    . GLY A 1 66 ? 10.146  6.515   3.113   1.00 0.00 ? 66 GLY A H    2  
ATOM 2236  H HA2  . GLY A 1 66 ? 10.515  8.352   5.343   1.00 0.00 ? 66 GLY A HA2  2  
ATOM 2237  H HA3  . GLY A 1 66 ? 11.319  6.805   5.121   1.00 0.00 ? 66 GLY A HA3  2  
ATOM 2238  N N    . PRO A 1 67 ? 13.312  8.442   4.923   1.00 0.00 ? 67 PRO A N    2  
ATOM 2239  C CA   . PRO A 1 67 ? 14.575  9.094   4.564   1.00 0.00 ? 67 PRO A CA   2  
ATOM 2240  C C    . PRO A 1 67 ? 15.311  8.357   3.450   1.00 0.00 ? 67 PRO A C    2  
ATOM 2241  O O    . PRO A 1 67 ? 15.797  7.243   3.645   1.00 0.00 ? 67 PRO A O    2  
ATOM 2242  C CB   . PRO A 1 67 ? 15.383  9.043   5.863   1.00 0.00 ? 67 PRO A CB   2  
ATOM 2243  C CG   . PRO A 1 67 ? 14.828  7.879   6.609   1.00 0.00 ? 67 PRO A CG   2  
ATOM 2244  C CD   . PRO A 1 67 ? 13.367  7.820   6.257   1.00 0.00 ? 67 PRO A CD   2  
ATOM 2245  H HA   . PRO A 1 67 ? 14.422  10.123  4.273   1.00 0.00 ? 67 PRO A HA   2  
ATOM 2246  H HB2  . PRO A 1 67 ? 16.430  8.903   5.633   1.00 0.00 ? 67 PRO A HB2  2  
ATOM 2247  H HB3  . PRO A 1 67 ? 15.249  9.963   6.411   1.00 0.00 ? 67 PRO A HB3  2  
ATOM 2248  H HG2  . PRO A 1 67 ? 15.325  6.973   6.298   1.00 0.00 ? 67 PRO A HG2  2  
ATOM 2249  H HG3  . PRO A 1 67 ? 14.951  8.031   7.671   1.00 0.00 ? 67 PRO A HG3  2  
ATOM 2250  H HD2  . PRO A 1 67 ? 13.029  6.795   6.219   1.00 0.00 ? 67 PRO A HD2  2  
ATOM 2251  H HD3  . PRO A 1 67 ? 12.784  8.385   6.970   1.00 0.00 ? 67 PRO A HD3  2  
ATOM 2252  N N    . SER A 1 68 ? 15.389  8.986   2.281   1.00 0.00 ? 68 SER A N    2  
ATOM 2253  C CA   . SER A 1 68 ? 16.063  8.388   1.135   1.00 0.00 ? 68 SER A CA   2  
ATOM 2254  C C    . SER A 1 68 ? 17.577  8.524   1.263   1.00 0.00 ? 68 SER A C    2  
ATOM 2255  O O    . SER A 1 68 ? 18.075  9.287   2.090   1.00 0.00 ? 68 SER A O    2  
ATOM 2256  C CB   . SER A 1 68 ? 15.589  9.046   -0.162  1.00 0.00 ? 68 SER A CB   2  
ATOM 2257  O OG   . SER A 1 68 ? 15.769  8.180   -1.269  1.00 0.00 ? 68 SER A OG   2  
ATOM 2258  H H    . SER A 1 68 ? 14.981  9.873   2.188   1.00 0.00 ? 68 SER A H    2  
ATOM 2259  H HA   . SER A 1 68 ? 15.808  7.339   1.110   1.00 0.00 ? 68 SER A HA   2  
ATOM 2260  H HB2  . SER A 1 68 ? 14.540  9.289   -0.078  1.00 0.00 ? 68 SER A HB2  2  
ATOM 2261  H HB3  . SER A 1 68 ? 16.155  9.951   -0.332  1.00 0.00 ? 68 SER A HB3  2  
ATOM 2262  H HG   . SER A 1 68 ? 15.758  8.692   -2.082  1.00 0.00 ? 68 SER A HG   2  
ATOM 2263  N N    . SER A 1 69 ? 18.304  7.777   0.438   1.00 0.00 ? 69 SER A N    2  
ATOM 2264  C CA   . SER A 1 69 ? 19.761  7.810   0.461   1.00 0.00 ? 69 SER A CA   2  
ATOM 2265  C C    . SER A 1 69 ? 20.337  7.290   -0.853  1.00 0.00 ? 69 SER A C    2  
ATOM 2266  O O    . SER A 1 69 ? 20.302  6.092   -1.128  1.00 0.00 ? 69 SER A O    2  
ATOM 2267  C CB   . SER A 1 69 ? 20.293  6.977   1.629   1.00 0.00 ? 69 SER A CB   2  
ATOM 2268  O OG   . SER A 1 69 ? 19.977  5.606   1.463   1.00 0.00 ? 69 SER A OG   2  
ATOM 2269  H H    . SER A 1 69 ? 17.848  7.188   -0.199  1.00 0.00 ? 69 SER A H    2  
ATOM 2270  H HA   . SER A 1 69 ? 20.068  8.837   0.593   1.00 0.00 ? 69 SER A HA   2  
ATOM 2271  H HB2  . SER A 1 69 ? 21.366  7.082   1.683   1.00 0.00 ? 69 SER A HB2  2  
ATOM 2272  H HB3  . SER A 1 69 ? 19.850  7.329   2.549   1.00 0.00 ? 69 SER A HB3  2  
ATOM 2273  H HG   . SER A 1 69 ? 19.054  5.461   1.686   1.00 0.00 ? 69 SER A HG   2  
ATOM 2274  N N    . GLY A 1 70 ? 20.867  8.203   -1.662  1.00 0.00 ? 70 GLY A N    2  
ATOM 2275  C CA   . GLY A 1 70 ? 21.443  7.819   -2.937  1.00 0.00 ? 70 GLY A CA   2  
ATOM 2276  C C    . GLY A 1 70 ? 20.601  8.271   -4.114  1.00 0.00 ? 70 GLY A C    2  
ATOM 2277  O O    . GLY A 1 70 ? 20.701  9.416   -4.554  1.00 0.00 ? 70 GLY A O    2  
ATOM 2278  H H    . GLY A 1 70 ? 20.867  9.145   -1.390  1.00 0.00 ? 70 GLY A H    2  
ATOM 2279  H HA2  . GLY A 1 70 ? 22.426  8.257   -3.023  1.00 0.00 ? 70 GLY A HA2  2  
ATOM 2280  H HA3  . GLY A 1 70 ? 21.535  6.743   -2.968  1.00 0.00 ? 70 GLY A HA3  2  
ATOM 2281  N N    . GLY A 1 1  ? -25.349 -8.577  4.055   1.00 0.00 ? 1  GLY A N    3  
ATOM 2282  C CA   . GLY A 1 1  ? -24.037 -8.099  4.448   1.00 0.00 ? 1  GLY A CA   3  
ATOM 2283  C C    . GLY A 1 1  ? -23.580 -6.913  3.622   1.00 0.00 ? 1  GLY A C    3  
ATOM 2284  O O    . GLY A 1 1  ? -23.652 -6.939  2.393   1.00 0.00 ? 1  GLY A O    3  
ATOM 2285  H H1   . GLY A 1 1  ? -26.109 -7.957  4.035   1.00 0.00 ? 1  GLY A H1   3  
ATOM 2286  H HA2  . GLY A 1 1  ? -24.067 -7.811  5.488   1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2287  H HA3  . GLY A 1 1  ? -23.324 -8.902  4.328   1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2288  N N    . SER A 1 2  ? -23.111 -5.869  4.298   1.00 0.00 ? 2  SER A N    3  
ATOM 2289  C CA   . SER A 1 2  ? -22.646 -4.665  3.618   1.00 0.00 ? 2  SER A CA   3  
ATOM 2290  C C    . SER A 1 2  ? -21.282 -4.235  4.148   1.00 0.00 ? 2  SER A C    3  
ATOM 2291  O O    . SER A 1 2  ? -21.189 -3.430  5.075   1.00 0.00 ? 2  SER A O    3  
ATOM 2292  C CB   . SER A 1 2  ? -23.657 -3.530  3.798   1.00 0.00 ? 2  SER A CB   3  
ATOM 2293  O OG   . SER A 1 2  ? -24.949 -3.927  3.374   1.00 0.00 ? 2  SER A OG   3  
ATOM 2294  H H    . SER A 1 2  ? -23.079 -5.909  5.276   1.00 0.00 ? 2  SER A H    3  
ATOM 2295  H HA   . SER A 1 2  ? -22.556 -4.892  2.567   1.00 0.00 ? 2  SER A HA   3  
ATOM 2296  H HB2  . SER A 1 2  ? -23.702 -3.254  4.841   1.00 0.00 ? 2  SER A HB2  3  
ATOM 2297  H HB3  . SER A 1 2  ? -23.344 -2.678  3.213   1.00 0.00 ? 2  SER A HB3  3  
ATOM 2298  H HG   . SER A 1 2  ? -25.590 -3.715  4.057   1.00 0.00 ? 2  SER A HG   3  
ATOM 2299  N N    . SER A 1 3  ? -20.225 -4.778  3.552   1.00 0.00 ? 3  SER A N    3  
ATOM 2300  C CA   . SER A 1 3  ? -18.864 -4.454  3.966   1.00 0.00 ? 3  SER A CA   3  
ATOM 2301  C C    . SER A 1 3  ? -17.943 -4.332  2.755   1.00 0.00 ? 3  SER A C    3  
ATOM 2302  O O    . SER A 1 3  ? -18.168 -4.964  1.724   1.00 0.00 ? 3  SER A O    3  
ATOM 2303  C CB   . SER A 1 3  ? -18.331 -5.524  4.920   1.00 0.00 ? 3  SER A CB   3  
ATOM 2304  O OG   . SER A 1 3  ? -16.951 -5.333  5.180   1.00 0.00 ? 3  SER A OG   3  
ATOM 2305  H H    . SER A 1 3  ? -20.364 -5.413  2.819   1.00 0.00 ? 3  SER A H    3  
ATOM 2306  H HA   . SER A 1 3  ? -18.891 -3.505  4.480   1.00 0.00 ? 3  SER A HA   3  
ATOM 2307  H HB2  . SER A 1 3  ? -18.870 -5.471  5.854   1.00 0.00 ? 3  SER A HB2  3  
ATOM 2308  H HB3  . SER A 1 3  ? -18.470 -6.499  4.478   1.00 0.00 ? 3  SER A HB3  3  
ATOM 2309  H HG   . SER A 1 3  ? -16.820 -4.486  5.612   1.00 0.00 ? 3  SER A HG   3  
ATOM 2310  N N    . GLY A 1 4  ? -16.905 -3.512  2.890   1.00 0.00 ? 4  GLY A N    3  
ATOM 2311  C CA   . GLY A 1 4  ? -15.965 -3.320  1.801   1.00 0.00 ? 4  GLY A CA   3  
ATOM 2312  C C    . GLY A 1 4  ? -16.400 -2.227  0.845   1.00 0.00 ? 4  GLY A C    3  
ATOM 2313  O O    . GLY A 1 4  ? -17.062 -2.497  -0.157  1.00 0.00 ? 4  GLY A O    3  
ATOM 2314  H H    . GLY A 1 4  ? -16.776 -3.034  3.736   1.00 0.00 ? 4  GLY A H    3  
ATOM 2315  H HA2  . GLY A 1 4  ? -15.001 -3.061  2.213   1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2316  H HA3  . GLY A 1 4  ? -15.874 -4.246  1.253   1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2317  N N    . SER A 1 5  ? -16.030 -0.989  1.157   1.00 0.00 ? 5  SER A N    3  
ATOM 2318  C CA   . SER A 1 5  ? -16.392 0.150   0.321   1.00 0.00 ? 5  SER A CA   3  
ATOM 2319  C C    . SER A 1 5  ? -15.147 0.809   -0.267  1.00 0.00 ? 5  SER A C    3  
ATOM 2320  O O    . SER A 1 5  ? -14.610 1.761   0.299   1.00 0.00 ? 5  SER A O    3  
ATOM 2321  C CB   . SER A 1 5  ? -17.190 1.172   1.132   1.00 0.00 ? 5  SER A CB   3  
ATOM 2322  O OG   . SER A 1 5  ? -16.410 1.706   2.188   1.00 0.00 ? 5  SER A OG   3  
ATOM 2323  H H    . SER A 1 5  ? -15.504 -0.838  1.970   1.00 0.00 ? 5  SER A H    3  
ATOM 2324  H HA   . SER A 1 5  ? -17.007 -0.215  -0.488  1.00 0.00 ? 5  SER A HA   3  
ATOM 2325  H HB2  . SER A 1 5  ? -17.498 1.979   0.485   1.00 0.00 ? 5  SER A HB2  3  
ATOM 2326  H HB3  . SER A 1 5  ? -18.062 0.692   1.551   1.00 0.00 ? 5  SER A HB3  3  
ATOM 2327  H HG   . SER A 1 5  ? -16.971 2.221   2.772   1.00 0.00 ? 5  SER A HG   3  
ATOM 2328  N N    . SER A 1 6  ? -14.694 0.295   -1.406  1.00 0.00 ? 6  SER A N    3  
ATOM 2329  C CA   . SER A 1 6  ? -13.511 0.830   -2.069  1.00 0.00 ? 6  SER A CA   3  
ATOM 2330  C C    . SER A 1 6  ? -13.692 0.833   -3.584  1.00 0.00 ? 6  SER A C    3  
ATOM 2331  O O    . SER A 1 6  ? -14.445 0.029   -4.132  1.00 0.00 ? 6  SER A O    3  
ATOM 2332  C CB   . SER A 1 6  ? -12.275 0.010   -1.693  1.00 0.00 ? 6  SER A CB   3  
ATOM 2333  O OG   . SER A 1 6  ? -11.090 0.767   -1.865  1.00 0.00 ? 6  SER A OG   3  
ATOM 2334  H H    . SER A 1 6  ? -15.166 -0.465  -1.808  1.00 0.00 ? 6  SER A H    3  
ATOM 2335  H HA   . SER A 1 6  ? -13.374 1.847   -1.732  1.00 0.00 ? 6  SER A HA   3  
ATOM 2336  H HB2  . SER A 1 6  ? -12.348 -0.293  -0.660  1.00 0.00 ? 6  SER A HB2  3  
ATOM 2337  H HB3  . SER A 1 6  ? -12.223 -0.867  -2.323  1.00 0.00 ? 6  SER A HB3  3  
ATOM 2338  H HG   . SER A 1 6  ? -11.197 1.367   -2.606  1.00 0.00 ? 6  SER A HG   3  
ATOM 2339  N N    . GLY A 1 7  ? -12.995 1.745   -4.255  1.00 0.00 ? 7  GLY A N    3  
ATOM 2340  C CA   . GLY A 1 7  ? -13.092 1.837   -5.700  1.00 0.00 ? 7  GLY A CA   3  
ATOM 2341  C C    . GLY A 1 7  ? -12.086 0.951   -6.406  1.00 0.00 ? 7  GLY A C    3  
ATOM 2342  O O    . GLY A 1 7  ? -10.892 1.249   -6.428  1.00 0.00 ? 7  GLY A O    3  
ATOM 2343  H H    . GLY A 1 7  ? -12.411 2.360   -3.765  1.00 0.00 ? 7  GLY A H    3  
ATOM 2344  H HA2  . GLY A 1 7  ? -14.087 1.546   -6.002  1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2345  H HA3  . GLY A 1 7  ? -12.922 2.862   -5.996  1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2346  N N    . LYS A 1 8  ? -12.567 -0.145  -6.984  1.00 0.00 ? 8  LYS A N    3  
ATOM 2347  C CA   . LYS A 1 8  ? -11.702 -1.079  -7.695  1.00 0.00 ? 8  LYS A CA   3  
ATOM 2348  C C    . LYS A 1 8  ? -10.601 -0.337  -8.446  1.00 0.00 ? 8  LYS A C    3  
ATOM 2349  O O    . LYS A 1 8  ? -10.849 0.279   -9.482  1.00 0.00 ? 8  LYS A O    3  
ATOM 2350  C CB   . LYS A 1 8  ? -12.523 -1.922  -8.673  1.00 0.00 ? 8  LYS A CB   3  
ATOM 2351  C CG   . LYS A 1 8  ? -11.903 -3.275  -8.978  1.00 0.00 ? 8  LYS A CG   3  
ATOM 2352  C CD   . LYS A 1 8  ? -11.907 -4.179  -7.757  1.00 0.00 ? 8  LYS A CD   3  
ATOM 2353  C CE   . LYS A 1 8  ? -11.775 -5.643  -8.146  1.00 0.00 ? 8  LYS A CE   3  
ATOM 2354  N NZ   . LYS A 1 8  ? -13.013 -6.159  -8.793  1.00 0.00 ? 8  LYS A NZ   3  
ATOM 2355  H H    . LYS A 1 8  ? -13.529 -0.329  -6.933  1.00 0.00 ? 8  LYS A H    3  
ATOM 2356  H HA   . LYS A 1 8  ? -11.247 -1.731  -6.965  1.00 0.00 ? 8  LYS A HA   3  
ATOM 2357  H HB2  . LYS A 1 8  ? -13.504 -2.086  -8.254  1.00 0.00 ? 8  LYS A HB2  3  
ATOM 2358  H HB3  . LYS A 1 8  ? -12.624 -1.379  -9.602  1.00 0.00 ? 8  LYS A HB3  3  
ATOM 2359  H HG2  . LYS A 1 8  ? -12.467 -3.751  -9.766  1.00 0.00 ? 8  LYS A HG2  3  
ATOM 2360  H HG3  . LYS A 1 8  ? -10.882 -3.128  -9.303  1.00 0.00 ? 8  LYS A HG3  3  
ATOM 2361  H HD2  . LYS A 1 8  ? -11.078 -3.911  -7.119  1.00 0.00 ? 8  LYS A HD2  3  
ATOM 2362  H HD3  . LYS A 1 8  ? -12.835 -4.040  -7.221  1.00 0.00 ? 8  LYS A HD3  3  
ATOM 2363  H HE2  . LYS A 1 8  ? -10.950 -5.746  -8.834  1.00 0.00 ? 8  LYS A HE2  3  
ATOM 2364  H HE3  . LYS A 1 8  ? -11.576 -6.222  -7.256  1.00 0.00 ? 8  LYS A HE3  3  
ATOM 2365  H HZ1  . LYS A 1 8  ? -13.456 -5.410  -9.364  1.00 0.00 ? 8  LYS A HZ1  3  
ATOM 2366  H HZ2  . LYS A 1 8  ? -13.690 -6.473  -8.069  1.00 0.00 ? 8  LYS A HZ2  3  
ATOM 2367  H HZ3  . LYS A 1 8  ? -12.785 -6.963  -9.412  1.00 0.00 ? 8  LYS A HZ3  3  
ATOM 2368  N N    . GLY A 1 9  ? -9.383  -0.402  -7.917  1.00 0.00 ? 9  GLY A N    3  
ATOM 2369  C CA   . GLY A 1 9  ? -8.262  0.267   -8.552  1.00 0.00 ? 9  GLY A CA   3  
ATOM 2370  C C    . GLY A 1 9  ? -7.190  -0.703  -9.006  1.00 0.00 ? 9  GLY A C    3  
ATOM 2371  O O    . GLY A 1 9  ? -6.933  -1.709  -8.346  1.00 0.00 ? 9  GLY A O    3  
ATOM 2372  H H    . GLY A 1 9  ? -9.244  -0.908  -7.089  1.00 0.00 ? 9  GLY A H    3  
ATOM 2373  H HA2  . GLY A 1 9  ? -8.623  0.816   -9.409  1.00 0.00 ? 9  GLY A HA2  3  
ATOM 2374  H HA3  . GLY A 1 9  ? -7.827  0.962   -7.849  1.00 0.00 ? 9  GLY A HA3  3  
ATOM 2375  N N    . GLY A 1 10 ? -6.563  -0.402  -10.140 1.00 0.00 ? 10 GLY A N    3  
ATOM 2376  C CA   . GLY A 1 10 ? -5.521  -1.266  -10.663 1.00 0.00 ? 10 GLY A CA   3  
ATOM 2377  C C    . GLY A 1 10 ? -5.896  -2.733  -10.596 1.00 0.00 ? 10 GLY A C    3  
ATOM 2378  O O    . GLY A 1 10 ? -7.008  -3.113  -10.963 1.00 0.00 ? 10 GLY A O    3  
ATOM 2379  H H    . GLY A 1 10 ? -6.810  0.414   -10.624 1.00 0.00 ? 10 GLY A H    3  
ATOM 2380  H HA2  . GLY A 1 10 ? -5.332  -1.000  -11.693 1.00 0.00 ? 10 GLY A HA2  3  
ATOM 2381  H HA3  . GLY A 1 10 ? -4.619  -1.110  -10.090 1.00 0.00 ? 10 GLY A HA3  3  
ATOM 2382  N N    . GLN A 1 11 ? -4.966  -3.559  -10.127 1.00 0.00 ? 11 GLN A N    3  
ATOM 2383  C CA   . GLN A 1 11 ? -5.205  -4.993  -10.015 1.00 0.00 ? 11 GLN A CA   3  
ATOM 2384  C C    . GLN A 1 11 ? -4.653  -5.536  -8.701  1.00 0.00 ? 11 GLN A C    3  
ATOM 2385  O O    . GLN A 1 11 ? -3.453  -5.453  -8.439  1.00 0.00 ? 11 GLN A O    3  
ATOM 2386  C CB   . GLN A 1 11 ? -4.568  -5.731  -11.194 1.00 0.00 ? 11 GLN A CB   3  
ATOM 2387  C CG   . GLN A 1 11 ? -5.327  -5.562  -12.500 1.00 0.00 ? 11 GLN A CG   3  
ATOM 2388  C CD   . GLN A 1 11 ? -4.549  -6.070  -13.697 1.00 0.00 ? 11 GLN A CD   3  
ATOM 2389  O OE1  . GLN A 1 11 ? -3.408  -5.667  -13.928 1.00 0.00 ? 11 GLN A OE1  3  
ATOM 2390  N NE2  . GLN A 1 11 ? -5.162  -6.962  -14.467 1.00 0.00 ? 11 GLN A NE2  3  
ATOM 2391  H H    . GLN A 1 11 ? -4.100  -3.196  -9.850  1.00 0.00 ? 11 GLN A H    3  
ATOM 2392  H HA   . GLN A 1 11 ? -6.272  -5.154  -10.036 1.00 0.00 ? 11 GLN A HA   3  
ATOM 2393  H HB2  . GLN A 1 11 ? -3.563  -5.360  -11.335 1.00 0.00 ? 11 GLN A HB2  3  
ATOM 2394  H HB3  . GLN A 1 11 ? -4.524  -6.785  -10.962 1.00 0.00 ? 11 GLN A HB3  3  
ATOM 2395  H HG2  . GLN A 1 11 ? -6.256  -6.109  -12.435 1.00 0.00 ? 11 GLN A HG2  3  
ATOM 2396  H HG3  . GLN A 1 11 ? -5.538  -4.513  -12.645 1.00 0.00 ? 11 GLN A HG3  3  
ATOM 2397  H HE21 . GLN A 1 11 ? -6.071  -7.236  -14.223 1.00 0.00 ? 11 GLN A HE21 3  
ATOM 2398  H HE22 . GLN A 1 11 ? -4.683  -7.307  -15.248 1.00 0.00 ? 11 GLN A HE22 3  
ATOM 2399  N N    . VAL A 1 12 ? -5.537  -6.092  -7.878  1.00 0.00 ? 12 VAL A N    3  
ATOM 2400  C CA   . VAL A 1 12 ? -5.138  -6.649  -6.592  1.00 0.00 ? 12 VAL A CA   3  
ATOM 2401  C C    . VAL A 1 12 ? -5.585  -8.101  -6.459  1.00 0.00 ? 12 VAL A C    3  
ATOM 2402  O O    . VAL A 1 12 ? -6.673  -8.468  -6.902  1.00 0.00 ? 12 VAL A O    3  
ATOM 2403  C CB   . VAL A 1 12 ? -5.721  -5.835  -5.422  1.00 0.00 ? 12 VAL A CB   3  
ATOM 2404  C CG1  . VAL A 1 12 ? -5.356  -6.474  -4.091  1.00 0.00 ? 12 VAL A CG1  3  
ATOM 2405  C CG2  . VAL A 1 12 ? -5.236  -4.394  -5.482  1.00 0.00 ? 12 VAL A CG2  3  
ATOM 2406  H H    . VAL A 1 12 ? -6.479  -6.128  -8.143  1.00 0.00 ? 12 VAL A H    3  
ATOM 2407  H HA   . VAL A 1 12 ? -4.060  -6.607  -6.529  1.00 0.00 ? 12 VAL A HA   3  
ATOM 2408  H HB   . VAL A 1 12 ? -6.798  -5.834  -5.512  1.00 0.00 ? 12 VAL A HB   3  
ATOM 2409  H HG11 . VAL A 1 12 ? -6.168  -7.105  -3.760  1.00 0.00 ? 12 VAL A HG11 3  
ATOM 2410  H HG12 . VAL A 1 12 ? -4.462  -7.068  -4.210  1.00 0.00 ? 12 VAL A HG12 3  
ATOM 2411  H HG13 . VAL A 1 12 ? -5.180  -5.702  -3.357  1.00 0.00 ? 12 VAL A HG13 3  
ATOM 2412  H HG21 . VAL A 1 12 ? -4.881  -4.094  -4.507  1.00 0.00 ? 12 VAL A HG21 3  
ATOM 2413  H HG22 . VAL A 1 12 ? -4.432  -4.314  -6.199  1.00 0.00 ? 12 VAL A HG22 3  
ATOM 2414  H HG23 . VAL A 1 12 ? -6.051  -3.752  -5.782  1.00 0.00 ? 12 VAL A HG23 3  
ATOM 2415  N N    . ARG A 1 13 ? -4.738  -8.921  -5.846  1.00 0.00 ? 13 ARG A N    3  
ATOM 2416  C CA   . ARG A 1 13 ? -5.046  -10.334 -5.656  1.00 0.00 ? 13 ARG A CA   3  
ATOM 2417  C C    . ARG A 1 13 ? -4.967  -10.713 -4.180  1.00 0.00 ? 13 ARG A C    3  
ATOM 2418  O O    . ARG A 1 13 ? -4.473  -11.785 -3.829  1.00 0.00 ? 13 ARG A O    3  
ATOM 2419  C CB   . ARG A 1 13 ? -4.083  -11.201 -6.468  1.00 0.00 ? 13 ARG A CB   3  
ATOM 2420  C CG   . ARG A 1 13 ? -4.687  -12.519 -6.924  1.00 0.00 ? 13 ARG A CG   3  
ATOM 2421  C CD   . ARG A 1 13 ? -3.909  -13.117 -8.086  1.00 0.00 ? 13 ARG A CD   3  
ATOM 2422  N NE   . ARG A 1 13 ? -2.832  -13.992 -7.631  1.00 0.00 ? 13 ARG A NE   3  
ATOM 2423  C CZ   . ARG A 1 13 ? -2.186  -14.836 -8.427  1.00 0.00 ? 13 ARG A CZ   3  
ATOM 2424  N NH1  . ARG A 1 13 ? -2.506  -14.919 -9.711  1.00 0.00 ? 13 ARG A NH1  3  
ATOM 2425  N NH2  . ARG A 1 13 ? -1.217  -15.600 -7.939  1.00 0.00 ? 13 ARG A NH2  3  
ATOM 2426  H H    . ARG A 1 13 ? -3.886  -8.569  -5.515  1.00 0.00 ? 13 ARG A H    3  
ATOM 2427  H HA   . ARG A 1 13 ? -6.053  -10.504 -6.006  1.00 0.00 ? 13 ARG A HA   3  
ATOM 2428  H HB2  . ARG A 1 13 ? -3.772  -10.651 -7.344  1.00 0.00 ? 13 ARG A HB2  3  
ATOM 2429  H HB3  . ARG A 1 13 ? -3.215  -11.418 -5.863  1.00 0.00 ? 13 ARG A HB3  3  
ATOM 2430  H HG2  . ARG A 1 13 ? -4.672  -13.216 -6.099  1.00 0.00 ? 13 ARG A HG2  3  
ATOM 2431  H HG3  . ARG A 1 13 ? -5.707  -12.348 -7.235  1.00 0.00 ? 13 ARG A HG3  3  
ATOM 2432  H HD2  . ARG A 1 13 ? -4.588  -13.687 -8.701  1.00 0.00 ? 13 ARG A HD2  3  
ATOM 2433  H HD3  . ARG A 1 13 ? -3.485  -12.312 -8.669  1.00 0.00 ? 13 ARG A HD3  3  
ATOM 2434  H HE   . ARG A 1 13 ? -2.580  -13.947 -6.686  1.00 0.00 ? 13 ARG A HE   3  
ATOM 2435  H HH11 . ARG A 1 13 ? -3.234  -14.344 -10.082 1.00 0.00 ? 13 ARG A HH11 3  
ATOM 2436  H HH12 . ARG A 1 13 ? -2.016  -15.555 -10.308 1.00 0.00 ? 13 ARG A HH12 3  
ATOM 2437  H HH21 . ARG A 1 13 ? -0.973  -15.541 -6.971  1.00 0.00 ? 13 ARG A HH21 3  
ATOM 2438  H HH22 . ARG A 1 13 ? -0.731  -16.236 -8.538  1.00 0.00 ? 13 ARG A HH22 3  
ATOM 2439  N N    . PHE A 1 14 ? -5.458  -9.826  -3.320  1.00 0.00 ? 14 PHE A N    3  
ATOM 2440  C CA   . PHE A 1 14 ? -5.442  -10.067 -1.881  1.00 0.00 ? 14 PHE A CA   3  
ATOM 2441  C C    . PHE A 1 14 ? -6.793  -9.727  -1.258  1.00 0.00 ? 14 PHE A C    3  
ATOM 2442  O O    . PHE A 1 14 ? -7.589  -8.990  -1.840  1.00 0.00 ? 14 PHE A O    3  
ATOM 2443  C CB   . PHE A 1 14 ? -4.339  -9.241  -1.217  1.00 0.00 ? 14 PHE A CB   3  
ATOM 2444  C CG   . PHE A 1 14 ? -2.965  -9.539  -1.746  1.00 0.00 ? 14 PHE A CG   3  
ATOM 2445  C CD1  . PHE A 1 14 ? -2.221  -10.587 -1.227  1.00 0.00 ? 14 PHE A CD1  3  
ATOM 2446  C CD2  . PHE A 1 14 ? -2.418  -8.773  -2.762  1.00 0.00 ? 14 PHE A CD2  3  
ATOM 2447  C CE1  . PHE A 1 14 ? -0.957  -10.863 -1.712  1.00 0.00 ? 14 PHE A CE1  3  
ATOM 2448  C CE2  . PHE A 1 14 ? -1.154  -9.044  -3.251  1.00 0.00 ? 14 PHE A CE2  3  
ATOM 2449  C CZ   . PHE A 1 14 ? -0.423  -10.092 -2.726  1.00 0.00 ? 14 PHE A CZ   3  
ATOM 2450  H H    . PHE A 1 14 ? -5.839  -8.990  -3.660  1.00 0.00 ? 14 PHE A H    3  
ATOM 2451  H HA   . PHE A 1 14 ? -5.240  -11.115 -1.724  1.00 0.00 ? 14 PHE A HA   3  
ATOM 2452  H HB2  . PHE A 1 14 ? -4.536  -8.192  -1.380  1.00 0.00 ? 14 PHE A HB2  3  
ATOM 2453  H HB3  . PHE A 1 14 ? -4.338  -9.442  -0.156  1.00 0.00 ? 14 PHE A HB3  3  
ATOM 2454  H HD1  . PHE A 1 14 ? -2.637  -11.192 -0.435  1.00 0.00 ? 14 PHE A HD1  3  
ATOM 2455  H HD2  . PHE A 1 14 ? -2.990  -7.953  -3.174  1.00 0.00 ? 14 PHE A HD2  3  
ATOM 2456  H HE1  . PHE A 1 14 ? -0.387  -11.683 -1.300  1.00 0.00 ? 14 PHE A HE1  3  
ATOM 2457  H HE2  . PHE A 1 14 ? -0.740  -8.439  -4.044  1.00 0.00 ? 14 PHE A HE2  3  
ATOM 2458  H HZ   . PHE A 1 14 ? 0.565   -10.305 -3.106  1.00 0.00 ? 14 PHE A HZ   3  
ATOM 2459  N N    . SER A 1 15 ? -7.044  -10.271 -0.072  1.00 0.00 ? 15 SER A N    3  
ATOM 2460  C CA   . SER A 1 15 ? -8.300  -10.030 0.629   1.00 0.00 ? 15 SER A CA   3  
ATOM 2461  C C    . SER A 1 15 ? -8.114  -8.997  1.736   1.00 0.00 ? 15 SER A C    3  
ATOM 2462  O O    . SER A 1 15 ? -7.021  -8.842  2.279   1.00 0.00 ? 15 SER A O    3  
ATOM 2463  C CB   . SER A 1 15 ? -8.837  -11.335 1.219   1.00 0.00 ? 15 SER A CB   3  
ATOM 2464  O OG   . SER A 1 15 ? -10.241 -11.273 1.401   1.00 0.00 ? 15 SER A OG   3  
ATOM 2465  H H    . SER A 1 15 ? -6.369  -10.851 0.340   1.00 0.00 ? 15 SER A H    3  
ATOM 2466  H HA   . SER A 1 15 ? -9.012  -9.649  -0.088  1.00 0.00 ? 15 SER A HA   3  
ATOM 2467  H HB2  . SER A 1 15 ? -8.609  -12.151 0.550   1.00 0.00 ? 15 SER A HB2  3  
ATOM 2468  H HB3  . SER A 1 15 ? -8.370  -11.514 2.177   1.00 0.00 ? 15 SER A HB3  3  
ATOM 2469  H HG   . SER A 1 15 ? -10.491 -10.385 1.668   1.00 0.00 ? 15 SER A HG   3  
ATOM 2470  N N    . ASN A 1 16 ? -9.192  -8.291  2.064   1.00 0.00 ? 16 ASN A N    3  
ATOM 2471  C CA   . ASN A 1 16 ? -9.149  -7.271  3.106   1.00 0.00 ? 16 ASN A CA   3  
ATOM 2472  C C    . ASN A 1 16 ? -8.310  -7.739  4.291   1.00 0.00 ? 16 ASN A C    3  
ATOM 2473  O O    . ASN A 1 16 ? -7.321  -7.102  4.655   1.00 0.00 ? 16 ASN A O    3  
ATOM 2474  C CB   . ASN A 1 16 ? -10.566 -6.929  3.572   1.00 0.00 ? 16 ASN A CB   3  
ATOM 2475  C CG   . ASN A 1 16 ? -10.584 -6.308  4.955   1.00 0.00 ? 16 ASN A CG   3  
ATOM 2476  O OD1  . ASN A 1 16 ? -11.092 -6.900  5.908   1.00 0.00 ? 16 ASN A OD1  3  
ATOM 2477  N ND2  . ASN A 1 16 ? -10.030 -5.107  5.072   1.00 0.00 ? 16 ASN A ND2  3  
ATOM 2478  H H    . ASN A 1 16 ? -10.035 -8.460  1.595   1.00 0.00 ? 16 ASN A H    3  
ATOM 2479  H HA   . ASN A 1 16 ? -8.695  -6.387  2.685   1.00 0.00 ? 16 ASN A HA   3  
ATOM 2480  H HB2  . ASN A 1 16 ? -11.007 -6.229  2.878   1.00 0.00 ? 16 ASN A HB2  3  
ATOM 2481  H HB3  . ASN A 1 16 ? -11.159 -7.831  3.595   1.00 0.00 ? 16 ASN A HB3  3  
ATOM 2482  H HD21 . ASN A 1 16 ? -9.645  -4.695  4.270   1.00 0.00 ? 16 ASN A HD21 3  
ATOM 2483  H HD22 . ASN A 1 16 ? -10.028 -4.682  5.955   1.00 0.00 ? 16 ASN A HD22 3  
ATOM 2484  N N    . ASP A 1 17 ? -8.712  -8.855  4.889   1.00 0.00 ? 17 ASP A N    3  
ATOM 2485  C CA   . ASP A 1 17 ? -7.997  -9.410  6.033   1.00 0.00 ? 17 ASP A CA   3  
ATOM 2486  C C    . ASP A 1 17 ? -6.546  -9.712  5.672   1.00 0.00 ? 17 ASP A C    3  
ATOM 2487  O O    . ASP A 1 17 ? -5.622  -9.270  6.355   1.00 0.00 ? 17 ASP A O    3  
ATOM 2488  C CB   . ASP A 1 17 ? -8.688  -10.682 6.526   1.00 0.00 ? 17 ASP A CB   3  
ATOM 2489  C CG   . ASP A 1 17 ? -10.188 -10.508 6.667   1.00 0.00 ? 17 ASP A CG   3  
ATOM 2490  O OD1  . ASP A 1 17 ? -10.613 -9.518  7.299   1.00 0.00 ? 17 ASP A OD1  3  
ATOM 2491  O OD2  . ASP A 1 17 ? -10.935 -11.362 6.146   1.00 0.00 ? 17 ASP A OD2  3  
ATOM 2492  H H    . ASP A 1 17 ? -9.508  -9.318  4.553   1.00 0.00 ? 17 ASP A H    3  
ATOM 2493  H HA   . ASP A 1 17 ? -8.012  -8.674  6.823   1.00 0.00 ? 17 ASP A HA   3  
ATOM 2494  H HB2  . ASP A 1 17 ? -8.502  -11.481 5.822   1.00 0.00 ? 17 ASP A HB2  3  
ATOM 2495  H HB3  . ASP A 1 17 ? -8.283  -10.954 7.489   1.00 0.00 ? 17 ASP A HB3  3  
ATOM 2496  N N    . GLN A 1 18 ? -6.354  -10.468 4.596   1.00 0.00 ? 18 GLN A N    3  
ATOM 2497  C CA   . GLN A 1 18 ? -5.015  -10.830 4.146   1.00 0.00 ? 18 GLN A CA   3  
ATOM 2498  C C    . GLN A 1 18 ? -4.094  -9.615  4.145   1.00 0.00 ? 18 GLN A C    3  
ATOM 2499  O O    . GLN A 1 18 ? -3.034  -9.625  4.772   1.00 0.00 ? 18 GLN A O    3  
ATOM 2500  C CB   . GLN A 1 18 ? -5.073  -11.442 2.745   1.00 0.00 ? 18 GLN A CB   3  
ATOM 2501  C CG   . GLN A 1 18 ? -5.356  -12.936 2.745   1.00 0.00 ? 18 GLN A CG   3  
ATOM 2502  C CD   . GLN A 1 18 ? -5.736  -13.457 1.373   1.00 0.00 ? 18 GLN A CD   3  
ATOM 2503  O OE1  . GLN A 1 18 ? -5.774  -12.705 0.398   1.00 0.00 ? 18 GLN A OE1  3  
ATOM 2504  N NE2  . GLN A 1 18 ? -6.020  -14.752 1.289   1.00 0.00 ? 18 GLN A NE2  3  
ATOM 2505  H H    . GLN A 1 18 ? -7.131  -10.789 4.093   1.00 0.00 ? 18 GLN A H    3  
ATOM 2506  H HA   . GLN A 1 18 ? -4.622  -11.564 4.833   1.00 0.00 ? 18 GLN A HA   3  
ATOM 2507  H HB2  . GLN A 1 18 ? -5.852  -10.950 2.182   1.00 0.00 ? 18 GLN A HB2  3  
ATOM 2508  H HB3  . GLN A 1 18 ? -4.126  -11.277 2.254   1.00 0.00 ? 18 GLN A HB3  3  
ATOM 2509  H HG2  . GLN A 1 18 ? -4.471  -13.457 3.078   1.00 0.00 ? 18 GLN A HG2  3  
ATOM 2510  H HG3  . GLN A 1 18 ? -6.169  -13.135 3.428   1.00 0.00 ? 18 GLN A HG3  3  
ATOM 2511  H HE21 . GLN A 1 18 ? -5.970  -15.290 2.108   1.00 0.00 ? 18 GLN A HE21 3  
ATOM 2512  H HE22 . GLN A 1 18 ? -6.269  -15.115 0.415   1.00 0.00 ? 18 GLN A HE22 3  
ATOM 2513  N N    . THR A 1 19 ? -4.504  -8.567  3.436   1.00 0.00 ? 19 THR A N    3  
ATOM 2514  C CA   . THR A 1 19 ? -3.715  -7.345  3.352   1.00 0.00 ? 19 THR A CA   3  
ATOM 2515  C C    . THR A 1 19 ? -3.353  -6.828  4.740   1.00 0.00 ? 19 THR A C    3  
ATOM 2516  O O    . THR A 1 19 ? -2.181  -6.598  5.040   1.00 0.00 ? 19 THR A O    3  
ATOM 2517  C CB   . THR A 1 19 ? -4.469  -6.241  2.587   1.00 0.00 ? 19 THR A CB   3  
ATOM 2518  O OG1  . THR A 1 19 ? -4.946  -6.751  1.336   1.00 0.00 ? 19 THR A OG1  3  
ATOM 2519  C CG2  . THR A 1 19 ? -3.568  -5.041  2.341   1.00 0.00 ? 19 THR A CG2  3  
ATOM 2520  H H    . THR A 1 19 ? -5.358  -8.620  2.958   1.00 0.00 ? 19 THR A H    3  
ATOM 2521  H HA   . THR A 1 19 ? -2.806  -7.571  2.814   1.00 0.00 ? 19 THR A HA   3  
ATOM 2522  H HB   . THR A 1 19 ? -5.313  -5.923  3.183   1.00 0.00 ? 19 THR A HB   3  
ATOM 2523  H HG1  . THR A 1 19 ? -5.858  -6.480  1.207   1.00 0.00 ? 19 THR A HG1  3  
ATOM 2524  H HG21 . THR A 1 19 ? -2.892  -5.259  1.527   1.00 0.00 ? 19 THR A HG21 3  
ATOM 2525  H HG22 . THR A 1 19 ? -2.999  -4.829  3.234   1.00 0.00 ? 19 THR A HG22 3  
ATOM 2526  H HG23 . THR A 1 19 ? -4.172  -4.184  2.086   1.00 0.00 ? 19 THR A HG23 3  
ATOM 2527  N N    . ILE A 1 20 ? -4.364  -6.648  5.582   1.00 0.00 ? 20 ILE A N    3  
ATOM 2528  C CA   . ILE A 1 20 ? -4.151  -6.161  6.939   1.00 0.00 ? 20 ILE A CA   3  
ATOM 2529  C C    . ILE A 1 20 ? -2.881  -6.752  7.542   1.00 0.00 ? 20 ILE A C    3  
ATOM 2530  O O    . ILE A 1 20 ? -1.958  -6.023  7.905   1.00 0.00 ? 20 ILE A O    3  
ATOM 2531  C CB   . ILE A 1 20 ? -5.344  -6.497  7.853   1.00 0.00 ? 20 ILE A CB   3  
ATOM 2532  C CG1  . ILE A 1 20 ? -6.578  -5.695  7.433   1.00 0.00 ? 20 ILE A CG1  3  
ATOM 2533  C CG2  . ILE A 1 20 ? -4.993  -6.217  9.306   1.00 0.00 ? 20 ILE A CG2  3  
ATOM 2534  C CD1  . ILE A 1 20 ? -7.861  -6.185  8.065   1.00 0.00 ? 20 ILE A CD1  3  
ATOM 2535  H H    . ILE A 1 20 ? -5.276  -6.849  5.284   1.00 0.00 ? 20 ILE A H    3  
ATOM 2536  H HA   . ILE A 1 20 ? -4.049  -5.086  6.894   1.00 0.00 ? 20 ILE A HA   3  
ATOM 2537  H HB   . ILE A 1 20 ? -5.558  -7.550  7.755   1.00 0.00 ? 20 ILE A HB   3  
ATOM 2538  H HG12 . ILE A 1 20 ? -6.442  -4.663  7.716   1.00 0.00 ? 20 ILE A HG12 3  
ATOM 2539  H HG13 . ILE A 1 20 ? -6.690  -5.757  6.360   1.00 0.00 ? 20 ILE A HG13 3  
ATOM 2540  H HG21 . ILE A 1 20 ? -4.205  -6.884  9.621   1.00 0.00 ? 20 ILE A HG21 3  
ATOM 2541  H HG22 . ILE A 1 20 ? -4.660  -5.195  9.405   1.00 0.00 ? 20 ILE A HG22 3  
ATOM 2542  H HG23 . ILE A 1 20 ? -5.865  -6.374  9.924   1.00 0.00 ? 20 ILE A HG23 3  
ATOM 2543  H HD11 . ILE A 1 20 ? -8.681  -6.038  7.377   1.00 0.00 ? 20 ILE A HD11 3  
ATOM 2544  H HD12 . ILE A 1 20 ? -7.770  -7.235  8.298   1.00 0.00 ? 20 ILE A HD12 3  
ATOM 2545  H HD13 . ILE A 1 20 ? -8.050  -5.631  8.973   1.00 0.00 ? 20 ILE A HD13 3  
ATOM 2546  N N    . GLU A 1 21 ? -2.842  -8.076  7.644   1.00 0.00 ? 21 GLU A N    3  
ATOM 2547  C CA   . GLU A 1 21 ? -1.684  -8.765  8.202   1.00 0.00 ? 21 GLU A CA   3  
ATOM 2548  C C    . GLU A 1 21 ? -0.459  -8.580  7.311   1.00 0.00 ? 21 GLU A C    3  
ATOM 2549  O O    . GLU A 1 21 ? 0.615   -8.205  7.783   1.00 0.00 ? 21 GLU A O    3  
ATOM 2550  C CB   . GLU A 1 21 ? -1.983  -10.256 8.373   1.00 0.00 ? 21 GLU A CB   3  
ATOM 2551  C CG   . GLU A 1 21 ? -2.578  -10.606 9.727   1.00 0.00 ? 21 GLU A CG   3  
ATOM 2552  C CD   . GLU A 1 21 ? -1.519  -10.929 10.763  1.00 0.00 ? 21 GLU A CD   3  
ATOM 2553  O OE1  . GLU A 1 21 ? -0.830  -9.993  11.221  1.00 0.00 ? 21 GLU A OE1  3  
ATOM 2554  O OE2  . GLU A 1 21 ? -1.379  -12.119 11.117  1.00 0.00 ? 21 GLU A OE2  3  
ATOM 2555  H H    . GLU A 1 21 ? -3.609  -8.603  7.337   1.00 0.00 ? 21 GLU A H    3  
ATOM 2556  H HA   . GLU A 1 21 ? -1.478  -8.335  9.171   1.00 0.00 ? 21 GLU A HA   3  
ATOM 2557  H HB2  . GLU A 1 21 ? -2.680  -10.561 7.607   1.00 0.00 ? 21 GLU A HB2  3  
ATOM 2558  H HB3  . GLU A 1 21 ? -1.064  -10.811 8.253   1.00 0.00 ? 21 GLU A HB3  3  
ATOM 2559  H HG2  . GLU A 1 21 ? -3.159  -9.767  10.079  1.00 0.00 ? 21 GLU A HG2  3  
ATOM 2560  H HG3  . GLU A 1 21 ? -3.222  -11.465 9.612   1.00 0.00 ? 21 GLU A HG3  3  
ATOM 2561  N N    . LEU A 1 22 ? -0.628  -8.846  6.021   1.00 0.00 ? 22 LEU A N    3  
ATOM 2562  C CA   . LEU A 1 22 ? 0.464   -8.709  5.062   1.00 0.00 ? 22 LEU A CA   3  
ATOM 2563  C C    . LEU A 1 22 ? 1.277   -7.449  5.338   1.00 0.00 ? 22 LEU A C    3  
ATOM 2564  O O    . LEU A 1 22 ? 2.462   -7.381  5.017   1.00 0.00 ? 22 LEU A O    3  
ATOM 2565  C CB   . LEU A 1 22 ? -0.086  -8.673  3.635   1.00 0.00 ? 22 LEU A CB   3  
ATOM 2566  C CG   . LEU A 1 22 ? -0.348  -10.030 2.982   1.00 0.00 ? 22 LEU A CG   3  
ATOM 2567  C CD1  . LEU A 1 22 ? -1.091  -9.855  1.666   1.00 0.00 ? 22 LEU A CD1  3  
ATOM 2568  C CD2  . LEU A 1 22 ? 0.959   -10.778 2.763   1.00 0.00 ? 22 LEU A CD2  3  
ATOM 2569  H H    . LEU A 1 22 ? -1.506  -9.141  5.704   1.00 0.00 ? 22 LEU A H    3  
ATOM 2570  H HA   . LEU A 1 22 ? 1.108   -9.569  5.169   1.00 0.00 ? 22 LEU A HA   3  
ATOM 2571  H HB2  . LEU A 1 22 ? -1.019  -8.130  3.654   1.00 0.00 ? 22 LEU A HB2  3  
ATOM 2572  H HB3  . LEU A 1 22 ? 0.626   -8.141  3.021   1.00 0.00 ? 22 LEU A HB3  3  
ATOM 2573  H HG   . LEU A 1 22 ? -0.969  -10.625 3.638   1.00 0.00 ? 22 LEU A HG   3  
ATOM 2574  H HD11 . LEU A 1 22 ? -0.810  -8.915  1.217   1.00 0.00 ? 22 LEU A HD11 3  
ATOM 2575  H HD12 . LEU A 1 22 ? -2.155  -9.864  1.850   1.00 0.00 ? 22 LEU A HD12 3  
ATOM 2576  H HD13 . LEU A 1 22 ? -0.834  -10.665 0.998   1.00 0.00 ? 22 LEU A HD13 3  
ATOM 2577  H HD21 . LEU A 1 22 ? 1.008   -11.622 3.436   1.00 0.00 ? 22 LEU A HD21 3  
ATOM 2578  H HD22 . LEU A 1 22 ? 1.790   -10.115 2.957   1.00 0.00 ? 22 LEU A HD22 3  
ATOM 2579  H HD23 . LEU A 1 22 ? 1.008   -11.128 1.743   1.00 0.00 ? 22 LEU A HD23 3  
ATOM 2580  N N    . GLU A 1 23 ? 0.630   -6.454  5.938   1.00 0.00 ? 23 GLU A N    3  
ATOM 2581  C CA   . GLU A 1 23 ? 1.295   -5.196  6.258   1.00 0.00 ? 23 GLU A CA   3  
ATOM 2582  C C    . GLU A 1 23 ? 1.943   -5.259  7.639   1.00 0.00 ? 23 GLU A C    3  
ATOM 2583  O O    . GLU A 1 23 ? 3.157   -5.109  7.775   1.00 0.00 ? 23 GLU A O    3  
ATOM 2584  C CB   . GLU A 1 23 ? 0.296   -4.038  6.205   1.00 0.00 ? 23 GLU A CB   3  
ATOM 2585  C CG   . GLU A 1 23 ? -0.427  -3.919  4.874   1.00 0.00 ? 23 GLU A CG   3  
ATOM 2586  C CD   . GLU A 1 23 ? -0.950  -2.519  4.616   1.00 0.00 ? 23 GLU A CD   3  
ATOM 2587  O OE1  . GLU A 1 23 ? -0.432  -1.569  5.240   1.00 0.00 ? 23 GLU A OE1  3  
ATOM 2588  O OE2  . GLU A 1 23 ? -1.876  -2.374  3.792   1.00 0.00 ? 23 GLU A OE2  3  
ATOM 2589  H H    . GLU A 1 23 ? -0.315  -6.568  6.169   1.00 0.00 ? 23 GLU A H    3  
ATOM 2590  H HA   . GLU A 1 23 ? 2.065   -5.030  5.520   1.00 0.00 ? 23 GLU A HA   3  
ATOM 2591  H HB2  . GLU A 1 23 ? -0.441  -4.177  6.981   1.00 0.00 ? 23 GLU A HB2  3  
ATOM 2592  H HB3  . GLU A 1 23 ? 0.826   -3.114  6.386   1.00 0.00 ? 23 GLU A HB3  3  
ATOM 2593  H HG2  . GLU A 1 23 ? 0.257   -4.183  4.081   1.00 0.00 ? 23 GLU A HG2  3  
ATOM 2594  H HG3  . GLU A 1 23 ? -1.261  -4.606  4.870   1.00 0.00 ? 23 GLU A HG3  3  
ATOM 2595  N N    . LYS A 1 24 ? 1.124   -5.482  8.661   1.00 0.00 ? 24 LYS A N    3  
ATOM 2596  C CA   . LYS A 1 24 ? 1.615   -5.566  10.031  1.00 0.00 ? 24 LYS A CA   3  
ATOM 2597  C C    . LYS A 1 24 ? 2.940   -6.320  10.089  1.00 0.00 ? 24 LYS A C    3  
ATOM 2598  O O    . LYS A 1 24 ? 3.747   -6.108  10.994  1.00 0.00 ? 24 LYS A O    3  
ATOM 2599  C CB   . LYS A 1 24 ? 0.582   -6.260  10.923  1.00 0.00 ? 24 LYS A CB   3  
ATOM 2600  C CG   . LYS A 1 24 ? -0.771  -5.570  10.936  1.00 0.00 ? 24 LYS A CG   3  
ATOM 2601  C CD   . LYS A 1 24 ? -1.837  -6.445  11.575  1.00 0.00 ? 24 LYS A CD   3  
ATOM 2602  C CE   . LYS A 1 24 ? -1.924  -6.211  13.075  1.00 0.00 ? 24 LYS A CE   3  
ATOM 2603  N NZ   . LYS A 1 24 ? -0.996  -7.099  13.830  1.00 0.00 ? 24 LYS A NZ   3  
ATOM 2604  H H    . LYS A 1 24 ? 0.165   -5.594  8.489   1.00 0.00 ? 24 LYS A H    3  
ATOM 2605  H HA   . LYS A 1 24 ? 1.770   -4.560  10.390  1.00 0.00 ? 24 LYS A HA   3  
ATOM 2606  H HB2  . LYS A 1 24 ? 0.444   -7.272  10.572  1.00 0.00 ? 24 LYS A HB2  3  
ATOM 2607  H HB3  . LYS A 1 24 ? 0.959   -6.287  11.935  1.00 0.00 ? 24 LYS A HB3  3  
ATOM 2608  H HG2  . LYS A 1 24 ? -0.691  -4.651  11.497  1.00 0.00 ? 24 LYS A HG2  3  
ATOM 2609  H HG3  . LYS A 1 24 ? -1.062  -5.349  9.919   1.00 0.00 ? 24 LYS A HG3  3  
ATOM 2610  H HD2  . LYS A 1 24 ? -2.793  -6.215  11.130  1.00 0.00 ? 24 LYS A HD2  3  
ATOM 2611  H HD3  . LYS A 1 24 ? -1.594  -7.483  11.395  1.00 0.00 ? 24 LYS A HD3  3  
ATOM 2612  H HE2  . LYS A 1 24 ? -1.671  -5.182  13.281  1.00 0.00 ? 24 LYS A HE2  3  
ATOM 2613  H HE3  . LYS A 1 24 ? -2.936  -6.405  13.398  1.00 0.00 ? 24 LYS A HE3  3  
ATOM 2614  H HZ1  . LYS A 1 24 ? -0.117  -7.236  13.291  1.00 0.00 ? 24 LYS A HZ1  3  
ATOM 2615  H HZ2  . LYS A 1 24 ? -1.439  -8.025  13.990  1.00 0.00 ? 24 LYS A HZ2  3  
ATOM 2616  H HZ3  . LYS A 1 24 ? -0.764  -6.673  14.750  1.00 0.00 ? 24 LYS A HZ3  3  
ATOM 2617  N N    . LYS A 1 25 ? 3.158   -7.199  9.117   1.00 0.00 ? 25 LYS A N    3  
ATOM 2618  C CA   . LYS A 1 25 ? 4.387   -7.982  9.055   1.00 0.00 ? 25 LYS A CA   3  
ATOM 2619  C C    . LYS A 1 25 ? 5.529   -7.157  8.469   1.00 0.00 ? 25 LYS A C    3  
ATOM 2620  O O    . LYS A 1 25 ? 6.572   -6.987  9.101   1.00 0.00 ? 25 LYS A O    3  
ATOM 2621  C CB   . LYS A 1 25 ? 4.170   -9.242  8.214   1.00 0.00 ? 25 LYS A CB   3  
ATOM 2622  C CG   . LYS A 1 25 ? 5.270   -10.277 8.375   1.00 0.00 ? 25 LYS A CG   3  
ATOM 2623  C CD   . LYS A 1 25 ? 5.384   -10.751 9.815   1.00 0.00 ? 25 LYS A CD   3  
ATOM 2624  C CE   . LYS A 1 25 ? 6.091   -12.094 9.905   1.00 0.00 ? 25 LYS A CE   3  
ATOM 2625  N NZ   . LYS A 1 25 ? 5.788   -12.796 11.183  1.00 0.00 ? 25 LYS A NZ   3  
ATOM 2626  H H    . LYS A 1 25 ? 2.477   -7.323  8.423   1.00 0.00 ? 25 LYS A H    3  
ATOM 2627  H HA   . LYS A 1 25 ? 4.647   -8.271  10.062  1.00 0.00 ? 25 LYS A HA   3  
ATOM 2628  H HB2  . LYS A 1 25 ? 3.233   -9.696  8.502   1.00 0.00 ? 25 LYS A HB2  3  
ATOM 2629  H HB3  . LYS A 1 25 ? 4.119   -8.961  7.172   1.00 0.00 ? 25 LYS A HB3  3  
ATOM 2630  H HG2  . LYS A 1 25 ? 5.049   -11.125 7.745   1.00 0.00 ? 25 LYS A HG2  3  
ATOM 2631  H HG3  . LYS A 1 25 ? 6.211   -9.838  8.075   1.00 0.00 ? 25 LYS A HG3  3  
ATOM 2632  H HD2  . LYS A 1 25 ? 5.945   -10.023 10.381  1.00 0.00 ? 25 LYS A HD2  3  
ATOM 2633  H HD3  . LYS A 1 25 ? 4.392   -10.847 10.232  1.00 0.00 ? 25 LYS A HD3  3  
ATOM 2634  H HE2  . LYS A 1 25 ? 5.769   -12.712 9.081   1.00 0.00 ? 25 LYS A HE2  3  
ATOM 2635  H HE3  . LYS A 1 25 ? 7.156   -11.931 9.838   1.00 0.00 ? 25 LYS A HE3  3  
ATOM 2636  H HZ1  . LYS A 1 25 ? 6.432   -13.602 11.310  1.00 0.00 ? 25 LYS A HZ1  3  
ATOM 2637  H HZ2  . LYS A 1 25 ? 4.809   -13.147 11.175  1.00 0.00 ? 25 LYS A HZ2  3  
ATOM 2638  H HZ3  . LYS A 1 25 ? 5.904   -12.144 11.985  1.00 0.00 ? 25 LYS A HZ3  3  
ATOM 2639  N N    . PHE A 1 26 ? 5.324   -6.646  7.260   1.00 0.00 ? 26 PHE A N    3  
ATOM 2640  C CA   . PHE A 1 26 ? 6.336   -5.839  6.590   1.00 0.00 ? 26 PHE A CA   3  
ATOM 2641  C C    . PHE A 1 26 ? 6.894   -4.775  7.531   1.00 0.00 ? 26 PHE A C    3  
ATOM 2642  O O    . PHE A 1 26 ? 8.083   -4.459  7.491   1.00 0.00 ? 26 PHE A O    3  
ATOM 2643  C CB   . PHE A 1 26 ? 5.747   -5.175  5.344   1.00 0.00 ? 26 PHE A CB   3  
ATOM 2644  C CG   . PHE A 1 26 ? 6.572   -4.031  4.826   1.00 0.00 ? 26 PHE A CG   3  
ATOM 2645  C CD1  . PHE A 1 26 ? 6.484   -2.777  5.408   1.00 0.00 ? 26 PHE A CD1  3  
ATOM 2646  C CD2  . PHE A 1 26 ? 7.437   -4.211  3.758   1.00 0.00 ? 26 PHE A CD2  3  
ATOM 2647  C CE1  . PHE A 1 26 ? 7.242   -1.723  4.933   1.00 0.00 ? 26 PHE A CE1  3  
ATOM 2648  C CE2  . PHE A 1 26 ? 8.197   -3.161  3.280   1.00 0.00 ? 26 PHE A CE2  3  
ATOM 2649  C CZ   . PHE A 1 26 ? 8.100   -1.916  3.869   1.00 0.00 ? 26 PHE A CZ   3  
ATOM 2650  H H    . PHE A 1 26 ? 4.471   -6.816  6.807   1.00 0.00 ? 26 PHE A H    3  
ATOM 2651  H HA   . PHE A 1 26 ? 7.139   -6.495  6.292   1.00 0.00 ? 26 PHE A HA   3  
ATOM 2652  H HB2  . PHE A 1 26 ? 5.668   -5.909  4.556   1.00 0.00 ? 26 PHE A HB2  3  
ATOM 2653  H HB3  . PHE A 1 26 ? 4.763   -4.797  5.577   1.00 0.00 ? 26 PHE A HB3  3  
ATOM 2654  H HD1  . PHE A 1 26 ? 5.814   -2.625  6.241   1.00 0.00 ? 26 PHE A HD1  3  
ATOM 2655  H HD2  . PHE A 1 26 ? 7.514   -5.186  3.297   1.00 0.00 ? 26 PHE A HD2  3  
ATOM 2656  H HE1  . PHE A 1 26 ? 7.164   -0.751  5.396   1.00 0.00 ? 26 PHE A HE1  3  
ATOM 2657  H HE2  . PHE A 1 26 ? 8.868   -3.315  2.447   1.00 0.00 ? 26 PHE A HE2  3  
ATOM 2658  H HZ   . PHE A 1 26 ? 8.693   -1.094  3.496   1.00 0.00 ? 26 PHE A HZ   3  
ATOM 2659  N N    . GLU A 1 27 ? 6.026   -4.226  8.375   1.00 0.00 ? 27 GLU A N    3  
ATOM 2660  C CA   . GLU A 1 27 ? 6.432   -3.197  9.325   1.00 0.00 ? 27 GLU A CA   3  
ATOM 2661  C C    . GLU A 1 27 ? 7.504   -3.724  10.274  1.00 0.00 ? 27 GLU A C    3  
ATOM 2662  O O    . GLU A 1 27 ? 8.547   -3.097  10.463  1.00 0.00 ? 27 GLU A O    3  
ATOM 2663  C CB   . GLU A 1 27 ? 5.224   -2.705  10.125  1.00 0.00 ? 27 GLU A CB   3  
ATOM 2664  C CG   . GLU A 1 27 ? 4.041   -2.305  9.258   1.00 0.00 ? 27 GLU A CG   3  
ATOM 2665  C CD   . GLU A 1 27 ? 4.449   -1.449  8.075   1.00 0.00 ? 27 GLU A CD   3  
ATOM 2666  O OE1  . GLU A 1 27 ? 5.305   -0.558  8.254   1.00 0.00 ? 27 GLU A OE1  3  
ATOM 2667  O OE2  . GLU A 1 27 ? 3.910   -1.670  6.970   1.00 0.00 ? 27 GLU A OE2  3  
ATOM 2668  H H    . GLU A 1 27 ? 5.091   -4.520  8.358   1.00 0.00 ? 27 GLU A H    3  
ATOM 2669  H HA   . GLU A 1 27 ? 6.840   -2.370  8.764   1.00 0.00 ? 27 GLU A HA   3  
ATOM 2670  H HB2  . GLU A 1 27 ? 4.905   -3.492  10.793  1.00 0.00 ? 27 GLU A HB2  3  
ATOM 2671  H HB3  . GLU A 1 27 ? 5.520   -1.847  10.710  1.00 0.00 ? 27 GLU A HB3  3  
ATOM 2672  H HG2  . GLU A 1 27 ? 3.564   -3.200  8.888   1.00 0.00 ? 27 GLU A HG2  3  
ATOM 2673  H HG3  . GLU A 1 27 ? 3.340   -1.749  9.863   1.00 0.00 ? 27 GLU A HG3  3  
ATOM 2674  N N    . THR A 1 28 ? 7.239   -4.883  10.871  1.00 0.00 ? 28 THR A N    3  
ATOM 2675  C CA   . THR A 1 28 ? 8.179   -5.495  11.802  1.00 0.00 ? 28 THR A CA   3  
ATOM 2676  C C    . THR A 1 28 ? 9.394   -6.051  11.070  1.00 0.00 ? 28 THR A C    3  
ATOM 2677  O O    . THR A 1 28 ? 10.481  -6.148  11.638  1.00 0.00 ? 28 THR A O    3  
ATOM 2678  C CB   . THR A 1 28 ? 7.514   -6.628  12.606  1.00 0.00 ? 28 THR A CB   3  
ATOM 2679  O OG1  . THR A 1 28 ? 6.927   -7.582  11.715  1.00 0.00 ? 28 THR A OG1  3  
ATOM 2680  C CG2  . THR A 1 28 ? 6.449   -6.076  13.541  1.00 0.00 ? 28 THR A CG2  3  
ATOM 2681  H H    . THR A 1 28 ? 6.391   -5.335  10.680  1.00 0.00 ? 28 THR A H    3  
ATOM 2682  H HA   . THR A 1 28 ? 8.505   -4.733  12.495  1.00 0.00 ? 28 THR A HA   3  
ATOM 2683  H HB   . THR A 1 28 ? 8.272   -7.121  13.199  1.00 0.00 ? 28 THR A HB   3  
ATOM 2684  H HG1  . THR A 1 28 ? 6.233   -7.158  11.204  1.00 0.00 ? 28 THR A HG1  3  
ATOM 2685  H HG21 . THR A 1 28 ? 6.923   -5.623  14.399  1.00 0.00 ? 28 THR A HG21 3  
ATOM 2686  H HG22 . THR A 1 28 ? 5.805   -6.879  13.867  1.00 0.00 ? 28 THR A HG22 3  
ATOM 2687  H HG23 . THR A 1 28 ? 5.864   -5.334  13.020  1.00 0.00 ? 28 THR A HG23 3  
ATOM 2688  N N    . GLN A 1 29 ? 9.203   -6.416  9.806   1.00 0.00 ? 29 GLN A N    3  
ATOM 2689  C CA   . GLN A 1 29 ? 10.285  -6.963  8.997   1.00 0.00 ? 29 GLN A CA   3  
ATOM 2690  C C    . GLN A 1 29 ? 10.020  -6.742  7.511   1.00 0.00 ? 29 GLN A C    3  
ATOM 2691  O O    . GLN A 1 29 ? 9.127   -7.360  6.931   1.00 0.00 ? 29 GLN A O    3  
ATOM 2692  C CB   . GLN A 1 29 ? 10.457  -8.456  9.280   1.00 0.00 ? 29 GLN A CB   3  
ATOM 2693  C CG   . GLN A 1 29 ? 11.886  -8.946  9.111   1.00 0.00 ? 29 GLN A CG   3  
ATOM 2694  C CD   . GLN A 1 29 ? 11.975  -10.455 8.989   1.00 0.00 ? 29 GLN A CD   3  
ATOM 2695  O OE1  . GLN A 1 29 ? 11.228  -11.187 9.639   1.00 0.00 ? 29 GLN A OE1  3  
ATOM 2696  N NE2  . GLN A 1 29 ? 12.892  -10.928 8.153   1.00 0.00 ? 29 GLN A NE2  3  
ATOM 2697  H H    . GLN A 1 29 ? 8.313   -6.315  9.409   1.00 0.00 ? 29 GLN A H    3  
ATOM 2698  H HA   . GLN A 1 29 ? 11.194  -6.447  9.267   1.00 0.00 ? 29 GLN A HA   3  
ATOM 2699  H HB2  . GLN A 1 29 ? 10.148  -8.656  10.295  1.00 0.00 ? 29 GLN A HB2  3  
ATOM 2700  H HB3  . GLN A 1 29 ? 9.827   -9.013  8.603   1.00 0.00 ? 29 GLN A HB3  3  
ATOM 2701  H HG2  . GLN A 1 29 ? 12.303  -8.504  8.219   1.00 0.00 ? 29 GLN A HG2  3  
ATOM 2702  H HG3  . GLN A 1 29 ? 12.464  -8.634  9.969   1.00 0.00 ? 29 GLN A HG3  3  
ATOM 2703  H HE21 . GLN A 1 29 ? 13.453  -10.286 7.669   1.00 0.00 ? 29 GLN A HE21 3  
ATOM 2704  H HE22 . GLN A 1 29 ? 12.972  -11.899 8.055   1.00 0.00 ? 29 GLN A HE22 3  
ATOM 2705  N N    . LYS A 1 30 ? 10.800  -5.857  6.901   1.00 0.00 ? 30 LYS A N    3  
ATOM 2706  C CA   . LYS A 1 30 ? 10.651  -5.554  5.482   1.00 0.00 ? 30 LYS A CA   3  
ATOM 2707  C C    . LYS A 1 30 ? 10.761  -6.821  4.641   1.00 0.00 ? 30 LYS A C    3  
ATOM 2708  O O    . LYS A 1 30 ? 10.112  -6.946  3.602   1.00 0.00 ? 30 LYS A O    3  
ATOM 2709  C CB   . LYS A 1 30 ? 11.711  -4.542  5.041   1.00 0.00 ? 30 LYS A CB   3  
ATOM 2710  C CG   . LYS A 1 30 ? 11.763  -3.298  5.911   1.00 0.00 ? 30 LYS A CG   3  
ATOM 2711  C CD   . LYS A 1 30 ? 10.499  -2.466  5.770   1.00 0.00 ? 30 LYS A CD   3  
ATOM 2712  C CE   . LYS A 1 30 ? 10.533  -1.243  6.674   1.00 0.00 ? 30 LYS A CE   3  
ATOM 2713  N NZ   . LYS A 1 30 ? 10.359  -1.609  8.107   1.00 0.00 ? 30 LYS A NZ   3  
ATOM 2714  H H    . LYS A 1 30 ? 11.495  -5.396  7.417   1.00 0.00 ? 30 LYS A H    3  
ATOM 2715  H HA   . LYS A 1 30 ? 9.672   -5.123  5.336   1.00 0.00 ? 30 LYS A HA   3  
ATOM 2716  H HB2  . LYS A 1 30 ? 12.680  -5.018  5.072   1.00 0.00 ? 30 LYS A HB2  3  
ATOM 2717  H HB3  . LYS A 1 30 ? 11.500  -4.238  4.026   1.00 0.00 ? 30 LYS A HB3  3  
ATOM 2718  H HG2  . LYS A 1 30 ? 11.872  -3.595  6.943   1.00 0.00 ? 30 LYS A HG2  3  
ATOM 2719  H HG3  . LYS A 1 30 ? 12.612  -2.698  5.615   1.00 0.00 ? 30 LYS A HG3  3  
ATOM 2720  H HD2  . LYS A 1 30 ? 10.406  -2.139  4.745   1.00 0.00 ? 30 LYS A HD2  3  
ATOM 2721  H HD3  . LYS A 1 30 ? 9.646   -3.075  6.034   1.00 0.00 ? 30 LYS A HD3  3  
ATOM 2722  H HE2  . LYS A 1 30 ? 11.483  -0.747  6.551   1.00 0.00 ? 30 LYS A HE2  3  
ATOM 2723  H HE3  . LYS A 1 30 ? 9.737   -0.574  6.383   1.00 0.00 ? 30 LYS A HE3  3  
ATOM 2724  H HZ1  . LYS A 1 30 ? 10.474  -2.635  8.230   1.00 0.00 ? 30 LYS A HZ1  3  
ATOM 2725  H HZ2  . LYS A 1 30 ? 9.410   -1.336  8.433   1.00 0.00 ? 30 LYS A HZ2  3  
ATOM 2726  H HZ3  . LYS A 1 30 ? 11.067  -1.119  8.690   1.00 0.00 ? 30 LYS A HZ3  3  
ATOM 2727  N N    . TYR A 1 31 ? 11.585  -7.758  5.097   1.00 0.00 ? 31 TYR A N    3  
ATOM 2728  C CA   . TYR A 1 31 ? 11.780  -9.016  4.385   1.00 0.00 ? 31 TYR A CA   3  
ATOM 2729  C C    . TYR A 1 31 ? 11.442  -10.206 5.279   1.00 0.00 ? 31 TYR A C    3  
ATOM 2730  O O    . TYR A 1 31 ? 11.300  -10.064 6.494   1.00 0.00 ? 31 TYR A O    3  
ATOM 2731  C CB   . TYR A 1 31 ? 13.224  -9.128  3.892   1.00 0.00 ? 31 TYR A CB   3  
ATOM 2732  C CG   . TYR A 1 31 ? 13.559  -8.165  2.776   1.00 0.00 ? 31 TYR A CG   3  
ATOM 2733  C CD1  . TYR A 1 31 ? 14.012  -6.881  3.051   1.00 0.00 ? 31 TYR A CD1  3  
ATOM 2734  C CD2  . TYR A 1 31 ? 13.423  -8.540  1.444   1.00 0.00 ? 31 TYR A CD2  3  
ATOM 2735  C CE1  . TYR A 1 31 ? 14.318  -5.998  2.034   1.00 0.00 ? 31 TYR A CE1  3  
ATOM 2736  C CE2  . TYR A 1 31 ? 13.728  -7.664  0.421   1.00 0.00 ? 31 TYR A CE2  3  
ATOM 2737  C CZ   . TYR A 1 31 ? 14.175  -6.394  0.721   1.00 0.00 ? 31 TYR A CZ   3  
ATOM 2738  O OH   . TYR A 1 31 ? 14.480  -5.517  -0.295  1.00 0.00 ? 31 TYR A OH   3  
ATOM 2739  H H    . TYR A 1 31 ? 12.074  -7.601  5.931   1.00 0.00 ? 31 TYR A H    3  
ATOM 2740  H HA   . TYR A 1 31 ? 11.117  -9.021  3.532   1.00 0.00 ? 31 TYR A HA   3  
ATOM 2741  H HB2  . TYR A 1 31 ? 13.894  -8.928  4.714   1.00 0.00 ? 31 TYR A HB2  3  
ATOM 2742  H HB3  . TYR A 1 31 ? 13.396  -10.130 3.529   1.00 0.00 ? 31 TYR A HB3  3  
ATOM 2743  H HD1  . TYR A 1 31 ? 14.123  -6.574  4.081   1.00 0.00 ? 31 TYR A HD1  3  
ATOM 2744  H HD2  . TYR A 1 31 ? 13.072  -9.535  1.213   1.00 0.00 ? 31 TYR A HD2  3  
ATOM 2745  H HE1  . TYR A 1 31 ? 14.668  -5.003  2.269   1.00 0.00 ? 31 TYR A HE1  3  
ATOM 2746  H HE2  . TYR A 1 31 ? 13.616  -7.973  -0.608  1.00 0.00 ? 31 TYR A HE2  3  
ATOM 2747  H HH   . TYR A 1 31 ? 14.801  -6.008  -1.055  1.00 0.00 ? 31 TYR A HH   3  
ATOM 2748  N N    . LEU A 1 32 ? 11.316  -11.378 4.668   1.00 0.00 ? 32 LEU A N    3  
ATOM 2749  C CA   . LEU A 1 32 ? 10.995  -12.595 5.406   1.00 0.00 ? 32 LEU A CA   3  
ATOM 2750  C C    . LEU A 1 32 ? 11.679  -13.807 4.781   1.00 0.00 ? 32 LEU A C    3  
ATOM 2751  O O    . LEU A 1 32 ? 11.490  -14.098 3.600   1.00 0.00 ? 32 LEU A O    3  
ATOM 2752  C CB   . LEU A 1 32 ? 9.481   -12.810 5.440   1.00 0.00 ? 32 LEU A CB   3  
ATOM 2753  C CG   . LEU A 1 32 ? 8.659   -11.695 6.087   1.00 0.00 ? 32 LEU A CG   3  
ATOM 2754  C CD1  . LEU A 1 32 ? 7.211   -11.764 5.627   1.00 0.00 ? 32 LEU A CD1  3  
ATOM 2755  C CD2  . LEU A 1 32 ? 8.744   -11.780 7.604   1.00 0.00 ? 32 LEU A CD2  3  
ATOM 2756  H H    . LEU A 1 32 ? 11.441  -11.428 3.697   1.00 0.00 ? 32 LEU A H    3  
ATOM 2757  H HA   . LEU A 1 32 ? 11.357  -12.474 6.416   1.00 0.00 ? 32 LEU A HA   3  
ATOM 2758  H HB2  . LEU A 1 32 ? 9.140   -12.925 4.423   1.00 0.00 ? 32 LEU A HB2  3  
ATOM 2759  H HB3  . LEU A 1 32 ? 9.290   -13.723 5.987   1.00 0.00 ? 32 LEU A HB3  3  
ATOM 2760  H HG   . LEU A 1 32 ? 9.060   -10.738 5.782   1.00 0.00 ? 32 LEU A HG   3  
ATOM 2761  H HD11 . LEU A 1 32 ? 6.971   -12.778 5.347   1.00 0.00 ? 32 LEU A HD11 3  
ATOM 2762  H HD12 . LEU A 1 32 ? 7.072   -11.112 4.778   1.00 0.00 ? 32 LEU A HD12 3  
ATOM 2763  H HD13 . LEU A 1 32 ? 6.563   -11.449 6.432   1.00 0.00 ? 32 LEU A HD13 3  
ATOM 2764  H HD21 . LEU A 1 32 ? 8.486   -12.779 7.923   1.00 0.00 ? 32 LEU A HD21 3  
ATOM 2765  H HD22 . LEU A 1 32 ? 8.055   -11.073 8.043   1.00 0.00 ? 32 LEU A HD22 3  
ATOM 2766  H HD23 . LEU A 1 32 ? 9.750   -11.549 7.921   1.00 0.00 ? 32 LEU A HD23 3  
ATOM 2767  N N    . SER A 1 33 ? 12.471  -14.512 5.582   1.00 0.00 ? 33 SER A N    3  
ATOM 2768  C CA   . SER A 1 33 ? 13.184  -15.692 5.107   1.00 0.00 ? 33 SER A CA   3  
ATOM 2769  C C    . SER A 1 33 ? 12.207  -16.753 4.609   1.00 0.00 ? 33 SER A C    3  
ATOM 2770  O O    . SER A 1 33 ? 11.047  -16.807 5.019   1.00 0.00 ? 33 SER A O    3  
ATOM 2771  C CB   . SER A 1 33 ? 14.057  -16.270 6.223   1.00 0.00 ? 33 SER A CB   3  
ATOM 2772  O OG   . SER A 1 33 ? 14.688  -15.239 6.963   1.00 0.00 ? 33 SER A OG   3  
ATOM 2773  H H    . SER A 1 33 ? 12.581  -14.229 6.515   1.00 0.00 ? 33 SER A H    3  
ATOM 2774  H HA   . SER A 1 33 ? 13.817  -15.389 4.287   1.00 0.00 ? 33 SER A HA   3  
ATOM 2775  H HB2  . SER A 1 33 ? 13.442  -16.852 6.893   1.00 0.00 ? 33 SER A HB2  3  
ATOM 2776  H HB3  . SER A 1 33 ? 14.817  -16.903 5.790   1.00 0.00 ? 33 SER A HB3  3  
ATOM 2777  H HG   . SER A 1 33 ? 15.638  -15.380 6.963   1.00 0.00 ? 33 SER A HG   3  
ATOM 2778  N N    . PRO A 1 34 ? 12.686  -17.618 3.703   1.00 0.00 ? 34 PRO A N    3  
ATOM 2779  C CA   . PRO A 1 34 ? 11.873  -18.694 3.129   1.00 0.00 ? 34 PRO A CA   3  
ATOM 2780  C C    . PRO A 1 34 ? 11.117  -19.481 4.195   1.00 0.00 ? 34 PRO A C    3  
ATOM 2781  O O    . PRO A 1 34 ? 9.934   -19.791 4.050   1.00 0.00 ? 34 PRO A O    3  
ATOM 2782  C CB   . PRO A 1 34 ? 12.904  -19.587 2.436   1.00 0.00 ? 34 PRO A CB   3  
ATOM 2783  C CG   . PRO A 1 34 ? 14.039  -18.677 2.116   1.00 0.00 ? 34 PRO A CG   3  
ATOM 2784  C CD   . PRO A 1 34 ? 14.058  -17.613 3.170   1.00 0.00 ? 34 PRO A CD   3  
ATOM 2785  H HA   . PRO A 1 34 ? 11.173  -18.316 2.399   1.00 0.00 ? 34 PRO A HA   3  
ATOM 2786  H HB2  . PRO A 1 34 ? 13.209  -20.378 3.107   1.00 0.00 ? 34 PRO A HB2  3  
ATOM 2787  H HB3  . PRO A 1 34 ? 12.475  -20.012 1.541   1.00 0.00 ? 34 PRO A HB3  3  
ATOM 2788  H HG2  . PRO A 1 34 ? 14.968  -19.227 2.133   1.00 0.00 ? 34 PRO A HG2  3  
ATOM 2789  H HG3  . PRO A 1 34 ? 13.886  -18.227 1.146   1.00 0.00 ? 34 PRO A HG3  3  
ATOM 2790  H HD2  . PRO A 1 34 ? 14.773  -17.864 3.940   1.00 0.00 ? 34 PRO A HD2  3  
ATOM 2791  H HD3  . PRO A 1 34 ? 14.297  -16.656 2.730   1.00 0.00 ? 34 PRO A HD3  3  
ATOM 2792  N N    . PRO A 1 35 ? 11.814  -19.813 5.292   1.00 0.00 ? 35 PRO A N    3  
ATOM 2793  C CA   . PRO A 1 35 ? 11.228  -20.568 6.404   1.00 0.00 ? 35 PRO A CA   3  
ATOM 2794  C C    . PRO A 1 35 ? 9.881   -20.003 6.841   1.00 0.00 ? 35 PRO A C    3  
ATOM 2795  O O    . PRO A 1 35 ? 8.930   -20.750 7.071   1.00 0.00 ? 35 PRO A O    3  
ATOM 2796  C CB   . PRO A 1 35 ? 12.262  -20.412 7.522   1.00 0.00 ? 35 PRO A CB   3  
ATOM 2797  C CG   . PRO A 1 35 ? 13.552  -20.178 6.815   1.00 0.00 ? 35 PRO A CG   3  
ATOM 2798  C CD   . PRO A 1 35 ? 13.228  -19.477 5.531   1.00 0.00 ? 35 PRO A CD   3  
ATOM 2799  H HA   . PRO A 1 35 ? 11.116  -21.614 6.158   1.00 0.00 ? 35 PRO A HA   3  
ATOM 2800  H HB2  . PRO A 1 35 ? 11.995  -19.572 8.148   1.00 0.00 ? 35 PRO A HB2  3  
ATOM 2801  H HB3  . PRO A 1 35 ? 12.295  -21.314 8.114   1.00 0.00 ? 35 PRO A HB3  3  
ATOM 2802  H HG2  . PRO A 1 35 ? 14.194  -19.556 7.419   1.00 0.00 ? 35 PRO A HG2  3  
ATOM 2803  H HG3  . PRO A 1 35 ? 14.032  -21.123 6.604   1.00 0.00 ? 35 PRO A HG3  3  
ATOM 2804  H HD2  . PRO A 1 35 ? 13.356  -18.411 5.646   1.00 0.00 ? 35 PRO A HD2  3  
ATOM 2805  H HD3  . PRO A 1 35 ? 13.853  -19.851 4.734   1.00 0.00 ? 35 PRO A HD3  3  
ATOM 2806  N N    . GLU A 1 36 ? 9.807   -18.680 6.954   1.00 0.00 ? 36 GLU A N    3  
ATOM 2807  C CA   . GLU A 1 36 ? 8.576   -18.017 7.365   1.00 0.00 ? 36 GLU A CA   3  
ATOM 2808  C C    . GLU A 1 36 ? 7.632   -17.839 6.179   1.00 0.00 ? 36 GLU A C    3  
ATOM 2809  O O    . GLU A 1 36 ? 6.549   -18.423 6.140   1.00 0.00 ? 36 GLU A O    3  
ATOM 2810  C CB   . GLU A 1 36 ? 8.888   -16.656 7.991   1.00 0.00 ? 36 GLU A CB   3  
ATOM 2811  C CG   . GLU A 1 36 ? 10.060  -16.685 8.957   1.00 0.00 ? 36 GLU A CG   3  
ATOM 2812  C CD   . GLU A 1 36 ? 9.636   -16.988 10.381  1.00 0.00 ? 36 GLU A CD   3  
ATOM 2813  O OE1  . GLU A 1 36 ? 9.248   -18.145 10.650  1.00 0.00 ? 36 GLU A OE1  3  
ATOM 2814  O OE2  . GLU A 1 36 ? 9.690   -16.070 11.226  1.00 0.00 ? 36 GLU A OE2  3  
ATOM 2815  H H    . GLU A 1 36 ? 10.600  -18.139 6.757   1.00 0.00 ? 36 GLU A H    3  
ATOM 2816  H HA   . GLU A 1 36 ? 8.093   -18.640 8.103   1.00 0.00 ? 36 GLU A HA   3  
ATOM 2817  H HB2  . GLU A 1 36 ? 9.115   -15.954 7.203   1.00 0.00 ? 36 GLU A HB2  3  
ATOM 2818  H HB3  . GLU A 1 36 ? 8.016   -16.312 8.527   1.00 0.00 ? 36 GLU A HB3  3  
ATOM 2819  H HG2  . GLU A 1 36 ? 10.756  -17.446 8.636   1.00 0.00 ? 36 GLU A HG2  3  
ATOM 2820  H HG3  . GLU A 1 36 ? 10.548  -15.722 8.940   1.00 0.00 ? 36 GLU A HG3  3  
ATOM 2821  N N    . ARG A 1 37 ? 8.051   -17.027 5.214   1.00 0.00 ? 37 ARG A N    3  
ATOM 2822  C CA   . ARG A 1 37 ? 7.243   -16.769 4.028   1.00 0.00 ? 37 ARG A CA   3  
ATOM 2823  C C    . ARG A 1 37 ? 6.468   -18.018 3.617   1.00 0.00 ? 37 ARG A C    3  
ATOM 2824  O O    . ARG A 1 37 ? 5.306   -17.936 3.216   1.00 0.00 ? 37 ARG A O    3  
ATOM 2825  C CB   . ARG A 1 37 ? 8.131   -16.304 2.872   1.00 0.00 ? 37 ARG A CB   3  
ATOM 2826  C CG   . ARG A 1 37 ? 7.383   -15.514 1.810   1.00 0.00 ? 37 ARG A CG   3  
ATOM 2827  C CD   . ARG A 1 37 ? 8.215   -15.351 0.548   1.00 0.00 ? 37 ARG A CD   3  
ATOM 2828  N NE   . ARG A 1 37 ? 8.486   -16.632 -0.098  1.00 0.00 ? 37 ARG A NE   3  
ATOM 2829  C CZ   . ARG A 1 37 ? 9.461   -16.818 -0.982  1.00 0.00 ? 37 ARG A CZ   3  
ATOM 2830  N NH1  . ARG A 1 37 ? 10.253  -15.811 -1.322  1.00 0.00 ? 37 ARG A NH1  3  
ATOM 2831  N NH2  . ARG A 1 37 ? 9.645   -18.014 -1.526  1.00 0.00 ? 37 ARG A NH2  3  
ATOM 2832  H H    . ARG A 1 37 ? 8.924   -16.589 5.302   1.00 0.00 ? 37 ARG A H    3  
ATOM 2833  H HA   . ARG A 1 37 ? 6.540   -15.986 4.268   1.00 0.00 ? 37 ARG A HA   3  
ATOM 2834  H HB2  . ARG A 1 37 ? 8.918   -15.678 3.266   1.00 0.00 ? 37 ARG A HB2  3  
ATOM 2835  H HB3  . ARG A 1 37 ? 8.572   -17.170 2.401   1.00 0.00 ? 37 ARG A HB3  3  
ATOM 2836  H HG2  . ARG A 1 37 ? 6.471   -16.036 1.561   1.00 0.00 ? 37 ARG A HG2  3  
ATOM 2837  H HG3  . ARG A 1 37 ? 7.145   -14.537 2.203   1.00 0.00 ? 37 ARG A HG3  3  
ATOM 2838  H HD2  . ARG A 1 37 ? 7.678   -14.717 -0.142  1.00 0.00 ? 37 ARG A HD2  3  
ATOM 2839  H HD3  . ARG A 1 37 ? 9.153   -14.884 0.809   1.00 0.00 ? 37 ARG A HD3  3  
ATOM 2840  H HE   . ARG A 1 37 ? 7.913   -17.390 0.138   1.00 0.00 ? 37 ARG A HE   3  
ATOM 2841  H HH11 . ARG A 1 37 ? 10.117  -14.909 -0.912  1.00 0.00 ? 37 ARG A HH11 3  
ATOM 2842  H HH12 . ARG A 1 37 ? 10.987  -15.954 -1.986  1.00 0.00 ? 37 ARG A HH12 3  
ATOM 2843  H HH21 . ARG A 1 37 ? 9.050   -18.776 -1.272  1.00 0.00 ? 37 ARG A HH21 3  
ATOM 2844  H HH22 . ARG A 1 37 ? 10.379  -18.153 -2.191  1.00 0.00 ? 37 ARG A HH22 3  
ATOM 2845  N N    . LYS A 1 38 ? 7.118   -19.172 3.719   1.00 0.00 ? 38 LYS A N    3  
ATOM 2846  C CA   . LYS A 1 38 ? 6.491   -20.438 3.359   1.00 0.00 ? 38 LYS A CA   3  
ATOM 2847  C C    . LYS A 1 38 ? 5.260   -20.699 4.221   1.00 0.00 ? 38 LYS A C    3  
ATOM 2848  O O    . LYS A 1 38 ? 4.188   -21.023 3.707   1.00 0.00 ? 38 LYS A O    3  
ATOM 2849  C CB   . LYS A 1 38 ? 7.489   -21.588 3.515   1.00 0.00 ? 38 LYS A CB   3  
ATOM 2850  C CG   . LYS A 1 38 ? 8.468   -21.703 2.359   1.00 0.00 ? 38 LYS A CG   3  
ATOM 2851  C CD   . LYS A 1 38 ? 9.754   -22.391 2.785   1.00 0.00 ? 38 LYS A CD   3  
ATOM 2852  C CE   . LYS A 1 38 ? 9.621   -23.906 2.730   1.00 0.00 ? 38 LYS A CE   3  
ATOM 2853  N NZ   . LYS A 1 38 ? 10.860  -24.589 3.194   1.00 0.00 ? 38 LYS A NZ   3  
ATOM 2854  H H    . LYS A 1 38 ? 8.043   -19.172 4.045   1.00 0.00 ? 38 LYS A H    3  
ATOM 2855  H HA   . LYS A 1 38 ? 6.185   -20.375 2.325   1.00 0.00 ? 38 LYS A HA   3  
ATOM 2856  H HB2  . LYS A 1 38 ? 8.053   -21.438 4.423   1.00 0.00 ? 38 LYS A HB2  3  
ATOM 2857  H HB3  . LYS A 1 38 ? 6.941   -22.516 3.589   1.00 0.00 ? 38 LYS A HB3  3  
ATOM 2858  H HG2  . LYS A 1 38 ? 8.010   -22.278 1.567   1.00 0.00 ? 38 LYS A HG2  3  
ATOM 2859  H HG3  . LYS A 1 38 ? 8.703   -20.712 1.998   1.00 0.00 ? 38 LYS A HG3  3  
ATOM 2860  H HD2  . LYS A 1 38 ? 10.551  -22.088 2.123   1.00 0.00 ? 38 LYS A HD2  3  
ATOM 2861  H HD3  . LYS A 1 38 ? 9.992   -22.096 3.797   1.00 0.00 ? 38 LYS A HD3  3  
ATOM 2862  H HE2  . LYS A 1 38 ? 8.798   -24.205 3.361   1.00 0.00 ? 38 LYS A HE2  3  
ATOM 2863  H HE3  . LYS A 1 38 ? 9.418   -24.199 1.711   1.00 0.00 ? 38 LYS A HE3  3  
ATOM 2864  H HZ1  . LYS A 1 38 ? 11.342  -25.039 2.389   1.00 0.00 ? 38 LYS A HZ1  3  
ATOM 2865  H HZ2  . LYS A 1 38 ? 10.625  -25.319 3.895   1.00 0.00 ? 38 LYS A HZ2  3  
ATOM 2866  H HZ3  . LYS A 1 38 ? 11.506  -23.900 3.629   1.00 0.00 ? 38 LYS A HZ3  3  
ATOM 2867  N N    . ARG A 1 39 ? 5.420   -20.557 5.532   1.00 0.00 ? 39 ARG A N    3  
ATOM 2868  C CA   . ARG A 1 39 ? 4.321   -20.777 6.465   1.00 0.00 ? 39 ARG A CA   3  
ATOM 2869  C C    . ARG A 1 39 ? 3.274   -19.674 6.341   1.00 0.00 ? 39 ARG A C    3  
ATOM 2870  O O    . ARG A 1 39 ? 2.071   -19.941 6.350   1.00 0.00 ? 39 ARG A O    3  
ATOM 2871  C CB   . ARG A 1 39 ? 4.846   -20.838 7.900   1.00 0.00 ? 39 ARG A CB   3  
ATOM 2872  C CG   . ARG A 1 39 ? 6.012   -21.797 8.082   1.00 0.00 ? 39 ARG A CG   3  
ATOM 2873  C CD   . ARG A 1 39 ? 6.937   -21.344 9.200   1.00 0.00 ? 39 ARG A CD   3  
ATOM 2874  N NE   . ARG A 1 39 ? 6.523   -21.867 10.499  1.00 0.00 ? 39 ARG A NE   3  
ATOM 2875  C CZ   . ARG A 1 39 ? 7.243   -21.735 11.608  1.00 0.00 ? 39 ARG A CZ   3  
ATOM 2876  N NH1  . ARG A 1 39 ? 8.406   -21.099 11.575  1.00 0.00 ? 39 ARG A NH1  3  
ATOM 2877  N NH2  . ARG A 1 39 ? 6.799   -22.239 12.752  1.00 0.00 ? 39 ARG A NH2  3  
ATOM 2878  H H    . ARG A 1 39 ? 6.298   -20.297 5.881   1.00 0.00 ? 39 ARG A H    3  
ATOM 2879  H HA   . ARG A 1 39 ? 3.861   -21.723 6.218   1.00 0.00 ? 39 ARG A HA   3  
ATOM 2880  H HB2  . ARG A 1 39 ? 5.172   -19.851 8.194   1.00 0.00 ? 39 ARG A HB2  3  
ATOM 2881  H HB3  . ARG A 1 39 ? 4.045   -21.153 8.551   1.00 0.00 ? 39 ARG A HB3  3  
ATOM 2882  H HG2  . ARG A 1 39 ? 5.625   -22.776 8.324   1.00 0.00 ? 39 ARG A HG2  3  
ATOM 2883  H HG3  . ARG A 1 39 ? 6.572   -21.847 7.160   1.00 0.00 ? 39 ARG A HG3  3  
ATOM 2884  H HD2  . ARG A 1 39 ? 7.937   -21.691 8.985   1.00 0.00 ? 39 ARG A HD2  3  
ATOM 2885  H HD3  . ARG A 1 39 ? 6.931   -20.265 9.238   1.00 0.00 ? 39 ARG A HD3  3  
ATOM 2886  H HE   . ARG A 1 39 ? 5.667   -22.341 10.546  1.00 0.00 ? 39 ARG A HE   3  
ATOM 2887  H HH11 . ARG A 1 39 ? 8.742   -20.717 10.714  1.00 0.00 ? 39 ARG A HH11 3  
ATOM 2888  H HH12 . ARG A 1 39 ? 8.945   -21.000 12.412  1.00 0.00 ? 39 ARG A HH12 3  
ATOM 2889  H HH21 . ARG A 1 39 ? 5.923   -22.719 12.781  1.00 0.00 ? 39 ARG A HH21 3  
ATOM 2890  H HH22 . ARG A 1 39 ? 7.341   -22.139 13.586  1.00 0.00 ? 39 ARG A HH22 3  
ATOM 2891  N N    . LEU A 1 40 ? 3.738   -18.435 6.228   1.00 0.00 ? 40 LEU A N    3  
ATOM 2892  C CA   . LEU A 1 40 ? 2.842   -17.290 6.103   1.00 0.00 ? 40 LEU A CA   3  
ATOM 2893  C C    . LEU A 1 40 ? 1.843   -17.502 4.970   1.00 0.00 ? 40 LEU A C    3  
ATOM 2894  O O    . LEU A 1 40 ? 0.636   -17.345 5.156   1.00 0.00 ? 40 LEU A O    3  
ATOM 2895  C CB   . LEU A 1 40 ? 3.646   -16.012 5.858   1.00 0.00 ? 40 LEU A CB   3  
ATOM 2896  C CG   . LEU A 1 40 ? 2.890   -14.697 6.049   1.00 0.00 ? 40 LEU A CG   3  
ATOM 2897  C CD1  . LEU A 1 40 ? 2.466   -14.531 7.500   1.00 0.00 ? 40 LEU A CD1  3  
ATOM 2898  C CD2  . LEU A 1 40 ? 3.747   -13.521 5.603   1.00 0.00 ? 40 LEU A CD2  3  
ATOM 2899  H H    . LEU A 1 40 ? 4.706   -18.285 6.227   1.00 0.00 ? 40 LEU A H    3  
ATOM 2900  H HA   . LEU A 1 40 ? 2.300   -17.192 7.032   1.00 0.00 ? 40 LEU A HA   3  
ATOM 2901  H HB2  . LEU A 1 40 ? 4.484   -16.014 6.537   1.00 0.00 ? 40 LEU A HB2  3  
ATOM 2902  H HB3  . LEU A 1 40 ? 4.009   -16.042 4.840   1.00 0.00 ? 40 LEU A HB3  3  
ATOM 2903  H HG   . LEU A 1 40 ? 1.997   -14.711 5.440   1.00 0.00 ? 40 LEU A HG   3  
ATOM 2904  H HD11 . LEU A 1 40 ? 3.329   -14.627 8.140   1.00 0.00 ? 40 LEU A HD11 3  
ATOM 2905  H HD12 . LEU A 1 40 ? 1.743   -15.292 7.753   1.00 0.00 ? 40 LEU A HD12 3  
ATOM 2906  H HD13 . LEU A 1 40 ? 2.023   -13.555 7.636   1.00 0.00 ? 40 LEU A HD13 3  
ATOM 2907  H HD21 . LEU A 1 40 ? 3.985   -12.905 6.458   1.00 0.00 ? 40 LEU A HD21 3  
ATOM 2908  H HD22 . LEU A 1 40 ? 3.202   -12.933 4.878   1.00 0.00 ? 40 LEU A HD22 3  
ATOM 2909  H HD23 . LEU A 1 40 ? 4.659   -13.888 5.158   1.00 0.00 ? 40 LEU A HD23 3  
ATOM 2910  N N    . ALA A 1 41 ? 2.353   -17.861 3.797   1.00 0.00 ? 41 ALA A N    3  
ATOM 2911  C CA   . ALA A 1 41 ? 1.506   -18.098 2.635   1.00 0.00 ? 41 ALA A CA   3  
ATOM 2912  C C    . ALA A 1 41 ? 0.409   -19.108 2.954   1.00 0.00 ? 41 ALA A C    3  
ATOM 2913  O O    . ALA A 1 41 ? -0.636  -19.131 2.303   1.00 0.00 ? 41 ALA A O    3  
ATOM 2914  C CB   . ALA A 1 41 ? 2.344   -18.579 1.460   1.00 0.00 ? 41 ALA A CB   3  
ATOM 2915  H H    . ALA A 1 41 ? 3.323   -17.970 3.711   1.00 0.00 ? 41 ALA A H    3  
ATOM 2916  H HA   . ALA A 1 41 ? 1.048   -17.159 2.359   1.00 0.00 ? 41 ALA A HA   3  
ATOM 2917  H HB1  . ALA A 1 41 ? 1.985   -19.544 1.134   1.00 0.00 ? 41 ALA A HB1  3  
ATOM 2918  H HB2  . ALA A 1 41 ? 2.263   -17.872 0.648   1.00 0.00 ? 41 ALA A HB2  3  
ATOM 2919  H HB3  . ALA A 1 41 ? 3.376   -18.662 1.764   1.00 0.00 ? 41 ALA A HB3  3  
ATOM 2920  N N    . LYS A 1 42 ? 0.653   -19.944 3.958   1.00 0.00 ? 42 LYS A N    3  
ATOM 2921  C CA   . LYS A 1 42 ? -0.314  -20.957 4.363   1.00 0.00 ? 42 LYS A CA   3  
ATOM 2922  C C    . LYS A 1 42 ? -1.293  -20.395 5.389   1.00 0.00 ? 42 LYS A C    3  
ATOM 2923  O O    . LYS A 1 42 ? -2.452  -20.804 5.443   1.00 0.00 ? 42 LYS A O    3  
ATOM 2924  C CB   . LYS A 1 42 ? 0.407   -22.175 4.944   1.00 0.00 ? 42 LYS A CB   3  
ATOM 2925  C CG   . LYS A 1 42 ? -0.525  -23.173 5.609   1.00 0.00 ? 42 LYS A CG   3  
ATOM 2926  C CD   . LYS A 1 42 ? -1.293  -23.989 4.583   1.00 0.00 ? 42 LYS A CD   3  
ATOM 2927  C CE   . LYS A 1 42 ? -2.337  -24.876 5.244   1.00 0.00 ? 42 LYS A CE   3  
ATOM 2928  N NZ   . LYS A 1 42 ? -3.263  -25.481 4.246   1.00 0.00 ? 42 LYS A NZ   3  
ATOM 2929  H H    . LYS A 1 42 ? 1.505   -19.876 4.439   1.00 0.00 ? 42 LYS A H    3  
ATOM 2930  H HA   . LYS A 1 42 ? -0.865  -21.260 3.486   1.00 0.00 ? 42 LYS A HA   3  
ATOM 2931  H HB2  . LYS A 1 42 ? 0.933   -22.681 4.148   1.00 0.00 ? 42 LYS A HB2  3  
ATOM 2932  H HB3  . LYS A 1 42 ? 1.123   -21.838 5.680   1.00 0.00 ? 42 LYS A HB3  3  
ATOM 2933  H HG2  . LYS A 1 42 ? 0.058   -23.844 6.223   1.00 0.00 ? 42 LYS A HG2  3  
ATOM 2934  H HG3  . LYS A 1 42 ? -1.229  -22.636 6.229   1.00 0.00 ? 42 LYS A HG3  3  
ATOM 2935  H HD2  . LYS A 1 42 ? -1.789  -23.316 3.899   1.00 0.00 ? 42 LYS A HD2  3  
ATOM 2936  H HD3  . LYS A 1 42 ? -0.598  -24.612 4.038   1.00 0.00 ? 42 LYS A HD3  3  
ATOM 2937  H HE2  . LYS A 1 42 ? -1.833  -25.665 5.780   1.00 0.00 ? 42 LYS A HE2  3  
ATOM 2938  H HE3  . LYS A 1 42 ? -2.910  -24.278 5.938   1.00 0.00 ? 42 LYS A HE3  3  
ATOM 2939  H HZ1  . LYS A 1 42 ? -3.596  -24.754 3.582   1.00 0.00 ? 42 LYS A HZ1  3  
ATOM 2940  H HZ2  . LYS A 1 42 ? -4.085  -25.897 4.728   1.00 0.00 ? 42 LYS A HZ2  3  
ATOM 2941  H HZ3  . LYS A 1 42 ? -2.773  -26.226 3.711   1.00 0.00 ? 42 LYS A HZ3  3  
ATOM 2942  N N    . MET A 1 43 ? -0.818  -19.455 6.200   1.00 0.00 ? 43 MET A N    3  
ATOM 2943  C CA   . MET A 1 43 ? -1.653  -18.835 7.223   1.00 0.00 ? 43 MET A CA   3  
ATOM 2944  C C    . MET A 1 43 ? -2.654  -17.870 6.596   1.00 0.00 ? 43 MET A C    3  
ATOM 2945  O O    . MET A 1 43 ? -3.842  -17.894 6.920   1.00 0.00 ? 43 MET A O    3  
ATOM 2946  C CB   . MET A 1 43 ? -0.784  -18.096 8.242   1.00 0.00 ? 43 MET A CB   3  
ATOM 2947  C CG   . MET A 1 43 ? -1.570  -17.156 9.142   1.00 0.00 ? 43 MET A CG   3  
ATOM 2948  S SD   . MET A 1 43 ? -0.811  -16.953 10.765  1.00 0.00 ? 43 MET A SD   3  
ATOM 2949  C CE   . MET A 1 43 ? 0.695   -16.087 10.330  1.00 0.00 ? 43 MET A CE   3  
ATOM 2950  H H    . MET A 1 43 ? 0.115   -19.170 6.109   1.00 0.00 ? 43 MET A H    3  
ATOM 2951  H HA   . MET A 1 43 ? -2.196  -19.620 7.727   1.00 0.00 ? 43 MET A HA   3  
ATOM 2952  H HB2  . MET A 1 43 ? -0.285  -18.823 8.866   1.00 0.00 ? 43 MET A HB2  3  
ATOM 2953  H HB3  . MET A 1 43 ? -0.043  -17.517 7.713   1.00 0.00 ? 43 MET A HB3  3  
ATOM 2954  H HG2  . MET A 1 43 ? -1.630  -16.189 8.666   1.00 0.00 ? 43 MET A HG2  3  
ATOM 2955  H HG3  . MET A 1 43 ? -2.566  -17.554 9.272   1.00 0.00 ? 43 MET A HG3  3  
ATOM 2956  H HE1  . MET A 1 43 ? 0.968   -16.330 9.313   1.00 0.00 ? 43 MET A HE1  3  
ATOM 2957  H HE2  . MET A 1 43 ? 0.535   -15.022 10.415  1.00 0.00 ? 43 MET A HE2  3  
ATOM 2958  H HE3  . MET A 1 43 ? 1.489   -16.388 10.998  1.00 0.00 ? 43 MET A HE3  3  
ATOM 2959  N N    . LEU A 1 44 ? -2.167  -17.021 5.698   1.00 0.00 ? 44 LEU A N    3  
ATOM 2960  C CA   . LEU A 1 44 ? -3.019  -16.047 5.025   1.00 0.00 ? 44 LEU A CA   3  
ATOM 2961  C C    . LEU A 1 44 ? -3.606  -16.629 3.743   1.00 0.00 ? 44 LEU A C    3  
ATOM 2962  O O    . LEU A 1 44 ? -4.257  -15.925 2.972   1.00 0.00 ? 44 LEU A O    3  
ATOM 2963  C CB   . LEU A 1 44 ? -2.225  -14.779 4.706   1.00 0.00 ? 44 LEU A CB   3  
ATOM 2964  C CG   . LEU A 1 44 ? -1.457  -14.157 5.872   1.00 0.00 ? 44 LEU A CG   3  
ATOM 2965  C CD1  . LEU A 1 44 ? -0.447  -13.140 5.364   1.00 0.00 ? 44 LEU A CD1  3  
ATOM 2966  C CD2  . LEU A 1 44 ? -2.418  -13.509 6.859   1.00 0.00 ? 44 LEU A CD2  3  
ATOM 2967  H H    . LEU A 1 44 ? -1.212  -17.049 5.481   1.00 0.00 ? 44 LEU A H    3  
ATOM 2968  H HA   . LEU A 1 44 ? -3.828  -15.796 5.695   1.00 0.00 ? 44 LEU A HA   3  
ATOM 2969  H HB2  . LEU A 1 44 ? -1.512  -15.022 3.933   1.00 0.00 ? 44 LEU A HB2  3  
ATOM 2970  H HB3  . LEU A 1 44 ? -2.919  -14.040 4.333   1.00 0.00 ? 44 LEU A HB3  3  
ATOM 2971  H HG   . LEU A 1 44 ? -0.914  -14.933 6.393   1.00 0.00 ? 44 LEU A HG   3  
ATOM 2972  H HD11 . LEU A 1 44 ? -0.964  -12.349 4.841   1.00 0.00 ? 44 LEU A HD11 3  
ATOM 2973  H HD12 . LEU A 1 44 ? 0.245   -13.625 4.691   1.00 0.00 ? 44 LEU A HD12 3  
ATOM 2974  H HD13 . LEU A 1 44 ? 0.097   -12.724 6.200   1.00 0.00 ? 44 LEU A HD13 3  
ATOM 2975  H HD21 . LEU A 1 44 ? -1.997  -12.581 7.214   1.00 0.00 ? 44 LEU A HD21 3  
ATOM 2976  H HD22 . LEU A 1 44 ? -2.578  -14.175 7.694   1.00 0.00 ? 44 LEU A HD22 3  
ATOM 2977  H HD23 . LEU A 1 44 ? -3.359  -13.313 6.368   1.00 0.00 ? 44 LEU A HD23 3  
ATOM 2978  N N    . GLN A 1 45 ? -3.372  -17.919 3.525   1.00 0.00 ? 45 GLN A N    3  
ATOM 2979  C CA   . GLN A 1 45 ? -3.879  -18.596 2.337   1.00 0.00 ? 45 GLN A CA   3  
ATOM 2980  C C    . GLN A 1 45 ? -3.371  -17.922 1.067   1.00 0.00 ? 45 GLN A C    3  
ATOM 2981  O O    . GLN A 1 45 ? -4.104  -17.786 0.087   1.00 0.00 ? 45 GLN A O    3  
ATOM 2982  C CB   . GLN A 1 45 ? -5.409  -18.609 2.345   1.00 0.00 ? 45 GLN A CB   3  
ATOM 2983  C CG   . GLN A 1 45 ? -6.004  -19.782 3.106   1.00 0.00 ? 45 GLN A CG   3  
ATOM 2984  C CD   . GLN A 1 45 ? -7.478  -19.980 2.813   1.00 0.00 ? 45 GLN A CD   3  
ATOM 2985  O OE1  . GLN A 1 45 ? -8.043  -19.324 1.938   1.00 0.00 ? 45 GLN A OE1  3  
ATOM 2986  N NE2  . GLN A 1 45 ? -8.110  -20.890 3.545   1.00 0.00 ? 45 GLN A NE2  3  
ATOM 2987  H H    . GLN A 1 45 ? -2.847  -18.427 4.177   1.00 0.00 ? 45 GLN A H    3  
ATOM 2988  H HA   . GLN A 1 45 ? -3.520  -19.614 2.357   1.00 0.00 ? 45 GLN A HA   3  
ATOM 2989  H HB2  . GLN A 1 45 ? -5.762  -17.695 2.799   1.00 0.00 ? 45 GLN A HB2  3  
ATOM 2990  H HB3  . GLN A 1 45 ? -5.761  -18.654 1.325   1.00 0.00 ? 45 GLN A HB3  3  
ATOM 2991  H HG2  . GLN A 1 45 ? -5.474  -20.681 2.829   1.00 0.00 ? 45 GLN A HG2  3  
ATOM 2992  H HG3  . GLN A 1 45 ? -5.883  -19.605 4.165   1.00 0.00 ? 45 GLN A HG3  3  
ATOM 2993  H HE21 . GLN A 1 45 ? -7.597  -21.374 4.226   1.00 0.00 ? 45 GLN A HE21 3  
ATOM 2994  H HE22 . GLN A 1 45 ? -9.063  -21.038 3.378   1.00 0.00 ? 45 GLN A HE22 3  
ATOM 2995  N N    . LEU A 1 46 ? -2.111  -17.502 1.091   1.00 0.00 ? 46 LEU A N    3  
ATOM 2996  C CA   . LEU A 1 46 ? -1.503  -16.840 -0.059  1.00 0.00 ? 46 LEU A CA   3  
ATOM 2997  C C    . LEU A 1 46 ? -0.430  -17.722 -0.690  1.00 0.00 ? 46 LEU A C    3  
ATOM 2998  O O    . LEU A 1 46 ? -0.214  -18.856 -0.263  1.00 0.00 ? 46 LEU A O    3  
ATOM 2999  C CB   . LEU A 1 46 ? -0.897  -15.500 0.360   1.00 0.00 ? 46 LEU A CB   3  
ATOM 3000  C CG   . LEU A 1 46 ? -1.821  -14.559 1.135   1.00 0.00 ? 46 LEU A CG   3  
ATOM 3001  C CD1  . LEU A 1 46 ? -1.025  -13.420 1.754   1.00 0.00 ? 46 LEU A CD1  3  
ATOM 3002  C CD2  . LEU A 1 46 ? -2.914  -14.017 0.227   1.00 0.00 ? 46 LEU A CD2  3  
ATOM 3003  H H    . LEU A 1 46 ? -1.575  -17.638 1.899   1.00 0.00 ? 46 LEU A H    3  
ATOM 3004  H HA   . LEU A 1 46 ? -2.280  -16.663 -0.788  1.00 0.00 ? 46 LEU A HA   3  
ATOM 3005  H HB2  . LEU A 1 46 ? -0.038  -15.704 0.979   1.00 0.00 ? 46 LEU A HB2  3  
ATOM 3006  H HB3  . LEU A 1 46 ? -0.579  -14.987 -0.537  1.00 0.00 ? 46 LEU A HB3  3  
ATOM 3007  H HG   . LEU A 1 46 ? -2.293  -15.109 1.937   1.00 0.00 ? 46 LEU A HG   3  
ATOM 3008  H HD11 . LEU A 1 46 ? -0.752  -12.713 0.985   1.00 0.00 ? 46 LEU A HD11 3  
ATOM 3009  H HD12 . LEU A 1 46 ? -0.131  -13.814 2.215   1.00 0.00 ? 46 LEU A HD12 3  
ATOM 3010  H HD13 . LEU A 1 46 ? -1.627  -12.925 2.502   1.00 0.00 ? 46 LEU A HD13 3  
ATOM 3011  H HD21 . LEU A 1 46 ? -2.496  -13.790 -0.743  1.00 0.00 ? 46 LEU A HD21 3  
ATOM 3012  H HD22 . LEU A 1 46 ? -3.328  -13.117 0.660   1.00 0.00 ? 46 LEU A HD22 3  
ATOM 3013  H HD23 . LEU A 1 46 ? -3.693  -14.756 0.120   1.00 0.00 ? 46 LEU A HD23 3  
ATOM 3014  N N    . SER A 1 47 ? 0.243   -17.191 -1.706  1.00 0.00 ? 47 SER A N    3  
ATOM 3015  C CA   . SER A 1 47 ? 1.294   -17.929 -2.396  1.00 0.00 ? 47 SER A CA   3  
ATOM 3016  C C    . SER A 1 47 ? 2.662   -17.314 -2.120  1.00 0.00 ? 47 SER A C    3  
ATOM 3017  O O    . SER A 1 47 ? 2.784   -16.103 -1.938  1.00 0.00 ? 47 SER A O    3  
ATOM 3018  C CB   . SER A 1 47 ? 1.026   -17.951 -3.902  1.00 0.00 ? 47 SER A CB   3  
ATOM 3019  O OG   . SER A 1 47 ? 0.192   -19.040 -4.257  1.00 0.00 ? 47 SER A OG   3  
ATOM 3020  H H    . SER A 1 47 ? 0.025   -16.281 -2.000  1.00 0.00 ? 47 SER A H    3  
ATOM 3021  H HA   . SER A 1 47 ? 1.286   -18.943 -2.024  1.00 0.00 ? 47 SER A HA   3  
ATOM 3022  H HB2  . SER A 1 47 ? 0.541   -17.031 -4.192  1.00 0.00 ? 47 SER A HB2  3  
ATOM 3023  H HB3  . SER A 1 47 ? 1.965   -18.044 -4.430  1.00 0.00 ? 47 SER A HB3  3  
ATOM 3024  H HG   . SER A 1 47 ? -0.668  -18.932 -3.844  1.00 0.00 ? 47 SER A HG   3  
ATOM 3025  N N    . GLU A 1 48 ? 3.689   -18.158 -2.089  1.00 0.00 ? 48 GLU A N    3  
ATOM 3026  C CA   . GLU A 1 48 ? 5.048   -17.697 -1.834  1.00 0.00 ? 48 GLU A CA   3  
ATOM 3027  C C    . GLU A 1 48 ? 5.376   -16.472 -2.682  1.00 0.00 ? 48 GLU A C    3  
ATOM 3028  O O    . GLU A 1 48 ? 6.025   -15.536 -2.214  1.00 0.00 ? 48 GLU A O    3  
ATOM 3029  C CB   . GLU A 1 48 ? 6.052   -18.815 -2.124  1.00 0.00 ? 48 GLU A CB   3  
ATOM 3030  C CG   . GLU A 1 48 ? 6.258   -19.766 -0.958  1.00 0.00 ? 48 GLU A CG   3  
ATOM 3031  C CD   . GLU A 1 48 ? 7.332   -20.801 -1.231  1.00 0.00 ? 48 GLU A CD   3  
ATOM 3032  O OE1  . GLU A 1 48 ? 7.246   -21.485 -2.273  1.00 0.00 ? 48 GLU A OE1  3  
ATOM 3033  O OE2  . GLU A 1 48 ? 8.259   -20.927 -0.404  1.00 0.00 ? 48 GLU A OE2  3  
ATOM 3034  H H    . GLU A 1 48 ? 3.528   -19.113 -2.241  1.00 0.00 ? 48 GLU A H    3  
ATOM 3035  H HA   . GLU A 1 48 ? 5.117   -17.427 -0.791  1.00 0.00 ? 48 GLU A HA   3  
ATOM 3036  H HB2  . GLU A 1 48 ? 5.702   -19.387 -2.971  1.00 0.00 ? 48 GLU A HB2  3  
ATOM 3037  H HB3  . GLU A 1 48 ? 7.005   -18.371 -2.371  1.00 0.00 ? 48 GLU A HB3  3  
ATOM 3038  H HG2  . GLU A 1 48 ? 6.546   -19.193 -0.089  1.00 0.00 ? 48 GLU A HG2  3  
ATOM 3039  H HG3  . GLU A 1 48 ? 5.328   -20.278 -0.758  1.00 0.00 ? 48 GLU A HG3  3  
ATOM 3040  N N    . ARG A 1 49 ? 4.922   -16.486 -3.931  1.00 0.00 ? 49 ARG A N    3  
ATOM 3041  C CA   . ARG A 1 49 ? 5.168   -15.377 -4.845  1.00 0.00 ? 49 ARG A CA   3  
ATOM 3042  C C    . ARG A 1 49 ? 4.388   -14.137 -4.418  1.00 0.00 ? 49 ARG A C    3  
ATOM 3043  O O    . ARG A 1 49 ? 4.861   -13.011 -4.574  1.00 0.00 ? 49 ARG A O    3  
ATOM 3044  C CB   . ARG A 1 49 ? 4.781   -15.769 -6.272  1.00 0.00 ? 49 ARG A CB   3  
ATOM 3045  C CG   . ARG A 1 49 ? 3.337   -15.446 -6.622  1.00 0.00 ? 49 ARG A CG   3  
ATOM 3046  C CD   . ARG A 1 49 ? 2.851   -16.275 -7.801  1.00 0.00 ? 49 ARG A CD   3  
ATOM 3047  N NE   . ARG A 1 49 ? 2.609   -17.666 -7.430  1.00 0.00 ? 49 ARG A NE   3  
ATOM 3048  C CZ   . ARG A 1 49 ? 2.328   -18.623 -8.308  1.00 0.00 ? 49 ARG A CZ   3  
ATOM 3049  N NH1  . ARG A 1 49 ? 2.255   -18.340 -9.601  1.00 0.00 ? 49 ARG A NH1  3  
ATOM 3050  N NH2  . ARG A 1 49 ? 2.120   -19.866 -7.892  1.00 0.00 ? 49 ARG A NH2  3  
ATOM 3051  H H    . ARG A 1 49 ? 4.411   -17.260 -4.246  1.00 0.00 ? 49 ARG A H    3  
ATOM 3052  H HA   . ARG A 1 49 ? 6.224   -15.151 -4.817  1.00 0.00 ? 49 ARG A HA   3  
ATOM 3053  H HB2  . ARG A 1 49 ? 5.422   -15.243 -6.964  1.00 0.00 ? 49 ARG A HB2  3  
ATOM 3054  H HB3  . ARG A 1 49 ? 4.929   -16.832 -6.393  1.00 0.00 ? 49 ARG A HB3  3  
ATOM 3055  H HG2  . ARG A 1 49 ? 2.713   -15.658 -5.766  1.00 0.00 ? 49 ARG A HG2  3  
ATOM 3056  H HG3  . ARG A 1 49 ? 3.263   -14.399 -6.874  1.00 0.00 ? 49 ARG A HG3  3  
ATOM 3057  H HD2  . ARG A 1 49 ? 1.932   -15.846 -8.171  1.00 0.00 ? 49 ARG A HD2  3  
ATOM 3058  H HD3  . ARG A 1 49 ? 3.600   -16.244 -8.578  1.00 0.00 ? 49 ARG A HD3  3  
ATOM 3059  H HE   . ARG A 1 49 ? 2.658   -17.897 -6.479  1.00 0.00 ? 49 ARG A HE   3  
ATOM 3060  H HH11 . ARG A 1 49 ? 2.412   -17.404 -9.917  1.00 0.00 ? 49 ARG A HH11 3  
ATOM 3061  H HH12 . ARG A 1 49 ? 2.044   -19.062 -10.260 1.00 0.00 ? 49 ARG A HH12 3  
ATOM 3062  H HH21 . ARG A 1 49 ? 2.175   -20.083 -6.918  1.00 0.00 ? 49 ARG A HH21 3  
ATOM 3063  H HH22 . ARG A 1 49 ? 1.909   -20.585 -8.554  1.00 0.00 ? 49 ARG A HH22 3  
ATOM 3064  N N    . GLN A 1 50 ? 3.193   -14.352 -3.879  1.00 0.00 ? 50 GLN A N    3  
ATOM 3065  C CA   . GLN A 1 50 ? 2.348   -13.252 -3.431  1.00 0.00 ? 50 GLN A CA   3  
ATOM 3066  C C    . GLN A 1 50 ? 2.920   -12.603 -2.175  1.00 0.00 ? 50 GLN A C    3  
ATOM 3067  O O    . GLN A 1 50 ? 2.724   -11.411 -1.934  1.00 0.00 ? 50 GLN A O    3  
ATOM 3068  C CB   . GLN A 1 50 ? 0.927   -13.750 -3.160  1.00 0.00 ? 50 GLN A CB   3  
ATOM 3069  C CG   . GLN A 1 50 ? 0.058   -13.817 -4.405  1.00 0.00 ? 50 GLN A CG   3  
ATOM 3070  C CD   . GLN A 1 50 ? -1.273  -14.497 -4.152  1.00 0.00 ? 50 GLN A CD   3  
ATOM 3071  O OE1  . GLN A 1 50 ? -1.325  -15.609 -3.626  1.00 0.00 ? 50 GLN A OE1  3  
ATOM 3072  N NE2  . GLN A 1 50 ? -2.359  -13.831 -4.526  1.00 0.00 ? 50 GLN A NE2  3  
ATOM 3073  H H    . GLN A 1 50 ? 2.871   -15.272 -3.781  1.00 0.00 ? 50 GLN A H    3  
ATOM 3074  H HA   . GLN A 1 50 ? 2.317   -12.515 -4.219  1.00 0.00 ? 50 GLN A HA   3  
ATOM 3075  H HB2  . GLN A 1 50 ? 0.980   -14.738 -2.730  1.00 0.00 ? 50 GLN A HB2  3  
ATOM 3076  H HB3  . GLN A 1 50 ? 0.454   -13.084 -2.453  1.00 0.00 ? 50 GLN A HB3  3  
ATOM 3077  H HG2  . GLN A 1 50 ? -0.130  -12.812 -4.753  1.00 0.00 ? 50 GLN A HG2  3  
ATOM 3078  H HG3  . GLN A 1 50 ? 0.588   -14.368 -5.168  1.00 0.00 ? 50 GLN A HG3  3  
ATOM 3079  H HE21 . GLN A 1 50 ? -2.241  -12.950 -4.941  1.00 0.00 ? 50 GLN A HE21 3  
ATOM 3080  H HE22 . GLN A 1 50 ? -3.232  -14.247 -4.376  1.00 0.00 ? 50 GLN A HE22 3  
ATOM 3081  N N    . VAL A 1 51 ? 3.629   -13.394 -1.376  1.00 0.00 ? 51 VAL A N    3  
ATOM 3082  C CA   . VAL A 1 51 ? 4.230   -12.897 -0.144  1.00 0.00 ? 51 VAL A CA   3  
ATOM 3083  C C    . VAL A 1 51 ? 5.639   -12.371 -0.394  1.00 0.00 ? 51 VAL A C    3  
ATOM 3084  O O    . VAL A 1 51 ? 6.140   -11.527 0.348   1.00 0.00 ? 51 VAL A O    3  
ATOM 3085  C CB   . VAL A 1 51 ? 4.288   -13.994 0.935   1.00 0.00 ? 51 VAL A CB   3  
ATOM 3086  C CG1  . VAL A 1 51 ? 4.791   -13.422 2.252   1.00 0.00 ? 51 VAL A CG1  3  
ATOM 3087  C CG2  . VAL A 1 51 ? 2.921   -14.639 1.112   1.00 0.00 ? 51 VAL A CG2  3  
ATOM 3088  H H    . VAL A 1 51 ? 3.750   -14.335 -1.621  1.00 0.00 ? 51 VAL A H    3  
ATOM 3089  H HA   . VAL A 1 51 ? 3.615   -12.089 0.225   1.00 0.00 ? 51 VAL A HA   3  
ATOM 3090  H HB   . VAL A 1 51 ? 4.982   -14.755 0.610   1.00 0.00 ? 51 VAL A HB   3  
ATOM 3091  H HG11 . VAL A 1 51 ? 4.036   -12.774 2.674   1.00 0.00 ? 51 VAL A HG11 3  
ATOM 3092  H HG12 . VAL A 1 51 ? 5.000   -14.229 2.939   1.00 0.00 ? 51 VAL A HG12 3  
ATOM 3093  H HG13 . VAL A 1 51 ? 5.693   -12.855 2.076   1.00 0.00 ? 51 VAL A HG13 3  
ATOM 3094  H HG21 . VAL A 1 51 ? 2.156   -13.879 1.056   1.00 0.00 ? 51 VAL A HG21 3  
ATOM 3095  H HG22 . VAL A 1 51 ? 2.763   -15.368 0.331   1.00 0.00 ? 51 VAL A HG22 3  
ATOM 3096  H HG23 . VAL A 1 51 ? 2.875   -15.127 2.074   1.00 0.00 ? 51 VAL A HG23 3  
ATOM 3097  N N    . LYS A 1 52 ? 6.275   -12.876 -1.446  1.00 0.00 ? 52 LYS A N    3  
ATOM 3098  C CA   . LYS A 1 52 ? 7.627   -12.457 -1.798  1.00 0.00 ? 52 LYS A CA   3  
ATOM 3099  C C    . LYS A 1 52 ? 7.598   -11.220 -2.689  1.00 0.00 ? 52 LYS A C    3  
ATOM 3100  O O    . LYS A 1 52 ? 8.555   -10.445 -2.725  1.00 0.00 ? 52 LYS A O    3  
ATOM 3101  C CB   . LYS A 1 52 ? 8.367   -13.593 -2.507  1.00 0.00 ? 52 LYS A CB   3  
ATOM 3102  C CG   . LYS A 1 52 ? 8.166   -13.603 -4.012  1.00 0.00 ? 52 LYS A CG   3  
ATOM 3103  C CD   . LYS A 1 52 ? 9.195   -12.737 -4.718  1.00 0.00 ? 52 LYS A CD   3  
ATOM 3104  C CE   . LYS A 1 52 ? 9.460   -13.227 -6.134  1.00 0.00 ? 52 LYS A CE   3  
ATOM 3105  N NZ   . LYS A 1 52 ? 10.390  -14.389 -6.153  1.00 0.00 ? 52 LYS A NZ   3  
ATOM 3106  H H    . LYS A 1 52 ? 5.823   -13.547 -2.001  1.00 0.00 ? 52 LYS A H    3  
ATOM 3107  H HA   . LYS A 1 52 ? 8.147   -12.215 -0.883  1.00 0.00 ? 52 LYS A HA   3  
ATOM 3108  H HB2  . LYS A 1 52 ? 9.424   -13.498 -2.306  1.00 0.00 ? 52 LYS A HB2  3  
ATOM 3109  H HB3  . LYS A 1 52 ? 8.017   -14.536 -2.112  1.00 0.00 ? 52 LYS A HB3  3  
ATOM 3110  H HG2  . LYS A 1 52 ? 8.257   -14.617 -4.372  1.00 0.00 ? 52 LYS A HG2  3  
ATOM 3111  H HG3  . LYS A 1 52 ? 7.177   -13.228 -4.237  1.00 0.00 ? 52 LYS A HG3  3  
ATOM 3112  H HD2  . LYS A 1 52 ? 8.829   -11.722 -4.764  1.00 0.00 ? 52 LYS A HD2  3  
ATOM 3113  H HD3  . LYS A 1 52 ? 10.119  -12.763 -4.159  1.00 0.00 ? 52 LYS A HD3  3  
ATOM 3114  H HE2  . LYS A 1 52 ? 8.522   -13.520 -6.580  1.00 0.00 ? 52 LYS A HE2  3  
ATOM 3115  H HE3  . LYS A 1 52 ? 9.894   -12.419 -6.705  1.00 0.00 ? 52 LYS A HE3  3  
ATOM 3116  H HZ1  . LYS A 1 52 ? 9.915   -15.220 -6.561  1.00 0.00 ? 52 LYS A HZ1  3  
ATOM 3117  H HZ2  . LYS A 1 52 ? 10.696  -14.619 -5.186  1.00 0.00 ? 52 LYS A HZ2  3  
ATOM 3118  H HZ3  . LYS A 1 52 ? 11.229  -14.166 -6.727  1.00 0.00 ? 52 LYS A HZ3  3  
ATOM 3119  N N    . THR A 1 53 ? 6.494   -11.039 -3.408  1.00 0.00 ? 53 THR A N    3  
ATOM 3120  C CA   . THR A 1 53 ? 6.341   -9.896  -4.299  1.00 0.00 ? 53 THR A CA   3  
ATOM 3121  C C    . THR A 1 53 ? 5.771   -8.692  -3.557  1.00 0.00 ? 53 THR A C    3  
ATOM 3122  O O    . THR A 1 53 ? 6.351   -7.607  -3.579  1.00 0.00 ? 53 THR A O    3  
ATOM 3123  C CB   . THR A 1 53 ? 5.425   -10.231 -5.491  1.00 0.00 ? 53 THR A CB   3  
ATOM 3124  O OG1  . THR A 1 53 ? 6.068   -11.178 -6.352  1.00 0.00 ? 53 THR A OG1  3  
ATOM 3125  C CG2  . THR A 1 53 ? 5.078   -8.976  -6.277  1.00 0.00 ? 53 THR A CG2  3  
ATOM 3126  H H    . THR A 1 53 ? 5.767   -11.691 -3.337  1.00 0.00 ? 53 THR A H    3  
ATOM 3127  H HA   . THR A 1 53 ? 7.318   -9.640  -4.684  1.00 0.00 ? 53 THR A HA   3  
ATOM 3128  H HB   . THR A 1 53 ? 4.510   -10.664 -5.111  1.00 0.00 ? 53 THR A HB   3  
ATOM 3129  H HG1  . THR A 1 53 ? 5.506   -11.949 -6.456  1.00 0.00 ? 53 THR A HG1  3  
ATOM 3130  H HG21 . THR A 1 53 ? 4.043   -8.719  -6.108  1.00 0.00 ? 53 THR A HG21 3  
ATOM 3131  H HG22 . THR A 1 53 ? 5.237   -9.155  -7.330  1.00 0.00 ? 53 THR A HG22 3  
ATOM 3132  H HG23 . THR A 1 53 ? 5.708   -8.162  -5.951  1.00 0.00 ? 53 THR A HG23 3  
ATOM 3133  N N    . TRP A 1 54 ? 4.634   -8.892  -2.902  1.00 0.00 ? 54 TRP A N    3  
ATOM 3134  C CA   . TRP A 1 54 ? 3.986   -7.822  -2.152  1.00 0.00 ? 54 TRP A CA   3  
ATOM 3135  C C    . TRP A 1 54 ? 5.005   -7.036  -1.334  1.00 0.00 ? 54 TRP A C    3  
ATOM 3136  O O    . TRP A 1 54 ? 5.165   -5.829  -1.519  1.00 0.00 ? 54 TRP A O    3  
ATOM 3137  C CB   . TRP A 1 54 ? 2.909   -8.397  -1.230  1.00 0.00 ? 54 TRP A CB   3  
ATOM 3138  C CG   . TRP A 1 54 ? 2.040   -7.348  -0.605  1.00 0.00 ? 54 TRP A CG   3  
ATOM 3139  C CD1  . TRP A 1 54 ? 0.831   -6.906  -1.062  1.00 0.00 ? 54 TRP A CD1  3  
ATOM 3140  C CD2  . TRP A 1 54 ? 2.315   -6.608  0.590   1.00 0.00 ? 54 TRP A CD2  3  
ATOM 3141  N NE1  . TRP A 1 54 ? 0.338   -5.936  -0.223  1.00 0.00 ? 54 TRP A NE1  3  
ATOM 3142  C CE2  . TRP A 1 54 ? 1.229   -5.736  0.798   1.00 0.00 ? 54 TRP A CE2  3  
ATOM 3143  C CE3  . TRP A 1 54 ? 3.371   -6.600  1.505   1.00 0.00 ? 54 TRP A CE3  3  
ATOM 3144  C CZ2  . TRP A 1 54 ? 1.172   -4.865  1.883   1.00 0.00 ? 54 TRP A CZ2  3  
ATOM 3145  C CZ3  . TRP A 1 54 ? 3.313   -5.734  2.580   1.00 0.00 ? 54 TRP A CZ3  3  
ATOM 3146  C CH2  . TRP A 1 54 ? 2.220   -4.877  2.763   1.00 0.00 ? 54 TRP A CH2  3  
ATOM 3147  H H    . TRP A 1 54 ? 4.220   -9.781  -2.922  1.00 0.00 ? 54 TRP A H    3  
ATOM 3148  H HA   . TRP A 1 54 ? 3.520   -7.156  -2.862  1.00 0.00 ? 54 TRP A HA   3  
ATOM 3149  H HB2  . TRP A 1 54 ? 2.274   -9.060  -1.798  1.00 0.00 ? 54 TRP A HB2  3  
ATOM 3150  H HB3  . TRP A 1 54 ? 3.385   -8.954  -0.436  1.00 0.00 ? 54 TRP A HB3  3  
ATOM 3151  H HD1  . TRP A 1 54 ? 0.348   -7.273  -1.954  1.00 0.00 ? 54 TRP A HD1  3  
ATOM 3152  H HE1  . TRP A 1 54 ? -0.515  -5.466  -0.337  1.00 0.00 ? 54 TRP A HE1  3  
ATOM 3153  H HE3  . TRP A 1 54 ? 4.222   -7.253  1.381   1.00 0.00 ? 54 TRP A HE3  3  
ATOM 3154  H HZ2  . TRP A 1 54 ? 0.335   -4.199  2.038   1.00 0.00 ? 54 TRP A HZ2  3  
ATOM 3155  H HZ3  . TRP A 1 54 ? 4.120   -5.713  3.298   1.00 0.00 ? 54 TRP A HZ3  3  
ATOM 3156  H HH2  . TRP A 1 54 ? 2.217   -4.218  3.617   1.00 0.00 ? 54 TRP A HH2  3  
ATOM 3157  N N    . PHE A 1 55 ? 5.692   -7.727  -0.431  1.00 0.00 ? 55 PHE A N    3  
ATOM 3158  C CA   . PHE A 1 55 ? 6.696   -7.092  0.416   1.00 0.00 ? 55 PHE A CA   3  
ATOM 3159  C C    . PHE A 1 55 ? 7.672   -6.271  -0.421  1.00 0.00 ? 55 PHE A C    3  
ATOM 3160  O O    . PHE A 1 55 ? 7.946   -5.111  -0.113  1.00 0.00 ? 55 PHE A O    3  
ATOM 3161  C CB   . PHE A 1 55 ? 7.458   -8.148  1.219   1.00 0.00 ? 55 PHE A CB   3  
ATOM 3162  C CG   . PHE A 1 55 ? 6.711   -8.636  2.428   1.00 0.00 ? 55 PHE A CG   3  
ATOM 3163  C CD1  . PHE A 1 55 ? 5.560   -9.394  2.288   1.00 0.00 ? 55 PHE A CD1  3  
ATOM 3164  C CD2  . PHE A 1 55 ? 7.160   -8.335  3.704   1.00 0.00 ? 55 PHE A CD2  3  
ATOM 3165  C CE1  . PHE A 1 55 ? 4.871   -9.845  3.398   1.00 0.00 ? 55 PHE A CE1  3  
ATOM 3166  C CE2  . PHE A 1 55 ? 6.475   -8.784  4.817   1.00 0.00 ? 55 PHE A CE2  3  
ATOM 3167  C CZ   . PHE A 1 55 ? 5.329   -9.538  4.665   1.00 0.00 ? 55 PHE A CZ   3  
ATOM 3168  H H    . PHE A 1 55 ? 5.519   -8.687  -0.330  1.00 0.00 ? 55 PHE A H    3  
ATOM 3169  H HA   . PHE A 1 55 ? 6.183   -6.433  1.099   1.00 0.00 ? 55 PHE A HA   3  
ATOM 3170  H HB2  . PHE A 1 55 ? 7.655   -9.000  0.586   1.00 0.00 ? 55 PHE A HB2  3  
ATOM 3171  H HB3  . PHE A 1 55 ? 8.395   -7.729  1.553   1.00 0.00 ? 55 PHE A HB3  3  
ATOM 3172  H HD1  . PHE A 1 55 ? 5.201   -9.635  1.297   1.00 0.00 ? 55 PHE A HD1  3  
ATOM 3173  H HD2  . PHE A 1 55 ? 8.056   -7.744  3.825   1.00 0.00 ? 55 PHE A HD2  3  
ATOM 3174  H HE1  . PHE A 1 55 ? 3.975   -10.435 3.275   1.00 0.00 ? 55 PHE A HE1  3  
ATOM 3175  H HE2  . PHE A 1 55 ? 6.835   -8.542  5.807   1.00 0.00 ? 55 PHE A HE2  3  
ATOM 3176  H HZ   . PHE A 1 55 ? 4.793   -9.890  5.533   1.00 0.00 ? 55 PHE A HZ   3  
ATOM 3177  N N    . GLN A 1 56 ? 8.194   -6.882  -1.480  1.00 0.00 ? 56 GLN A N    3  
ATOM 3178  C CA   . GLN A 1 56 ? 9.141   -6.208  -2.360  1.00 0.00 ? 56 GLN A CA   3  
ATOM 3179  C C    . GLN A 1 56 ? 8.598   -4.855  -2.810  1.00 0.00 ? 56 GLN A C    3  
ATOM 3180  O O    . GLN A 1 56 ? 9.184   -3.813  -2.521  1.00 0.00 ? 56 GLN A O    3  
ATOM 3181  C CB   . GLN A 1 56 ? 9.445   -7.080  -3.580  1.00 0.00 ? 56 GLN A CB   3  
ATOM 3182  C CG   . GLN A 1 56 ? 10.559  -8.087  -3.345  1.00 0.00 ? 56 GLN A CG   3  
ATOM 3183  C CD   . GLN A 1 56 ? 11.022  -8.754  -4.625  1.00 0.00 ? 56 GLN A CD   3  
ATOM 3184  O OE1  . GLN A 1 56 ? 10.412  -8.587  -5.681  1.00 0.00 ? 56 GLN A OE1  3  
ATOM 3185  N NE2  . GLN A 1 56 ? 12.106  -9.516  -4.537  1.00 0.00 ? 56 GLN A NE2  3  
ATOM 3186  H H    . GLN A 1 56 ? 7.936   -7.807  -1.673  1.00 0.00 ? 56 GLN A H    3  
ATOM 3187  H HA   . GLN A 1 56 ? 10.053  -6.049  -1.806  1.00 0.00 ? 56 GLN A HA   3  
ATOM 3188  H HB2  . GLN A 1 56 ? 8.551   -7.621  -3.853  1.00 0.00 ? 56 GLN A HB2  3  
ATOM 3189  H HB3  . GLN A 1 56 ? 9.735   -6.441  -4.401  1.00 0.00 ? 56 GLN A HB3  3  
ATOM 3190  H HG2  . GLN A 1 56 ? 11.400  -7.577  -2.899  1.00 0.00 ? 56 GLN A HG2  3  
ATOM 3191  H HG3  . GLN A 1 56 ? 10.201  -8.848  -2.668  1.00 0.00 ? 56 GLN A HG3  3  
ATOM 3192  H HE21 . GLN A 1 56 ? 12.540  -9.604  -3.662  1.00 0.00 ? 56 GLN A HE21 3  
ATOM 3193  H HE22 . GLN A 1 56 ? 12.427  -9.960  -5.348  1.00 0.00 ? 56 GLN A HE22 3  
ATOM 3194  N N    . ASN A 1 57 ? 7.475   -4.880  -3.520  1.00 0.00 ? 57 ASN A N    3  
ATOM 3195  C CA   . ASN A 1 57 ? 6.853   -3.656  -4.011  1.00 0.00 ? 57 ASN A CA   3  
ATOM 3196  C C    . ASN A 1 57 ? 6.695   -2.637  -2.886  1.00 0.00 ? 57 ASN A C    3  
ATOM 3197  O O    . ASN A 1 57 ? 7.146   -1.497  -2.999  1.00 0.00 ? 57 ASN A O    3  
ATOM 3198  C CB   . ASN A 1 57 ? 5.489   -3.964  -4.631  1.00 0.00 ? 57 ASN A CB   3  
ATOM 3199  C CG   . ASN A 1 57 ? 5.543   -5.133  -5.595  1.00 0.00 ? 57 ASN A CG   3  
ATOM 3200  O OD1  . ASN A 1 57 ? 6.599   -5.728  -5.809  1.00 0.00 ? 57 ASN A OD1  3  
ATOM 3201  N ND2  . ASN A 1 57 ? 4.401   -5.467  -6.184  1.00 0.00 ? 57 ASN A ND2  3  
ATOM 3202  H H    . ASN A 1 57 ? 7.054   -5.743  -3.719  1.00 0.00 ? 57 ASN A H    3  
ATOM 3203  H HA   . ASN A 1 57 ? 7.497   -3.239  -4.770  1.00 0.00 ? 57 ASN A HA   3  
ATOM 3204  H HB2  . ASN A 1 57 ? 4.789   -4.205  -3.843  1.00 0.00 ? 57 ASN A HB2  3  
ATOM 3205  H HB3  . ASN A 1 57 ? 5.138   -3.095  -5.166  1.00 0.00 ? 57 ASN A HB3  3  
ATOM 3206  H HD21 . ASN A 1 57 ? 3.598   -4.948  -5.967  1.00 0.00 ? 57 ASN A HD21 3  
ATOM 3207  H HD22 . ASN A 1 57 ? 4.407   -6.220  -6.812  1.00 0.00 ? 57 ASN A HD22 3  
ATOM 3208  N N    . ARG A 1 58 ? 6.051   -3.057  -1.802  1.00 0.00 ? 58 ARG A N    3  
ATOM 3209  C CA   . ARG A 1 58 ? 5.833   -2.182  -0.656  1.00 0.00 ? 58 ARG A CA   3  
ATOM 3210  C C    . ARG A 1 58 ? 7.099   -1.398  -0.322  1.00 0.00 ? 58 ARG A C    3  
ATOM 3211  O O    . ARG A 1 58 ? 7.104   -0.167  -0.352  1.00 0.00 ? 58 ARG A O    3  
ATOM 3212  C CB   . ARG A 1 58 ? 5.390   -2.998  0.559   1.00 0.00 ? 58 ARG A CB   3  
ATOM 3213  C CG   . ARG A 1 58 ? 4.947   -2.146  1.737   1.00 0.00 ? 58 ARG A CG   3  
ATOM 3214  C CD   . ARG A 1 58 ? 3.507   -1.682  1.579   1.00 0.00 ? 58 ARG A CD   3  
ATOM 3215  N NE   . ARG A 1 58 ? 3.130   -0.709  2.600   1.00 0.00 ? 58 ARG A NE   3  
ATOM 3216  C CZ   . ARG A 1 58 ? 2.034   0.038   2.535   1.00 0.00 ? 58 ARG A CZ   3  
ATOM 3217  N NH1  . ARG A 1 58 ? 1.210   -0.077  1.502   1.00 0.00 ? 58 ARG A NH1  3  
ATOM 3218  N NH2  . ARG A 1 58 ? 1.759   0.902   3.504   1.00 0.00 ? 58 ARG A NH2  3  
ATOM 3219  H H    . ARG A 1 58 ? 5.715   -3.977  -1.771  1.00 0.00 ? 58 ARG A H    3  
ATOM 3220  H HA   . ARG A 1 58 ? 5.050   -1.485  -0.916  1.00 0.00 ? 58 ARG A HA   3  
ATOM 3221  H HB2  . ARG A 1 58 ? 4.563   -3.632  0.271   1.00 0.00 ? 58 ARG A HB2  3  
ATOM 3222  H HB3  . ARG A 1 58 ? 6.213   -3.618  0.881   1.00 0.00 ? 58 ARG A HB3  3  
ATOM 3223  H HG2  . ARG A 1 58 ? 5.028   -2.729  2.642   1.00 0.00 ? 58 ARG A HG2  3  
ATOM 3224  H HG3  . ARG A 1 58 ? 5.589   -1.281  1.805   1.00 0.00 ? 58 ARG A HG3  3  
ATOM 3225  H HD2  . ARG A 1 58 ? 3.393   -1.229  0.605   1.00 0.00 ? 58 ARG A HD2  3  
ATOM 3226  H HD3  . ARG A 1 58 ? 2.856   -2.540  1.655   1.00 0.00 ? 58 ARG A HD3  3  
ATOM 3227  H HE   . ARG A 1 58 ? 3.725   -0.608  3.372   1.00 0.00 ? 58 ARG A HE   3  
ATOM 3228  H HH11 . ARG A 1 58 ? 1.414   -0.727  0.771   1.00 0.00 ? 58 ARG A HH11 3  
ATOM 3229  H HH12 . ARG A 1 58 ? 0.384   0.486   1.456   1.00 0.00 ? 58 ARG A HH12 3  
ATOM 3230  H HH21 . ARG A 1 58 ? 2.377   0.991   4.285   1.00 0.00 ? 58 ARG A HH21 3  
ATOM 3231  H HH22 . ARG A 1 58 ? 0.934   1.463   3.454   1.00 0.00 ? 58 ARG A HH22 3  
ATOM 3232  N N    . ARG A 1 59 ? 8.168   -2.119  -0.003  1.00 0.00 ? 59 ARG A N    3  
ATOM 3233  C CA   . ARG A 1 59 ? 9.439   -1.492  0.339   1.00 0.00 ? 59 ARG A CA   3  
ATOM 3234  C C    . ARG A 1 59 ? 9.665   -0.233  -0.494  1.00 0.00 ? 59 ARG A C    3  
ATOM 3235  O O    . ARG A 1 59 ? 9.885   0.850   0.047   1.00 0.00 ? 59 ARG A O    3  
ATOM 3236  C CB   . ARG A 1 59 ? 10.592  -2.473  0.123   1.00 0.00 ? 59 ARG A CB   3  
ATOM 3237  C CG   . ARG A 1 59 ? 11.774  -2.238  1.048   1.00 0.00 ? 59 ARG A CG   3  
ATOM 3238  C CD   . ARG A 1 59 ? 12.931  -3.171  0.723   1.00 0.00 ? 59 ARG A CD   3  
ATOM 3239  N NE   . ARG A 1 59 ? 13.432  -2.967  -0.634  1.00 0.00 ? 59 ARG A NE   3  
ATOM 3240  C CZ   . ARG A 1 59 ? 12.909  -3.551  -1.706  1.00 0.00 ? 59 ARG A CZ   3  
ATOM 3241  N NH1  . ARG A 1 59 ? 11.874  -4.370  -1.580  1.00 0.00 ? 59 ARG A NH1  3  
ATOM 3242  N NH2  . ARG A 1 59 ? 13.421  -3.316  -2.907  1.00 0.00 ? 59 ARG A NH2  3  
ATOM 3243  H H    . ARG A 1 59 ? 8.101   -3.097  0.004   1.00 0.00 ? 59 ARG A H    3  
ATOM 3244  H HA   . ARG A 1 59 ? 9.403   -1.217  1.383   1.00 0.00 ? 59 ARG A HA   3  
ATOM 3245  H HB2  . ARG A 1 59 ? 10.230  -3.478  0.286   1.00 0.00 ? 59 ARG A HB2  3  
ATOM 3246  H HB3  . ARG A 1 59 ? 10.937  -2.385  -0.897  1.00 0.00 ? 59 ARG A HB3  3  
ATOM 3247  H HG2  . ARG A 1 59 ? 12.108  -1.217  0.939   1.00 0.00 ? 59 ARG A HG2  3  
ATOM 3248  H HG3  . ARG A 1 59 ? 11.461  -2.409  2.067   1.00 0.00 ? 59 ARG A HG3  3  
ATOM 3249  H HD2  . ARG A 1 59 ? 13.731  -2.987  1.423   1.00 0.00 ? 59 ARG A HD2  3  
ATOM 3250  H HD3  . ARG A 1 59 ? 12.592  -4.191  0.822   1.00 0.00 ? 59 ARG A HD3  3  
ATOM 3251  H HE   . ARG A 1 59 ? 14.197  -2.366  -0.750  1.00 0.00 ? 59 ARG A HE   3  
ATOM 3252  H HH11 . ARG A 1 59 ? 11.486  -4.549  -0.677  1.00 0.00 ? 59 ARG A HH11 3  
ATOM 3253  H HH12 . ARG A 1 59 ? 11.481  -4.808  -2.390  1.00 0.00 ? 59 ARG A HH12 3  
ATOM 3254  H HH21 . ARG A 1 59 ? 14.201  -2.699  -3.006  1.00 0.00 ? 59 ARG A HH21 3  
ATOM 3255  H HH22 . ARG A 1 59 ? 13.027  -3.757  -3.714  1.00 0.00 ? 59 ARG A HH22 3  
ATOM 3256  N N    . ALA A 1 60 ? 9.610   -0.385  -1.813  1.00 0.00 ? 60 ALA A N    3  
ATOM 3257  C CA   . ALA A 1 60 ? 9.807   0.739   -2.720  1.00 0.00 ? 60 ALA A CA   3  
ATOM 3258  C C    . ALA A 1 60 ? 9.091   1.986   -2.213  1.00 0.00 ? 60 ALA A C    3  
ATOM 3259  O O    . ALA A 1 60 ? 9.645   3.085   -2.235  1.00 0.00 ? 60 ALA A O    3  
ATOM 3260  C CB   . ALA A 1 60 ? 9.323   0.380   -4.117  1.00 0.00 ? 60 ALA A CB   3  
ATOM 3261  H H    . ALA A 1 60 ? 9.431   -1.274  -2.185  1.00 0.00 ? 60 ALA A H    3  
ATOM 3262  H HA   . ALA A 1 60 ? 10.867  0.942   -2.774  1.00 0.00 ? 60 ALA A HA   3  
ATOM 3263  H HB1  . ALA A 1 60 ? 10.162  0.376   -4.798  1.00 0.00 ? 60 ALA A HB1  3  
ATOM 3264  H HB2  . ALA A 1 60 ? 8.868   -0.598  -4.100  1.00 0.00 ? 60 ALA A HB2  3  
ATOM 3265  H HB3  . ALA A 1 60 ? 8.597   1.110   -4.444  1.00 0.00 ? 60 ALA A HB3  3  
ATOM 3266  N N    . LYS A 1 61 ? 7.855   1.808   -1.758  1.00 0.00 ? 61 LYS A N    3  
ATOM 3267  C CA   . LYS A 1 61 ? 7.062   2.919   -1.245  1.00 0.00 ? 61 LYS A CA   3  
ATOM 3268  C C    . LYS A 1 61 ? 7.610   3.407   0.093   1.00 0.00 ? 61 LYS A C    3  
ATOM 3269  O O    . LYS A 1 61 ? 7.904   4.591   0.258   1.00 0.00 ? 61 LYS A O    3  
ATOM 3270  C CB   . LYS A 1 61 ? 5.600   2.497   -1.085  1.00 0.00 ? 61 LYS A CB   3  
ATOM 3271  C CG   . LYS A 1 61 ? 4.671   3.644   -0.725  1.00 0.00 ? 61 LYS A CG   3  
ATOM 3272  C CD   . LYS A 1 61 ? 3.213   3.220   -0.783  1.00 0.00 ? 61 LYS A CD   3  
ATOM 3273  C CE   . LYS A 1 61 ? 2.317   4.206   -0.049  1.00 0.00 ? 61 LYS A CE   3  
ATOM 3274  N NZ   . LYS A 1 61 ? 0.970   3.632   0.226   1.00 0.00 ? 61 LYS A NZ   3  
ATOM 3275  H H    . LYS A 1 61 ? 7.468   0.908   -1.766  1.00 0.00 ? 61 LYS A H    3  
ATOM 3276  H HA   . LYS A 1 61 ? 7.119   3.726   -1.959  1.00 0.00 ? 61 LYS A HA   3  
ATOM 3277  H HB2  . LYS A 1 61 ? 5.259   2.063   -2.013  1.00 0.00 ? 61 LYS A HB2  3  
ATOM 3278  H HB3  . LYS A 1 61 ? 5.536   1.752   -0.305  1.00 0.00 ? 61 LYS A HB3  3  
ATOM 3279  H HG2  . LYS A 1 61 ? 4.898   3.979   0.276   1.00 0.00 ? 61 LYS A HG2  3  
ATOM 3280  H HG3  . LYS A 1 61 ? 4.829   4.455   -1.423  1.00 0.00 ? 61 LYS A HG3  3  
ATOM 3281  H HD2  . LYS A 1 61 ? 2.902   3.170   -1.816  1.00 0.00 ? 61 LYS A HD2  3  
ATOM 3282  H HD3  . LYS A 1 61 ? 3.112   2.246   -0.327  1.00 0.00 ? 61 LYS A HD3  3  
ATOM 3283  H HE2  . LYS A 1 61 ? 2.784   4.469   0.888   1.00 0.00 ? 61 LYS A HE2  3  
ATOM 3284  H HE3  . LYS A 1 61 ? 2.205   5.092   -0.656  1.00 0.00 ? 61 LYS A HE3  3  
ATOM 3285  H HZ1  . LYS A 1 61 ? 0.408   4.297   0.795   1.00 0.00 ? 61 LYS A HZ1  3  
ATOM 3286  H HZ2  . LYS A 1 61 ? 1.062   2.738   0.749   1.00 0.00 ? 61 LYS A HZ2  3  
ATOM 3287  H HZ3  . LYS A 1 61 ? 0.471   3.449   -0.668  1.00 0.00 ? 61 LYS A HZ3  3  
ATOM 3288  N N    . TRP A 1 62 ? 7.746   2.488   1.042   1.00 0.00 ? 62 TRP A N    3  
ATOM 3289  C CA   . TRP A 1 62 ? 8.261   2.826   2.364   1.00 0.00 ? 62 TRP A CA   3  
ATOM 3290  C C    . TRP A 1 62 ? 9.432   3.797   2.261   1.00 0.00 ? 62 TRP A C    3  
ATOM 3291  O O    . TRP A 1 62 ? 9.448   4.836   2.920   1.00 0.00 ? 62 TRP A O    3  
ATOM 3292  C CB   . TRP A 1 62 ? 8.697   1.559   3.103   1.00 0.00 ? 62 TRP A CB   3  
ATOM 3293  C CG   . TRP A 1 62 ? 9.571   1.835   4.289   1.00 0.00 ? 62 TRP A CG   3  
ATOM 3294  C CD1  . TRP A 1 62 ? 9.241   2.557   5.400   1.00 0.00 ? 62 TRP A CD1  3  
ATOM 3295  C CD2  . TRP A 1 62 ? 10.919  1.393   4.480   1.00 0.00 ? 62 TRP A CD2  3  
ATOM 3296  N NE1  . TRP A 1 62 ? 10.303  2.591   6.271   1.00 0.00 ? 62 TRP A NE1  3  
ATOM 3297  C CE2  . TRP A 1 62 ? 11.344  1.884   5.730   1.00 0.00 ? 62 TRP A CE2  3  
ATOM 3298  C CE3  . TRP A 1 62 ? 11.808  0.630   3.719   1.00 0.00 ? 62 TRP A CE3  3  
ATOM 3299  C CZ2  . TRP A 1 62 ? 12.619  1.636   6.233   1.00 0.00 ? 62 TRP A CZ2  3  
ATOM 3300  C CZ3  . TRP A 1 62 ? 13.073  0.385   4.219   1.00 0.00 ? 62 TRP A CZ3  3  
ATOM 3301  C CH2  . TRP A 1 62 ? 13.469  0.886   5.466   1.00 0.00 ? 62 TRP A CH2  3  
ATOM 3302  H H    . TRP A 1 62 ? 7.495   1.560   0.849   1.00 0.00 ? 62 TRP A H    3  
ATOM 3303  H HA   . TRP A 1 62 ? 7.464   3.299   2.918   1.00 0.00 ? 62 TRP A HA   3  
ATOM 3304  H HB2  . TRP A 1 62 ? 7.820   1.033   3.450   1.00 0.00 ? 62 TRP A HB2  3  
ATOM 3305  H HB3  . TRP A 1 62 ? 9.247   0.926   2.422   1.00 0.00 ? 62 TRP A HB3  3  
ATOM 3306  H HD1  . TRP A 1 62 ? 8.283   3.028   5.556   1.00 0.00 ? 62 TRP A HD1  3  
ATOM 3307  H HE1  . TRP A 1 62 ? 10.312  3.047   7.139   1.00 0.00 ? 62 TRP A HE1  3  
ATOM 3308  H HE3  . TRP A 1 62 ? 11.521  0.235   2.756   1.00 0.00 ? 62 TRP A HE3  3  
ATOM 3309  H HZ2  . TRP A 1 62 ? 12.939  2.015   7.192   1.00 0.00 ? 62 TRP A HZ2  3  
ATOM 3310  H HZ3  . TRP A 1 62 ? 13.774  -0.203  3.644   1.00 0.00 ? 62 TRP A HZ3  3  
ATOM 3311  H HH2  . TRP A 1 62 ? 14.466  0.670   5.816   1.00 0.00 ? 62 TRP A HH2  3  
ATOM 3312  N N    . ARG A 1 63 ? 10.409  3.452   1.429   1.00 0.00 ? 63 ARG A N    3  
ATOM 3313  C CA   . ARG A 1 63 ? 11.585  4.294   1.241   1.00 0.00 ? 63 ARG A CA   3  
ATOM 3314  C C    . ARG A 1 63 ? 11.181  5.706   0.823   1.00 0.00 ? 63 ARG A C    3  
ATOM 3315  O O    . ARG A 1 63 ? 11.593  6.688   1.440   1.00 0.00 ? 63 ARG A O    3  
ATOM 3316  C CB   . ARG A 1 63 ? 12.512  3.685   0.187   1.00 0.00 ? 63 ARG A CB   3  
ATOM 3317  C CG   . ARG A 1 63 ? 13.447  2.622   0.741   1.00 0.00 ? 63 ARG A CG   3  
ATOM 3318  C CD   . ARG A 1 63 ? 12.793  1.249   0.739   1.00 0.00 ? 63 ARG A CD   3  
ATOM 3319  N NE   . ARG A 1 63 ? 12.765  0.658   -0.596  1.00 0.00 ? 63 ARG A NE   3  
ATOM 3320  C CZ   . ARG A 1 63 ? 13.825  0.108   -1.178  1.00 0.00 ? 63 ARG A CZ   3  
ATOM 3321  N NH1  . ARG A 1 63 ? 14.990  0.075   -0.546  1.00 0.00 ? 63 ARG A NH1  3  
ATOM 3322  N NH2  . ARG A 1 63 ? 13.721  -0.410  -2.395  1.00 0.00 ? 63 ARG A NH2  3  
ATOM 3323  H H    . ARG A 1 63 ? 10.339  2.612   0.930   1.00 0.00 ? 63 ARG A H    3  
ATOM 3324  H HA   . ARG A 1 63 ? 12.110  4.347   2.182   1.00 0.00 ? 63 ARG A HA   3  
ATOM 3325  H HB2  . ARG A 1 63 ? 11.910  3.235   -0.588  1.00 0.00 ? 63 ARG A HB2  3  
ATOM 3326  H HB3  . ARG A 1 63 ? 13.112  4.471   -0.245  1.00 0.00 ? 63 ARG A HB3  3  
ATOM 3327  H HG2  . ARG A 1 63 ? 14.337  2.585   0.130   1.00 0.00 ? 63 ARG A HG2  3  
ATOM 3328  H HG3  . ARG A 1 63 ? 13.714  2.883   1.754   1.00 0.00 ? 63 ARG A HG3  3  
ATOM 3329  H HD2  . ARG A 1 63 ? 13.348  0.600   1.399   1.00 0.00 ? 63 ARG A HD2  3  
ATOM 3330  H HD3  . ARG A 1 63 ? 11.780  1.348   1.101   1.00 0.00 ? 63 ARG A HD3  3  
ATOM 3331  H HE   . ARG A 1 63 ? 11.914  0.671   -1.081  1.00 0.00 ? 63 ARG A HE   3  
ATOM 3332  H HH11 . ARG A 1 63 ? 15.071  0.464   0.372   1.00 0.00 ? 63 ARG A HH11 3  
ATOM 3333  H HH12 . ARG A 1 63 ? 15.786  -0.340  -0.986  1.00 0.00 ? 63 ARG A HH12 3  
ATOM 3334  H HH21 . ARG A 1 63 ? 12.844  -0.387  -2.875  1.00 0.00 ? 63 ARG A HH21 3  
ATOM 3335  H HH22 . ARG A 1 63 ? 14.519  -0.823  -2.833  1.00 0.00 ? 63 ARG A HH22 3  
ATOM 3336  N N    . ARG A 1 64 ? 10.374  5.798   -0.229  1.00 0.00 ? 64 ARG A N    3  
ATOM 3337  C CA   . ARG A 1 64 ? 9.916   7.088   -0.729  1.00 0.00 ? 64 ARG A CA   3  
ATOM 3338  C C    . ARG A 1 64 ? 9.386   7.956   0.408   1.00 0.00 ? 64 ARG A C    3  
ATOM 3339  O O    . ARG A 1 64 ? 9.848   9.079   0.613   1.00 0.00 ? 64 ARG A O    3  
ATOM 3340  C CB   . ARG A 1 64 ? 8.827   6.892   -1.786  1.00 0.00 ? 64 ARG A CB   3  
ATOM 3341  C CG   . ARG A 1 64 ? 9.332   6.254   -3.070  1.00 0.00 ? 64 ARG A CG   3  
ATOM 3342  C CD   . ARG A 1 64 ? 8.408   6.552   -4.240  1.00 0.00 ? 64 ARG A CD   3  
ATOM 3343  N NE   . ARG A 1 64 ? 8.698   7.847   -4.851  1.00 0.00 ? 64 ARG A NE   3  
ATOM 3344  C CZ   . ARG A 1 64 ? 9.792   8.096   -5.562  1.00 0.00 ? 64 ARG A CZ   3  
ATOM 3345  N NH1  . ARG A 1 64 ? 10.694  7.144   -5.752  1.00 0.00 ? 64 ARG A NH1  3  
ATOM 3346  N NH2  . ARG A 1 64 ? 9.984   9.300   -6.085  1.00 0.00 ? 64 ARG A NH2  3  
ATOM 3347  H H    . ARG A 1 64 ? 10.079  4.979   -0.679  1.00 0.00 ? 64 ARG A H    3  
ATOM 3348  H HA   . ARG A 1 64 ? 10.760  7.586   -1.183  1.00 0.00 ? 64 ARG A HA   3  
ATOM 3349  H HB2  . ARG A 1 64 ? 8.054   6.260   -1.376  1.00 0.00 ? 64 ARG A HB2  3  
ATOM 3350  H HB3  . ARG A 1 64 ? 8.403   7.854   -2.030  1.00 0.00 ? 64 ARG A HB3  3  
ATOM 3351  H HG2  . ARG A 1 64 ? 10.314  6.644   -3.293  1.00 0.00 ? 64 ARG A HG2  3  
ATOM 3352  H HG3  . ARG A 1 64 ? 9.390   5.185   -2.931  1.00 0.00 ? 64 ARG A HG3  3  
ATOM 3353  H HD2  . ARG A 1 64 ? 8.531   5.779   -4.984  1.00 0.00 ? 64 ARG A HD2  3  
ATOM 3354  H HD3  . ARG A 1 64 ? 7.389   6.551   -3.886  1.00 0.00 ? 64 ARG A HD3  3  
ATOM 3355  H HE   . ARG A 1 64 ? 8.044   8.565   -4.723  1.00 0.00 ? 64 ARG A HE   3  
ATOM 3356  H HH11 . ARG A 1 64 ? 10.552  6.235   -5.359  1.00 0.00 ? 64 ARG A HH11 3  
ATOM 3357  H HH12 . ARG A 1 64 ? 11.517  7.334   -6.288  1.00 0.00 ? 64 ARG A HH12 3  
ATOM 3358  H HH21 . ARG A 1 64 ? 9.306   10.021  -5.945  1.00 0.00 ? 64 ARG A HH21 3  
ATOM 3359  H HH22 . ARG A 1 64 ? 10.807  9.487   -6.620  1.00 0.00 ? 64 ARG A HH22 3  
ATOM 3360  N N    . SER A 1 65 ? 8.413   7.428   1.144   1.00 0.00 ? 65 SER A N    3  
ATOM 3361  C CA   . SER A 1 65 ? 7.817   8.156   2.258   1.00 0.00 ? 65 SER A CA   3  
ATOM 3362  C C    . SER A 1 65 ? 8.860   8.457   3.331   1.00 0.00 ? 65 SER A C    3  
ATOM 3363  O O    . SER A 1 65 ? 8.868   9.537   3.919   1.00 0.00 ? 65 SER A O    3  
ATOM 3364  C CB   . SER A 1 65 ? 6.665   7.351   2.863   1.00 0.00 ? 65 SER A CB   3  
ATOM 3365  O OG   . SER A 1 65 ? 7.150   6.274   3.645   1.00 0.00 ? 65 SER A OG   3  
ATOM 3366  H H    . SER A 1 65 ? 8.088   6.529   0.931   1.00 0.00 ? 65 SER A H    3  
ATOM 3367  H HA   . SER A 1 65 ? 7.432   9.089   1.876   1.00 0.00 ? 65 SER A HA   3  
ATOM 3368  H HB2  . SER A 1 65 ? 6.069   7.996   3.490   1.00 0.00 ? 65 SER A HB2  3  
ATOM 3369  H HB3  . SER A 1 65 ? 6.051   6.955   2.067   1.00 0.00 ? 65 SER A HB3  3  
ATOM 3370  H HG   . SER A 1 65 ? 6.410   5.778   4.002   1.00 0.00 ? 65 SER A HG   3  
ATOM 3371  N N    . GLY A 1 66 ? 9.739   7.491   3.580   1.00 0.00 ? 66 GLY A N    3  
ATOM 3372  C CA   . GLY A 1 66 ? 10.774  7.671   4.581   1.00 0.00 ? 66 GLY A CA   3  
ATOM 3373  C C    . GLY A 1 66 ? 11.835  8.663   4.147   1.00 0.00 ? 66 GLY A C    3  
ATOM 3374  O O    . GLY A 1 66 ? 11.687  9.365   3.147   1.00 0.00 ? 66 GLY A O    3  
ATOM 3375  H H    . GLY A 1 66 ? 9.685   6.650   3.080   1.00 0.00 ? 66 GLY A H    3  
ATOM 3376  H HA2  . GLY A 1 66 ? 10.319  8.023   5.495   1.00 0.00 ? 66 GLY A HA2  3  
ATOM 3377  H HA3  . GLY A 1 66 ? 11.245  6.717   4.770   1.00 0.00 ? 66 GLY A HA3  3  
ATOM 3378  N N    . PRO A 1 67 ? 12.935  8.731   4.912   1.00 0.00 ? 67 PRO A N    3  
ATOM 3379  C CA   . PRO A 1 67 ? 14.046  9.642   4.621   1.00 0.00 ? 67 PRO A CA   3  
ATOM 3380  C C    . PRO A 1 67 ? 14.820  9.232   3.373   1.00 0.00 ? 67 PRO A C    3  
ATOM 3381  O O    . PRO A 1 67 ? 15.193  8.070   3.216   1.00 0.00 ? 67 PRO A O    3  
ATOM 3382  C CB   . PRO A 1 67 ? 14.934  9.527   5.862   1.00 0.00 ? 67 PRO A CB   3  
ATOM 3383  C CG   . PRO A 1 67 ? 14.629  8.180   6.422   1.00 0.00 ? 67 PRO A CG   3  
ATOM 3384  C CD   . PRO A 1 67 ? 13.179  7.924   6.119   1.00 0.00 ? 67 PRO A CD   3  
ATOM 3385  H HA   . PRO A 1 67 ? 13.705  10.661  4.513   1.00 0.00 ? 67 PRO A HA   3  
ATOM 3386  H HB2  . PRO A 1 67 ? 15.972  9.611   5.574   1.00 0.00 ? 67 PRO A HB2  3  
ATOM 3387  H HB3  . PRO A 1 67 ? 14.684  10.311  6.562   1.00 0.00 ? 67 PRO A HB3  3  
ATOM 3388  H HG2  . PRO A 1 67 ? 15.249  7.436   5.946   1.00 0.00 ? 67 PRO A HG2  3  
ATOM 3389  H HG3  . PRO A 1 67 ? 14.794  8.181   7.489   1.00 0.00 ? 67 PRO A HG3  3  
ATOM 3390  H HD2  . PRO A 1 67 ? 13.015  6.875   5.921   1.00 0.00 ? 67 PRO A HD2  3  
ATOM 3391  H HD3  . PRO A 1 67 ? 12.558  8.258   6.937   1.00 0.00 ? 67 PRO A HD3  3  
ATOM 3392  N N    . SER A 1 68 ? 15.059  10.194  2.487   1.00 0.00 ? 68 SER A N    3  
ATOM 3393  C CA   . SER A 1 68 ? 15.786  9.932   1.251   1.00 0.00 ? 68 SER A CA   3  
ATOM 3394  C C    . SER A 1 68 ? 17.200  10.502  1.321   1.00 0.00 ? 68 SER A C    3  
ATOM 3395  O O    . SER A 1 68 ? 18.180  9.787   1.113   1.00 0.00 ? 68 SER A O    3  
ATOM 3396  C CB   . SER A 1 68 ? 15.040  10.534  0.058   1.00 0.00 ? 68 SER A CB   3  
ATOM 3397  O OG   . SER A 1 68 ? 13.688  10.111  0.036   1.00 0.00 ? 68 SER A OG   3  
ATOM 3398  H H    . SER A 1 68 ? 14.736  11.102  2.669   1.00 0.00 ? 68 SER A H    3  
ATOM 3399  H HA   . SER A 1 68 ? 15.848  8.862   1.123   1.00 0.00 ? 68 SER A HA   3  
ATOM 3400  H HB2  . SER A 1 68 ? 15.067  11.611  0.126   1.00 0.00 ? 68 SER A HB2  3  
ATOM 3401  H HB3  . SER A 1 68 ? 15.519  10.219  -0.858  1.00 0.00 ? 68 SER A HB3  3  
ATOM 3402  H HG   . SER A 1 68 ? 13.141  10.764  0.480   1.00 0.00 ? 68 SER A HG   3  
ATOM 3403  N N    . SER A 1 69 ? 17.297  11.794  1.616   1.00 0.00 ? 69 SER A N    3  
ATOM 3404  C CA   . SER A 1 69 ? 18.589  12.462  1.710   1.00 0.00 ? 69 SER A CA   3  
ATOM 3405  C C    . SER A 1 69 ? 19.364  11.977  2.931   1.00 0.00 ? 69 SER A C    3  
ATOM 3406  O O    . SER A 1 69 ? 18.869  12.031  4.056   1.00 0.00 ? 69 SER A O    3  
ATOM 3407  C CB   . SER A 1 69 ? 18.399  13.979  1.782   1.00 0.00 ? 69 SER A CB   3  
ATOM 3408  O OG   . SER A 1 69 ? 19.637  14.655  1.642   1.00 0.00 ? 69 SER A OG   3  
ATOM 3409  H H    . SER A 1 69 ? 16.478  12.311  1.771   1.00 0.00 ? 69 SER A H    3  
ATOM 3410  H HA   . SER A 1 69 ? 19.153  12.221  0.821   1.00 0.00 ? 69 SER A HA   3  
ATOM 3411  H HB2  . SER A 1 69 ? 17.739  14.294  0.989   1.00 0.00 ? 69 SER A HB2  3  
ATOM 3412  H HB3  . SER A 1 69 ? 17.966  14.239  2.737   1.00 0.00 ? 69 SER A HB3  3  
ATOM 3413  H HG   . SER A 1 69 ? 19.483  15.538  1.300   1.00 0.00 ? 69 SER A HG   3  
ATOM 3414  N N    . GLY A 1 70 ? 20.584  11.501  2.699   1.00 0.00 ? 70 GLY A N    3  
ATOM 3415  C CA   . GLY A 1 70 ? 21.409  11.012  3.789   1.00 0.00 ? 70 GLY A CA   3  
ATOM 3416  C C    . GLY A 1 70 ? 22.660  11.844  3.987   1.00 0.00 ? 70 GLY A C    3  
ATOM 3417  O O    . GLY A 1 70 ? 22.844  12.462  5.036   1.00 0.00 ? 70 GLY A O    3  
ATOM 3418  H H    . GLY A 1 70 ? 20.927  11.482  1.781   1.00 0.00 ? 70 GLY A H    3  
ATOM 3419  H HA2  . GLY A 1 70 ? 20.830  11.029  4.700   1.00 0.00 ? 70 GLY A HA2  3  
ATOM 3420  H HA3  . GLY A 1 70 ? 21.698  9.993   3.577   1.00 0.00 ? 70 GLY A HA3  3  
ATOM 3421  N N    . GLY A 1 1  ? -27.055 -3.367  1.682   1.00 0.00 ? 1  GLY A N    4  
ATOM 3422  C CA   . GLY A 1 1  ? -27.283 -2.384  2.725   1.00 0.00 ? 1  GLY A CA   4  
ATOM 3423  C C    . GLY A 1 1  ? -26.131 -2.302  3.706   1.00 0.00 ? 1  GLY A C    4  
ATOM 3424  O O    . GLY A 1 1  ? -25.345 -1.355  3.674   1.00 0.00 ? 1  GLY A O    4  
ATOM 3425  H H1   . GLY A 1 1  ? -27.141 -3.109  0.740   1.00 0.00 ? 1  GLY A H1   4  
ATOM 3426  H HA2  . GLY A 1 1  ? -27.422 -1.416  2.267   1.00 0.00 ? 1  GLY A HA2  4  
ATOM 3427  H HA3  . GLY A 1 1  ? -28.181 -2.648  3.263   1.00 0.00 ? 1  GLY A HA3  4  
ATOM 3428  N N    . SER A 1 2  ? -26.030 -3.297  4.582   1.00 0.00 ? 2  SER A N    4  
ATOM 3429  C CA   . SER A 1 2  ? -24.968 -3.331  5.581   1.00 0.00 ? 2  SER A CA   4  
ATOM 3430  C C    . SER A 1 2  ? -24.064 -4.542  5.372   1.00 0.00 ? 2  SER A C    4  
ATOM 3431  O O    . SER A 1 2  ? -23.674 -5.211  6.329   1.00 0.00 ? 2  SER A O    4  
ATOM 3432  C CB   . SER A 1 2  ? -25.566 -3.363  6.990   1.00 0.00 ? 2  SER A CB   4  
ATOM 3433  O OG   . SER A 1 2  ? -25.869 -2.056  7.445   1.00 0.00 ? 2  SER A OG   4  
ATOM 3434  H H    . SER A 1 2  ? -26.687 -4.024  4.557   1.00 0.00 ? 2  SER A H    4  
ATOM 3435  H HA   . SER A 1 2  ? -24.379 -2.433  5.470   1.00 0.00 ? 2  SER A HA   4  
ATOM 3436  H HB2  . SER A 1 2  ? -26.473 -3.947  6.980   1.00 0.00 ? 2  SER A HB2  4  
ATOM 3437  H HB3  . SER A 1 2  ? -24.855 -3.813  7.668   1.00 0.00 ? 2  SER A HB3  4  
ATOM 3438  H HG   . SER A 1 2  ? -25.056 -1.552  7.537   1.00 0.00 ? 2  SER A HG   4  
ATOM 3439  N N    . SER A 1 3  ? -23.736 -4.817  4.114   1.00 0.00 ? 3  SER A N    4  
ATOM 3440  C CA   . SER A 1 3  ? -22.881 -5.949  3.777   1.00 0.00 ? 3  SER A CA   4  
ATOM 3441  C C    . SER A 1 3  ? -21.450 -5.489  3.513   1.00 0.00 ? 3  SER A C    4  
ATOM 3442  O O    . SER A 1 3  ? -20.801 -5.951  2.575   1.00 0.00 ? 3  SER A O    4  
ATOM 3443  C CB   . SER A 1 3  ? -23.428 -6.681  2.550   1.00 0.00 ? 3  SER A CB   4  
ATOM 3444  O OG   . SER A 1 3  ? -22.775 -7.925  2.366   1.00 0.00 ? 3  SER A OG   4  
ATOM 3445  H H    . SER A 1 3  ? -24.079 -4.245  3.395   1.00 0.00 ? 3  SER A H    4  
ATOM 3446  H HA   . SER A 1 3  ? -22.880 -6.625  4.619   1.00 0.00 ? 3  SER A HA   4  
ATOM 3447  H HB2  . SER A 1 3  ? -24.484 -6.858  2.682   1.00 0.00 ? 3  SER A HB2  4  
ATOM 3448  H HB3  . SER A 1 3  ? -23.271 -6.072  1.672   1.00 0.00 ? 3  SER A HB3  4  
ATOM 3449  H HG   . SER A 1 3  ? -22.055 -7.820  1.740   1.00 0.00 ? 3  SER A HG   4  
ATOM 3450  N N    . GLY A 1 4  ? -20.964 -4.576  4.349   1.00 0.00 ? 4  GLY A N    4  
ATOM 3451  C CA   . GLY A 1 4  ? -19.614 -4.069  4.190   1.00 0.00 ? 4  GLY A CA   4  
ATOM 3452  C C    . GLY A 1 4  ? -19.260 -3.806  2.740   1.00 0.00 ? 4  GLY A C    4  
ATOM 3453  O O    . GLY A 1 4  ? -20.126 -3.464  1.935   1.00 0.00 ? 4  GLY A O    4  
ATOM 3454  H H    . GLY A 1 4  ? -21.527 -4.245  5.079   1.00 0.00 ? 4  GLY A H    4  
ATOM 3455  H HA2  . GLY A 1 4  ? -19.520 -3.148  4.745   1.00 0.00 ? 4  GLY A HA2  4  
ATOM 3456  H HA3  . GLY A 1 4  ? -18.920 -4.792  4.592   1.00 0.00 ? 4  GLY A HA3  4  
ATOM 3457  N N    . SER A 1 5  ? -17.984 -3.965  2.405   1.00 0.00 ? 5  SER A N    4  
ATOM 3458  C CA   . SER A 1 5  ? -17.516 -3.738  1.043   1.00 0.00 ? 5  SER A CA   4  
ATOM 3459  C C    . SER A 1 5  ? -16.190 -4.451  0.797   1.00 0.00 ? 5  SER A C    4  
ATOM 3460  O O    . SER A 1 5  ? -15.591 -5.006  1.719   1.00 0.00 ? 5  SER A O    4  
ATOM 3461  C CB   . SER A 1 5  ? -17.358 -2.239  0.779   1.00 0.00 ? 5  SER A CB   4  
ATOM 3462  O OG   . SER A 1 5  ? -16.478 -1.646  1.718   1.00 0.00 ? 5  SER A OG   4  
ATOM 3463  H H    . SER A 1 5  ? -17.340 -4.240  3.092   1.00 0.00 ? 5  SER A H    4  
ATOM 3464  H HA   . SER A 1 5  ? -18.257 -4.137  0.367   1.00 0.00 ? 5  SER A HA   4  
ATOM 3465  H HB2  . SER A 1 5  ? -16.960 -2.091  -0.213  1.00 0.00 ? 5  SER A HB2  4  
ATOM 3466  H HB3  . SER A 1 5  ? -18.323 -1.759  0.855   1.00 0.00 ? 5  SER A HB3  4  
ATOM 3467  H HG   . SER A 1 5  ? -15.571 -1.764  1.425   1.00 0.00 ? 5  SER A HG   4  
ATOM 3468  N N    . SER A 1 6  ? -15.738 -4.433  -0.452  1.00 0.00 ? 6  SER A N    4  
ATOM 3469  C CA   . SER A 1 6  ? -14.485 -5.081  -0.822  1.00 0.00 ? 6  SER A CA   4  
ATOM 3470  C C    . SER A 1 6  ? -13.298 -4.159  -0.557  1.00 0.00 ? 6  SER A C    4  
ATOM 3471  O O    . SER A 1 6  ? -12.381 -4.507  0.186   1.00 0.00 ? 6  SER A O    4  
ATOM 3472  C CB   . SER A 1 6  ? -14.511 -5.486  -2.297  1.00 0.00 ? 6  SER A CB   4  
ATOM 3473  O OG   . SER A 1 6  ? -13.218 -5.846  -2.750  1.00 0.00 ? 6  SER A OG   4  
ATOM 3474  H H    . SER A 1 6  ? -16.261 -3.974  -1.143  1.00 0.00 ? 6  SER A H    4  
ATOM 3475  H HA   . SER A 1 6  ? -14.379 -5.968  -0.215  1.00 0.00 ? 6  SER A HA   4  
ATOM 3476  H HB2  . SER A 1 6  ? -15.172 -6.330  -2.423  1.00 0.00 ? 6  SER A HB2  4  
ATOM 3477  H HB3  . SER A 1 6  ? -14.870 -4.656  -2.889  1.00 0.00 ? 6  SER A HB3  4  
ATOM 3478  H HG   . SER A 1 6  ? -13.278 -6.632  -3.298  1.00 0.00 ? 6  SER A HG   4  
ATOM 3479  N N    . GLY A 1 7  ? -13.323 -2.980  -1.172  1.00 0.00 ? 7  GLY A N    4  
ATOM 3480  C CA   . GLY A 1 7  ? -12.245 -2.026  -0.991  1.00 0.00 ? 7  GLY A CA   4  
ATOM 3481  C C    . GLY A 1 7  ? -11.256 -2.044  -2.140  1.00 0.00 ? 7  GLY A C    4  
ATOM 3482  O O    . GLY A 1 7  ? -11.618 -1.771  -3.285  1.00 0.00 ? 7  GLY A O    4  
ATOM 3483  H H    . GLY A 1 7  ? -14.080 -2.757  -1.753  1.00 0.00 ? 7  GLY A H    4  
ATOM 3484  H HA2  . GLY A 1 7  ? -12.666 -1.036  -0.907  1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3485  H HA3  . GLY A 1 7  ? -11.720 -2.262  -0.077  1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3486  N N    . LYS A 1 8  ? -10.004 -2.365  -1.835  1.00 0.00 ? 8  LYS A N    4  
ATOM 3487  C CA   . LYS A 1 8  ? -8.958  -2.418  -2.851  1.00 0.00 ? 8  LYS A CA   4  
ATOM 3488  C C    . LYS A 1 8  ? -9.458  -3.117  -4.111  1.00 0.00 ? 8  LYS A C    4  
ATOM 3489  O O    . LYS A 1 8  ? -10.431 -3.869  -4.070  1.00 0.00 ? 8  LYS A O    4  
ATOM 3490  C CB   . LYS A 1 8  ? -7.726  -3.144  -2.306  1.00 0.00 ? 8  LYS A CB   4  
ATOM 3491  C CG   . LYS A 1 8  ? -6.729  -2.222  -1.625  1.00 0.00 ? 8  LYS A CG   4  
ATOM 3492  C CD   . LYS A 1 8  ? -7.173  -1.862  -0.218  1.00 0.00 ? 8  LYS A CD   4  
ATOM 3493  C CE   . LYS A 1 8  ? -8.069  -0.632  -0.214  1.00 0.00 ? 8  LYS A CE   4  
ATOM 3494  N NZ   . LYS A 1 8  ? -7.279  0.630   -0.184  1.00 0.00 ? 8  LYS A NZ   4  
ATOM 3495  H H    . LYS A 1 8  ? -9.776  -2.573  -0.904  1.00 0.00 ? 8  LYS A H    4  
ATOM 3496  H HA   . LYS A 1 8  ? -8.687  -1.403  -3.100  1.00 0.00 ? 8  LYS A HA   4  
ATOM 3497  H HB2  . LYS A 1 8  ? -8.047  -3.885  -1.589  1.00 0.00 ? 8  LYS A HB2  4  
ATOM 3498  H HB3  . LYS A 1 8  ? -7.225  -3.640  -3.125  1.00 0.00 ? 8  LYS A HB3  4  
ATOM 3499  H HG2  . LYS A 1 8  ? -5.771  -2.719  -1.573  1.00 0.00 ? 8  LYS A HG2  4  
ATOM 3500  H HG3  . LYS A 1 8  ? -6.635  -1.316  -2.207  1.00 0.00 ? 8  LYS A HG3  4  
ATOM 3501  H HD2  . LYS A 1 8  ? -7.720  -2.693  0.202   1.00 0.00 ? 8  LYS A HD2  4  
ATOM 3502  H HD3  . LYS A 1 8  ? -6.299  -1.662  0.386   1.00 0.00 ? 8  LYS A HD3  4  
ATOM 3503  H HE2  . LYS A 1 8  ? -8.678  -0.644  -1.104  1.00 0.00 ? 8  LYS A HE2  4  
ATOM 3504  H HE3  . LYS A 1 8  ? -8.705  -0.670  0.658   1.00 0.00 ? 8  LYS A HE3  4  
ATOM 3505  H HZ1  . LYS A 1 8  ? -7.077  0.947   -1.154  1.00 0.00 ? 8  LYS A HZ1  4  
ATOM 3506  H HZ2  . LYS A 1 8  ? -6.378  0.476   0.312   1.00 0.00 ? 8  LYS A HZ2  4  
ATOM 3507  H HZ3  . LYS A 1 8  ? -7.812  1.374   0.309   1.00 0.00 ? 8  LYS A HZ3  4  
ATOM 3508  N N    . GLY A 1 9  ? -8.784  -2.865  -5.229  1.00 0.00 ? 9  GLY A N    4  
ATOM 3509  C CA   . GLY A 1 9  ? -9.174  -3.480  -6.484  1.00 0.00 ? 9  GLY A CA   4  
ATOM 3510  C C    . GLY A 1 9  ? -8.468  -2.864  -7.676  1.00 0.00 ? 9  GLY A C    4  
ATOM 3511  O O    . GLY A 1 9  ? -8.290  -1.648  -7.741  1.00 0.00 ? 9  GLY A O    4  
ATOM 3512  H H    . GLY A 1 9  ? -8.016  -2.257  -5.201  1.00 0.00 ? 9  GLY A H    4  
ATOM 3513  H HA2  . GLY A 1 9  ? -8.940  -4.533  -6.445  1.00 0.00 ? 9  GLY A HA2  4  
ATOM 3514  H HA3  . GLY A 1 9  ? -10.240 -3.363  -6.613  1.00 0.00 ? 9  GLY A HA3  4  
ATOM 3515  N N    . GLY A 1 10 ? -8.061  -3.706  -8.621  1.00 0.00 ? 10 GLY A N    4  
ATOM 3516  C CA   . GLY A 1 10 ? -7.373  -3.219  -9.802  1.00 0.00 ? 10 GLY A CA   4  
ATOM 3517  C C    . GLY A 1 10 ? -6.233  -4.125  -10.224 1.00 0.00 ? 10 GLY A C    4  
ATOM 3518  O O    . GLY A 1 10 ? -6.446  -5.119  -10.917 1.00 0.00 ? 10 GLY A O    4  
ATOM 3519  H H    . GLY A 1 10 ? -8.230  -4.666  -8.516  1.00 0.00 ? 10 GLY A H    4  
ATOM 3520  H HA2  . GLY A 1 10 ? -8.081  -3.147  -10.614 1.00 0.00 ? 10 GLY A HA2  4  
ATOM 3521  H HA3  . GLY A 1 10 ? -6.978  -2.235  -9.594  1.00 0.00 ? 10 GLY A HA3  4  
ATOM 3522  N N    . GLN A 1 11 ? -5.019  -3.780  -9.806  1.00 0.00 ? 11 GLN A N    4  
ATOM 3523  C CA   . GLN A 1 11 ? -3.842  -4.569  -10.147 1.00 0.00 ? 11 GLN A CA   4  
ATOM 3524  C C    . GLN A 1 11 ? -3.568  -5.626  -9.083  1.00 0.00 ? 11 GLN A C    4  
ATOM 3525  O O    . GLN A 1 11 ? -3.518  -6.820  -9.378  1.00 0.00 ? 11 GLN A O    4  
ATOM 3526  C CB   . GLN A 1 11 ? -2.621  -3.660  -10.306 1.00 0.00 ? 11 GLN A CB   4  
ATOM 3527  C CG   . GLN A 1 11 ? -1.423  -4.354  -10.933 1.00 0.00 ? 11 GLN A CG   4  
ATOM 3528  C CD   . GLN A 1 11 ? -0.337  -3.381  -11.348 1.00 0.00 ? 11 GLN A CD   4  
ATOM 3529  O OE1  . GLN A 1 11 ? -0.509  -2.165  -11.259 1.00 0.00 ? 11 GLN A OE1  4  
ATOM 3530  N NE2  . GLN A 1 11 ? 0.791   -3.913  -11.804 1.00 0.00 ? 11 GLN A NE2  4  
ATOM 3531  H H    . GLN A 1 11 ? -4.914  -2.976  -9.256  1.00 0.00 ? 11 GLN A H    4  
ATOM 3532  H HA   . GLN A 1 11 ? -4.035  -5.063  -11.087 1.00 0.00 ? 11 GLN A HA   4  
ATOM 3533  H HB2  . GLN A 1 11 ? -2.891  -2.820  -10.929 1.00 0.00 ? 11 GLN A HB2  4  
ATOM 3534  H HB3  . GLN A 1 11 ? -2.330  -3.296  -9.331  1.00 0.00 ? 11 GLN A HB3  4  
ATOM 3535  H HG2  . GLN A 1 11 ? -1.009  -5.047  -10.216 1.00 0.00 ? 11 GLN A HG2  4  
ATOM 3536  H HG3  . GLN A 1 11 ? -1.754  -4.896  -11.806 1.00 0.00 ? 11 GLN A HG3  4  
ATOM 3537  H HE21 . GLN A 1 11 ? 0.857   -4.890  -11.848 1.00 0.00 ? 11 GLN A HE21 4  
ATOM 3538  H HE22 . GLN A 1 11 ? 1.510   -3.308  -12.080 1.00 0.00 ? 11 GLN A HE22 4  
ATOM 3539  N N    . VAL A 1 12 ? -3.391  -5.179  -7.843  1.00 0.00 ? 12 VAL A N    4  
ATOM 3540  C CA   . VAL A 1 12 ? -3.122  -6.087  -6.734  1.00 0.00 ? 12 VAL A CA   4  
ATOM 3541  C C    . VAL A 1 12 ? -4.368  -6.884  -6.363  1.00 0.00 ? 12 VAL A C    4  
ATOM 3542  O O    . VAL A 1 12 ? -5.489  -6.386  -6.464  1.00 0.00 ? 12 VAL A O    4  
ATOM 3543  C CB   . VAL A 1 12 ? -2.625  -5.325  -5.492  1.00 0.00 ? 12 VAL A CB   4  
ATOM 3544  C CG1  . VAL A 1 12 ? -2.405  -6.281  -4.330  1.00 0.00 ? 12 VAL A CG1  4  
ATOM 3545  C CG2  . VAL A 1 12 ? -1.349  -4.561  -5.813  1.00 0.00 ? 12 VAL A CG2  4  
ATOM 3546  H H    . VAL A 1 12 ? -3.442  -4.216  -7.670  1.00 0.00 ? 12 VAL A H    4  
ATOM 3547  H HA   . VAL A 1 12 ? -2.347  -6.773  -7.044  1.00 0.00 ? 12 VAL A HA   4  
ATOM 3548  H HB   . VAL A 1 12 ? -3.383  -4.612  -5.205  1.00 0.00 ? 12 VAL A HB   4  
ATOM 3549  H HG11 . VAL A 1 12 ? -3.348  -6.728  -4.050  1.00 0.00 ? 12 VAL A HG11 4  
ATOM 3550  H HG12 . VAL A 1 12 ? -1.712  -7.055  -4.627  1.00 0.00 ? 12 VAL A HG12 4  
ATOM 3551  H HG13 . VAL A 1 12 ? -2.001  -5.738  -3.489  1.00 0.00 ? 12 VAL A HG13 4  
ATOM 3552  H HG21 . VAL A 1 12 ? -0.923  -4.941  -6.729  1.00 0.00 ? 12 VAL A HG21 4  
ATOM 3553  H HG22 . VAL A 1 12 ? -1.577  -3.511  -5.930  1.00 0.00 ? 12 VAL A HG22 4  
ATOM 3554  H HG23 . VAL A 1 12 ? -0.641  -4.687  -5.007  1.00 0.00 ? 12 VAL A HG23 4  
ATOM 3555  N N    . ARG A 1 13 ? -4.163  -8.124  -5.932  1.00 0.00 ? 13 ARG A N    4  
ATOM 3556  C CA   . ARG A 1 13 ? -5.270  -8.991  -5.545  1.00 0.00 ? 13 ARG A CA   4  
ATOM 3557  C C    . ARG A 1 13 ? -5.015  -9.623  -4.180  1.00 0.00 ? 13 ARG A C    4  
ATOM 3558  O O    . ARG A 1 13 ? -4.098  -10.428 -4.018  1.00 0.00 ? 13 ARG A O    4  
ATOM 3559  C CB   . ARG A 1 13 ? -5.479  -10.085 -6.594  1.00 0.00 ? 13 ARG A CB   4  
ATOM 3560  C CG   . ARG A 1 13 ? -4.194  -10.537 -7.268  1.00 0.00 ? 13 ARG A CG   4  
ATOM 3561  C CD   . ARG A 1 13 ? -4.394  -11.834 -8.037  1.00 0.00 ? 13 ARG A CD   4  
ATOM 3562  N NE   . ARG A 1 13 ? -5.168  -11.631 -9.259  1.00 0.00 ? 13 ARG A NE   4  
ATOM 3563  C CZ   . ARG A 1 13 ? -5.842  -12.599 -9.870  1.00 0.00 ? 13 ARG A CZ   4  
ATOM 3564  N NH1  . ARG A 1 13 ? -5.838  -13.829 -9.376  1.00 0.00 ? 13 ARG A NH1  4  
ATOM 3565  N NH2  . ARG A 1 13 ? -6.523  -12.336 -10.978 1.00 0.00 ? 13 ARG A NH2  4  
ATOM 3566  H H    . ARG A 1 13 ? -3.246  -8.465  -5.873  1.00 0.00 ? 13 ARG A H    4  
ATOM 3567  H HA   . ARG A 1 13 ? -6.162  -8.385  -5.487  1.00 0.00 ? 13 ARG A HA   4  
ATOM 3568  H HB2  . ARG A 1 13 ? -5.931  -10.943 -6.118  1.00 0.00 ? 13 ARG A HB2  4  
ATOM 3569  H HB3  . ARG A 1 13 ? -6.148  -9.713  -7.356  1.00 0.00 ? 13 ARG A HB3  4  
ATOM 3570  H HG2  . ARG A 1 13 ? -3.870  -9.770  -7.955  1.00 0.00 ? 13 ARG A HG2  4  
ATOM 3571  H HG3  . ARG A 1 13 ? -3.438  -10.690 -6.512  1.00 0.00 ? 13 ARG A HG3  4  
ATOM 3572  H HD2  . ARG A 1 13 ? -3.426  -12.235 -8.297  1.00 0.00 ? 13 ARG A HD2  4  
ATOM 3573  H HD3  . ARG A 1 13 ? -4.916  -12.535 -7.403  1.00 0.00 ? 13 ARG A HD3  4  
ATOM 3574  H HE   . ARG A 1 13 ? -5.185  -10.730 -9.641  1.00 0.00 ? 13 ARG A HE   4  
ATOM 3575  H HH11 . ARG A 1 13 ? -5.327  -14.029 -8.540  1.00 0.00 ? 13 ARG A HH11 4  
ATOM 3576  H HH12 . ARG A 1 13 ? -6.348  -14.555 -9.838  1.00 0.00 ? 13 ARG A HH12 4  
ATOM 3577  H HH21 . ARG A 1 13 ? -6.529  -11.410 -11.354 1.00 0.00 ? 13 ARG A HH21 4  
ATOM 3578  H HH22 . ARG A 1 13 ? -7.030  -13.065 -11.438 1.00 0.00 ? 13 ARG A HH22 4  
ATOM 3579  N N    . PHE A 1 14 ? -5.832  -9.251  -3.200  1.00 0.00 ? 14 PHE A N    4  
ATOM 3580  C CA   . PHE A 1 14 ? -5.694  -9.780  -1.848  1.00 0.00 ? 14 PHE A CA   4  
ATOM 3581  C C    . PHE A 1 14 ? -6.966  -9.543  -1.039  1.00 0.00 ? 14 PHE A C    4  
ATOM 3582  O O    . PHE A 1 14 ? -7.718  -8.606  -1.305  1.00 0.00 ? 14 PHE A O    4  
ATOM 3583  C CB   . PHE A 1 14 ? -4.500  -9.133  -1.144  1.00 0.00 ? 14 PHE A CB   4  
ATOM 3584  C CG   . PHE A 1 14 ? -3.171  -9.633  -1.634  1.00 0.00 ? 14 PHE A CG   4  
ATOM 3585  C CD1  . PHE A 1 14 ? -2.811  -10.961 -1.466  1.00 0.00 ? 14 PHE A CD1  4  
ATOM 3586  C CD2  . PHE A 1 14 ? -2.283  -8.776  -2.264  1.00 0.00 ? 14 PHE A CD2  4  
ATOM 3587  C CE1  . PHE A 1 14 ? -1.589  -11.423 -1.916  1.00 0.00 ? 14 PHE A CE1  4  
ATOM 3588  C CE2  . PHE A 1 14 ? -1.059  -9.234  -2.716  1.00 0.00 ? 14 PHE A CE2  4  
ATOM 3589  C CZ   . PHE A 1 14 ? -0.713  -10.559 -2.543  1.00 0.00 ? 14 PHE A CZ   4  
ATOM 3590  H H    . PHE A 1 14 ? -6.545  -8.606  -3.391  1.00 0.00 ? 14 PHE A H    4  
ATOM 3591  H HA   . PHE A 1 14 ? -5.523  -10.843 -1.924  1.00 0.00 ? 14 PHE A HA   4  
ATOM 3592  H HB2  . PHE A 1 14 ? -4.532  -8.066  -1.304  1.00 0.00 ? 14 PHE A HB2  4  
ATOM 3593  H HB3  . PHE A 1 14 ? -4.562  -9.336  -0.085  1.00 0.00 ? 14 PHE A HB3  4  
ATOM 3594  H HD1  . PHE A 1 14 ? -3.496  -11.638 -0.978  1.00 0.00 ? 14 PHE A HD1  4  
ATOM 3595  H HD2  . PHE A 1 14 ? -2.554  -7.739  -2.400  1.00 0.00 ? 14 PHE A HD2  4  
ATOM 3596  H HE1  . PHE A 1 14 ? -1.321  -12.460 -1.780  1.00 0.00 ? 14 PHE A HE1  4  
ATOM 3597  H HE2  . PHE A 1 14 ? -0.377  -8.555  -3.205  1.00 0.00 ? 14 PHE A HE2  4  
ATOM 3598  H HZ   . PHE A 1 14 ? 0.243   -10.918 -2.894  1.00 0.00 ? 14 PHE A HZ   4  
ATOM 3599  N N    . SER A 1 15 ? -7.199  -10.400 -0.050  1.00 0.00 ? 15 SER A N    4  
ATOM 3600  C CA   . SER A 1 15 ? -8.382  -10.287 0.796   1.00 0.00 ? 15 SER A CA   4  
ATOM 3601  C C    . SER A 1 15 ? -8.176  -9.232  1.880   1.00 0.00 ? 15 SER A C    4  
ATOM 3602  O O    . SER A 1 15 ? -7.045  -8.920  2.250   1.00 0.00 ? 15 SER A O    4  
ATOM 3603  C CB   . SER A 1 15 ? -8.706  -11.637 1.438   1.00 0.00 ? 15 SER A CB   4  
ATOM 3604  O OG   . SER A 1 15 ? -9.775  -11.520 2.361   1.00 0.00 ? 15 SER A OG   4  
ATOM 3605  H H    . SER A 1 15 ? -6.562  -11.126 0.113   1.00 0.00 ? 15 SER A H    4  
ATOM 3606  H HA   . SER A 1 15 ? -9.209  -9.987  0.171   1.00 0.00 ? 15 SER A HA   4  
ATOM 3607  H HB2  . SER A 1 15 ? -8.987  -12.340 0.669   1.00 0.00 ? 15 SER A HB2  4  
ATOM 3608  H HB3  . SER A 1 15 ? -7.834  -12.003 1.960   1.00 0.00 ? 15 SER A HB3  4  
ATOM 3609  H HG   . SER A 1 15 ? -9.692  -12.197 3.035   1.00 0.00 ? 15 SER A HG   4  
ATOM 3610  N N    . ASN A 1 16 ? -9.279  -8.688  2.383   1.00 0.00 ? 16 ASN A N    4  
ATOM 3611  C CA   . ASN A 1 16 ? -9.221  -7.668  3.424   1.00 0.00 ? 16 ASN A CA   4  
ATOM 3612  C C    . ASN A 1 16 ? -8.235  -8.063  4.519   1.00 0.00 ? 16 ASN A C    4  
ATOM 3613  O O    . ASN A 1 16 ? -7.265  -7.353  4.781   1.00 0.00 ? 16 ASN A O    4  
ATOM 3614  C CB   . ASN A 1 16 ? -10.609 -7.446  4.027   1.00 0.00 ? 16 ASN A CB   4  
ATOM 3615  C CG   . ASN A 1 16 ? -11.271 -8.744  4.449   1.00 0.00 ? 16 ASN A CG   4  
ATOM 3616  O OD1  . ASN A 1 16 ? -11.049 -9.792  3.843   1.00 0.00 ? 16 ASN A OD1  4  
ATOM 3617  N ND2  . ASN A 1 16 ? -12.089 -8.679  5.493   1.00 0.00 ? 16 ASN A ND2  4  
ATOM 3618  H H    . ASN A 1 16 ? -10.152 -8.978  2.047   1.00 0.00 ? 16 ASN A H    4  
ATOM 3619  H HA   . ASN A 1 16 ? -8.885  -6.748  2.968   1.00 0.00 ? 16 ASN A HA   4  
ATOM 3620  H HB2  . ASN A 1 16 ? -10.520 -6.811  4.897   1.00 0.00 ? 16 ASN A HB2  4  
ATOM 3621  H HB3  . ASN A 1 16 ? -11.240 -6.962  3.297   1.00 0.00 ? 16 ASN A HB3  4  
ATOM 3622  H HD21 . ASN A 1 16 ? -12.218 -7.809  5.927   1.00 0.00 ? 16 ASN A HD21 4  
ATOM 3623  H HD22 . ASN A 1 16 ? -12.529 -9.503  5.787   1.00 0.00 ? 16 ASN A HD22 4  
ATOM 3624  N N    . ASP A 1 17 ? -8.492  -9.201  5.155   1.00 0.00 ? 17 ASP A N    4  
ATOM 3625  C CA   . ASP A 1 17 ? -7.627  -9.693  6.221   1.00 0.00 ? 17 ASP A CA   4  
ATOM 3626  C C    . ASP A 1 17 ? -6.201  -9.889  5.717   1.00 0.00 ? 17 ASP A C    4  
ATOM 3627  O O    . ASP A 1 17 ? -5.243  -9.436  6.343   1.00 0.00 ? 17 ASP A O    4  
ATOM 3628  C CB   . ASP A 1 17 ? -8.169  -11.009 6.780   1.00 0.00 ? 17 ASP A CB   4  
ATOM 3629  C CG   . ASP A 1 17 ? -9.647  -10.934 7.108   1.00 0.00 ? 17 ASP A CG   4  
ATOM 3630  O OD1  . ASP A 1 17 ? -10.019 -10.135 7.994   1.00 0.00 ? 17 ASP A OD1  4  
ATOM 3631  O OD2  . ASP A 1 17 ? -10.433 -11.673 6.479   1.00 0.00 ? 17 ASP A OD2  4  
ATOM 3632  H H    . ASP A 1 17 ? -9.282  -9.723  4.901   1.00 0.00 ? 17 ASP A H    4  
ATOM 3633  H HA   . ASP A 1 17 ? -7.618  -8.955  7.008   1.00 0.00 ? 17 ASP A HA   4  
ATOM 3634  H HB2  . ASP A 1 17 ? -8.021  -11.792 6.050   1.00 0.00 ? 17 ASP A HB2  4  
ATOM 3635  H HB3  . ASP A 1 17 ? -7.630  -11.259 7.683   1.00 0.00 ? 17 ASP A HB3  4  
ATOM 3636  N N    . GLN A 1 18 ? -6.068  -10.568 4.582   1.00 0.00 ? 18 GLN A N    4  
ATOM 3637  C CA   . GLN A 1 18 ? -4.758  -10.826 3.995   1.00 0.00 ? 18 GLN A CA   4  
ATOM 3638  C C    . GLN A 1 18 ? -3.930  -9.547  3.929   1.00 0.00 ? 18 GLN A C    4  
ATOM 3639  O O    . GLN A 1 18 ? -2.796  -9.503  4.407   1.00 0.00 ? 18 GLN A O    4  
ATOM 3640  C CB   . GLN A 1 18 ? -4.912  -11.421 2.594   1.00 0.00 ? 18 GLN A CB   4  
ATOM 3641  C CG   . GLN A 1 18 ? -5.023  -12.937 2.586   1.00 0.00 ? 18 GLN A CG   4  
ATOM 3642  C CD   . GLN A 1 18 ? -5.486  -13.481 1.249   1.00 0.00 ? 18 GLN A CD   4  
ATOM 3643  O OE1  . GLN A 1 18 ? -5.592  -12.744 0.269   1.00 0.00 ? 18 GLN A OE1  4  
ATOM 3644  N NE2  . GLN A 1 18 ? -5.763  -14.779 1.202   1.00 0.00 ? 18 GLN A NE2  4  
ATOM 3645  H H    . GLN A 1 18 ? -6.869  -10.904 4.129   1.00 0.00 ? 18 GLN A H    4  
ATOM 3646  H HA   . GLN A 1 18 ? -4.247  -11.538 4.625   1.00 0.00 ? 18 GLN A HA   4  
ATOM 3647  H HB2  . GLN A 1 18 ? -5.801  -11.014 2.138   1.00 0.00 ? 18 GLN A HB2  4  
ATOM 3648  H HB3  . GLN A 1 18 ? -4.053  -11.142 2.002   1.00 0.00 ? 18 GLN A HB3  4  
ATOM 3649  H HG2  . GLN A 1 18 ? -4.055  -13.358 2.813   1.00 0.00 ? 18 GLN A HG2  4  
ATOM 3650  H HG3  . GLN A 1 18 ? -5.731  -13.237 3.345   1.00 0.00 ? 18 GLN A HG3  4  
ATOM 3651  H HE21 . GLN A 1 18 ? -5.656  -15.305 2.023   1.00 0.00 ? 18 GLN A HE21 4  
ATOM 3652  H HE22 . GLN A 1 18 ? -6.064  -15.157 0.350   1.00 0.00 ? 18 GLN A HE22 4  
ATOM 3653  N N    . THR A 1 19 ? -4.504  -8.506  3.333   1.00 0.00 ? 19 THR A N    4  
ATOM 3654  C CA   . THR A 1 19 ? -3.819  -7.226  3.202   1.00 0.00 ? 19 THR A CA   4  
ATOM 3655  C C    . THR A 1 19 ? -3.442  -6.663  4.568   1.00 0.00 ? 19 THR A C    4  
ATOM 3656  O O    . THR A 1 19 ? -2.369  -6.083  4.735   1.00 0.00 ? 19 THR A O    4  
ATOM 3657  C CB   . THR A 1 19 ? -4.689  -6.197  2.457   1.00 0.00 ? 19 THR A CB   4  
ATOM 3658  O OG1  . THR A 1 19 ? -5.186  -6.764  1.240   1.00 0.00 ? 19 THR A OG1  4  
ATOM 3659  C CG2  . THR A 1 19 ? -3.893  -4.938  2.149   1.00 0.00 ? 19 THR A CG2  4  
ATOM 3660  H H    . THR A 1 19 ? -5.410  -8.604  2.972   1.00 0.00 ? 19 THR A H    4  
ATOM 3661  H HA   . THR A 1 19 ? -2.918  -7.387  2.629   1.00 0.00 ? 19 THR A HA   4  
ATOM 3662  H HB   . THR A 1 19 ? -5.525  -5.931  3.088   1.00 0.00 ? 19 THR A HB   4  
ATOM 3663  H HG1  . THR A 1 19 ? -5.499  -6.063  0.664   1.00 0.00 ? 19 THR A HG1  4  
ATOM 3664  H HG21 . THR A 1 19 ? -2.841  -5.133  2.293   1.00 0.00 ? 19 THR A HG21 4  
ATOM 3665  H HG22 . THR A 1 19 ? -4.207  -4.143  2.809   1.00 0.00 ? 19 THR A HG22 4  
ATOM 3666  H HG23 . THR A 1 19 ? -4.067  -4.645  1.124   1.00 0.00 ? 19 THR A HG23 4  
ATOM 3667  N N    . ILE A 1 20 ? -4.330  -6.838  5.541   1.00 0.00 ? 20 ILE A N    4  
ATOM 3668  C CA   . ILE A 1 20 ? -4.089  -6.348  6.892   1.00 0.00 ? 20 ILE A CA   4  
ATOM 3669  C C    . ILE A 1 20 ? -2.806  -6.938  7.469   1.00 0.00 ? 20 ILE A C    4  
ATOM 3670  O O    . ILE A 1 20 ? -1.874  -6.209  7.807   1.00 0.00 ? 20 ILE A O    4  
ATOM 3671  C CB   . ILE A 1 20 ? -5.263  -6.684  7.831   1.00 0.00 ? 20 ILE A CB   4  
ATOM 3672  C CG1  . ILE A 1 20 ? -6.501  -5.872  7.444   1.00 0.00 ? 20 ILE A CG1  4  
ATOM 3673  C CG2  . ILE A 1 20 ? -4.877  -6.416  9.278   1.00 0.00 ? 20 ILE A CG2  4  
ATOM 3674  C CD1  . ILE A 1 20 ? -7.762  -6.323  8.147   1.00 0.00 ? 20 ILE A CD1  4  
ATOM 3675  H H    . ILE A 1 20 ? -5.167  -7.308  5.345   1.00 0.00 ? 20 ILE A H    4  
ATOM 3676  H HA   . ILE A 1 20 ? -3.988  -5.274  6.844   1.00 0.00 ? 20 ILE A HA   4  
ATOM 3677  H HB   . ILE A 1 20 ? -5.485  -7.735  7.731   1.00 0.00 ? 20 ILE A HB   4  
ATOM 3678  H HG12 . ILE A 1 20 ? -6.336  -4.836  7.692   1.00 0.00 ? 20 ILE A HG12 4  
ATOM 3679  H HG13 . ILE A 1 20 ? -6.663  -5.962  6.380   1.00 0.00 ? 20 ILE A HG13 4  
ATOM 3680  H HG21 . ILE A 1 20 ? -5.768  -6.224  9.858   1.00 0.00 ? 20 ILE A HG21 4  
ATOM 3681  H HG22 . ILE A 1 20 ? -4.365  -7.277  9.679   1.00 0.00 ? 20 ILE A HG22 4  
ATOM 3682  H HG23 . ILE A 1 20 ? -4.226  -5.556  9.324   1.00 0.00 ? 20 ILE A HG23 4  
ATOM 3683  H HD11 . ILE A 1 20 ? -7.711  -7.386  8.333   1.00 0.00 ? 20 ILE A HD11 4  
ATOM 3684  H HD12 . ILE A 1 20 ? -7.861  -5.797  9.084   1.00 0.00 ? 20 ILE A HD12 4  
ATOM 3685  H HD13 . ILE A 1 20 ? -8.618  -6.109  7.523   1.00 0.00 ? 20 ILE A HD13 4  
ATOM 3686  N N    . GLU A 1 21 ? -2.767  -8.262  7.578   1.00 0.00 ? 21 GLU A N    4  
ATOM 3687  C CA   . GLU A 1 21 ? -1.598  -8.950  8.113   1.00 0.00 ? 21 GLU A CA   4  
ATOM 3688  C C    . GLU A 1 21 ? -0.368  -8.685  7.250   1.00 0.00 ? 21 GLU A C    4  
ATOM 3689  O O    . GLU A 1 21 ? 0.650   -8.189  7.735   1.00 0.00 ? 21 GLU A O    4  
ATOM 3690  C CB   . GLU A 1 21 ? -1.858  -10.455 8.200   1.00 0.00 ? 21 GLU A CB   4  
ATOM 3691  C CG   . GLU A 1 21 ? -2.862  -10.837 9.275   1.00 0.00 ? 21 GLU A CG   4  
ATOM 3692  C CD   . GLU A 1 21 ? -4.295  -10.768 8.787   1.00 0.00 ? 21 GLU A CD   4  
ATOM 3693  O OE1  . GLU A 1 21 ? -4.657  -11.560 7.892   1.00 0.00 ? 21 GLU A OE1  4  
ATOM 3694  O OE2  . GLU A 1 21 ? -5.056  -9.921  9.301   1.00 0.00 ? 21 GLU A OE2  4  
ATOM 3695  H H    . GLU A 1 21 ? -3.542  -8.789  7.291   1.00 0.00 ? 21 GLU A H    4  
ATOM 3696  H HA   . GLU A 1 21 ? -1.414  -8.568  9.106   1.00 0.00 ? 21 GLU A HA   4  
ATOM 3697  H HB2  . GLU A 1 21 ? -2.234  -10.799 7.247   1.00 0.00 ? 21 GLU A HB2  4  
ATOM 3698  H HB3  . GLU A 1 21 ? -0.926  -10.957 8.412   1.00 0.00 ? 21 GLU A HB3  4  
ATOM 3699  H HG2  . GLU A 1 21 ? -2.656  -11.847 9.599   1.00 0.00 ? 21 GLU A HG2  4  
ATOM 3700  H HG3  . GLU A 1 21 ? -2.749  -10.163 10.112  1.00 0.00 ? 21 GLU A HG3  4  
ATOM 3701  N N    . LEU A 1 22 ? -0.469  -9.019  5.968   1.00 0.00 ? 22 LEU A N    4  
ATOM 3702  C CA   . LEU A 1 22 ? 0.635   -8.818  5.036   1.00 0.00 ? 22 LEU A CA   4  
ATOM 3703  C C    . LEU A 1 22 ? 1.371   -7.516  5.335   1.00 0.00 ? 22 LEU A C    4  
ATOM 3704  O O    . LEU A 1 22 ? 2.578   -7.412  5.123   1.00 0.00 ? 22 LEU A O    4  
ATOM 3705  C CB   . LEU A 1 22 ? 0.117   -8.806  3.596   1.00 0.00 ? 22 LEU A CB   4  
ATOM 3706  C CG   . LEU A 1 22 ? -0.133  -10.174 2.961   1.00 0.00 ? 22 LEU A CG   4  
ATOM 3707  C CD1  . LEU A 1 22 ? -0.887  -10.023 1.649   1.00 0.00 ? 22 LEU A CD1  4  
ATOM 3708  C CD2  . LEU A 1 22 ? 1.181   -10.908 2.741   1.00 0.00 ? 22 LEU A CD2  4  
ATOM 3709  H H    . LEU A 1 22 ? -1.305  -9.410  5.640   1.00 0.00 ? 22 LEU A H    4  
ATOM 3710  H HA   . LEU A 1 22 ? 1.323   -9.642  5.154   1.00 0.00 ? 22 LEU A HA   4  
ATOM 3711  H HB2  . LEU A 1 22 ? -0.815  -8.261  3.585   1.00 0.00 ? 22 LEU A HB2  4  
ATOM 3712  H HB3  . LEU A 1 22 ? 0.843   -8.285  2.989   1.00 0.00 ? 22 LEU A HB3  4  
ATOM 3713  H HG   . LEU A 1 22 ? -0.742  -10.768 3.628   1.00 0.00 ? 22 LEU A HG   4  
ATOM 3714  H HD11 . LEU A 1 22 ? -0.388  -10.592 0.879   1.00 0.00 ? 22 LEU A HD11 4  
ATOM 3715  H HD12 . LEU A 1 22 ? -0.913  -8.981  1.366   1.00 0.00 ? 22 LEU A HD12 4  
ATOM 3716  H HD13 . LEU A 1 22 ? -1.896  -10.388 1.769   1.00 0.00 ? 22 LEU A HD13 4  
ATOM 3717  H HD21 . LEU A 1 22 ? 1.426   -10.901 1.689   1.00 0.00 ? 22 LEU A HD21 4  
ATOM 3718  H HD22 . LEU A 1 22 ? 1.085   -11.929 3.082   1.00 0.00 ? 22 LEU A HD22 4  
ATOM 3719  H HD23 . LEU A 1 22 ? 1.966   -10.415 3.296   1.00 0.00 ? 22 LEU A HD23 4  
ATOM 3720  N N    . GLU A 1 23 ? 0.634   -6.527  5.830   1.00 0.00 ? 23 GLU A N    4  
ATOM 3721  C CA   . GLU A 1 23 ? 1.218   -5.232  6.160   1.00 0.00 ? 23 GLU A CA   4  
ATOM 3722  C C    . GLU A 1 23 ? 1.852   -5.258  7.548   1.00 0.00 ? 23 GLU A C    4  
ATOM 3723  O O    . GLU A 1 23 ? 3.054   -5.040  7.699   1.00 0.00 ? 23 GLU A O    4  
ATOM 3724  C CB   . GLU A 1 23 ? 0.153   -4.135  6.094   1.00 0.00 ? 23 GLU A CB   4  
ATOM 3725  C CG   . GLU A 1 23 ? -0.257  -3.769  4.677   1.00 0.00 ? 23 GLU A CG   4  
ATOM 3726  C CD   . GLU A 1 23 ? 0.589   -2.654  4.095   1.00 0.00 ? 23 GLU A CD   4  
ATOM 3727  O OE1  . GLU A 1 23 ? 1.619   -2.308  4.712   1.00 0.00 ? 23 GLU A OE1  4  
ATOM 3728  O OE2  . GLU A 1 23 ? 0.223   -2.129  3.023   1.00 0.00 ? 23 GLU A OE2  4  
ATOM 3729  H H    . GLU A 1 23 ? -0.324  -6.671  5.977   1.00 0.00 ? 23 GLU A H    4  
ATOM 3730  H HA   . GLU A 1 23 ? 1.986   -5.019  5.431   1.00 0.00 ? 23 GLU A HA   4  
ATOM 3731  H HB2  . GLU A 1 23 ? -0.725  -4.471  6.626   1.00 0.00 ? 23 GLU A HB2  4  
ATOM 3732  H HB3  . GLU A 1 23 ? 0.537   -3.248  6.576   1.00 0.00 ? 23 GLU A HB3  4  
ATOM 3733  H HG2  . GLU A 1 23 ? -0.156  -4.642  4.050   1.00 0.00 ? 23 GLU A HG2  4  
ATOM 3734  H HG3  . GLU A 1 23 ? -1.289  -3.451  4.686   1.00 0.00 ? 23 GLU A HG3  4  
ATOM 3735  N N    . LYS A 1 24 ? 1.033   -5.526  8.560   1.00 0.00 ? 24 LYS A N    4  
ATOM 3736  C CA   . LYS A 1 24 ? 1.511   -5.582  9.936   1.00 0.00 ? 24 LYS A CA   4  
ATOM 3737  C C    . LYS A 1 24 ? 2.829   -6.345  10.024  1.00 0.00 ? 24 LYS A C    4  
ATOM 3738  O O    . LYS A 1 24 ? 3.601   -6.165  10.966  1.00 0.00 ? 24 LYS A O    4  
ATOM 3739  C CB   . LYS A 1 24 ? 0.464   -6.244  10.835  1.00 0.00 ? 24 LYS A CB   4  
ATOM 3740  C CG   . LYS A 1 24 ? -0.878  -5.534  10.830  1.00 0.00 ? 24 LYS A CG   4  
ATOM 3741  C CD   . LYS A 1 24 ? -2.009  -6.477  11.204  1.00 0.00 ? 24 LYS A CD   4  
ATOM 3742  C CE   . LYS A 1 24 ? -2.017  -6.775  12.696  1.00 0.00 ? 24 LYS A CE   4  
ATOM 3743  N NZ   . LYS A 1 24 ? -2.615  -5.660  13.481  1.00 0.00 ? 24 LYS A NZ   4  
ATOM 3744  H H    . LYS A 1 24 ? 0.084   -5.691  8.376   1.00 0.00 ? 24 LYS A H    4  
ATOM 3745  H HA   . LYS A 1 24 ? 1.673   -4.569  10.273  1.00 0.00 ? 24 LYS A HA   4  
ATOM 3746  H HB2  . LYS A 1 24 ? 0.312   -7.260  10.501  1.00 0.00 ? 24 LYS A HB2  4  
ATOM 3747  H HB3  . LYS A 1 24 ? 0.836   -6.260  11.849  1.00 0.00 ? 24 LYS A HB3  4  
ATOM 3748  H HG2  . LYS A 1 24 ? -0.849  -4.724  11.544  1.00 0.00 ? 24 LYS A HG2  4  
ATOM 3749  H HG3  . LYS A 1 24 ? -1.063  -5.139  9.842   1.00 0.00 ? 24 LYS A HG3  4  
ATOM 3750  H HD2  . LYS A 1 24 ? -2.951  -6.022  10.935  1.00 0.00 ? 24 LYS A HD2  4  
ATOM 3751  H HD3  . LYS A 1 24 ? -1.888  -7.404  10.661  1.00 0.00 ? 24 LYS A HD3  4  
ATOM 3752  H HE2  . LYS A 1 24 ? -2.590  -7.673  12.867  1.00 0.00 ? 24 LYS A HE2  4  
ATOM 3753  H HE3  . LYS A 1 24 ? -0.999  -6.930  13.023  1.00 0.00 ? 24 LYS A HE3  4  
ATOM 3754  H HZ1  . LYS A 1 24 ? -3.607  -5.519  13.201  1.00 0.00 ? 24 LYS A HZ1  4  
ATOM 3755  H HZ2  . LYS A 1 24 ? -2.089  -4.780  13.309  1.00 0.00 ? 24 LYS A HZ2  4  
ATOM 3756  H HZ3  . LYS A 1 24 ? -2.580  -5.880  14.497  1.00 0.00 ? 24 LYS A HZ3  4  
ATOM 3757  N N    . LYS A 1 25 ? 3.080   -7.198  9.037   1.00 0.00 ? 25 LYS A N    4  
ATOM 3758  C CA   . LYS A 1 25 ? 4.306   -7.987  9.000   1.00 0.00 ? 25 LYS A CA   4  
ATOM 3759  C C    . LYS A 1 25 ? 5.459   -7.175  8.421   1.00 0.00 ? 25 LYS A C    4  
ATOM 3760  O O    . LYS A 1 25 ? 6.500   -7.014  9.058   1.00 0.00 ? 25 LYS A O    4  
ATOM 3761  C CB   . LYS A 1 25 ? 4.094   -9.256  8.171   1.00 0.00 ? 25 LYS A CB   4  
ATOM 3762  C CG   . LYS A 1 25 ? 5.222   -10.265 8.305   1.00 0.00 ? 25 LYS A CG   4  
ATOM 3763  C CD   . LYS A 1 25 ? 5.319   -10.809 9.720   1.00 0.00 ? 25 LYS A CD   4  
ATOM 3764  C CE   . LYS A 1 25 ? 6.141   -12.088 9.770   1.00 0.00 ? 25 LYS A CE   4  
ATOM 3765  N NZ   . LYS A 1 25 ? 5.864   -12.877 11.002  1.00 0.00 ? 25 LYS A NZ   4  
ATOM 3766  H H    . LYS A 1 25 ? 2.426   -7.298  8.313   1.00 0.00 ? 25 LYS A H    4  
ATOM 3767  H HA   . LYS A 1 25 ? 4.551   -8.266  10.014  1.00 0.00 ? 25 LYS A HA   4  
ATOM 3768  H HB2  . LYS A 1 25 ? 3.177   -9.730  8.487   1.00 0.00 ? 25 LYS A HB2  4  
ATOM 3769  H HB3  . LYS A 1 25 ? 4.007   -8.981  7.130   1.00 0.00 ? 25 LYS A HB3  4  
ATOM 3770  H HG2  . LYS A 1 25 ? 5.042   -11.085 7.626   1.00 0.00 ? 25 LYS A HG2  4  
ATOM 3771  H HG3  . LYS A 1 25 ? 6.156   -9.783  8.049   1.00 0.00 ? 25 LYS A HG3  4  
ATOM 3772  H HD2  . LYS A 1 25 ? 5.789   -10.069 10.350  1.00 0.00 ? 25 LYS A HD2  4  
ATOM 3773  H HD3  . LYS A 1 25 ? 4.323   -11.016 10.085  1.00 0.00 ? 25 LYS A HD3  4  
ATOM 3774  H HE2  . LYS A 1 25 ? 5.900   -12.689 8.907   1.00 0.00 ? 25 LYS A HE2  4  
ATOM 3775  H HE3  . LYS A 1 25 ? 7.189   -11.828 9.747   1.00 0.00 ? 25 LYS A HE3  4  
ATOM 3776  H HZ1  . LYS A 1 25 ? 6.693   -12.862 11.630  1.00 0.00 ? 25 LYS A HZ1  4  
ATOM 3777  H HZ2  . LYS A 1 25 ? 5.650   -13.864 10.754  1.00 0.00 ? 25 LYS A HZ2  4  
ATOM 3778  H HZ3  . LYS A 1 25 ? 5.050   -12.474 11.510  1.00 0.00 ? 25 LYS A HZ3  4  
ATOM 3779  N N    . PHE A 1 26 ? 5.267   -6.664  7.209   1.00 0.00 ? 26 PHE A N    4  
ATOM 3780  C CA   . PHE A 1 26 ? 6.292   -5.867  6.544   1.00 0.00 ? 26 PHE A CA   4  
ATOM 3781  C C    . PHE A 1 26 ? 6.852   -4.806  7.486   1.00 0.00 ? 26 PHE A C    4  
ATOM 3782  O O    . PHE A 1 26 ? 8.064   -4.607  7.563   1.00 0.00 ? 26 PHE A O    4  
ATOM 3783  C CB   . PHE A 1 26 ? 5.717   -5.202  5.291   1.00 0.00 ? 26 PHE A CB   4  
ATOM 3784  C CG   . PHE A 1 26 ? 6.551   -4.061  4.783   1.00 0.00 ? 26 PHE A CG   4  
ATOM 3785  C CD1  . PHE A 1 26 ? 6.489   -2.816  5.388   1.00 0.00 ? 26 PHE A CD1  4  
ATOM 3786  C CD2  . PHE A 1 26 ? 7.398   -4.233  3.700   1.00 0.00 ? 26 PHE A CD2  4  
ATOM 3787  C CE1  . PHE A 1 26 ? 7.254   -1.765  4.922   1.00 0.00 ? 26 PHE A CE1  4  
ATOM 3788  C CE2  . PHE A 1 26 ? 8.167   -3.185  3.229   1.00 0.00 ? 26 PHE A CE2  4  
ATOM 3789  C CZ   . PHE A 1 26 ? 8.095   -1.950  3.842   1.00 0.00 ? 26 PHE A CZ   4  
ATOM 3790  H H    . PHE A 1 26 ? 4.416   -6.827  6.751   1.00 0.00 ? 26 PHE A H    4  
ATOM 3791  H HA   . PHE A 1 26 ? 7.091   -6.532  6.254   1.00 0.00 ? 26 PHE A HA   4  
ATOM 3792  H HB2  . PHE A 1 26 ? 5.646   -5.937  4.503   1.00 0.00 ? 26 PHE A HB2  4  
ATOM 3793  H HB3  . PHE A 1 26 ? 4.732   -4.822  5.514   1.00 0.00 ? 26 PHE A HB3  4  
ATOM 3794  H HD1  . PHE A 1 26 ? 5.832   -2.671  6.233   1.00 0.00 ? 26 PHE A HD1  4  
ATOM 3795  H HD2  . PHE A 1 26 ? 7.455   -5.200  3.220   1.00 0.00 ? 26 PHE A HD2  4  
ATOM 3796  H HE1  . PHE A 1 26 ? 7.197   -0.800  5.402   1.00 0.00 ? 26 PHE A HE1  4  
ATOM 3797  H HE2  . PHE A 1 26 ? 8.823   -3.334  2.384   1.00 0.00 ? 26 PHE A HE2  4  
ATOM 3798  H HZ   . PHE A 1 26 ? 8.694   -1.129  3.475   1.00 0.00 ? 26 PHE A HZ   4  
ATOM 3799  N N    . GLU A 1 27 ? 5.960   -4.126  8.200   1.00 0.00 ? 27 GLU A N    4  
ATOM 3800  C CA   . GLU A 1 27 ? 6.365   -3.084  9.135   1.00 0.00 ? 27 GLU A CA   4  
ATOM 3801  C C    . GLU A 1 27 ? 7.409   -3.609  10.116  1.00 0.00 ? 27 GLU A C    4  
ATOM 3802  O O    . GLU A 1 27 ? 8.453   -2.989  10.321  1.00 0.00 ? 27 GLU A O    4  
ATOM 3803  C CB   . GLU A 1 27 ? 5.150   -2.555  9.901   1.00 0.00 ? 27 GLU A CB   4  
ATOM 3804  C CG   . GLU A 1 27 ? 3.979   -2.186  9.006   1.00 0.00 ? 27 GLU A CG   4  
ATOM 3805  C CD   . GLU A 1 27 ? 4.347   -1.148  7.963   1.00 0.00 ? 27 GLU A CD   4  
ATOM 3806  O OE1  . GLU A 1 27 ? 5.110   -0.217  8.295   1.00 0.00 ? 27 GLU A OE1  4  
ATOM 3807  O OE2  . GLU A 1 27 ? 3.871   -1.267  6.814   1.00 0.00 ? 27 GLU A OE2  4  
ATOM 3808  H H    . GLU A 1 27 ? 5.007   -4.330  8.094   1.00 0.00 ? 27 GLU A H    4  
ATOM 3809  H HA   . GLU A 1 27 ? 6.798   -2.276  8.565   1.00 0.00 ? 27 GLU A HA   4  
ATOM 3810  H HB2  . GLU A 1 27 ? 4.820   -3.312  10.597  1.00 0.00 ? 27 GLU A HB2  4  
ATOM 3811  H HB3  . GLU A 1 27 ? 5.444   -1.675  10.454  1.00 0.00 ? 27 GLU A HB3  4  
ATOM 3812  H HG2  . GLU A 1 27 ? 3.635   -3.075  8.500   1.00 0.00 ? 27 GLU A HG2  4  
ATOM 3813  H HG3  . GLU A 1 27 ? 3.183   -1.791  9.620   1.00 0.00 ? 27 GLU A HG3  4  
ATOM 3814  N N    . THR A 1 28 ? 7.120   -4.757  10.721  1.00 0.00 ? 28 THR A N    4  
ATOM 3815  C CA   . THR A 1 28 ? 8.031   -5.366  11.682  1.00 0.00 ? 28 THR A CA   4  
ATOM 3816  C C    . THR A 1 28 ? 9.258   -5.944  10.986  1.00 0.00 ? 28 THR A C    4  
ATOM 3817  O O    . THR A 1 28 ? 10.329  -6.049  11.582  1.00 0.00 ? 28 THR A O    4  
ATOM 3818  C CB   . THR A 1 28 ? 7.337   -6.481  12.486  1.00 0.00 ? 28 THR A CB   4  
ATOM 3819  O OG1  . THR A 1 28 ? 6.741   -7.430  11.593  1.00 0.00 ? 28 THR A OG1  4  
ATOM 3820  C CG2  . THR A 1 28 ? 6.272   -5.904  13.405  1.00 0.00 ? 28 THR A CG2  4  
ATOM 3821  H H    . THR A 1 28 ? 6.272   -5.203  10.516  1.00 0.00 ? 28 THR A H    4  
ATOM 3822  H HA   . THR A 1 28 ? 8.349   -4.598  12.372  1.00 0.00 ? 28 THR A HA   4  
ATOM 3823  H HB   . THR A 1 28 ? 8.079   -6.984  13.090  1.00 0.00 ? 28 THR A HB   4  
ATOM 3824  H HG1  . THR A 1 28 ? 7.404   -7.749  10.976  1.00 0.00 ? 28 THR A HG1  4  
ATOM 3825  H HG21 . THR A 1 28 ? 6.746   -5.375  14.219  1.00 0.00 ? 28 THR A HG21 4  
ATOM 3826  H HG22 . THR A 1 28 ? 5.665   -6.704  13.801  1.00 0.00 ? 28 THR A HG22 4  
ATOM 3827  H HG23 . THR A 1 28 ? 5.648   -5.221  12.848  1.00 0.00 ? 28 THR A HG23 4  
ATOM 3828  N N    . GLN A 1 29 ? 9.093   -6.317  9.721   1.00 0.00 ? 29 GLN A N    4  
ATOM 3829  C CA   . GLN A 1 29 ? 10.189  -6.885  8.944   1.00 0.00 ? 29 GLN A CA   4  
ATOM 3830  C C    . GLN A 1 29 ? 9.963   -6.675  7.450   1.00 0.00 ? 29 GLN A C    4  
ATOM 3831  O O    . GLN A 1 29 ? 9.069   -7.279  6.856   1.00 0.00 ? 29 GLN A O    4  
ATOM 3832  C CB   . GLN A 1 29 ? 10.335  -8.377  9.245   1.00 0.00 ? 29 GLN A CB   4  
ATOM 3833  C CG   . GLN A 1 29 ? 11.762  -8.887  9.114   1.00 0.00 ? 29 GLN A CG   4  
ATOM 3834  C CD   . GLN A 1 29 ? 11.838  -10.400 9.062   1.00 0.00 ? 29 GLN A CD   4  
ATOM 3835  O OE1  . GLN A 1 29 ? 11.106  -11.095 9.768   1.00 0.00 ? 29 GLN A OE1  4  
ATOM 3836  N NE2  . GLN A 1 29 ? 12.727  -10.921 8.224   1.00 0.00 ? 29 GLN A NE2  4  
ATOM 3837  H H    . GLN A 1 29 ? 8.215   -6.208  9.300   1.00 0.00 ? 29 GLN A H    4  
ATOM 3838  H HA   . GLN A 1 29 ? 11.097  -6.378  9.232   1.00 0.00 ? 29 GLN A HA   4  
ATOM 3839  H HB2  . GLN A 1 29 ? 10.001  -8.563  10.255  1.00 0.00 ? 29 GLN A HB2  4  
ATOM 3840  H HB3  . GLN A 1 29 ? 9.713   -8.934  8.560   1.00 0.00 ? 29 GLN A HB3  4  
ATOM 3841  H HG2  . GLN A 1 29 ? 12.190  -8.490  8.206   1.00 0.00 ? 29 GLN A HG2  4  
ATOM 3842  H HG3  . GLN A 1 29 ? 12.333  -8.541  9.962   1.00 0.00 ? 29 GLN A HG3  4  
ATOM 3843  H HE21 . GLN A 1 29 ? 13.277  -10.306 7.694   1.00 0.00 ? 29 GLN A HE21 4  
ATOM 3844  H HE22 . GLN A 1 29 ? 12.798  -11.896 8.171   1.00 0.00 ? 29 GLN A HE22 4  
ATOM 3845  N N    . LYS A 1 30 ? 10.777  -5.816  6.848   1.00 0.00 ? 30 LYS A N    4  
ATOM 3846  C CA   . LYS A 1 30 ? 10.668  -5.526  5.423   1.00 0.00 ? 30 LYS A CA   4  
ATOM 3847  C C    . LYS A 1 30 ? 10.797  -6.802  4.598   1.00 0.00 ? 30 LYS A C    4  
ATOM 3848  O O    . LYS A 1 30 ? 10.222  -6.912  3.514   1.00 0.00 ? 30 LYS A O    4  
ATOM 3849  C CB   . LYS A 1 30 ? 11.744  -4.523  5.002   1.00 0.00 ? 30 LYS A CB   4  
ATOM 3850  C CG   . LYS A 1 30 ? 11.767  -3.263  5.851   1.00 0.00 ? 30 LYS A CG   4  
ATOM 3851  C CD   . LYS A 1 30 ? 10.653  -2.306  5.459   1.00 0.00 ? 30 LYS A CD   4  
ATOM 3852  C CE   . LYS A 1 30 ? 10.479  -1.202  6.491   1.00 0.00 ? 30 LYS A CE   4  
ATOM 3853  N NZ   . LYS A 1 30 ? 10.101  -1.744  7.825   1.00 0.00 ? 30 LYS A NZ   4  
ATOM 3854  H H    . LYS A 1 30 ? 11.471  -5.365  7.376   1.00 0.00 ? 30 LYS A H    4  
ATOM 3855  H HA   . LYS A 1 30 ? 9.695   -5.093  5.247   1.00 0.00 ? 30 LYS A HA   4  
ATOM 3856  H HB2  . LYS A 1 30 ? 12.711  -4.998  5.074   1.00 0.00 ? 30 LYS A HB2  4  
ATOM 3857  H HB3  . LYS A 1 30 ? 11.569  -4.236  3.975   1.00 0.00 ? 30 LYS A HB3  4  
ATOM 3858  H HG2  . LYS A 1 30 ? 11.644  -3.537  6.888   1.00 0.00 ? 30 LYS A HG2  4  
ATOM 3859  H HG3  . LYS A 1 30 ? 12.718  -2.768  5.718   1.00 0.00 ? 30 LYS A HG3  4  
ATOM 3860  H HD2  . LYS A 1 30 ? 10.894  -1.858  4.506   1.00 0.00 ? 30 LYS A HD2  4  
ATOM 3861  H HD3  . LYS A 1 30 ? 9.728   -2.859  5.376   1.00 0.00 ? 30 LYS A HD3  4  
ATOM 3862  H HE2  . LYS A 1 30 ? 11.409  -0.662  6.581   1.00 0.00 ? 30 LYS A HE2  4  
ATOM 3863  H HE3  . LYS A 1 30 ? 9.705   -0.530  6.152   1.00 0.00 ? 30 LYS A HE3  4  
ATOM 3864  H HZ1  . LYS A 1 30 ? 9.182   -1.357  8.120   1.00 0.00 ? 30 LYS A HZ1  4  
ATOM 3865  H HZ2  . LYS A 1 30 ? 10.817  -1.484  8.533   1.00 0.00 ? 30 LYS A HZ2  4  
ATOM 3866  H HZ3  . LYS A 1 30 ? 10.031  -2.781  7.783   1.00 0.00 ? 30 LYS A HZ3  4  
ATOM 3867  N N    . TYR A 1 31 ? 11.552  -7.763  5.116   1.00 0.00 ? 31 TYR A N    4  
ATOM 3868  C CA   . TYR A 1 31 ? 11.756  -9.031  4.426   1.00 0.00 ? 31 TYR A CA   4  
ATOM 3869  C C    . TYR A 1 31 ? 11.406  -10.208 5.333   1.00 0.00 ? 31 TYR A C    4  
ATOM 3870  O O    . TYR A 1 31 ? 11.187  -10.038 6.533   1.00 0.00 ? 31 TYR A O    4  
ATOM 3871  C CB   . TYR A 1 31 ? 13.206  -9.151  3.954   1.00 0.00 ? 31 TYR A CB   4  
ATOM 3872  C CG   . TYR A 1 31 ? 13.492  -8.394  2.677   1.00 0.00 ? 31 TYR A CG   4  
ATOM 3873  C CD1  . TYR A 1 31 ? 13.607  -7.009  2.678   1.00 0.00 ? 31 TYR A CD1  4  
ATOM 3874  C CD2  . TYR A 1 31 ? 13.646  -9.063  1.469   1.00 0.00 ? 31 TYR A CD2  4  
ATOM 3875  C CE1  . TYR A 1 31 ? 13.867  -6.313  1.513   1.00 0.00 ? 31 TYR A CE1  4  
ATOM 3876  C CE2  . TYR A 1 31 ? 13.908  -8.375  0.300   1.00 0.00 ? 31 TYR A CE2  4  
ATOM 3877  C CZ   . TYR A 1 31 ? 14.017  -7.000  0.327   1.00 0.00 ? 31 TYR A CZ   4  
ATOM 3878  O OH   . TYR A 1 31 ? 14.277  -6.311  -0.835  1.00 0.00 ? 31 TYR A OH   4  
ATOM 3879  H H    . TYR A 1 31 ? 11.984  -7.617  5.983   1.00 0.00 ? 31 TYR A H    4  
ATOM 3880  H HA   . TYR A 1 31 ? 11.105  -9.049  3.565   1.00 0.00 ? 31 TYR A HA   4  
ATOM 3881  H HB2  . TYR A 1 31 ? 13.861  -8.766  4.720   1.00 0.00 ? 31 TYR A HB2  4  
ATOM 3882  H HB3  . TYR A 1 31 ? 13.436  -10.192 3.781   1.00 0.00 ? 31 TYR A HB3  4  
ATOM 3883  H HD1  . TYR A 1 31 ? 13.490  -6.474  3.609   1.00 0.00 ? 31 TYR A HD1  4  
ATOM 3884  H HD2  . TYR A 1 31 ? 13.560  -10.140 1.451   1.00 0.00 ? 31 TYR A HD2  4  
ATOM 3885  H HE1  . TYR A 1 31 ? 13.953  -5.237  1.535   1.00 0.00 ? 31 TYR A HE1  4  
ATOM 3886  H HE2  . TYR A 1 31 ? 14.025  -8.913  -0.630  1.00 0.00 ? 31 TYR A HE2  4  
ATOM 3887  H HH   . TYR A 1 31 ? 13.683  -5.560  -0.901  1.00 0.00 ? 31 TYR A HH   4  
ATOM 3888  N N    . LEU A 1 32 ? 11.355  -11.400 4.750   1.00 0.00 ? 32 LEU A N    4  
ATOM 3889  C CA   . LEU A 1 32 ? 11.033  -12.607 5.503   1.00 0.00 ? 32 LEU A CA   4  
ATOM 3890  C C    . LEU A 1 32 ? 11.733  -13.824 4.908   1.00 0.00 ? 32 LEU A C    4  
ATOM 3891  O O    . LEU A 1 32 ? 11.580  -14.123 3.723   1.00 0.00 ? 32 LEU A O    4  
ATOM 3892  C CB   . LEU A 1 32 ? 9.520   -12.832 5.520   1.00 0.00 ? 32 LEU A CB   4  
ATOM 3893  C CG   . LEU A 1 32 ? 8.681   -11.707 6.128   1.00 0.00 ? 32 LEU A CG   4  
ATOM 3894  C CD1  . LEU A 1 32 ? 7.257   -11.756 5.595   1.00 0.00 ? 32 LEU A CD1  4  
ATOM 3895  C CD2  . LEU A 1 32 ? 8.687   -11.799 7.647   1.00 0.00 ? 32 LEU A CD2  4  
ATOM 3896  H H    . LEU A 1 32 ? 11.539  -11.472 3.790   1.00 0.00 ? 32 LEU A H    4  
ATOM 3897  H HA   . LEU A 1 32 ? 11.379  -12.467 6.516   1.00 0.00 ? 32 LEU A HA   4  
ATOM 3898  H HB2  . LEU A 1 32 ? 9.195   -12.972 4.501   1.00 0.00 ? 32 LEU A HB2  4  
ATOM 3899  H HB3  . LEU A 1 32 ? 9.326   -13.733 6.085   1.00 0.00 ? 32 LEU A HB3  4  
ATOM 3900  H HG   . LEU A 1 32 ? 9.109   -10.755 5.847   1.00 0.00 ? 32 LEU A HG   4  
ATOM 3901  H HD11 . LEU A 1 32 ? 7.177   -11.124 4.724   1.00 0.00 ? 32 LEU A HD11 4  
ATOM 3902  H HD12 . LEU A 1 32 ? 6.576   -11.406 6.357   1.00 0.00 ? 32 LEU A HD12 4  
ATOM 3903  H HD13 . LEU A 1 32 ? 7.007   -12.772 5.329   1.00 0.00 ? 32 LEU A HD13 4  
ATOM 3904  H HD21 . LEU A 1 32 ? 8.383   -12.790 7.949   1.00 0.00 ? 32 LEU A HD21 4  
ATOM 3905  H HD22 . LEU A 1 32 ? 7.999   -11.071 8.054   1.00 0.00 ? 32 LEU A HD22 4  
ATOM 3906  H HD23 . LEU A 1 32 ? 9.682   -11.599 8.015   1.00 0.00 ? 32 LEU A HD23 4  
ATOM 3907  N N    . SER A 1 33 ? 12.499  -14.525 5.738   1.00 0.00 ? 33 SER A N    4  
ATOM 3908  C CA   . SER A 1 33 ? 13.223  -15.710 5.293   1.00 0.00 ? 33 SER A CA   4  
ATOM 3909  C C    . SER A 1 33 ? 12.261  -16.769 4.765   1.00 0.00 ? 33 SER A C    4  
ATOM 3910  O O    . SER A 1 33 ? 11.088  -16.818 5.136   1.00 0.00 ? 33 SER A O    4  
ATOM 3911  C CB   . SER A 1 33 ? 14.055  -16.286 6.441   1.00 0.00 ? 33 SER A CB   4  
ATOM 3912  O OG   . SER A 1 33 ? 14.657  -15.254 7.203   1.00 0.00 ? 33 SER A OG   4  
ATOM 3913  H H    . SER A 1 33 ? 12.580  -14.237 6.671   1.00 0.00 ? 33 SER A H    4  
ATOM 3914  H HA   . SER A 1 33 ? 13.886  -15.412 4.494   1.00 0.00 ? 33 SER A HA   4  
ATOM 3915  H HB2  . SER A 1 33 ? 13.416  -16.868 7.088   1.00 0.00 ? 33 SER A HB2  4  
ATOM 3916  H HB3  . SER A 1 33 ? 14.831  -16.919 6.037   1.00 0.00 ? 33 SER A HB3  4  
ATOM 3917  H HG   . SER A 1 33 ? 15.057  -14.611 6.612   1.00 0.00 ? 33 SER A HG   4  
ATOM 3918  N N    . PRO A 1 34 ? 12.768  -17.639 3.879   1.00 0.00 ? 34 PRO A N    4  
ATOM 3919  C CA   . PRO A 1 34 ? 11.971  -18.714 3.280   1.00 0.00 ? 34 PRO A CA   4  
ATOM 3920  C C    . PRO A 1 34 ? 11.178  -19.496 4.322   1.00 0.00 ? 34 PRO A C    4  
ATOM 3921  O O    . PRO A 1 34 ? 9.999   -19.802 4.138   1.00 0.00 ? 34 PRO A O    4  
ATOM 3922  C CB   . PRO A 1 34 ? 13.023  -19.612 2.625   1.00 0.00 ? 34 PRO A CB   4  
ATOM 3923  C CG   . PRO A 1 34 ? 14.171  -18.706 2.341   1.00 0.00 ? 34 PRO A CG   4  
ATOM 3924  C CD   . PRO A 1 34 ? 14.157  -17.639 3.392   1.00 0.00 ? 34 PRO A CD   4  
ATOM 3925  H HA   . PRO A 1 34 ? 11.297  -18.336 2.526   1.00 0.00 ? 34 PRO A HA   4  
ATOM 3926  H HB2  . PRO A 1 34 ? 13.302  -20.402 3.308   1.00 0.00 ? 34 PRO A HB2  4  
ATOM 3927  H HB3  . PRO A 1 34 ? 12.623  -20.038 1.717   1.00 0.00 ? 34 PRO A HB3  4  
ATOM 3928  H HG2  . PRO A 1 34 ? 15.096  -19.259 2.391   1.00 0.00 ? 34 PRO A HG2  4  
ATOM 3929  H HG3  . PRO A 1 34 ? 14.052  -18.259 1.365   1.00 0.00 ? 34 PRO A HG3  4  
ATOM 3930  H HD2  . PRO A 1 34 ? 14.844  -17.890 4.187   1.00 0.00 ? 34 PRO A HD2  4  
ATOM 3931  H HD3  . PRO A 1 34 ? 14.413  -16.684 2.957   1.00 0.00 ? 34 PRO A HD3  4  
ATOM 3932  N N    . PRO A 1 35 ? 11.836  -19.827 5.443   1.00 0.00 ? 35 PRO A N    4  
ATOM 3933  C CA   . PRO A 1 35 ? 11.210  -20.576 6.536   1.00 0.00 ? 35 PRO A CA   4  
ATOM 3934  C C    . PRO A 1 35 ? 9.851   -20.006 6.927   1.00 0.00 ? 35 PRO A C    4  
ATOM 3935  O O    . PRO A 1 35 ? 8.888   -20.748 7.114   1.00 0.00 ? 35 PRO A O    4  
ATOM 3936  C CB   . PRO A 1 35 ? 12.206  -20.421 7.688   1.00 0.00 ? 35 PRO A CB   4  
ATOM 3937  C CG   . PRO A 1 35 ? 13.520  -20.192 7.024   1.00 0.00 ? 35 PRO A CG   4  
ATOM 3938  C CD   . PRO A 1 35 ? 13.242  -19.494 5.729   1.00 0.00 ? 35 PRO A CD   4  
ATOM 3939  H HA   . PRO A 1 35 ? 11.103  -21.622 6.290   1.00 0.00 ? 35 PRO A HA   4  
ATOM 3940  H HB2  . PRO A 1 35 ? 11.921  -19.578 8.302   1.00 0.00 ? 35 PRO A HB2  4  
ATOM 3941  H HB3  . PRO A 1 35 ? 12.216  -21.321 8.284   1.00 0.00 ? 35 PRO A HB3  4  
ATOM 3942  H HG2  . PRO A 1 35 ? 14.144  -19.571 7.649   1.00 0.00 ? 35 PRO A HG2  4  
ATOM 3943  H HG3  . PRO A 1 35 ? 14.004  -21.139 6.833   1.00 0.00 ? 35 PRO A HG3  4  
ATOM 3944  H HD2  . PRO A 1 35 ? 13.370  -18.428 5.845   1.00 0.00 ? 35 PRO A HD2  4  
ATOM 3945  H HD3  . PRO A 1 35 ? 13.892  -19.872 4.954   1.00 0.00 ? 35 PRO A HD3  4  
ATOM 3946  N N    . GLU A 1 36 ? 9.781   -18.684 7.047   1.00 0.00 ? 36 GLU A N    4  
ATOM 3947  C CA   . GLU A 1 36 ? 8.539   -18.015 7.415   1.00 0.00 ? 36 GLU A CA   4  
ATOM 3948  C C    . GLU A 1 36 ? 7.630   -17.848 6.201   1.00 0.00 ? 36 GLU A C    4  
ATOM 3949  O O    . GLU A 1 36 ? 6.550   -18.436 6.134   1.00 0.00 ? 36 GLU A O    4  
ATOM 3950  C CB   . GLU A 1 36 ? 8.834   -16.649 8.038   1.00 0.00 ? 36 GLU A CB   4  
ATOM 3951  C CG   . GLU A 1 36 ? 9.930   -16.683 9.090   1.00 0.00 ? 36 GLU A CG   4  
ATOM 3952  C CD   . GLU A 1 36 ? 9.393   -16.957 10.482  1.00 0.00 ? 36 GLU A CD   4  
ATOM 3953  O OE1  . GLU A 1 36 ? 8.582   -17.895 10.630  1.00 0.00 ? 36 GLU A OE1  4  
ATOM 3954  O OE2  . GLU A 1 36 ? 9.784   -16.234 11.421  1.00 0.00 ? 36 GLU A OE2  4  
ATOM 3955  H H    . GLU A 1 36 ? 10.584  -18.146 6.884   1.00 0.00 ? 36 GLU A H    4  
ATOM 3956  H HA   . GLU A 1 36 ? 8.035   -18.631 8.145   1.00 0.00 ? 36 GLU A HA   4  
ATOM 3957  H HB2  . GLU A 1 36 ? 9.135   -15.968 7.255   1.00 0.00 ? 36 GLU A HB2  4  
ATOM 3958  H HB3  . GLU A 1 36 ? 7.932   -16.276 8.500   1.00 0.00 ? 36 GLU A HB3  4  
ATOM 3959  H HG2  . GLU A 1 36 ? 10.634  -17.460 8.833   1.00 0.00 ? 36 GLU A HG2  4  
ATOM 3960  H HG3  . GLU A 1 36 ? 10.435  -15.729 9.096   1.00 0.00 ? 36 GLU A HG3  4  
ATOM 3961  N N    . ARG A 1 37 ? 8.075   -17.042 5.243   1.00 0.00 ? 37 ARG A N    4  
ATOM 3962  C CA   . ARG A 1 37 ? 7.302   -16.795 4.032   1.00 0.00 ? 37 ARG A CA   4  
ATOM 3963  C C    . ARG A 1 37 ? 6.530   -18.043 3.616   1.00 0.00 ? 37 ARG A C    4  
ATOM 3964  O O    . ARG A 1 37 ? 5.431   -17.953 3.068   1.00 0.00 ? 37 ARG A O    4  
ATOM 3965  C CB   . ARG A 1 37 ? 8.224   -16.350 2.895   1.00 0.00 ? 37 ARG A CB   4  
ATOM 3966  C CG   . ARG A 1 37 ? 7.501   -15.619 1.775   1.00 0.00 ? 37 ARG A CG   4  
ATOM 3967  C CD   . ARG A 1 37 ? 8.302   -15.650 0.482   1.00 0.00 ? 37 ARG A CD   4  
ATOM 3968  N NE   . ARG A 1 37 ? 8.521   -17.013 0.006   1.00 0.00 ? 37 ARG A NE   4  
ATOM 3969  C CZ   . ARG A 1 37 ? 9.308   -17.315 -1.020  1.00 0.00 ? 37 ARG A CZ   4  
ATOM 3970  N NH1  . ARG A 1 37 ? 9.947   -16.356 -1.675  1.00 0.00 ? 37 ARG A NH1  4  
ATOM 3971  N NH2  . ARG A 1 37 ? 9.457   -18.580 -1.394  1.00 0.00 ? 37 ARG A NH2  4  
ATOM 3972  H H    . ARG A 1 37 ? 8.944   -16.601 5.353   1.00 0.00 ? 37 ARG A H    4  
ATOM 3973  H HA   . ARG A 1 37 ? 6.598   -16.004 4.243   1.00 0.00 ? 37 ARG A HA   4  
ATOM 3974  H HB2  . ARG A 1 37 ? 8.980   -15.690 3.296   1.00 0.00 ? 37 ARG A HB2  4  
ATOM 3975  H HB3  . ARG A 1 37 ? 8.705   -17.221 2.475   1.00 0.00 ? 37 ARG A HB3  4  
ATOM 3976  H HG2  . ARG A 1 37 ? 6.546   -16.094 1.605   1.00 0.00 ? 37 ARG A HG2  4  
ATOM 3977  H HG3  . ARG A 1 37 ? 7.347   -14.592 2.069   1.00 0.00 ? 37 ARG A HG3  4  
ATOM 3978  H HD2  . ARG A 1 37 ? 7.762   -15.098 -0.273  1.00 0.00 ? 37 ARG A HD2  4  
ATOM 3979  H HD3  . ARG A 1 37 ? 9.258   -15.180 0.656   1.00 0.00 ? 37 ARG A HD3  4  
ATOM 3980  H HE   . ARG A 1 37 ? 8.059   -17.738 0.476   1.00 0.00 ? 37 ARG A HE   4  
ATOM 3981  H HH11 . ARG A 1 37 ? 9.837   -15.402 -1.395  1.00 0.00 ? 37 ARG A HH11 4  
ATOM 3982  H HH12 . ARG A 1 37 ? 10.540  -16.586 -2.447  1.00 0.00 ? 37 ARG A HH12 4  
ATOM 3983  H HH21 . ARG A 1 37 ? 8.977   -19.306 -0.902  1.00 0.00 ? 37 ARG A HH21 4  
ATOM 3984  H HH22 . ARG A 1 37 ? 10.049  -18.806 -2.167  1.00 0.00 ? 37 ARG A HH22 4  
ATOM 3985  N N    . LYS A 1 38 ? 7.112   -19.208 3.879   1.00 0.00 ? 38 LYS A N    4  
ATOM 3986  C CA   . LYS A 1 38 ? 6.480   -20.476 3.534   1.00 0.00 ? 38 LYS A CA   4  
ATOM 3987  C C    . LYS A 1 38 ? 5.238   -20.714 4.386   1.00 0.00 ? 38 LYS A C    4  
ATOM 3988  O O    . LYS A 1 38 ? 4.162   -21.006 3.864   1.00 0.00 ? 38 LYS A O    4  
ATOM 3989  C CB   . LYS A 1 38 ? 7.468   -21.629 3.720   1.00 0.00 ? 38 LYS A CB   4  
ATOM 3990  C CG   . LYS A 1 38 ? 8.467   -21.764 2.583   1.00 0.00 ? 38 LYS A CG   4  
ATOM 3991  C CD   . LYS A 1 38 ? 9.695   -22.550 3.010   1.00 0.00 ? 38 LYS A CD   4  
ATOM 3992  C CE   . LYS A 1 38 ? 10.317  -23.292 1.837   1.00 0.00 ? 38 LYS A CE   4  
ATOM 3993  N NZ   . LYS A 1 38 ? 11.728  -23.679 2.112   1.00 0.00 ? 38 LYS A NZ   4  
ATOM 3994  H H    . LYS A 1 38 ? 7.989   -19.215 4.318   1.00 0.00 ? 38 LYS A H    4  
ATOM 3995  H HA   . LYS A 1 38 ? 6.186   -20.428 2.496   1.00 0.00 ? 38 LYS A HA   4  
ATOM 3996  H HB2  . LYS A 1 38 ? 8.016   -21.474 4.637   1.00 0.00 ? 38 LYS A HB2  4  
ATOM 3997  H HB3  . LYS A 1 38 ? 6.913   -22.554 3.794   1.00 0.00 ? 38 LYS A HB3  4  
ATOM 3998  H HG2  . LYS A 1 38 ? 7.994   -22.276 1.759   1.00 0.00 ? 38 LYS A HG2  4  
ATOM 3999  H HG3  . LYS A 1 38 ? 8.774   -20.777 2.268   1.00 0.00 ? 38 LYS A HG3  4  
ATOM 4000  H HD2  . LYS A 1 38 ? 10.425  -21.867 3.418   1.00 0.00 ? 38 LYS A HD2  4  
ATOM 4001  H HD3  . LYS A 1 38 ? 9.407   -23.266 3.767   1.00 0.00 ? 38 LYS A HD3  4  
ATOM 4002  H HE2  . LYS A 1 38 ? 9.739   -24.183 1.645   1.00 0.00 ? 38 LYS A HE2  4  
ATOM 4003  H HE3  . LYS A 1 38 ? 10.291  -22.652 0.968   1.00 0.00 ? 38 LYS A HE3  4  
ATOM 4004  H HZ1  . LYS A 1 38 ? 12.030  -24.422 1.449   1.00 0.00 ? 38 LYS A HZ1  4  
ATOM 4005  H HZ2  . LYS A 1 38 ? 11.818  -24.041 3.083   1.00 0.00 ? 38 LYS A HZ2  4  
ATOM 4006  H HZ3  . LYS A 1 38 ? 12.353  -22.856 2.001   1.00 0.00 ? 38 LYS A HZ3  4  
ATOM 4007  N N    . ARG A 1 39 ? 5.393   -20.586 5.700   1.00 0.00 ? 39 ARG A N    4  
ATOM 4008  C CA   . ARG A 1 39 ? 4.284   -20.788 6.624   1.00 0.00 ? 39 ARG A CA   4  
ATOM 4009  C C    . ARG A 1 39 ? 3.232   -19.695 6.456   1.00 0.00 ? 39 ARG A C    4  
ATOM 4010  O O    . ARG A 1 39 ? 2.031   -19.969 6.464   1.00 0.00 ? 39 ARG A O    4  
ATOM 4011  C CB   . ARG A 1 39 ? 4.791   -20.805 8.067   1.00 0.00 ? 39 ARG A CB   4  
ATOM 4012  C CG   . ARG A 1 39 ? 5.545   -22.073 8.432   1.00 0.00 ? 39 ARG A CG   4  
ATOM 4013  C CD   . ARG A 1 39 ? 6.467   -21.850 9.621   1.00 0.00 ? 39 ARG A CD   4  
ATOM 4014  N NE   . ARG A 1 39 ? 6.989   -23.106 10.152  1.00 0.00 ? 39 ARG A NE   4  
ATOM 4015  C CZ   . ARG A 1 39 ? 7.867   -23.176 11.147  1.00 0.00 ? 39 ARG A CZ   4  
ATOM 4016  N NH1  . ARG A 1 39 ? 8.318   -22.066 11.715  1.00 0.00 ? 39 ARG A NH1  4  
ATOM 4017  N NH2  . ARG A 1 39 ? 8.295   -24.356 11.575  1.00 0.00 ? 39 ARG A NH2  4  
ATOM 4018  H H    . ARG A 1 39 ? 6.276   -20.352 6.056   1.00 0.00 ? 39 ARG A H    4  
ATOM 4019  H HA   . ARG A 1 39 ? 3.833   -21.743 6.398   1.00 0.00 ? 39 ARG A HA   4  
ATOM 4020  H HB2  . ARG A 1 39 ? 5.453   -19.964 8.214   1.00 0.00 ? 39 ARG A HB2  4  
ATOM 4021  H HB3  . ARG A 1 39 ? 3.947   -20.709 8.733   1.00 0.00 ? 39 ARG A HB3  4  
ATOM 4022  H HG2  . ARG A 1 39 ? 4.833   -22.845 8.684   1.00 0.00 ? 39 ARG A HG2  4  
ATOM 4023  H HG3  . ARG A 1 39 ? 6.135   -22.387 7.584   1.00 0.00 ? 39 ARG A HG3  4  
ATOM 4024  H HD2  . ARG A 1 39 ? 7.295   -21.232 9.306   1.00 0.00 ? 39 ARG A HD2  4  
ATOM 4025  H HD3  . ARG A 1 39 ? 5.915   -21.343 10.398  1.00 0.00 ? 39 ARG A HD3  4  
ATOM 4026  H HE   . ARG A 1 39 ? 6.669   -23.939 9.746   1.00 0.00 ? 39 ARG A HE   4  
ATOM 4027  H HH11 . ARG A 1 39 ? 7.996   -21.175 11.396  1.00 0.00 ? 39 ARG A HH11 4  
ATOM 4028  H HH12 . ARG A 1 39 ? 8.978   -22.121 12.465  1.00 0.00 ? 39 ARG A HH12 4  
ATOM 4029  H HH21 . ARG A 1 39 ? 7.957   -25.195 11.148  1.00 0.00 ? 39 ARG A HH21 4  
ATOM 4030  H HH22 . ARG A 1 39 ? 8.955   -24.407 12.323  1.00 0.00 ? 39 ARG A HH22 4  
ATOM 4031  N N    . LEU A 1 40 ? 3.690   -18.458 6.306   1.00 0.00 ? 40 LEU A N    4  
ATOM 4032  C CA   . LEU A 1 40 ? 2.789   -17.323 6.137   1.00 0.00 ? 40 LEU A CA   4  
ATOM 4033  C C    . LEU A 1 40 ? 1.823   -17.563 4.980   1.00 0.00 ? 40 LEU A C    4  
ATOM 4034  O O    . LEU A 1 40 ? 0.607   -17.484 5.148   1.00 0.00 ? 40 LEU A O    4  
ATOM 4035  C CB   . LEU A 1 40 ? 3.589   -16.043 5.891   1.00 0.00 ? 40 LEU A CB   4  
ATOM 4036  C CG   . LEU A 1 40 ? 2.870   -14.731 6.208   1.00 0.00 ? 40 LEU A CG   4  
ATOM 4037  C CD1  . LEU A 1 40 ? 2.626   -14.604 7.704   1.00 0.00 ? 40 LEU A CD1  4  
ATOM 4038  C CD2  . LEU A 1 40 ? 3.674   -13.545 5.694   1.00 0.00 ? 40 LEU A CD2  4  
ATOM 4039  H H    . LEU A 1 40 ? 4.657   -18.302 6.308   1.00 0.00 ? 40 LEU A H    4  
ATOM 4040  H HA   . LEU A 1 40 ? 2.220   -17.214 7.048   1.00 0.00 ? 40 LEU A HA   4  
ATOM 4041  H HB2  . LEU A 1 40 ? 4.479   -16.088 6.500   1.00 0.00 ? 40 LEU A HB2  4  
ATOM 4042  H HB3  . LEU A 1 40 ? 3.870   -16.024 4.848   1.00 0.00 ? 40 LEU A HB3  4  
ATOM 4043  H HG   . LEU A 1 40 ? 1.910   -14.725 5.712   1.00 0.00 ? 40 LEU A HG   4  
ATOM 4044  H HD11 . LEU A 1 40 ? 1.957   -15.387 8.027   1.00 0.00 ? 40 LEU A HD11 4  
ATOM 4045  H HD12 . LEU A 1 40 ? 2.184   -13.642 7.916   1.00 0.00 ? 40 LEU A HD12 4  
ATOM 4046  H HD13 . LEU A 1 40 ? 3.565   -14.692 8.230   1.00 0.00 ? 40 LEU A HD13 4  
ATOM 4047  H HD21 . LEU A 1 40 ? 4.433   -13.895 5.010   1.00 0.00 ? 40 LEU A HD21 4  
ATOM 4048  H HD22 . LEU A 1 40 ? 4.144   -13.042 6.526   1.00 0.00 ? 40 LEU A HD22 4  
ATOM 4049  H HD23 . LEU A 1 40 ? 3.016   -12.859 5.183   1.00 0.00 ? 40 LEU A HD23 4  
ATOM 4050  N N    . ALA A 1 41 ? 2.374   -17.857 3.807   1.00 0.00 ? 41 ALA A N    4  
ATOM 4051  C CA   . ALA A 1 41 ? 1.562   -18.112 2.624   1.00 0.00 ? 41 ALA A CA   4  
ATOM 4052  C C    . ALA A 1 41 ? 0.457   -19.119 2.924   1.00 0.00 ? 41 ALA A C    4  
ATOM 4053  O O    . ALA A 1 41 ? -0.555  -19.173 2.224   1.00 0.00 ? 41 ALA A O    4  
ATOM 4054  C CB   . ALA A 1 41 ? 2.435   -18.609 1.481   1.00 0.00 ? 41 ALA A CB   4  
ATOM 4055  H H    . ALA A 1 41 ? 3.350   -17.905 3.736   1.00 0.00 ? 41 ALA A H    4  
ATOM 4056  H HA   . ALA A 1 41 ? 1.112   -17.178 2.321   1.00 0.00 ? 41 ALA A HA   4  
ATOM 4057  H HB1  . ALA A 1 41 ? 3.473   -18.565 1.778   1.00 0.00 ? 41 ALA A HB1  4  
ATOM 4058  H HB2  . ALA A 1 41 ? 2.171   -19.628 1.243   1.00 0.00 ? 41 ALA A HB2  4  
ATOM 4059  H HB3  . ALA A 1 41 ? 2.282   -17.984 0.614   1.00 0.00 ? 41 ALA A HB3  4  
ATOM 4060  N N    . LYS A 1 42 ? 0.656   -19.916 3.968   1.00 0.00 ? 42 LYS A N    4  
ATOM 4061  C CA   . LYS A 1 42 ? -0.324  -20.921 4.362   1.00 0.00 ? 42 LYS A CA   4  
ATOM 4062  C C    . LYS A 1 42 ? -1.295  -20.360 5.395   1.00 0.00 ? 42 LYS A C    4  
ATOM 4063  O O    . LYS A 1 42 ? -2.462  -20.748 5.440   1.00 0.00 ? 42 LYS A O    4  
ATOM 4064  C CB   . LYS A 1 42 ? 0.381   -22.156 4.927   1.00 0.00 ? 42 LYS A CB   4  
ATOM 4065  C CG   . LYS A 1 42 ? -0.563  -23.151 5.580   1.00 0.00 ? 42 LYS A CG   4  
ATOM 4066  C CD   . LYS A 1 42 ? -1.202  -24.070 4.552   1.00 0.00 ? 42 LYS A CD   4  
ATOM 4067  C CE   . LYS A 1 42 ? -2.458  -24.730 5.100   1.00 0.00 ? 42 LYS A CE   4  
ATOM 4068  N NZ   . LYS A 1 42 ? -3.610  -23.787 5.135   1.00 0.00 ? 42 LYS A NZ   4  
ATOM 4069  H H    . LYS A 1 42 ? 1.483   -19.825 4.488   1.00 0.00 ? 42 LYS A H    4  
ATOM 4070  H HA   . LYS A 1 42 ? -0.879  -21.206 3.481   1.00 0.00 ? 42 LYS A HA   4  
ATOM 4071  H HB2  . LYS A 1 42 ? 0.901   -22.658 4.124   1.00 0.00 ? 42 LYS A HB2  4  
ATOM 4072  H HB3  . LYS A 1 42 ? 1.102   -21.837 5.667   1.00 0.00 ? 42 LYS A HB3  4  
ATOM 4073  H HG2  . LYS A 1 42 ? -0.009  -23.750 6.287   1.00 0.00 ? 42 LYS A HG2  4  
ATOM 4074  H HG3  . LYS A 1 42 ? -1.341  -22.608 6.097   1.00 0.00 ? 42 LYS A HG3  4  
ATOM 4075  H HD2  . LYS A 1 42 ? -1.465  -23.491 3.679   1.00 0.00 ? 42 LYS A HD2  4  
ATOM 4076  H HD3  . LYS A 1 42 ? -0.493  -24.837 4.278   1.00 0.00 ? 42 LYS A HD3  4  
ATOM 4077  H HE2  . LYS A 1 42 ? -2.711  -25.570 4.471   1.00 0.00 ? 42 LYS A HE2  4  
ATOM 4078  H HE3  . LYS A 1 42 ? -2.258  -25.078 6.102   1.00 0.00 ? 42 LYS A HE3  4  
ATOM 4079  H HZ1  . LYS A 1 42 ? -4.136  -23.832 4.238   1.00 0.00 ? 42 LYS A HZ1  4  
ATOM 4080  H HZ2  . LYS A 1 42 ? -3.272  -22.814 5.276   1.00 0.00 ? 42 LYS A HZ2  4  
ATOM 4081  H HZ3  . LYS A 1 42 ? -4.253  -24.036 5.913   1.00 0.00 ? 42 LYS A HZ3  4  
ATOM 4082  N N    . MET A 1 43 ? -0.805  -19.443 6.224   1.00 0.00 ? 43 MET A N    4  
ATOM 4083  C CA   . MET A 1 43 ? -1.631  -18.826 7.255   1.00 0.00 ? 43 MET A CA   4  
ATOM 4084  C C    . MET A 1 43 ? -2.628  -17.849 6.641   1.00 0.00 ? 43 MET A C    4  
ATOM 4085  O O    . MET A 1 43 ? -3.803  -17.829 7.011   1.00 0.00 ? 43 MET A O    4  
ATOM 4086  C CB   . MET A 1 43 ? -0.753  -18.102 8.277   1.00 0.00 ? 43 MET A CB   4  
ATOM 4087  C CG   . MET A 1 43 ? -1.521  -17.128 9.156   1.00 0.00 ? 43 MET A CG   4  
ATOM 4088  S SD   . MET A 1 43 ? -0.695  -16.813 10.728  1.00 0.00 ? 43 MET A SD   4  
ATOM 4089  C CE   . MET A 1 43 ? 0.589   -15.675 10.214  1.00 0.00 ? 43 MET A CE   4  
ATOM 4090  H H    . MET A 1 43 ? 0.134   -19.174 6.140   1.00 0.00 ? 43 MET A H    4  
ATOM 4091  H HA   . MET A 1 43 ? -2.177  -19.612 7.756   1.00 0.00 ? 43 MET A HA   4  
ATOM 4092  H HB2  . MET A 1 43 ? -0.283  -18.836 8.915   1.00 0.00 ? 43 MET A HB2  4  
ATOM 4093  H HB3  . MET A 1 43 ? 0.012   -17.551 7.751   1.00 0.00 ? 43 MET A HB3  4  
ATOM 4094  H HG2  . MET A 1 43 ? -1.626  -16.192 8.628   1.00 0.00 ? 43 MET A HG2  4  
ATOM 4095  H HG3  . MET A 1 43 ? -2.499  -17.539 9.355   1.00 0.00 ? 43 MET A HG3  4  
ATOM 4096  H HE1  . MET A 1 43 ? 0.330   -15.248 9.256   1.00 0.00 ? 43 MET A HE1  4  
ATOM 4097  H HE2  . MET A 1 43 ? 0.685   -14.886 10.945  1.00 0.00 ? 43 MET A HE2  4  
ATOM 4098  H HE3  . MET A 1 43 ? 1.527   -16.205 10.130  1.00 0.00 ? 43 MET A HE3  4  
ATOM 4099  N N    . LEU A 1 44 ? -2.153  -17.039 5.701   1.00 0.00 ? 44 LEU A N    4  
ATOM 4100  C CA   . LEU A 1 44 ? -3.004  -16.058 5.035   1.00 0.00 ? 44 LEU A CA   4  
ATOM 4101  C C    . LEU A 1 44 ? -3.599  -16.635 3.754   1.00 0.00 ? 44 LEU A C    4  
ATOM 4102  O O    . LEU A 1 44 ? -4.258  -15.927 2.992   1.00 0.00 ? 44 LEU A O    4  
ATOM 4103  C CB   . LEU A 1 44 ? -2.204  -14.794 4.715   1.00 0.00 ? 44 LEU A CB   4  
ATOM 4104  C CG   . LEU A 1 44 ? -1.416  -14.187 5.876   1.00 0.00 ? 44 LEU A CG   4  
ATOM 4105  C CD1  . LEU A 1 44 ? -0.359  -13.224 5.358   1.00 0.00 ? 44 LEU A CD1  4  
ATOM 4106  C CD2  . LEU A 1 44 ? -2.354  -13.482 6.845   1.00 0.00 ? 44 LEU A CD2  4  
ATOM 4107  H H    . LEU A 1 44 ? -1.209  -17.102 5.448   1.00 0.00 ? 44 LEU A H    4  
ATOM 4108  H HA   . LEU A 1 44 ? -3.808  -15.805 5.709   1.00 0.00 ? 44 LEU A HA   4  
ATOM 4109  H HB2  . LEU A 1 44 ? -1.502  -15.036 3.931   1.00 0.00 ? 44 LEU A HB2  4  
ATOM 4110  H HB3  . LEU A 1 44 ? -2.897  -14.047 4.357   1.00 0.00 ? 44 LEU A HB3  4  
ATOM 4111  H HG   . LEU A 1 44 ? -0.911  -14.978 6.414   1.00 0.00 ? 44 LEU A HG   4  
ATOM 4112  H HD11 . LEU A 1 44 ? -0.821  -12.501 4.703   1.00 0.00 ? 44 LEU A HD11 4  
ATOM 4113  H HD12 . LEU A 1 44 ? 0.394   -13.774 4.814   1.00 0.00 ? 44 LEU A HD12 4  
ATOM 4114  H HD13 . LEU A 1 44 ? 0.102   -12.713 6.192   1.00 0.00 ? 44 LEU A HD13 4  
ATOM 4115  H HD21 . LEU A 1 44 ? -2.871  -12.686 6.330   1.00 0.00 ? 44 LEU A HD21 4  
ATOM 4116  H HD22 . LEU A 1 44 ? -1.781  -13.069 7.664   1.00 0.00 ? 44 LEU A HD22 4  
ATOM 4117  H HD23 . LEU A 1 44 ? -3.073  -14.190 7.229   1.00 0.00 ? 44 LEU A HD23 4  
ATOM 4118  N N    . GLN A 1 45 ? -3.364  -17.923 3.525   1.00 0.00 ? 45 GLN A N    4  
ATOM 4119  C CA   . GLN A 1 45 ? -3.879  -18.593 2.337   1.00 0.00 ? 45 GLN A CA   4  
ATOM 4120  C C    . GLN A 1 45 ? -3.384  -17.909 1.068   1.00 0.00 ? 45 GLN A C    4  
ATOM 4121  O O    . GLN A 1 45 ? -4.108  -17.817 0.076   1.00 0.00 ? 45 GLN A O    4  
ATOM 4122  C CB   . GLN A 1 45 ? -5.408  -18.610 2.358   1.00 0.00 ? 45 GLN A CB   4  
ATOM 4123  C CG   . GLN A 1 45 ? -5.996  -18.824 3.744   1.00 0.00 ? 45 GLN A CG   4  
ATOM 4124  C CD   . GLN A 1 45 ? -7.382  -19.436 3.702   1.00 0.00 ? 45 GLN A CD   4  
ATOM 4125  O OE1  . GLN A 1 45 ? -7.577  -20.522 3.156   1.00 0.00 ? 45 GLN A OE1  4  
ATOM 4126  N NE2  . GLN A 1 45 ? -8.354  -18.741 4.281   1.00 0.00 ? 45 GLN A NE2  4  
ATOM 4127  H H    . GLN A 1 45 ? -2.832  -18.433 4.170   1.00 0.00 ? 45 GLN A H    4  
ATOM 4128  H HA   . GLN A 1 45 ? -3.517  -19.610 2.348   1.00 0.00 ? 45 GLN A HA   4  
ATOM 4129  H HB2  . GLN A 1 45 ? -5.772  -17.668 1.978   1.00 0.00 ? 45 GLN A HB2  4  
ATOM 4130  H HB3  . GLN A 1 45 ? -5.756  -19.407 1.717   1.00 0.00 ? 45 GLN A HB3  4  
ATOM 4131  H HG2  . GLN A 1 45 ? -5.345  -19.483 4.299   1.00 0.00 ? 45 GLN A HG2  4  
ATOM 4132  H HG3  . GLN A 1 45 ? -6.054  -17.870 4.247   1.00 0.00 ? 45 GLN A HG3  4  
ATOM 4133  H HE21 . GLN A 1 45 ? -8.125  -17.882 4.695   1.00 0.00 ? 45 GLN A HE21 4  
ATOM 4134  H HE22 . GLN A 1 45 ? -9.260  -19.112 4.268   1.00 0.00 ? 45 GLN A HE22 4  
ATOM 4135  N N    . LEU A 1 46 ? -2.145  -17.430 1.105   1.00 0.00 ? 46 LEU A N    4  
ATOM 4136  C CA   . LEU A 1 46 ? -1.552  -16.753 -0.043  1.00 0.00 ? 46 LEU A CA   4  
ATOM 4137  C C    . LEU A 1 46 ? -0.506  -17.636 -0.715  1.00 0.00 ? 46 LEU A C    4  
ATOM 4138  O O    . LEU A 1 46 ? -0.294  -18.780 -0.314  1.00 0.00 ? 46 LEU A O    4  
ATOM 4139  C CB   . LEU A 1 46 ? -0.917  -15.431 0.391   1.00 0.00 ? 46 LEU A CB   4  
ATOM 4140  C CG   . LEU A 1 46 ? -1.840  -14.448 1.112   1.00 0.00 ? 46 LEU A CG   4  
ATOM 4141  C CD1  . LEU A 1 46 ? -1.043  -13.280 1.672   1.00 0.00 ? 46 LEU A CD1  4  
ATOM 4142  C CD2  . LEU A 1 46 ? -2.928  -13.951 0.171   1.00 0.00 ? 46 LEU A CD2  4  
ATOM 4143  H H    . LEU A 1 46 ? -1.616  -17.534 1.923   1.00 0.00 ? 46 LEU A H    4  
ATOM 4144  H HA   . LEU A 1 46 ? -2.341  -16.548 -0.751  1.00 0.00 ? 46 LEU A HA   4  
ATOM 4145  H HB2  . LEU A 1 46 ? -0.097  -15.660 1.054   1.00 0.00 ? 46 LEU A HB2  4  
ATOM 4146  H HB3  . LEU A 1 46 ? -0.536  -14.941 -0.494  1.00 0.00 ? 46 LEU A HB3  4  
ATOM 4147  H HG   . LEU A 1 46 ? -2.318  -14.953 1.940   1.00 0.00 ? 46 LEU A HG   4  
ATOM 4148  H HD11 . LEU A 1 46 ? -0.905  -12.536 0.901   1.00 0.00 ? 46 LEU A HD11 4  
ATOM 4149  H HD12 . LEU A 1 46 ? -0.080  -13.631 2.011   1.00 0.00 ? 46 LEU A HD12 4  
ATOM 4150  H HD13 . LEU A 1 46 ? -1.579  -12.843 2.502   1.00 0.00 ? 46 LEU A HD13 4  
ATOM 4151  H HD21 . LEU A 1 46 ? -3.279  -12.985 0.504   1.00 0.00 ? 46 LEU A HD21 4  
ATOM 4152  H HD22 . LEU A 1 46 ? -3.750  -14.652 0.170   1.00 0.00 ? 46 LEU A HD22 4  
ATOM 4153  H HD23 . LEU A 1 46 ? -2.528  -13.863 -0.828  1.00 0.00 ? 46 LEU A HD23 4  
ATOM 4154  N N    . SER A 1 47 ? 0.147   -17.096 -1.740  1.00 0.00 ? 47 SER A N    4  
ATOM 4155  C CA   . SER A 1 47 ? 1.171   -17.836 -2.469  1.00 0.00 ? 47 SER A CA   4  
ATOM 4156  C C    . SER A 1 47 ? 2.558   -17.269 -2.182  1.00 0.00 ? 47 SER A C    4  
ATOM 4157  O O    . SER A 1 47 ? 2.719   -16.065 -1.985  1.00 0.00 ? 47 SER A O    4  
ATOM 4158  C CB   . SER A 1 47 ? 0.890   -17.791 -3.972  1.00 0.00 ? 47 SER A CB   4  
ATOM 4159  O OG   . SER A 1 47 ? 1.595   -18.813 -4.654  1.00 0.00 ? 47 SER A OG   4  
ATOM 4160  H H    . SER A 1 47 ? -0.066  -16.180 -2.013  1.00 0.00 ? 47 SER A H    4  
ATOM 4161  H HA   . SER A 1 47 ? 1.139   -18.863 -2.136  1.00 0.00 ? 47 SER A HA   4  
ATOM 4162  H HB2  . SER A 1 47 ? -0.168  -17.924 -4.142  1.00 0.00 ? 47 SER A HB2  4  
ATOM 4163  H HB3  . SER A 1 47 ? 1.199   -16.833 -4.364  1.00 0.00 ? 47 SER A HB3  4  
ATOM 4164  H HG   . SER A 1 47 ? 0.977   -19.486 -4.950  1.00 0.00 ? 47 SER A HG   4  
ATOM 4165  N N    . GLU A 1 48 ? 3.557   -18.147 -2.162  1.00 0.00 ? 48 GLU A N    4  
ATOM 4166  C CA   . GLU A 1 48 ? 4.930   -17.734 -1.899  1.00 0.00 ? 48 GLU A CA   4  
ATOM 4167  C C    . GLU A 1 48 ? 5.306   -16.523 -2.746  1.00 0.00 ? 48 GLU A C    4  
ATOM 4168  O O    . GLU A 1 48 ? 5.931   -15.580 -2.259  1.00 0.00 ? 48 GLU A O    4  
ATOM 4169  C CB   . GLU A 1 48 ? 5.895   -18.888 -2.181  1.00 0.00 ? 48 GLU A CB   4  
ATOM 4170  C CG   . GLU A 1 48 ? 6.155   -19.774 -0.974  1.00 0.00 ? 48 GLU A CG   4  
ATOM 4171  C CD   . GLU A 1 48 ? 7.059   -20.948 -1.296  1.00 0.00 ? 48 GLU A CD   4  
ATOM 4172  O OE1  . GLU A 1 48 ? 6.639   -21.823 -2.081  1.00 0.00 ? 48 GLU A OE1  4  
ATOM 4173  O OE2  . GLU A 1 48 ? 8.187   -20.991 -0.762  1.00 0.00 ? 48 GLU A OE2  4  
ATOM 4174  H H    . GLU A 1 48 ? 3.365   -19.094 -2.326  1.00 0.00 ? 48 GLU A H    4  
ATOM 4175  H HA   . GLU A 1 48 ? 5.002   -17.465 -0.856  1.00 0.00 ? 48 GLU A HA   4  
ATOM 4176  H HB2  . GLU A 1 48 ? 5.485   -19.500 -2.970  1.00 0.00 ? 48 GLU A HB2  4  
ATOM 4177  H HB3  . GLU A 1 48 ? 6.839   -18.478 -2.510  1.00 0.00 ? 48 GLU A HB3  4  
ATOM 4178  H HG2  . GLU A 1 48 ? 6.622   -19.181 -0.202  1.00 0.00 ? 48 GLU A HG2  4  
ATOM 4179  H HG3  . GLU A 1 48 ? 5.211   -20.154 -0.613  1.00 0.00 ? 48 GLU A HG3  4  
ATOM 4180  N N    . ARG A 1 49 ? 4.922   -16.556 -4.018  1.00 0.00 ? 49 ARG A N    4  
ATOM 4181  C CA   . ARG A 1 49 ? 5.220   -15.462 -4.935  1.00 0.00 ? 49 ARG A CA   4  
ATOM 4182  C C    . ARG A 1 49 ? 4.413   -14.217 -4.577  1.00 0.00 ? 49 ARG A C    4  
ATOM 4183  O O    . ARG A 1 49 ? 4.810   -13.097 -4.893  1.00 0.00 ? 49 ARG A O    4  
ATOM 4184  C CB   . ARG A 1 49 ? 4.921   -15.880 -6.376  1.00 0.00 ? 49 ARG A CB   4  
ATOM 4185  C CG   . ARG A 1 49 ? 3.750   -16.840 -6.501  1.00 0.00 ? 49 ARG A CG   4  
ATOM 4186  C CD   . ARG A 1 49 ? 3.204   -16.872 -7.920  1.00 0.00 ? 49 ARG A CD   4  
ATOM 4187  N NE   . ARG A 1 49 ? 3.864   -17.887 -8.737  1.00 0.00 ? 49 ARG A NE   4  
ATOM 4188  C CZ   . ARG A 1 49 ? 3.604   -18.076 -10.026 1.00 0.00 ? 49 ARG A CZ   4  
ATOM 4189  N NH1  . ARG A 1 49 ? 2.704   -17.322 -10.641 1.00 0.00 ? 49 ARG A NH1  4  
ATOM 4190  N NH2  . ARG A 1 49 ? 4.246   -19.020 -10.702 1.00 0.00 ? 49 ARG A NH2  4  
ATOM 4191  H H    . ARG A 1 49 ? 4.427   -17.334 -4.348  1.00 0.00 ? 49 ARG A H    4  
ATOM 4192  H HA   . ARG A 1 49 ? 6.271   -15.232 -4.847  1.00 0.00 ? 49 ARG A HA   4  
ATOM 4193  H HB2  . ARG A 1 49 ? 4.697   -14.997 -6.956  1.00 0.00 ? 49 ARG A HB2  4  
ATOM 4194  H HB3  . ARG A 1 49 ? 5.797   -16.358 -6.788  1.00 0.00 ? 49 ARG A HB3  4  
ATOM 4195  H HG2  . ARG A 1 49 ? 4.080   -17.833 -6.231  1.00 0.00 ? 49 ARG A HG2  4  
ATOM 4196  H HG3  . ARG A 1 49 ? 2.965   -16.525 -5.829  1.00 0.00 ? 49 ARG A HG3  4  
ATOM 4197  H HD2  . ARG A 1 49 ? 2.147   -17.087 -7.880  1.00 0.00 ? 49 ARG A HD2  4  
ATOM 4198  H HD3  . ARG A 1 49 ? 3.358   -15.904 -8.372  1.00 0.00 ? 49 ARG A HD3  4  
ATOM 4199  H HE   . ARG A 1 49 ? 4.533   -18.456 -8.302  1.00 0.00 ? 49 ARG A HE   4  
ATOM 4200  H HH11 . ARG A 1 49 ? 2.220   -16.609 -10.135 1.00 0.00 ? 49 ARG A HH11 4  
ATOM 4201  H HH12 . ARG A 1 49 ? 2.511   -17.465 -11.612 1.00 0.00 ? 49 ARG A HH12 4  
ATOM 4202  H HH21 . ARG A 1 49 ? 4.926   -19.591 -10.241 1.00 0.00 ? 49 ARG A HH21 4  
ATOM 4203  H HH22 . ARG A 1 49 ? 4.050   -19.162 -11.672 1.00 0.00 ? 49 ARG A HH22 4  
ATOM 4204  N N    . GLN A 1 50 ? 3.278   -14.424 -3.917  1.00 0.00 ? 50 GLN A N    4  
ATOM 4205  C CA   . GLN A 1 50 ? 2.415   -13.319 -3.518  1.00 0.00 ? 50 GLN A CA   4  
ATOM 4206  C C    . GLN A 1 50 ? 2.980   -12.600 -2.297  1.00 0.00 ? 50 GLN A C    4  
ATOM 4207  O O    . GLN A 1 50 ? 2.869   -11.380 -2.175  1.00 0.00 ? 50 GLN A O    4  
ATOM 4208  C CB   . GLN A 1 50 ? 1.004   -13.829 -3.216  1.00 0.00 ? 50 GLN A CB   4  
ATOM 4209  C CG   . GLN A 1 50 ? 0.161   -14.057 -4.460  1.00 0.00 ? 50 GLN A CG   4  
ATOM 4210  C CD   . GLN A 1 50 ? -1.180  -14.692 -4.148  1.00 0.00 ? 50 GLN A CD   4  
ATOM 4211  O OE1  . GLN A 1 50 ? -1.246  -15.802 -3.618  1.00 0.00 ? 50 GLN A OE1  4  
ATOM 4212  N NE2  . GLN A 1 50 ? -2.258  -13.990 -4.476  1.00 0.00 ? 50 GLN A NE2  4  
ATOM 4213  H H    . GLN A 1 50 ? 3.015   -15.341 -3.694  1.00 0.00 ? 50 GLN A H    4  
ATOM 4214  H HA   . GLN A 1 50 ? 2.367   -12.622 -4.340  1.00 0.00 ? 50 GLN A HA   4  
ATOM 4215  H HB2  . GLN A 1 50 ? 1.079   -14.763 -2.681  1.00 0.00 ? 50 GLN A HB2  4  
ATOM 4216  H HB3  . GLN A 1 50 ? 0.499   -13.106 -2.593  1.00 0.00 ? 50 GLN A HB3  4  
ATOM 4217  H HG2  . GLN A 1 50 ? -0.012  -13.107 -4.942  1.00 0.00 ? 50 GLN A HG2  4  
ATOM 4218  H HG3  . GLN A 1 50 ? 0.703   -14.707 -5.132  1.00 0.00 ? 50 GLN A HG3  4  
ATOM 4219  H HE21 . GLN A 1 50 ? -2.129  -13.113 -4.896  1.00 0.00 ? 50 GLN A HE21 4  
ATOM 4220  H HE22 . GLN A 1 50 ? -3.137  -14.376 -4.286  1.00 0.00 ? 50 GLN A HE22 4  
ATOM 4221  N N    . VAL A 1 51 ? 3.586   -13.364 -1.394  1.00 0.00 ? 51 VAL A N    4  
ATOM 4222  C CA   . VAL A 1 51 ? 4.170   -12.801 -0.183  1.00 0.00 ? 51 VAL A CA   4  
ATOM 4223  C C    . VAL A 1 51 ? 5.594   -12.316 -0.433  1.00 0.00 ? 51 VAL A C    4  
ATOM 4224  O O    . VAL A 1 51 ? 6.132   -11.513 0.330   1.00 0.00 ? 51 VAL A O    4  
ATOM 4225  C CB   . VAL A 1 51 ? 4.183   -13.828 0.964   1.00 0.00 ? 51 VAL A CB   4  
ATOM 4226  C CG1  . VAL A 1 51 ? 4.804   -13.224 2.215   1.00 0.00 ? 51 VAL A CG1  4  
ATOM 4227  C CG2  . VAL A 1 51 ? 2.775   -14.328 1.247   1.00 0.00 ? 51 VAL A CG2  4  
ATOM 4228  H H    . VAL A 1 51 ? 3.643   -14.331 -1.547  1.00 0.00 ? 51 VAL A H    4  
ATOM 4229  H HA   . VAL A 1 51 ? 3.562   -11.961 0.121   1.00 0.00 ? 51 VAL A HA   4  
ATOM 4230  H HB   . VAL A 1 51 ? 4.788   -14.670 0.660   1.00 0.00 ? 51 VAL A HB   4  
ATOM 4231  H HG11 . VAL A 1 51 ? 4.280   -12.316 2.474   1.00 0.00 ? 51 VAL A HG11 4  
ATOM 4232  H HG12 . VAL A 1 51 ? 4.732   -13.929 3.030   1.00 0.00 ? 51 VAL A HG12 4  
ATOM 4233  H HG13 . VAL A 1 51 ? 5.843   -12.997 2.026   1.00 0.00 ? 51 VAL A HG13 4  
ATOM 4234  H HG21 . VAL A 1 51 ? 2.712   -14.666 2.271   1.00 0.00 ? 51 VAL A HG21 4  
ATOM 4235  H HG22 . VAL A 1 51 ? 2.069   -13.526 1.090   1.00 0.00 ? 51 VAL A HG22 4  
ATOM 4236  H HG23 . VAL A 1 51 ? 2.543   -15.147 0.582   1.00 0.00 ? 51 VAL A HG23 4  
ATOM 4237  N N    . LYS A 1 52 ? 6.200   -12.808 -1.508  1.00 0.00 ? 52 LYS A N    4  
ATOM 4238  C CA   . LYS A 1 52 ? 7.562   -12.425 -1.862  1.00 0.00 ? 52 LYS A CA   4  
ATOM 4239  C C    . LYS A 1 52 ? 7.564   -11.184 -2.749  1.00 0.00 ? 52 LYS A C    4  
ATOM 4240  O O    . LYS A 1 52 ? 8.491   -10.374 -2.699  1.00 0.00 ? 52 LYS A O    4  
ATOM 4241  C CB   . LYS A 1 52 ? 8.268   -13.578 -2.578  1.00 0.00 ? 52 LYS A CB   4  
ATOM 4242  C CG   . LYS A 1 52 ? 8.088   -13.560 -4.086  1.00 0.00 ? 52 LYS A CG   4  
ATOM 4243  C CD   . LYS A 1 52 ? 9.147   -12.707 -4.764  1.00 0.00 ? 52 LYS A CD   4  
ATOM 4244  C CE   . LYS A 1 52 ? 9.435   -13.194 -6.176  1.00 0.00 ? 52 LYS A CE   4  
ATOM 4245  N NZ   . LYS A 1 52 ? 10.171  -12.175 -6.975  1.00 0.00 ? 52 LYS A NZ   4  
ATOM 4246  H H    . LYS A 1 52 ? 5.719   -13.445 -2.078  1.00 0.00 ? 52 LYS A H    4  
ATOM 4247  H HA   . LYS A 1 52 ? 8.091   -12.201 -0.948  1.00 0.00 ? 52 LYS A HA   4  
ATOM 4248  H HB2  . LYS A 1 52 ? 9.325   -13.526 -2.362  1.00 0.00 ? 52 LYS A HB2  4  
ATOM 4249  H HB3  . LYS A 1 52 ? 7.878   -14.513 -2.201  1.00 0.00 ? 52 LYS A HB3  4  
ATOM 4250  H HG2  . LYS A 1 52 ? 8.160   -14.570 -4.461  1.00 0.00 ? 52 LYS A HG2  4  
ATOM 4251  H HG3  . LYS A 1 52 ? 7.112   -13.157 -4.317  1.00 0.00 ? 52 LYS A HG3  4  
ATOM 4252  H HD2  . LYS A 1 52 ? 8.798   -11.686 -4.812  1.00 0.00 ? 52 LYS A HD2  4  
ATOM 4253  H HD3  . LYS A 1 52 ? 10.058  -12.751 -4.184  1.00 0.00 ? 52 LYS A HD3  4  
ATOM 4254  H HE2  . LYS A 1 52 ? 10.031  -14.092 -6.118  1.00 0.00 ? 52 LYS A HE2  4  
ATOM 4255  H HE3  . LYS A 1 52 ? 8.498   -13.415 -6.665  1.00 0.00 ? 52 LYS A HE3  4  
ATOM 4256  H HZ1  . LYS A 1 52 ? 10.425  -11.365 -6.374  1.00 0.00 ? 52 LYS A HZ1  4  
ATOM 4257  H HZ2  . LYS A 1 52 ? 9.576   -11.838 -7.758  1.00 0.00 ? 52 LYS A HZ2  4  
ATOM 4258  H HZ3  . LYS A 1 52 ? 11.041  -12.589 -7.367  1.00 0.00 ? 52 LYS A HZ3  4  
ATOM 4259  N N    . THR A 1 53 ? 6.521   -11.039 -3.560  1.00 0.00 ? 53 THR A N    4  
ATOM 4260  C CA   . THR A 1 53 ? 6.403   -9.897  -4.457  1.00 0.00 ? 53 THR A CA   4  
ATOM 4261  C C    . THR A 1 53 ? 5.854   -8.677  -3.726  1.00 0.00 ? 53 THR A C    4  
ATOM 4262  O O    . THR A 1 53 ? 6.426   -7.590  -3.798  1.00 0.00 ? 53 THR A O    4  
ATOM 4263  C CB   . THR A 1 53 ? 5.491   -10.216 -5.657  1.00 0.00 ? 53 THR A CB   4  
ATOM 4264  O OG1  . THR A 1 53 ? 6.190   -11.036 -6.600  1.00 0.00 ? 53 THR A OG1  4  
ATOM 4265  C CG2  . THR A 1 53 ? 5.023   -8.938  -6.336  1.00 0.00 ? 53 THR A CG2  4  
ATOM 4266  H H    . THR A 1 53 ? 5.815   -11.718 -3.554  1.00 0.00 ? 53 THR A H    4  
ATOM 4267  H HA   . THR A 1 53 ? 7.389   -9.665  -4.834  1.00 0.00 ? 53 THR A HA   4  
ATOM 4268  H HB   . THR A 1 53 ? 4.625   -10.754 -5.297  1.00 0.00 ? 53 THR A HB   4  
ATOM 4269  H HG1  . THR A 1 53 ? 5.758   -10.979 -7.456  1.00 0.00 ? 53 THR A HG1  4  
ATOM 4270  H HG21 . THR A 1 53 ? 5.852   -8.252  -6.422  1.00 0.00 ? 53 THR A HG21 4  
ATOM 4271  H HG22 . THR A 1 53 ? 4.239   -8.484  -5.749  1.00 0.00 ? 53 THR A HG22 4  
ATOM 4272  H HG23 . THR A 1 53 ? 4.646   -9.172  -7.321  1.00 0.00 ? 53 THR A HG23 4  
ATOM 4273  N N    . TRP A 1 54 ? 4.743   -8.866  -3.023  1.00 0.00 ? 54 TRP A N    4  
ATOM 4274  C CA   . TRP A 1 54 ? 4.117   -7.780  -2.278  1.00 0.00 ? 54 TRP A CA   4  
ATOM 4275  C C    . TRP A 1 54 ? 5.146   -7.033  -1.437  1.00 0.00 ? 54 TRP A C    4  
ATOM 4276  O O    . TRP A 1 54 ? 5.385   -5.843  -1.643  1.00 0.00 ? 54 TRP A O    4  
ATOM 4277  C CB   . TRP A 1 54 ? 3.005   -8.325  -1.380  1.00 0.00 ? 54 TRP A CB   4  
ATOM 4278  C CG   . TRP A 1 54 ? 2.150   -7.252  -0.775  1.00 0.00 ? 54 TRP A CG   4  
ATOM 4279  C CD1  . TRP A 1 54 ? 1.004   -6.725  -1.298  1.00 0.00 ? 54 TRP A CD1  4  
ATOM 4280  C CD2  . TRP A 1 54 ? 2.376   -6.576  0.466   1.00 0.00 ? 54 TRP A CD2  4  
ATOM 4281  N NE1  . TRP A 1 54 ? 0.504   -5.761  -0.456  1.00 0.00 ? 54 TRP A NE1  4  
ATOM 4282  C CE2  . TRP A 1 54 ? 1.326   -5.651  0.633   1.00 0.00 ? 54 TRP A CE2  4  
ATOM 4283  C CE3  . TRP A 1 54 ? 3.361   -6.662  1.454   1.00 0.00 ? 54 TRP A CE3  4  
ATOM 4284  C CZ2  . TRP A 1 54 ? 1.237   -4.820  1.747   1.00 0.00 ? 54 TRP A CZ2  4  
ATOM 4285  C CZ3  . TRP A 1 54 ? 3.271   -5.836  2.558   1.00 0.00 ? 54 TRP A CZ3  4  
ATOM 4286  C CH2  . TRP A 1 54 ? 2.215   -4.926  2.698   1.00 0.00 ? 54 TRP A CH2  4  
ATOM 4287  H H    . TRP A 1 54 ? 4.334   -9.757  -3.005  1.00 0.00 ? 54 TRP A H    4  
ATOM 4288  H HA   . TRP A 1 54 ? 3.686   -7.094  -2.992  1.00 0.00 ? 54 TRP A HA   4  
ATOM 4289  H HB2  . TRP A 1 54 ? 2.365   -8.972  -1.962  1.00 0.00 ? 54 TRP A HB2  4  
ATOM 4290  H HB3  . TRP A 1 54 ? 3.448   -8.893  -0.575  1.00 0.00 ? 54 TRP A HB3  4  
ATOM 4291  H HD1  . TRP A 1 54 ? 0.568   -7.030  -2.237  1.00 0.00 ? 54 TRP A HD1  4  
ATOM 4292  H HE1  . TRP A 1 54 ? -0.311  -5.239  -0.611  1.00 0.00 ? 54 TRP A HE1  4  
ATOM 4293  H HE3  . TRP A 1 54 ? 4.183   -7.357  1.364   1.00 0.00 ? 54 TRP A HE3  4  
ATOM 4294  H HZ2  . TRP A 1 54 ? 0.429   -4.113  1.869   1.00 0.00 ? 54 TRP A HZ2  4  
ATOM 4295  H HZ3  . TRP A 1 54 ? 4.024   -5.888  3.331   1.00 0.00 ? 54 TRP A HZ3  4  
ATOM 4296  H HH2  . TRP A 1 54 ? 2.186   -4.300  3.577   1.00 0.00 ? 54 TRP A HH2  4  
ATOM 4297  N N    . PHE A 1 55 ? 5.753   -7.738  -0.488  1.00 0.00 ? 55 PHE A N    4  
ATOM 4298  C CA   . PHE A 1 55 ? 6.756   -7.141  0.385   1.00 0.00 ? 55 PHE A CA   4  
ATOM 4299  C C    . PHE A 1 55 ? 7.751   -6.309  -0.419  1.00 0.00 ? 55 PHE A C    4  
ATOM 4300  O O    . PHE A 1 55 ? 8.011   -5.150  -0.096  1.00 0.00 ? 55 PHE A O    4  
ATOM 4301  C CB   . PHE A 1 55 ? 7.497   -8.229  1.165   1.00 0.00 ? 55 PHE A CB   4  
ATOM 4302  C CG   . PHE A 1 55 ? 6.762   -8.694  2.390   1.00 0.00 ? 55 PHE A CG   4  
ATOM 4303  C CD1  . PHE A 1 55 ? 5.606   -9.449  2.275   1.00 0.00 ? 55 PHE A CD1  4  
ATOM 4304  C CD2  . PHE A 1 55 ? 7.228   -8.376  3.656   1.00 0.00 ? 55 PHE A CD2  4  
ATOM 4305  C CE1  . PHE A 1 55 ? 4.928   -9.879  3.400   1.00 0.00 ? 55 PHE A CE1  4  
ATOM 4306  C CE2  . PHE A 1 55 ? 6.554   -8.804  4.784   1.00 0.00 ? 55 PHE A CE2  4  
ATOM 4307  C CZ   . PHE A 1 55 ? 5.402   -9.555  4.656   1.00 0.00 ? 55 PHE A CZ   4  
ATOM 4308  H H    . PHE A 1 55 ? 5.520   -8.684  -0.372  1.00 0.00 ? 55 PHE A H    4  
ATOM 4309  H HA   . PHE A 1 55 ? 6.246   -6.495  1.082   1.00 0.00 ? 55 PHE A HA   4  
ATOM 4310  H HB2  . PHE A 1 55 ? 7.646   -9.084  0.523   1.00 0.00 ? 55 PHE A HB2  4  
ATOM 4311  H HB3  . PHE A 1 55 ? 8.457   -7.847  1.478   1.00 0.00 ? 55 PHE A HB3  4  
ATOM 4312  H HD1  . PHE A 1 55 ? 5.234   -9.703  1.292   1.00 0.00 ? 55 PHE A HD1  4  
ATOM 4313  H HD2  . PHE A 1 55 ? 8.128   -7.788  3.757   1.00 0.00 ? 55 PHE A HD2  4  
ATOM 4314  H HE1  . PHE A 1 55 ? 4.027   -10.466 3.296   1.00 0.00 ? 55 PHE A HE1  4  
ATOM 4315  H HE2  . PHE A 1 55 ? 6.926   -8.549  5.765   1.00 0.00 ? 55 PHE A HE2  4  
ATOM 4316  H HZ   . PHE A 1 55 ? 4.874   -9.891  5.536   1.00 0.00 ? 55 PHE A HZ   4  
ATOM 4317  N N    . GLN A 1 56 ? 8.305   -6.910  -1.468  1.00 0.00 ? 56 GLN A N    4  
ATOM 4318  C CA   . GLN A 1 56 ? 9.272   -6.226  -2.317  1.00 0.00 ? 56 GLN A CA   4  
ATOM 4319  C C    . GLN A 1 56 ? 8.723   -4.886  -2.796  1.00 0.00 ? 56 GLN A C    4  
ATOM 4320  O O    . GLN A 1 56 ? 9.343   -3.843  -2.594  1.00 0.00 ? 56 GLN A O    4  
ATOM 4321  C CB   . GLN A 1 56 ? 9.636   -7.100  -3.519  1.00 0.00 ? 56 GLN A CB   4  
ATOM 4322  C CG   . GLN A 1 56 ? 10.760  -8.084  -3.237  1.00 0.00 ? 56 GLN A CG   4  
ATOM 4323  C CD   . GLN A 1 56 ? 11.334  -8.692  -4.501  1.00 0.00 ? 56 GLN A CD   4  
ATOM 4324  O OE1  . GLN A 1 56 ? 11.433  -9.913  -4.627  1.00 0.00 ? 56 GLN A OE1  4  
ATOM 4325  N NE2  . GLN A 1 56 ? 11.716  -7.842  -5.447  1.00 0.00 ? 56 GLN A NE2  4  
ATOM 4326  H H    . GLN A 1 56 ? 8.057   -7.835  -1.674  1.00 0.00 ? 56 GLN A H    4  
ATOM 4327  H HA   . GLN A 1 56 ? 10.161  -6.048  -1.731  1.00 0.00 ? 56 GLN A HA   4  
ATOM 4328  H HB2  . GLN A 1 56 ? 8.763   -7.660  -3.819  1.00 0.00 ? 56 GLN A HB2  4  
ATOM 4329  H HB3  . GLN A 1 56 ? 9.942   -6.462  -4.334  1.00 0.00 ? 56 GLN A HB3  4  
ATOM 4330  H HG2  . GLN A 1 56 ? 11.551  -7.568  -2.713  1.00 0.00 ? 56 GLN A HG2  4  
ATOM 4331  H HG3  . GLN A 1 56 ? 10.377  -8.879  -2.614  1.00 0.00 ? 56 GLN A HG3  4  
ATOM 4332  H HE21 . GLN A 1 56 ? 11.608  -6.882  -5.277  1.00 0.00 ? 56 GLN A HE21 4  
ATOM 4333  H HE22 . GLN A 1 56 ? 12.091  -8.207  -6.274  1.00 0.00 ? 56 GLN A HE22 4  
ATOM 4334  N N    . ASN A 1 57 ? 7.557   -4.923  -3.433  1.00 0.00 ? 57 ASN A N    4  
ATOM 4335  C CA   . ASN A 1 57 ? 6.926   -3.711  -3.942  1.00 0.00 ? 57 ASN A CA   4  
ATOM 4336  C C    . ASN A 1 57 ? 6.702   -2.702  -2.820  1.00 0.00 ? 57 ASN A C    4  
ATOM 4337  O O    . ASN A 1 57 ? 7.126   -1.550  -2.914  1.00 0.00 ? 57 ASN A O    4  
ATOM 4338  C CB   . ASN A 1 57 ? 5.592   -4.049  -4.613  1.00 0.00 ? 57 ASN A CB   4  
ATOM 4339  C CG   . ASN A 1 57 ? 5.762   -4.455  -6.064  1.00 0.00 ? 57 ASN A CG   4  
ATOM 4340  O OD1  . ASN A 1 57 ? 5.476   -3.678  -6.975  1.00 0.00 ? 57 ASN A OD1  4  
ATOM 4341  N ND2  . ASN A 1 57 ? 6.229   -5.678  -6.285  1.00 0.00 ? 57 ASN A ND2  4  
ATOM 4342  H H    . ASN A 1 57 ? 7.111   -5.786  -3.564  1.00 0.00 ? 57 ASN A H    4  
ATOM 4343  H HA   . ASN A 1 57 ? 7.587   -3.276  -4.676  1.00 0.00 ? 57 ASN A HA   4  
ATOM 4344  H HB2  . ASN A 1 57 ? 5.127   -4.867  -4.082  1.00 0.00 ? 57 ASN A HB2  4  
ATOM 4345  H HB3  . ASN A 1 57 ? 4.946   -3.185  -4.573  1.00 0.00 ? 57 ASN A HB3  4  
ATOM 4346  H HD21 . ASN A 1 57 ? 6.436   -6.242  -5.511  1.00 0.00 ? 57 ASN A HD21 4  
ATOM 4347  H HD22 . ASN A 1 57 ? 6.349   -5.967  -7.214  1.00 0.00 ? 57 ASN A HD22 4  
ATOM 4348  N N    . ARG A 1 58 ? 6.033   -3.143  -1.760  1.00 0.00 ? 58 ARG A N    4  
ATOM 4349  C CA   . ARG A 1 58 ? 5.752   -2.279  -0.620  1.00 0.00 ? 58 ARG A CA   4  
ATOM 4350  C C    . ARG A 1 58 ? 6.987   -1.470  -0.233  1.00 0.00 ? 58 ARG A C    4  
ATOM 4351  O O    . ARG A 1 58 ? 6.934   -0.243  -0.141  1.00 0.00 ? 58 ARG A O    4  
ATOM 4352  C CB   . ARG A 1 58 ? 5.280   -3.110  0.574   1.00 0.00 ? 58 ARG A CB   4  
ATOM 4353  C CG   . ARG A 1 58 ? 4.641   -2.284  1.678   1.00 0.00 ? 58 ARG A CG   4  
ATOM 4354  C CD   . ARG A 1 58 ? 3.435   -1.510  1.167   1.00 0.00 ? 58 ARG A CD   4  
ATOM 4355  N NE   . ARG A 1 58 ? 2.531   -2.355  0.392   1.00 0.00 ? 58 ARG A NE   4  
ATOM 4356  C CZ   . ARG A 1 58 ? 1.465   -1.893  -0.253  1.00 0.00 ? 58 ARG A CZ   4  
ATOM 4357  N NH1  . ARG A 1 58 ? 1.172   -0.600  -0.215  1.00 0.00 ? 58 ARG A NH1  4  
ATOM 4358  N NH2  . ARG A 1 58 ? 0.690   -2.725  -0.937  1.00 0.00 ? 58 ARG A NH2  4  
ATOM 4359  H H    . ARG A 1 58 ? 5.720   -4.072  -1.744  1.00 0.00 ? 58 ARG A H    4  
ATOM 4360  H HA   . ARG A 1 58 ? 4.965   -1.597  -0.906  1.00 0.00 ? 58 ARG A HA   4  
ATOM 4361  H HB2  . ARG A 1 58 ? 4.555   -3.833  0.230   1.00 0.00 ? 58 ARG A HB2  4  
ATOM 4362  H HB3  . ARG A 1 58 ? 6.127   -3.633  0.991   1.00 0.00 ? 58 ARG A HB3  4  
ATOM 4363  H HG2  . ARG A 1 58 ? 4.321   -2.944  2.470   1.00 0.00 ? 58 ARG A HG2  4  
ATOM 4364  H HG3  . ARG A 1 58 ? 5.370   -1.586  2.060   1.00 0.00 ? 58 ARG A HG3  4  
ATOM 4365  H HD2  . ARG A 1 58 ? 2.899   -1.106  2.013   1.00 0.00 ? 58 ARG A HD2  4  
ATOM 4366  H HD3  . ARG A 1 58 ? 3.782   -0.701  0.542   1.00 0.00 ? 58 ARG A HD3  4  
ATOM 4367  H HE   . ARG A 1 58 ? 2.728   -3.313  0.351   1.00 0.00 ? 58 ARG A HE   4  
ATOM 4368  H HH11 . ARG A 1 58 ? 1.755   0.029   0.299   1.00 0.00 ? 58 ARG A HH11 4  
ATOM 4369  H HH12 . ARG A 1 58 ? 0.370   -0.255  -0.702  1.00 0.00 ? 58 ARG A HH12 4  
ATOM 4370  H HH21 . ARG A 1 58 ? 0.908   -3.700  -0.967  1.00 0.00 ? 58 ARG A HH21 4  
ATOM 4371  H HH22 . ARG A 1 58 ? -0.112  -2.376  -1.421  1.00 0.00 ? 58 ARG A HH22 4  
ATOM 4372  N N    . ARG A 1 59 ? 8.097   -2.166  -0.008  1.00 0.00 ? 59 ARG A N    4  
ATOM 4373  C CA   . ARG A 1 59 ? 9.344   -1.513  0.371   1.00 0.00 ? 59 ARG A CA   4  
ATOM 4374  C C    . ARG A 1 59 ? 9.571   -0.252  -0.459  1.00 0.00 ? 59 ARG A C    4  
ATOM 4375  O O    . ARG A 1 59 ? 9.626   0.854   0.077   1.00 0.00 ? 59 ARG A O    4  
ATOM 4376  C CB   . ARG A 1 59 ? 10.522  -2.473  0.192   1.00 0.00 ? 59 ARG A CB   4  
ATOM 4377  C CG   . ARG A 1 59 ? 11.698  -2.170  1.105   1.00 0.00 ? 59 ARG A CG   4  
ATOM 4378  C CD   . ARG A 1 59 ? 12.814  -3.189  0.932   1.00 0.00 ? 59 ARG A CD   4  
ATOM 4379  N NE   . ARG A 1 59 ? 13.739  -2.812  -0.133  1.00 0.00 ? 59 ARG A NE   4  
ATOM 4380  C CZ   . ARG A 1 59 ? 13.542  -3.102  -1.414  1.00 0.00 ? 59 ARG A CZ   4  
ATOM 4381  N NH1  . ARG A 1 59 ? 12.459  -3.768  -1.787  1.00 0.00 ? 59 ARG A NH1  4  
ATOM 4382  N NH2  . ARG A 1 59 ? 14.430  -2.725  -2.325  1.00 0.00 ? 59 ARG A NH2  4  
ATOM 4383  H H    . ARG A 1 59 ? 8.076   -3.142  -0.097  1.00 0.00 ? 59 ARG A H    4  
ATOM 4384  H HA   . ARG A 1 59 ? 9.272   -1.236  1.412   1.00 0.00 ? 59 ARG A HA   4  
ATOM 4385  H HB2  . ARG A 1 59 ? 10.185  -3.479  0.397   1.00 0.00 ? 59 ARG A HB2  4  
ATOM 4386  H HB3  . ARG A 1 59 ? 10.863  -2.418  -0.830  1.00 0.00 ? 59 ARG A HB3  4  
ATOM 4387  H HG2  . ARG A 1 59 ? 12.082  -1.189  0.868   1.00 0.00 ? 59 ARG A HG2  4  
ATOM 4388  H HG3  . ARG A 1 59 ? 11.361  -2.189  2.131   1.00 0.00 ? 59 ARG A HG3  4  
ATOM 4389  H HD2  . ARG A 1 59 ? 13.361  -3.265  1.860   1.00 0.00 ? 59 ARG A HD2  4  
ATOM 4390  H HD3  . ARG A 1 59 ? 12.375  -4.146  0.694   1.00 0.00 ? 59 ARG A HD3  4  
ATOM 4391  H HE   . ARG A 1 59 ? 14.547  -2.319  0.121   1.00 0.00 ? 59 ARG A HE   4  
ATOM 4392  H HH11 . ARG A 1 59 ? 11.787  -4.053  -1.103  1.00 0.00 ? 59 ARG A HH11 4  
ATOM 4393  H HH12 . ARG A 1 59 ? 12.312  -3.985  -2.753  1.00 0.00 ? 59 ARG A HH12 4  
ATOM 4394  H HH21 . ARG A 1 59 ? 15.248  -2.222  -2.048  1.00 0.00 ? 59 ARG A HH21 4  
ATOM 4395  H HH22 . ARG A 1 59 ? 14.281  -2.944  -3.289  1.00 0.00 ? 59 ARG A HH22 4  
ATOM 4396  N N    . ALA A 1 60 ? 9.704   -0.429  -1.769  1.00 0.00 ? 60 ALA A N    4  
ATOM 4397  C CA   . ALA A 1 60 ? 9.923   0.694   -2.673  1.00 0.00 ? 60 ALA A CA   4  
ATOM 4398  C C    . ALA A 1 60 ? 9.103   1.908   -2.250  1.00 0.00 ? 60 ALA A C    4  
ATOM 4399  O O    . ALA A 1 60 ? 9.572   3.044   -2.323  1.00 0.00 ? 60 ALA A O    4  
ATOM 4400  C CB   . ALA A 1 60 ? 9.583   0.296   -4.101  1.00 0.00 ? 60 ALA A CB   4  
ATOM 4401  H H    . ALA A 1 60 ? 9.651   -1.335  -2.137  1.00 0.00 ? 60 ALA A H    4  
ATOM 4402  H HA   . ALA A 1 60 ? 10.972  0.951   -2.637  1.00 0.00 ? 60 ALA A HA   4  
ATOM 4403  H HB1  . ALA A 1 60 ? 10.076  -0.635  -4.342  1.00 0.00 ? 60 ALA A HB1  4  
ATOM 4404  H HB2  . ALA A 1 60 ? 8.514   0.173   -4.196  1.00 0.00 ? 60 ALA A HB2  4  
ATOM 4405  H HB3  . ALA A 1 60 ? 9.919   1.067   -4.779  1.00 0.00 ? 60 ALA A HB3  4  
ATOM 4406  N N    . LYS A 1 61 ? 7.874   1.661   -1.808  1.00 0.00 ? 61 LYS A N    4  
ATOM 4407  C CA   . LYS A 1 61 ? 6.988   2.733   -1.372  1.00 0.00 ? 61 LYS A CA   4  
ATOM 4408  C C    . LYS A 1 61 ? 7.362   3.215   0.025   1.00 0.00 ? 61 LYS A C    4  
ATOM 4409  O O    . LYS A 1 61 ? 7.427   4.417   0.281   1.00 0.00 ? 61 LYS A O    4  
ATOM 4410  C CB   . LYS A 1 61 ? 5.533   2.257   -1.387  1.00 0.00 ? 61 LYS A CB   4  
ATOM 4411  C CG   . LYS A 1 61 ? 4.833   2.480   -2.716  1.00 0.00 ? 61 LYS A CG   4  
ATOM 4412  C CD   . LYS A 1 61 ? 5.036   1.305   -3.657  1.00 0.00 ? 61 LYS A CD   4  
ATOM 4413  C CE   . LYS A 1 61 ? 4.040   0.190   -3.379  1.00 0.00 ? 61 LYS A CE   4  
ATOM 4414  N NZ   . LYS A 1 61 ? 4.208   -0.952  -4.320  1.00 0.00 ? 61 LYS A NZ   4  
ATOM 4415  H H    . LYS A 1 61 ? 7.556   0.734   -1.773  1.00 0.00 ? 61 LYS A H    4  
ATOM 4416  H HA   . LYS A 1 61 ? 7.096   3.555   -2.064  1.00 0.00 ? 61 LYS A HA   4  
ATOM 4417  H HB2  . LYS A 1 61 ? 5.510   1.201   -1.164  1.00 0.00 ? 61 LYS A HB2  4  
ATOM 4418  H HB3  . LYS A 1 61 ? 4.985   2.789   -0.622  1.00 0.00 ? 61 LYS A HB3  4  
ATOM 4419  H HG2  . LYS A 1 61 ? 3.776   2.607   -2.539  1.00 0.00 ? 61 LYS A HG2  4  
ATOM 4420  H HG3  . LYS A 1 61 ? 5.233   3.372   -3.178  1.00 0.00 ? 61 LYS A HG3  4  
ATOM 4421  H HD2  . LYS A 1 61 ? 4.906   1.642   -4.675  1.00 0.00 ? 61 LYS A HD2  4  
ATOM 4422  H HD3  . LYS A 1 61 ? 6.039   0.921   -3.529  1.00 0.00 ? 61 LYS A HD3  4  
ATOM 4423  H HE2  . LYS A 1 61 ? 4.187   -0.163  -2.370  1.00 0.00 ? 61 LYS A HE2  4  
ATOM 4424  H HE3  . LYS A 1 61 ? 3.040   0.585   -3.480  1.00 0.00 ? 61 LYS A HE3  4  
ATOM 4425  H HZ1  . LYS A 1 61 ? 3.594   -1.742  -4.036  1.00 0.00 ? 61 LYS A HZ1  4  
ATOM 4426  H HZ2  . LYS A 1 61 ? 5.196   -1.277  -4.316  1.00 0.00 ? 61 LYS A HZ2  4  
ATOM 4427  H HZ3  . LYS A 1 61 ? 3.955   -0.660  -5.286  1.00 0.00 ? 61 LYS A HZ3  4  
ATOM 4428  N N    . TRP A 1 62 ? 7.609   2.270   0.925   1.00 0.00 ? 62 TRP A N    4  
ATOM 4429  C CA   . TRP A 1 62 ? 7.979   2.599   2.297   1.00 0.00 ? 62 TRP A CA   4  
ATOM 4430  C C    . TRP A 1 62 ? 9.160   3.562   2.326   1.00 0.00 ? 62 TRP A C    4  
ATOM 4431  O O    . TRP A 1 62 ? 9.121   4.587   3.007   1.00 0.00 ? 62 TRP A O    4  
ATOM 4432  C CB   . TRP A 1 62 ? 8.322   1.327   3.074   1.00 0.00 ? 62 TRP A CB   4  
ATOM 4433  C CG   . TRP A 1 62 ? 9.213   1.573   4.254   1.00 0.00 ? 62 TRP A CG   4  
ATOM 4434  C CD1  . TRP A 1 62 ? 8.861   2.152   5.439   1.00 0.00 ? 62 TRP A CD1  4  
ATOM 4435  C CD2  . TRP A 1 62 ? 10.604  1.250   4.360   1.00 0.00 ? 62 TRP A CD2  4  
ATOM 4436  N NE1  . TRP A 1 62 ? 9.950   2.208   6.276   1.00 0.00 ? 62 TRP A NE1  4  
ATOM 4437  C CE2  . TRP A 1 62 ? 11.031  1.660   5.638   1.00 0.00 ? 62 TRP A CE2  4  
ATOM 4438  C CE3  . TRP A 1 62 ? 11.529  0.652   3.500   1.00 0.00 ? 62 TRP A CE3  4  
ATOM 4439  C CZ2  . TRP A 1 62 ? 12.342  1.492   6.074   1.00 0.00 ? 62 TRP A CZ2  4  
ATOM 4440  C CZ3  . TRP A 1 62 ? 12.831  0.486   3.934   1.00 0.00 ? 62 TRP A CZ3  4  
ATOM 4441  C CH2  . TRP A 1 62 ? 13.227  0.904   5.212   1.00 0.00 ? 62 TRP A CH2  4  
ATOM 4442  H H    . TRP A 1 62 ? 7.541   1.328   0.661   1.00 0.00 ? 62 TRP A H    4  
ATOM 4443  H HA   . TRP A 1 62 ? 7.129   3.076   2.763   1.00 0.00 ? 62 TRP A HA   4  
ATOM 4444  H HB2  . TRP A 1 62 ? 7.410   0.875   3.434   1.00 0.00 ? 62 TRP A HB2  4  
ATOM 4445  H HB3  . TRP A 1 62 ? 8.826   0.636   2.413   1.00 0.00 ? 62 TRP A HB3  4  
ATOM 4446  H HD1  . TRP A 1 62 ? 7.870   2.511   5.670   1.00 0.00 ? 62 TRP A HD1  4  
ATOM 4447  H HE1  . TRP A 1 62 ? 9.951   2.579   7.184   1.00 0.00 ? 62 TRP A HE1  4  
ATOM 4448  H HE3  . TRP A 1 62 ? 11.243  0.323   2.512   1.00 0.00 ? 62 TRP A HE3  4  
ATOM 4449  H HZ2  . TRP A 1 62 ? 12.663  1.808   7.056   1.00 0.00 ? 62 TRP A HZ2  4  
ATOM 4450  H HZ3  . TRP A 1 62 ? 13.560  0.026   3.284   1.00 0.00 ? 62 TRP A HZ3  4  
ATOM 4451  H HH2  . TRP A 1 62 ? 14.254  0.754   5.509   1.00 0.00 ? 62 TRP A HH2  4  
ATOM 4452  N N    . ARG A 1 63 ? 10.210  3.226   1.584   1.00 0.00 ? 63 ARG A N    4  
ATOM 4453  C CA   . ARG A 1 63 ? 11.404  4.061   1.527   1.00 0.00 ? 63 ARG A CA   4  
ATOM 4454  C C    . ARG A 1 63 ? 11.040  5.507   1.201   1.00 0.00 ? 63 ARG A C    4  
ATOM 4455  O O    . ARG A 1 63 ? 11.259  6.410   2.009   1.00 0.00 ? 63 ARG A O    4  
ATOM 4456  C CB   . ARG A 1 63 ? 12.380  3.521   0.480   1.00 0.00 ? 63 ARG A CB   4  
ATOM 4457  C CG   . ARG A 1 63 ? 13.092  2.249   0.910   1.00 0.00 ? 63 ARG A CG   4  
ATOM 4458  C CD   . ARG A 1 63 ? 14.354  2.015   0.095   1.00 0.00 ? 63 ARG A CD   4  
ATOM 4459  N NE   . ARG A 1 63 ? 15.473  2.824   0.572   1.00 0.00 ? 63 ARG A NE   4  
ATOM 4460  C CZ   . ARG A 1 63 ? 16.713  2.706   0.112   1.00 0.00 ? 63 ARG A CZ   4  
ATOM 4461  N NH1  . ARG A 1 63 ? 16.993  1.818   -0.832  1.00 0.00 ? 63 ARG A NH1  4  
ATOM 4462  N NH2  . ARG A 1 63 ? 17.677  3.479   0.596   1.00 0.00 ? 63 ARG A NH2  4  
ATOM 4463  H H    . ARG A 1 63 ? 10.182  2.396   1.064   1.00 0.00 ? 63 ARG A H    4  
ATOM 4464  H HA   . ARG A 1 63 ? 11.877  4.032   2.497   1.00 0.00 ? 63 ARG A HA   4  
ATOM 4465  H HB2  . ARG A 1 63 ? 11.836  3.313   -0.429  1.00 0.00 ? 63 ARG A HB2  4  
ATOM 4466  H HB3  . ARG A 1 63 ? 13.126  4.275   0.279   1.00 0.00 ? 63 ARG A HB3  4  
ATOM 4467  H HG2  . ARG A 1 63 ? 13.361  2.333   1.953   1.00 0.00 ? 63 ARG A HG2  4  
ATOM 4468  H HG3  . ARG A 1 63 ? 12.425  1.411   0.775   1.00 0.00 ? 63 ARG A HG3  4  
ATOM 4469  H HD2  . ARG A 1 63 ? 14.622  0.971   0.164   1.00 0.00 ? 63 ARG A HD2  4  
ATOM 4470  H HD3  . ARG A 1 63 ? 14.153  2.267   -0.936  1.00 0.00 ? 63 ARG A HD3  4  
ATOM 4471  H HE   . ARG A 1 63 ? 15.288  3.486   1.269   1.00 0.00 ? 63 ARG A HE   4  
ATOM 4472  H HH11 . ARG A 1 63 ? 16.268  1.236   -1.199  1.00 0.00 ? 63 ARG A HH11 4  
ATOM 4473  H HH12 . ARG A 1 63 ? 17.928  1.733   -1.177  1.00 0.00 ? 63 ARG A HH12 4  
ATOM 4474  H HH21 . ARG A 1 63 ? 17.470  4.150   1.308   1.00 0.00 ? 63 ARG A HH21 4  
ATOM 4475  H HH22 . ARG A 1 63 ? 18.611  3.390   0.250   1.00 0.00 ? 63 ARG A HH22 4  
ATOM 4476  N N    . ARG A 1 64 ? 10.485  5.719   0.012   1.00 0.00 ? 64 ARG A N    4  
ATOM 4477  C CA   . ARG A 1 64 ? 10.092  7.054   -0.421  1.00 0.00 ? 64 ARG A CA   4  
ATOM 4478  C C    . ARG A 1 64 ? 9.338   7.785   0.686   1.00 0.00 ? 64 ARG A C    4  
ATOM 4479  O O    . ARG A 1 64 ? 9.660   8.925   1.022   1.00 0.00 ? 64 ARG A O    4  
ATOM 4480  C CB   . ARG A 1 64 ? 9.223   6.972   -1.677  1.00 0.00 ? 64 ARG A CB   4  
ATOM 4481  C CG   . ARG A 1 64 ? 9.989   6.554   -2.921  1.00 0.00 ? 64 ARG A CG   4  
ATOM 4482  C CD   . ARG A 1 64 ? 10.855  7.686   -3.449  1.00 0.00 ? 64 ARG A CD   4  
ATOM 4483  N NE   . ARG A 1 64 ? 10.055  8.797   -3.956  1.00 0.00 ? 64 ARG A NE   4  
ATOM 4484  C CZ   . ARG A 1 64 ? 10.576  9.884   -4.515  1.00 0.00 ? 64 ARG A CZ   4  
ATOM 4485  N NH1  . ARG A 1 64 ? 11.890  10.004  -4.639  1.00 0.00 ? 64 ARG A NH1  4  
ATOM 4486  N NH2  . ARG A 1 64 ? 9.781   10.852  -4.953  1.00 0.00 ? 64 ARG A NH2  4  
ATOM 4487  H H    . ARG A 1 64 ? 10.335  4.958   -0.588  1.00 0.00 ? 64 ARG A H    4  
ATOM 4488  H HA   . ARG A 1 64 ? 10.992  7.606   -0.652  1.00 0.00 ? 64 ARG A HA   4  
ATOM 4489  H HB2  . ARG A 1 64 ? 8.435   6.253   -1.508  1.00 0.00 ? 64 ARG A HB2  4  
ATOM 4490  H HB3  . ARG A 1 64 ? 8.783   7.940   -1.860  1.00 0.00 ? 64 ARG A HB3  4  
ATOM 4491  H HG2  . ARG A 1 64 ? 10.623  5.714   -2.678  1.00 0.00 ? 64 ARG A HG2  4  
ATOM 4492  H HG3  . ARG A 1 64 ? 9.284   6.265   -3.686  1.00 0.00 ? 64 ARG A HG3  4  
ATOM 4493  H HD2  . ARG A 1 64 ? 11.483  8.045   -2.647  1.00 0.00 ? 64 ARG A HD2  4  
ATOM 4494  H HD3  . ARG A 1 64 ? 11.474  7.306   -4.248  1.00 0.00 ? 64 ARG A HD3  4  
ATOM 4495  H HE   . ARG A 1 64 ? 9.081   8.729   -3.875  1.00 0.00 ? 64 ARG A HE   4  
ATOM 4496  H HH11 . ARG A 1 64 ? 12.491  9.276   -4.311  1.00 0.00 ? 64 ARG A HH11 4  
ATOM 4497  H HH12 . ARG A 1 64 ? 12.280  10.823  -5.061  1.00 0.00 ? 64 ARG A HH12 4  
ATOM 4498  H HH21 . ARG A 1 64 ? 8.790   10.765  -4.862  1.00 0.00 ? 64 ARG A HH21 4  
ATOM 4499  H HH22 . ARG A 1 64 ? 10.175  11.669  -5.374  1.00 0.00 ? 64 ARG A HH22 4  
ATOM 4500  N N    . SER A 1 65 ? 8.332   7.122   1.247   1.00 0.00 ? 65 SER A N    4  
ATOM 4501  C CA   . SER A 1 65 ? 7.529   7.709   2.313   1.00 0.00 ? 65 SER A CA   4  
ATOM 4502  C C    . SER A 1 65 ? 8.365   7.917   3.572   1.00 0.00 ? 65 SER A C    4  
ATOM 4503  O O    . SER A 1 65 ? 8.111   8.831   4.356   1.00 0.00 ? 65 SER A O    4  
ATOM 4504  C CB   . SER A 1 65 ? 6.328   6.816   2.627   1.00 0.00 ? 65 SER A CB   4  
ATOM 4505  O OG   . SER A 1 65 ? 5.300   7.550   3.269   1.00 0.00 ? 65 SER A OG   4  
ATOM 4506  H H    . SER A 1 65 ? 8.124   6.216   0.936   1.00 0.00 ? 65 SER A H    4  
ATOM 4507  H HA   . SER A 1 65 ? 7.173   8.669   1.969   1.00 0.00 ? 65 SER A HA   4  
ATOM 4508  H HB2  . SER A 1 65 ? 5.939   6.404   1.708   1.00 0.00 ? 65 SER A HB2  4  
ATOM 4509  H HB3  . SER A 1 65 ? 6.640   6.012   3.278   1.00 0.00 ? 65 SER A HB3  4  
ATOM 4510  H HG   . SER A 1 65 ? 4.529   7.589   2.697   1.00 0.00 ? 65 SER A HG   4  
ATOM 4511  N N    . GLY A 1 66 ? 9.365   7.061   3.759   1.00 0.00 ? 66 GLY A N    4  
ATOM 4512  C CA   . GLY A 1 66 ? 10.224  7.167   4.924   1.00 0.00 ? 66 GLY A CA   4  
ATOM 4513  C C    . GLY A 1 66 ? 10.793  8.561   5.101   1.00 0.00 ? 66 GLY A C    4  
ATOM 4514  O O    . GLY A 1 66 ? 10.858  9.352   4.159   1.00 0.00 ? 66 GLY A O    4  
ATOM 4515  H H    . GLY A 1 66 ? 9.521   6.352   3.101   1.00 0.00 ? 66 GLY A H    4  
ATOM 4516  H HA2  . GLY A 1 66 ? 9.654   6.908   5.803   1.00 0.00 ? 66 GLY A HA2  4  
ATOM 4517  H HA3  . GLY A 1 66 ? 11.041  6.468   4.819   1.00 0.00 ? 66 GLY A HA3  4  
ATOM 4518  N N    . PRO A 1 67 ? 11.215  8.880   6.333   1.00 0.00 ? 67 PRO A N    4  
ATOM 4519  C CA   . PRO A 1 67 ? 11.787  10.190  6.659   1.00 0.00 ? 67 PRO A CA   4  
ATOM 4520  C C    . PRO A 1 67 ? 13.160  10.396  6.029   1.00 0.00 ? 67 PRO A C    4  
ATOM 4521  O O    . PRO A 1 67 ? 13.656  11.520  5.952   1.00 0.00 ? 67 PRO A O    4  
ATOM 4522  C CB   . PRO A 1 67 ? 11.898  10.158  8.186   1.00 0.00 ? 67 PRO A CB   4  
ATOM 4523  C CG   . PRO A 1 67 ? 11.995  8.711   8.528   1.00 0.00 ? 67 PRO A CG   4  
ATOM 4524  C CD   . PRO A 1 67 ? 11.167  7.987   7.503   1.00 0.00 ? 67 PRO A CD   4  
ATOM 4525  H HA   . PRO A 1 67 ? 11.131  10.995  6.361   1.00 0.00 ? 67 PRO A HA   4  
ATOM 4526  H HB2  . PRO A 1 67 ? 12.782  10.698  8.496   1.00 0.00 ? 67 PRO A HB2  4  
ATOM 4527  H HB3  . PRO A 1 67 ? 11.021  10.610  8.624   1.00 0.00 ? 67 PRO A HB3  4  
ATOM 4528  H HG2  . PRO A 1 67 ? 13.023  8.389   8.476   1.00 0.00 ? 67 PRO A HG2  4  
ATOM 4529  H HG3  . PRO A 1 67 ? 11.597  8.542   9.518   1.00 0.00 ? 67 PRO A HG3  4  
ATOM 4530  H HD2  . PRO A 1 67 ? 11.606  7.027   7.273   1.00 0.00 ? 67 PRO A HD2  4  
ATOM 4531  H HD3  . PRO A 1 67 ? 10.153  7.866   7.853   1.00 0.00 ? 67 PRO A HD3  4  
ATOM 4532  N N    . SER A 1 68 ? 13.770  9.304   5.579   1.00 0.00 ? 68 SER A N    4  
ATOM 4533  C CA   . SER A 1 68 ? 15.088  9.365   4.958   1.00 0.00 ? 68 SER A CA   4  
ATOM 4534  C C    . SER A 1 68 ? 15.065  10.260  3.723   1.00 0.00 ? 68 SER A C    4  
ATOM 4535  O O    . SER A 1 68 ? 14.262  10.060  2.812   1.00 0.00 ? 68 SER A O    4  
ATOM 4536  C CB   . SER A 1 68 ? 15.560  7.961   4.576   1.00 0.00 ? 68 SER A CB   4  
ATOM 4537  O OG   . SER A 1 68 ? 16.820  8.005   3.929   1.00 0.00 ? 68 SER A OG   4  
ATOM 4538  H H    . SER A 1 68 ? 13.323  8.436   5.669   1.00 0.00 ? 68 SER A H    4  
ATOM 4539  H HA   . SER A 1 68 ? 15.775  9.783   5.679   1.00 0.00 ? 68 SER A HA   4  
ATOM 4540  H HB2  . SER A 1 68 ? 15.649  7.358   5.468   1.00 0.00 ? 68 SER A HB2  4  
ATOM 4541  H HB3  . SER A 1 68 ? 14.841  7.511   3.908   1.00 0.00 ? 68 SER A HB3  4  
ATOM 4542  H HG   . SER A 1 68 ? 17.519  7.923   4.582   1.00 0.00 ? 68 SER A HG   4  
ATOM 4543  N N    . SER A 1 69 ? 15.954  11.248  3.699   1.00 0.00 ? 69 SER A N    4  
ATOM 4544  C CA   . SER A 1 69 ? 16.035  12.177  2.578   1.00 0.00 ? 69 SER A CA   4  
ATOM 4545  C C    . SER A 1 69 ? 17.457  12.706  2.413   1.00 0.00 ? 69 SER A C    4  
ATOM 4546  O O    . SER A 1 69 ? 18.133  13.019  3.392   1.00 0.00 ? 69 SER A O    4  
ATOM 4547  C CB   . SER A 1 69 ? 15.066  13.342  2.784   1.00 0.00 ? 69 SER A CB   4  
ATOM 4548  O OG   . SER A 1 69 ? 15.278  14.358  1.818   1.00 0.00 ? 69 SER A OG   4  
ATOM 4549  H H    . SER A 1 69 ? 16.569  11.355  4.456   1.00 0.00 ? 69 SER A H    4  
ATOM 4550  H HA   . SER A 1 69 ? 15.757  11.641  1.683   1.00 0.00 ? 69 SER A HA   4  
ATOM 4551  H HB2  . SER A 1 69 ? 14.052  12.984  2.695   1.00 0.00 ? 69 SER A HB2  4  
ATOM 4552  H HB3  . SER A 1 69 ? 15.215  13.761  3.768   1.00 0.00 ? 69 SER A HB3  4  
ATOM 4553  H HG   . SER A 1 69 ? 15.502  13.957  0.975   1.00 0.00 ? 69 SER A HG   4  
ATOM 4554  N N    . GLY A 1 70 ? 17.904  12.802  1.164   1.00 0.00 ? 70 GLY A N    4  
ATOM 4555  C CA   . GLY A 1 70 ? 19.242  13.293  0.892   1.00 0.00 ? 70 GLY A CA   4  
ATOM 4556  C C    . GLY A 1 70 ? 19.247  14.735  0.423   1.00 0.00 ? 70 GLY A C    4  
ATOM 4557  O O    . GLY A 1 70 ? 19.680  15.629  1.149   1.00 0.00 ? 70 GLY A O    4  
ATOM 4558  H H    . GLY A 1 70 ? 17.321  12.538  0.422   1.00 0.00 ? 70 GLY A H    4  
ATOM 4559  H HA2  . GLY A 1 70 ? 19.832  13.216  1.793   1.00 0.00 ? 70 GLY A HA2  4  
ATOM 4560  H HA3  . GLY A 1 70 ? 19.690  12.677  0.126   1.00 0.00 ? 70 GLY A HA3  4  
ATOM 4561  N N    . GLY A 1 1  ? -21.952 -12.888 13.323  1.00 0.00 ? 1  GLY A N    5  
ATOM 4562  C CA   . GLY A 1 1  ? -21.363 -12.707 12.010  1.00 0.00 ? 1  GLY A CA   5  
ATOM 4563  C C    . GLY A 1 1  ? -22.340 -12.115 11.013  1.00 0.00 ? 1  GLY A C    5  
ATOM 4564  O O    . GLY A 1 1  ? -23.553 -12.195 11.201  1.00 0.00 ? 1  GLY A O    5  
ATOM 4565  H H1   . GLY A 1 1  ? -22.680 -12.301 13.617  1.00 0.00 ? 1  GLY A H1   5  
ATOM 4566  H HA2  . GLY A 1 1  ? -20.511 -12.049 12.097  1.00 0.00 ? 1  GLY A HA2  5  
ATOM 4567  H HA3  . GLY A 1 1  ? -21.029 -13.666 11.642  1.00 0.00 ? 1  GLY A HA3  5  
ATOM 4568  N N    . SER A 1 2  ? -21.809 -11.517 9.950   1.00 0.00 ? 2  SER A N    5  
ATOM 4569  C CA   . SER A 1 2  ? -22.643 -10.904 8.923   1.00 0.00 ? 2  SER A CA   5  
ATOM 4570  C C    . SER A 1 2  ? -21.900 -10.832 7.592   1.00 0.00 ? 2  SER A C    5  
ATOM 4571  O O    . SER A 1 2  ? -20.676 -10.953 7.545   1.00 0.00 ? 2  SER A O    5  
ATOM 4572  C CB   . SER A 1 2  ? -23.074 -9.502  9.356   1.00 0.00 ? 2  SER A CB   5  
ATOM 4573  O OG   . SER A 1 2  ? -24.278 -9.546  10.103  1.00 0.00 ? 2  SER A OG   5  
ATOM 4574  H H    . SER A 1 2  ? -20.834 -11.486 9.857   1.00 0.00 ? 2  SER A H    5  
ATOM 4575  H HA   . SER A 1 2  ? -23.522 -11.520 8.798   1.00 0.00 ? 2  SER A HA   5  
ATOM 4576  H HB2  . SER A 1 2  ? -22.301 -9.063  9.968   1.00 0.00 ? 2  SER A HB2  5  
ATOM 4577  H HB3  . SER A 1 2  ? -23.231 -8.890  8.480   1.00 0.00 ? 2  SER A HB3  5  
ATOM 4578  H HG   . SER A 1 2  ? -24.196 -10.198 10.803  1.00 0.00 ? 2  SER A HG   5  
ATOM 4579  N N    . SER A 1 3  ? -22.650 -10.634 6.513   1.00 0.00 ? 3  SER A N    5  
ATOM 4580  C CA   . SER A 1 3  ? -22.064 -10.549 5.180   1.00 0.00 ? 3  SER A CA   5  
ATOM 4581  C C    . SER A 1 3  ? -21.849 -9.094  4.773   1.00 0.00 ? 3  SER A C    5  
ATOM 4582  O O    . SER A 1 3  ? -22.802 -8.329  4.634   1.00 0.00 ? 3  SER A O    5  
ATOM 4583  C CB   . SER A 1 3  ? -22.964 -11.248 4.159   1.00 0.00 ? 3  SER A CB   5  
ATOM 4584  O OG   . SER A 1 3  ? -22.302 -11.400 2.916   1.00 0.00 ? 3  SER A OG   5  
ATOM 4585  H H    . SER A 1 3  ? -23.621 -10.545 6.616   1.00 0.00 ? 3  SER A H    5  
ATOM 4586  H HA   . SER A 1 3  ? -21.108 -11.049 5.206   1.00 0.00 ? 3  SER A HA   5  
ATOM 4587  H HB2  . SER A 1 3  ? -23.235 -12.224 4.531   1.00 0.00 ? 3  SER A HB2  5  
ATOM 4588  H HB3  . SER A 1 3  ? -23.858 -10.659 4.009   1.00 0.00 ? 3  SER A HB3  5  
ATOM 4589  H HG   . SER A 1 3  ? -21.370 -11.575 3.068   1.00 0.00 ? 3  SER A HG   5  
ATOM 4590  N N    . GLY A 1 4  ? -20.587 -8.720  4.585   1.00 0.00 ? 4  GLY A N    5  
ATOM 4591  C CA   . GLY A 1 4  ? -20.267 -7.359  4.196   1.00 0.00 ? 4  GLY A CA   5  
ATOM 4592  C C    . GLY A 1 4  ? -18.898 -7.245  3.555   1.00 0.00 ? 4  GLY A C    5  
ATOM 4593  O O    . GLY A 1 4  ? -18.692 -6.430  2.655   1.00 0.00 ? 4  GLY A O    5  
ATOM 4594  H H    . GLY A 1 4  ? -19.867 -9.373  4.711   1.00 0.00 ? 4  GLY A H    5  
ATOM 4595  H HA2  . GLY A 1 4  ? -21.012 -7.012  3.495   1.00 0.00 ? 4  GLY A HA2  5  
ATOM 4596  H HA3  . GLY A 1 4  ? -20.294 -6.730  5.074   1.00 0.00 ? 4  GLY A HA3  5  
ATOM 4597  N N    . SER A 1 5  ? -17.959 -8.063  4.019   1.00 0.00 ? 5  SER A N    5  
ATOM 4598  C CA   . SER A 1 5  ? -16.601 -8.047  3.489   1.00 0.00 ? 5  SER A CA   5  
ATOM 4599  C C    . SER A 1 5  ? -16.614 -8.009  1.964   1.00 0.00 ? 5  SER A C    5  
ATOM 4600  O O    . SER A 1 5  ? -17.205 -8.873  1.316   1.00 0.00 ? 5  SER A O    5  
ATOM 4601  C CB   . SER A 1 5  ? -15.827 -9.275  3.974   1.00 0.00 ? 5  SER A CB   5  
ATOM 4602  O OG   . SER A 1 5  ? -14.443 -9.146  3.698   1.00 0.00 ? 5  SER A OG   5  
ATOM 4603  H H    . SER A 1 5  ? -18.185 -8.691  4.738   1.00 0.00 ? 5  SER A H    5  
ATOM 4604  H HA   . SER A 1 5  ? -16.112 -7.156  3.855   1.00 0.00 ? 5  SER A HA   5  
ATOM 4605  H HB2  . SER A 1 5  ? -15.961 -9.384  5.039   1.00 0.00 ? 5  SER A HB2  5  
ATOM 4606  H HB3  . SER A 1 5  ? -16.202 -10.155 3.471   1.00 0.00 ? 5  SER A HB3  5  
ATOM 4607  H HG   . SER A 1 5  ? -14.323 -8.656  2.882   1.00 0.00 ? 5  SER A HG   5  
ATOM 4608  N N    . SER A 1 6  ? -15.957 -7.002  1.398   1.00 0.00 ? 6  SER A N    5  
ATOM 4609  C CA   . SER A 1 6  ? -15.895 -6.848  -0.051  1.00 0.00 ? 6  SER A CA   5  
ATOM 4610  C C    . SER A 1 6  ? -14.455 -6.650  -0.515  1.00 0.00 ? 6  SER A C    5  
ATOM 4611  O O    . SER A 1 6  ? -13.596 -6.222  0.254   1.00 0.00 ? 6  SER A O    5  
ATOM 4612  C CB   . SER A 1 6  ? -16.754 -5.664  -0.496  1.00 0.00 ? 6  SER A CB   5  
ATOM 4613  O OG   . SER A 1 6  ? -16.381 -4.478  0.185   1.00 0.00 ? 6  SER A OG   5  
ATOM 4614  H H    . SER A 1 6  ? -15.505 -6.346  1.968   1.00 0.00 ? 6  SER A H    5  
ATOM 4615  H HA   . SER A 1 6  ? -16.283 -7.752  -0.497  1.00 0.00 ? 6  SER A HA   5  
ATOM 4616  H HB2  . SER A 1 6  ? -16.628 -5.509  -1.557  1.00 0.00 ? 6  SER A HB2  5  
ATOM 4617  H HB3  . SER A 1 6  ? -17.792 -5.876  -0.284  1.00 0.00 ? 6  SER A HB3  5  
ATOM 4618  H HG   . SER A 1 6  ? -16.331 -3.752  -0.440  1.00 0.00 ? 6  SER A HG   5  
ATOM 4619  N N    . GLY A 1 7  ? -14.199 -6.965  -1.782  1.00 0.00 ? 7  GLY A N    5  
ATOM 4620  C CA   . GLY A 1 7  ? -12.863 -6.815  -2.328  1.00 0.00 ? 7  GLY A CA   5  
ATOM 4621  C C    . GLY A 1 7  ? -12.864 -6.142  -3.686  1.00 0.00 ? 7  GLY A C    5  
ATOM 4622  O O    . GLY A 1 7  ? -13.508 -6.616  -4.622  1.00 0.00 ? 7  GLY A O    5  
ATOM 4623  H H    . GLY A 1 7  ? -14.924 -7.302  -2.349  1.00 0.00 ? 7  GLY A H    5  
ATOM 4624  H HA2  . GLY A 1 7  ? -12.271 -6.225  -1.645  1.00 0.00 ? 7  GLY A HA2  5  
ATOM 4625  H HA3  . GLY A 1 7  ? -12.415 -7.793  -2.425  1.00 0.00 ? 7  GLY A HA3  5  
ATOM 4626  N N    . LYS A 1 8  ? -12.142 -5.032  -3.795  1.00 0.00 ? 8  LYS A N    5  
ATOM 4627  C CA   . LYS A 1 8  ? -12.061 -4.291  -5.047  1.00 0.00 ? 8  LYS A CA   5  
ATOM 4628  C C    . LYS A 1 8  ? -10.632 -3.830  -5.316  1.00 0.00 ? 8  LYS A C    5  
ATOM 4629  O O    . LYS A 1 8  ? -10.081 -3.019  -4.572  1.00 0.00 ? 8  LYS A O    5  
ATOM 4630  C CB   . LYS A 1 8  ? -13.000 -3.082  -5.010  1.00 0.00 ? 8  LYS A CB   5  
ATOM 4631  C CG   . LYS A 1 8  ? -13.289 -2.494  -6.380  1.00 0.00 ? 8  LYS A CG   5  
ATOM 4632  C CD   . LYS A 1 8  ? -12.090 -1.739  -6.927  1.00 0.00 ? 8  LYS A CD   5  
ATOM 4633  C CE   . LYS A 1 8  ? -12.465 -0.899  -8.138  1.00 0.00 ? 8  LYS A CE   5  
ATOM 4634  N NZ   . LYS A 1 8  ? -13.020 0.426   -7.744  1.00 0.00 ? 8  LYS A NZ   5  
ATOM 4635  H H    . LYS A 1 8  ? -11.650 -4.704  -3.012  1.00 0.00 ? 8  LYS A H    5  
ATOM 4636  H HA   . LYS A 1 8  ? -12.369 -4.951  -5.844  1.00 0.00 ? 8  LYS A HA   5  
ATOM 4637  H HB2  . LYS A 1 8  ? -13.937 -3.383  -4.565  1.00 0.00 ? 8  LYS A HB2  5  
ATOM 4638  H HB3  . LYS A 1 8  ? -12.552 -2.312  -4.399  1.00 0.00 ? 8  LYS A HB3  5  
ATOM 4639  H HG2  . LYS A 1 8  ? -13.537 -3.295  -7.061  1.00 0.00 ? 8  LYS A HG2  5  
ATOM 4640  H HG3  . LYS A 1 8  ? -14.126 -1.815  -6.301  1.00 0.00 ? 8  LYS A HG3  5  
ATOM 4641  H HD2  . LYS A 1 8  ? -11.703 -1.087  -6.158  1.00 0.00 ? 8  LYS A HD2  5  
ATOM 4642  H HD3  . LYS A 1 8  ? -11.328 -2.450  -7.215  1.00 0.00 ? 8  LYS A HD3  5  
ATOM 4643  H HE2  . LYS A 1 8  ? -11.583 -0.745  -8.741  1.00 0.00 ? 8  LYS A HE2  5  
ATOM 4644  H HE3  . LYS A 1 8  ? -13.206 -1.433  -8.715  1.00 0.00 ? 8  LYS A HE3  5  
ATOM 4645  H HZ1  . LYS A 1 8  ? -13.198 1.004   -8.590  1.00 0.00 ? 8  LYS A HZ1  5  
ATOM 4646  H HZ2  . LYS A 1 8  ? -12.346 0.928   -7.131  1.00 0.00 ? 8  LYS A HZ2  5  
ATOM 4647  H HZ3  . LYS A 1 8  ? -13.914 0.300   -7.229  1.00 0.00 ? 8  LYS A HZ3  5  
ATOM 4648  N N    . GLY A 1 9  ? -10.038 -4.351  -6.385  1.00 0.00 ? 9  GLY A N    5  
ATOM 4649  C CA   . GLY A 1 9  ? -8.679  -3.979  -6.733  1.00 0.00 ? 9  GLY A CA   5  
ATOM 4650  C C    . GLY A 1 9  ? -8.443  -3.980  -8.230  1.00 0.00 ? 9  GLY A C    5  
ATOM 4651  O O    . GLY A 1 9  ? -9.185  -4.610  -8.982  1.00 0.00 ? 9  GLY A O    5  
ATOM 4652  H H    . GLY A 1 9  ? -10.526 -4.993  -6.942  1.00 0.00 ? 9  GLY A H    5  
ATOM 4653  H HA2  . GLY A 1 9  ? -8.477  -2.991  -6.348  1.00 0.00 ? 9  GLY A HA2  5  
ATOM 4654  H HA3  . GLY A 1 9  ? -7.997  -4.680  -6.273  1.00 0.00 ? 9  GLY A HA3  5  
ATOM 4655  N N    . GLY A 1 10 ? -7.406  -3.269  -8.665  1.00 0.00 ? 10 GLY A N    5  
ATOM 4656  C CA   . GLY A 1 10 ? -7.095  -3.202  -10.081 1.00 0.00 ? 10 GLY A CA   5  
ATOM 4657  C C    . GLY A 1 10 ? -6.124  -4.283  -10.512 1.00 0.00 ? 10 GLY A C    5  
ATOM 4658  O O    . GLY A 1 10 ? -6.452  -5.121  -11.352 1.00 0.00 ? 10 GLY A O    5  
ATOM 4659  H H    . GLY A 1 10 ? -6.849  -2.787  -8.019  1.00 0.00 ? 10 GLY A H    5  
ATOM 4660  H HA2  . GLY A 1 10 ? -8.009  -3.308  -10.645 1.00 0.00 ? 10 GLY A HA2  5  
ATOM 4661  H HA3  . GLY A 1 10 ? -6.660  -2.237  -10.296 1.00 0.00 ? 10 GLY A HA3  5  
ATOM 4662  N N    . GLN A 1 11 ? -4.925  -4.264  -9.938  1.00 0.00 ? 11 GLN A N    5  
ATOM 4663  C CA   . GLN A 1 11 ? -3.903  -5.249  -10.271 1.00 0.00 ? 11 GLN A CA   5  
ATOM 4664  C C    . GLN A 1 11 ? -3.605  -6.149  -9.076  1.00 0.00 ? 11 GLN A C    5  
ATOM 4665  O O    . GLN A 1 11 ? -3.402  -7.354  -9.228  1.00 0.00 ? 11 GLN A O    5  
ATOM 4666  C CB   . GLN A 1 11 ? -2.622  -4.551  -10.730 1.00 0.00 ? 11 GLN A CB   5  
ATOM 4667  C CG   . GLN A 1 11 ? -2.071  -3.561  -9.716  1.00 0.00 ? 11 GLN A CG   5  
ATOM 4668  C CD   . GLN A 1 11 ? -0.607  -3.241  -9.949  1.00 0.00 ? 11 GLN A CD   5  
ATOM 4669  O OE1  . GLN A 1 11 ? -0.212  -2.856  -11.050 1.00 0.00 ? 11 GLN A OE1  5  
ATOM 4670  N NE2  . GLN A 1 11 ? 0.206   -3.399  -8.911  1.00 0.00 ? 11 GLN A NE2  5  
ATOM 4671  H H    . GLN A 1 11 ? -4.724  -3.571  -9.276  1.00 0.00 ? 11 GLN A H    5  
ATOM 4672  H HA   . GLN A 1 11 ? -4.280  -5.858  -11.078 1.00 0.00 ? 11 GLN A HA   5  
ATOM 4673  H HB2  . GLN A 1 11 ? -1.866  -5.298  -10.920 1.00 0.00 ? 11 GLN A HB2  5  
ATOM 4674  H HB3  . GLN A 1 11 ? -2.826  -4.017  -11.647 1.00 0.00 ? 11 GLN A HB3  5  
ATOM 4675  H HG2  . GLN A 1 11 ? -2.638  -2.645  -9.781  1.00 0.00 ? 11 GLN A HG2  5  
ATOM 4676  H HG3  . GLN A 1 11 ? -2.180  -3.981  -8.727  1.00 0.00 ? 11 GLN A HG3  5  
ATOM 4677  H HE21 . GLN A 1 11 ? -0.180  -3.710  -8.065  1.00 0.00 ? 11 GLN A HE21 5  
ATOM 4678  H HE22 . GLN A 1 11 ? 1.156   -3.200  -9.033  1.00 0.00 ? 11 GLN A HE22 5  
ATOM 4679  N N    . VAL A 1 12 ? -3.579  -5.556  -7.887  1.00 0.00 ? 12 VAL A N    5  
ATOM 4680  C CA   . VAL A 1 12 ? -3.306  -6.304  -6.665  1.00 0.00 ? 12 VAL A CA   5  
ATOM 4681  C C    . VAL A 1 12 ? -4.441  -7.272  -6.348  1.00 0.00 ? 12 VAL A C    5  
ATOM 4682  O O    . VAL A 1 12 ? -5.603  -7.002  -6.652  1.00 0.00 ? 12 VAL A O    5  
ATOM 4683  C CB   . VAL A 1 12 ? -3.099  -5.362  -5.464  1.00 0.00 ? 12 VAL A CB   5  
ATOM 4684  C CG1  . VAL A 1 12 ? -2.880  -6.162  -4.189  1.00 0.00 ? 12 VAL A CG1  5  
ATOM 4685  C CG2  . VAL A 1 12 ? -1.932  -4.421  -5.721  1.00 0.00 ? 12 VAL A CG2  5  
ATOM 4686  H H    . VAL A 1 12 ? -3.748  -4.592  -7.829  1.00 0.00 ? 12 VAL A H    5  
ATOM 4687  H HA   . VAL A 1 12 ? -2.397  -6.867  -6.815  1.00 0.00 ? 12 VAL A HA   5  
ATOM 4688  H HB   . VAL A 1 12 ? -3.993  -4.768  -5.341  1.00 0.00 ? 12 VAL A HB   5  
ATOM 4689  H HG11 . VAL A 1 12 ? -3.836  -6.432  -3.765  1.00 0.00 ? 12 VAL A HG11 5  
ATOM 4690  H HG12 . VAL A 1 12 ? -2.320  -7.057  -4.418  1.00 0.00 ? 12 VAL A HG12 5  
ATOM 4691  H HG13 . VAL A 1 12 ? -2.328  -5.563  -3.479  1.00 0.00 ? 12 VAL A HG13 5  
ATOM 4692  H HG21 . VAL A 1 12 ? -1.394  -4.747  -6.598  1.00 0.00 ? 12 VAL A HG21 5  
ATOM 4693  H HG22 . VAL A 1 12 ? -2.304  -3.419  -5.879  1.00 0.00 ? 12 VAL A HG22 5  
ATOM 4694  H HG23 . VAL A 1 12 ? -1.270  -4.428  -4.868  1.00 0.00 ? 12 VAL A HG23 5  
ATOM 4695  N N    . ARG A 1 13 ? -4.096  -8.400  -5.736  1.00 0.00 ? 13 ARG A N    5  
ATOM 4696  C CA   . ARG A 1 13 ? -5.085  -9.409  -5.378  1.00 0.00 ? 13 ARG A CA   5  
ATOM 4697  C C    . ARG A 1 13 ? -4.858  -9.914  -3.957  1.00 0.00 ? 13 ARG A C    5  
ATOM 4698  O O    . ARG A 1 13 ? -3.992  -10.756 -3.717  1.00 0.00 ? 13 ARG A O    5  
ATOM 4699  C CB   . ARG A 1 13 ? -5.030  -10.579 -6.362  1.00 0.00 ? 13 ARG A CB   5  
ATOM 4700  C CG   . ARG A 1 13 ? -5.864  -10.362 -7.614  1.00 0.00 ? 13 ARG A CG   5  
ATOM 4701  C CD   . ARG A 1 13 ? -5.819  -11.575 -8.530  1.00 0.00 ? 13 ARG A CD   5  
ATOM 4702  N NE   . ARG A 1 13 ? -6.473  -12.737 -7.934  1.00 0.00 ? 13 ARG A NE   5  
ATOM 4703  C CZ   . ARG A 1 13 ? -6.511  -13.934 -8.508  1.00 0.00 ? 13 ARG A CZ   5  
ATOM 4704  N NH1  . ARG A 1 13 ? -5.935  -14.126 -9.687  1.00 0.00 ? 13 ARG A NH1  5  
ATOM 4705  N NH2  . ARG A 1 13 ? -7.125  -14.942 -7.903  1.00 0.00 ? 13 ARG A NH2  5  
ATOM 4706  H H    . ARG A 1 13 ? -3.153  -8.558  -5.520  1.00 0.00 ? 13 ARG A H    5  
ATOM 4707  H HA   . ARG A 1 13 ? -6.061  -8.950  -5.433  1.00 0.00 ? 13 ARG A HA   5  
ATOM 4708  H HB2  . ARG A 1 13 ? -4.004  -10.734 -6.662  1.00 0.00 ? 13 ARG A HB2  5  
ATOM 4709  H HB3  . ARG A 1 13 ? -5.390  -11.468 -5.866  1.00 0.00 ? 13 ARG A HB3  5  
ATOM 4710  H HG2  . ARG A 1 13 ? -6.889  -10.181 -7.326  1.00 0.00 ? 13 ARG A HG2  5  
ATOM 4711  H HG3  . ARG A 1 13 ? -5.481  -9.505  -8.146  1.00 0.00 ? 13 ARG A HG3  5  
ATOM 4712  H HD2  . ARG A 1 13 ? -6.317  -11.329 -9.456  1.00 0.00 ? 13 ARG A HD2  5  
ATOM 4713  H HD3  . ARG A 1 13 ? -4.786  -11.818 -8.732  1.00 0.00 ? 13 ARG A HD3  5  
ATOM 4714  H HE   . ARG A 1 13 ? -6.904  -12.617 -7.063  1.00 0.00 ? 13 ARG A HE   5  
ATOM 4715  H HH11 . ARG A 1 13 ? -5.471  -13.368 -10.145 1.00 0.00 ? 13 ARG A HH11 5  
ATOM 4716  H HH12 . ARG A 1 13 ? -5.964  -15.029 -10.117 1.00 0.00 ? 13 ARG A HH12 5  
ATOM 4717  H HH21 . ARG A 1 13 ? -7.560  -14.801 -7.014  1.00 0.00 ? 13 ARG A HH21 5  
ATOM 4718  H HH22 . ARG A 1 13 ? -7.154  -15.842 -8.336  1.00 0.00 ? 13 ARG A HH22 5  
ATOM 4719  N N    . PHE A 1 14 ? -5.640  -9.393  -3.017  1.00 0.00 ? 14 PHE A N    5  
ATOM 4720  C CA   . PHE A 1 14 ? -5.523  -9.790  -1.619  1.00 0.00 ? 14 PHE A CA   5  
ATOM 4721  C C    . PHE A 1 14 ? -6.768  -9.390  -0.833  1.00 0.00 ? 14 PHE A C    5  
ATOM 4722  O O    . PHE A 1 14 ? -7.202  -8.239  -0.881  1.00 0.00 ? 14 PHE A O    5  
ATOM 4723  C CB   . PHE A 1 14 ? -4.282  -9.153  -0.988  1.00 0.00 ? 14 PHE A CB   5  
ATOM 4724  C CG   . PHE A 1 14 ? -2.990  -9.706  -1.518  1.00 0.00 ? 14 PHE A CG   5  
ATOM 4725  C CD1  . PHE A 1 14 ? -2.647  -11.031 -1.302  1.00 0.00 ? 14 PHE A CD1  5  
ATOM 4726  C CD2  . PHE A 1 14 ? -2.118  -8.900  -2.233  1.00 0.00 ? 14 PHE A CD2  5  
ATOM 4727  C CE1  . PHE A 1 14 ? -1.458  -11.541 -1.789  1.00 0.00 ? 14 PHE A CE1  5  
ATOM 4728  C CE2  . PHE A 1 14 ? -0.928  -9.405  -2.722  1.00 0.00 ? 14 PHE A CE2  5  
ATOM 4729  C CZ   . PHE A 1 14 ? -0.598  -10.727 -2.500  1.00 0.00 ? 14 PHE A CZ   5  
ATOM 4730  H H    . PHE A 1 14 ? -6.312  -8.725  -3.270  1.00 0.00 ? 14 PHE A H    5  
ATOM 4731  H HA   . PHE A 1 14 ? -5.421  -10.864 -1.587  1.00 0.00 ? 14 PHE A HA   5  
ATOM 4732  H HB2  . PHE A 1 14 ? -4.293  -8.091  -1.182  1.00 0.00 ? 14 PHE A HB2  5  
ATOM 4733  H HB3  . PHE A 1 14 ? -4.304  -9.321  0.078   1.00 0.00 ? 14 PHE A HB3  5  
ATOM 4734  H HD1  . PHE A 1 14 ? -3.319  -11.669 -0.747  1.00 0.00 ? 14 PHE A HD1  5  
ATOM 4735  H HD2  . PHE A 1 14 ? -2.376  -7.864  -2.407  1.00 0.00 ? 14 PHE A HD2  5  
ATOM 4736  H HE1  . PHE A 1 14 ? -1.203  -12.576 -1.614  1.00 0.00 ? 14 PHE A HE1  5  
ATOM 4737  H HE2  . PHE A 1 14 ? -0.258  -8.766  -3.278  1.00 0.00 ? 14 PHE A HE2  5  
ATOM 4738  H HZ   . PHE A 1 14 ? 0.331   -11.124 -2.881  1.00 0.00 ? 14 PHE A HZ   5  
ATOM 4739  N N    . SER A 1 15 ? -7.339  -10.349 -0.111  1.00 0.00 ? 15 SER A N    5  
ATOM 4740  C CA   . SER A 1 15 ? -8.537  -10.099 0.681   1.00 0.00 ? 15 SER A CA   5  
ATOM 4741  C C    . SER A 1 15 ? -8.277  -9.028  1.736   1.00 0.00 ? 15 SER A C    5  
ATOM 4742  O O    . SER A 1 15 ? -7.132  -8.764  2.099   1.00 0.00 ? 15 SER A O    5  
ATOM 4743  C CB   . SER A 1 15 ? -9.009  -11.390 1.353   1.00 0.00 ? 15 SER A CB   5  
ATOM 4744  O OG   . SER A 1 15 ? -10.331 -11.255 1.845   1.00 0.00 ? 15 SER A OG   5  
ATOM 4745  H H    . SER A 1 15 ? -6.946  -11.247 -0.114  1.00 0.00 ? 15 SER A H    5  
ATOM 4746  H HA   . SER A 1 15 ? -9.310  -9.748  0.012   1.00 0.00 ? 15 SER A HA   5  
ATOM 4747  H HB2  . SER A 1 15 ? -8.984  -12.196 0.636   1.00 0.00 ? 15 SER A HB2  5  
ATOM 4748  H HB3  . SER A 1 15 ? -8.352  -11.622 2.179   1.00 0.00 ? 15 SER A HB3  5  
ATOM 4749  H HG   . SER A 1 15 ? -10.930 -11.097 1.112   1.00 0.00 ? 15 SER A HG   5  
ATOM 4750  N N    . ASN A 1 16 ? -9.350  -8.414  2.225   1.00 0.00 ? 16 ASN A N    5  
ATOM 4751  C CA   . ASN A 1 16 ? -9.239  -7.372  3.238   1.00 0.00 ? 16 ASN A CA   5  
ATOM 4752  C C    . ASN A 1 16 ? -8.256  -7.778  4.331   1.00 0.00 ? 16 ASN A C    5  
ATOM 4753  O O    . ASN A 1 16 ? -7.226  -7.131  4.525   1.00 0.00 ? 16 ASN A O    5  
ATOM 4754  C CB   . ASN A 1 16 ? -10.610 -7.081  3.853   1.00 0.00 ? 16 ASN A CB   5  
ATOM 4755  C CG   . ASN A 1 16 ? -11.438 -8.337  4.040   1.00 0.00 ? 16 ASN A CG   5  
ATOM 4756  O OD1  . ASN A 1 16 ? -11.706 -9.065  3.084   1.00 0.00 ? 16 ASN A OD1  5  
ATOM 4757  N ND2  . ASN A 1 16 ? -11.848 -8.597  5.276   1.00 0.00 ? 16 ASN A ND2  5  
ATOM 4758  H H    . ASN A 1 16 ? -10.238 -8.669  1.896   1.00 0.00 ? 16 ASN A H    5  
ATOM 4759  H HA   . ASN A 1 16 ? -8.874  -6.478  2.755   1.00 0.00 ? 16 ASN A HA   5  
ATOM 4760  H HB2  . ASN A 1 16 ? -10.474 -6.616  4.818   1.00 0.00 ? 16 ASN A HB2  5  
ATOM 4761  H HB3  . ASN A 1 16 ? -11.152 -6.407  3.207   1.00 0.00 ? 16 ASN A HB3  5  
ATOM 4762  H HD21 . ASN A 1 16 ? -11.597 -7.972  5.988   1.00 0.00 ? 16 ASN A HD21 5  
ATOM 4763  H HD22 . ASN A 1 16 ? -12.384 -9.403  5.425   1.00 0.00 ? 16 ASN A HD22 5  
ATOM 4764  N N    . ASP A 1 17 ? -8.580  -8.852  5.042   1.00 0.00 ? 17 ASP A N    5  
ATOM 4765  C CA   . ASP A 1 17 ? -7.724  -9.346  6.114   1.00 0.00 ? 17 ASP A CA   5  
ATOM 4766  C C    . ASP A 1 17 ? -6.310  -9.605  5.605   1.00 0.00 ? 17 ASP A C    5  
ATOM 4767  O O    . ASP A 1 17 ? -5.339  -9.082  6.152   1.00 0.00 ? 17 ASP A O    5  
ATOM 4768  C CB   . ASP A 1 17 ? -8.308  -10.628 6.712   1.00 0.00 ? 17 ASP A CB   5  
ATOM 4769  C CG   . ASP A 1 17 ? -9.481  -10.356 7.632   1.00 0.00 ? 17 ASP A CG   5  
ATOM 4770  O OD1  . ASP A 1 17 ? -10.615 -10.226 7.124   1.00 0.00 ? 17 ASP A OD1  5  
ATOM 4771  O OD2  . ASP A 1 17 ? -9.267  -10.271 8.859   1.00 0.00 ? 17 ASP A OD2  5  
ATOM 4772  H H    . ASP A 1 17 ? -9.414  -9.325  4.839   1.00 0.00 ? 17 ASP A H    5  
ATOM 4773  H HA   . ASP A 1 17 ? -7.684  -8.588  6.882   1.00 0.00 ? 17 ASP A HA   5  
ATOM 4774  H HB2  . ASP A 1 17 ? -8.644  -11.270 5.911   1.00 0.00 ? 17 ASP A HB2  5  
ATOM 4775  H HB3  . ASP A 1 17 ? -7.540  -11.136 7.277   1.00 0.00 ? 17 ASP A HB3  5  
ATOM 4776  N N    . GLN A 1 18 ? -6.202  -10.416 4.558   1.00 0.00 ? 18 GLN A N    5  
ATOM 4777  C CA   . GLN A 1 18 ? -4.906  -10.746 3.977   1.00 0.00 ? 18 GLN A CA   5  
ATOM 4778  C C    . GLN A 1 18 ? -4.014  -9.511  3.900   1.00 0.00 ? 18 GLN A C    5  
ATOM 4779  O O    . GLN A 1 18 ? -2.885  -9.515  4.392   1.00 0.00 ? 18 GLN A O    5  
ATOM 4780  C CB   . GLN A 1 18 ? -5.087  -11.347 2.582   1.00 0.00 ? 18 GLN A CB   5  
ATOM 4781  C CG   . GLN A 1 18 ? -5.262  -12.857 2.589   1.00 0.00 ? 18 GLN A CG   5  
ATOM 4782  C CD   . GLN A 1 18 ? -5.599  -13.411 1.219   1.00 0.00 ? 18 GLN A CD   5  
ATOM 4783  O OE1  . GLN A 1 18 ? -5.557  -12.694 0.219   1.00 0.00 ? 18 GLN A OE1  5  
ATOM 4784  N NE2  . GLN A 1 18 ? -5.936  -14.695 1.165   1.00 0.00 ? 18 GLN A NE2  5  
ATOM 4785  H H    . GLN A 1 18 ? -7.013  -10.802 4.167   1.00 0.00 ? 18 GLN A H    5  
ATOM 4786  H HA   . GLN A 1 18 ? -4.433  -11.477 4.616   1.00 0.00 ? 18 GLN A HA   5  
ATOM 4787  H HB2  . GLN A 1 18 ? -5.959  -10.907 2.124   1.00 0.00 ? 18 GLN A HB2  5  
ATOM 4788  H HB3  . GLN A 1 18 ? -4.218  -11.110 1.986   1.00 0.00 ? 18 GLN A HB3  5  
ATOM 4789  H HG2  . GLN A 1 18 ? -4.343  -13.312 2.927   1.00 0.00 ? 18 GLN A HG2  5  
ATOM 4790  H HG3  . GLN A 1 18 ? -6.060  -13.111 3.270   1.00 0.00 ? 18 GLN A HG3  5  
ATOM 4791  H HE21 . GLN A 1 18 ? -5.949  -15.204 2.003   1.00 0.00 ? 18 GLN A HE21 5  
ATOM 4792  H HE22 . GLN A 1 18 ? -6.160  -15.079 0.293   1.00 0.00 ? 18 GLN A HE22 5  
ATOM 4793  N N    . THR A 1 19 ? -4.528  -8.454  3.279   1.00 0.00 ? 19 THR A N    5  
ATOM 4794  C CA   . THR A 1 19 ? -3.778  -7.213  3.136   1.00 0.00 ? 19 THR A CA   5  
ATOM 4795  C C    . THR A 1 19 ? -3.386  -6.647  4.496   1.00 0.00 ? 19 THR A C    5  
ATOM 4796  O O    . THR A 1 19 ? -2.254  -6.205  4.692   1.00 0.00 ? 19 THR A O    5  
ATOM 4797  C CB   . THR A 1 19 ? -4.588  -6.153  2.366   1.00 0.00 ? 19 THR A CB   5  
ATOM 4798  O OG1  . THR A 1 19 ? -4.869  -6.618  1.041   1.00 0.00 ? 19 THR A OG1  5  
ATOM 4799  C CG2  . THR A 1 19 ? -3.828  -4.836  2.296   1.00 0.00 ? 19 THR A CG2  5  
ATOM 4800  H H    . THR A 1 19 ? -5.433  -8.512  2.908   1.00 0.00 ? 19 THR A H    5  
ATOM 4801  H HA   . THR A 1 19 ? -2.881  -7.428  2.574   1.00 0.00 ? 19 THR A HA   5  
ATOM 4802  H HB   . THR A 1 19 ? -5.520  -5.986  2.886   1.00 0.00 ? 19 THR A HB   5  
ATOM 4803  H HG1  . THR A 1 19 ? -4.903  -7.577  1.039   1.00 0.00 ? 19 THR A HG1  5  
ATOM 4804  H HG21 . THR A 1 19 ? -3.625  -4.485  3.297   1.00 0.00 ? 19 THR A HG21 5  
ATOM 4805  H HG22 . THR A 1 19 ? -4.424  -4.104  1.771   1.00 0.00 ? 19 THR A HG22 5  
ATOM 4806  H HG23 . THR A 1 19 ? -2.897  -4.986  1.772   1.00 0.00 ? 19 THR A HG23 5  
ATOM 4807  N N    . ILE A 1 20 ? -4.329  -6.664  5.432   1.00 0.00 ? 20 ILE A N    5  
ATOM 4808  C CA   . ILE A 1 20 ? -4.080  -6.154  6.775   1.00 0.00 ? 20 ILE A CA   5  
ATOM 4809  C C    . ILE A 1 20 ? -2.849  -6.808  7.392   1.00 0.00 ? 20 ILE A C    5  
ATOM 4810  O O    . ILE A 1 20 ? -1.885  -6.129  7.745   1.00 0.00 ? 20 ILE A O    5  
ATOM 4811  C CB   . ILE A 1 20 ? -5.290  -6.389  7.699   1.00 0.00 ? 20 ILE A CB   5  
ATOM 4812  C CG1  . ILE A 1 20 ? -6.503  -5.602  7.197   1.00 0.00 ? 20 ILE A CG1  5  
ATOM 4813  C CG2  . ILE A 1 20 ? -4.950  -5.993  9.128   1.00 0.00 ? 20 ILE A CG2  5  
ATOM 4814  C CD1  . ILE A 1 20 ? -7.805  -6.023  7.843   1.00 0.00 ? 20 ILE A CD1  5  
ATOM 4815  H H    . ILE A 1 20 ? -5.212  -7.029  5.215   1.00 0.00 ? 20 ILE A H    5  
ATOM 4816  H HA   . ILE A 1 20 ? -3.911  -5.090  6.701   1.00 0.00 ? 20 ILE A HA   5  
ATOM 4817  H HB   . ILE A 1 20 ? -5.524  -7.442  7.689   1.00 0.00 ? 20 ILE A HB   5  
ATOM 4818  H HG12 . ILE A 1 20 ? -6.355  -4.554  7.403   1.00 0.00 ? 20 ILE A HG12 5  
ATOM 4819  H HG13 . ILE A 1 20 ? -6.599  -5.746  6.131   1.00 0.00 ? 20 ILE A HG13 5  
ATOM 4820  H HG21 . ILE A 1 20 ? -4.069  -6.529  9.450   1.00 0.00 ? 20 ILE A HG21 5  
ATOM 4821  H HG22 . ILE A 1 20 ? -4.759  -4.931  9.171   1.00 0.00 ? 20 ILE A HG22 5  
ATOM 4822  H HG23 . ILE A 1 20 ? -5.777  -6.238  9.777   1.00 0.00 ? 20 ILE A HG23 5  
ATOM 4823  H HD11 . ILE A 1 20 ? -7.607  -6.761  8.606   1.00 0.00 ? 20 ILE A HD11 5  
ATOM 4824  H HD12 . ILE A 1 20 ? -8.280  -5.162  8.289   1.00 0.00 ? 20 ILE A HD12 5  
ATOM 4825  H HD13 . ILE A 1 20 ? -8.458  -6.446  7.094   1.00 0.00 ? 20 ILE A HD13 5  
ATOM 4826  N N    . GLU A 1 21 ? -2.888  -8.131  7.518   1.00 0.00 ? 21 GLU A N    5  
ATOM 4827  C CA   . GLU A 1 21 ? -1.774  -8.877  8.092   1.00 0.00 ? 21 GLU A CA   5  
ATOM 4828  C C    . GLU A 1 21 ? -0.502  -8.667  7.276   1.00 0.00 ? 21 GLU A C    5  
ATOM 4829  O O    . GLU A 1 21 ? 0.540   -8.291  7.815   1.00 0.00 ? 21 GLU A O    5  
ATOM 4830  C CB   . GLU A 1 21 ? -2.110  -10.368 8.159   1.00 0.00 ? 21 GLU A CB   5  
ATOM 4831  C CG   . GLU A 1 21 ? -2.926  -10.754 9.381   1.00 0.00 ? 21 GLU A CG   5  
ATOM 4832  C CD   . GLU A 1 21 ? -2.705  -12.195 9.799   1.00 0.00 ? 21 GLU A CD   5  
ATOM 4833  O OE1  . GLU A 1 21 ? -1.534  -12.587 9.984   1.00 0.00 ? 21 GLU A OE1  5  
ATOM 4834  O OE2  . GLU A 1 21 ? -3.704  -12.931 9.940   1.00 0.00 ? 21 GLU A OE2  5  
ATOM 4835  H H    . GLU A 1 21 ? -3.685  -8.617  7.218   1.00 0.00 ? 21 GLU A H    5  
ATOM 4836  H HA   . GLU A 1 21 ? -1.610  -8.509  9.093   1.00 0.00 ? 21 GLU A HA   5  
ATOM 4837  H HB2  . GLU A 1 21 ? -2.672  -10.638 7.276   1.00 0.00 ? 21 GLU A HB2  5  
ATOM 4838  H HB3  . GLU A 1 21 ? -1.189  -10.931 8.174   1.00 0.00 ? 21 GLU A HB3  5  
ATOM 4839  H HG2  . GLU A 1 21 ? -2.646  -10.111 10.202  1.00 0.00 ? 21 GLU A HG2  5  
ATOM 4840  H HG3  . GLU A 1 21 ? -3.973  -10.616 9.158   1.00 0.00 ? 21 GLU A HG3  5  
ATOM 4841  N N    . LEU A 1 22 ? -0.593  -8.913  5.974   1.00 0.00 ? 22 LEU A N    5  
ATOM 4842  C CA   . LEU A 1 22 ? 0.550   -8.753  5.083   1.00 0.00 ? 22 LEU A CA   5  
ATOM 4843  C C    . LEU A 1 22 ? 1.324   -7.480  5.413   1.00 0.00 ? 22 LEU A C    5  
ATOM 4844  O O    . LEU A 1 22 ? 2.539   -7.417  5.232   1.00 0.00 ? 22 LEU A O    5  
ATOM 4845  C CB   . LEU A 1 22 ? 0.085   -8.716  3.626   1.00 0.00 ? 22 LEU A CB   5  
ATOM 4846  C CG   . LEU A 1 22 ? -0.220  -10.071 2.985   1.00 0.00 ? 22 LEU A CG   5  
ATOM 4847  C CD1  . LEU A 1 22 ? -0.976  -9.885  1.678   1.00 0.00 ? 22 LEU A CD1  5  
ATOM 4848  C CD2  . LEU A 1 22 ? 1.064   -10.853 2.753   1.00 0.00 ? 22 LEU A CD2  5  
ATOM 4849  H H    . LEU A 1 22 ? -1.449  -9.211  5.602   1.00 0.00 ? 22 LEU A H    5  
ATOM 4850  H HA   . LEU A 1 22 ? 1.202   -9.602  5.223   1.00 0.00 ? 22 LEU A HA   5  
ATOM 4851  H HB2  . LEU A 1 22 ? -0.813  -8.119  3.580   1.00 0.00 ? 22 LEU A HB2  5  
ATOM 4852  H HB3  . LEU A 1 22 ? 0.862   -8.241  3.043   1.00 0.00 ? 22 LEU A HB3  5  
ATOM 4853  H HG   . LEU A 1 22 ? -0.847  -10.645 3.653   1.00 0.00 ? 22 LEU A HG   5  
ATOM 4854  H HD11 . LEU A 1 22 ? -2.034  -10.008 1.854   1.00 0.00 ? 22 LEU A HD11 5  
ATOM 4855  H HD12 . LEU A 1 22 ? -0.642  -10.620 0.962   1.00 0.00 ? 22 LEU A HD12 5  
ATOM 4856  H HD13 . LEU A 1 22 ? -0.788  -8.894  1.292   1.00 0.00 ? 22 LEU A HD13 5  
ATOM 4857  H HD21 . LEU A 1 22 ? 1.288   -11.443 3.629   1.00 0.00 ? 22 LEU A HD21 5  
ATOM 4858  H HD22 . LEU A 1 22 ? 1.876   -10.164 2.566   1.00 0.00 ? 22 LEU A HD22 5  
ATOM 4859  H HD23 . LEU A 1 22 ? 0.940   -11.504 1.901   1.00 0.00 ? 22 LEU A HD23 5  
ATOM 4860  N N    . GLU A 1 23 ? 0.610   -6.470  5.901   1.00 0.00 ? 23 GLU A N    5  
ATOM 4861  C CA   . GLU A 1 23 ? 1.231   -5.199  6.258   1.00 0.00 ? 23 GLU A CA   5  
ATOM 4862  C C    . GLU A 1 23 ? 1.889   -5.283  7.632   1.00 0.00 ? 23 GLU A C    5  
ATOM 4863  O O    . GLU A 1 23 ? 3.110   -5.188  7.756   1.00 0.00 ? 23 GLU A O    5  
ATOM 4864  C CB   . GLU A 1 23 ? 0.191   -4.077  6.245   1.00 0.00 ? 23 GLU A CB   5  
ATOM 4865  C CG   . GLU A 1 23 ? -0.069  -3.504  4.863   1.00 0.00 ? 23 GLU A CG   5  
ATOM 4866  C CD   . GLU A 1 23 ? 0.913   -2.410  4.490   1.00 0.00 ? 23 GLU A CD   5  
ATOM 4867  O OE1  . GLU A 1 23 ? 2.041   -2.419  5.026   1.00 0.00 ? 23 GLU A OE1  5  
ATOM 4868  O OE2  . GLU A 1 23 ? 0.554   -1.545  3.664   1.00 0.00 ? 23 GLU A OE2  5  
ATOM 4869  H H    . GLU A 1 23 ? -0.356  -6.581  6.022   1.00 0.00 ? 23 GLU A H    5  
ATOM 4870  H HA   . GLU A 1 23 ? 1.990   -4.983  5.522   1.00 0.00 ? 23 GLU A HA   5  
ATOM 4871  H HB2  . GLU A 1 23 ? -0.740  -4.461  6.635   1.00 0.00 ? 23 GLU A HB2  5  
ATOM 4872  H HB3  . GLU A 1 23 ? 0.535   -3.277  6.885   1.00 0.00 ? 23 GLU A HB3  5  
ATOM 4873  H HG2  . GLU A 1 23 ? 0.009   -4.299  4.136   1.00 0.00 ? 23 GLU A HG2  5  
ATOM 4874  H HG3  . GLU A 1 23 ? -1.068  -3.093  4.839   1.00 0.00 ? 23 GLU A HG3  5  
ATOM 4875  N N    . LYS A 1 24 ? 1.070   -5.460  8.664   1.00 0.00 ? 24 LYS A N    5  
ATOM 4876  C CA   . LYS A 1 24 ? 1.570   -5.557  10.030  1.00 0.00 ? 24 LYS A CA   5  
ATOM 4877  C C    . LYS A 1 24 ? 2.896   -6.309  10.072  1.00 0.00 ? 24 LYS A C    5  
ATOM 4878  O O    . LYS A 1 24 ? 3.733   -6.065  10.941  1.00 0.00 ? 24 LYS A O    5  
ATOM 4879  C CB   . LYS A 1 24 ? 0.544   -6.261  10.921  1.00 0.00 ? 24 LYS A CB   5  
ATOM 4880  C CG   . LYS A 1 24 ? -0.773  -5.513  11.040  1.00 0.00 ? 24 LYS A CG   5  
ATOM 4881  C CD   . LYS A 1 24 ? -1.873  -6.405  11.589  1.00 0.00 ? 24 LYS A CD   5  
ATOM 4882  C CE   . LYS A 1 24 ? -1.903  -6.382  13.110  1.00 0.00 ? 24 LYS A CE   5  
ATOM 4883  N NZ   . LYS A 1 24 ? -0.783  -7.166  13.699  1.00 0.00 ? 24 LYS A NZ   5  
ATOM 4884  H H    . LYS A 1 24 ? 0.105   -5.528  8.502   1.00 0.00 ? 24 LYS A H    5  
ATOM 4885  H HA   . LYS A 1 24 ? 1.727   -4.554  10.398  1.00 0.00 ? 24 LYS A HA   5  
ATOM 4886  H HB2  . LYS A 1 24 ? 0.343   -7.240  10.514  1.00 0.00 ? 24 LYS A HB2  5  
ATOM 4887  H HB3  . LYS A 1 24 ? 0.962   -6.371  11.912  1.00 0.00 ? 24 LYS A HB3  5  
ATOM 4888  H HG2  . LYS A 1 24 ? -0.640  -4.672  11.705  1.00 0.00 ? 24 LYS A HG2  5  
ATOM 4889  H HG3  . LYS A 1 24 ? -1.064  -5.158  10.062  1.00 0.00 ? 24 LYS A HG3  5  
ATOM 4890  H HD2  . LYS A 1 24 ? -2.825  -6.059  11.217  1.00 0.00 ? 24 LYS A HD2  5  
ATOM 4891  H HD3  . LYS A 1 24 ? -1.701  -7.420  11.257  1.00 0.00 ? 24 LYS A HD3  5  
ATOM 4892  H HE2  . LYS A 1 24 ? -1.828  -5.358  13.442  1.00 0.00 ? 24 LYS A HE2  5  
ATOM 4893  H HE3  . LYS A 1 24 ? -2.840  -6.801  13.445  1.00 0.00 ? 24 LYS A HE3  5  
ATOM 4894  H HZ1  . LYS A 1 24 ? -0.296  -7.707  12.956  1.00 0.00 ? 24 LYS A HZ1  5  
ATOM 4895  H HZ2  . LYS A 1 24 ? -1.147  -7.829  14.413  1.00 0.00 ? 24 LYS A HZ2  5  
ATOM 4896  H HZ3  . LYS A 1 24 ? -0.098  -6.527  14.152  1.00 0.00 ? 24 LYS A HZ3  5  
ATOM 4897  N N    . LYS A 1 25 ? 3.082   -7.224  9.127   1.00 0.00 ? 25 LYS A N    5  
ATOM 4898  C CA   . LYS A 1 25 ? 4.308   -8.011  9.053   1.00 0.00 ? 25 LYS A CA   5  
ATOM 4899  C C    . LYS A 1 25 ? 5.449   -7.187  8.466   1.00 0.00 ? 25 LYS A C    5  
ATOM 4900  O O    . LYS A 1 25 ? 6.486   -7.002  9.103   1.00 0.00 ? 25 LYS A O    5  
ATOM 4901  C CB   . LYS A 1 25 ? 4.083   -9.266  8.207   1.00 0.00 ? 25 LYS A CB   5  
ATOM 4902  C CG   . LYS A 1 25 ? 5.193   -10.294 8.337   1.00 0.00 ? 25 LYS A CG   5  
ATOM 4903  C CD   . LYS A 1 25 ? 5.253   -10.875 9.740   1.00 0.00 ? 25 LYS A CD   5  
ATOM 4904  C CE   . LYS A 1 25 ? 6.044   -12.174 9.772   1.00 0.00 ? 25 LYS A CE   5  
ATOM 4905  N NZ   . LYS A 1 25 ? 5.803   -12.939 11.026  1.00 0.00 ? 25 LYS A NZ   5  
ATOM 4906  H H    . LYS A 1 25 ? 2.378   -7.374  8.461   1.00 0.00 ? 25 LYS A H    5  
ATOM 4907  H HA   . LYS A 1 25 ? 4.573   -8.307  10.057  1.00 0.00 ? 25 LYS A HA   5  
ATOM 4908  H HB2  . LYS A 1 25 ? 3.155   -9.728  8.509   1.00 0.00 ? 25 LYS A HB2  5  
ATOM 4909  H HB3  . LYS A 1 25 ? 4.009   -8.976  7.168   1.00 0.00 ? 25 LYS A HB3  5  
ATOM 4910  H HG2  . LYS A 1 25 ? 5.014   -11.095 7.635   1.00 0.00 ? 25 LYS A HG2  5  
ATOM 4911  H HG3  . LYS A 1 25 ? 6.138   -9.821  8.112   1.00 0.00 ? 25 LYS A HG3  5  
ATOM 4912  H HD2  . LYS A 1 25 ? 5.729   -10.161 10.396  1.00 0.00 ? 25 LYS A HD2  5  
ATOM 4913  H HD3  . LYS A 1 25 ? 4.247   -11.068 10.084  1.00 0.00 ? 25 LYS A HD3  5  
ATOM 4914  H HE2  . LYS A 1 25 ? 5.751   -12.780 8.928   1.00 0.00 ? 25 LYS A HE2  5  
ATOM 4915  H HE3  . LYS A 1 25 ? 7.096   -11.941 9.699   1.00 0.00 ? 25 LYS A HE3  5  
ATOM 4916  H HZ1  . LYS A 1 25 ? 4.805   -12.858 11.308  1.00 0.00 ? 25 LYS A HZ1  5  
ATOM 4917  H HZ2  . LYS A 1 25 ? 6.399   -12.567 11.792  1.00 0.00 ? 25 LYS A HZ2  5  
ATOM 4918  H HZ3  . LYS A 1 25 ? 6.031   -13.944 10.882  1.00 0.00 ? 25 LYS A HZ3  5  
ATOM 4919  N N    . PHE A 1 26 ? 5.250   -6.692  7.249   1.00 0.00 ? 26 PHE A N    5  
ATOM 4920  C CA   . PHE A 1 26 ? 6.263   -5.887  6.576   1.00 0.00 ? 26 PHE A CA   5  
ATOM 4921  C C    . PHE A 1 26 ? 6.833   -4.831  7.519   1.00 0.00 ? 26 PHE A C    5  
ATOM 4922  O O    . PHE A 1 26 ? 8.036   -4.575  7.524   1.00 0.00 ? 26 PHE A O    5  
ATOM 4923  C CB   . PHE A 1 26 ? 5.669   -5.213  5.337   1.00 0.00 ? 26 PHE A CB   5  
ATOM 4924  C CG   . PHE A 1 26 ? 6.468   -4.037  4.853   1.00 0.00 ? 26 PHE A CG   5  
ATOM 4925  C CD1  . PHE A 1 26 ? 6.297   -2.785  5.422   1.00 0.00 ? 26 PHE A CD1  5  
ATOM 4926  C CD2  . PHE A 1 26 ? 7.390   -4.183  3.830   1.00 0.00 ? 26 PHE A CD2  5  
ATOM 4927  C CE1  . PHE A 1 26 ? 7.031   -1.701  4.978   1.00 0.00 ? 26 PHE A CE1  5  
ATOM 4928  C CE2  . PHE A 1 26 ? 8.127   -3.103  3.381   1.00 0.00 ? 26 PHE A CE2  5  
ATOM 4929  C CZ   . PHE A 1 26 ? 7.948   -1.861  3.957   1.00 0.00 ? 26 PHE A CZ   5  
ATOM 4930  H H    . PHE A 1 26 ? 4.402   -6.874  6.791   1.00 0.00 ? 26 PHE A H    5  
ATOM 4931  H HA   . PHE A 1 26 ? 7.060   -6.546  6.269   1.00 0.00 ? 26 PHE A HA   5  
ATOM 4932  H HB2  . PHE A 1 26 ? 5.618   -5.932  4.534   1.00 0.00 ? 26 PHE A HB2  5  
ATOM 4933  H HB3  . PHE A 1 26 ? 4.673   -4.866  5.568   1.00 0.00 ? 26 PHE A HB3  5  
ATOM 4934  H HD1  . PHE A 1 26 ? 5.581   -2.659  6.221   1.00 0.00 ? 26 PHE A HD1  5  
ATOM 4935  H HD2  . PHE A 1 26 ? 7.532   -5.156  3.379   1.00 0.00 ? 26 PHE A HD2  5  
ATOM 4936  H HE1  . PHE A 1 26 ? 6.889   -0.731  5.429   1.00 0.00 ? 26 PHE A HE1  5  
ATOM 4937  H HE2  . PHE A 1 26 ? 8.843   -3.232  2.583   1.00 0.00 ? 26 PHE A HE2  5  
ATOM 4938  H HZ   . PHE A 1 26 ? 8.522   -1.015  3.608   1.00 0.00 ? 26 PHE A HZ   5  
ATOM 4939  N N    . GLU A 1 27 ? 5.959   -4.222  8.314   1.00 0.00 ? 27 GLU A N    5  
ATOM 4940  C CA   . GLU A 1 27 ? 6.375   -3.193  9.260   1.00 0.00 ? 27 GLU A CA   5  
ATOM 4941  C C    . GLU A 1 27 ? 7.444   -3.727  10.208  1.00 0.00 ? 27 GLU A C    5  
ATOM 4942  O O    . GLU A 1 27 ? 8.480   -3.094  10.415  1.00 0.00 ? 27 GLU A O    5  
ATOM 4943  C CB   . GLU A 1 27 ? 5.173   -2.689  10.060  1.00 0.00 ? 27 GLU A CB   5  
ATOM 4944  C CG   . GLU A 1 27 ? 3.956   -2.383  9.204   1.00 0.00 ? 27 GLU A CG   5  
ATOM 4945  C CD   . GLU A 1 27 ? 4.282   -1.486  8.025   1.00 0.00 ? 27 GLU A CD   5  
ATOM 4946  O OE1  . GLU A 1 27 ? 5.161   -0.611  8.170   1.00 0.00 ? 27 GLU A OE1  5  
ATOM 4947  O OE2  . GLU A 1 27 ? 3.659   -1.661  6.957   1.00 0.00 ? 27 GLU A OE2  5  
ATOM 4948  H H    . GLU A 1 27 ? 5.012   -4.470  8.263   1.00 0.00 ? 27 GLU A H    5  
ATOM 4949  H HA   . GLU A 1 27 ? 6.790   -2.372  8.695   1.00 0.00 ? 27 GLU A HA   5  
ATOM 4950  H HB2  . GLU A 1 27 ? 4.898   -3.440  10.786  1.00 0.00 ? 27 GLU A HB2  5  
ATOM 4951  H HB3  . GLU A 1 27 ? 5.456   -1.786  10.581  1.00 0.00 ? 27 GLU A HB3  5  
ATOM 4952  H HG2  . GLU A 1 27 ? 3.553   -3.312  8.828   1.00 0.00 ? 27 GLU A HG2  5  
ATOM 4953  H HG3  . GLU A 1 27 ? 3.214   -1.892  9.816   1.00 0.00 ? 27 GLU A HG3  5  
ATOM 4954  N N    . THR A 1 28 ? 7.185   -4.897  10.784  1.00 0.00 ? 28 THR A N    5  
ATOM 4955  C CA   . THR A 1 28 ? 8.123   -5.517  11.712  1.00 0.00 ? 28 THR A CA   5  
ATOM 4956  C C    . THR A 1 28 ? 9.348   -6.053  10.980  1.00 0.00 ? 28 THR A C    5  
ATOM 4957  O O    . THR A 1 28 ? 10.424  -6.178  11.563  1.00 0.00 ? 28 THR A O    5  
ATOM 4958  C CB   . THR A 1 28 ? 7.462   -6.667  12.494  1.00 0.00 ? 28 THR A CB   5  
ATOM 4959  O OG1  . THR A 1 28 ? 6.827   -7.575  11.587  1.00 0.00 ? 28 THR A OG1  5  
ATOM 4960  C CG2  . THR A 1 28 ? 6.438   -6.131  13.483  1.00 0.00 ? 28 THR A CG2  5  
ATOM 4961  H H    . THR A 1 28 ? 6.343   -5.354  10.579  1.00 0.00 ? 28 THR A H    5  
ATOM 4962  H HA   . THR A 1 28 ? 8.439   -4.763  12.419  1.00 0.00 ? 28 THR A HA   5  
ATOM 4963  H HB   . THR A 1 28 ? 8.228   -7.196  13.043  1.00 0.00 ? 28 THR A HB   5  
ATOM 4964  H HG1  . THR A 1 28 ? 6.975   -8.477  11.881  1.00 0.00 ? 28 THR A HG1  5  
ATOM 4965  H HG21 . THR A 1 28 ? 6.899   -5.379  14.107  1.00 0.00 ? 28 THR A HG21 5  
ATOM 4966  H HG22 . THR A 1 28 ? 6.077   -6.939  14.101  1.00 0.00 ? 28 THR A HG22 5  
ATOM 4967  H HG23 . THR A 1 28 ? 5.612   -5.693  12.944  1.00 0.00 ? 28 THR A HG23 5  
ATOM 4968  N N    . GLN A 1 29 ? 9.176   -6.367  9.700   1.00 0.00 ? 29 GLN A N    5  
ATOM 4969  C CA   . GLN A 1 29 ? 10.269  -6.890  8.889   1.00 0.00 ? 29 GLN A CA   5  
ATOM 4970  C C    . GLN A 1 29 ? 10.011  -6.648  7.406   1.00 0.00 ? 29 GLN A C    5  
ATOM 4971  O O    . GLN A 1 29 ? 9.082   -7.211  6.827   1.00 0.00 ? 29 GLN A O    5  
ATOM 4972  C CB   . GLN A 1 29 ? 10.455  -8.386  9.149   1.00 0.00 ? 29 GLN A CB   5  
ATOM 4973  C CG   . GLN A 1 29 ? 11.890  -8.859  8.980   1.00 0.00 ? 29 GLN A CG   5  
ATOM 4974  C CD   . GLN A 1 29 ? 12.009  -10.371 8.976   1.00 0.00 ? 29 GLN A CD   5  
ATOM 4975  O OE1  . GLN A 1 29 ? 11.320  -11.061 9.728   1.00 0.00 ? 29 GLN A OE1  5  
ATOM 4976  N NE2  . GLN A 1 29 ? 12.886  -10.893 8.127   1.00 0.00 ? 29 GLN A NE2  5  
ATOM 4977  H H    . GLN A 1 29 ? 8.294   -6.245  9.292   1.00 0.00 ? 29 GLN A H    5  
ATOM 4978  H HA   . GLN A 1 29 ? 11.171  -6.370  9.174   1.00 0.00 ? 29 GLN A HA   5  
ATOM 4979  H HB2  . GLN A 1 29 ? 10.143  -8.605  10.159  1.00 0.00 ? 29 GLN A HB2  5  
ATOM 4980  H HB3  . GLN A 1 29 ? 9.833   -8.939  8.461   1.00 0.00 ? 29 GLN A HB3  5  
ATOM 4981  H HG2  . GLN A 1 29 ? 12.272  -8.481  8.044   1.00 0.00 ? 29 GLN A HG2  5  
ATOM 4982  H HG3  . GLN A 1 29 ? 12.482  -8.468  9.794   1.00 0.00 ? 29 GLN A HG3  5  
ATOM 4983  H HE21 . GLN A 1 29 ? 13.401  -10.282 7.560   1.00 0.00 ? 29 GLN A HE21 5  
ATOM 4984  H HE22 . GLN A 1 29 ? 12.984  -11.867 8.104   1.00 0.00 ? 29 GLN A HE22 5  
ATOM 4985  N N    . LYS A 1 30 ? 10.838  -5.806  6.796   1.00 0.00 ? 30 LYS A N    5  
ATOM 4986  C CA   . LYS A 1 30 ? 10.701  -5.490  5.379   1.00 0.00 ? 30 LYS A CA   5  
ATOM 4987  C C    . LYS A 1 30 ? 10.724  -6.759  4.533   1.00 0.00 ? 30 LYS A C    5  
ATOM 4988  O O    . LYS A 1 30 ? 10.030  -6.854  3.520   1.00 0.00 ? 30 LYS A O    5  
ATOM 4989  C CB   . LYS A 1 30 ? 11.822  -4.547  4.935   1.00 0.00 ? 30 LYS A CB   5  
ATOM 4990  C CG   . LYS A 1 30 ? 11.847  -3.232  5.694   1.00 0.00 ? 30 LYS A CG   5  
ATOM 4991  C CD   . LYS A 1 30 ? 10.793  -2.269  5.175   1.00 0.00 ? 30 LYS A CD   5  
ATOM 4992  C CE   . LYS A 1 30 ? 10.398  -1.251  6.235   1.00 0.00 ? 30 LYS A CE   5  
ATOM 4993  N NZ   . LYS A 1 30 ? 9.647   -1.882  7.356   1.00 0.00 ? 30 LYS A NZ   5  
ATOM 4994  H H    . LYS A 1 30 ? 11.560  -5.389  7.311   1.00 0.00 ? 30 LYS A H    5  
ATOM 4995  H HA   . LYS A 1 30 ? 9.751   -4.996  5.240   1.00 0.00 ? 30 LYS A HA   5  
ATOM 4996  H HB2  . LYS A 1 30 ? 12.771  -5.042  5.081   1.00 0.00 ? 30 LYS A HB2  5  
ATOM 4997  H HB3  . LYS A 1 30 ? 11.698  -4.330  3.884   1.00 0.00 ? 30 LYS A HB3  5  
ATOM 4998  H HG2  . LYS A 1 30 ? 11.659  -3.426  6.739   1.00 0.00 ? 30 LYS A HG2  5  
ATOM 4999  H HG3  . LYS A 1 30 ? 12.822  -2.780  5.580   1.00 0.00 ? 30 LYS A HG3  5  
ATOM 5000  H HD2  . LYS A 1 30 ? 11.187  -1.744  4.318   1.00 0.00 ? 30 LYS A HD2  5  
ATOM 5001  H HD3  . LYS A 1 30 ? 9.917   -2.830  4.884   1.00 0.00 ? 30 LYS A HD3  5  
ATOM 5002  H HE2  . LYS A 1 30 ? 11.292  -0.792  6.625   1.00 0.00 ? 30 LYS A HE2  5  
ATOM 5003  H HE3  . LYS A 1 30 ? 9.776   -0.496  5.776   1.00 0.00 ? 30 LYS A HE3  5  
ATOM 5004  H HZ1  . LYS A 1 30 ? 8.732   -2.242  7.016   1.00 0.00 ? 30 LYS A HZ1  5  
ATOM 5005  H HZ2  . LYS A 1 30 ? 9.474   -1.184  8.107   1.00 0.00 ? 30 LYS A HZ2  5  
ATOM 5006  H HZ3  . LYS A 1 30 ? 10.193  -2.673  7.752   1.00 0.00 ? 30 LYS A HZ3  5  
ATOM 5007  N N    . TYR A 1 31 ? 11.524  -7.731  4.955   1.00 0.00 ? 31 TYR A N    5  
ATOM 5008  C CA   . TYR A 1 31 ? 11.638  -8.994  4.236   1.00 0.00 ? 31 TYR A CA   5  
ATOM 5009  C C    . TYR A 1 31 ? 11.372  -10.176 5.163   1.00 0.00 ? 31 TYR A C    5  
ATOM 5010  O O    . TYR A 1 31 ? 11.316  -10.022 6.384   1.00 0.00 ? 31 TYR A O    5  
ATOM 5011  C CB   . TYR A 1 31 ? 13.027  -9.125  3.610   1.00 0.00 ? 31 TYR A CB   5  
ATOM 5012  C CG   . TYR A 1 31 ? 13.235  -8.237  2.404   1.00 0.00 ? 31 TYR A CG   5  
ATOM 5013  C CD1  . TYR A 1 31 ? 12.912  -8.679  1.127   1.00 0.00 ? 31 TYR A CD1  5  
ATOM 5014  C CD2  . TYR A 1 31 ? 13.755  -6.956  2.542   1.00 0.00 ? 31 TYR A CD2  5  
ATOM 5015  C CE1  . TYR A 1 31 ? 13.100  -7.871  0.023   1.00 0.00 ? 31 TYR A CE1  5  
ATOM 5016  C CE2  . TYR A 1 31 ? 13.946  -6.141  1.443   1.00 0.00 ? 31 TYR A CE2  5  
ATOM 5017  C CZ   . TYR A 1 31 ? 13.617  -6.603  0.186   1.00 0.00 ? 31 TYR A CZ   5  
ATOM 5018  O OH   . TYR A 1 31 ? 13.807  -5.795  -0.912  1.00 0.00 ? 31 TYR A OH   5  
ATOM 5019  H H    . TYR A 1 31 ? 12.052  -7.596  5.770   1.00 0.00 ? 31 TYR A H    5  
ATOM 5020  H HA   . TYR A 1 31 ? 10.898  -8.995  3.449   1.00 0.00 ? 31 TYR A HA   5  
ATOM 5021  H HB2  . TYR A 1 31 ? 13.772  -8.864  4.346   1.00 0.00 ? 31 TYR A HB2  5  
ATOM 5022  H HB3  . TYR A 1 31 ? 13.179  -10.149 3.299   1.00 0.00 ? 31 TYR A HB3  5  
ATOM 5023  H HD1  . TYR A 1 31 ? 12.507  -9.673  1.003   1.00 0.00 ? 31 TYR A HD1  5  
ATOM 5024  H HD2  . TYR A 1 31 ? 14.012  -6.598  3.528   1.00 0.00 ? 31 TYR A HD2  5  
ATOM 5025  H HE1  . TYR A 1 31 ? 12.843  -8.233  -0.962  1.00 0.00 ? 31 TYR A HE1  5  
ATOM 5026  H HE2  . TYR A 1 31 ? 14.351  -5.148  1.570   1.00 0.00 ? 31 TYR A HE2  5  
ATOM 5027  H HH   . TYR A 1 31 ? 12.967  -5.412  -1.176  1.00 0.00 ? 31 TYR A HH   5  
ATOM 5028  N N    . LEU A 1 32 ? 11.208  -11.356 4.575   1.00 0.00 ? 32 LEU A N    5  
ATOM 5029  C CA   . LEU A 1 32 ? 10.949  -12.566 5.348   1.00 0.00 ? 32 LEU A CA   5  
ATOM 5030  C C    . LEU A 1 32 ? 11.637  -13.772 4.718   1.00 0.00 ? 32 LEU A C    5  
ATOM 5031  O O    . LEU A 1 32 ? 11.430  -14.074 3.542   1.00 0.00 ? 32 LEU A O    5  
ATOM 5032  C CB   . LEU A 1 32 ? 9.443   -12.818 5.447   1.00 0.00 ? 32 LEU A CB   5  
ATOM 5033  C CG   . LEU A 1 32 ? 8.612   -11.689 6.058   1.00 0.00 ? 32 LEU A CG   5  
ATOM 5034  C CD1  . LEU A 1 32 ? 7.170   -11.770 5.582   1.00 0.00 ? 32 LEU A CD1  5  
ATOM 5035  C CD2  . LEU A 1 32 ? 8.678   -11.741 7.577   1.00 0.00 ? 32 LEU A CD2  5  
ATOM 5036  H H    . LEU A 1 32 ? 11.263  -11.416 3.599   1.00 0.00 ? 32 LEU A H    5  
ATOM 5037  H HA   . LEU A 1 32 ? 11.347  -12.417 6.340   1.00 0.00 ? 32 LEU A HA   5  
ATOM 5038  H HB2  . LEU A 1 32 ? 9.072   -12.999 4.450   1.00 0.00 ? 32 LEU A HB2  5  
ATOM 5039  H HB3  . LEU A 1 32 ? 9.296   -13.703 6.050   1.00 0.00 ? 32 LEU A HB3  5  
ATOM 5040  H HG   . LEU A 1 32 ? 9.016   -10.739 5.737   1.00 0.00 ? 32 LEU A HG   5  
ATOM 5041  H HD11 . LEU A 1 32 ? 6.998   -12.729 5.117   1.00 0.00 ? 32 LEU A HD11 5  
ATOM 5042  H HD12 . LEU A 1 32 ? 6.983   -10.984 4.866   1.00 0.00 ? 32 LEU A HD12 5  
ATOM 5043  H HD13 . LEU A 1 32 ? 6.506   -11.653 6.426   1.00 0.00 ? 32 LEU A HD13 5  
ATOM 5044  H HD21 . LEU A 1 32 ? 9.625   -11.342 7.910   1.00 0.00 ? 32 LEU A HD21 5  
ATOM 5045  H HD22 . LEU A 1 32 ? 8.584   -12.766 7.907   1.00 0.00 ? 32 LEU A HD22 5  
ATOM 5046  H HD23 . LEU A 1 32 ? 7.873   -11.153 7.993   1.00 0.00 ? 32 LEU A HD23 5  
ATOM 5047  N N    . SER A 1 33 ? 12.456  -14.459 5.508   1.00 0.00 ? 33 SER A N    5  
ATOM 5048  C CA   . SER A 1 33 ? 13.177  -15.632 5.027   1.00 0.00 ? 33 SER A CA   5  
ATOM 5049  C C    . SER A 1 33 ? 12.207  -16.702 4.536   1.00 0.00 ? 33 SER A C    5  
ATOM 5050  O O    . SER A 1 33 ? 11.049  -16.763 4.949   1.00 0.00 ? 33 SER A O    5  
ATOM 5051  C CB   . SER A 1 33 ? 14.064  -16.202 6.136   1.00 0.00 ? 33 SER A CB   5  
ATOM 5052  O OG   . SER A 1 33 ? 14.697  -15.165 6.866   1.00 0.00 ? 33 SER A OG   5  
ATOM 5053  H H    . SER A 1 33 ? 12.580  -14.168 6.436   1.00 0.00 ? 33 SER A H    5  
ATOM 5054  H HA   . SER A 1 33 ? 13.801  -15.323 4.202   1.00 0.00 ? 33 SER A HA   5  
ATOM 5055  H HB2  . SER A 1 33 ? 13.459  -16.785 6.813   1.00 0.00 ? 33 SER A HB2  5  
ATOM 5056  H HB3  . SER A 1 33 ? 14.823  -16.833 5.697   1.00 0.00 ? 33 SER A HB3  5  
ATOM 5057  H HG   . SER A 1 33 ? 15.531  -15.484 7.218   1.00 0.00 ? 33 SER A HG   5  
ATOM 5058  N N    . PRO A 1 34 ? 12.690  -17.568 3.632   1.00 0.00 ? 34 PRO A N    5  
ATOM 5059  C CA   . PRO A 1 34 ? 11.883  -18.652 3.065   1.00 0.00 ? 34 PRO A CA   5  
ATOM 5060  C C    . PRO A 1 34 ? 11.137  -19.441 4.135   1.00 0.00 ? 34 PRO A C    5  
ATOM 5061  O O    . PRO A 1 34 ? 9.956   -19.760 3.995   1.00 0.00 ? 34 PRO A O    5  
ATOM 5062  C CB   . PRO A 1 34 ? 12.920  -19.540 2.372   1.00 0.00 ? 34 PRO A CB   5  
ATOM 5063  C CG   . PRO A 1 34 ? 14.047  -18.622 2.045   1.00 0.00 ? 34 PRO A CG   5  
ATOM 5064  C CD   . PRO A 1 34 ? 14.061  -17.554 3.095   1.00 0.00 ? 34 PRO A CD   5  
ATOM 5065  H HA   . PRO A 1 34 ? 11.178  -18.282 2.335   1.00 0.00 ? 34 PRO A HA   5  
ATOM 5066  H HB2  . PRO A 1 34 ? 13.232  -20.326 3.045   1.00 0.00 ? 34 PRO A HB2  5  
ATOM 5067  H HB3  . PRO A 1 34 ? 12.491  -19.971 1.480   1.00 0.00 ? 34 PRO A HB3  5  
ATOM 5068  H HG2  . PRO A 1 34 ? 14.979  -19.165 2.062   1.00 0.00 ? 34 PRO A HG2  5  
ATOM 5069  H HG3  . PRO A 1 34 ? 13.888  -18.178 1.073   1.00 0.00 ? 34 PRO A HG3  5  
ATOM 5070  H HD2  . PRO A 1 34 ? 14.779  -17.797 3.864   1.00 0.00 ? 34 PRO A HD2  5  
ATOM 5071  H HD3  . PRO A 1 34 ? 14.290  -16.597 2.650   1.00 0.00 ? 34 PRO A HD3  5  
ATOM 5072  N N    . PRO A 1 35 ? 11.839  -19.764 5.231   1.00 0.00 ? 35 PRO A N    5  
ATOM 5073  C CA   . PRO A 1 35 ? 11.262  -20.518 6.347   1.00 0.00 ? 35 PRO A CA   5  
ATOM 5074  C C    . PRO A 1 35 ? 9.913   -19.962 6.787   1.00 0.00 ? 35 PRO A C    5  
ATOM 5075  O O    . PRO A 1 35 ? 8.961   -20.712 6.998   1.00 0.00 ? 35 PRO A O    5  
ATOM 5076  C CB   . PRO A 1 35 ? 12.299  -20.352 7.462   1.00 0.00 ? 35 PRO A CB   5  
ATOM 5077  C CG   . PRO A 1 35 ? 13.585  -20.111 6.750   1.00 0.00 ? 35 PRO A CG   5  
ATOM 5078  C CD   . PRO A 1 35 ? 13.251  -19.417 5.465   1.00 0.00 ? 35 PRO A CD   5  
ATOM 5079  H HA   . PRO A 1 35 ? 11.157  -21.566 6.106   1.00 0.00 ? 35 PRO A HA   5  
ATOM 5080  H HB2  . PRO A 1 35 ? 12.028  -19.511 8.086   1.00 0.00 ? 35 PRO A HB2  5  
ATOM 5081  H HB3  . PRO A 1 35 ? 12.340  -21.251 8.057   1.00 0.00 ? 35 PRO A HB3  5  
ATOM 5082  H HG2  . PRO A 1 35 ? 14.225  -19.482 7.350   1.00 0.00 ? 35 PRO A HG2  5  
ATOM 5083  H HG3  . PRO A 1 35 ? 14.070  -21.052 6.541   1.00 0.00 ? 35 PRO A HG3  5  
ATOM 5084  H HD2  . PRO A 1 35 ? 13.373  -18.349 5.576   1.00 0.00 ? 35 PRO A HD2  5  
ATOM 5085  H HD3  . PRO A 1 35 ? 13.876  -19.789 4.667   1.00 0.00 ? 35 PRO A HD3  5  
ATOM 5086  N N    . GLU A 1 36 ? 9.838   -18.641 6.923   1.00 0.00 ? 36 GLU A N    5  
ATOM 5087  C CA   . GLU A 1 36 ? 8.604   -17.985 7.339   1.00 0.00 ? 36 GLU A CA   5  
ATOM 5088  C C    . GLU A 1 36 ? 7.652   -17.819 6.158   1.00 0.00 ? 36 GLU A C    5  
ATOM 5089  O O    . GLU A 1 36 ? 6.592   -18.443 6.108   1.00 0.00 ? 36 GLU A O    5  
ATOM 5090  C CB   . GLU A 1 36 ? 8.909   -16.620 7.959   1.00 0.00 ? 36 GLU A CB   5  
ATOM 5091  C CG   . GLU A 1 36 ? 10.054  -16.647 8.957   1.00 0.00 ? 36 GLU A CG   5  
ATOM 5092  C CD   . GLU A 1 36 ? 9.589   -16.946 10.369  1.00 0.00 ? 36 GLU A CD   5  
ATOM 5093  O OE1  . GLU A 1 36 ? 8.568   -16.366 10.794  1.00 0.00 ? 36 GLU A OE1  5  
ATOM 5094  O OE2  . GLU A 1 36 ? 10.247  -17.761 11.050  1.00 0.00 ? 36 GLU A OE2  5  
ATOM 5095  H H    . GLU A 1 36 ? 10.631  -18.096 6.741   1.00 0.00 ? 36 GLU A H    5  
ATOM 5096  H HA   . GLU A 1 36 ? 8.130   -18.609 8.082   1.00 0.00 ? 36 GLU A HA   5  
ATOM 5097  H HB2  . GLU A 1 36 ? 9.164   -15.928 7.169   1.00 0.00 ? 36 GLU A HB2  5  
ATOM 5098  H HB3  . GLU A 1 36 ? 8.025   -16.263 8.466   1.00 0.00 ? 36 GLU A HB3  5  
ATOM 5099  H HG2  . GLU A 1 36 ? 10.758  -17.409 8.658   1.00 0.00 ? 36 GLU A HG2  5  
ATOM 5100  H HG3  . GLU A 1 36 ? 10.543  -15.684 8.951   1.00 0.00 ? 36 GLU A HG3  5  
ATOM 5101  N N    . ARG A 1 37 ? 8.039   -16.972 5.209   1.00 0.00 ? 37 ARG A N    5  
ATOM 5102  C CA   . ARG A 1 37 ? 7.220   -16.721 4.029   1.00 0.00 ? 37 ARG A CA   5  
ATOM 5103  C C    . ARG A 1 37 ? 6.484   -17.987 3.599   1.00 0.00 ? 37 ARG A C    5  
ATOM 5104  O O    . ARG A 1 37 ? 5.367   -17.925 3.086   1.00 0.00 ? 37 ARG A O    5  
ATOM 5105  C CB   . ARG A 1 37 ? 8.088   -16.207 2.879   1.00 0.00 ? 37 ARG A CB   5  
ATOM 5106  C CG   . ARG A 1 37 ? 7.353   -15.274 1.931   1.00 0.00 ? 37 ARG A CG   5  
ATOM 5107  C CD   . ARG A 1 37 ? 8.234   -14.860 0.763   1.00 0.00 ? 37 ARG A CD   5  
ATOM 5108  N NE   . ARG A 1 37 ? 9.572   -14.468 1.198   1.00 0.00 ? 37 ARG A NE   5  
ATOM 5109  C CZ   . ARG A 1 37 ? 10.643  -14.516 0.414   1.00 0.00 ? 37 ARG A CZ   5  
ATOM 5110  N NH1  . ARG A 1 37 ? 10.534  -14.937 -0.838  1.00 0.00 ? 37 ARG A NH1  5  
ATOM 5111  N NH2  . ARG A 1 37 ? 11.827  -14.143 0.883   1.00 0.00 ? 37 ARG A NH2  5  
ATOM 5112  H H    . ARG A 1 37 ? 8.894   -16.504 5.305   1.00 0.00 ? 37 ARG A H    5  
ATOM 5113  H HA   . ARG A 1 37 ? 6.492   -15.965 4.285   1.00 0.00 ? 37 ARG A HA   5  
ATOM 5114  H HB2  . ARG A 1 37 ? 8.932   -15.674 3.291   1.00 0.00 ? 37 ARG A HB2  5  
ATOM 5115  H HB3  . ARG A 1 37 ? 8.448   -17.052 2.312   1.00 0.00 ? 37 ARG A HB3  5  
ATOM 5116  H HG2  . ARG A 1 37 ? 6.480   -15.780 1.547   1.00 0.00 ? 37 ARG A HG2  5  
ATOM 5117  H HG3  . ARG A 1 37 ? 7.050   -14.391 2.473   1.00 0.00 ? 37 ARG A HG3  5  
ATOM 5118  H HD2  . ARG A 1 37 ? 8.318   -15.693 0.080   1.00 0.00 ? 37 ARG A HD2  5  
ATOM 5119  H HD3  . ARG A 1 37 ? 7.771   -14.026 0.258   1.00 0.00 ? 37 ARG A HD3  5  
ATOM 5120  H HE   . ARG A 1 37 ? 9.675   -14.154 2.120   1.00 0.00 ? 37 ARG A HE   5  
ATOM 5121  H HH11 . ARG A 1 37 ? 9.643   -15.219 -1.195  1.00 0.00 ? 37 ARG A HH11 5  
ATOM 5122  H HH12 . ARG A 1 37 ? 11.342  -14.972 -1.427  1.00 0.00 ? 37 ARG A HH12 5  
ATOM 5123  H HH21 . ARG A 1 37 ? 11.913  -13.824 1.826   1.00 0.00 ? 37 ARG A HH21 5  
ATOM 5124  H HH22 . ARG A 1 37 ? 12.633  -14.179 0.292   1.00 0.00 ? 37 ARG A HH22 5  
ATOM 5125  N N    . LYS A 1 38 ? 7.119   -19.135 3.811   1.00 0.00 ? 38 LYS A N    5  
ATOM 5126  C CA   . LYS A 1 38 ? 6.526   -20.416 3.447   1.00 0.00 ? 38 LYS A CA   5  
ATOM 5127  C C    . LYS A 1 38 ? 5.306   -20.717 4.312   1.00 0.00 ? 38 LYS A C    5  
ATOM 5128  O O    . LYS A 1 38 ? 4.246   -21.082 3.802   1.00 0.00 ? 38 LYS A O    5  
ATOM 5129  C CB   . LYS A 1 38 ? 7.556   -21.538 3.592   1.00 0.00 ? 38 LYS A CB   5  
ATOM 5130  C CG   . LYS A 1 38 ? 8.486   -21.669 2.397   1.00 0.00 ? 38 LYS A CG   5  
ATOM 5131  C CD   . LYS A 1 38 ? 9.609   -22.655 2.670   1.00 0.00 ? 38 LYS A CD   5  
ATOM 5132  C CE   . LYS A 1 38 ? 10.847  -22.330 1.848   1.00 0.00 ? 38 LYS A CE   5  
ATOM 5133  N NZ   . LYS A 1 38 ? 11.816  -23.461 1.835   1.00 0.00 ? 38 LYS A NZ   5  
ATOM 5134  H H    . LYS A 1 38 ? 8.008   -19.120 4.224   1.00 0.00 ? 38 LYS A H    5  
ATOM 5135  H HA   . LYS A 1 38 ? 6.214   -20.356 2.415   1.00 0.00 ? 38 LYS A HA   5  
ATOM 5136  H HB2  . LYS A 1 38 ? 8.157   -21.348 4.469   1.00 0.00 ? 38 LYS A HB2  5  
ATOM 5137  H HB3  . LYS A 1 38 ? 7.035   -22.476 3.719   1.00 0.00 ? 38 LYS A HB3  5  
ATOM 5138  H HG2  . LYS A 1 38 ? 7.917   -22.014 1.546   1.00 0.00 ? 38 LYS A HG2  5  
ATOM 5139  H HG3  . LYS A 1 38 ? 8.914   -20.700 2.178   1.00 0.00 ? 38 LYS A HG3  5  
ATOM 5140  H HD2  . LYS A 1 38 ? 9.866   -22.613 3.718   1.00 0.00 ? 38 LYS A HD2  5  
ATOM 5141  H HD3  . LYS A 1 38 ? 9.272   -23.650 2.419   1.00 0.00 ? 38 LYS A HD3  5  
ATOM 5142  H HE2  . LYS A 1 38 ? 10.544  -22.115 0.835   1.00 0.00 ? 38 LYS A HE2  5  
ATOM 5143  H HE3  . LYS A 1 38 ? 11.327  -21.461 2.272   1.00 0.00 ? 38 LYS A HE3  5  
ATOM 5144  H HZ1  . LYS A 1 38 ? 11.505  -24.206 2.491   1.00 0.00 ? 38 LYS A HZ1  5  
ATOM 5145  H HZ2  . LYS A 1 38 ? 12.757  -23.129 2.128   1.00 0.00 ? 38 LYS A HZ2  5  
ATOM 5146  H HZ3  . LYS A 1 38 ? 11.884  -23.863 0.878   1.00 0.00 ? 38 LYS A HZ3  5  
ATOM 5147  N N    . ARG A 1 39 ? 5.462   -20.561 5.622   1.00 0.00 ? 39 ARG A N    5  
ATOM 5148  C CA   . ARG A 1 39 ? 4.374   -20.816 6.557   1.00 0.00 ? 39 ARG A CA   5  
ATOM 5149  C C    . ARG A 1 39 ? 3.298   -19.738 6.447   1.00 0.00 ? 39 ARG A C    5  
ATOM 5150  O O    . ARG A 1 39 ? 2.103   -20.032 6.490   1.00 0.00 ? 39 ARG A O    5  
ATOM 5151  C CB   . ARG A 1 39 ? 4.907   -20.874 7.990   1.00 0.00 ? 39 ARG A CB   5  
ATOM 5152  C CG   . ARG A 1 39 ? 6.145   -21.741 8.145   1.00 0.00 ? 39 ARG A CG   5  
ATOM 5153  C CD   . ARG A 1 39 ? 7.034   -21.247 9.274   1.00 0.00 ? 39 ARG A CD   5  
ATOM 5154  N NE   . ARG A 1 39 ? 6.627   -21.787 10.568  1.00 0.00 ? 39 ARG A NE   5  
ATOM 5155  C CZ   . ARG A 1 39 ? 6.766   -23.063 10.909  1.00 0.00 ? 39 ARG A CZ   5  
ATOM 5156  N NH1  . ARG A 1 39 ? 7.300   -23.926 10.055  1.00 0.00 ? 39 ARG A NH1  5  
ATOM 5157  N NH2  . ARG A 1 39 ? 6.372   -23.479 12.105  1.00 0.00 ? 39 ARG A NH2  5  
ATOM 5158  H H    . ARG A 1 39 ? 6.331   -20.268 5.969   1.00 0.00 ? 39 ARG A H    5  
ATOM 5159  H HA   . ARG A 1 39 ? 3.937   -21.770 6.306   1.00 0.00 ? 39 ARG A HA   5  
ATOM 5160  H HB2  . ARG A 1 39 ? 5.153   -19.872 8.311   1.00 0.00 ? 39 ARG A HB2  5  
ATOM 5161  H HB3  . ARG A 1 39 ? 4.134   -21.269 8.633   1.00 0.00 ? 39 ARG A HB3  5  
ATOM 5162  H HG2  . ARG A 1 39 ? 5.839   -22.754 8.360   1.00 0.00 ? 39 ARG A HG2  5  
ATOM 5163  H HG3  . ARG A 1 39 ? 6.705   -21.721 7.221   1.00 0.00 ? 39 ARG A HG3  5  
ATOM 5164  H HD2  . ARG A 1 39 ? 8.051   -21.549 9.073   1.00 0.00 ? 39 ARG A HD2  5  
ATOM 5165  H HD3  . ARG A 1 39 ? 6.980   -20.169 9.311   1.00 0.00 ? 39 ARG A HD3  5  
ATOM 5166  H HE   . ARG A 1 39 ? 6.231   -21.167 11.215  1.00 0.00 ? 39 ARG A HE   5  
ATOM 5167  H HH11 . ARG A 1 39 ? 7.599   -23.615 9.153   1.00 0.00 ? 39 ARG A HH11 5  
ATOM 5168  H HH12 . ARG A 1 39 ? 7.405   -24.887 10.314  1.00 0.00 ? 39 ARG A HH12 5  
ATOM 5169  H HH21 . ARG A 1 39 ? 5.969   -22.832 12.752  1.00 0.00 ? 39 ARG A HH21 5  
ATOM 5170  H HH22 . ARG A 1 39 ? 6.477   -24.440 12.360  1.00 0.00 ? 39 ARG A HH22 5  
ATOM 5171  N N    . LEU A 1 40 ? 3.731   -18.491 6.304   1.00 0.00 ? 40 LEU A N    5  
ATOM 5172  C CA   . LEU A 1 40 ? 2.806   -17.369 6.187   1.00 0.00 ? 40 LEU A CA   5  
ATOM 5173  C C    . LEU A 1 40 ? 1.803   -17.605 5.063   1.00 0.00 ? 40 LEU A C    5  
ATOM 5174  O O    . LEU A 1 40 ? 0.593   -17.497 5.265   1.00 0.00 ? 40 LEU A O    5  
ATOM 5175  C CB   . LEU A 1 40 ? 3.576   -16.071 5.934   1.00 0.00 ? 40 LEU A CB   5  
ATOM 5176  C CG   . LEU A 1 40 ? 2.810   -14.774 6.195   1.00 0.00 ? 40 LEU A CG   5  
ATOM 5177  C CD1  . LEU A 1 40 ? 2.520   -14.614 7.679   1.00 0.00 ? 40 LEU A CD1  5  
ATOM 5178  C CD2  . LEU A 1 40 ? 3.591   -13.578 5.670   1.00 0.00 ? 40 LEU A CD2  5  
ATOM 5179  H H    . LEU A 1 40 ? 4.695   -18.318 6.276   1.00 0.00 ? 40 LEU A H    5  
ATOM 5180  H HA   . LEU A 1 40 ? 2.270   -17.283 7.120   1.00 0.00 ? 40 LEU A HA   5  
ATOM 5181  H HB2  . LEU A 1 40 ? 4.447   -16.074 6.572   1.00 0.00 ? 40 LEU A HB2  5  
ATOM 5182  H HB3  . LEU A 1 40 ? 3.889   -16.070 4.900   1.00 0.00 ? 40 LEU A HB3  5  
ATOM 5183  H HG   . LEU A 1 40 ? 1.864   -14.811 5.673   1.00 0.00 ? 40 LEU A HG   5  
ATOM 5184  H HD11 . LEU A 1 40 ? 3.420   -14.805 8.244   1.00 0.00 ? 40 LEU A HD11 5  
ATOM 5185  H HD12 . LEU A 1 40 ? 1.754   -15.316 7.974   1.00 0.00 ? 40 LEU A HD12 5  
ATOM 5186  H HD13 . LEU A 1 40 ? 2.180   -13.607 7.873   1.00 0.00 ? 40 LEU A HD13 5  
ATOM 5187  H HD21 . LEU A 1 40 ? 4.194   -13.165 6.466   1.00 0.00 ? 40 LEU A HD21 5  
ATOM 5188  H HD22 . LEU A 1 40 ? 2.902   -12.827 5.313   1.00 0.00 ? 40 LEU A HD22 5  
ATOM 5189  H HD23 . LEU A 1 40 ? 4.232   -13.894 4.860   1.00 0.00 ? 40 LEU A HD23 5  
ATOM 5190  N N    . ALA A 1 41 ? 2.313   -17.930 3.880   1.00 0.00 ? 41 ALA A N    5  
ATOM 5191  C CA   . ALA A 1 41 ? 1.461   -18.186 2.725   1.00 0.00 ? 41 ALA A CA   5  
ATOM 5192  C C    . ALA A 1 41 ? 0.379   -19.208 3.057   1.00 0.00 ? 41 ALA A C    5  
ATOM 5193  O O    . ALA A 1 41 ? -0.683  -19.228 2.434   1.00 0.00 ? 41 ALA A O    5  
ATOM 5194  C CB   . ALA A 1 41 ? 2.298   -18.664 1.548   1.00 0.00 ? 41 ALA A CB   5  
ATOM 5195  H H    . ALA A 1 41 ? 3.285   -18.001 3.782   1.00 0.00 ? 41 ALA A H    5  
ATOM 5196  H HA   . ALA A 1 41 ? 0.989   -17.255 2.445   1.00 0.00 ? 41 ALA A HA   5  
ATOM 5197  H HB1  . ALA A 1 41 ? 2.252   -17.932 0.754   1.00 0.00 ? 41 ALA A HB1  5  
ATOM 5198  H HB2  . ALA A 1 41 ? 3.323   -18.790 1.863   1.00 0.00 ? 41 ALA A HB2  5  
ATOM 5199  H HB3  . ALA A 1 41 ? 1.912   -19.606 1.190   1.00 0.00 ? 41 ALA A HB3  5  
ATOM 5200  N N    . LYS A 1 42 ? 0.656   -20.058 4.040   1.00 0.00 ? 42 LYS A N    5  
ATOM 5201  C CA   . LYS A 1 42 ? -0.293  -21.083 4.456   1.00 0.00 ? 42 LYS A CA   5  
ATOM 5202  C C    . LYS A 1 42 ? -1.298  -20.521 5.457   1.00 0.00 ? 42 LYS A C    5  
ATOM 5203  O O    . LYS A 1 42 ? -2.421  -21.012 5.565   1.00 0.00 ? 42 LYS A O    5  
ATOM 5204  C CB   . LYS A 1 42 ? 0.447   -22.272 5.073   1.00 0.00 ? 42 LYS A CB   5  
ATOM 5205  C CG   . LYS A 1 42 ? -0.388  -23.540 5.140   1.00 0.00 ? 42 LYS A CG   5  
ATOM 5206  C CD   . LYS A 1 42 ? 0.476   -24.764 5.393   1.00 0.00 ? 42 LYS A CD   5  
ATOM 5207  C CE   . LYS A 1 42 ? -0.277  -26.050 5.090   1.00 0.00 ? 42 LYS A CE   5  
ATOM 5208  N NZ   . LYS A 1 42 ? -0.550  -26.203 3.634   1.00 0.00 ? 42 LYS A NZ   5  
ATOM 5209  H H    . LYS A 1 42 ? 1.520   -19.992 4.499   1.00 0.00 ? 42 LYS A H    5  
ATOM 5210  H HA   . LYS A 1 42 ? -0.826  -21.418 3.578   1.00 0.00 ? 42 LYS A HA   5  
ATOM 5211  H HB2  . LYS A 1 42 ? 1.328   -22.477 4.484   1.00 0.00 ? 42 LYS A HB2  5  
ATOM 5212  H HB3  . LYS A 1 42 ? 0.748   -22.012 6.077   1.00 0.00 ? 42 LYS A HB3  5  
ATOM 5213  H HG2  . LYS A 1 42 ? -1.105  -23.446 5.942   1.00 0.00 ? 42 LYS A HG2  5  
ATOM 5214  H HG3  . LYS A 1 42 ? -0.909  -23.666 4.201   1.00 0.00 ? 42 LYS A HG3  5  
ATOM 5215  H HD2  . LYS A 1 42 ? 1.350   -24.714 4.761   1.00 0.00 ? 42 LYS A HD2  5  
ATOM 5216  H HD3  . LYS A 1 42 ? 0.780   -24.771 6.430   1.00 0.00 ? 42 LYS A HD3  5  
ATOM 5217  H HE2  . LYS A 1 42 ? 0.317   -26.887 5.425   1.00 0.00 ? 42 LYS A HE2  5  
ATOM 5218  H HE3  . LYS A 1 42 ? -1.215  -26.037 5.624   1.00 0.00 ? 42 LYS A HE3  5  
ATOM 5219  H HZ1  . LYS A 1 42 ? -1.046  -25.362 3.274   1.00 0.00 ? 42 LYS A HZ1  5  
ATOM 5220  H HZ2  . LYS A 1 42 ? -1.144  -27.039 3.468   1.00 0.00 ? 42 LYS A HZ2  5  
ATOM 5221  H HZ3  . LYS A 1 42 ? 0.343   -26.315 3.112   1.00 0.00 ? 42 LYS A HZ3  5  
ATOM 5222  N N    . MET A 1 43 ? -0.886  -19.489 6.185   1.00 0.00 ? 43 MET A N    5  
ATOM 5223  C CA   . MET A 1 43 ? -1.752  -18.859 7.175   1.00 0.00 ? 43 MET A CA   5  
ATOM 5224  C C    . MET A 1 43 ? -2.711  -17.876 6.512   1.00 0.00 ? 43 MET A C    5  
ATOM 5225  O O    . MET A 1 43 ? -3.903  -17.851 6.821   1.00 0.00 ? 43 MET A O    5  
ATOM 5226  C CB   . MET A 1 43 ? -0.914  -18.138 8.232   1.00 0.00 ? 43 MET A CB   5  
ATOM 5227  C CG   . MET A 1 43 ? -1.725  -17.209 9.121   1.00 0.00 ? 43 MET A CG   5  
ATOM 5228  S SD   . MET A 1 43 ? -0.993  -16.998 10.756  1.00 0.00 ? 43 MET A SD   5  
ATOM 5229  C CE   . MET A 1 43 ? 0.155   -15.660 10.442  1.00 0.00 ? 43 MET A CE   5  
ATOM 5230  H H    . MET A 1 43 ? 0.021   -19.142 6.054   1.00 0.00 ? 43 MET A H    5  
ATOM 5231  H HA   . MET A 1 43 ? -2.327  -19.637 7.655   1.00 0.00 ? 43 MET A HA   5  
ATOM 5232  H HB2  . MET A 1 43 ? -0.435  -18.875 8.860   1.00 0.00 ? 43 MET A HB2  5  
ATOM 5233  H HB3  . MET A 1 43 ? -0.155  -17.552 7.735   1.00 0.00 ? 43 MET A HB3  5  
ATOM 5234  H HG2  . MET A 1 43 ? -1.791  -16.242 8.645   1.00 0.00 ? 43 MET A HG2  5  
ATOM 5235  H HG3  . MET A 1 43 ? -2.717  -17.620 9.236   1.00 0.00 ? 43 MET A HG3  5  
ATOM 5236  H HE1  . MET A 1 43 ? 1.111   -15.894 10.887  1.00 0.00 ? 43 MET A HE1  5  
ATOM 5237  H HE2  . MET A 1 43 ? 0.276   -15.531 9.377   1.00 0.00 ? 43 MET A HE2  5  
ATOM 5238  H HE3  . MET A 1 43 ? -0.229  -14.747 10.874  1.00 0.00 ? 43 MET A HE3  5  
ATOM 5239  N N    . LEU A 1 44 ? -2.184  -17.067 5.599   1.00 0.00 ? 44 LEU A N    5  
ATOM 5240  C CA   . LEU A 1 44 ? -2.994  -16.081 4.891   1.00 0.00 ? 44 LEU A CA   5  
ATOM 5241  C C    . LEU A 1 44 ? -3.575  -16.672 3.610   1.00 0.00 ? 44 LEU A C    5  
ATOM 5242  O O    . LEU A 1 44 ? -4.210  -15.969 2.825   1.00 0.00 ? 44 LEU A O    5  
ATOM 5243  C CB   . LEU A 1 44 ? -2.155  -14.845 4.562   1.00 0.00 ? 44 LEU A CB   5  
ATOM 5244  C CG   . LEU A 1 44 ? -1.412  -14.206 5.736   1.00 0.00 ? 44 LEU A CG   5  
ATOM 5245  C CD1  . LEU A 1 44 ? -0.405  -13.182 5.236   1.00 0.00 ? 44 LEU A CD1  5  
ATOM 5246  C CD2  . LEU A 1 44 ? -2.396  -13.562 6.702   1.00 0.00 ? 44 LEU A CD2  5  
ATOM 5247  H H    . LEU A 1 44 ? -1.228  -17.134 5.395   1.00 0.00 ? 44 LEU A H    5  
ATOM 5248  H HA   . LEU A 1 44 ? -3.806  -15.792 5.541   1.00 0.00 ? 44 LEU A HA   5  
ATOM 5249  H HB2  . LEU A 1 44 ? -1.422  -15.130 3.823   1.00 0.00 ? 44 LEU A HB2  5  
ATOM 5250  H HB3  . LEU A 1 44 ? -2.816  -14.100 4.142   1.00 0.00 ? 44 LEU A HB3  5  
ATOM 5251  H HG   . LEU A 1 44 ? -0.870  -14.973 6.271   1.00 0.00 ? 44 LEU A HG   5  
ATOM 5252  H HD11 . LEU A 1 44 ? -0.006  -12.631 6.074   1.00 0.00 ? 44 LEU A HD11 5  
ATOM 5253  H HD12 . LEU A 1 44 ? -0.892  -12.500 4.555   1.00 0.00 ? 44 LEU A HD12 5  
ATOM 5254  H HD13 . LEU A 1 44 ? 0.399   -13.690 4.723   1.00 0.00 ? 44 LEU A HD13 5  
ATOM 5255  H HD21 . LEU A 1 44 ? -2.334  -14.056 7.660   1.00 0.00 ? 44 LEU A HD21 5  
ATOM 5256  H HD22 . LEU A 1 44 ? -3.398  -13.657 6.311   1.00 0.00 ? 44 LEU A HD22 5  
ATOM 5257  H HD23 . LEU A 1 44 ? -2.152  -12.516 6.819   1.00 0.00 ? 44 LEU A HD23 5  
ATOM 5258  N N    . GLN A 1 45 ? -3.354  -17.967 3.409   1.00 0.00 ? 45 GLN A N    5  
ATOM 5259  C CA   . GLN A 1 45 ? -3.857  -18.651 2.224   1.00 0.00 ? 45 GLN A CA   5  
ATOM 5260  C C    . GLN A 1 45 ? -3.306  -18.015 0.952   1.00 0.00 ? 45 GLN A C    5  
ATOM 5261  O O    . GLN A 1 45 ? -3.972  -17.996 -0.084  1.00 0.00 ? 45 GLN A O    5  
ATOM 5262  C CB   . GLN A 1 45 ? -5.386  -18.621 2.202   1.00 0.00 ? 45 GLN A CB   5  
ATOM 5263  C CG   . GLN A 1 45 ? -6.029  -19.784 2.940   1.00 0.00 ? 45 GLN A CG   5  
ATOM 5264  C CD   . GLN A 1 45 ? -7.540  -19.680 2.991   1.00 0.00 ? 45 GLN A CD   5  
ATOM 5265  O OE1  . GLN A 1 45 ? -8.224  -19.915 1.994   1.00 0.00 ? 45 GLN A OE1  5  
ATOM 5266  N NE2  . GLN A 1 45 ? -8.071  -19.326 4.156   1.00 0.00 ? 45 GLN A NE2  5  
ATOM 5267  H H    . GLN A 1 45 ? -2.841  -18.473 4.071   1.00 0.00 ? 45 GLN A H    5  
ATOM 5268  H HA   . GLN A 1 45 ? -3.528  -19.678 2.269   1.00 0.00 ? 45 GLN A HA   5  
ATOM 5269  H HB2  . GLN A 1 45 ? -5.723  -17.702 2.659   1.00 0.00 ? 45 GLN A HB2  5  
ATOM 5270  H HB3  . GLN A 1 45 ? -5.721  -18.646 1.175   1.00 0.00 ? 45 GLN A HB3  5  
ATOM 5271  H HG2  . GLN A 1 45 ? -5.764  -20.703 2.438   1.00 0.00 ? 45 GLN A HG2  5  
ATOM 5272  H HG3  . GLN A 1 45 ? -5.650  -19.805 3.951   1.00 0.00 ? 45 GLN A HG3  5  
ATOM 5273  H HE21 . GLN A 1 45 ? -7.464  -19.153 4.907   1.00 0.00 ? 45 GLN A HE21 5  
ATOM 5274  H HE22 . GLN A 1 45 ? -9.045  -19.250 4.217   1.00 0.00 ? 45 GLN A HE22 5  
ATOM 5275  N N    . LEU A 1 46 ? -2.087  -17.494 1.038   1.00 0.00 ? 46 LEU A N    5  
ATOM 5276  C CA   . LEU A 1 46 ? -1.445  -16.856 -0.107  1.00 0.00 ? 46 LEU A CA   5  
ATOM 5277  C C    . LEU A 1 46 ? -0.348  -17.746 -0.682  1.00 0.00 ? 46 LEU A C    5  
ATOM 5278  O O    . LEU A 1 46 ? -0.142  -18.869 -0.223  1.00 0.00 ? 46 LEU A O    5  
ATOM 5279  C CB   . LEU A 1 46 ? -0.860  -15.503 0.301   1.00 0.00 ? 46 LEU A CB   5  
ATOM 5280  C CG   . LEU A 1 46 ? -1.800  -14.566 1.061   1.00 0.00 ? 46 LEU A CG   5  
ATOM 5281  C CD1  . LEU A 1 46 ? -1.030  -13.385 1.631   1.00 0.00 ? 46 LEU A CD1  5  
ATOM 5282  C CD2  . LEU A 1 46 ? -2.921  -14.085 0.152   1.00 0.00 ? 46 LEU A CD2  5  
ATOM 5283  H H    . LEU A 1 46 ? -1.606  -17.540 1.890   1.00 0.00 ? 46 LEU A H    5  
ATOM 5284  H HA   . LEU A 1 46 ? -2.199  -16.699 -0.864  1.00 0.00 ? 46 LEU A HA   5  
ATOM 5285  H HB2  . LEU A 1 46 ? -0.002  -15.690 0.928   1.00 0.00 ? 46 LEU A HB2  5  
ATOM 5286  H HB3  . LEU A 1 46 ? -0.542  -14.996 -0.599  1.00 0.00 ? 46 LEU A HB3  5  
ATOM 5287  H HG   . LEU A 1 46 ? -2.244  -15.104 1.886   1.00 0.00 ? 46 LEU A HG   5  
ATOM 5288  H HD11 . LEU A 1 46 ? -1.648  -12.864 2.346   1.00 0.00 ? 46 LEU A HD11 5  
ATOM 5289  H HD12 . LEU A 1 46 ? -0.758  -12.712 0.832   1.00 0.00 ? 46 LEU A HD12 5  
ATOM 5290  H HD13 . LEU A 1 46 ? -0.135  -13.742 2.120   1.00 0.00 ? 46 LEU A HD13 5  
ATOM 5291  H HD21 . LEU A 1 46 ? -3.353  -13.183 0.561   1.00 0.00 ? 46 LEU A HD21 5  
ATOM 5292  H HD22 . LEU A 1 46 ? -3.682  -14.849 0.084   1.00 0.00 ? 46 LEU A HD22 5  
ATOM 5293  H HD23 . LEU A 1 46 ? -2.526  -13.881 -0.831  1.00 0.00 ? 46 LEU A HD23 5  
ATOM 5294  N N    . SER A 1 47 ? 0.354   -17.235 -1.688  1.00 0.00 ? 47 SER A N    5  
ATOM 5295  C CA   . SER A 1 47 ? 1.430   -17.983 -2.327  1.00 0.00 ? 47 SER A CA   5  
ATOM 5296  C C    . SER A 1 47 ? 2.783   -17.336 -2.047  1.00 0.00 ? 47 SER A C    5  
ATOM 5297  O O    . SER A 1 47 ? 2.876   -16.124 -1.859  1.00 0.00 ? 47 SER A O    5  
ATOM 5298  C CB   . SER A 1 47 ? 1.195   -18.067 -3.837  1.00 0.00 ? 47 SER A CB   5  
ATOM 5299  O OG   . SER A 1 47 ? 1.886   -19.168 -4.400  1.00 0.00 ? 47 SER A OG   5  
ATOM 5300  H H    . SER A 1 47 ? 0.142   -16.333 -2.010  1.00 0.00 ? 47 SER A H    5  
ATOM 5301  H HA   . SER A 1 47 ? 1.429   -18.981 -1.916  1.00 0.00 ? 47 SER A HA   5  
ATOM 5302  H HB2  . SER A 1 47 ? 0.139   -18.184 -4.028  1.00 0.00 ? 47 SER A HB2  5  
ATOM 5303  H HB3  . SER A 1 47 ? 1.547   -17.159 -4.304  1.00 0.00 ? 47 SER A HB3  5  
ATOM 5304  H HG   . SER A 1 47 ? 2.339   -18.888 -5.198  1.00 0.00 ? 47 SER A HG   5  
ATOM 5305  N N    . GLU A 1 48 ? 3.830   -18.156 -2.021  1.00 0.00 ? 48 GLU A N    5  
ATOM 5306  C CA   . GLU A 1 48 ? 5.178   -17.664 -1.763  1.00 0.00 ? 48 GLU A CA   5  
ATOM 5307  C C    . GLU A 1 48 ? 5.482   -16.437 -2.618  1.00 0.00 ? 48 GLU A C    5  
ATOM 5308  O O    . GLU A 1 48 ? 6.052   -15.458 -2.137  1.00 0.00 ? 48 GLU A O    5  
ATOM 5309  C CB   . GLU A 1 48 ? 6.207   -18.761 -2.040  1.00 0.00 ? 48 GLU A CB   5  
ATOM 5310  C CG   . GLU A 1 48 ? 6.401   -19.721 -0.879  1.00 0.00 ? 48 GLU A CG   5  
ATOM 5311  C CD   . GLU A 1 48 ? 7.567   -20.668 -1.093  1.00 0.00 ? 48 GLU A CD   5  
ATOM 5312  O OE1  . GLU A 1 48 ? 8.706   -20.294 -0.743  1.00 0.00 ? 48 GLU A OE1  5  
ATOM 5313  O OE2  . GLU A 1 48 ? 7.340   -21.781 -1.611  1.00 0.00 ? 48 GLU A OE2  5  
ATOM 5314  H H    . GLU A 1 48 ? 3.692   -19.113 -2.178  1.00 0.00 ? 48 GLU A H    5  
ATOM 5315  H HA   . GLU A 1 48 ? 5.235   -17.385 -0.721  1.00 0.00 ? 48 GLU A HA   5  
ATOM 5316  H HB2  . GLU A 1 48 ? 5.886   -19.329 -2.901  1.00 0.00 ? 48 GLU A HB2  5  
ATOM 5317  H HB3  . GLU A 1 48 ? 7.158   -18.298 -2.260  1.00 0.00 ? 48 GLU A HB3  5  
ATOM 5318  H HG2  . GLU A 1 48 ? 6.583   -19.149 0.018   1.00 0.00 ? 48 GLU A HG2  5  
ATOM 5319  H HG3  . GLU A 1 48 ? 5.501   -20.305 -0.756  1.00 0.00 ? 48 GLU A HG3  5  
ATOM 5320  N N    . ARG A 1 49 ? 5.099   -16.500 -3.889  1.00 0.00 ? 49 ARG A N    5  
ATOM 5321  C CA   . ARG A 1 49 ? 5.332   -15.396 -4.812  1.00 0.00 ? 49 ARG A CA   5  
ATOM 5322  C C    . ARG A 1 49 ? 4.539   -14.161 -4.395  1.00 0.00 ? 49 ARG A C    5  
ATOM 5323  O O    . ARG A 1 49 ? 5.005   -13.032 -4.547  1.00 0.00 ? 49 ARG A O    5  
ATOM 5324  C CB   . ARG A 1 49 ? 4.949   -15.804 -6.236  1.00 0.00 ? 49 ARG A CB   5  
ATOM 5325  C CG   . ARG A 1 49 ? 3.772   -16.764 -6.298  1.00 0.00 ? 49 ARG A CG   5  
ATOM 5326  C CD   . ARG A 1 49 ? 3.150   -16.794 -7.685  1.00 0.00 ? 49 ARG A CD   5  
ATOM 5327  N NE   . ARG A 1 49 ? 1.923   -17.585 -7.718  1.00 0.00 ? 49 ARG A NE   5  
ATOM 5328  C CZ   . ARG A 1 49 ? 1.905   -18.910 -7.804  1.00 0.00 ? 49 ARG A CZ   5  
ATOM 5329  N NH1  . ARG A 1 49 ? 3.042   -19.589 -7.865  1.00 0.00 ? 49 ARG A NH1  5  
ATOM 5330  N NH2  . ARG A 1 49 ? 0.748   -19.559 -7.829  1.00 0.00 ? 49 ARG A NH2  5  
ATOM 5331  H H    . ARG A 1 49 ? 4.649   -17.307 -4.214  1.00 0.00 ? 49 ARG A H    5  
ATOM 5332  H HA   . ARG A 1 49 ? 6.385   -15.158 -4.787  1.00 0.00 ? 49 ARG A HA   5  
ATOM 5333  H HB2  . ARG A 1 49 ? 4.691   -14.917 -6.795  1.00 0.00 ? 49 ARG A HB2  5  
ATOM 5334  H HB3  . ARG A 1 49 ? 5.798   -16.279 -6.702  1.00 0.00 ? 49 ARG A HB3  5  
ATOM 5335  H HG2  . ARG A 1 49 ? 4.116   -17.757 -6.049  1.00 0.00 ? 49 ARG A HG2  5  
ATOM 5336  H HG3  . ARG A 1 49 ? 3.025   -16.449 -5.584  1.00 0.00 ? 49 ARG A HG3  5  
ATOM 5337  H HD2  . ARG A 1 49 ? 2.922   -15.781 -7.985  1.00 0.00 ? 49 ARG A HD2  5  
ATOM 5338  H HD3  . ARG A 1 49 ? 3.862   -17.222 -8.375  1.00 0.00 ? 49 ARG A HD3  5  
ATOM 5339  H HE   . ARG A 1 49 ? 1.071   -17.103 -7.674  1.00 0.00 ? 49 ARG A HE   5  
ATOM 5340  H HH11 . ARG A 1 49 ? 3.915   -19.103 -7.846  1.00 0.00 ? 49 ARG A HH11 5  
ATOM 5341  H HH12 . ARG A 1 49 ? 3.026   -20.587 -7.929  1.00 0.00 ? 49 ARG A HH12 5  
ATOM 5342  H HH21 . ARG A 1 49 ? -0.112  -19.051 -7.783  1.00 0.00 ? 49 ARG A HH21 5  
ATOM 5343  H HH22 . ARG A 1 49 ? 0.735   -20.556 -7.894  1.00 0.00 ? 49 ARG A HH22 5  
ATOM 5344  N N    . GLN A 1 50 ? 3.339   -14.384 -3.869  1.00 0.00 ? 50 GLN A N    5  
ATOM 5345  C CA   . GLN A 1 50 ? 2.482   -13.289 -3.431  1.00 0.00 ? 50 GLN A CA   5  
ATOM 5346  C C    . GLN A 1 50 ? 3.056   -12.610 -2.192  1.00 0.00 ? 50 GLN A C    5  
ATOM 5347  O O    . GLN A 1 50 ? 2.972   -11.390 -2.045  1.00 0.00 ? 50 GLN A O    5  
ATOM 5348  C CB   . GLN A 1 50 ? 1.071   -13.804 -3.136  1.00 0.00 ? 50 GLN A CB   5  
ATOM 5349  C CG   . GLN A 1 50 ? 0.211   -13.967 -4.379  1.00 0.00 ? 50 GLN A CG   5  
ATOM 5350  C CD   . GLN A 1 50 ? -1.206  -14.396 -4.056  1.00 0.00 ? 50 GLN A CD   5  
ATOM 5351  O OE1  . GLN A 1 50 ? -2.133  -13.585 -4.078  1.00 0.00 ? 50 GLN A OE1  5  
ATOM 5352  N NE2  . GLN A 1 50 ? -1.383  -15.677 -3.754  1.00 0.00 ? 50 GLN A NE2  5  
ATOM 5353  H H    . GLN A 1 50 ? 3.023   -15.306 -3.773  1.00 0.00 ? 50 GLN A H    5  
ATOM 5354  H HA   . GLN A 1 50 ? 2.431   -12.567 -4.231  1.00 0.00 ? 50 GLN A HA   5  
ATOM 5355  H HB2  . GLN A 1 50 ? 1.146   -14.764 -2.648  1.00 0.00 ? 50 GLN A HB2  5  
ATOM 5356  H HB3  . GLN A 1 50 ? 0.579   -13.109 -2.473  1.00 0.00 ? 50 GLN A HB3  5  
ATOM 5357  H HG2  . GLN A 1 50 ? 0.174   -13.022 -4.902  1.00 0.00 ? 50 GLN A HG2  5  
ATOM 5358  H HG3  . GLN A 1 50 ? 0.662   -14.713 -5.018  1.00 0.00 ? 50 GLN A HG3  5  
ATOM 5359  H HE21 . GLN A 1 50 ? -0.598  -16.265 -3.755  1.00 0.00 ? 50 GLN A HE21 5  
ATOM 5360  H HE22 . GLN A 1 50 ? -2.288  -15.981 -3.540  1.00 0.00 ? 50 GLN A HE22 5  
ATOM 5361  N N    . VAL A 1 51 ? 3.641   -13.407 -1.303  1.00 0.00 ? 51 VAL A N    5  
ATOM 5362  C CA   . VAL A 1 51 ? 4.230   -12.882 -0.077  1.00 0.00 ? 51 VAL A CA   5  
ATOM 5363  C C    . VAL A 1 51 ? 5.634   -12.343 -0.329  1.00 0.00 ? 51 VAL A C    5  
ATOM 5364  O O    . VAL A 1 51 ? 6.114   -11.468 0.391   1.00 0.00 ? 51 VAL A O    5  
ATOM 5365  C CB   . VAL A 1 51 ? 4.296   -13.961 1.020   1.00 0.00 ? 51 VAL A CB   5  
ATOM 5366  C CG1  . VAL A 1 51 ? 4.784   -13.361 2.330   1.00 0.00 ? 51 VAL A CG1  5  
ATOM 5367  C CG2  . VAL A 1 51 ? 2.937   -14.620 1.200   1.00 0.00 ? 51 VAL A CG2  5  
ATOM 5368  H H    . VAL A 1 51 ? 3.677   -14.370 -1.477  1.00 0.00 ? 51 VAL A H    5  
ATOM 5369  H HA   . VAL A 1 51 ? 3.604   -12.076 0.276   1.00 0.00 ? 51 VAL A HA   5  
ATOM 5370  H HB   . VAL A 1 51 ? 5.002   -14.718 0.711   1.00 0.00 ? 51 VAL A HB   5  
ATOM 5371  H HG11 . VAL A 1 51 ? 5.631   -12.718 2.138   1.00 0.00 ? 51 VAL A HG11 5  
ATOM 5372  H HG12 . VAL A 1 51 ? 3.989   -12.786 2.782   1.00 0.00 ? 51 VAL A HG12 5  
ATOM 5373  H HG13 . VAL A 1 51 ? 5.081   -14.154 3.000   1.00 0.00 ? 51 VAL A HG13 5  
ATOM 5374  H HG21 . VAL A 1 51 ? 2.806   -15.385 0.449   1.00 0.00 ? 51 VAL A HG21 5  
ATOM 5375  H HG22 . VAL A 1 51 ? 2.880   -15.067 2.182   1.00 0.00 ? 51 VAL A HG22 5  
ATOM 5376  H HG23 . VAL A 1 51 ? 2.159   -13.878 1.098   1.00 0.00 ? 51 VAL A HG23 5  
ATOM 5377  N N    . LYS A 1 52 ? 6.289   -12.872 -1.358  1.00 0.00 ? 52 LYS A N    5  
ATOM 5378  C CA   . LYS A 1 52 ? 7.638   -12.444 -1.708  1.00 0.00 ? 52 LYS A CA   5  
ATOM 5379  C C    . LYS A 1 52 ? 7.602   -11.210 -2.604  1.00 0.00 ? 52 LYS A C    5  
ATOM 5380  O O    . LYS A 1 52 ? 8.547   -10.420 -2.630  1.00 0.00 ? 52 LYS A O    5  
ATOM 5381  C CB   . LYS A 1 52 ? 8.388   -13.577 -2.412  1.00 0.00 ? 52 LYS A CB   5  
ATOM 5382  C CG   . LYS A 1 52 ? 8.167   -13.610 -3.915  1.00 0.00 ? 52 LYS A CG   5  
ATOM 5383  C CD   . LYS A 1 52 ? 9.199   -12.770 -4.649  1.00 0.00 ? 52 LYS A CD   5  
ATOM 5384  C CE   . LYS A 1 52 ? 10.465  -13.564 -4.932  1.00 0.00 ? 52 LYS A CE   5  
ATOM 5385  N NZ   . LYS A 1 52 ? 11.174  -13.065 -6.143  1.00 0.00 ? 52 LYS A NZ   5  
ATOM 5386  H H    . LYS A 1 52 ? 5.853   -13.567 -1.896  1.00 0.00 ? 52 LYS A H    5  
ATOM 5387  H HA   . LYS A 1 52 ? 8.155   -12.195 -0.794  1.00 0.00 ? 52 LYS A HA   5  
ATOM 5388  H HB2  . LYS A 1 52 ? 9.446   -13.462 -2.227  1.00 0.00 ? 52 LYS A HB2  5  
ATOM 5389  H HB3  . LYS A 1 52 ? 8.060   -14.520 -2.000  1.00 0.00 ? 52 LYS A HB3  5  
ATOM 5390  H HG2  . LYS A 1 52 ? 8.241   -14.632 -4.258  1.00 0.00 ? 52 LYS A HG2  5  
ATOM 5391  H HG3  . LYS A 1 52 ? 7.181   -13.225 -4.133  1.00 0.00 ? 52 LYS A HG3  5  
ATOM 5392  H HD2  . LYS A 1 52 ? 8.779   -12.438 -5.587  1.00 0.00 ? 52 LYS A HD2  5  
ATOM 5393  H HD3  . LYS A 1 52 ? 9.450   -11.913 -4.041  1.00 0.00 ? 52 LYS A HD3  5  
ATOM 5394  H HE2  . LYS A 1 52 ? 11.123  -13.483 -4.081  1.00 0.00 ? 52 LYS A HE2  5  
ATOM 5395  H HE3  . LYS A 1 52 ? 10.198  -14.600 -5.083  1.00 0.00 ? 52 LYS A HE3  5  
ATOM 5396  H HZ1  . LYS A 1 52 ? 10.869  -13.600 -6.981  1.00 0.00 ? 52 LYS A HZ1  5  
ATOM 5397  H HZ2  . LYS A 1 52 ? 12.201  -13.179 -6.028  1.00 0.00 ? 52 LYS A HZ2  5  
ATOM 5398  H HZ3  . LYS A 1 52 ? 10.962  -12.058 -6.291  1.00 0.00 ? 52 LYS A HZ3  5  
ATOM 5399  N N    . THR A 1 53 ? 6.505   -11.048 -3.337  1.00 0.00 ? 53 THR A N    5  
ATOM 5400  C CA   . THR A 1 53 ? 6.346   -9.910  -4.233  1.00 0.00 ? 53 THR A CA   5  
ATOM 5401  C C    . THR A 1 53 ? 5.767   -8.707  -3.498  1.00 0.00 ? 53 THR A C    5  
ATOM 5402  O O    . THR A 1 53 ? 6.370   -7.634  -3.472  1.00 0.00 ? 53 THR A O    5  
ATOM 5403  C CB   . THR A 1 53 ? 5.433   -10.257 -5.425  1.00 0.00 ? 53 THR A CB   5  
ATOM 5404  O OG1  . THR A 1 53 ? 6.112   -11.144 -6.320  1.00 0.00 ? 53 THR A OG1  5  
ATOM 5405  C CG2  . THR A 1 53 ? 5.014   -8.998  -6.170  1.00 0.00 ? 53 THR A CG2  5  
ATOM 5406  H H    . THR A 1 53 ? 5.786   -11.711 -3.272  1.00 0.00 ? 53 THR A H    5  
ATOM 5407  H HA   . THR A 1 53 ? 7.321   -9.649  -4.618  1.00 0.00 ? 53 THR A HA   5  
ATOM 5408  H HB   . THR A 1 53 ? 4.546   -10.746 -5.049  1.00 0.00 ? 53 THR A HB   5  
ATOM 5409  H HG1  . THR A 1 53 ? 6.737   -10.645 -6.853  1.00 0.00 ? 53 THR A HG1  5  
ATOM 5410  H HG21 . THR A 1 53 ? 4.207   -8.517  -5.638  1.00 0.00 ? 53 THR A HG21 5  
ATOM 5411  H HG22 . THR A 1 53 ? 4.684   -9.261  -7.164  1.00 0.00 ? 53 THR A HG22 5  
ATOM 5412  H HG23 . THR A 1 53 ? 5.854   -8.323  -6.236  1.00 0.00 ? 53 THR A HG23 5  
ATOM 5413  N N    . TRP A 1 54 ? 4.595   -8.893  -2.900  1.00 0.00 ? 54 TRP A N    5  
ATOM 5414  C CA   . TRP A 1 54 ? 3.935   -7.821  -2.162  1.00 0.00 ? 54 TRP A CA   5  
ATOM 5415  C C    . TRP A 1 54 ? 4.941   -7.034  -1.330  1.00 0.00 ? 54 TRP A C    5  
ATOM 5416  O O    . TRP A 1 54 ? 5.082   -5.821  -1.493  1.00 0.00 ? 54 TRP A O    5  
ATOM 5417  C CB   . TRP A 1 54 ? 2.844   -8.395  -1.257  1.00 0.00 ? 54 TRP A CB   5  
ATOM 5418  C CG   . TRP A 1 54 ? 1.971   -7.344  -0.640  1.00 0.00 ? 54 TRP A CG   5  
ATOM 5419  C CD1  . TRP A 1 54 ? 0.769   -6.897  -1.111  1.00 0.00 ? 54 TRP A CD1  5  
ATOM 5420  C CD2  . TRP A 1 54 ? 2.234   -6.608  0.559   1.00 0.00 ? 54 TRP A CD2  5  
ATOM 5421  N NE1  . TRP A 1 54 ? 0.269   -5.927  -0.275  1.00 0.00 ? 54 TRP A NE1  5  
ATOM 5422  C CE2  . TRP A 1 54 ? 1.148   -5.732  0.757   1.00 0.00 ? 54 TRP A CE2  5  
ATOM 5423  C CE3  . TRP A 1 54 ? 3.279   -6.604  1.487   1.00 0.00 ? 54 TRP A CE3  5  
ATOM 5424  C CZ2  . TRP A 1 54 ? 1.081   -4.863  1.843   1.00 0.00 ? 54 TRP A CZ2  5  
ATOM 5425  C CZ3  . TRP A 1 54 ? 3.211   -5.741  2.563   1.00 0.00 ? 54 TRP A CZ3  5  
ATOM 5426  C CH2  . TRP A 1 54 ? 2.118   -4.881  2.735   1.00 0.00 ? 54 TRP A CH2  5  
ATOM 5427  H H    . TRP A 1 54 ? 4.164   -9.771  -2.956  1.00 0.00 ? 54 TRP A H    5  
ATOM 5428  H HA   . TRP A 1 54 ? 3.481   -7.156  -2.882  1.00 0.00 ? 54 TRP A HA   5  
ATOM 5429  H HB2  . TRP A 1 54 ? 2.214   -9.054  -1.836  1.00 0.00 ? 54 TRP A HB2  5  
ATOM 5430  H HB3  . TRP A 1 54 ? 3.307   -8.956  -0.458  1.00 0.00 ? 54 TRP A HB3  5  
ATOM 5431  H HD1  . TRP A 1 54 ? 0.295   -7.261  -2.009  1.00 0.00 ? 54 TRP A HD1  5  
ATOM 5432  H HE1  . TRP A 1 54 ? -0.581  -5.454  -0.399  1.00 0.00 ? 54 TRP A HE1  5  
ATOM 5433  H HE3  . TRP A 1 54 ? 4.129   -7.260  1.372   1.00 0.00 ? 54 TRP A HE3  5  
ATOM 5434  H HZ2  . TRP A 1 54 ? 0.245   -4.195  1.989   1.00 0.00 ? 54 TRP A HZ2  5  
ATOM 5435  H HZ3  . TRP A 1 54 ? 4.010   -5.724  3.290   1.00 0.00 ? 54 TRP A HZ3  5  
ATOM 5436  H HH2  . TRP A 1 54 ? 2.107   -4.224  3.590   1.00 0.00 ? 54 TRP A HH2  5  
ATOM 5437  N N    . PHE A 1 55 ? 5.639   -7.729  -0.438  1.00 0.00 ? 55 PHE A N    5  
ATOM 5438  C CA   . PHE A 1 55 ? 6.631   -7.094  0.420   1.00 0.00 ? 55 PHE A CA   5  
ATOM 5439  C C    . PHE A 1 55 ? 7.629   -6.288  -0.407  1.00 0.00 ? 55 PHE A C    5  
ATOM 5440  O O    . PHE A 1 55 ? 7.845   -5.103  -0.155  1.00 0.00 ? 55 PHE A O    5  
ATOM 5441  C CB   . PHE A 1 55 ? 7.370   -8.147  1.248   1.00 0.00 ? 55 PHE A CB   5  
ATOM 5442  C CG   . PHE A 1 55 ? 6.588   -8.635  2.433   1.00 0.00 ? 55 PHE A CG   5  
ATOM 5443  C CD1  . PHE A 1 55 ? 5.464   -9.425  2.261   1.00 0.00 ? 55 PHE A CD1  5  
ATOM 5444  C CD2  . PHE A 1 55 ? 6.977   -8.302  3.721   1.00 0.00 ? 55 PHE A CD2  5  
ATOM 5445  C CE1  . PHE A 1 55 ? 4.742   -9.876  3.350   1.00 0.00 ? 55 PHE A CE1  5  
ATOM 5446  C CE2  . PHE A 1 55 ? 6.260   -8.750  4.814   1.00 0.00 ? 55 PHE A CE2  5  
ATOM 5447  C CZ   . PHE A 1 55 ? 5.140   -9.537  4.628   1.00 0.00 ? 55 PHE A CZ   5  
ATOM 5448  H H    . PHE A 1 55 ? 5.481   -8.693  -0.355  1.00 0.00 ? 55 PHE A H    5  
ATOM 5449  H HA   . PHE A 1 55 ? 6.111   -6.424  1.087   1.00 0.00 ? 55 PHE A HA   5  
ATOM 5450  H HB2  . PHE A 1 55 ? 7.588   -8.999  0.621   1.00 0.00 ? 55 PHE A HB2  5  
ATOM 5451  H HB3  . PHE A 1 55 ? 8.296   -7.726  1.609   1.00 0.00 ? 55 PHE A HB3  5  
ATOM 5452  H HD1  . PHE A 1 55 ? 5.151   -9.691  1.261   1.00 0.00 ? 55 PHE A HD1  5  
ATOM 5453  H HD2  . PHE A 1 55 ? 7.852   -7.686  3.868   1.00 0.00 ? 55 PHE A HD2  5  
ATOM 5454  H HE1  . PHE A 1 55 ? 3.867   -10.491 3.201   1.00 0.00 ? 55 PHE A HE1  5  
ATOM 5455  H HE2  . PHE A 1 55 ? 6.573   -8.483  5.812   1.00 0.00 ? 55 PHE A HE2  5  
ATOM 5456  H HZ   . PHE A 1 55 ? 4.578   -9.889  5.480   1.00 0.00 ? 55 PHE A HZ   5  
ATOM 5457  N N    . GLN A 1 56 ? 8.234   -6.941  -1.394  1.00 0.00 ? 56 GLN A N    5  
ATOM 5458  C CA   . GLN A 1 56 ? 9.210   -6.286  -2.257  1.00 0.00 ? 56 GLN A CA   5  
ATOM 5459  C C    . GLN A 1 56 ? 8.662   -4.969  -2.797  1.00 0.00 ? 56 GLN A C    5  
ATOM 5460  O O    . GLN A 1 56 ? 9.298   -3.923  -2.671  1.00 0.00 ? 56 GLN A O    5  
ATOM 5461  C CB   . GLN A 1 56 ? 9.595   -7.206  -3.417  1.00 0.00 ? 56 GLN A CB   5  
ATOM 5462  C CG   . GLN A 1 56 ? 10.743  -8.148  -3.091  1.00 0.00 ? 56 GLN A CG   5  
ATOM 5463  C CD   . GLN A 1 56 ? 10.936  -9.220  -4.146  1.00 0.00 ? 56 GLN A CD   5  
ATOM 5464  O OE1  . GLN A 1 56 ? 10.167  -9.310  -5.104  1.00 0.00 ? 56 GLN A OE1  5  
ATOM 5465  N NE2  . GLN A 1 56 ? 11.966  -10.040 -3.976  1.00 0.00 ? 56 GLN A NE2  5  
ATOM 5466  H H    . GLN A 1 56 ? 8.020   -7.884  -1.545  1.00 0.00 ? 56 GLN A H    5  
ATOM 5467  H HA   . GLN A 1 56 ? 10.090  -6.080  -1.666  1.00 0.00 ? 56 GLN A HA   5  
ATOM 5468  H HB2  . GLN A 1 56 ? 8.736   -7.800  -3.690  1.00 0.00 ? 56 GLN A HB2  5  
ATOM 5469  H HB3  . GLN A 1 56 ? 9.886   -6.598  -4.261  1.00 0.00 ? 56 GLN A HB3  5  
ATOM 5470  H HG2  . GLN A 1 56 ? 11.653  -7.573  -3.014  1.00 0.00 ? 56 GLN A HG2  5  
ATOM 5471  H HG3  . GLN A 1 56 ? 10.540  -8.627  -2.145  1.00 0.00 ? 56 GLN A HG3  5  
ATOM 5472  H HE21 . GLN A 1 56 ? 12.536  -9.909  -3.188  1.00 0.00 ? 56 GLN A HE21 5  
ATOM 5473  H HE22 . GLN A 1 56 ? 12.114  -10.742 -4.642  1.00 0.00 ? 56 GLN A HE22 5  
ATOM 5474  N N    . ASN A 1 57 ? 7.479   -5.029  -3.399  1.00 0.00 ? 57 ASN A N    5  
ATOM 5475  C CA   . ASN A 1 57 ? 6.846   -3.840  -3.959  1.00 0.00 ? 57 ASN A CA   5  
ATOM 5476  C C    . ASN A 1 57 ? 6.534   -2.823  -2.866  1.00 0.00 ? 57 ASN A C    5  
ATOM 5477  O O    . ASN A 1 57 ? 6.594   -1.615  -3.093  1.00 0.00 ? 57 ASN A O    5  
ATOM 5478  C CB   . ASN A 1 57 ? 5.562   -4.222  -4.698  1.00 0.00 ? 57 ASN A CB   5  
ATOM 5479  C CG   . ASN A 1 57 ? 5.837   -4.961  -5.993  1.00 0.00 ? 57 ASN A CG   5  
ATOM 5480  O OD1  . ASN A 1 57 ? 6.846   -4.720  -6.656  1.00 0.00 ? 57 ASN A OD1  5  
ATOM 5481  N ND2  . ASN A 1 57 ? 4.939   -5.868  -6.359  1.00 0.00 ? 57 ASN A ND2  5  
ATOM 5482  H H    . ASN A 1 57 ? 7.021   -5.892  -3.469  1.00 0.00 ? 57 ASN A H    5  
ATOM 5483  H HA   . ASN A 1 57 ? 7.536   -3.397  -4.661  1.00 0.00 ? 57 ASN A HA   5  
ATOM 5484  H HB2  . ASN A 1 57 ? 4.964   -4.859  -4.063  1.00 0.00 ? 57 ASN A HB2  5  
ATOM 5485  H HB3  . ASN A 1 57 ? 5.005   -3.325  -4.928  1.00 0.00 ? 57 ASN A HB3  5  
ATOM 5486  H HD21 . ASN A 1 57 ? 4.159   -6.007  -5.782  1.00 0.00 ? 57 ASN A HD21 5  
ATOM 5487  H HD22 . ASN A 1 57 ? 5.092   -6.361  -7.192  1.00 0.00 ? 57 ASN A HD22 5  
ATOM 5488  N N    . ARG A 1 58 ? 6.202   -3.321  -1.679  1.00 0.00 ? 58 ARG A N    5  
ATOM 5489  C CA   . ARG A 1 58 ? 5.880   -2.457  -0.551  1.00 0.00 ? 58 ARG A CA   5  
ATOM 5490  C C    . ARG A 1 58 ? 7.075   -1.586  -0.175  1.00 0.00 ? 58 ARG A C    5  
ATOM 5491  O O    . ARG A 1 58 ? 6.968   -0.361  -0.110  1.00 0.00 ? 58 ARG A O    5  
ATOM 5492  C CB   . ARG A 1 58 ? 5.446   -3.294  0.654   1.00 0.00 ? 58 ARG A CB   5  
ATOM 5493  C CG   . ARG A 1 58 ? 5.074   -2.464  1.871   1.00 0.00 ? 58 ARG A CG   5  
ATOM 5494  C CD   . ARG A 1 58 ? 3.774   -1.705  1.651   1.00 0.00 ? 58 ARG A CD   5  
ATOM 5495  N NE   . ARG A 1 58 ? 3.589   -0.640  2.633   1.00 0.00 ? 58 ARG A NE   5  
ATOM 5496  C CZ   . ARG A 1 58 ? 2.674   0.316   2.517   1.00 0.00 ? 58 ARG A CZ   5  
ATOM 5497  N NH1  . ARG A 1 58 ? 1.865   0.339   1.467   1.00 0.00 ? 58 ARG A NH1  5  
ATOM 5498  N NH2  . ARG A 1 58 ? 2.567   1.250   3.453   1.00 0.00 ? 58 ARG A NH2  5  
ATOM 5499  H H    . ARG A 1 58 ? 6.171   -4.294  -1.560  1.00 0.00 ? 58 ARG A H    5  
ATOM 5500  H HA   . ARG A 1 58 ? 5.062   -1.816  -0.846  1.00 0.00 ? 58 ARG A HA   5  
ATOM 5501  H HB2  . ARG A 1 58 ? 4.588   -3.888  0.374   1.00 0.00 ? 58 ARG A HB2  5  
ATOM 5502  H HB3  . ARG A 1 58 ? 6.256   -3.953  0.928   1.00 0.00 ? 58 ARG A HB3  5  
ATOM 5503  H HG2  . ARG A 1 58 ? 4.956   -3.120  2.721   1.00 0.00 ? 58 ARG A HG2  5  
ATOM 5504  H HG3  . ARG A 1 58 ? 5.865   -1.756  2.067   1.00 0.00 ? 58 ARG A HG3  5  
ATOM 5505  H HD2  . ARG A 1 58 ? 3.788   -1.272  0.663   1.00 0.00 ? 58 ARG A HD2  5  
ATOM 5506  H HD3  . ARG A 1 58 ? 2.951   -2.400  1.728   1.00 0.00 ? 58 ARG A HD3  5  
ATOM 5507  H HE   . ARG A 1 58 ? 4.176   -0.639  3.417   1.00 0.00 ? 58 ARG A HE   5  
ATOM 5508  H HH11 . ARG A 1 58 ? 1.942   -0.364  0.761   1.00 0.00 ? 58 ARG A HH11 5  
ATOM 5509  H HH12 . ARG A 1 58 ? 1.176   1.059   1.383   1.00 0.00 ? 58 ARG A HH12 5  
ATOM 5510  H HH21 . ARG A 1 58 ? 3.175   1.236   4.246   1.00 0.00 ? 58 ARG A HH21 5  
ATOM 5511  H HH22 . ARG A 1 58 ? 1.878   1.969   3.364   1.00 0.00 ? 58 ARG A HH22 5  
ATOM 5512  N N    . ARG A 1 59 ? 8.213   -2.227  0.073   1.00 0.00 ? 59 ARG A N    5  
ATOM 5513  C CA   . ARG A 1 59 ? 9.428   -1.512  0.445   1.00 0.00 ? 59 ARG A CA   5  
ATOM 5514  C C    . ARG A 1 59 ? 9.629   -0.286  -0.442  1.00 0.00 ? 59 ARG A C    5  
ATOM 5515  O O    . ARG A 1 59 ? 9.837   0.822   0.052   1.00 0.00 ? 59 ARG A O    5  
ATOM 5516  C CB   . ARG A 1 59 ? 10.642  -2.436  0.339   1.00 0.00 ? 59 ARG A CB   5  
ATOM 5517  C CG   . ARG A 1 59 ? 11.831  -1.977  1.167   1.00 0.00 ? 59 ARG A CG   5  
ATOM 5518  C CD   . ARG A 1 59 ? 13.147  -2.411  0.540   1.00 0.00 ? 59 ARG A CD   5  
ATOM 5519  N NE   . ARG A 1 59 ? 13.363  -1.790  -0.764  1.00 0.00 ? 59 ARG A NE   5  
ATOM 5520  C CZ   . ARG A 1 59 ? 14.362  -2.116  -1.576  1.00 0.00 ? 59 ARG A CZ   5  
ATOM 5521  N NH1  . ARG A 1 59 ? 15.231  -3.052  -1.221  1.00 0.00 ? 59 ARG A NH1  5  
ATOM 5522  N NH2  . ARG A 1 59 ? 14.493  -1.506  -2.748  1.00 0.00 ? 59 ARG A NH2  5  
ATOM 5523  H H    . ARG A 1 59 ? 8.235   -3.205  0.005   1.00 0.00 ? 59 ARG A H    5  
ATOM 5524  H HA   . ARG A 1 59 ? 9.321   -1.187  1.469   1.00 0.00 ? 59 ARG A HA   5  
ATOM 5525  H HB2  . ARG A 1 59 ? 10.358  -3.424  0.674   1.00 0.00 ? 59 ARG A HB2  5  
ATOM 5526  H HB3  . ARG A 1 59 ? 10.949  -2.490  -0.694  1.00 0.00 ? 59 ARG A HB3  5  
ATOM 5527  H HG2  . ARG A 1 59 ? 11.816  -0.899  1.235   1.00 0.00 ? 59 ARG A HG2  5  
ATOM 5528  H HG3  . ARG A 1 59 ? 11.755  -2.403  2.156   1.00 0.00 ? 59 ARG A HG3  5  
ATOM 5529  H HD2  . ARG A 1 59 ? 13.954  -2.131  1.200   1.00 0.00 ? 59 ARG A HD2  5  
ATOM 5530  H HD3  . ARG A 1 59 ? 13.136  -3.484  0.420   1.00 0.00 ? 59 ARG A HD3  5  
ATOM 5531  H HE   . ARG A 1 59 ? 12.732  -1.096  -1.046  1.00 0.00 ? 59 ARG A HE   5  
ATOM 5532  H HH11 . ARG A 1 59 ? 15.135  -3.514  -0.340  1.00 0.00 ? 59 ARG A HH11 5  
ATOM 5533  H HH12 . ARG A 1 59 ? 15.982  -3.297  -1.836  1.00 0.00 ? 59 ARG A HH12 5  
ATOM 5534  H HH21 . ARG A 1 59 ? 13.839  -0.800  -3.019  1.00 0.00 ? 59 ARG A HH21 5  
ATOM 5535  H HH22 . ARG A 1 59 ? 15.245  -1.752  -3.358  1.00 0.00 ? 59 ARG A HH22 5  
ATOM 5536  N N    . ALA A 1 60 ? 9.567   -0.494  -1.753  1.00 0.00 ? 60 ALA A N    5  
ATOM 5537  C CA   . ALA A 1 60 ? 9.742   0.593   -2.708  1.00 0.00 ? 60 ALA A CA   5  
ATOM 5538  C C    . ALA A 1 60 ? 8.957   1.829   -2.281  1.00 0.00 ? 60 ALA A C    5  
ATOM 5539  O O    . ALA A 1 60 ? 9.459   2.951   -2.351  1.00 0.00 ? 60 ALA A O    5  
ATOM 5540  C CB   . ALA A 1 60 ? 9.315   0.148   -4.099  1.00 0.00 ? 60 ALA A CB   5  
ATOM 5541  H H    . ALA A 1 60 ? 9.399   -1.400  -2.086  1.00 0.00 ? 60 ALA A H    5  
ATOM 5542  H HA   . ALA A 1 60 ? 10.793  0.841   -2.743  1.00 0.00 ? 60 ALA A HA   5  
ATOM 5543  H HB1  . ALA A 1 60 ? 10.165  -0.269  -4.619  1.00 0.00 ? 60 ALA A HB1  5  
ATOM 5544  H HB2  . ALA A 1 60 ? 8.541   -0.600  -4.015  1.00 0.00 ? 60 ALA A HB2  5  
ATOM 5545  H HB3  . ALA A 1 60 ? 8.937   0.998   -4.648  1.00 0.00 ? 60 ALA A HB3  5  
ATOM 5546  N N    . LYS A 1 61 ? 7.722   1.617   -1.840  1.00 0.00 ? 61 LYS A N    5  
ATOM 5547  C CA   . LYS A 1 61 ? 6.866   2.713   -1.402  1.00 0.00 ? 61 LYS A CA   5  
ATOM 5548  C C    . LYS A 1 61 ? 7.306   3.235   -0.038  1.00 0.00 ? 61 LYS A C    5  
ATOM 5549  O O    . LYS A 1 61 ? 7.458   4.441   0.156   1.00 0.00 ? 61 LYS A O    5  
ATOM 5550  C CB   . LYS A 1 61 ? 5.407   2.255   -1.338  1.00 0.00 ? 61 LYS A CB   5  
ATOM 5551  C CG   . LYS A 1 61 ? 4.407   3.389   -1.475  1.00 0.00 ? 61 LYS A CG   5  
ATOM 5552  C CD   . LYS A 1 61 ? 3.059   2.888   -1.966  1.00 0.00 ? 61 LYS A CD   5  
ATOM 5553  C CE   . LYS A 1 61 ? 2.315   3.961   -2.745  1.00 0.00 ? 61 LYS A CE   5  
ATOM 5554  N NZ   . LYS A 1 61 ? 1.506   4.835   -1.851  1.00 0.00 ? 61 LYS A NZ   5  
ATOM 5555  H H    . LYS A 1 61 ? 7.377   0.699   -1.808  1.00 0.00 ? 61 LYS A H    5  
ATOM 5556  H HA   . LYS A 1 61 ? 6.953   3.511   -2.124  1.00 0.00 ? 61 LYS A HA   5  
ATOM 5557  H HB2  . LYS A 1 61 ? 5.230   1.547   -2.134  1.00 0.00 ? 61 LYS A HB2  5  
ATOM 5558  H HB3  . LYS A 1 61 ? 5.238   1.766   -0.389  1.00 0.00 ? 61 LYS A HB3  5  
ATOM 5559  H HG2  . LYS A 1 61 ? 4.275   3.859   -0.511  1.00 0.00 ? 61 LYS A HG2  5  
ATOM 5560  H HG3  . LYS A 1 61 ? 4.791   4.112   -2.180  1.00 0.00 ? 61 LYS A HG3  5  
ATOM 5561  H HD2  . LYS A 1 61 ? 3.214   2.035   -2.609  1.00 0.00 ? 61 LYS A HD2  5  
ATOM 5562  H HD3  . LYS A 1 61 ? 2.462   2.595   -1.114  1.00 0.00 ? 61 LYS A HD3  5  
ATOM 5563  H HE2  . LYS A 1 61 ? 3.035   4.569   -3.273  1.00 0.00 ? 61 LYS A HE2  5  
ATOM 5564  H HE3  . LYS A 1 61 ? 1.659   3.482   -3.456  1.00 0.00 ? 61 LYS A HE3  5  
ATOM 5565  H HZ1  . LYS A 1 61 ? 1.927   4.862   -0.901  1.00 0.00 ? 61 LYS A HZ1  5  
ATOM 5566  H HZ2  . LYS A 1 61 ? 0.535   4.470   -1.778  1.00 0.00 ? 61 LYS A HZ2  5  
ATOM 5567  H HZ3  . LYS A 1 61 ? 1.473   5.803   -2.232  1.00 0.00 ? 61 LYS A HZ3  5  
ATOM 5568  N N    . TRP A 1 62 ? 7.511   2.320   0.903   1.00 0.00 ? 62 TRP A N    5  
ATOM 5569  C CA   . TRP A 1 62 ? 7.935   2.688   2.248   1.00 0.00 ? 62 TRP A CA   5  
ATOM 5570  C C    . TRP A 1 62 ? 9.144   3.615   2.203   1.00 0.00 ? 62 TRP A C    5  
ATOM 5571  O O    . TRP A 1 62 ? 9.128   4.701   2.783   1.00 0.00 ? 62 TRP A O    5  
ATOM 5572  C CB   . TRP A 1 62 ? 8.267   1.436   3.061   1.00 0.00 ? 62 TRP A CB   5  
ATOM 5573  C CG   . TRP A 1 62 ? 9.112   1.717   4.267   1.00 0.00 ? 62 TRP A CG   5  
ATOM 5574  C CD1  . TRP A 1 62 ? 8.713   2.324   5.424   1.00 0.00 ? 62 TRP A CD1  5  
ATOM 5575  C CD2  . TRP A 1 62 ? 10.499  1.405   4.433   1.00 0.00 ? 62 TRP A CD2  5  
ATOM 5576  N NE1  . TRP A 1 62 ? 9.769   2.407   6.299   1.00 0.00 ? 62 TRP A NE1  5  
ATOM 5577  C CE2  . TRP A 1 62 ? 10.876  1.850   5.716   1.00 0.00 ? 62 TRP A CE2  5  
ATOM 5578  C CE3  . TRP A 1 62 ? 11.460  0.792   3.625   1.00 0.00 ? 62 TRP A CE3  5  
ATOM 5579  C CZ2  . TRP A 1 62 ? 12.171  1.701   6.205   1.00 0.00 ? 62 TRP A CZ2  5  
ATOM 5580  C CZ3  . TRP A 1 62 ? 12.745  0.644   4.111   1.00 0.00 ? 62 TRP A CZ3  5  
ATOM 5581  C CH2  . TRP A 1 62 ? 13.091  1.096   5.392   1.00 0.00 ? 62 TRP A CH2  5  
ATOM 5582  H H    . TRP A 1 62 ? 7.373   1.373   0.687   1.00 0.00 ? 62 TRP A H    5  
ATOM 5583  H HA   . TRP A 1 62 ? 7.116   3.208   2.723   1.00 0.00 ? 62 TRP A HA   5  
ATOM 5584  H HB2  . TRP A 1 62 ? 7.349   0.978   3.397   1.00 0.00 ? 62 TRP A HB2  5  
ATOM 5585  H HB3  . TRP A 1 62 ? 8.804   0.740   2.433   1.00 0.00 ? 62 TRP A HB3  5  
ATOM 5586  H HD1  . TRP A 1 62 ? 7.712   2.682   5.609   1.00 0.00 ? 62 TRP A HD1  5  
ATOM 5587  H HE1  . TRP A 1 62 ? 9.734   2.800   7.197   1.00 0.00 ? 62 TRP A HE1  5  
ATOM 5588  H HE3  . TRP A 1 62 ? 11.212  0.436   2.635   1.00 0.00 ? 62 TRP A HE3  5  
ATOM 5589  H HZ2  . TRP A 1 62 ? 12.453  2.043   7.190   1.00 0.00 ? 62 TRP A HZ2  5  
ATOM 5590  H HZ3  . TRP A 1 62 ? 13.500  0.173   3.500   1.00 0.00 ? 62 TRP A HZ3  5  
ATOM 5591  H HH2  . TRP A 1 62 ? 14.106  0.961   5.731   1.00 0.00 ? 62 TRP A HH2  5  
ATOM 5592  N N    . ARG A 1 63 ? 10.192  3.181   1.511   1.00 0.00 ? 63 ARG A N    5  
ATOM 5593  C CA   . ARG A 1 63 ? 11.411  3.972   1.391   1.00 0.00 ? 63 ARG A CA   5  
ATOM 5594  C C    . ARG A 1 63 ? 11.106  5.358   0.829   1.00 0.00 ? 63 ARG A C    5  
ATOM 5595  O O    . ARG A 1 63 ? 11.560  6.369   1.365   1.00 0.00 ? 63 ARG A O    5  
ATOM 5596  C CB   . ARG A 1 63 ? 12.422  3.258   0.493   1.00 0.00 ? 63 ARG A CB   5  
ATOM 5597  C CG   . ARG A 1 63 ? 13.161  2.126   1.188   1.00 0.00 ? 63 ARG A CG   5  
ATOM 5598  C CD   . ARG A 1 63 ? 14.435  1.754   0.446   1.00 0.00 ? 63 ARG A CD   5  
ATOM 5599  N NE   . ARG A 1 63 ? 15.553  2.622   0.810   1.00 0.00 ? 63 ARG A NE   5  
ATOM 5600  C CZ   . ARG A 1 63 ? 16.241  2.499   1.939   1.00 0.00 ? 63 ARG A CZ   5  
ATOM 5601  N NH1  . ARG A 1 63 ? 15.928  1.550   2.811   1.00 0.00 ? 63 ARG A NH1  5  
ATOM 5602  N NH2  . ARG A 1 63 ? 17.245  3.327   2.199   1.00 0.00 ? 63 ARG A NH2  5  
ATOM 5603  H H    . ARG A 1 63 ? 10.146  2.306   1.070   1.00 0.00 ? 63 ARG A H    5  
ATOM 5604  H HA   . ARG A 1 63 ? 11.834  4.082   2.378   1.00 0.00 ? 63 ARG A HA   5  
ATOM 5605  H HB2  . ARG A 1 63 ? 11.902  2.848   -0.361  1.00 0.00 ? 63 ARG A HB2  5  
ATOM 5606  H HB3  . ARG A 1 63 ? 13.151  3.977   0.149   1.00 0.00 ? 63 ARG A HB3  5  
ATOM 5607  H HG2  . ARG A 1 63 ? 13.418  2.438   2.189   1.00 0.00 ? 63 ARG A HG2  5  
ATOM 5608  H HG3  . ARG A 1 63 ? 12.515  1.262   1.232   1.00 0.00 ? 63 ARG A HG3  5  
ATOM 5609  H HD2  . ARG A 1 63 ? 14.692  0.734   0.687   1.00 0.00 ? 63 ARG A HD2  5  
ATOM 5610  H HD3  . ARG A 1 63 ? 14.256  1.839   -0.615  1.00 0.00 ? 63 ARG A HD3  5  
ATOM 5611  H HE   . ARG A 1 63 ? 15.801  3.330   0.180   1.00 0.00 ? 63 ARG A HE   5  
ATOM 5612  H HH11 . ARG A 1 63 ? 15.172  0.925   2.617   1.00 0.00 ? 63 ARG A HH11 5  
ATOM 5613  H HH12 . ARG A 1 63 ? 16.448  1.460   3.660   1.00 0.00 ? 63 ARG A HH12 5  
ATOM 5614  H HH21 . ARG A 1 63 ? 17.484  4.044   1.544   1.00 0.00 ? 63 ARG A HH21 5  
ATOM 5615  H HH22 . ARG A 1 63 ? 17.762  3.235   3.049   1.00 0.00 ? 63 ARG A HH22 5  
ATOM 5616  N N    . ARG A 1 64 ? 10.334  5.396   -0.252  1.00 0.00 ? 64 ARG A N    5  
ATOM 5617  C CA   . ARG A 1 64 ? 9.970   6.657   -0.887  1.00 0.00 ? 64 ARG A CA   5  
ATOM 5618  C C    . ARG A 1 64 ? 9.399   7.635   0.135   1.00 0.00 ? 64 ARG A C    5  
ATOM 5619  O O    . ARG A 1 64 ? 9.884   8.758   0.273   1.00 0.00 ? 64 ARG A O    5  
ATOM 5620  C CB   . ARG A 1 64 ? 8.951   6.415   -2.002  1.00 0.00 ? 64 ARG A CB   5  
ATOM 5621  C CG   . ARG A 1 64 ? 8.766   7.608   -2.927  1.00 0.00 ? 64 ARG A CG   5  
ATOM 5622  C CD   . ARG A 1 64 ? 9.910   7.723   -3.922  1.00 0.00 ? 64 ARG A CD   5  
ATOM 5623  N NE   . ARG A 1 64 ? 10.149  9.107   -4.323  1.00 0.00 ? 64 ARG A NE   5  
ATOM 5624  C CZ   . ARG A 1 64 ? 11.110  9.473   -5.164  1.00 0.00 ? 64 ARG A CZ   5  
ATOM 5625  N NH1  . ARG A 1 64 ? 11.917  8.562   -5.690  1.00 0.00 ? 64 ARG A NH1  5  
ATOM 5626  N NH2  . ARG A 1 64 ? 11.265  10.753  -5.480  1.00 0.00 ? 64 ARG A NH2  5  
ATOM 5627  H H    . ARG A 1 64 ? 10.003  4.556   -0.633  1.00 0.00 ? 64 ARG A H    5  
ATOM 5628  H HA   . ARG A 1 64 ? 10.865  7.084   -1.315  1.00 0.00 ? 64 ARG A HA   5  
ATOM 5629  H HB2  . ARG A 1 64 ? 9.277   5.575   -2.596  1.00 0.00 ? 64 ARG A HB2  5  
ATOM 5630  H HB3  . ARG A 1 64 ? 7.996   6.182   -1.556  1.00 0.00 ? 64 ARG A HB3  5  
ATOM 5631  H HG2  . ARG A 1 64 ? 7.841   7.489   -3.471  1.00 0.00 ? 64 ARG A HG2  5  
ATOM 5632  H HG3  . ARG A 1 64 ? 8.724   8.509   -2.333  1.00 0.00 ? 64 ARG A HG3  5  
ATOM 5633  H HD2  . ARG A 1 64 ? 10.807  7.330   -3.467  1.00 0.00 ? 64 ARG A HD2  5  
ATOM 5634  H HD3  . ARG A 1 64 ? 9.666   7.141   -4.799  1.00 0.00 ? 64 ARG A HD3  5  
ATOM 5635  H HE   . ARG A 1 64 ? 9.564   9.796   -3.945  1.00 0.00 ? 64 ARG A HE   5  
ATOM 5636  H HH11 . ARG A 1 64 ? 11.802  7.598   -5.455  1.00 0.00 ? 64 ARG A HH11 5  
ATOM 5637  H HH12 . ARG A 1 64 ? 12.639  8.841   -6.324  1.00 0.00 ? 64 ARG A HH12 5  
ATOM 5638  H HH21 . ARG A 1 64 ? 10.659  11.442  -5.085  1.00 0.00 ? 64 ARG A HH21 5  
ATOM 5639  H HH22 . ARG A 1 64 ? 11.989  11.027  -6.112  1.00 0.00 ? 64 ARG A HH22 5  
ATOM 5640  N N    . SER A 1 65 ? 8.365   7.201   0.849   1.00 0.00 ? 65 SER A N    5  
ATOM 5641  C CA   . SER A 1 65 ? 7.725   8.040   1.856   1.00 0.00 ? 65 SER A CA   5  
ATOM 5642  C C    . SER A 1 65 ? 8.726   8.463   2.927   1.00 0.00 ? 65 SER A C    5  
ATOM 5643  O O    . SER A 1 65 ? 8.726   9.609   3.374   1.00 0.00 ? 65 SER A O    5  
ATOM 5644  C CB   . SER A 1 65 ? 6.555   7.295   2.501   1.00 0.00 ? 65 SER A CB   5  
ATOM 5645  O OG   . SER A 1 65 ? 5.432   7.264   1.637   1.00 0.00 ? 65 SER A OG   5  
ATOM 5646  H H    . SER A 1 65 ? 8.024   6.296   0.693   1.00 0.00 ? 65 SER A H    5  
ATOM 5647  H HA   . SER A 1 65 ? 7.350   8.923   1.361   1.00 0.00 ? 65 SER A HA   5  
ATOM 5648  H HB2  . SER A 1 65 ? 6.853   6.281   2.720   1.00 0.00 ? 65 SER A HB2  5  
ATOM 5649  H HB3  . SER A 1 65 ? 6.275   7.795   3.417   1.00 0.00 ? 65 SER A HB3  5  
ATOM 5650  H HG   . SER A 1 65 ? 4.990   6.415   1.716   1.00 0.00 ? 65 SER A HG   5  
ATOM 5651  N N    . GLY A 1 66 ? 9.578   7.527   3.334   1.00 0.00 ? 66 GLY A N    5  
ATOM 5652  C CA   . GLY A 1 66 ? 10.573  7.821   4.349   1.00 0.00 ? 66 GLY A CA   5  
ATOM 5653  C C    . GLY A 1 66 ? 11.683  8.715   3.833   1.00 0.00 ? 66 GLY A C    5  
ATOM 5654  O O    . GLY A 1 66 ? 11.834  8.919   2.628   1.00 0.00 ? 66 GLY A O    5  
ATOM 5655  H H    . GLY A 1 66 ? 9.532   6.630   2.942   1.00 0.00 ? 66 GLY A H    5  
ATOM 5656  H HA2  . GLY A 1 66 ? 10.089  8.310   5.181   1.00 0.00 ? 66 GLY A HA2  5  
ATOM 5657  H HA3  . GLY A 1 66 ? 11.005  6.892   4.693   1.00 0.00 ? 66 GLY A HA3  5  
ATOM 5658  N N    . PRO A 1 67 ? 12.482  9.268   4.757   1.00 0.00 ? 67 PRO A N    5  
ATOM 5659  C CA   . PRO A 1 67 ? 13.596  10.155  4.412   1.00 0.00 ? 67 PRO A CA   5  
ATOM 5660  C C    . PRO A 1 67 ? 14.738  9.412   3.728   1.00 0.00 ? 67 PRO A C    5  
ATOM 5661  O O    . PRO A 1 67 ? 15.297  8.466   4.283   1.00 0.00 ? 67 PRO A O    5  
ATOM 5662  C CB   . PRO A 1 67 ? 14.049  10.700  5.769   1.00 0.00 ? 67 PRO A CB   5  
ATOM 5663  C CG   . PRO A 1 67 ? 13.630  9.662   6.753   1.00 0.00 ? 67 PRO A CG   5  
ATOM 5664  C CD   . PRO A 1 67 ? 12.359  9.068   6.211   1.00 0.00 ? 67 PRO A CD   5  
ATOM 5665  H HA   . PRO A 1 67 ? 13.273  10.972  3.784   1.00 0.00 ? 67 PRO A HA   5  
ATOM 5666  H HB2  . PRO A 1 67 ? 15.122  10.832  5.766   1.00 0.00 ? 67 PRO A HB2  5  
ATOM 5667  H HB3  . PRO A 1 67 ? 13.565  11.645  5.962   1.00 0.00 ? 67 PRO A HB3  5  
ATOM 5668  H HG2  . PRO A 1 67 ? 14.393  8.904   6.835   1.00 0.00 ? 67 PRO A HG2  5  
ATOM 5669  H HG3  . PRO A 1 67 ? 13.449  10.121  7.714   1.00 0.00 ? 67 PRO A HG3  5  
ATOM 5670  H HD2  . PRO A 1 67 ? 12.301  8.017   6.453   1.00 0.00 ? 67 PRO A HD2  5  
ATOM 5671  H HD3  . PRO A 1 67 ? 11.500  9.595   6.601   1.00 0.00 ? 67 PRO A HD3  5  
ATOM 5672  N N    . SER A 1 68 ? 15.081  9.846   2.519   1.00 0.00 ? 68 SER A N    5  
ATOM 5673  C CA   . SER A 1 68 ? 16.155  9.220   1.758   1.00 0.00 ? 68 SER A CA   5  
ATOM 5674  C C    . SER A 1 68 ? 17.457  10.001  1.911   1.00 0.00 ? 68 SER A C    5  
ATOM 5675  O O    . SER A 1 68 ? 17.492  11.215  1.713   1.00 0.00 ? 68 SER A O    5  
ATOM 5676  C CB   . SER A 1 68 ? 15.773  9.127   0.279   1.00 0.00 ? 68 SER A CB   5  
ATOM 5677  O OG   . SER A 1 68 ? 16.894  8.778   -0.516  1.00 0.00 ? 68 SER A OG   5  
ATOM 5678  H H    . SER A 1 68 ? 14.598  10.605  2.130   1.00 0.00 ? 68 SER A H    5  
ATOM 5679  H HA   . SER A 1 68 ? 16.299  8.223   2.147   1.00 0.00 ? 68 SER A HA   5  
ATOM 5680  H HB2  . SER A 1 68 ? 15.010  8.374   0.154   1.00 0.00 ? 68 SER A HB2  5  
ATOM 5681  H HB3  . SER A 1 68 ? 15.395  10.083  -0.053  1.00 0.00 ? 68 SER A HB3  5  
ATOM 5682  H HG   . SER A 1 68 ? 16.598  8.297   -1.292  1.00 0.00 ? 68 SER A HG   5  
ATOM 5683  N N    . SER A 1 69 ? 18.526  9.294   2.264   1.00 0.00 ? 69 SER A N    5  
ATOM 5684  C CA   . SER A 1 69 ? 19.830  9.920   2.447   1.00 0.00 ? 69 SER A CA   5  
ATOM 5685  C C    . SER A 1 69 ? 20.824  9.421   1.403   1.00 0.00 ? 69 SER A C    5  
ATOM 5686  O O    . SER A 1 69 ? 21.425  8.359   1.560   1.00 0.00 ? 69 SER A O    5  
ATOM 5687  C CB   . SER A 1 69 ? 20.362  9.635   3.853   1.00 0.00 ? 69 SER A CB   5  
ATOM 5688  O OG   . SER A 1 69 ? 20.405  8.242   4.110   1.00 0.00 ? 69 SER A OG   5  
ATOM 5689  H H    . SER A 1 69 ? 18.434  8.328   2.407   1.00 0.00 ? 69 SER A H    5  
ATOM 5690  H HA   . SER A 1 69 ? 19.705  10.986  2.328   1.00 0.00 ? 69 SER A HA   5  
ATOM 5691  H HB2  . SER A 1 69 ? 21.360  10.036  3.945   1.00 0.00 ? 69 SER A HB2  5  
ATOM 5692  H HB3  . SER A 1 69 ? 19.717  10.104  4.581   1.00 0.00 ? 69 SER A HB3  5  
ATOM 5693  H HG   . SER A 1 69 ? 19.632  7.987   4.619   1.00 0.00 ? 69 SER A HG   5  
ATOM 5694  N N    . GLY A 1 70 ? 20.991  10.196  0.336   1.00 0.00 ? 70 GLY A N    5  
ATOM 5695  C CA   . GLY A 1 70 ? 21.913  9.816   -0.719  1.00 0.00 ? 70 GLY A CA   5  
ATOM 5696  C C    . GLY A 1 70 ? 23.321  10.319  -0.467  1.00 0.00 ? 70 GLY A C    5  
ATOM 5697  O O    . GLY A 1 70 ? 23.537  11.518  -0.293  1.00 0.00 ? 70 GLY A O    5  
ATOM 5698  H H    . GLY A 1 70 ? 20.485  11.032  0.264   1.00 0.00 ? 70 GLY A H    5  
ATOM 5699  H HA2  . GLY A 1 70 ? 21.934  8.740   -0.794  1.00 0.00 ? 70 GLY A HA2  5  
ATOM 5700  H HA3  . GLY A 1 70 ? 21.559  10.225  -1.654  1.00 0.00 ? 70 GLY A HA3  5  
ATOM 5701  N N    . GLY A 1 1  ? 3.876   15.822  -8.170  1.00 0.00 ? 1  GLY A N    6  
ATOM 5702  C CA   . GLY A 1 1  ? 3.102   16.826  -7.463  1.00 0.00 ? 1  GLY A CA   6  
ATOM 5703  C C    . GLY A 1 1  ? 1.774   16.290  -6.966  1.00 0.00 ? 1  GLY A C    6  
ATOM 5704  O O    . GLY A 1 1  ? 0.721   16.863  -7.246  1.00 0.00 ? 1  GLY A O    6  
ATOM 5705  H H1   . GLY A 1 1  ? 3.796   15.741  -9.144  1.00 0.00 ? 1  GLY A H1   6  
ATOM 5706  H HA2  . GLY A 1 1  ? 3.675   17.178  -6.619  1.00 0.00 ? 1  GLY A HA2  6  
ATOM 5707  H HA3  . GLY A 1 1  ? 2.915   17.655  -8.130  1.00 0.00 ? 1  GLY A HA3  6  
ATOM 5708  N N    . SER A 1 2  ? 1.822   15.186  -6.227  1.00 0.00 ? 2  SER A N    6  
ATOM 5709  C CA   . SER A 1 2  ? 0.613   14.569  -5.694  1.00 0.00 ? 2  SER A CA   6  
ATOM 5710  C C    . SER A 1 2  ? -0.429  14.380  -6.792  1.00 0.00 ? 2  SER A C    6  
ATOM 5711  O O    . SER A 1 2  ? -1.617  14.630  -6.585  1.00 0.00 ? 2  SER A O    6  
ATOM 5712  C CB   . SER A 1 2  ? 0.034   15.425  -4.566  1.00 0.00 ? 2  SER A CB   6  
ATOM 5713  O OG   . SER A 1 2  ? 0.753   15.235  -3.360  1.00 0.00 ? 2  SER A OG   6  
ATOM 5714  H H    . SER A 1 2  ? 2.692   14.776  -6.038  1.00 0.00 ? 2  SER A H    6  
ATOM 5715  H HA   . SER A 1 2  ? 0.882   13.601  -5.298  1.00 0.00 ? 2  SER A HA   6  
ATOM 5716  H HB2  . SER A 1 2  ? 0.088   16.467  -4.843  1.00 0.00 ? 2  SER A HB2  6  
ATOM 5717  H HB3  . SER A 1 2  ? -0.998  15.149  -4.403  1.00 0.00 ? 2  SER A HB3  6  
ATOM 5718  H HG   . SER A 1 2  ? 0.719   14.309  -3.109  1.00 0.00 ? 2  SER A HG   6  
ATOM 5719  N N    . SER A 1 3  ? 0.024   13.937  -7.960  1.00 0.00 ? 3  SER A N    6  
ATOM 5720  C CA   . SER A 1 3  ? -0.867  13.718  -9.093  1.00 0.00 ? 3  SER A CA   6  
ATOM 5721  C C    . SER A 1 3  ? -1.396  12.287  -9.099  1.00 0.00 ? 3  SER A C    6  
ATOM 5722  O O    . SER A 1 3  ? -2.603  12.059  -9.027  1.00 0.00 ? 3  SER A O    6  
ATOM 5723  C CB   . SER A 1 3  ? -0.139  14.010  -10.406 1.00 0.00 ? 3  SER A CB   6  
ATOM 5724  O OG   . SER A 1 3  ? 0.247   15.371  -10.483 1.00 0.00 ? 3  SER A OG   6  
ATOM 5725  H H    . SER A 1 3  ? 0.982   13.756  -8.063  1.00 0.00 ? 3  SER A H    6  
ATOM 5726  H HA   . SER A 1 3  ? -1.701  14.397  -8.994  1.00 0.00 ? 3  SER A HA   6  
ATOM 5727  H HB2  . SER A 1 3  ? 0.745   13.394  -10.470 1.00 0.00 ? 3  SER A HB2  6  
ATOM 5728  H HB3  . SER A 1 3  ? -0.795  13.786  -11.235 1.00 0.00 ? 3  SER A HB3  6  
ATOM 5729  H HG   . SER A 1 3  ? 0.919   15.476  -11.161 1.00 0.00 ? 3  SER A HG   6  
ATOM 5730  N N    . GLY A 1 4  ? -0.482  11.325  -9.184  1.00 0.00 ? 4  GLY A N    6  
ATOM 5731  C CA   . GLY A 1 4  ? -0.875  9.928   -9.198  1.00 0.00 ? 4  GLY A CA   6  
ATOM 5732  C C    . GLY A 1 4  ? -0.735  9.300   -10.570 1.00 0.00 ? 4  GLY A C    6  
ATOM 5733  O O    . GLY A 1 4  ? -0.154  9.896   -11.477 1.00 0.00 ? 4  GLY A O    6  
ATOM 5734  H H    . GLY A 1 4  ? 0.466   11.566  -9.238  1.00 0.00 ? 4  GLY A H    6  
ATOM 5735  H HA2  . GLY A 1 4  ? -0.256  9.384   -8.500  1.00 0.00 ? 4  GLY A HA2  6  
ATOM 5736  H HA3  . GLY A 1 4  ? -1.906  9.852   -8.884  1.00 0.00 ? 4  GLY A HA3  6  
ATOM 5737  N N    . SER A 1 5  ? -1.267  8.092   -10.724 1.00 0.00 ? 5  SER A N    6  
ATOM 5738  C CA   . SER A 1 5  ? -1.193  7.380   -11.994 1.00 0.00 ? 5  SER A CA   6  
ATOM 5739  C C    . SER A 1 5  ? -2.134  6.179   -11.999 1.00 0.00 ? 5  SER A C    6  
ATOM 5740  O O    . SER A 1 5  ? -2.213  5.434   -11.022 1.00 0.00 ? 5  SER A O    6  
ATOM 5741  C CB   . SER A 1 5  ? 0.241   6.920   -12.263 1.00 0.00 ? 5  SER A CB   6  
ATOM 5742  O OG   . SER A 1 5  ? 0.978   7.919   -12.946 1.00 0.00 ? 5  SER A OG   6  
ATOM 5743  H H    . SER A 1 5  ? -1.717  7.668   -9.963  1.00 0.00 ? 5  SER A H    6  
ATOM 5744  H HA   . SER A 1 5  ? -1.496  8.062   -12.775 1.00 0.00 ? 5  SER A HA   6  
ATOM 5745  H HB2  . SER A 1 5  ? 0.730   6.707   -11.325 1.00 0.00 ? 5  SER A HB2  6  
ATOM 5746  H HB3  . SER A 1 5  ? 0.221   6.026   -12.870 1.00 0.00 ? 5  SER A HB3  6  
ATOM 5747  H HG   . SER A 1 5  ? 0.638   8.785   -12.709 1.00 0.00 ? 5  SER A HG   6  
ATOM 5748  N N    . SER A 1 6  ? -2.845  5.997   -13.107 1.00 0.00 ? 6  SER A N    6  
ATOM 5749  C CA   . SER A 1 6  ? -3.784  4.889   -13.239 1.00 0.00 ? 6  SER A CA   6  
ATOM 5750  C C    . SER A 1 6  ? -4.177  4.681   -14.699 1.00 0.00 ? 6  SER A C    6  
ATOM 5751  O O    . SER A 1 6  ? -4.420  5.639   -15.431 1.00 0.00 ? 6  SER A O    6  
ATOM 5752  C CB   . SER A 1 6  ? -5.034  5.148   -12.395 1.00 0.00 ? 6  SER A CB   6  
ATOM 5753  O OG   . SER A 1 6  ? -5.883  6.096   -13.019 1.00 0.00 ? 6  SER A OG   6  
ATOM 5754  H H    . SER A 1 6  ? -2.738  6.624   -13.852 1.00 0.00 ? 6  SER A H    6  
ATOM 5755  H HA   . SER A 1 6  ? -3.296  3.996   -12.879 1.00 0.00 ? 6  SER A HA   6  
ATOM 5756  H HB2  . SER A 1 6  ? -5.577  4.224   -12.268 1.00 0.00 ? 6  SER A HB2  6  
ATOM 5757  H HB3  . SER A 1 6  ? -4.739  5.527   -11.428 1.00 0.00 ? 6  SER A HB3  6  
ATOM 5758  H HG   . SER A 1 6  ? -6.798  5.832   -12.900 1.00 0.00 ? 6  SER A HG   6  
ATOM 5759  N N    . GLY A 1 7  ? -4.236  3.419   -15.115 1.00 0.00 ? 7  GLY A N    6  
ATOM 5760  C CA   . GLY A 1 7  ? -4.599  3.106   -16.485 1.00 0.00 ? 7  GLY A CA   6  
ATOM 5761  C C    . GLY A 1 7  ? -4.597  1.616   -16.759 1.00 0.00 ? 7  GLY A C    6  
ATOM 5762  O O    . GLY A 1 7  ? -5.655  0.991   -16.845 1.00 0.00 ? 7  GLY A O    6  
ATOM 5763  H H    . GLY A 1 7  ? -4.031  2.695   -14.487 1.00 0.00 ? 7  GLY A H    6  
ATOM 5764  H HA2  . GLY A 1 7  ? -5.586  3.497   -16.682 1.00 0.00 ? 7  GLY A HA2  6  
ATOM 5765  H HA3  . GLY A 1 7  ? -3.894  3.584   -17.150 1.00 0.00 ? 7  GLY A HA3  6  
ATOM 5766  N N    . LYS A 1 8  ? -3.407  1.043   -16.899 1.00 0.00 ? 8  LYS A N    6  
ATOM 5767  C CA   . LYS A 1 8  ? -3.270  -0.384  -17.166 1.00 0.00 ? 8  LYS A CA   6  
ATOM 5768  C C    . LYS A 1 8  ? -3.994  -1.208  -16.106 1.00 0.00 ? 8  LYS A C    6  
ATOM 5769  O O    . LYS A 1 8  ? -3.853  -0.959  -14.909 1.00 0.00 ? 8  LYS A O    6  
ATOM 5770  C CB   . LYS A 1 8  ? -1.791  -0.776  -17.210 1.00 0.00 ? 8  LYS A CB   6  
ATOM 5771  C CG   . LYS A 1 8  ? -1.563  -2.262  -17.426 1.00 0.00 ? 8  LYS A CG   6  
ATOM 5772  C CD   . LYS A 1 8  ? -0.089  -2.576  -17.627 1.00 0.00 ? 8  LYS A CD   6  
ATOM 5773  C CE   . LYS A 1 8  ? 0.160   -4.076  -17.672 1.00 0.00 ? 8  LYS A CE   6  
ATOM 5774  N NZ   . LYS A 1 8  ? -0.347  -4.684  -18.934 1.00 0.00 ? 8  LYS A NZ   6  
ATOM 5775  H H    . LYS A 1 8  ? -2.599  1.594   -16.819 1.00 0.00 ? 8  LYS A H    6  
ATOM 5776  H HA   . LYS A 1 8  ? -3.716  -0.586  -18.128 1.00 0.00 ? 8  LYS A HA   6  
ATOM 5777  H HB2  . LYS A 1 8  ? -1.312  -0.238  -18.014 1.00 0.00 ? 8  LYS A HB2  6  
ATOM 5778  H HB3  . LYS A 1 8  ? -1.329  -0.495  -16.275 1.00 0.00 ? 8  LYS A HB3  6  
ATOM 5779  H HG2  . LYS A 1 8  ? -1.920  -2.802  -16.562 1.00 0.00 ? 8  LYS A HG2  6  
ATOM 5780  H HG3  . LYS A 1 8  ? -2.111  -2.578  -18.303 1.00 0.00 ? 8  LYS A HG3  6  
ATOM 5781  H HD2  . LYS A 1 8  ? 0.239   -2.140  -18.558 1.00 0.00 ? 8  LYS A HD2  6  
ATOM 5782  H HD3  . LYS A 1 8  ? 0.475   -2.151  -16.809 1.00 0.00 ? 8  LYS A HD3  6  
ATOM 5783  H HE2  . LYS A 1 8  ? 1.222   -4.254  -17.598 1.00 0.00 ? 8  LYS A HE2  6  
ATOM 5784  H HE3  . LYS A 1 8  ? -0.342  -4.536  -16.834 1.00 0.00 ? 8  LYS A HE3  6  
ATOM 5785  H HZ1  . LYS A 1 8  ? 0.164   -4.290  -19.750 1.00 0.00 ? 8  LYS A HZ1  6  
ATOM 5786  H HZ2  . LYS A 1 8  ? -1.361  -4.485  -19.045 1.00 0.00 ? 8  LYS A HZ2  6  
ATOM 5787  H HZ3  . LYS A 1 8  ? -0.207  -5.714  -18.915 1.00 0.00 ? 8  LYS A HZ3  6  
ATOM 5788  N N    . GLY A 1 9  ? -4.770  -2.191  -16.554 1.00 0.00 ? 9  GLY A N    6  
ATOM 5789  C CA   . GLY A 1 9  ? -5.503  -3.037  -15.630 1.00 0.00 ? 9  GLY A CA   6  
ATOM 5790  C C    . GLY A 1 9  ? -4.908  -4.426  -15.519 1.00 0.00 ? 9  GLY A C    6  
ATOM 5791  O O    . GLY A 1 9  ? -4.090  -4.827  -16.347 1.00 0.00 ? 9  GLY A O    6  
ATOM 5792  H H    . GLY A 1 9  ? -4.844  -2.343  -17.519 1.00 0.00 ? 9  GLY A H    6  
ATOM 5793  H HA2  . GLY A 1 9  ? -5.497  -2.575  -14.654 1.00 0.00 ? 9  GLY A HA2  6  
ATOM 5794  H HA3  . GLY A 1 9  ? -6.524  -3.121  -15.971 1.00 0.00 ? 9  GLY A HA3  6  
ATOM 5795  N N    . GLY A 1 10 ? -5.317  -5.164  -14.491 1.00 0.00 ? 10 GLY A N    6  
ATOM 5796  C CA   . GLY A 1 10 ? -4.807  -6.508  -14.293 1.00 0.00 ? 10 GLY A CA   6  
ATOM 5797  C C    . GLY A 1 10 ? -3.753  -6.573  -13.205 1.00 0.00 ? 10 GLY A C    6  
ATOM 5798  O O    . GLY A 1 10 ? -2.564  -6.398  -13.474 1.00 0.00 ? 10 GLY A O    6  
ATOM 5799  H H    . GLY A 1 10 ? -5.971  -4.792  -13.862 1.00 0.00 ? 10 GLY A H    6  
ATOM 5800  H HA2  . GLY A 1 10 ? -5.627  -7.156  -14.024 1.00 0.00 ? 10 GLY A HA2  6  
ATOM 5801  H HA3  . GLY A 1 10 ? -4.374  -6.856  -15.219 1.00 0.00 ? 10 GLY A HA3  6  
ATOM 5802  N N    . GLN A 1 11 ? -4.188  -6.824  -11.975 1.00 0.00 ? 11 GLN A N    6  
ATOM 5803  C CA   . GLN A 1 11 ? -3.273  -6.909  -10.844 1.00 0.00 ? 11 GLN A CA   6  
ATOM 5804  C C    . GLN A 1 11 ? -3.808  -7.862  -9.780  1.00 0.00 ? 11 GLN A C    6  
ATOM 5805  O O    . GLN A 1 11 ? -4.933  -8.352  -9.881  1.00 0.00 ? 11 GLN A O    6  
ATOM 5806  C CB   . GLN A 1 11 ? -3.048  -5.522  -10.237 1.00 0.00 ? 11 GLN A CB   6  
ATOM 5807  C CG   . GLN A 1 11 ? -4.305  -4.908  -9.642  1.00 0.00 ? 11 GLN A CG   6  
ATOM 5808  C CD   . GLN A 1 11 ? -5.132  -4.162  -10.669 1.00 0.00 ? 11 GLN A CD   6  
ATOM 5809  O OE1  . GLN A 1 11 ? -4.593  -3.489  -11.548 1.00 0.00 ? 11 GLN A OE1  6  
ATOM 5810  N NE2  . GLN A 1 11 ? -6.451  -4.277  -10.564 1.00 0.00 ? 11 GLN A NE2  6  
ATOM 5811  H H    . GLN A 1 11 ? -5.147  -6.954  -11.825 1.00 0.00 ? 11 GLN A H    6  
ATOM 5812  H HA   . GLN A 1 11 ? -2.330  -7.289  -11.208 1.00 0.00 ? 11 GLN A HA   6  
ATOM 5813  H HB2  . GLN A 1 11 ? -2.306  -5.600  -9.456  1.00 0.00 ? 11 GLN A HB2  6  
ATOM 5814  H HB3  . GLN A 1 11 ? -2.680  -4.861  -11.007 1.00 0.00 ? 11 GLN A HB3  6  
ATOM 5815  H HG2  . GLN A 1 11 ? -4.910  -5.696  -9.219  1.00 0.00 ? 11 GLN A HG2  6  
ATOM 5816  H HG3  . GLN A 1 11 ? -4.017  -4.218  -8.862  1.00 0.00 ? 11 GLN A HG3  6  
ATOM 5817  H HE21 . GLN A 1 11 ? -6.811  -4.829  -9.838  1.00 0.00 ? 11 GLN A HE21 6  
ATOM 5818  H HE22 . GLN A 1 11 ? -7.010  -3.805  -11.215 1.00 0.00 ? 11 GLN A HE22 6  
ATOM 5819  N N    . VAL A 1 12 ? -2.996  -8.120  -8.760  1.00 0.00 ? 12 VAL A N    6  
ATOM 5820  C CA   . VAL A 1 12 ? -3.388  -9.014  -7.677  1.00 0.00 ? 12 VAL A CA   6  
ATOM 5821  C C    . VAL A 1 12 ? -4.219  -8.278  -6.631  1.00 0.00 ? 12 VAL A C    6  
ATOM 5822  O O    . VAL A 1 12 ? -3.926  -7.134  -6.284  1.00 0.00 ? 12 VAL A O    6  
ATOM 5823  C CB   . VAL A 1 12 ? -2.159  -9.640  -6.993  1.00 0.00 ? 12 VAL A CB   6  
ATOM 5824  C CG1  . VAL A 1 12 ? -2.588  -10.550 -5.853  1.00 0.00 ? 12 VAL A CG1  6  
ATOM 5825  C CG2  . VAL A 1 12 ? -1.316  -10.401 -8.005  1.00 0.00 ? 12 VAL A CG2  6  
ATOM 5826  H H    . VAL A 1 12 ? -2.111  -7.698  -8.735  1.00 0.00 ? 12 VAL A H    6  
ATOM 5827  H HA   . VAL A 1 12 ? -3.983  -9.810  -8.101  1.00 0.00 ? 12 VAL A HA   6  
ATOM 5828  H HB   . VAL A 1 12 ? -1.557  -8.844  -6.581  1.00 0.00 ? 12 VAL A HB   6  
ATOM 5829  H HG11 . VAL A 1 12 ? -1.784  -10.634 -5.137  1.00 0.00 ? 12 VAL A HG11 6  
ATOM 5830  H HG12 . VAL A 1 12 ? -3.460  -10.135 -5.369  1.00 0.00 ? 12 VAL A HG12 6  
ATOM 5831  H HG13 . VAL A 1 12 ? -2.824  -11.529 -6.243  1.00 0.00 ? 12 VAL A HG13 6  
ATOM 5832  H HG21 . VAL A 1 12 ? -1.910  -10.609 -8.883  1.00 0.00 ? 12 VAL A HG21 6  
ATOM 5833  H HG22 . VAL A 1 12 ? -0.460  -9.803  -8.284  1.00 0.00 ? 12 VAL A HG22 6  
ATOM 5834  H HG23 . VAL A 1 12 ? -0.980  -11.330 -7.569  1.00 0.00 ? 12 VAL A HG23 6  
ATOM 5835  N N    . ARG A 1 13 ? -5.256  -8.943  -6.133  1.00 0.00 ? 13 ARG A N    6  
ATOM 5836  C CA   . ARG A 1 13 ? -6.130  -8.352  -5.127  1.00 0.00 ? 13 ARG A CA   6  
ATOM 5837  C C    . ARG A 1 13 ? -6.217  -9.243  -3.891  1.00 0.00 ? 13 ARG A C    6  
ATOM 5838  O O    . ARG A 1 13 ? -6.895  -10.271 -3.900  1.00 0.00 ? 13 ARG A O    6  
ATOM 5839  C CB   . ARG A 1 13 ? -7.528  -8.125  -5.704  1.00 0.00 ? 13 ARG A CB   6  
ATOM 5840  C CG   . ARG A 1 13 ? -7.619  -6.918  -6.624  1.00 0.00 ? 13 ARG A CG   6  
ATOM 5841  C CD   . ARG A 1 13 ? -7.312  -7.292  -8.066  1.00 0.00 ? 13 ARG A CD   6  
ATOM 5842  N NE   . ARG A 1 13 ? -7.960  -6.391  -9.015  1.00 0.00 ? 13 ARG A NE   6  
ATOM 5843  C CZ   . ARG A 1 13 ? -8.122  -6.673  -10.303 1.00 0.00 ? 13 ARG A CZ   6  
ATOM 5844  N NH1  . ARG A 1 13 ? -7.687  -7.825  -10.792 1.00 0.00 ? 13 ARG A NH1  6  
ATOM 5845  N NH2  . ARG A 1 13 ? -8.722  -5.801  -11.103 1.00 0.00 ? 13 ARG A NH2  6  
ATOM 5846  H H    . ARG A 1 13 ? -5.439  -9.852  -6.450  1.00 0.00 ? 13 ARG A H    6  
ATOM 5847  H HA   . ARG A 1 13 ? -5.710  -7.399  -4.840  1.00 0.00 ? 13 ARG A HA   6  
ATOM 5848  H HB2  . ARG A 1 13 ? -7.819  -9.001  -6.266  1.00 0.00 ? 13 ARG A HB2  6  
ATOM 5849  H HB3  . ARG A 1 13 ? -8.222  -7.983  -4.890  1.00 0.00 ? 13 ARG A HB3  6  
ATOM 5850  H HG2  . ARG A 1 13 ? -8.619  -6.514  -6.574  1.00 0.00 ? 13 ARG A HG2  6  
ATOM 5851  H HG3  . ARG A 1 13 ? -6.910  -6.173  -6.295  1.00 0.00 ? 13 ARG A HG3  6  
ATOM 5852  H HD2  . ARG A 1 13 ? -6.243  -7.249  -8.215  1.00 0.00 ? 13 ARG A HD2  6  
ATOM 5853  H HD3  . ARG A 1 13 ? -7.660  -8.299  -8.244  1.00 0.00 ? 13 ARG A HD3  6  
ATOM 5854  H HE   . ARG A 1 13 ? -8.290  -5.534  -8.674  1.00 0.00 ? 13 ARG A HE   6  
ATOM 5855  H HH11 . ARG A 1 13 ? -7.235  -8.484  -10.191 1.00 0.00 ? 13 ARG A HH11 6  
ATOM 5856  H HH12 . ARG A 1 13 ? -7.811  -8.036  -11.762 1.00 0.00 ? 13 ARG A HH12 6  
ATOM 5857  H HH21 . ARG A 1 13 ? -9.052  -4.932  -10.738 1.00 0.00 ? 13 ARG A HH21 6  
ATOM 5858  H HH22 . ARG A 1 13 ? -8.844  -6.014  -12.072 1.00 0.00 ? 13 ARG A HH22 6  
ATOM 5859  N N    . PHE A 1 14 ? -5.525  -8.842  -2.829  1.00 0.00 ? 14 PHE A N    6  
ATOM 5860  C CA   . PHE A 1 14 ? -5.523  -9.605  -1.586  1.00 0.00 ? 14 PHE A CA   6  
ATOM 5861  C C    . PHE A 1 14 ? -6.840  -9.427  -0.836  1.00 0.00 ? 14 PHE A C    6  
ATOM 5862  O O    . PHE A 1 14 ? -7.591  -8.487  -1.094  1.00 0.00 ? 14 PHE A O    6  
ATOM 5863  C CB   . PHE A 1 14 ? -4.355  -9.170  -0.699  1.00 0.00 ? 14 PHE A CB   6  
ATOM 5864  C CG   . PHE A 1 14 ? -3.009  -9.538  -1.257  1.00 0.00 ? 14 PHE A CG   6  
ATOM 5865  C CD1  . PHE A 1 14 ? -2.374  -8.711  -2.169  1.00 0.00 ? 14 PHE A CD1  6  
ATOM 5866  C CD2  . PHE A 1 14 ? -2.380  -10.710 -0.868  1.00 0.00 ? 14 PHE A CD2  6  
ATOM 5867  C CE1  . PHE A 1 14 ? -1.135  -9.046  -2.684  1.00 0.00 ? 14 PHE A CE1  6  
ATOM 5868  C CE2  . PHE A 1 14 ? -1.142  -11.049 -1.379  1.00 0.00 ? 14 PHE A CE2  6  
ATOM 5869  C CZ   . PHE A 1 14 ? -0.519  -10.217 -2.289  1.00 0.00 ? 14 PHE A CZ   6  
ATOM 5870  H H    . PHE A 1 14 ? -5.004  -8.014  -2.883  1.00 0.00 ? 14 PHE A H    6  
ATOM 5871  H HA   . PHE A 1 14 ? -5.404  -10.647 -1.838  1.00 0.00 ? 14 PHE A HA   6  
ATOM 5872  H HB2  . PHE A 1 14 ? -4.382  -8.098  -0.580  1.00 0.00 ? 14 PHE A HB2  6  
ATOM 5873  H HB3  . PHE A 1 14 ? -4.453  -9.639  0.269   1.00 0.00 ? 14 PHE A HB3  6  
ATOM 5874  H HD1  . PHE A 1 14 ? -2.855  -7.794  -2.479  1.00 0.00 ? 14 PHE A HD1  6  
ATOM 5875  H HD2  . PHE A 1 14 ? -2.866  -11.362 -0.158  1.00 0.00 ? 14 PHE A HD2  6  
ATOM 5876  H HE1  . PHE A 1 14 ? -0.652  -8.393  -3.395  1.00 0.00 ? 14 PHE A HE1  6  
ATOM 5877  H HE2  . PHE A 1 14 ? -0.662  -11.966 -1.069  1.00 0.00 ? 14 PHE A HE2  6  
ATOM 5878  H HZ   . PHE A 1 14 ? 0.448   -10.481 -2.690  1.00 0.00 ? 14 PHE A HZ   6  
ATOM 5879  N N    . SER A 1 15 ? -7.112  -10.337 0.093   1.00 0.00 ? 15 SER A N    6  
ATOM 5880  C CA   . SER A 1 15 ? -8.340  -10.284 0.878   1.00 0.00 ? 15 SER A CA   6  
ATOM 5881  C C    . SER A 1 15 ? -8.239  -9.227  1.974   1.00 0.00 ? 15 SER A C    6  
ATOM 5882  O O    . SER A 1 15 ? -7.144  -8.814  2.354   1.00 0.00 ? 15 SER A O    6  
ATOM 5883  C CB   . SER A 1 15 ? -8.633  -11.651 1.499   1.00 0.00 ? 15 SER A CB   6  
ATOM 5884  O OG   . SER A 1 15 ? -8.976  -12.600 0.504   1.00 0.00 ? 15 SER A OG   6  
ATOM 5885  H H    . SER A 1 15 ? -6.473  -11.063 0.253   1.00 0.00 ? 15 SER A H    6  
ATOM 5886  H HA   . SER A 1 15 ? -9.148  -10.020 0.213   1.00 0.00 ? 15 SER A HA   6  
ATOM 5887  H HB2  . SER A 1 15 ? -7.757  -12.000 2.025   1.00 0.00 ? 15 SER A HB2  6  
ATOM 5888  H HB3  . SER A 1 15 ? -9.456  -11.560 2.192   1.00 0.00 ? 15 SER A HB3  6  
ATOM 5889  H HG   . SER A 1 15 ? -8.279  -12.639 -0.156  1.00 0.00 ? 15 SER A HG   6  
ATOM 5890  N N    . ASN A 1 16 ? -9.390  -8.793  2.476   1.00 0.00 ? 16 ASN A N    6  
ATOM 5891  C CA   . ASN A 1 16 ? -9.433  -7.783  3.527   1.00 0.00 ? 16 ASN A CA   6  
ATOM 5892  C C    . ASN A 1 16 ? -8.449  -8.118  4.644   1.00 0.00 ? 16 ASN A C    6  
ATOM 5893  O O    . ASN A 1 16 ? -7.493  -7.381  4.884   1.00 0.00 ? 16 ASN A O    6  
ATOM 5894  C CB   . ASN A 1 16 ? -10.849 -7.669  4.097   1.00 0.00 ? 16 ASN A CB   6  
ATOM 5895  C CG   . ASN A 1 16 ? -11.116 -6.310  4.713   1.00 0.00 ? 16 ASN A CG   6  
ATOM 5896  O OD1  . ASN A 1 16 ? -11.900 -5.520  4.186   1.00 0.00 ? 16 ASN A OD1  6  
ATOM 5897  N ND2  . ASN A 1 16 ? -10.465 -6.031  5.836   1.00 0.00 ? 16 ASN A ND2  6  
ATOM 5898  H H    . ASN A 1 16 ? -10.231 -9.160  2.132   1.00 0.00 ? 16 ASN A H    6  
ATOM 5899  H HA   . ASN A 1 16 ? -9.154  -6.836  3.089   1.00 0.00 ? 16 ASN A HA   6  
ATOM 5900  H HB2  . ASN A 1 16 ? -11.563 -7.830  3.303   1.00 0.00 ? 16 ASN A HB2  6  
ATOM 5901  H HB3  . ASN A 1 16 ? -10.986 -8.423  4.858   1.00 0.00 ? 16 ASN A HB3  6  
ATOM 5902  H HD21 . ASN A 1 16 ? -9.856  -6.708  6.199   1.00 0.00 ? 16 ASN A HD21 6  
ATOM 5903  H HD22 . ASN A 1 16 ? -10.620 -5.159  6.257   1.00 0.00 ? 16 ASN A HD22 6  
ATOM 5904  N N    . ASP A 1 17 ? -8.690  -9.234  5.322   1.00 0.00 ? 17 ASP A N    6  
ATOM 5905  C CA   . ASP A 1 17 ? -7.825  -9.669  6.412   1.00 0.00 ? 17 ASP A CA   6  
ATOM 5906  C C    . ASP A 1 17 ? -6.406  -9.923  5.912   1.00 0.00 ? 17 ASP A C    6  
ATOM 5907  O O    . ASP A 1 17 ? -5.437  -9.433  6.492   1.00 0.00 ? 17 ASP A O    6  
ATOM 5908  C CB   . ASP A 1 17 ? -8.384  -10.936 7.062   1.00 0.00 ? 17 ASP A CB   6  
ATOM 5909  C CG   . ASP A 1 17 ? -9.584  -10.653 7.944   1.00 0.00 ? 17 ASP A CG   6  
ATOM 5910  O OD1  . ASP A 1 17 ? -9.580  -9.614  8.637   1.00 0.00 ? 17 ASP A OD1  6  
ATOM 5911  O OD2  . ASP A 1 17 ? -10.528 -11.470 7.941   1.00 0.00 ? 17 ASP A OD2  6  
ATOM 5912  H H    . ASP A 1 17 ? -9.469  -9.780  5.083   1.00 0.00 ? 17 ASP A H    6  
ATOM 5913  H HA   . ASP A 1 17 ? -7.798  -8.880  7.149   1.00 0.00 ? 17 ASP A HA   6  
ATOM 5914  H HB2  . ASP A 1 17 ? -8.685  -11.627 6.288   1.00 0.00 ? 17 ASP A HB2  6  
ATOM 5915  H HB3  . ASP A 1 17 ? -7.614  -11.392 7.667   1.00 0.00 ? 17 ASP A HB3  6  
ATOM 5916  N N    . GLN A 1 18 ? -6.293  -10.691 4.833   1.00 0.00 ? 18 GLN A N    6  
ATOM 5917  C CA   . GLN A 1 18 ? -4.993  -11.011 4.257   1.00 0.00 ? 18 GLN A CA   6  
ATOM 5918  C C    . GLN A 1 18 ? -4.109  -9.770  4.186   1.00 0.00 ? 18 GLN A C    6  
ATOM 5919  O O    . GLN A 1 18 ? -3.013  -9.741  4.749   1.00 0.00 ? 18 GLN A O    6  
ATOM 5920  C CB   . GLN A 1 18 ? -5.164  -11.610 2.860   1.00 0.00 ? 18 GLN A CB   6  
ATOM 5921  C CG   . GLN A 1 18 ? -5.545  -13.081 2.871   1.00 0.00 ? 18 GLN A CG   6  
ATOM 5922  C CD   . GLN A 1 18 ? -5.756  -13.640 1.478   1.00 0.00 ? 18 GLN A CD   6  
ATOM 5923  O OE1  . GLN A 1 18 ? -5.792  -12.897 0.497   1.00 0.00 ? 18 GLN A OE1  6  
ATOM 5924  N NE2  . GLN A 1 18 ? -5.897  -14.957 1.383   1.00 0.00 ? 18 GLN A NE2  6  
ATOM 5925  H H    . GLN A 1 18 ? -7.103  -11.052 4.416   1.00 0.00 ? 18 GLN A H    6  
ATOM 5926  H HA   . GLN A 1 18 ? -4.517  -11.740 4.895   1.00 0.00 ? 18 GLN A HA   6  
ATOM 5927  H HB2  . GLN A 1 18 ? -5.936  -11.064 2.339   1.00 0.00 ? 18 GLN A HB2  6  
ATOM 5928  H HB3  . GLN A 1 18 ? -4.234  -11.505 2.320   1.00 0.00 ? 18 GLN A HB3  6  
ATOM 5929  H HG2  . GLN A 1 18 ? -4.755  -13.641 3.351   1.00 0.00 ? 18 GLN A HG2  6  
ATOM 5930  H HG3  . GLN A 1 18 ? -6.460  -13.198 3.433   1.00 0.00 ? 18 GLN A HG3  6  
ATOM 5931  H HE21 . GLN A 1 18 ? -5.858  -15.487 2.208   1.00 0.00 ? 18 GLN A HE21 6  
ATOM 5932  H HE22 . GLN A 1 18 ? -6.035  -15.346 0.495   1.00 0.00 ? 18 GLN A HE22 6  
ATOM 5933  N N    . THR A 1 19 ? -4.591  -8.745  3.491   1.00 0.00 ? 19 THR A N    6  
ATOM 5934  C CA   . THR A 1 19 ? -3.844  -7.502  3.345   1.00 0.00 ? 19 THR A CA   6  
ATOM 5935  C C    . THR A 1 19 ? -3.422  -6.951  4.702   1.00 0.00 ? 19 THR A C    6  
ATOM 5936  O O    . THR A 1 19 ? -2.244  -6.679  4.933   1.00 0.00 ? 19 THR A O    6  
ATOM 5937  C CB   . THR A 1 19 ? -4.671  -6.433  2.605   1.00 0.00 ? 19 THR A CB   6  
ATOM 5938  O OG1  . THR A 1 19 ? -5.118  -6.946  1.345   1.00 0.00 ? 19 THR A OG1  6  
ATOM 5939  C CG2  . THR A 1 19 ? -3.850  -5.172  2.382   1.00 0.00 ? 19 THR A CG2  6  
ATOM 5940  H H    . THR A 1 19 ? -5.469  -8.828  3.065   1.00 0.00 ? 19 THR A H    6  
ATOM 5941  H HA   . THR A 1 19 ? -2.959  -7.710  2.761   1.00 0.00 ? 19 THR A HA   6  
ATOM 5942  H HB   . THR A 1 19 ? -5.531  -6.183  3.209   1.00 0.00 ? 19 THR A HB   6  
ATOM 5943  H HG1  . THR A 1 19 ? -5.301  -6.216  0.749   1.00 0.00 ? 19 THR A HG1  6  
ATOM 5944  H HG21 . THR A 1 19 ? -3.205  -5.007  3.232   1.00 0.00 ? 19 THR A HG21 6  
ATOM 5945  H HG22 . THR A 1 19 ? -4.512  -4.328  2.263   1.00 0.00 ? 19 THR A HG22 6  
ATOM 5946  H HG23 . THR A 1 19 ? -3.249  -5.287  1.492   1.00 0.00 ? 19 THR A HG23 6  
ATOM 5947  N N    . ILE A 1 20 ? -4.391  -6.790  5.597   1.00 0.00 ? 20 ILE A N    6  
ATOM 5948  C CA   . ILE A 1 20 ? -4.119  -6.274  6.933   1.00 0.00 ? 20 ILE A CA   6  
ATOM 5949  C C    . ILE A 1 20 ? -2.828  -6.858  7.495   1.00 0.00 ? 20 ILE A C    6  
ATOM 5950  O O    . ILE A 1 20 ? -1.897  -6.125  7.828   1.00 0.00 ? 20 ILE A O    6  
ATOM 5951  C CB   . ILE A 1 20 ? -5.275  -6.583  7.902   1.00 0.00 ? 20 ILE A CB   6  
ATOM 5952  C CG1  . ILE A 1 20 ? -6.540  -5.835  7.477   1.00 0.00 ? 20 ILE A CG1  6  
ATOM 5953  C CG2  . ILE A 1 20 ? -4.886  -6.211  9.325   1.00 0.00 ? 20 ILE A CG2  6  
ATOM 5954  C CD1  . ILE A 1 20 ? -7.792  -6.324  8.171   1.00 0.00 ? 20 ILE A CD1  6  
ATOM 5955  H H    . ILE A 1 20 ? -5.311  -7.025  5.354   1.00 0.00 ? 20 ILE A H    6  
ATOM 5956  H HA   . ILE A 1 20 ? -4.014  -5.201  6.860   1.00 0.00 ? 20 ILE A HA   6  
ATOM 5957  H HB   . ILE A 1 20 ? -5.465  -7.645  7.873   1.00 0.00 ? 20 ILE A HB   6  
ATOM 5958  H HG12 . ILE A 1 20 ? -6.424  -4.787  7.702   1.00 0.00 ? 20 ILE A HG12 6  
ATOM 5959  H HG13 . ILE A 1 20 ? -6.681  -5.957  6.413   1.00 0.00 ? 20 ILE A HG13 6  
ATOM 5960  H HG21 . ILE A 1 20 ? -4.349  -5.274  9.318   1.00 0.00 ? 20 ILE A HG21 6  
ATOM 5961  H HG22 . ILE A 1 20 ? -5.777  -6.109  9.927   1.00 0.00 ? 20 ILE A HG22 6  
ATOM 5962  H HG23 . ILE A 1 20 ? -4.257  -6.983  9.741   1.00 0.00 ? 20 ILE A HG23 6  
ATOM 5963  H HD11 . ILE A 1 20 ? -8.396  -6.885  7.473   1.00 0.00 ? 20 ILE A HD11 6  
ATOM 5964  H HD12 . ILE A 1 20 ? -7.521  -6.956  9.002   1.00 0.00 ? 20 ILE A HD12 6  
ATOM 5965  H HD13 . ILE A 1 20 ? -8.357  -5.476  8.533   1.00 0.00 ? 20 ILE A HD13 6  
ATOM 5966  N N    . GLU A 1 21 ? -2.779  -8.182  7.597   1.00 0.00 ? 21 GLU A N    6  
ATOM 5967  C CA   . GLU A 1 21 ? -1.601  -8.865  8.119   1.00 0.00 ? 21 GLU A CA   6  
ATOM 5968  C C    . GLU A 1 21 ? -0.387  -8.611  7.230   1.00 0.00 ? 21 GLU A C    6  
ATOM 5969  O O    . GLU A 1 21 ? 0.689   -8.259  7.716   1.00 0.00 ? 21 GLU A O    6  
ATOM 5970  C CB   . GLU A 1 21 ? -1.861  -10.369 8.227   1.00 0.00 ? 21 GLU A CB   6  
ATOM 5971  C CG   . GLU A 1 21 ? -2.459  -10.789 9.559   1.00 0.00 ? 21 GLU A CG   6  
ATOM 5972  C CD   . GLU A 1 21 ? -1.403  -11.060 10.613  1.00 0.00 ? 21 GLU A CD   6  
ATOM 5973  O OE1  . GLU A 1 21 ? -0.289  -10.509 10.493  1.00 0.00 ? 21 GLU A OE1  6  
ATOM 5974  O OE2  . GLU A 1 21 ? -1.692  -11.825 11.558  1.00 0.00 ? 21 GLU A OE2  6  
ATOM 5975  H H    . GLU A 1 21 ? -3.554  -8.713  7.316   1.00 0.00 ? 21 GLU A H    6  
ATOM 5976  H HA   . GLU A 1 21 ? -1.399  -8.473  9.104   1.00 0.00 ? 21 GLU A HA   6  
ATOM 5977  H HB2  . GLU A 1 21 ? -2.542  -10.662 7.441   1.00 0.00 ? 21 GLU A HB2  6  
ATOM 5978  H HB3  . GLU A 1 21 ? -0.927  -10.894 8.094   1.00 0.00 ? 21 GLU A HB3  6  
ATOM 5979  H HG2  . GLU A 1 21 ? -3.105  -10.000 9.914   1.00 0.00 ? 21 GLU A HG2  6  
ATOM 5980  H HG3  . GLU A 1 21 ? -3.039  -11.688 9.412   1.00 0.00 ? 21 GLU A HG3  6  
ATOM 5981  N N    . LEU A 1 22 ? -0.567  -8.791  5.927   1.00 0.00 ? 22 LEU A N    6  
ATOM 5982  C CA   . LEU A 1 22 ? 0.513   -8.582  4.969   1.00 0.00 ? 22 LEU A CA   6  
ATOM 5983  C C    . LEU A 1 22 ? 1.253   -7.280  5.258   1.00 0.00 ? 22 LEU A C    6  
ATOM 5984  O O    . LEU A 1 22 ? 2.453   -7.170  5.009   1.00 0.00 ? 22 LEU A O    6  
ATOM 5985  C CB   . LEU A 1 22 ? -0.041  -8.561  3.543   1.00 0.00 ? 22 LEU A CB   6  
ATOM 5986  C CG   . LEU A 1 22 ? -0.299  -9.926  2.903   1.00 0.00 ? 22 LEU A CG   6  
ATOM 5987  C CD1  . LEU A 1 22 ? -0.975  -9.762  1.551   1.00 0.00 ? 22 LEU A CD1  6  
ATOM 5988  C CD2  . LEU A 1 22 ? 1.002   -10.703 2.760   1.00 0.00 ? 22 LEU A CD2  6  
ATOM 5989  H H    . LEU A 1 22 ? -1.447  -9.072  5.600   1.00 0.00 ? 22 LEU A H    6  
ATOM 5990  H HA   . LEU A 1 22 ? 1.205   -9.405  5.065   1.00 0.00 ? 22 LEU A HA   6  
ATOM 5991  H HB2  . LEU A 1 22 ? -0.975  -8.022  3.559   1.00 0.00 ? 22 LEU A HB2  6  
ATOM 5992  H HB3  . LEU A 1 22 ? 0.668   -8.032  2.921   1.00 0.00 ? 22 LEU A HB3  6  
ATOM 5993  H HG   . LEU A 1 22 ? -0.962  -10.495 3.540   1.00 0.00 ? 22 LEU A HG   6  
ATOM 5994  H HD11 . LEU A 1 22 ? -0.623  -10.527 0.877   1.00 0.00 ? 22 LEU A HD11 6  
ATOM 5995  H HD12 . LEU A 1 22 ? -0.740  -8.789  1.146   1.00 0.00 ? 22 LEU A HD12 6  
ATOM 5996  H HD13 . LEU A 1 22 ? -2.045  -9.852  1.671   1.00 0.00 ? 22 LEU A HD13 6  
ATOM 5997  H HD21 . LEU A 1 22 ? 1.828   -10.081 3.070   1.00 0.00 ? 22 LEU A HD21 6  
ATOM 5998  H HD22 . LEU A 1 22 ? 1.136   -10.992 1.728   1.00 0.00 ? 22 LEU A HD22 6  
ATOM 5999  H HD23 . LEU A 1 22 ? 0.963   -11.586 3.380   1.00 0.00 ? 22 LEU A HD23 6  
ATOM 6000  N N    . GLU A 1 23 ? 0.529   -6.299  5.787   1.00 0.00 ? 23 GLU A N    6  
ATOM 6001  C CA   . GLU A 1 23 ? 1.119   -5.005  6.112   1.00 0.00 ? 23 GLU A CA   6  
ATOM 6002  C C    . GLU A 1 23 ? 1.744   -5.026  7.503   1.00 0.00 ? 23 GLU A C    6  
ATOM 6003  O O    . GLU A 1 23 ? 2.915   -4.687  7.675   1.00 0.00 ? 23 GLU A O    6  
ATOM 6004  C CB   . GLU A 1 23 ? 0.060   -3.903  6.033   1.00 0.00 ? 23 GLU A CB   6  
ATOM 6005  C CG   . GLU A 1 23 ? -0.534  -3.728  4.646   1.00 0.00 ? 23 GLU A CG   6  
ATOM 6006  C CD   . GLU A 1 23 ? -0.999  -2.308  4.386   1.00 0.00 ? 23 GLU A CD   6  
ATOM 6007  O OE1  . GLU A 1 23 ? -0.206  -1.372  4.622   1.00 0.00 ? 23 GLU A OE1  6  
ATOM 6008  O OE2  . GLU A 1 23 ? -2.154  -2.132  3.946   1.00 0.00 ? 23 GLU A OE2  6  
ATOM 6009  H H    . GLU A 1 23 ? -0.423  -6.448  5.962   1.00 0.00 ? 23 GLU A H    6  
ATOM 6010  H HA   . GLU A 1 23 ? 1.891   -4.801  5.386   1.00 0.00 ? 23 GLU A HA   6  
ATOM 6011  H HB2  . GLU A 1 23 ? -0.741  -4.140  6.718   1.00 0.00 ? 23 GLU A HB2  6  
ATOM 6012  H HB3  . GLU A 1 23 ? 0.510   -2.967  6.330   1.00 0.00 ? 23 GLU A HB3  6  
ATOM 6013  H HG2  . GLU A 1 23 ? 0.215   -3.985  3.912   1.00 0.00 ? 23 GLU A HG2  6  
ATOM 6014  H HG3  . GLU A 1 23 ? -1.380  -4.392  4.543   1.00 0.00 ? 23 GLU A HG3  6  
ATOM 6015  N N    . LYS A 1 24 ? 0.955   -5.427  8.494   1.00 0.00 ? 24 LYS A N    6  
ATOM 6016  C CA   . LYS A 1 24 ? 1.430   -5.494  9.871   1.00 0.00 ? 24 LYS A CA   6  
ATOM 6017  C C    . LYS A 1 24 ? 2.744   -6.263  9.957   1.00 0.00 ? 24 LYS A C    6  
ATOM 6018  O O    . LYS A 1 24 ? 3.533   -6.063  10.881  1.00 0.00 ? 24 LYS A O    6  
ATOM 6019  C CB   . LYS A 1 24 ? 0.378   -6.159  10.763  1.00 0.00 ? 24 LYS A CB   6  
ATOM 6020  C CG   . LYS A 1 24 ? -0.921  -5.378  10.857  1.00 0.00 ? 24 LYS A CG   6  
ATOM 6021  C CD   . LYS A 1 24 ? -2.085  -6.278  11.237  1.00 0.00 ? 24 LYS A CD   6  
ATOM 6022  C CE   . LYS A 1 24 ? -2.059  -6.627  12.717  1.00 0.00 ? 24 LYS A CE   6  
ATOM 6023  N NZ   . LYS A 1 24 ? -3.162  -7.556  13.088  1.00 0.00 ? 24 LYS A NZ   6  
ATOM 6024  H H    . LYS A 1 24 ? 0.031   -5.685  8.294   1.00 0.00 ? 24 LYS A H    6  
ATOM 6025  H HA   . LYS A 1 24 ? 1.594   -4.484  10.215  1.00 0.00 ? 24 LYS A HA   6  
ATOM 6026  H HB2  . LYS A 1 24 ? 0.158   -7.140  10.368  1.00 0.00 ? 24 LYS A HB2  6  
ATOM 6027  H HB3  . LYS A 1 24 ? 0.783   -6.264  11.759  1.00 0.00 ? 24 LYS A HB3  6  
ATOM 6028  H HG2  . LYS A 1 24 ? -0.815  -4.608  11.606  1.00 0.00 ? 24 LYS A HG2  6  
ATOM 6029  H HG3  . LYS A 1 24 ? -1.128  -4.924  9.898   1.00 0.00 ? 24 LYS A HG3  6  
ATOM 6030  H HD2  . LYS A 1 24 ? -3.011  -5.767  11.017  1.00 0.00 ? 24 LYS A HD2  6  
ATOM 6031  H HD3  . LYS A 1 24 ? -2.029  -7.189  10.660  1.00 0.00 ? 24 LYS A HD3  6  
ATOM 6032  H HE2  . LYS A 1 24 ? -1.114  -7.096  12.946  1.00 0.00 ? 24 LYS A HE2  6  
ATOM 6033  H HE3  . LYS A 1 24 ? -2.157  -5.717  13.291  1.00 0.00 ? 24 LYS A HE3  6  
ATOM 6034  H HZ1  . LYS A 1 24 ? -4.049  -7.026  13.211  1.00 0.00 ? 24 LYS A HZ1  6  
ATOM 6035  H HZ2  . LYS A 1 24 ? -2.936  -8.042  13.979  1.00 0.00 ? 24 LYS A HZ2  6  
ATOM 6036  H HZ3  . LYS A 1 24 ? -3.297  -8.268  12.342  1.00 0.00 ? 24 LYS A HZ3  6  
ATOM 6037  N N    . LYS A 1 25 ? 2.975   -7.142  8.988   1.00 0.00 ? 25 LYS A N    6  
ATOM 6038  C CA   . LYS A 1 25 ? 4.195   -7.939  8.951   1.00 0.00 ? 25 LYS A CA   6  
ATOM 6039  C C    . LYS A 1 25 ? 5.356   -7.132  8.378   1.00 0.00 ? 25 LYS A C    6  
ATOM 6040  O O    . LYS A 1 25 ? 6.389   -6.966  9.026   1.00 0.00 ? 25 LYS A O    6  
ATOM 6041  C CB   . LYS A 1 25 ? 3.978   -9.203  8.117   1.00 0.00 ? 25 LYS A CB   6  
ATOM 6042  C CG   . LYS A 1 25 ? 5.101   -10.218 8.247   1.00 0.00 ? 25 LYS A CG   6  
ATOM 6043  C CD   . LYS A 1 25 ? 5.191   -10.772 9.659   1.00 0.00 ? 25 LYS A CD   6  
ATOM 6044  C CE   . LYS A 1 25 ? 6.038   -12.035 9.709   1.00 0.00 ? 25 LYS A CE   6  
ATOM 6045  N NZ   . LYS A 1 25 ? 5.885   -12.754 11.004  1.00 0.00 ? 25 LYS A NZ   6  
ATOM 6046  H H    . LYS A 1 25 ? 2.308   -7.256  8.278   1.00 0.00 ? 25 LYS A H    6  
ATOM 6047  H HA   . LYS A 1 25 ? 4.436   -8.223  9.964   1.00 0.00 ? 25 LYS A HA   6  
ATOM 6048  H HB2  . LYS A 1 25 ? 3.058   -9.673  8.431   1.00 0.00 ? 25 LYS A HB2  6  
ATOM 6049  H HB3  . LYS A 1 25 ? 3.893   -8.923  7.077   1.00 0.00 ? 25 LYS A HB3  6  
ATOM 6050  H HG2  . LYS A 1 25 ? 4.918   -11.033 7.563   1.00 0.00 ? 25 LYS A HG2  6  
ATOM 6051  H HG3  . LYS A 1 25 ? 6.037   -9.739  7.997   1.00 0.00 ? 25 LYS A HG3  6  
ATOM 6052  H HD2  . LYS A 1 25 ? 5.638   -10.027 10.301  1.00 0.00 ? 25 LYS A HD2  6  
ATOM 6053  H HD3  . LYS A 1 25 ? 4.196   -11.002 10.011  1.00 0.00 ? 25 LYS A HD3  6  
ATOM 6054  H HE2  . LYS A 1 25 ? 5.733   -12.688 8.906   1.00 0.00 ? 25 LYS A HE2  6  
ATOM 6055  H HE3  . LYS A 1 25 ? 7.074   -11.763 9.578   1.00 0.00 ? 25 LYS A HE3  6  
ATOM 6056  H HZ1  . LYS A 1 25 ? 6.787   -13.193 11.277  1.00 0.00 ? 25 LYS A HZ1  6  
ATOM 6057  H HZ2  . LYS A 1 25 ? 5.163   -13.497 10.917  1.00 0.00 ? 25 LYS A HZ2  6  
ATOM 6058  H HZ3  . LYS A 1 25 ? 5.595   -12.089 11.750  1.00 0.00 ? 25 LYS A HZ3  6  
ATOM 6059  N N    . PHE A 1 26 ? 5.177   -6.631  7.160   1.00 0.00 ? 26 PHE A N    6  
ATOM 6060  C CA   . PHE A 1 26 ? 6.210   -5.840  6.500   1.00 0.00 ? 26 PHE A CA   6  
ATOM 6061  C C    . PHE A 1 26 ? 6.757   -4.768  7.438   1.00 0.00 ? 26 PHE A C    6  
ATOM 6062  O O    . PHE A 1 26 ? 7.965   -4.548  7.507   1.00 0.00 ? 26 PHE A O    6  
ATOM 6063  C CB   . PHE A 1 26 ? 5.651   -5.189  5.233   1.00 0.00 ? 26 PHE A CB   6  
ATOM 6064  C CG   . PHE A 1 26 ? 6.451   -4.007  4.764   1.00 0.00 ? 26 PHE A CG   6  
ATOM 6065  C CD1  . PHE A 1 26 ? 6.267   -2.759  5.337   1.00 0.00 ? 26 PHE A CD1  6  
ATOM 6066  C CD2  . PHE A 1 26 ? 7.386   -4.145  3.751   1.00 0.00 ? 26 PHE A CD2  6  
ATOM 6067  C CE1  . PHE A 1 26 ? 7.001   -1.670  4.906   1.00 0.00 ? 26 PHE A CE1  6  
ATOM 6068  C CE2  . PHE A 1 26 ? 8.123   -3.059  3.317   1.00 0.00 ? 26 PHE A CE2  6  
ATOM 6069  C CZ   . PHE A 1 26 ? 7.931   -1.820  3.896   1.00 0.00 ? 26 PHE A CZ   6  
ATOM 6070  H H    . PHE A 1 26 ? 4.331   -6.798  6.694   1.00 0.00 ? 26 PHE A H    6  
ATOM 6071  H HA   . PHE A 1 26 ? 7.013   -6.507  6.227   1.00 0.00 ? 26 PHE A HA   6  
ATOM 6072  H HB2  . PHE A 1 26 ? 5.640   -5.918  4.437   1.00 0.00 ? 26 PHE A HB2  6  
ATOM 6073  H HB3  . PHE A 1 26 ? 4.643   -4.855  5.424   1.00 0.00 ? 26 PHE A HB3  6  
ATOM 6074  H HD1  . PHE A 1 26 ? 5.541   -2.640  6.128   1.00 0.00 ? 26 PHE A HD1  6  
ATOM 6075  H HD2  . PHE A 1 26 ? 7.537   -5.114  3.297   1.00 0.00 ? 26 PHE A HD2  6  
ATOM 6076  H HE1  . PHE A 1 26 ? 6.849   -0.702  5.361   1.00 0.00 ? 26 PHE A HE1  6  
ATOM 6077  H HE2  . PHE A 1 26 ? 8.849   -3.181  2.527   1.00 0.00 ? 26 PHE A HE2  6  
ATOM 6078  H HZ   . PHE A 1 26 ? 8.505   -0.971  3.558   1.00 0.00 ? 26 PHE A HZ   6  
ATOM 6079  N N    . GLU A 1 27 ? 5.857   -4.104  8.156   1.00 0.00 ? 27 GLU A N    6  
ATOM 6080  C CA   . GLU A 1 27 ? 6.249   -3.054  9.089   1.00 0.00 ? 27 GLU A CA   6  
ATOM 6081  C C    . GLU A 1 27 ? 7.305   -3.562  10.067  1.00 0.00 ? 27 GLU A C    6  
ATOM 6082  O O    . GLU A 1 27 ? 8.346   -2.932  10.258  1.00 0.00 ? 27 GLU A O    6  
ATOM 6083  C CB   . GLU A 1 27 ? 5.029   -2.542  9.858   1.00 0.00 ? 27 GLU A CB   6  
ATOM 6084  C CG   . GLU A 1 27 ? 3.882   -2.109  8.961   1.00 0.00 ? 27 GLU A CG   6  
ATOM 6085  C CD   . GLU A 1 27 ? 3.997   -0.661  8.525   1.00 0.00 ? 27 GLU A CD   6  
ATOM 6086  O OE1  . GLU A 1 27 ? 5.080   -0.272  8.040   1.00 0.00 ? 27 GLU A OE1  6  
ATOM 6087  O OE2  . GLU A 1 27 ? 3.004   0.083   8.669   1.00 0.00 ? 27 GLU A OE2  6  
ATOM 6088  H H    . GLU A 1 27 ? 4.907   -4.325  8.057   1.00 0.00 ? 27 GLU A H    6  
ATOM 6089  H HA   . GLU A 1 27 ? 6.669   -2.241  8.516   1.00 0.00 ? 27 GLU A HA   6  
ATOM 6090  H HB2  . GLU A 1 27 ? 4.674   -3.327  10.509  1.00 0.00 ? 27 GLU A HB2  6  
ATOM 6091  H HB3  . GLU A 1 27 ? 5.328   -1.696  10.459  1.00 0.00 ? 27 GLU A HB3  6  
ATOM 6092  H HG2  . GLU A 1 27 ? 3.875   -2.734  8.080   1.00 0.00 ? 27 GLU A HG2  6  
ATOM 6093  H HG3  . GLU A 1 27 ? 2.954   -2.236  9.498   1.00 0.00 ? 27 GLU A HG3  6  
ATOM 6094  N N    . THR A 1 28 ? 7.028   -4.705  10.686  1.00 0.00 ? 28 THR A N    6  
ATOM 6095  C CA   . THR A 1 28 ? 7.951   -5.297  11.646  1.00 0.00 ? 28 THR A CA   6  
ATOM 6096  C C    . THR A 1 28 ? 9.178   -5.871  10.947  1.00 0.00 ? 28 THR A C    6  
ATOM 6097  O O    . THR A 1 28 ? 10.248  -5.984  11.545  1.00 0.00 ? 28 THR A O    6  
ATOM 6098  C CB   . THR A 1 28 ? 7.272   -6.412  12.464  1.00 0.00 ? 28 THR A CB   6  
ATOM 6099  O OG1  . THR A 1 28 ? 6.767   -7.425  11.587  1.00 0.00 ? 28 THR A OG1  6  
ATOM 6100  C CG2  . THR A 1 28 ? 6.137   -5.850  13.306  1.00 0.00 ? 28 THR A CG2  6  
ATOM 6101  H H    . THR A 1 28 ? 6.182   -5.160  10.492  1.00 0.00 ? 28 THR A H    6  
ATOM 6102  H HA   . THR A 1 28 ? 8.267   -4.521  12.328  1.00 0.00 ? 28 THR A HA   6  
ATOM 6103  H HB   . THR A 1 28 ? 8.007   -6.852  13.124  1.00 0.00 ? 28 THR A HB   6  
ATOM 6104  H HG1  . THR A 1 28 ? 7.473   -7.735  11.015  1.00 0.00 ? 28 THR A HG1  6  
ATOM 6105  H HG21 . THR A 1 28 ? 5.807   -4.912  12.886  1.00 0.00 ? 28 THR A HG21 6  
ATOM 6106  H HG22 . THR A 1 28 ? 6.483   -5.691  14.317  1.00 0.00 ? 28 THR A HG22 6  
ATOM 6107  H HG23 . THR A 1 28 ? 5.315   -6.550  13.314  1.00 0.00 ? 28 THR A HG23 6  
ATOM 6108  N N    . GLN A 1 29 ? 9.016   -6.231  9.678   1.00 0.00 ? 29 GLN A N    6  
ATOM 6109  C CA   . GLN A 1 29 ? 10.112  -6.794  8.898   1.00 0.00 ? 29 GLN A CA   6  
ATOM 6110  C C    . GLN A 1 29 ? 9.894   -6.561  7.407   1.00 0.00 ? 29 GLN A C    6  
ATOM 6111  O O    . GLN A 1 29 ? 9.029   -7.183  6.790   1.00 0.00 ? 29 GLN A O    6  
ATOM 6112  C CB   . GLN A 1 29 ? 10.249  -8.291  9.178   1.00 0.00 ? 29 GLN A CB   6  
ATOM 6113  C CG   . GLN A 1 29 ? 11.677  -8.803  9.066   1.00 0.00 ? 29 GLN A CG   6  
ATOM 6114  C CD   . GLN A 1 29 ? 11.743  -10.292 8.790   1.00 0.00 ? 29 GLN A CD   6  
ATOM 6115  O OE1  . GLN A 1 29 ? 11.007  -11.079 9.386   1.00 0.00 ? 29 GLN A OE1  6  
ATOM 6116  N NE2  . GLN A 1 29 ? 12.627  -10.687 7.881   1.00 0.00 ? 29 GLN A NE2  6  
ATOM 6117  H H    . GLN A 1 29 ? 8.139   -6.117  9.257   1.00 0.00 ? 29 GLN A H    6  
ATOM 6118  H HA   . GLN A 1 29 ? 11.022  -6.296  9.198   1.00 0.00 ? 29 GLN A HA   6  
ATOM 6119  H HB2  . GLN A 1 29 ? 9.894   -8.493  10.178  1.00 0.00 ? 29 GLN A HB2  6  
ATOM 6120  H HB3  . GLN A 1 29 ? 9.639   -8.835  8.472   1.00 0.00 ? 29 GLN A HB3  6  
ATOM 6121  H HG2  . GLN A 1 29 ? 12.171  -8.281  8.260   1.00 0.00 ? 29 GLN A HG2  6  
ATOM 6122  H HG3  . GLN A 1 29 ? 12.191  -8.600  9.994   1.00 0.00 ? 29 GLN A HG3  6  
ATOM 6123  H HE21 . GLN A 1 29 ? 13.181  -10.003 7.447   1.00 0.00 ? 29 GLN A HE21 6  
ATOM 6124  H HE22 . GLN A 1 29 ? 12.692  -11.643 7.684   1.00 0.00 ? 29 GLN A HE22 6  
ATOM 6125  N N    . LYS A 1 30 ? 10.685  -5.661  6.831   1.00 0.00 ? 30 LYS A N    6  
ATOM 6126  C CA   . LYS A 1 30 ? 10.580  -5.346  5.412   1.00 0.00 ? 30 LYS A CA   6  
ATOM 6127  C C    . LYS A 1 30 ? 10.606  -6.617  4.569   1.00 0.00 ? 30 LYS A C    6  
ATOM 6128  O O    . LYS A 1 30 ? 9.934   -6.705  3.541   1.00 0.00 ? 30 LYS A O    6  
ATOM 6129  C CB   . LYS A 1 30 ? 11.721  -4.418  4.989   1.00 0.00 ? 30 LYS A CB   6  
ATOM 6130  C CG   . LYS A 1 30 ? 11.799  -3.139  5.804   1.00 0.00 ? 30 LYS A CG   6  
ATOM 6131  C CD   . LYS A 1 30 ? 10.723  -2.148  5.390   1.00 0.00 ? 30 LYS A CD   6  
ATOM 6132  C CE   . LYS A 1 30 ? 10.369  -1.203  6.527   1.00 0.00 ? 30 LYS A CE   6  
ATOM 6133  N NZ   . LYS A 1 30 ? 9.754   -1.923  7.676   1.00 0.00 ? 30 LYS A NZ   6  
ATOM 6134  H H    . LYS A 1 30 ? 11.357  -5.198  7.376   1.00 0.00 ? 30 LYS A H    6  
ATOM 6135  H HA   . LYS A 1 30 ? 9.640   -4.842  5.252   1.00 0.00 ? 30 LYS A HA   6  
ATOM 6136  H HB2  . LYS A 1 30 ? 12.658  -4.946  5.097   1.00 0.00 ? 30 LYS A HB2  6  
ATOM 6137  H HB3  . LYS A 1 30 ? 11.586  -4.151  3.951   1.00 0.00 ? 30 LYS A HB3  6  
ATOM 6138  H HG2  . LYS A 1 30 ? 11.668  -3.379  6.848   1.00 0.00 ? 30 LYS A HG2  6  
ATOM 6139  H HG3  . LYS A 1 30 ? 12.769  -2.686  5.655   1.00 0.00 ? 30 LYS A HG3  6  
ATOM 6140  H HD2  . LYS A 1 30 ? 11.083  -1.568  4.553   1.00 0.00 ? 30 LYS A HD2  6  
ATOM 6141  H HD3  . LYS A 1 30 ? 9.837   -2.694  5.097   1.00 0.00 ? 30 LYS A HD3  6  
ATOM 6142  H HE2  . LYS A 1 30 ? 11.269  -0.710  6.862   1.00 0.00 ? 30 LYS A HE2  6  
ATOM 6143  H HE3  . LYS A 1 30 ? 9.670   -0.465  6.160   1.00 0.00 ? 30 LYS A HE3  6  
ATOM 6144  H HZ1  . LYS A 1 30 ? 8.776   -1.599  7.819   1.00 0.00 ? 30 LYS A HZ1  6  
ATOM 6145  H HZ2  . LYS A 1 30 ? 10.298  -1.741  8.544   1.00 0.00 ? 30 LYS A HZ2  6  
ATOM 6146  H HZ3  . LYS A 1 30 ? 9.746   -2.947  7.494   1.00 0.00 ? 30 LYS A HZ3  6  
ATOM 6147  N N    . TYR A 1 31 ? 11.383  -7.599  5.011   1.00 0.00 ? 31 TYR A N    6  
ATOM 6148  C CA   . TYR A 1 31 ? 11.496  -8.865  4.297   1.00 0.00 ? 31 TYR A CA   6  
ATOM 6149  C C    . TYR A 1 31 ? 11.138  -10.038 5.205   1.00 0.00 ? 31 TYR A C    6  
ATOM 6150  O O    . TYR A 1 31 ? 10.839  -9.855  6.386   1.00 0.00 ? 31 TYR A O    6  
ATOM 6151  C CB   . TYR A 1 31 ? 12.915  -9.043  3.752   1.00 0.00 ? 31 TYR A CB   6  
ATOM 6152  C CG   . TYR A 1 31 ? 13.128  -8.404  2.399   1.00 0.00 ? 31 TYR A CG   6  
ATOM 6153  C CD1  . TYR A 1 31 ? 12.861  -7.056  2.195   1.00 0.00 ? 31 TYR A CD1  6  
ATOM 6154  C CD2  . TYR A 1 31 ? 13.598  -9.148  1.324   1.00 0.00 ? 31 TYR A CD2  6  
ATOM 6155  C CE1  . TYR A 1 31 ? 13.053  -6.468  0.959   1.00 0.00 ? 31 TYR A CE1  6  
ATOM 6156  C CE2  . TYR A 1 31 ? 13.795  -8.569  0.085   1.00 0.00 ? 31 TYR A CE2  6  
ATOM 6157  C CZ   . TYR A 1 31 ? 13.521  -7.229  -0.092  1.00 0.00 ? 31 TYR A CZ   6  
ATOM 6158  O OH   . TYR A 1 31 ? 13.715  -6.647  -1.324  1.00 0.00 ? 31 TYR A OH   6  
ATOM 6159  H H    . TYR A 1 31 ? 11.894  -7.470  5.837   1.00 0.00 ? 31 TYR A H    6  
ATOM 6160  H HA   . TYR A 1 31 ? 10.804  -8.842  3.468   1.00 0.00 ? 31 TYR A HA   6  
ATOM 6161  H HB2  . TYR A 1 31 ? 13.616  -8.599  4.442   1.00 0.00 ? 31 TYR A HB2  6  
ATOM 6162  H HB3  . TYR A 1 31 ? 13.128  -10.097 3.659   1.00 0.00 ? 31 TYR A HB3  6  
ATOM 6163  H HD1  . TYR A 1 31 ? 12.495  -6.463  3.020   1.00 0.00 ? 31 TYR A HD1  6  
ATOM 6164  H HD2  . TYR A 1 31 ? 13.812  -10.198 1.466   1.00 0.00 ? 31 TYR A HD2  6  
ATOM 6165  H HE1  . TYR A 1 31 ? 12.839  -5.419  0.820   1.00 0.00 ? 31 TYR A HE1  6  
ATOM 6166  H HE2  . TYR A 1 31 ? 14.161  -9.164  -0.739  1.00 0.00 ? 31 TYR A HE2  6  
ATOM 6167  H HH   . TYR A 1 31 ? 14.425  -6.003  -1.265  1.00 0.00 ? 31 TYR A HH   6  
ATOM 6168  N N    . LEU A 1 32 ? 11.172  -11.242 4.646   1.00 0.00 ? 32 LEU A N    6  
ATOM 6169  C CA   . LEU A 1 32 ? 10.852  -12.447 5.404   1.00 0.00 ? 32 LEU A CA   6  
ATOM 6170  C C    . LEU A 1 32 ? 11.589  -13.657 4.841   1.00 0.00 ? 32 LEU A C    6  
ATOM 6171  O O    . LEU A 1 32 ? 11.462  -13.979 3.660   1.00 0.00 ? 32 LEU A O    6  
ATOM 6172  C CB   . LEU A 1 32 ? 9.343   -12.700 5.384   1.00 0.00 ? 32 LEU A CB   6  
ATOM 6173  C CG   . LEU A 1 32 ? 8.469   -11.591 5.971   1.00 0.00 ? 32 LEU A CG   6  
ATOM 6174  C CD1  . LEU A 1 32 ? 7.049   -11.692 5.436   1.00 0.00 ? 32 LEU A CD1  6  
ATOM 6175  C CD2  . LEU A 1 32 ? 8.474   -11.655 7.491   1.00 0.00 ? 32 LEU A CD2  6  
ATOM 6176  H H    . LEU A 1 32 ? 11.418  -11.325 3.702   1.00 0.00 ? 32 LEU A H    6  
ATOM 6177  H HA   . LEU A 1 32 ? 11.169  -12.290 6.425   1.00 0.00 ? 32 LEU A HA   6  
ATOM 6178  H HB2  . LEU A 1 32 ? 9.046   -12.846 4.357   1.00 0.00 ? 32 LEU A HB2  6  
ATOM 6179  H HB3  . LEU A 1 32 ? 9.153   -13.604 5.945   1.00 0.00 ? 32 LEU A HB3  6  
ATOM 6180  H HG   . LEU A 1 32 ? 8.869   -10.631 5.674   1.00 0.00 ? 32 LEU A HG   6  
ATOM 6181  H HD11 . LEU A 1 32 ? 6.908   -10.967 4.649   1.00 0.00 ? 32 LEU A HD11 6  
ATOM 6182  H HD12 . LEU A 1 32 ? 6.348   -11.497 6.235   1.00 0.00 ? 32 LEU A HD12 6  
ATOM 6183  H HD13 . LEU A 1 32 ? 6.881   -12.686 5.046   1.00 0.00 ? 32 LEU A HD13 6  
ATOM 6184  H HD21 . LEU A 1 32 ? 9.464   -11.427 7.857   1.00 0.00 ? 32 LEU A HD21 6  
ATOM 6185  H HD22 . LEU A 1 32 ? 8.193   -12.649 7.810   1.00 0.00 ? 32 LEU A HD22 6  
ATOM 6186  H HD23 . LEU A 1 32 ? 7.770   -10.938 7.884   1.00 0.00 ? 32 LEU A HD23 6  
ATOM 6187  N N    . SER A 1 33 ? 12.359  -14.324 5.695   1.00 0.00 ? 33 SER A N    6  
ATOM 6188  C CA   . SER A 1 33 ? 13.119  -15.499 5.282   1.00 0.00 ? 33 SER A CA   6  
ATOM 6189  C C    . SER A 1 33 ? 12.190  -16.591 4.761   1.00 0.00 ? 33 SER A C    6  
ATOM 6190  O O    . SER A 1 33 ? 11.013  -16.663 5.117   1.00 0.00 ? 33 SER A O    6  
ATOM 6191  C CB   . SER A 1 33 ? 13.948  -16.033 6.452   1.00 0.00 ? 33 SER A CB   6  
ATOM 6192  O OG   . SER A 1 33 ? 14.516  -14.973 7.200   1.00 0.00 ? 33 SER A OG   6  
ATOM 6193  H H    . SER A 1 33 ? 12.419  -14.018 6.624   1.00 0.00 ? 33 SER A H    6  
ATOM 6194  H HA   . SER A 1 33 ? 13.785  -15.200 4.487   1.00 0.00 ? 33 SER A HA   6  
ATOM 6195  H HB2  . SER A 1 33 ? 13.314  -16.617 7.101   1.00 0.00 ? 33 SER A HB2  6  
ATOM 6196  H HB3  . SER A 1 33 ? 14.744  -16.656 6.070   1.00 0.00 ? 33 SER A HB3  6  
ATOM 6197  H HG   . SER A 1 33 ? 15.036  -14.413 6.619   1.00 0.00 ? 33 SER A HG   6  
ATOM 6198  N N    . PRO A 1 34 ? 12.730  -17.464 3.897   1.00 0.00 ? 34 PRO A N    6  
ATOM 6199  C CA   . PRO A 1 34 ? 11.968  -18.569 3.309   1.00 0.00 ? 34 PRO A CA   6  
ATOM 6200  C C    . PRO A 1 34 ? 11.180  -19.351 4.354   1.00 0.00 ? 34 PRO A C    6  
ATOM 6201  O O    . PRO A 1 34 ? 10.012  -19.690 4.160   1.00 0.00 ? 34 PRO A O    6  
ATOM 6202  C CB   . PRO A 1 34 ? 13.051  -19.452 2.684   1.00 0.00 ? 34 PRO A CB   6  
ATOM 6203  C CG   . PRO A 1 34 ? 14.180  -18.523 2.398   1.00 0.00 ? 34 PRO A CG   6  
ATOM 6204  C CD   . PRO A 1 34 ? 14.126  -17.438 3.429   1.00 0.00 ? 34 PRO A CD   6  
ATOM 6205  H HA   . PRO A 1 34 ? 11.296  -18.221 2.538   1.00 0.00 ? 34 PRO A HA   6  
ATOM 6206  H HB2  . PRO A 1 34 ? 13.340  -20.223 3.385   1.00 0.00 ? 34 PRO A HB2  6  
ATOM 6207  H HB3  . PRO A 1 34 ? 12.674  -19.905 1.779   1.00 0.00 ? 34 PRO A HB3  6  
ATOM 6208  H HG2  . PRO A 1 34 ? 15.118  -19.052 2.471   1.00 0.00 ? 34 PRO A HG2  6  
ATOM 6209  H HG3  . PRO A 1 34 ? 14.064  -18.097 1.413   1.00 0.00 ? 34 PRO A HG3  6  
ATOM 6210  H HD2  . PRO A 1 34 ? 14.808  -17.658 4.238   1.00 0.00 ? 34 PRO A HD2  6  
ATOM 6211  H HD3  . PRO A 1 34 ? 14.364  -16.485 2.981   1.00 0.00 ? 34 PRO A HD3  6  
ATOM 6212  N N    . PRO A 1 35 ? 11.831  -19.645 5.489   1.00 0.00 ? 35 PRO A N    6  
ATOM 6213  C CA   . PRO A 1 35 ? 11.209  -20.390 6.588   1.00 0.00 ? 35 PRO A CA   6  
ATOM 6214  C C    . PRO A 1 35 ? 9.831   -19.847 6.950   1.00 0.00 ? 35 PRO A C    6  
ATOM 6215  O O    . PRO A 1 35 ? 8.891   -20.611 7.166   1.00 0.00 ? 35 PRO A O    6  
ATOM 6216  C CB   . PRO A 1 35 ? 12.185  -20.189 7.750   1.00 0.00 ? 35 PRO A CB   6  
ATOM 6217  C CG   . PRO A 1 35 ? 13.502  -19.941 7.099   1.00 0.00 ? 35 PRO A CG   6  
ATOM 6218  C CD   . PRO A 1 35 ? 13.224  -19.273 5.788   1.00 0.00 ? 35 PRO A CD   6  
ATOM 6219  H HA   . PRO A 1 35 ? 11.131  -21.443 6.359   1.00 0.00 ? 35 PRO A HA   6  
ATOM 6220  H HB2  . PRO A 1 35 ? 11.871  -19.343 8.345   1.00 0.00 ? 35 PRO A HB2  6  
ATOM 6221  H HB3  . PRO A 1 35 ? 12.209  -21.078 8.362   1.00 0.00 ? 35 PRO A HB3  6  
ATOM 6222  H HG2  . PRO A 1 35 ? 14.102  -19.292 7.720   1.00 0.00 ? 35 PRO A HG2  6  
ATOM 6223  H HG3  . PRO A 1 35 ? 14.011  -20.878 6.932   1.00 0.00 ? 35 PRO A HG3  6  
ATOM 6224  H HD2  . PRO A 1 35 ? 13.324  -18.202 5.886   1.00 0.00 ? 35 PRO A HD2  6  
ATOM 6225  H HD3  . PRO A 1 35 ? 13.894  -19.649 5.029   1.00 0.00 ? 35 PRO A HD3  6  
ATOM 6226  N N    . GLU A 1 36 ? 9.719   -18.524 7.013   1.00 0.00 ? 36 GLU A N    6  
ATOM 6227  C CA   . GLU A 1 36 ? 8.455   -17.880 7.349   1.00 0.00 ? 36 GLU A CA   6  
ATOM 6228  C C    . GLU A 1 36 ? 7.568   -17.745 6.115   1.00 0.00 ? 36 GLU A C    6  
ATOM 6229  O O    . GLU A 1 36 ? 6.494   -18.342 6.041   1.00 0.00 ? 36 GLU A O    6  
ATOM 6230  C CB   . GLU A 1 36 ? 8.707   -16.501 7.963   1.00 0.00 ? 36 GLU A CB   6  
ATOM 6231  C CG   . GLU A 1 36 ? 9.809   -16.492 9.009   1.00 0.00 ? 36 GLU A CG   6  
ATOM 6232  C CD   . GLU A 1 36 ? 9.291   -16.783 10.404  1.00 0.00 ? 36 GLU A CD   6  
ATOM 6233  O OE1  . GLU A 1 36 ? 8.882   -17.936 10.656  1.00 0.00 ? 36 GLU A OE1  6  
ATOM 6234  O OE2  . GLU A 1 36 ? 9.294   -15.859 11.244  1.00 0.00 ? 36 GLU A OE2  6  
ATOM 6235  H H    . GLU A 1 36 ? 10.505  -17.968 6.830   1.00 0.00 ? 36 GLU A H    6  
ATOM 6236  H HA   . GLU A 1 36 ? 7.950   -18.499 8.074   1.00 0.00 ? 36 GLU A HA   6  
ATOM 6237  H HB2  . GLU A 1 36 ? 8.981   -15.814 7.175   1.00 0.00 ? 36 GLU A HB2  6  
ATOM 6238  H HB3  . GLU A 1 36 ? 7.795   -16.156 8.428   1.00 0.00 ? 36 GLU A HB3  6  
ATOM 6239  H HG2  . GLU A 1 36 ? 10.540  -17.243 8.749   1.00 0.00 ? 36 GLU A HG2  6  
ATOM 6240  H HG3  . GLU A 1 36 ? 10.279  -15.520 9.011   1.00 0.00 ? 36 GLU A HG3  6  
ATOM 6241  N N    . ARG A 1 37 ? 8.025   -16.956 5.148   1.00 0.00 ? 37 ARG A N    6  
ATOM 6242  C CA   . ARG A 1 37 ? 7.274   -16.740 3.918   1.00 0.00 ? 37 ARG A CA   6  
ATOM 6243  C C    . ARG A 1 37 ? 6.544   -18.013 3.497   1.00 0.00 ? 37 ARG A C    6  
ATOM 6244  O O    . ARG A 1 37 ? 5.412   -17.962 3.014   1.00 0.00 ? 37 ARG A O    6  
ATOM 6245  C CB   . ARG A 1 37 ? 8.208   -16.282 2.797   1.00 0.00 ? 37 ARG A CB   6  
ATOM 6246  C CG   . ARG A 1 37 ? 7.501   -15.524 1.686   1.00 0.00 ? 37 ARG A CG   6  
ATOM 6247  C CD   . ARG A 1 37 ? 8.379   -15.398 0.451   1.00 0.00 ? 37 ARG A CD   6  
ATOM 6248  N NE   . ARG A 1 37 ? 8.555   -16.678 -0.229  1.00 0.00 ? 37 ARG A NE   6  
ATOM 6249  C CZ   . ARG A 1 37 ? 9.365   -16.854 -1.267  1.00 0.00 ? 37 ARG A CZ   6  
ATOM 6250  N NH1  . ARG A 1 37 ? 10.072  -15.837 -1.741  1.00 0.00 ? 37 ARG A NH1  6  
ATOM 6251  N NH2  . ARG A 1 37 ? 9.471   -18.050 -1.832  1.00 0.00 ? 37 ARG A NH2  6  
ATOM 6252  H H    . ARG A 1 37 ? 8.889   -16.507 5.265   1.00 0.00 ? 37 ARG A H    6  
ATOM 6253  H HA   . ARG A 1 37 ? 6.544   -15.967 4.105   1.00 0.00 ? 37 ARG A HA   6  
ATOM 6254  H HB2  . ARG A 1 37 ? 8.966   -15.636 3.217   1.00 0.00 ? 37 ARG A HB2  6  
ATOM 6255  H HB3  . ARG A 1 37 ? 8.685   -17.149 2.365   1.00 0.00 ? 37 ARG A HB3  6  
ATOM 6256  H HG2  . ARG A 1 37 ? 6.599   -16.054 1.419   1.00 0.00 ? 37 ARG A HG2  6  
ATOM 6257  H HG3  . ARG A 1 37 ? 7.249   -14.536 2.041   1.00 0.00 ? 37 ARG A HG3  6  
ATOM 6258  H HD2  . ARG A 1 37 ? 7.920   -14.699 -0.232  1.00 0.00 ? 37 ARG A HD2  6  
ATOM 6259  H HD3  . ARG A 1 37 ? 9.347   -15.024 0.751   1.00 0.00 ? 37 ARG A HD3  6  
ATOM 6260  H HE   . ARG A 1 37 ? 8.042   -17.443 0.104   1.00 0.00 ? 37 ARG A HE   6  
ATOM 6261  H HH11 . ARG A 1 37 ? 9.995   -14.936 -1.316  1.00 0.00 ? 37 ARG A HH11 6  
ATOM 6262  H HH12 . ARG A 1 37 ? 10.683  -15.973 -2.521  1.00 0.00 ? 37 ARG A HH12 6  
ATOM 6263  H HH21 . ARG A 1 37 ? 8.940   -18.819 -1.478  1.00 0.00 ? 37 ARG A HH21 6  
ATOM 6264  H HH22 . ARG A 1 37 ? 10.081  -18.182 -2.613  1.00 0.00 ? 37 ARG A HH22 6  
ATOM 6265  N N    . LYS A 1 38 ? 7.199   -19.154 3.683   1.00 0.00 ? 38 LYS A N    6  
ATOM 6266  C CA   . LYS A 1 38 ? 6.614   -20.440 3.324   1.00 0.00 ? 38 LYS A CA   6  
ATOM 6267  C C    . LYS A 1 38 ? 5.378   -20.730 4.169   1.00 0.00 ? 38 LYS A C    6  
ATOM 6268  O O    . LYS A 1 38 ? 4.344   -21.151 3.650   1.00 0.00 ? 38 LYS A O    6  
ATOM 6269  C CB   . LYS A 1 38 ? 7.642   -21.559 3.504   1.00 0.00 ? 38 LYS A CB   6  
ATOM 6270  C CG   . LYS A 1 38 ? 8.615   -21.683 2.344   1.00 0.00 ? 38 LYS A CG   6  
ATOM 6271  C CD   . LYS A 1 38 ? 9.820   -22.530 2.716   1.00 0.00 ? 38 LYS A CD   6  
ATOM 6272  C CE   . LYS A 1 38 ? 9.580   -24.003 2.418   1.00 0.00 ? 38 LYS A CE   6  
ATOM 6273  N NZ   . LYS A 1 38 ? 9.672   -24.296 0.961   1.00 0.00 ? 38 LYS A NZ   6  
ATOM 6274  H H    . LYS A 1 38 ? 8.099   -19.130 4.072   1.00 0.00 ? 38 LYS A H    6  
ATOM 6275  H HA   . LYS A 1 38 ? 6.322   -20.394 2.286   1.00 0.00 ? 38 LYS A HA   6  
ATOM 6276  H HB2  . LYS A 1 38 ? 8.209   -21.370 4.404   1.00 0.00 ? 38 LYS A HB2  6  
ATOM 6277  H HB3  . LYS A 1 38 ? 7.119   -22.499 3.609   1.00 0.00 ? 38 LYS A HB3  6  
ATOM 6278  H HG2  . LYS A 1 38 ? 8.109   -22.144 1.509   1.00 0.00 ? 38 LYS A HG2  6  
ATOM 6279  H HG3  . LYS A 1 38 ? 8.953   -20.696 2.063   1.00 0.00 ? 38 LYS A HG3  6  
ATOM 6280  H HD2  . LYS A 1 38 ? 10.675  -22.195 2.147   1.00 0.00 ? 38 LYS A HD2  6  
ATOM 6281  H HD3  . LYS A 1 38 ? 10.020  -22.414 3.772   1.00 0.00 ? 38 LYS A HD3  6  
ATOM 6282  H HE2  . LYS A 1 38 ? 10.321  -24.588 2.941   1.00 0.00 ? 38 LYS A HE2  6  
ATOM 6283  H HE3  . LYS A 1 38 ? 8.595   -24.271 2.769   1.00 0.00 ? 38 LYS A HE3  6  
ATOM 6284  H HZ1  . LYS A 1 38 ? 10.423  -23.721 0.528   1.00 0.00 ? 38 LYS A HZ1  6  
ATOM 6285  H HZ2  . LYS A 1 38 ? 8.769   -24.074 0.494   1.00 0.00 ? 38 LYS A HZ2  6  
ATOM 6286  H HZ3  . LYS A 1 38 ? 9.889   -25.301 0.811   1.00 0.00 ? 38 LYS A HZ3  6  
ATOM 6287  N N    . ARG A 1 39 ? 5.491   -20.502 5.474   1.00 0.00 ? 39 ARG A N    6  
ATOM 6288  C CA   . ARG A 1 39 ? 4.382   -20.739 6.390   1.00 0.00 ? 39 ARG A CA   6  
ATOM 6289  C C    . ARG A 1 39 ? 3.299   -19.678 6.218   1.00 0.00 ? 39 ARG A C    6  
ATOM 6290  O O    . ARG A 1 39 ? 2.112   -19.997 6.129   1.00 0.00 ? 39 ARG A O    6  
ATOM 6291  C CB   . ARG A 1 39 ? 4.881   -20.744 7.836   1.00 0.00 ? 39 ARG A CB   6  
ATOM 6292  C CG   . ARG A 1 39 ? 6.004   -21.736 8.090   1.00 0.00 ? 39 ARG A CG   6  
ATOM 6293  C CD   . ARG A 1 39 ? 6.870   -21.309 9.265   1.00 0.00 ? 39 ARG A CD   6  
ATOM 6294  N NE   . ARG A 1 39 ? 6.379   -21.848 10.531  1.00 0.00 ? 39 ARG A NE   6  
ATOM 6295  C CZ   . ARG A 1 39 ? 5.430   -21.269 11.257  1.00 0.00 ? 39 ARG A CZ   6  
ATOM 6296  N NH1  . ARG A 1 39 ? 4.872   -20.138 10.846  1.00 0.00 ? 39 ARG A NH1  6  
ATOM 6297  N NH2  . ARG A 1 39 ? 5.037   -21.820 12.399  1.00 0.00 ? 39 ARG A NH2  6  
ATOM 6298  H H    . ARG A 1 39 ? 6.341   -20.167 5.828   1.00 0.00 ? 39 ARG A H    6  
ATOM 6299  H HA   . ARG A 1 39 ? 3.962   -21.706 6.160   1.00 0.00 ? 39 ARG A HA   6  
ATOM 6300  H HB2  . ARG A 1 39 ? 5.240   -19.756 8.085   1.00 0.00 ? 39 ARG A HB2  6  
ATOM 6301  H HB3  . ARG A 1 39 ? 4.056   -20.993 8.487   1.00 0.00 ? 39 ARG A HB3  6  
ATOM 6302  H HG2  . ARG A 1 39 ? 5.575   -22.704 8.306   1.00 0.00 ? 39 ARG A HG2  6  
ATOM 6303  H HG3  . ARG A 1 39 ? 6.620   -21.802 7.205   1.00 0.00 ? 39 ARG A HG3  6  
ATOM 6304  H HD2  . ARG A 1 39 ? 7.877   -21.663 9.100   1.00 0.00 ? 39 ARG A HD2  6  
ATOM 6305  H HD3  . ARG A 1 39 ? 6.872   -20.231 9.320   1.00 0.00 ? 39 ARG A HD3  6  
ATOM 6306  H HE   . ARG A 1 39 ? 6.778   -22.682 10.854  1.00 0.00 ? 39 ARG A HE   6  
ATOM 6307  H HH11 . ARG A 1 39 ? 5.166   -19.721 9.986   1.00 0.00 ? 39 ARG A HH11 6  
ATOM 6308  H HH12 . ARG A 1 39 ? 4.157   -19.705 11.394  1.00 0.00 ? 39 ARG A HH12 6  
ATOM 6309  H HH21 . ARG A 1 39 ? 5.455   -22.672 12.712  1.00 0.00 ? 39 ARG A HH21 6  
ATOM 6310  H HH22 . ARG A 1 39 ? 4.323   -21.383 12.945  1.00 0.00 ? 39 ARG A HH22 6  
ATOM 6311  N N    . LEU A 1 40 ? 3.714   -18.417 6.172   1.00 0.00 ? 40 LEU A N    6  
ATOM 6312  C CA   . LEU A 1 40 ? 2.780   -17.309 6.011   1.00 0.00 ? 40 LEU A CA   6  
ATOM 6313  C C    . LEU A 1 40 ? 1.816   -17.573 4.859   1.00 0.00 ? 40 LEU A C    6  
ATOM 6314  O O    . LEU A 1 40 ? 0.600   -17.464 5.017   1.00 0.00 ? 40 LEU A O    6  
ATOM 6315  C CB   . LEU A 1 40 ? 3.541   -16.005 5.766   1.00 0.00 ? 40 LEU A CB   6  
ATOM 6316  C CG   . LEU A 1 40 ? 2.742   -14.715 5.957   1.00 0.00 ? 40 LEU A CG   6  
ATOM 6317  C CD1  . LEU A 1 40 ? 2.365   -14.532 7.419   1.00 0.00 ? 40 LEU A CD1  6  
ATOM 6318  C CD2  . LEU A 1 40 ? 3.535   -13.518 5.454   1.00 0.00 ? 40 LEU A CD2  6  
ATOM 6319  H H    . LEU A 1 40 ? 4.672   -18.226 6.248   1.00 0.00 ? 40 LEU A H    6  
ATOM 6320  H HA   . LEU A 1 40 ? 2.212   -17.219 6.926   1.00 0.00 ? 40 LEU A HA   6  
ATOM 6321  H HB2  . LEU A 1 40 ? 4.378   -15.979 6.447   1.00 0.00 ? 40 LEU A HB2  6  
ATOM 6322  H HB3  . LEU A 1 40 ? 3.906   -16.023 4.749   1.00 0.00 ? 40 LEU A HB3  6  
ATOM 6323  H HG   . LEU A 1 40 ? 1.828   -14.778 5.382   1.00 0.00 ? 40 LEU A HG   6  
ATOM 6324  H HD11 . LEU A 1 40 ? 3.260   -14.524 8.023   1.00 0.00 ? 40 LEU A HD11 6  
ATOM 6325  H HD12 . LEU A 1 40 ? 1.727   -15.345 7.731   1.00 0.00 ? 40 LEU A HD12 6  
ATOM 6326  H HD13 . LEU A 1 40 ? 1.840   -13.596 7.540   1.00 0.00 ? 40 LEU A HD13 6  
ATOM 6327  H HD21 . LEU A 1 40 ? 4.336   -13.860 4.816   1.00 0.00 ? 40 LEU A HD21 6  
ATOM 6328  H HD22 . LEU A 1 40 ? 3.949   -12.981 6.295   1.00 0.00 ? 40 LEU A HD22 6  
ATOM 6329  H HD23 . LEU A 1 40 ? 2.883   -12.864 4.894   1.00 0.00 ? 40 LEU A HD23 6  
ATOM 6330  N N    . ALA A 1 41 ? 2.367   -17.921 3.701   1.00 0.00 ? 41 ALA A N    6  
ATOM 6331  C CA   . ALA A 1 41 ? 1.556   -18.205 2.524   1.00 0.00 ? 41 ALA A CA   6  
ATOM 6332  C C    . ALA A 1 41 ? 0.485   -19.245 2.832   1.00 0.00 ? 41 ALA A C    6  
ATOM 6333  O O    . ALA A 1 41 ? -0.541  -19.315 2.155   1.00 0.00 ? 41 ALA A O    6  
ATOM 6334  C CB   . ALA A 1 41 ? 2.438   -18.677 1.377   1.00 0.00 ? 41 ALA A CB   6  
ATOM 6335  H H    . ALA A 1 41 ? 3.342   -17.991 3.638   1.00 0.00 ? 41 ALA A H    6  
ATOM 6336  H HA   . ALA A 1 41 ? 1.075   -17.286 2.221   1.00 0.00 ? 41 ALA A HA   6  
ATOM 6337  H HB1  . ALA A 1 41 ? 3.459   -18.761 1.720   1.00 0.00 ? 41 ALA A HB1  6  
ATOM 6338  H HB2  . ALA A 1 41 ? 2.093   -19.640 1.031   1.00 0.00 ? 41 ALA A HB2  6  
ATOM 6339  H HB3  . ALA A 1 41 ? 2.387   -17.964 0.568   1.00 0.00 ? 41 ALA A HB3  6  
ATOM 6340  N N    . LYS A 1 42 ? 0.728   -20.052 3.859   1.00 0.00 ? 42 LYS A N    6  
ATOM 6341  C CA   . LYS A 1 42 ? -0.215  -21.089 4.259   1.00 0.00 ? 42 LYS A CA   6  
ATOM 6342  C C    . LYS A 1 42 ? -1.194  -20.560 5.303   1.00 0.00 ? 42 LYS A C    6  
ATOM 6343  O O    . LYS A 1 42 ? -2.326  -21.034 5.401   1.00 0.00 ? 42 LYS A O    6  
ATOM 6344  C CB   . LYS A 1 42 ? 0.533   -22.302 4.815   1.00 0.00 ? 42 LYS A CB   6  
ATOM 6345  C CG   . LYS A 1 42 ? -0.373  -23.325 5.478   1.00 0.00 ? 42 LYS A CG   6  
ATOM 6346  C CD   . LYS A 1 42 ? -1.107  -24.169 4.449   1.00 0.00 ? 42 LYS A CD   6  
ATOM 6347  C CE   . LYS A 1 42 ? -2.256  -24.941 5.079   1.00 0.00 ? 42 LYS A CE   6  
ATOM 6348  N NZ   . LYS A 1 42 ? -1.772  -26.101 5.878   1.00 0.00 ? 42 LYS A NZ   6  
ATOM 6349  H H    . LYS A 1 42 ? 1.564   -19.947 4.361   1.00 0.00 ? 42 LYS A H    6  
ATOM 6350  H HA   . LYS A 1 42 ? -0.769  -21.389 3.383   1.00 0.00 ? 42 LYS A HA   6  
ATOM 6351  H HB2  . LYS A 1 42 ? 1.059   -22.788 4.006   1.00 0.00 ? 42 LYS A HB2  6  
ATOM 6352  H HB3  . LYS A 1 42 ? 1.252   -21.962 5.547   1.00 0.00 ? 42 LYS A HB3  6  
ATOM 6353  H HG2  . LYS A 1 42 ? 0.226   -23.975 6.099   1.00 0.00 ? 42 LYS A HG2  6  
ATOM 6354  H HG3  . LYS A 1 42 ? -1.098  -22.807 6.089   1.00 0.00 ? 42 LYS A HG3  6  
ATOM 6355  H HD2  . LYS A 1 42 ? -1.502  -23.522 3.680   1.00 0.00 ? 42 LYS A HD2  6  
ATOM 6356  H HD3  . LYS A 1 42 ? -0.411  -24.870 4.009   1.00 0.00 ? 42 LYS A HD3  6  
ATOM 6357  H HE2  . LYS A 1 42 ? -2.808  -24.276 5.724   1.00 0.00 ? 42 LYS A HE2  6  
ATOM 6358  H HE3  . LYS A 1 42 ? -2.904  -25.301 4.293   1.00 0.00 ? 42 LYS A HE3  6  
ATOM 6359  H HZ1  . LYS A 1 42 ? -0.740  -26.191 5.789   1.00 0.00 ? 42 LYS A HZ1  6  
ATOM 6360  H HZ2  . LYS A 1 42 ? -2.215  -26.979 5.539   1.00 0.00 ? 42 LYS A HZ2  6  
ATOM 6361  H HZ3  . LYS A 1 42 ? -2.013  -25.969 6.881   1.00 0.00 ? 42 LYS A HZ3  6  
ATOM 6362  N N    . MET A 1 43 ? -0.751  -19.576 6.078   1.00 0.00 ? 43 MET A N    6  
ATOM 6363  C CA   . MET A 1 43 ? -1.590  -18.982 7.112   1.00 0.00 ? 43 MET A CA   6  
ATOM 6364  C C    . MET A 1 43 ? -2.609  -18.024 6.502   1.00 0.00 ? 43 MET A C    6  
ATOM 6365  O O    . MET A 1 43 ? -3.791  -18.057 6.847   1.00 0.00 ? 43 MET A O    6  
ATOM 6366  C CB   . MET A 1 43 ? -0.728  -18.243 8.137   1.00 0.00 ? 43 MET A CB   6  
ATOM 6367  C CG   . MET A 1 43 ? -1.523  -17.327 9.053   1.00 0.00 ? 43 MET A CG   6  
ATOM 6368  S SD   . MET A 1 43 ? -0.760  -17.134 10.675  1.00 0.00 ? 43 MET A SD   6  
ATOM 6369  C CE   . MET A 1 43 ? -0.061  -15.492 10.528  1.00 0.00 ? 43 MET A CE   6  
ATOM 6370  H H    . MET A 1 43 ? 0.161   -19.240 5.952   1.00 0.00 ? 43 MET A H    6  
ATOM 6371  H HA   . MET A 1 43 ? -2.119  -19.781 7.610   1.00 0.00 ? 43 MET A HA   6  
ATOM 6372  H HB2  . MET A 1 43 ? -0.213  -18.969 8.748   1.00 0.00 ? 43 MET A HB2  6  
ATOM 6373  H HB3  . MET A 1 43 ? 0.002   -17.645 7.611   1.00 0.00 ? 43 MET A HB3  6  
ATOM 6374  H HG2  . MET A 1 43 ? -1.599  -16.354 8.590   1.00 0.00 ? 43 MET A HG2  6  
ATOM 6375  H HG3  . MET A 1 43 ? -2.512  -17.740 9.182   1.00 0.00 ? 43 MET A HG3  6  
ATOM 6376  H HE1  . MET A 1 43 ? 0.380   -15.374 9.550   1.00 0.00 ? 43 MET A HE1  6  
ATOM 6377  H HE2  . MET A 1 43 ? -0.840  -14.756 10.663  1.00 0.00 ? 43 MET A HE2  6  
ATOM 6378  H HE3  . MET A 1 43 ? 0.699   -15.355 11.284  1.00 0.00 ? 43 MET A HE3  6  
ATOM 6379  N N    . LEU A 1 44 ? -2.144  -17.172 5.596   1.00 0.00 ? 44 LEU A N    6  
ATOM 6380  C CA   . LEU A 1 44 ? -3.015  -16.204 4.938   1.00 0.00 ? 44 LEU A CA   6  
ATOM 6381  C C    . LEU A 1 44 ? -3.599  -16.782 3.653   1.00 0.00 ? 44 LEU A C    6  
ATOM 6382  O O    . LEU A 1 44 ? -4.289  -16.088 2.907   1.00 0.00 ? 44 LEU A O    6  
ATOM 6383  C CB   . LEU A 1 44 ? -2.242  -14.921 4.628   1.00 0.00 ? 44 LEU A CB   6  
ATOM 6384  C CG   . LEU A 1 44 ? -1.468  -14.305 5.794   1.00 0.00 ? 44 LEU A CG   6  
ATOM 6385  C CD1  . LEU A 1 44 ? -0.441  -13.306 5.285   1.00 0.00 ? 44 LEU A CD1  6  
ATOM 6386  C CD2  . LEU A 1 44 ? -2.422  -13.640 6.775   1.00 0.00 ? 44 LEU A CD2  6  
ATOM 6387  H H    . LEU A 1 44 ? -1.193  -17.193 5.363   1.00 0.00 ? 44 LEU A H    6  
ATOM 6388  H HA   . LEU A 1 44 ? -3.824  -15.973 5.614   1.00 0.00 ? 44 LEU A HA   6  
ATOM 6389  H HB2  . LEU A 1 44 ? -1.535  -15.142 3.842   1.00 0.00 ? 44 LEU A HB2  6  
ATOM 6390  H HB3  . LEU A 1 44 ? -2.951  -14.185 4.275   1.00 0.00 ? 44 LEU A HB3  6  
ATOM 6391  H HG   . LEU A 1 44 ? -0.938  -15.088 6.320   1.00 0.00 ? 44 LEU A HG   6  
ATOM 6392  H HD11 . LEU A 1 44 ? -0.946  -12.499 4.776   1.00 0.00 ? 44 LEU A HD11 6  
ATOM 6393  H HD12 . LEU A 1 44 ? 0.232   -13.799 4.599   1.00 0.00 ? 44 LEU A HD12 6  
ATOM 6394  H HD13 . LEU A 1 44 ? 0.121   -12.911 6.119   1.00 0.00 ? 44 LEU A HD13 6  
ATOM 6395  H HD21 . LEU A 1 44 ? -1.996  -12.707 7.114   1.00 0.00 ? 44 LEU A HD21 6  
ATOM 6396  H HD22 . LEU A 1 44 ? -2.579  -14.292 7.622   1.00 0.00 ? 44 LEU A HD22 6  
ATOM 6397  H HD23 . LEU A 1 44 ? -3.365  -13.449 6.286   1.00 0.00 ? 44 LEU A HD23 6  
ATOM 6398  N N    . GLN A 1 45 ? -3.318  -18.057 3.403   1.00 0.00 ? 45 GLN A N    6  
ATOM 6399  C CA   . GLN A 1 45 ? -3.818  -18.729 2.209   1.00 0.00 ? 45 GLN A CA   6  
ATOM 6400  C C    . GLN A 1 45 ? -3.260  -18.079 0.946   1.00 0.00 ? 45 GLN A C    6  
ATOM 6401  O O    . GLN A 1 45 ? -3.903  -18.088 -0.105  1.00 0.00 ? 45 GLN A O    6  
ATOM 6402  C CB   . GLN A 1 45 ? -5.347  -18.696 2.181   1.00 0.00 ? 45 GLN A CB   6  
ATOM 6403  C CG   . GLN A 1 45 ? -5.993  -19.837 2.950   1.00 0.00 ? 45 GLN A CG   6  
ATOM 6404  C CD   . GLN A 1 45 ? -7.499  -19.877 2.778   1.00 0.00 ? 45 GLN A CD   6  
ATOM 6405  O OE1  . GLN A 1 45 ? -8.122  -18.876 2.421   1.00 0.00 ? 45 GLN A OE1  6  
ATOM 6406  N NE2  . GLN A 1 45 ? -8.093  -21.037 3.030   1.00 0.00 ? 45 GLN A NE2  6  
ATOM 6407  H H    . GLN A 1 45 ? -2.763  -18.557 4.036   1.00 0.00 ? 45 GLN A H    6  
ATOM 6408  H HA   . GLN A 1 45 ? -3.489  -19.756 2.245   1.00 0.00 ? 45 GLN A HA   6  
ATOM 6409  H HB2  . GLN A 1 45 ? -5.683  -17.764 2.611   1.00 0.00 ? 45 GLN A HB2  6  
ATOM 6410  H HB3  . GLN A 1 45 ? -5.677  -18.750 1.154   1.00 0.00 ? 45 GLN A HB3  6  
ATOM 6411  H HG2  . GLN A 1 45 ? -5.582  -20.771 2.598   1.00 0.00 ? 45 GLN A HG2  6  
ATOM 6412  H HG3  . GLN A 1 45 ? -5.769  -19.719 4.000   1.00 0.00 ? 45 GLN A HG3  6  
ATOM 6413  H HE21 . GLN A 1 45 ? -7.534  -21.792 3.311   1.00 0.00 ? 45 GLN A HE21 6  
ATOM 6414  H HE22 . GLN A 1 45 ? -9.066  -21.091 2.928   1.00 0.00 ? 45 GLN A HE22 6  
ATOM 6415  N N    . LEU A 1 46 ? -2.062  -17.517 1.056   1.00 0.00 ? 46 LEU A N    6  
ATOM 6416  C CA   . LEU A 1 46 ? -1.418  -16.862 -0.077  1.00 0.00 ? 46 LEU A CA   6  
ATOM 6417  C C    . LEU A 1 46 ? -0.309  -17.737 -0.653  1.00 0.00 ? 46 LEU A C    6  
ATOM 6418  O O    . LEU A 1 46 ? -0.024  -18.816 -0.135  1.00 0.00 ? 46 LEU A O    6  
ATOM 6419  C CB   . LEU A 1 46 ? -0.846  -15.508 0.348   1.00 0.00 ? 46 LEU A CB   6  
ATOM 6420  C CG   . LEU A 1 46 ? -1.834  -14.535 0.990   1.00 0.00 ? 46 LEU A CG   6  
ATOM 6421  C CD1  . LEU A 1 46 ? -1.112  -13.292 1.488   1.00 0.00 ? 46 LEU A CD1  6  
ATOM 6422  C CD2  . LEU A 1 46 ? -2.929  -14.157 0.004   1.00 0.00 ? 46 LEU A CD2  6  
ATOM 6423  H H    . LEU A 1 46 ? -1.599  -17.542 1.918   1.00 0.00 ? 46 LEU A H    6  
ATOM 6424  H HA   . LEU A 1 46 ? -2.167  -16.704 -0.839  1.00 0.00 ? 46 LEU A HA   6  
ATOM 6425  H HB2  . LEU A 1 46 ? -0.054  -15.692 1.058   1.00 0.00 ? 46 LEU A HB2  6  
ATOM 6426  H HB3  . LEU A 1 46 ? -0.435  -15.033 -0.532  1.00 0.00 ? 46 LEU A HB3  6  
ATOM 6427  H HG   . LEU A 1 46 ? -2.300  -15.013 1.841   1.00 0.00 ? 46 LEU A HG   6  
ATOM 6428  H HD11 . LEU A 1 46 ? -0.050  -13.485 1.529   1.00 0.00 ? 46 LEU A HD11 6  
ATOM 6429  H HD12 . LEU A 1 46 ? -1.470  -13.039 2.475   1.00 0.00 ? 46 LEU A HD12 6  
ATOM 6430  H HD13 . LEU A 1 46 ? -1.304  -12.470 0.815   1.00 0.00 ? 46 LEU A HD13 6  
ATOM 6431  H HD21 . LEU A 1 46 ? -3.510  -13.340 0.406   1.00 0.00 ? 46 LEU A HD21 6  
ATOM 6432  H HD22 . LEU A 1 46 ? -3.573  -15.009 -0.162  1.00 0.00 ? 46 LEU A HD22 6  
ATOM 6433  H HD23 . LEU A 1 46 ? -2.483  -13.855 -0.932  1.00 0.00 ? 46 LEU A HD23 6  
ATOM 6434  N N    . SER A 1 47 ? 0.314   -17.263 -1.727  1.00 0.00 ? 47 SER A N    6  
ATOM 6435  C CA   . SER A 1 47 ? 1.391   -18.003 -2.375  1.00 0.00 ? 47 SER A CA   6  
ATOM 6436  C C    . SER A 1 47 ? 2.736   -17.320 -2.143  1.00 0.00 ? 47 SER A C    6  
ATOM 6437  O O    . SER A 1 47 ? 2.829   -16.093 -2.147  1.00 0.00 ? 47 SER A O    6  
ATOM 6438  C CB   . SER A 1 47 ? 1.122   -18.127 -3.876  1.00 0.00 ? 47 SER A CB   6  
ATOM 6439  O OG   . SER A 1 47 ? -0.032  -18.910 -4.124  1.00 0.00 ? 47 SER A OG   6  
ATOM 6440  H H    . SER A 1 47 ? 0.041   -16.396 -2.094  1.00 0.00 ? 47 SER A H    6  
ATOM 6441  H HA   . SER A 1 47 ? 1.423   -18.991 -1.940  1.00 0.00 ? 47 SER A HA   6  
ATOM 6442  H HB2  . SER A 1 47 ? 0.972   -17.144 -4.295  1.00 0.00 ? 47 SER A HB2  6  
ATOM 6443  H HB3  . SER A 1 47 ? 1.971   -18.596 -4.353  1.00 0.00 ? 47 SER A HB3  6  
ATOM 6444  H HG   . SER A 1 47 ? 0.005   -19.262 -5.017  1.00 0.00 ? 47 SER A HG   6  
ATOM 6445  N N    . GLU A 1 48 ? 3.774   -18.125 -1.940  1.00 0.00 ? 48 GLU A N    6  
ATOM 6446  C CA   . GLU A 1 48 ? 5.113   -17.598 -1.705  1.00 0.00 ? 48 GLU A CA   6  
ATOM 6447  C C    . GLU A 1 48 ? 5.396   -16.405 -2.613  1.00 0.00 ? 48 GLU A C    6  
ATOM 6448  O O    . GLU A 1 48 ? 6.009   -15.423 -2.194  1.00 0.00 ? 48 GLU A O    6  
ATOM 6449  C CB   . GLU A 1 48 ? 6.162   -18.689 -1.935  1.00 0.00 ? 48 GLU A CB   6  
ATOM 6450  C CG   . GLU A 1 48 ? 6.249   -19.698 -0.802  1.00 0.00 ? 48 GLU A CG   6  
ATOM 6451  C CD   . GLU A 1 48 ? 7.034   -20.937 -1.184  1.00 0.00 ? 48 GLU A CD   6  
ATOM 6452  O OE1  . GLU A 1 48 ? 6.563   -21.693 -2.059  1.00 0.00 ? 48 GLU A OE1  6  
ATOM 6453  O OE2  . GLU A 1 48 ? 8.121   -21.151 -0.607  1.00 0.00 ? 48 GLU A OE2  6  
ATOM 6454  H H    . GLU A 1 48 ? 3.636   -19.095 -1.948  1.00 0.00 ? 48 GLU A H    6  
ATOM 6455  H HA   . GLU A 1 48 ? 5.166   -17.273 -0.677  1.00 0.00 ? 48 GLU A HA   6  
ATOM 6456  H HB2  . GLU A 1 48 ? 5.919   -19.218 -2.844  1.00 0.00 ? 48 GLU A HB2  6  
ATOM 6457  H HB3  . GLU A 1 48 ? 7.129   -18.222 -2.048  1.00 0.00 ? 48 GLU A HB3  6  
ATOM 6458  H HG2  . GLU A 1 48 ? 6.731   -19.231 0.043   1.00 0.00 ? 48 GLU A HG2  6  
ATOM 6459  H HG3  . GLU A 1 48 ? 5.248   -19.995 -0.524  1.00 0.00 ? 48 GLU A HG3  6  
ATOM 6460  N N    . ARG A 1 49 ? 4.946   -16.499 -3.860  1.00 0.00 ? 49 ARG A N    6  
ATOM 6461  C CA   . ARG A 1 49 ? 5.152   -15.430 -4.830  1.00 0.00 ? 49 ARG A CA   6  
ATOM 6462  C C    . ARG A 1 49 ? 4.411   -14.164 -4.408  1.00 0.00 ? 49 ARG A C    6  
ATOM 6463  O O    . ARG A 1 49 ? 4.964   -13.066 -4.454  1.00 0.00 ? 49 ARG A O    6  
ATOM 6464  C CB   . ARG A 1 49 ? 4.682   -15.872 -6.216  1.00 0.00 ? 49 ARG A CB   6  
ATOM 6465  C CG   . ARG A 1 49 ? 5.270   -15.048 -7.350  1.00 0.00 ? 49 ARG A CG   6  
ATOM 6466  C CD   . ARG A 1 49 ? 6.758   -15.313 -7.517  1.00 0.00 ? 49 ARG A CD   6  
ATOM 6467  N NE   . ARG A 1 49 ? 7.032   -16.708 -7.853  1.00 0.00 ? 49 ARG A NE   6  
ATOM 6468  C CZ   . ARG A 1 49 ? 6.751   -17.248 -9.033  1.00 0.00 ? 49 ARG A CZ   6  
ATOM 6469  N NH1  . ARG A 1 49 ? 6.191   -16.515 -9.986  1.00 0.00 ? 49 ARG A NH1  6  
ATOM 6470  N NH2  . ARG A 1 49 ? 7.030   -18.525 -9.263  1.00 0.00 ? 49 ARG A NH2  6  
ATOM 6471  H H    . ARG A 1 49 ? 4.465   -17.307 -4.136  1.00 0.00 ? 49 ARG A H    6  
ATOM 6472  H HA   . ARG A 1 49 ? 6.210   -15.217 -4.869  1.00 0.00 ? 49 ARG A HA   6  
ATOM 6473  H HB2  . ARG A 1 49 ? 4.963   -16.904 -6.367  1.00 0.00 ? 49 ARG A HB2  6  
ATOM 6474  H HB3  . ARG A 1 49 ? 3.606   -15.790 -6.261  1.00 0.00 ? 49 ARG A HB3  6  
ATOM 6475  H HG2  . ARG A 1 49 ? 4.765   -15.305 -8.270  1.00 0.00 ? 49 ARG A HG2  6  
ATOM 6476  H HG3  . ARG A 1 49 ? 5.121   -14.000 -7.136  1.00 0.00 ? 49 ARG A HG3  6  
ATOM 6477  H HD2  . ARG A 1 49 ? 7.136   -14.682 -8.308  1.00 0.00 ? 49 ARG A HD2  6  
ATOM 6478  H HD3  . ARG A 1 49 ? 7.259   -15.069 -6.592  1.00 0.00 ? 49 ARG A HD3  6  
ATOM 6479  H HE   . ARG A 1 49 ? 7.445   -17.268 -7.163  1.00 0.00 ? 49 ARG A HE   6  
ATOM 6480  H HH11 . ARG A 1 49 ? 5.981   -15.553 -9.816  1.00 0.00 ? 49 ARG A HH11 6  
ATOM 6481  H HH12 . ARG A 1 49 ? 5.982   -16.924 -10.874 1.00 0.00 ? 49 ARG A HH12 6  
ATOM 6482  H HH21 . ARG A 1 49 ? 7.452   -19.081 -8.547  1.00 0.00 ? 49 ARG A HH21 6  
ATOM 6483  H HH22 . ARG A 1 49 ? 6.818   -18.931 -10.151 1.00 0.00 ? 49 ARG A HH22 6  
ATOM 6484  N N    . GLN A 1 50 ? 3.157   -14.328 -3.999  1.00 0.00 ? 50 GLN A N    6  
ATOM 6485  C CA   . GLN A 1 50 ? 2.340   -13.198 -3.571  1.00 0.00 ? 50 GLN A CA   6  
ATOM 6486  C C    . GLN A 1 50 ? 2.886   -12.589 -2.284  1.00 0.00 ? 50 GLN A C    6  
ATOM 6487  O O    . GLN A 1 50 ? 2.652   -11.416 -1.993  1.00 0.00 ? 50 GLN A O    6  
ATOM 6488  C CB   . GLN A 1 50 ? 0.890   -13.639 -3.367  1.00 0.00 ? 50 GLN A CB   6  
ATOM 6489  C CG   . GLN A 1 50 ? 0.091   -13.723 -4.657  1.00 0.00 ? 50 GLN A CG   6  
ATOM 6490  C CD   . GLN A 1 50 ? -1.334  -14.186 -4.433  1.00 0.00 ? 50 GLN A CD   6  
ATOM 6491  O OE1  . GLN A 1 50 ? -2.277  -13.399 -4.525  1.00 0.00 ? 50 GLN A OE1  6  
ATOM 6492  N NE2  . GLN A 1 50 ? -1.500  -15.470 -4.135  1.00 0.00 ? 50 GLN A NE2  6  
ATOM 6493  H H    . GLN A 1 50 ? 2.772   -15.228 -3.985  1.00 0.00 ? 50 GLN A H    6  
ATOM 6494  H HA   . GLN A 1 50 ? 2.373   -12.452 -4.350  1.00 0.00 ? 50 GLN A HA   6  
ATOM 6495  H HB2  . GLN A 1 50 ? 0.885   -14.613 -2.901  1.00 0.00 ? 50 GLN A HB2  6  
ATOM 6496  H HB3  . GLN A 1 50 ? 0.401   -12.933 -2.712  1.00 0.00 ? 50 GLN A HB3  6  
ATOM 6497  H HG2  . GLN A 1 50 ? 0.067   -12.745 -5.115  1.00 0.00 ? 50 GLN A HG2  6  
ATOM 6498  H HG3  . GLN A 1 50 ? 0.580   -14.419 -5.323  1.00 0.00 ? 50 GLN A HG3  6  
ATOM 6499  H HE21 . GLN A 1 50 ? -0.703  -16.037 -4.077  1.00 0.00 ? 50 GLN A HE21 6  
ATOM 6500  H HE22 . GLN A 1 50 ? -2.411  -15.796 -3.984  1.00 0.00 ? 50 GLN A HE22 6  
ATOM 6501  N N    . VAL A 1 51 ? 3.613   -13.393 -1.516  1.00 0.00 ? 51 VAL A N    6  
ATOM 6502  C CA   . VAL A 1 51 ? 4.193   -12.933 -0.260  1.00 0.00 ? 51 VAL A CA   6  
ATOM 6503  C C    . VAL A 1 51 ? 5.607   -12.403 -0.468  1.00 0.00 ? 51 VAL A C    6  
ATOM 6504  O O    . VAL A 1 51 ? 6.118   -11.630 0.342   1.00 0.00 ? 51 VAL A O    6  
ATOM 6505  C CB   . VAL A 1 51 ? 4.229   -14.061 0.788   1.00 0.00 ? 51 VAL A CB   6  
ATOM 6506  C CG1  . VAL A 1 51 ? 4.764   -13.542 2.114   1.00 0.00 ? 51 VAL A CG1  6  
ATOM 6507  C CG2  . VAL A 1 51 ? 2.845   -14.669 0.964   1.00 0.00 ? 51 VAL A CG2  6  
ATOM 6508  H H    . VAL A 1 51 ? 3.765   -14.319 -1.802  1.00 0.00 ? 51 VAL A H    6  
ATOM 6509  H HA   . VAL A 1 51 ? 3.572   -12.136 0.122   1.00 0.00 ? 51 VAL A HA   6  
ATOM 6510  H HB   . VAL A 1 51 ? 4.896   -14.833 0.434   1.00 0.00 ? 51 VAL A HB   6  
ATOM 6511  H HG11 . VAL A 1 51 ? 4.114   -12.763 2.484   1.00 0.00 ? 51 VAL A HG11 6  
ATOM 6512  H HG12 . VAL A 1 51 ? 4.802   -14.351 2.829   1.00 0.00 ? 51 VAL A HG12 6  
ATOM 6513  H HG13 . VAL A 1 51 ? 5.757   -13.142 1.969   1.00 0.00 ? 51 VAL A HG13 6  
ATOM 6514  H HG21 . VAL A 1 51 ? 2.818   -15.241 1.879   1.00 0.00 ? 51 VAL A HG21 6  
ATOM 6515  H HG22 . VAL A 1 51 ? 2.108   -13.881 1.010   1.00 0.00 ? 51 VAL A HG22 6  
ATOM 6516  H HG23 . VAL A 1 51 ? 2.627   -15.317 0.128   1.00 0.00 ? 51 VAL A HG23 6  
ATOM 6517  N N    . LYS A 1 52 ? 6.235   -12.824 -1.561  1.00 0.00 ? 52 LYS A N    6  
ATOM 6518  C CA   . LYS A 1 52 ? 7.591   -12.391 -1.879  1.00 0.00 ? 52 LYS A CA   6  
ATOM 6519  C C    . LYS A 1 52 ? 7.572   -11.145 -2.760  1.00 0.00 ? 52 LYS A C    6  
ATOM 6520  O O    . LYS A 1 52 ? 8.493   -10.330 -2.721  1.00 0.00 ? 52 LYS A O    6  
ATOM 6521  C CB   . LYS A 1 52 ? 8.355   -13.514 -2.583  1.00 0.00 ? 52 LYS A CB   6  
ATOM 6522  C CG   . LYS A 1 52 ? 8.214   -13.492 -4.095  1.00 0.00 ? 52 LYS A CG   6  
ATOM 6523  C CD   . LYS A 1 52 ? 9.298   -12.649 -4.744  1.00 0.00 ? 52 LYS A CD   6  
ATOM 6524  C CE   . LYS A 1 52 ? 9.588   -13.111 -6.164  1.00 0.00 ? 52 LYS A CE   6  
ATOM 6525  N NZ   . LYS A 1 52 ? 10.469  -14.311 -6.188  1.00 0.00 ? 52 LYS A NZ   6  
ATOM 6526  H H    . LYS A 1 52 ? 5.775   -13.440 -2.169  1.00 0.00 ? 52 LYS A H    6  
ATOM 6527  H HA   . LYS A 1 52 ? 8.089   -12.153 -0.952  1.00 0.00 ? 52 LYS A HA   6  
ATOM 6528  H HB2  . LYS A 1 52 ? 9.404   -13.428 -2.339  1.00 0.00 ? 52 LYS A HB2  6  
ATOM 6529  H HB3  . LYS A 1 52 ? 7.988   -14.464 -2.222  1.00 0.00 ? 52 LYS A HB3  6  
ATOM 6530  H HG2  . LYS A 1 52 ? 8.286   -14.502 -4.469  1.00 0.00 ? 52 LYS A HG2  6  
ATOM 6531  H HG3  . LYS A 1 52 ? 7.248   -13.079 -4.351  1.00 0.00 ? 52 LYS A HG3  6  
ATOM 6532  H HD2  . LYS A 1 52 ? 8.974   -11.619 -4.772  1.00 0.00 ? 52 LYS A HD2  6  
ATOM 6533  H HD3  . LYS A 1 52 ? 10.203  -12.728 -4.158  1.00 0.00 ? 52 LYS A HD3  6  
ATOM 6534  H HE2  . LYS A 1 52 ? 8.654   -13.350 -6.648  1.00 0.00 ? 52 LYS A HE2  6  
ATOM 6535  H HE3  . LYS A 1 52 ? 10.074  -12.307 -6.698  1.00 0.00 ? 52 LYS A HE3  6  
ATOM 6536  H HZ1  . LYS A 1 52 ? 10.144  -14.978 -6.918  1.00 0.00 ? 52 LYS A HZ1  6  
ATOM 6537  H HZ2  . LYS A 1 52 ? 10.446  -14.789 -5.265  1.00 0.00 ? 52 LYS A HZ2  6  
ATOM 6538  H HZ3  . LYS A 1 52 ? 11.448  -14.033 -6.399  1.00 0.00 ? 52 LYS A HZ3  6  
ATOM 6539  N N    . THR A 1 53 ? 6.514   -11.004 -3.554  1.00 0.00 ? 53 THR A N    6  
ATOM 6540  C CA   . THR A 1 53 ? 6.375   -9.858  -4.443  1.00 0.00 ? 53 THR A CA   6  
ATOM 6541  C C    . THR A 1 53 ? 5.797   -8.656  -3.706  1.00 0.00 ? 53 THR A C    6  
ATOM 6542  O O    . THR A 1 53 ? 6.340   -7.553  -3.775  1.00 0.00 ? 53 THR A O    6  
ATOM 6543  C CB   . THR A 1 53 ? 5.474   -10.188 -5.648  1.00 0.00 ? 53 THR A CB   6  
ATOM 6544  O OG1  . THR A 1 53 ? 6.126   -11.133 -6.504  1.00 0.00 ? 53 THR A OG1  6  
ATOM 6545  C CG2  . THR A 1 53 ? 5.139   -8.930  -6.435  1.00 0.00 ? 53 THR A CG2  6  
ATOM 6546  H H    . THR A 1 53 ? 5.813   -11.687 -3.540  1.00 0.00 ? 53 THR A H    6  
ATOM 6547  H HA   . THR A 1 53 ? 7.357   -9.602  -4.815  1.00 0.00 ? 53 THR A HA   6  
ATOM 6548  H HB   . THR A 1 53 ? 4.554   -10.622 -5.282  1.00 0.00 ? 53 THR A HB   6  
ATOM 6549  H HG1  . THR A 1 53 ? 5.630   -11.220 -7.321  1.00 0.00 ? 53 THR A HG1  6  
ATOM 6550  H HG21 . THR A 1 53 ? 5.879   -8.171  -6.231  1.00 0.00 ? 53 THR A HG21 6  
ATOM 6551  H HG22 . THR A 1 53 ? 4.164   -8.571  -6.141  1.00 0.00 ? 53 THR A HG22 6  
ATOM 6552  H HG23 . THR A 1 53 ? 5.136   -9.156  -7.490  1.00 0.00 ? 53 THR A HG23 6  
ATOM 6553  N N    . TRP A 1 54 ? 4.694   -8.875  -2.999  1.00 0.00 ? 54 TRP A N    6  
ATOM 6554  C CA   . TRP A 1 54 ? 4.043   -7.809  -2.247  1.00 0.00 ? 54 TRP A CA   6  
ATOM 6555  C C    . TRP A 1 54 ? 5.056   -7.039  -1.407  1.00 0.00 ? 54 TRP A C    6  
ATOM 6556  O O    . TRP A 1 54 ? 5.227   -5.831  -1.575  1.00 0.00 ? 54 TRP A O    6  
ATOM 6557  C CB   . TRP A 1 54 ? 2.949   -8.385  -1.348  1.00 0.00 ? 54 TRP A CB   6  
ATOM 6558  C CG   . TRP A 1 54 ? 2.068   -7.337  -0.737  1.00 0.00 ? 54 TRP A CG   6  
ATOM 6559  C CD1  . TRP A 1 54 ? 0.867   -6.896  -1.215  1.00 0.00 ? 54 TRP A CD1  6  
ATOM 6560  C CD2  . TRP A 1 54 ? 2.320   -6.599  0.463   1.00 0.00 ? 54 TRP A CD2  6  
ATOM 6561  N NE1  . TRP A 1 54 ? 0.358   -5.927  -0.385  1.00 0.00 ? 54 TRP A NE1  6  
ATOM 6562  C CE2  . TRP A 1 54 ? 1.230   -5.727  0.653   1.00 0.00 ? 54 TRP A CE2  6  
ATOM 6563  C CE3  . TRP A 1 54 ? 3.360   -6.590  1.397   1.00 0.00 ? 54 TRP A CE3  6  
ATOM 6564  C CZ2  . TRP A 1 54 ? 1.153   -4.857  1.737   1.00 0.00 ? 54 TRP A CZ2  6  
ATOM 6565  C CZ3  . TRP A 1 54 ? 3.282   -5.726  2.472   1.00 0.00 ? 54 TRP A CZ3  6  
ATOM 6566  C CH2  . TRP A 1 54 ? 2.185   -4.870  2.636   1.00 0.00 ? 54 TRP A CH2  6  
ATOM 6567  H H    . TRP A 1 54 ? 4.308   -9.776  -2.983  1.00 0.00 ? 54 TRP A H    6  
ATOM 6568  H HA   . TRP A 1 54 ? 3.593   -7.131  -2.957  1.00 0.00 ? 54 TRP A HA   6  
ATOM 6569  H HB2  . TRP A 1 54 ? 2.325   -9.047  -1.929  1.00 0.00 ? 54 TRP A HB2  6  
ATOM 6570  H HB3  . TRP A 1 54 ? 3.410   -8.943  -0.545  1.00 0.00 ? 54 TRP A HB3  6  
ATOM 6571  H HD1  . TRP A 1 54 ? 0.400   -7.262  -2.117  1.00 0.00 ? 54 TRP A HD1  6  
ATOM 6572  H HE1  . TRP A 1 54 ? -0.493  -5.457  -0.514  1.00 0.00 ? 54 TRP A HE1  6  
ATOM 6573  H HE3  . TRP A 1 54 ? 4.214   -7.242  1.288   1.00 0.00 ? 54 TRP A HE3  6  
ATOM 6574  H HZ2  . TRP A 1 54 ? 0.314   -4.192  1.877   1.00 0.00 ? 54 TRP A HZ2  6  
ATOM 6575  H HZ3  . TRP A 1 54 ? 4.076   -5.705  3.204   1.00 0.00 ? 54 TRP A HZ3  6  
ATOM 6576  H HH2  . TRP A 1 54 ? 2.166   -4.211  3.490   1.00 0.00 ? 54 TRP A HH2  6  
ATOM 6577  N N    . PHE A 1 55 ? 5.726   -7.745  -0.501  1.00 0.00 ? 55 PHE A N    6  
ATOM 6578  C CA   . PHE A 1 55 ? 6.721   -7.126  0.366   1.00 0.00 ? 55 PHE A CA   6  
ATOM 6579  C C    . PHE A 1 55 ? 7.757   -6.362  -0.453  1.00 0.00 ? 55 PHE A C    6  
ATOM 6580  O O    . PHE A 1 55 ? 7.922   -5.153  -0.291  1.00 0.00 ? 55 PHE A O    6  
ATOM 6581  C CB   . PHE A 1 55 ? 7.414   -8.190  1.221   1.00 0.00 ? 55 PHE A CB   6  
ATOM 6582  C CG   . PHE A 1 55 ? 6.590   -8.651  2.388   1.00 0.00 ? 55 PHE A CG   6  
ATOM 6583  C CD1  . PHE A 1 55 ? 5.462   -9.432  2.191   1.00 0.00 ? 55 PHE A CD1  6  
ATOM 6584  C CD2  . PHE A 1 55 ? 6.942   -8.304  3.683   1.00 0.00 ? 55 PHE A CD2  6  
ATOM 6585  C CE1  . PHE A 1 55 ? 4.701   -9.859  3.263   1.00 0.00 ? 55 PHE A CE1  6  
ATOM 6586  C CE2  . PHE A 1 55 ? 6.185   -8.728  4.759   1.00 0.00 ? 55 PHE A CE2  6  
ATOM 6587  C CZ   . PHE A 1 55 ? 5.062   -9.506  4.549   1.00 0.00 ? 55 PHE A CZ   6  
ATOM 6588  H H    . PHE A 1 55 ? 5.545   -8.704  -0.414  1.00 0.00 ? 55 PHE A H    6  
ATOM 6589  H HA   . PHE A 1 55 ? 6.210   -6.432  1.015   1.00 0.00 ? 55 PHE A HA   6  
ATOM 6590  H HB2  . PHE A 1 55 ? 7.630   -9.051  0.607   1.00 0.00 ? 55 PHE A HB2  6  
ATOM 6591  H HB3  . PHE A 1 55 ? 8.339   -7.786  1.605   1.00 0.00 ? 55 PHE A HB3  6  
ATOM 6592  H HD1  . PHE A 1 55 ? 5.178   -9.709  1.186   1.00 0.00 ? 55 PHE A HD1  6  
ATOM 6593  H HD2  . PHE A 1 55 ? 7.818   -7.695  3.849   1.00 0.00 ? 55 PHE A HD2  6  
ATOM 6594  H HE1  . PHE A 1 55 ? 3.824   -10.467 3.095   1.00 0.00 ? 55 PHE A HE1  6  
ATOM 6595  H HE2  . PHE A 1 55 ? 6.469   -8.450  5.763   1.00 0.00 ? 55 PHE A HE2  6  
ATOM 6596  H HZ   . PHE A 1 55 ? 4.470   -9.839  5.387   1.00 0.00 ? 55 PHE A HZ   6  
ATOM 6597  N N    . GLN A 1 56 ? 8.452   -7.077  -1.332  1.00 0.00 ? 56 GLN A N    6  
ATOM 6598  C CA   . GLN A 1 56 ? 9.473   -6.466  -2.176  1.00 0.00 ? 56 GLN A CA   6  
ATOM 6599  C C    . GLN A 1 56 ? 9.014   -5.104  -2.686  1.00 0.00 ? 56 GLN A C    6  
ATOM 6600  O O    . GLN A 1 56 ? 9.655   -4.086  -2.429  1.00 0.00 ? 56 GLN A O    6  
ATOM 6601  C CB   . GLN A 1 56 ? 9.804   -7.382  -3.356  1.00 0.00 ? 56 GLN A CB   6  
ATOM 6602  C CG   . GLN A 1 56 ? 10.891  -8.399  -3.050  1.00 0.00 ? 56 GLN A CG   6  
ATOM 6603  C CD   . GLN A 1 56 ? 11.610  -8.877  -4.296  1.00 0.00 ? 56 GLN A CD   6  
ATOM 6604  O OE1  . GLN A 1 56 ? 11.186  -9.835  -4.943  1.00 0.00 ? 56 GLN A OE1  6  
ATOM 6605  N NE2  . GLN A 1 56 ? 12.705  -8.209  -4.640  1.00 0.00 ? 56 GLN A NE2  6  
ATOM 6606  H H    . GLN A 1 56 ? 8.275   -8.036  -1.414  1.00 0.00 ? 56 GLN A H    6  
ATOM 6607  H HA   . GLN A 1 56 ? 10.361  -6.331  -1.577  1.00 0.00 ? 56 GLN A HA   6  
ATOM 6608  H HB2  . GLN A 1 56 ? 8.910   -7.916  -3.643  1.00 0.00 ? 56 GLN A HB2  6  
ATOM 6609  H HB3  . GLN A 1 56 ? 10.133  -6.774  -4.186  1.00 0.00 ? 56 GLN A HB3  6  
ATOM 6610  H HG2  . GLN A 1 56 ? 11.613  -7.947  -2.387  1.00 0.00 ? 56 GLN A HG2  6  
ATOM 6611  H HG3  . GLN A 1 56 ? 10.440  -9.252  -2.563  1.00 0.00 ? 56 GLN A HG3  6  
ATOM 6612  H HE21 . GLN A 1 56 ? 12.984  -7.457  -4.077  1.00 0.00 ? 56 GLN A HE21 6  
ATOM 6613  H HE22 . GLN A 1 56 ? 13.190  -8.497  -5.441  1.00 0.00 ? 56 GLN A HE22 6  
ATOM 6614  N N    . ASN A 1 57 ? 7.900   -5.094  -3.411  1.00 0.00 ? 57 ASN A N    6  
ATOM 6615  C CA   . ASN A 1 57 ? 7.356   -3.857  -3.959  1.00 0.00 ? 57 ASN A CA   6  
ATOM 6616  C C    . ASN A 1 57 ? 7.031   -2.866  -2.846  1.00 0.00 ? 57 ASN A C    6  
ATOM 6617  O O    . ASN A 1 57 ? 7.153   -1.654  -3.025  1.00 0.00 ? 57 ASN A O    6  
ATOM 6618  C CB   . ASN A 1 57 ? 6.099   -4.149  -4.781  1.00 0.00 ? 57 ASN A CB   6  
ATOM 6619  C CG   . ASN A 1 57 ? 6.417   -4.486  -6.225  1.00 0.00 ? 57 ASN A CG   6  
ATOM 6620  O OD1  . ASN A 1 57 ? 7.470   -4.114  -6.743  1.00 0.00 ? 57 ASN A OD1  6  
ATOM 6621  N ND2  . ASN A 1 57 ? 5.505   -5.193  -6.882  1.00 0.00 ? 57 ASN A ND2  6  
ATOM 6622  H H    . ASN A 1 57 ? 7.433   -5.939  -3.583  1.00 0.00 ? 57 ASN A H    6  
ATOM 6623  H HA   . ASN A 1 57 ? 8.104   -3.423  -4.605  1.00 0.00 ? 57 ASN A HA   6  
ATOM 6624  H HB2  . ASN A 1 57 ? 5.576   -4.987  -4.343  1.00 0.00 ? 57 ASN A HB2  6  
ATOM 6625  H HB3  . ASN A 1 57 ? 5.456   -3.281  -4.766  1.00 0.00 ? 57 ASN A HB3  6  
ATOM 6626  H HD21 . ASN A 1 57 ? 4.690   -5.455  -6.405  1.00 0.00 ? 57 ASN A HD21 6  
ATOM 6627  H HD22 . ASN A 1 57 ? 5.686   -5.426  -7.817  1.00 0.00 ? 57 ASN A HD22 6  
ATOM 6628  N N    . ARG A 1 58 ? 6.616   -3.390  -1.697  1.00 0.00 ? 58 ARG A N    6  
ATOM 6629  C CA   . ARG A 1 58 ? 6.273   -2.552  -0.555  1.00 0.00 ? 58 ARG A CA   6  
ATOM 6630  C C    . ARG A 1 58 ? 7.452   -1.671  -0.153  1.00 0.00 ? 58 ARG A C    6  
ATOM 6631  O O    . ARG A 1 58 ? 7.365   -0.443  -0.195  1.00 0.00 ? 58 ARG A O    6  
ATOM 6632  C CB   . ARG A 1 58 ? 5.843   -3.419  0.630   1.00 0.00 ? 58 ARG A CB   6  
ATOM 6633  C CG   . ARG A 1 58 ? 5.121   -2.645  1.721   1.00 0.00 ? 58 ARG A CG   6  
ATOM 6634  C CD   . ARG A 1 58 ? 3.992   -1.801  1.150   1.00 0.00 ? 58 ARG A CD   6  
ATOM 6635  N NE   . ARG A 1 58 ? 3.175   -2.549  0.199   1.00 0.00 ? 58 ARG A NE   6  
ATOM 6636  C CZ   . ARG A 1 58 ? 2.262   -1.989  -0.586  1.00 0.00 ? 58 ARG A CZ   6  
ATOM 6637  N NH1  . ARG A 1 58 ? 2.049   -0.682  -0.533  1.00 0.00 ? 58 ARG A NH1  6  
ATOM 6638  N NH2  . ARG A 1 58 ? 1.558   -2.738  -1.426  1.00 0.00 ? 58 ARG A NH2  6  
ATOM 6639  H H    . ARG A 1 58 ? 6.539   -4.364  -1.616  1.00 0.00 ? 58 ARG A H    6  
ATOM 6640  H HA   . ARG A 1 58 ? 5.448   -1.919  -0.844  1.00 0.00 ? 58 ARG A HA   6  
ATOM 6641  H HB2  . ARG A 1 58 ? 5.183   -4.195  0.273   1.00 0.00 ? 58 ARG A HB2  6  
ATOM 6642  H HB3  . ARG A 1 58 ? 6.721   -3.875  1.064   1.00 0.00 ? 58 ARG A HB3  6  
ATOM 6643  H HG2  . ARG A 1 58 ? 4.707   -3.344  2.432   1.00 0.00 ? 58 ARG A HG2  6  
ATOM 6644  H HG3  . ARG A 1 58 ? 5.827   -1.997  2.218   1.00 0.00 ? 58 ARG A HG3  6  
ATOM 6645  H HD2  . ARG A 1 58 ? 3.365   -1.465  1.962   1.00 0.00 ? 58 ARG A HD2  6  
ATOM 6646  H HD3  . ARG A 1 58 ? 4.419   -0.945  0.649   1.00 0.00 ? 58 ARG A HD3  6  
ATOM 6647  H HE   . ARG A 1 58 ? 3.316   -3.517  0.143   1.00 0.00 ? 58 ARG A HE   6  
ATOM 6648  H HH11 . ARG A 1 58 ? 2.579   -0.115  0.098   1.00 0.00 ? 58 ARG A HH11 6  
ATOM 6649  H HH12 . ARG A 1 58 ? 1.362   -0.262  -1.126  1.00 0.00 ? 58 ARG A HH12 6  
ATOM 6650  H HH21 . ARG A 1 58 ? 1.716   -3.724  -1.469  1.00 0.00 ? 58 ARG A HH21 6  
ATOM 6651  H HH22 . ARG A 1 58 ? 0.871   -2.315  -2.016  1.00 0.00 ? 58 ARG A HH22 6  
ATOM 6652  N N    . ARG A 1 59 ? 8.553   -2.306  0.236   1.00 0.00 ? 59 ARG A N    6  
ATOM 6653  C CA   . ARG A 1 59 ? 9.749   -1.580  0.647   1.00 0.00 ? 59 ARG A CA   6  
ATOM 6654  C C    . ARG A 1 59 ? 9.997   -0.381  -0.264  1.00 0.00 ? 59 ARG A C    6  
ATOM 6655  O O    . ARG A 1 59 ? 10.039  0.761   0.193   1.00 0.00 ? 59 ARG A O    6  
ATOM 6656  C CB   . ARG A 1 59 ? 10.965  -2.507  0.630   1.00 0.00 ? 59 ARG A CB   6  
ATOM 6657  C CG   . ARG A 1 59 ? 12.040  -2.120  1.633   1.00 0.00 ? 59 ARG A CG   6  
ATOM 6658  C CD   . ARG A 1 59 ? 13.415  -2.593  1.186   1.00 0.00 ? 59 ARG A CD   6  
ATOM 6659  N NE   . ARG A 1 59 ? 14.486  -1.798  1.780   1.00 0.00 ? 59 ARG A NE   6  
ATOM 6660  C CZ   . ARG A 1 59 ? 15.705  -1.702  1.260   1.00 0.00 ? 59 ARG A CZ   6  
ATOM 6661  N NH1  . ARG A 1 59 ? 16.005  -2.348  0.142   1.00 0.00 ? 59 ARG A NH1  6  
ATOM 6662  N NH2  . ARG A 1 59 ? 16.627  -0.959  1.859   1.00 0.00 ? 59 ARG A NH2  6  
ATOM 6663  H H    . ARG A 1 59 ? 8.561   -3.286  0.248   1.00 0.00 ? 59 ARG A H    6  
ATOM 6664  H HA   . ARG A 1 59 ? 9.592   -1.225  1.654   1.00 0.00 ? 59 ARG A HA   6  
ATOM 6665  H HB2  . ARG A 1 59 ? 10.640  -3.513  0.855   1.00 0.00 ? 59 ARG A HB2  6  
ATOM 6666  H HB3  . ARG A 1 59 ? 11.402  -2.491  -0.357  1.00 0.00 ? 59 ARG A HB3  6  
ATOM 6667  H HG2  . ARG A 1 59 ? 12.056  -1.045  1.732   1.00 0.00 ? 59 ARG A HG2  6  
ATOM 6668  H HG3  . ARG A 1 59 ? 11.807  -2.569  2.587   1.00 0.00 ? 59 ARG A HG3  6  
ATOM 6669  H HD2  . ARG A 1 59 ? 13.539  -3.624  1.480   1.00 0.00 ? 59 ARG A HD2  6  
ATOM 6670  H HD3  . ARG A 1 59 ? 13.475  -2.515  0.111   1.00 0.00 ? 59 ARG A HD3  6  
ATOM 6671  H HE   . ARG A 1 59 ? 14.287  -1.312  2.607   1.00 0.00 ? 59 ARG A HE   6  
ATOM 6672  H HH11 . ARG A 1 59 ? 15.312  -2.908  -0.312  1.00 0.00 ? 59 ARG A HH11 6  
ATOM 6673  H HH12 . ARG A 1 59 ? 16.923  -2.274  -0.248  1.00 0.00 ? 59 ARG A HH12 6  
ATOM 6674  H HH21 . ARG A 1 59 ? 16.404  -0.470  2.702   1.00 0.00 ? 59 ARG A HH21 6  
ATOM 6675  H HH22 . ARG A 1 59 ? 17.544  -0.888  1.467   1.00 0.00 ? 59 ARG A HH22 6  
ATOM 6676  N N    . ALA A 1 60 ? 10.162  -0.650  -1.555  1.00 0.00 ? 60 ALA A N    6  
ATOM 6677  C CA   . ALA A 1 60 ? 10.405  0.406   -2.530  1.00 0.00 ? 60 ALA A CA   6  
ATOM 6678  C C    . ALA A 1 60 ? 9.504   1.609   -2.273  1.00 0.00 ? 60 ALA A C    6  
ATOM 6679  O O    . ALA A 1 60 ? 9.925   2.756   -2.419  1.00 0.00 ? 60 ALA A O    6  
ATOM 6680  C CB   . ALA A 1 60 ? 10.195  -0.121  -3.942  1.00 0.00 ? 60 ALA A CB   6  
ATOM 6681  H H    . ALA A 1 60 ? 10.119  -1.580  -1.859  1.00 0.00 ? 60 ALA A H    6  
ATOM 6682  H HA   . ALA A 1 60 ? 11.436  0.715   -2.438  1.00 0.00 ? 60 ALA A HA   6  
ATOM 6683  H HB1  . ALA A 1 60 ? 10.103  0.710   -4.625  1.00 0.00 ? 60 ALA A HB1  6  
ATOM 6684  H HB2  . ALA A 1 60 ? 11.039  -0.731  -4.228  1.00 0.00 ? 60 ALA A HB2  6  
ATOM 6685  H HB3  . ALA A 1 60 ? 9.294   -0.715  -3.974  1.00 0.00 ? 60 ALA A HB3  6  
ATOM 6686  N N    . LYS A 1 61 ? 8.261   1.339   -1.889  1.00 0.00 ? 61 LYS A N    6  
ATOM 6687  C CA   . LYS A 1 61 ? 7.299   2.399   -1.610  1.00 0.00 ? 61 LYS A CA   6  
ATOM 6688  C C    . LYS A 1 61 ? 7.544   3.008   -0.233  1.00 0.00 ? 61 LYS A C    6  
ATOM 6689  O O    . LYS A 1 61 ? 7.482   4.225   -0.063  1.00 0.00 ? 61 LYS A O    6  
ATOM 6690  C CB   . LYS A 1 61 ? 5.871   1.854   -1.692  1.00 0.00 ? 61 LYS A CB   6  
ATOM 6691  C CG   . LYS A 1 61 ? 5.285   1.893   -3.093  1.00 0.00 ? 61 LYS A CG   6  
ATOM 6692  C CD   . LYS A 1 61 ? 3.765   1.877   -3.062  1.00 0.00 ? 61 LYS A CD   6  
ATOM 6693  C CE   . LYS A 1 61 ? 3.195   3.287   -3.016  1.00 0.00 ? 61 LYS A CE   6  
ATOM 6694  N NZ   . LYS A 1 61 ? 3.011   3.765   -1.618  1.00 0.00 ? 61 LYS A NZ   6  
ATOM 6695  H H    . LYS A 1 61 ? 7.983   0.404   -1.790  1.00 0.00 ? 61 LYS A H    6  
ATOM 6696  H HA   . LYS A 1 61 ? 7.425   3.167   -2.358  1.00 0.00 ? 61 LYS A HA   6  
ATOM 6697  H HB2  . LYS A 1 61 ? 5.869   0.829   -1.352  1.00 0.00 ? 61 LYS A HB2  6  
ATOM 6698  H HB3  . LYS A 1 61 ? 5.237   2.441   -1.043  1.00 0.00 ? 61 LYS A HB3  6  
ATOM 6699  H HG2  . LYS A 1 61 ? 5.615   2.794   -3.587  1.00 0.00 ? 61 LYS A HG2  6  
ATOM 6700  H HG3  . LYS A 1 61 ? 5.633   1.030   -3.643  1.00 0.00 ? 61 LYS A HG3  6  
ATOM 6701  H HD2  . LYS A 1 61 ? 3.401   1.382   -3.950  1.00 0.00 ? 61 LYS A HD2  6  
ATOM 6702  H HD3  . LYS A 1 61 ? 3.437   1.337   -2.185  1.00 0.00 ? 61 LYS A HD3  6  
ATOM 6703  H HE2  . LYS A 1 61 ? 3.872   3.952   -3.529  1.00 0.00 ? 61 LYS A HE2  6  
ATOM 6704  H HE3  . LYS A 1 61 ? 2.238   3.290   -3.517  1.00 0.00 ? 61 LYS A HE3  6  
ATOM 6705  H HZ1  . LYS A 1 61 ? 3.930   3.816   -1.134  1.00 0.00 ? 61 LYS A HZ1  6  
ATOM 6706  H HZ2  . LYS A 1 61 ? 2.393   3.113   -1.095  1.00 0.00 ? 61 LYS A HZ2  6  
ATOM 6707  H HZ3  . LYS A 1 61 ? 2.578   4.711   -1.618  1.00 0.00 ? 61 LYS A HZ3  6  
ATOM 6708  N N    . TRP A 1 62 ? 7.823   2.154   0.745   1.00 0.00 ? 62 TRP A N    6  
ATOM 6709  C CA   . TRP A 1 62 ? 8.079   2.609   2.107   1.00 0.00 ? 62 TRP A CA   6  
ATOM 6710  C C    . TRP A 1 62 ? 9.267   3.563   2.147   1.00 0.00 ? 62 TRP A C    6  
ATOM 6711  O O    . TRP A 1 62 ? 9.324   4.462   2.987   1.00 0.00 ? 62 TRP A O    6  
ATOM 6712  C CB   . TRP A 1 62 ? 8.337   1.414   3.025   1.00 0.00 ? 62 TRP A CB   6  
ATOM 6713  C CG   . TRP A 1 62 ? 9.094   1.773   4.269   1.00 0.00 ? 62 TRP A CG   6  
ATOM 6714  C CD1  . TRP A 1 62 ? 8.602   2.411   5.371   1.00 0.00 ? 62 TRP A CD1  6  
ATOM 6715  C CD2  . TRP A 1 62 ? 10.477  1.516   4.534   1.00 0.00 ? 62 TRP A CD2  6  
ATOM 6716  N NE1  . TRP A 1 62 ? 9.597   2.566   6.307   1.00 0.00 ? 62 TRP A NE1  6  
ATOM 6717  C CE2  . TRP A 1 62 ? 10.756  2.025   5.818   1.00 0.00 ? 62 TRP A CE2  6  
ATOM 6718  C CE3  . TRP A 1 62 ? 11.506  0.903   3.814   1.00 0.00 ? 62 TRP A CE3  6  
ATOM 6719  C CZ2  . TRP A 1 62 ? 12.021  1.940   6.393   1.00 0.00 ? 62 TRP A CZ2  6  
ATOM 6720  C CZ3  . TRP A 1 62 ? 12.761  0.820   4.386   1.00 0.00 ? 62 TRP A CZ3  6  
ATOM 6721  C CH2  . TRP A 1 62 ? 13.010  1.336   5.665   1.00 0.00 ? 62 TRP A CH2  6  
ATOM 6722  H H    . TRP A 1 62 ? 7.858   1.194   0.547   1.00 0.00 ? 62 TRP A H    6  
ATOM 6723  H HA   . TRP A 1 62 ? 7.199   3.133   2.451   1.00 0.00 ? 62 TRP A HA   6  
ATOM 6724  H HB2  . TRP A 1 62 ? 7.392   0.985   3.323   1.00 0.00 ? 62 TRP A HB2  6  
ATOM 6725  H HB3  . TRP A 1 62 ? 8.911   0.673   2.487   1.00 0.00 ? 62 TRP A HB3  6  
ATOM 6726  H HD1  . TRP A 1 62 ? 7.580   2.741   5.478   1.00 0.00 ? 62 TRP A HD1  6  
ATOM 6727  H HE1  . TRP A 1 62 ? 9.492   2.994   7.183   1.00 0.00 ? 62 TRP A HE1  6  
ATOM 6728  H HE3  . TRP A 1 62 ? 11.334  0.500   2.827   1.00 0.00 ? 62 TRP A HE3  6  
ATOM 6729  H HZ2  . TRP A 1 62 ? 12.229  2.332   7.378   1.00 0.00 ? 62 TRP A HZ2  6  
ATOM 6730  H HZ3  . TRP A 1 62 ? 13.569  0.351   3.844   1.00 0.00 ? 62 TRP A HZ3  6  
ATOM 6731  H HH2  . TRP A 1 62 ? 14.006  1.249   6.072   1.00 0.00 ? 62 TRP A HH2  6  
ATOM 6732  N N    . ARG A 1 63 ? 10.214  3.362   1.236   1.00 0.00 ? 63 ARG A N    6  
ATOM 6733  C CA   . ARG A 1 63 ? 11.401  4.205   1.170   1.00 0.00 ? 63 ARG A CA   6  
ATOM 6734  C C    . ARG A 1 63 ? 11.053  5.595   0.645   1.00 0.00 ? 63 ARG A C    6  
ATOM 6735  O O    . ARG A 1 63 ? 11.454  6.606   1.223   1.00 0.00 ? 63 ARG A O    6  
ATOM 6736  C CB   . ARG A 1 63 ? 12.460  3.561   0.273   1.00 0.00 ? 63 ARG A CB   6  
ATOM 6737  C CG   . ARG A 1 63 ? 13.130  2.348   0.897   1.00 0.00 ? 63 ARG A CG   6  
ATOM 6738  C CD   . ARG A 1 63 ? 13.788  1.471   -0.158  1.00 0.00 ? 63 ARG A CD   6  
ATOM 6739  N NE   . ARG A 1 63 ? 15.078  2.005   -0.585  1.00 0.00 ? 63 ARG A NE   6  
ATOM 6740  C CZ   . ARG A 1 63 ? 15.858  1.412   -1.483  1.00 0.00 ? 63 ARG A CZ   6  
ATOM 6741  N NH1  . ARG A 1 63 ? 15.479  0.272   -2.045  1.00 0.00 ? 63 ARG A NH1  6  
ATOM 6742  N NH2  . ARG A 1 63 ? 17.019  1.959   -1.820  1.00 0.00 ? 63 ARG A NH2  6  
ATOM 6743  H H    . ARG A 1 63 ? 10.111  2.629   0.594   1.00 0.00 ? 63 ARG A H    6  
ATOM 6744  H HA   . ARG A 1 63 ? 11.798  4.300   2.169   1.00 0.00 ? 63 ARG A HA   6  
ATOM 6745  H HB2  . ARG A 1 63 ? 11.994  3.252   -0.651  1.00 0.00 ? 63 ARG A HB2  6  
ATOM 6746  H HB3  . ARG A 1 63 ? 13.223  4.294   0.054   1.00 0.00 ? 63 ARG A HB3  6  
ATOM 6747  H HG2  . ARG A 1 63 ? 13.885  2.683   1.592   1.00 0.00 ? 63 ARG A HG2  6  
ATOM 6748  H HG3  . ARG A 1 63 ? 12.386  1.768   1.421   1.00 0.00 ? 63 ARG A HG3  6  
ATOM 6749  H HD2  . ARG A 1 63 ? 13.936  0.485   0.255   1.00 0.00 ? 63 ARG A HD2  6  
ATOM 6750  H HD3  . ARG A 1 63 ? 13.133  1.409   -1.014  1.00 0.00 ? 63 ARG A HD3  6  
ATOM 6751  H HE   . ARG A 1 63 ? 15.378  2.846   -0.183  1.00 0.00 ? 63 ARG A HE   6  
ATOM 6752  H HH11 . ARG A 1 63 ? 14.605  -0.142  -1.793  1.00 0.00 ? 63 ARG A HH11 6  
ATOM 6753  H HH12 . ARG A 1 63 ? 16.067  -0.172  -2.721  1.00 0.00 ? 63 ARG A HH12 6  
ATOM 6754  H HH21 . ARG A 1 63 ? 17.307  2.818   -1.399  1.00 0.00 ? 63 ARG A HH21 6  
ATOM 6755  H HH22 . ARG A 1 63 ? 17.604  1.512   -2.495  1.00 0.00 ? 63 ARG A HH22 6  
ATOM 6756  N N    . ARG A 1 64 ? 10.304  5.638   -0.452  1.00 0.00 ? 64 ARG A N    6  
ATOM 6757  C CA   . ARG A 1 64 ? 9.903   6.903   -1.055  1.00 0.00 ? 64 ARG A CA   6  
ATOM 6758  C C    . ARG A 1 64 ? 9.082   7.736   -0.075  1.00 0.00 ? 64 ARG A C    6  
ATOM 6759  O O    . ARG A 1 64 ? 9.332   8.928   0.104   1.00 0.00 ? 64 ARG A O    6  
ATOM 6760  C CB   . ARG A 1 64 ? 9.096   6.652   -2.330  1.00 0.00 ? 64 ARG A CB   6  
ATOM 6761  C CG   . ARG A 1 64 ? 9.194   7.779   -3.345  1.00 0.00 ? 64 ARG A CG   6  
ATOM 6762  C CD   . ARG A 1 64 ? 8.719   7.334   -4.719  1.00 0.00 ? 64 ARG A CD   6  
ATOM 6763  N NE   . ARG A 1 64 ? 9.766   6.636   -5.460  1.00 0.00 ? 64 ARG A NE   6  
ATOM 6764  C CZ   . ARG A 1 64 ? 9.567   6.048   -6.634  1.00 0.00 ? 64 ARG A CZ   6  
ATOM 6765  N NH1  . ARG A 1 64 ? 8.368   6.074   -7.199  1.00 0.00 ? 64 ARG A NH1  6  
ATOM 6766  N NH2  . ARG A 1 64 ? 10.570  5.432   -7.247  1.00 0.00 ? 64 ARG A NH2  6  
ATOM 6767  H H    . ARG A 1 64 ? 10.016  4.798   -0.867  1.00 0.00 ? 64 ARG A H    6  
ATOM 6768  H HA   . ARG A 1 64 ? 10.800  7.449   -1.309  1.00 0.00 ? 64 ARG A HA   6  
ATOM 6769  H HB2  . ARG A 1 64 ? 9.454   5.746   -2.796  1.00 0.00 ? 64 ARG A HB2  6  
ATOM 6770  H HB3  . ARG A 1 64 ? 8.057   6.525   -2.064  1.00 0.00 ? 64 ARG A HB3  6  
ATOM 6771  H HG2  . ARG A 1 64 ? 8.579   8.604   -3.013  1.00 0.00 ? 64 ARG A HG2  6  
ATOM 6772  H HG3  . ARG A 1 64 ? 10.222  8.100   -3.414  1.00 0.00 ? 64 ARG A HG3  6  
ATOM 6773  H HD2  . ARG A 1 64 ? 7.875   6.672   -4.597  1.00 0.00 ? 64 ARG A HD2  6  
ATOM 6774  H HD3  . ARG A 1 64 ? 8.414   8.206   -5.279  1.00 0.00 ? 64 ARG A HD3  6  
ATOM 6775  H HE   . ARG A 1 64 ? 10.660  6.604   -5.061  1.00 0.00 ? 64 ARG A HE   6  
ATOM 6776  H HH11 . ARG A 1 64 ? 7.611   6.539   -6.740  1.00 0.00 ? 64 ARG A HH11 6  
ATOM 6777  H HH12 . ARG A 1 64 ? 8.221   5.632   -8.084  1.00 0.00 ? 64 ARG A HH12 6  
ATOM 6778  H HH21 . ARG A 1 64 ? 11.476  5.410   -6.825  1.00 0.00 ? 64 ARG A HH21 6  
ATOM 6779  H HH22 . ARG A 1 64 ? 10.420  4.990   -8.131  1.00 0.00 ? 64 ARG A HH22 6  
ATOM 6780  N N    . SER A 1 65 ? 8.100   7.100   0.555   1.00 0.00 ? 65 SER A N    6  
ATOM 6781  C CA   . SER A 1 65 ? 7.238   7.783   1.513   1.00 0.00 ? 65 SER A CA   6  
ATOM 6782  C C    . SER A 1 65 ? 8.023   8.187   2.758   1.00 0.00 ? 65 SER A C    6  
ATOM 6783  O O    . SER A 1 65 ? 7.853   9.286   3.282   1.00 0.00 ? 65 SER A O    6  
ATOM 6784  C CB   . SER A 1 65 ? 6.064   6.884   1.906   1.00 0.00 ? 65 SER A CB   6  
ATOM 6785  O OG   . SER A 1 65 ? 5.133   6.767   0.844   1.00 0.00 ? 65 SER A OG   6  
ATOM 6786  H H    . SER A 1 65 ? 7.950   6.149   0.370   1.00 0.00 ? 65 SER A H    6  
ATOM 6787  H HA   . SER A 1 65 ? 6.855   8.674   1.039   1.00 0.00 ? 65 SER A HA   6  
ATOM 6788  H HB2  . SER A 1 65 ? 6.434   5.901   2.155   1.00 0.00 ? 65 SER A HB2  6  
ATOM 6789  H HB3  . SER A 1 65 ? 5.562   7.307   2.764   1.00 0.00 ? 65 SER A HB3  6  
ATOM 6790  H HG   . SER A 1 65 ? 5.605   6.629   0.019   1.00 0.00 ? 65 SER A HG   6  
ATOM 6791  N N    . GLY A 1 66 ? 8.883   7.287   3.226   1.00 0.00 ? 66 GLY A N    6  
ATOM 6792  C CA   . GLY A 1 66 ? 9.681   7.567   4.405   1.00 0.00 ? 66 GLY A CA   6  
ATOM 6793  C C    . GLY A 1 66 ? 10.680  8.684   4.177   1.00 0.00 ? 66 GLY A C    6  
ATOM 6794  O O    . GLY A 1 66 ? 11.225  8.845   3.085   1.00 0.00 ? 66 GLY A O    6  
ATOM 6795  H H    . GLY A 1 66 ? 8.976   6.426   2.766   1.00 0.00 ? 66 GLY A H    6  
ATOM 6796  H HA2  . GLY A 1 66 ? 9.023   7.846   5.214   1.00 0.00 ? 66 GLY A HA2  6  
ATOM 6797  H HA3  . GLY A 1 66 ? 10.218  6.671   4.683   1.00 0.00 ? 66 GLY A HA3  6  
ATOM 6798  N N    . PRO A 1 67 ? 10.931  9.481   5.226   1.00 0.00 ? 67 PRO A N    6  
ATOM 6799  C CA   . PRO A 1 67 ? 11.872  10.604  5.159   1.00 0.00 ? 67 PRO A CA   6  
ATOM 6800  C C    . PRO A 1 67 ? 13.320  10.141  5.039   1.00 0.00 ? 67 PRO A C    6  
ATOM 6801  O O    . PRO A 1 67 ? 13.683  9.073   5.533   1.00 0.00 ? 67 PRO A O    6  
ATOM 6802  C CB   . PRO A 1 67 ? 11.651  11.331  6.488   1.00 0.00 ? 67 PRO A CB   6  
ATOM 6803  C CG   . PRO A 1 67 ? 11.129  10.283  7.411   1.00 0.00 ? 67 PRO A CG   6  
ATOM 6804  C CD   . PRO A 1 67 ? 10.318  9.348   6.558   1.00 0.00 ? 67 PRO A CD   6  
ATOM 6805  H HA   . PRO A 1 67 ? 11.638  11.269  4.341   1.00 0.00 ? 67 PRO A HA   6  
ATOM 6806  H HB2  . PRO A 1 67 ? 12.590  11.736  6.840   1.00 0.00 ? 67 PRO A HB2  6  
ATOM 6807  H HB3  . PRO A 1 67 ? 10.937  12.128  6.353   1.00 0.00 ? 67 PRO A HB3  6  
ATOM 6808  H HG2  . PRO A 1 67 ? 11.951  9.755   7.869   1.00 0.00 ? 67 PRO A HG2  6  
ATOM 6809  H HG3  . PRO A 1 67 ? 10.505  10.738  8.166   1.00 0.00 ? 67 PRO A HG3  6  
ATOM 6810  H HD2  . PRO A 1 67 ? 10.403  8.335   6.922   1.00 0.00 ? 67 PRO A HD2  6  
ATOM 6811  H HD3  . PRO A 1 67 ? 9.283   9.657   6.537   1.00 0.00 ? 67 PRO A HD3  6  
ATOM 6812  N N    . SER A 1 68 ? 14.142  10.951  4.381   1.00 0.00 ? 68 SER A N    6  
ATOM 6813  C CA   . SER A 1 68 ? 15.551  10.623  4.193   1.00 0.00 ? 68 SER A CA   6  
ATOM 6814  C C    . SER A 1 68 ? 16.350  11.861  3.799   1.00 0.00 ? 68 SER A C    6  
ATOM 6815  O O    . SER A 1 68 ? 16.117  12.453  2.745   1.00 0.00 ? 68 SER A O    6  
ATOM 6816  C CB   . SER A 1 68 ? 15.705  9.540   3.124   1.00 0.00 ? 68 SER A CB   6  
ATOM 6817  O OG   . SER A 1 68 ? 15.237  9.995   1.866   1.00 0.00 ? 68 SER A OG   6  
ATOM 6818  H H    . SER A 1 68 ? 13.793  11.789  4.011   1.00 0.00 ? 68 SER A H    6  
ATOM 6819  H HA   . SER A 1 68 ? 15.931  10.247  5.131   1.00 0.00 ? 68 SER A HA   6  
ATOM 6820  H HB2  . SER A 1 68 ? 16.748  9.275   3.032   1.00 0.00 ? 68 SER A HB2  6  
ATOM 6821  H HB3  . SER A 1 68 ? 15.136  8.668   3.413   1.00 0.00 ? 68 SER A HB3  6  
ATOM 6822  H HG   . SER A 1 68 ? 14.480  10.570  1.995   1.00 0.00 ? 68 SER A HG   6  
ATOM 6823  N N    . SER A 1 69 ? 17.292  12.247  4.653   1.00 0.00 ? 69 SER A N    6  
ATOM 6824  C CA   . SER A 1 69 ? 18.124  13.417  4.397   1.00 0.00 ? 69 SER A CA   6  
ATOM 6825  C C    . SER A 1 69 ? 19.548  13.003  4.038   1.00 0.00 ? 69 SER A C    6  
ATOM 6826  O O    . SER A 1 69 ? 19.947  11.860  4.255   1.00 0.00 ? 69 SER A O    6  
ATOM 6827  C CB   . SER A 1 69 ? 18.140  14.335  5.620   1.00 0.00 ? 69 SER A CB   6  
ATOM 6828  O OG   . SER A 1 69 ? 18.480  15.662  5.258   1.00 0.00 ? 69 SER A OG   6  
ATOM 6829  H H    . SER A 1 69 ? 17.429  11.733  5.477   1.00 0.00 ? 69 SER A H    6  
ATOM 6830  H HA   . SER A 1 69 ? 17.695  13.952  3.562   1.00 0.00 ? 69 SER A HA   6  
ATOM 6831  H HB2  . SER A 1 69 ? 17.162  14.339  6.078   1.00 0.00 ? 69 SER A HB2  6  
ATOM 6832  H HB3  . SER A 1 69 ? 18.868  13.971  6.330   1.00 0.00 ? 69 SER A HB3  6  
ATOM 6833  H HG   . SER A 1 69 ? 19.388  15.687  4.947   1.00 0.00 ? 69 SER A HG   6  
ATOM 6834  N N    . GLY A 1 70 ? 20.309  13.943  3.486   1.00 0.00 ? 70 GLY A N    6  
ATOM 6835  C CA   . GLY A 1 70 ? 21.680  13.658  3.106   1.00 0.00 ? 70 GLY A CA   6  
ATOM 6836  C C    . GLY A 1 70 ? 22.186  14.589  2.022   1.00 0.00 ? 70 GLY A C    6  
ATOM 6837  O O    . GLY A 1 70 ? 22.572  14.143  0.941   1.00 0.00 ? 70 GLY A O    6  
ATOM 6838  H H    . GLY A 1 70 ? 19.937  14.838  3.337   1.00 0.00 ? 70 GLY A H    6  
ATOM 6839  H HA2  . GLY A 1 70 ? 22.312  13.758  3.976   1.00 0.00 ? 70 GLY A HA2  6  
ATOM 6840  H HA3  . GLY A 1 70 ? 21.738  12.641  2.746   1.00 0.00 ? 70 GLY A HA3  6  
ATOM 6841  N N    . GLY A 1 1  ? -26.450 -4.204  11.528  1.00 0.00 ? 1  GLY A N    7  
ATOM 6842  C CA   . GLY A 1 1  ? -25.110 -3.802  11.144  1.00 0.00 ? 1  GLY A CA   7  
ATOM 6843  C C    . GLY A 1 1  ? -24.974 -2.299  11.003  1.00 0.00 ? 1  GLY A C    7  
ATOM 6844  O O    . GLY A 1 1  ? -25.924 -1.616  10.622  1.00 0.00 ? 1  GLY A O    7  
ATOM 6845  H H1   . GLY A 1 1  ? -26.738 -4.117  12.461  1.00 0.00 ? 1  GLY A H1   7  
ATOM 6846  H HA2  . GLY A 1 1  ? -24.414 -4.147  11.894  1.00 0.00 ? 1  GLY A HA2  7  
ATOM 6847  H HA3  . GLY A 1 1  ? -24.864 -4.264  10.199  1.00 0.00 ? 1  GLY A HA3  7  
ATOM 6848  N N    . SER A 1 2  ? -23.789 -1.781  11.314  1.00 0.00 ? 2  SER A N    7  
ATOM 6849  C CA   . SER A 1 2  ? -23.534 -0.349  11.225  1.00 0.00 ? 2  SER A CA   7  
ATOM 6850  C C    . SER A 1 2  ? -23.100 0.039   9.815   1.00 0.00 ? 2  SER A C    7  
ATOM 6851  O O    . SER A 1 2  ? -22.771 -0.819  8.996   1.00 0.00 ? 2  SER A O    7  
ATOM 6852  C CB   . SER A 1 2  ? -22.459 0.063   12.233  1.00 0.00 ? 2  SER A CB   7  
ATOM 6853  O OG   . SER A 1 2  ? -22.477 1.462   12.455  1.00 0.00 ? 2  SER A OG   7  
ATOM 6854  H H    . SER A 1 2  ? -23.071 -2.378  11.612  1.00 0.00 ? 2  SER A H    7  
ATOM 6855  H HA   . SER A 1 2  ? -24.452 0.167   11.461  1.00 0.00 ? 2  SER A HA   7  
ATOM 6856  H HB2  . SER A 1 2  ? -22.637 -0.441  13.171  1.00 0.00 ? 2  SER A HB2  7  
ATOM 6857  H HB3  . SER A 1 2  ? -21.487 -0.217  11.852  1.00 0.00 ? 2  SER A HB3  7  
ATOM 6858  H HG   . SER A 1 2  ? -22.035 1.660   13.284  1.00 0.00 ? 2  SER A HG   7  
ATOM 6859  N N    . SER A 1 3  ? -23.102 1.339   9.538   1.00 0.00 ? 3  SER A N    7  
ATOM 6860  C CA   . SER A 1 3  ? -22.713 1.843   8.226   1.00 0.00 ? 3  SER A CA   7  
ATOM 6861  C C    . SER A 1 3  ? -21.431 2.666   8.318   1.00 0.00 ? 3  SER A C    7  
ATOM 6862  O O    . SER A 1 3  ? -21.453 3.825   8.730   1.00 0.00 ? 3  SER A O    7  
ATOM 6863  C CB   . SER A 1 3  ? -23.836 2.692   7.628   1.00 0.00 ? 3  SER A CB   7  
ATOM 6864  O OG   . SER A 1 3  ? -24.159 3.780   8.477   1.00 0.00 ? 3  SER A OG   7  
ATOM 6865  H H    . SER A 1 3  ? -23.375 1.975   10.233  1.00 0.00 ? 3  SER A H    7  
ATOM 6866  H HA   . SER A 1 3  ? -22.536 0.993   7.584   1.00 0.00 ? 3  SER A HA   7  
ATOM 6867  H HB2  . SER A 1 3  ? -23.521 3.079   6.671   1.00 0.00 ? 3  SER A HB2  7  
ATOM 6868  H HB3  . SER A 1 3  ? -24.716 2.080   7.497   1.00 0.00 ? 3  SER A HB3  7  
ATOM 6869  H HG   . SER A 1 3  ? -23.392 4.014   9.005   1.00 0.00 ? 3  SER A HG   7  
ATOM 6870  N N    . GLY A 1 4  ? -20.315 2.056   7.931   1.00 0.00 ? 4  GLY A N    7  
ATOM 6871  C CA   . GLY A 1 4  ? -19.039 2.746   7.977   1.00 0.00 ? 4  GLY A CA   7  
ATOM 6872  C C    . GLY A 1 4  ? -17.892 1.876   7.502   1.00 0.00 ? 4  GLY A C    7  
ATOM 6873  O O    . GLY A 1 4  ? -17.147 1.323   8.310   1.00 0.00 ? 4  GLY A O    7  
ATOM 6874  H H    . GLY A 1 4  ? -20.358 1.130   7.611   1.00 0.00 ? 4  GLY A H    7  
ATOM 6875  H HA2  . GLY A 1 4  ? -19.094 3.624   7.352   1.00 0.00 ? 4  GLY A HA2  7  
ATOM 6876  H HA3  . GLY A 1 4  ? -18.845 3.052   8.995   1.00 0.00 ? 4  GLY A HA3  7  
ATOM 6877  N N    . SER A 1 5  ? -17.751 1.752   6.186   1.00 0.00 ? 5  SER A N    7  
ATOM 6878  C CA   . SER A 1 5  ? -16.690 0.939   5.603   1.00 0.00 ? 5  SER A CA   7  
ATOM 6879  C C    . SER A 1 5  ? -16.263 1.493   4.248   1.00 0.00 ? 5  SER A C    7  
ATOM 6880  O O    . SER A 1 5  ? -17.095 1.734   3.373   1.00 0.00 ? 5  SER A O    7  
ATOM 6881  C CB   . SER A 1 5  ? -17.156 -0.511  5.451   1.00 0.00 ? 5  SER A CB   7  
ATOM 6882  O OG   . SER A 1 5  ? -16.053 -1.385  5.284   1.00 0.00 ? 5  SER A OG   7  
ATOM 6883  H H    . SER A 1 5  ? -18.378 2.218   5.593   1.00 0.00 ? 5  SER A H    7  
ATOM 6884  H HA   . SER A 1 5  ? -15.844 0.968   6.274   1.00 0.00 ? 5  SER A HA   7  
ATOM 6885  H HB2  . SER A 1 5  ? -17.703 -0.805  6.334   1.00 0.00 ? 5  SER A HB2  7  
ATOM 6886  H HB3  . SER A 1 5  ? -17.798 -0.590  4.586   1.00 0.00 ? 5  SER A HB3  7  
ATOM 6887  H HG   . SER A 1 5  ? -16.281 -2.255  5.619   1.00 0.00 ? 5  SER A HG   7  
ATOM 6888  N N    . SER A 1 6  ? -14.959 1.692   4.081   1.00 0.00 ? 6  SER A N    7  
ATOM 6889  C CA   . SER A 1 6  ? -14.420 2.221   2.834   1.00 0.00 ? 6  SER A CA   7  
ATOM 6890  C C    . SER A 1 6  ? -13.303 1.328   2.303   1.00 0.00 ? 6  SER A C    7  
ATOM 6891  O O    . SER A 1 6  ? -12.803 0.454   3.009   1.00 0.00 ? 6  SER A O    7  
ATOM 6892  C CB   . SER A 1 6  ? -13.895 3.643   3.043   1.00 0.00 ? 6  SER A CB   7  
ATOM 6893  O OG   . SER A 1 6  ? -14.959 4.579   3.082   1.00 0.00 ? 6  SER A OG   7  
ATOM 6894  H H    . SER A 1 6  ? -14.346 1.480   4.816   1.00 0.00 ? 6  SER A H    7  
ATOM 6895  H HA   . SER A 1 6  ? -15.221 2.245   2.110   1.00 0.00 ? 6  SER A HA   7  
ATOM 6896  H HB2  . SER A 1 6  ? -13.355 3.691   3.977   1.00 0.00 ? 6  SER A HB2  7  
ATOM 6897  H HB3  . SER A 1 6  ? -13.233 3.903   2.230   1.00 0.00 ? 6  SER A HB3  7  
ATOM 6898  H HG   . SER A 1 6  ? -15.412 4.585   2.236   1.00 0.00 ? 6  SER A HG   7  
ATOM 6899  N N    . GLY A 1 7  ? -12.917 1.555   1.051   1.00 0.00 ? 7  GLY A N    7  
ATOM 6900  C CA   . GLY A 1 7  ? -11.862 0.764   0.445   1.00 0.00 ? 7  GLY A CA   7  
ATOM 6901  C C    . GLY A 1 7  ? -12.216 -0.707  0.361   1.00 0.00 ? 7  GLY A C    7  
ATOM 6902  O O    . GLY A 1 7  ? -11.420 -1.568  0.737   1.00 0.00 ? 7  GLY A O    7  
ATOM 6903  H H    . GLY A 1 7  ? -13.351 2.266   0.535   1.00 0.00 ? 7  GLY A H    7  
ATOM 6904  H HA2  . GLY A 1 7  ? -11.675 1.136   -0.551  1.00 0.00 ? 7  GLY A HA2  7  
ATOM 6905  H HA3  . GLY A 1 7  ? -10.963 0.873   1.034   1.00 0.00 ? 7  GLY A HA3  7  
ATOM 6906  N N    . LYS A 1 8  ? -13.416 -0.998  -0.132  1.00 0.00 ? 8  LYS A N    7  
ATOM 6907  C CA   . LYS A 1 8  ? -13.876 -2.375  -0.264  1.00 0.00 ? 8  LYS A CA   7  
ATOM 6908  C C    . LYS A 1 8  ? -12.810 -3.244  -0.926  1.00 0.00 ? 8  LYS A C    7  
ATOM 6909  O O    . LYS A 1 8  ? -12.432 -4.288  -0.398  1.00 0.00 ? 8  LYS A O    7  
ATOM 6910  C CB   . LYS A 1 8  ? -15.169 -2.426  -1.080  1.00 0.00 ? 8  LYS A CB   7  
ATOM 6911  C CG   . LYS A 1 8  ? -15.726 -3.829  -1.250  1.00 0.00 ? 8  LYS A CG   7  
ATOM 6912  C CD   . LYS A 1 8  ? -16.489 -4.280  -0.016  1.00 0.00 ? 8  LYS A CD   7  
ATOM 6913  C CE   . LYS A 1 8  ? -16.900 -5.741  -0.116  1.00 0.00 ? 8  LYS A CE   7  
ATOM 6914  N NZ   . LYS A 1 8  ? -17.667 -6.186  1.080   1.00 0.00 ? 8  LYS A NZ   7  
ATOM 6915  H H    . LYS A 1 8  ? -14.006 -0.268  -0.415  1.00 0.00 ? 8  LYS A H    7  
ATOM 6916  H HA   . LYS A 1 8  ? -14.070 -2.757  0.727   1.00 0.00 ? 8  LYS A HA   7  
ATOM 6917  H HB2  . LYS A 1 8  ? -15.916 -1.822  -0.586  1.00 0.00 ? 8  LYS A HB2  7  
ATOM 6918  H HB3  . LYS A 1 8  ? -14.979 -2.016  -2.061  1.00 0.00 ? 8  LYS A HB3  7  
ATOM 6919  H HG2  . LYS A 1 8  ? -16.395 -3.841  -2.098  1.00 0.00 ? 8  LYS A HG2  7  
ATOM 6920  H HG3  . LYS A 1 8  ? -14.907 -4.513  -1.425  1.00 0.00 ? 8  LYS A HG3  7  
ATOM 6921  H HD2  . LYS A 1 8  ? -15.860 -4.154  0.852   1.00 0.00 ? 8  LYS A HD2  7  
ATOM 6922  H HD3  . LYS A 1 8  ? -17.377 -3.672  0.090   1.00 0.00 ? 8  LYS A HD3  7  
ATOM 6923  H HE2  . LYS A 1 8  ? -17.513 -5.869  -0.995  1.00 0.00 ? 8  LYS A HE2  7  
ATOM 6924  H HE3  . LYS A 1 8  ? -16.009 -6.346  -0.208  1.00 0.00 ? 8  LYS A HE3  7  
ATOM 6925  H HZ1  . LYS A 1 8  ? -17.239 -5.795  1.944   1.00 0.00 ? 8  LYS A HZ1  7  
ATOM 6926  H HZ2  . LYS A 1 8  ? -17.661 -7.223  1.143   1.00 0.00 ? 8  LYS A HZ2  7  
ATOM 6927  H HZ3  . LYS A 1 8  ? -18.652 -5.858  1.015   1.00 0.00 ? 8  LYS A HZ3  7  
ATOM 6928  N N    . GLY A 1 9  ? -12.330 -2.803  -2.085  1.00 0.00 ? 9  GLY A N    7  
ATOM 6929  C CA   . GLY A 1 9  ? -11.312 -3.551  -2.798  1.00 0.00 ? 9  GLY A CA   7  
ATOM 6930  C C    . GLY A 1 9  ? -10.991 -2.949  -4.152  1.00 0.00 ? 9  GLY A C    7  
ATOM 6931  O O    . GLY A 1 9  ? -11.430 -1.844  -4.467  1.00 0.00 ? 9  GLY A O    7  
ATOM 6932  H H    . GLY A 1 9  ? -12.669 -1.962  -2.458  1.00 0.00 ? 9  GLY A H    7  
ATOM 6933  H HA2  . GLY A 1 9  ? -10.411 -3.572  -2.202  1.00 0.00 ? 9  GLY A HA2  7  
ATOM 6934  H HA3  . GLY A 1 9  ? -11.660 -4.564  -2.942  1.00 0.00 ? 9  GLY A HA3  7  
ATOM 6935  N N    . GLY A 1 10 ? -10.220 -3.677  -4.954  1.00 0.00 ? 10 GLY A N    7  
ATOM 6936  C CA   . GLY A 1 10 ? -9.852  -3.190  -6.271  1.00 0.00 ? 10 GLY A CA   7  
ATOM 6937  C C    . GLY A 1 10 ? -8.809  -4.062  -6.941  1.00 0.00 ? 10 GLY A C    7  
ATOM 6938  O O    . GLY A 1 10 ? -8.741  -5.264  -6.687  1.00 0.00 ? 10 GLY A O    7  
ATOM 6939  H H    . GLY A 1 10 ? -9.898  -4.551  -4.650  1.00 0.00 ? 10 GLY A H    7  
ATOM 6940  H HA2  . GLY A 1 10 ? -10.735 -3.161  -6.892  1.00 0.00 ? 10 GLY A HA2  7  
ATOM 6941  H HA3  . GLY A 1 10 ? -9.459  -2.188  -6.175  1.00 0.00 ? 10 GLY A HA3  7  
ATOM 6942  N N    . GLN A 1 11 ? -7.995  -3.455  -7.799  1.00 0.00 ? 11 GLN A N    7  
ATOM 6943  C CA   . GLN A 1 11 ? -6.952  -4.186  -8.509  1.00 0.00 ? 11 GLN A CA   7  
ATOM 6944  C C    . GLN A 1 11 ? -6.359  -5.282  -7.628  1.00 0.00 ? 11 GLN A C    7  
ATOM 6945  O O    . GLN A 1 11 ? -6.368  -6.458  -7.992  1.00 0.00 ? 11 GLN A O    7  
ATOM 6946  C CB   . GLN A 1 11 ? -5.849  -3.229  -8.964  1.00 0.00 ? 11 GLN A CB   7  
ATOM 6947  C CG   . GLN A 1 11 ? -5.133  -3.682  -10.227 1.00 0.00 ? 11 GLN A CG   7  
ATOM 6948  C CD   . GLN A 1 11 ? -4.112  -2.672  -10.713 1.00 0.00 ? 11 GLN A CD   7  
ATOM 6949  O OE1  . GLN A 1 11 ? -3.378  -2.084  -9.919  1.00 0.00 ? 11 GLN A OE1  7  
ATOM 6950  N NE2  . GLN A 1 11 ? -4.060  -2.467  -12.024 1.00 0.00 ? 11 GLN A NE2  7  
ATOM 6951  H H    . GLN A 1 11 ? -8.099  -2.495  -7.958  1.00 0.00 ? 11 GLN A H    7  
ATOM 6952  H HA   . GLN A 1 11 ? -7.400  -4.644  -9.377  1.00 0.00 ? 11 GLN A HA   7  
ATOM 6953  H HB2  . GLN A 1 11 ? -6.285  -2.259  -9.151  1.00 0.00 ? 11 GLN A HB2  7  
ATOM 6954  H HB3  . GLN A 1 11 ? -5.117  -3.140  -8.174  1.00 0.00 ? 11 GLN A HB3  7  
ATOM 6955  H HG2  . GLN A 1 11 ? -4.626  -4.614  -10.023 1.00 0.00 ? 11 GLN A HG2  7  
ATOM 6956  H HG3  . GLN A 1 11 ? -5.866  -3.834  -11.005 1.00 0.00 ? 11 GLN A HG3  7  
ATOM 6957  H HE21 . GLN A 1 11 ? -4.677  -2.971  -12.595 1.00 0.00 ? 11 GLN A HE21 7  
ATOM 6958  H HE22 . GLN A 1 11 ? -3.410  -1.819  -12.365 1.00 0.00 ? 11 GLN A HE22 7  
ATOM 6959  N N    . VAL A 1 12 ? -5.843  -4.887  -6.468  1.00 0.00 ? 12 VAL A N    7  
ATOM 6960  C CA   . VAL A 1 12 ? -5.247  -5.836  -5.535  1.00 0.00 ? 12 VAL A CA   7  
ATOM 6961  C C    . VAL A 1 12 ? -6.088  -7.103  -5.426  1.00 0.00 ? 12 VAL A C    7  
ATOM 6962  O O    . VAL A 1 12 ? -7.311  -7.039  -5.304  1.00 0.00 ? 12 VAL A O    7  
ATOM 6963  C CB   . VAL A 1 12 ? -5.086  -5.218  -4.133  1.00 0.00 ? 12 VAL A CB   7  
ATOM 6964  C CG1  . VAL A 1 12 ? -6.446  -4.951  -3.507  1.00 0.00 ? 12 VAL A CG1  7  
ATOM 6965  C CG2  . VAL A 1 12 ? -4.249  -6.126  -3.244  1.00 0.00 ? 12 VAL A CG2  7  
ATOM 6966  H H    . VAL A 1 12 ? -5.865  -3.936  -6.234  1.00 0.00 ? 12 VAL A H    7  
ATOM 6967  H HA   . VAL A 1 12 ? -4.266  -6.097  -5.905  1.00 0.00 ? 12 VAL A HA   7  
ATOM 6968  H HB   . VAL A 1 12 ? -4.570  -4.274  -4.235  1.00 0.00 ? 12 VAL A HB   7  
ATOM 6969  H HG11 . VAL A 1 12 ? -6.453  -3.964  -3.069  1.00 0.00 ? 12 VAL A HG11 7  
ATOM 6970  H HG12 . VAL A 1 12 ? -7.211  -5.014  -4.267  1.00 0.00 ? 12 VAL A HG12 7  
ATOM 6971  H HG13 . VAL A 1 12 ? -6.639  -5.686  -2.740  1.00 0.00 ? 12 VAL A HG13 7  
ATOM 6972  H HG21 . VAL A 1 12 ? -3.319  -5.634  -3.002  1.00 0.00 ? 12 VAL A HG21 7  
ATOM 6973  H HG22 . VAL A 1 12 ? -4.792  -6.339  -2.334  1.00 0.00 ? 12 VAL A HG22 7  
ATOM 6974  H HG23 . VAL A 1 12 ? -4.044  -7.049  -3.764  1.00 0.00 ? 12 VAL A HG23 7  
ATOM 6975  N N    . ARG A 1 13 ? -5.423  -8.253  -5.471  1.00 0.00 ? 13 ARG A N    7  
ATOM 6976  C CA   . ARG A 1 13 ? -6.109  -9.536  -5.378  1.00 0.00 ? 13 ARG A CA   7  
ATOM 6977  C C    . ARG A 1 13 ? -6.234  -9.981  -3.924  1.00 0.00 ? 13 ARG A C    7  
ATOM 6978  O O    . ARG A 1 13 ? -7.101  -10.787 -3.583  1.00 0.00 ? 13 ARG A O    7  
ATOM 6979  C CB   . ARG A 1 13 ? -5.361  -10.598 -6.186  1.00 0.00 ? 13 ARG A CB   7  
ATOM 6980  C CG   . ARG A 1 13 ? -5.445  -10.391 -7.690  1.00 0.00 ? 13 ARG A CG   7  
ATOM 6981  C CD   . ARG A 1 13 ? -4.465  -11.287 -8.431  1.00 0.00 ? 13 ARG A CD   7  
ATOM 6982  N NE   . ARG A 1 13 ? -4.032  -10.697 -9.695  1.00 0.00 ? 13 ARG A NE   7  
ATOM 6983  C CZ   . ARG A 1 13 ? -3.200  -11.296 -10.539 1.00 0.00 ? 13 ARG A CZ   7  
ATOM 6984  N NH1  . ARG A 1 13 ? -2.714  -12.497 -10.255 1.00 0.00 ? 13 ARG A NH1  7  
ATOM 6985  N NH2  . ARG A 1 13 ? -2.853  -10.695 -11.669 1.00 0.00 ? 13 ARG A NH2  7  
ATOM 6986  H H    . ARG A 1 13 ? -4.448  -8.238  -5.569  1.00 0.00 ? 13 ARG A H    7  
ATOM 6987  H HA   . ARG A 1 13 ? -7.099  -9.413  -5.791  1.00 0.00 ? 13 ARG A HA   7  
ATOM 6988  H HB2  . ARG A 1 13 ? -4.320  -10.584 -5.901  1.00 0.00 ? 13 ARG A HB2  7  
ATOM 6989  H HB3  . ARG A 1 13 ? -5.776  -11.567 -5.954  1.00 0.00 ? 13 ARG A HB3  7  
ATOM 6990  H HG2  . ARG A 1 13 ? -6.447  -10.621 -8.020  1.00 0.00 ? 13 ARG A HG2  7  
ATOM 6991  H HG3  . ARG A 1 13 ? -5.218  -9.359  -7.914  1.00 0.00 ? 13 ARG A HG3  7  
ATOM 6992  H HD2  . ARG A 1 13 ? -3.600  -11.447 -7.805  1.00 0.00 ? 13 ARG A HD2  7  
ATOM 6993  H HD3  . ARG A 1 13 ? -4.945  -12.233 -8.631  1.00 0.00 ? 13 ARG A HD3  7  
ATOM 6994  H HE   . ARG A 1 13 ? -4.380  -9.810  -9.924  1.00 0.00 ? 13 ARG A HE   7  
ATOM 6995  H HH11 . ARG A 1 13 ? -2.975  -12.953 -9.404  1.00 0.00 ? 13 ARG A HH11 7  
ATOM 6996  H HH12 . ARG A 1 13 ? -2.089  -12.947 -10.893 1.00 0.00 ? 13 ARG A HH12 7  
ATOM 6997  H HH21 . ARG A 1 13 ? -3.218  -9.790  -11.887 1.00 0.00 ? 13 ARG A HH21 7  
ATOM 6998  H HH22 . ARG A 1 13 ? -2.227  -11.147 -12.304 1.00 0.00 ? 13 ARG A HH22 7  
ATOM 6999  N N    . PHE A 1 14 ? -5.363  -9.453  -3.072  1.00 0.00 ? 14 PHE A N    7  
ATOM 7000  C CA   . PHE A 1 14 ? -5.375  -9.797  -1.655  1.00 0.00 ? 14 PHE A CA   7  
ATOM 7001  C C    . PHE A 1 14 ? -6.696  -9.392  -1.007  1.00 0.00 ? 14 PHE A C    7  
ATOM 7002  O O    . PHE A 1 14 ? -7.274  -8.359  -1.344  1.00 0.00 ? 14 PHE A O    7  
ATOM 7003  C CB   . PHE A 1 14 ? -4.210  -9.116  -0.933  1.00 0.00 ? 14 PHE A CB   7  
ATOM 7004  C CG   . PHE A 1 14 ? -2.861  -9.542  -1.437  1.00 0.00 ? 14 PHE A CG   7  
ATOM 7005  C CD1  . PHE A 1 14 ? -2.327  -10.767 -1.073  1.00 0.00 ? 14 PHE A CD1  7  
ATOM 7006  C CD2  . PHE A 1 14 ? -2.127  -8.717  -2.274  1.00 0.00 ? 14 PHE A CD2  7  
ATOM 7007  C CE1  . PHE A 1 14 ? -1.085  -11.161 -1.535  1.00 0.00 ? 14 PHE A CE1  7  
ATOM 7008  C CE2  . PHE A 1 14 ? -0.885  -9.106  -2.739  1.00 0.00 ? 14 PHE A CE2  7  
ATOM 7009  C CZ   . PHE A 1 14 ? -0.364  -10.330 -2.370  1.00 0.00 ? 14 PHE A CZ   7  
ATOM 7010  H H    . PHE A 1 14 ? -4.696  -8.816  -3.404  1.00 0.00 ? 14 PHE A H    7  
ATOM 7011  H HA   . PHE A 1 14 ? -5.261  -10.867 -1.574  1.00 0.00 ? 14 PHE A HA   7  
ATOM 7012  H HB2  . PHE A 1 14 ? -4.291  -8.047  -1.064  1.00 0.00 ? 14 PHE A HB2  7  
ATOM 7013  H HB3  . PHE A 1 14 ? -4.262  -9.350  0.120   1.00 0.00 ? 14 PHE A HB3  7  
ATOM 7014  H HD1  . PHE A 1 14 ? -2.890  -11.419 -0.422  1.00 0.00 ? 14 PHE A HD1  7  
ATOM 7015  H HD2  . PHE A 1 14 ? -2.535  -7.758  -2.564  1.00 0.00 ? 14 PHE A HD2  7  
ATOM 7016  H HE1  . PHE A 1 14 ? -0.680  -12.119 -1.245  1.00 0.00 ? 14 PHE A HE1  7  
ATOM 7017  H HE2  . PHE A 1 14 ? -0.324  -8.453  -3.391  1.00 0.00 ? 14 PHE A HE2  7  
ATOM 7018  H HZ   . PHE A 1 14 ? 0.607   -10.636 -2.731  1.00 0.00 ? 14 PHE A HZ   7  
ATOM 7019  N N    . SER A 1 15 ? -7.169  -10.215 -0.077  1.00 0.00 ? 15 SER A N    7  
ATOM 7020  C CA   . SER A 1 15 ? -8.424  -9.946  0.615   1.00 0.00 ? 15 SER A CA   7  
ATOM 7021  C C    . SER A 1 15 ? -8.230  -8.893  1.702   1.00 0.00 ? 15 SER A C    7  
ATOM 7022  O O    . SER A 1 15 ? -7.103  -8.531  2.037   1.00 0.00 ? 15 SER A O    7  
ATOM 7023  C CB   . SER A 1 15 ? -8.978  -11.233 1.230   1.00 0.00 ? 15 SER A CB   7  
ATOM 7024  O OG   . SER A 1 15 ? -9.157  -12.233 0.242   1.00 0.00 ? 15 SER A OG   7  
ATOM 7025  H H    . SER A 1 15 ? -6.662  -11.024 0.148   1.00 0.00 ? 15 SER A H    7  
ATOM 7026  H HA   . SER A 1 15 ? -9.129  -9.571  -0.111  1.00 0.00 ? 15 SER A HA   7  
ATOM 7027  H HB2  . SER A 1 15 ? -8.288  -11.599 1.975   1.00 0.00 ? 15 SER A HB2  7  
ATOM 7028  H HB3  . SER A 1 15 ? -9.932  -11.026 1.693   1.00 0.00 ? 15 SER A HB3  7  
ATOM 7029  H HG   . SER A 1 15 ? -8.315  -12.654 0.055   1.00 0.00 ? 15 SER A HG   7  
ATOM 7030  N N    . ASN A 1 16 ? -9.339  -8.405  2.249   1.00 0.00 ? 16 ASN A N    7  
ATOM 7031  C CA   . ASN A 1 16 ? -9.292  -7.393  3.298   1.00 0.00 ? 16 ASN A CA   7  
ATOM 7032  C C    . ASN A 1 16 ? -8.331  -7.804  4.409   1.00 0.00 ? 16 ASN A C    7  
ATOM 7033  O O    . ASN A 1 16 ? -7.337  -7.125  4.667   1.00 0.00 ? 16 ASN A O    7  
ATOM 7034  C CB   . ASN A 1 16 ? -10.690 -7.163  3.876   1.00 0.00 ? 16 ASN A CB   7  
ATOM 7035  C CG   . ASN A 1 16 ? -11.504 -6.186  3.051   1.00 0.00 ? 16 ASN A CG   7  
ATOM 7036  O OD1  . ASN A 1 16 ? -11.867 -6.471  1.909   1.00 0.00 ? 16 ASN A OD1  7  
ATOM 7037  N ND2  . ASN A 1 16 ? -11.796 -5.025  3.626   1.00 0.00 ? 16 ASN A ND2  7  
ATOM 7038  H H    . ASN A 1 16 ? -10.209 -8.733  1.940   1.00 0.00 ? 16 ASN A H    7  
ATOM 7039  H HA   . ASN A 1 16 ? -8.940  -6.473  2.855   1.00 0.00 ? 16 ASN A HA   7  
ATOM 7040  H HB2  . ASN A 1 16 ? -11.219 -8.105  3.908   1.00 0.00 ? 16 ASN A HB2  7  
ATOM 7041  H HB3  . ASN A 1 16 ? -10.599 -6.772  4.878   1.00 0.00 ? 16 ASN A HB3  7  
ATOM 7042  H HD21 . ASN A 1 16 ? -11.473 -4.866  4.538   1.00 0.00 ? 16 ASN A HD21 7  
ATOM 7043  H HD22 . ASN A 1 16 ? -12.321 -4.375  3.115   1.00 0.00 ? 16 ASN A HD22 7  
ATOM 7044  N N    . ASP A 1 17 ? -8.634  -8.920  5.062   1.00 0.00 ? 17 ASP A N    7  
ATOM 7045  C CA   . ASP A 1 17 ? -7.797  -9.424  6.144   1.00 0.00 ? 17 ASP A CA   7  
ATOM 7046  C C    . ASP A 1 17 ? -6.390  -9.736  5.643   1.00 0.00 ? 17 ASP A C    7  
ATOM 7047  O O    . ASP A 1 17 ? -5.403  -9.249  6.193   1.00 0.00 ? 17 ASP A O    7  
ATOM 7048  C CB   . ASP A 1 17 ? -8.421  -10.677 6.761   1.00 0.00 ? 17 ASP A CB   7  
ATOM 7049  C CG   . ASP A 1 17 ? -7.433  -11.464 7.598   1.00 0.00 ? 17 ASP A CG   7  
ATOM 7050  O OD1  . ASP A 1 17 ? -7.021  -10.957 8.662   1.00 0.00 ? 17 ASP A OD1  7  
ATOM 7051  O OD2  . ASP A 1 17 ? -7.072  -12.588 7.190   1.00 0.00 ? 17 ASP A OD2  7  
ATOM 7052  H H    . ASP A 1 17 ? -9.440  -9.418  4.810   1.00 0.00 ? 17 ASP A H    7  
ATOM 7053  H HA   . ASP A 1 17 ? -7.734  -8.656  6.900   1.00 0.00 ? 17 ASP A HA   7  
ATOM 7054  H HB2  . ASP A 1 17 ? -9.248  -10.386 7.392   1.00 0.00 ? 17 ASP A HB2  7  
ATOM 7055  H HB3  . ASP A 1 17 ? -8.785  -11.316 5.970   1.00 0.00 ? 17 ASP A HB3  7  
ATOM 7056  N N    . GLN A 1 18 ? -6.308  -10.552 4.597   1.00 0.00 ? 18 GLN A N    7  
ATOM 7057  C CA   . GLN A 1 18 ? -5.021  -10.930 4.023   1.00 0.00 ? 18 GLN A CA   7  
ATOM 7058  C C    . GLN A 1 18 ? -4.085  -9.728  3.946   1.00 0.00 ? 18 GLN A C    7  
ATOM 7059  O O    . GLN A 1 18 ? -2.941  -9.789  4.397   1.00 0.00 ? 18 GLN A O    7  
ATOM 7060  C CB   . GLN A 1 18 ? -5.217  -11.529 2.629   1.00 0.00 ? 18 GLN A CB   7  
ATOM 7061  C CG   . GLN A 1 18 ? -5.461  -13.029 2.641   1.00 0.00 ? 18 GLN A CG   7  
ATOM 7062  C CD   . GLN A 1 18 ? -5.893  -13.561 1.288   1.00 0.00 ? 18 GLN A CD   7  
ATOM 7063  O OE1  . GLN A 1 18 ? -5.982  -12.813 0.314   1.00 0.00 ? 18 GLN A OE1  7  
ATOM 7064  N NE2  . GLN A 1 18 ? -6.164  -14.859 1.221   1.00 0.00 ? 18 GLN A NE2  7  
ATOM 7065  H H    . GLN A 1 18 ? -7.130  -10.908 4.202   1.00 0.00 ? 18 GLN A H    7  
ATOM 7066  H HA   . GLN A 1 18 ? -4.578  -11.675 4.666   1.00 0.00 ? 18 GLN A HA   7  
ATOM 7067  H HB2  . GLN A 1 18 ? -6.065  -11.052 2.161   1.00 0.00 ? 18 GLN A HB2  7  
ATOM 7068  H HB3  . GLN A 1 18 ? -4.334  -11.334 2.040   1.00 0.00 ? 18 GLN A HB3  7  
ATOM 7069  H HG2  . GLN A 1 18 ? -4.547  -13.527 2.931   1.00 0.00 ? 18 GLN A HG2  7  
ATOM 7070  H HG3  . GLN A 1 18 ? -6.234  -13.250 3.362   1.00 0.00 ? 18 GLN A HG3  7  
ATOM 7071  H HE21 . GLN A 1 18 ? -6.073  -15.393 2.039   1.00 0.00 ? 18 GLN A HE21 7  
ATOM 7072  H HE22 . GLN A 1 18 ? -6.447  -15.229 0.360   1.00 0.00 ? 18 GLN A HE22 7  
ATOM 7073  N N    . THR A 1 19 ? -4.579  -8.636  3.371   1.00 0.00 ? 19 THR A N    7  
ATOM 7074  C CA   . THR A 1 19 ? -3.786  -7.420  3.234   1.00 0.00 ? 19 THR A CA   7  
ATOM 7075  C C    . THR A 1 19 ? -3.354  -6.889  4.595   1.00 0.00 ? 19 THR A C    7  
ATOM 7076  O O    . THR A 1 19 ? -2.177  -6.603  4.815   1.00 0.00 ? 19 THR A O    7  
ATOM 7077  C CB   . THR A 1 19 ? -4.569  -6.321  2.491   1.00 0.00 ? 19 THR A CB   7  
ATOM 7078  O OG1  . THR A 1 19 ? -5.134  -6.850  1.286   1.00 0.00 ? 19 THR A OG1  7  
ATOM 7079  C CG2  . THR A 1 19 ? -3.664  -5.144  2.158   1.00 0.00 ? 19 THR A CG2  7  
ATOM 7080  H H    . THR A 1 19 ? -5.498  -8.649  3.031   1.00 0.00 ? 19 THR A H    7  
ATOM 7081  H HA   . THR A 1 19 ? -2.906  -7.660  2.655   1.00 0.00 ? 19 THR A HA   7  
ATOM 7082  H HB   . THR A 1 19 ? -5.367  -5.973  3.131   1.00 0.00 ? 19 THR A HB   7  
ATOM 7083  H HG1  . THR A 1 19 ? -4.538  -7.506  0.914   1.00 0.00 ? 19 THR A HG1  7  
ATOM 7084  H HG21 . THR A 1 19 ? -2.952  -5.440  1.402   1.00 0.00 ? 19 THR A HG21 7  
ATOM 7085  H HG22 . THR A 1 19 ? -3.137  -4.832  3.047   1.00 0.00 ? 19 THR A HG22 7  
ATOM 7086  H HG23 . THR A 1 19 ? -4.262  -4.325  1.788   1.00 0.00 ? 19 THR A HG23 7  
ATOM 7087  N N    . ILE A 1 20 ? -4.313  -6.759  5.506   1.00 0.00 ? 20 ILE A N    7  
ATOM 7088  C CA   . ILE A 1 20 ? -4.029  -6.263  6.847   1.00 0.00 ? 20 ILE A CA   7  
ATOM 7089  C C    . ILE A 1 20 ? -2.757  -6.890  7.408   1.00 0.00 ? 20 ILE A C    7  
ATOM 7090  O O    . ILE A 1 20 ? -1.813  -6.187  7.764   1.00 0.00 ? 20 ILE A O    7  
ATOM 7091  C CB   . ILE A 1 20 ? -5.196  -6.548  7.811   1.00 0.00 ? 20 ILE A CB   7  
ATOM 7092  C CG1  . ILE A 1 20 ? -6.414  -5.701  7.436   1.00 0.00 ? 20 ILE A CG1  7  
ATOM 7093  C CG2  . ILE A 1 20 ? -4.776  -6.275  9.247   1.00 0.00 ? 20 ILE A CG2  7  
ATOM 7094  C CD1  . ILE A 1 20 ? -7.654  -6.038  8.236   1.00 0.00 ? 20 ILE A CD1  7  
ATOM 7095  H H    . ILE A 1 20 ? -5.232  -7.004  5.271   1.00 0.00 ? 20 ILE A H    7  
ATOM 7096  H HA   . ILE A 1 20 ? -3.893  -5.193  6.785   1.00 0.00 ? 20 ILE A HA   7  
ATOM 7097  H HB   . ILE A 1 20 ? -5.455  -7.593  7.729   1.00 0.00 ? 20 ILE A HB   7  
ATOM 7098  H HG12 . ILE A 1 20 ? -6.186  -4.660  7.602   1.00 0.00 ? 20 ILE A HG12 7  
ATOM 7099  H HG13 . ILE A 1 20 ? -6.641  -5.854  6.391   1.00 0.00 ? 20 ILE A HG13 7  
ATOM 7100  H HG21 . ILE A 1 20 ? -4.537  -5.228  9.359   1.00 0.00 ? 20 ILE A HG21 7  
ATOM 7101  H HG22 . ILE A 1 20 ? -5.586  -6.532  9.914   1.00 0.00 ? 20 ILE A HG22 7  
ATOM 7102  H HG23 . ILE A 1 20 ? -3.908  -6.870  9.488   1.00 0.00 ? 20 ILE A HG23 7  
ATOM 7103  H HD11 . ILE A 1 20 ? -7.872  -5.230  8.919   1.00 0.00 ? 20 ILE A HD11 7  
ATOM 7104  H HD12 . ILE A 1 20 ? -8.488  -6.180  7.565   1.00 0.00 ? 20 ILE A HD12 7  
ATOM 7105  H HD13 . ILE A 1 20 ? -7.484  -6.946  8.796   1.00 0.00 ? 20 ILE A HD13 7  
ATOM 7106  N N    . GLU A 1 21 ? -2.741  -8.218  7.481   1.00 0.00 ? 21 GLU A N    7  
ATOM 7107  C CA   . GLU A 1 21 ? -1.583  -8.939  7.997   1.00 0.00 ? 21 GLU A CA   7  
ATOM 7108  C C    . GLU A 1 21 ? -0.352  -8.681  7.134   1.00 0.00 ? 21 GLU A C    7  
ATOM 7109  O O    . GLU A 1 21 ? 0.684   -8.232  7.628   1.00 0.00 ? 21 GLU A O    7  
ATOM 7110  C CB   . GLU A 1 21 ? -1.874  -10.440 8.054   1.00 0.00 ? 21 GLU A CB   7  
ATOM 7111  C CG   . GLU A 1 21 ? -2.799  -10.839 9.191   1.00 0.00 ? 21 GLU A CG   7  
ATOM 7112  C CD   . GLU A 1 21 ? -2.556  -12.256 9.672   1.00 0.00 ? 21 GLU A CD   7  
ATOM 7113  O OE1  . GLU A 1 21 ? -1.378  -12.661 9.754   1.00 0.00 ? 21 GLU A OE1  7  
ATOM 7114  O OE2  . GLU A 1 21 ? -3.545  -12.960 9.966   1.00 0.00 ? 21 GLU A OE2  7  
ATOM 7115  H H    . GLU A 1 21 ? -3.525  -8.723  7.181   1.00 0.00 ? 21 GLU A H    7  
ATOM 7116  H HA   . GLU A 1 21 ? -1.389  -8.582  8.997   1.00 0.00 ? 21 GLU A HA   7  
ATOM 7117  H HB2  . GLU A 1 21 ? -2.331  -10.742 7.122   1.00 0.00 ? 21 GLU A HB2  7  
ATOM 7118  H HB3  . GLU A 1 21 ? -0.941  -10.971 8.174   1.00 0.00 ? 21 GLU A HB3  7  
ATOM 7119  H HG2  . GLU A 1 21 ? -2.643  -10.163 10.019  1.00 0.00 ? 21 GLU A HG2  7  
ATOM 7120  H HG3  . GLU A 1 21 ? -3.821  -10.760 8.851   1.00 0.00 ? 21 GLU A HG3  7  
ATOM 7121  N N    . LEU A 1 22 ? -0.471  -8.967  5.843   1.00 0.00 ? 22 LEU A N    7  
ATOM 7122  C CA   . LEU A 1 22 ? 0.632   -8.767  4.910   1.00 0.00 ? 22 LEU A CA   7  
ATOM 7123  C C    . LEU A 1 22 ? 1.374   -7.469  5.214   1.00 0.00 ? 22 LEU A C    7  
ATOM 7124  O O    . LEU A 1 22 ? 2.560   -7.337  4.915   1.00 0.00 ? 22 LEU A O    7  
ATOM 7125  C CB   . LEU A 1 22 ? 0.112   -8.745  3.471   1.00 0.00 ? 22 LEU A CB   7  
ATOM 7126  C CG   . LEU A 1 22 ? -0.126  -10.109 2.823   1.00 0.00 ? 22 LEU A CG   7  
ATOM 7127  C CD1  . LEU A 1 22 ? -0.797  -9.946  1.468   1.00 0.00 ? 22 LEU A CD1  7  
ATOM 7128  C CD2  . LEU A 1 22 ? 1.185   -10.869 2.683   1.00 0.00 ? 22 LEU A CD2  7  
ATOM 7129  H H    . LEU A 1 22 ? -1.320  -9.322  5.508   1.00 0.00 ? 22 LEU A H    7  
ATOM 7130  H HA   . LEU A 1 22 ? 1.317   -9.594  5.024   1.00 0.00 ? 22 LEU A HA   7  
ATOM 7131  H HB2  . LEU A 1 22 ? -0.824  -8.209  3.467   1.00 0.00 ? 22 LEU A HB2  7  
ATOM 7132  H HB3  . LEU A 1 22 ? 0.833   -8.212  2.868   1.00 0.00 ? 22 LEU A HB3  7  
ATOM 7133  H HG   . LEU A 1 22 ? -0.785  -10.690 3.453   1.00 0.00 ? 22 LEU A HG   7  
ATOM 7134  H HD11 . LEU A 1 22 ? -0.528  -8.989  1.046   1.00 0.00 ? 22 LEU A HD11 7  
ATOM 7135  H HD12 . LEU A 1 22 ? -1.869  -9.998  1.588   1.00 0.00 ? 22 LEU A HD12 7  
ATOM 7136  H HD13 . LEU A 1 22 ? -0.471  -10.736 0.807   1.00 0.00 ? 22 LEU A HD13 7  
ATOM 7137  H HD21 . LEU A 1 22 ? 2.001   -10.240 3.005   1.00 0.00 ? 22 LEU A HD21 7  
ATOM 7138  H HD22 . LEU A 1 22 ? 1.331   -11.147 1.649   1.00 0.00 ? 22 LEU A HD22 7  
ATOM 7139  H HD23 . LEU A 1 22 ? 1.152   -11.759 3.294   1.00 0.00 ? 22 LEU A HD23 7  
ATOM 7140  N N    . GLU A 1 23 ? 0.667   -6.516  5.812   1.00 0.00 ? 23 GLU A N    7  
ATOM 7141  C CA   . GLU A 1 23 ? 1.260   -5.229  6.158   1.00 0.00 ? 23 GLU A CA   7  
ATOM 7142  C C    . GLU A 1 23 ? 1.891   -5.277  7.547   1.00 0.00 ? 23 GLU A C    7  
ATOM 7143  O O    . GLU A 1 23 ? 3.106   -5.140  7.694   1.00 0.00 ? 23 GLU A O    7  
ATOM 7144  C CB   . GLU A 1 23 ? 0.202   -4.124  6.104   1.00 0.00 ? 23 GLU A CB   7  
ATOM 7145  C CG   . GLU A 1 23 ? -0.419  -3.943  4.730   1.00 0.00 ? 23 GLU A CG   7  
ATOM 7146  C CD   . GLU A 1 23 ? -0.866  -2.517  4.475   1.00 0.00 ? 23 GLU A CD   7  
ATOM 7147  O OE1  . GLU A 1 23 ? -0.055  -1.593  4.694   1.00 0.00 ? 23 GLU A OE1  7  
ATOM 7148  O OE2  . GLU A 1 23 ? -2.027  -2.324  4.057   1.00 0.00 ? 23 GLU A OE2  7  
ATOM 7149  H H    . GLU A 1 23 ? -0.275  -6.681  6.025   1.00 0.00 ? 23 GLU A H    7  
ATOM 7150  H HA   . GLU A 1 23 ? 2.030   -5.013  5.433   1.00 0.00 ? 23 GLU A HA   7  
ATOM 7151  H HB2  . GLU A 1 23 ? -0.585  -4.361  6.805   1.00 0.00 ? 23 GLU A HB2  7  
ATOM 7152  H HB3  . GLU A 1 23 ? 0.660   -3.190  6.395   1.00 0.00 ? 23 GLU A HB3  7  
ATOM 7153  H HG2  . GLU A 1 23 ? 0.310   -4.215  3.981   1.00 0.00 ? 23 GLU A HG2  7  
ATOM 7154  H HG3  . GLU A 1 23 ? -1.277  -4.594  4.648   1.00 0.00 ? 23 GLU A HG3  7  
ATOM 7155  N N    . LYS A 1 24 ? 1.057   -5.472  8.563   1.00 0.00 ? 24 LYS A N    7  
ATOM 7156  C CA   . LYS A 1 24 ? 1.531   -5.538  9.940   1.00 0.00 ? 24 LYS A CA   7  
ATOM 7157  C C    . LYS A 1 24 ? 2.837   -6.322  10.029  1.00 0.00 ? 24 LYS A C    7  
ATOM 7158  O O    . LYS A 1 24 ? 3.633   -6.120  10.946  1.00 0.00 ? 24 LYS A O    7  
ATOM 7159  C CB   . LYS A 1 24 ? 0.473   -6.187  10.834  1.00 0.00 ? 24 LYS A CB   7  
ATOM 7160  C CG   . LYS A 1 24 ? -0.858  -5.454  10.833  1.00 0.00 ? 24 LYS A CG   7  
ATOM 7161  C CD   . LYS A 1 24 ? -1.948  -6.277  11.498  1.00 0.00 ? 24 LYS A CD   7  
ATOM 7162  C CE   . LYS A 1 24 ? -1.778  -6.310  13.009  1.00 0.00 ? 24 LYS A CE   7  
ATOM 7163  N NZ   . LYS A 1 24 ? -0.763  -7.315  13.431  1.00 0.00 ? 24 LYS A NZ   7  
ATOM 7164  H H    . LYS A 1 24 ? 0.099   -5.574  8.382   1.00 0.00 ? 24 LYS A H    7  
ATOM 7165  H HA   . LYS A 1 24 ? 1.707   -4.529  10.280  1.00 0.00 ? 24 LYS A HA   7  
ATOM 7166  H HB2  . LYS A 1 24 ? 0.303   -7.199  10.495  1.00 0.00 ? 24 LYS A HB2  7  
ATOM 7167  H HB3  . LYS A 1 24 ? 0.844   -6.215  11.849  1.00 0.00 ? 24 LYS A HB3  7  
ATOM 7168  H HG2  . LYS A 1 24 ? -0.746  -4.524  11.370  1.00 0.00 ? 24 LYS A HG2  7  
ATOM 7169  H HG3  . LYS A 1 24 ? -1.145  -5.251  9.811   1.00 0.00 ? 24 LYS A HG3  7  
ATOM 7170  H HD2  . LYS A 1 24 ? -2.909  -5.841  11.265  1.00 0.00 ? 24 LYS A HD2  7  
ATOM 7171  H HD3  . LYS A 1 24 ? -1.908  -7.287  11.117  1.00 0.00 ? 24 LYS A HD3  7  
ATOM 7172  H HE2  . LYS A 1 24 ? -1.466  -5.334  13.345  1.00 0.00 ? 24 LYS A HE2  7  
ATOM 7173  H HE3  . LYS A 1 24 ? -2.728  -6.560  13.460  1.00 0.00 ? 24 LYS A HE3  7  
ATOM 7174  H HZ1  . LYS A 1 24 ? 0.160   -6.855  13.564  1.00 0.00 ? 24 LYS A HZ1  7  
ATOM 7175  H HZ2  . LYS A 1 24 ? -0.668  -8.054  12.705  1.00 0.00 ? 24 LYS A HZ2  7  
ATOM 7176  H HZ3  . LYS A 1 24 ? -1.050  -7.759  14.326  1.00 0.00 ? 24 LYS A HZ3  7  
ATOM 7177  N N    . LYS A 1 25 ? 3.051   -7.216  9.070   1.00 0.00 ? 25 LYS A N    7  
ATOM 7178  C CA   . LYS A 1 25 ? 4.261   -8.029  9.037   1.00 0.00 ? 25 LYS A CA   7  
ATOM 7179  C C    . LYS A 1 25 ? 5.439   -7.228  8.491   1.00 0.00 ? 25 LYS A C    7  
ATOM 7180  O O    . LYS A 1 25 ? 6.467   -7.087  9.153   1.00 0.00 ? 25 LYS A O    7  
ATOM 7181  C CB   . LYS A 1 25 ? 4.039   -9.278  8.181   1.00 0.00 ? 25 LYS A CB   7  
ATOM 7182  C CG   . LYS A 1 25 ? 5.148   -10.308 8.309   1.00 0.00 ? 25 LYS A CG   7  
ATOM 7183  C CD   . LYS A 1 25 ? 5.275   -10.816 9.735   1.00 0.00 ? 25 LYS A CD   7  
ATOM 7184  C CE   . LYS A 1 25 ? 6.074   -12.109 9.797   1.00 0.00 ? 25 LYS A CE   7  
ATOM 7185  N NZ   . LYS A 1 25 ? 5.773   -12.889 11.029  1.00 0.00 ? 25 LYS A NZ   7  
ATOM 7186  H H    . LYS A 1 25 ? 2.379   -7.332  8.365   1.00 0.00 ? 25 LYS A H    7  
ATOM 7187  H HA   . LYS A 1 25 ? 4.485   -8.331  10.049  1.00 0.00 ? 25 LYS A HA   7  
ATOM 7188  H HB2  . LYS A 1 25 ? 3.109   -9.741  8.477   1.00 0.00 ? 25 LYS A HB2  7  
ATOM 7189  H HB3  . LYS A 1 25 ? 3.969   -8.981  7.144   1.00 0.00 ? 25 LYS A HB3  7  
ATOM 7190  H HG2  . LYS A 1 25 ? 4.928   -11.142 7.659   1.00 0.00 ? 25 LYS A HG2  7  
ATOM 7191  H HG3  . LYS A 1 25 ? 6.083   -9.855  8.012   1.00 0.00 ? 25 LYS A HG3  7  
ATOM 7192  H HD2  . LYS A 1 25 ? 5.777   -10.068 10.331  1.00 0.00 ? 25 LYS A HD2  7  
ATOM 7193  H HD3  . LYS A 1 25 ? 4.287   -10.994 10.134  1.00 0.00 ? 25 LYS A HD3  7  
ATOM 7194  H HE2  . LYS A 1 25 ? 5.831   -12.708 8.933   1.00 0.00 ? 25 LYS A HE2  7  
ATOM 7195  H HE3  . LYS A 1 25 ? 7.127   -11.867 9.782   1.00 0.00 ? 25 LYS A HE3  7  
ATOM 7196  H HZ1  . LYS A 1 25 ? 4.914   -12.518 11.485  1.00 0.00 ? 25 LYS A HZ1  7  
ATOM 7197  H HZ2  . LYS A 1 25 ? 6.565   -12.819 11.699  1.00 0.00 ? 25 LYS A HZ2  7  
ATOM 7198  H HZ3  . LYS A 1 25 ? 5.621   -13.890 10.790  1.00 0.00 ? 25 LYS A HZ3  7  
ATOM 7199  N N    . PHE A 1 26 ? 5.283   -6.706  7.279   1.00 0.00 ? 26 PHE A N    7  
ATOM 7200  C CA   . PHE A 1 26 ? 6.334   -5.919  6.644   1.00 0.00 ? 26 PHE A CA   7  
ATOM 7201  C C    . PHE A 1 26 ? 6.890   -4.876  7.608   1.00 0.00 ? 26 PHE A C    7  
ATOM 7202  O O    . PHE A 1 26 ? 8.103   -4.696  7.712   1.00 0.00 ? 26 PHE A O    7  
ATOM 7203  C CB   . PHE A 1 26 ? 5.797   -5.232  5.386   1.00 0.00 ? 26 PHE A CB   7  
ATOM 7204  C CG   . PHE A 1 26 ? 6.664   -4.107  4.901   1.00 0.00 ? 26 PHE A CG   7  
ATOM 7205  C CD1  . PHE A 1 26 ? 6.694   -2.897  5.576   1.00 0.00 ? 26 PHE A CD1  7  
ATOM 7206  C CD2  . PHE A 1 26 ? 7.451   -4.258  3.770   1.00 0.00 ? 26 PHE A CD2  7  
ATOM 7207  C CE1  . PHE A 1 26 ? 7.491   -1.859  5.132   1.00 0.00 ? 26 PHE A CE1  7  
ATOM 7208  C CE2  . PHE A 1 26 ? 8.250   -3.224  3.321   1.00 0.00 ? 26 PHE A CE2  7  
ATOM 7209  C CZ   . PHE A 1 26 ? 8.271   -2.023  4.003   1.00 0.00 ? 26 PHE A CZ   7  
ATOM 7210  H H    . PHE A 1 26 ? 4.440   -6.853  6.800   1.00 0.00 ? 26 PHE A H    7  
ATOM 7211  H HA   . PHE A 1 26 ? 7.128   -6.593  6.364   1.00 0.00 ? 26 PHE A HA   7  
ATOM 7212  H HB2  . PHE A 1 26 ? 5.723   -5.959  4.592   1.00 0.00 ? 26 PHE A HB2  7  
ATOM 7213  H HB3  . PHE A 1 26 ? 4.816   -4.832  5.595   1.00 0.00 ? 26 PHE A HB3  7  
ATOM 7214  H HD1  . PHE A 1 26 ? 6.086   -2.768  6.460   1.00 0.00 ? 26 PHE A HD1  7  
ATOM 7215  H HD2  . PHE A 1 26 ? 7.435   -5.197  3.236   1.00 0.00 ? 26 PHE A HD2  7  
ATOM 7216  H HE1  . PHE A 1 26 ? 7.506   -0.922  5.667   1.00 0.00 ? 26 PHE A HE1  7  
ATOM 7217  H HE2  . PHE A 1 26 ? 8.858   -3.355  2.438   1.00 0.00 ? 26 PHE A HE2  7  
ATOM 7218  H HZ   . PHE A 1 26 ? 8.894   -1.214  3.654   1.00 0.00 ? 26 PHE A HZ   7  
ATOM 7219  N N    . GLU A 1 27 ? 5.994   -4.191  8.312   1.00 0.00 ? 27 GLU A N    7  
ATOM 7220  C CA   . GLU A 1 27 ? 6.395   -3.165  9.267   1.00 0.00 ? 27 GLU A CA   7  
ATOM 7221  C C    . GLU A 1 27 ? 7.444   -3.703  10.235  1.00 0.00 ? 27 GLU A C    7  
ATOM 7222  O O    . GLU A 1 27 ? 8.473   -3.068  10.471  1.00 0.00 ? 27 GLU A O    7  
ATOM 7223  C CB   . GLU A 1 27 ? 5.179   -2.657  10.045  1.00 0.00 ? 27 GLU A CB   7  
ATOM 7224  C CG   . GLU A 1 27 ? 3.968   -2.381  9.169   1.00 0.00 ? 27 GLU A CG   7  
ATOM 7225  C CD   . GLU A 1 27 ? 4.314   -1.574  7.933   1.00 0.00 ? 27 GLU A CD   7  
ATOM 7226  O OE1  . GLU A 1 27 ? 5.146   -0.649  8.041   1.00 0.00 ? 27 GLU A OE1  7  
ATOM 7227  O OE2  . GLU A 1 27 ? 3.753   -1.869  6.857   1.00 0.00 ? 27 GLU A OE2  7  
ATOM 7228  H H    . GLU A 1 27 ? 5.040   -4.380  8.185   1.00 0.00 ? 27 GLU A H    7  
ATOM 7229  H HA   . GLU A 1 27 ? 6.823   -2.344  8.711   1.00 0.00 ? 27 GLU A HA   7  
ATOM 7230  H HB2  . GLU A 1 27 ? 4.904   -3.397  10.782  1.00 0.00 ? 27 GLU A HB2  7  
ATOM 7231  H HB3  . GLU A 1 27 ? 5.448   -1.741  10.551  1.00 0.00 ? 27 GLU A HB3  7  
ATOM 7232  H HG2  . GLU A 1 27 ? 3.542   -3.323  8.858   1.00 0.00 ? 27 GLU A HG2  7  
ATOM 7233  H HG3  . GLU A 1 27 ? 3.240   -1.831  9.748   1.00 0.00 ? 27 GLU A HG3  7  
ATOM 7234  N N    . THR A 1 28 ? 7.176   -4.879  10.795  1.00 0.00 ? 28 THR A N    7  
ATOM 7235  C CA   . THR A 1 28 ? 8.094   -5.503  11.739  1.00 0.00 ? 28 THR A CA   7  
ATOM 7236  C C    . THR A 1 28 ? 9.339   -6.026  11.031  1.00 0.00 ? 28 THR A C    7  
ATOM 7237  O O    . THR A 1 28 ? 10.405  -6.140  11.635  1.00 0.00 ? 28 THR A O    7  
ATOM 7238  C CB   . THR A 1 28 ? 7.420   -6.664  12.495  1.00 0.00 ? 28 THR A CB   7  
ATOM 7239  O OG1  . THR A 1 28 ? 6.820   -7.571  11.564  1.00 0.00 ? 28 THR A OG1  7  
ATOM 7240  C CG2  . THR A 1 28 ? 6.363   -6.142  13.456  1.00 0.00 ? 28 THR A CG2  7  
ATOM 7241  H H    . THR A 1 28 ? 6.340   -5.336  10.567  1.00 0.00 ? 28 THR A H    7  
ATOM 7242  H HA   . THR A 1 28 ? 8.390   -4.755  12.461  1.00 0.00 ? 28 THR A HA   7  
ATOM 7243  H HB   . THR A 1 28 ? 8.174   -7.189  13.063  1.00 0.00 ? 28 THR A HB   7  
ATOM 7244  H HG1  . THR A 1 28 ? 6.640   -8.406  12.002  1.00 0.00 ? 28 THR A HG1  7  
ATOM 7245  H HG21 . THR A 1 28 ? 5.865   -6.975  13.930  1.00 0.00 ? 28 THR A HG21 7  
ATOM 7246  H HG22 . THR A 1 28 ? 5.640   -5.553  12.912  1.00 0.00 ? 28 THR A HG22 7  
ATOM 7247  H HG23 . THR A 1 28 ? 6.834   -5.528  14.210  1.00 0.00 ? 28 THR A HG23 7  
ATOM 7248  N N    . GLN A 1 29 ? 9.195   -6.344  9.749   1.00 0.00 ? 29 GLN A N    7  
ATOM 7249  C CA   . GLN A 1 29 ? 10.309  -6.856  8.959   1.00 0.00 ? 29 GLN A CA   7  
ATOM 7250  C C    . GLN A 1 29 ? 10.068  -6.634  7.470   1.00 0.00 ? 29 GLN A C    7  
ATOM 7251  O O    . GLN A 1 29 ? 9.171   -7.235  6.879   1.00 0.00 ? 29 GLN A O    7  
ATOM 7252  C CB   . GLN A 1 29 ? 10.517  -8.345  9.238   1.00 0.00 ? 29 GLN A CB   7  
ATOM 7253  C CG   . GLN A 1 29 ? 11.961  -8.796  9.090   1.00 0.00 ? 29 GLN A CG   7  
ATOM 7254  C CD   . GLN A 1 29 ? 12.097  -10.305 9.023   1.00 0.00 ? 29 GLN A CD   7  
ATOM 7255  O OE1  . GLN A 1 29 ? 11.378  -11.035 9.706   1.00 0.00 ? 29 GLN A OE1  7  
ATOM 7256  N NE2  . GLN A 1 29 ? 13.024  -10.780 8.199   1.00 0.00 ? 29 GLN A NE2  7  
ATOM 7257  H H    . GLN A 1 29 ? 8.320   -6.231  9.324   1.00 0.00 ? 29 GLN A H    7  
ATOM 7258  H HA   . GLN A 1 29 ? 11.197  -6.317  9.252   1.00 0.00 ? 29 GLN A HA   7  
ATOM 7259  H HB2  . GLN A 1 29 ? 10.197  -8.559  10.247  1.00 0.00 ? 29 GLN A HB2  7  
ATOM 7260  H HB3  . GLN A 1 29 ? 9.912   -8.916  8.549   1.00 0.00 ? 29 GLN A HB3  7  
ATOM 7261  H HG2  . GLN A 1 29 ? 12.365  -8.374  8.182   1.00 0.00 ? 29 GLN A HG2  7  
ATOM 7262  H HG3  . GLN A 1 29 ? 12.526  -8.435  9.937   1.00 0.00 ? 29 GLN A HG3  7  
ATOM 7263  H HE21 . GLN A 1 29 ? 13.560  -10.138 7.688   1.00 0.00 ? 29 GLN A HE21 7  
ATOM 7264  H HE22 . GLN A 1 29 ? 13.134  -11.751 8.137   1.00 0.00 ? 29 GLN A HE22 7  
ATOM 7265  N N    . LYS A 1 30 ? 10.875  -5.766  6.868   1.00 0.00 ? 30 LYS A N    7  
ATOM 7266  C CA   . LYS A 1 30 ? 10.751  -5.465  5.447   1.00 0.00 ? 30 LYS A CA   7  
ATOM 7267  C C    . LYS A 1 30 ? 10.867  -6.734  4.609   1.00 0.00 ? 30 LYS A C    7  
ATOM 7268  O O    . LYS A 1 30 ? 10.338  -6.808  3.500   1.00 0.00 ? 30 LYS A O    7  
ATOM 7269  C CB   . LYS A 1 30 ? 11.825  -4.461  5.022   1.00 0.00 ? 30 LYS A CB   7  
ATOM 7270  C CG   . LYS A 1 30 ? 11.877  -3.219  5.896   1.00 0.00 ? 30 LYS A CG   7  
ATOM 7271  C CD   . LYS A 1 30 ? 10.617  -2.382  5.751   1.00 0.00 ? 30 LYS A CD   7  
ATOM 7272  C CE   . LYS A 1 30 ? 10.394  -1.495  6.966   1.00 0.00 ? 30 LYS A CE   7  
ATOM 7273  N NZ   . LYS A 1 30 ? 9.671   -2.213  8.052   1.00 0.00 ? 30 LYS A NZ   7  
ATOM 7274  H H    . LYS A 1 30 ? 11.572  -5.319  7.393   1.00 0.00 ? 30 LYS A H    7  
ATOM 7275  H HA   . LYS A 1 30 ? 9.778   -5.028  5.284   1.00 0.00 ? 30 LYS A HA   7  
ATOM 7276  H HB2  . LYS A 1 30 ? 12.790  -4.945  5.063   1.00 0.00 ? 30 LYS A HB2  7  
ATOM 7277  H HB3  . LYS A 1 30 ? 11.630  -4.152  4.005   1.00 0.00 ? 30 LYS A HB3  7  
ATOM 7278  H HG2  . LYS A 1 30 ? 11.979  -3.520  6.928   1.00 0.00 ? 30 LYS A HG2  7  
ATOM 7279  H HG3  . LYS A 1 30 ? 12.730  -2.622  5.607   1.00 0.00 ? 30 LYS A HG3  7  
ATOM 7280  H HD2  . LYS A 1 30 ? 10.709  -1.757  4.875   1.00 0.00 ? 30 LYS A HD2  7  
ATOM 7281  H HD3  . LYS A 1 30 ? 9.768   -3.042  5.637   1.00 0.00 ? 30 LYS A HD3  7  
ATOM 7282  H HE2  . LYS A 1 30 ? 11.353  -1.169  7.338   1.00 0.00 ? 30 LYS A HE2  7  
ATOM 7283  H HE3  . LYS A 1 30 ? 9.813   -0.636  6.665   1.00 0.00 ? 30 LYS A HE3  7  
ATOM 7284  H HZ1  . LYS A 1 30 ? 10.195  -3.069  8.325   1.00 0.00 ? 30 LYS A HZ1  7  
ATOM 7285  H HZ2  . LYS A 1 30 ? 8.723   -2.491  7.727   1.00 0.00 ? 30 LYS A HZ2  7  
ATOM 7286  H HZ3  . LYS A 1 30 ? 9.574   -1.598  8.884   1.00 0.00 ? 30 LYS A HZ3  7  
ATOM 7287  N N    . TYR A 1 31 ? 11.561  -7.731  5.147   1.00 0.00 ? 31 TYR A N    7  
ATOM 7288  C CA   . TYR A 1 31 ? 11.747  -8.997  4.448   1.00 0.00 ? 31 TYR A CA   7  
ATOM 7289  C C    . TYR A 1 31 ? 11.422  -10.176 5.360   1.00 0.00 ? 31 TYR A C    7  
ATOM 7290  O O    . TYR A 1 31 ? 11.256  -10.013 6.570   1.00 0.00 ? 31 TYR A O    7  
ATOM 7291  C CB   . TYR A 1 31 ? 13.184  -9.115  3.936   1.00 0.00 ? 31 TYR A CB   7  
ATOM 7292  C CG   . TYR A 1 31 ? 13.389  -8.518  2.562   1.00 0.00 ? 31 TYR A CG   7  
ATOM 7293  C CD1  . TYR A 1 31 ? 13.569  -7.151  2.397   1.00 0.00 ? 31 TYR A CD1  7  
ATOM 7294  C CD2  . TYR A 1 31 ? 13.403  -9.323  1.429   1.00 0.00 ? 31 TYR A CD2  7  
ATOM 7295  C CE1  . TYR A 1 31 ? 13.755  -6.601  1.143   1.00 0.00 ? 31 TYR A CE1  7  
ATOM 7296  C CE2  . TYR A 1 31 ? 13.590  -8.782  0.172   1.00 0.00 ? 31 TYR A CE2  7  
ATOM 7297  C CZ   . TYR A 1 31 ? 13.765  -7.421  0.034   1.00 0.00 ? 31 TYR A CZ   7  
ATOM 7298  O OH   . TYR A 1 31 ? 13.952  -6.878  -1.216  1.00 0.00 ? 31 TYR A OH   7  
ATOM 7299  H H    . TYR A 1 31 ? 11.960  -7.612  6.034   1.00 0.00 ? 31 TYR A H    7  
ATOM 7300  H HA   . TYR A 1 31 ? 11.073  -9.012  3.604   1.00 0.00 ? 31 TYR A HA   7  
ATOM 7301  H HB2  . TYR A 1 31 ? 13.845  -8.606  4.620   1.00 0.00 ? 31 TYR A HB2  7  
ATOM 7302  H HB3  . TYR A 1 31 ? 13.457  -10.159 3.889   1.00 0.00 ? 31 TYR A HB3  7  
ATOM 7303  H HD1  . TYR A 1 31 ? 13.561  -6.512  3.268   1.00 0.00 ? 31 TYR A HD1  7  
ATOM 7304  H HD2  . TYR A 1 31 ? 13.265  -10.389 1.541   1.00 0.00 ? 31 TYR A HD2  7  
ATOM 7305  H HE1  . TYR A 1 31 ? 13.893  -5.536  1.035   1.00 0.00 ? 31 TYR A HE1  7  
ATOM 7306  H HE2  . TYR A 1 31 ? 13.598  -9.424  -0.697  1.00 0.00 ? 31 TYR A HE2  7  
ATOM 7307  H HH   . TYR A 1 31 ? 13.813  -5.929  -1.177  1.00 0.00 ? 31 TYR A HH   7  
ATOM 7308  N N    . LEU A 1 32 ? 11.332  -11.363 4.772   1.00 0.00 ? 32 LEU A N    7  
ATOM 7309  C CA   . LEU A 1 32 ? 11.027  -12.572 5.530   1.00 0.00 ? 32 LEU A CA   7  
ATOM 7310  C C    . LEU A 1 32 ? 11.720  -13.786 4.921   1.00 0.00 ? 32 LEU A C    7  
ATOM 7311  O O    . LEU A 1 32 ? 11.556  -14.078 3.736   1.00 0.00 ? 32 LEU A O    7  
ATOM 7312  C CB   . LEU A 1 32 ? 9.515   -12.802 5.574   1.00 0.00 ? 32 LEU A CB   7  
ATOM 7313  C CG   . LEU A 1 32 ? 8.681   -11.669 6.172   1.00 0.00 ? 32 LEU A CG   7  
ATOM 7314  C CD1  . LEU A 1 32 ? 7.261   -11.708 5.629   1.00 0.00 ? 32 LEU A CD1  7  
ATOM 7315  C CD2  . LEU A 1 32 ? 8.675   -11.755 7.691   1.00 0.00 ? 32 LEU A CD2  7  
ATOM 7316  H H    . LEU A 1 32 ? 11.474  -11.430 3.805   1.00 0.00 ? 32 LEU A H    7  
ATOM 7317  H HA   . LEU A 1 32 ? 11.391  -12.432 6.537   1.00 0.00 ? 32 LEU A HA   7  
ATOM 7318  H HB2  . LEU A 1 32 ? 9.176   -12.964 4.562   1.00 0.00 ? 32 LEU A HB2  7  
ATOM 7319  H HB3  . LEU A 1 32 ? 9.334   -13.692 6.159   1.00 0.00 ? 32 LEU A HB3  7  
ATOM 7320  H HG   . LEU A 1 32 ? 9.119   -10.721 5.891   1.00 0.00 ? 32 LEU A HG   7  
ATOM 7321  H HD11 . LEU A 1 32 ? 7.187   -11.063 4.767   1.00 0.00 ? 32 LEU A HD11 7  
ATOM 7322  H HD12 . LEU A 1 32 ? 6.574   -11.370 6.392   1.00 0.00 ? 32 LEU A HD12 7  
ATOM 7323  H HD13 . LEU A 1 32 ? 7.012   -12.720 5.344   1.00 0.00 ? 32 LEU A HD13 7  
ATOM 7324  H HD21 . LEU A 1 32 ? 8.482   -12.774 7.993   1.00 0.00 ? 32 LEU A HD21 7  
ATOM 7325  H HD22 . LEU A 1 32 ? 7.904   -11.110 8.086   1.00 0.00 ? 32 LEU A HD22 7  
ATOM 7326  H HD23 . LEU A 1 32 ? 9.636   -11.443 8.073   1.00 0.00 ? 32 LEU A HD23 7  
ATOM 7327  N N    . SER A 1 33 ? 12.494  -14.492 5.740   1.00 0.00 ? 33 SER A N    7  
ATOM 7328  C CA   . SER A 1 33 ? 13.214  -15.674 5.282   1.00 0.00 ? 33 SER A CA   7  
ATOM 7329  C C    . SER A 1 33 ? 12.245  -16.734 4.767   1.00 0.00 ? 33 SER A C    7  
ATOM 7330  O O    . SER A 1 33 ? 11.078  -16.787 5.156   1.00 0.00 ? 33 SER A O    7  
ATOM 7331  C CB   . SER A 1 33 ? 14.064  -16.251 6.415   1.00 0.00 ? 33 SER A CB   7  
ATOM 7332  O OG   . SER A 1 33 ? 14.676  -15.219 7.170   1.00 0.00 ? 33 SER A OG   7  
ATOM 7333  H H    . SER A 1 33 ? 12.585  -14.208 6.674   1.00 0.00 ? 33 SER A H    7  
ATOM 7334  H HA   . SER A 1 33 ? 13.864  -15.374 4.473   1.00 0.00 ? 33 SER A HA   7  
ATOM 7335  H HB2  . SER A 1 33 ? 13.436  -16.836 7.071   1.00 0.00 ? 33 SER A HB2  7  
ATOM 7336  H HB3  . SER A 1 33 ? 14.835  -16.882 5.998   1.00 0.00 ? 33 SER A HB3  7  
ATOM 7337  H HG   . SER A 1 33 ? 14.865  -14.472 6.597   1.00 0.00 ? 33 SER A HG   7  
ATOM 7338  N N    . PRO A 1 34 ? 12.739  -17.600 3.870   1.00 0.00 ? 34 PRO A N    7  
ATOM 7339  C CA   . PRO A 1 34 ? 11.935  -18.676 3.282   1.00 0.00 ? 34 PRO A CA   7  
ATOM 7340  C C    . PRO A 1 34 ? 11.161  -19.462 4.334   1.00 0.00 ? 34 PRO A C    7  
ATOM 7341  O O    . PRO A 1 34 ? 9.980   -19.771 4.169   1.00 0.00 ? 34 PRO A O    7  
ATOM 7342  C CB   . PRO A 1 34 ? 12.978  -19.570 2.607   1.00 0.00 ? 34 PRO A CB   7  
ATOM 7343  C CG   . PRO A 1 34 ? 14.119  -18.660 2.306   1.00 0.00 ? 34 PRO A CG   7  
ATOM 7344  C CD   . PRO A 1 34 ? 14.121  -17.596 3.360   1.00 0.00 ? 34 PRO A CD   7  
ATOM 7345  H HA   . PRO A 1 34 ? 11.248  -18.297 2.539   1.00 0.00 ? 34 PRO A HA   7  
ATOM 7346  H HB2  . PRO A 1 34 ? 13.270  -20.361 3.283   1.00 0.00 ? 34 PRO A HB2  7  
ATOM 7347  H HB3  . PRO A 1 34 ? 12.564  -19.995 1.705   1.00 0.00 ? 34 PRO A HB3  7  
ATOM 7348  H HG2  . PRO A 1 34 ? 15.047  -19.211 2.340   1.00 0.00 ? 34 PRO A HG2  7  
ATOM 7349  H HG3  . PRO A 1 34 ? 13.984  -18.211 1.333   1.00 0.00 ? 34 PRO A HG3  7  
ATOM 7350  H HD2  . PRO A 1 34 ? 14.821  -17.848 4.143   1.00 0.00 ? 34 PRO A HD2  7  
ATOM 7351  H HD3  . PRO A 1 34 ? 14.368  -16.640 2.924   1.00 0.00 ? 34 PRO A HD3  7  
ATOM 7352  N N    . PRO A 1 35 ? 11.838  -19.794 5.443   1.00 0.00 ? 35 PRO A N    7  
ATOM 7353  C CA   . PRO A 1 35 ? 11.232  -20.548 6.545   1.00 0.00 ? 35 PRO A CA   7  
ATOM 7354  C C    . PRO A 1 35 ? 9.878   -19.982 6.958   1.00 0.00 ? 35 PRO A C    7  
ATOM 7355  O O    . PRO A 1 35 ? 8.934   -20.730 7.211   1.00 0.00 ? 35 PRO A O    7  
ATOM 7356  C CB   . PRO A 1 35 ? 12.246  -20.393 7.680   1.00 0.00 ? 35 PRO A CB   7  
ATOM 7357  C CG   . PRO A 1 35 ? 13.549  -20.160 6.996   1.00 0.00 ? 35 PRO A CG   7  
ATOM 7358  C CD   . PRO A 1 35 ? 13.247  -19.459 5.707   1.00 0.00 ? 35 PRO A CD   7  
ATOM 7359  H HA   . PRO A 1 35 ? 11.123  -21.594 6.297   1.00 0.00 ? 35 PRO A HA   7  
ATOM 7360  H HB2  . PRO A 1 35 ? 11.969  -19.553 8.302   1.00 0.00 ? 35 PRO A HB2  7  
ATOM 7361  H HB3  . PRO A 1 35 ? 12.268  -21.295 8.274   1.00 0.00 ? 35 PRO A HB3  7  
ATOM 7362  H HG2  . PRO A 1 35 ? 14.181  -19.538 7.612   1.00 0.00 ? 35 PRO A HG2  7  
ATOM 7363  H HG3  . PRO A 1 35 ? 14.031  -21.105 6.794   1.00 0.00 ? 35 PRO A HG3  7  
ATOM 7364  H HD2  . PRO A 1 35 ? 13.375  -18.393 5.824   1.00 0.00 ? 35 PRO A HD2  7  
ATOM 7365  H HD3  . PRO A 1 35 ? 13.886  -19.833 4.921   1.00 0.00 ? 35 PRO A HD3  7  
ATOM 7366  N N    . GLU A 1 36 ? 9.791   -18.657 7.025   1.00 0.00 ? 36 GLU A N    7  
ATOM 7367  C CA   . GLU A 1 36 ? 8.551   -17.992 7.409   1.00 0.00 ? 36 GLU A CA   7  
ATOM 7368  C C    . GLU A 1 36 ? 7.632   -17.817 6.204   1.00 0.00 ? 36 GLU A C    7  
ATOM 7369  O O    . GLU A 1 36 ? 6.563   -18.423 6.132   1.00 0.00 ? 36 GLU A O    7  
ATOM 7370  C CB   . GLU A 1 36 ? 8.851   -16.630 8.039   1.00 0.00 ? 36 GLU A CB   7  
ATOM 7371  C CG   . GLU A 1 36 ? 9.954   -16.671 9.082   1.00 0.00 ? 36 GLU A CG   7  
ATOM 7372  C CD   . GLU A 1 36 ? 9.432   -16.980 10.472  1.00 0.00 ? 36 GLU A CD   7  
ATOM 7373  O OE1  . GLU A 1 36 ? 9.277   -18.177 10.794  1.00 0.00 ? 36 GLU A OE1  7  
ATOM 7374  O OE2  . GLU A 1 36 ? 9.179   -16.026 11.237  1.00 0.00 ? 36 GLU A OE2  7  
ATOM 7375  H H    . GLU A 1 36 ? 10.578  -18.115 6.812   1.00 0.00 ? 36 GLU A H    7  
ATOM 7376  H HA   . GLU A 1 36 ? 8.054   -18.614 8.139   1.00 0.00 ? 36 GLU A HA   7  
ATOM 7377  H HB2  . GLU A 1 36 ? 9.145   -15.944 7.259   1.00 0.00 ? 36 GLU A HB2  7  
ATOM 7378  H HB3  . GLU A 1 36 ? 7.952   -16.260 8.510   1.00 0.00 ? 36 GLU A HB3  7  
ATOM 7379  H HG2  . GLU A 1 36 ? 10.667  -17.433 8.804   1.00 0.00 ? 36 GLU A HG2  7  
ATOM 7380  H HG3  . GLU A 1 36 ? 10.448  -15.710 9.104   1.00 0.00 ? 36 GLU A HG3  7  
ATOM 7381  N N    . ARG A 1 37 ? 8.056   -16.983 5.260   1.00 0.00 ? 37 ARG A N    7  
ATOM 7382  C CA   . ARG A 1 37 ? 7.271   -16.726 4.059   1.00 0.00 ? 37 ARG A CA   7  
ATOM 7383  C C    . ARG A 1 37 ? 6.517   -17.978 3.624   1.00 0.00 ? 37 ARG A C    7  
ATOM 7384  O O    . ARG A 1 37 ? 5.404   -17.897 3.102   1.00 0.00 ? 37 ARG A O    7  
ATOM 7385  C CB   . ARG A 1 37 ? 8.178   -16.244 2.925   1.00 0.00 ? 37 ARG A CB   7  
ATOM 7386  C CG   . ARG A 1 37 ? 7.464   -15.377 1.901   1.00 0.00 ? 37 ARG A CG   7  
ATOM 7387  C CD   . ARG A 1 37 ? 8.369   -15.045 0.724   1.00 0.00 ? 37 ARG A CD   7  
ATOM 7388  N NE   . ARG A 1 37 ? 9.104   -16.215 0.252   1.00 0.00 ? 37 ARG A NE   7  
ATOM 7389  C CZ   . ARG A 1 37 ? 10.260  -16.615 0.771   1.00 0.00 ? 37 ARG A CZ   7  
ATOM 7390  N NH1  . ARG A 1 37 ? 10.808  -15.943 1.773   1.00 0.00 ? 37 ARG A NH1  7  
ATOM 7391  N NH2  . ARG A 1 37 ? 10.868  -17.690 0.287   1.00 0.00 ? 37 ARG A NH2  7  
ATOM 7392  H H    . ARG A 1 37 ? 8.917   -16.529 5.375   1.00 0.00 ? 37 ARG A H    7  
ATOM 7393  H HA   . ARG A 1 37 ? 6.555   -15.951 4.290   1.00 0.00 ? 37 ARG A HA   7  
ATOM 7394  H HB2  . ARG A 1 37 ? 8.989   -15.669 3.347   1.00 0.00 ? 37 ARG A HB2  7  
ATOM 7395  H HB3  . ARG A 1 37 ? 8.584   -17.104 2.415   1.00 0.00 ? 37 ARG A HB3  7  
ATOM 7396  H HG2  . ARG A 1 37 ? 6.597   -15.907 1.536   1.00 0.00 ? 37 ARG A HG2  7  
ATOM 7397  H HG3  . ARG A 1 37 ? 7.153   -14.458 2.375   1.00 0.00 ? 37 ARG A HG3  7  
ATOM 7398  H HD2  . ARG A 1 37 ? 7.761   -14.664 -0.083  1.00 0.00 ? 37 ARG A HD2  7  
ATOM 7399  H HD3  . ARG A 1 37 ? 9.074   -14.288 1.032   1.00 0.00 ? 37 ARG A HD3  7  
ATOM 7400  H HE   . ARG A 1 37 ? 8.716   -16.727 -0.488  1.00 0.00 ? 37 ARG A HE   7  
ATOM 7401  H HH11 . ARG A 1 37 ? 10.352  -15.133 2.140   1.00 0.00 ? 37 ARG A HH11 7  
ATOM 7402  H HH12 . ARG A 1 37 ? 11.678  -16.247 2.162   1.00 0.00 ? 37 ARG A HH12 7  
ATOM 7403  H HH21 . ARG A 1 37 ? 10.457  -18.200 -0.468  1.00 0.00 ? 37 ARG A HH21 7  
ATOM 7404  H HH22 . ARG A 1 37 ? 11.738  -17.991 0.678   1.00 0.00 ? 37 ARG A HH22 7  
ATOM 7405  N N    . LYS A 1 38 ? 7.129   -19.137 3.841   1.00 0.00 ? 38 LYS A N    7  
ATOM 7406  C CA   . LYS A 1 38 ? 6.517   -20.408 3.473   1.00 0.00 ? 38 LYS A CA   7  
ATOM 7407  C C    . LYS A 1 38 ? 5.253   -20.660 4.290   1.00 0.00 ? 38 LYS A C    7  
ATOM 7408  O O    . LYS A 1 38 ? 4.179   -20.888 3.734   1.00 0.00 ? 38 LYS A O    7  
ATOM 7409  C CB   . LYS A 1 38 ? 7.509   -21.555 3.681   1.00 0.00 ? 38 LYS A CB   7  
ATOM 7410  C CG   . LYS A 1 38 ? 8.530   -21.686 2.565   1.00 0.00 ? 38 LYS A CG   7  
ATOM 7411  C CD   . LYS A 1 38 ? 9.743   -22.485 3.010   1.00 0.00 ? 38 LYS A CD   7  
ATOM 7412  C CE   . LYS A 1 38 ? 10.385  -23.220 1.843   1.00 0.00 ? 38 LYS A CE   7  
ATOM 7413  N NZ   . LYS A 1 38 ? 10.431  -22.379 0.615   1.00 0.00 ? 38 LYS A NZ   7  
ATOM 7414  H H    . LYS A 1 38 ? 8.016   -19.138 4.261   1.00 0.00 ? 38 LYS A H    7  
ATOM 7415  H HA   . LYS A 1 38 ? 6.252   -20.358 2.428   1.00 0.00 ? 38 LYS A HA   7  
ATOM 7416  H HB2  . LYS A 1 38 ? 8.038   -21.393 4.609   1.00 0.00 ? 38 LYS A HB2  7  
ATOM 7417  H HB3  . LYS A 1 38 ? 6.958   -22.483 3.749   1.00 0.00 ? 38 LYS A HB3  7  
ATOM 7418  H HG2  . LYS A 1 38 ? 8.070   -22.188 1.726   1.00 0.00 ? 38 LYS A HG2  7  
ATOM 7419  H HG3  . LYS A 1 38 ? 8.851   -20.699 2.265   1.00 0.00 ? 38 LYS A HG3  7  
ATOM 7420  H HD2  . LYS A 1 38 ? 10.469  -21.811 3.440   1.00 0.00 ? 38 LYS A HD2  7  
ATOM 7421  H HD3  . LYS A 1 38 ? 9.435   -23.207 3.753   1.00 0.00 ? 38 LYS A HD3  7  
ATOM 7422  H HE2  . LYS A 1 38 ? 11.392  -23.495 2.118   1.00 0.00 ? 38 LYS A HE2  7  
ATOM 7423  H HE3  . LYS A 1 38 ? 9.812   -24.112 1.638   1.00 0.00 ? 38 LYS A HE3  7  
ATOM 7424  H HZ1  . LYS A 1 38 ? 11.138  -22.755 -0.049  1.00 0.00 ? 38 LYS A HZ1  7  
ATOM 7425  H HZ2  . LYS A 1 38 ? 10.687  -21.402 0.861   1.00 0.00 ? 38 LYS A HZ2  7  
ATOM 7426  H HZ3  . LYS A 1 38 ? 9.501   -22.376 0.150   1.00 0.00 ? 38 LYS A HZ3  7  
ATOM 7427  N N    . ARG A 1 39 ? 5.390   -20.616 5.611   1.00 0.00 ? 39 ARG A N    7  
ATOM 7428  C CA   . ARG A 1 39 ? 4.259   -20.839 6.504   1.00 0.00 ? 39 ARG A CA   7  
ATOM 7429  C C    . ARG A 1 39 ? 3.212   -19.741 6.341   1.00 0.00 ? 39 ARG A C    7  
ATOM 7430  O O    . ARG A 1 39 ? 2.011   -20.011 6.314   1.00 0.00 ? 39 ARG A O    7  
ATOM 7431  C CB   . ARG A 1 39 ? 4.732   -20.896 7.957   1.00 0.00 ? 39 ARG A CB   7  
ATOM 7432  C CG   . ARG A 1 39 ? 5.690   -22.042 8.241   1.00 0.00 ? 39 ARG A CG   7  
ATOM 7433  C CD   . ARG A 1 39 ? 6.442   -21.829 9.546   1.00 0.00 ? 39 ARG A CD   7  
ATOM 7434  N NE   . ARG A 1 39 ? 6.789   -23.092 10.190  1.00 0.00 ? 39 ARG A NE   7  
ATOM 7435  C CZ   . ARG A 1 39 ? 5.888   -23.959 10.642  1.00 0.00 ? 39 ARG A CZ   7  
ATOM 7436  N NH1  . ARG A 1 39 ? 4.594   -23.699 10.519  1.00 0.00 ? 39 ARG A NH1  7  
ATOM 7437  N NH2  . ARG A 1 39 ? 6.283   -25.088 11.217  1.00 0.00 ? 39 ARG A NH2  7  
ATOM 7438  H H    . ARG A 1 39 ? 6.272   -20.430 5.995   1.00 0.00 ? 39 ARG A H    7  
ATOM 7439  H HA   . ARG A 1 39 ? 3.812   -21.787 6.243   1.00 0.00 ? 39 ARG A HA   7  
ATOM 7440  H HB2  . ARG A 1 39 ? 5.233   -19.970 8.197   1.00 0.00 ? 39 ARG A HB2  7  
ATOM 7441  H HB3  . ARG A 1 39 ? 3.871   -21.007 8.599   1.00 0.00 ? 39 ARG A HB3  7  
ATOM 7442  H HG2  . ARG A 1 39 ? 5.127   -22.961 8.309   1.00 0.00 ? 39 ARG A HG2  7  
ATOM 7443  H HG3  . ARG A 1 39 ? 6.402   -22.112 7.433   1.00 0.00 ? 39 ARG A HG3  7  
ATOM 7444  H HD2  . ARG A 1 39 ? 7.349   -21.281 9.338   1.00 0.00 ? 39 ARG A HD2  7  
ATOM 7445  H HD3  . ARG A 1 39 ? 5.819   -21.253 10.214  1.00 0.00 ? 39 ARG A HD3  7  
ATOM 7446  H HE   . ARG A 1 39 ? 7.740   -23.304 10.292  1.00 0.00 ? 39 ARG A HE   7  
ATOM 7447  H HH11 . ARG A 1 39 ? 4.294   -22.850 10.085  1.00 0.00 ? 39 ARG A HH11 7  
ATOM 7448  H HH12 . ARG A 1 39 ? 3.918   -24.354 10.858  1.00 0.00 ? 39 ARG A HH12 7  
ATOM 7449  H HH21 . ARG A 1 39 ? 7.257   -25.287 11.311  1.00 0.00 ? 39 ARG A HH21 7  
ATOM 7450  H HH22 . ARG A 1 39 ? 5.604   -25.739 11.556  1.00 0.00 ? 39 ARG A HH22 7  
ATOM 7451  N N    . LEU A 1 40 ? 3.676   -18.501 6.233   1.00 0.00 ? 40 LEU A N    7  
ATOM 7452  C CA   . LEU A 1 40 ? 2.781   -17.360 6.073   1.00 0.00 ? 40 LEU A CA   7  
ATOM 7453  C C    . LEU A 1 40 ? 1.803   -17.592 4.926   1.00 0.00 ? 40 LEU A C    7  
ATOM 7454  O O    . LEU A 1 40 ? 0.589   -17.491 5.103   1.00 0.00 ? 40 LEU A O    7  
ATOM 7455  C CB   . LEU A 1 40 ? 3.588   -16.085 5.820   1.00 0.00 ? 40 LEU A CB   7  
ATOM 7456  C CG   . LEU A 1 40 ? 2.864   -14.767 6.096   1.00 0.00 ? 40 LEU A CG   7  
ATOM 7457  C CD1  . LEU A 1 40 ? 2.579   -14.616 7.582   1.00 0.00 ? 40 LEU A CD1  7  
ATOM 7458  C CD2  . LEU A 1 40 ? 3.684   -13.591 5.586   1.00 0.00 ? 40 LEU A CD2  7  
ATOM 7459  H H    . LEU A 1 40 ? 4.644   -18.347 6.261   1.00 0.00 ? 40 LEU A H    7  
ATOM 7460  H HA   . LEU A 1 40 ? 2.222   -17.246 6.990   1.00 0.00 ? 40 LEU A HA   7  
ATOM 7461  H HB2  . LEU A 1 40 ? 4.465   -16.118 6.448   1.00 0.00 ? 40 LEU A HB2  7  
ATOM 7462  H HB3  . LEU A 1 40 ? 3.890   -16.086 4.782   1.00 0.00 ? 40 LEU A HB3  7  
ATOM 7463  H HG   . LEU A 1 40 ? 1.917   -14.767 5.574   1.00 0.00 ? 40 LEU A HG   7  
ATOM 7464  H HD11 . LEU A 1 40 ? 1.967   -15.439 7.917   1.00 0.00 ? 40 LEU A HD11 7  
ATOM 7465  H HD12 . LEU A 1 40 ? 2.058   -13.686 7.756   1.00 0.00 ? 40 LEU A HD12 7  
ATOM 7466  H HD13 . LEU A 1 40 ? 3.511   -14.613 8.129   1.00 0.00 ? 40 LEU A HD13 7  
ATOM 7467  H HD21 . LEU A 1 40 ? 4.034   -13.006 6.424   1.00 0.00 ? 40 LEU A HD21 7  
ATOM 7468  H HD22 . LEU A 1 40 ? 3.069   -12.973 4.948   1.00 0.00 ? 40 LEU A HD22 7  
ATOM 7469  H HD23 . LEU A 1 40 ? 4.530   -13.959 5.025   1.00 0.00 ? 40 LEU A HD23 7  
ATOM 7470  N N    . ALA A 1 41 ? 2.339   -17.906 3.752   1.00 0.00 ? 41 ALA A N    7  
ATOM 7471  C CA   . ALA A 1 41 ? 1.513   -18.157 2.577   1.00 0.00 ? 41 ALA A CA   7  
ATOM 7472  C C    . ALA A 1 41 ? 0.432   -19.190 2.877   1.00 0.00 ? 41 ALA A C    7  
ATOM 7473  O O    . ALA A 1 41 ? -0.592  -19.249 2.195   1.00 0.00 ? 41 ALA A O    7  
ATOM 7474  C CB   . ALA A 1 41 ? 2.378   -18.618 1.413   1.00 0.00 ? 41 ALA A CB   7  
ATOM 7475  H H    . ALA A 1 41 ? 3.314   -17.972 3.674   1.00 0.00 ? 41 ALA A H    7  
ATOM 7476  H HA   . ALA A 1 41 ? 1.040   -17.227 2.297   1.00 0.00 ? 41 ALA A HA   7  
ATOM 7477  H HB1  . ALA A 1 41 ? 2.445   -17.826 0.680   1.00 0.00 ? 41 ALA A HB1  7  
ATOM 7478  H HB2  . ALA A 1 41 ? 3.366   -18.861 1.773   1.00 0.00 ? 41 ALA A HB2  7  
ATOM 7479  H HB3  . ALA A 1 41 ? 1.934   -19.492 0.959   1.00 0.00 ? 41 ALA A HB3  7  
ATOM 7480  N N    . LYS A 1 42 ? 0.666   -20.005 3.900   1.00 0.00 ? 42 LYS A N    7  
ATOM 7481  C CA   . LYS A 1 42 ? -0.288  -21.036 4.292   1.00 0.00 ? 42 LYS A CA   7  
ATOM 7482  C C    . LYS A 1 42 ? -1.246  -20.514 5.357   1.00 0.00 ? 42 LYS A C    7  
ATOM 7483  O O    . LYS A 1 42 ? -2.366  -21.006 5.492   1.00 0.00 ? 42 LYS A O    7  
ATOM 7484  C CB   . LYS A 1 42 ? 0.451   -22.270 4.815   1.00 0.00 ? 42 LYS A CB   7  
ATOM 7485  C CG   . LYS A 1 42 ? -0.472  -23.337 5.378   1.00 0.00 ? 42 LYS A CG   7  
ATOM 7486  C CD   . LYS A 1 42 ? -1.186  -24.097 4.274   1.00 0.00 ? 42 LYS A CD   7  
ATOM 7487  C CE   . LYS A 1 42 ? -2.254  -25.023 4.835   1.00 0.00 ? 42 LYS A CE   7  
ATOM 7488  N NZ   . LYS A 1 42 ? -3.113  -25.594 3.760   1.00 0.00 ? 42 LYS A NZ   7  
ATOM 7489  H H    . LYS A 1 42 ? 1.501   -19.909 4.406   1.00 0.00 ? 42 LYS A H    7  
ATOM 7490  H HA   . LYS A 1 42 ? -0.856  -21.311 3.417   1.00 0.00 ? 42 LYS A HA   7  
ATOM 7491  H HB2  . LYS A 1 42 ? 1.018   -22.705 4.006   1.00 0.00 ? 42 LYS A HB2  7  
ATOM 7492  H HB3  . LYS A 1 42 ? 1.131   -21.963 5.596   1.00 0.00 ? 42 LYS A HB3  7  
ATOM 7493  H HG2  . LYS A 1 42 ? 0.112   -24.034 5.960   1.00 0.00 ? 42 LYS A HG2  7  
ATOM 7494  H HG3  . LYS A 1 42 ? -1.209  -22.864 6.013   1.00 0.00 ? 42 LYS A HG3  7  
ATOM 7495  H HD2  . LYS A 1 42 ? -1.654  -23.389 3.606   1.00 0.00 ? 42 LYS A HD2  7  
ATOM 7496  H HD3  . LYS A 1 42 ? -0.463  -24.685 3.727   1.00 0.00 ? 42 LYS A HD3  7  
ATOM 7497  H HE2  . LYS A 1 42 ? -1.771  -25.829 5.364   1.00 0.00 ? 42 LYS A HE2  7  
ATOM 7498  H HE3  . LYS A 1 42 ? -2.874  -24.463 5.519   1.00 0.00 ? 42 LYS A HE3  7  
ATOM 7499  H HZ1  . LYS A 1 42 ? -3.699  -24.847 3.337   1.00 0.00 ? 42 LYS A HZ1  7  
ATOM 7500  H HZ2  . LYS A 1 42 ? -3.736  -26.328 4.153   1.00 0.00 ? 42 LYS A HZ2  7  
ATOM 7501  H HZ3  . LYS A 1 42 ? -2.521  -26.019 3.018   1.00 0.00 ? 42 LYS A HZ3  7  
ATOM 7502  N N    . MET A 1 43 ? -0.800  -19.514 6.110   1.00 0.00 ? 43 MET A N    7  
ATOM 7503  C CA   . MET A 1 43 ? -1.620  -18.924 7.162   1.00 0.00 ? 43 MET A CA   7  
ATOM 7504  C C    . MET A 1 43 ? -2.651  -17.966 6.574   1.00 0.00 ? 43 MET A C    7  
ATOM 7505  O O    . MET A 1 43 ? -3.822  -17.986 6.957   1.00 0.00 ? 43 MET A O    7  
ATOM 7506  C CB   . MET A 1 43 ? -0.739  -18.187 8.172   1.00 0.00 ? 43 MET A CB   7  
ATOM 7507  C CG   . MET A 1 43 ? -1.506  -17.207 9.046   1.00 0.00 ? 43 MET A CG   7  
ATOM 7508  S SD   . MET A 1 43 ? -0.749  -16.982 10.667  1.00 0.00 ? 43 MET A SD   7  
ATOM 7509  C CE   . MET A 1 43 ? 0.443   -15.694 10.308  1.00 0.00 ? 43 MET A CE   7  
ATOM 7510  H H    . MET A 1 43 ? 0.102   -19.164 5.955   1.00 0.00 ? 43 MET A H    7  
ATOM 7511  H HA   . MET A 1 43 ? -2.138  -19.726 7.667   1.00 0.00 ? 43 MET A HA   7  
ATOM 7512  H HB2  . MET A 1 43 ? -0.264  -18.913 8.815   1.00 0.00 ? 43 MET A HB2  7  
ATOM 7513  H HB3  . MET A 1 43 ? 0.022   -17.639 7.637   1.00 0.00 ? 43 MET A HB3  7  
ATOM 7514  H HG2  . MET A 1 43 ? -1.541  -16.251 8.545   1.00 0.00 ? 43 MET A HG2  7  
ATOM 7515  H HG3  . MET A 1 43 ? -2.511  -17.578 9.181   1.00 0.00 ? 43 MET A HG3  7  
ATOM 7516  H HE1  . MET A 1 43 ? 1.350   -16.138 9.928   1.00 0.00 ? 43 MET A HE1  7  
ATOM 7517  H HE2  . MET A 1 43 ? 0.034   -15.022 9.568   1.00 0.00 ? 43 MET A HE2  7  
ATOM 7518  H HE3  . MET A 1 43 ? 0.661   -15.144 11.212  1.00 0.00 ? 43 MET A HE3  7  
ATOM 7519  N N    . LEU A 1 44 ? -2.209  -17.128 5.643   1.00 0.00 ? 44 LEU A N    7  
ATOM 7520  C CA   . LEU A 1 44 ? -3.094  -16.161 5.002   1.00 0.00 ? 44 LEU A CA   7  
ATOM 7521  C C    . LEU A 1 44 ? -3.714  -16.745 3.736   1.00 0.00 ? 44 LEU A C    7  
ATOM 7522  O O    . LEU A 1 44 ? -4.491  -16.081 3.052   1.00 0.00 ? 44 LEU A O    7  
ATOM 7523  C CB   . LEU A 1 44 ? -2.326  -14.882 4.664   1.00 0.00 ? 44 LEU A CB   7  
ATOM 7524  C CG   . LEU A 1 44 ? -1.545  -14.245 5.814   1.00 0.00 ? 44 LEU A CG   7  
ATOM 7525  C CD1  . LEU A 1 44 ? -0.534  -13.242 5.281   1.00 0.00 ? 44 LEU A CD1  7  
ATOM 7526  C CD2  . LEU A 1 44 ? -2.494  -13.577 6.798   1.00 0.00 ? 44 LEU A CD2  7  
ATOM 7527  H H    . LEU A 1 44 ? -1.267  -17.159 5.379   1.00 0.00 ? 44 LEU A H    7  
ATOM 7528  H HA   . LEU A 1 44 ? -3.885  -15.923 5.698   1.00 0.00 ? 44 LEU A HA   7  
ATOM 7529  H HB2  . LEU A 1 44 ? -1.624  -15.116 3.878   1.00 0.00 ? 44 LEU A HB2  7  
ATOM 7530  H HB3  . LEU A 1 44 ? -3.039  -14.154 4.304   1.00 0.00 ? 44 LEU A HB3  7  
ATOM 7531  H HG   . LEU A 1 44 ? -1.002  -15.016 6.343   1.00 0.00 ? 44 LEU A HG   7  
ATOM 7532  H HD11 . LEU A 1 44 ? -0.145  -12.654 6.099   1.00 0.00 ? 44 LEU A HD11 7  
ATOM 7533  H HD12 . LEU A 1 44 ? -1.015  -12.590 4.567   1.00 0.00 ? 44 LEU A HD12 7  
ATOM 7534  H HD13 . LEU A 1 44 ? 0.276   -13.769 4.798   1.00 0.00 ? 44 LEU A HD13 7  
ATOM 7535  H HD21 . LEU A 1 44 ? -3.381  -13.250 6.276   1.00 0.00 ? 44 LEU A HD21 7  
ATOM 7536  H HD22 . LEU A 1 44 ? -2.006  -12.724 7.247   1.00 0.00 ? 44 LEU A HD22 7  
ATOM 7537  H HD23 . LEU A 1 44 ? -2.769  -14.282 7.569   1.00 0.00 ? 44 LEU A HD23 7  
ATOM 7538  N N    . GLN A 1 45 ? -3.365  -17.991 3.434   1.00 0.00 ? 45 GLN A N    7  
ATOM 7539  C CA   . GLN A 1 45 ? -3.888  -18.665 2.251   1.00 0.00 ? 45 GLN A CA   7  
ATOM 7540  C C    . GLN A 1 45 ? -3.369  -18.008 0.976   1.00 0.00 ? 45 GLN A C    7  
ATOM 7541  O O    . GLN A 1 45 ? -4.091  -17.897 -0.016  1.00 0.00 ? 45 GLN A O    7  
ATOM 7542  C CB   . GLN A 1 45 ? -5.417  -18.646 2.263   1.00 0.00 ? 45 GLN A CB   7  
ATOM 7543  C CG   . GLN A 1 45 ? -6.022  -19.136 3.568   1.00 0.00 ? 45 GLN A CG   7  
ATOM 7544  C CD   . GLN A 1 45 ? -7.530  -19.278 3.496   1.00 0.00 ? 45 GLN A CD   7  
ATOM 7545  O OE1  . GLN A 1 45 ? -8.110  -19.319 2.411   1.00 0.00 ? 45 GLN A OE1  7  
ATOM 7546  N NE2  . GLN A 1 45 ? -8.173  -19.354 4.655   1.00 0.00 ? 45 GLN A NE2  7  
ATOM 7547  H H    . GLN A 1 45 ? -2.741  -18.468 4.019   1.00 0.00 ? 45 GLN A H    7  
ATOM 7548  H HA   . GLN A 1 45 ? -3.549  -19.689 2.276   1.00 0.00 ? 45 GLN A HA   7  
ATOM 7549  H HB2  . GLN A 1 45 ? -5.754  -17.635 2.092   1.00 0.00 ? 45 GLN A HB2  7  
ATOM 7550  H HB3  . GLN A 1 45 ? -5.779  -19.277 1.464   1.00 0.00 ? 45 GLN A HB3  7  
ATOM 7551  H HG2  . GLN A 1 45 ? -5.597  -20.100 3.808   1.00 0.00 ? 45 GLN A HG2  7  
ATOM 7552  H HG3  . GLN A 1 45 ? -5.778  -18.432 4.350   1.00 0.00 ? 45 GLN A HG3  7  
ATOM 7553  H HE21 . GLN A 1 45 ? -7.646  -19.314 5.481   1.00 0.00 ? 45 GLN A HE21 7  
ATOM 7554  H HE22 . GLN A 1 45 ? -9.148  -19.445 4.638   1.00 0.00 ? 45 GLN A HE22 7  
ATOM 7555  N N    . LEU A 1 46 ? -2.114  -17.573 1.009   1.00 0.00 ? 46 LEU A N    7  
ATOM 7556  C CA   . LEU A 1 46 ? -1.498  -16.926 -0.144  1.00 0.00 ? 46 LEU A CA   7  
ATOM 7557  C C    . LEU A 1 46 ? -0.379  -17.789 -0.719  1.00 0.00 ? 46 LEU A C    7  
ATOM 7558  O O    . LEU A 1 46 ? -0.115  -18.887 -0.230  1.00 0.00 ? 46 LEU A O    7  
ATOM 7559  C CB   . LEU A 1 46 ? -0.948  -15.554 0.250   1.00 0.00 ? 46 LEU A CB   7  
ATOM 7560  C CG   . LEU A 1 46 ? -1.954  -14.578 0.860   1.00 0.00 ? 46 LEU A CG   7  
ATOM 7561  C CD1  . LEU A 1 46 ? -1.234  -13.408 1.512   1.00 0.00 ? 46 LEU A CD1  7  
ATOM 7562  C CD2  . LEU A 1 46 ? -2.928  -14.083 -0.199  1.00 0.00 ? 46 LEU A CD2  7  
ATOM 7563  H H    . LEU A 1 46 ? -1.589  -17.689 1.828   1.00 0.00 ? 46 LEU A H    7  
ATOM 7564  H HA   . LEU A 1 46 ? -2.260  -16.797 -0.898  1.00 0.00 ? 46 LEU A HA   7  
ATOM 7565  H HB2  . LEU A 1 46 ? -0.159  -15.708 0.969   1.00 0.00 ? 46 LEU A HB2  7  
ATOM 7566  H HB3  . LEU A 1 46 ? -0.538  -15.096 -0.639  1.00 0.00 ? 46 LEU A HB3  7  
ATOM 7567  H HG   . LEU A 1 46 ? -2.522  -15.088 1.626   1.00 0.00 ? 46 LEU A HG   7  
ATOM 7568  H HD11 . LEU A 1 46 ? -1.891  -12.934 2.226   1.00 0.00 ? 46 LEU A HD11 7  
ATOM 7569  H HD12 . LEU A 1 46 ? -0.950  -12.693 0.755   1.00 0.00 ? 46 LEU A HD12 7  
ATOM 7570  H HD13 . LEU A 1 46 ? -0.350  -13.766 2.018   1.00 0.00 ? 46 LEU A HD13 7  
ATOM 7571  H HD21 . LEU A 1 46 ? -3.515  -13.271 0.203   1.00 0.00 ? 46 LEU A HD21 7  
ATOM 7572  H HD22 . LEU A 1 46 ? -3.584  -14.891 -0.490  1.00 0.00 ? 46 LEU A HD22 7  
ATOM 7573  H HD23 . LEU A 1 46 ? -2.377  -13.738 -1.062  1.00 0.00 ? 46 LEU A HD23 7  
ATOM 7574  N N    . SER A 1 47 ? 0.276   -17.283 -1.759  1.00 0.00 ? 47 SER A N    7  
ATOM 7575  C CA   . SER A 1 47 ? 1.366   -18.008 -2.402  1.00 0.00 ? 47 SER A CA   7  
ATOM 7576  C C    . SER A 1 47 ? 2.710   -17.360 -2.087  1.00 0.00 ? 47 SER A C    7  
ATOM 7577  O O    . SER A 1 47 ? 2.798   -16.146 -1.905  1.00 0.00 ? 47 SER A O    7  
ATOM 7578  C CB   . SER A 1 47 ? 1.152   -18.055 -3.916  1.00 0.00 ? 47 SER A CB   7  
ATOM 7579  O OG   . SER A 1 47 ? 0.214   -19.058 -4.268  1.00 0.00 ? 47 SER A OG   7  
ATOM 7580  H H    . SER A 1 47 ? 0.019   -16.402 -2.103  1.00 0.00 ? 47 SER A H    7  
ATOM 7581  H HA   . SER A 1 47 ? 1.366   -19.017 -2.016  1.00 0.00 ? 47 SER A HA   7  
ATOM 7582  H HB2  . SER A 1 47 ? 0.782   -17.099 -4.255  1.00 0.00 ? 47 SER A HB2  7  
ATOM 7583  H HB3  . SER A 1 47 ? 2.092   -18.271 -4.403  1.00 0.00 ? 47 SER A HB3  7  
ATOM 7584  H HG   . SER A 1 47 ? 0.009   -18.990 -5.203  1.00 0.00 ? 47 SER A HG   7  
ATOM 7585  N N    . GLU A 1 48 ? 3.755   -18.180 -2.024  1.00 0.00 ? 48 GLU A N    7  
ATOM 7586  C CA   . GLU A 1 48 ? 5.095   -17.686 -1.729  1.00 0.00 ? 48 GLU A CA   7  
ATOM 7587  C C    . GLU A 1 48 ? 5.419   -16.455 -2.570  1.00 0.00 ? 48 GLU A C    7  
ATOM 7588  O O    . GLU A 1 48 ? 5.956   -15.469 -2.065  1.00 0.00 ? 48 GLU A O    7  
ATOM 7589  C CB   . GLU A 1 48 ? 6.134   -18.780 -1.987  1.00 0.00 ? 48 GLU A CB   7  
ATOM 7590  C CG   . GLU A 1 48 ? 6.281   -19.763 -0.837  1.00 0.00 ? 48 GLU A CG   7  
ATOM 7591  C CD   . GLU A 1 48 ? 7.111   -20.976 -1.209  1.00 0.00 ? 48 GLU A CD   7  
ATOM 7592  O OE1  . GLU A 1 48 ? 8.349   -20.841 -1.299  1.00 0.00 ? 48 GLU A OE1  7  
ATOM 7593  O OE2  . GLU A 1 48 ? 6.523   -22.059 -1.411  1.00 0.00 ? 48 GLU A OE2  7  
ATOM 7594  H H    . GLU A 1 48 ? 3.621   -19.138 -2.178  1.00 0.00 ? 48 GLU A H    7  
ATOM 7595  H HA   . GLU A 1 48 ? 5.126   -17.413 -0.685  1.00 0.00 ? 48 GLU A HA   7  
ATOM 7596  H HB2  . GLU A 1 48 ? 5.847   -19.331 -2.871  1.00 0.00 ? 48 GLU A HB2  7  
ATOM 7597  H HB3  . GLU A 1 48 ? 7.093   -18.315 -2.160  1.00 0.00 ? 48 GLU A HB3  7  
ATOM 7598  H HG2  . GLU A 1 48 ? 6.757   -19.260 -0.010  1.00 0.00 ? 48 GLU A HG2  7  
ATOM 7599  H HG3  . GLU A 1 48 ? 5.298   -20.096 -0.537  1.00 0.00 ? 48 GLU A HG3  7  
ATOM 7600  N N    . ARG A 1 49 ? 5.088   -16.520 -3.856  1.00 0.00 ? 49 ARG A N    7  
ATOM 7601  C CA   . ARG A 1 49 ? 5.344   -15.412 -4.768  1.00 0.00 ? 49 ARG A CA   7  
ATOM 7602  C C    . ARG A 1 49 ? 4.544   -14.178 -4.363  1.00 0.00 ? 49 ARG A C    7  
ATOM 7603  O O    . ARG A 1 49 ? 5.014   -13.049 -4.501  1.00 0.00 ? 49 ARG A O    7  
ATOM 7604  C CB   . ARG A 1 49 ? 4.994   -15.812 -6.202  1.00 0.00 ? 49 ARG A CB   7  
ATOM 7605  C CG   . ARG A 1 49 ? 3.555   -15.508 -6.585  1.00 0.00 ? 49 ARG A CG   7  
ATOM 7606  C CD   . ARG A 1 49 ? 3.112   -16.328 -7.787  1.00 0.00 ? 49 ARG A CD   7  
ATOM 7607  N NE   . ARG A 1 49 ? 2.795   -17.706 -7.422  1.00 0.00 ? 49 ARG A NE   7  
ATOM 7608  C CZ   . ARG A 1 49 ? 2.720   -18.699 -8.301  1.00 0.00 ? 49 ARG A CZ   7  
ATOM 7609  N NH1  . ARG A 1 49 ? 2.939   -18.469 -9.588  1.00 0.00 ? 49 ARG A NH1  7  
ATOM 7610  N NH2  . ARG A 1 49 ? 2.427   -19.927 -7.892  1.00 0.00 ? 49 ARG A NH2  7  
ATOM 7611  H H    . ARG A 1 49 ? 4.662   -17.333 -4.200  1.00 0.00 ? 49 ARG A H    7  
ATOM 7612  H HA   . ARG A 1 49 ? 6.397   -15.176 -4.716  1.00 0.00 ? 49 ARG A HA   7  
ATOM 7613  H HB2  . ARG A 1 49 ? 5.644   -15.280 -6.881  1.00 0.00 ? 49 ARG A HB2  7  
ATOM 7614  H HB3  . ARG A 1 49 ? 5.157   -16.873 -6.317  1.00 0.00 ? 49 ARG A HB3  7  
ATOM 7615  H HG2  . ARG A 1 49 ? 2.912   -15.741 -5.748  1.00 0.00 ? 49 ARG A HG2  7  
ATOM 7616  H HG3  . ARG A 1 49 ? 3.470   -14.458 -6.824  1.00 0.00 ? 49 ARG A HG3  7  
ATOM 7617  H HD2  . ARG A 1 49 ? 2.235   -15.868 -8.216  1.00 0.00 ? 49 ARG A HD2  7  
ATOM 7618  H HD3  . ARG A 1 49 ? 3.909   -16.331 -8.515  1.00 0.00 ? 49 ARG A HD3  7  
ATOM 7619  H HE   . ARG A 1 49 ? 2.630   -17.899 -6.476  1.00 0.00 ? 49 ARG A HE   7  
ATOM 7620  H HH11 . ARG A 1 49 ? 3.162   -17.545 -9.899  1.00 0.00 ? 49 ARG A HH11 7  
ATOM 7621  H HH12 . ARG A 1 49 ? 2.883   -19.219 -10.247 1.00 0.00 ? 49 ARG A HH12 7  
ATOM 7622  H HH21 . ARG A 1 49 ? 2.262   -20.105 -6.923  1.00 0.00 ? 49 ARG A HH21 7  
ATOM 7623  H HH22 . ARG A 1 49 ? 2.371   -20.674 -8.554  1.00 0.00 ? 49 ARG A HH22 7  
ATOM 7624  N N    . GLN A 1 50 ? 3.333   -14.402 -3.862  1.00 0.00 ? 50 GLN A N    7  
ATOM 7625  C CA   . GLN A 1 50 ? 2.468   -13.308 -3.438  1.00 0.00 ? 50 GLN A CA   7  
ATOM 7626  C C    . GLN A 1 50 ? 3.038   -12.608 -2.209  1.00 0.00 ? 50 GLN A C    7  
ATOM 7627  O O    . GLN A 1 50 ? 2.915   -11.392 -2.062  1.00 0.00 ? 50 GLN A O    7  
ATOM 7628  C CB   . GLN A 1 50 ? 1.062   -13.830 -3.136  1.00 0.00 ? 50 GLN A CB   7  
ATOM 7629  C CG   . GLN A 1 50 ? 0.150   -13.860 -4.352  1.00 0.00 ? 50 GLN A CG   7  
ATOM 7630  C CD   . GLN A 1 50 ? -1.172  -14.548 -4.073  1.00 0.00 ? 50 GLN A CD   7  
ATOM 7631  O OE1  . GLN A 1 50 ? -1.206  -15.705 -3.654  1.00 0.00 ? 50 GLN A OE1  7  
ATOM 7632  N NE2  . GLN A 1 50 ? -2.270  -13.838 -4.305  1.00 0.00 ? 50 GLN A NE2  7  
ATOM 7633  H H    . GLN A 1 50 ? 3.015   -15.324 -3.776  1.00 0.00 ? 50 GLN A H    7  
ATOM 7634  H HA   . GLN A 1 50 ? 2.411   -12.597 -4.248  1.00 0.00 ? 50 GLN A HA   7  
ATOM 7635  H HB2  . GLN A 1 50 ? 1.139   -14.834 -2.746  1.00 0.00 ? 50 GLN A HB2  7  
ATOM 7636  H HB3  . GLN A 1 50 ? 0.608   -13.196 -2.388  1.00 0.00 ? 50 GLN A HB3  7  
ATOM 7637  H HG2  . GLN A 1 50 ? -0.050  -12.844 -4.661  1.00 0.00 ? 50 GLN A HG2  7  
ATOM 7638  H HG3  . GLN A 1 50 ? 0.652   -14.386 -5.149  1.00 0.00 ? 50 GLN A HG3  7  
ATOM 7639  H HE21 . GLN A 1 50 ? -2.166  -12.922 -4.639  1.00 0.00 ? 50 GLN A HE21 7  
ATOM 7640  H HE22 . GLN A 1 50 ? -3.138  -14.258 -4.134  1.00 0.00 ? 50 GLN A HE22 7  
ATOM 7641  N N    . VAL A 1 51 ? 3.661   -13.383 -1.328  1.00 0.00 ? 51 VAL A N    7  
ATOM 7642  C CA   . VAL A 1 51 ? 4.251   -12.837 -0.111  1.00 0.00 ? 51 VAL A CA   7  
ATOM 7643  C C    . VAL A 1 51 ? 5.656   -12.307 -0.372  1.00 0.00 ? 51 VAL A C    7  
ATOM 7644  O O    . VAL A 1 51 ? 6.165   -11.470 0.374   1.00 0.00 ? 51 VAL A O    7  
ATOM 7645  C CB   . VAL A 1 51 ? 4.313   -13.895 1.006   1.00 0.00 ? 51 VAL A CB   7  
ATOM 7646  C CG1  . VAL A 1 51 ? 4.653   -13.245 2.339   1.00 0.00 ? 51 VAL A CG1  7  
ATOM 7647  C CG2  . VAL A 1 51 ? 2.997   -14.654 1.094   1.00 0.00 ? 51 VAL A CG2  7  
ATOM 7648  H H    . VAL A 1 51 ? 3.726   -14.346 -1.500  1.00 0.00 ? 51 VAL A H    7  
ATOM 7649  H HA   . VAL A 1 51 ? 3.626   -12.023 0.226   1.00 0.00 ? 51 VAL A HA   7  
ATOM 7650  H HB   . VAL A 1 51 ? 5.095   -14.600 0.765   1.00 0.00 ? 51 VAL A HB   7  
ATOM 7651  H HG11 . VAL A 1 51 ? 3.744   -13.071 2.896   1.00 0.00 ? 51 VAL A HG11 7  
ATOM 7652  H HG12 . VAL A 1 51 ? 5.303   -13.898 2.903   1.00 0.00 ? 51 VAL A HG12 7  
ATOM 7653  H HG13 . VAL A 1 51 ? 5.152   -12.304 2.163   1.00 0.00 ? 51 VAL A HG13 7  
ATOM 7654  H HG21 . VAL A 1 51 ? 2.895   -15.083 2.080   1.00 0.00 ? 51 VAL A HG21 7  
ATOM 7655  H HG22 . VAL A 1 51 ? 2.177   -13.976 0.910   1.00 0.00 ? 51 VAL A HG22 7  
ATOM 7656  H HG23 . VAL A 1 51 ? 2.986   -15.442 0.356   1.00 0.00 ? 51 VAL A HG23 7  
ATOM 7657  N N    . LYS A 1 52 ? 6.280   -12.799 -1.437  1.00 0.00 ? 52 LYS A N    7  
ATOM 7658  C CA   . LYS A 1 52 ? 7.627   -12.374 -1.800  1.00 0.00 ? 52 LYS A CA   7  
ATOM 7659  C C    . LYS A 1 52 ? 7.585   -11.166 -2.730  1.00 0.00 ? 52 LYS A C    7  
ATOM 7660  O O    . LYS A 1 52 ? 8.516   -10.361 -2.763  1.00 0.00 ? 52 LYS A O    7  
ATOM 7661  C CB   . LYS A 1 52 ? 8.382   -13.523 -2.472  1.00 0.00 ? 52 LYS A CB   7  
ATOM 7662  C CG   . LYS A 1 52 ? 8.215   -13.560 -3.981  1.00 0.00 ? 52 LYS A CG   7  
ATOM 7663  C CD   . LYS A 1 52 ? 9.270   -12.718 -4.680  1.00 0.00 ? 52 LYS A CD   7  
ATOM 7664  C CE   . LYS A 1 52 ? 9.576   -13.251 -6.071  1.00 0.00 ? 52 LYS A CE   7  
ATOM 7665  N NZ   . LYS A 1 52 ? 10.719  -12.533 -6.701  1.00 0.00 ? 52 LYS A NZ   7  
ATOM 7666  H H    . LYS A 1 52 ? 5.822   -13.464 -1.994  1.00 0.00 ? 52 LYS A H    7  
ATOM 7667  H HA   . LYS A 1 52 ? 8.143   -12.097 -0.893  1.00 0.00 ? 52 LYS A HA   7  
ATOM 7668  H HB2  . LYS A 1 52 ? 9.435   -13.424 -2.250  1.00 0.00 ? 52 LYS A HB2  7  
ATOM 7669  H HB3  . LYS A 1 52 ? 8.024   -14.459 -2.068  1.00 0.00 ? 52 LYS A HB3  7  
ATOM 7670  H HG2  . LYS A 1 52 ? 8.304   -14.581 -4.319  1.00 0.00 ? 52 LYS A HG2  7  
ATOM 7671  H HG3  . LYS A 1 52 ? 7.237   -13.178 -4.235  1.00 0.00 ? 52 LYS A HG3  7  
ATOM 7672  H HD2  . LYS A 1 52 ? 8.910   -11.704 -4.767  1.00 0.00 ? 52 LYS A HD2  7  
ATOM 7673  H HD3  . LYS A 1 52 ? 10.176  -12.731 -4.091  1.00 0.00 ? 52 LYS A HD3  7  
ATOM 7674  H HE2  . LYS A 1 52 ? 9.819   -14.299 -5.996  1.00 0.00 ? 52 LYS A HE2  7  
ATOM 7675  H HE3  . LYS A 1 52 ? 8.700   -13.127 -6.690  1.00 0.00 ? 52 LYS A HE3  7  
ATOM 7676  H HZ1  . LYS A 1 52 ? 11.295  -12.068 -5.970  1.00 0.00 ? 52 LYS A HZ1  7  
ATOM 7677  H HZ2  . LYS A 1 52 ? 10.368  -11.810 -7.360  1.00 0.00 ? 52 LYS A HZ2  7  
ATOM 7678  H HZ3  . LYS A 1 52 ? 11.318  -13.203 -7.225  1.00 0.00 ? 52 LYS A HZ3  7  
ATOM 7679  N N    . THR A 1 53 ? 6.497   -11.044 -3.485  1.00 0.00 ? 53 THR A N    7  
ATOM 7680  C CA   . THR A 1 53 ? 6.333   -9.934  -4.416  1.00 0.00 ? 53 THR A CA   7  
ATOM 7681  C C    . THR A 1 53 ? 5.757   -8.710  -3.714  1.00 0.00 ? 53 THR A C    7  
ATOM 7682  O O    . THR A 1 53 ? 6.225   -7.589  -3.917  1.00 0.00 ? 53 THR A O    7  
ATOM 7683  C CB   . THR A 1 53 ? 5.416   -10.318 -5.592  1.00 0.00 ? 53 THR A CB   7  
ATOM 7684  O OG1  . THR A 1 53 ? 5.992   -11.402 -6.329  1.00 0.00 ? 53 THR A OG1  7  
ATOM 7685  C CG2  . THR A 1 53 ? 5.195   -9.130  -6.516  1.00 0.00 ? 53 THR A CG2  7  
ATOM 7686  H H    . THR A 1 53 ? 5.789   -11.718 -3.414  1.00 0.00 ? 53 THR A H    7  
ATOM 7687  H HA   . THR A 1 53 ? 7.307   -9.685  -4.812  1.00 0.00 ? 53 THR A HA   7  
ATOM 7688  H HB   . THR A 1 53 ? 4.460   -10.630 -5.196  1.00 0.00 ? 53 THR A HB   7  
ATOM 7689  H HG1  . THR A 1 53 ? 5.591   -11.445 -7.201  1.00 0.00 ? 53 THR A HG1  7  
ATOM 7690  H HG21 . THR A 1 53 ? 6.033   -9.038  -7.191  1.00 0.00 ? 53 THR A HG21 7  
ATOM 7691  H HG22 . THR A 1 53 ? 5.105   -8.228  -5.928  1.00 0.00 ? 53 THR A HG22 7  
ATOM 7692  H HG23 . THR A 1 53 ? 4.290   -9.280  -7.085  1.00 0.00 ? 53 THR A HG23 7  
ATOM 7693  N N    . TRP A 1 54 ? 4.739   -8.930  -2.890  1.00 0.00 ? 54 TRP A N    7  
ATOM 7694  C CA   . TRP A 1 54 ? 4.099   -7.843  -2.158  1.00 0.00 ? 54 TRP A CA   7  
ATOM 7695  C C    . TRP A 1 54 ? 5.122   -7.060  -1.342  1.00 0.00 ? 54 TRP A C    7  
ATOM 7696  O O    . TRP A 1 54 ? 5.292   -5.856  -1.533  1.00 0.00 ? 54 TRP A O    7  
ATOM 7697  C CB   . TRP A 1 54 ? 3.008   -8.393  -1.239  1.00 0.00 ? 54 TRP A CB   7  
ATOM 7698  C CG   . TRP A 1 54 ? 2.148   -7.326  -0.633  1.00 0.00 ? 54 TRP A CG   7  
ATOM 7699  C CD1  . TRP A 1 54 ? 0.965   -6.850  -1.123  1.00 0.00 ? 54 TRP A CD1  7  
ATOM 7700  C CD2  . TRP A 1 54 ? 2.405   -6.600  0.574   1.00 0.00 ? 54 TRP A CD2  7  
ATOM 7701  N NE1  . TRP A 1 54 ? 0.471   -5.873  -0.293  1.00 0.00 ? 54 TRP A NE1  7  
ATOM 7702  C CE2  . TRP A 1 54 ? 1.336   -5.701  0.756   1.00 0.00 ? 54 TRP A CE2  7  
ATOM 7703  C CE3  . TRP A 1 54 ? 3.433   -6.623  1.520   1.00 0.00 ? 54 TRP A CE3  7  
ATOM 7704  C CZ2  . TRP A 1 54 ? 1.268   -4.835  1.844   1.00 0.00 ? 54 TRP A CZ2  7  
ATOM 7705  C CZ3  . TRP A 1 54 ? 3.365   -5.763  2.599   1.00 0.00 ? 54 TRP A CZ3  7  
ATOM 7706  C CH2  . TRP A 1 54 ? 2.289   -4.879  2.755   1.00 0.00 ? 54 TRP A CH2  7  
ATOM 7707  H H    . TRP A 1 54 ? 4.410   -9.846  -2.770  1.00 0.00 ? 54 TRP A H    7  
ATOM 7708  H HA   . TRP A 1 54 ? 3.648   -7.179  -2.881  1.00 0.00 ? 54 TRP A HA   7  
ATOM 7709  H HB2  . TRP A 1 54 ? 2.369   -9.055  -1.804  1.00 0.00 ? 54 TRP A HB2  7  
ATOM 7710  H HB3  . TRP A 1 54 ? 3.471   -8.946  -0.434  1.00 0.00 ? 54 TRP A HB3  7  
ATOM 7711  H HD1  . TRP A 1 54 ? 0.499   -7.200  -2.031  1.00 0.00 ? 54 TRP A HD1  7  
ATOM 7712  H HE1  . TRP A 1 54 ? -0.365  -5.380  -0.429  1.00 0.00 ? 54 TRP A HE1  7  
ATOM 7713  H HE3  . TRP A 1 54 ? 4.271   -7.297  1.418   1.00 0.00 ? 54 TRP A HE3  7  
ATOM 7714  H HZ2  . TRP A 1 54 ? 0.445   -4.149  1.978   1.00 0.00 ? 54 TRP A HZ2  7  
ATOM 7715  H HZ3  . TRP A 1 54 ? 4.151   -5.766  3.340   1.00 0.00 ? 54 TRP A HZ3  7  
ATOM 7716  H HH2  . TRP A 1 54 ? 2.277   -4.225  3.613   1.00 0.00 ? 54 TRP A HH2  7  
ATOM 7717  N N    . PHE A 1 55 ? 5.800   -7.751  -0.432  1.00 0.00 ? 55 PHE A N    7  
ATOM 7718  C CA   . PHE A 1 55 ? 6.806   -7.119  0.414   1.00 0.00 ? 55 PHE A CA   7  
ATOM 7719  C C    . PHE A 1 55 ? 7.791   -6.309  -0.424  1.00 0.00 ? 55 PHE A C    7  
ATOM 7720  O O    . PHE A 1 55 ? 8.141   -5.183  -0.072  1.00 0.00 ? 55 PHE A O    7  
ATOM 7721  C CB   . PHE A 1 55 ? 7.559   -8.177  1.224   1.00 0.00 ? 55 PHE A CB   7  
ATOM 7722  C CG   . PHE A 1 55 ? 6.816   -8.637  2.445   1.00 0.00 ? 55 PHE A CG   7  
ATOM 7723  C CD1  . PHE A 1 55 ? 5.633   -9.348  2.326   1.00 0.00 ? 55 PHE A CD1  7  
ATOM 7724  C CD2  . PHE A 1 55 ? 7.301   -8.359  3.713   1.00 0.00 ? 55 PHE A CD2  7  
ATOM 7725  C CE1  . PHE A 1 55 ? 4.946   -9.773  3.447   1.00 0.00 ? 55 PHE A CE1  7  
ATOM 7726  C CE2  . PHE A 1 55 ? 6.620   -8.783  4.839   1.00 0.00 ? 55 PHE A CE2  7  
ATOM 7727  C CZ   . PHE A 1 55 ? 5.440   -9.490  4.706   1.00 0.00 ? 55 PHE A CZ   7  
ATOM 7728  H H    . PHE A 1 55 ? 5.620   -8.709  -0.326  1.00 0.00 ? 55 PHE A H    7  
ATOM 7729  H HA   . PHE A 1 55 ? 6.297   -6.453  1.093   1.00 0.00 ? 55 PHE A HA   7  
ATOM 7730  H HB2  . PHE A 1 55 ? 7.737   -9.039  0.600   1.00 0.00 ? 55 PHE A HB2  7  
ATOM 7731  H HB3  . PHE A 1 55 ? 8.506   -7.768  1.544   1.00 0.00 ? 55 PHE A HB3  7  
ATOM 7732  H HD1  . PHE A 1 55 ? 5.245   -9.570  1.341   1.00 0.00 ? 55 PHE A HD1  7  
ATOM 7733  H HD2  . PHE A 1 55 ? 8.222   -7.806  3.819   1.00 0.00 ? 55 PHE A HD2  7  
ATOM 7734  H HE1  . PHE A 1 55 ? 4.025   -10.326 3.339   1.00 0.00 ? 55 PHE A HE1  7  
ATOM 7735  H HE2  . PHE A 1 55 ? 7.007   -8.560  5.821   1.00 0.00 ? 55 PHE A HE2  7  
ATOM 7736  H HZ   . PHE A 1 55 ? 4.906   -9.822  5.583   1.00 0.00 ? 55 PHE A HZ   7  
ATOM 7737  N N    . GLN A 1 56 ? 8.232   -6.890  -1.535  1.00 0.00 ? 56 GLN A N    7  
ATOM 7738  C CA   . GLN A 1 56 ? 9.177   -6.223  -2.423  1.00 0.00 ? 56 GLN A CA   7  
ATOM 7739  C C    . GLN A 1 56 ? 8.649   -4.857  -2.851  1.00 0.00 ? 56 GLN A C    7  
ATOM 7740  O O    . GLN A 1 56 ? 9.245   -3.826  -2.542  1.00 0.00 ? 56 GLN A O    7  
ATOM 7741  C CB   . GLN A 1 56 ? 9.449   -7.087  -3.655  1.00 0.00 ? 56 GLN A CB   7  
ATOM 7742  C CG   . GLN A 1 56 ? 10.589  -8.074  -3.466  1.00 0.00 ? 56 GLN A CG   7  
ATOM 7743  C CD   . GLN A 1 56 ? 11.015  -8.730  -4.765  1.00 0.00 ? 56 GLN A CD   7  
ATOM 7744  O OE1  . GLN A 1 56 ? 10.275  -8.721  -5.750  1.00 0.00 ? 56 GLN A OE1  7  
ATOM 7745  N NE2  . GLN A 1 56 ? 12.212  -9.304  -4.774  1.00 0.00 ? 56 GLN A NE2  7  
ATOM 7746  H H    . GLN A 1 56 ? 7.916   -7.789  -1.762  1.00 0.00 ? 56 GLN A H    7  
ATOM 7747  H HA   . GLN A 1 56 ? 10.100  -6.084  -1.881  1.00 0.00 ? 56 GLN A HA   7  
ATOM 7748  H HB2  . GLN A 1 56 ? 8.555   -7.644  -3.894  1.00 0.00 ? 56 GLN A HB2  7  
ATOM 7749  H HB3  . GLN A 1 56 ? 9.694   -6.442  -4.486  1.00 0.00 ? 56 GLN A HB3  7  
ATOM 7750  H HG2  . GLN A 1 56 ? 11.438  -7.549  -3.052  1.00 0.00 ? 56 GLN A HG2  7  
ATOM 7751  H HG3  . GLN A 1 56 ? 10.272  -8.843  -2.778  1.00 0.00 ? 56 GLN A HG3  7  
ATOM 7752  H HE21 . GLN A 1 56 ? 12.746  -9.273  -3.952  1.00 0.00 ? 56 GLN A HE21 7  
ATOM 7753  H HE22 . GLN A 1 56 ? 12.512  -9.736  -5.600  1.00 0.00 ? 56 GLN A HE22 7  
ATOM 7754  N N    . ASN A 1 57 ? 7.528   -4.859  -3.565  1.00 0.00 ? 57 ASN A N    7  
ATOM 7755  C CA   . ASN A 1 57 ? 6.921   -3.619  -4.036  1.00 0.00 ? 57 ASN A CA   7  
ATOM 7756  C C    . ASN A 1 57 ? 6.777   -2.616  -2.897  1.00 0.00 ? 57 ASN A C    7  
ATOM 7757  O O    . ASN A 1 57 ? 7.340   -1.522  -2.945  1.00 0.00 ? 57 ASN A O    7  
ATOM 7758  C CB   . ASN A 1 57 ? 5.551   -3.902  -4.658  1.00 0.00 ? 57 ASN A CB   7  
ATOM 7759  C CG   . ASN A 1 57 ? 5.648   -4.280  -6.123  1.00 0.00 ? 57 ASN A CG   7  
ATOM 7760  O OD1  . ASN A 1 57 ? 6.575   -3.869  -6.822  1.00 0.00 ? 57 ASN A OD1  7  
ATOM 7761  N ND2  . ASN A 1 57 ? 4.689   -5.068  -6.595  1.00 0.00 ? 57 ASN A ND2  7  
ATOM 7762  H H    . ASN A 1 57 ? 7.099   -5.713  -3.779  1.00 0.00 ? 57 ASN A H    7  
ATOM 7763  H HA   . ASN A 1 57 ? 7.569   -3.199  -4.791  1.00 0.00 ? 57 ASN A HA   7  
ATOM 7764  H HB2  . ASN A 1 57 ? 5.083   -4.718  -4.126  1.00 0.00 ? 57 ASN A HB2  7  
ATOM 7765  H HB3  . ASN A 1 57 ? 4.935   -3.020  -4.572  1.00 0.00 ? 57 ASN A HB3  7  
ATOM 7766  H HD21 . ASN A 1 57 ? 3.982   -5.357  -5.981  1.00 0.00 ? 57 ASN A HD21 7  
ATOM 7767  H HD22 . ASN A 1 57 ? 4.727   -5.328  -7.539  1.00 0.00 ? 57 ASN A HD22 7  
ATOM 7768  N N    . ARG A 1 58 ? 6.021   -2.996  -1.872  1.00 0.00 ? 58 ARG A N    7  
ATOM 7769  C CA   . ARG A 1 58 ? 5.802   -2.129  -0.720  1.00 0.00 ? 58 ARG A CA   7  
ATOM 7770  C C    . ARG A 1 58 ? 7.073   -1.362  -0.369  1.00 0.00 ? 58 ARG A C    7  
ATOM 7771  O O    . ARG A 1 58 ? 7.098   -0.132  -0.406  1.00 0.00 ? 58 ARG A O    7  
ATOM 7772  C CB   . ARG A 1 58 ? 5.341   -2.953  0.484   1.00 0.00 ? 58 ARG A CB   7  
ATOM 7773  C CG   . ARG A 1 58 ? 4.606   -2.136  1.534   1.00 0.00 ? 58 ARG A CG   7  
ATOM 7774  C CD   . ARG A 1 58 ? 3.416   -1.402  0.937   1.00 0.00 ? 58 ARG A CD   7  
ATOM 7775  N NE   . ARG A 1 58 ? 2.661   -2.245  0.013   1.00 0.00 ? 58 ARG A NE   7  
ATOM 7776  C CZ   . ARG A 1 58 ? 1.812   -1.767  -0.890  1.00 0.00 ? 58 ARG A CZ   7  
ATOM 7777  N NH1  . ARG A 1 58 ? 1.610   -0.460  -0.989  1.00 0.00 ? 58 ARG A NH1  7  
ATOM 7778  N NH2  . ARG A 1 58 ? 1.162   -2.597  -1.696  1.00 0.00 ? 58 ARG A NH2  7  
ATOM 7779  H H    . ARG A 1 58 ? 5.598   -3.880  -1.892  1.00 0.00 ? 58 ARG A H    7  
ATOM 7780  H HA   . ARG A 1 58 ? 5.029   -1.422  -0.979  1.00 0.00 ? 58 ARG A HA   7  
ATOM 7781  H HB2  . ARG A 1 58 ? 4.679   -3.734  0.139   1.00 0.00 ? 58 ARG A HB2  7  
ATOM 7782  H HB3  . ARG A 1 58 ? 6.205   -3.403  0.949   1.00 0.00 ? 58 ARG A HB3  7  
ATOM 7783  H HG2  . ARG A 1 58 ? 4.254   -2.799  2.311   1.00 0.00 ? 58 ARG A HG2  7  
ATOM 7784  H HG3  . ARG A 1 58 ? 5.288   -1.414  1.957   1.00 0.00 ? 58 ARG A HG3  7  
ATOM 7785  H HD2  . ARG A 1 58 ? 2.763   -1.090  1.739   1.00 0.00 ? 58 ARG A HD2  7  
ATOM 7786  H HD3  . ARG A 1 58 ? 3.775   -0.533  0.407   1.00 0.00 ? 58 ARG A HD3  7  
ATOM 7787  H HE   . ARG A 1 58 ? 2.795   -3.213  0.069   1.00 0.00 ? 58 ARG A HE   7  
ATOM 7788  H HH11 . ARG A 1 58 ? 2.099   0.167   -0.384  1.00 0.00 ? 58 ARG A HH11 7  
ATOM 7789  H HH12 . ARG A 1 58 ? 0.971   -0.103  -1.671  1.00 0.00 ? 58 ARG A HH12 7  
ATOM 7790  H HH21 . ARG A 1 58 ? 1.312   -3.583  -1.624  1.00 0.00 ? 58 ARG A HH21 7  
ATOM 7791  H HH22 . ARG A 1 58 ? 0.523   -2.237  -2.375  1.00 0.00 ? 58 ARG A HH22 7  
ATOM 7792  N N    . ARG A 1 59 ? 8.126   -2.097  -0.026  1.00 0.00 ? 59 ARG A N    7  
ATOM 7793  C CA   . ARG A 1 59 ? 9.400   -1.486  0.334   1.00 0.00 ? 59 ARG A CA   7  
ATOM 7794  C C    . ARG A 1 59 ? 9.663   -0.241  -0.508  1.00 0.00 ? 59 ARG A C    7  
ATOM 7795  O O    . ARG A 1 59 ? 9.792   0.862   0.021   1.00 0.00 ? 59 ARG A O    7  
ATOM 7796  C CB   . ARG A 1 59 ? 10.541  -2.489  0.151   1.00 0.00 ? 59 ARG A CB   7  
ATOM 7797  C CG   . ARG A 1 59 ? 11.727  -2.236  1.068   1.00 0.00 ? 59 ARG A CG   7  
ATOM 7798  C CD   . ARG A 1 59 ? 12.846  -3.235  0.819   1.00 0.00 ? 59 ARG A CD   7  
ATOM 7799  N NE   . ARG A 1 59 ? 13.747  -2.793  -0.242  1.00 0.00 ? 59 ARG A NE   7  
ATOM 7800  C CZ   . ARG A 1 59 ? 13.543  -3.042  -1.530  1.00 0.00 ? 59 ARG A CZ   7  
ATOM 7801  N NH1  . ARG A 1 59 ? 12.473  -3.724  -1.916  1.00 0.00 ? 59 ARG A NH1  7  
ATOM 7802  N NH2  . ARG A 1 59 ? 14.408  -2.607  -2.437  1.00 0.00 ? 59 ARG A NH2  7  
ATOM 7803  H H    . ARG A 1 59 ? 8.045   -3.074  -0.015  1.00 0.00 ? 59 ARG A H    7  
ATOM 7804  H HA   . ARG A 1 59 ? 9.348   -1.199  1.374   1.00 0.00 ? 59 ARG A HA   7  
ATOM 7805  H HB2  . ARG A 1 59 ? 10.167  -3.482  0.349   1.00 0.00 ? 59 ARG A HB2  7  
ATOM 7806  H HB3  . ARG A 1 59 ? 10.887  -2.440  -0.870  1.00 0.00 ? 59 ARG A HB3  7  
ATOM 7807  H HG2  . ARG A 1 59 ? 12.102  -1.239  0.890   1.00 0.00 ? 59 ARG A HG2  7  
ATOM 7808  H HG3  . ARG A 1 59 ? 11.401  -2.322  2.094   1.00 0.00 ? 59 ARG A HG3  7  
ATOM 7809  H HD2  . ARG A 1 59 ? 13.412  -3.356  1.731   1.00 0.00 ? 59 ARG A HD2  7  
ATOM 7810  H HD3  . ARG A 1 59 ? 12.410  -4.181  0.538   1.00 0.00 ? 59 ARG A HD3  7  
ATOM 7811  H HE   . ARG A 1 59 ? 14.544  -2.287  0.021   1.00 0.00 ? 59 ARG A HE   7  
ATOM 7812  H HH11 . ARG A 1 59 ? 11.819  -4.052  -1.235  1.00 0.00 ? 59 ARG A HH11 7  
ATOM 7813  H HH12 . ARG A 1 59 ? 12.321  -3.909  -2.887  1.00 0.00 ? 59 ARG A HH12 7  
ATOM 7814  H HH21 . ARG A 1 59 ? 15.216  -2.092  -2.150  1.00 0.00 ? 59 ARG A HH21 7  
ATOM 7815  H HH22 . ARG A 1 59 ? 14.254  -2.794  -3.406  1.00 0.00 ? 59 ARG A HH22 7  
ATOM 7816  N N    . ALA A 1 60 ? 9.742   -0.427  -1.821  1.00 0.00 ? 60 ALA A N    7  
ATOM 7817  C CA   . ALA A 1 60 ? 9.988   0.681   -2.737  1.00 0.00 ? 60 ALA A CA   7  
ATOM 7818  C C    . ALA A 1 60 ? 9.242   1.935   -2.293  1.00 0.00 ? 60 ALA A C    7  
ATOM 7819  O O    . ALA A 1 60 ? 9.784   3.040   -2.337  1.00 0.00 ? 60 ALA A O    7  
ATOM 7820  C CB   . ALA A 1 60 ? 9.583   0.296   -4.152  1.00 0.00 ? 60 ALA A CB   7  
ATOM 7821  H H    . ALA A 1 60 ? 9.630   -1.331  -2.184  1.00 0.00 ? 60 ALA A H    7  
ATOM 7822  H HA   . ALA A 1 60 ? 11.049  0.885   -2.735  1.00 0.00 ? 60 ALA A HA   7  
ATOM 7823  H HB1  . ALA A 1 60 ? 9.175   -0.705  -4.149  1.00 0.00 ? 60 ALA A HB1  7  
ATOM 7824  H HB2  . ALA A 1 60 ? 8.838   0.988   -4.513  1.00 0.00 ? 60 ALA A HB2  7  
ATOM 7825  H HB3  . ALA A 1 60 ? 10.449  0.330   -4.795  1.00 0.00 ? 60 ALA A HB3  7  
ATOM 7826  N N    . LYS A 1 61 ? 7.996   1.757   -1.868  1.00 0.00 ? 61 LYS A N    7  
ATOM 7827  C CA   . LYS A 1 61 ? 7.175   2.874   -1.416  1.00 0.00 ? 61 LYS A CA   7  
ATOM 7828  C C    . LYS A 1 61 ? 7.535   3.271   0.013   1.00 0.00 ? 61 LYS A C    7  
ATOM 7829  O O    . LYS A 1 61 ? 7.782   4.443   0.298   1.00 0.00 ? 61 LYS A O    7  
ATOM 7830  C CB   . LYS A 1 61 ? 5.691   2.509   -1.497  1.00 0.00 ? 61 LYS A CB   7  
ATOM 7831  C CG   . LYS A 1 61 ? 4.784   3.700   -1.752  1.00 0.00 ? 61 LYS A CG   7  
ATOM 7832  C CD   . LYS A 1 61 ? 3.540   3.298   -2.525  1.00 0.00 ? 61 LYS A CD   7  
ATOM 7833  C CE   . LYS A 1 61 ? 3.031   4.438   -3.394  1.00 0.00 ? 61 LYS A CE   7  
ATOM 7834  N NZ   . LYS A 1 61 ? 4.107   5.001   -4.256  1.00 0.00 ? 61 LYS A NZ   7  
ATOM 7835  H H    . LYS A 1 61 ? 7.620   0.852   -1.857  1.00 0.00 ? 61 LYS A H    7  
ATOM 7836  H HA   . LYS A 1 61 ? 7.367   3.712   -2.068  1.00 0.00 ? 61 LYS A HA   7  
ATOM 7837  H HB2  . LYS A 1 61 ? 5.551   1.798   -2.297  1.00 0.00 ? 61 LYS A HB2  7  
ATOM 7838  H HB3  . LYS A 1 61 ? 5.395   2.050   -0.564  1.00 0.00 ? 61 LYS A HB3  7  
ATOM 7839  H HG2  . LYS A 1 61 ? 4.485   4.123   -0.805  1.00 0.00 ? 61 LYS A HG2  7  
ATOM 7840  H HG3  . LYS A 1 61 ? 5.329   4.439   -2.323  1.00 0.00 ? 61 LYS A HG3  7  
ATOM 7841  H HD2  . LYS A 1 61 ? 3.776   2.456   -3.159  1.00 0.00 ? 61 LYS A HD2  7  
ATOM 7842  H HD3  . LYS A 1 61 ? 2.766   3.017   -1.825  1.00 0.00 ? 61 LYS A HD3  7  
ATOM 7843  H HE2  . LYS A 1 61 ? 2.236   4.067   -4.022  1.00 0.00 ? 61 LYS A HE2  7  
ATOM 7844  H HE3  . LYS A 1 61 ? 2.649   5.219   -2.753  1.00 0.00 ? 61 LYS A HE3  7  
ATOM 7845  H HZ1  . LYS A 1 61 ? 4.732   5.612   -3.693  1.00 0.00 ? 61 LYS A HZ1  7  
ATOM 7846  H HZ2  . LYS A 1 61 ? 3.691   5.565   -5.025  1.00 0.00 ? 61 LYS A HZ2  7  
ATOM 7847  H HZ3  . LYS A 1 61 ? 4.672   4.233   -4.671  1.00 0.00 ? 61 LYS A HZ3  7  
ATOM 7848  N N    . TRP A 1 62 ? 7.563   2.288   0.905   1.00 0.00 ? 62 TRP A N    7  
ATOM 7849  C CA   . TRP A 1 62 ? 7.895   2.535   2.304   1.00 0.00 ? 62 TRP A CA   7  
ATOM 7850  C C    . TRP A 1 62 ? 9.146   3.398   2.423   1.00 0.00 ? 62 TRP A C    7  
ATOM 7851  O O    . TRP A 1 62 ? 9.294   4.166   3.373   1.00 0.00 ? 62 TRP A O    7  
ATOM 7852  C CB   . TRP A 1 62 ? 8.101   1.211   3.042   1.00 0.00 ? 62 TRP A CB   7  
ATOM 7853  C CG   . TRP A 1 62 ? 9.010   1.328   4.228   1.00 0.00 ? 62 TRP A CG   7  
ATOM 7854  C CD1  . TRP A 1 62 ? 8.682   1.793   5.469   1.00 0.00 ? 62 TRP A CD1  7  
ATOM 7855  C CD2  . TRP A 1 62 ? 10.396  0.975   4.283   1.00 0.00 ? 62 TRP A CD2  7  
ATOM 7856  N NE1  . TRP A 1 62 ? 9.781   1.751   6.293   1.00 0.00 ? 62 TRP A NE1  7  
ATOM 7857  C CE2  . TRP A 1 62 ? 10.845  1.252   5.589   1.00 0.00 ? 62 TRP A CE2  7  
ATOM 7858  C CE3  . TRP A 1 62 ? 11.301  0.450   3.357   1.00 0.00 ? 62 TRP A CE3  7  
ATOM 7859  C CZ2  . TRP A 1 62 ? 12.158  1.022   5.989   1.00 0.00 ? 62 TRP A CZ2  7  
ATOM 7860  C CZ3  . TRP A 1 62 ? 12.605  0.222   3.755   1.00 0.00 ? 62 TRP A CZ3  7  
ATOM 7861  C CH2  . TRP A 1 62 ? 13.023  0.507   5.062   1.00 0.00 ? 62 TRP A CH2  7  
ATOM 7862  H H    . TRP A 1 62 ? 7.357   1.374   0.617   1.00 0.00 ? 62 TRP A H    7  
ATOM 7863  H HA   . TRP A 1 62 ? 7.065   3.061   2.752   1.00 0.00 ? 62 TRP A HA   7  
ATOM 7864  H HB2  . TRP A 1 62 ? 7.145   0.847   3.389   1.00 0.00 ? 62 TRP A HB2  7  
ATOM 7865  H HB3  . TRP A 1 62 ? 8.531   0.491   2.361   1.00 0.00 ? 62 TRP A HB3  7  
ATOM 7866  H HD1  . TRP A 1 62 ? 7.699   2.142   5.748   1.00 0.00 ? 62 TRP A HD1  7  
ATOM 7867  H HE1  . TRP A 1 62 ? 9.799   2.031   7.232   1.00 0.00 ? 62 TRP A HE1  7  
ATOM 7868  H HE3  . TRP A 1 62 ? 10.998  0.223   2.346   1.00 0.00 ? 62 TRP A HE3  7  
ATOM 7869  H HZ2  . TRP A 1 62 ? 12.496  1.235   6.993   1.00 0.00 ? 62 TRP A HZ2  7  
ATOM 7870  H HZ3  . TRP A 1 62 ? 13.319  -0.183  3.053   1.00 0.00 ? 62 TRP A HZ3  7  
ATOM 7871  H HH2  . TRP A 1 62 ? 14.051  0.314   5.329   1.00 0.00 ? 62 TRP A HH2  7  
ATOM 7872  N N    . ARG A 1 63 ? 10.045  3.266   1.452   1.00 0.00 ? 63 ARG A N    7  
ATOM 7873  C CA   . ARG A 1 63 ? 11.284  4.034   1.449   1.00 0.00 ? 63 ARG A CA   7  
ATOM 7874  C C    . ARG A 1 63 ? 11.023  5.487   1.064   1.00 0.00 ? 63 ARG A C    7  
ATOM 7875  O O    . ARG A 1 63 ? 11.733  6.393   1.502   1.00 0.00 ? 63 ARG A O    7  
ATOM 7876  C CB   . ARG A 1 63 ? 12.292  3.412   0.481   1.00 0.00 ? 63 ARG A CB   7  
ATOM 7877  C CG   . ARG A 1 63 ? 12.970  2.165   1.026   1.00 0.00 ? 63 ARG A CG   7  
ATOM 7878  C CD   . ARG A 1 63 ? 14.369  1.997   0.455   1.00 0.00 ? 63 ARG A CD   7  
ATOM 7879  N NE   . ARG A 1 63 ? 15.201  3.175   0.689   1.00 0.00 ? 63 ARG A NE   7  
ATOM 7880  C CZ   . ARG A 1 63 ? 16.424  3.322   0.191   1.00 0.00 ? 63 ARG A CZ   7  
ATOM 7881  N NH1  . ARG A 1 63 ? 16.953  2.372   -0.567  1.00 0.00 ? 63 ARG A NH1  7  
ATOM 7882  N NH2  . ARG A 1 63 ? 17.119  4.422   0.449   1.00 0.00 ? 63 ARG A NH2  7  
ATOM 7883  H H    . ARG A 1 63 ? 9.870   2.638   0.721   1.00 0.00 ? 63 ARG A H    7  
ATOM 7884  H HA   . ARG A 1 63 ? 11.694  4.007   2.448   1.00 0.00 ? 63 ARG A HA   7  
ATOM 7885  H HB2  . ARG A 1 63 ? 11.780  3.146   -0.432  1.00 0.00 ? 63 ARG A HB2  7  
ATOM 7886  H HB3  . ARG A 1 63 ? 13.055  4.142   0.257   1.00 0.00 ? 63 ARG A HB3  7  
ATOM 7887  H HG2  . ARG A 1 63 ? 13.040  2.245   2.101   1.00 0.00 ? 63 ARG A HG2  7  
ATOM 7888  H HG3  . ARG A 1 63 ? 12.378  1.301   0.765   1.00 0.00 ? 63 ARG A HG3  7  
ATOM 7889  H HD2  . ARG A 1 63 ? 14.834  1.142   0.921   1.00 0.00 ? 63 ARG A HD2  7  
ATOM 7890  H HD3  . ARG A 1 63 ? 14.291  1.829   -0.609  1.00 0.00 ? 63 ARG A HD3  7  
ATOM 7891  H HE   . ARG A 1 63 ? 14.829  3.889   1.247   1.00 0.00 ? 63 ARG A HE   7  
ATOM 7892  H HH11 . ARG A 1 63 ? 16.431  1.542   -0.764  1.00 0.00 ? 63 ARG A HH11 7  
ATOM 7893  H HH12 . ARG A 1 63 ? 17.873  2.486   -0.942  1.00 0.00 ? 63 ARG A HH12 7  
ATOM 7894  H HH21 . ARG A 1 63 ? 16.723  5.141   1.020   1.00 0.00 ? 63 ARG A HH21 7  
ATOM 7895  H HH22 . ARG A 1 63 ? 18.038  4.532   0.073   1.00 0.00 ? 63 ARG A HH22 7  
ATOM 7896  N N    . ARG A 1 64 ? 10.001  5.701   0.242   1.00 0.00 ? 64 ARG A N    7  
ATOM 7897  C CA   . ARG A 1 64 ? 9.647   7.044   -0.204  1.00 0.00 ? 64 ARG A CA   7  
ATOM 7898  C C    . ARG A 1 64 ? 8.754   7.739   0.820   1.00 0.00 ? 64 ARG A C    7  
ATOM 7899  O O    . ARG A 1 64 ? 8.963   8.906   1.150   1.00 0.00 ? 64 ARG A O    7  
ATOM 7900  C CB   . ARG A 1 64 ? 8.939   6.984   -1.558  1.00 0.00 ? 64 ARG A CB   7  
ATOM 7901  C CG   . ARG A 1 64 ? 9.133   8.233   -2.403  1.00 0.00 ? 64 ARG A CG   7  
ATOM 7902  C CD   . ARG A 1 64 ? 8.187   9.345   -1.979  1.00 0.00 ? 64 ARG A CD   7  
ATOM 7903  N NE   . ARG A 1 64 ? 6.803   9.057   -2.346  1.00 0.00 ? 64 ARG A NE   7  
ATOM 7904  C CZ   . ARG A 1 64 ? 6.371   9.008   -3.600  1.00 0.00 ? 64 ARG A CZ   7  
ATOM 7905  N NH1  . ARG A 1 64 ? 7.209   9.228   -4.603  1.00 0.00 ? 64 ARG A NH1  7  
ATOM 7906  N NH2  . ARG A 1 64 ? 5.096   8.739   -3.854  1.00 0.00 ? 64 ARG A NH2  7  
ATOM 7907  H H    . ARG A 1 64 ? 9.472   4.938   -0.073  1.00 0.00 ? 64 ARG A H    7  
ATOM 7908  H HA   . ARG A 1 64 ? 10.561  7.610   -0.310  1.00 0.00 ? 64 ARG A HA   7  
ATOM 7909  H HB2  . ARG A 1 64 ? 9.318   6.139   -2.113  1.00 0.00 ? 64 ARG A HB2  7  
ATOM 7910  H HB3  . ARG A 1 64 ? 7.880   6.850   -1.391  1.00 0.00 ? 64 ARG A HB3  7  
ATOM 7911  H HG2  . ARG A 1 64 ? 10.150  8.578   -2.289  1.00 0.00 ? 64 ARG A HG2  7  
ATOM 7912  H HG3  . ARG A 1 64 ? 8.947   7.988   -3.438  1.00 0.00 ? 64 ARG A HG3  7  
ATOM 7913  H HD2  . ARG A 1 64 ? 8.248   9.463   -0.907  1.00 0.00 ? 64 ARG A HD2  7  
ATOM 7914  H HD3  . ARG A 1 64 ? 8.494   10.263  -2.459  1.00 0.00 ? 64 ARG A HD3  7  
ATOM 7915  H HE   . ARG A 1 64 ? 6.167   8.891   -1.620  1.00 0.00 ? 64 ARG A HE   7  
ATOM 7916  H HH11 . ARG A 1 64 ? 8.170   9.430   -4.415  1.00 0.00 ? 64 ARG A HH11 7  
ATOM 7917  H HH12 . ARG A 1 64 ? 6.881   9.190   -5.548  1.00 0.00 ? 64 ARG A HH12 7  
ATOM 7918  H HH21 . ARG A 1 64 ? 4.461   8.573   -3.101  1.00 0.00 ? 64 ARG A HH21 7  
ATOM 7919  H HH22 . ARG A 1 64 ? 4.772   8.703   -4.799  1.00 0.00 ? 64 ARG A HH22 7  
ATOM 7920  N N    . SER A 1 65 ? 7.758   7.013   1.318   1.00 0.00 ? 65 SER A N    7  
ATOM 7921  C CA   . SER A 1 65 ? 6.830   7.561   2.300   1.00 0.00 ? 65 SER A CA   7  
ATOM 7922  C C    . SER A 1 65 ? 7.536   7.825   3.626   1.00 0.00 ? 65 SER A C    7  
ATOM 7923  O O    . SER A 1 65 ? 7.179   8.746   4.360   1.00 0.00 ? 65 SER A O    7  
ATOM 7924  C CB   . SER A 1 65 ? 5.657   6.602   2.516   1.00 0.00 ? 65 SER A CB   7  
ATOM 7925  O OG   . SER A 1 65 ? 4.832   7.037   3.583   1.00 0.00 ? 65 SER A OG   7  
ATOM 7926  H H    . SER A 1 65 ? 7.643   6.088   1.015   1.00 0.00 ? 65 SER A H    7  
ATOM 7927  H HA   . SER A 1 65 ? 6.452   8.496   1.914   1.00 0.00 ? 65 SER A HA   7  
ATOM 7928  H HB2  . SER A 1 65 ? 5.065   6.554   1.615   1.00 0.00 ? 65 SER A HB2  7  
ATOM 7929  H HB3  . SER A 1 65 ? 6.039   5.618   2.749   1.00 0.00 ? 65 SER A HB3  7  
ATOM 7930  H HG   . SER A 1 65 ? 4.791   6.352   4.255   1.00 0.00 ? 65 SER A HG   7  
ATOM 7931  N N    . GLY A 1 66 ? 8.541   7.008   3.927   1.00 0.00 ? 66 GLY A N    7  
ATOM 7932  C CA   . GLY A 1 66 ? 9.283   7.169   5.164   1.00 0.00 ? 66 GLY A CA   7  
ATOM 7933  C C    . GLY A 1 66 ? 10.230  8.351   5.123   1.00 0.00 ? 66 GLY A C    7  
ATOM 7934  O O    . GLY A 1 66 ? 9.847   9.490   5.393   1.00 0.00 ? 66 GLY A O    7  
ATOM 7935  H H    . GLY A 1 66 ? 8.782   6.291   3.304   1.00 0.00 ? 66 GLY A H    7  
ATOM 7936  H HA2  . GLY A 1 66 ? 8.583   7.309   5.975   1.00 0.00 ? 66 GLY A HA2  7  
ATOM 7937  H HA3  . GLY A 1 66 ? 9.854   6.271   5.347   1.00 0.00 ? 66 GLY A HA3  7  
ATOM 7938  N N    . PRO A 1 67 ? 11.499  8.086   4.781   1.00 0.00 ? 67 PRO A N    7  
ATOM 7939  C CA   . PRO A 1 67 ? 12.531  9.125   4.698   1.00 0.00 ? 67 PRO A CA   7  
ATOM 7940  C C    . PRO A 1 67 ? 12.308  10.071  3.524   1.00 0.00 ? 67 PRO A C    7  
ATOM 7941  O O    . PRO A 1 67 ? 12.820  9.846   2.427   1.00 0.00 ? 67 PRO A O    7  
ATOM 7942  C CB   . PRO A 1 67 ? 13.823  8.327   4.505   1.00 0.00 ? 67 PRO A CB   7  
ATOM 7943  C CG   . PRO A 1 67 ? 13.387  7.046   3.881   1.00 0.00 ? 67 PRO A CG   7  
ATOM 7944  C CD   . PRO A 1 67 ? 12.025  6.752   4.446   1.00 0.00 ? 67 PRO A CD   7  
ATOM 7945  H HA   . PRO A 1 67 ? 12.592  9.696   5.613   1.00 0.00 ? 67 PRO A HA   7  
ATOM 7946  H HB2  . PRO A 1 67 ? 14.493  8.875   3.858   1.00 0.00 ? 67 PRO A HB2  7  
ATOM 7947  H HB3  . PRO A 1 67 ? 14.293  8.160   5.462   1.00 0.00 ? 67 PRO A HB3  7  
ATOM 7948  H HG2  . PRO A 1 67 ? 13.332  7.160   2.809   1.00 0.00 ? 67 PRO A HG2  7  
ATOM 7949  H HG3  . PRO A 1 67 ? 14.079  6.258   4.141   1.00 0.00 ? 67 PRO A HG3  7  
ATOM 7950  H HD2  . PRO A 1 67 ? 11.406  6.268   3.706   1.00 0.00 ? 67 PRO A HD2  7  
ATOM 7951  H HD3  . PRO A 1 67 ? 12.109  6.138   5.331   1.00 0.00 ? 67 PRO A HD3  7  
ATOM 7952  N N    . SER A 1 68 ? 11.541  11.131  3.760   1.00 0.00 ? 68 SER A N    7  
ATOM 7953  C CA   . SER A 1 68 ? 11.248  12.110  2.720   1.00 0.00 ? 68 SER A CA   7  
ATOM 7954  C C    . SER A 1 68 ? 12.509  12.868  2.318   1.00 0.00 ? 68 SER A C    7  
ATOM 7955  O O    . SER A 1 68 ? 13.067  13.631  3.107   1.00 0.00 ? 68 SER A O    7  
ATOM 7956  C CB   . SER A 1 68 ? 10.180  13.093  3.202   1.00 0.00 ? 68 SER A CB   7  
ATOM 7957  O OG   . SER A 1 68 ? 8.935   12.442  3.391   1.00 0.00 ? 68 SER A OG   7  
ATOM 7958  H H    . SER A 1 68 ? 11.161  11.255  4.656   1.00 0.00 ? 68 SER A H    7  
ATOM 7959  H HA   . SER A 1 68 ? 10.872  11.577  1.860   1.00 0.00 ? 68 SER A HA   7  
ATOM 7960  H HB2  . SER A 1 68 ? 10.491  13.528  4.140   1.00 0.00 ? 68 SER A HB2  7  
ATOM 7961  H HB3  . SER A 1 68 ? 10.055  13.875  2.467   1.00 0.00 ? 68 SER A HB3  7  
ATOM 7962  H HG   . SER A 1 68 ? 8.275   12.840  2.819   1.00 0.00 ? 68 SER A HG   7  
ATOM 7963  N N    . SER A 1 69 ? 12.953  12.653  1.083   1.00 0.00 ? 69 SER A N    7  
ATOM 7964  C CA   . SER A 1 69 ? 14.150  13.313  0.576   1.00 0.00 ? 69 SER A CA   7  
ATOM 7965  C C    . SER A 1 69 ? 13.893  13.921  -0.800  1.00 0.00 ? 69 SER A C    7  
ATOM 7966  O O    . SER A 1 69 ? 13.942  13.229  -1.816  1.00 0.00 ? 69 SER A O    7  
ATOM 7967  C CB   . SER A 1 69 ? 15.311  12.320  0.498   1.00 0.00 ? 69 SER A CB   7  
ATOM 7968  O OG   . SER A 1 69 ? 16.542  12.990  0.290   1.00 0.00 ? 69 SER A OG   7  
ATOM 7969  H H    . SER A 1 69 ? 12.464  12.034  0.501   1.00 0.00 ? 69 SER A H    7  
ATOM 7970  H HA   . SER A 1 69 ? 14.409  14.104  1.263   1.00 0.00 ? 69 SER A HA   7  
ATOM 7971  H HB2  . SER A 1 69 ? 15.369  11.765  1.422   1.00 0.00 ? 69 SER A HB2  7  
ATOM 7972  H HB3  . SER A 1 69 ? 15.143  11.637  -0.322  1.00 0.00 ? 69 SER A HB3  7  
ATOM 7973  H HG   . SER A 1 69 ? 16.488  13.878  0.651   1.00 0.00 ? 69 SER A HG   7  
ATOM 7974  N N    . GLY A 1 70 ? 13.618  15.222  -0.823  1.00 0.00 ? 70 GLY A N    7  
ATOM 7975  C CA   . GLY A 1 70 ? 13.357  15.902  -2.078  1.00 0.00 ? 70 GLY A CA   7  
ATOM 7976  C C    . GLY A 1 70 ? 13.452  17.410  -1.951  1.00 0.00 ? 70 GLY A C    7  
ATOM 7977  O O    . GLY A 1 70 ? 13.651  17.935  -0.856  1.00 0.00 ? 70 GLY A O    7  
ATOM 7978  H H    . GLY A 1 70 ? 13.593  15.723  0.018   1.00 0.00 ? 70 GLY A H    7  
ATOM 7979  H HA2  . GLY A 1 70 ? 14.075  15.568  -2.813  1.00 0.00 ? 70 GLY A HA2  7  
ATOM 7980  H HA3  . GLY A 1 70 ? 12.365  15.643  -2.416  1.00 0.00 ? 70 GLY A HA3  7  
ATOM 7981  N N    . GLY A 1 1  ? -14.878 8.949   -10.189 1.00 0.00 ? 1  GLY A N    8  
ATOM 7982  C CA   . GLY A 1 1  ? -13.701 9.333   -10.947 1.00 0.00 ? 1  GLY A CA   8  
ATOM 7983  C C    . GLY A 1 1  ? -12.764 8.167   -11.192 1.00 0.00 ? 1  GLY A C    8  
ATOM 7984  O O    . GLY A 1 1  ? -12.989 7.065   -10.691 1.00 0.00 ? 1  GLY A O    8  
ATOM 7985  H H1   . GLY A 1 1  ? -14.918 9.129   -9.226  1.00 0.00 ? 1  GLY A H1   8  
ATOM 7986  H HA2  . GLY A 1 1  ? -14.015 9.735   -11.898 1.00 0.00 ? 1  GLY A HA2  8  
ATOM 7987  H HA3  . GLY A 1 1  ? -13.169 10.098  -10.401 1.00 0.00 ? 1  GLY A HA3  8  
ATOM 7988  N N    . SER A 1 2  ? -11.712 8.408   -11.967 1.00 0.00 ? 2  SER A N    8  
ATOM 7989  C CA   . SER A 1 2  ? -10.740 7.368   -12.283 1.00 0.00 ? 2  SER A CA   8  
ATOM 7990  C C    . SER A 1 2  ? -9.936  6.982   -11.045 1.00 0.00 ? 2  SER A C    8  
ATOM 7991  O O    . SER A 1 2  ? -8.826  7.469   -10.835 1.00 0.00 ? 2  SER A O    8  
ATOM 7992  C CB   . SER A 1 2  ? -9.796  7.841   -13.390 1.00 0.00 ? 2  SER A CB   8  
ATOM 7993  O OG   . SER A 1 2  ? -9.215  9.092   -13.065 1.00 0.00 ? 2  SER A OG   8  
ATOM 7994  H H    . SER A 1 2  ? -11.587 9.308   -12.337 1.00 0.00 ? 2  SER A H    8  
ATOM 7995  H HA   . SER A 1 2  ? -11.283 6.502   -12.630 1.00 0.00 ? 2  SER A HA   8  
ATOM 7996  H HB2  . SER A 1 2  ? -9.008  7.116   -13.522 1.00 0.00 ? 2  SER A HB2  8  
ATOM 7997  H HB3  . SER A 1 2  ? -10.350 7.943   -14.312 1.00 0.00 ? 2  SER A HB3  8  
ATOM 7998  H HG   . SER A 1 2  ? -8.374  8.950   -12.625 1.00 0.00 ? 2  SER A HG   8  
ATOM 7999  N N    . SER A 1 3  ? -10.507 6.102   -10.228 1.00 0.00 ? 3  SER A N    8  
ATOM 8000  C CA   . SER A 1 3  ? -9.846  5.652   -9.008  1.00 0.00 ? 3  SER A CA   8  
ATOM 8001  C C    . SER A 1 3  ? -9.359  4.213   -9.153  1.00 0.00 ? 3  SER A C    8  
ATOM 8002  O O    . SER A 1 3  ? -10.047 3.270   -8.764  1.00 0.00 ? 3  SER A O    8  
ATOM 8003  C CB   . SER A 1 3  ? -10.800 5.761   -7.816  1.00 0.00 ? 3  SER A CB   8  
ATOM 8004  O OG   . SER A 1 3  ? -10.087 5.983   -6.612  1.00 0.00 ? 3  SER A OG   8  
ATOM 8005  H H    . SER A 1 3  ? -11.394 5.749   -10.450 1.00 0.00 ? 3  SER A H    8  
ATOM 8006  H HA   . SER A 1 3  ? -8.994  6.292   -8.836  1.00 0.00 ? 3  SER A HA   8  
ATOM 8007  H HB2  . SER A 1 3  ? -11.478 6.585   -7.976  1.00 0.00 ? 3  SER A HB2  8  
ATOM 8008  H HB3  . SER A 1 3  ? -11.363 4.843   -7.724  1.00 0.00 ? 3  SER A HB3  8  
ATOM 8009  H HG   . SER A 1 3  ? -9.249  6.408   -6.809  1.00 0.00 ? 3  SER A HG   8  
ATOM 8010  N N    . GLY A 1 4  ? -8.165  4.053   -9.717  1.00 0.00 ? 4  GLY A N    8  
ATOM 8011  C CA   . GLY A 1 4  ? -7.605  2.728   -9.905  1.00 0.00 ? 4  GLY A CA   8  
ATOM 8012  C C    . GLY A 1 4  ? -6.277  2.758   -10.635 1.00 0.00 ? 4  GLY A C    8  
ATOM 8013  O O    . GLY A 1 4  ? -5.914  3.769   -11.235 1.00 0.00 ? 4  GLY A O    8  
ATOM 8014  H H    . GLY A 1 4  ? -7.661  4.842   -10.008 1.00 0.00 ? 4  GLY A H    8  
ATOM 8015  H HA2  . GLY A 1 4  ? -7.462  2.269   -8.938  1.00 0.00 ? 4  GLY A HA2  8  
ATOM 8016  H HA3  . GLY A 1 4  ? -8.303  2.132   -10.475 1.00 0.00 ? 4  GLY A HA3  8  
ATOM 8017  N N    . SER A 1 5  ? -5.551  1.646   -10.585 1.00 0.00 ? 5  SER A N    8  
ATOM 8018  C CA   . SER A 1 5  ? -4.253  1.551   -11.242 1.00 0.00 ? 5  SER A CA   8  
ATOM 8019  C C    . SER A 1 5  ? -4.079  0.188   -11.907 1.00 0.00 ? 5  SER A C    8  
ATOM 8020  O O    . SER A 1 5  ? -4.282  -0.851  -11.279 1.00 0.00 ? 5  SER A O    8  
ATOM 8021  C CB   . SER A 1 5  ? -3.127  1.785   -10.233 1.00 0.00 ? 5  SER A CB   8  
ATOM 8022  O OG   . SER A 1 5  ? -1.922  2.143   -10.887 1.00 0.00 ? 5  SER A OG   8  
ATOM 8023  H H    . SER A 1 5  ? -5.895  0.872   -10.091 1.00 0.00 ? 5  SER A H    8  
ATOM 8024  H HA   . SER A 1 5  ? -4.209  2.317   -12.002 1.00 0.00 ? 5  SER A HA   8  
ATOM 8025  H HB2  . SER A 1 5  ? -3.409  2.583   -9.562  1.00 0.00 ? 5  SER A HB2  8  
ATOM 8026  H HB3  . SER A 1 5  ? -2.961  0.880   -9.667  1.00 0.00 ? 5  SER A HB3  8  
ATOM 8027  H HG   . SER A 1 5  ? -1.432  1.349   -11.114 1.00 0.00 ? 5  SER A HG   8  
ATOM 8028  N N    . SER A 1 6  ? -3.703  0.202   -13.182 1.00 0.00 ? 6  SER A N    8  
ATOM 8029  C CA   . SER A 1 6  ? -3.506  -1.031  -13.934 1.00 0.00 ? 6  SER A CA   8  
ATOM 8030  C C    . SER A 1 6  ? -2.851  -0.747  -15.282 1.00 0.00 ? 6  SER A C    8  
ATOM 8031  O O    . SER A 1 6  ? -3.376  0.017   -16.091 1.00 0.00 ? 6  SER A O    8  
ATOM 8032  C CB   . SER A 1 6  ? -4.842  -1.745  -14.144 1.00 0.00 ? 6  SER A CB   8  
ATOM 8033  O OG   . SER A 1 6  ? -4.659  -2.988  -14.799 1.00 0.00 ? 6  SER A OG   8  
ATOM 8034  H H    . SER A 1 6  ? -3.557  1.063   -13.627 1.00 0.00 ? 6  SER A H    8  
ATOM 8035  H HA   . SER A 1 6  ? -2.853  -1.670  -13.358 1.00 0.00 ? 6  SER A HA   8  
ATOM 8036  H HB2  . SER A 1 6  ? -5.308  -1.922  -13.186 1.00 0.00 ? 6  SER A HB2  8  
ATOM 8037  H HB3  . SER A 1 6  ? -5.487  -1.124  -14.749 1.00 0.00 ? 6  SER A HB3  8  
ATOM 8038  H HG   . SER A 1 6  ? -4.412  -2.835  -15.713 1.00 0.00 ? 6  SER A HG   8  
ATOM 8039  N N    . GLY A 1 7  ? -1.699  -1.367  -15.517 1.00 0.00 ? 7  GLY A N    8  
ATOM 8040  C CA   . GLY A 1 7  ? -0.990  -1.168  -16.767 1.00 0.00 ? 7  GLY A CA   8  
ATOM 8041  C C    . GLY A 1 7  ? 0.277   -1.997  -16.854 1.00 0.00 ? 7  GLY A C    8  
ATOM 8042  O O    . GLY A 1 7  ? 0.478   -2.738  -17.816 1.00 0.00 ? 7  GLY A O    8  
ATOM 8043  H H    . GLY A 1 7  ? -1.327  -1.965  -14.835 1.00 0.00 ? 7  GLY A H    8  
ATOM 8044  H HA2  . GLY A 1 7  ? -1.641  -1.439  -17.585 1.00 0.00 ? 7  GLY A HA2  8  
ATOM 8045  H HA3  . GLY A 1 7  ? -0.730  -0.124  -16.858 1.00 0.00 ? 7  GLY A HA3  8  
ATOM 8046  N N    . LYS A 1 8  ? 1.134   -1.871  -15.847 1.00 0.00 ? 8  LYS A N    8  
ATOM 8047  C CA   . LYS A 1 8  ? 2.389   -2.613  -15.812 1.00 0.00 ? 8  LYS A CA   8  
ATOM 8048  C C    . LYS A 1 8  ? 2.180   -4.056  -16.261 1.00 0.00 ? 8  LYS A C    8  
ATOM 8049  O O    . LYS A 1 8  ? 2.881   -4.550  -17.143 1.00 0.00 ? 8  LYS A O    8  
ATOM 8050  C CB   . LYS A 1 8  ? 2.982   -2.587  -14.402 1.00 0.00 ? 8  LYS A CB   8  
ATOM 8051  C CG   . LYS A 1 8  ? 4.498   -2.678  -14.377 1.00 0.00 ? 8  LYS A CG   8  
ATOM 8052  C CD   . LYS A 1 8  ? 4.975   -4.103  -14.602 1.00 0.00 ? 8  LYS A CD   8  
ATOM 8053  C CE   . LYS A 1 8  ? 5.104   -4.860  -13.289 1.00 0.00 ? 8  LYS A CE   8  
ATOM 8054  N NZ   . LYS A 1 8  ? 3.830   -5.534  -12.910 1.00 0.00 ? 8  LYS A NZ   8  
ATOM 8055  H H    . LYS A 1 8  ? 0.918   -1.264  -15.108 1.00 0.00 ? 8  LYS A H    8  
ATOM 8056  H HA   . LYS A 1 8  ? 3.077   -2.133  -16.492 1.00 0.00 ? 8  LYS A HA   8  
ATOM 8057  H HB2  . LYS A 1 8  ? 2.689   -1.667  -13.918 1.00 0.00 ? 8  LYS A HB2  8  
ATOM 8058  H HB3  . LYS A 1 8  ? 2.583   -3.421  -13.842 1.00 0.00 ? 8  LYS A HB3  8  
ATOM 8059  H HG2  . LYS A 1 8  ? 4.900   -2.048  -15.158 1.00 0.00 ? 8  LYS A HG2  8  
ATOM 8060  H HG3  . LYS A 1 8  ? 4.854   -2.335  -13.416 1.00 0.00 ? 8  LYS A HG3  8  
ATOM 8061  H HD2  . LYS A 1 8  ? 4.265   -4.616  -15.232 1.00 0.00 ? 8  LYS A HD2  8  
ATOM 8062  H HD3  . LYS A 1 8  ? 5.940   -4.078  -15.089 1.00 0.00 ? 8  LYS A HD3  8  
ATOM 8063  H HE2  . LYS A 1 8  ? 5.878   -5.605  -13.392 1.00 0.00 ? 8  LYS A HE2  8  
ATOM 8064  H HE3  . LYS A 1 8  ? 5.377   -4.162  -12.511 1.00 0.00 ? 8  LYS A HE3  8  
ATOM 8065  H HZ1  . LYS A 1 8  ? 3.569   -5.280  -11.936 1.00 0.00 ? 8  LYS A HZ1  8  
ATOM 8066  H HZ2  . LYS A 1 8  ? 3.941   -6.566  -12.970 1.00 0.00 ? 8  LYS A HZ2  8  
ATOM 8067  H HZ3  . LYS A 1 8  ? 3.066   -5.239  -13.551 1.00 0.00 ? 8  LYS A HZ3  8  
ATOM 8068  N N    . GLY A 1 9  ? 1.209   -4.727  -15.649 1.00 0.00 ? 9  GLY A N    8  
ATOM 8069  C CA   . GLY A 1 9  ? 0.925   -6.106  -16.000 1.00 0.00 ? 9  GLY A CA   8  
ATOM 8070  C C    . GLY A 1 9  ? 0.793   -6.999  -14.782 1.00 0.00 ? 9  GLY A C    8  
ATOM 8071  O O    . GLY A 1 9  ? 0.834   -6.524  -13.648 1.00 0.00 ? 9  GLY A O    8  
ATOM 8072  H H    . GLY A 1 9  ? 0.682   -4.282  -14.953 1.00 0.00 ? 9  GLY A H    8  
ATOM 8073  H HA2  . GLY A 1 9  ? 0.002   -6.140  -16.560 1.00 0.00 ? 9  GLY A HA2  8  
ATOM 8074  H HA3  . GLY A 1 9  ? 1.726   -6.480  -16.621 1.00 0.00 ? 9  GLY A HA3  8  
ATOM 8075  N N    . GLY A 1 10 ? 0.632   -8.298  -15.017 1.00 0.00 ? 10 GLY A N    8  
ATOM 8076  C CA   . GLY A 1 10 ? 0.494   -9.238  -13.921 1.00 0.00 ? 10 GLY A CA   8  
ATOM 8077  C C    . GLY A 1 10 ? -0.696  -8.926  -13.035 1.00 0.00 ? 10 GLY A C    8  
ATOM 8078  O O    . GLY A 1 10 ? -0.749  -7.870  -12.406 1.00 0.00 ? 10 GLY A O    8  
ATOM 8079  H H    . GLY A 1 10 ? 0.606   -8.620  -15.943 1.00 0.00 ? 10 GLY A H    8  
ATOM 8080  H HA2  . GLY A 1 10 ? 0.377   -10.232 -14.326 1.00 0.00 ? 10 GLY A HA2  8  
ATOM 8081  H HA3  . GLY A 1 10 ? 1.392   -9.209  -13.321 1.00 0.00 ? 10 GLY A HA3  8  
ATOM 8082  N N    . GLN A 1 11 ? -1.654  -9.847  -12.987 1.00 0.00 ? 11 GLN A N    8  
ATOM 8083  C CA   . GLN A 1 11 ? -2.849  -9.662  -12.173 1.00 0.00 ? 11 GLN A CA   8  
ATOM 8084  C C    . GLN A 1 11 ? -2.570  -9.996  -10.712 1.00 0.00 ? 11 GLN A C    8  
ATOM 8085  O O    . GLN A 1 11 ? -2.058  -11.070 -10.396 1.00 0.00 ? 11 GLN A O    8  
ATOM 8086  C CB   . GLN A 1 11 ? -3.990  -10.536 -12.699 1.00 0.00 ? 11 GLN A CB   8  
ATOM 8087  C CG   . GLN A 1 11 ? -3.819  -12.013 -12.384 1.00 0.00 ? 11 GLN A CG   8  
ATOM 8088  C CD   . GLN A 1 11 ? -4.686  -12.900 -13.257 1.00 0.00 ? 11 GLN A CD   8  
ATOM 8089  O OE1  . GLN A 1 11 ? -5.910  -12.909 -13.130 1.00 0.00 ? 11 GLN A OE1  8  
ATOM 8090  N NE2  . GLN A 1 11 ? -4.053  -13.652 -14.150 1.00 0.00 ? 11 GLN A NE2  8  
ATOM 8091  H H    . GLN A 1 11 ? -1.554  -10.668 -13.511 1.00 0.00 ? 11 GLN A H    8  
ATOM 8092  H HA   . GLN A 1 11 ? -3.141  -8.625  -12.243 1.00 0.00 ? 11 GLN A HA   8  
ATOM 8093  H HB2  . GLN A 1 11 ? -4.917  -10.200 -12.260 1.00 0.00 ? 11 GLN A HB2  8  
ATOM 8094  H HB3  . GLN A 1 11 ? -4.048  -10.423 -13.772 1.00 0.00 ? 11 GLN A HB3  8  
ATOM 8095  H HG2  . GLN A 1 11 ? -2.785  -12.284 -12.538 1.00 0.00 ? 11 GLN A HG2  8  
ATOM 8096  H HG3  . GLN A 1 11 ? -4.084  -12.180 -11.351 1.00 0.00 ? 11 GLN A HG3  8  
ATOM 8097  H HE21 . GLN A 1 11 ? -3.075  -13.593 -14.194 1.00 0.00 ? 11 GLN A HE21 8  
ATOM 8098  H HE22 . GLN A 1 11 ? -4.588  -14.235 -14.727 1.00 0.00 ? 11 GLN A HE22 8  
ATOM 8099  N N    . VAL A 1 12 ? -2.910  -9.068  -9.822  1.00 0.00 ? 12 VAL A N    8  
ATOM 8100  C CA   . VAL A 1 12 ? -2.697  -9.264  -8.394  1.00 0.00 ? 12 VAL A CA   8  
ATOM 8101  C C    . VAL A 1 12 ? -3.897  -8.780  -7.587  1.00 0.00 ? 12 VAL A C    8  
ATOM 8102  O O    . VAL A 1 12 ? -4.515  -7.770  -7.921  1.00 0.00 ? 12 VAL A O    8  
ATOM 8103  C CB   . VAL A 1 12 ? -1.435  -8.526  -7.908  1.00 0.00 ? 12 VAL A CB   8  
ATOM 8104  C CG1  . VAL A 1 12 ? -0.205  -9.028  -8.648  1.00 0.00 ? 12 VAL A CG1  8  
ATOM 8105  C CG2  . VAL A 1 12 ? -1.596  -7.024  -8.084  1.00 0.00 ? 12 VAL A CG2  8  
ATOM 8106  H H    . VAL A 1 12 ? -3.315  -8.232  -10.135 1.00 0.00 ? 12 VAL A H    8  
ATOM 8107  H HA   . VAL A 1 12 ? -2.560  -10.321 -8.218  1.00 0.00 ? 12 VAL A HA   8  
ATOM 8108  H HB   . VAL A 1 12 ? -1.305  -8.732  -6.856  1.00 0.00 ? 12 VAL A HB   8  
ATOM 8109  H HG11 . VAL A 1 12 ? -0.465  -9.902  -9.228  1.00 0.00 ? 12 VAL A HG11 8  
ATOM 8110  H HG12 . VAL A 1 12 ? 0.162   -8.254  -9.305  1.00 0.00 ? 12 VAL A HG12 8  
ATOM 8111  H HG13 . VAL A 1 12 ? 0.563   -9.288  -7.933  1.00 0.00 ? 12 VAL A HG13 8  
ATOM 8112  H HG21 . VAL A 1 12 ? -2.280  -6.646  -7.339  1.00 0.00 ? 12 VAL A HG21 8  
ATOM 8113  H HG22 . VAL A 1 12 ? -0.636  -6.542  -7.968  1.00 0.00 ? 12 VAL A HG22 8  
ATOM 8114  H HG23 . VAL A 1 12 ? -1.986  -6.816  -9.069  1.00 0.00 ? 12 VAL A HG23 8  
ATOM 8115  N N    . ARG A 1 13 ? -4.221  -9.509  -6.524  1.00 0.00 ? 13 ARG A N    8  
ATOM 8116  C CA   . ARG A 1 13 ? -5.348  -9.155  -5.670  1.00 0.00 ? 13 ARG A CA   8  
ATOM 8117  C C    . ARG A 1 13 ? -5.255  -9.868  -4.324  1.00 0.00 ? 13 ARG A C    8  
ATOM 8118  O O    . ARG A 1 13 ? -4.903  -11.046 -4.256  1.00 0.00 ? 13 ARG A O    8  
ATOM 8119  C CB   . ARG A 1 13 ? -6.668  -9.510  -6.357  1.00 0.00 ? 13 ARG A CB   8  
ATOM 8120  C CG   . ARG A 1 13 ? -7.872  -8.790  -5.773  1.00 0.00 ? 13 ARG A CG   8  
ATOM 8121  C CD   . ARG A 1 13 ? -8.114  -7.457  -6.464  1.00 0.00 ? 13 ARG A CD   8  
ATOM 8122  N NE   . ARG A 1 13 ? -8.258  -7.609  -7.910  1.00 0.00 ? 13 ARG A NE   8  
ATOM 8123  C CZ   . ARG A 1 13 ? -8.377  -6.585  -8.748  1.00 0.00 ? 13 ARG A CZ   8  
ATOM 8124  N NH1  . ARG A 1 13 ? -8.368  -5.342  -8.287  1.00 0.00 ? 13 ARG A NH1  8  
ATOM 8125  N NH2  . ARG A 1 13 ? -8.504  -6.804  -10.050 1.00 0.00 ? 13 ARG A NH2  8  
ATOM 8126  H H    . ARG A 1 13 ? -3.690  -10.304 -6.309  1.00 0.00 ? 13 ARG A H    8  
ATOM 8127  H HA   . ARG A 1 13 ? -5.315  -8.089  -5.502  1.00 0.00 ? 13 ARG A HA   8  
ATOM 8128  H HB2  . ARG A 1 13 ? -6.596  -9.254  -7.404  1.00 0.00 ? 13 ARG A HB2  8  
ATOM 8129  H HB3  . ARG A 1 13 ? -6.832  -10.573 -6.266  1.00 0.00 ? 13 ARG A HB3  8  
ATOM 8130  H HG2  . ARG A 1 13 ? -8.747  -9.411  -5.897  1.00 0.00 ? 13 ARG A HG2  8  
ATOM 8131  H HG3  . ARG A 1 13 ? -7.699  -8.614  -4.721  1.00 0.00 ? 13 ARG A HG3  8  
ATOM 8132  H HD2  . ARG A 1 13 ? -9.017  -7.019  -6.066  1.00 0.00 ? 13 ARG A HD2  8  
ATOM 8133  H HD3  . ARG A 1 13 ? -7.277  -6.805  -6.262  1.00 0.00 ? 13 ARG A HD3  8  
ATOM 8134  H HE   . ARG A 1 13 ? -8.267  -8.519  -8.272  1.00 0.00 ? 13 ARG A HE   8  
ATOM 8135  H HH11 . ARG A 1 13 ? -8.271  -5.175  -7.306  1.00 0.00 ? 13 ARG A HH11 8  
ATOM 8136  H HH12 . ARG A 1 13 ? -8.457  -4.573  -8.920  1.00 0.00 ? 13 ARG A HH12 8  
ATOM 8137  H HH21 . ARG A 1 13 ? -8.511  -7.740  -10.402 1.00 0.00 ? 13 ARG A HH21 8  
ATOM 8138  H HH22 . ARG A 1 13 ? -8.594  -6.033  -10.680 1.00 0.00 ? 13 ARG A HH22 8  
ATOM 8139  N N    . PHE A 1 14 ? -5.573  -9.145  -3.254  1.00 0.00 ? 14 PHE A N    8  
ATOM 8140  C CA   . PHE A 1 14 ? -5.524  -9.708  -1.910  1.00 0.00 ? 14 PHE A CA   8  
ATOM 8141  C C    . PHE A 1 14 ? -6.856  -9.516  -1.191  1.00 0.00 ? 14 PHE A C    8  
ATOM 8142  O O    . PHE A 1 14 ? -7.687  -8.709  -1.607  1.00 0.00 ? 14 PHE A O    8  
ATOM 8143  C CB   . PHE A 1 14 ? -4.398  -9.058  -1.103  1.00 0.00 ? 14 PHE A CB   8  
ATOM 8144  C CG   . PHE A 1 14 ? -3.024  -9.458  -1.560  1.00 0.00 ? 14 PHE A CG   8  
ATOM 8145  C CD1  . PHE A 1 14 ? -2.405  -8.788  -2.604  1.00 0.00 ? 14 PHE A CD1  8  
ATOM 8146  C CD2  . PHE A 1 14 ? -2.353  -10.503 -0.948  1.00 0.00 ? 14 PHE A CD2  8  
ATOM 8147  C CE1  . PHE A 1 14 ? -1.141  -9.153  -3.027  1.00 0.00 ? 14 PHE A CE1  8  
ATOM 8148  C CE2  . PHE A 1 14 ? -1.088  -10.873 -1.366  1.00 0.00 ? 14 PHE A CE2  8  
ATOM 8149  C CZ   . PHE A 1 14 ? -0.482  -10.198 -2.408  1.00 0.00 ? 14 PHE A CZ   8  
ATOM 8150  H H    . PHE A 1 14 ? -5.846  -8.211  -3.372  1.00 0.00 ? 14 PHE A H    8  
ATOM 8151  H HA   . PHE A 1 14 ? -5.326  -10.765 -2.001  1.00 0.00 ? 14 PHE A HA   8  
ATOM 8152  H HB2  . PHE A 1 14 ? -4.476  -7.985  -1.189  1.00 0.00 ? 14 PHE A HB2  8  
ATOM 8153  H HB3  . PHE A 1 14 ? -4.499  -9.340  -0.066  1.00 0.00 ? 14 PHE A HB3  8  
ATOM 8154  H HD1  . PHE A 1 14 ? -2.920  -7.971  -3.089  1.00 0.00 ? 14 PHE A HD1  8  
ATOM 8155  H HD2  . PHE A 1 14 ? -2.826  -11.033 -0.134  1.00 0.00 ? 14 PHE A HD2  8  
ATOM 8156  H HE1  . PHE A 1 14 ? -0.670  -8.624  -3.841  1.00 0.00 ? 14 PHE A HE1  8  
ATOM 8157  H HE2  . PHE A 1 14 ? -0.576  -11.690 -0.881  1.00 0.00 ? 14 PHE A HE2  8  
ATOM 8158  H HZ   . PHE A 1 14 ? 0.506   -10.484 -2.736  1.00 0.00 ? 14 PHE A HZ   8  
ATOM 8159  N N    . SER A 1 15 ? -7.052  -10.265 -0.110  1.00 0.00 ? 15 SER A N    8  
ATOM 8160  C CA   . SER A 1 15 ? -8.284  -10.182 0.664   1.00 0.00 ? 15 SER A CA   8  
ATOM 8161  C C    . SER A 1 15 ? -8.167  -9.126  1.760   1.00 0.00 ? 15 SER A C    8  
ATOM 8162  O O    . SER A 1 15 ? -7.066  -8.762  2.170   1.00 0.00 ? 15 SER A O    8  
ATOM 8163  C CB   . SER A 1 15 ? -8.616  -11.541 1.283   1.00 0.00 ? 15 SER A CB   8  
ATOM 8164  O OG   . SER A 1 15 ? -9.935  -11.558 1.800   1.00 0.00 ? 15 SER A OG   8  
ATOM 8165  H H    . SER A 1 15 ? -6.351  -10.890 0.171   1.00 0.00 ? 15 SER A H    8  
ATOM 8166  H HA   . SER A 1 15 ? -9.080  -9.898  -0.008  1.00 0.00 ? 15 SER A HA   8  
ATOM 8167  H HB2  . SER A 1 15 ? -8.528  -12.308 0.529   1.00 0.00 ? 15 SER A HB2  8  
ATOM 8168  H HB3  . SER A 1 15 ? -7.923  -11.746 2.087   1.00 0.00 ? 15 SER A HB3  8  
ATOM 8169  H HG   . SER A 1 15 ? -10.323 -12.424 1.658   1.00 0.00 ? 15 SER A HG   8  
ATOM 8170  N N    . ASN A 1 16 ? -9.311  -8.640  2.229   1.00 0.00 ? 16 ASN A N    8  
ATOM 8171  C CA   . ASN A 1 16 ? -9.338  -7.626  3.277   1.00 0.00 ? 16 ASN A CA   8  
ATOM 8172  C C    . ASN A 1 16 ? -8.406  -8.004  4.424   1.00 0.00 ? 16 ASN A C    8  
ATOM 8173  O O    . ASN A 1 16 ? -7.473  -7.269  4.748   1.00 0.00 ? 16 ASN A O    8  
ATOM 8174  C CB   . ASN A 1 16 ? -10.763 -7.443  3.802   1.00 0.00 ? 16 ASN A CB   8  
ATOM 8175  C CG   . ASN A 1 16 ? -11.412 -8.760  4.183   1.00 0.00 ? 16 ASN A CG   8  
ATOM 8176  O OD1  . ASN A 1 16 ? -11.683 -9.602  3.326   1.00 0.00 ? 16 ASN A OD1  8  
ATOM 8177  N ND2  . ASN A 1 16 ? -11.667 -8.943  5.473   1.00 0.00 ? 16 ASN A ND2  8  
ATOM 8178  H H    . ASN A 1 16 ? -10.158 -8.970  1.862   1.00 0.00 ? 16 ASN A H    8  
ATOM 8179  H HA   . ASN A 1 16 ? -9.000  -6.695  2.846   1.00 0.00 ? 16 ASN A HA   8  
ATOM 8180  H HB2  . ASN A 1 16 ? -10.739 -6.810  4.678   1.00 0.00 ? 16 ASN A HB2  8  
ATOM 8181  H HB3  . ASN A 1 16 ? -11.365 -6.973  3.039   1.00 0.00 ? 16 ASN A HB3  8  
ATOM 8182  H HD21 . ASN A 1 16 ? -11.424 -8.229  6.099   1.00 0.00 ? 16 ASN A HD21 8  
ATOM 8183  H HD22 . ASN A 1 16 ? -12.085 -9.786  5.747   1.00 0.00 ? 16 ASN A HD22 8  
ATOM 8184  N N    . ASP A 1 17 ? -8.665  -9.156  5.034   1.00 0.00 ? 17 ASP A N    8  
ATOM 8185  C CA   . ASP A 1 17 ? -7.848  -9.633  6.144   1.00 0.00 ? 17 ASP A CA   8  
ATOM 8186  C C    . ASP A 1 17 ? -6.409  -9.872  5.697   1.00 0.00 ? 17 ASP A C    8  
ATOM 8187  O O    . ASP A 1 17 ? -5.468  -9.370  6.311   1.00 0.00 ? 17 ASP A O    8  
ATOM 8188  C CB   . ASP A 1 17 ? -8.437  -10.922 6.720   1.00 0.00 ? 17 ASP A CB   8  
ATOM 8189  C CG   . ASP A 1 17 ? -7.567  -11.520 7.809   1.00 0.00 ? 17 ASP A CG   8  
ATOM 8190  O OD1  . ASP A 1 17 ? -6.468  -12.017 7.485   1.00 0.00 ? 17 ASP A OD1  8  
ATOM 8191  O OD2  . ASP A 1 17 ? -7.985  -11.489 8.985   1.00 0.00 ? 17 ASP A OD2  8  
ATOM 8192  H H    . ASP A 1 17 ? -9.422  -9.698  4.730   1.00 0.00 ? 17 ASP A H    8  
ATOM 8193  H HA   . ASP A 1 17 ? -7.852  -8.873  6.910   1.00 0.00 ? 17 ASP A HA   8  
ATOM 8194  H HB2  . ASP A 1 17 ? -9.410  -10.711 7.138   1.00 0.00 ? 17 ASP A HB2  8  
ATOM 8195  H HB3  . ASP A 1 17 ? -8.540  -11.649 5.927   1.00 0.00 ? 17 ASP A HB3  8  
ATOM 8196  N N    . GLN A 1 18 ? -6.248  -10.642 4.626   1.00 0.00 ? 18 GLN A N    8  
ATOM 8197  C CA   . GLN A 1 18 ? -4.923  -10.948 4.098   1.00 0.00 ? 18 GLN A CA   8  
ATOM 8198  C C    . GLN A 1 18 ? -4.035  -9.708  4.103   1.00 0.00 ? 18 GLN A C    8  
ATOM 8199  O O    . GLN A 1 18 ? -2.968  -9.697  4.718   1.00 0.00 ? 18 GLN A O    8  
ATOM 8200  C CB   . GLN A 1 18 ? -5.033  -11.505 2.678   1.00 0.00 ? 18 GLN A CB   8  
ATOM 8201  C CG   . GLN A 1 18 ? -5.371  -12.987 2.631   1.00 0.00 ? 18 GLN A CG   8  
ATOM 8202  C CD   . GLN A 1 18 ? -5.781  -13.448 1.246   1.00 0.00 ? 18 GLN A CD   8  
ATOM 8203  O OE1  . GLN A 1 18 ? -5.906  -12.642 0.323   1.00 0.00 ? 18 GLN A OE1  8  
ATOM 8204  N NE2  . GLN A 1 18 ? -5.993  -14.750 1.094   1.00 0.00 ? 18 GLN A NE2  8  
ATOM 8205  H H    . GLN A 1 18 ? -7.037  -11.013 4.180   1.00 0.00 ? 18 GLN A H    8  
ATOM 8206  H HA   . GLN A 1 18 ? -4.478  -11.696 4.736   1.00 0.00 ? 18 GLN A HA   8  
ATOM 8207  H HB2  . GLN A 1 18 ? -5.804  -10.965 2.150   1.00 0.00 ? 18 GLN A HB2  8  
ATOM 8208  H HB3  . GLN A 1 18 ? -4.090  -11.358 2.172   1.00 0.00 ? 18 GLN A HB3  8  
ATOM 8209  H HG2  . GLN A 1 18 ? -4.503  -13.551 2.938   1.00 0.00 ? 18 GLN A HG2  8  
ATOM 8210  H HG3  . GLN A 1 18 ? -6.185  -13.179 3.314   1.00 0.00 ? 18 GLN A HG3  8  
ATOM 8211  H HE21 . GLN A 1 18 ? -5.876  -15.332 1.874   1.00 0.00 ? 18 GLN A HE21 8  
ATOM 8212  H HE22 . GLN A 1 18 ? -6.260  -15.075 0.210   1.00 0.00 ? 18 GLN A HE22 8  
ATOM 8213  N N    . THR A 1 19 ? -4.482  -8.663  3.413   1.00 0.00 ? 19 THR A N    8  
ATOM 8214  C CA   . THR A 1 19 ? -3.728  -7.418  3.337   1.00 0.00 ? 19 THR A CA   8  
ATOM 8215  C C    . THR A 1 19 ? -3.370  -6.906  4.727   1.00 0.00 ? 19 THR A C    8  
ATOM 8216  O O    . THR A 1 19 ? -2.199  -6.683  5.034   1.00 0.00 ? 19 THR A O    8  
ATOM 8217  C CB   . THR A 1 19 ? -4.518  -6.328  2.587   1.00 0.00 ? 19 THR A CB   8  
ATOM 8218  O OG1  . THR A 1 19 ? -5.006  -6.844  1.344   1.00 0.00 ? 19 THR A OG1  8  
ATOM 8219  C CG2  . THR A 1 19 ? -3.645  -5.109  2.329   1.00 0.00 ? 19 THR A CG2  8  
ATOM 8220  H H    . THR A 1 19 ? -5.340  -8.733  2.944   1.00 0.00 ? 19 THR A H    8  
ATOM 8221  H HA   . THR A 1 19 ? -2.817  -7.613  2.790   1.00 0.00 ? 19 THR A HA   8  
ATOM 8222  H HB   . THR A 1 19 ? -5.357  -6.029  3.199   1.00 0.00 ? 19 THR A HB   8  
ATOM 8223  H HG1  . THR A 1 19 ? -4.281  -7.241  0.855   1.00 0.00 ? 19 THR A HG1  8  
ATOM 8224  H HG21 . THR A 1 19 ? -3.322  -5.110  1.299   1.00 0.00 ? 19 THR A HG21 8  
ATOM 8225  H HG22 . THR A 1 19 ? -2.783  -5.140  2.978   1.00 0.00 ? 19 THR A HG22 8  
ATOM 8226  H HG23 . THR A 1 19 ? -4.213  -4.212  2.527   1.00 0.00 ? 19 THR A HG23 8  
ATOM 8227  N N    . ILE A 1 20 ? -4.386  -6.721  5.564   1.00 0.00 ? 20 ILE A N    8  
ATOM 8228  C CA   . ILE A 1 20 ? -4.177  -6.236  6.922   1.00 0.00 ? 20 ILE A CA   8  
ATOM 8229  C C    . ILE A 1 20 ? -2.895  -6.808  7.519   1.00 0.00 ? 20 ILE A C    8  
ATOM 8230  O O    . ILE A 1 20 ? -1.959  -6.070  7.825   1.00 0.00 ? 20 ILE A O    8  
ATOM 8231  C CB   . ILE A 1 20 ? -5.361  -6.598  7.838   1.00 0.00 ? 20 ILE A CB   8  
ATOM 8232  C CG1  . ILE A 1 20 ? -6.614  -5.826  7.417   1.00 0.00 ? 20 ILE A CG1  8  
ATOM 8233  C CG2  . ILE A 1 20 ? -5.017  -6.307  9.290   1.00 0.00 ? 20 ILE A CG2  8  
ATOM 8234  C CD1  . ILE A 1 20 ? -7.890  -6.369  8.020   1.00 0.00 ? 20 ILE A CD1  8  
ATOM 8235  H H    . ILE A 1 20 ? -5.297  -6.916  5.260   1.00 0.00 ? 20 ILE A H    8  
ATOM 8236  H HA   . ILE A 1 20 ? -4.094  -5.159  6.883   1.00 0.00 ? 20 ILE A HA   8  
ATOM 8237  H HB   . ILE A 1 20 ? -5.551  -7.656  7.743   1.00 0.00 ? 20 ILE A HB   8  
ATOM 8238  H HG12 . ILE A 1 20 ? -6.515  -4.796  7.723   1.00 0.00 ? 20 ILE A HG12 8  
ATOM 8239  H HG13 . ILE A 1 20 ? -6.709  -5.869  6.341   1.00 0.00 ? 20 ILE A HG13 8  
ATOM 8240  H HG21 . ILE A 1 20 ? -4.244  -5.553  9.333   1.00 0.00 ? 20 ILE A HG21 8  
ATOM 8241  H HG22 . ILE A 1 20 ? -5.896  -5.948  9.804   1.00 0.00 ? 20 ILE A HG22 8  
ATOM 8242  H HG23 . ILE A 1 20 ? -4.665  -7.210  9.765   1.00 0.00 ? 20 ILE A HG23 8  
ATOM 8243  H HD11 . ILE A 1 20 ? -8.459  -6.882  7.258   1.00 0.00 ? 20 ILE A HD11 8  
ATOM 8244  H HD12 . ILE A 1 20 ? -7.648  -7.058  8.815   1.00 0.00 ? 20 ILE A HD12 8  
ATOM 8245  H HD13 . ILE A 1 20 ? -8.476  -5.553  8.417   1.00 0.00 ? 20 ILE A HD13 8  
ATOM 8246  N N    . GLU A 1 21 ? -2.860  -8.127  7.679   1.00 0.00 ? 21 GLU A N    8  
ATOM 8247  C CA   . GLU A 1 21 ? -1.692  -8.797  8.238   1.00 0.00 ? 21 GLU A CA   8  
ATOM 8248  C C    . GLU A 1 21 ? -0.469  -8.591  7.349   1.00 0.00 ? 21 GLU A C    8  
ATOM 8249  O O    . GLU A 1 21 ? 0.582   -8.147  7.813   1.00 0.00 ? 21 GLU A O    8  
ATOM 8250  C CB   . GLU A 1 21 ? -1.967  -10.293 8.407   1.00 0.00 ? 21 GLU A CB   8  
ATOM 8251  C CG   . GLU A 1 21 ? -2.583  -10.651 9.749   1.00 0.00 ? 21 GLU A CG   8  
ATOM 8252  C CD   . GLU A 1 21 ? -1.540  -10.952 10.807  1.00 0.00 ? 21 GLU A CD   8  
ATOM 8253  O OE1  . GLU A 1 21 ? -0.889  -12.013 10.713  1.00 0.00 ? 21 GLU A OE1  8  
ATOM 8254  O OE2  . GLU A 1 21 ? -1.376  -10.127 11.730  1.00 0.00 ? 21 GLU A OE2  8  
ATOM 8255  H H    . GLU A 1 21 ? -3.638  -8.661  7.415   1.00 0.00 ? 21 GLU A H    8  
ATOM 8256  H HA   . GLU A 1 21 ? -1.494  -8.366  9.207   1.00 0.00 ? 21 GLU A HA   8  
ATOM 8257  H HB2  . GLU A 1 21 ? -2.642  -10.613 7.627   1.00 0.00 ? 21 GLU A HB2  8  
ATOM 8258  H HB3  . GLU A 1 21 ? -1.036  -10.831 8.307   1.00 0.00 ? 21 GLU A HB3  8  
ATOM 8259  H HG2  . GLU A 1 21 ? -3.187  -9.822  10.086  1.00 0.00 ? 21 GLU A HG2  8  
ATOM 8260  H HG3  . GLU A 1 21 ? -3.209  -11.522 9.622   1.00 0.00 ? 21 GLU A HG3  8  
ATOM 8261  N N    . LEU A 1 22 ? -0.614  -8.916  6.069   1.00 0.00 ? 22 LEU A N    8  
ATOM 8262  C CA   . LEU A 1 22 ? 0.479   -8.768  5.114   1.00 0.00 ? 22 LEU A CA   8  
ATOM 8263  C C    . LEU A 1 22 ? 1.277   -7.498  5.393   1.00 0.00 ? 22 LEU A C    8  
ATOM 8264  O O    . LEU A 1 22 ? 2.469   -7.426  5.097   1.00 0.00 ? 22 LEU A O    8  
ATOM 8265  C CB   . LEU A 1 22 ? -0.067  -8.737  3.685   1.00 0.00 ? 22 LEU A CB   8  
ATOM 8266  C CG   . LEU A 1 22 ? -0.318  -10.097 3.033   1.00 0.00 ? 22 LEU A CG   8  
ATOM 8267  C CD1  . LEU A 1 22 ? -0.949  -9.922  1.660   1.00 0.00 ? 22 LEU A CD1  8  
ATOM 8268  C CD2  . LEU A 1 22 ? 0.979   -10.886 2.929   1.00 0.00 ? 22 LEU A CD2  8  
ATOM 8269  H H    . LEU A 1 22 ? -1.475  -9.265  5.758   1.00 0.00 ? 22 LEU A H    8  
ATOM 8270  H HA   . LEU A 1 22 ? 1.132   -9.620  5.222   1.00 0.00 ? 22 LEU A HA   8  
ATOM 8271  H HB2  . LEU A 1 22 ? -1.004  -8.200  3.701   1.00 0.00 ? 22 LEU A HB2  8  
ATOM 8272  H HB3  . LEU A 1 22 ? 0.643   -8.200  3.072   1.00 0.00 ? 22 LEU A HB3  8  
ATOM 8273  H HG   . LEU A 1 22 ? -1.006  -10.662 3.646   1.00 0.00 ? 22 LEU A HG   8  
ATOM 8274  H HD11 . LEU A 1 22 ? -1.620  -9.077  1.678   1.00 0.00 ? 22 LEU A HD11 8  
ATOM 8275  H HD12 . LEU A 1 22 ? -1.499  -10.815 1.401   1.00 0.00 ? 22 LEU A HD12 8  
ATOM 8276  H HD13 . LEU A 1 22 ? -0.174  -9.752  0.927   1.00 0.00 ? 22 LEU A HD13 8  
ATOM 8277  H HD21 . LEU A 1 22 ? 1.815   -10.202 2.909   1.00 0.00 ? 22 LEU A HD21 8  
ATOM 8278  H HD22 . LEU A 1 22 ? 0.972   -11.472 2.022   1.00 0.00 ? 22 LEU A HD22 8  
ATOM 8279  H HD23 . LEU A 1 22 ? 1.071   -11.541 3.782   1.00 0.00 ? 22 LEU A HD23 8  
ATOM 8280  N N    . GLU A 1 23 ? 0.611   -6.500  5.966   1.00 0.00 ? 23 GLU A N    8  
ATOM 8281  C CA   . GLU A 1 23 ? 1.260   -5.234  6.286   1.00 0.00 ? 23 GLU A CA   8  
ATOM 8282  C C    . GLU A 1 23 ? 1.922   -5.294  7.660   1.00 0.00 ? 23 GLU A C    8  
ATOM 8283  O O    . GLU A 1 23 ? 3.136   -5.129  7.785   1.00 0.00 ? 23 GLU A O    8  
ATOM 8284  C CB   . GLU A 1 23 ? 0.244   -4.091  6.246   1.00 0.00 ? 23 GLU A CB   8  
ATOM 8285  C CG   . GLU A 1 23 ? -0.515  -3.996  4.933   1.00 0.00 ? 23 GLU A CG   8  
ATOM 8286  C CD   . GLU A 1 23 ? -0.967  -2.583  4.621   1.00 0.00 ? 23 GLU A CD   8  
ATOM 8287  O OE1  . GLU A 1 23 ? -2.079  -2.209  5.048   1.00 0.00 ? 23 GLU A OE1  8  
ATOM 8288  O OE2  . GLU A 1 23 ? -0.209  -1.851  3.951   1.00 0.00 ? 23 GLU A OE2  8  
ATOM 8289  H H    . GLU A 1 23 ? -0.338  -6.618  6.178   1.00 0.00 ? 23 GLU A H    8  
ATOM 8290  H HA   . GLU A 1 23 ? 2.021   -5.054  5.541   1.00 0.00 ? 23 GLU A HA   8  
ATOM 8291  H HB2  . GLU A 1 23 ? -0.471  -4.233  7.043   1.00 0.00 ? 23 GLU A HB2  8  
ATOM 8292  H HB3  . GLU A 1 23 ? 0.765   -3.158  6.404   1.00 0.00 ? 23 GLU A HB3  8  
ATOM 8293  H HG2  . GLU A 1 23 ? 0.128   -4.336  4.135   1.00 0.00 ? 23 GLU A HG2  8  
ATOM 8294  H HG3  . GLU A 1 23 ? -1.385  -4.633  4.988   1.00 0.00 ? 23 GLU A HG3  8  
ATOM 8295  N N    . LYS A 1 24 ? 1.115   -5.530  8.688   1.00 0.00 ? 24 LYS A N    8  
ATOM 8296  C CA   . LYS A 1 24 ? 1.619   -5.612  10.054  1.00 0.00 ? 24 LYS A CA   8  
ATOM 8297  C C    . LYS A 1 24 ? 2.952   -6.354  10.098  1.00 0.00 ? 24 LYS A C    8  
ATOM 8298  O O    . LYS A 1 24 ? 3.759   -6.149  11.004  1.00 0.00 ? 24 LYS A O    8  
ATOM 8299  C CB   . LYS A 1 24 ? 0.602   -6.317  10.954  1.00 0.00 ? 24 LYS A CB   8  
ATOM 8300  C CG   . LYS A 1 24 ? -0.737  -5.603  11.033  1.00 0.00 ? 24 LYS A CG   8  
ATOM 8301  C CD   . LYS A 1 24 ? -1.735  -6.382  11.873  1.00 0.00 ? 24 LYS A CD   8  
ATOM 8302  C CE   . LYS A 1 24 ? -2.743  -5.458  12.540  1.00 0.00 ? 24 LYS A CE   8  
ATOM 8303  N NZ   . LYS A 1 24 ? -4.014  -6.164  12.862  1.00 0.00 ? 24 LYS A NZ   8  
ATOM 8304  H H    . LYS A 1 24 ? 0.156   -5.653  8.525   1.00 0.00 ? 24 LYS A H    8  
ATOM 8305  H HA   . LYS A 1 24 ? 1.770   -4.606  10.414  1.00 0.00 ? 24 LYS A HA   8  
ATOM 8306  H HB2  . LYS A 1 24 ? 0.432   -7.314  10.574  1.00 0.00 ? 24 LYS A HB2  8  
ATOM 8307  H HB3  . LYS A 1 24 ? 1.009   -6.385  11.952  1.00 0.00 ? 24 LYS A HB3  8  
ATOM 8308  H HG2  . LYS A 1 24 ? -0.590  -4.630  11.479  1.00 0.00 ? 24 LYS A HG2  8  
ATOM 8309  H HG3  . LYS A 1 24 ? -1.132  -5.487  10.034  1.00 0.00 ? 24 LYS A HG3  8  
ATOM 8310  H HD2  . LYS A 1 24 ? -2.265  -7.074  11.236  1.00 0.00 ? 24 LYS A HD2  8  
ATOM 8311  H HD3  . LYS A 1 24 ? -1.201  -6.929  12.637  1.00 0.00 ? 24 LYS A HD3  8  
ATOM 8312  H HE2  . LYS A 1 24 ? -2.313  -5.076  13.452  1.00 0.00 ? 24 LYS A HE2  8  
ATOM 8313  H HE3  . LYS A 1 24 ? -2.957  -4.637  11.871  1.00 0.00 ? 24 LYS A HE3  8  
ATOM 8314  H HZ1  . LYS A 1 24 ? -4.811  -5.496  12.835  1.00 0.00 ? 24 LYS A HZ1  8  
ATOM 8315  H HZ2  . LYS A 1 24 ? -3.960  -6.583  13.812  1.00 0.00 ? 24 LYS A HZ2  8  
ATOM 8316  H HZ3  . LYS A 1 24 ? -4.188  -6.921  12.170  1.00 0.00 ? 24 LYS A HZ3  8  
ATOM 8317  N N    . LYS A 1 25 ? 3.176   -7.216  9.112   1.00 0.00 ? 25 LYS A N    8  
ATOM 8318  C CA   . LYS A 1 25 ? 4.412   -7.987  9.036   1.00 0.00 ? 25 LYS A CA   8  
ATOM 8319  C C    . LYS A 1 25 ? 5.538   -7.152  8.435   1.00 0.00 ? 25 LYS A C    8  
ATOM 8320  O O    . LYS A 1 25 ? 6.586   -6.969  9.054   1.00 0.00 ? 25 LYS A O    8  
ATOM 8321  C CB   . LYS A 1 25 ? 4.198   -9.251  8.200   1.00 0.00 ? 25 LYS A CB   8  
ATOM 8322  C CG   . LYS A 1 25 ? 5.329   -10.258 8.319   1.00 0.00 ? 25 LYS A CG   8  
ATOM 8323  C CD   . LYS A 1 25 ? 5.438   -10.809 9.730   1.00 0.00 ? 25 LYS A CD   8  
ATOM 8324  C CE   . LYS A 1 25 ? 6.260   -12.089 9.766   1.00 0.00 ? 25 LYS A CE   8  
ATOM 8325  N NZ   . LYS A 1 25 ? 6.125   -12.798 11.069  1.00 0.00 ? 25 LYS A NZ   8  
ATOM 8326  H H    . LYS A 1 25 ? 2.494   -7.337  8.418   1.00 0.00 ? 25 LYS A H    8  
ATOM 8327  H HA   . LYS A 1 25 ? 4.687   -8.272  10.040  1.00 0.00 ? 25 LYS A HA   8  
ATOM 8328  H HB2  . LYS A 1 25 ? 3.283   -9.729  8.519   1.00 0.00 ? 25 LYS A HB2  8  
ATOM 8329  H HB3  . LYS A 1 25 ? 4.103   -8.969  7.161   1.00 0.00 ? 25 LYS A HB3  8  
ATOM 8330  H HG2  . LYS A 1 25 ? 5.144   -11.075 7.638   1.00 0.00 ? 25 LYS A HG2  8  
ATOM 8331  H HG3  . LYS A 1 25 ? 6.259   -9.773  8.058   1.00 0.00 ? 25 LYS A HG3  8  
ATOM 8332  H HD2  . LYS A 1 25 ? 5.913   -10.072 10.360  1.00 0.00 ? 25 LYS A HD2  8  
ATOM 8333  H HD3  . LYS A 1 25 ? 4.445   -11.019 10.103  1.00 0.00 ? 25 LYS A HD3  8  
ATOM 8334  H HE2  . LYS A 1 25 ? 5.923   -12.740 8.975   1.00 0.00 ? 25 LYS A HE2  8  
ATOM 8335  H HE3  . LYS A 1 25 ? 7.298   -11.839 9.609   1.00 0.00 ? 25 LYS A HE3  8  
ATOM 8336  H HZ1  . LYS A 1 25 ? 5.121   -12.881 11.328  1.00 0.00 ? 25 LYS A HZ1  8  
ATOM 8337  H HZ2  . LYS A 1 25 ? 6.621   -12.272 11.816  1.00 0.00 ? 25 LYS A HZ2  8  
ATOM 8338  H HZ3  . LYS A 1 25 ? 6.534   -13.752 11.001  1.00 0.00 ? 25 LYS A HZ3  8  
ATOM 8339  N N    . PHE A 1 26 ? 5.314   -6.647  7.227   1.00 0.00 ? 26 PHE A N    8  
ATOM 8340  C CA   . PHE A 1 26 ? 6.310   -5.830  6.543   1.00 0.00 ? 26 PHE A CA   8  
ATOM 8341  C C    . PHE A 1 26 ? 6.872   -4.763  7.477   1.00 0.00 ? 26 PHE A C    8  
ATOM 8342  O O    . PHE A 1 26 ? 8.078   -4.517  7.499   1.00 0.00 ? 26 PHE A O    8  
ATOM 8343  C CB   . PHE A 1 26 ? 5.697   -5.170  5.306   1.00 0.00 ? 26 PHE A CB   8  
ATOM 8344  C CG   . PHE A 1 26 ? 6.467   -3.976  4.820   1.00 0.00 ? 26 PHE A CG   8  
ATOM 8345  C CD1  . PHE A 1 26 ? 6.253   -2.724  5.374   1.00 0.00 ? 26 PHE A CD1  8  
ATOM 8346  C CD2  . PHE A 1 26 ? 7.406   -4.106  3.809   1.00 0.00 ? 26 PHE A CD2  8  
ATOM 8347  C CE1  . PHE A 1 26 ? 6.961   -1.624  4.927   1.00 0.00 ? 26 PHE A CE1  8  
ATOM 8348  C CE2  . PHE A 1 26 ? 8.117   -3.009  3.359   1.00 0.00 ? 26 PHE A CE2  8  
ATOM 8349  C CZ   . PHE A 1 26 ? 7.895   -1.766  3.920   1.00 0.00 ? 26 PHE A CZ   8  
ATOM 8350  H H    . PHE A 1 26 ? 4.458   -6.828  6.784   1.00 0.00 ? 26 PHE A H    8  
ATOM 8351  H HA   . PHE A 1 26 ? 7.113   -6.480  6.232   1.00 0.00 ? 26 PHE A HA   8  
ATOM 8352  H HB2  . PHE A 1 26 ? 5.661   -5.890  4.503   1.00 0.00 ? 26 PHE A HB2  8  
ATOM 8353  H HB3  . PHE A 1 26 ? 4.694   -4.846  5.539   1.00 0.00 ? 26 PHE A HB3  8  
ATOM 8354  H HD1  . PHE A 1 26 ? 5.524   -2.611  6.163   1.00 0.00 ? 26 PHE A HD1  8  
ATOM 8355  H HD2  . PHE A 1 26 ? 7.581   -5.078  3.370   1.00 0.00 ? 26 PHE A HD2  8  
ATOM 8356  H HE1  . PHE A 1 26 ? 6.785   -0.654  5.368   1.00 0.00 ? 26 PHE A HE1  8  
ATOM 8357  H HE2  . PHE A 1 26 ? 8.846   -3.124  2.571   1.00 0.00 ? 26 PHE A HE2  8  
ATOM 8358  H HZ   . PHE A 1 26 ? 8.448   -0.908  3.569   1.00 0.00 ? 26 PHE A HZ   8  
ATOM 8359  N N    . GLU A 1 27 ? 5.990   -4.132  8.245   1.00 0.00 ? 27 GLU A N    8  
ATOM 8360  C CA   . GLU A 1 27 ? 6.398   -3.090  9.180   1.00 0.00 ? 27 GLU A CA   8  
ATOM 8361  C C    . GLU A 1 27 ? 7.461   -3.610  10.143  1.00 0.00 ? 27 GLU A C    8  
ATOM 8362  O O    . GLU A 1 27 ? 8.498   -2.976  10.344  1.00 0.00 ? 27 GLU A O    8  
ATOM 8363  C CB   . GLU A 1 27 ? 5.190   -2.577  9.965   1.00 0.00 ? 27 GLU A CB   8  
ATOM 8364  C CG   . GLU A 1 27 ? 3.989   -2.251  9.092   1.00 0.00 ? 27 GLU A CG   8  
ATOM 8365  C CD   . GLU A 1 27 ? 4.326   -1.282  7.976   1.00 0.00 ? 27 GLU A CD   8  
ATOM 8366  O OE1  . GLU A 1 27 ? 5.243   -0.456  8.163   1.00 0.00 ? 27 GLU A OE1  8  
ATOM 8367  O OE2  . GLU A 1 27 ? 3.671   -1.349  6.915   1.00 0.00 ? 27 GLU A OE2  8  
ATOM 8368  H H    . GLU A 1 27 ? 5.042   -4.373  8.182   1.00 0.00 ? 27 GLU A H    8  
ATOM 8369  H HA   . GLU A 1 27 ? 6.816   -2.276  8.607   1.00 0.00 ? 27 GLU A HA   8  
ATOM 8370  H HB2  . GLU A 1 27 ? 4.895   -3.329  10.682  1.00 0.00 ? 27 GLU A HB2  8  
ATOM 8371  H HB3  . GLU A 1 27 ? 5.475   -1.680  10.496  1.00 0.00 ? 27 GLU A HB3  8  
ATOM 8372  H HG2  . GLU A 1 27 ? 3.621   -3.167  8.654   1.00 0.00 ? 27 GLU A HG2  8  
ATOM 8373  H HG3  . GLU A 1 27 ? 3.219   -1.814  9.710   1.00 0.00 ? 27 GLU A HG3  8  
ATOM 8374  N N    . THR A 1 28 ? 7.196   -4.769  10.739  1.00 0.00 ? 28 THR A N    8  
ATOM 8375  C CA   . THR A 1 28 ? 8.128   -5.374  11.682  1.00 0.00 ? 28 THR A CA   8  
ATOM 8376  C C    . THR A 1 28 ? 9.356   -5.924  10.966  1.00 0.00 ? 28 THR A C    8  
ATOM 8377  O O    . THR A 1 28 ? 10.427  -6.047  11.560  1.00 0.00 ? 28 THR A O    8  
ATOM 8378  C CB   . THR A 1 28 ? 7.461   -6.511  12.479  1.00 0.00 ? 28 THR A CB   8  
ATOM 8379  O OG1  . THR A 1 28 ? 6.863   -7.453  11.582  1.00 0.00 ? 28 THR A OG1  8  
ATOM 8380  C CG2  . THR A 1 28 ? 6.402   -5.961  13.424  1.00 0.00 ? 28 THR A CG2  8  
ATOM 8381  H H    . THR A 1 28 ? 6.353   -5.227  10.538  1.00 0.00 ? 28 THR A H    8  
ATOM 8382  H HA   . THR A 1 28 ? 8.440   -4.610  12.379  1.00 0.00 ? 28 THR A HA   8  
ATOM 8383  H HB   . THR A 1 28 ? 8.218   -7.013  13.064  1.00 0.00 ? 28 THR A HB   8  
ATOM 8384  H HG1  . THR A 1 28 ? 7.251   -8.320  11.724  1.00 0.00 ? 28 THR A HG1  8  
ATOM 8385  H HG21 . THR A 1 28 ? 5.501   -5.745  12.869  1.00 0.00 ? 28 THR A HG21 8  
ATOM 8386  H HG22 . THR A 1 28 ? 6.767   -5.055  13.885  1.00 0.00 ? 28 THR A HG22 8  
ATOM 8387  H HG23 . THR A 1 28 ? 6.187   -6.693  14.188  1.00 0.00 ? 28 THR A HG23 8  
ATOM 8388  N N    . GLN A 1 29 ? 9.193   -6.252  9.689   1.00 0.00 ? 29 GLN A N    8  
ATOM 8389  C CA   . GLN A 1 29 ? 10.291  -6.788  8.893   1.00 0.00 ? 29 GLN A CA   8  
ATOM 8390  C C    . GLN A 1 29 ? 10.042  -6.568  7.404   1.00 0.00 ? 29 GLN A C    8  
ATOM 8391  O O    . GLN A 1 29 ? 9.124   -7.148  6.824   1.00 0.00 ? 29 GLN A O    8  
ATOM 8392  C CB   . GLN A 1 29 ? 10.472  -8.281  9.176   1.00 0.00 ? 29 GLN A CB   8  
ATOM 8393  C CG   . GLN A 1 29 ? 11.906  -8.760  9.016   1.00 0.00 ? 29 GLN A CG   8  
ATOM 8394  C CD   . GLN A 1 29 ? 12.003  -10.264 8.852   1.00 0.00 ? 29 GLN A CD   8  
ATOM 8395  O OE1  . GLN A 1 29 ? 11.217  -11.016 9.429   1.00 0.00 ? 29 GLN A OE1  8  
ATOM 8396  N NE2  . GLN A 1 29 ? 12.971  -10.712 8.060   1.00 0.00 ? 29 GLN A NE2  8  
ATOM 8397  H H    . GLN A 1 29 ? 8.315   -6.130  9.272   1.00 0.00 ? 29 GLN A H    8  
ATOM 8398  H HA   . GLN A 1 29 ? 11.192  -6.266  9.176   1.00 0.00 ? 29 GLN A HA   8  
ATOM 8399  H HB2  . GLN A 1 29 ? 10.158  -8.483  10.189  1.00 0.00 ? 29 GLN A HB2  8  
ATOM 8400  H HB3  . GLN A 1 29 ? 9.850   -8.842  8.495   1.00 0.00 ? 29 GLN A HB3  8  
ATOM 8401  H HG2  . GLN A 1 29 ? 12.334  -8.290  8.144   1.00 0.00 ? 29 GLN A HG2  8  
ATOM 8402  H HG3  . GLN A 1 29 ? 12.468  -8.471  9.892   1.00 0.00 ? 29 GLN A HG3  8  
ATOM 8403  H HE21 . GLN A 1 29 ? 13.561  -10.055 7.634   1.00 0.00 ? 29 GLN A HE21 8  
ATOM 8404  H HE22 . GLN A 1 29 ? 13.057  -11.679 7.937   1.00 0.00 ? 29 GLN A HE22 8  
ATOM 8405  N N    . LYS A 1 30 ? 10.866  -5.726  6.790   1.00 0.00 ? 30 LYS A N    8  
ATOM 8406  C CA   . LYS A 1 30 ? 10.737  -5.428  5.368   1.00 0.00 ? 30 LYS A CA   8  
ATOM 8407  C C    . LYS A 1 30 ? 10.831  -6.703  4.535   1.00 0.00 ? 30 LYS A C    8  
ATOM 8408  O O    . LYS A 1 30 ? 10.196  -6.818  3.486   1.00 0.00 ? 30 LYS A O    8  
ATOM 8409  C CB   . LYS A 1 30 ? 11.822  -4.441  4.933   1.00 0.00 ? 30 LYS A CB   8  
ATOM 8410  C CG   . LYS A 1 30 ? 11.836  -3.156  5.742   1.00 0.00 ? 30 LYS A CG   8  
ATOM 8411  C CD   . LYS A 1 30 ? 10.805  -2.163  5.231   1.00 0.00 ? 30 LYS A CD   8  
ATOM 8412  C CE   . LYS A 1 30 ? 10.383  -1.188  6.318   1.00 0.00 ? 30 LYS A CE   8  
ATOM 8413  N NZ   . LYS A 1 30 ? 9.459   -1.818  7.301   1.00 0.00 ? 30 LYS A NZ   8  
ATOM 8414  H H    . LYS A 1 30 ? 11.580  -5.294  7.306   1.00 0.00 ? 30 LYS A H    8  
ATOM 8415  H HA   . LYS A 1 30 ? 9.769   -4.979  5.210   1.00 0.00 ? 30 LYS A HA   8  
ATOM 8416  H HB2  . LYS A 1 30 ? 12.787  -4.916  5.034   1.00 0.00 ? 30 LYS A HB2  8  
ATOM 8417  H HB3  . LYS A 1 30 ? 11.664  -4.186  3.895   1.00 0.00 ? 30 LYS A HB3  8  
ATOM 8418  H HG2  . LYS A 1 30 ? 11.615  -3.388  6.773   1.00 0.00 ? 30 LYS A HG2  8  
ATOM 8419  H HG3  . LYS A 1 30 ? 12.818  -2.709  5.674   1.00 0.00 ? 30 LYS A HG3  8  
ATOM 8420  H HD2  . LYS A 1 30 ? 11.231  -1.607  4.409   1.00 0.00 ? 30 LYS A HD2  8  
ATOM 8421  H HD3  . LYS A 1 30 ? 9.935   -2.706  4.888   1.00 0.00 ? 30 LYS A HD3  8  
ATOM 8422  H HE2  . LYS A 1 30 ? 11.265  -0.843  6.837   1.00 0.00 ? 30 LYS A HE2  8  
ATOM 8423  H HE3  . LYS A 1 30 ? 9.886   -0.348  5.857   1.00 0.00 ? 30 LYS A HE3  8  
ATOM 8424  H HZ1  . LYS A 1 30 ? 8.485   -1.801  6.936   1.00 0.00 ? 30 LYS A HZ1  8  
ATOM 8425  H HZ2  . LYS A 1 30 ? 9.488   -1.301  8.202   1.00 0.00 ? 30 LYS A HZ2  8  
ATOM 8426  H HZ3  . LYS A 1 30 ? 9.737   -2.806  7.471   1.00 0.00 ? 30 LYS A HZ3  8  
ATOM 8427  N N    . TYR A 1 31 ? 11.623  -7.657  5.009   1.00 0.00 ? 31 TYR A N    8  
ATOM 8428  C CA   . TYR A 1 31 ? 11.800  -8.923  4.308   1.00 0.00 ? 31 TYR A CA   8  
ATOM 8429  C C    . TYR A 1 31 ? 11.434  -10.100 5.206   1.00 0.00 ? 31 TYR A C    8  
ATOM 8430  O O    . TYR A 1 31 ? 11.227  -9.937  6.410   1.00 0.00 ? 31 TYR A O    8  
ATOM 8431  C CB   . TYR A 1 31 ? 13.245  -9.066  3.825   1.00 0.00 ? 31 TYR A CB   8  
ATOM 8432  C CG   . TYR A 1 31 ? 13.655  -8.011  2.823   1.00 0.00 ? 31 TYR A CG   8  
ATOM 8433  C CD1  . TYR A 1 31 ? 13.283  -8.111  1.488   1.00 0.00 ? 31 TYR A CD1  8  
ATOM 8434  C CD2  . TYR A 1 31 ? 14.416  -6.915  3.210   1.00 0.00 ? 31 TYR A CD2  8  
ATOM 8435  C CE1  . TYR A 1 31 ? 13.656  -7.150  0.568   1.00 0.00 ? 31 TYR A CE1  8  
ATOM 8436  C CE2  . TYR A 1 31 ? 14.793  -5.948  2.298   1.00 0.00 ? 31 TYR A CE2  8  
ATOM 8437  C CZ   . TYR A 1 31 ? 14.411  -6.070  0.978   1.00 0.00 ? 31 TYR A CZ   8  
ATOM 8438  O OH   . TYR A 1 31 ? 14.785  -5.111  0.066   1.00 0.00 ? 31 TYR A OH   8  
ATOM 8439  H H    . TYR A 1 31 ? 12.103  -7.507  5.851   1.00 0.00 ? 31 TYR A H    8  
ATOM 8440  H HA   . TYR A 1 31 ? 11.143  -8.921  3.450   1.00 0.00 ? 31 TYR A HA   8  
ATOM 8441  H HB2  . TYR A 1 31 ? 13.909  -8.993  4.673   1.00 0.00 ? 31 TYR A HB2  8  
ATOM 8442  H HB3  . TYR A 1 31 ? 13.367  -10.032 3.359   1.00 0.00 ? 31 TYR A HB3  8  
ATOM 8443  H HD1  . TYR A 1 31 ? 12.692  -8.958  1.170   1.00 0.00 ? 31 TYR A HD1  8  
ATOM 8444  H HD2  . TYR A 1 31 ? 14.714  -6.822  4.245   1.00 0.00 ? 31 TYR A HD2  8  
ATOM 8445  H HE1  . TYR A 1 31 ? 13.358  -7.245  -0.465  1.00 0.00 ? 31 TYR A HE1  8  
ATOM 8446  H HE2  . TYR A 1 31 ? 15.384  -5.103  2.618   1.00 0.00 ? 31 TYR A HE2  8  
ATOM 8447  H HH   . TYR A 1 31 ? 14.441  -5.341  -0.800  1.00 0.00 ? 31 TYR A HH   8  
ATOM 8448  N N    . LEU A 1 32 ? 11.355  -11.286 4.614   1.00 0.00 ? 32 LEU A N    8  
ATOM 8449  C CA   . LEU A 1 32 ? 11.014  -12.493 5.359   1.00 0.00 ? 32 LEU A CA   8  
ATOM 8450  C C    . LEU A 1 32 ? 11.707  -13.715 4.764   1.00 0.00 ? 32 LEU A C    8  
ATOM 8451  O O    . LEU A 1 32 ? 11.544  -14.019 3.582   1.00 0.00 ? 32 LEU A O    8  
ATOM 8452  C CB   . LEU A 1 32 ? 9.499   -12.703 5.362   1.00 0.00 ? 32 LEU A CB   8  
ATOM 8453  C CG   . LEU A 1 32 ? 8.668   -11.586 5.994   1.00 0.00 ? 32 LEU A CG   8  
ATOM 8454  C CD1  . LEU A 1 32 ? 7.225   -11.662 5.520   1.00 0.00 ? 32 LEU A CD1  8  
ATOM 8455  C CD2  . LEU A 1 32 ? 8.738   -11.662 7.512   1.00 0.00 ? 32 LEU A CD2  8  
ATOM 8456  H H    . LEU A 1 32 ? 11.530  -11.353 3.652   1.00 0.00 ? 32 LEU A H    8  
ATOM 8457  H HA   . LEU A 1 32 ? 11.354  -12.361 6.376   1.00 0.00 ? 32 LEU A HA   8  
ATOM 8458  H HB2  . LEU A 1 32 ? 9.179   -12.815 4.338   1.00 0.00 ? 32 LEU A HB2  8  
ATOM 8459  H HB3  . LEU A 1 32 ? 9.294   -13.616 5.904   1.00 0.00 ? 32 LEU A HB3  8  
ATOM 8460  H HG   . LEU A 1 32 ? 9.069   -10.630 5.687   1.00 0.00 ? 32 LEU A HG   8  
ATOM 8461  H HD11 . LEU A 1 32 ? 6.940   -12.696 5.397   1.00 0.00 ? 32 LEU A HD11 8  
ATOM 8462  H HD12 . LEU A 1 32 ? 7.128   -11.146 4.576   1.00 0.00 ? 32 LEU A HD12 8  
ATOM 8463  H HD13 . LEU A 1 32 ? 6.581   -11.196 6.252   1.00 0.00 ? 32 LEU A HD13 8  
ATOM 8464  H HD21 . LEU A 1 32 ? 8.091   -10.910 7.939   1.00 0.00 ? 32 LEU A HD21 8  
ATOM 8465  H HD22 . LEU A 1 32 ? 9.754   -11.487 7.834   1.00 0.00 ? 32 LEU A HD22 8  
ATOM 8466  H HD23 . LEU A 1 32 ? 8.419   -12.640 7.839   1.00 0.00 ? 32 LEU A HD23 8  
ATOM 8467  N N    . SER A 1 33 ? 12.479  -14.412 5.591   1.00 0.00 ? 33 SER A N    8  
ATOM 8468  C CA   . SER A 1 33 ? 13.199  -15.600 5.146   1.00 0.00 ? 33 SER A CA   8  
ATOM 8469  C C    . SER A 1 33 ? 12.229  -16.665 4.641   1.00 0.00 ? 33 SER A C    8  
ATOM 8470  O O    . SER A 1 33 ? 11.063  -16.714 5.031   1.00 0.00 ? 33 SER A O    8  
ATOM 8471  C CB   . SER A 1 33 ? 14.046  -16.166 6.288   1.00 0.00 ? 33 SER A CB   8  
ATOM 8472  O OG   . SER A 1 33 ? 14.654  -15.127 7.035   1.00 0.00 ? 33 SER A OG   8  
ATOM 8473  H H    . SER A 1 33 ? 12.569  -14.119 6.522   1.00 0.00 ? 33 SER A H    8  
ATOM 8474  H HA   . SER A 1 33 ? 13.850  -15.309 4.336   1.00 0.00 ? 33 SER A HA   8  
ATOM 8475  H HB2  . SER A 1 33 ? 13.418  -16.746 6.946   1.00 0.00 ? 33 SER A HB2  8  
ATOM 8476  H HB3  . SER A 1 33 ? 14.820  -16.799 5.878   1.00 0.00 ? 33 SER A HB3  8  
ATOM 8477  H HG   . SER A 1 33 ? 14.073  -14.867 7.753   1.00 0.00 ? 33 SER A HG   8  
ATOM 8478  N N    . PRO A 1 34 ? 12.723  -17.539 3.752   1.00 0.00 ? 34 PRO A N    8  
ATOM 8479  C CA   . PRO A 1 34 ? 11.919  -18.619 3.174   1.00 0.00 ? 34 PRO A CA   8  
ATOM 8480  C C    . PRO A 1 34 ? 11.144  -19.396 4.233   1.00 0.00 ? 34 PRO A C    8  
ATOM 8481  O O    . PRO A 1 34 ? 9.963   -19.705 4.071   1.00 0.00 ? 34 PRO A O    8  
ATOM 8482  C CB   . PRO A 1 34 ? 12.961  -19.520 2.507   1.00 0.00 ? 34 PRO A CB   8  
ATOM 8483  C CG   . PRO A 1 34 ? 14.103  -18.613 2.198   1.00 0.00 ? 34 PRO A CG   8  
ATOM 8484  C CD   . PRO A 1 34 ? 14.105  -17.540 3.242   1.00 0.00 ? 34 PRO A CD   8  
ATOM 8485  H HA   . PRO A 1 34 ? 11.232  -18.247 2.428   1.00 0.00 ? 34 PRO A HA   8  
ATOM 8486  H HB2  . PRO A 1 34 ? 13.253  -20.305 3.190   1.00 0.00 ? 34 PRO A HB2  8  
ATOM 8487  H HB3  . PRO A 1 34 ? 12.547  -19.952 1.608   1.00 0.00 ? 34 PRO A HB3  8  
ATOM 8488  H HG2  . PRO A 1 34 ? 15.030  -19.164 2.237   1.00 0.00 ? 34 PRO A HG2  8  
ATOM 8489  H HG3  . PRO A 1 34 ? 13.967  -18.173 1.221   1.00 0.00 ? 34 PRO A HG3  8  
ATOM 8490  H HD2  . PRO A 1 34 ? 14.805  -17.785 4.027   1.00 0.00 ? 34 PRO A HD2  8  
ATOM 8491  H HD3  . PRO A 1 34 ? 14.352  -16.587 2.797   1.00 0.00 ? 34 PRO A HD3  8  
ATOM 8492  N N    . PRO A 1 35 ? 11.821  -19.719 5.345   1.00 0.00 ? 35 PRO A N    8  
ATOM 8493  C CA   . PRO A 1 35 ? 11.215  -20.462 6.453   1.00 0.00 ? 35 PRO A CA   8  
ATOM 8494  C C    . PRO A 1 35 ? 9.862   -19.892 6.862   1.00 0.00 ? 35 PRO A C    8  
ATOM 8495  O O    . PRO A 1 35 ? 8.906   -20.635 7.082   1.00 0.00 ? 35 PRO A O    8  
ATOM 8496  C CB   . PRO A 1 35 ? 12.230  -20.298 7.587   1.00 0.00 ? 35 PRO A CB   8  
ATOM 8497  C CG   . PRO A 1 35 ? 13.532  -20.071 6.901   1.00 0.00 ? 35 PRO A CG   8  
ATOM 8498  C CD   . PRO A 1 35 ? 13.231  -19.382 5.606   1.00 0.00 ? 35 PRO A CD   8  
ATOM 8499  H HA   . PRO A 1 35 ? 11.106  -21.510 6.215   1.00 0.00 ? 35 PRO A HA   8  
ATOM 8500  H HB2  . PRO A 1 35 ? 11.953  -19.452 8.201   1.00 0.00 ? 35 PRO A HB2  8  
ATOM 8501  H HB3  . PRO A 1 35 ? 12.251  -21.194 8.189   1.00 0.00 ? 35 PRO A HB3  8  
ATOM 8502  H HG2  . PRO A 1 35 ? 14.165  -19.445 7.511   1.00 0.00 ? 35 PRO A HG2  8  
ATOM 8503  H HG3  . PRO A 1 35 ? 14.014  -21.018 6.707   1.00 0.00 ? 35 PRO A HG3  8  
ATOM 8504  H HD2  . PRO A 1 35 ? 13.359  -18.315 5.713   1.00 0.00 ? 35 PRO A HD2  8  
ATOM 8505  H HD3  . PRO A 1 35 ? 13.869  -19.764 4.823   1.00 0.00 ? 35 PRO A HD3  8  
ATOM 8506  N N    . GLU A 1 36 ? 9.788   -18.568 6.962   1.00 0.00 ? 36 GLU A N    8  
ATOM 8507  C CA   . GLU A 1 36 ? 8.550   -17.899 7.345   1.00 0.00 ? 36 GLU A CA   8  
ATOM 8508  C C    . GLU A 1 36 ? 7.622   -17.743 6.144   1.00 0.00 ? 36 GLU A C    8  
ATOM 8509  O O    . GLU A 1 36 ? 6.558   -18.360 6.084   1.00 0.00 ? 36 GLU A O    8  
ATOM 8510  C CB   . GLU A 1 36 ? 8.852   -16.528 7.952   1.00 0.00 ? 36 GLU A CB   8  
ATOM 8511  C CG   . GLU A 1 36 ? 10.006  -16.540 8.941   1.00 0.00 ? 36 GLU A CG   8  
ATOM 8512  C CD   . GLU A 1 36 ? 9.554   -16.808 10.363  1.00 0.00 ? 36 GLU A CD   8  
ATOM 8513  O OE1  . GLU A 1 36 ? 8.938   -17.869 10.599  1.00 0.00 ? 36 GLU A OE1  8  
ATOM 8514  O OE2  . GLU A 1 36 ? 9.814   -15.957 11.239  1.00 0.00 ? 36 GLU A OE2  8  
ATOM 8515  H H    . GLU A 1 36 ? 10.584  -18.029 6.774   1.00 0.00 ? 36 GLU A H    8  
ATOM 8516  H HA   . GLU A 1 36 ? 8.059   -18.511 8.087   1.00 0.00 ? 36 GLU A HA   8  
ATOM 8517  H HB2  . GLU A 1 36 ? 9.095   -15.840 7.155   1.00 0.00 ? 36 GLU A HB2  8  
ATOM 8518  H HB3  . GLU A 1 36 ? 7.971   -16.173 8.465   1.00 0.00 ? 36 GLU A HB3  8  
ATOM 8519  H HG2  . GLU A 1 36 ? 10.704  -17.312 8.650   1.00 0.00 ? 36 GLU A HG2  8  
ATOM 8520  H HG3  . GLU A 1 36 ? 10.500  -15.580 8.910   1.00 0.00 ? 36 GLU A HG3  8  
ATOM 8521  N N    . ARG A 1 37 ? 8.032   -16.914 5.191   1.00 0.00 ? 37 ARG A N    8  
ATOM 8522  C CA   . ARG A 1 37 ? 7.237   -16.674 3.992   1.00 0.00 ? 37 ARG A CA   8  
ATOM 8523  C C    . ARG A 1 37 ? 6.488   -17.936 3.575   1.00 0.00 ? 37 ARG A C    8  
ATOM 8524  O O    . ARG A 1 37 ? 5.370   -17.868 3.065   1.00 0.00 ? 37 ARG A O    8  
ATOM 8525  C CB   . ARG A 1 37 ? 8.133   -16.198 2.847   1.00 0.00 ? 37 ARG A CB   8  
ATOM 8526  C CG   . ARG A 1 37 ? 7.387   -15.425 1.772   1.00 0.00 ? 37 ARG A CG   8  
ATOM 8527  C CD   . ARG A 1 37 ? 8.141   -15.440 0.451   1.00 0.00 ? 37 ARG A CD   8  
ATOM 8528  N NE   . ARG A 1 37 ? 8.636   -16.773 0.118   1.00 0.00 ? 37 ARG A NE   8  
ATOM 8529  C CZ   . ARG A 1 37 ? 9.633   -16.996 -0.731  1.00 0.00 ? 37 ARG A CZ   8  
ATOM 8530  N NH1  . ARG A 1 37 ? 10.238  -15.980 -1.329  1.00 0.00 ? 37 ARG A NH1  8  
ATOM 8531  N NH2  . ARG A 1 37 ? 10.026  -18.238 -0.982  1.00 0.00 ? 37 ARG A NH2  8  
ATOM 8532  H H    . ARG A 1 37 ? 8.890   -16.451 5.296   1.00 0.00 ? 37 ARG A H    8  
ATOM 8533  H HA   . ARG A 1 37 ? 6.518   -15.902 4.220   1.00 0.00 ? 37 ARG A HA   8  
ATOM 8534  H HB2  . ARG A 1 37 ? 8.904   -15.558 3.250   1.00 0.00 ? 37 ARG A HB2  8  
ATOM 8535  H HB3  . ARG A 1 37 ? 8.595   -17.058 2.386   1.00 0.00 ? 37 ARG A HB3  8  
ATOM 8536  H HG2  . ARG A 1 37 ? 6.417   -15.875 1.625   1.00 0.00 ? 37 ARG A HG2  8  
ATOM 8537  H HG3  . ARG A 1 37 ? 7.266   -14.402 2.096   1.00 0.00 ? 37 ARG A HG3  8  
ATOM 8538  H HD2  . ARG A 1 37 ? 7.475   -15.108 -0.332  1.00 0.00 ? 37 ARG A HD2  8  
ATOM 8539  H HD3  . ARG A 1 37 ? 8.979   -14.762 0.522   1.00 0.00 ? 37 ARG A HD3  8  
ATOM 8540  H HE   . ARG A 1 37 ? 8.202   -17.538 0.549   1.00 0.00 ? 37 ARG A HE   8  
ATOM 8541  H HH11 . ARG A 1 37 ? 9.945   -15.043 -1.141  1.00 0.00 ? 37 ARG A HH11 8  
ATOM 8542  H HH12 . ARG A 1 37 ? 10.990  -16.150 -1.967  1.00 0.00 ? 37 ARG A HH12 8  
ATOM 8543  H HH21 . ARG A 1 37 ? 9.572   -19.007 -0.532  1.00 0.00 ? 37 ARG A HH21 8  
ATOM 8544  H HH22 . ARG A 1 37 ? 10.776  -18.405 -1.621  1.00 0.00 ? 37 ARG A HH22 8  
ATOM 8545  N N    . LYS A 1 38 ? 7.112   -19.088 3.796   1.00 0.00 ? 38 LYS A N    8  
ATOM 8546  C CA   . LYS A 1 38 ? 6.506   -20.367 3.445   1.00 0.00 ? 38 LYS A CA   8  
ATOM 8547  C C    . LYS A 1 38 ? 5.277   -20.642 4.306   1.00 0.00 ? 38 LYS A C    8  
ATOM 8548  O O    . LYS A 1 38 ? 4.209   -20.972 3.792   1.00 0.00 ? 38 LYS A O    8  
ATOM 8549  C CB   . LYS A 1 38 ? 7.522   -21.499 3.612   1.00 0.00 ? 38 LYS A CB   8  
ATOM 8550  C CG   . LYS A 1 38 ? 8.385   -21.728 2.383   1.00 0.00 ? 38 LYS A CG   8  
ATOM 8551  C CD   . LYS A 1 38 ? 9.471   -22.757 2.648   1.00 0.00 ? 38 LYS A CD   8  
ATOM 8552  C CE   . LYS A 1 38 ? 10.708  -22.117 3.259   1.00 0.00 ? 38 LYS A CE   8  
ATOM 8553  N NZ   . LYS A 1 38 ? 11.887  -23.026 3.206   1.00 0.00 ? 38 LYS A NZ   8  
ATOM 8554  H H    . LYS A 1 38 ? 8.003   -19.078 4.207   1.00 0.00 ? 38 LYS A H    8  
ATOM 8555  H HA   . LYS A 1 38 ? 6.202   -20.317 2.411   1.00 0.00 ? 38 LYS A HA   8  
ATOM 8556  H HB2  . LYS A 1 38 ? 8.170   -21.266 4.443   1.00 0.00 ? 38 LYS A HB2  8  
ATOM 8557  H HB3  . LYS A 1 38 ? 6.990   -22.415 3.827   1.00 0.00 ? 38 LYS A HB3  8  
ATOM 8558  H HG2  . LYS A 1 38 ? 7.760   -22.080 1.575   1.00 0.00 ? 38 LYS A HG2  8  
ATOM 8559  H HG3  . LYS A 1 38 ? 8.848   -20.793 2.101   1.00 0.00 ? 38 LYS A HG3  8  
ATOM 8560  H HD2  . LYS A 1 38 ? 9.091   -23.502 3.331   1.00 0.00 ? 38 LYS A HD2  8  
ATOM 8561  H HD3  . LYS A 1 38 ? 9.744   -23.228 1.714   1.00 0.00 ? 38 LYS A HD3  8  
ATOM 8562  H HE2  . LYS A 1 38 ? 10.937  -21.214 2.713   1.00 0.00 ? 38 LYS A HE2  8  
ATOM 8563  H HE3  . LYS A 1 38 ? 10.499  -21.871 4.289   1.00 0.00 ? 38 LYS A HE3  8  
ATOM 8564  H HZ1  . LYS A 1 38 ? 12.030  -23.478 4.132   1.00 0.00 ? 38 LYS A HZ1  8  
ATOM 8565  H HZ2  . LYS A 1 38 ? 12.742  -22.488 2.959   1.00 0.00 ? 38 LYS A HZ2  8  
ATOM 8566  H HZ3  . LYS A 1 38 ? 11.736  -23.765 2.491   1.00 0.00 ? 38 LYS A HZ3  8  
ATOM 8567  N N    . ARG A 1 39 ? 5.437   -20.502 5.618   1.00 0.00 ? 39 ARG A N    8  
ATOM 8568  C CA   . ARG A 1 39 ? 4.340   -20.734 6.550   1.00 0.00 ? 39 ARG A CA   8  
ATOM 8569  C C    . ARG A 1 39 ? 3.273   -19.651 6.416   1.00 0.00 ? 39 ARG A C    8  
ATOM 8570  O O    . ARG A 1 39 ? 2.076   -19.934 6.475   1.00 0.00 ? 39 ARG A O    8  
ATOM 8571  C CB   . ARG A 1 39 ? 4.863   -20.774 7.987   1.00 0.00 ? 39 ARG A CB   8  
ATOM 8572  C CG   . ARG A 1 39 ? 4.856   -19.419 8.676   1.00 0.00 ? 39 ARG A CG   8  
ATOM 8573  C CD   . ARG A 1 39 ? 5.770   -19.407 9.891   1.00 0.00 ? 39 ARG A CD   8  
ATOM 8574  N NE   . ARG A 1 39 ? 5.078   -19.842 11.101  1.00 0.00 ? 39 ARG A NE   8  
ATOM 8575  C CZ   . ARG A 1 39 ? 5.689   -20.055 12.261  1.00 0.00 ? 39 ARG A CZ   8  
ATOM 8576  N NH1  . ARG A 1 39 ? 6.998   -19.872 12.368  1.00 0.00 ? 39 ARG A NH1  8  
ATOM 8577  N NH2  . ARG A 1 39 ? 4.991   -20.450 13.318  1.00 0.00 ? 39 ARG A NH2  8  
ATOM 8578  H H    . ARG A 1 39 ? 6.313   -20.236 5.968   1.00 0.00 ? 39 ARG A H    8  
ATOM 8579  H HA   . ARG A 1 39 ? 3.898   -21.690 6.311   1.00 0.00 ? 39 ARG A HA   8  
ATOM 8580  H HB2  . ARG A 1 39 ? 4.248   -21.450 8.564   1.00 0.00 ? 39 ARG A HB2  8  
ATOM 8581  H HB3  . ARG A 1 39 ? 5.878   -21.143 7.978   1.00 0.00 ? 39 ARG A HB3  8  
ATOM 8582  H HG2  . ARG A 1 39 ? 5.194   -18.669 7.977   1.00 0.00 ? 39 ARG A HG2  8  
ATOM 8583  H HG3  . ARG A 1 39 ? 3.848   -19.192 8.992   1.00 0.00 ? 39 ARG A HG3  8  
ATOM 8584  H HD2  . ARG A 1 39 ? 6.602   -20.070 9.706   1.00 0.00 ? 39 ARG A HD2  8  
ATOM 8585  H HD3  . ARG A 1 39 ? 6.136   -18.402 10.039  1.00 0.00 ? 39 ARG A HD3  8  
ATOM 8586  H HE   . ARG A 1 39 ? 4.110   -19.984 11.045  1.00 0.00 ? 39 ARG A HE   8  
ATOM 8587  H HH11 . ARG A 1 39 ? 7.527   -19.573 11.574  1.00 0.00 ? 39 ARG A HH11 8  
ATOM 8588  H HH12 . ARG A 1 39 ? 7.456   -20.031 13.243  1.00 0.00 ? 39 ARG A HH12 8  
ATOM 8589  H HH21 . ARG A 1 39 ? 4.004   -20.589 13.242  1.00 0.00 ? 39 ARG A HH21 8  
ATOM 8590  H HH22 . ARG A 1 39 ? 5.452   -20.609 14.191  1.00 0.00 ? 39 ARG A HH22 8  
ATOM 8591  N N    . LEU A 1 40 ? 3.716   -18.412 6.236   1.00 0.00 ? 40 LEU A N    8  
ATOM 8592  C CA   . LEU A 1 40 ? 2.799   -17.285 6.094   1.00 0.00 ? 40 LEU A CA   8  
ATOM 8593  C C    . LEU A 1 40 ? 1.810   -17.529 4.959   1.00 0.00 ? 40 LEU A C    8  
ATOM 8594  O O    . LEU A 1 40 ? 0.598   -17.415 5.144   1.00 0.00 ? 40 LEU A O    8  
ATOM 8595  C CB   . LEU A 1 40 ? 3.581   -15.996 5.837   1.00 0.00 ? 40 LEU A CB   8  
ATOM 8596  C CG   . LEU A 1 40 ? 2.847   -14.692 6.149   1.00 0.00 ? 40 LEU A CG   8  
ATOM 8597  C CD1  . LEU A 1 40 ? 2.584   -14.572 7.642   1.00 0.00 ? 40 LEU A CD1  8  
ATOM 8598  C CD2  . LEU A 1 40 ? 3.645   -13.497 5.649   1.00 0.00 ? 40 LEU A CD2  8  
ATOM 8599  H H    . LEU A 1 40 ? 4.681   -18.249 6.198   1.00 0.00 ? 40 LEU A H    8  
ATOM 8600  H HA   . LEU A 1 40 ? 2.251   -17.186 7.019   1.00 0.00 ? 40 LEU A HA   8  
ATOM 8601  H HB2  . LEU A 1 40 ? 4.475   -16.025 6.441   1.00 0.00 ? 40 LEU A HB2  8  
ATOM 8602  H HB3  . LEU A 1 40 ? 3.856   -15.980 4.791   1.00 0.00 ? 40 LEU A HB3  8  
ATOM 8603  H HG   . LEU A 1 40 ? 1.892   -14.694 5.642   1.00 0.00 ? 40 LEU A HG   8  
ATOM 8604  H HD11 . LEU A 1 40 ? 2.664   -15.546 8.101   1.00 0.00 ? 40 LEU A HD11 8  
ATOM 8605  H HD12 . LEU A 1 40 ? 1.591   -14.179 7.803   1.00 0.00 ? 40 LEU A HD12 8  
ATOM 8606  H HD13 . LEU A 1 40 ? 3.310   -13.905 8.083   1.00 0.00 ? 40 LEU A HD13 8  
ATOM 8607  H HD21 . LEU A 1 40 ? 4.592   -13.836 5.256   1.00 0.00 ? 40 LEU A HD21 8  
ATOM 8608  H HD22 . LEU A 1 40 ? 3.819   -12.813 6.467   1.00 0.00 ? 40 LEU A HD22 8  
ATOM 8609  H HD23 . LEU A 1 40 ? 3.091   -12.995 4.870   1.00 0.00 ? 40 LEU A HD23 8  
ATOM 8610  N N    . ALA A 1 41 ? 2.334   -17.866 3.786   1.00 0.00 ? 41 ALA A N    8  
ATOM 8611  C CA   . ALA A 1 41 ? 1.496   -18.130 2.622   1.00 0.00 ? 41 ALA A CA   8  
ATOM 8612  C C    . ALA A 1 41 ? 0.398   -19.134 2.953   1.00 0.00 ? 41 ALA A C    8  
ATOM 8613  O O    . ALA A 1 41 ? -0.637  -19.181 2.287   1.00 0.00 ? 41 ALA A O    8  
ATOM 8614  C CB   . ALA A 1 41 ? 2.345   -18.635 1.465   1.00 0.00 ? 41 ALA A CB   8  
ATOM 8615  H H    . ALA A 1 41 ? 3.307   -17.941 3.701   1.00 0.00 ? 41 ALA A H    8  
ATOM 8616  H HA   . ALA A 1 41 ? 1.039   -17.198 2.322   1.00 0.00 ? 41 ALA A HA   8  
ATOM 8617  H HB1  . ALA A 1 41 ? 1.949   -19.576 1.113   1.00 0.00 ? 41 ALA A HB1  8  
ATOM 8618  H HB2  . ALA A 1 41 ? 2.324   -17.913 0.662   1.00 0.00 ? 41 ALA A HB2  8  
ATOM 8619  H HB3  . ALA A 1 41 ? 3.362   -18.774 1.798   1.00 0.00 ? 41 ALA A HB3  8  
ATOM 8620  N N    . LYS A 1 42 ? 0.629   -19.938 3.985   1.00 0.00 ? 42 LYS A N    8  
ATOM 8621  C CA   . LYS A 1 42 ? -0.341  -20.943 4.406   1.00 0.00 ? 42 LYS A CA   8  
ATOM 8622  C C    . LYS A 1 42 ? -1.289  -20.377 5.458   1.00 0.00 ? 42 LYS A C    8  
ATOM 8623  O O    . LYS A 1 42 ? -2.438  -20.805 5.565   1.00 0.00 ? 42 LYS A O    8  
ATOM 8624  C CB   . LYS A 1 42 ? 0.378   -22.174 4.962   1.00 0.00 ? 42 LYS A CB   8  
ATOM 8625  C CG   . LYS A 1 42 ? -0.565  -23.256 5.458   1.00 0.00 ? 42 LYS A CG   8  
ATOM 8626  C CD   . LYS A 1 42 ? -0.960  -24.207 4.340   1.00 0.00 ? 42 LYS A CD   8  
ATOM 8627  C CE   . LYS A 1 42 ? -1.320  -25.583 4.880   1.00 0.00 ? 42 LYS A CE   8  
ATOM 8628  N NZ   . LYS A 1 42 ? -2.094  -26.382 3.890   1.00 0.00 ? 42 LYS A NZ   8  
ATOM 8629  H H    . LYS A 1 42 ? 1.473   -19.854 4.477   1.00 0.00 ? 42 LYS A H    8  
ATOM 8630  H HA   . LYS A 1 42 ? -0.915  -21.233 3.539   1.00 0.00 ? 42 LYS A HA   8  
ATOM 8631  H HB2  . LYS A 1 42 ? 0.999   -22.595 4.185   1.00 0.00 ? 42 LYS A HB2  8  
ATOM 8632  H HB3  . LYS A 1 42 ? 1.006   -21.868 5.786   1.00 0.00 ? 42 LYS A HB3  8  
ATOM 8633  H HG2  . LYS A 1 42 ? -0.074  -23.819 6.238   1.00 0.00 ? 42 LYS A HG2  8  
ATOM 8634  H HG3  . LYS A 1 42 ? -1.456  -22.791 5.854   1.00 0.00 ? 42 LYS A HG3  8  
ATOM 8635  H HD2  . LYS A 1 42 ? -1.815  -23.802 3.820   1.00 0.00 ? 42 LYS A HD2  8  
ATOM 8636  H HD3  . LYS A 1 42 ? -0.132  -24.305 3.653   1.00 0.00 ? 42 LYS A HD3  8  
ATOM 8637  H HE2  . LYS A 1 42 ? -0.410  -26.110 5.122   1.00 0.00 ? 42 LYS A HE2  8  
ATOM 8638  H HE3  . LYS A 1 42 ? -1.914  -25.460 5.774   1.00 0.00 ? 42 LYS A HE3  8  
ATOM 8639  H HZ1  . LYS A 1 42 ? -1.721  -27.351 3.844   1.00 0.00 ? 42 LYS A HZ1  8  
ATOM 8640  H HZ2  . LYS A 1 42 ? -2.022  -25.949 2.947   1.00 0.00 ? 42 LYS A HZ2  8  
ATOM 8641  H HZ3  . LYS A 1 42 ? -3.096  -26.420 4.166   1.00 0.00 ? 42 LYS A HZ3  8  
ATOM 8642  N N    . MET A 1 43 ? -0.801  -19.411 6.230   1.00 0.00 ? 43 MET A N    8  
ATOM 8643  C CA   . MET A 1 43 ? -1.607  -18.785 7.271   1.00 0.00 ? 43 MET A CA   8  
ATOM 8644  C C    . MET A 1 43 ? -2.611  -17.808 6.668   1.00 0.00 ? 43 MET A C    8  
ATOM 8645  O O    . MET A 1 43 ? -3.772  -17.763 7.078   1.00 0.00 ? 43 MET A O    8  
ATOM 8646  C CB   . MET A 1 43 ? -0.708  -18.057 8.273   1.00 0.00 ? 43 MET A CB   8  
ATOM 8647  C CG   . MET A 1 43 ? -1.431  -16.981 9.067   1.00 0.00 ? 43 MET A CG   8  
ATOM 8648  S SD   . MET A 1 43 ? -0.647  -16.646 10.656  1.00 0.00 ? 43 MET A SD   8  
ATOM 8649  C CE   . MET A 1 43 ? 0.616   -15.473 10.170  1.00 0.00 ? 43 MET A CE   8  
ATOM 8650  H H    . MET A 1 43 ? 0.123   -19.112 6.096   1.00 0.00 ? 43 MET A H    8  
ATOM 8651  H HA   . MET A 1 43 ? -2.146  -19.565 7.786   1.00 0.00 ? 43 MET A HA   8  
ATOM 8652  H HB2  . MET A 1 43 ? -0.306  -18.779 8.968   1.00 0.00 ? 43 MET A HB2  8  
ATOM 8653  H HB3  . MET A 1 43 ? 0.106   -17.592 7.737   1.00 0.00 ? 43 MET A HB3  8  
ATOM 8654  H HG2  . MET A 1 43 ? -1.441  -16.070 8.488   1.00 0.00 ? 43 MET A HG2  8  
ATOM 8655  H HG3  . MET A 1 43 ? -2.446  -17.305 9.243   1.00 0.00 ? 43 MET A HG3  8  
ATOM 8656  H HE1  . MET A 1 43 ? 0.406   -14.512 10.616  1.00 0.00 ? 43 MET A HE1  8  
ATOM 8657  H HE2  . MET A 1 43 ? 1.581   -15.822 10.505  1.00 0.00 ? 43 MET A HE2  8  
ATOM 8658  H HE3  . MET A 1 43 ? 0.622   -15.376 9.093   1.00 0.00 ? 43 MET A HE3  8  
ATOM 8659  N N    . LEU A 1 44 ? -2.158  -17.028 5.693   1.00 0.00 ? 44 LEU A N    8  
ATOM 8660  C CA   . LEU A 1 44 ? -3.017  -16.051 5.033   1.00 0.00 ? 44 LEU A CA   8  
ATOM 8661  C C    . LEU A 1 44 ? -3.695  -16.661 3.810   1.00 0.00 ? 44 LEU A C    8  
ATOM 8662  O O    . LEU A 1 44 ? -4.565  -16.042 3.198   1.00 0.00 ? 44 LEU A O    8  
ATOM 8663  C CB   . LEU A 1 44 ? -2.204  -14.824 4.620   1.00 0.00 ? 44 LEU A CB   8  
ATOM 8664  C CG   . LEU A 1 44 ? -1.373  -14.167 5.723   1.00 0.00 ? 44 LEU A CG   8  
ATOM 8665  C CD1  . LEU A 1 44 ? -0.333  -13.233 5.123   1.00 0.00 ? 44 LEU A CD1  8  
ATOM 8666  C CD2  . LEU A 1 44 ? -2.273  -13.414 6.692   1.00 0.00 ? 44 LEU A CD2  8  
ATOM 8667  H H    . LEU A 1 44 ? -1.224  -17.110 5.409   1.00 0.00 ? 44 LEU A H    8  
ATOM 8668  H HA   . LEU A 1 44 ? -3.777  -15.749 5.737   1.00 0.00 ? 44 LEU A HA   8  
ATOM 8669  H HB2  . LEU A 1 44 ? -1.529  -15.123 3.832   1.00 0.00 ? 44 LEU A HB2  8  
ATOM 8670  H HB3  . LEU A 1 44 ? -2.893  -14.084 4.238   1.00 0.00 ? 44 LEU A HB3  8  
ATOM 8671  H HG   . LEU A 1 44 ? -0.851  -14.935 6.277   1.00 0.00 ? 44 LEU A HG   8  
ATOM 8672  H HD11 . LEU A 1 44 ? 0.181   -12.711 5.916   1.00 0.00 ? 44 LEU A HD11 8  
ATOM 8673  H HD12 . LEU A 1 44 ? -0.820  -12.518 4.477   1.00 0.00 ? 44 LEU A HD12 8  
ATOM 8674  H HD13 . LEU A 1 44 ? 0.379   -13.809 4.550   1.00 0.00 ? 44 LEU A HD13 8  
ATOM 8675  H HD21 . LEU A 1 44 ? -2.303  -13.938 7.635   1.00 0.00 ? 44 LEU A HD21 8  
ATOM 8676  H HD22 . LEU A 1 44 ? -3.271  -13.353 6.282   1.00 0.00 ? 44 LEU A HD22 8  
ATOM 8677  H HD23 . LEU A 1 44 ? -1.884  -12.418 6.844   1.00 0.00 ? 44 LEU A HD23 8  
ATOM 8678  N N    . GLN A 1 45 ? -3.292  -17.878 3.461   1.00 0.00 ? 45 GLN A N    8  
ATOM 8679  C CA   . GLN A 1 45 ? -3.862  -18.572 2.312   1.00 0.00 ? 45 GLN A CA   8  
ATOM 8680  C C    . GLN A 1 45 ? -3.401  -17.933 1.007   1.00 0.00 ? 45 GLN A C    8  
ATOM 8681  O O    . GLN A 1 45 ? -4.185  -17.774 0.070   1.00 0.00 ? 45 GLN A O    8  
ATOM 8682  C CB   . GLN A 1 45 ? -5.390  -18.559 2.389   1.00 0.00 ? 45 GLN A CB   8  
ATOM 8683  C CG   . GLN A 1 45 ? -5.932  -18.853 3.778   1.00 0.00 ? 45 GLN A CG   8  
ATOM 8684  C CD   . GLN A 1 45 ? -7.419  -19.148 3.774   1.00 0.00 ? 45 GLN A CD   8  
ATOM 8685  O OE1  . GLN A 1 45 ? -8.186  -18.525 3.039   1.00 0.00 ? 45 GLN A OE1  8  
ATOM 8686  N NE2  . GLN A 1 45 ? -7.835  -20.103 4.598   1.00 0.00 ? 45 GLN A NE2  8  
ATOM 8687  H H    . GLN A 1 45 ? -2.595  -18.320 3.989   1.00 0.00 ? 45 GLN A H    8  
ATOM 8688  H HA   . GLN A 1 45 ? -3.519  -19.595 2.339   1.00 0.00 ? 45 GLN A HA   8  
ATOM 8689  H HB2  . GLN A 1 45 ? -5.746  -17.586 2.085   1.00 0.00 ? 45 GLN A HB2  8  
ATOM 8690  H HB3  . GLN A 1 45 ? -5.779  -19.303 1.710   1.00 0.00 ? 45 GLN A HB3  8  
ATOM 8691  H HG2  . GLN A 1 45 ? -5.412  -19.710 4.180   1.00 0.00 ? 45 GLN A HG2  8  
ATOM 8692  H HG3  . GLN A 1 45 ? -5.752  -17.995 4.410   1.00 0.00 ? 45 GLN A HG3  8  
ATOM 8693  H HE21 . GLN A 1 45 ? -7.168  -20.556 5.156   1.00 0.00 ? 45 GLN A HE21 8  
ATOM 8694  H HE22 . GLN A 1 45 ? -8.791  -20.314 4.617   1.00 0.00 ? 45 GLN A HE22 8  
ATOM 8695  N N    . LEU A 1 46 ? -2.126  -17.567 0.951   1.00 0.00 ? 46 LEU A N    8  
ATOM 8696  C CA   . LEU A 1 46 ? -1.559  -16.944 -0.240  1.00 0.00 ? 46 LEU A CA   8  
ATOM 8697  C C    . LEU A 1 46 ? -0.433  -17.796 -0.817  1.00 0.00 ? 46 LEU A C    8  
ATOM 8698  O O    . LEU A 1 46 ? -0.131  -18.874 -0.305  1.00 0.00 ? 46 LEU A O    8  
ATOM 8699  C CB   . LEU A 1 46 ? -1.037  -15.545 0.091   1.00 0.00 ? 46 LEU A CB   8  
ATOM 8700  C CG   . LEU A 1 46 ? -2.059  -14.567 0.672   1.00 0.00 ? 46 LEU A CG   8  
ATOM 8701  C CD1  . LEU A 1 46 ? -1.361  -13.476 1.469   1.00 0.00 ? 46 LEU A CD1  8  
ATOM 8702  C CD2  . LEU A 1 46 ? -2.908  -13.961 -0.436  1.00 0.00 ? 46 LEU A CD2  8  
ATOM 8703  H H    . LEU A 1 46 ? -1.550  -17.719 1.729   1.00 0.00 ? 46 LEU A H    8  
ATOM 8704  H HA   . LEU A 1 46 ? -2.345  -16.861 -0.976  1.00 0.00 ? 46 LEU A HA   8  
ATOM 8705  H HB2  . LEU A 1 46 ? -0.237  -15.651 0.807   1.00 0.00 ? 46 LEU A HB2  8  
ATOM 8706  H HB3  . LEU A 1 46 ? -0.647  -15.114 -0.820  1.00 0.00 ? 46 LEU A HB3  8  
ATOM 8707  H HG   . LEU A 1 46 ? -2.717  -15.102 1.344   1.00 0.00 ? 46 LEU A HG   8  
ATOM 8708  H HD11 . LEU A 1 46 ? -2.042  -13.077 2.206   1.00 0.00 ? 46 LEU A HD11 8  
ATOM 8709  H HD12 . LEU A 1 46 ? -1.050  -12.686 0.802   1.00 0.00 ? 46 LEU A HD12 8  
ATOM 8710  H HD13 . LEU A 1 46 ? -0.495  -13.891 1.964   1.00 0.00 ? 46 LEU A HD13 8  
ATOM 8711  H HD21 . LEU A 1 46 ? -2.313  -13.866 -1.333  1.00 0.00 ? 46 LEU A HD21 8  
ATOM 8712  H HD22 . LEU A 1 46 ? -3.256  -12.985 -0.130  1.00 0.00 ? 46 LEU A HD22 8  
ATOM 8713  H HD23 . LEU A 1 46 ? -3.755  -14.601 -0.632  1.00 0.00 ? 46 LEU A HD23 8  
ATOM 8714  N N    . SER A 1 47 ? 0.186   -17.304 -1.886  1.00 0.00 ? 47 SER A N    8  
ATOM 8715  C CA   . SER A 1 47 ? 1.278   -18.021 -2.534  1.00 0.00 ? 47 SER A CA   8  
ATOM 8716  C C    . SER A 1 47 ? 2.621   -17.374 -2.209  1.00 0.00 ? 47 SER A C    8  
ATOM 8717  O O    . SER A 1 47 ? 2.705   -16.163 -2.008  1.00 0.00 ? 47 SER A O    8  
ATOM 8718  C CB   . SER A 1 47 ? 1.067   -18.053 -4.049  1.00 0.00 ? 47 SER A CB   8  
ATOM 8719  O OG   . SER A 1 47 ? 1.814   -19.099 -4.646  1.00 0.00 ? 47 SER A OG   8  
ATOM 8720  H H    . SER A 1 47 ? -0.101  -16.440 -2.248  1.00 0.00 ? 47 SER A H    8  
ATOM 8721  H HA   . SER A 1 47 ? 1.279   -19.033 -2.158  1.00 0.00 ? 47 SER A HA   8  
ATOM 8722  H HB2  . SER A 1 47 ? 0.020   -18.208 -4.261  1.00 0.00 ? 47 SER A HB2  8  
ATOM 8723  H HB3  . SER A 1 47 ? 1.385   -17.112 -4.474  1.00 0.00 ? 47 SER A HB3  8  
ATOM 8724  H HG   . SER A 1 47 ? 2.289   -18.759 -5.407  1.00 0.00 ? 47 SER A HG   8  
ATOM 8725  N N    . GLU A 1 48 ? 3.668   -18.191 -2.161  1.00 0.00 ? 48 GLU A N    8  
ATOM 8726  C CA   . GLU A 1 48 ? 5.007   -17.698 -1.860  1.00 0.00 ? 48 GLU A CA   8  
ATOM 8727  C C    . GLU A 1 48 ? 5.336   -16.468 -2.702  1.00 0.00 ? 48 GLU A C    8  
ATOM 8728  O O    . GLU A 1 48 ? 5.961   -15.523 -2.221  1.00 0.00 ? 48 GLU A O    8  
ATOM 8729  C CB   . GLU A 1 48 ? 6.046   -18.793 -2.110  1.00 0.00 ? 48 GLU A CB   8  
ATOM 8730  C CG   . GLU A 1 48 ? 6.311   -19.669 -0.897  1.00 0.00 ? 48 GLU A CG   8  
ATOM 8731  C CD   . GLU A 1 48 ? 7.377   -20.716 -1.155  1.00 0.00 ? 48 GLU A CD   8  
ATOM 8732  O OE1  . GLU A 1 48 ? 7.334   -21.355 -2.227  1.00 0.00 ? 48 GLU A OE1  8  
ATOM 8733  O OE2  . GLU A 1 48 ? 8.253   -20.897 -0.284  1.00 0.00 ? 48 GLU A OE2  8  
ATOM 8734  H H    . GLU A 1 48 ? 3.537   -19.147 -2.331  1.00 0.00 ? 48 GLU A H    8  
ATOM 8735  H HA   . GLU A 1 48 ? 5.033   -17.422 -0.817  1.00 0.00 ? 48 GLU A HA   8  
ATOM 8736  H HB2  . GLU A 1 48 ? 5.700   -19.424 -2.915  1.00 0.00 ? 48 GLU A HB2  8  
ATOM 8737  H HB3  . GLU A 1 48 ? 6.976   -18.329 -2.403  1.00 0.00 ? 48 GLU A HB3  8  
ATOM 8738  H HG2  . GLU A 1 48 ? 6.636   -19.041 -0.080  1.00 0.00 ? 48 GLU A HG2  8  
ATOM 8739  H HG3  . GLU A 1 48 ? 5.394   -20.169 -0.622  1.00 0.00 ? 48 GLU A HG3  8  
ATOM 8740  N N    . ARG A 1 49 ? 4.911   -16.489 -3.961  1.00 0.00 ? 49 ARG A N    8  
ATOM 8741  C CA   . ARG A 1 49 ? 5.162   -15.378 -4.870  1.00 0.00 ? 49 ARG A CA   8  
ATOM 8742  C C    . ARG A 1 49 ? 4.390   -14.135 -4.436  1.00 0.00 ? 49 ARG A C    8  
ATOM 8743  O O    . ARG A 1 49 ? 4.875   -13.012 -4.574  1.00 0.00 ? 49 ARG A O    8  
ATOM 8744  C CB   . ARG A 1 49 ? 4.770   -15.761 -6.298  1.00 0.00 ? 49 ARG A CB   8  
ATOM 8745  C CG   . ARG A 1 49 ? 3.326   -15.434 -6.642  1.00 0.00 ? 49 ARG A CG   8  
ATOM 8746  C CD   . ARG A 1 49 ? 2.844   -16.234 -7.843  1.00 0.00 ? 49 ARG A CD   8  
ATOM 8747  N NE   . ARG A 1 49 ? 3.111   -15.545 -9.102  1.00 0.00 ? 49 ARG A NE   8  
ATOM 8748  C CZ   . ARG A 1 49 ? 4.286   -15.575 -9.721  1.00 0.00 ? 49 ARG A CZ   8  
ATOM 8749  N NH1  . ARG A 1 49 ? 5.297   -16.256 -9.200  1.00 0.00 ? 49 ARG A NH1  8  
ATOM 8750  N NH2  . ARG A 1 49 ? 4.452   -14.923 -10.865 1.00 0.00 ? 49 ARG A NH2  8  
ATOM 8751  H H    . ARG A 1 49 ? 4.418   -17.271 -4.286  1.00 0.00 ? 49 ARG A H    8  
ATOM 8752  H HA   . ARG A 1 49 ? 6.219   -15.158 -4.843  1.00 0.00 ? 49 ARG A HA   8  
ATOM 8753  H HB2  . ARG A 1 49 ? 5.410   -15.232 -6.990  1.00 0.00 ? 49 ARG A HB2  8  
ATOM 8754  H HB3  . ARG A 1 49 ? 4.916   -16.823 -6.426  1.00 0.00 ? 49 ARG A HB3  8  
ATOM 8755  H HG2  . ARG A 1 49 ? 2.701   -15.669 -5.793  1.00 0.00 ? 49 ARG A HG2  8  
ATOM 8756  H HG3  . ARG A 1 49 ? 3.249   -14.381 -6.868  1.00 0.00 ? 49 ARG A HG3  8  
ATOM 8757  H HD2  . ARG A 1 49 ? 3.351   -17.187 -7.850  1.00 0.00 ? 49 ARG A HD2  8  
ATOM 8758  H HD3  . ARG A 1 49 ? 1.781   -16.393 -7.748  1.00 0.00 ? 49 ARG A HD3  8  
ATOM 8759  H HE   . ARG A 1 49 ? 2.378   -15.036 -9.505  1.00 0.00 ? 49 ARG A HE   8  
ATOM 8760  H HH11 . ARG A 1 49 ? 5.175   -16.749 -8.339  1.00 0.00 ? 49 ARG A HH11 8  
ATOM 8761  H HH12 . ARG A 1 49 ? 6.180   -16.278 -9.669  1.00 0.00 ? 49 ARG A HH12 8  
ATOM 8762  H HH21 . ARG A 1 49 ? 3.692   -14.408 -11.262 1.00 0.00 ? 49 ARG A HH21 8  
ATOM 8763  H HH22 . ARG A 1 49 ? 5.336   -14.946 -11.330 1.00 0.00 ? 49 ARG A HH22 8  
ATOM 8764  N N    . GLN A 1 50 ? 3.187   -14.345 -3.912  1.00 0.00 ? 50 GLN A N    8  
ATOM 8765  C CA   . GLN A 1 50 ? 2.348   -13.242 -3.459  1.00 0.00 ? 50 GLN A CA   8  
ATOM 8766  C C    . GLN A 1 50 ? 2.938   -12.585 -2.215  1.00 0.00 ? 50 GLN A C    8  
ATOM 8767  O O    . GLN A 1 50 ? 2.817   -11.375 -2.023  1.00 0.00 ? 50 GLN A O    8  
ATOM 8768  C CB   . GLN A 1 50 ? 0.931   -13.738 -3.165  1.00 0.00 ? 50 GLN A CB   8  
ATOM 8769  C CG   . GLN A 1 50 ? 0.007   -13.689 -4.372  1.00 0.00 ? 50 GLN A CG   8  
ATOM 8770  C CD   . GLN A 1 50 ? -1.451  -13.869 -3.998  1.00 0.00 ? 50 GLN A CD   8  
ATOM 8771  O OE1  . GLN A 1 50 ? -2.177  -12.894 -3.798  1.00 0.00 ? 50 GLN A OE1  8  
ATOM 8772  N NE2  . GLN A 1 50 ? -1.888  -15.119 -3.900  1.00 0.00 ? 50 GLN A NE2  8  
ATOM 8773  H H    . GLN A 1 50 ? 2.855   -15.263 -3.828  1.00 0.00 ? 50 GLN A H    8  
ATOM 8774  H HA   . GLN A 1 50 ? 2.306   -12.510 -4.251  1.00 0.00 ? 50 GLN A HA   8  
ATOM 8775  H HB2  . GLN A 1 50 ? 0.984   -14.760 -2.820  1.00 0.00 ? 50 GLN A HB2  8  
ATOM 8776  H HB3  . GLN A 1 50 ? 0.502   -13.125 -2.386  1.00 0.00 ? 50 GLN A HB3  8  
ATOM 8777  H HG2  . GLN A 1 50 ? 0.122   -12.733 -4.859  1.00 0.00 ? 50 GLN A HG2  8  
ATOM 8778  H HG3  . GLN A 1 50 ? 0.288   -14.477 -5.055  1.00 0.00 ? 50 GLN A HG3  8  
ATOM 8779  H HE21 . GLN A 1 50 ? -1.252  -15.846 -4.072  1.00 0.00 ? 50 GLN A HE21 8  
ATOM 8780  H HE22 . GLN A 1 50 ? -2.826  -15.264 -3.659  1.00 0.00 ? 50 GLN A HE22 8  
ATOM 8781  N N    . VAL A 1 51 ? 3.576   -13.391 -1.372  1.00 0.00 ? 51 VAL A N    8  
ATOM 8782  C CA   . VAL A 1 51 ? 4.185   -12.888 -0.147  1.00 0.00 ? 51 VAL A CA   8  
ATOM 8783  C C    . VAL A 1 51 ? 5.593   -12.364 -0.408  1.00 0.00 ? 51 VAL A C    8  
ATOM 8784  O O    . VAL A 1 51 ? 6.116   -11.551 0.354   1.00 0.00 ? 51 VAL A O    8  
ATOM 8785  C CB   . VAL A 1 51 ? 4.248   -13.980 0.938   1.00 0.00 ? 51 VAL A CB   8  
ATOM 8786  C CG1  . VAL A 1 51 ? 4.615   -13.375 2.284   1.00 0.00 ? 51 VAL A CG1  8  
ATOM 8787  C CG2  . VAL A 1 51 ? 2.924   -14.724 1.022   1.00 0.00 ? 51 VAL A CG2  8  
ATOM 8788  H H    . VAL A 1 51 ? 3.639   -14.347 -1.580  1.00 0.00 ? 51 VAL A H    8  
ATOM 8789  H HA   . VAL A 1 51 ? 3.573   -12.078 0.222   1.00 0.00 ? 51 VAL A HA   8  
ATOM 8790  H HB   . VAL A 1 51 ? 5.017   -14.687 0.664   1.00 0.00 ? 51 VAL A HB   8  
ATOM 8791  H HG11 . VAL A 1 51 ? 5.260   -14.055 2.821   1.00 0.00 ? 51 VAL A HG11 8  
ATOM 8792  H HG12 . VAL A 1 51 ? 5.128   -12.437 2.130   1.00 0.00 ? 51 VAL A HG12 8  
ATOM 8793  H HG13 . VAL A 1 51 ? 3.716   -13.203 2.859   1.00 0.00 ? 51 VAL A HG13 8  
ATOM 8794  H HG21 . VAL A 1 51 ? 2.822   -15.167 2.001   1.00 0.00 ? 51 VAL A HG21 8  
ATOM 8795  H HG22 . VAL A 1 51 ? 2.110   -14.032 0.854   1.00 0.00 ? 51 VAL A HG22 8  
ATOM 8796  H HG23 . VAL A 1 51 ? 2.897   -15.499 0.270   1.00 0.00 ? 51 VAL A HG23 8  
ATOM 8797  N N    . LYS A 1 52 ? 6.202   -12.836 -1.490  1.00 0.00 ? 52 LYS A N    8  
ATOM 8798  C CA   . LYS A 1 52 ? 7.550   -12.415 -1.855  1.00 0.00 ? 52 LYS A CA   8  
ATOM 8799  C C    . LYS A 1 52 ? 7.511   -11.181 -2.750  1.00 0.00 ? 52 LYS A C    8  
ATOM 8800  O O    . LYS A 1 52 ? 8.446   -10.380 -2.763  1.00 0.00 ? 52 LYS A O    8  
ATOM 8801  C CB   . LYS A 1 52 ? 8.286   -13.552 -2.567  1.00 0.00 ? 52 LYS A CB   8  
ATOM 8802  C CG   . LYS A 1 52 ? 8.104   -13.544 -4.075  1.00 0.00 ? 52 LYS A CG   8  
ATOM 8803  C CD   . LYS A 1 52 ? 9.176   -12.715 -4.762  1.00 0.00 ? 52 LYS A CD   8  
ATOM 8804  C CE   . LYS A 1 52 ? 10.427  -13.537 -5.033  1.00 0.00 ? 52 LYS A CE   8  
ATOM 8805  N NZ   . LYS A 1 52 ? 10.200  -14.563 -6.087  1.00 0.00 ? 52 LYS A NZ   8  
ATOM 8806  H H    . LYS A 1 52 ? 5.733   -13.483 -2.059  1.00 0.00 ? 52 LYS A H    8  
ATOM 8807  H HA   . LYS A 1 52 ? 8.078   -12.169 -0.946  1.00 0.00 ? 52 LYS A HA   8  
ATOM 8808  H HB2  . LYS A 1 52 ? 9.342   -13.471 -2.352  1.00 0.00 ? 52 LYS A HB2  8  
ATOM 8809  H HB3  . LYS A 1 52 ? 7.921   -14.495 -2.186  1.00 0.00 ? 52 LYS A HB3  8  
ATOM 8810  H HG2  . LYS A 1 52 ? 8.159   -14.558 -4.441  1.00 0.00 ? 52 LYS A HG2  8  
ATOM 8811  H HG3  . LYS A 1 52 ? 7.135   -13.127 -4.309  1.00 0.00 ? 52 LYS A HG3  8  
ATOM 8812  H HD2  . LYS A 1 52 ? 8.790   -12.349 -5.701  1.00 0.00 ? 52 LYS A HD2  8  
ATOM 8813  H HD3  . LYS A 1 52 ? 9.435   -11.880 -4.127  1.00 0.00 ? 52 LYS A HD3  8  
ATOM 8814  H HE2  . LYS A 1 52 ? 11.216  -12.873 -5.353  1.00 0.00 ? 52 LYS A HE2  8  
ATOM 8815  H HE3  . LYS A 1 52 ? 10.722  -14.031 -4.119  1.00 0.00 ? 52 LYS A HE3  8  
ATOM 8816  H HZ1  . LYS A 1 52 ? 10.130  -15.507 -5.657  1.00 0.00 ? 52 LYS A HZ1  8  
ATOM 8817  H HZ2  . LYS A 1 52 ? 10.988  -14.560 -6.765  1.00 0.00 ? 52 LYS A HZ2  8  
ATOM 8818  H HZ3  . LYS A 1 52 ? 9.317   -14.361 -6.598  1.00 0.00 ? 52 LYS A HZ3  8  
ATOM 8819  N N    . THR A 1 53 ? 6.421   -11.031 -3.497  1.00 0.00 ? 53 THR A N    8  
ATOM 8820  C CA   . THR A 1 53 ? 6.260   -9.894  -4.395  1.00 0.00 ? 53 THR A CA   8  
ATOM 8821  C C    . THR A 1 53 ? 5.687   -8.689  -3.658  1.00 0.00 ? 53 THR A C    8  
ATOM 8822  O O    . THR A 1 53 ? 6.189   -7.573  -3.790  1.00 0.00 ? 53 THR A O    8  
ATOM 8823  C CB   . THR A 1 53 ? 5.341   -10.241 -5.581  1.00 0.00 ? 53 THR A CB   8  
ATOM 8824  O OG1  . THR A 1 53 ? 6.013   -11.135 -6.476  1.00 0.00 ? 53 THR A OG1  8  
ATOM 8825  C CG2  . THR A 1 53 ? 4.925   -8.984  -6.329  1.00 0.00 ? 53 THR A CG2  8  
ATOM 8826  H H    . THR A 1 53 ? 5.710   -11.703 -3.442  1.00 0.00 ? 53 THR A H    8  
ATOM 8827  H HA   . THR A 1 53 ? 7.234   -9.636  -4.784  1.00 0.00 ? 53 THR A HA   8  
ATOM 8828  H HB   . THR A 1 53 ? 4.454   -10.726 -5.200  1.00 0.00 ? 53 THR A HB   8  
ATOM 8829  H HG1  . THR A 1 53 ? 6.553   -11.747 -5.972  1.00 0.00 ? 53 THR A HG1  8  
ATOM 8830  H HG21 . THR A 1 53 ? 4.198   -8.440  -5.744  1.00 0.00 ? 53 THR A HG21 8  
ATOM 8831  H HG22 . THR A 1 53 ? 4.490   -9.257  -7.279  1.00 0.00 ? 53 THR A HG22 8  
ATOM 8832  H HG23 . THR A 1 53 ? 5.791   -8.361  -6.495  1.00 0.00 ? 53 THR A HG23 8  
ATOM 8833  N N    . TRP A 1 54 ? 4.634   -8.922  -2.883  1.00 0.00 ? 54 TRP A N    8  
ATOM 8834  C CA   . TRP A 1 54 ? 3.993   -7.853  -2.125  1.00 0.00 ? 54 TRP A CA   8  
ATOM 8835  C C    . TRP A 1 54 ? 5.020   -7.067  -1.317  1.00 0.00 ? 54 TRP A C    8  
ATOM 8836  O O    . TRP A 1 54 ? 5.196   -5.866  -1.521  1.00 0.00 ? 54 TRP A O    8  
ATOM 8837  C CB   . TRP A 1 54 ? 2.927   -8.431  -1.192  1.00 0.00 ? 54 TRP A CB   8  
ATOM 8838  C CG   . TRP A 1 54 ? 2.038   -7.387  -0.588  1.00 0.00 ? 54 TRP A CG   8  
ATOM 8839  C CD1  . TRP A 1 54 ? 0.836   -6.953  -1.072  1.00 0.00 ? 54 TRP A CD1  8  
ATOM 8840  C CD2  . TRP A 1 54 ? 2.281   -6.644  0.612   1.00 0.00 ? 54 TRP A CD2  8  
ATOM 8841  N NE1  . TRP A 1 54 ? 0.318   -5.986  -0.245  1.00 0.00 ? 54 TRP A NE1  8  
ATOM 8842  C CE2  . TRP A 1 54 ? 1.185   -5.779  0.795   1.00 0.00 ? 54 TRP A CE2  8  
ATOM 8843  C CE3  . TRP A 1 54 ? 3.316   -6.628  1.550   1.00 0.00 ? 54 TRP A CE3  8  
ATOM 8844  C CZ2  . TRP A 1 54 ? 1.098   -4.907  1.878   1.00 0.00 ? 54 TRP A CZ2  8  
ATOM 8845  C CZ3  . TRP A 1 54 ? 3.229   -5.762  2.623   1.00 0.00 ? 54 TRP A CZ3  8  
ATOM 8846  C CH2  . TRP A 1 54 ? 2.126   -4.911  2.781   1.00 0.00 ? 54 TRP A CH2  8  
ATOM 8847  H H    . TRP A 1 54 ? 4.279   -9.833  -2.819  1.00 0.00 ? 54 TRP A H    8  
ATOM 8848  H HA   . TRP A 1 54 ? 3.519   -7.186  -2.829  1.00 0.00 ? 54 TRP A HA   8  
ATOM 8849  H HB2  . TRP A 1 54 ? 2.305   -9.117  -1.747  1.00 0.00 ? 54 TRP A HB2  8  
ATOM 8850  H HB3  . TRP A 1 54 ? 3.413   -8.962  -0.387  1.00 0.00 ? 54 TRP A HB3  8  
ATOM 8851  H HD1  . TRP A 1 54 ? 0.375   -7.324  -1.974  1.00 0.00 ? 54 TRP A HD1  8  
ATOM 8852  H HE1  . TRP A 1 54 ? -0.535  -5.521  -0.379  1.00 0.00 ? 54 TRP A HE1  8  
ATOM 8853  H HE3  . TRP A 1 54 ? 4.174   -7.275  1.446   1.00 0.00 ? 54 TRP A HE3  8  
ATOM 8854  H HZ2  . TRP A 1 54 ? 0.254   -4.246  2.013   1.00 0.00 ? 54 TRP A HZ2  8  
ATOM 8855  H HZ3  . TRP A 1 54 ? 4.020   -5.734  3.358   1.00 0.00 ? 54 TRP A HZ3  8  
ATOM 8856  H HH2  . TRP A 1 54 ? 2.100   -4.252  3.634   1.00 0.00 ? 54 TRP A HH2  8  
ATOM 8857  N N    . PHE A 1 55 ? 5.696   -7.752  -0.401  1.00 0.00 ? 55 PHE A N    8  
ATOM 8858  C CA   . PHE A 1 55 ? 6.705   -7.116  0.438   1.00 0.00 ? 55 PHE A CA   8  
ATOM 8859  C C    . PHE A 1 55 ? 7.673   -6.291  -0.406  1.00 0.00 ? 55 PHE A C    8  
ATOM 8860  O O    . PHE A 1 55 ? 7.939   -5.129  -0.103  1.00 0.00 ? 55 PHE A O    8  
ATOM 8861  C CB   . PHE A 1 55 ? 7.477   -8.172  1.233   1.00 0.00 ? 55 PHE A CB   8  
ATOM 8862  C CG   . PHE A 1 55 ? 6.743   -8.661  2.449   1.00 0.00 ? 55 PHE A CG   8  
ATOM 8863  C CD1  . PHE A 1 55 ? 5.619   -9.461  2.320   1.00 0.00 ? 55 PHE A CD1  8  
ATOM 8864  C CD2  . PHE A 1 55 ? 7.177   -8.321  3.720   1.00 0.00 ? 55 PHE A CD2  8  
ATOM 8865  C CE1  . PHE A 1 55 ? 4.941   -9.914  3.437   1.00 0.00 ? 55 PHE A CE1  8  
ATOM 8866  C CE2  . PHE A 1 55 ? 6.503   -8.771  4.840   1.00 0.00 ? 55 PHE A CE2  8  
ATOM 8867  C CZ   . PHE A 1 55 ? 5.384   -9.567  4.698   1.00 0.00 ? 55 PHE A CZ   8  
ATOM 8868  H H    . PHE A 1 55 ? 5.511   -8.708  -0.285  1.00 0.00 ? 55 PHE A H    8  
ATOM 8869  H HA   . PHE A 1 55 ? 6.197   -6.459  1.127   1.00 0.00 ? 55 PHE A HA   8  
ATOM 8870  H HB2  . PHE A 1 55 ? 7.668   -9.022  0.597   1.00 0.00 ? 55 PHE A HB2  8  
ATOM 8871  H HB3  . PHE A 1 55 ? 8.416   -7.751  1.558   1.00 0.00 ? 55 PHE A HB3  8  
ATOM 8872  H HD1  . PHE A 1 55 ? 5.271   -9.733  1.333   1.00 0.00 ? 55 PHE A HD1  8  
ATOM 8873  H HD2  . PHE A 1 55 ? 8.051   -7.698  3.832   1.00 0.00 ? 55 PHE A HD2  8  
ATOM 8874  H HE1  . PHE A 1 55 ? 4.066   -10.536 3.322   1.00 0.00 ? 55 PHE A HE1  8  
ATOM 8875  H HE2  . PHE A 1 55 ? 6.851   -8.499  5.825   1.00 0.00 ? 55 PHE A HE2  8  
ATOM 8876  H HZ   . PHE A 1 55 ? 4.856   -9.921  5.572   1.00 0.00 ? 55 PHE A HZ   8  
ATOM 8877  N N    . GLN A 1 56 ? 8.194   -6.903  -1.464  1.00 0.00 ? 56 GLN A N    8  
ATOM 8878  C CA   . GLN A 1 56 ? 9.133   -6.226  -2.351  1.00 0.00 ? 56 GLN A CA   8  
ATOM 8879  C C    . GLN A 1 56 ? 8.622   -4.839  -2.729  1.00 0.00 ? 56 GLN A C    8  
ATOM 8880  O O    . GLN A 1 56 ? 9.304   -3.837  -2.517  1.00 0.00 ? 56 GLN A O    8  
ATOM 8881  C CB   . GLN A 1 56 ? 9.365   -7.058  -3.613  1.00 0.00 ? 56 GLN A CB   8  
ATOM 8882  C CG   . GLN A 1 56 ? 10.444  -8.117  -3.454  1.00 0.00 ? 56 GLN A CG   8  
ATOM 8883  C CD   . GLN A 1 56 ? 11.844  -7.537  -3.502  1.00 0.00 ? 56 GLN A CD   8  
ATOM 8884  O OE1  . GLN A 1 56 ? 12.087  -6.432  -3.016  1.00 0.00 ? 56 GLN A OE1  8  
ATOM 8885  N NE2  . GLN A 1 56 ? 12.773  -8.280  -4.090  1.00 0.00 ? 56 GLN A NE2  8  
ATOM 8886  H H    . GLN A 1 56 ? 7.943   -7.830  -1.653  1.00 0.00 ? 56 GLN A H    8  
ATOM 8887  H HA   . GLN A 1 56 ? 10.069  -6.119  -1.824  1.00 0.00 ? 56 GLN A HA   8  
ATOM 8888  H HB2  . GLN A 1 56 ? 8.443   -7.551  -3.880  1.00 0.00 ? 56 GLN A HB2  8  
ATOM 8889  H HB3  . GLN A 1 56 ? 9.656   -6.397  -4.417  1.00 0.00 ? 56 GLN A HB3  8  
ATOM 8890  H HG2  . GLN A 1 56 ? 10.309  -8.610  -2.503  1.00 0.00 ? 56 GLN A HG2  8  
ATOM 8891  H HG3  . GLN A 1 56 ? 10.342  -8.839  -4.251  1.00 0.00 ? 56 GLN A HG3  8  
ATOM 8892  H HE21 . GLN A 1 56 ? 12.507  -9.150  -4.456  1.00 0.00 ? 56 GLN A HE21 8  
ATOM 8893  H HE22 . GLN A 1 56 ? 13.686  -7.929  -4.136  1.00 0.00 ? 56 GLN A HE22 8  
ATOM 8894  N N    . ASN A 1 57 ? 7.418   -4.790  -3.289  1.00 0.00 ? 57 ASN A N    8  
ATOM 8895  C CA   . ASN A 1 57 ? 6.816   -3.526  -3.697  1.00 0.00 ? 57 ASN A CA   8  
ATOM 8896  C C    . ASN A 1 57 ? 6.658   -2.588  -2.504  1.00 0.00 ? 57 ASN A C    8  
ATOM 8897  O O    . ASN A 1 57 ? 7.179   -1.473  -2.504  1.00 0.00 ? 57 ASN A O    8  
ATOM 8898  C CB   . ASN A 1 57 ? 5.454   -3.773  -4.349  1.00 0.00 ? 57 ASN A CB   8  
ATOM 8899  C CG   . ASN A 1 57 ? 5.571   -4.097  -5.826  1.00 0.00 ? 57 ASN A CG   8  
ATOM 8900  O OD1  . ASN A 1 57 ? 5.600   -3.200  -6.669  1.00 0.00 ? 57 ASN A OD1  8  
ATOM 8901  N ND2  . ASN A 1 57 ? 5.637   -5.384  -6.146  1.00 0.00 ? 57 ASN A ND2  8  
ATOM 8902  H H    . ASN A 1 57 ? 6.922   -5.623  -3.432  1.00 0.00 ? 57 ASN A H    8  
ATOM 8903  H HA   . ASN A 1 57 ? 7.472   -3.064  -4.419  1.00 0.00 ? 57 ASN A HA   8  
ATOM 8904  H HB2  . ASN A 1 57 ? 4.970   -4.604  -3.856  1.00 0.00 ? 57 ASN A HB2  8  
ATOM 8905  H HB3  . ASN A 1 57 ? 4.843   -2.890  -4.240  1.00 0.00 ? 57 ASN A HB3  8  
ATOM 8906  H HD21 . ASN A 1 57 ? 5.608   -6.043  -5.422  1.00 0.00 ? 57 ASN A HD21 8  
ATOM 8907  H HD22 . ASN A 1 57 ? 5.714   -5.621  -7.094  1.00 0.00 ? 57 ASN A HD22 8  
ATOM 8908  N N    . ARG A 1 58 ? 5.936   -3.049  -1.487  1.00 0.00 ? 58 ARG A N    8  
ATOM 8909  C CA   . ARG A 1 58 ? 5.709   -2.252  -0.288  1.00 0.00 ? 58 ARG A CA   8  
ATOM 8910  C C    . ARG A 1 58 ? 6.978   -1.509  0.119   1.00 0.00 ? 58 ARG A C    8  
ATOM 8911  O O    . ARG A 1 58 ? 6.959   -0.295  0.327   1.00 0.00 ? 58 ARG A O    8  
ATOM 8912  C CB   . ARG A 1 58 ? 5.236   -3.144  0.861   1.00 0.00 ? 58 ARG A CB   8  
ATOM 8913  C CG   . ARG A 1 58 ? 4.956   -2.384  2.147   1.00 0.00 ? 58 ARG A CG   8  
ATOM 8914  C CD   . ARG A 1 58 ? 4.032   -1.201  1.905   1.00 0.00 ? 58 ARG A CD   8  
ATOM 8915  N NE   . ARG A 1 58 ? 3.644   -0.545  3.150   1.00 0.00 ? 58 ARG A NE   8  
ATOM 8916  C CZ   . ARG A 1 58 ? 2.537   0.176   3.288   1.00 0.00 ? 58 ARG A CZ   8  
ATOM 8917  N NH1  . ARG A 1 58 ? 1.712   0.332   2.262   1.00 0.00 ? 58 ARG A NH1  8  
ATOM 8918  N NH2  . ARG A 1 58 ? 2.253   0.742   4.454   1.00 0.00 ? 58 ARG A NH2  8  
ATOM 8919  H H    . ARG A 1 58 ? 5.546   -3.947  -1.546  1.00 0.00 ? 58 ARG A H    8  
ATOM 8920  H HA   . ARG A 1 58 ? 4.938   -1.529  -0.511  1.00 0.00 ? 58 ARG A HA   8  
ATOM 8921  H HB2  . ARG A 1 58 ? 4.329   -3.647  0.562   1.00 0.00 ? 58 ARG A HB2  8  
ATOM 8922  H HB3  . ARG A 1 58 ? 5.998   -3.883  1.064   1.00 0.00 ? 58 ARG A HB3  8  
ATOM 8923  H HG2  . ARG A 1 58 ? 4.489   -3.052  2.855   1.00 0.00 ? 58 ARG A HG2  8  
ATOM 8924  H HG3  . ARG A 1 58 ? 5.890   -2.023  2.551   1.00 0.00 ? 58 ARG A HG3  8  
ATOM 8925  H HD2  . ARG A 1 58 ? 4.541   -0.486  1.276   1.00 0.00 ? 58 ARG A HD2  8  
ATOM 8926  H HD3  . ARG A 1 58 ? 3.143   -1.553  1.402   1.00 0.00 ? 58 ARG A HD3  8  
ATOM 8927  H HE   . ARG A 1 58 ? 4.240   -0.647  3.921   1.00 0.00 ? 58 ARG A HE   8  
ATOM 8928  H HH11 . ARG A 1 58 ? 1.923   -0.095  1.383   1.00 0.00 ? 58 ARG A HH11 8  
ATOM 8929  H HH12 . ARG A 1 58 ? 0.878   0.874   2.369   1.00 0.00 ? 58 ARG A HH12 8  
ATOM 8930  H HH21 . ARG A 1 58 ? 2.873   0.627   5.230   1.00 0.00 ? 58 ARG A HH21 8  
ATOM 8931  H HH22 . ARG A 1 58 ? 1.420   1.284   4.556   1.00 0.00 ? 58 ARG A HH22 8  
ATOM 8932  N N    . ARG A 1 59 ? 8.078   -2.245  0.231   1.00 0.00 ? 59 ARG A N    8  
ATOM 8933  C CA   . ARG A 1 59 ? 9.355   -1.656  0.615   1.00 0.00 ? 59 ARG A CA   8  
ATOM 8934  C C    . ARG A 1 59 ? 9.721   -0.500  -0.310  1.00 0.00 ? 59 ARG A C    8  
ATOM 8935  O O    . ARG A 1 59 ? 9.889   0.635   0.135   1.00 0.00 ? 59 ARG A O    8  
ATOM 8936  C CB   . ARG A 1 59 ? 10.459  -2.716  0.586   1.00 0.00 ? 59 ARG A CB   8  
ATOM 8937  C CG   . ARG A 1 59 ? 11.689  -2.337  1.394   1.00 0.00 ? 59 ARG A CG   8  
ATOM 8938  C CD   . ARG A 1 59 ? 12.938  -3.023  0.864   1.00 0.00 ? 59 ARG A CD   8  
ATOM 8939  N NE   . ARG A 1 59 ? 14.146  -2.250  1.139   1.00 0.00 ? 59 ARG A NE   8  
ATOM 8940  C CZ   . ARG A 1 59 ? 14.776  -2.263  2.309   1.00 0.00 ? 59 ARG A CZ   8  
ATOM 8941  N NH1  . ARG A 1 59 ? 14.315  -3.005  3.306   1.00 0.00 ? 59 ARG A NH1  8  
ATOM 8942  N NH2  . ARG A 1 59 ? 15.870  -1.533  2.482   1.00 0.00 ? 59 ARG A NH2  8  
ATOM 8943  H H    . ARG A 1 59 ? 8.030   -3.208  0.053   1.00 0.00 ? 59 ARG A H    8  
ATOM 8944  H HA   . ARG A 1 59 ? 9.258   -1.279  1.622   1.00 0.00 ? 59 ARG A HA   8  
ATOM 8945  H HB2  . ARG A 1 59 ? 10.066  -3.640  0.982   1.00 0.00 ? 59 ARG A HB2  8  
ATOM 8946  H HB3  . ARG A 1 59 ? 10.763  -2.873  -0.438  1.00 0.00 ? 59 ARG A HB3  8  
ATOM 8947  H HG2  . ARG A 1 59 ? 11.829  -1.267  1.340   1.00 0.00 ? 59 ARG A HG2  8  
ATOM 8948  H HG3  . ARG A 1 59 ? 11.536  -2.630  2.422   1.00 0.00 ? 59 ARG A HG3  8  
ATOM 8949  H HD2  . ARG A 1 59 ? 13.027  -3.991  1.333   1.00 0.00 ? 59 ARG A HD2  8  
ATOM 8950  H HD3  . ARG A 1 59 ? 12.837  -3.148  -0.204  1.00 0.00 ? 59 ARG A HD3  8  
ATOM 8951  H HE   . ARG A 1 59 ? 14.504  -1.694  0.416   1.00 0.00 ? 59 ARG A HE   8  
ATOM 8952  H HH11 . ARG A 1 59 ? 13.491  -3.558  3.177   1.00 0.00 ? 59 ARG A HH11 8  
ATOM 8953  H HH12 . ARG A 1 59 ? 14.792  -3.014  4.185   1.00 0.00 ? 59 ARG A HH12 8  
ATOM 8954  H HH21 . ARG A 1 59 ? 16.221  -0.972  1.733   1.00 0.00 ? 59 ARG A HH21 8  
ATOM 8955  H HH22 . ARG A 1 59 ? 16.343  -1.543  3.363   1.00 0.00 ? 59 ARG A HH22 8  
ATOM 8956  N N    . ALA A 1 60 ? 9.843   -0.796  -1.600  1.00 0.00 ? 60 ALA A N    8  
ATOM 8957  C CA   . ALA A 1 60 ? 10.187  0.219   -2.588  1.00 0.00 ? 60 ALA A CA   8  
ATOM 8958  C C    . ALA A 1 60 ? 9.419   1.512   -2.336  1.00 0.00 ? 60 ALA A C    8  
ATOM 8959  O O    . ALA A 1 60 ? 9.933   2.607   -2.569  1.00 0.00 ? 60 ALA A O    8  
ATOM 8960  C CB   . ALA A 1 60 ? 9.910   -0.297  -3.992  1.00 0.00 ? 60 ALA A CB   8  
ATOM 8961  H H    . ALA A 1 60 ? 9.696   -1.719  -1.894  1.00 0.00 ? 60 ALA A H    8  
ATOM 8962  H HA   . ALA A 1 60 ? 11.246  0.419   -2.506  1.00 0.00 ? 60 ALA A HA   8  
ATOM 8963  H HB1  . ALA A 1 60 ? 9.308   0.423   -4.527  1.00 0.00 ? 60 ALA A HB1  8  
ATOM 8964  H HB2  . ALA A 1 60 ? 10.845  -0.442  -4.513  1.00 0.00 ? 60 ALA A HB2  8  
ATOM 8965  H HB3  . ALA A 1 60 ? 9.381   -1.236  -3.933  1.00 0.00 ? 60 ALA A HB3  8  
ATOM 8966  N N    . LYS A 1 61 ? 8.186   1.380   -1.861  1.00 0.00 ? 61 LYS A N    8  
ATOM 8967  C CA   . LYS A 1 61 ? 7.346   2.537   -1.577  1.00 0.00 ? 61 LYS A CA   8  
ATOM 8968  C C    . LYS A 1 61 ? 7.695   3.143   -0.221  1.00 0.00 ? 61 LYS A C    8  
ATOM 8969  O O    . LYS A 1 61 ? 7.728   4.364   -0.066  1.00 0.00 ? 61 LYS A O    8  
ATOM 8970  C CB   . LYS A 1 61 ? 5.868   2.141   -1.605  1.00 0.00 ? 61 LYS A CB   8  
ATOM 8971  C CG   . LYS A 1 61 ? 5.249   2.199   -2.991  1.00 0.00 ? 61 LYS A CG   8  
ATOM 8972  C CD   . LYS A 1 61 ? 3.741   2.369   -2.922  1.00 0.00 ? 61 LYS A CD   8  
ATOM 8973  C CE   . LYS A 1 61 ? 3.210   3.130   -4.127  1.00 0.00 ? 61 LYS A CE   8  
ATOM 8974  N NZ   . LYS A 1 61 ? 2.886   2.218   -5.259  1.00 0.00 ? 61 LYS A NZ   8  
ATOM 8975  H H    . LYS A 1 61 ? 7.831   0.480   -1.696  1.00 0.00 ? 61 LYS A H    8  
ATOM 8976  H HA   . LYS A 1 61 ? 7.527   3.275   -2.344  1.00 0.00 ? 61 LYS A HA   8  
ATOM 8977  H HB2  . LYS A 1 61 ? 5.771   1.132   -1.233  1.00 0.00 ? 61 LYS A HB2  8  
ATOM 8978  H HB3  . LYS A 1 61 ? 5.316   2.809   -0.960  1.00 0.00 ? 61 LYS A HB3  8  
ATOM 8979  H HG2  . LYS A 1 61 ? 5.671   3.036   -3.529  1.00 0.00 ? 61 LYS A HG2  8  
ATOM 8980  H HG3  . LYS A 1 61 ? 5.476   1.281   -3.515  1.00 0.00 ? 61 LYS A HG3  8  
ATOM 8981  H HD2  . LYS A 1 61 ? 3.278   1.394   -2.893  1.00 0.00 ? 61 LYS A HD2  8  
ATOM 8982  H HD3  . LYS A 1 61 ? 3.490   2.915   -2.023  1.00 0.00 ? 61 LYS A HD3  8  
ATOM 8983  H HE2  . LYS A 1 61 ? 2.316   3.660   -3.836  1.00 0.00 ? 61 LYS A HE2  8  
ATOM 8984  H HE3  . LYS A 1 61 ? 3.960   3.837   -4.449  1.00 0.00 ? 61 LYS A HE3  8  
ATOM 8985  H HZ1  . LYS A 1 61 ? 2.260   2.699   -5.937  1.00 0.00 ? 61 LYS A HZ1  8  
ATOM 8986  H HZ2  . LYS A 1 61 ? 2.405   1.366   -4.906  1.00 0.00 ? 61 LYS A HZ2  8  
ATOM 8987  H HZ3  . LYS A 1 61 ? 3.757   1.933   -5.750  1.00 0.00 ? 61 LYS A HZ3  8  
ATOM 8988  N N    . TRP A 1 62 ? 7.955   2.282   0.756   1.00 0.00 ? 62 TRP A N    8  
ATOM 8989  C CA   . TRP A 1 62 ? 8.303   2.734   2.099   1.00 0.00 ? 62 TRP A CA   8  
ATOM 8990  C C    . TRP A 1 62 ? 9.484   3.697   2.061   1.00 0.00 ? 62 TRP A C    8  
ATOM 8991  O O    . TRP A 1 62 ? 9.421   4.793   2.617   1.00 0.00 ? 62 TRP A O    8  
ATOM 8992  C CB   . TRP A 1 62 ? 8.635   1.537   2.992   1.00 0.00 ? 62 TRP A CB   8  
ATOM 8993  C CG   . TRP A 1 62 ? 9.484   1.894   4.174   1.00 0.00 ? 62 TRP A CG   8  
ATOM 8994  C CD1  . TRP A 1 62 ? 9.116   2.654   5.247   1.00 0.00 ? 62 TRP A CD1  8  
ATOM 8995  C CD2  . TRP A 1 62 ? 10.843  1.508   4.401   1.00 0.00 ? 62 TRP A CD2  8  
ATOM 8996  N NE1  . TRP A 1 62 ? 10.165  2.764   6.128   1.00 0.00 ? 62 TRP A NE1  8  
ATOM 8997  C CE2  . TRP A 1 62 ? 11.236  2.068   5.632   1.00 0.00 ? 62 TRP A CE2  8  
ATOM 8998  C CE3  . TRP A 1 62 ? 11.767  0.741   3.685   1.00 0.00 ? 62 TRP A CE3  8  
ATOM 8999  C CZ2  . TRP A 1 62 ? 12.511  1.886   6.159   1.00 0.00 ? 62 TRP A CZ2  8  
ATOM 9000  C CZ3  . TRP A 1 62 ? 13.032  0.561   4.210   1.00 0.00 ? 62 TRP A CZ3  8  
ATOM 9001  C CH2  . TRP A 1 62 ? 13.395  1.131   5.437   1.00 0.00 ? 62 TRP A CH2  8  
ATOM 9002  H H    . TRP A 1 62 ? 7.913   1.321   0.571   1.00 0.00 ? 62 TRP A H    8  
ATOM 9003  H HA   . TRP A 1 62 ? 7.446   3.249   2.507   1.00 0.00 ? 62 TRP A HA   8  
ATOM 9004  H HB2  . TRP A 1 62 ? 7.716   1.104   3.359   1.00 0.00 ? 62 TRP A HB2  8  
ATOM 9005  H HB3  . TRP A 1 62 ? 9.167   0.799   2.409   1.00 0.00 ? 62 TRP A HB3  8  
ATOM 9006  H HD1  . TRP A 1 62 ? 8.140   3.099   5.371   1.00 0.00 ? 62 TRP A HD1  8  
ATOM 9007  H HE1  . TRP A 1 62 ? 10.148  3.258   6.974   1.00 0.00 ? 62 TRP A HE1  8  
ATOM 9008  H HE3  . TRP A 1 62 ? 11.506  0.294   2.737   1.00 0.00 ? 62 TRP A HE3  8  
ATOM 9009  H HZ2  . TRP A 1 62 ? 12.806  2.318   7.105   1.00 0.00 ? 62 TRP A HZ2  8  
ATOM 9010  H HZ3  . TRP A 1 62 ? 13.760  -0.028  3.671   1.00 0.00 ? 62 TRP A HZ3  8  
ATOM 9011  H HH2  . TRP A 1 62 ? 14.395  0.965   5.809   1.00 0.00 ? 62 TRP A HH2  8  
ATOM 9012  N N    . ARG A 1 63 ? 10.560  3.282   1.400   1.00 0.00 ? 63 ARG A N    8  
ATOM 9013  C CA   . ARG A 1 63 ? 11.755  4.109   1.290   1.00 0.00 ? 63 ARG A CA   8  
ATOM 9014  C C    . ARG A 1 63 ? 11.425  5.462   0.668   1.00 0.00 ? 63 ARG A C    8  
ATOM 9015  O O    . ARG A 1 63 ? 11.873  6.504   1.148   1.00 0.00 ? 63 ARG A O    8  
ATOM 9016  C CB   . ARG A 1 63 ? 12.819  3.396   0.453   1.00 0.00 ? 63 ARG A CB   8  
ATOM 9017  C CG   . ARG A 1 63 ? 13.696  2.452   1.259   1.00 0.00 ? 63 ARG A CG   8  
ATOM 9018  C CD   . ARG A 1 63 ? 14.437  1.475   0.358   1.00 0.00 ? 63 ARG A CD   8  
ATOM 9019  N NE   . ARG A 1 63 ? 15.733  1.998   -0.067  1.00 0.00 ? 63 ARG A NE   8  
ATOM 9020  C CZ   . ARG A 1 63 ? 15.888  2.842   -1.081  1.00 0.00 ? 63 ARG A CZ   8  
ATOM 9021  N NH1  . ARG A 1 63 ? 14.834  3.257   -1.770  1.00 0.00 ? 63 ARG A NH1  8  
ATOM 9022  N NH2  . ARG A 1 63 ? 17.100  3.273   -1.407  1.00 0.00 ? 63 ARG A NH2  8  
ATOM 9023  H H    . ARG A 1 63 ? 10.550  2.398   0.977   1.00 0.00 ? 63 ARG A H    8  
ATOM 9024  H HA   . ARG A 1 63 ? 12.141  4.269   2.286   1.00 0.00 ? 63 ARG A HA   8  
ATOM 9025  H HB2  . ARG A 1 63 ? 12.329  2.825   -0.321  1.00 0.00 ? 63 ARG A HB2  8  
ATOM 9026  H HB3  . ARG A 1 63 ? 13.454  4.138   -0.007  1.00 0.00 ? 63 ARG A HB3  8  
ATOM 9027  H HG2  . ARG A 1 63 ? 14.419  3.031   1.814   1.00 0.00 ? 63 ARG A HG2  8  
ATOM 9028  H HG3  . ARG A 1 63 ? 13.075  1.896   1.944   1.00 0.00 ? 63 ARG A HG3  8  
ATOM 9029  H HD2  . ARG A 1 63 ? 14.592  0.554   0.899   1.00 0.00 ? 63 ARG A HD2  8  
ATOM 9030  H HD3  . ARG A 1 63 ? 13.833  1.283   -0.515  1.00 0.00 ? 63 ARG A HD3  8  
ATOM 9031  H HE   . ARG A 1 63 ? 16.525  1.705   0.429   1.00 0.00 ? 63 ARG A HE   8  
ATOM 9032  H HH11 . ARG A 1 63 ? 13.920  2.935   -1.525  1.00 0.00 ? 63 ARG A HH11 8  
ATOM 9033  H HH12 . ARG A 1 63 ? 14.953  3.894   -2.532  1.00 0.00 ? 63 ARG A HH12 8  
ATOM 9034  H HH21 . ARG A 1 63 ? 17.897  2.963   -0.890  1.00 0.00 ? 63 ARG A HH21 8  
ATOM 9035  H HH22 . ARG A 1 63 ? 17.216  3.908   -2.170  1.00 0.00 ? 63 ARG A HH22 8  
ATOM 9036  N N    . ARG A 1 64 ? 10.640  5.439   -0.404  1.00 0.00 ? 64 ARG A N    8  
ATOM 9037  C CA   . ARG A 1 64 ? 10.251  6.663   -1.093  1.00 0.00 ? 64 ARG A CA   8  
ATOM 9038  C C    . ARG A 1 64 ? 9.660   7.674   -0.115  1.00 0.00 ? 64 ARG A C    8  
ATOM 9039  O O    . ARG A 1 64 ? 10.026  8.850   -0.125  1.00 0.00 ? 64 ARG A O    8  
ATOM 9040  C CB   . ARG A 1 64 ? 9.237   6.353   -2.196  1.00 0.00 ? 64 ARG A CB   8  
ATOM 9041  C CG   . ARG A 1 64 ? 9.208   7.391   -3.306  1.00 0.00 ? 64 ARG A CG   8  
ATOM 9042  C CD   . ARG A 1 64 ? 7.981   7.228   -4.190  1.00 0.00 ? 64 ARG A CD   8  
ATOM 9043  N NE   . ARG A 1 64 ? 8.099   6.077   -5.082  1.00 0.00 ? 64 ARG A NE   8  
ATOM 9044  C CZ   . ARG A 1 64 ? 7.119   5.660   -5.876  1.00 0.00 ? 64 ARG A CZ   8  
ATOM 9045  N NH1  . ARG A 1 64 ? 5.956   6.296   -5.890  1.00 0.00 ? 64 ARG A NH1  8  
ATOM 9046  N NH2  . ARG A 1 64 ? 7.303   4.605   -6.660  1.00 0.00 ? 64 ARG A NH2  8  
ATOM 9047  H H    . ARG A 1 64 ? 10.314  4.578   -0.740  1.00 0.00 ? 64 ARG A H    8  
ATOM 9048  H HA   . ARG A 1 64 ? 11.137  7.088   -1.540  1.00 0.00 ? 64 ARG A HA   8  
ATOM 9049  H HB2  . ARG A 1 64 ? 9.481   5.397   -2.635  1.00 0.00 ? 64 ARG A HB2  8  
ATOM 9050  H HB3  . ARG A 1 64 ? 8.252   6.298   -1.758  1.00 0.00 ? 64 ARG A HB3  8  
ATOM 9051  H HG2  . ARG A 1 64 ? 9.191   8.377   -2.864  1.00 0.00 ? 64 ARG A HG2  8  
ATOM 9052  H HG3  . ARG A 1 64 ? 10.095  7.282   -3.912  1.00 0.00 ? 64 ARG A HG3  8  
ATOM 9053  H HD2  . ARG A 1 64 ? 7.115   7.095   -3.559  1.00 0.00 ? 64 ARG A HD2  8  
ATOM 9054  H HD3  . ARG A 1 64 ? 7.861   8.121   -4.784  1.00 0.00 ? 64 ARG A HD3  8  
ATOM 9055  H HE   . ARG A 1 64 ? 8.950   5.593   -5.088  1.00 0.00 ? 64 ARG A HE   8  
ATOM 9056  H HH11 . ARG A 1 64 ? 5.815   7.092   -5.301  1.00 0.00 ? 64 ARG A HH11 8  
ATOM 9057  H HH12 . ARG A 1 64 ? 5.221   5.980   -6.490  1.00 0.00 ? 64 ARG A HH12 8  
ATOM 9058  H HH21 . ARG A 1 64 ? 8.178   4.123   -6.652  1.00 0.00 ? 64 ARG A HH21 8  
ATOM 9059  H HH22 . ARG A 1 64 ? 6.565   4.292   -7.257  1.00 0.00 ? 64 ARG A HH22 8  
ATOM 9060  N N    . SER A 1 65 ? 8.745   7.208   0.729   1.00 0.00 ? 65 SER A N    8  
ATOM 9061  C CA   . SER A 1 65 ? 8.100   8.072   1.711   1.00 0.00 ? 65 SER A CA   8  
ATOM 9062  C C    . SER A 1 65 ? 9.066   8.431   2.836   1.00 0.00 ? 65 SER A C    8  
ATOM 9063  O O    . SER A 1 65 ? 9.095   9.567   3.306   1.00 0.00 ? 65 SER A O    8  
ATOM 9064  C CB   . SER A 1 65 ? 6.860   7.387   2.288   1.00 0.00 ? 65 SER A CB   8  
ATOM 9065  O OG   . SER A 1 65 ? 6.198   8.229   3.216   1.00 0.00 ? 65 SER A OG   8  
ATOM 9066  H H    . SER A 1 65 ? 8.495   6.261   0.688   1.00 0.00 ? 65 SER A H    8  
ATOM 9067  H HA   . SER A 1 65 ? 7.799   8.979   1.208   1.00 0.00 ? 65 SER A HA   8  
ATOM 9068  H HB2  . SER A 1 65 ? 6.178   7.149   1.486   1.00 0.00 ? 65 SER A HB2  8  
ATOM 9069  H HB3  . SER A 1 65 ? 7.155   6.478   2.791   1.00 0.00 ? 65 SER A HB3  8  
ATOM 9070  H HG   . SER A 1 65 ? 6.846   8.659   3.778   1.00 0.00 ? 65 SER A HG   8  
ATOM 9071  N N    . GLY A 1 66 ? 9.857   7.451   3.264   1.00 0.00 ? 66 GLY A N    8  
ATOM 9072  C CA   . GLY A 1 66 ? 10.814  7.682   4.330   1.00 0.00 ? 66 GLY A CA   8  
ATOM 9073  C C    . GLY A 1 66 ? 11.857  8.717   3.959   1.00 0.00 ? 66 GLY A C    8  
ATOM 9074  O O    . GLY A 1 66 ? 12.005  9.091   2.795   1.00 0.00 ? 66 GLY A O    8  
ATOM 9075  H H    . GLY A 1 66 ? 9.790   6.564   2.852   1.00 0.00 ? 66 GLY A H    8  
ATOM 9076  H HA2  . GLY A 1 66 ? 10.283  8.019   5.208   1.00 0.00 ? 66 GLY A HA2  8  
ATOM 9077  H HA3  . GLY A 1 66 ? 11.313  6.752   4.558   1.00 0.00 ? 66 GLY A HA3  8  
ATOM 9078  N N    . PRO A 1 67 ? 12.601  9.200   4.965   1.00 0.00 ? 67 PRO A N    8  
ATOM 9079  C CA   . PRO A 1 67 ? 13.648  10.206  4.763   1.00 0.00 ? 67 PRO A CA   8  
ATOM 9080  C C    . PRO A 1 67 ? 14.851  9.648   4.010   1.00 0.00 ? 67 PRO A C    8  
ATOM 9081  O O    . PRO A 1 67 ? 14.856  8.487   3.601   1.00 0.00 ? 67 PRO A O    8  
ATOM 9082  C CB   . PRO A 1 67 ? 14.044  10.597  6.189   1.00 0.00 ? 67 PRO A CB   8  
ATOM 9083  C CG   . PRO A 1 67 ? 13.695  9.409   7.018   1.00 0.00 ? 67 PRO A CG   8  
ATOM 9084  C CD   . PRO A 1 67 ? 12.479  8.799   6.377   1.00 0.00 ? 67 PRO A CD   8  
ATOM 9085  H HA   . PRO A 1 67 ? 13.269  11.073  4.243   1.00 0.00 ? 67 PRO A HA   8  
ATOM 9086  H HB2  . PRO A 1 67 ? 15.104  10.808  6.226   1.00 0.00 ? 67 PRO A HB2  8  
ATOM 9087  H HB3  . PRO A 1 67 ? 13.487  11.469  6.495   1.00 0.00 ? 67 PRO A HB3  8  
ATOM 9088  H HG2  . PRO A 1 67 ? 14.514  8.705   7.015   1.00 0.00 ? 67 PRO A HG2  8  
ATOM 9089  H HG3  . PRO A 1 67 ? 13.470  9.720   8.028   1.00 0.00 ? 67 PRO A HG3  8  
ATOM 9090  H HD2  . PRO A 1 67 ? 12.500  7.724   6.476   1.00 0.00 ? 67 PRO A HD2  8  
ATOM 9091  H HD3  . PRO A 1 67 ? 11.579  9.204   6.815   1.00 0.00 ? 67 PRO A HD3  8  
ATOM 9092  N N    . SER A 1 68 ? 15.870  10.483  3.830   1.00 0.00 ? 68 SER A N    8  
ATOM 9093  C CA   . SER A 1 68 ? 17.077  10.074  3.122   1.00 0.00 ? 68 SER A CA   8  
ATOM 9094  C C    . SER A 1 68 ? 17.871  9.061   3.943   1.00 0.00 ? 68 SER A C    8  
ATOM 9095  O O    . SER A 1 68 ? 18.102  9.257   5.136   1.00 0.00 ? 68 SER A O    8  
ATOM 9096  C CB   . SER A 1 68 ? 17.950  11.292  2.812   1.00 0.00 ? 68 SER A CB   8  
ATOM 9097  O OG   . SER A 1 68 ? 17.364  12.095  1.802   1.00 0.00 ? 68 SER A OG   8  
ATOM 9098  H H    . SER A 1 68 ? 15.806  11.397  4.179   1.00 0.00 ? 68 SER A H    8  
ATOM 9099  H HA   . SER A 1 68 ? 16.777  9.611   2.194   1.00 0.00 ? 68 SER A HA   8  
ATOM 9100  H HB2  . SER A 1 68 ? 18.065  11.886  3.706   1.00 0.00 ? 68 SER A HB2  8  
ATOM 9101  H HB3  . SER A 1 68 ? 18.920  10.959  2.474   1.00 0.00 ? 68 SER A HB3  8  
ATOM 9102  H HG   . SER A 1 68 ? 17.440  13.020  2.044   1.00 0.00 ? 68 SER A HG   8  
ATOM 9103  N N    . SER A 1 69 ? 18.285  7.978   3.294   1.00 0.00 ? 69 SER A N    8  
ATOM 9104  C CA   . SER A 1 69 ? 19.050  6.932   3.963   1.00 0.00 ? 69 SER A CA   8  
ATOM 9105  C C    . SER A 1 69 ? 19.605  5.933   2.952   1.00 0.00 ? 69 SER A C    8  
ATOM 9106  O O    . SER A 1 69 ? 18.852  5.224   2.285   1.00 0.00 ? 69 SER A O    8  
ATOM 9107  C CB   . SER A 1 69 ? 18.174  6.206   4.986   1.00 0.00 ? 69 SER A CB   8  
ATOM 9108  O OG   . SER A 1 69 ? 18.250  6.829   6.256   1.00 0.00 ? 69 SER A OG   8  
ATOM 9109  H H    . SER A 1 69 ? 18.070  7.879   2.343   1.00 0.00 ? 69 SER A H    8  
ATOM 9110  H HA   . SER A 1 69 ? 19.875  7.402   4.477   1.00 0.00 ? 69 SER A HA   8  
ATOM 9111  H HB2  . SER A 1 69 ? 17.148  6.221   4.652   1.00 0.00 ? 69 SER A HB2  8  
ATOM 9112  H HB3  . SER A 1 69 ? 18.508  5.182   5.079   1.00 0.00 ? 69 SER A HB3  8  
ATOM 9113  H HG   . SER A 1 69 ? 18.429  7.766   6.143   1.00 0.00 ? 69 SER A HG   8  
ATOM 9114  N N    . GLY A 1 70 ? 20.929  5.884   2.844   1.00 0.00 ? 70 GLY A N    8  
ATOM 9115  C CA   . GLY A 1 70 ? 21.564  4.970   1.912   1.00 0.00 ? 70 GLY A CA   8  
ATOM 9116  C C    . GLY A 1 70 ? 22.975  4.605   2.328   1.00 0.00 ? 70 GLY A C    8  
ATOM 9117  O O    . GLY A 1 70 ? 23.393  3.455   2.188   1.00 0.00 ? 70 GLY A O    8  
ATOM 9118  H H    . GLY A 1 70 ? 21.480  6.473   3.401   1.00 0.00 ? 70 GLY A H    8  
ATOM 9119  H HA2  . GLY A 1 70 ? 20.973  4.068   1.850   1.00 0.00 ? 70 GLY A HA2  8  
ATOM 9120  H HA3  . GLY A 1 70 ? 21.597  5.434   0.937   1.00 0.00 ? 70 GLY A HA3  8  
ATOM 9121  N N    . GLY A 1 1  ? -0.655  22.335  -11.726 1.00 0.00 ? 1  GLY A N    9  
ATOM 9122  C CA   . GLY A 1 1  ? -1.050  21.306  -10.782 1.00 0.00 ? 1  GLY A CA   9  
ATOM 9123  C C    . GLY A 1 1  ? 0.101   20.395  -10.403 1.00 0.00 ? 1  GLY A C    9  
ATOM 9124  O O    . GLY A 1 1  ? 0.881   19.980  -11.260 1.00 0.00 ? 1  GLY A O    9  
ATOM 9125  H H1   . GLY A 1 1  ? -0.493  22.101  -12.664 1.00 0.00 ? 1  GLY A H1   9  
ATOM 9126  H HA2  . GLY A 1 1  ? -1.430  21.779  -9.889  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 9127  H HA3  . GLY A 1 1  ? -1.835  20.710  -11.224 1.00 0.00 ? 1  GLY A HA3  9  
ATOM 9128  N N    . SER A 1 2  ? 0.208   20.083  -9.116  1.00 0.00 ? 2  SER A N    9  
ATOM 9129  C CA   . SER A 1 2  ? 1.275   19.220  -8.624  1.00 0.00 ? 2  SER A CA   9  
ATOM 9130  C C    . SER A 1 2  ? 0.940   17.751  -8.865  1.00 0.00 ? 2  SER A C    9  
ATOM 9131  O O    . SER A 1 2  ? 1.758   16.993  -9.387  1.00 0.00 ? 2  SER A O    9  
ATOM 9132  C CB   . SER A 1 2  ? 1.510   19.463  -7.132  1.00 0.00 ? 2  SER A CB   9  
ATOM 9133  O OG   . SER A 1 2  ? 2.511   18.596  -6.626  1.00 0.00 ? 2  SER A OG   9  
ATOM 9134  H H    . SER A 1 2  ? -0.445  20.445  -8.481  1.00 0.00 ? 2  SER A H    9  
ATOM 9135  H HA   . SER A 1 2  ? 2.176   19.465  -9.166  1.00 0.00 ? 2  SER A HA   9  
ATOM 9136  H HB2  . SER A 1 2  ? 1.826   20.484  -6.982  1.00 0.00 ? 2  SER A HB2  9  
ATOM 9137  H HB3  . SER A 1 2  ? 0.591   19.286  -6.592  1.00 0.00 ? 2  SER A HB3  9  
ATOM 9138  H HG   . SER A 1 2  ? 3.362   18.836  -7.001  1.00 0.00 ? 2  SER A HG   9  
ATOM 9139  N N    . SER A 1 3  ? -0.270  17.356  -8.482  1.00 0.00 ? 3  SER A N    9  
ATOM 9140  C CA   . SER A 1 3  ? -0.714  15.977  -8.652  1.00 0.00 ? 3  SER A CA   9  
ATOM 9141  C C    . SER A 1 3  ? -1.710  15.865  -9.802  1.00 0.00 ? 3  SER A C    9  
ATOM 9142  O O    . SER A 1 3  ? -2.868  16.259  -9.675  1.00 0.00 ? 3  SER A O    9  
ATOM 9143  C CB   . SER A 1 3  ? -1.349  15.461  -7.359  1.00 0.00 ? 3  SER A CB   9  
ATOM 9144  O OG   . SER A 1 3  ? -2.490  16.226  -7.011  1.00 0.00 ? 3  SER A OG   9  
ATOM 9145  H H    . SER A 1 3  ? -0.877  18.007  -8.072  1.00 0.00 ? 3  SER A H    9  
ATOM 9146  H HA   . SER A 1 3  ? 0.153   15.376  -8.882  1.00 0.00 ? 3  SER A HA   9  
ATOM 9147  H HB2  . SER A 1 3  ? -1.648  14.432  -7.494  1.00 0.00 ? 3  SER A HB2  9  
ATOM 9148  H HB3  . SER A 1 3  ? -0.629  15.524  -6.557  1.00 0.00 ? 3  SER A HB3  9  
ATOM 9149  H HG   . SER A 1 3  ? -3.246  15.643  -6.905  1.00 0.00 ? 3  SER A HG   9  
ATOM 9150  N N    . GLY A 1 4  ? -1.248  15.325  -10.926 1.00 0.00 ? 4  GLY A N    9  
ATOM 9151  C CA   . GLY A 1 4  ? -2.110  15.170  -12.083 1.00 0.00 ? 4  GLY A CA   9  
ATOM 9152  C C    . GLY A 1 4  ? -2.494  13.725  -12.331 1.00 0.00 ? 4  GLY A C    9  
ATOM 9153  O O    . GLY A 1 4  ? -3.625  13.434  -12.722 1.00 0.00 ? 4  GLY A O    9  
ATOM 9154  H H    . GLY A 1 4  ? -0.315  15.028  -10.969 1.00 0.00 ? 4  GLY A H    9  
ATOM 9155  H HA2  . GLY A 1 4  ? -3.008  15.749  -11.929 1.00 0.00 ? 4  GLY A HA2  9  
ATOM 9156  H HA3  . GLY A 1 4  ? -1.595  15.548  -12.954 1.00 0.00 ? 4  GLY A HA3  9  
ATOM 9157  N N    . SER A 1 5  ? -1.551  12.816  -12.104 1.00 0.00 ? 5  SER A N    9  
ATOM 9158  C CA   . SER A 1 5  ? -1.795  11.393  -12.311 1.00 0.00 ? 5  SER A CA   9  
ATOM 9159  C C    . SER A 1 5  ? -1.225  10.572  -11.159 1.00 0.00 ? 5  SER A C    9  
ATOM 9160  O O    . SER A 1 5  ? -0.225  10.949  -10.548 1.00 0.00 ? 5  SER A O    9  
ATOM 9161  C CB   . SER A 1 5  ? -1.178  10.935  -13.634 1.00 0.00 ? 5  SER A CB   9  
ATOM 9162  O OG   . SER A 1 5  ? -1.729  9.698   -14.052 1.00 0.00 ? 5  SER A OG   9  
ATOM 9163  H H    . SER A 1 5  ? -0.669  13.110  -11.793 1.00 0.00 ? 5  SER A H    9  
ATOM 9164  H HA   . SER A 1 5  ? -2.864  11.243  -12.350 1.00 0.00 ? 5  SER A HA   9  
ATOM 9165  H HB2  . SER A 1 5  ? -1.371  11.677  -14.394 1.00 0.00 ? 5  SER A HB2  9  
ATOM 9166  H HB3  . SER A 1 5  ? -0.112  10.817  -13.508 1.00 0.00 ? 5  SER A HB3  9  
ATOM 9167  H HG   . SER A 1 5  ? -2.002  9.193   -13.283 1.00 0.00 ? 5  SER A HG   9  
ATOM 9168  N N    . SER A 1 6  ? -1.869  9.446   -10.868 1.00 0.00 ? 6  SER A N    9  
ATOM 9169  C CA   . SER A 1 6  ? -1.429  8.571   -9.787  1.00 0.00 ? 6  SER A CA   9  
ATOM 9170  C C    . SER A 1 6  ? -1.062  7.190   -10.321 1.00 0.00 ? 6  SER A C    9  
ATOM 9171  O O    . SER A 1 6  ? -1.665  6.701   -11.275 1.00 0.00 ? 6  SER A O    9  
ATOM 9172  C CB   . SER A 1 6  ? -2.524  8.446   -8.726  1.00 0.00 ? 6  SER A CB   9  
ATOM 9173  O OG   . SER A 1 6  ? -2.628  9.632   -7.958  1.00 0.00 ? 6  SER A OG   9  
ATOM 9174  H H    . SER A 1 6  ? -2.660  9.199   -11.391 1.00 0.00 ? 6  SER A H    9  
ATOM 9175  H HA   . SER A 1 6  ? -0.553  9.015   -9.337  1.00 0.00 ? 6  SER A HA   9  
ATOM 9176  H HB2  . SER A 1 6  ? -3.471  8.261   -9.210  1.00 0.00 ? 6  SER A HB2  9  
ATOM 9177  H HB3  . SER A 1 6  ? -2.290  7.623   -8.066  1.00 0.00 ? 6  SER A HB3  9  
ATOM 9178  H HG   . SER A 1 6  ? -1.760  10.034  -7.870  1.00 0.00 ? 6  SER A HG   9  
ATOM 9179  N N    . GLY A 1 7  ? -0.067  6.566   -9.697  1.00 0.00 ? 7  GLY A N    9  
ATOM 9180  C CA   . GLY A 1 7  ? 0.364   5.247   -10.122 1.00 0.00 ? 7  GLY A CA   9  
ATOM 9181  C C    . GLY A 1 7  ? -0.767  4.238   -10.120 1.00 0.00 ? 7  GLY A C    9  
ATOM 9182  O O    . GLY A 1 7  ? -1.552  4.176   -9.173  1.00 0.00 ? 7  GLY A O    9  
ATOM 9183  H H    . GLY A 1 7  ? 0.377   7.005   -8.942  1.00 0.00 ? 7  GLY A H    9  
ATOM 9184  H HA2  . GLY A 1 7  ? 0.768   5.317   -11.121 1.00 0.00 ? 7  GLY A HA2  9  
ATOM 9185  H HA3  . GLY A 1 7  ? 1.140   4.902   -9.454  1.00 0.00 ? 7  GLY A HA3  9  
ATOM 9186  N N    . LYS A 1 8  ? -0.854  3.447   -11.183 1.00 0.00 ? 8  LYS A N    9  
ATOM 9187  C CA   . LYS A 1 8  ? -1.898  2.436   -11.302 1.00 0.00 ? 8  LYS A CA   9  
ATOM 9188  C C    . LYS A 1 8  ? -1.599  1.237   -10.407 1.00 0.00 ? 8  LYS A C    9  
ATOM 9189  O O    . LYS A 1 8  ? -2.454  0.794   -9.641  1.00 0.00 ? 8  LYS A O    9  
ATOM 9190  C CB   . LYS A 1 8  ? -2.031  1.979   -12.757 1.00 0.00 ? 8  LYS A CB   9  
ATOM 9191  C CG   . LYS A 1 8  ? -3.382  1.364   -13.080 1.00 0.00 ? 8  LYS A CG   9  
ATOM 9192  C CD   . LYS A 1 8  ? -4.421  2.431   -13.384 1.00 0.00 ? 8  LYS A CD   9  
ATOM 9193  C CE   . LYS A 1 8  ? -5.806  1.826   -13.561 1.00 0.00 ? 8  LYS A CE   9  
ATOM 9194  N NZ   . LYS A 1 8  ? -6.013  1.310   -14.943 1.00 0.00 ? 8  LYS A NZ   9  
ATOM 9195  H H    . LYS A 1 8  ? -0.199  3.544   -11.907 1.00 0.00 ? 8  LYS A H    9  
ATOM 9196  H HA   . LYS A 1 8  ? -2.829  2.882   -10.987 1.00 0.00 ? 8  LYS A HA   9  
ATOM 9197  H HB2  . LYS A 1 8  ? -1.882  2.830   -13.404 1.00 0.00 ? 8  LYS A HB2  9  
ATOM 9198  H HB3  . LYS A 1 8  ? -1.267  1.243   -12.962 1.00 0.00 ? 8  LYS A HB3  9  
ATOM 9199  H HG2  . LYS A 1 8  ? -3.279  0.722   -13.942 1.00 0.00 ? 8  LYS A HG2  9  
ATOM 9200  H HG3  . LYS A 1 8  ? -3.715  0.782   -12.232 1.00 0.00 ? 8  LYS A HG3  9  
ATOM 9201  H HD2  . LYS A 1 8  ? -4.451  3.136   -12.567 1.00 0.00 ? 8  LYS A HD2  9  
ATOM 9202  H HD3  . LYS A 1 8  ? -4.143  2.943   -14.294 1.00 0.00 ? 8  LYS A HD3  9  
ATOM 9203  H HE2  . LYS A 1 8  ? -5.920  1.012   -12.862 1.00 0.00 ? 8  LYS A HE2  9  
ATOM 9204  H HE3  . LYS A 1 8  ? -6.545  2.585   -13.354 1.00 0.00 ? 8  LYS A HE3  9  
ATOM 9205  H HZ1  . LYS A 1 8  ? -6.169  2.102   -15.599 1.00 0.00 ? 8  LYS A HZ1  9  
ATOM 9206  H HZ2  . LYS A 1 8  ? -6.843  0.685   -14.970 1.00 0.00 ? 8  LYS A HZ2  9  
ATOM 9207  H HZ3  . LYS A 1 8  ? -5.178  0.774   -15.254 1.00 0.00 ? 8  LYS A HZ3  9  
ATOM 9208  N N    . GLY A 1 9  ? -0.379  0.718   -10.508 1.00 0.00 ? 9  GLY A N    9  
ATOM 9209  C CA   . GLY A 1 9  ? 0.011   -0.423  -9.701  1.00 0.00 ? 9  GLY A CA   9  
ATOM 9210  C C    . GLY A 1 9  ? 0.061   -1.709  -10.502 1.00 0.00 ? 9  GLY A C    9  
ATOM 9211  O O    . GLY A 1 9  ? 0.154   -1.682  -11.728 1.00 0.00 ? 9  GLY A O    9  
ATOM 9212  H H    . GLY A 1 9  ? 0.261   1.114   -11.136 1.00 0.00 ? 9  GLY A H    9  
ATOM 9213  H HA2  . GLY A 1 9  ? 0.987   -0.235  -9.280  1.00 0.00 ? 9  GLY A HA2  9  
ATOM 9214  H HA3  . GLY A 1 9  ? -0.701  -0.541  -8.897  1.00 0.00 ? 9  GLY A HA3  9  
ATOM 9215  N N    . GLY A 1 10 ? -0.000  -2.841  -9.806  1.00 0.00 ? 10 GLY A N    9  
ATOM 9216  C CA   . GLY A 1 10 ? 0.042   -4.127  -10.476 1.00 0.00 ? 10 GLY A CA   9  
ATOM 9217  C C    . GLY A 1 10 ? -1.269  -4.881  -10.365 1.00 0.00 ? 10 GLY A C    9  
ATOM 9218  O O    . GLY A 1 10 ? -2.197  -4.429  -9.696  1.00 0.00 ? 10 GLY A O    9  
ATOM 9219  H H    . GLY A 1 10 ? -0.074  -2.801  -8.829  1.00 0.00 ? 10 GLY A H    9  
ATOM 9220  H HA2  . GLY A 1 10 ? 0.268   -3.970  -11.520 1.00 0.00 ? 10 GLY A HA2  9  
ATOM 9221  H HA3  . GLY A 1 10 ? 0.825   -4.725  -10.034 1.00 0.00 ? 10 GLY A HA3  9  
ATOM 9222  N N    . GLN A 1 11 ? -1.344  -6.033  -11.025 1.00 0.00 ? 11 GLN A N    9  
ATOM 9223  C CA   . GLN A 1 11 ? -2.552  -6.849  -10.999 1.00 0.00 ? 11 GLN A CA   9  
ATOM 9224  C C    . GLN A 1 11 ? -2.487  -7.883  -9.880  1.00 0.00 ? 11 GLN A C    9  
ATOM 9225  O O    . GLN A 1 11 ? -2.033  -9.008  -10.085 1.00 0.00 ? 11 GLN A O    9  
ATOM 9226  C CB   . GLN A 1 11 ? -2.748  -7.549  -12.345 1.00 0.00 ? 11 GLN A CB   9  
ATOM 9227  C CG   . GLN A 1 11 ? -4.166  -8.052  -12.569 1.00 0.00 ? 11 GLN A CG   9  
ATOM 9228  C CD   . GLN A 1 11 ? -4.451  -9.343  -11.827 1.00 0.00 ? 11 GLN A CD   9  
ATOM 9229  O OE1  . GLN A 1 11 ? -5.209  -9.360  -10.856 1.00 0.00 ? 11 GLN A OE1  9  
ATOM 9230  N NE2  . GLN A 1 11 ? -3.845  -10.433 -12.282 1.00 0.00 ? 11 GLN A NE2  9  
ATOM 9231  H H    . GLN A 1 11 ? -0.571  -6.340  -11.541 1.00 0.00 ? 11 GLN A H    9  
ATOM 9232  H HA   . GLN A 1 11 ? -3.391  -6.194  -10.819 1.00 0.00 ? 11 GLN A HA   9  
ATOM 9233  H HB2  . GLN A 1 11 ? -2.506  -6.857  -13.137 1.00 0.00 ? 11 GLN A HB2  9  
ATOM 9234  H HB3  . GLN A 1 11 ? -2.078  -8.394  -12.399 1.00 0.00 ? 11 GLN A HB3  9  
ATOM 9235  H HG2  . GLN A 1 11 ? -4.859  -7.298  -12.227 1.00 0.00 ? 11 GLN A HG2  9  
ATOM 9236  H HG3  . GLN A 1 11 ? -4.311  -8.220  -13.625 1.00 0.00 ? 11 GLN A HG3  9  
ATOM 9237  H HE21 . GLN A 1 11 ? -3.254  -10.344 -13.059 1.00 0.00 ? 11 GLN A HE21 9  
ATOM 9238  H HE22 . GLN A 1 11 ? -4.011  -11.281 -11.821 1.00 0.00 ? 11 GLN A HE22 9  
ATOM 9239  N N    . VAL A 1 12 ? -2.943  -7.493  -8.694  1.00 0.00 ? 12 VAL A N    9  
ATOM 9240  C CA   . VAL A 1 12 ? -2.937  -8.385  -7.541  1.00 0.00 ? 12 VAL A CA   9  
ATOM 9241  C C    . VAL A 1 12 ? -4.304  -8.419  -6.865  1.00 0.00 ? 12 VAL A C    9  
ATOM 9242  O O    . VAL A 1 12 ? -5.168  -7.589  -7.148  1.00 0.00 ? 12 VAL A O    9  
ATOM 9243  C CB   . VAL A 1 12 ? -1.876  -7.962  -6.508  1.00 0.00 ? 12 VAL A CB   9  
ATOM 9244  C CG1  . VAL A 1 12 ? -0.477  -8.125  -7.082  1.00 0.00 ? 12 VAL A CG1  9  
ATOM 9245  C CG2  . VAL A 1 12 ? -2.113  -6.528  -6.059  1.00 0.00 ? 12 VAL A CG2  9  
ATOM 9246  H H    . VAL A 1 12 ? -3.293  -6.583  -8.591  1.00 0.00 ? 12 VAL A H    9  
ATOM 9247  H HA   . VAL A 1 12 ? -2.694  -9.379  -7.889  1.00 0.00 ? 12 VAL A HA   9  
ATOM 9248  H HB   . VAL A 1 12 ? -1.965  -8.606  -5.646  1.00 0.00 ? 12 VAL A HB   9  
ATOM 9249  H HG11 . VAL A 1 12 ? -0.457  -8.980  -7.743  1.00 0.00 ? 12 VAL A HG11 9  
ATOM 9250  H HG12 . VAL A 1 12 ? -0.207  -7.236  -7.633  1.00 0.00 ? 12 VAL A HG12 9  
ATOM 9251  H HG13 . VAL A 1 12 ? 0.227   -8.278  -6.277  1.00 0.00 ? 12 VAL A HG13 9  
ATOM 9252  H HG21 . VAL A 1 12 ? -1.821  -5.851  -6.849  1.00 0.00 ? 12 VAL A HG21 9  
ATOM 9253  H HG22 . VAL A 1 12 ? -3.160  -6.388  -5.835  1.00 0.00 ? 12 VAL A HG22 9  
ATOM 9254  H HG23 . VAL A 1 12 ? -1.526  -6.325  -5.176  1.00 0.00 ? 12 VAL A HG23 9  
ATOM 9255  N N    . ARG A 1 13 ? -4.491  -9.383  -5.970  1.00 0.00 ? 13 ARG A N    9  
ATOM 9256  C CA   . ARG A 1 13 ? -5.753  -9.525  -5.253  1.00 0.00 ? 13 ARG A CA   9  
ATOM 9257  C C    . ARG A 1 13 ? -5.520  -10.065 -3.845  1.00 0.00 ? 13 ARG A C    9  
ATOM 9258  O O    . ARG A 1 13 ? -5.004  -11.169 -3.669  1.00 0.00 ? 13 ARG A O    9  
ATOM 9259  C CB   . ARG A 1 13 ? -6.696  -10.456 -6.018  1.00 0.00 ? 13 ARG A CB   9  
ATOM 9260  C CG   . ARG A 1 13 ? -8.153  -10.318 -5.607  1.00 0.00 ? 13 ARG A CG   9  
ATOM 9261  C CD   . ARG A 1 13 ? -9.078  -11.009 -6.596  1.00 0.00 ? 13 ARG A CD   9  
ATOM 9262  N NE   . ARG A 1 13 ? -9.204  -10.260 -7.844  1.00 0.00 ? 13 ARG A NE   9  
ATOM 9263  C CZ   . ARG A 1 13 ? -10.021 -10.609 -8.831  1.00 0.00 ? 13 ARG A CZ   9  
ATOM 9264  N NH1  . ARG A 1 13 ? -10.781 -11.689 -8.717  1.00 0.00 ? 13 ARG A NH1  9  
ATOM 9265  N NH2  . ARG A 1 13 ? -10.079 -9.876  -9.936  1.00 0.00 ? 13 ARG A NH2  9  
ATOM 9266  H H    . ARG A 1 13 ? -3.764  -10.014 -5.787  1.00 0.00 ? 13 ARG A H    9  
ATOM 9267  H HA   . ARG A 1 13 ? -6.206  -8.548  -5.181  1.00 0.00 ? 13 ARG A HA   9  
ATOM 9268  H HB2  . ARG A 1 13 ? -6.621  -10.237 -7.073  1.00 0.00 ? 13 ARG A HB2  9  
ATOM 9269  H HB3  . ARG A 1 13 ? -6.391  -11.477 -5.848  1.00 0.00 ? 13 ARG A HB3  9  
ATOM 9270  H HG2  . ARG A 1 13 ? -8.286  -10.766 -4.633  1.00 0.00 ? 13 ARG A HG2  9  
ATOM 9271  H HG3  . ARG A 1 13 ? -8.407  -9.270  -5.561  1.00 0.00 ? 13 ARG A HG3  9  
ATOM 9272  H HD2  . ARG A 1 13 ? -8.683  -11.990 -6.814  1.00 0.00 ? 13 ARG A HD2  9  
ATOM 9273  H HD3  . ARG A 1 13 ? -10.055 -11.107 -6.146  1.00 0.00 ? 13 ARG A HD3  9  
ATOM 9274  H HE   . ARG A 1 13 ? -8.651  -9.459  -7.949  1.00 0.00 ? 13 ARG A HE   9  
ATOM 9275  H HH11 . ARG A 1 13 ? -10.740 -12.242 -7.885  1.00 0.00 ? 13 ARG A HH11 9  
ATOM 9276  H HH12 . ARG A 1 13 ? -11.397 -11.948 -9.461  1.00 0.00 ? 13 ARG A HH12 9  
ATOM 9277  H HH21 . ARG A 1 13 ? -9.507  -9.061  -10.026 1.00 0.00 ? 13 ARG A HH21 9  
ATOM 9278  H HH22 . ARG A 1 13 ? -10.694 -10.139 -10.678 1.00 0.00 ? 13 ARG A HH22 9  
ATOM 9279  N N    . PHE A 1 14 ? -5.904  -9.279  -2.845  1.00 0.00 ? 14 PHE A N    9  
ATOM 9280  C CA   . PHE A 1 14 ? -5.736  -9.677  -1.452  1.00 0.00 ? 14 PHE A CA   9  
ATOM 9281  C C    . PHE A 1 14 ? -6.968  -9.309  -0.629  1.00 0.00 ? 14 PHE A C    9  
ATOM 9282  O O    . PHE A 1 14 ? -7.380  -8.150  -0.594  1.00 0.00 ? 14 PHE A O    9  
ATOM 9283  C CB   . PHE A 1 14 ? -4.494  -9.012  -0.856  1.00 0.00 ? 14 PHE A CB   9  
ATOM 9284  C CG   . PHE A 1 14 ? -3.209  -9.475  -1.481  1.00 0.00 ? 14 PHE A CG   9  
ATOM 9285  C CD1  . PHE A 1 14 ? -2.824  -10.804 -1.403  1.00 0.00 ? 14 PHE A CD1  9  
ATOM 9286  C CD2  . PHE A 1 14 ? -2.386  -8.581  -2.147  1.00 0.00 ? 14 PHE A CD2  9  
ATOM 9287  C CE1  . PHE A 1 14 ? -1.641  -11.232 -1.976  1.00 0.00 ? 14 PHE A CE1  9  
ATOM 9288  C CE2  . PHE A 1 14 ? -1.202  -9.004  -2.723  1.00 0.00 ? 14 PHE A CE2  9  
ATOM 9289  C CZ   . PHE A 1 14 ? -0.830  -10.331 -2.638  1.00 0.00 ? 14 PHE A CZ   9  
ATOM 9290  H H    . PHE A 1 14 ? -6.309  -8.410  -3.048  1.00 0.00 ? 14 PHE A H    9  
ATOM 9291  H HA   . PHE A 1 14 ? -5.608  -10.748 -1.427  1.00 0.00 ? 14 PHE A HA   9  
ATOM 9292  H HB2  . PHE A 1 14 ? -4.564  -7.944  -0.995  1.00 0.00 ? 14 PHE A HB2  9  
ATOM 9293  H HB3  . PHE A 1 14 ? -4.449  -9.232  0.200   1.00 0.00 ? 14 PHE A HB3  9  
ATOM 9294  H HD1  . PHE A 1 14 ? -3.457  -11.510 -0.886  1.00 0.00 ? 14 PHE A HD1  9  
ATOM 9295  H HD2  . PHE A 1 14 ? -2.676  -7.542  -2.214  1.00 0.00 ? 14 PHE A HD2  9  
ATOM 9296  H HE1  . PHE A 1 14 ? -1.353  -12.270 -1.909  1.00 0.00 ? 14 PHE A HE1  9  
ATOM 9297  H HE2  . PHE A 1 14 ? -0.571  -8.296  -3.240  1.00 0.00 ? 14 PHE A HE2  9  
ATOM 9298  H HZ   . PHE A 1 14 ? 0.094   -10.663 -3.087  1.00 0.00 ? 14 PHE A HZ   9  
ATOM 9299  N N    . SER A 1 15 ? -7.550  -10.305 0.031   1.00 0.00 ? 15 SER A N    9  
ATOM 9300  C CA   . SER A 1 15 ? -8.737  -10.088 0.850   1.00 0.00 ? 15 SER A CA   9  
ATOM 9301  C C    . SER A 1 15 ? -8.486  -9.003  1.893   1.00 0.00 ? 15 SER A C    9  
ATOM 9302  O O    . SER A 1 15 ? -7.365  -8.521  2.046   1.00 0.00 ? 15 SER A O    9  
ATOM 9303  C CB   . SER A 1 15 ? -9.151  -11.389 1.540   1.00 0.00 ? 15 SER A CB   9  
ATOM 9304  O OG   . SER A 1 15 ? -10.526 -11.371 1.879   1.00 0.00 ? 15 SER A OG   9  
ATOM 9305  H H    . SER A 1 15 ? -7.174  -11.207 -0.037  1.00 0.00 ? 15 SER A H    9  
ATOM 9306  H HA   . SER A 1 15 ? -9.535  -9.767  0.198   1.00 0.00 ? 15 SER A HA   9  
ATOM 9307  H HB2  . SER A 1 15 ? -8.967  -12.220 0.877   1.00 0.00 ? 15 SER A HB2  9  
ATOM 9308  H HB3  . SER A 1 15 ? -8.571  -11.514 2.443   1.00 0.00 ? 15 SER A HB3  9  
ATOM 9309  H HG   . SER A 1 15 ? -11.029 -10.986 1.158   1.00 0.00 ? 15 SER A HG   9  
ATOM 9310  N N    . ASN A 1 16 ? -9.540  -8.624  2.609   1.00 0.00 ? 16 ASN A N    9  
ATOM 9311  C CA   . ASN A 1 16 ? -9.436  -7.596  3.637   1.00 0.00 ? 16 ASN A CA   9  
ATOM 9312  C C    . ASN A 1 16 ? -8.398  -7.980  4.688   1.00 0.00 ? 16 ASN A C    9  
ATOM 9313  O O    . ASN A 1 16 ? -7.389  -7.295  4.858   1.00 0.00 ? 16 ASN A O    9  
ATOM 9314  C CB   . ASN A 1 16 ? -10.795 -7.373  4.305   1.00 0.00 ? 16 ASN A CB   9  
ATOM 9315  C CG   . ASN A 1 16 ? -11.788 -6.696  3.381   1.00 0.00 ? 16 ASN A CG   9  
ATOM 9316  O OD1  . ASN A 1 16 ? -12.647 -7.350  2.788   1.00 0.00 ? 16 ASN A OD1  9  
ATOM 9317  N ND2  . ASN A 1 16 ? -11.676 -5.379  3.254   1.00 0.00 ? 16 ASN A ND2  9  
ATOM 9318  H H    . ASN A 1 16 ? -10.409 -9.045  2.441   1.00 0.00 ? 16 ASN A H    9  
ATOM 9319  H HA   . ASN A 1 16 ? -9.125  -6.679  3.159   1.00 0.00 ? 16 ASN A HA   9  
ATOM 9320  H HB2  . ASN A 1 16 ? -11.203 -8.327  4.604   1.00 0.00 ? 16 ASN A HB2  9  
ATOM 9321  H HB3  . ASN A 1 16 ? -10.663 -6.753  5.178   1.00 0.00 ? 16 ASN A HB3  9  
ATOM 9322  H HD21 . ASN A 1 16 ? -10.968 -4.924  3.756   1.00 0.00 ? 16 ASN A HD21 9  
ATOM 9323  H HD22 . ASN A 1 16 ? -12.306 -4.916  2.663   1.00 0.00 ? 16 ASN A HD22 9  
ATOM 9324  N N    . ASP A 1 17 ? -8.653  -9.080  5.388   1.00 0.00 ? 17 ASP A N    9  
ATOM 9325  C CA   . ASP A 1 17 ? -7.740  -9.557  6.421   1.00 0.00 ? 17 ASP A CA   9  
ATOM 9326  C C    . ASP A 1 17 ? -6.347  -9.796  5.846   1.00 0.00 ? 17 ASP A C    9  
ATOM 9327  O O    . ASP A 1 17 ? -5.359  -9.261  6.348   1.00 0.00 ? 17 ASP A O    9  
ATOM 9328  C CB   . ASP A 1 17 ? -8.275  -10.845 7.048   1.00 0.00 ? 17 ASP A CB   9  
ATOM 9329  C CG   . ASP A 1 17 ? -8.873  -11.785 6.020   1.00 0.00 ? 17 ASP A CG   9  
ATOM 9330  O OD1  . ASP A 1 17 ? -8.106  -12.545 5.394   1.00 0.00 ? 17 ASP A OD1  9  
ATOM 9331  O OD2  . ASP A 1 17 ? -10.109 -11.759 5.840   1.00 0.00 ? 17 ASP A OD2  9  
ATOM 9332  H H    . ASP A 1 17 ? -9.474  -9.583  5.206   1.00 0.00 ? 17 ASP A H    9  
ATOM 9333  H HA   . ASP A 1 17 ? -7.675  -8.796  7.184   1.00 0.00 ? 17 ASP A HA   9  
ATOM 9334  H HB2  . ASP A 1 17 ? -7.466  -11.357 7.548   1.00 0.00 ? 17 ASP A HB2  9  
ATOM 9335  H HB3  . ASP A 1 17 ? -9.039  -10.596 7.770   1.00 0.00 ? 17 ASP A HB3  9  
ATOM 9336  N N    . GLN A 1 18 ? -6.278  -10.603 4.793   1.00 0.00 ? 18 GLN A N    9  
ATOM 9337  C CA   . GLN A 1 18 ? -5.005  -10.914 4.152   1.00 0.00 ? 18 GLN A CA   9  
ATOM 9338  C C    . GLN A 1 18 ? -4.128  -9.671  4.051   1.00 0.00 ? 18 GLN A C    9  
ATOM 9339  O O    . GLN A 1 18 ? -3.042  -9.615  4.628   1.00 0.00 ? 18 GLN A O    9  
ATOM 9340  C CB   . GLN A 1 18 ? -5.241  -11.501 2.759   1.00 0.00 ? 18 GLN A CB   9  
ATOM 9341  C CG   . GLN A 1 18 ? -5.406  -13.012 2.755   1.00 0.00 ? 18 GLN A CG   9  
ATOM 9342  C CD   . GLN A 1 18 ? -5.875  -13.545 1.416   1.00 0.00 ? 18 GLN A CD   9  
ATOM 9343  O OE1  . GLN A 1 18 ? -6.109  -12.781 0.479   1.00 0.00 ? 18 GLN A OE1  9  
ATOM 9344  N NE2  . GLN A 1 18 ? -6.014  -14.861 1.318   1.00 0.00 ? 18 GLN A NE2  9  
ATOM 9345  H H    . GLN A 1 18 ? -7.100  -10.999 4.439   1.00 0.00 ? 18 GLN A H    9  
ATOM 9346  H HA   . GLN A 1 18 ? -4.499  -11.648 4.760   1.00 0.00 ? 18 GLN A HA   9  
ATOM 9347  H HB2  . GLN A 1 18 ? -6.136  -11.061 2.343   1.00 0.00 ? 18 GLN A HB2  9  
ATOM 9348  H HB3  . GLN A 1 18 ? -4.401  -11.251 2.129   1.00 0.00 ? 18 GLN A HB3  9  
ATOM 9349  H HG2  . GLN A 1 18 ? -4.455  -13.466 2.993   1.00 0.00 ? 18 GLN A HG2  9  
ATOM 9350  H HG3  . GLN A 1 18 ? -6.131  -13.284 3.508   1.00 0.00 ? 18 GLN A HG3  9  
ATOM 9351  H HE21 . GLN A 1 18 ? -5.810  -15.408 2.106   1.00 0.00 ? 18 GLN A HE21 9  
ATOM 9352  H HE22 . GLN A 1 18 ? -6.316  -15.233 0.464   1.00 0.00 ? 18 GLN A HE22 9  
ATOM 9353  N N    . THR A 1 19 ? -4.607  -8.673  3.314   1.00 0.00 ? 19 THR A N    9  
ATOM 9354  C CA   . THR A 1 19 ? -3.866  -7.431  3.135   1.00 0.00 ? 19 THR A CA   9  
ATOM 9355  C C    . THR A 1 19 ? -3.432  -6.852  4.477   1.00 0.00 ? 19 THR A C    9  
ATOM 9356  O O    . THR A 1 19 ? -2.265  -6.509  4.668   1.00 0.00 ? 19 THR A O    9  
ATOM 9357  C CB   . THR A 1 19 ? -4.704  -6.380  2.383   1.00 0.00 ? 19 THR A CB   9  
ATOM 9358  O OG1  . THR A 1 19 ? -5.119  -6.901  1.115   1.00 0.00 ? 19 THR A OG1  9  
ATOM 9359  C CG2  . THR A 1 19 ? -3.908  -5.100  2.176   1.00 0.00 ? 19 THR A CG2  9  
ATOM 9360  H H    . THR A 1 19 ? -5.479  -8.777  2.879   1.00 0.00 ? 19 THR A H    9  
ATOM 9361  H HA   . THR A 1 19 ? -2.987  -7.648  2.547   1.00 0.00 ? 19 THR A HA   9  
ATOM 9362  H HB   . THR A 1 19 ? -5.580  -6.150  2.973   1.00 0.00 ? 19 THR A HB   9  
ATOM 9363  H HG1  . THR A 1 19 ? -5.713  -6.277  0.692   1.00 0.00 ? 19 THR A HG1  9  
ATOM 9364  H HG21 . THR A 1 19 ? -2.862  -5.293  2.363   1.00 0.00 ? 19 THR A HG21 9  
ATOM 9365  H HG22 . THR A 1 19 ? -4.263  -4.342  2.857   1.00 0.00 ? 19 THR A HG22 9  
ATOM 9366  H HG23 . THR A 1 19 ? -4.035  -4.759  1.159   1.00 0.00 ? 19 THR A HG23 9  
ATOM 9367  N N    . ILE A 1 20 ? -4.378  -6.747  5.404   1.00 0.00 ? 20 ILE A N    9  
ATOM 9368  C CA   . ILE A 1 20 ? -4.092  -6.211  6.730   1.00 0.00 ? 20 ILE A CA   9  
ATOM 9369  C C    . ILE A 1 20 ? -2.830  -6.836  7.315   1.00 0.00 ? 20 ILE A C    9  
ATOM 9370  O O    . ILE A 1 20 ? -1.840  -6.147  7.557   1.00 0.00 ? 20 ILE A O    9  
ATOM 9371  C CB   . ILE A 1 20 ? -5.266  -6.448  7.698   1.00 0.00 ? 20 ILE A CB   9  
ATOM 9372  C CG1  . ILE A 1 20 ? -6.503  -5.678  7.233   1.00 0.00 ? 20 ILE A CG1  9  
ATOM 9373  C CG2  . ILE A 1 20 ? -4.878  -6.036  9.111   1.00 0.00 ? 20 ILE A CG2  9  
ATOM 9374  C CD1  . ILE A 1 20 ? -7.800  -6.231  7.780   1.00 0.00 ? 20 ILE A CD1  9  
ATOM 9375  H H    . ILE A 1 20 ? -5.290  -7.037  5.193   1.00 0.00 ? 20 ILE A H    9  
ATOM 9376  H HA   . ILE A 1 20 ? -3.941  -5.145  6.632   1.00 0.00 ? 20 ILE A HA   9  
ATOM 9377  H HB   . ILE A 1 20 ? -5.489  -7.504  7.706   1.00 0.00 ? 20 ILE A HB   9  
ATOM 9378  H HG12 . ILE A 1 20 ? -6.421  -4.651  7.552   1.00 0.00 ? 20 ILE A HG12 9  
ATOM 9379  H HG13 . ILE A 1 20 ? -6.555  -5.713  6.154   1.00 0.00 ? 20 ILE A HG13 9  
ATOM 9380  H HG21 . ILE A 1 20 ? -5.672  -5.446  9.544   1.00 0.00 ? 20 ILE A HG21 9  
ATOM 9381  H HG22 . ILE A 1 20 ? -4.718  -6.919  9.711   1.00 0.00 ? 20 ILE A HG22 9  
ATOM 9382  H HG23 . ILE A 1 20 ? -3.971  -5.452  9.079   1.00 0.00 ? 20 ILE A HG23 9  
ATOM 9383  H HD11 . ILE A 1 20 ? -8.427  -6.557  6.963   1.00 0.00 ? 20 ILE A HD11 9  
ATOM 9384  H HD12 . ILE A 1 20 ? -7.590  -7.068  8.429   1.00 0.00 ? 20 ILE A HD12 9  
ATOM 9385  H HD13 . ILE A 1 20 ? -8.312  -5.461  8.340   1.00 0.00 ? 20 ILE A HD13 9  
ATOM 9386  N N    . GLU A 1 21 ? -2.874  -8.146  7.537   1.00 0.00 ? 21 GLU A N    9  
ATOM 9387  C CA   . GLU A 1 21 ? -1.733  -8.864  8.093   1.00 0.00 ? 21 GLU A CA   9  
ATOM 9388  C C    . GLU A 1 21 ? -0.492  -8.669  7.226   1.00 0.00 ? 21 GLU A C    9  
ATOM 9389  O O    . GLU A 1 21 ? 0.586   -8.349  7.728   1.00 0.00 ? 21 GLU A O    9  
ATOM 9390  C CB   . GLU A 1 21 ? -2.052  -10.356 8.217   1.00 0.00 ? 21 GLU A CB   9  
ATOM 9391  C CG   . GLU A 1 21 ? -2.711  -10.729 9.534   1.00 0.00 ? 21 GLU A CG   9  
ATOM 9392  C CD   . GLU A 1 21 ? -1.704  -11.005 10.633  1.00 0.00 ? 21 GLU A CD   9  
ATOM 9393  O OE1  . GLU A 1 21 ? -0.968  -10.070 11.013  1.00 0.00 ? 21 GLU A OE1  9  
ATOM 9394  O OE2  . GLU A 1 21 ? -1.651  -12.156 11.114  1.00 0.00 ? 21 GLU A OE2  9  
ATOM 9395  H H    . GLU A 1 21 ? -3.692  -8.641  7.323   1.00 0.00 ? 21 GLU A H    9  
ATOM 9396  H HA   . GLU A 1 21 ? -1.536  -8.464  9.076   1.00 0.00 ? 21 GLU A HA   9  
ATOM 9397  H HB2  . GLU A 1 21 ? -2.715  -10.638 7.413   1.00 0.00 ? 21 GLU A HB2  9  
ATOM 9398  H HB3  . GLU A 1 21 ? -1.133  -10.916 8.127   1.00 0.00 ? 21 GLU A HB3  9  
ATOM 9399  H HG2  . GLU A 1 21 ? -3.348  -9.915  9.847   1.00 0.00 ? 21 GLU A HG2  9  
ATOM 9400  H HG3  . GLU A 1 21 ? -3.309  -11.616 9.384   1.00 0.00 ? 21 GLU A HG3  9  
ATOM 9401  N N    . LEU A 1 22 ? -0.653  -8.864  5.922   1.00 0.00 ? 22 LEU A N    9  
ATOM 9402  C CA   . LEU A 1 22 ? 0.454   -8.710  4.983   1.00 0.00 ? 22 LEU A CA   9  
ATOM 9403  C C    . LEU A 1 22 ? 1.238   -7.434  5.271   1.00 0.00 ? 22 LEU A C    9  
ATOM 9404  O O    . LEU A 1 22 ? 2.431   -7.350  4.981   1.00 0.00 ? 22 LEU A O    9  
ATOM 9405  C CB   . LEU A 1 22 ? -0.070  -8.688  3.546   1.00 0.00 ? 22 LEU A CB   9  
ATOM 9406  C CG   . LEU A 1 22 ? -0.355  -10.050 2.914   1.00 0.00 ? 22 LEU A CG   9  
ATOM 9407  C CD1  . LEU A 1 22 ? -1.098  -9.884  1.598   1.00 0.00 ? 22 LEU A CD1  9  
ATOM 9408  C CD2  . LEU A 1 22 ? 0.940   -10.821 2.703   1.00 0.00 ? 22 LEU A CD2  9  
ATOM 9409  H H    . LEU A 1 22 ? -1.535  -9.118  5.581   1.00 0.00 ? 22 LEU A H    9  
ATOM 9410  H HA   . LEU A 1 22 ? 1.111   -9.558  5.105   1.00 0.00 ? 22 LEU A HA   9  
ATOM 9411  H HB2  . LEU A 1 22 ? -0.989  -8.121  3.538   1.00 0.00 ? 22 LEU A HB2  9  
ATOM 9412  H HB3  . LEU A 1 22 ? 0.666   -8.185  2.935   1.00 0.00 ? 22 LEU A HB3  9  
ATOM 9413  H HG   . LEU A 1 22 ? -0.982  -10.626 3.580   1.00 0.00 ? 22 LEU A HG   9  
ATOM 9414  H HD11 . LEU A 1 22 ? -2.134  -10.155 1.733   1.00 0.00 ? 22 LEU A HD11 9  
ATOM 9415  H HD12 . LEU A 1 22 ? -0.653  -10.522 0.849   1.00 0.00 ? 22 LEU A HD12 9  
ATOM 9416  H HD13 . LEU A 1 22 ? -1.034  -8.854  1.276   1.00 0.00 ? 22 LEU A HD13 9  
ATOM 9417  H HD21 . LEU A 1 22 ? 0.836   -11.472 1.847   1.00 0.00 ? 22 LEU A HD21 9  
ATOM 9418  H HD22 . LEU A 1 22 ? 1.154   -11.414 3.581   1.00 0.00 ? 22 LEU A HD22 9  
ATOM 9419  H HD23 . LEU A 1 22 ? 1.749   -10.127 2.531   1.00 0.00 ? 22 LEU A HD23 9  
ATOM 9420  N N    . GLU A 1 23 ? 0.560   -6.445  5.845   1.00 0.00 ? 23 GLU A N    9  
ATOM 9421  C CA   . GLU A 1 23 ? 1.195   -5.174  6.173   1.00 0.00 ? 23 GLU A CA   9  
ATOM 9422  C C    . GLU A 1 23 ? 1.798   -5.213  7.574   1.00 0.00 ? 23 GLU A C    9  
ATOM 9423  O O    . GLU A 1 23 ? 2.984   -4.943  7.760   1.00 0.00 ? 23 GLU A O    9  
ATOM 9424  C CB   . GLU A 1 23 ? 0.182   -4.032  6.072   1.00 0.00 ? 23 GLU A CB   9  
ATOM 9425  C CG   . GLU A 1 23 ? -0.412  -3.866  4.684   1.00 0.00 ? 23 GLU A CG   9  
ATOM 9426  C CD   . GLU A 1 23 ? -0.904  -2.455  4.424   1.00 0.00 ? 23 GLU A CD   9  
ATOM 9427  O OE1  . GLU A 1 23 ? -0.186  -1.501  4.790   1.00 0.00 ? 23 GLU A OE1  9  
ATOM 9428  O OE2  . GLU A 1 23 ? -2.005  -2.305  3.856   1.00 0.00 ? 23 GLU A OE2  9  
ATOM 9429  H H    . GLU A 1 23 ? -0.389  -6.573  6.051   1.00 0.00 ? 23 GLU A H    9  
ATOM 9430  H HA   . GLU A 1 23 ? 1.987   -5.005  5.458   1.00 0.00 ? 23 GLU A HA   9  
ATOM 9431  H HB2  . GLU A 1 23 ? -0.623  -4.219  6.767   1.00 0.00 ? 23 GLU A HB2  9  
ATOM 9432  H HB3  . GLU A 1 23 ? 0.672   -3.108  6.343   1.00 0.00 ? 23 GLU A HB3  9  
ATOM 9433  H HG2  . GLU A 1 23 ? 0.343   -4.108  3.951   1.00 0.00 ? 23 GLU A HG2  9  
ATOM 9434  H HG3  . GLU A 1 23 ? -1.244  -4.546  4.579   1.00 0.00 ? 23 GLU A HG3  9  
ATOM 9435  N N    . LYS A 1 24 ? 0.971   -5.550  8.558   1.00 0.00 ? 24 LYS A N    9  
ATOM 9436  C CA   . LYS A 1 24 ? 1.419   -5.625  9.943   1.00 0.00 ? 24 LYS A CA   9  
ATOM 9437  C C    . LYS A 1 24 ? 2.738   -6.384  10.048  1.00 0.00 ? 24 LYS A C    9  
ATOM 9438  O O    . LYS A 1 24 ? 3.472   -6.243  11.026  1.00 0.00 ? 24 LYS A O    9  
ATOM 9439  C CB   . LYS A 1 24 ? 0.357   -6.306  10.809  1.00 0.00 ? 24 LYS A CB   9  
ATOM 9440  C CG   . LYS A 1 24 ? -0.994  -5.611  10.773  1.00 0.00 ? 24 LYS A CG   9  
ATOM 9441  C CD   . LYS A 1 24 ? -2.033  -6.370  11.582  1.00 0.00 ? 24 LYS A CD   9  
ATOM 9442  C CE   . LYS A 1 24 ? -2.061  -5.904  13.029  1.00 0.00 ? 24 LYS A CE   9  
ATOM 9443  N NZ   . LYS A 1 24 ? -0.994  -6.552  13.841  1.00 0.00 ? 24 LYS A NZ   9  
ATOM 9444  H H    . LYS A 1 24 ? 0.035   -5.754  8.347   1.00 0.00 ? 24 LYS A H    9  
ATOM 9445  H HA   . LYS A 1 24 ? 1.569   -4.617  10.299  1.00 0.00 ? 24 LYS A HA   9  
ATOM 9446  H HB2  . LYS A 1 24 ? 0.225   -7.321  10.464  1.00 0.00 ? 24 LYS A HB2  9  
ATOM 9447  H HB3  . LYS A 1 24 ? 0.701   -6.324  11.833  1.00 0.00 ? 24 LYS A HB3  9  
ATOM 9448  H HG2  . LYS A 1 24 ? -0.888  -4.618  11.184  1.00 0.00 ? 24 LYS A HG2  9  
ATOM 9449  H HG3  . LYS A 1 24 ? -1.327  -5.544  9.747   1.00 0.00 ? 24 LYS A HG3  9  
ATOM 9450  H HD2  . LYS A 1 24 ? -3.006  -6.207  11.144  1.00 0.00 ? 24 LYS A HD2  9  
ATOM 9451  H HD3  . LYS A 1 24 ? -1.796  -7.424  11.556  1.00 0.00 ? 24 LYS A HD3  9  
ATOM 9452  H HE2  . LYS A 1 24 ? -1.920  -4.835  13.053  1.00 0.00 ? 24 LYS A HE2  9  
ATOM 9453  H HE3  . LYS A 1 24 ? -3.024  -6.150  13.454  1.00 0.00 ? 24 LYS A HE3  9  
ATOM 9454  H HZ1  . LYS A 1 24 ? -0.963  -7.573  13.641  1.00 0.00 ? 24 LYS A HZ1  9  
ATOM 9455  H HZ2  . LYS A 1 24 ? -1.184  -6.416  14.855  1.00 0.00 ? 24 LYS A HZ2  9  
ATOM 9456  H HZ3  . LYS A 1 24 ? -0.069  -6.136  13.613  1.00 0.00 ? 24 LYS A HZ3  9  
ATOM 9457  N N    . LYS A 1 25 ? 3.034   -7.189  9.033   1.00 0.00 ? 25 LYS A N    9  
ATOM 9458  C CA   . LYS A 1 25 ? 4.266   -7.968  9.008   1.00 0.00 ? 25 LYS A CA   9  
ATOM 9459  C C    . LYS A 1 25 ? 5.413   -7.156  8.416   1.00 0.00 ? 25 LYS A C    9  
ATOM 9460  O O    . LYS A 1 25 ? 6.435   -6.939  9.068   1.00 0.00 ? 25 LYS A O    9  
ATOM 9461  C CB   . LYS A 1 25 ? 4.065   -9.252  8.198   1.00 0.00 ? 25 LYS A CB   9  
ATOM 9462  C CG   . LYS A 1 25 ? 5.226   -10.226 8.305   1.00 0.00 ? 25 LYS A CG   9  
ATOM 9463  C CD   . LYS A 1 25 ? 5.376   -10.761 9.720   1.00 0.00 ? 25 LYS A CD   9  
ATOM 9464  C CE   . LYS A 1 25 ? 6.188   -12.047 9.746   1.00 0.00 ? 25 LYS A CE   9  
ATOM 9465  N NZ   . LYS A 1 25 ? 6.001   -12.796 11.019  1.00 0.00 ? 25 LYS A NZ   9  
ATOM 9466  H H    . LYS A 1 25 ? 2.409   -7.259  8.280   1.00 0.00 ? 25 LYS A H    9  
ATOM 9467  H HA   . LYS A 1 25 ? 4.514   -8.230  10.025  1.00 0.00 ? 25 LYS A HA   9  
ATOM 9468  H HB2  . LYS A 1 25 ? 3.172   -9.748  8.548   1.00 0.00 ? 25 LYS A HB2  9  
ATOM 9469  H HB3  . LYS A 1 25 ? 3.937   -8.990  7.158   1.00 0.00 ? 25 LYS A HB3  9  
ATOM 9470  H HG2  . LYS A 1 25 ? 5.051   -11.054 7.635   1.00 0.00 ? 25 LYS A HG2  9  
ATOM 9471  H HG3  . LYS A 1 25 ? 6.137   -9.718  8.024   1.00 0.00 ? 25 LYS A HG3  9  
ATOM 9472  H HD2  . LYS A 1 25 ? 5.876   -10.020 10.325  1.00 0.00 ? 25 LYS A HD2  9  
ATOM 9473  H HD3  . LYS A 1 25 ? 4.394   -10.958 10.127  1.00 0.00 ? 25 LYS A HD3  9  
ATOM 9474  H HE2  . LYS A 1 25 ? 5.877   -12.671 8.922   1.00 0.00 ? 25 LYS A HE2  9  
ATOM 9475  H HE3  . LYS A 1 25 ? 7.234   -11.798 9.634   1.00 0.00 ? 25 LYS A HE3  9  
ATOM 9476  H HZ1  . LYS A 1 25 ? 6.890   -13.262 11.293  1.00 0.00 ? 25 LYS A HZ1  9  
ATOM 9477  H HZ2  . LYS A 1 25 ? 5.265   -13.521 10.902  1.00 0.00 ? 25 LYS A HZ2  9  
ATOM 9478  H HZ3  . LYS A 1 25 ? 5.715   -12.145 11.778  1.00 0.00 ? 25 LYS A HZ3  9  
ATOM 9479  N N    . PHE A 1 26 ? 5.237   -6.707  7.178   1.00 0.00 ? 26 PHE A N    9  
ATOM 9480  C CA   . PHE A 1 26 ? 6.257   -5.917  6.498   1.00 0.00 ? 26 PHE A CA   9  
ATOM 9481  C C    . PHE A 1 26 ? 6.785   -4.812  7.409   1.00 0.00 ? 26 PHE A C    9  
ATOM 9482  O O    . PHE A 1 26 ? 7.972   -4.489  7.384   1.00 0.00 ? 26 PHE A O    9  
ATOM 9483  C CB   . PHE A 1 26 ? 5.690   -5.308  5.215   1.00 0.00 ? 26 PHE A CB   9  
ATOM 9484  C CG   . PHE A 1 26 ? 6.446   -4.100  4.739   1.00 0.00 ? 26 PHE A CG   9  
ATOM 9485  C CD1  . PHE A 1 26 ? 6.209   -2.854  5.297   1.00 0.00 ? 26 PHE A CD1  9  
ATOM 9486  C CD2  . PHE A 1 26 ? 7.394   -4.211  3.735   1.00 0.00 ? 26 PHE A CD2  9  
ATOM 9487  C CE1  . PHE A 1 26 ? 6.903   -1.741  4.861   1.00 0.00 ? 26 PHE A CE1  9  
ATOM 9488  C CE2  . PHE A 1 26 ? 8.091   -3.101  3.295   1.00 0.00 ? 26 PHE A CE2  9  
ATOM 9489  C CZ   . PHE A 1 26 ? 7.846   -1.865  3.859   1.00 0.00 ? 26 PHE A CZ   9  
ATOM 9490  H H    . PHE A 1 26 ? 4.400   -6.912  6.709   1.00 0.00 ? 26 PHE A H    9  
ATOM 9491  H HA   . PHE A 1 26 ? 7.072   -6.577  6.244   1.00 0.00 ? 26 PHE A HA   9  
ATOM 9492  H HB2  . PHE A 1 26 ? 5.720   -6.048  4.429   1.00 0.00 ? 26 PHE A HB2  9  
ATOM 9493  H HB3  . PHE A 1 26 ? 4.666   -5.013  5.387   1.00 0.00 ? 26 PHE A HB3  9  
ATOM 9494  H HD1  . PHE A 1 26 ? 5.473   -2.756  6.081   1.00 0.00 ? 26 PHE A HD1  9  
ATOM 9495  H HD2  . PHE A 1 26 ? 7.587   -5.178  3.292   1.00 0.00 ? 26 PHE A HD2  9  
ATOM 9496  H HE1  . PHE A 1 26 ? 6.710   -0.776  5.304   1.00 0.00 ? 26 PHE A HE1  9  
ATOM 9497  H HE2  . PHE A 1 26 ? 8.828   -3.202  2.511   1.00 0.00 ? 26 PHE A HE2  9  
ATOM 9498  H HZ   . PHE A 1 26 ? 8.389   -0.997  3.517   1.00 0.00 ? 26 PHE A HZ   9  
ATOM 9499  N N    . GLU A 1 27 ? 5.894   -4.237  8.210   1.00 0.00 ? 27 GLU A N    9  
ATOM 9500  C CA   . GLU A 1 27 ? 6.270   -3.168  9.127   1.00 0.00 ? 27 GLU A CA   9  
ATOM 9501  C C    . GLU A 1 27 ? 7.328   -3.647  10.118  1.00 0.00 ? 27 GLU A C    9  
ATOM 9502  O O    . GLU A 1 27 ? 8.353   -2.994  10.315  1.00 0.00 ? 27 GLU A O    9  
ATOM 9503  C CB   . GLU A 1 27 ? 5.041   -2.658  9.883   1.00 0.00 ? 27 GLU A CB   9  
ATOM 9504  C CG   . GLU A 1 27 ? 3.867   -2.322  8.979   1.00 0.00 ? 27 GLU A CG   9  
ATOM 9505  C CD   . GLU A 1 27 ? 3.887   -0.881  8.508   1.00 0.00 ? 27 GLU A CD   9  
ATOM 9506  O OE1  . GLU A 1 27 ? 3.391   -0.007  9.249   1.00 0.00 ? 27 GLU A OE1  9  
ATOM 9507  O OE2  . GLU A 1 27 ? 4.399   -0.628  7.397   1.00 0.00 ? 27 GLU A OE2  9  
ATOM 9508  H H    . GLU A 1 27 ? 4.962   -4.539  8.184   1.00 0.00 ? 27 GLU A H    9  
ATOM 9509  H HA   . GLU A 1 27 ? 6.683   -2.359  8.543   1.00 0.00 ? 27 GLU A HA   9  
ATOM 9510  H HB2  . GLU A 1 27 ? 4.725   -3.416  10.584  1.00 0.00 ? 27 GLU A HB2  9  
ATOM 9511  H HB3  . GLU A 1 27 ? 5.314   -1.767  10.429  1.00 0.00 ? 27 GLU A HB3  9  
ATOM 9512  H HG2  . GLU A 1 27 ? 3.899   -2.968  8.115   1.00 0.00 ? 27 GLU A HG2  9  
ATOM 9513  H HG3  . GLU A 1 27 ? 2.950   -2.495  9.523   1.00 0.00 ? 27 GLU A HG3  9  
ATOM 9514  N N    . THR A 1 28 ? 7.070   -4.794  10.740  1.00 0.00 ? 28 THR A N    9  
ATOM 9515  C CA   . THR A 1 28 ? 7.997   -5.361  11.711  1.00 0.00 ? 28 THR A CA   9  
ATOM 9516  C C    . THR A 1 28 ? 9.241   -5.916  11.026  1.00 0.00 ? 28 THR A C    9  
ATOM 9517  O O    . THR A 1 28 ? 10.300  -6.032  11.641  1.00 0.00 ? 28 THR A O    9  
ATOM 9518  C CB   . THR A 1 28 ? 7.334   -6.483  12.532  1.00 0.00 ? 28 THR A CB   9  
ATOM 9519  O OG1  . THR A 1 28 ? 6.824   -7.495  11.657  1.00 0.00 ? 28 THR A OG1  9  
ATOM 9520  C CG2  . THR A 1 28 ? 6.205   -5.931  13.389  1.00 0.00 ? 28 THR A CG2  9  
ATOM 9521  H H    . THR A 1 28 ? 6.236   -5.268  10.540  1.00 0.00 ? 28 THR A H    9  
ATOM 9522  H HA   . THR A 1 28 ? 8.293   -4.574  12.389  1.00 0.00 ? 28 THR A HA   9  
ATOM 9523  H HB   . THR A 1 28 ? 8.078   -6.921  13.182  1.00 0.00 ? 28 THR A HB   9  
ATOM 9524  H HG1  . THR A 1 28 ? 7.497   -8.165  11.515  1.00 0.00 ? 28 THR A HG1  9  
ATOM 9525  H HG21 . THR A 1 28 ? 6.558   -5.784  14.399  1.00 0.00 ? 28 THR A HG21 9  
ATOM 9526  H HG22 . THR A 1 28 ? 5.382   -6.629  13.394  1.00 0.00 ? 28 THR A HG22 9  
ATOM 9527  H HG23 . THR A 1 28 ? 5.874   -4.987  12.983  1.00 0.00 ? 28 THR A HG23 9  
ATOM 9528  N N    . GLN A 1 29 ? 9.104   -6.257  9.748   1.00 0.00 ? 29 GLN A N    9  
ATOM 9529  C CA   . GLN A 1 29 ? 10.218  -6.800  8.980   1.00 0.00 ? 29 GLN A CA   9  
ATOM 9530  C C    . GLN A 1 29 ? 10.008  -6.578  7.486   1.00 0.00 ? 29 GLN A C    9  
ATOM 9531  O O    . GLN A 1 29 ? 9.099   -7.150  6.884   1.00 0.00 ? 29 GLN A O    9  
ATOM 9532  C CB   . GLN A 1 29 ? 10.383  -8.293  9.267   1.00 0.00 ? 29 GLN A CB   9  
ATOM 9533  C CG   . GLN A 1 29 ? 11.820  -8.777  9.164   1.00 0.00 ? 29 GLN A CG   9  
ATOM 9534  C CD   . GLN A 1 29 ? 11.917  -10.270 8.919   1.00 0.00 ? 29 GLN A CD   9  
ATOM 9535  O OE1  . GLN A 1 29 ? 11.181  -11.058 9.514   1.00 0.00 ? 29 GLN A OE1  9  
ATOM 9536  N NE2  . GLN A 1 29 ? 12.828  -10.668 8.039   1.00 0.00 ? 29 GLN A NE2  9  
ATOM 9537  H H    . GLN A 1 29 ? 8.234   -6.141  9.313   1.00 0.00 ? 29 GLN A H    9  
ATOM 9538  H HA   . GLN A 1 29 ? 11.114  -6.283  9.285   1.00 0.00 ? 29 GLN A HA   9  
ATOM 9539  H HB2  . GLN A 1 29 ? 10.028  -8.497  10.266  1.00 0.00 ? 29 GLN A HB2  9  
ATOM 9540  H HB3  . GLN A 1 29 ? 9.787   -8.852  8.561   1.00 0.00 ? 29 GLN A HB3  9  
ATOM 9541  H HG2  . GLN A 1 29 ? 12.302  -8.263  8.346   1.00 0.00 ? 29 GLN A HG2  9  
ATOM 9542  H HG3  . GLN A 1 29 ? 12.332  -8.544  10.086  1.00 0.00 ? 29 GLN A HG3  9  
ATOM 9543  H HE21 . GLN A 1 29 ? 13.380  -9.985  7.603   1.00 0.00 ? 29 GLN A HE21 9  
ATOM 9544  H HE22 . GLN A 1 29 ? 12.913  -11.628 7.862   1.00 0.00 ? 29 GLN A HE22 9  
ATOM 9545  N N    . LYS A 1 30 ? 10.854  -5.743  6.892   1.00 0.00 ? 30 LYS A N    9  
ATOM 9546  C CA   . LYS A 1 30 ? 10.763  -5.445  5.468   1.00 0.00 ? 30 LYS A CA   9  
ATOM 9547  C C    . LYS A 1 30 ? 10.844  -6.723  4.638   1.00 0.00 ? 30 LYS A C    9  
ATOM 9548  O O    . LYS A 1 30 ? 10.217  -6.831  3.584   1.00 0.00 ? 30 LYS A O    9  
ATOM 9549  C CB   . LYS A 1 30 ? 11.879  -4.484  5.054   1.00 0.00 ? 30 LYS A CB   9  
ATOM 9550  C CG   . LYS A 1 30 ? 11.937  -3.221  5.895   1.00 0.00 ? 30 LYS A CG   9  
ATOM 9551  C CD   . LYS A 1 30 ? 10.781  -2.286  5.577   1.00 0.00 ? 30 LYS A CD   9  
ATOM 9552  C CE   . LYS A 1 30 ? 10.511  -1.324  6.723   1.00 0.00 ? 30 LYS A CE   9  
ATOM 9553  N NZ   . LYS A 1 30 ? 10.084  -2.038  7.958   1.00 0.00 ? 30 LYS A NZ   9  
ATOM 9554  H H    . LYS A 1 30 ? 11.558  -5.318  7.425   1.00 0.00 ? 30 LYS A H    9  
ATOM 9555  H HA   . LYS A 1 30 ? 9.808   -4.974  5.288   1.00 0.00 ? 30 LYS A HA   9  
ATOM 9556  H HB2  . LYS A 1 30 ? 12.828  -4.994  5.143   1.00 0.00 ? 30 LYS A HB2  9  
ATOM 9557  H HB3  . LYS A 1 30 ? 11.729  -4.199  4.023   1.00 0.00 ? 30 LYS A HB3  9  
ATOM 9558  H HG2  . LYS A 1 30 ? 11.889  -3.491  6.939   1.00 0.00 ? 30 LYS A HG2  9  
ATOM 9559  H HG3  . LYS A 1 30 ? 12.867  -2.708  5.695   1.00 0.00 ? 30 LYS A HG3  9  
ATOM 9560  H HD2  . LYS A 1 30 ? 11.023  -1.716  4.692   1.00 0.00 ? 30 LYS A HD2  9  
ATOM 9561  H HD3  . LYS A 1 30 ? 9.893   -2.875  5.395   1.00 0.00 ? 30 LYS A HD3  9  
ATOM 9562  H HE2  . LYS A 1 30 ? 11.413  -0.770  6.931   1.00 0.00 ? 30 LYS A HE2  9  
ATOM 9563  H HE3  . LYS A 1 30 ? 9.730   -0.640  6.424   1.00 0.00 ? 30 LYS A HE3  9  
ATOM 9564  H HZ1  . LYS A 1 30 ? 9.324   -2.713  7.735   1.00 0.00 ? 30 LYS A HZ1  9  
ATOM 9565  H HZ2  . LYS A 1 30 ? 9.732   -1.357  8.661   1.00 0.00 ? 30 LYS A HZ2  9  
ATOM 9566  H HZ3  . LYS A 1 30 ? 10.886  -2.558  8.366   1.00 0.00 ? 30 LYS A HZ3  9  
ATOM 9567  N N    . TYR A 1 31 ? 11.619  -7.688  5.121   1.00 0.00 ? 31 TYR A N    9  
ATOM 9568  C CA   . TYR A 1 31 ? 11.782  -8.958  4.423   1.00 0.00 ? 31 TYR A CA   9  
ATOM 9569  C C    . TYR A 1 31 ? 11.369  -10.126 5.314   1.00 0.00 ? 31 TYR A C    9  
ATOM 9570  O O    . TYR A 1 31 ? 11.025  -9.940  6.482   1.00 0.00 ? 31 TYR A O    9  
ATOM 9571  C CB   . TYR A 1 31 ? 13.234  -9.133  3.974   1.00 0.00 ? 31 TYR A CB   9  
ATOM 9572  C CG   . TYR A 1 31 ? 13.534  -8.497  2.636   1.00 0.00 ? 31 TYR A CG   9  
ATOM 9573  C CD1  . TYR A 1 31 ? 13.240  -7.160  2.398   1.00 0.00 ? 31 TYR A CD1  9  
ATOM 9574  C CD2  . TYR A 1 31 ? 14.113  -9.233  1.609   1.00 0.00 ? 31 TYR A CD2  9  
ATOM 9575  C CE1  . TYR A 1 31 ? 13.512  -6.575  1.176   1.00 0.00 ? 31 TYR A CE1  9  
ATOM 9576  C CE2  . TYR A 1 31 ? 14.391  -8.656  0.385   1.00 0.00 ? 31 TYR A CE2  9  
ATOM 9577  C CZ   . TYR A 1 31 ? 14.088  -7.327  0.173   1.00 0.00 ? 31 TYR A CZ   9  
ATOM 9578  O OH   . TYR A 1 31 ? 14.362  -6.748  -1.045  1.00 0.00 ? 31 TYR A OH   9  
ATOM 9579  H H    . TYR A 1 31 ? 12.093  -7.543  5.966   1.00 0.00 ? 31 TYR A H    9  
ATOM 9580  H HA   . TYR A 1 31 ? 11.145  -8.941  3.551   1.00 0.00 ? 31 TYR A HA   9  
ATOM 9581  H HB2  . TYR A 1 31 ? 13.887  -8.686  4.707   1.00 0.00 ? 31 TYR A HB2  9  
ATOM 9582  H HB3  . TYR A 1 31 ? 13.454  -10.188 3.897   1.00 0.00 ? 31 TYR A HB3  9  
ATOM 9583  H HD1  . TYR A 1 31 ? 12.790  -6.574  3.186   1.00 0.00 ? 31 TYR A HD1  9  
ATOM 9584  H HD2  . TYR A 1 31 ? 14.349  -10.274 1.778   1.00 0.00 ? 31 TYR A HD2  9  
ATOM 9585  H HE1  . TYR A 1 31 ? 13.276  -5.535  1.010   1.00 0.00 ? 31 TYR A HE1  9  
ATOM 9586  H HE2  . TYR A 1 31 ? 14.841  -9.244  -0.401  1.00 0.00 ? 31 TYR A HE2  9  
ATOM 9587  H HH   . TYR A 1 31 ? 14.887  -5.955  -0.911  1.00 0.00 ? 31 TYR A HH   9  
ATOM 9588  N N    . LEU A 1 32 ? 11.404  -11.330 4.753   1.00 0.00 ? 32 LEU A N    9  
ATOM 9589  C CA   . LEU A 1 32 ? 11.035  -12.530 5.495   1.00 0.00 ? 32 LEU A CA   9  
ATOM 9590  C C    . LEU A 1 32 ? 11.749  -13.757 4.937   1.00 0.00 ? 32 LEU A C    9  
ATOM 9591  O O    . LEU A 1 32 ? 11.631  -14.072 3.753   1.00 0.00 ? 32 LEU A O    9  
ATOM 9592  C CB   . LEU A 1 32 ? 9.520   -12.740 5.442   1.00 0.00 ? 32 LEU A CB   9  
ATOM 9593  C CG   . LEU A 1 32 ? 8.666   -11.614 6.025   1.00 0.00 ? 32 LEU A CG   9  
ATOM 9594  C CD1  . LEU A 1 32 ? 7.246   -11.686 5.484   1.00 0.00 ? 32 LEU A CD1  9  
ATOM 9595  C CD2  . LEU A 1 32 ? 8.663   -11.680 7.546   1.00 0.00 ? 32 LEU A CD2  9  
ATOM 9596  H H    . LEU A 1 32 ? 11.686  -11.414 3.819   1.00 0.00 ? 32 LEU A H    9  
ATOM 9597  H HA   . LEU A 1 32 ? 11.334  -12.390 6.523   1.00 0.00 ? 32 LEU A HA   9  
ATOM 9598  H HB2  . LEU A 1 32 ? 9.240   -12.865 4.407   1.00 0.00 ? 32 LEU A HB2  9  
ATOM 9599  H HB3  . LEU A 1 32 ? 9.294   -13.646 5.986   1.00 0.00 ? 32 LEU A HB3  9  
ATOM 9600  H HG   . LEU A 1 32 ? 9.086   -10.662 5.732   1.00 0.00 ? 32 LEU A HG   9  
ATOM 9601  H HD11 . LEU A 1 32 ? 7.170   -11.084 4.592   1.00 0.00 ? 32 LEU A HD11 9  
ATOM 9602  H HD12 . LEU A 1 32 ? 6.558   -11.315 6.229   1.00 0.00 ? 32 LEU A HD12 9  
ATOM 9603  H HD13 . LEU A 1 32 ? 7.002   -12.712 5.249   1.00 0.00 ? 32 LEU A HD13 9  
ATOM 9604  H HD21 . LEU A 1 32 ? 8.428   -12.686 7.861   1.00 0.00 ? 32 LEU A HD21 9  
ATOM 9605  H HD22 . LEU A 1 32 ? 7.920   -10.999 7.934   1.00 0.00 ? 32 LEU A HD22 9  
ATOM 9606  H HD23 . LEU A 1 32 ? 9.637   -11.403 7.920   1.00 0.00 ? 32 LEU A HD23 9  
ATOM 9607  N N    . SER A 1 33 ? 12.490  -14.446 5.799   1.00 0.00 ? 33 SER A N    9  
ATOM 9608  C CA   . SER A 1 33 ? 13.226  -15.638 5.392   1.00 0.00 ? 33 SER A CA   9  
ATOM 9609  C C    . SER A 1 33 ? 12.275  -16.709 4.865   1.00 0.00 ? 33 SER A C    9  
ATOM 9610  O O    . SER A 1 33 ? 11.096  -16.757 5.217   1.00 0.00 ? 33 SER A O    9  
ATOM 9611  C CB   . SER A 1 33 ? 14.034  -16.190 6.567   1.00 0.00 ? 33 SER A CB   9  
ATOM 9612  O OG   . SER A 1 33 ? 14.612  -15.142 7.326   1.00 0.00 ? 33 SER A OG   9  
ATOM 9613  H H    . SER A 1 33 ? 12.545  -14.145 6.730   1.00 0.00 ? 33 SER A H    9  
ATOM 9614  H HA   . SER A 1 33 ? 13.904  -15.355 4.601   1.00 0.00 ? 33 SER A HA   9  
ATOM 9615  H HB2  . SER A 1 33 ? 13.384  -16.766 7.209   1.00 0.00 ? 33 SER A HB2  9  
ATOM 9616  H HB3  . SER A 1 33 ? 14.824  -16.825 6.191   1.00 0.00 ? 33 SER A HB3  9  
ATOM 9617  H HG   . SER A 1 33 ? 14.929  -15.490 8.163   1.00 0.00 ? 33 SER A HG   9  
ATOM 9618  N N    . PRO A 1 34 ? 12.800  -17.591 4.001   1.00 0.00 ? 34 PRO A N    9  
ATOM 9619  C CA   . PRO A 1 34 ? 12.017  -18.678 3.407   1.00 0.00 ? 34 PRO A CA   9  
ATOM 9620  C C    . PRO A 1 34 ? 11.209  -19.447 4.447   1.00 0.00 ? 34 PRO A C    9  
ATOM 9621  O O    . PRO A 1 34 ? 10.035  -19.761 4.249   1.00 0.00 ? 34 PRO A O    9  
ATOM 9622  C CB   . PRO A 1 34 ? 13.082  -19.583 2.783   1.00 0.00 ? 34 PRO A CB   9  
ATOM 9623  C CG   . PRO A 1 34 ? 14.231  -18.677 2.503   1.00 0.00 ? 34 PRO A CG   9  
ATOM 9624  C CD   . PRO A 1 34 ? 14.197  -17.594 3.537   1.00 0.00 ? 34 PRO A CD   9  
ATOM 9625  H HA   . PRO A 1 34 ? 11.354  -18.315 2.635   1.00 0.00 ? 34 PRO A HA   9  
ATOM 9626  H HB2  . PRO A 1 34 ? 13.353  -20.361 3.483   1.00 0.00 ? 34 PRO A HB2  9  
ATOM 9627  H HB3  . PRO A 1 34 ? 12.698  -20.025 1.876   1.00 0.00 ? 34 PRO A HB3  9  
ATOM 9628  H HG2  . PRO A 1 34 ? 15.158  -19.225 2.578   1.00 0.00 ? 34 PRO A HG2  9  
ATOM 9629  H HG3  . PRO A 1 34 ? 14.127  -18.246 1.518   1.00 0.00 ? 34 PRO A HG3  9  
ATOM 9630  H HD2  . PRO A 1 34 ? 14.872  -17.830 4.347   1.00 0.00 ? 34 PRO A HD2  9  
ATOM 9631  H HD3  . PRO A 1 34 ? 14.457  -16.644 3.091   1.00 0.00 ? 34 PRO A HD3  9  
ATOM 9632  N N    . PRO A 1 35 ? 11.850  -19.757 5.584   1.00 0.00 ? 35 PRO A N    9  
ATOM 9633  C CA   . PRO A 1 35 ? 11.209  -20.491 6.679   1.00 0.00 ? 35 PRO A CA   9  
ATOM 9634  C C    . PRO A 1 35 ? 9.841   -19.921 7.038   1.00 0.00 ? 35 PRO A C    9  
ATOM 9635  O O    . PRO A 1 35 ? 8.888   -20.665 7.262   1.00 0.00 ? 35 PRO A O    9  
ATOM 9636  C CB   . PRO A 1 35 ? 12.185  -20.313 7.845   1.00 0.00 ? 35 PRO A CB   9  
ATOM 9637  C CG   . PRO A 1 35 ? 13.509  -20.090 7.199   1.00 0.00 ? 35 PRO A CG   9  
ATOM 9638  C CD   . PRO A 1 35 ? 13.249  -19.414 5.888   1.00 0.00 ? 35 PRO A CD   9  
ATOM 9639  H HA   . PRO A 1 35 ? 11.110  -21.542 6.448   1.00 0.00 ? 35 PRO A HA   9  
ATOM 9640  H HB2  . PRO A 1 35 ? 11.887  -19.462 8.441   1.00 0.00 ? 35 PRO A HB2  9  
ATOM 9641  H HB3  . PRO A 1 35 ? 12.189  -21.204 8.455   1.00 0.00 ? 35 PRO A HB3  9  
ATOM 9642  H HG2  . PRO A 1 35 ? 14.120  -19.456 7.824   1.00 0.00 ? 35 PRO A HG2  9  
ATOM 9643  H HG3  . PRO A 1 35 ? 14.000  -21.038 7.031   1.00 0.00 ? 35 PRO A HG3  9  
ATOM 9644  H HD2  . PRO A 1 35 ? 13.372  -18.346 5.989   1.00 0.00 ? 35 PRO A HD2  9  
ATOM 9645  H HD3  . PRO A 1 35 ? 13.914  -19.802 5.130   1.00 0.00 ? 35 PRO A HD3  9  
ATOM 9646  N N    . GLU A 1 36 ? 9.753   -18.595 7.089   1.00 0.00 ? 36 GLU A N    9  
ATOM 9647  C CA   . GLU A 1 36 ? 8.501   -17.926 7.421   1.00 0.00 ? 36 GLU A CA   9  
ATOM 9648  C C    . GLU A 1 36 ? 7.619   -17.777 6.185   1.00 0.00 ? 36 GLU A C    9  
ATOM 9649  O O    . GLU A 1 36 ? 6.550   -18.382 6.095   1.00 0.00 ? 36 GLU A O    9  
ATOM 9650  C CB   . GLU A 1 36 ? 8.779   -16.550 8.031   1.00 0.00 ? 36 GLU A CB   9  
ATOM 9651  C CG   . GLU A 1 36 ? 9.893   -16.556 9.064   1.00 0.00 ? 36 GLU A CG   9  
ATOM 9652  C CD   . GLU A 1 36 ? 9.385   -16.816 10.469  1.00 0.00 ? 36 GLU A CD   9  
ATOM 9653  O OE1  . GLU A 1 36 ? 8.278   -17.378 10.604  1.00 0.00 ? 36 GLU A OE1  9  
ATOM 9654  O OE2  . GLU A 1 36 ? 10.093  -16.457 11.432  1.00 0.00 ? 36 GLU A OE2  9  
ATOM 9655  H H    . GLU A 1 36 ? 10.549  -18.055 6.900   1.00 0.00 ? 36 GLU A H    9  
ATOM 9656  H HA   . GLU A 1 36 ? 7.983   -18.533 8.147   1.00 0.00 ? 36 GLU A HA   9  
ATOM 9657  H HB2  . GLU A 1 36 ? 9.052   -15.867 7.240   1.00 0.00 ? 36 GLU A HB2  9  
ATOM 9658  H HB3  . GLU A 1 36 ? 7.877   -16.193 8.507   1.00 0.00 ? 36 GLU A HB3  9  
ATOM 9659  H HG2  . GLU A 1 36 ? 10.602  -17.328 8.805   1.00 0.00 ? 36 GLU A HG2  9  
ATOM 9660  H HG3  . GLU A 1 36 ? 10.387  -15.595 9.047   1.00 0.00 ? 36 GLU A HG3  9  
ATOM 9661  N N    . ARG A 1 37 ? 8.074   -16.968 5.234   1.00 0.00 ? 37 ARG A N    9  
ATOM 9662  C CA   . ARG A 1 37 ? 7.327   -16.739 4.003   1.00 0.00 ? 37 ARG A CA   9  
ATOM 9663  C C    . ARG A 1 37 ? 6.578   -17.999 3.579   1.00 0.00 ? 37 ARG A C    9  
ATOM 9664  O O    . ARG A 1 37 ? 5.457   -17.927 3.073   1.00 0.00 ? 37 ARG A O    9  
ATOM 9665  C CB   . ARG A 1 37 ? 8.269   -16.292 2.884   1.00 0.00 ? 37 ARG A CB   9  
ATOM 9666  C CG   . ARG A 1 37 ? 7.565   -15.574 1.745   1.00 0.00 ? 37 ARG A CG   9  
ATOM 9667  C CD   . ARG A 1 37 ? 8.374   -15.643 0.459   1.00 0.00 ? 37 ARG A CD   9  
ATOM 9668  N NE   . ARG A 1 37 ? 8.707   -17.017 0.094   1.00 0.00 ? 37 ARG A NE   9  
ATOM 9669  C CZ   . ARG A 1 37 ? 9.428   -17.340 -0.974  1.00 0.00 ? 37 ARG A CZ   9  
ATOM 9670  N NH1  . ARG A 1 37 ? 9.889   -16.392 -1.778  1.00 0.00 ? 37 ARG A NH1  9  
ATOM 9671  N NH2  . ARG A 1 37 ? 9.689   -18.613 -1.239  1.00 0.00 ? 37 ARG A NH2  9  
ATOM 9672  H H    . ARG A 1 37 ? 8.933   -16.514 5.363   1.00 0.00 ? 37 ARG A H    9  
ATOM 9673  H HA   . ARG A 1 37 ? 6.609   -15.954 4.192   1.00 0.00 ? 37 ARG A HA   9  
ATOM 9674  H HB2  . ARG A 1 37 ? 9.010   -15.623 3.298   1.00 0.00 ? 37 ARG A HB2  9  
ATOM 9675  H HB3  . ARG A 1 37 ? 8.767   -17.161 2.481   1.00 0.00 ? 37 ARG A HB3  9  
ATOM 9676  H HG2  . ARG A 1 37 ? 6.604   -16.039 1.578   1.00 0.00 ? 37 ARG A HG2  9  
ATOM 9677  H HG3  . ARG A 1 37 ? 7.424   -14.539 2.017   1.00 0.00 ? 37 ARG A HG3  9  
ATOM 9678  H HD2  . ARG A 1 37 ? 7.796   -15.199 -0.338  1.00 0.00 ? 37 ARG A HD2  9  
ATOM 9679  H HD3  . ARG A 1 37 ? 9.287   -15.084 0.594   1.00 0.00 ? 37 ARG A HD3  9  
ATOM 9680  H HE   . ARG A 1 37 ? 8.376   -17.733 0.675   1.00 0.00 ? 37 ARG A HE   9  
ATOM 9681  H HH11 . ARG A 1 37 ? 9.694   -15.431 -1.580  1.00 0.00 ? 37 ARG A HH11 9  
ATOM 9682  H HH12 . ARG A 1 37 ? 10.433  -16.637 -2.581  1.00 0.00 ? 37 ARG A HH12 9  
ATOM 9683  H HH21 . ARG A 1 37 ? 9.344   -19.331 -0.635  1.00 0.00 ? 37 ARG A HH21 9  
ATOM 9684  H HH22 . ARG A 1 37 ? 10.232  -18.855 -2.043  1.00 0.00 ? 37 ARG A HH22 9  
ATOM 9685  N N    . LYS A 1 38 ? 7.204   -19.152 3.788   1.00 0.00 ? 38 LYS A N    9  
ATOM 9686  C CA   . LYS A 1 38 ? 6.598   -20.428 3.429   1.00 0.00 ? 38 LYS A CA   9  
ATOM 9687  C C    . LYS A 1 38 ? 5.344   -20.688 4.258   1.00 0.00 ? 38 LYS A C    9  
ATOM 9688  O O    . LYS A 1 38 ? 4.292   -21.033 3.719   1.00 0.00 ? 38 LYS A O    9  
ATOM 9689  C CB   . LYS A 1 38 ? 7.600   -21.567 3.630   1.00 0.00 ? 38 LYS A CB   9  
ATOM 9690  C CG   . LYS A 1 38 ? 8.614   -21.691 2.506   1.00 0.00 ? 38 LYS A CG   9  
ATOM 9691  C CD   . LYS A 1 38 ? 9.847   -22.459 2.949   1.00 0.00 ? 38 LYS A CD   9  
ATOM 9692  C CE   . LYS A 1 38 ? 9.544   -23.937 3.143   1.00 0.00 ? 38 LYS A CE   9  
ATOM 9693  N NZ   . LYS A 1 38 ? 9.058   -24.228 4.520   1.00 0.00 ? 38 LYS A NZ   9  
ATOM 9694  H H    . LYS A 1 38 ? 8.096   -19.144 4.195   1.00 0.00 ? 38 LYS A H    9  
ATOM 9695  H HA   . LYS A 1 38 ? 6.322   -20.383 2.386   1.00 0.00 ? 38 LYS A HA   9  
ATOM 9696  H HB2  . LYS A 1 38 ? 8.136   -21.400 4.553   1.00 0.00 ? 38 LYS A HB2  9  
ATOM 9697  H HB3  . LYS A 1 38 ? 7.058   -22.499 3.703   1.00 0.00 ? 38 LYS A HB3  9  
ATOM 9698  H HG2  . LYS A 1 38 ? 8.157   -22.212 1.677   1.00 0.00 ? 38 LYS A HG2  9  
ATOM 9699  H HG3  . LYS A 1 38 ? 8.911   -20.701 2.191   1.00 0.00 ? 38 LYS A HG3  9  
ATOM 9700  H HD2  . LYS A 1 38 ? 10.615  -22.357 2.197   1.00 0.00 ? 38 LYS A HD2  9  
ATOM 9701  H HD3  . LYS A 1 38 ? 10.200  -22.048 3.885   1.00 0.00 ? 38 LYS A HD3  9  
ATOM 9702  H HE2  . LYS A 1 38 ? 8.785   -24.231 2.433   1.00 0.00 ? 38 LYS A HE2  9  
ATOM 9703  H HE3  . LYS A 1 38 ? 10.445  -24.503 2.961   1.00 0.00 ? 38 LYS A HE3  9  
ATOM 9704  H HZ1  . LYS A 1 38 ? 9.798   -24.001 5.215   1.00 0.00 ? 38 LYS A HZ1  9  
ATOM 9705  H HZ2  . LYS A 1 38 ? 8.814   -25.235 4.607   1.00 0.00 ? 38 LYS A HZ2  9  
ATOM 9706  H HZ3  . LYS A 1 38 ? 8.214   -23.658 4.730   1.00 0.00 ? 38 LYS A HZ3  9  
ATOM 9707  N N    . ARG A 1 39 ? 5.463   -20.518 5.571   1.00 0.00 ? 39 ARG A N    9  
ATOM 9708  C CA   . ARG A 1 39 ? 4.339   -20.734 6.474   1.00 0.00 ? 39 ARG A CA   9  
ATOM 9709  C C    . ARG A 1 39 ? 3.277   -19.653 6.289   1.00 0.00 ? 39 ARG A C    9  
ATOM 9710  O O    . ARG A 1 39 ? 2.078   -19.934 6.318   1.00 0.00 ? 39 ARG A O    9  
ATOM 9711  C CB   . ARG A 1 39 ? 4.819   -20.749 7.926   1.00 0.00 ? 39 ARG A CB   9  
ATOM 9712  C CG   . ARG A 1 39 ? 4.792   -19.382 8.591   1.00 0.00 ? 39 ARG A CG   9  
ATOM 9713  C CD   . ARG A 1 39 ? 5.675   -19.346 9.828   1.00 0.00 ? 39 ARG A CD   9  
ATOM 9714  N NE   . ARG A 1 39 ? 5.073   -20.062 10.951  1.00 0.00 ? 39 ARG A NE   9  
ATOM 9715  C CZ   . ARG A 1 39 ? 5.654   -20.186 12.139  1.00 0.00 ? 39 ARG A CZ   9  
ATOM 9716  N NH1  . ARG A 1 39 ? 6.845   -19.646 12.358  1.00 0.00 ? 39 ARG A NH1  9  
ATOM 9717  N NH2  . ARG A 1 39 ? 5.043   -20.852 13.110  1.00 0.00 ? 39 ARG A NH2  9  
ATOM 9718  H H    . ARG A 1 39 ? 6.327   -20.242 5.941   1.00 0.00 ? 39 ARG A H    9  
ATOM 9719  H HA   . ARG A 1 39 ? 3.903   -21.694 6.238   1.00 0.00 ? 39 ARG A HA   9  
ATOM 9720  H HB2  . ARG A 1 39 ? 4.187   -21.414 8.496   1.00 0.00 ? 39 ARG A HB2  9  
ATOM 9721  H HB3  . ARG A 1 39 ? 5.833   -21.118 7.953   1.00 0.00 ? 39 ARG A HB3  9  
ATOM 9722  H HG2  . ARG A 1 39 ? 5.147   -18.643 7.888   1.00 0.00 ? 39 ARG A HG2  9  
ATOM 9723  H HG3  . ARG A 1 39 ? 3.776   -19.152 8.876   1.00 0.00 ? 39 ARG A HG3  9  
ATOM 9724  H HD2  . ARG A 1 39 ? 6.624   -19.803 9.590   1.00 0.00 ? 39 ARG A HD2  9  
ATOM 9725  H HD3  . ARG A 1 39 ? 5.832   -18.317 10.112  1.00 0.00 ? 39 ARG A HD3  9  
ATOM 9726  H HE   . ARG A 1 39 ? 4.193   -20.468 10.810  1.00 0.00 ? 39 ARG A HE   9  
ATOM 9727  H HH11 . ARG A 1 39 ? 7.307   -19.143 11.628  1.00 0.00 ? 39 ARG A HH11 9  
ATOM 9728  H HH12 . ARG A 1 39 ? 7.279   -19.741 13.254  1.00 0.00 ? 39 ARG A HH12 9  
ATOM 9729  H HH21 . ARG A 1 39 ? 4.145   -21.260 12.949  1.00 0.00 ? 39 ARG A HH21 9  
ATOM 9730  H HH22 . ARG A 1 39 ? 5.481   -20.946 14.004  1.00 0.00 ? 39 ARG A HH22 9  
ATOM 9731  N N    . LEU A 1 40 ? 3.726   -18.417 6.100   1.00 0.00 ? 40 LEU A N    9  
ATOM 9732  C CA   . LEU A 1 40 ? 2.815   -17.294 5.910   1.00 0.00 ? 40 LEU A CA   9  
ATOM 9733  C C    . LEU A 1 40 ? 1.845   -17.566 4.765   1.00 0.00 ? 40 LEU A C    9  
ATOM 9734  O O    . LEU A 1 40 ? 0.629   -17.474 4.933   1.00 0.00 ? 40 LEU A O    9  
ATOM 9735  C CB   . LEU A 1 40 ? 3.605   -16.013 5.631   1.00 0.00 ? 40 LEU A CB   9  
ATOM 9736  C CG   . LEU A 1 40 ? 2.891   -14.701 5.956   1.00 0.00 ? 40 LEU A CG   9  
ATOM 9737  C CD1  . LEU A 1 40 ? 2.605   -14.603 7.446   1.00 0.00 ? 40 LEU A CD1  9  
ATOM 9738  C CD2  . LEU A 1 40 ? 3.721   -13.513 5.491   1.00 0.00 ? 40 LEU A CD2  9  
ATOM 9739  H H    . LEU A 1 40 ? 4.692   -18.256 6.086   1.00 0.00 ? 40 LEU A H    9  
ATOM 9740  H HA   . LEU A 1 40 ? 2.251   -17.167 6.822   1.00 0.00 ? 40 LEU A HA   9  
ATOM 9741  H HB2  . LEU A 1 40 ? 4.511   -16.050 6.216   1.00 0.00 ? 40 LEU A HB2  9  
ATOM 9742  H HB3  . LEU A 1 40 ? 3.856   -16.003 4.580   1.00 0.00 ? 40 LEU A HB3  9  
ATOM 9743  H HG   . LEU A 1 40 ? 1.945   -14.674 5.433   1.00 0.00 ? 40 LEU A HG   9  
ATOM 9744  H HD11 . LEU A 1 40 ? 3.523   -14.738 7.999   1.00 0.00 ? 40 LEU A HD11 9  
ATOM 9745  H HD12 . LEU A 1 40 ? 1.899   -15.369 7.729   1.00 0.00 ? 40 LEU A HD12 9  
ATOM 9746  H HD13 . LEU A 1 40 ? 2.190   -13.631 7.670   1.00 0.00 ? 40 LEU A HD13 9  
ATOM 9747  H HD21 . LEU A 1 40 ? 4.062   -12.954 6.350   1.00 0.00 ? 40 LEU A HD21 9  
ATOM 9748  H HD22 . LEU A 1 40 ? 3.116   -12.875 4.863   1.00 0.00 ? 40 LEU A HD22 9  
ATOM 9749  H HD23 . LEU A 1 40 ? 4.574   -13.867 4.931   1.00 0.00 ? 40 LEU A HD23 9  
ATOM 9750  N N    . ALA A 1 41 ? 2.391   -17.903 3.601   1.00 0.00 ? 41 ALA A N    9  
ATOM 9751  C CA   . ALA A 1 41 ? 1.574   -18.193 2.430   1.00 0.00 ? 41 ALA A CA   9  
ATOM 9752  C C    . ALA A 1 41 ? 0.490   -19.215 2.756   1.00 0.00 ? 41 ALA A C    9  
ATOM 9753  O O    . ALA A 1 41 ? -0.559  -19.251 2.111   1.00 0.00 ? 41 ALA A O    9  
ATOM 9754  C CB   . ALA A 1 41 ? 2.447   -18.693 1.288   1.00 0.00 ? 41 ALA A CB   9  
ATOM 9755  H H    . ALA A 1 41 ? 3.367   -17.960 3.530   1.00 0.00 ? 41 ALA A H    9  
ATOM 9756  H HA   . ALA A 1 41 ? 1.104   -17.273 2.115   1.00 0.00 ? 41 ALA A HA   9  
ATOM 9757  H HB1  . ALA A 1 41 ? 2.010   -19.587 0.867   1.00 0.00 ? 41 ALA A HB1  9  
ATOM 9758  H HB2  . ALA A 1 41 ? 2.513   -17.931 0.526   1.00 0.00 ? 41 ALA A HB2  9  
ATOM 9759  H HB3  . ALA A 1 41 ? 3.435   -18.916 1.662   1.00 0.00 ? 41 ALA A HB3  9  
ATOM 9760  N N    . LYS A 1 42 ? 0.749   -20.046 3.760   1.00 0.00 ? 42 LYS A N    9  
ATOM 9761  C CA   . LYS A 1 42 ? -0.204  -21.069 4.173   1.00 0.00 ? 42 LYS A CA   9  
ATOM 9762  C C    . LYS A 1 42 ? -1.141  -20.536 5.252   1.00 0.00 ? 42 LYS A C    9  
ATOM 9763  O O    . LYS A 1 42 ? -2.281  -20.983 5.373   1.00 0.00 ? 42 LYS A O    9  
ATOM 9764  C CB   . LYS A 1 42 ? 0.535   -22.305 4.689   1.00 0.00 ? 42 LYS A CB   9  
ATOM 9765  C CG   . LYS A 1 42 ? -0.284  -23.582 4.608   1.00 0.00 ? 42 LYS A CG   9  
ATOM 9766  C CD   . LYS A 1 42 ? 0.541   -24.799 4.990   1.00 0.00 ? 42 LYS A CD   9  
ATOM 9767  C CE   . LYS A 1 42 ? -0.194  -26.092 4.674   1.00 0.00 ? 42 LYS A CE   9  
ATOM 9768  N NZ   . LYS A 1 42 ? 0.335   -27.238 5.465   1.00 0.00 ? 42 LYS A NZ   9  
ATOM 9769  H H    . LYS A 1 42 ? 1.603   -19.968 4.236   1.00 0.00 ? 42 LYS A H    9  
ATOM 9770  H HA   . LYS A 1 42 ? -0.790  -21.345 3.309   1.00 0.00 ? 42 LYS A HA   9  
ATOM 9771  H HB2  . LYS A 1 42 ? 1.435   -22.442 4.107   1.00 0.00 ? 42 LYS A HB2  9  
ATOM 9772  H HB3  . LYS A 1 42 ? 0.807   -22.142 5.722   1.00 0.00 ? 42 LYS A HB3  9  
ATOM 9773  H HG2  . LYS A 1 42 ? -1.124  -23.504 5.283   1.00 0.00 ? 42 LYS A HG2  9  
ATOM 9774  H HG3  . LYS A 1 42 ? -0.643  -23.704 3.596   1.00 0.00 ? 42 LYS A HG3  9  
ATOM 9775  H HD2  . LYS A 1 42 ? 1.469   -24.782 4.438   1.00 0.00 ? 42 LYS A HD2  9  
ATOM 9776  H HD3  . LYS A 1 42 ? 0.750   -24.763 6.050   1.00 0.00 ? 42 LYS A HD3  9  
ATOM 9777  H HE2  . LYS A 1 42 ? -1.241  -25.961 4.902   1.00 0.00 ? 42 LYS A HE2  9  
ATOM 9778  H HE3  . LYS A 1 42 ? -0.079  -26.308 3.622   1.00 0.00 ? 42 LYS A HE3  9  
ATOM 9779  H HZ1  . LYS A 1 42 ? 0.151   -28.132 4.965   1.00 0.00 ? 42 LYS A HZ1  9  
ATOM 9780  H HZ2  . LYS A 1 42 ? -0.128  -27.274 6.396   1.00 0.00 ? 42 LYS A HZ2  9  
ATOM 9781  H HZ3  . LYS A 1 42 ? 1.360   -27.135 5.603   1.00 0.00 ? 42 LYS A HZ3  9  
ATOM 9782  N N    . MET A 1 43 ? -0.653  -19.577 6.032   1.00 0.00 ? 43 MET A N    9  
ATOM 9783  C CA   . MET A 1 43 ? -1.449  -18.981 7.099   1.00 0.00 ? 43 MET A CA   9  
ATOM 9784  C C    . MET A 1 43 ? -2.485  -18.017 6.531   1.00 0.00 ? 43 MET A C    9  
ATOM 9785  O O    . MET A 1 43 ? -3.654  -18.047 6.918   1.00 0.00 ? 43 MET A O    9  
ATOM 9786  C CB   . MET A 1 43 ? -0.544  -18.249 8.092   1.00 0.00 ? 43 MET A CB   9  
ATOM 9787  C CG   . MET A 1 43 ? -1.288  -17.273 8.987   1.00 0.00 ? 43 MET A CG   9  
ATOM 9788  S SD   . MET A 1 43 ? -0.435  -16.972 10.547  1.00 0.00 ? 43 MET A SD   9  
ATOM 9789  C CE   . MET A 1 43 ? 0.153   -15.299 10.294  1.00 0.00 ? 43 MET A CE   9  
ATOM 9790  H H    . MET A 1 43 ? 0.264   -19.262 5.887   1.00 0.00 ? 43 MET A H    9  
ATOM 9791  H HA   . MET A 1 43 ? -1.962  -19.780 7.615   1.00 0.00 ? 43 MET A HA   9  
ATOM 9792  H HB2  . MET A 1 43 ? -0.054  -18.979 8.719   1.00 0.00 ? 43 MET A HB2  9  
ATOM 9793  H HB3  . MET A 1 43 ? 0.205   -17.699 7.541   1.00 0.00 ? 43 MET A HB3  9  
ATOM 9794  H HG2  . MET A 1 43 ? -1.394  -16.334 8.465   1.00 0.00 ? 43 MET A HG2  9  
ATOM 9795  H HG3  . MET A 1 43 ? -2.268  -17.676 9.200   1.00 0.00 ? 43 MET A HG3  9  
ATOM 9796  H HE1  . MET A 1 43 ? 1.036   -15.134 10.893  1.00 0.00 ? 43 MET A HE1  9  
ATOM 9797  H HE2  . MET A 1 43 ? 0.393   -15.157 9.251   1.00 0.00 ? 43 MET A HE2  9  
ATOM 9798  H HE3  . MET A 1 43 ? -0.617  -14.599 10.586  1.00 0.00 ? 43 MET A HE3  9  
ATOM 9799  N N    . LEU A 1 44 ? -2.050  -17.162 5.612   1.00 0.00 ? 44 LEU A N    9  
ATOM 9800  C CA   . LEU A 1 44 ? -2.940  -16.188 4.990   1.00 0.00 ? 44 LEU A CA   9  
ATOM 9801  C C    . LEU A 1 44 ? -3.613  -16.776 3.754   1.00 0.00 ? 44 LEU A C    9  
ATOM 9802  O O    . LEU A 1 44 ? -4.416  -16.113 3.099   1.00 0.00 ? 44 LEU A O    9  
ATOM 9803  C CB   . LEU A 1 44 ? -2.162  -14.927 4.610   1.00 0.00 ? 44 LEU A CB   9  
ATOM 9804  C CG   . LEU A 1 44 ? -1.336  -14.286 5.726   1.00 0.00 ? 44 LEU A CG   9  
ATOM 9805  C CD1  . LEU A 1 44 ? -0.367  -13.264 5.153   1.00 0.00 ? 44 LEU A CD1  9  
ATOM 9806  C CD2  . LEU A 1 44 ? -2.247  -13.638 6.759   1.00 0.00 ? 44 LEU A CD2  9  
ATOM 9807  H H    . LEU A 1 44 ? -1.108  -17.186 5.344   1.00 0.00 ? 44 LEU A H    9  
ATOM 9808  H HA   . LEU A 1 44 ? -3.701  -15.928 5.711   1.00 0.00 ? 44 LEU A HA   9  
ATOM 9809  H HB2  . LEU A 1 44 ? -1.489  -15.183 3.807   1.00 0.00 ? 44 LEU A HB2  9  
ATOM 9810  H HB3  . LEU A 1 44 ? -2.875  -14.193 4.261   1.00 0.00 ? 44 LEU A HB3  9  
ATOM 9811  H HG   . LEU A 1 44 ? -0.758  -15.052 6.223   1.00 0.00 ? 44 LEU A HG   9  
ATOM 9812  H HD11 . LEU A 1 44 ? 0.465   -13.139 5.829   1.00 0.00 ? 44 LEU A HD11 9  
ATOM 9813  H HD12 . LEU A 1 44 ? -0.873  -12.319 5.026   1.00 0.00 ? 44 LEU A HD12 9  
ATOM 9814  H HD13 . LEU A 1 44 ? -0.005  -13.609 4.195   1.00 0.00 ? 44 LEU A HD13 9  
ATOM 9815  H HD21 . LEU A 1 44 ? -3.207  -13.429 6.311   1.00 0.00 ? 44 LEU A HD21 9  
ATOM 9816  H HD22 . LEU A 1 44 ? -1.802  -12.716 7.103   1.00 0.00 ? 44 LEU A HD22 9  
ATOM 9817  H HD23 . LEU A 1 44 ? -2.378  -14.309 7.595   1.00 0.00 ? 44 LEU A HD23 9  
ATOM 9818  N N    . GLN A 1 45 ? -3.280  -18.025 3.443   1.00 0.00 ? 45 GLN A N    9  
ATOM 9819  C CA   . GLN A 1 45 ? -3.854  -18.702 2.287   1.00 0.00 ? 45 GLN A CA   9  
ATOM 9820  C C    . GLN A 1 45 ? -3.410  -18.035 0.989   1.00 0.00 ? 45 GLN A C    9  
ATOM 9821  O O    . GLN A 1 45 ? -4.161  -17.988 0.014   1.00 0.00 ? 45 GLN A O    9  
ATOM 9822  C CB   . GLN A 1 45 ? -5.381  -18.704 2.376   1.00 0.00 ? 45 GLN A CB   9  
ATOM 9823  C CG   . GLN A 1 45 ? -5.912  -19.225 3.702   1.00 0.00 ? 45 GLN A CG   9  
ATOM 9824  C CD   . GLN A 1 45 ? -7.327  -18.760 3.987   1.00 0.00 ? 45 GLN A CD   9  
ATOM 9825  O OE1  . GLN A 1 45 ? -8.160  -18.680 3.084   1.00 0.00 ? 45 GLN A OE1  9  
ATOM 9826  N NE2  . GLN A 1 45 ? -7.605  -18.450 5.248   1.00 0.00 ? 45 GLN A NE2  9  
ATOM 9827  H H    . GLN A 1 45 ? -2.634  -18.501 4.005   1.00 0.00 ? 45 GLN A H    9  
ATOM 9828  H HA   . GLN A 1 45 ? -3.501  -19.722 2.291   1.00 0.00 ? 45 GLN A HA   9  
ATOM 9829  H HB2  . GLN A 1 45 ? -5.739  -17.695 2.241   1.00 0.00 ? 45 GLN A HB2  9  
ATOM 9830  H HB3  . GLN A 1 45 ? -5.775  -19.327 1.586   1.00 0.00 ? 45 GLN A HB3  9  
ATOM 9831  H HG2  . GLN A 1 45 ? -5.903  -20.305 3.680   1.00 0.00 ? 45 GLN A HG2  9  
ATOM 9832  H HG3  . GLN A 1 45 ? -5.267  -18.876 4.495   1.00 0.00 ? 45 GLN A HG3  9  
ATOM 9833  H HE21 . GLN A 1 45 ? -6.891  -18.537 5.914   1.00 0.00 ? 45 GLN A HE21 9  
ATOM 9834  H HE22 . GLN A 1 45 ? -8.511  -18.146 5.460   1.00 0.00 ? 45 GLN A HE22 9  
ATOM 9835  N N    . LEU A 1 46 ? -2.186  -17.519 0.984   1.00 0.00 ? 46 LEU A N    9  
ATOM 9836  C CA   . LEU A 1 46 ? -1.641  -16.853 -0.194  1.00 0.00 ? 46 LEU A CA   9  
ATOM 9837  C C    . LEU A 1 46 ? -0.529  -17.686 -0.825  1.00 0.00 ? 46 LEU A C    9  
ATOM 9838  O O    . LEU A 1 46 ? -0.211  -18.776 -0.350  1.00 0.00 ? 46 LEU A O    9  
ATOM 9839  C CB   . LEU A 1 46 ? -1.107  -15.469 0.180   1.00 0.00 ? 46 LEU A CB   9  
ATOM 9840  C CG   . LEU A 1 46 ? -2.102  -14.526 0.857   1.00 0.00 ? 46 LEU A CG   9  
ATOM 9841  C CD1  . LEU A 1 46 ? -1.371  -13.383 1.544   1.00 0.00 ? 46 LEU A CD1  9  
ATOM 9842  C CD2  . LEU A 1 46 ? -3.103  -13.990 -0.156  1.00 0.00 ? 46 LEU A CD2  9  
ATOM 9843  H H    . LEU A 1 46 ? -1.634  -17.587 1.791   1.00 0.00 ? 46 LEU A H    9  
ATOM 9844  H HA   . LEU A 1 46 ? -2.441  -16.741 -0.910  1.00 0.00 ? 46 LEU A HA   9  
ATOM 9845  H HB2  . LEU A 1 46 ? -0.273  -15.606 0.850   1.00 0.00 ? 46 LEU A HB2  9  
ATOM 9846  H HB3  . LEU A 1 46 ? -0.763  -14.993 -0.728  1.00 0.00 ? 46 LEU A HB3  9  
ATOM 9847  H HG   . LEU A 1 46 ? -2.650  -15.073 1.612   1.00 0.00 ? 46 LEU A HG   9  
ATOM 9848  H HD11 . LEU A 1 46 ? -0.354  -13.680 1.752   1.00 0.00 ? 46 LEU A HD11 9  
ATOM 9849  H HD12 . LEU A 1 46 ? -1.872  -13.141 2.470   1.00 0.00 ? 46 LEU A HD12 9  
ATOM 9850  H HD13 . LEU A 1 46 ? -1.370  -12.517 0.898   1.00 0.00 ? 46 LEU A HD13 9  
ATOM 9851  H HD21 . LEU A 1 46 ? -2.580  -13.687 -1.051  1.00 0.00 ? 46 LEU A HD21 9  
ATOM 9852  H HD22 . LEU A 1 46 ? -3.619  -13.139 0.264   1.00 0.00 ? 46 LEU A HD22 9  
ATOM 9853  H HD23 . LEU A 1 46 ? -3.817  -14.761 -0.400  1.00 0.00 ? 46 LEU A HD23 9  
ATOM 9854  N N    . SER A 1 47 ? 0.058   -17.164 -1.896  1.00 0.00 ? 47 SER A N    9  
ATOM 9855  C CA   . SER A 1 47 ? 1.133   -17.861 -2.594  1.00 0.00 ? 47 SER A CA   9  
ATOM 9856  C C    . SER A 1 47 ? 2.490   -17.264 -2.233  1.00 0.00 ? 47 SER A C    9  
ATOM 9857  O O    . SER A 1 47 ? 2.655   -16.045 -2.202  1.00 0.00 ? 47 SER A O    9  
ATOM 9858  C CB   . SER A 1 47 ? 0.918   -17.790 -4.107  1.00 0.00 ? 47 SER A CB   9  
ATOM 9859  O OG   . SER A 1 47 ? 1.351   -16.544 -4.626  1.00 0.00 ? 47 SER A OG   9  
ATOM 9860  H H    . SER A 1 47 ? -0.240  -16.291 -2.227  1.00 0.00 ? 47 SER A H    9  
ATOM 9861  H HA   . SER A 1 47 ? 1.114   -18.895 -2.284  1.00 0.00 ? 47 SER A HA   9  
ATOM 9862  H HB2  . SER A 1 47 ? 1.478   -18.579 -4.585  1.00 0.00 ? 47 SER A HB2  9  
ATOM 9863  H HB3  . SER A 1 47 ? -0.133  -17.912 -4.324  1.00 0.00 ? 47 SER A HB3  9  
ATOM 9864  H HG   . SER A 1 47 ? 1.072   -16.464 -5.541  1.00 0.00 ? 47 SER A HG   9  
ATOM 9865  N N    . GLU A 1 48 ? 3.459   -18.133 -1.961  1.00 0.00 ? 48 GLU A N    9  
ATOM 9866  C CA   . GLU A 1 48 ? 4.802   -17.693 -1.602  1.00 0.00 ? 48 GLU A CA   9  
ATOM 9867  C C    . GLU A 1 48 ? 5.265   -16.561 -2.515  1.00 0.00 ? 48 GLU A C    9  
ATOM 9868  O O    . GLU A 1 48 ? 5.997   -15.667 -2.090  1.00 0.00 ? 48 GLU A O    9  
ATOM 9869  C CB   . GLU A 1 48 ? 5.785   -18.862 -1.681  1.00 0.00 ? 48 GLU A CB   9  
ATOM 9870  C CG   . GLU A 1 48 ? 5.561   -19.919 -0.613  1.00 0.00 ? 48 GLU A CG   9  
ATOM 9871  C CD   . GLU A 1 48 ? 4.576   -20.988 -1.046  1.00 0.00 ? 48 GLU A CD   9  
ATOM 9872  O OE1  . GLU A 1 48 ? 4.979   -21.889 -1.811  1.00 0.00 ? 48 GLU A OE1  9  
ATOM 9873  O OE2  . GLU A 1 48 ? 3.404   -20.923 -0.622  1.00 0.00 ? 48 GLU A OE2  9  
ATOM 9874  H H    . GLU A 1 48 ? 3.266   -19.093 -2.003  1.00 0.00 ? 48 GLU A H    9  
ATOM 9875  H HA   . GLU A 1 48 ? 4.770   -17.329 -0.586  1.00 0.00 ? 48 GLU A HA   9  
ATOM 9876  H HB2  . GLU A 1 48 ? 5.689   -19.332 -2.649  1.00 0.00 ? 48 GLU A HB2  9  
ATOM 9877  H HB3  . GLU A 1 48 ? 6.789   -18.480 -1.575  1.00 0.00 ? 48 GLU A HB3  9  
ATOM 9878  H HG2  . GLU A 1 48 ? 6.505   -20.391 -0.388  1.00 0.00 ? 48 GLU A HG2  9  
ATOM 9879  H HG3  . GLU A 1 48 ? 5.180   -19.439 0.276   1.00 0.00 ? 48 GLU A HG3  9  
ATOM 9880  N N    . ARG A 1 49 ? 4.834   -16.608 -3.771  1.00 0.00 ? 49 ARG A N    9  
ATOM 9881  C CA   . ARG A 1 49 ? 5.206   -15.589 -4.745  1.00 0.00 ? 49 ARG A CA   9  
ATOM 9882  C C    . ARG A 1 49 ? 4.485   -14.275 -4.460  1.00 0.00 ? 49 ARG A C    9  
ATOM 9883  O O    . ARG A 1 49 ? 5.040   -13.195 -4.662  1.00 0.00 ? 49 ARG A O    9  
ATOM 9884  C CB   . ARG A 1 49 ? 4.880   -16.064 -6.162  1.00 0.00 ? 49 ARG A CB   9  
ATOM 9885  C CG   . ARG A 1 49 ? 5.221   -15.048 -7.239  1.00 0.00 ? 49 ARG A CG   9  
ATOM 9886  C CD   . ARG A 1 49 ? 5.542   -15.724 -8.563  1.00 0.00 ? 49 ARG A CD   9  
ATOM 9887  N NE   . ARG A 1 49 ? 5.774   -14.755 -9.631  1.00 0.00 ? 49 ARG A NE   9  
ATOM 9888  C CZ   . ARG A 1 49 ? 5.644   -15.040 -10.922 1.00 0.00 ? 49 ARG A CZ   9  
ATOM 9889  N NH1  . ARG A 1 49 ? 5.286   -16.258 -11.303 1.00 0.00 ? 49 ARG A NH1  9  
ATOM 9890  N NH2  . ARG A 1 49 ? 5.872   -14.104 -11.835 1.00 0.00 ? 49 ARG A NH2  9  
ATOM 9891  H H    . ARG A 1 49 ? 4.253   -17.346 -4.050  1.00 0.00 ? 49 ARG A H    9  
ATOM 9892  H HA   . ARG A 1 49 ? 6.270   -15.426 -4.665  1.00 0.00 ? 49 ARG A HA   9  
ATOM 9893  H HB2  . ARG A 1 49 ? 5.437   -16.968 -6.363  1.00 0.00 ? 49 ARG A HB2  9  
ATOM 9894  H HB3  . ARG A 1 49 ? 3.824   -16.280 -6.223  1.00 0.00 ? 49 ARG A HB3  9  
ATOM 9895  H HG2  . ARG A 1 49 ? 4.377   -14.389 -7.380  1.00 0.00 ? 49 ARG A HG2  9  
ATOM 9896  H HG3  . ARG A 1 49 ? 6.079   -14.474 -6.921  1.00 0.00 ? 49 ARG A HG3  9  
ATOM 9897  H HD2  . ARG A 1 49 ? 6.429   -16.327 -8.438  1.00 0.00 ? 49 ARG A HD2  9  
ATOM 9898  H HD3  . ARG A 1 49 ? 4.713   -16.358 -8.838  1.00 0.00 ? 49 ARG A HD3  9  
ATOM 9899  H HE   . ARG A 1 49 ? 6.039   -13.849 -9.372  1.00 0.00 ? 49 ARG A HE   9  
ATOM 9900  H HH11 . ARG A 1 49 ? 5.113   -16.965 -10.617 1.00 0.00 ? 49 ARG A HH11 9  
ATOM 9901  H HH12 . ARG A 1 49 ? 5.188   -16.470 -12.276 1.00 0.00 ? 49 ARG A HH12 9  
ATOM 9902  H HH21 . ARG A 1 49 ? 6.142   -13.185 -11.551 1.00 0.00 ? 49 ARG A HH21 9  
ATOM 9903  H HH22 . ARG A 1 49 ? 5.774   -14.319 -12.806 1.00 0.00 ? 49 ARG A HH22 9  
ATOM 9904  N N    . GLN A 1 50 ? 3.246   -14.376 -3.990  1.00 0.00 ? 50 GLN A N    9  
ATOM 9905  C CA   . GLN A 1 50 ? 2.448   -13.196 -3.678  1.00 0.00 ? 50 GLN A CA   9  
ATOM 9906  C C    . GLN A 1 50 ? 2.991   -12.483 -2.443  1.00 0.00 ? 50 GLN A C    9  
ATOM 9907  O O    . GLN A 1 50 ? 2.865   -11.266 -2.311  1.00 0.00 ? 50 GLN A O    9  
ATOM 9908  C CB   . GLN A 1 50 ? 0.986   -13.586 -3.455  1.00 0.00 ? 50 GLN A CB   9  
ATOM 9909  C CG   . GLN A 1 50 ? 0.157   -13.588 -4.729  1.00 0.00 ? 50 GLN A CG   9  
ATOM 9910  C CD   . GLN A 1 50 ? -1.326  -13.757 -4.460  1.00 0.00 ? 50 GLN A CD   9  
ATOM 9911  O OE1  . GLN A 1 50 ? -2.058  -12.777 -4.317  1.00 0.00 ? 50 GLN A OE1  9  
ATOM 9912  N NE2  . GLN A 1 50 ? -1.777  -15.004 -4.389  1.00 0.00 ? 50 GLN A NE2  9  
ATOM 9913  H H    . GLN A 1 50 ? 2.858   -15.265 -3.850  1.00 0.00 ? 50 GLN A H    9  
ATOM 9914  H HA   . GLN A 1 50 ? 2.508   -12.524 -4.521  1.00 0.00 ? 50 GLN A HA   9  
ATOM 9915  H HB2  . GLN A 1 50 ? 0.952   -14.576 -3.026  1.00 0.00 ? 50 GLN A HB2  9  
ATOM 9916  H HB3  . GLN A 1 50 ? 0.541   -12.887 -2.763  1.00 0.00 ? 50 GLN A HB3  9  
ATOM 9917  H HG2  . GLN A 1 50 ? 0.308   -12.652 -5.245  1.00 0.00 ? 50 GLN A HG2  9  
ATOM 9918  H HG3  . GLN A 1 50 ? 0.488   -14.402 -5.358  1.00 0.00 ? 50 GLN A HG3  9  
ATOM 9919  H HE21 . GLN A 1 50 ? -1.135  -15.735 -4.511  1.00 0.00 ? 50 GLN A HE21 9  
ATOM 9920  H HE22 . GLN A 1 50 ? -2.730  -15.142 -4.215  1.00 0.00 ? 50 GLN A HE22 9  
ATOM 9921  N N    . VAL A 1 51 ? 3.594   -13.251 -1.540  1.00 0.00 ? 51 VAL A N    9  
ATOM 9922  C CA   . VAL A 1 51 ? 4.156   -12.693 -0.316  1.00 0.00 ? 51 VAL A CA   9  
ATOM 9923  C C    . VAL A 1 51 ? 5.564   -12.157 -0.552  1.00 0.00 ? 51 VAL A C    9  
ATOM 9924  O O    . VAL A 1 51 ? 6.016   -11.243 0.137   1.00 0.00 ? 51 VAL A O    9  
ATOM 9925  C CB   . VAL A 1 51 ? 4.200   -13.742 0.810   1.00 0.00 ? 51 VAL A CB   9  
ATOM 9926  C CG1  . VAL A 1 51 ? 4.650   -13.105 2.116   1.00 0.00 ? 51 VAL A CG1  9  
ATOM 9927  C CG2  . VAL A 1 51 ? 2.841   -14.406 0.972   1.00 0.00 ? 51 VAL A CG2  9  
ATOM 9928  H H    . VAL A 1 51 ? 3.663   -14.215 -1.702  1.00 0.00 ? 51 VAL A H    9  
ATOM 9929  H HA   . VAL A 1 51 ? 3.520   -11.879 0.003   1.00 0.00 ? 51 VAL A HA   9  
ATOM 9930  H HB   . VAL A 1 51 ? 4.918   -14.502 0.539   1.00 0.00 ? 51 VAL A HB   9  
ATOM 9931  H HG11 . VAL A 1 51 ? 4.904   -13.880 2.825   1.00 0.00 ? 51 VAL A HG11 9  
ATOM 9932  H HG12 . VAL A 1 51 ? 5.515   -12.484 1.935   1.00 0.00 ? 51 VAL A HG12 9  
ATOM 9933  H HG13 . VAL A 1 51 ? 3.850   -12.501 2.516   1.00 0.00 ? 51 VAL A HG13 9  
ATOM 9934  H HG21 . VAL A 1 51 ? 2.810   -14.936 1.913   1.00 0.00 ? 51 VAL A HG21 9  
ATOM 9935  H HG22 . VAL A 1 51 ? 2.067   -13.652 0.958   1.00 0.00 ? 51 VAL A HG22 9  
ATOM 9936  H HG23 . VAL A 1 51 ? 2.680   -15.101 0.162   1.00 0.00 ? 51 VAL A HG23 9  
ATOM 9937  N N    . LYS A 1 52 ? 6.253   -12.732 -1.532  1.00 0.00 ? 52 LYS A N    9  
ATOM 9938  C CA   . LYS A 1 52 ? 7.610   -12.313 -1.862  1.00 0.00 ? 52 LYS A CA   9  
ATOM 9939  C C    . LYS A 1 52 ? 7.595   -11.084 -2.766  1.00 0.00 ? 52 LYS A C    9  
ATOM 9940  O O    . LYS A 1 52 ? 8.546   -10.302 -2.785  1.00 0.00 ? 52 LYS A O    9  
ATOM 9941  C CB   . LYS A 1 52 ? 8.366   -13.453 -2.547  1.00 0.00 ? 52 LYS A CB   9  
ATOM 9942  C CG   . LYS A 1 52 ? 8.208   -13.467 -4.058  1.00 0.00 ? 52 LYS A CG   9  
ATOM 9943  C CD   . LYS A 1 52 ? 9.267   -12.615 -4.737  1.00 0.00 ? 52 LYS A CD   9  
ATOM 9944  C CE   . LYS A 1 52 ? 9.602   -13.143 -6.123  1.00 0.00 ? 52 LYS A CE   9  
ATOM 9945  N NZ   . LYS A 1 52 ? 10.639  -12.313 -6.797  1.00 0.00 ? 52 LYS A NZ   9  
ATOM 9946  H H    . LYS A 1 52 ? 5.838   -13.456 -2.047  1.00 0.00 ? 52 LYS A H    9  
ATOM 9947  H HA   . LYS A 1 52 ? 8.113   -12.061 -0.941  1.00 0.00 ? 52 LYS A HA   9  
ATOM 9948  H HB2  . LYS A 1 52 ? 9.417   -13.362 -2.317  1.00 0.00 ? 52 LYS A HB2  9  
ATOM 9949  H HB3  . LYS A 1 52 ? 8.002   -14.394 -2.160  1.00 0.00 ? 52 LYS A HB3  9  
ATOM 9950  H HG2  . LYS A 1 52 ? 8.298   -14.483 -4.411  1.00 0.00 ? 52 LYS A HG2  9  
ATOM 9951  H HG3  . LYS A 1 52 ? 7.231   -13.081 -4.312  1.00 0.00 ? 52 LYS A HG3  9  
ATOM 9952  H HD2  . LYS A 1 52 ? 8.899   -11.604 -4.829  1.00 0.00 ? 52 LYS A HD2  9  
ATOM 9953  H HD3  . LYS A 1 52 ? 10.163  -12.620 -4.133  1.00 0.00 ? 52 LYS A HD3  9  
ATOM 9954  H HE2  . LYS A 1 52 ? 9.967   -14.154 -6.031  1.00 0.00 ? 52 LYS A HE2  9  
ATOM 9955  H HE3  . LYS A 1 52 ? 8.704   -13.138 -6.723  1.00 0.00 ? 52 LYS A HE3  9  
ATOM 9956  H HZ1  . LYS A 1 52 ? 11.086  -12.854 -7.565  1.00 0.00 ? 52 LYS A HZ1  9  
ATOM 9957  H HZ2  . LYS A 1 52 ? 11.371  -12.033 -6.115  1.00 0.00 ? 52 LYS A HZ2  9  
ATOM 9958  H HZ3  . LYS A 1 52 ? 10.207  -11.456 -7.197  1.00 0.00 ? 52 LYS A HZ3  9  
ATOM 9959  N N    . THR A 1 53 ? 6.508   -10.917 -3.513  1.00 0.00 ? 53 THR A N    9  
ATOM 9960  C CA   . THR A 1 53 ? 6.369   -9.784  -4.418  1.00 0.00 ? 53 THR A CA   9  
ATOM 9961  C C    . THR A 1 53 ? 5.817   -8.563  -3.690  1.00 0.00 ? 53 THR A C    9  
ATOM 9962  O O    . THR A 1 53 ? 6.438   -7.500  -3.683  1.00 0.00 ? 53 THR A O    9  
ATOM 9963  C CB   . THR A 1 53 ? 5.445   -10.121 -5.604  1.00 0.00 ? 53 THR A CB   9  
ATOM 9964  O OG1  . THR A 1 53 ? 6.130   -10.969 -6.533  1.00 0.00 ? 53 THR A OG1  9  
ATOM 9965  C CG2  . THR A 1 53 ? 4.985   -8.854  -6.309  1.00 0.00 ? 53 THR A CG2  9  
ATOM 9966  H H    . THR A 1 53 ? 5.783   -11.575 -3.454  1.00 0.00 ? 53 THR A H    9  
ATOM 9967  H HA   . THR A 1 53 ? 7.348   -9.546  -4.808  1.00 0.00 ? 53 THR A HA   9  
ATOM 9968  H HB   . THR A 1 53 ? 4.576   -10.641 -5.226  1.00 0.00 ? 53 THR A HB   9  
ATOM 9969  H HG1  . THR A 1 53 ? 5.652   -10.982 -7.366  1.00 0.00 ? 53 THR A HG1  9  
ATOM 9970  H HG21 . THR A 1 53 ? 4.819   -9.065  -7.356  1.00 0.00 ? 53 THR A HG21 9  
ATOM 9971  H HG22 . THR A 1 53 ? 5.744   -8.092  -6.211  1.00 0.00 ? 53 THR A HG22 9  
ATOM 9972  H HG23 . THR A 1 53 ? 4.066   -8.507  -5.862  1.00 0.00 ? 53 THR A HG23 9  
ATOM 9973  N N    . TRP A 1 54 ? 4.649   -8.723  -3.079  1.00 0.00 ? 54 TRP A N    9  
ATOM 9974  C CA   . TRP A 1 54 ? 4.015   -7.633  -2.347  1.00 0.00 ? 54 TRP A CA   9  
ATOM 9975  C C    . TRP A 1 54 ? 5.032   -6.888  -1.489  1.00 0.00 ? 54 TRP A C    9  
ATOM 9976  O O    . TRP A 1 54 ? 5.185   -5.672  -1.606  1.00 0.00 ? 54 TRP A O    9  
ATOM 9977  C CB   . TRP A 1 54 ? 2.885   -8.171  -1.467  1.00 0.00 ? 54 TRP A CB   9  
ATOM 9978  C CG   . TRP A 1 54 ? 2.072   -7.093  -0.819  1.00 0.00 ? 54 TRP A CG   9  
ATOM 9979  C CD1  . TRP A 1 54 ? 0.912   -6.546  -1.289  1.00 0.00 ? 54 TRP A CD1  9  
ATOM 9980  C CD2  . TRP A 1 54 ? 2.358   -6.429  0.417   1.00 0.00 ? 54 TRP A CD2  9  
ATOM 9981  N NE1  . TRP A 1 54 ? 0.460   -5.583  -0.420  1.00 0.00 ? 54 TRP A NE1  9  
ATOM 9982  C CE2  . TRP A 1 54 ? 1.329   -5.492  0.635   1.00 0.00 ? 54 TRP A CE2  9  
ATOM 9983  C CE3  . TRP A 1 54 ? 3.383   -6.536  1.361   1.00 0.00 ? 54 TRP A CE3  9  
ATOM 9984  C CZ2  . TRP A 1 54 ? 1.298   -4.669  1.757   1.00 0.00 ? 54 TRP A CZ2  9  
ATOM 9985  C CZ3  . TRP A 1 54 ? 3.350   -5.717  2.475   1.00 0.00 ? 54 TRP A CZ3  9  
ATOM 9986  C CH2  . TRP A 1 54 ? 2.313   -4.794  2.666   1.00 0.00 ? 54 TRP A CH2  9  
ATOM 9987  H H    . TRP A 1 54 ? 4.203   -9.595  -3.120  1.00 0.00 ? 54 TRP A H    9  
ATOM 9988  H HA   . TRP A 1 54 ? 3.600   -6.947  -3.070  1.00 0.00 ? 54 TRP A HA   9  
ATOM 9989  H HB2  . TRP A 1 54 ? 2.222   -8.772  -2.071  1.00 0.00 ? 54 TRP A HB2  9  
ATOM 9990  H HB3  . TRP A 1 54 ? 3.309   -8.785  -0.686  1.00 0.00 ? 54 TRP A HB3  9  
ATOM 9991  H HD1  . TRP A 1 54 ? 0.432   -6.838  -2.211  1.00 0.00 ? 54 TRP A HD1  9  
ATOM 9992  H HE1  . TRP A 1 54 ? -0.354  -5.048  -0.536  1.00 0.00 ? 54 TRP A HE1  9  
ATOM 9993  H HE3  . TRP A 1 54 ? 4.190   -7.241  1.232   1.00 0.00 ? 54 TRP A HE3  9  
ATOM 9994  H HZ2  . TRP A 1 54 ? 0.505   -3.953  1.919   1.00 0.00 ? 54 TRP A HZ2  9  
ATOM 9995  H HZ3  . TRP A 1 54 ? 4.134   -5.785  3.215   1.00 0.00 ? 54 TRP A HZ3  9  
ATOM 9996  H HH2  . TRP A 1 54 ? 2.329   -4.176  3.549   1.00 0.00 ? 54 TRP A HH2  9  
ATOM 9997  N N    . PHE A 1 55 ? 5.726   -7.625  -0.628  1.00 0.00 ? 55 PHE A N    9  
ATOM 9998  C CA   . PHE A 1 55 ? 6.729   -7.033  0.250   1.00 0.00 ? 55 PHE A CA   9  
ATOM 9999  C C    . PHE A 1 55 ? 7.745   -6.225  -0.553  1.00 0.00 ? 55 PHE A C    9  
ATOM 10000 O O    . PHE A 1 55 ? 7.966   -5.045  -0.283  1.00 0.00 ? 55 PHE A O    9  
ATOM 10001 C CB   . PHE A 1 55 ? 7.445   -8.123  1.050   1.00 0.00 ? 55 PHE A CB   9  
ATOM 10002 C CG   . PHE A 1 55 ? 6.703   -8.545  2.286   1.00 0.00 ? 55 PHE A CG   9  
ATOM 10003 C CD1  . PHE A 1 55 ? 5.430   -9.085  2.195   1.00 0.00 ? 55 PHE A CD1  9  
ATOM 10004 C CD2  . PHE A 1 55 ? 7.278   -8.400  3.538   1.00 0.00 ? 55 PHE A CD2  9  
ATOM 10005 C CE1  . PHE A 1 55 ? 4.744   -9.474  3.330   1.00 0.00 ? 55 PHE A CE1  9  
ATOM 10006 C CE2  . PHE A 1 55 ? 6.597   -8.788  4.677   1.00 0.00 ? 55 PHE A CE2  9  
ATOM 10007 C CZ   . PHE A 1 55 ? 5.329   -9.325  4.573   1.00 0.00 ? 55 PHE A CZ   9  
ATOM 10008 H H    . PHE A 1 55 ? 5.559   -8.590  -0.581  1.00 0.00 ? 55 PHE A H    9  
ATOM 10009 H HA   . PHE A 1 55 ? 6.221   -6.371  0.934   1.00 0.00 ? 55 PHE A HA   9  
ATOM 10010 H HB2  . PHE A 1 55 ? 7.570   -8.995  0.425   1.00 0.00 ? 55 PHE A HB2  9  
ATOM 10011 H HB3  . PHE A 1 55 ? 8.415   -7.760  1.351   1.00 0.00 ? 55 PHE A HB3  9  
ATOM 10012 H HD1  . PHE A 1 55 ? 4.972   -9.202  1.223   1.00 0.00 ? 55 PHE A HD1  9  
ATOM 10013 H HD2  . PHE A 1 55 ? 8.269   -7.980  3.621   1.00 0.00 ? 55 PHE A HD2  9  
ATOM 10014 H HE1  . PHE A 1 55 ? 3.753   -9.893  3.245   1.00 0.00 ? 55 PHE A HE1  9  
ATOM 10015 H HE2  . PHE A 1 55 ? 7.056   -8.670  5.647   1.00 0.00 ? 55 PHE A HE2  9  
ATOM 10016 H HZ   . PHE A 1 55 ? 4.795   -9.629  5.461   1.00 0.00 ? 55 PHE A HZ   9  
ATOM 10017 N N    . GLN A 1 56 ? 8.360   -6.871  -1.538  1.00 0.00 ? 56 GLN A N    9  
ATOM 10018 C CA   . GLN A 1 56 ? 9.354   -6.213  -2.379  1.00 0.00 ? 56 GLN A CA   9  
ATOM 10019 C C    . GLN A 1 56 ? 8.855   -4.849  -2.845  1.00 0.00 ? 56 GLN A C    9  
ATOM 10020 O O    . GLN A 1 56 ? 9.521   -3.834  -2.647  1.00 0.00 ? 56 GLN A O    9  
ATOM 10021 C CB   . GLN A 1 56 ? 9.689   -7.088  -3.588  1.00 0.00 ? 56 GLN A CB   9  
ATOM 10022 C CG   . GLN A 1 56 ? 10.840  -8.049  -3.343  1.00 0.00 ? 56 GLN A CG   9  
ATOM 10023 C CD   . GLN A 1 56 ? 11.522  -8.482  -4.626  1.00 0.00 ? 56 GLN A CD   9  
ATOM 10024 O OE1  . GLN A 1 56 ? 10.981  -8.310  -5.719  1.00 0.00 ? 56 GLN A OE1  9  
ATOM 10025 N NE2  . GLN A 1 56 ? 12.717  -9.048  -4.500  1.00 0.00 ? 56 GLN A NE2  9  
ATOM 10026 H H    . GLN A 1 56 ? 8.141   -7.811  -1.704  1.00 0.00 ? 56 GLN A H    9  
ATOM 10027 H HA   . GLN A 1 56 ? 10.247  -6.073  -1.789  1.00 0.00 ? 56 GLN A HA   9  
ATOM 10028 H HB2  . GLN A 1 56 ? 8.816   -7.665  -3.853  1.00 0.00 ? 56 GLN A HB2  9  
ATOM 10029 H HB3  . GLN A 1 56 ? 9.953   -6.448  -4.417  1.00 0.00 ? 56 GLN A HB3  9  
ATOM 10030 H HG2  . GLN A 1 56 ? 11.570  -7.564  -2.712  1.00 0.00 ? 56 GLN A HG2  9  
ATOM 10031 H HG3  . GLN A 1 56 ? 10.459  -8.926  -2.841  1.00 0.00 ? 56 GLN A HG3  9  
ATOM 10032 H HE21 . GLN A 1 56 ? 13.086  -9.154  -3.597  1.00 0.00 ? 56 GLN A HE21 9  
ATOM 10033 H HE22 . GLN A 1 56 ? 13.180  -9.338  -5.312  1.00 0.00 ? 56 GLN A HE22 9  
ATOM 10034 N N    . ASN A 1 57 ? 7.680   -4.835  -3.466  1.00 0.00 ? 57 ASN A N    9  
ATOM 10035 C CA   . ASN A 1 57 ? 7.093   -3.595  -3.961  1.00 0.00 ? 57 ASN A CA   9  
ATOM 10036 C C    . ASN A 1 57 ? 6.781   -2.643  -2.811  1.00 0.00 ? 57 ASN A C    9  
ATOM 10037 O O    . ASN A 1 57 ? 6.851   -1.423  -2.965  1.00 0.00 ? 57 ASN A O    9  
ATOM 10038 C CB   . ASN A 1 57 ? 5.817   -3.891  -4.753  1.00 0.00 ? 57 ASN A CB   9  
ATOM 10039 C CG   . ASN A 1 57 ? 6.110   -4.416  -6.145  1.00 0.00 ? 57 ASN A CG   9  
ATOM 10040 O OD1  . ASN A 1 57 ? 7.246   -4.360  -6.616  1.00 0.00 ? 57 ASN A OD1  9  
ATOM 10041 N ND2  . ASN A 1 57 ? 5.082   -4.928  -6.812  1.00 0.00 ? 57 ASN A ND2  9  
ATOM 10042 H H    . ASN A 1 57 ? 7.196   -5.677  -3.594  1.00 0.00 ? 57 ASN A H    9  
ATOM 10043 H HA   . ASN A 1 57 ? 7.812   -3.127  -4.617  1.00 0.00 ? 57 ASN A HA   9  
ATOM 10044 H HB2  . ASN A 1 57 ? 5.237   -4.634  -4.224  1.00 0.00 ? 57 ASN A HB2  9  
ATOM 10045 H HB3  . ASN A 1 57 ? 5.238   -2.985  -4.843  1.00 0.00 ? 57 ASN A HB3  9  
ATOM 10046 H HD21 . ASN A 1 57 ? 4.205   -4.939  -6.375  1.00 0.00 ? 57 ASN A HD21 9  
ATOM 10047 H HD22 . ASN A 1 57 ? 5.243   -5.275  -7.715  1.00 0.00 ? 57 ASN A HD22 9  
ATOM 10048 N N    . ARG A 1 58 ? 6.438   -3.208  -1.658  1.00 0.00 ? 58 ARG A N    9  
ATOM 10049 C CA   . ARG A 1 58 ? 6.115   -2.410  -0.482  1.00 0.00 ? 58 ARG A CA   9  
ATOM 10050 C C    . ARG A 1 58 ? 7.295   -1.529  -0.082  1.00 0.00 ? 58 ARG A C    9  
ATOM 10051 O O    . ARG A 1 58 ? 7.172   -0.307  -0.007  1.00 0.00 ? 58 ARG A O    9  
ATOM 10052 C CB   . ARG A 1 58 ? 5.724   -3.318  0.685   1.00 0.00 ? 58 ARG A CB   9  
ATOM 10053 C CG   . ARG A 1 58 ? 5.066   -2.578  1.839   1.00 0.00 ? 58 ARG A CG   9  
ATOM 10054 C CD   . ARG A 1 58 ? 3.975   -1.640  1.349   1.00 0.00 ? 58 ARG A CD   9  
ATOM 10055 N NE   . ARG A 1 58 ? 3.154   -2.252  0.307   1.00 0.00 ? 58 ARG A NE   9  
ATOM 10056 C CZ   . ARG A 1 58 ? 2.150   -1.628  -0.299  1.00 0.00 ? 58 ARG A CZ   9  
ATOM 10057 N NH1  . ARG A 1 58 ? 1.845   -0.381  0.031   1.00 0.00 ? 58 ARG A NH1  9  
ATOM 10058 N NH2  . ARG A 1 58 ? 1.450   -2.252  -1.238  1.00 0.00 ? 58 ARG A NH2  9  
ATOM 10059 H H    . ARG A 1 58 ? 6.400   -4.186  -1.598  1.00 0.00 ? 58 ARG A H    9  
ATOM 10060 H HA   . ARG A 1 58 ? 5.277   -1.777  -0.730  1.00 0.00 ? 58 ARG A HA   9  
ATOM 10061 H HB2  . ARG A 1 58 ? 5.034   -4.068  0.328   1.00 0.00 ? 58 ARG A HB2  9  
ATOM 10062 H HB3  . ARG A 1 58 ? 6.612   -3.806  1.059   1.00 0.00 ? 58 ARG A HB3  9  
ATOM 10063 H HG2  . ARG A 1 58 ? 4.630   -3.299  2.514   1.00 0.00 ? 58 ARG A HG2  9  
ATOM 10064 H HG3  . ARG A 1 58 ? 5.817   -2.003  2.360   1.00 0.00 ? 58 ARG A HG3  9  
ATOM 10065 H HD2  . ARG A 1 58 ? 3.342   -1.378  2.184   1.00 0.00 ? 58 ARG A HD2  9  
ATOM 10066 H HD3  . ARG A 1 58 ? 4.436   -0.748  0.953   1.00 0.00 ? 58 ARG A HD3  9  
ATOM 10067 H HE   . ARG A 1 58 ? 3.363   -3.173  0.047   1.00 0.00 ? 58 ARG A HE   9  
ATOM 10068 H HH11 . ARG A 1 58 ? 2.371   0.092   0.737   1.00 0.00 ? 58 ARG A HH11 9  
ATOM 10069 H HH12 . ARG A 1 58 ? 1.089   0.087   -0.428  1.00 0.00 ? 58 ARG A HH12 9  
ATOM 10070 H HH21 . ARG A 1 58 ? 1.678   -3.192  -1.490  1.00 0.00 ? 58 ARG A HH21 9  
ATOM 10071 H HH22 . ARG A 1 58 ? 0.695   -1.782  -1.693  1.00 0.00 ? 58 ARG A HH22 9  
ATOM 10072 N N    . ARG A 1 59 ? 8.437   -2.159  0.174   1.00 0.00 ? 59 ARG A N    9  
ATOM 10073 C CA   . ARG A 1 59 ? 9.638   -1.433  0.568   1.00 0.00 ? 59 ARG A CA   9  
ATOM 10074 C C    . ARG A 1 59 ? 9.902   -0.264  -0.377  1.00 0.00 ? 59 ARG A C    9  
ATOM 10075 O O    . ARG A 1 59 ? 9.919   0.893   0.041   1.00 0.00 ? 59 ARG A O    9  
ATOM 10076 C CB   . ARG A 1 59 ? 10.846  -2.373  0.583   1.00 0.00 ? 59 ARG A CB   9  
ATOM 10077 C CG   . ARG A 1 59 ? 11.926  -1.960  1.569   1.00 0.00 ? 59 ARG A CG   9  
ATOM 10078 C CD   . ARG A 1 59 ? 13.274  -2.563  1.204   1.00 0.00 ? 59 ARG A CD   9  
ATOM 10079 N NE   . ARG A 1 59 ? 14.385  -1.802  1.769   1.00 0.00 ? 59 ARG A NE   9  
ATOM 10080 C CZ   . ARG A 1 59 ? 15.623  -1.843  1.289   1.00 0.00 ? 59 ARG A CZ   9  
ATOM 10081 N NH1  . ARG A 1 59 ? 15.906  -2.604  0.241   1.00 0.00 ? 59 ARG A NH1  9  
ATOM 10082 N NH2  . ARG A 1 59 ? 16.580  -1.122  1.858   1.00 0.00 ? 59 ARG A NH2  9  
ATOM 10083 H H    . ARG A 1 59 ? 8.472   -3.136  0.097   1.00 0.00 ? 59 ARG A H    9  
ATOM 10084 H HA   . ARG A 1 59 ? 9.481   -1.047  1.564   1.00 0.00 ? 59 ARG A HA   9  
ATOM 10085 H HB2  . ARG A 1 59 ? 10.511  -3.366  0.844   1.00 0.00 ? 59 ARG A HB2  9  
ATOM 10086 H HB3  . ARG A 1 59 ? 11.280  -2.396  -0.405  1.00 0.00 ? 59 ARG A HB3  9  
ATOM 10087 H HG2  . ARG A 1 59 ? 12.013  -0.884  1.565   1.00 0.00 ? 59 ARG A HG2  9  
ATOM 10088 H HG3  . ARG A 1 59 ? 11.646  -2.297  2.556   1.00 0.00 ? 59 ARG A HG3  9  
ATOM 10089 H HD2  . ARG A 1 59 ? 13.315  -3.574  1.580   1.00 0.00 ? 59 ARG A HD2  9  
ATOM 10090 H HD3  . ARG A 1 59 ? 13.367  -2.575  0.128   1.00 0.00 ? 59 ARG A HD3  9  
ATOM 10091 H HE   . ARG A 1 59 ? 14.198  -1.233  2.544   1.00 0.00 ? 59 ARG A HE   9  
ATOM 10092 H HH11 . ARG A 1 59 ? 15.186  -3.148  -0.190  1.00 0.00 ? 59 ARG A HH11 9  
ATOM 10093 H HH12 . ARG A 1 59 ? 16.839  -2.633  -0.119  1.00 0.00 ? 59 ARG A HH12 9  
ATOM 10094 H HH21 . ARG A 1 59 ? 16.371  -0.547  2.648   1.00 0.00 ? 59 ARG A HH21 9  
ATOM 10095 H HH22 . ARG A 1 59 ? 17.512  -1.154  1.496   1.00 0.00 ? 59 ARG A HH22 9  
ATOM 10096 N N    . ALA A 1 60 ? 10.107  -0.576  -1.653  1.00 0.00 ? 60 ALA A N    9  
ATOM 10097 C CA   . ALA A 1 60 ? 10.367  0.448   -2.657  1.00 0.00 ? 60 ALA A CA   9  
ATOM 10098 C C    . ALA A 1 60 ? 9.481   1.670   -2.438  1.00 0.00 ? 60 ALA A C    9  
ATOM 10099 O O    . ALA A 1 60 ? 9.846   2.788   -2.802  1.00 0.00 ? 60 ALA A O    9  
ATOM 10100 C CB   . ALA A 1 60 ? 10.156  -0.117  -4.054  1.00 0.00 ? 60 ALA A CB   9  
ATOM 10101 H H    . ALA A 1 60 ? 10.080  -1.517  -1.925  1.00 0.00 ? 60 ALA A H    9  
ATOM 10102 H HA   . ALA A 1 60 ? 11.402  0.746   -2.568  1.00 0.00 ? 60 ALA A HA   9  
ATOM 10103 H HB1  . ALA A 1 60 ? 9.234   -0.679  -4.078  1.00 0.00 ? 60 ALA A HB1  9  
ATOM 10104 H HB2  . ALA A 1 60 ? 10.104  0.694   -4.765  1.00 0.00 ? 60 ALA A HB2  9  
ATOM 10105 H HB3  . ALA A 1 60 ? 10.981  -0.766  -4.307  1.00 0.00 ? 60 ALA A HB3  9  
ATOM 10106 N N    . LYS A 1 61 ? 8.314   1.449   -1.843  1.00 0.00 ? 61 LYS A N    9  
ATOM 10107 C CA   . LYS A 1 61 ? 7.374   2.531   -1.575  1.00 0.00 ? 61 LYS A CA   9  
ATOM 10108 C C    . LYS A 1 61 ? 7.611   3.127   -0.191  1.00 0.00 ? 61 LYS A C    9  
ATOM 10109 O O    . LYS A 1 61 ? 7.563   4.344   -0.013  1.00 0.00 ? 61 LYS A O    9  
ATOM 10110 C CB   . LYS A 1 61 ? 5.935   2.023   -1.684  1.00 0.00 ? 61 LYS A CB   9  
ATOM 10111 C CG   . LYS A 1 61 ? 5.358   2.126   -3.086  1.00 0.00 ? 61 LYS A CG   9  
ATOM 10112 C CD   . LYS A 1 61 ? 3.849   1.945   -3.082  1.00 0.00 ? 61 LYS A CD   9  
ATOM 10113 C CE   . LYS A 1 61 ? 3.141   3.178   -2.542  1.00 0.00 ? 61 LYS A CE   9  
ATOM 10114 N NZ   . LYS A 1 61 ? 1.672   2.964   -2.418  1.00 0.00 ? 61 LYS A NZ   9  
ATOM 10115 H H    . LYS A 1 61 ? 8.079   0.535   -1.577  1.00 0.00 ? 61 LYS A H    9  
ATOM 10116 H HA   . LYS A 1 61 ? 7.533   3.299   -2.317  1.00 0.00 ? 61 LYS A HA   9  
ATOM 10117 H HB2  . LYS A 1 61 ? 5.907   0.987   -1.382  1.00 0.00 ? 61 LYS A HB2  9  
ATOM 10118 H HB3  . LYS A 1 61 ? 5.310   2.601   -1.018  1.00 0.00 ? 61 LYS A HB3  9  
ATOM 10119 H HG2  . LYS A 1 61 ? 5.592   3.099   -3.491  1.00 0.00 ? 61 LYS A HG2  9  
ATOM 10120 H HG3  . LYS A 1 61 ? 5.802   1.360   -3.705  1.00 0.00 ? 61 LYS A HG3  9  
ATOM 10121 H HD2  . LYS A 1 61 ? 3.514   1.766   -4.093  1.00 0.00 ? 61 LYS A HD2  9  
ATOM 10122 H HD3  . LYS A 1 61 ? 3.599   1.096   -2.462  1.00 0.00 ? 61 LYS A HD3  9  
ATOM 10123 H HE2  . LYS A 1 61 ? 3.545   3.412   -1.570  1.00 0.00 ? 61 LYS A HE2  9  
ATOM 10124 H HE3  . LYS A 1 61 ? 3.320   4.004   -3.215  1.00 0.00 ? 61 LYS A HE3  9  
ATOM 10125 H HZ1  . LYS A 1 61 ? 1.483   2.092   -1.883  1.00 0.00 ? 61 LYS A HZ1  9  
ATOM 10126 H HZ2  . LYS A 1 61 ? 1.243   2.879   -3.361  1.00 0.00 ? 61 LYS A HZ2  9  
ATOM 10127 H HZ3  . LYS A 1 61 ? 1.235   3.766   -1.920  1.00 0.00 ? 61 LYS A HZ3  9  
ATOM 10128 N N    . TRP A 1 62 ? 7.867   2.263   0.783   1.00 0.00 ? 62 TRP A N    9  
ATOM 10129 C CA   . TRP A 1 62 ? 8.113   2.705   2.152   1.00 0.00 ? 62 TRP A CA   9  
ATOM 10130 C C    . TRP A 1 62 ? 9.334   3.616   2.218   1.00 0.00 ? 62 TRP A C    9  
ATOM 10131 O O    . TRP A 1 62 ? 9.368   4.567   2.999   1.00 0.00 ? 62 TRP A O    9  
ATOM 10132 C CB   . TRP A 1 62 ? 8.310   1.498   3.071   1.00 0.00 ? 62 TRP A CB   9  
ATOM 10133 C CG   . TRP A 1 62 ? 9.132   1.806   4.286   1.00 0.00 ? 62 TRP A CG   9  
ATOM 10134 C CD1  . TRP A 1 62 ? 8.695   2.377   5.448   1.00 0.00 ? 62 TRP A CD1  9  
ATOM 10135 C CD2  . TRP A 1 62 ? 10.532  1.562   4.459   1.00 0.00 ? 62 TRP A CD2  9  
ATOM 10136 N NE1  . TRP A 1 62 ? 9.740   2.502   6.332   1.00 0.00 ? 62 TRP A NE1  9  
ATOM 10137 C CE2  . TRP A 1 62 ? 10.877  2.009   5.749   1.00 0.00 ? 62 TRP A CE2  9  
ATOM 10138 C CE3  . TRP A 1 62 ? 11.527  1.008   3.649   1.00 0.00 ? 62 TRP A CE3  9  
ATOM 10139 C CZ2  . TRP A 1 62 ? 12.175  1.918   6.245   1.00 0.00 ? 62 TRP A CZ2  9  
ATOM 10140 C CZ3  . TRP A 1 62 ? 12.815  0.919   4.143   1.00 0.00 ? 62 TRP A CZ3  9  
ATOM 10141 C CH2  . TRP A 1 62 ? 13.130  1.371   5.431   1.00 0.00 ? 62 TRP A CH2  9  
ATOM 10142 H H    . TRP A 1 62 ? 7.892   1.304   0.579   1.00 0.00 ? 62 TRP A H    9  
ATOM 10143 H HA   . TRP A 1 62 ? 7.246   3.259   2.481   1.00 0.00 ? 62 TRP A HA   9  
ATOM 10144 H HB2  . TRP A 1 62 ? 7.346   1.144   3.403   1.00 0.00 ? 62 TRP A HB2  9  
ATOM 10145 H HB3  . TRP A 1 62 ? 8.809   0.713   2.521   1.00 0.00 ? 62 TRP A HB3  9  
ATOM 10146 H HD1  . TRP A 1 62 ? 7.676   2.681   5.630   1.00 0.00 ? 62 TRP A HD1  9  
ATOM 10147 H HE1  . TRP A 1 62 ? 9.680   2.881   7.234   1.00 0.00 ? 62 TRP A HE1  9  
ATOM 10148 H HE3  . TRP A 1 62 ? 11.304  0.654   2.653   1.00 0.00 ? 62 TRP A HE3  9  
ATOM 10149 H HZ2  . TRP A 1 62 ? 12.434  2.262   7.237   1.00 0.00 ? 62 TRP A HZ2  9  
ATOM 10150 H HZ3  . TRP A 1 62 ? 13.597  0.494   3.531   1.00 0.00 ? 62 TRP A HZ3  9  
ATOM 10151 H HH2  . TRP A 1 62 ? 14.148  1.282   5.776   1.00 0.00 ? 62 TRP A HH2  9  
ATOM 10152 N N    . ARG A 1 63 ? 10.334  3.319   1.395   1.00 0.00 ? 63 ARG A N    9  
ATOM 10153 C CA   . ARG A 1 63 ? 11.557  4.112   1.362   1.00 0.00 ? 63 ARG A CA   9  
ATOM 10154 C C    . ARG A 1 63 ? 11.255  5.563   1.001   1.00 0.00 ? 63 ARG A C    9  
ATOM 10155 O O    . ARG A 1 63 ? 11.676  6.487   1.697   1.00 0.00 ? 63 ARG A O    9  
ATOM 10156 C CB   . ARG A 1 63 ? 12.546  3.520   0.356   1.00 0.00 ? 63 ARG A CB   9  
ATOM 10157 C CG   . ARG A 1 63 ? 13.431  2.431   0.941   1.00 0.00 ? 63 ARG A CG   9  
ATOM 10158 C CD   . ARG A 1 63 ? 14.541  2.039   -0.022  1.00 0.00 ? 63 ARG A CD   9  
ATOM 10159 N NE   . ARG A 1 63 ? 14.016  1.527   -1.284  1.00 0.00 ? 63 ARG A NE   9  
ATOM 10160 C CZ   . ARG A 1 63 ? 14.722  1.478   -2.408  1.00 0.00 ? 63 ARG A CZ   9  
ATOM 10161 N NH1  . ARG A 1 63 ? 15.977  1.907   -2.426  1.00 0.00 ? 63 ARG A NH1  9  
ATOM 10162 N NH2  . ARG A 1 63 ? 14.174  0.998   -3.517  1.00 0.00 ? 63 ARG A NH2  9  
ATOM 10163 H H    . ARG A 1 63 ? 10.248  2.549   0.796   1.00 0.00 ? 63 ARG A H    9  
ATOM 10164 H HA   . ARG A 1 63 ? 11.998  4.083   2.347   1.00 0.00 ? 63 ARG A HA   9  
ATOM 10165 H HB2  . ARG A 1 63 ? 11.993  3.099   -0.470  1.00 0.00 ? 63 ARG A HB2  9  
ATOM 10166 H HB3  . ARG A 1 63 ? 13.182  4.311   -0.012  1.00 0.00 ? 63 ARG A HB3  9  
ATOM 10167 H HG2  . ARG A 1 63 ? 13.875  2.793   1.856   1.00 0.00 ? 63 ARG A HG2  9  
ATOM 10168 H HG3  . ARG A 1 63 ? 12.825  1.563   1.151   1.00 0.00 ? 63 ARG A HG3  9  
ATOM 10169 H HD2  . ARG A 1 63 ? 15.149  2.909   -0.222  1.00 0.00 ? 63 ARG A HD2  9  
ATOM 10170 H HD3  . ARG A 1 63 ? 15.148  1.275   0.442   1.00 0.00 ? 63 ARG A HD3  9  
ATOM 10171 H HE   . ARG A 1 63 ? 13.091  1.205   -1.294  1.00 0.00 ? 63 ARG A HE   9  
ATOM 10172 H HH11 . ARG A 1 63 ? 16.393  2.268   -1.592  1.00 0.00 ? 63 ARG A HH11 9  
ATOM 10173 H HH12 . ARG A 1 63 ? 16.507  1.867   -3.273  1.00 0.00 ? 63 ARG A HH12 9  
ATOM 10174 H HH21 . ARG A 1 63 ? 13.229  0.674   -3.507  1.00 0.00 ? 63 ARG A HH21 9  
ATOM 10175 H HH22 . ARG A 1 63 ? 14.706  0.962   -4.362  1.00 0.00 ? 63 ARG A HH22 9  
ATOM 10176 N N    . ARG A 1 64 ? 10.523  5.756   -0.092  1.00 0.00 ? 64 ARG A N    9  
ATOM 10177 C CA   . ARG A 1 64 ? 10.166  7.094   -0.546  1.00 0.00 ? 64 ARG A CA   9  
ATOM 10178 C C    . ARG A 1 64 ? 9.473   7.878   0.564   1.00 0.00 ? 64 ARG A C    9  
ATOM 10179 O O    . ARG A 1 64 ? 9.831   9.022   0.847   1.00 0.00 ? 64 ARG A O    9  
ATOM 10180 C CB   . ARG A 1 64 ? 9.256   7.014   -1.773  1.00 0.00 ? 64 ARG A CB   9  
ATOM 10181 C CG   . ARG A 1 64 ? 8.852   8.372   -2.322  1.00 0.00 ? 64 ARG A CG   9  
ATOM 10182 C CD   . ARG A 1 64 ? 8.193   8.248   -3.687  1.00 0.00 ? 64 ARG A CD   9  
ATOM 10183 N NE   . ARG A 1 64 ? 9.165   7.972   -4.741  1.00 0.00 ? 64 ARG A NE   9  
ATOM 10184 C CZ   . ARG A 1 64 ? 8.830   7.602   -5.972  1.00 0.00 ? 64 ARG A CZ   9  
ATOM 10185 N NH1  . ARG A 1 64 ? 7.553   7.465   -6.302  1.00 0.00 ? 64 ARG A NH1  9  
ATOM 10186 N NH2  . ARG A 1 64 ? 9.773   7.369   -6.876  1.00 0.00 ? 64 ARG A NH2  9  
ATOM 10187 H H    . ARG A 1 64 ? 10.217  4.979   -0.605  1.00 0.00 ? 64 ARG A H    9  
ATOM 10188 H HA   . ARG A 1 64 ? 11.077  7.606   -0.818  1.00 0.00 ? 64 ARG A HA   9  
ATOM 10189 H HB2  . ARG A 1 64 ? 9.771   6.473   -2.554  1.00 0.00 ? 64 ARG A HB2  9  
ATOM 10190 H HB3  . ARG A 1 64 ? 8.359   6.476   -1.506  1.00 0.00 ? 64 ARG A HB3  9  
ATOM 10191 H HG2  . ARG A 1 64 ? 8.154   8.833   -1.639  1.00 0.00 ? 64 ARG A HG2  9  
ATOM 10192 H HG3  . ARG A 1 64 ? 9.733   8.990   -2.412  1.00 0.00 ? 64 ARG A HG3  9  
ATOM 10193 H HD2  . ARG A 1 64 ? 7.475   7.442   -3.653  1.00 0.00 ? 64 ARG A HD2  9  
ATOM 10194 H HD3  . ARG A 1 64 ? 7.685   9.173   -3.912  1.00 0.00 ? 64 ARG A HD3  9  
ATOM 10195 H HE   . ARG A 1 64 ? 10.115  8.067   -4.519  1.00 0.00 ? 64 ARG A HE   9  
ATOM 10196 H HH11 . ARG A 1 64 ? 6.841   7.641   -5.623  1.00 0.00 ? 64 ARG A HH11 9  
ATOM 10197 H HH12 . ARG A 1 64 ? 7.303   7.187   -7.229  1.00 0.00 ? 64 ARG A HH12 9  
ATOM 10198 H HH21 . ARG A 1 64 ? 10.736  7.472   -6.631  1.00 0.00 ? 64 ARG A HH21 9  
ATOM 10199 H HH22 . ARG A 1 64 ? 9.519   7.091   -7.802  1.00 0.00 ? 64 ARG A HH22 9  
ATOM 10200 N N    . SER A 1 65 ? 8.478   7.256   1.189   1.00 0.00 ? 65 SER A N    9  
ATOM 10201 C CA   . SER A 1 65 ? 7.732   7.897   2.265   1.00 0.00 ? 65 SER A CA   9  
ATOM 10202 C C    . SER A 1 65 ? 8.662   8.309   3.402   1.00 0.00 ? 65 SER A C    9  
ATOM 10203 O O    . SER A 1 65 ? 8.522   9.389   3.974   1.00 0.00 ? 65 SER A O    9  
ATOM 10204 C CB   . SER A 1 65 ? 6.648   6.955   2.794   1.00 0.00 ? 65 SER A CB   9  
ATOM 10205 O OG   . SER A 1 65 ? 6.002   7.507   3.928   1.00 0.00 ? 65 SER A OG   9  
ATOM 10206 H H    . SER A 1 65 ? 8.240   6.345   0.918   1.00 0.00 ? 65 SER A H    9  
ATOM 10207 H HA   . SER A 1 65 ? 7.262   8.781   1.862   1.00 0.00 ? 65 SER A HA   9  
ATOM 10208 H HB2  . SER A 1 65 ? 5.913   6.787   2.022   1.00 0.00 ? 65 SER A HB2  9  
ATOM 10209 H HB3  . SER A 1 65 ? 7.099   6.014   3.074   1.00 0.00 ? 65 SER A HB3  9  
ATOM 10210 H HG   . SER A 1 65 ? 5.564   8.324   3.680   1.00 0.00 ? 65 SER A HG   9  
ATOM 10211 N N    . GLY A 1 66 ? 9.615   7.438   3.723   1.00 0.00 ? 66 GLY A N    9  
ATOM 10212 C CA   . GLY A 1 66 ? 10.555  7.728   4.790   1.00 0.00 ? 66 GLY A CA   9  
ATOM 10213 C C    . GLY A 1 66 ? 11.568  8.786   4.398   1.00 0.00 ? 66 GLY A C    9  
ATOM 10214 O O    . GLY A 1 66 ? 11.339  9.591   3.496   1.00 0.00 ? 66 GLY A O    9  
ATOM 10215 H H    . GLY A 1 66 ? 9.679   6.592   3.233   1.00 0.00 ? 66 GLY A H    9  
ATOM 10216 H HA2  . GLY A 1 66 ? 10.008  8.072   5.655   1.00 0.00 ? 66 GLY A HA2  9  
ATOM 10217 H HA3  . GLY A 1 66 ? 11.081  6.821   5.047   1.00 0.00 ? 66 GLY A HA3  9  
ATOM 10218 N N    . PRO A 1 67 ? 12.718  8.794   5.088   1.00 0.00 ? 67 PRO A N    9  
ATOM 10219 C CA   . PRO A 1 67 ? 13.792  9.756   4.826   1.00 0.00 ? 67 PRO A CA   9  
ATOM 10220 C C    . PRO A 1 67 ? 14.482  9.505   3.489   1.00 0.00 ? 67 PRO A C    9  
ATOM 10221 O O    . PRO A 1 67 ? 14.299  8.456   2.873   1.00 0.00 ? 67 PRO A O    9  
ATOM 10222 C CB   . PRO A 1 67 ? 14.768  9.523   5.982   1.00 0.00 ? 67 PRO A CB   9  
ATOM 10223 C CG   . PRO A 1 67 ? 14.524  8.116   6.407   1.00 0.00 ? 67 PRO A CG   9  
ATOM 10224 C CD   . PRO A 1 67 ? 13.059  7.863   6.177   1.00 0.00 ? 67 PRO A CD   9  
ATOM 10225 H HA   . PRO A 1 67 ? 13.430  10.773  4.857   1.00 0.00 ? 67 PRO A HA   9  
ATOM 10226 H HB2  . PRO A 1 67 ? 15.782  9.662   5.635   1.00 0.00 ? 67 PRO A HB2  9  
ATOM 10227 H HB3  . PRO A 1 67 ? 14.557  10.219  6.781   1.00 0.00 ? 67 PRO A HB3  9  
ATOM 10228 H HG2  . PRO A 1 67 ? 15.119  7.444   5.808   1.00 0.00 ? 67 PRO A HG2  9  
ATOM 10229 H HG3  . PRO A 1 67 ? 14.764  8.002   7.453   1.00 0.00 ? 67 PRO A HG3  9  
ATOM 10230 H HD2  . PRO A 1 67 ? 12.896  6.839   5.875   1.00 0.00 ? 67 PRO A HD2  9  
ATOM 10231 H HD3  . PRO A 1 67 ? 12.493  8.090   7.068   1.00 0.00 ? 67 PRO A HD3  9  
ATOM 10232 N N    . SER A 1 68 ? 15.276  10.475  3.047   1.00 0.00 ? 68 SER A N    9  
ATOM 10233 C CA   . SER A 1 68 ? 15.991  10.360  1.781   1.00 0.00 ? 68 SER A CA   9  
ATOM 10234 C C    . SER A 1 68 ? 17.487  10.582  1.980   1.00 0.00 ? 68 SER A C    9  
ATOM 10235 O O    . SER A 1 68 ? 18.301  9.710   1.675   1.00 0.00 ? 68 SER A O    9  
ATOM 10236 C CB   . SER A 1 68 ? 15.444  11.369  0.769   1.00 0.00 ? 68 SER A CB   9  
ATOM 10237 O OG   . SER A 1 68 ? 16.074  11.219  -0.492  1.00 0.00 ? 68 SER A OG   9  
ATOM 10238 H H    . SER A 1 68 ? 15.382  11.288  3.584   1.00 0.00 ? 68 SER A H    9  
ATOM 10239 H HA   . SER A 1 68 ? 15.834  9.361   1.401   1.00 0.00 ? 68 SER A HA   9  
ATOM 10240 H HB2  . SER A 1 68 ? 14.383  11.214  0.648   1.00 0.00 ? 68 SER A HB2  9  
ATOM 10241 H HB3  . SER A 1 68 ? 15.623  12.371  1.131   1.00 0.00 ? 68 SER A HB3  9  
ATOM 10242 H HG   . SER A 1 68 ? 17.004  11.019  -0.363  1.00 0.00 ? 68 SER A HG   9  
ATOM 10243 N N    . SER A 1 69 ? 17.842  11.755  2.493   1.00 0.00 ? 69 SER A N    9  
ATOM 10244 C CA   . SER A 1 69 ? 19.240  12.095  2.730   1.00 0.00 ? 69 SER A CA   9  
ATOM 10245 C C    . SER A 1 69 ? 19.877  11.119  3.715   1.00 0.00 ? 69 SER A C    9  
ATOM 10246 O O    . SER A 1 69 ? 19.250  10.705  4.689   1.00 0.00 ? 69 SER A O    9  
ATOM 10247 C CB   . SER A 1 69 ? 19.356  13.524  3.263   1.00 0.00 ? 69 SER A CB   9  
ATOM 10248 O OG   . SER A 1 69 ? 20.713  13.917  3.377   1.00 0.00 ? 69 SER A OG   9  
ATOM 10249 H H    . SER A 1 69 ? 17.146  12.409  2.716   1.00 0.00 ? 69 SER A H    9  
ATOM 10250 H HA   . SER A 1 69 ? 19.762  12.028  1.787   1.00 0.00 ? 69 SER A HA   9  
ATOM 10251 H HB2  . SER A 1 69 ? 18.854  14.200  2.587   1.00 0.00 ? 69 SER A HB2  9  
ATOM 10252 H HB3  . SER A 1 69 ? 18.894  13.581  4.238   1.00 0.00 ? 69 SER A HB3  9  
ATOM 10253 H HG   . SER A 1 69 ? 21.185  13.285  3.924   1.00 0.00 ? 69 SER A HG   9  
ATOM 10254 N N    . GLY A 1 70 ? 21.129  10.756  3.453   1.00 0.00 ? 70 GLY A N    9  
ATOM 10255 C CA   . GLY A 1 70 ? 21.831  9.832   4.324   1.00 0.00 ? 70 GLY A CA   9  
ATOM 10256 C C    . GLY A 1 70 ? 23.109  9.306   3.702   1.00 0.00 ? 70 GLY A C    9  
ATOM 10257 O O    . GLY A 1 70 ? 24.207  9.631   4.154   1.00 0.00 ? 70 GLY A O    9  
ATOM 10258 H H    . GLY A 1 70 ? 21.579  11.119  2.661   1.00 0.00 ? 70 GLY A H    9  
ATOM 10259 H HA2  . GLY A 1 70 ? 22.074  10.338  5.246   1.00 0.00 ? 70 GLY A HA2  9  
ATOM 10260 H HA3  . GLY A 1 70 ? 21.181  8.998   4.543   1.00 0.00 ? 70 GLY A HA3  9  
ATOM 10261 N N    . GLY A 1 1  ? -2.237  25.676  2.106   1.00 0.00 ? 1  GLY A N    10 
ATOM 10262 C CA   . GLY A 1 1  ? -2.000  24.308  1.684   1.00 0.00 ? 1  GLY A CA   10 
ATOM 10263 C C    . GLY A 1 1  ? -3.052  23.812  0.711   1.00 0.00 ? 1  GLY A C    10 
ATOM 10264 O O    . GLY A 1 1  ? -4.243  24.058  0.896   1.00 0.00 ? 1  GLY A O    10 
ATOM 10265 H H1   . GLY A 1 1  ? -1.540  26.354  1.979   1.00 0.00 ? 1  GLY A H1   10 
ATOM 10266 H HA2  . GLY A 1 1  ? -1.031  24.252  1.211   1.00 0.00 ? 1  GLY A HA2  10 
ATOM 10267 H HA3  . GLY A 1 1  ? -2.002  23.669  2.555   1.00 0.00 ? 1  GLY A HA3  10 
ATOM 10268 N N    . SER A 1 2  ? -2.610  23.113  -0.330  1.00 0.00 ? 2  SER A N    10 
ATOM 10269 C CA   . SER A 1 2  ? -3.521  22.585  -1.339  1.00 0.00 ? 2  SER A CA   10 
ATOM 10270 C C    . SER A 1 2  ? -3.389  21.069  -1.450  1.00 0.00 ? 2  SER A C    10 
ATOM 10271 O O    . SER A 1 2  ? -2.374  20.557  -1.922  1.00 0.00 ? 2  SER A O    10 
ATOM 10272 C CB   . SER A 1 2  ? -3.243  23.234  -2.696  1.00 0.00 ? 2  SER A CB   10 
ATOM 10273 O OG   . SER A 1 2  ? -1.972  22.852  -3.193  1.00 0.00 ? 2  SER A OG   10 
ATOM 10274 H H    . SER A 1 2  ? -1.647  22.950  -0.422  1.00 0.00 ? 2  SER A H    10 
ATOM 10275 H HA   . SER A 1 2  ? -4.528  22.826  -1.034  1.00 0.00 ? 2  SER A HA   10 
ATOM 10276 H HB2  . SER A 1 2  ? -4.000  22.926  -3.401  1.00 0.00 ? 2  SER A HB2  10 
ATOM 10277 H HB3  . SER A 1 2  ? -3.266  24.309  -2.589  1.00 0.00 ? 2  SER A HB3  10 
ATOM 10278 H HG   . SER A 1 2  ? -1.914  23.073  -4.126  1.00 0.00 ? 2  SER A HG   10 
ATOM 10279 N N    . SER A 1 3  ? -4.423  20.358  -1.012  1.00 0.00 ? 3  SER A N    10 
ATOM 10280 C CA   . SER A 1 3  ? -4.423  18.901  -1.059  1.00 0.00 ? 3  SER A CA   10 
ATOM 10281 C C    . SER A 1 3  ? -4.537  18.403  -2.497  1.00 0.00 ? 3  SER A C    10 
ATOM 10282 O O    . SER A 1 3  ? -4.699  19.191  -3.427  1.00 0.00 ? 3  SER A O    10 
ATOM 10283 C CB   . SER A 1 3  ? -5.574  18.342  -0.221  1.00 0.00 ? 3  SER A CB   10 
ATOM 10284 O OG   . SER A 1 3  ? -5.494  18.792  1.120   1.00 0.00 ? 3  SER A OG   10 
ATOM 10285 H H    . SER A 1 3  ? -5.204  20.825  -0.647  1.00 0.00 ? 3  SER A H    10 
ATOM 10286 H HA   . SER A 1 3  ? -3.487  18.556  -0.645  1.00 0.00 ? 3  SER A HA   10 
ATOM 10287 H HB2  . SER A 1 3  ? -6.513  18.668  -0.641  1.00 0.00 ? 3  SER A HB2  10 
ATOM 10288 H HB3  . SER A 1 3  ? -5.532  17.263  -0.230  1.00 0.00 ? 3  SER A HB3  10 
ATOM 10289 H HG   . SER A 1 3  ? -6.262  18.486  1.608   1.00 0.00 ? 3  SER A HG   10 
ATOM 10290 N N    . GLY A 1 4  ? -4.452  17.087  -2.670  1.00 0.00 ? 4  GLY A N    10 
ATOM 10291 C CA   . GLY A 1 4  ? -4.547  16.506  -3.996  1.00 0.00 ? 4  GLY A CA   10 
ATOM 10292 C C    . GLY A 1 4  ? -5.308  15.195  -4.001  1.00 0.00 ? 4  GLY A C    10 
ATOM 10293 O O    . GLY A 1 4  ? -5.923  14.823  -3.001  1.00 0.00 ? 4  GLY A O    10 
ATOM 10294 H H    . GLY A 1 4  ? -4.323  16.507  -1.890  1.00 0.00 ? 4  GLY A H    10 
ATOM 10295 H HA2  . GLY A 1 4  ? -5.050  17.204  -4.648  1.00 0.00 ? 4  GLY A HA2  10 
ATOM 10296 H HA3  . GLY A 1 4  ? -3.550  16.331  -4.372  1.00 0.00 ? 4  GLY A HA3  10 
ATOM 10297 N N    . SER A 1 5  ? -5.269  14.494  -5.129  1.00 0.00 ? 5  SER A N    10 
ATOM 10298 C CA   . SER A 1 5  ? -5.965  13.219  -5.262  1.00 0.00 ? 5  SER A CA   10 
ATOM 10299 C C    . SER A 1 5  ? -5.439  12.205  -4.250  1.00 0.00 ? 5  SER A C    10 
ATOM 10300 O O    . SER A 1 5  ? -4.371  12.391  -3.666  1.00 0.00 ? 5  SER A O    10 
ATOM 10301 C CB   . SER A 1 5  ? -5.804  12.671  -6.681  1.00 0.00 ? 5  SER A CB   10 
ATOM 10302 O OG   . SER A 1 5  ? -6.726  11.624  -6.931  1.00 0.00 ? 5  SER A OG   10 
ATOM 10303 H H    . SER A 1 5  ? -4.762  14.843  -5.891  1.00 0.00 ? 5  SER A H    10 
ATOM 10304 H HA   . SER A 1 5  ? -7.013  13.392  -5.068  1.00 0.00 ? 5  SER A HA   10 
ATOM 10305 H HB2  . SER A 1 5  ? -5.978  13.464  -7.392  1.00 0.00 ? 5  SER A HB2  10 
ATOM 10306 H HB3  . SER A 1 5  ? -4.801  12.290  -6.805  1.00 0.00 ? 5  SER A HB3  10 
ATOM 10307 H HG   . SER A 1 5  ? -6.973  11.630  -7.858  1.00 0.00 ? 5  SER A HG   10 
ATOM 10308 N N    . SER A 1 6  ? -6.197  11.132  -4.048  1.00 0.00 ? 6  SER A N    10 
ATOM 10309 C CA   . SER A 1 6  ? -5.811  10.090  -3.105  1.00 0.00 ? 6  SER A CA   10 
ATOM 10310 C C    . SER A 1 6  ? -5.251  8.874   -3.838  1.00 0.00 ? 6  SER A C    10 
ATOM 10311 O O    . SER A 1 6  ? -4.215  8.329   -3.459  1.00 0.00 ? 6  SER A O    10 
ATOM 10312 C CB   . SER A 1 6  ? -7.010  9.676   -2.250  1.00 0.00 ? 6  SER A CB   10 
ATOM 10313 O OG   . SER A 1 6  ? -6.589  9.121   -1.015  1.00 0.00 ? 6  SER A OG   10 
ATOM 10314 H H    . SER A 1 6  ? -7.038  11.041  -4.544  1.00 0.00 ? 6  SER A H    10 
ATOM 10315 H HA   . SER A 1 6  ? -5.042  10.493  -2.462  1.00 0.00 ? 6  SER A HA   10 
ATOM 10316 H HB2  . SER A 1 6  ? -7.623  10.542  -2.051  1.00 0.00 ? 6  SER A HB2  10 
ATOM 10317 H HB3  . SER A 1 6  ? -7.591  8.938   -2.783  1.00 0.00 ? 6  SER A HB3  10 
ATOM 10318 H HG   . SER A 1 6  ? -6.250  8.235   -1.162  1.00 0.00 ? 6  SER A HG   10 
ATOM 10319 N N    . GLY A 1 7  ? -5.946  8.454   -4.891  1.00 0.00 ? 7  GLY A N    10 
ATOM 10320 C CA   . GLY A 1 7  ? -5.505  7.306   -5.661  1.00 0.00 ? 7  GLY A CA   10 
ATOM 10321 C C    . GLY A 1 7  ? -6.545  6.844   -6.662  1.00 0.00 ? 7  GLY A C    10 
ATOM 10322 O O    . GLY A 1 7  ? -7.746  6.973   -6.425  1.00 0.00 ? 7  GLY A O    10 
ATOM 10323 H H    . GLY A 1 7  ? -6.765  8.928   -5.147  1.00 0.00 ? 7  GLY A H    10 
ATOM 10324 H HA2  . GLY A 1 7  ? -4.601  7.568   -6.192  1.00 0.00 ? 7  GLY A HA2  10 
ATOM 10325 H HA3  . GLY A 1 7  ? -5.289  6.493   -4.983  1.00 0.00 ? 7  GLY A HA3  10 
ATOM 10326 N N    . LYS A 1 8  ? -6.085  6.306   -7.786  1.00 0.00 ? 8  LYS A N    10 
ATOM 10327 C CA   . LYS A 1 8  ? -6.983  5.824   -8.828  1.00 0.00 ? 8  LYS A CA   10 
ATOM 10328 C C    . LYS A 1 8  ? -6.878  4.309   -8.979  1.00 0.00 ? 8  LYS A C    10 
ATOM 10329 O O    . LYS A 1 8  ? -5.783  3.763   -9.105  1.00 0.00 ? 8  LYS A O    10 
ATOM 10330 C CB   . LYS A 1 8  ? -6.663  6.503   -10.161 1.00 0.00 ? 8  LYS A CB   10 
ATOM 10331 C CG   . LYS A 1 8  ? -7.541  6.034   -11.309 1.00 0.00 ? 8  LYS A CG   10 
ATOM 10332 C CD   . LYS A 1 8  ? -7.262  6.819   -12.580 1.00 0.00 ? 8  LYS A CD   10 
ATOM 10333 C CE   . LYS A 1 8  ? -5.946  6.399   -13.217 1.00 0.00 ? 8  LYS A CE   10 
ATOM 10334 N NZ   . LYS A 1 8  ? -6.041  5.056   -13.854 1.00 0.00 ? 8  LYS A NZ   10 
ATOM 10335 H H    . LYS A 1 8  ? -5.116  6.230   -7.918  1.00 0.00 ? 8  LYS A H    10 
ATOM 10336 H HA   . LYS A 1 8  ? -7.992  6.075   -8.539  1.00 0.00 ? 8  LYS A HA   10 
ATOM 10337 H HB2  . LYS A 1 8  ? -6.793  7.569   -10.048 1.00 0.00 ? 8  LYS A HB2  10 
ATOM 10338 H HB3  . LYS A 1 8  ? -5.633  6.300   -10.417 1.00 0.00 ? 8  LYS A HB3  10 
ATOM 10339 H HG2  . LYS A 1 8  ? -7.347  4.988   -11.495 1.00 0.00 ? 8  LYS A HG2  10 
ATOM 10340 H HG3  . LYS A 1 8  ? -8.578  6.167   -11.035 1.00 0.00 ? 8  LYS A HG3  10 
ATOM 10341 H HD2  . LYS A 1 8  ? -8.061  6.643   -13.284 1.00 0.00 ? 8  LYS A HD2  10 
ATOM 10342 H HD3  . LYS A 1 8  ? -7.216  7.872   -12.341 1.00 0.00 ? 8  LYS A HD3  10 
ATOM 10343 H HE2  . LYS A 1 8  ? -5.676  7.126   -13.968 1.00 0.00 ? 8  LYS A HE2  10 
ATOM 10344 H HE3  . LYS A 1 8  ? -5.184  6.372   -12.452 1.00 0.00 ? 8  LYS A HE3  10 
ATOM 10345 H HZ1  . LYS A 1 8  ? -6.994  4.914   -14.245 1.00 0.00 ? 8  LYS A HZ1  10 
ATOM 10346 H HZ2  . LYS A 1 8  ? -5.853  4.313   -13.151 1.00 0.00 ? 8  LYS A HZ2  10 
ATOM 10347 H HZ3  . LYS A 1 8  ? -5.346  4.975   -14.623 1.00 0.00 ? 8  LYS A HZ3  10 
ATOM 10348 N N    . GLY A 1 9  ? -8.025  3.636   -8.967  1.00 0.00 ? 9  GLY A N    10 
ATOM 10349 C CA   . GLY A 1 9  ? -8.039  2.192   -9.105  1.00 0.00 ? 9  GLY A CA   10 
ATOM 10350 C C    . GLY A 1 9  ? -7.222  1.499   -8.032  1.00 0.00 ? 9  GLY A C    10 
ATOM 10351 O O    . GLY A 1 9  ? -7.331  1.826   -6.851  1.00 0.00 ? 9  GLY A O    10 
ATOM 10352 H H    . GLY A 1 9  ? -8.868  4.125   -8.864  1.00 0.00 ? 9  GLY A H    10 
ATOM 10353 H HA2  . GLY A 1 9  ? -9.060  1.845   -9.046  1.00 0.00 ? 9  GLY A HA2  10 
ATOM 10354 H HA3  . GLY A 1 9  ? -7.636  1.930   -10.073 1.00 0.00 ? 9  GLY A HA3  10 
ATOM 10355 N N    . GLY A 1 10 ? -6.403  0.536   -8.444  1.00 0.00 ? 10 GLY A N    10 
ATOM 10356 C CA   . GLY A 1 10 ? -5.578  -0.191  -7.496  1.00 0.00 ? 10 GLY A CA   10 
ATOM 10357 C C    . GLY A 1 10 ? -5.567  -1.683  -7.763  1.00 0.00 ? 10 GLY A C    10 
ATOM 10358 O O    . GLY A 1 10 ? -5.989  -2.473  -6.918  1.00 0.00 ? 10 GLY A O    10 
ATOM 10359 H H    . GLY A 1 10 ? -6.358  0.318   -9.398  1.00 0.00 ? 10 GLY A H    10 
ATOM 10360 H HA2  . GLY A 1 10 ? -4.566  0.182   -7.556  1.00 0.00 ? 10 GLY A HA2  10 
ATOM 10361 H HA3  . GLY A 1 10 ? -5.957  -0.017  -6.500  1.00 0.00 ? 10 GLY A HA3  10 
ATOM 10362 N N    . GLN A 1 11 ? -5.086  -2.069  -8.940  1.00 0.00 ? 11 GLN A N    10 
ATOM 10363 C CA   . GLN A 1 11 ? -5.025  -3.477  -9.315  1.00 0.00 ? 11 GLN A CA   10 
ATOM 10364 C C    . GLN A 1 11 ? -4.328  -4.298  -8.236  1.00 0.00 ? 11 GLN A C    10 
ATOM 10365 O O    . GLN A 1 11 ? -3.119  -4.521  -8.295  1.00 0.00 ? 11 GLN A O    10 
ATOM 10366 C CB   . GLN A 1 11 ? -4.294  -3.639  -10.649 1.00 0.00 ? 11 GLN A CB   10 
ATOM 10367 C CG   . GLN A 1 11 ? -3.172  -2.634  -10.854 1.00 0.00 ? 11 GLN A CG   10 
ATOM 10368 C CD   . GLN A 1 11 ? -3.644  -1.365  -11.535 1.00 0.00 ? 11 GLN A CD   10 
ATOM 10369 O OE1  . GLN A 1 11 ? -4.746  -1.312  -12.081 1.00 0.00 ? 11 GLN A OE1  10 
ATOM 10370 N NE2  . GLN A 1 11 ? -2.809  -0.332  -11.507 1.00 0.00 ? 11 GLN A NE2  10 
ATOM 10371 H H    . GLN A 1 11 ? -4.765  -1.392  -9.570  1.00 0.00 ? 11 GLN A H    10 
ATOM 10372 H HA   . GLN A 1 11 ? -6.038  -3.834  -9.424  1.00 0.00 ? 11 GLN A HA   10 
ATOM 10373 H HB2  . GLN A 1 11 ? -3.872  -4.632  -10.696 1.00 0.00 ? 11 GLN A HB2  10 
ATOM 10374 H HB3  . GLN A 1 11 ? -5.005  -3.521  -11.453 1.00 0.00 ? 11 GLN A HB3  10 
ATOM 10375 H HG2  . GLN A 1 11 ? -2.758  -2.375  -9.891  1.00 0.00 ? 11 GLN A HG2  10 
ATOM 10376 H HG3  . GLN A 1 11 ? -2.406  -3.090  -11.464 1.00 0.00 ? 11 GLN A HG3  10 
ATOM 10377 H HE21 . GLN A 1 11 ? -1.947  -0.447  -11.055 1.00 0.00 ? 11 GLN A HE21 10 
ATOM 10378 H HE22 . GLN A 1 11 ? -3.088  0.500   -11.940 1.00 0.00 ? 11 GLN A HE22 10 
ATOM 10379 N N    . VAL A 1 12 ? -5.099  -4.746  -7.250  1.00 0.00 ? 12 VAL A N    10 
ATOM 10380 C CA   . VAL A 1 12 ? -4.555  -5.544  -6.157  1.00 0.00 ? 12 VAL A CA   10 
ATOM 10381 C C    . VAL A 1 12 ? -5.231  -6.909  -6.084  1.00 0.00 ? 12 VAL A C    10 
ATOM 10382 O O    . VAL A 1 12 ? -6.409  -7.048  -6.415  1.00 0.00 ? 12 VAL A O    10 
ATOM 10383 C CB   . VAL A 1 12 ? -4.720  -4.828  -4.803  1.00 0.00 ? 12 VAL A CB   10 
ATOM 10384 C CG1  . VAL A 1 12 ? -6.192  -4.601  -4.495  1.00 0.00 ? 12 VAL A CG1  10 
ATOM 10385 C CG2  . VAL A 1 12 ? -4.052  -5.626  -3.694  1.00 0.00 ? 12 VAL A CG2  10 
ATOM 10386 H H    . VAL A 1 12 ? -6.056  -4.536  -7.258  1.00 0.00 ? 12 VAL A H    10 
ATOM 10387 H HA   . VAL A 1 12 ? -3.500  -5.685  -6.339  1.00 0.00 ? 12 VAL A HA   10 
ATOM 10388 H HB   . VAL A 1 12 ? -4.236  -3.865  -4.867  1.00 0.00 ? 12 VAL A HB   10 
ATOM 10389 H HG11 . VAL A 1 12 ? -6.484  -3.619  -4.837  1.00 0.00 ? 12 VAL A HG11 10 
ATOM 10390 H HG12 . VAL A 1 12 ? -6.786  -5.350  -4.999  1.00 0.00 ? 12 VAL A HG12 10 
ATOM 10391 H HG13 . VAL A 1 12 ? -6.352  -4.672  -3.429  1.00 0.00 ? 12 VAL A HG13 10 
ATOM 10392 H HG21 . VAL A 1 12 ? -3.342  -6.316  -4.125  1.00 0.00 ? 12 VAL A HG21 10 
ATOM 10393 H HG22 . VAL A 1 12 ? -3.537  -4.952  -3.025  1.00 0.00 ? 12 VAL A HG22 10 
ATOM 10394 H HG23 . VAL A 1 12 ? -4.801  -6.176  -3.144  1.00 0.00 ? 12 VAL A HG23 10 
ATOM 10395 N N    . ARG A 1 13 ? -4.479  -7.913  -5.646  1.00 0.00 ? 13 ARG A N    10 
ATOM 10396 C CA   . ARG A 1 13 ? -5.005  -9.268  -5.530  1.00 0.00 ? 13 ARG A CA   10 
ATOM 10397 C C    . ARG A 1 13 ? -4.800  -9.811  -4.119  1.00 0.00 ? 13 ARG A C    10 
ATOM 10398 O O    . ARG A 1 13 ? -3.887  -10.599 -3.872  1.00 0.00 ? 13 ARG A O    10 
ATOM 10399 C CB   . ARG A 1 13 ? -4.329  -10.190 -6.546  1.00 0.00 ? 13 ARG A CB   10 
ATOM 10400 C CG   . ARG A 1 13 ? -5.044  -10.247 -7.886  1.00 0.00 ? 13 ARG A CG   10 
ATOM 10401 C CD   . ARG A 1 13 ? -4.384  -11.243 -8.827  1.00 0.00 ? 13 ARG A CD   10 
ATOM 10402 N NE   . ARG A 1 13 ? -4.942  -12.585 -8.684  1.00 0.00 ? 13 ARG A NE   10 
ATOM 10403 C CZ   . ARG A 1 13 ? -6.159  -12.923 -9.094  1.00 0.00 ? 13 ARG A CZ   10 
ATOM 10404 N NH1  . ARG A 1 13 ? -6.941  -12.022 -9.672  1.00 0.00 ? 13 ARG A NH1  10 
ATOM 10405 N NH2  . ARG A 1 13 ? -6.595  -14.165 -8.928  1.00 0.00 ? 13 ARG A NH2  10 
ATOM 10406 H H    . ARG A 1 13 ? -3.547  -7.739  -5.397  1.00 0.00 ? 13 ARG A H    10 
ATOM 10407 H HA   . ARG A 1 13 ? -6.064  -9.231  -5.739  1.00 0.00 ? 13 ARG A HA   10 
ATOM 10408 H HB2  . ARG A 1 13 ? -3.321  -9.841  -6.716  1.00 0.00 ? 13 ARG A HB2  10 
ATOM 10409 H HB3  . ARG A 1 13 ? -4.292  -11.189 -6.139  1.00 0.00 ? 13 ARG A HB3  10 
ATOM 10410 H HG2  . ARG A 1 13 ? -6.069  -10.548 -7.724  1.00 0.00 ? 13 ARG A HG2  10 
ATOM 10411 H HG3  . ARG A 1 13 ? -5.021  -9.267  -8.338  1.00 0.00 ? 13 ARG A HG3  10 
ATOM 10412 H HD2  . ARG A 1 13 ? -4.532  -10.909 -9.844  1.00 0.00 ? 13 ARG A HD2  10 
ATOM 10413 H HD3  . ARG A 1 13 ? -3.327  -11.277 -8.610  1.00 0.00 ? 13 ARG A HD3  10 
ATOM 10414 H HE   . ARG A 1 13 ? -4.380  -13.266 -8.260  1.00 0.00 ? 13 ARG A HE   10 
ATOM 10415 H HH11 . ARG A 1 13 ? -6.615  -11.086 -9.799  1.00 0.00 ? 13 ARG A HH11 10 
ATOM 10416 H HH12 . ARG A 1 13 ? -7.857  -12.279 -9.981  1.00 0.00 ? 13 ARG A HH12 10 
ATOM 10417 H HH21 . ARG A 1 13 ? -6.008  -14.847 -8.494  1.00 0.00 ? 13 ARG A HH21 10 
ATOM 10418 H HH22 . ARG A 1 13 ? -7.511  -14.419 -9.238  1.00 0.00 ? 13 ARG A HH22 10 
ATOM 10419 N N    . PHE A 1 14 ? -5.655  -9.383  -3.196  1.00 0.00 ? 14 PHE A N    10 
ATOM 10420 C CA   . PHE A 1 14 ? -5.567  -9.826  -1.809  1.00 0.00 ? 14 PHE A CA   10 
ATOM 10421 C C    . PHE A 1 14 ? -6.885  -9.587  -1.077  1.00 0.00 ? 14 PHE A C    10 
ATOM 10422 O O    . PHE A 1 14 ? -7.657  -8.700  -1.440  1.00 0.00 ? 14 PHE A O    10 
ATOM 10423 C CB   . PHE A 1 14 ? -4.432  -9.095  -1.089  1.00 0.00 ? 14 PHE A CB   10 
ATOM 10424 C CG   . PHE A 1 14 ? -3.064  -9.562  -1.498  1.00 0.00 ? 14 PHE A CG   10 
ATOM 10425 C CD1  . PHE A 1 14 ? -2.599  -10.808 -1.110  1.00 0.00 ? 14 PHE A CD1  10 
ATOM 10426 C CD2  . PHE A 1 14 ? -2.244  -8.755  -2.270  1.00 0.00 ? 14 PHE A CD2  10 
ATOM 10427 C CE1  . PHE A 1 14 ? -1.340  -11.239 -1.484  1.00 0.00 ? 14 PHE A CE1  10 
ATOM 10428 C CE2  . PHE A 1 14 ? -0.985  -9.181  -2.648  1.00 0.00 ? 14 PHE A CE2  10 
ATOM 10429 C CZ   . PHE A 1 14 ? -0.533  -10.426 -2.255  1.00 0.00 ? 14 PHE A CZ   10 
ATOM 10430 H H    . PHE A 1 14 ? -6.362  -8.755  -3.453  1.00 0.00 ? 14 PHE A H    10 
ATOM 10431 H HA   . PHE A 1 14 ? -5.358  -10.884 -1.812  1.00 0.00 ? 14 PHE A HA   10 
ATOM 10432 H HB2  . PHE A 1 14 ? -4.500  -8.039  -1.305  1.00 0.00 ? 14 PHE A HB2  10 
ATOM 10433 H HB3  . PHE A 1 14 ? -4.533  -9.248  -0.025  1.00 0.00 ? 14 PHE A HB3  10 
ATOM 10434 H HD1  . PHE A 1 14 ? -3.229  -11.446 -0.509  1.00 0.00 ? 14 PHE A HD1  10 
ATOM 10435 H HD2  . PHE A 1 14 ? -2.597  -7.780  -2.578  1.00 0.00 ? 14 PHE A HD2  10 
ATOM 10436 H HE1  . PHE A 1 14 ? -0.989  -12.213 -1.176  1.00 0.00 ? 14 PHE A HE1  10 
ATOM 10437 H HE2  . PHE A 1 14 ? -0.357  -8.542  -3.250  1.00 0.00 ? 14 PHE A HE2  10 
ATOM 10438 H HZ   . PHE A 1 14 ? 0.451   -10.761 -2.548  1.00 0.00 ? 14 PHE A HZ   10 
ATOM 10439 N N    . SER A 1 15 ? -7.135  -10.387 -0.045  1.00 0.00 ? 15 SER A N    10 
ATOM 10440 C CA   . SER A 1 15 ? -8.361  -10.267 0.735   1.00 0.00 ? 15 SER A CA   10 
ATOM 10441 C C    . SER A 1 15 ? -8.225  -9.178  1.796   1.00 0.00 ? 15 SER A C    10 
ATOM 10442 O O    . SER A 1 15 ? -7.131  -8.678  2.051   1.00 0.00 ? 15 SER A O    10 
ATOM 10443 C CB   . SER A 1 15 ? -8.700  -11.602 1.400   1.00 0.00 ? 15 SER A CB   10 
ATOM 10444 O OG   . SER A 1 15 ? -10.055 -11.636 1.814   1.00 0.00 ? 15 SER A OG   10 
ATOM 10445 H H    . SER A 1 15 ? -6.480  -11.075 0.195   1.00 0.00 ? 15 SER A H    10 
ATOM 10446 H HA   . SER A 1 15 ? -9.159  -9.997  0.060   1.00 0.00 ? 15 SER A HA   10 
ATOM 10447 H HB2  . SER A 1 15 ? -8.532  -12.404 0.697   1.00 0.00 ? 15 SER A HB2  10 
ATOM 10448 H HB3  . SER A 1 15 ? -8.068  -11.742 2.265   1.00 0.00 ? 15 SER A HB3  10 
ATOM 10449 H HG   . SER A 1 15 ? -10.117 -11.351 2.729   1.00 0.00 ? 15 SER A HG   10 
ATOM 10450 N N    . ASN A 1 16 ? -9.347  -8.816  2.409   1.00 0.00 ? 16 ASN A N    10 
ATOM 10451 C CA   . ASN A 1 16 ? -9.355  -7.786  3.442   1.00 0.00 ? 16 ASN A CA   10 
ATOM 10452 C C    . ASN A 1 16 ? -8.337  -8.102  4.533   1.00 0.00 ? 16 ASN A C    10 
ATOM 10453 O O    . ASN A 1 16 ? -7.387  -7.348  4.748   1.00 0.00 ? 16 ASN A O    10 
ATOM 10454 C CB   . ASN A 1 16 ? -10.752 -7.658  4.054   1.00 0.00 ? 16 ASN A CB   10 
ATOM 10455 C CG   . ASN A 1 16 ? -11.356 -9.005  4.400   1.00 0.00 ? 16 ASN A CG   10 
ATOM 10456 O OD1  . ASN A 1 16 ? -11.757 -9.764  3.517   1.00 0.00 ? 16 ASN A OD1  10 
ATOM 10457 N ND2  . ASN A 1 16 ? -11.425 -9.308  5.691   1.00 0.00 ? 16 ASN A ND2  10 
ATOM 10458 H H    . ASN A 1 16 ? -10.190 -9.251  2.162   1.00 0.00 ? 16 ASN A H    10 
ATOM 10459 H HA   . ASN A 1 16 ? -9.088  -6.848  2.977   1.00 0.00 ? 16 ASN A HA   10 
ATOM 10460 H HB2  . ASN A 1 16 ? -10.689 -7.070  4.958   1.00 0.00 ? 16 ASN A HB2  10 
ATOM 10461 H HB3  . ASN A 1 16 ? -11.403 -7.162  3.350   1.00 0.00 ? 16 ASN A HB3  10 
ATOM 10462 H HD21 . ASN A 1 16 ? -11.087 -8.655  6.339   1.00 0.00 ? 16 ASN A HD21 10 
ATOM 10463 H HD22 . ASN A 1 16 ? -11.811 -10.173 5.944   1.00 0.00 ? 16 ASN A HD22 10 
ATOM 10464 N N    . ASP A 1 17 ? -8.541  -9.221  5.219   1.00 0.00 ? 17 ASP A N    10 
ATOM 10465 C CA   . ASP A 1 17 ? -7.640  -9.638  6.287   1.00 0.00 ? 17 ASP A CA   10 
ATOM 10466 C C    . ASP A 1 17 ? -6.232  -9.875  5.749   1.00 0.00 ? 17 ASP A C    10 
ATOM 10467 O O    . ASP A 1 17 ? -5.245  -9.494  6.378   1.00 0.00 ? 17 ASP A O    10 
ATOM 10468 C CB   . ASP A 1 17 ? -8.163  -10.909 6.957   1.00 0.00 ? 17 ASP A CB   10 
ATOM 10469 C CG   . ASP A 1 17 ? -7.367  -11.283 8.192   1.00 0.00 ? 17 ASP A CG   10 
ATOM 10470 O OD1  . ASP A 1 17 ? -7.657  -10.731 9.274   1.00 0.00 ? 17 ASP A OD1  10 
ATOM 10471 O OD2  . ASP A 1 17 ? -6.453  -12.126 8.076   1.00 0.00 ? 17 ASP A OD2  10 
ATOM 10472 H H    . ASP A 1 17 ? -9.316  -9.780  5.001   1.00 0.00 ? 17 ASP A H    10 
ATOM 10473 H HA   . ASP A 1 17 ? -7.603  -8.845  7.019   1.00 0.00 ? 17 ASP A HA   10 
ATOM 10474 H HB2  . ASP A 1 17 ? -9.193  -10.757 7.248   1.00 0.00 ? 17 ASP A HB2  10 
ATOM 10475 H HB3  . ASP A 1 17 ? -8.109  -11.728 6.255   1.00 0.00 ? 17 ASP A HB3  10 
ATOM 10476 N N    . GLN A 1 18 ? -6.148  -10.507 4.583   1.00 0.00 ? 18 GLN A N    10 
ATOM 10477 C CA   . GLN A 1 18 ? -4.861  -10.796 3.962   1.00 0.00 ? 18 GLN A CA   10 
ATOM 10478 C C    . GLN A 1 18 ? -3.993  -9.543  3.901   1.00 0.00 ? 18 GLN A C    10 
ATOM 10479 O O    . GLN A 1 18 ? -2.847  -9.546  4.351   1.00 0.00 ? 18 GLN A O    10 
ATOM 10480 C CB   . GLN A 1 18 ? -5.065  -11.358 2.554   1.00 0.00 ? 18 GLN A CB   10 
ATOM 10481 C CG   . GLN A 1 18 ? -5.289  -12.862 2.526   1.00 0.00 ? 18 GLN A CG   10 
ATOM 10482 C CD   . GLN A 1 18 ? -5.570  -13.384 1.131   1.00 0.00 ? 18 GLN A CD   10 
ATOM 10483 O OE1  . GLN A 1 18 ? -5.511  -12.639 0.153   1.00 0.00 ? 18 GLN A OE1  10 
ATOM 10484 N NE2  . GLN A 1 18 ? -5.879  -14.672 1.032   1.00 0.00 ? 18 GLN A NE2  10 
ATOM 10485 H H    . GLN A 1 18 ? -6.971  -10.786 4.130   1.00 0.00 ? 18 GLN A H    10 
ATOM 10486 H HA   . GLN A 1 18 ? -4.360  -11.537 4.566   1.00 0.00 ? 18 GLN A HA   10 
ATOM 10487 H HB2  . GLN A 1 18 ? -5.924  -10.880 2.109   1.00 0.00 ? 18 GLN A HB2  10 
ATOM 10488 H HB3  . GLN A 1 18 ? -4.191  -11.136 1.960   1.00 0.00 ? 18 GLN A HB3  10 
ATOM 10489 H HG2  . GLN A 1 18 ? -4.404  -13.352 2.905   1.00 0.00 ? 18 GLN A HG2  10 
ATOM 10490 H HG3  . GLN A 1 18 ? -6.130  -13.099 3.160   1.00 0.00 ? 18 GLN A HG3  10 
ATOM 10491 H HE21 . GLN A 1 18 ? -5.908  -15.205 1.854   1.00 0.00 ? 18 GLN A HE21 10 
ATOM 10492 H HE22 . GLN A 1 18 ? -6.066  -15.036 0.142   1.00 0.00 ? 18 GLN A HE22 10 
ATOM 10493 N N    . THR A 1 19 ? -4.546  -8.472  3.340   1.00 0.00 ? 19 THR A N    10 
ATOM 10494 C CA   . THR A 1 19 ? -3.821  -7.214  3.218   1.00 0.00 ? 19 THR A CA   10 
ATOM 10495 C C    . THR A 1 19 ? -3.503  -6.628  4.589   1.00 0.00 ? 19 THR A C    10 
ATOM 10496 O O    . THR A 1 19 ? -2.433  -6.056  4.796   1.00 0.00 ? 19 THR A O    10 
ATOM 10497 C CB   . THR A 1 19 ? -4.624  -6.180  2.405   1.00 0.00 ? 19 THR A CB   10 
ATOM 10498 O OG1  . THR A 1 19 ? -4.929  -6.708  1.109   1.00 0.00 ? 19 THR A OG1  10 
ATOM 10499 C CG2  . THR A 1 19 ? -3.843  -4.883  2.259   1.00 0.00 ? 19 THR A CG2  10 
ATOM 10500 H H    . THR A 1 19 ? -5.462  -8.532  2.999   1.00 0.00 ? 19 THR A H    10 
ATOM 10501 H HA   . THR A 1 19 ? -2.896  -7.410  2.698   1.00 0.00 ? 19 THR A HA   10 
ATOM 10502 H HB   . THR A 1 19 ? -5.546  -5.971  2.927   1.00 0.00 ? 19 THR A HB   10 
ATOM 10503 H HG1  . THR A 1 19 ? -4.136  -7.085  0.721   1.00 0.00 ? 19 THR A HG1  10 
ATOM 10504 H HG21 . THR A 1 19 ? -3.054  -4.852  2.996   1.00 0.00 ? 19 THR A HG21 10 
ATOM 10505 H HG22 . THR A 1 19 ? -4.508  -4.045  2.407   1.00 0.00 ? 19 THR A HG22 10 
ATOM 10506 H HG23 . THR A 1 19 ? -3.414  -4.831  1.270   1.00 0.00 ? 19 THR A HG23 10 
ATOM 10507 N N    . ILE A 1 20 ? -4.438  -6.775  5.522   1.00 0.00 ? 20 ILE A N    10 
ATOM 10508 C CA   . ILE A 1 20 ? -4.255  -6.262  6.873   1.00 0.00 ? 20 ILE A CA   10 
ATOM 10509 C C    . ILE A 1 20 ? -2.990  -6.827  7.510   1.00 0.00 ? 20 ILE A C    10 
ATOM 10510 O O    . ILE A 1 20 ? -2.082  -6.082  7.876   1.00 0.00 ? 20 ILE A O    10 
ATOM 10511 C CB   . ILE A 1 20 ? -5.462  -6.596  7.771   1.00 0.00 ? 20 ILE A CB   10 
ATOM 10512 C CG1  . ILE A 1 20 ? -6.668  -5.740  7.381   1.00 0.00 ? 20 ILE A CG1  10 
ATOM 10513 C CG2  . ILE A 1 20 ? -5.107  -6.386  9.235   1.00 0.00 ? 20 ILE A CG2  10 
ATOM 10514 C CD1  . ILE A 1 20 ? -7.958  -6.180  8.037   1.00 0.00 ? 20 ILE A CD1  10 
ATOM 10515 H H    . ILE A 1 20 ? -5.270  -7.240  5.295   1.00 0.00 ? 20 ILE A H    10 
ATOM 10516 H HA   . ILE A 1 20 ? -4.165  -5.186  6.812   1.00 0.00 ? 20 ILE A HA   10 
ATOM 10517 H HB   . ILE A 1 20 ? -5.708  -7.638  7.631   1.00 0.00 ? 20 ILE A HB   10 
ATOM 10518 H HG12 . ILE A 1 20 ? -6.484  -4.717  7.667   1.00 0.00 ? 20 ILE A HG12 10 
ATOM 10519 H HG13 . ILE A 1 20 ? -6.805  -5.791  6.310   1.00 0.00 ? 20 ILE A HG13 10 
ATOM 10520 H HG21 . ILE A 1 20 ? -4.191  -5.817  9.306   1.00 0.00 ? 20 ILE A HG21 10 
ATOM 10521 H HG22 . ILE A 1 20 ? -5.904  -5.845  9.724   1.00 0.00 ? 20 ILE A HG22 10 
ATOM 10522 H HG23 . ILE A 1 20 ? -4.974  -7.344  9.715   1.00 0.00 ? 20 ILE A HG23 10 
ATOM 10523 H HD11 . ILE A 1 20 ? -8.755  -6.171  7.307   1.00 0.00 ? 20 ILE A HD11 10 
ATOM 10524 H HD12 . ILE A 1 20 ? -7.841  -7.178  8.430   1.00 0.00 ? 20 ILE A HD12 10 
ATOM 10525 H HD13 . ILE A 1 20 ? -8.202  -5.502  8.842   1.00 0.00 ? 20 ILE A HD13 10 
ATOM 10526 N N    . GLU A 1 21 ? -2.938  -8.149  7.636   1.00 0.00 ? 21 GLU A N    10 
ATOM 10527 C CA   . GLU A 1 21 ? -1.783  -8.814  8.227   1.00 0.00 ? 21 GLU A CA   10 
ATOM 10528 C C    . GLU A 1 21 ? -0.541  -8.618  7.363   1.00 0.00 ? 21 GLU A C    10 
ATOM 10529 O O    . GLU A 1 21 ? 0.512   -8.206  7.852   1.00 0.00 ? 21 GLU A O    10 
ATOM 10530 C CB   . GLU A 1 21 ? -2.062  -10.308 8.406   1.00 0.00 ? 21 GLU A CB   10 
ATOM 10531 C CG   . GLU A 1 21 ? -2.721  -10.649 9.732   1.00 0.00 ? 21 GLU A CG   10 
ATOM 10532 C CD   . GLU A 1 21 ? -1.713  -10.938 10.827  1.00 0.00 ? 21 GLU A CD   10 
ATOM 10533 O OE1  . GLU A 1 21 ? -0.940  -11.909 10.681  1.00 0.00 ? 21 GLU A OE1  10 
ATOM 10534 O OE2  . GLU A 1 21 ? -1.695  -10.194 11.830  1.00 0.00 ? 21 GLU A OE2  10 
ATOM 10535 H H    . GLU A 1 21 ? -3.693  -8.690  7.325   1.00 0.00 ? 21 GLU A H    10 
ATOM 10536 H HA   . GLU A 1 21 ? -1.605  -8.372  9.196   1.00 0.00 ? 21 GLU A HA   10 
ATOM 10537 H HB2  . GLU A 1 21 ? -2.712  -10.638 7.609   1.00 0.00 ? 21 GLU A HB2  10 
ATOM 10538 H HB3  . GLU A 1 21 ? -1.128  -10.846 8.343   1.00 0.00 ? 21 GLU A HB3  10 
ATOM 10539 H HG2  . GLU A 1 21 ? -3.335  -9.816  10.040  1.00 0.00 ? 21 GLU A HG2  10 
ATOM 10540 H HG3  . GLU A 1 21 ? -3.343  -11.522 9.597   1.00 0.00 ? 21 GLU A HG3  10 
ATOM 10541 N N    . LEU A 1 22 ? -0.670  -8.918  6.075   1.00 0.00 ? 22 LEU A N    10 
ATOM 10542 C CA   . LEU A 1 22 ? 0.441   -8.775  5.141   1.00 0.00 ? 22 LEU A CA   10 
ATOM 10543 C C    . LEU A 1 22 ? 1.266   -7.533  5.461   1.00 0.00 ? 22 LEU A C    10 
ATOM 10544 O O    . LEU A 1 22 ? 2.487   -7.531  5.308   1.00 0.00 ? 22 LEU A O    10 
ATOM 10545 C CB   . LEU A 1 22 ? -0.081  -8.699  3.705   1.00 0.00 ? 22 LEU A CB   10 
ATOM 10546 C CG   . LEU A 1 22 ? -0.337  -10.038 3.012   1.00 0.00 ? 22 LEU A CG   10 
ATOM 10547 C CD1  . LEU A 1 22 ? -0.975  -9.820  1.648   1.00 0.00 ? 22 LEU A CD1  10 
ATOM 10548 C CD2  . LEU A 1 22 ? 0.958   -10.826 2.878   1.00 0.00 ? 22 LEU A CD2  10 
ATOM 10549 H H    . LEU A 1 22 ? -1.533  -9.242  5.743   1.00 0.00 ? 22 LEU A H    10 
ATOM 10550 H HA   . LEU A 1 22 ? 1.071   -9.646  5.240   1.00 0.00 ? 22 LEU A HA   10 
ATOM 10551 H HB2  . LEU A 1 22 ? -1.010  -8.151  3.719   1.00 0.00 ? 22 LEU A HB2  10 
ATOM 10552 H HB3  . LEU A 1 22 ? 0.646   -8.156  3.118   1.00 0.00 ? 22 LEU A HB3  10 
ATOM 10553 H HG   . LEU A 1 22 ? -1.024  -10.621 3.611   1.00 0.00 ? 22 LEU A HG   10 
ATOM 10554 H HD11 . LEU A 1 22 ? -1.848  -10.447 1.555   1.00 0.00 ? 22 LEU A HD11 10 
ATOM 10555 H HD12 . LEU A 1 22 ? -0.265  -10.074 0.875   1.00 0.00 ? 22 LEU A HD12 10 
ATOM 10556 H HD13 . LEU A 1 22 ? -1.261  -8.784  1.547   1.00 0.00 ? 22 LEU A HD13 10 
ATOM 10557 H HD21 . LEU A 1 22 ? 0.997   -11.586 3.644   1.00 0.00 ? 22 LEU A HD21 10 
ATOM 10558 H HD22 . LEU A 1 22 ? 1.799   -10.157 2.990   1.00 0.00 ? 22 LEU A HD22 10 
ATOM 10559 H HD23 . LEU A 1 22 ? 0.996   -11.293 1.905   1.00 0.00 ? 22 LEU A HD23 10 
ATOM 10560 N N    . GLU A 1 23 ? 0.590   -6.479  5.906   1.00 0.00 ? 23 GLU A N    10 
ATOM 10561 C CA   . GLU A 1 23 ? 1.261   -5.230  6.249   1.00 0.00 ? 23 GLU A CA   10 
ATOM 10562 C C    . GLU A 1 23 ? 1.885   -5.312  7.640   1.00 0.00 ? 23 GLU A C    10 
ATOM 10563 O O    . GLU A 1 23 ? 3.087   -5.106  7.807   1.00 0.00 ? 23 GLU A O    10 
ATOM 10564 C CB   . GLU A 1 23 ? 0.276   -4.062  6.188   1.00 0.00 ? 23 GLU A CB   10 
ATOM 10565 C CG   . GLU A 1 23 ? 0.087   -3.497  4.790   1.00 0.00 ? 23 GLU A CG   10 
ATOM 10566 C CD   . GLU A 1 23 ? 1.109   -2.431  4.448   1.00 0.00 ? 23 GLU A CD   10 
ATOM 10567 O OE1  . GLU A 1 23 ? 2.283   -2.585  4.848   1.00 0.00 ? 23 GLU A OE1  10 
ATOM 10568 O OE2  . GLU A 1 23 ? 0.737   -1.442  3.783   1.00 0.00 ? 23 GLU A OE2  10 
ATOM 10569 H H    . GLU A 1 23 ? -0.383  -6.541  6.007   1.00 0.00 ? 23 GLU A H    10 
ATOM 10570 H HA   . GLU A 1 23 ? 2.045   -5.066  5.526   1.00 0.00 ? 23 GLU A HA   10 
ATOM 10571 H HB2  . GLU A 1 23 ? -0.684  -4.397  6.552   1.00 0.00 ? 23 GLU A HB2  10 
ATOM 10572 H HB3  . GLU A 1 23 ? 0.636   -3.269  6.827   1.00 0.00 ? 23 GLU A HB3  10 
ATOM 10573 H HG2  . GLU A 1 23 ? 0.177   -4.302  4.076   1.00 0.00 ? 23 GLU A HG2  10 
ATOM 10574 H HG3  . GLU A 1 23 ? -0.900  -3.064  4.721   1.00 0.00 ? 23 GLU A HG3  10 
ATOM 10575 N N    . LYS A 1 24 ? 1.058   -5.614  8.635   1.00 0.00 ? 24 LYS A N    10 
ATOM 10576 C CA   . LYS A 1 24 ? 1.526   -5.724  10.012  1.00 0.00 ? 24 LYS A CA   10 
ATOM 10577 C C    . LYS A 1 24 ? 2.851   -6.476  10.078  1.00 0.00 ? 24 LYS A C    10 
ATOM 10578 O O    . LYS A 1 24 ? 3.619   -6.320  11.027  1.00 0.00 ? 24 LYS A O    10 
ATOM 10579 C CB   . LYS A 1 24 ? 0.480   -6.436  10.872  1.00 0.00 ? 24 LYS A CB   10 
ATOM 10580 C CG   . LYS A 1 24 ? -0.861  -5.722  10.915  1.00 0.00 ? 24 LYS A CG   10 
ATOM 10581 C CD   . LYS A 1 24 ? -1.930  -6.584  11.565  1.00 0.00 ? 24 LYS A CD   10 
ATOM 10582 C CE   . LYS A 1 24 ? -3.002  -5.734  12.230  1.00 0.00 ? 24 LYS A CE   10 
ATOM 10583 N NZ   . LYS A 1 24 ? -4.111  -6.566  12.775  1.00 0.00 ? 24 LYS A NZ   10 
ATOM 10584 H H    . LYS A 1 24 ? 0.110   -5.767  8.439   1.00 0.00 ? 24 LYS A H    10 
ATOM 10585 H HA   . LYS A 1 24 ? 1.673   -4.725  10.393  1.00 0.00 ? 24 LYS A HA   10 
ATOM 10586 H HB2  . LYS A 1 24 ? 0.323   -7.429  10.478  1.00 0.00 ? 24 LYS A HB2  10 
ATOM 10587 H HB3  . LYS A 1 24 ? 0.855   -6.514  11.883  1.00 0.00 ? 24 LYS A HB3  10 
ATOM 10588 H HG2  . LYS A 1 24 ? -0.755  -4.810  11.482  1.00 0.00 ? 24 LYS A HG2  10 
ATOM 10589 H HG3  . LYS A 1 24 ? -1.165  -5.487  9.905   1.00 0.00 ? 24 LYS A HG3  10 
ATOM 10590 H HD2  . LYS A 1 24 ? -2.393  -7.200  10.809  1.00 0.00 ? 24 LYS A HD2  10 
ATOM 10591 H HD3  . LYS A 1 24 ? -1.468  -7.214  12.312  1.00 0.00 ? 24 LYS A HD3  10 
ATOM 10592 H HE2  . LYS A 1 24 ? -2.552  -5.176  13.036  1.00 0.00 ? 24 LYS A HE2  10 
ATOM 10593 H HE3  . LYS A 1 24 ? -3.404  -5.048  11.498  1.00 0.00 ? 24 LYS A HE3  10 
ATOM 10594 H HZ1  . LYS A 1 24 ? -4.268  -7.394  12.166  1.00 0.00 ? 24 LYS A HZ1  10 
ATOM 10595 H HZ2  . LYS A 1 24 ? -4.988  -6.009  12.816  1.00 0.00 ? 24 LYS A HZ2  10 
ATOM 10596 H HZ3  . LYS A 1 24 ? -3.874  -6.892  13.733  1.00 0.00 ? 24 LYS A HZ3  10 
ATOM 10597 N N    . LYS A 1 25 ? 3.114   -7.292  9.063   1.00 0.00 ? 25 LYS A N    10 
ATOM 10598 C CA   . LYS A 1 25 ? 4.348   -8.067  9.003   1.00 0.00 ? 25 LYS A CA   10 
ATOM 10599 C C    . LYS A 1 25 ? 5.479   -7.242  8.398   1.00 0.00 ? 25 LYS A C    10 
ATOM 10600 O O    . LYS A 1 25 ? 6.546   -7.099  8.997   1.00 0.00 ? 25 LYS A O    10 
ATOM 10601 C CB   . LYS A 1 25 ? 4.135   -9.341  8.182   1.00 0.00 ? 25 LYS A CB   10 
ATOM 10602 C CG   . LYS A 1 25 ? 5.267   -10.345 8.313   1.00 0.00 ? 25 LYS A CG   10 
ATOM 10603 C CD   . LYS A 1 25 ? 5.397   -10.855 9.739   1.00 0.00 ? 25 LYS A CD   10 
ATOM 10604 C CE   . LYS A 1 25 ? 6.206   -12.142 9.799   1.00 0.00 ? 25 LYS A CE   10 
ATOM 10605 N NZ   . LYS A 1 25 ? 6.058   -12.829 11.112  1.00 0.00 ? 25 LYS A NZ   10 
ATOM 10606 H H    . LYS A 1 25 ? 2.462   -7.374  8.335   1.00 0.00 ? 25 LYS A H    10 
ATOM 10607 H HA   . LYS A 1 25 ? 4.617   -8.340  10.012  1.00 0.00 ? 25 LYS A HA   10 
ATOM 10608 H HB2  . LYS A 1 25 ? 3.221   -9.815  8.506   1.00 0.00 ? 25 LYS A HB2  10 
ATOM 10609 H HB3  . LYS A 1 25 ? 4.040   -9.071  7.140   1.00 0.00 ? 25 LYS A HB3  10 
ATOM 10610 H HG2  . LYS A 1 25 ? 5.071   -11.182 7.660   1.00 0.00 ? 25 LYS A HG2  10 
ATOM 10611 H HG3  . LYS A 1 25 ? 6.193   -9.870  8.024   1.00 0.00 ? 25 LYS A HG3  10 
ATOM 10612 H HD2  . LYS A 1 25 ? 5.892   -10.104 10.337  1.00 0.00 ? 25 LYS A HD2  10 
ATOM 10613 H HD3  . LYS A 1 25 ? 4.410   -11.041 10.137  1.00 0.00 ? 25 LYS A HD3  10 
ATOM 10614 H HE2  . LYS A 1 25 ? 5.865   -12.802 9.016   1.00 0.00 ? 25 LYS A HE2  10 
ATOM 10615 H HE3  . LYS A 1 25 ? 7.247   -11.904 9.641   1.00 0.00 ? 25 LYS A HE3  10 
ATOM 10616 H HZ1  . LYS A 1 25 ? 5.551   -12.214 11.781  1.00 0.00 ? 25 LYS A HZ1  10 
ATOM 10617 H HZ2  . LYS A 1 25 ? 6.994   -13.053 11.505  1.00 0.00 ? 25 LYS A HZ2  10 
ATOM 10618 H HZ3  . LYS A 1 25 ? 5.521   -13.712 10.995  1.00 0.00 ? 25 LYS A HZ3  10 
ATOM 10619 N N    . PHE A 1 26 ? 5.240   -6.701  7.208   1.00 0.00 ? 26 PHE A N    10 
ATOM 10620 C CA   . PHE A 1 26 ? 6.239   -5.890  6.522   1.00 0.00 ? 26 PHE A CA   10 
ATOM 10621 C C    . PHE A 1 26 ? 6.781   -4.801  7.443   1.00 0.00 ? 26 PHE A C    10 
ATOM 10622 O O    . PHE A 1 26 ? 7.977   -4.509  7.439   1.00 0.00 ? 26 PHE A O    10 
ATOM 10623 C CB   . PHE A 1 26 ? 5.639   -5.258  5.265   1.00 0.00 ? 26 PHE A CB   10 
ATOM 10624 C CG   . PHE A 1 26 ? 6.397   -4.057  4.777   1.00 0.00 ? 26 PHE A CG   10 
ATOM 10625 C CD1  . PHE A 1 26 ? 6.109   -2.793  5.267   1.00 0.00 ? 26 PHE A CD1  10 
ATOM 10626 C CD2  . PHE A 1 26 ? 7.398   -4.191  3.828   1.00 0.00 ? 26 PHE A CD2  10 
ATOM 10627 C CE1  . PHE A 1 26 ? 6.805   -1.686  4.819   1.00 0.00 ? 26 PHE A CE1  10 
ATOM 10628 C CE2  . PHE A 1 26 ? 8.097   -3.088  3.376   1.00 0.00 ? 26 PHE A CE2  10 
ATOM 10629 C CZ   . PHE A 1 26 ? 7.801   -1.834  3.874   1.00 0.00 ? 26 PHE A CZ   10 
ATOM 10630 H H    . PHE A 1 26 ? 4.371   -6.851  6.781   1.00 0.00 ? 26 PHE A H    10 
ATOM 10631 H HA   . PHE A 1 26 ? 7.052   -6.539  6.235   1.00 0.00 ? 26 PHE A HA   10 
ATOM 10632 H HB2  . PHE A 1 26 ? 5.631   -5.990  4.471   1.00 0.00 ? 26 PHE A HB2  10 
ATOM 10633 H HB3  . PHE A 1 26 ? 4.626   -4.950  5.475   1.00 0.00 ? 26 PHE A HB3  10 
ATOM 10634 H HD1  . PHE A 1 26 ? 5.332   -2.676  6.008   1.00 0.00 ? 26 PHE A HD1  10 
ATOM 10635 H HD2  . PHE A 1 26 ? 7.630   -5.172  3.438   1.00 0.00 ? 26 PHE A HD2  10 
ATOM 10636 H HE1  . PHE A 1 26 ? 6.572   -0.707  5.210   1.00 0.00 ? 26 PHE A HE1  10 
ATOM 10637 H HE2  . PHE A 1 26 ? 8.875   -3.207  2.637   1.00 0.00 ? 26 PHE A HE2  10 
ATOM 10638 H HZ   . PHE A 1 26 ? 8.346   -0.970  3.522   1.00 0.00 ? 26 PHE A HZ   10 
ATOM 10639 N N    . GLU A 1 27 ? 5.892   -4.204  8.231   1.00 0.00 ? 27 GLU A N    10 
ATOM 10640 C CA   . GLU A 1 27 ? 6.281   -3.146  9.156   1.00 0.00 ? 27 GLU A CA   10 
ATOM 10641 C C    . GLU A 1 27 ? 7.372   -3.629  10.108  1.00 0.00 ? 27 GLU A C    10 
ATOM 10642 O O    . GLU A 1 27 ? 8.406   -2.980  10.268  1.00 0.00 ? 27 GLU A O    10 
ATOM 10643 C CB   . GLU A 1 27 ? 5.068   -2.665  9.955   1.00 0.00 ? 27 GLU A CB   10 
ATOM 10644 C CG   . GLU A 1 27 ? 3.883   -2.277  9.087   1.00 0.00 ? 27 GLU A CG   10 
ATOM 10645 C CD   . GLU A 1 27 ? 4.116   -0.988  8.323   1.00 0.00 ? 27 GLU A CD   10 
ATOM 10646 O OE1  . GLU A 1 27 ? 4.971   -0.188  8.755   1.00 0.00 ? 27 GLU A OE1  10 
ATOM 10647 O OE2  . GLU A 1 27 ? 3.443   -0.781  7.292   1.00 0.00 ? 27 GLU A OE2  10 
ATOM 10648 H H    . GLU A 1 27 ? 4.953   -4.480  8.188   1.00 0.00 ? 27 GLU A H    10 
ATOM 10649 H HA   . GLU A 1 27 ? 6.667   -2.322  8.575   1.00 0.00 ? 27 GLU A HA   10 
ATOM 10650 H HB2  . GLU A 1 27 ? 4.757   -3.454  10.623  1.00 0.00 ? 27 GLU A HB2  10 
ATOM 10651 H HB3  . GLU A 1 27 ? 5.356   -1.804  10.540  1.00 0.00 ? 27 GLU A HB3  10 
ATOM 10652 H HG2  . GLU A 1 27 ? 3.698   -3.070  8.378   1.00 0.00 ? 27 GLU A HG2  10 
ATOM 10653 H HG3  . GLU A 1 27 ? 3.016   -2.152  9.719   1.00 0.00 ? 27 GLU A HG3  10 
ATOM 10654 N N    . THR A 1 28 ? 7.133   -4.774  10.740  1.00 0.00 ? 28 THR A N    10 
ATOM 10655 C CA   . THR A 1 28 ? 8.092   -5.345  11.677  1.00 0.00 ? 28 THR A CA   10 
ATOM 10656 C C    . THR A 1 28 ? 9.304   -5.911  10.947  1.00 0.00 ? 28 THR A C    10 
ATOM 10657 O O    . THR A 1 28 ? 10.389  -6.019  11.518  1.00 0.00 ? 28 THR A O    10 
ATOM 10658 C CB   . THR A 1 28 ? 7.452   -6.459  12.527  1.00 0.00 ? 28 THR A CB   10 
ATOM 10659 O OG1  . THR A 1 28 ? 6.870   -7.452  11.675  1.00 0.00 ? 28 THR A OG1  10 
ATOM 10660 C CG2  . THR A 1 28 ? 6.388   -5.890  13.453  1.00 0.00 ? 28 THR A CG2  10 
ATOM 10661 H H    . THR A 1 28 ? 6.290   -5.245  10.571  1.00 0.00 ? 28 THR A H    10 
ATOM 10662 H HA   . THR A 1 28 ? 8.418   -4.558  12.341  1.00 0.00 ? 28 THR A HA   10 
ATOM 10663 H HB   . THR A 1 28 ? 8.223   -6.920  13.128  1.00 0.00 ? 28 THR A HB   10 
ATOM 10664 H HG1  . THR A 1 28 ? 6.907   -8.308  12.108  1.00 0.00 ? 28 THR A HG1  10 
ATOM 10665 H HG21 . THR A 1 28 ? 5.416   -6.252  13.150  1.00 0.00 ? 28 THR A HG21 10 
ATOM 10666 H HG22 . THR A 1 28 ? 6.404   -4.812  13.400  1.00 0.00 ? 28 THR A HG22 10 
ATOM 10667 H HG23 . THR A 1 28 ? 6.588   -6.204  14.466  1.00 0.00 ? 28 THR A HG23 10 
ATOM 10668 N N    . GLN A 1 29 ? 9.113   -6.270  9.681   1.00 0.00 ? 29 GLN A N    10 
ATOM 10669 C CA   . GLN A 1 29 ? 10.192  -6.825  8.874   1.00 0.00 ? 29 GLN A CA   10 
ATOM 10670 C C    . GLN A 1 29 ? 9.895   -6.668  7.386   1.00 0.00 ? 29 GLN A C    10 
ATOM 10671 O O    . GLN A 1 29 ? 9.011   -7.332  6.845   1.00 0.00 ? 29 GLN A O    10 
ATOM 10672 C CB   . GLN A 1 29 ? 10.402  -8.302  9.210   1.00 0.00 ? 29 GLN A CB   10 
ATOM 10673 C CG   . GLN A 1 29 ? 11.840  -8.767  9.042   1.00 0.00 ? 29 GLN A CG   10 
ATOM 10674 C CD   . GLN A 1 29 ? 11.958  -10.275 8.944   1.00 0.00 ? 29 GLN A CD   10 
ATOM 10675 O OE1  . GLN A 1 29 ? 11.160  -11.011 9.525   1.00 0.00 ? 29 GLN A OE1  10 
ATOM 10676 N NE2  . GLN A 1 29 ? 12.958  -10.744 8.207   1.00 0.00 ? 29 GLN A NE2  10 
ATOM 10677 H H    . GLN A 1 29 ? 8.225   -6.160  9.282   1.00 0.00 ? 29 GLN A H    10 
ATOM 10678 H HA   . GLN A 1 29 ? 11.095  -6.281  9.107   1.00 0.00 ? 29 GLN A HA   10 
ATOM 10679 H HB2  . GLN A 1 29 ? 10.110  -8.471  10.236  1.00 0.00 ? 29 GLN A HB2  10 
ATOM 10680 H HB3  . GLN A 1 29 ? 9.776   -8.899  8.563   1.00 0.00 ? 29 GLN A HB3  10 
ATOM 10681 H HG2  . GLN A 1 29 ? 12.242  -8.331  8.140   1.00 0.00 ? 29 GLN A HG2  10 
ATOM 10682 H HG3  . GLN A 1 29 ? 12.415  -8.429  9.891   1.00 0.00 ? 29 GLN A HG3  10 
ATOM 10683 H HE21 . GLN A 1 29 ? 13.556  -10.098 7.775   1.00 0.00 ? 29 GLN A HE21 10 
ATOM 10684 H HE22 . GLN A 1 29 ? 13.059  -11.714 8.127   1.00 0.00 ? 29 GLN A HE22 10 
ATOM 10685 N N    . LYS A 1 30 ? 10.639  -5.784  6.729   1.00 0.00 ? 30 LYS A N    10 
ATOM 10686 C CA   . LYS A 1 30 ? 10.457  -5.539  5.304   1.00 0.00 ? 30 LYS A CA   10 
ATOM 10687 C C    . LYS A 1 30 ? 10.660  -6.820  4.501   1.00 0.00 ? 30 LYS A C    10 
ATOM 10688 O O    . LYS A 1 30 ? 10.061  -7.001  3.441   1.00 0.00 ? 30 LYS A O    10 
ATOM 10689 C CB   . LYS A 1 30 ? 11.433  -4.463  4.822   1.00 0.00 ? 30 LYS A CB   10 
ATOM 10690 C CG   . LYS A 1 30 ? 11.412  -3.201  5.666   1.00 0.00 ? 30 LYS A CG   10 
ATOM 10691 C CD   . LYS A 1 30 ? 10.089  -2.464  5.535   1.00 0.00 ? 30 LYS A CD   10 
ATOM 10692 C CE   . LYS A 1 30 ? 9.922   -1.420  6.628   1.00 0.00 ? 30 LYS A CE   10 
ATOM 10693 N NZ   . LYS A 1 30 ? 9.631   -2.041  7.949   1.00 0.00 ? 30 LYS A NZ   10 
ATOM 10694 H H    . LYS A 1 30 ? 11.329  -5.285  7.216   1.00 0.00 ? 30 LYS A H    10 
ATOM 10695 H HA   . LYS A 1 30 ? 9.447   -5.190  5.153   1.00 0.00 ? 30 LYS A HA   10 
ATOM 10696 H HB2  . LYS A 1 30 ? 12.434  -4.867  4.841   1.00 0.00 ? 30 LYS A HB2  10 
ATOM 10697 H HB3  . LYS A 1 30 ? 11.182  -4.195  3.805   1.00 0.00 ? 30 LYS A HB3  10 
ATOM 10698 H HG2  . LYS A 1 30 ? 11.561  -3.468  6.701   1.00 0.00 ? 30 LYS A HG2  10 
ATOM 10699 H HG3  . LYS A 1 30 ? 12.211  -2.548  5.342   1.00 0.00 ? 30 LYS A HG3  10 
ATOM 10700 H HD2  . LYS A 1 30 ? 10.055  -1.972  4.574   1.00 0.00 ? 30 LYS A HD2  10 
ATOM 10701 H HD3  . LYS A 1 30 ? 9.281   -3.178  5.604   1.00 0.00 ? 30 LYS A HD3  10 
ATOM 10702 H HE2  . LYS A 1 30 ? 10.833  -0.846  6.702   1.00 0.00 ? 30 LYS A HE2  10 
ATOM 10703 H HE3  . LYS A 1 30 ? 9.106   -0.765  6.360   1.00 0.00 ? 30 LYS A HE3  10 
ATOM 10704 H HZ1  . LYS A 1 30 ? 10.479  -2.522  8.312   1.00 0.00 ? 30 LYS A HZ1  10 
ATOM 10705 H HZ2  . LYS A 1 30 ? 8.865   -2.739  7.855   1.00 0.00 ? 30 LYS A HZ2  10 
ATOM 10706 H HZ3  . LYS A 1 30 ? 9.339   -1.312  8.631   1.00 0.00 ? 30 LYS A HZ3  10 
ATOM 10707 N N    . TYR A 1 31 ? 11.506  -7.706  5.014   1.00 0.00 ? 31 TYR A N    10 
ATOM 10708 C CA   . TYR A 1 31 ? 11.788  -8.970  4.344   1.00 0.00 ? 31 TYR A CA   10 
ATOM 10709 C C    . TYR A 1 31 ? 11.446  -10.153 5.246   1.00 0.00 ? 31 TYR A C    10 
ATOM 10710 O O    . TYR A 1 31 ? 11.323  -10.006 6.462   1.00 0.00 ? 31 TYR A O    10 
ATOM 10711 C CB   . TYR A 1 31 ? 13.260  -9.037  3.934   1.00 0.00 ? 31 TYR A CB   10 
ATOM 10712 C CG   . TYR A 1 31 ? 13.552  -8.361  2.613   1.00 0.00 ? 31 TYR A CG   10 
ATOM 10713 C CD1  . TYR A 1 31 ? 13.739  -6.987  2.539   1.00 0.00 ? 31 TYR A CD1  10 
ATOM 10714 C CD2  . TYR A 1 31 ? 13.641  -9.098  1.438   1.00 0.00 ? 31 TYR A CD2  10 
ATOM 10715 C CE1  . TYR A 1 31 ? 14.005  -6.365  1.335   1.00 0.00 ? 31 TYR A CE1  10 
ATOM 10716 C CE2  . TYR A 1 31 ? 13.908  -8.486  0.229   1.00 0.00 ? 31 TYR A CE2  10 
ATOM 10717 C CZ   . TYR A 1 31 ? 14.089  -7.119  0.182   1.00 0.00 ? 31 TYR A CZ   10 
ATOM 10718 O OH   . TYR A 1 31 ? 14.355  -6.504  -1.019  1.00 0.00 ? 31 TYR A OH   10 
ATOM 10719 H H    . TYR A 1 31 ? 11.954  -7.505  5.862   1.00 0.00 ? 31 TYR A H    10 
ATOM 10720 H HA   . TYR A 1 31 ? 11.175  -9.020  3.456   1.00 0.00 ? 31 TYR A HA   10 
ATOM 10721 H HB2  . TYR A 1 31 ? 13.860  -8.556  4.691   1.00 0.00 ? 31 TYR A HB2  10 
ATOM 10722 H HB3  . TYR A 1 31 ? 13.557  -10.072 3.850   1.00 0.00 ? 31 TYR A HB3  10 
ATOM 10723 H HD1  . TYR A 1 31 ? 13.673  -6.400  3.444   1.00 0.00 ? 31 TYR A HD1  10 
ATOM 10724 H HD2  . TYR A 1 31 ? 13.500  -10.169 1.478   1.00 0.00 ? 31 TYR A HD2  10 
ATOM 10725 H HE1  . TYR A 1 31 ? 14.147  -5.295  1.298   1.00 0.00 ? 31 TYR A HE1  10 
ATOM 10726 H HE2  . TYR A 1 31 ? 13.974  -9.075  -0.673  1.00 0.00 ? 31 TYR A HE2  10 
ATOM 10727 H HH   . TYR A 1 31 ? 13.902  -6.972  -1.725  1.00 0.00 ? 31 TYR A HH   10 
ATOM 10728 N N    . LEU A 1 32 ? 11.294  -11.325 4.640   1.00 0.00 ? 32 LEU A N    10 
ATOM 10729 C CA   . LEU A 1 32 ? 10.966  -12.535 5.386   1.00 0.00 ? 32 LEU A CA   10 
ATOM 10730 C C    . LEU A 1 32 ? 11.661  -13.752 4.783   1.00 0.00 ? 32 LEU A C    10 
ATOM 10731 O O    . LEU A 1 32 ? 11.490  -14.055 3.603   1.00 0.00 ? 32 LEU A O    10 
ATOM 10732 C CB   . LEU A 1 32 ? 9.452   -12.754 5.402   1.00 0.00 ? 32 LEU A CB   10 
ATOM 10733 C CG   . LEU A 1 32 ? 8.618   -11.632 6.019   1.00 0.00 ? 32 LEU A CG   10 
ATOM 10734 C CD1  . LEU A 1 32 ? 7.181   -11.702 5.527   1.00 0.00 ? 32 LEU A CD1  10 
ATOM 10735 C CD2  . LEU A 1 32 ? 8.668   -11.704 7.539   1.00 0.00 ? 32 LEU A CD2  10 
ATOM 10736 H H    . LEU A 1 32 ? 11.404  -11.380 3.668   1.00 0.00 ? 32 LEU A H    10 
ATOM 10737 H HA   . LEU A 1 32 ? 11.313  -12.403 6.400   1.00 0.00 ? 32 LEU A HA   10 
ATOM 10738 H HB2  . LEU A 1 32 ? 9.127   -12.885 4.381   1.00 0.00 ? 32 LEU A HB2  10 
ATOM 10739 H HB3  . LEU A 1 32 ? 9.256   -13.659 5.959   1.00 0.00 ? 32 LEU A HB3  10 
ATOM 10740 H HG   . LEU A 1 32 ? 9.028   -10.678 5.716   1.00 0.00 ? 32 LEU A HG   10 
ATOM 10741 H HD11 . LEU A 1 32 ? 6.915   -12.731 5.338   1.00 0.00 ? 32 LEU A HD11 10 
ATOM 10742 H HD12 . LEU A 1 32 ? 7.084   -11.131 4.615   1.00 0.00 ? 32 LEU A HD12 10 
ATOM 10743 H HD13 . LEU A 1 32 ? 6.522   -11.292 6.279   1.00 0.00 ? 32 LEU A HD13 10 
ATOM 10744 H HD21 . LEU A 1 32 ? 9.643   -11.393 7.881   1.00 0.00 ? 32 LEU A HD21 10 
ATOM 10745 H HD22 . LEU A 1 32 ? 8.481   -12.720 7.857   1.00 0.00 ? 32 LEU A HD22 10 
ATOM 10746 H HD23 . LEU A 1 32 ? 7.915   -11.052 7.955   1.00 0.00 ? 32 LEU A HD23 10 
ATOM 10747 N N    . SER A 1 33 ? 12.445  -14.446 5.603   1.00 0.00 ? 33 SER A N    10 
ATOM 10748 C CA   . SER A 1 33 ? 13.167  -15.629 5.150   1.00 0.00 ? 33 SER A CA   10 
ATOM 10749 C C    . SER A 1 33 ? 12.200  -16.697 4.648   1.00 0.00 ? 33 SER A C    10 
ATOM 10750 O O    . SER A 1 33 ? 11.036  -16.752 5.045   1.00 0.00 ? 33 SER A O    10 
ATOM 10751 C CB   . SER A 1 33 ? 14.025  -16.193 6.284   1.00 0.00 ? 33 SER A CB   10 
ATOM 10752 O OG   . SER A 1 33 ? 14.635  -15.153 7.029   1.00 0.00 ? 33 SER A OG   10 
ATOM 10753 H H    . SER A 1 33 ? 12.541  -14.153 6.534   1.00 0.00 ? 33 SER A H    10 
ATOM 10754 H HA   . SER A 1 33 ? 13.812  -15.332 4.336   1.00 0.00 ? 33 SER A HA   10 
ATOM 10755 H HB2  . SER A 1 33 ? 13.403  -16.777 6.946   1.00 0.00 ? 33 SER A HB2  10 
ATOM 10756 H HB3  . SER A 1 33 ? 14.798  -16.823 5.868   1.00 0.00 ? 33 SER A HB3  10 
ATOM 10757 H HG   . SER A 1 33 ? 14.111  -14.971 7.813   1.00 0.00 ? 33 SER A HG   10 
ATOM 10758 N N    . PRO A 1 34 ? 12.693  -17.567 3.755   1.00 0.00 ? 34 PRO A N    10 
ATOM 10759 C CA   . PRO A 1 34 ? 11.891  -18.650 3.179   1.00 0.00 ? 34 PRO A CA   10 
ATOM 10760 C C    . PRO A 1 34 ? 11.126  -19.432 4.241   1.00 0.00 ? 34 PRO A C    10 
ATOM 10761 O O    . PRO A 1 34 ? 9.946   -19.747 4.085   1.00 0.00 ? 34 PRO A O    10 
ATOM 10762 C CB   . PRO A 1 34 ? 12.934  -19.544 2.504   1.00 0.00 ? 34 PRO A CB   10 
ATOM 10763 C CG   . PRO A 1 34 ? 14.070  -18.632 2.191   1.00 0.00 ? 34 PRO A CG   10 
ATOM 10764 C CD   . PRO A 1 34 ? 14.072  -17.561 3.238   1.00 0.00 ? 34 PRO A CD   10 
ATOM 10765 H HA   . PRO A 1 34 ? 11.198  -18.280 2.437   1.00 0.00 ? 34 PRO A HA   10 
ATOM 10766 H HB2  . PRO A 1 34 ? 13.233  -20.329 3.185   1.00 0.00 ? 34 PRO A HB2  10 
ATOM 10767 H HB3  . PRO A 1 34 ? 12.517  -19.977 1.608   1.00 0.00 ? 34 PRO A HB3  10 
ATOM 10768 H HG2  . PRO A 1 34 ? 15.000  -19.179 2.224   1.00 0.00 ? 34 PRO A HG2  10 
ATOM 10769 H HG3  . PRO A 1 34 ? 13.927  -18.190 1.216   1.00 0.00 ? 34 PRO A HG3  10 
ATOM 10770 H HD2  . PRO A 1 34 ? 14.778  -17.803 4.018   1.00 0.00 ? 34 PRO A HD2  10 
ATOM 10771 H HD3  . PRO A 1 34 ? 14.312  -16.606 2.793   1.00 0.00 ? 34 PRO A HD3  10 
ATOM 10772 N N    . PRO A 1 35 ? 11.811  -19.754 5.348   1.00 0.00 ? 35 PRO A N    10 
ATOM 10773 C CA   . PRO A 1 35 ? 11.214  -20.503 6.459   1.00 0.00 ? 35 PRO A CA   10 
ATOM 10774 C C    . PRO A 1 35 ? 9.860   -19.939 6.876   1.00 0.00 ? 35 PRO A C    10 
ATOM 10775 O O    . PRO A 1 35 ? 8.912   -20.688 7.109   1.00 0.00 ? 35 PRO A O    10 
ATOM 10776 C CB   . PRO A 1 35 ? 12.234  -20.335 7.588   1.00 0.00 ? 35 PRO A CB   10 
ATOM 10777 C CG   . PRO A 1 35 ? 13.532  -20.102 6.894   1.00 0.00 ? 35 PRO A CG   10 
ATOM 10778 C CD   . PRO A 1 35 ? 13.220  -19.411 5.602   1.00 0.00 ? 35 PRO A CD   10 
ATOM 10779 H HA   . PRO A 1 35 ? 11.108  -21.551 6.219   1.00 0.00 ? 35 PRO A HA   10 
ATOM 10780 H HB2  . PRO A 1 35 ? 11.957  -19.492 8.204   1.00 0.00 ? 35 PRO A HB2  10 
ATOM 10781 H HB3  . PRO A 1 35 ? 12.263  -21.233 8.187   1.00 0.00 ? 35 PRO A HB3  10 
ATOM 10782 H HG2  . PRO A 1 35 ? 14.165  -19.473 7.502   1.00 0.00 ? 35 PRO A HG2  10 
ATOM 10783 H HG3  . PRO A 1 35 ? 14.017  -21.046 6.696   1.00 0.00 ? 35 PRO A HG3  10 
ATOM 10784 H HD2  . PRO A 1 35 ? 13.344  -18.344 5.711   1.00 0.00 ? 35 PRO A HD2  10 
ATOM 10785 H HD3  . PRO A 1 35 ? 13.856  -19.788 4.815   1.00 0.00 ? 35 PRO A HD3  10 
ATOM 10786 N N    . GLU A 1 36 ? 9.777   -18.616 6.968   1.00 0.00 ? 36 GLU A N    10 
ATOM 10787 C CA   . GLU A 1 36 ? 8.538   -17.953 7.358   1.00 0.00 ? 36 GLU A CA   10 
ATOM 10788 C C    . GLU A 1 36 ? 7.608   -17.790 6.160   1.00 0.00 ? 36 GLU A C    10 
ATOM 10789 O O    . GLU A 1 36 ? 6.531   -18.385 6.112   1.00 0.00 ? 36 GLU A O    10 
ATOM 10790 C CB   . GLU A 1 36 ? 8.837   -16.586 7.976   1.00 0.00 ? 36 GLU A CB   10 
ATOM 10791 C CG   . GLU A 1 36 ? 9.989   -16.604 8.967   1.00 0.00 ? 36 GLU A CG   10 
ATOM 10792 C CD   . GLU A 1 36 ? 9.532   -16.884 10.386  1.00 0.00 ? 36 GLU A CD   10 
ATOM 10793 O OE1  . GLU A 1 36 ? 8.621   -17.720 10.561  1.00 0.00 ? 36 GLU A OE1  10 
ATOM 10794 O OE2  . GLU A 1 36 ? 10.086  -16.269 11.320  1.00 0.00 ? 36 GLU A OE2  10 
ATOM 10795 H H    . GLU A 1 36 ? 10.568  -18.072 6.770   1.00 0.00 ? 36 GLU A H    10 
ATOM 10796 H HA   . GLU A 1 36 ? 8.050   -18.572 8.096   1.00 0.00 ? 36 GLU A HA   10 
ATOM 10797 H HB2  . GLU A 1 36 ? 9.082   -15.893 7.184   1.00 0.00 ? 36 GLU A HB2  10 
ATOM 10798 H HB3  . GLU A 1 36 ? 7.954   -16.235 8.488   1.00 0.00 ? 36 GLU A HB3  10 
ATOM 10799 H HG2  . GLU A 1 36 ? 10.689  -17.371 8.673   1.00 0.00 ? 36 GLU A HG2  10 
ATOM 10800 H HG3  . GLU A 1 36 ? 10.480  -15.642 8.946   1.00 0.00 ? 36 GLU A HG3  10 
ATOM 10801 N N    . ARG A 1 37 ? 8.032   -16.981 5.195   1.00 0.00 ? 37 ARG A N    10 
ATOM 10802 C CA   . ARG A 1 37 ? 7.237   -16.738 3.997   1.00 0.00 ? 37 ARG A CA   10 
ATOM 10803 C C    . ARG A 1 37 ? 6.474   -17.993 3.587   1.00 0.00 ? 37 ARG A C    10 
ATOM 10804 O O    . ARG A 1 37 ? 5.355   -17.915 3.078   1.00 0.00 ? 37 ARG A O    10 
ATOM 10805 C CB   . ARG A 1 37 ? 8.135   -16.275 2.848   1.00 0.00 ? 37 ARG A CB   10 
ATOM 10806 C CG   . ARG A 1 37 ? 7.392   -15.510 1.765   1.00 0.00 ? 37 ARG A CG   10 
ATOM 10807 C CD   . ARG A 1 37 ? 8.179   -15.482 0.464   1.00 0.00 ? 37 ARG A CD   10 
ATOM 10808 N NE   . ARG A 1 37 ? 8.714   -16.796 0.119   1.00 0.00 ? 37 ARG A NE   10 
ATOM 10809 C CZ   . ARG A 1 37 ? 9.765   -16.977 -0.673  1.00 0.00 ? 37 ARG A CZ   10 
ATOM 10810 N NH1  . ARG A 1 37 ? 10.390  -15.933 -1.200  1.00 0.00 ? 37 ARG A NH1  10 
ATOM 10811 N NH2  . ARG A 1 37 ? 10.192  -18.205 -0.940  1.00 0.00 ? 37 ARG A NH2  10 
ATOM 10812 H H    . ARG A 1 37 ? 8.900   -16.535 5.291   1.00 0.00 ? 37 ARG A H    10 
ATOM 10813 H HA   . ARG A 1 37 ? 6.526   -15.957 4.224   1.00 0.00 ? 37 ARG A HA   10 
ATOM 10814 H HB2  . ARG A 1 37 ? 8.907   -15.634 3.246   1.00 0.00 ? 37 ARG A HB2  10 
ATOM 10815 H HB3  . ARG A 1 37 ? 8.594   -17.141 2.397   1.00 0.00 ? 37 ARG A HB3  10 
ATOM 10816 H HG2  . ARG A 1 37 ? 6.441   -15.989 1.587   1.00 0.00 ? 37 ARG A HG2  10 
ATOM 10817 H HG3  . ARG A 1 37 ? 7.230   -14.497 2.100   1.00 0.00 ? 37 ARG A HG3  10 
ATOM 10818 H HD2  . ARG A 1 37 ? 7.526   -15.150 -0.329  1.00 0.00 ? 37 ARG A HD2  10 
ATOM 10819 H HD3  . ARG A 1 37 ? 8.998   -14.786 0.570   1.00 0.00 ? 37 ARG A HD3  10 
ATOM 10820 H HE   . ARG A 1 37 ? 8.268   -17.582 0.498   1.00 0.00 ? 37 ARG A HE   10 
ATOM 10821 H HH11 . ARG A 1 37 ? 10.070  -15.007 -1.000  1.00 0.00 ? 37 ARG A HH11 10 
ATOM 10822 H HH12 . ARG A 1 37 ? 11.181  -16.072 -1.796  1.00 0.00 ? 37 ARG A HH12 10 
ATOM 10823 H HH21 . ARG A 1 37 ? 9.724   -18.994 -0.545  1.00 0.00 ? 37 ARG A HH21 10 
ATOM 10824 H HH22 . ARG A 1 37 ? 10.983  -18.340 -1.537  1.00 0.00 ? 37 ARG A HH22 10 
ATOM 10825 N N    . LYS A 1 38 ? 7.085   -19.151 3.812   1.00 0.00 ? 38 LYS A N    10 
ATOM 10826 C CA   . LYS A 1 38 ? 6.465   -20.425 3.468   1.00 0.00 ? 38 LYS A CA   10 
ATOM 10827 C C    . LYS A 1 38 ? 5.243   -20.689 4.342   1.00 0.00 ? 38 LYS A C    10 
ATOM 10828 O O    . LYS A 1 38 ? 4.171   -21.030 3.840   1.00 0.00 ? 38 LYS A O    10 
ATOM 10829 C CB   . LYS A 1 38 ? 7.473   -21.566 3.624   1.00 0.00 ? 38 LYS A CB   10 
ATOM 10830 C CG   . LYS A 1 38 ? 8.408   -21.718 2.437   1.00 0.00 ? 38 LYS A CG   10 
ATOM 10831 C CD   . LYS A 1 38 ? 9.573   -22.639 2.759   1.00 0.00 ? 38 LYS A CD   10 
ATOM 10832 C CE   . LYS A 1 38 ? 10.692  -22.499 1.739   1.00 0.00 ? 38 LYS A CE   10 
ATOM 10833 N NZ   . LYS A 1 38 ? 10.400  -23.252 0.488   1.00 0.00 ? 38 LYS A NZ   10 
ATOM 10834 H H    . LYS A 1 38 ? 7.977   -19.149 4.222   1.00 0.00 ? 38 LYS A H    10 
ATOM 10835 H HA   . LYS A 1 38 ? 6.150   -20.372 2.436   1.00 0.00 ? 38 LYS A HA   10 
ATOM 10836 H HB2  . LYS A 1 38 ? 8.070   -21.384 4.505   1.00 0.00 ? 38 LYS A HB2  10 
ATOM 10837 H HB3  . LYS A 1 38 ? 6.932   -22.493 3.751   1.00 0.00 ? 38 LYS A HB3  10 
ATOM 10838 H HG2  . LYS A 1 38 ? 7.856   -22.131 1.605   1.00 0.00 ? 38 LYS A HG2  10 
ATOM 10839 H HG3  . LYS A 1 38 ? 8.794   -20.745 2.167   1.00 0.00 ? 38 LYS A HG3  10 
ATOM 10840 H HD2  . LYS A 1 38 ? 9.959   -22.389 3.736   1.00 0.00 ? 38 LYS A HD2  10 
ATOM 10841 H HD3  . LYS A 1 38 ? 9.223   -23.661 2.759   1.00 0.00 ? 38 LYS A HD3  10 
ATOM 10842 H HE2  . LYS A 1 38 ? 10.815  -21.454 1.499   1.00 0.00 ? 38 LYS A HE2  10 
ATOM 10843 H HE3  . LYS A 1 38 ? 11.606  -22.879 2.172   1.00 0.00 ? 38 LYS A HE3  10 
ATOM 10844 H HZ1  . LYS A 1 38 ? 10.999  -22.902 -0.288  1.00 0.00 ? 38 LYS A HZ1  10 
ATOM 10845 H HZ2  . LYS A 1 38 ? 9.402   -23.130 0.222   1.00 0.00 ? 38 LYS A HZ2  10 
ATOM 10846 H HZ3  . LYS A 1 38 ? 10.589  -24.265 0.628   1.00 0.00 ? 38 LYS A HZ3  10 
ATOM 10847 N N    . ARG A 1 39 ? 5.411   -20.528 5.650   1.00 0.00 ? 39 ARG A N    10 
ATOM 10848 C CA   . ARG A 1 39 ? 4.321   -20.749 6.593   1.00 0.00 ? 39 ARG A CA   10 
ATOM 10849 C C    . ARG A 1 39 ? 3.252   -19.670 6.451   1.00 0.00 ? 39 ARG A C    10 
ATOM 10850 O O    . ARG A 1 39 ? 2.055   -19.952 6.523   1.00 0.00 ? 39 ARG A O    10 
ATOM 10851 C CB   . ARG A 1 39 ? 4.855   -20.768 8.027   1.00 0.00 ? 39 ARG A CB   10 
ATOM 10852 C CG   . ARG A 1 39 ? 4.850   -19.404 8.696   1.00 0.00 ? 39 ARG A CG   10 
ATOM 10853 C CD   . ARG A 1 39 ? 5.775   -19.372 9.903   1.00 0.00 ? 39 ARG A CD   10 
ATOM 10854 N NE   . ARG A 1 39 ? 5.105   -19.829 11.118  1.00 0.00 ? 39 ARG A NE   10 
ATOM 10855 C CZ   . ARG A 1 39 ? 4.120   -19.162 11.709  1.00 0.00 ? 39 ARG A CZ   10 
ATOM 10856 N NH1  . ARG A 1 39 ? 3.692   -18.015 11.200  1.00 0.00 ? 39 ARG A NH1  10 
ATOM 10857 N NH2  . ARG A 1 39 ? 3.561   -19.643 12.812  1.00 0.00 ? 39 ARG A NH2  10 
ATOM 10858 H H    . ARG A 1 39 ? 6.289   -20.255 5.990   1.00 0.00 ? 39 ARG A H    10 
ATOM 10859 H HA   . ARG A 1 39 ? 3.879   -21.709 6.370   1.00 0.00 ? 39 ARG A HA   10 
ATOM 10860 H HB2  . ARG A 1 39 ? 4.245   -21.436 8.617   1.00 0.00 ? 39 ARG A HB2  10 
ATOM 10861 H HB3  . ARG A 1 39 ? 5.870   -21.135 8.015   1.00 0.00 ? 39 ARG A HB3  10 
ATOM 10862 H HG2  . ARG A 1 39 ? 5.181   -18.662 7.984   1.00 0.00 ? 39 ARG A HG2  10 
ATOM 10863 H HG3  . ARG A 1 39 ? 3.845   -19.174 9.018   1.00 0.00 ? 39 ARG A HG3  10 
ATOM 10864 H HD2  . ARG A 1 39 ? 6.622   -20.013 9.708   1.00 0.00 ? 39 ARG A HD2  10 
ATOM 10865 H HD3  . ARG A 1 39 ? 6.117   -18.359 10.051  1.00 0.00 ? 39 ARG A HD3  10 
ATOM 10866 H HE   . ARG A 1 39 ? 5.406   -20.674 11.511  1.00 0.00 ? 39 ARG A HE   10 
ATOM 10867 H HH11 . ARG A 1 39 ? 4.111   -17.651 10.368  1.00 0.00 ? 39 ARG A HH11 10 
ATOM 10868 H HH12 . ARG A 1 39 ? 2.949   -17.516 11.646  1.00 0.00 ? 39 ARG A HH12 10 
ATOM 10869 H HH21 . ARG A 1 39 ? 3.880   -20.507 13.199  1.00 0.00 ? 39 ARG A HH21 10 
ATOM 10870 H HH22 . ARG A 1 39 ? 2.820   -19.140 13.256  1.00 0.00 ? 39 ARG A HH22 10 
ATOM 10871 N N    . LEU A 1 40 ? 3.691   -18.432 6.250   1.00 0.00 ? 40 LEU A N    10 
ATOM 10872 C CA   . LEU A 1 40 ? 2.773   -17.309 6.098   1.00 0.00 ? 40 LEU A CA   10 
ATOM 10873 C C    . LEU A 1 40 ? 1.800   -17.553 4.949   1.00 0.00 ? 40 LEU A C    10 
ATOM 10874 O O    . LEU A 1 40 ? 0.583   -17.520 5.135   1.00 0.00 ? 40 LEU A O    10 
ATOM 10875 C CB   . LEU A 1 40 ? 3.552   -16.016 5.855   1.00 0.00 ? 40 LEU A CB   10 
ATOM 10876 C CG   . LEU A 1 40 ? 2.777   -14.715 6.067   1.00 0.00 ? 40 LEU A CG   10 
ATOM 10877 C CD1  . LEU A 1 40 ? 2.406   -14.547 7.533   1.00 0.00 ? 40 LEU A CD1  10 
ATOM 10878 C CD2  . LEU A 1 40 ? 3.591   -13.524 5.582   1.00 0.00 ? 40 LEU A CD2  10 
ATOM 10879 H H    . LEU A 1 40 ? 4.656   -18.269 6.202   1.00 0.00 ? 40 LEU A H    10 
ATOM 10880 H HA   . LEU A 1 40 ? 2.211   -17.215 7.016   1.00 0.00 ? 40 LEU A HA   10 
ATOM 10881 H HB2  . LEU A 1 40 ? 4.398   -16.009 6.525   1.00 0.00 ? 40 LEU A HB2  10 
ATOM 10882 H HB3  . LEU A 1 40 ? 3.904   -16.030 4.834   1.00 0.00 ? 40 LEU A HB3  10 
ATOM 10883 H HG   . LEU A 1 40 ? 1.861   -14.751 5.494   1.00 0.00 ? 40 LEU A HG   10 
ATOM 10884 H HD11 . LEU A 1 40 ? 2.460   -15.504 8.029   1.00 0.00 ? 40 LEU A HD11 10 
ATOM 10885 H HD12 . LEU A 1 40 ? 1.401   -14.159 7.607   1.00 0.00 ? 40 LEU A HD12 10 
ATOM 10886 H HD13 . LEU A 1 40 ? 3.094   -13.859 8.001   1.00 0.00 ? 40 LEU A HD13 10 
ATOM 10887 H HD21 . LEU A 1 40 ? 2.958   -12.869 5.001   1.00 0.00 ? 40 LEU A HD21 10 
ATOM 10888 H HD22 . LEU A 1 40 ? 4.408   -13.873 4.967   1.00 0.00 ? 40 LEU A HD22 10 
ATOM 10889 H HD23 . LEU A 1 40 ? 3.984   -12.986 6.432   1.00 0.00 ? 40 LEU A HD23 10 
ATOM 10890 N N    . ALA A 1 41 ? 2.344   -17.800 3.762   1.00 0.00 ? 41 ALA A N    10 
ATOM 10891 C CA   . ALA A 1 41 ? 1.524   -18.054 2.584   1.00 0.00 ? 41 ALA A CA   10 
ATOM 10892 C C    . ALA A 1 41 ? 0.434   -19.077 2.884   1.00 0.00 ? 41 ALA A C    10 
ATOM 10893 O O    . ALA A 1 41 ? -0.609  -19.100 2.229   1.00 0.00 ? 41 ALA A O    10 
ATOM 10894 C CB   . ALA A 1 41 ? 2.393   -18.529 1.429   1.00 0.00 ? 41 ALA A CB   10 
ATOM 10895 H H    . ALA A 1 41 ? 3.320   -17.813 3.677   1.00 0.00 ? 41 ALA A H    10 
ATOM 10896 H HA   . ALA A 1 41 ? 1.059   -17.123 2.294   1.00 0.00 ? 41 ALA A HA   10 
ATOM 10897 H HB1  . ALA A 1 41 ? 2.328   -17.820 0.616   1.00 0.00 ? 41 ALA A HB1  10 
ATOM 10898 H HB2  . ALA A 1 41 ? 3.418   -18.607 1.758   1.00 0.00 ? 41 ALA A HB2  10 
ATOM 10899 H HB3  . ALA A 1 41 ? 2.048   -19.495 1.092   1.00 0.00 ? 41 ALA A HB3  10 
ATOM 10900 N N    . LYS A 1 42 ? 0.682   -19.925 3.877   1.00 0.00 ? 42 LYS A N    10 
ATOM 10901 C CA   . LYS A 1 42 ? -0.279  -20.951 4.265   1.00 0.00 ? 42 LYS A CA   10 
ATOM 10902 C C    . LYS A 1 42 ? -1.263  -20.413 5.298   1.00 0.00 ? 42 LYS A C    10 
ATOM 10903 O O    . LYS A 1 42 ? -2.424  -20.819 5.333   1.00 0.00 ? 42 LYS A O    10 
ATOM 10904 C CB   . LYS A 1 42 ? 0.450   -22.174 4.828   1.00 0.00 ? 42 LYS A CB   10 
ATOM 10905 C CG   . LYS A 1 42 ? -0.483  -23.242 5.370   1.00 0.00 ? 42 LYS A CG   10 
ATOM 10906 C CD   . LYS A 1 42 ? -1.171  -24.003 4.248   1.00 0.00 ? 42 LYS A CD   10 
ATOM 10907 C CE   . LYS A 1 42 ? -1.614  -25.385 4.702   1.00 0.00 ? 42 LYS A CE   10 
ATOM 10908 N NZ   . LYS A 1 42 ? -2.944  -25.350 5.371   1.00 0.00 ? 42 LYS A NZ   10 
ATOM 10909 H H    . LYS A 1 42 ? 1.531   -19.857 4.362   1.00 0.00 ? 42 LYS A H    10 
ATOM 10910 H HA   . LYS A 1 42 ? -0.826  -21.244 3.382   1.00 0.00 ? 42 LYS A HA   10 
ATOM 10911 H HB2  . LYS A 1 42 ? 1.050   -22.613 4.045   1.00 0.00 ? 42 LYS A HB2  10 
ATOM 10912 H HB3  . LYS A 1 42 ? 1.100   -21.853 5.630   1.00 0.00 ? 42 LYS A HB3  10 
ATOM 10913 H HG2  . LYS A 1 42 ? 0.088   -23.939 5.965   1.00 0.00 ? 42 LYS A HG2  10 
ATOM 10914 H HG3  . LYS A 1 42 ? -1.235  -22.771 5.987   1.00 0.00 ? 42 LYS A HG3  10 
ATOM 10915 H HD2  . LYS A 1 42 ? -2.039  -23.447 3.927   1.00 0.00 ? 42 LYS A HD2  10 
ATOM 10916 H HD3  . LYS A 1 42 ? -0.482  -24.108 3.422   1.00 0.00 ? 42 LYS A HD3  10 
ATOM 10917 H HE2  . LYS A 1 42 ? -1.671  -26.032 3.840   1.00 0.00 ? 42 LYS A HE2  10 
ATOM 10918 H HE3  . LYS A 1 42 ? -0.882  -25.773 5.395   1.00 0.00 ? 42 LYS A HE3  10 
ATOM 10919 H HZ1  . LYS A 1 42 ? -3.521  -24.578 4.977   1.00 0.00 ? 42 LYS A HZ1  10 
ATOM 10920 H HZ2  . LYS A 1 42 ? -2.827  -25.193 6.392   1.00 0.00 ? 42 LYS A HZ2  10 
ATOM 10921 H HZ3  . LYS A 1 42 ? -3.442  -26.250 5.224   1.00 0.00 ? 42 LYS A HZ3  10 
ATOM 10922 N N    . MET A 1 43 ? -0.792  -19.495 6.136   1.00 0.00 ? 43 MET A N    10 
ATOM 10923 C CA   . MET A 1 43 ? -1.633  -18.900 7.167   1.00 0.00 ? 43 MET A CA   10 
ATOM 10924 C C    . MET A 1 43 ? -2.638  -17.928 6.556   1.00 0.00 ? 43 MET A C    10 
ATOM 10925 O O    . MET A 1 43 ? -3.831  -17.980 6.859   1.00 0.00 ? 43 MET A O    10 
ATOM 10926 C CB   . MET A 1 43 ? -0.771  -18.175 8.203   1.00 0.00 ? 43 MET A CB   10 
ATOM 10927 C CG   . MET A 1 43 ? -1.537  -17.146 9.019   1.00 0.00 ? 43 MET A CG   10 
ATOM 10928 S SD   . MET A 1 43 ? -0.783  -16.834 10.626  1.00 0.00 ? 43 MET A SD   10 
ATOM 10929 C CE   . MET A 1 43 ? 0.140   -15.338 10.282  1.00 0.00 ? 43 MET A CE   10 
ATOM 10930 H H    . MET A 1 43 ? 0.143   -19.211 6.059   1.00 0.00 ? 43 MET A H    10 
ATOM 10931 H HA   . MET A 1 43 ? -2.173  -19.697 7.656   1.00 0.00 ? 43 MET A HA   10 
ATOM 10932 H HB2  . MET A 1 43 ? -0.356  -18.904 8.882   1.00 0.00 ? 43 MET A HB2  10 
ATOM 10933 H HB3  . MET A 1 43 ? 0.035   -17.669 7.692   1.00 0.00 ? 43 MET A HB3  10 
ATOM 10934 H HG2  . MET A 1 43 ? -1.569  -16.219 8.466   1.00 0.00 ? 43 MET A HG2  10 
ATOM 10935 H HG3  . MET A 1 43 ? -2.544  -17.506 9.172   1.00 0.00 ? 43 MET A HG3  10 
ATOM 10936 H HE1  . MET A 1 43 ? -0.464  -14.671 9.685   1.00 0.00 ? 43 MET A HE1  10 
ATOM 10937 H HE2  . MET A 1 43 ? 0.400   -14.854 11.212  1.00 0.00 ? 43 MET A HE2  10 
ATOM 10938 H HE3  . MET A 1 43 ? 1.042   -15.589 9.742   1.00 0.00 ? 43 MET A HE3  10 
ATOM 10939 N N    . LEU A 1 44 ? -2.150  -17.044 5.694   1.00 0.00 ? 44 LEU A N    10 
ATOM 10940 C CA   . LEU A 1 44 ? -3.005  -16.060 5.040   1.00 0.00 ? 44 LEU A CA   10 
ATOM 10941 C C    . LEU A 1 44 ? -3.566  -16.610 3.732   1.00 0.00 ? 44 LEU A C    10 
ATOM 10942 O O    . LEU A 1 44 ? -4.191  -15.883 2.960   1.00 0.00 ? 44 LEU A O    10 
ATOM 10943 C CB   . LEU A 1 44 ? -2.223  -14.773 4.771   1.00 0.00 ? 44 LEU A CB   10 
ATOM 10944 C CG   . LEU A 1 44 ? -1.477  -14.179 5.966   1.00 0.00 ? 44 LEU A CG   10 
ATOM 10945 C CD1  . LEU A 1 44 ? -0.468  -13.140 5.503   1.00 0.00 ? 44 LEU A CD1  10 
ATOM 10946 C CD2  . LEU A 1 44 ? -2.457  -13.569 6.958   1.00 0.00 ? 44 LEU A CD2  10 
ATOM 10947 H H    . LEU A 1 44 ? -1.191  -17.051 5.492   1.00 0.00 ? 44 LEU A H    10 
ATOM 10948 H HA   . LEU A 1 44 ? -3.827  -15.840 5.705   1.00 0.00 ? 44 LEU A HA   10 
ATOM 10949 H HB2  . LEU A 1 44 ? -1.499  -14.981 3.999   1.00 0.00 ? 44 LEU A HB2  10 
ATOM 10950 H HB3  . LEU A 1 44 ? -2.923  -14.030 4.415   1.00 0.00 ? 44 LEU A HB3  10 
ATOM 10951 H HG   . LEU A 1 44 ? -0.935  -14.967 6.472   1.00 0.00 ? 44 LEU A HG   10 
ATOM 10952 H HD11 . LEU A 1 44 ? -0.007  -12.678 6.363   1.00 0.00 ? 44 LEU A HD11 10 
ATOM 10953 H HD12 . LEU A 1 44 ? -0.972  -12.386 4.916   1.00 0.00 ? 44 LEU A HD12 10 
ATOM 10954 H HD13 . LEU A 1 44 ? 0.290   -13.618 4.901   1.00 0.00 ? 44 LEU A HD13 10 
ATOM 10955 H HD21 . LEU A 1 44 ? -2.787  -14.329 7.651   1.00 0.00 ? 44 LEU A HD21 10 
ATOM 10956 H HD22 . LEU A 1 44 ? -3.310  -13.174 6.424   1.00 0.00 ? 44 LEU A HD22 10 
ATOM 10957 H HD23 . LEU A 1 44 ? -1.971  -12.772 7.501   1.00 0.00 ? 44 LEU A HD23 10 
ATOM 10958 N N    . GLN A 1 45 ? -3.339  -17.897 3.492   1.00 0.00 ? 45 GLN A N    10 
ATOM 10959 C CA   . GLN A 1 45 ? -3.823  -18.544 2.278   1.00 0.00 ? 45 GLN A CA   10 
ATOM 10960 C C    . GLN A 1 45 ? -3.279  -17.848 1.036   1.00 0.00 ? 45 GLN A C    10 
ATOM 10961 O O    . GLN A 1 45 ? -3.948  -17.783 0.003   1.00 0.00 ? 45 GLN A O    10 
ATOM 10962 C CB   . GLN A 1 45 ? -5.353  -18.542 2.249   1.00 0.00 ? 45 GLN A CB   10 
ATOM 10963 C CG   . GLN A 1 45 ? -5.986  -19.023 3.545   1.00 0.00 ? 45 GLN A CG   10 
ATOM 10964 C CD   . GLN A 1 45 ? -7.501  -18.990 3.501   1.00 0.00 ? 45 GLN A CD   10 
ATOM 10965 O OE1  . GLN A 1 45 ? -8.139  -19.912 2.992   1.00 0.00 ? 45 GLN A OE1  10 
ATOM 10966 N NE2  . GLN A 1 45 ? -8.087  -17.925 4.036   1.00 0.00 ? 45 GLN A NE2  10 
ATOM 10967 H H    . GLN A 1 45 ? -2.834  -18.424 4.145   1.00 0.00 ? 45 GLN A H    10 
ATOM 10968 H HA   . GLN A 1 45 ? -3.474  -19.566 2.285   1.00 0.00 ? 45 GLN A HA   10 
ATOM 10969 H HB2  . GLN A 1 45 ? -5.696  -17.537 2.057   1.00 0.00 ? 45 GLN A HB2  10 
ATOM 10970 H HB3  . GLN A 1 45 ? -5.686  -19.187 1.450   1.00 0.00 ? 45 GLN A HB3  10 
ATOM 10971 H HG2  . GLN A 1 45 ? -5.669  -20.038 3.731   1.00 0.00 ? 45 GLN A HG2  10 
ATOM 10972 H HG3  . GLN A 1 45 ? -5.650  -18.389 4.352   1.00 0.00 ? 45 GLN A HG3  10 
ATOM 10973 H HE21 . GLN A 1 45 ? -7.515  -17.229 4.422   1.00 0.00 ? 45 GLN A HE21 10 
ATOM 10974 H HE22 . GLN A 1 45 ? -9.064  -17.877 4.020   1.00 0.00 ? 45 GLN A HE22 10 
ATOM 10975 N N    . LEU A 1 46 ? -2.061  -17.328 1.141   1.00 0.00 ? 46 LEU A N    10 
ATOM 10976 C CA   . LEU A 1 46 ? -1.425  -16.635 0.025   1.00 0.00 ? 46 LEU A CA   10 
ATOM 10977 C C    . LEU A 1 46 ? -0.323  -17.491 -0.590  1.00 0.00 ? 46 LEU A C    10 
ATOM 10978 O O    . LEU A 1 46 ? 0.153   -18.445 0.026   1.00 0.00 ? 46 LEU A O    10 
ATOM 10979 C CB   . LEU A 1 46 ? -0.848  -15.297 0.492   1.00 0.00 ? 46 LEU A CB   10 
ATOM 10980 C CG   . LEU A 1 46 ? -1.782  -14.418 1.325   1.00 0.00 ? 46 LEU A CG   10 
ATOM 10981 C CD1  . LEU A 1 46 ? -0.997  -13.316 2.020   1.00 0.00 ? 46 LEU A CD1  10 
ATOM 10982 C CD2  . LEU A 1 46 ? -2.878  -13.825 0.451   1.00 0.00 ? 46 LEU A CD2  10 
ATOM 10983 H H    . LEU A 1 46 ? -1.577  -17.411 1.989   1.00 0.00 ? 46 LEU A H    10 
ATOM 10984 H HA   . LEU A 1 46 ? -2.181  -16.450 -0.723  1.00 0.00 ? 46 LEU A HA   10 
ATOM 10985 H HB2  . LEU A 1 46 ? 0.028   -15.505 1.086   1.00 0.00 ? 46 LEU A HB2  10 
ATOM 10986 H HB3  . LEU A 1 46 ? -0.561  -14.737 -0.387  1.00 0.00 ? 46 LEU A HB3  10 
ATOM 10987 H HG   . LEU A 1 46 ? -2.251  -15.024 2.088   1.00 0.00 ? 46 LEU A HG   10 
ATOM 10988 H HD11 . LEU A 1 46 ? -1.600  -12.884 2.804   1.00 0.00 ? 46 LEU A HD11 10 
ATOM 10989 H HD12 . LEU A 1 46 ? -0.738  -12.551 1.302   1.00 0.00 ? 46 LEU A HD12 10 
ATOM 10990 H HD13 . LEU A 1 46 ? -0.095  -13.730 2.445   1.00 0.00 ? 46 LEU A HD13 10 
ATOM 10991 H HD21 . LEU A 1 46 ? -3.256  -12.924 0.911   1.00 0.00 ? 46 LEU A HD21 10 
ATOM 10992 H HD22 . LEU A 1 46 ? -3.680  -14.541 0.347   1.00 0.00 ? 46 LEU A HD22 10 
ATOM 10993 H HD23 . LEU A 1 46 ? -2.474  -13.591 -0.523  1.00 0.00 ? 46 LEU A HD23 10 
ATOM 10994 N N    . SER A 1 47 ? 0.081   -17.141 -1.807  1.00 0.00 ? 47 SER A N    10 
ATOM 10995 C CA   . SER A 1 47 ? 1.127   -17.878 -2.506  1.00 0.00 ? 47 SER A CA   10 
ATOM 10996 C C    . SER A 1 47 ? 2.504   -17.304 -2.185  1.00 0.00 ? 47 SER A C    10 
ATOM 10997 O O    . SER A 1 47 ? 2.678   -16.088 -2.112  1.00 0.00 ? 47 SER A O    10 
ATOM 10998 C CB   . SER A 1 47 ? 0.885   -17.839 -4.017  1.00 0.00 ? 47 SER A CB   10 
ATOM 10999 O OG   . SER A 1 47 ? 0.047   -18.905 -4.427  1.00 0.00 ? 47 SER A OG   10 
ATOM 11000 H H    . SER A 1 47 ? -0.337  -16.371 -2.246  1.00 0.00 ? 47 SER A H    10 
ATOM 11001 H HA   . SER A 1 47 ? 1.091   -18.904 -2.171  1.00 0.00 ? 47 SER A HA   10 
ATOM 11002 H HB2  . SER A 1 47 ? 0.414   -16.904 -4.279  1.00 0.00 ? 47 SER A HB2  10 
ATOM 11003 H HB3  . SER A 1 47 ? 1.831   -17.922 -4.532  1.00 0.00 ? 47 SER A HB3  10 
ATOM 11004 H HG   . SER A 1 47 ? 0.530   -19.482 -5.022  1.00 0.00 ? 47 SER A HG   10 
ATOM 11005 N N    . GLU A 1 48 ? 3.477   -18.189 -1.994  1.00 0.00 ? 48 GLU A N    10 
ATOM 11006 C CA   . GLU A 1 48 ? 4.838   -17.770 -1.680  1.00 0.00 ? 48 GLU A CA   10 
ATOM 11007 C C    . GLU A 1 48 ? 5.278   -16.624 -2.586  1.00 0.00 ? 48 GLU A C    10 
ATOM 11008 O O    . GLU A 1 48 ? 6.049   -15.755 -2.177  1.00 0.00 ? 48 GLU A O    10 
ATOM 11009 C CB   . GLU A 1 48 ? 5.804   -18.948 -1.824  1.00 0.00 ? 48 GLU A CB   10 
ATOM 11010 C CG   . GLU A 1 48 ? 5.884   -19.824 -0.586  1.00 0.00 ? 48 GLU A CG   10 
ATOM 11011 C CD   . GLU A 1 48 ? 6.679   -21.094 -0.820  1.00 0.00 ? 48 GLU A CD   10 
ATOM 11012 O OE1  . GLU A 1 48 ? 6.135   -22.028 -1.446  1.00 0.00 ? 48 GLU A OE1  10 
ATOM 11013 O OE2  . GLU A 1 48 ? 7.845   -21.154 -0.378  1.00 0.00 ? 48 GLU A OE2  10 
ATOM 11014 H H    . GLU A 1 48 ? 3.275   -19.145 -2.066  1.00 0.00 ? 48 GLU A H    10 
ATOM 11015 H HA   . GLU A 1 48 ? 4.852   -17.429 -0.656  1.00 0.00 ? 48 GLU A HA   10 
ATOM 11016 H HB2  . GLU A 1 48 ? 5.484   -19.561 -2.654  1.00 0.00 ? 48 GLU A HB2  10 
ATOM 11017 H HB3  . GLU A 1 48 ? 6.792   -18.564 -2.032  1.00 0.00 ? 48 GLU A HB3  10 
ATOM 11018 H HG2  . GLU A 1 48 ? 6.357   -19.264 0.207   1.00 0.00 ? 48 GLU A HG2  10 
ATOM 11019 H HG3  . GLU A 1 48 ? 4.882   -20.094 -0.286  1.00 0.00 ? 48 GLU A HG3  10 
ATOM 11020 N N    . ARG A 1 49 ? 4.783   -16.629 -3.820  1.00 0.00 ? 49 ARG A N    10 
ATOM 11021 C CA   . ARG A 1 49 ? 5.125   -15.591 -4.785  1.00 0.00 ? 49 ARG A CA   10 
ATOM 11022 C C    . ARG A 1 49 ? 4.457   -14.269 -4.422  1.00 0.00 ? 49 ARG A C    10 
ATOM 11023 O O    . ARG A 1 49 ? 5.034   -13.199 -4.611  1.00 0.00 ? 49 ARG A O    10 
ATOM 11024 C CB   . ARG A 1 49 ? 4.706   -16.017 -6.193  1.00 0.00 ? 49 ARG A CB   10 
ATOM 11025 C CG   . ARG A 1 49 ? 4.609   -14.861 -7.175  1.00 0.00 ? 49 ARG A CG   10 
ATOM 11026 C CD   . ARG A 1 49 ? 4.089   -15.321 -8.528  1.00 0.00 ? 49 ARG A CD   10 
ATOM 11027 N NE   . ARG A 1 49 ? 4.537   -14.451 -9.612  1.00 0.00 ? 49 ARG A NE   10 
ATOM 11028 C CZ   . ARG A 1 49 ? 5.796   -14.387 -10.030 1.00 0.00 ? 49 ARG A CZ   10 
ATOM 11029 N NH1  . ARG A 1 49 ? 6.727   -15.138 -9.458  1.00 0.00 ? 49 ARG A NH1  10 
ATOM 11030 N NH2  . ARG A 1 49 ? 6.126   -13.570 -11.022 1.00 0.00 ? 49 ARG A NH2  10 
ATOM 11031 H H    . ARG A 1 49 ? 4.173   -17.348 -4.087  1.00 0.00 ? 49 ARG A H    10 
ATOM 11032 H HA   . ARG A 1 49 ? 6.196   -15.458 -4.762  1.00 0.00 ? 49 ARG A HA   10 
ATOM 11033 H HB2  . ARG A 1 49 ? 5.429   -16.724 -6.573  1.00 0.00 ? 49 ARG A HB2  10 
ATOM 11034 H HB3  . ARG A 1 49 ? 3.740   -16.496 -6.139  1.00 0.00 ? 49 ARG A HB3  10 
ATOM 11035 H HG2  . ARG A 1 49 ? 3.934   -14.118 -6.777  1.00 0.00 ? 49 ARG A HG2  10 
ATOM 11036 H HG3  . ARG A 1 49 ? 5.590   -14.428 -7.305  1.00 0.00 ? 49 ARG A HG3  10 
ATOM 11037 H HD2  . ARG A 1 49 ? 4.445   -16.324 -8.714  1.00 0.00 ? 49 ARG A HD2  10 
ATOM 11038 H HD3  . ARG A 1 49 ? 3.009   -15.322 -8.502  1.00 0.00 ? 49 ARG A HD3  10 
ATOM 11039 H HE   . ARG A 1 49 ? 3.865   -13.887 -10.048 1.00 0.00 ? 49 ARG A HE   10 
ATOM 11040 H HH11 . ARG A 1 49 ? 6.481   -15.755 -8.711  1.00 0.00 ? 49 ARG A HH11 10 
ATOM 11041 H HH12 . ARG A 1 49 ? 7.675   -15.088 -9.775  1.00 0.00 ? 49 ARG A HH12 10 
ATOM 11042 H HH21 . ARG A 1 49 ? 5.427   -13.002 -11.456 1.00 0.00 ? 49 ARG A HH21 10 
ATOM 11043 H HH22 . ARG A 1 49 ? 7.074   -13.522 -11.336 1.00 0.00 ? 49 ARG A HH22 10 
ATOM 11044 N N    . GLN A 1 50 ? 3.237   -14.352 -3.900  1.00 0.00 ? 50 GLN A N    10 
ATOM 11045 C CA   . GLN A 1 50 ? 2.490   -13.161 -3.512  1.00 0.00 ? 50 GLN A CA   10 
ATOM 11046 C C    . GLN A 1 50 ? 3.101   -12.515 -2.272  1.00 0.00 ? 50 GLN A C    10 
ATOM 11047 O O    . GLN A 1 50 ? 3.062   -11.295 -2.112  1.00 0.00 ? 50 GLN A O    10 
ATOM 11048 C CB   . GLN A 1 50 ? 1.026   -13.515 -3.248  1.00 0.00 ? 50 GLN A CB   10 
ATOM 11049 C CG   . GLN A 1 50 ? 0.160   -13.498 -4.498  1.00 0.00 ? 50 GLN A CG   10 
ATOM 11050 C CD   . GLN A 1 50 ? -1.311  -13.693 -4.191  1.00 0.00 ? 50 GLN A CD   10 
ATOM 11051 O OE1  . GLN A 1 50 ? -2.109  -12.762 -4.301  1.00 0.00 ? 50 GLN A OE1  10 
ATOM 11052 N NE2  . GLN A 1 50 ? -1.680  -14.909 -3.805  1.00 0.00 ? 50 GLN A NE2  10 
ATOM 11053 H H    . GLN A 1 50 ? 2.830   -15.233 -3.774  1.00 0.00 ? 50 GLN A H    10 
ATOM 11054 H HA   . GLN A 1 50 ? 2.539   -12.458 -4.329  1.00 0.00 ? 50 GLN A HA   10 
ATOM 11055 H HB2  . GLN A 1 50 ? 0.979   -14.504 -2.817  1.00 0.00 ? 50 GLN A HB2  10 
ATOM 11056 H HB3  . GLN A 1 50 ? 0.617   -12.805 -2.544  1.00 0.00 ? 50 GLN A HB3  10 
ATOM 11057 H HG2  . GLN A 1 50 ? 0.286   -12.547 -4.994  1.00 0.00 ? 50 GLN A HG2  10 
ATOM 11058 H HG3  . GLN A 1 50 ? 0.485   -14.291 -5.155  1.00 0.00 ? 50 GLN A HG3  10 
ATOM 11059 H HE21 . GLN A 1 50 ? -0.989  -15.602 -3.739  1.00 0.00 ? 50 GLN A HE21 10 
ATOM 11060 H HE22 . GLN A 1 50 ? -2.624  -15.063 -3.600  1.00 0.00 ? 50 GLN A HE22 10 
ATOM 11061 N N    . VAL A 1 51 ? 3.664   -13.342 -1.397  1.00 0.00 ? 51 VAL A N    10 
ATOM 11062 C CA   . VAL A 1 51 ? 4.284   -12.852 -0.172  1.00 0.00 ? 51 VAL A CA   10 
ATOM 11063 C C    . VAL A 1 51 ? 5.709   -12.376 -0.429  1.00 0.00 ? 51 VAL A C    10 
ATOM 11064 O O    . VAL A 1 51 ? 6.251   -11.566 0.323   1.00 0.00 ? 51 VAL A O    10 
ATOM 11065 C CB   . VAL A 1 51 ? 4.306   -13.938 0.920   1.00 0.00 ? 51 VAL A CB   10 
ATOM 11066 C CG1  . VAL A 1 51 ? 4.848   -13.374 2.224   1.00 0.00 ? 51 VAL A CG1  10 
ATOM 11067 C CG2  . VAL A 1 51 ? 2.915   -14.521 1.119   1.00 0.00 ? 51 VAL A CG2  10 
ATOM 11068 H H    . VAL A 1 51 ? 3.664   -14.305 -1.580  1.00 0.00 ? 51 VAL A H    10 
ATOM 11069 H HA   . VAL A 1 51 ? 3.697   -12.020 0.189   1.00 0.00 ? 51 VAL A HA   10 
ATOM 11070 H HB   . VAL A 1 51 ? 4.963   -14.732 0.596   1.00 0.00 ? 51 VAL A HB   10 
ATOM 11071 H HG11 . VAL A 1 51 ? 5.003   -14.179 2.927   1.00 0.00 ? 51 VAL A HG11 10 
ATOM 11072 H HG12 . VAL A 1 51 ? 5.786   -12.871 2.037   1.00 0.00 ? 51 VAL A HG12 10 
ATOM 11073 H HG13 . VAL A 1 51 ? 4.138   -12.671 2.634   1.00 0.00 ? 51 VAL A HG13 10 
ATOM 11074 H HG21 . VAL A 1 51 ? 2.175   -13.765 0.905   1.00 0.00 ? 51 VAL A HG21 10 
ATOM 11075 H HG22 . VAL A 1 51 ? 2.777   -15.359 0.450   1.00 0.00 ? 51 VAL A HG22 10 
ATOM 11076 H HG23 . VAL A 1 51 ? 2.807   -14.854 2.140   1.00 0.00 ? 51 VAL A HG23 10 
ATOM 11077 N N    . LYS A 1 52 ? 6.313   -12.886 -1.498  1.00 0.00 ? 52 LYS A N    10 
ATOM 11078 C CA   . LYS A 1 52 ? 7.676   -12.513 -1.857  1.00 0.00 ? 52 LYS A CA   10 
ATOM 11079 C C    . LYS A 1 52 ? 7.685   -11.272 -2.744  1.00 0.00 ? 52 LYS A C    10 
ATOM 11080 O O    . LYS A 1 52 ? 8.642   -10.497 -2.737  1.00 0.00 ? 52 LYS A O    10 
ATOM 11081 C CB   . LYS A 1 52 ? 8.371   -13.672 -2.577  1.00 0.00 ? 52 LYS A CB   10 
ATOM 11082 C CG   . LYS A 1 52 ? 8.191   -13.646 -4.085  1.00 0.00 ? 52 LYS A CG   10 
ATOM 11083 C CD   . LYS A 1 52 ? 9.267   -12.812 -4.760  1.00 0.00 ? 52 LYS A CD   10 
ATOM 11084 C CE   . LYS A 1 52 ? 10.484  -13.653 -5.115  1.00 0.00 ? 52 LYS A CE   10 
ATOM 11085 N NZ   . LYS A 1 52 ? 11.272  -13.048 -6.223  1.00 0.00 ? 52 LYS A NZ   10 
ATOM 11086 H H    . LYS A 1 52 ? 5.830   -13.528 -2.059  1.00 0.00 ? 52 LYS A H    10 
ATOM 11087 H HA   . LYS A 1 52 ? 8.212   -12.294 -0.946  1.00 0.00 ? 52 LYS A HA   10 
ATOM 11088 H HB2  . LYS A 1 52 ? 9.428   -13.632 -2.360  1.00 0.00 ? 52 LYS A HB2  10 
ATOM 11089 H HB3  . LYS A 1 52 ? 7.970   -14.603 -2.203  1.00 0.00 ? 52 LYS A HB3  10 
ATOM 11090 H HG2  . LYS A 1 52 ? 8.245   -14.657 -4.462  1.00 0.00 ? 52 LYS A HG2  10 
ATOM 11091 H HG3  . LYS A 1 52 ? 7.223   -13.225 -4.316  1.00 0.00 ? 52 LYS A HG3  10 
ATOM 11092 H HD2  . LYS A 1 52 ? 8.863   -12.384 -5.666  1.00 0.00 ? 52 LYS A HD2  10 
ATOM 11093 H HD3  . LYS A 1 52 ? 9.570   -12.020 -4.090  1.00 0.00 ? 52 LYS A HD3  10 
ATOM 11094 H HE2  . LYS A 1 52 ? 11.113  -13.738 -4.242  1.00 0.00 ? 52 LYS A HE2  10 
ATOM 11095 H HE3  . LYS A 1 52 ? 10.151  -14.635 -5.415  1.00 0.00 ? 52 LYS A HE3  10 
ATOM 11096 H HZ1  . LYS A 1 52 ? 12.093  -12.536 -5.840  1.00 0.00 ? 52 LYS A HZ1  10 
ATOM 11097 H HZ2  . LYS A 1 52 ? 10.682  -12.381 -6.759  1.00 0.00 ? 52 LYS A HZ2  10 
ATOM 11098 H HZ3  . LYS A 1 52 ? 11.611  -13.790 -6.868  1.00 0.00 ? 52 LYS A HZ3  10 
ATOM 11099 N N    . THR A 1 53 ? 6.612   -11.088 -3.507  1.00 0.00 ? 53 THR A N    10 
ATOM 11100 C CA   . THR A 1 53 ? 6.496   -9.941  -4.399  1.00 0.00 ? 53 THR A CA   10 
ATOM 11101 C C    . THR A 1 53 ? 5.938   -8.727  -3.664  1.00 0.00 ? 53 THR A C    10 
ATOM 11102 O O    . THR A 1 53 ? 6.538   -7.653  -3.675  1.00 0.00 ? 53 THR A O    10 
ATOM 11103 C CB   . THR A 1 53 ? 5.592   -10.257 -5.606  1.00 0.00 ? 53 THR A CB   10 
ATOM 11104 O OG1  . THR A 1 53 ? 6.254   -11.170 -6.488  1.00 0.00 ? 53 THR A OG1  10 
ATOM 11105 C CG2  . THR A 1 53 ? 5.233   -8.985  -6.360  1.00 0.00 ? 53 THR A CG2  10 
ATOM 11106 H H    . THR A 1 53 ? 5.882   -11.740 -3.469  1.00 0.00 ? 53 THR A H    10 
ATOM 11107 H HA   . THR A 1 53 ? 7.483   -9.704  -4.767  1.00 0.00 ? 53 THR A HA   10 
ATOM 11108 H HB   . THR A 1 53 ? 4.681   -10.713 -5.244  1.00 0.00 ? 53 THR A HB   10 
ATOM 11109 H HG1  . THR A 1 53 ? 5.613   -11.785 -6.851  1.00 0.00 ? 53 THR A HG1  10 
ATOM 11110 H HG21 . THR A 1 53 ? 6.123   -8.393  -6.511  1.00 0.00 ? 53 THR A HG21 10 
ATOM 11111 H HG22 . THR A 1 53 ? 4.515   -8.417  -5.787  1.00 0.00 ? 53 THR A HG22 10 
ATOM 11112 H HG23 . THR A 1 53 ? 4.806   -9.244  -7.317  1.00 0.00 ? 53 THR A HG23 10 
ATOM 11113 N N    . TRP A 1 54 ? 4.787   -8.906  -3.026  1.00 0.00 ? 54 TRP A N    10 
ATOM 11114 C CA   . TRP A 1 54 ? 4.148   -7.824  -2.285  1.00 0.00 ? 54 TRP A CA   10 
ATOM 11115 C C    . TRP A 1 54 ? 5.166   -7.070  -1.437  1.00 0.00 ? 54 TRP A C    10 
ATOM 11116 O O    . TRP A 1 54 ? 5.413   -5.883  -1.656  1.00 0.00 ? 54 TRP A O    10 
ATOM 11117 C CB   . TRP A 1 54 ? 3.035   -8.377  -1.394  1.00 0.00 ? 54 TRP A CB   10 
ATOM 11118 C CG   . TRP A 1 54 ? 2.170   -7.311  -0.793  1.00 0.00 ? 54 TRP A CG   10 
ATOM 11119 C CD1  . TRP A 1 54 ? 1.034   -6.776  -1.331  1.00 0.00 ? 54 TRP A CD1  10 
ATOM 11120 C CD2  . TRP A 1 54 ? 2.373   -6.648  0.460   1.00 0.00 ? 54 TRP A CD2  10 
ATOM 11121 N NE1  . TRP A 1 54 ? 0.519   -5.821  -0.488  1.00 0.00 ? 54 TRP A NE1  10 
ATOM 11122 C CE2  . TRP A 1 54 ? 1.321   -5.724  0.618   1.00 0.00 ? 54 TRP A CE2  10 
ATOM 11123 C CE3  . TRP A 1 54 ? 3.339   -6.746  1.465   1.00 0.00 ? 54 TRP A CE3  10 
ATOM 11124 C CZ2  . TRP A 1 54 ? 1.211   -4.906  1.739   1.00 0.00 ? 54 TRP A CZ2  10 
ATOM 11125 C CZ3  . TRP A 1 54 ? 3.229   -5.933  2.576   1.00 0.00 ? 54 TRP A CZ3  10 
ATOM 11126 C CH2  . TRP A 1 54 ? 2.171   -5.023  2.707   1.00 0.00 ? 54 TRP A CH2  10 
ATOM 11127 H H    . TRP A 1 54 ? 4.356   -9.786  -3.054  1.00 0.00 ? 54 TRP A H    10 
ATOM 11128 H HA   . TRP A 1 54 ? 3.717   -7.142  -3.002  1.00 0.00 ? 54 TRP A HA   10 
ATOM 11129 H HB2  . TRP A 1 54 ? 2.403   -9.028  -1.980  1.00 0.00 ? 54 TRP A HB2  10 
ATOM 11130 H HB3  . TRP A 1 54 ? 3.477   -8.943  -0.586  1.00 0.00 ? 54 TRP A HB3  10 
ATOM 11131 H HD1  . TRP A 1 54 ? 0.616   -7.070  -2.282  1.00 0.00 ? 54 TRP A HD1  10 
ATOM 11132 H HE1  . TRP A 1 54 ? -0.293  -5.296  -0.653  1.00 0.00 ? 54 TRP A HE1  10 
ATOM 11133 H HE3  . TRP A 1 54 ? 4.161   -7.442  1.383   1.00 0.00 ? 54 TRP A HE3  10 
ATOM 11134 H HZ2  . TRP A 1 54 ? 0.402   -4.200  1.854   1.00 0.00 ? 54 TRP A HZ2  10 
ATOM 11135 H HZ3  . TRP A 1 54 ? 3.967   -5.995  3.363   1.00 0.00 ? 54 TRP A HZ3  10 
ATOM 11136 H HH2  . TRP A 1 54 ? 2.125   -4.407  3.592   1.00 0.00 ? 54 TRP A HH2  10 
ATOM 11137 N N    . PHE A 1 55 ? 5.756   -7.764  -0.470  1.00 0.00 ? 55 PHE A N    10 
ATOM 11138 C CA   . PHE A 1 55 ? 6.748   -7.159  0.411   1.00 0.00 ? 55 PHE A CA   10 
ATOM 11139 C C    . PHE A 1 55 ? 7.754   -6.336  -0.388  1.00 0.00 ? 55 PHE A C    10 
ATOM 11140 O O    . PHE A 1 55 ? 7.950   -5.150  -0.123  1.00 0.00 ? 55 PHE A O    10 
ATOM 11141 C CB   . PHE A 1 55 ? 7.477   -8.239  1.212   1.00 0.00 ? 55 PHE A CB   10 
ATOM 11142 C CG   . PHE A 1 55 ? 6.703   -8.728  2.403   1.00 0.00 ? 55 PHE A CG   10 
ATOM 11143 C CD1  . PHE A 1 55 ? 5.559   -9.492  2.236   1.00 0.00 ? 55 PHE A CD1  10 
ATOM 11144 C CD2  . PHE A 1 55 ? 7.118   -8.421  3.689   1.00 0.00 ? 55 PHE A CD2  10 
ATOM 11145 C CE1  . PHE A 1 55 ? 4.845   -9.944  3.330   1.00 0.00 ? 55 PHE A CE1  10 
ATOM 11146 C CE2  . PHE A 1 55 ? 6.408   -8.870  4.786   1.00 0.00 ? 55 PHE A CE2  10 
ATOM 11147 C CZ   . PHE A 1 55 ? 5.269   -9.631  4.607   1.00 0.00 ? 55 PHE A CZ   10 
ATOM 11148 H H    . PHE A 1 55 ? 5.517   -8.707  -0.345  1.00 0.00 ? 55 PHE A H    10 
ATOM 11149 H HA   . PHE A 1 55 ? 6.228   -6.505  1.094   1.00 0.00 ? 55 PHE A HA   10 
ATOM 11150 H HB2  . PHE A 1 55 ? 7.667   -9.086  0.571   1.00 0.00 ? 55 PHE A HB2  10 
ATOM 11151 H HB3  . PHE A 1 55 ? 8.417   -7.842  1.566   1.00 0.00 ? 55 PHE A HB3  10 
ATOM 11152 H HD1  . PHE A 1 55 ? 5.226   -9.737  1.238   1.00 0.00 ? 55 PHE A HD1  10 
ATOM 11153 H HD2  . PHE A 1 55 ? 8.008   -7.826  3.831   1.00 0.00 ? 55 PHE A HD2  10 
ATOM 11154 H HE1  . PHE A 1 55 ? 3.955   -10.538 3.186   1.00 0.00 ? 55 PHE A HE1  10 
ATOM 11155 H HE2  . PHE A 1 55 ? 6.742   -8.625  5.783   1.00 0.00 ? 55 PHE A HE2  10 
ATOM 11156 H HZ   . PHE A 1 55 ? 4.713   -9.983  5.463   1.00 0.00 ? 55 PHE A HZ   10 
ATOM 11157 N N    . GLN A 1 56 ? 8.389   -6.975  -1.365  1.00 0.00 ? 56 GLN A N    10 
ATOM 11158 C CA   . GLN A 1 56 ? 9.377   -6.302  -2.201  1.00 0.00 ? 56 GLN A CA   10 
ATOM 11159 C C    . GLN A 1 56 ? 8.818   -4.998  -2.760  1.00 0.00 ? 56 GLN A C    10 
ATOM 11160 O O    . GLN A 1 56 ? 9.499   -3.973  -2.767  1.00 0.00 ? 56 GLN A O    10 
ATOM 11161 C CB   . GLN A 1 56 ? 9.813   -7.217  -3.347  1.00 0.00 ? 56 GLN A CB   10 
ATOM 11162 C CG   . GLN A 1 56 ? 10.691  -8.374  -2.901  1.00 0.00 ? 56 GLN A CG   10 
ATOM 11163 C CD   . GLN A 1 56 ? 10.917  -9.393  -4.001  1.00 0.00 ? 56 GLN A CD   10 
ATOM 11164 O OE1  . GLN A 1 56 ? 10.188  -9.425  -4.993  1.00 0.00 ? 56 GLN A OE1  10 
ATOM 11165 N NE2  . GLN A 1 56 ? 11.932  -10.232 -3.832  1.00 0.00 ? 56 GLN A NE2  10 
ATOM 11166 H H    . GLN A 1 56 ? 8.190   -7.920  -1.526  1.00 0.00 ? 56 GLN A H    10 
ATOM 11167 H HA   . GLN A 1 56 ? 10.234  -6.078  -1.586  1.00 0.00 ? 56 GLN A HA   10 
ATOM 11168 H HB2  . GLN A 1 56 ? 8.932   -7.623  -3.823  1.00 0.00 ? 56 GLN A HB2  10 
ATOM 11169 H HB3  . GLN A 1 56 ? 10.364  -6.632  -4.068  1.00 0.00 ? 56 GLN A HB3  10 
ATOM 11170 H HG2  . GLN A 1 56 ? 11.649  -7.984  -2.591  1.00 0.00 ? 56 GLN A HG2  10 
ATOM 11171 H HG3  . GLN A 1 56 ? 10.217  -8.868  -2.066  1.00 0.00 ? 56 GLN A HG3  10 
ATOM 11172 H HE21 . GLN A 1 56 ? 12.470  -10.148 -3.016  1.00 0.00 ? 56 GLN A HE21 10 
ATOM 11173 H HE22 . GLN A 1 56 ? 12.101  -10.901 -4.527  1.00 0.00 ? 56 GLN A HE22 10 
ATOM 11174 N N    . ASN A 1 57 ? 7.575   -5.044  -3.228  1.00 0.00 ? 57 ASN A N    10 
ATOM 11175 C CA   . ASN A 1 57 ? 6.926   -3.865  -3.790  1.00 0.00 ? 57 ASN A CA   10 
ATOM 11176 C C    . ASN A 1 57 ? 6.626   -2.838  -2.702  1.00 0.00 ? 57 ASN A C    10 
ATOM 11177 O O    . ASN A 1 57 ? 6.582   -1.636  -2.964  1.00 0.00 ? 57 ASN A O    10 
ATOM 11178 C CB   . ASN A 1 57 ? 5.631   -4.261  -4.503  1.00 0.00 ? 57 ASN A CB   10 
ATOM 11179 C CG   . ASN A 1 57 ? 5.890   -5.032  -5.783  1.00 0.00 ? 57 ASN A CG   10 
ATOM 11180 O OD1  . ASN A 1 57 ? 6.996   -5.008  -6.323  1.00 0.00 ? 57 ASN A OD1  10 
ATOM 11181 N ND2  . ASN A 1 57 ? 4.866   -5.720  -6.276  1.00 0.00 ? 57 ASN A ND2  10 
ATOM 11182 H H    . ASN A 1 57 ? 7.083   -5.890  -3.195  1.00 0.00 ? 57 ASN A H    10 
ATOM 11183 H HA   . ASN A 1 57 ? 7.601   -3.425  -4.508  1.00 0.00 ? 57 ASN A HA   10 
ATOM 11184 H HB2  . ASN A 1 57 ? 5.041   -4.883  -3.845  1.00 0.00 ? 57 ASN A HB2  10 
ATOM 11185 H HB3  . ASN A 1 57 ? 5.074   -3.370  -4.747  1.00 0.00 ? 57 ASN A HB3  10 
ATOM 11186 H HD21 . ASN A 1 57 ? 4.014   -5.693  -5.792  1.00 0.00 ? 57 ASN A HD21 10 
ATOM 11187 H HD22 . ASN A 1 57 ? 5.006   -6.228  -7.103  1.00 0.00 ? 57 ASN A HD22 10 
ATOM 11188 N N    . ARG A 1 58 ? 6.422   -3.321  -1.481  1.00 0.00 ? 58 ARG A N    10 
ATOM 11189 C CA   . ARG A 1 58 ? 6.126   -2.446  -0.353  1.00 0.00 ? 58 ARG A CA   10 
ATOM 11190 C C    . ARG A 1 58 ? 7.289   -1.495  -0.082  1.00 0.00 ? 58 ARG A C    10 
ATOM 11191 O O    . ARG A 1 58 ? 7.117   -0.276  -0.071  1.00 0.00 ? 58 ARG A O    10 
ATOM 11192 C CB   . ARG A 1 58 ? 5.828   -3.274  0.899   1.00 0.00 ? 58 ARG A CB   10 
ATOM 11193 C CG   . ARG A 1 58 ? 5.052   -2.514  1.962   1.00 0.00 ? 58 ARG A CG   10 
ATOM 11194 C CD   . ARG A 1 58 ? 3.830   -1.826  1.374   1.00 0.00 ? 58 ARG A CD   10 
ATOM 11195 N NE   . ARG A 1 58 ? 3.257   -2.583  0.264   1.00 0.00 ? 58 ARG A NE   10 
ATOM 11196 C CZ   . ARG A 1 58 ? 2.488   -2.042  -0.674  1.00 0.00 ? 58 ARG A CZ   10 
ATOM 11197 N NH1  . ARG A 1 58 ? 2.202   -0.748  -0.637  1.00 0.00 ? 58 ARG A NH1  10 
ATOM 11198 N NH2  . ARG A 1 58 ? 2.004   -2.796  -1.653  1.00 0.00 ? 58 ARG A NH2  10 
ATOM 11199 H H    . ARG A 1 58 ? 6.471   -4.289  -1.334  1.00 0.00 ? 58 ARG A H    10 
ATOM 11200 H HA   . ARG A 1 58 ? 5.252   -1.864  -0.605  1.00 0.00 ? 58 ARG A HA   10 
ATOM 11201 H HB2  . ARG A 1 58 ? 5.250   -4.141  0.614   1.00 0.00 ? 58 ARG A HB2  10 
ATOM 11202 H HB3  . ARG A 1 58 ? 6.763   -3.600  1.330   1.00 0.00 ? 58 ARG A HB3  10 
ATOM 11203 H HG2  . ARG A 1 58 ? 4.729   -3.208  2.724   1.00 0.00 ? 58 ARG A HG2  10 
ATOM 11204 H HG3  . ARG A 1 58 ? 5.698   -1.768  2.401   1.00 0.00 ? 58 ARG A HG3  10 
ATOM 11205 H HD2  . ARG A 1 58 ? 3.085   -1.722  2.149   1.00 0.00 ? 58 ARG A HD2  10 
ATOM 11206 H HD3  . ARG A 1 58 ? 4.120   -0.848  1.020   1.00 0.00 ? 58 ARG A HD3  10 
ATOM 11207 H HE   . ARG A 1 58 ? 3.456   -3.541  0.218   1.00 0.00 ? 58 ARG A HE   10 
ATOM 11208 H HH11 . ARG A 1 58 ? 2.566   -0.177  0.098   1.00 0.00 ? 58 ARG A HH11 10 
ATOM 11209 H HH12 . ARG A 1 58 ? 1.623   -0.343  -1.346  1.00 0.00 ? 58 ARG A HH12 10 
ATOM 11210 H HH21 . ARG A 1 58 ? 2.217   -3.772  -1.684  1.00 0.00 ? 58 ARG A HH21 10 
ATOM 11211 H HH22 . ARG A 1 58 ? 1.425   -2.389  -2.358  1.00 0.00 ? 58 ARG A HH22 10 
ATOM 11212 N N    . ARG A 1 59 ? 8.471   -2.062  0.136   1.00 0.00 ? 59 ARG A N    10 
ATOM 11213 C CA   . ARG A 1 59 ? 9.661   -1.266  0.408   1.00 0.00 ? 59 ARG A CA   10 
ATOM 11214 C C    . ARG A 1 59 ? 9.785   -0.116  -0.587  1.00 0.00 ? 59 ARG A C    10 
ATOM 11215 O O    . ARG A 1 59 ? 10.008  1.031   -0.201  1.00 0.00 ? 59 ARG A O    10 
ATOM 11216 C CB   . ARG A 1 59 ? 10.913  -2.144  0.348   1.00 0.00 ? 59 ARG A CB   10 
ATOM 11217 C CG   . ARG A 1 59 ? 11.281  -2.771  1.683   1.00 0.00 ? 59 ARG A CG   10 
ATOM 11218 C CD   . ARG A 1 59 ? 12.777  -3.028  1.784   1.00 0.00 ? 59 ARG A CD   10 
ATOM 11219 N NE   . ARG A 1 59 ? 13.538  -1.788  1.911   1.00 0.00 ? 59 ARG A NE   10 
ATOM 11220 C CZ   . ARG A 1 59 ? 14.833  -1.690  1.635   1.00 0.00 ? 59 ARG A CZ   10 
ATOM 11221 N NH1  . ARG A 1 59 ? 15.508  -2.752  1.218   1.00 0.00 ? 59 ARG A NH1  10 
ATOM 11222 N NH2  . ARG A 1 59 ? 15.456  -0.526  1.776   1.00 0.00 ? 59 ARG A NH2  10 
ATOM 11223 H H    . ARG A 1 59 ? 8.544   -3.039  0.114   1.00 0.00 ? 59 ARG A H    10 
ATOM 11224 H HA   . ARG A 1 59 ? 9.567   -0.857  1.403   1.00 0.00 ? 59 ARG A HA   10 
ATOM 11225 H HB2  . ARG A 1 59 ? 10.747  -2.938  -0.364  1.00 0.00 ? 59 ARG A HB2  10 
ATOM 11226 H HB3  . ARG A 1 59 ? 11.745  -1.541  0.016   1.00 0.00 ? 59 ARG A HB3  10 
ATOM 11227 H HG2  . ARG A 1 59 ? 10.988  -2.101  2.478   1.00 0.00 ? 59 ARG A HG2  10 
ATOM 11228 H HG3  . ARG A 1 59 ? 10.755  -3.708  1.787   1.00 0.00 ? 59 ARG A HG3  10 
ATOM 11229 H HD2  . ARG A 1 59 ? 12.965  -3.645  2.649   1.00 0.00 ? 59 ARG A HD2  10 
ATOM 11230 H HD3  . ARG A 1 59 ? 13.099  -3.548  0.894   1.00 0.00 ? 59 ARG A HD3  10 
ATOM 11231 H HE   . ARG A 1 59 ? 13.058  -0.991  2.218   1.00 0.00 ? 59 ARG A HE   10 
ATOM 11232 H HH11 . ARG A 1 59 ? 15.041  -3.629  1.110   1.00 0.00 ? 59 ARG A HH11 10 
ATOM 11233 H HH12 . ARG A 1 59 ? 16.484  -2.674  1.010   1.00 0.00 ? 59 ARG A HH12 10 
ATOM 11234 H HH21 . ARG A 1 59 ? 14.951  0.276   2.091   1.00 0.00 ? 59 ARG A HH21 10 
ATOM 11235 H HH22 . ARG A 1 59 ? 16.431  -0.453  1.568   1.00 0.00 ? 59 ARG A HH22 10 
ATOM 11236 N N    . ALA A 1 60 ? 9.641   -0.432  -1.870  1.00 0.00 ? 60 ALA A N    10 
ATOM 11237 C CA   . ALA A 1 60 ? 9.736   0.574   -2.920  1.00 0.00 ? 60 ALA A CA   10 
ATOM 11238 C C    . ALA A 1 60 ? 8.944   1.825   -2.554  1.00 0.00 ? 60 ALA A C    10 
ATOM 11239 O O    . ALA A 1 60 ? 9.343   2.943   -2.883  1.00 0.00 ? 60 ALA A O    10 
ATOM 11240 C CB   . ALA A 1 60 ? 9.244   0.005   -4.243  1.00 0.00 ? 60 ALA A CB   10 
ATOM 11241 H H    . ALA A 1 60 ? 9.466   -1.364  -2.115  1.00 0.00 ? 60 ALA A H    10 
ATOM 11242 H HA   . ALA A 1 60 ? 10.777  0.840   -3.035  1.00 0.00 ? 60 ALA A HA   10 
ATOM 11243 H HB1  . ALA A 1 60 ? 8.682   -0.899  -4.057  1.00 0.00 ? 60 ALA A HB1  10 
ATOM 11244 H HB2  . ALA A 1 60 ? 8.611   0.729   -4.733  1.00 0.00 ? 60 ALA A HB2  10 
ATOM 11245 H HB3  . ALA A 1 60 ? 10.091  -0.221  -4.874  1.00 0.00 ? 60 ALA A HB3  10 
ATOM 11246 N N    . LYS A 1 61 ? 7.820   1.631   -1.873  1.00 0.00 ? 61 LYS A N    10 
ATOM 11247 C CA   . LYS A 1 61 ? 6.972   2.743   -1.461  1.00 0.00 ? 61 LYS A CA   10 
ATOM 11248 C C    . LYS A 1 61 ? 7.360   3.237   -0.071  1.00 0.00 ? 61 LYS A C    10 
ATOM 11249 O O    . LYS A 1 61 ? 7.656   4.417   0.118   1.00 0.00 ? 61 LYS A O    10 
ATOM 11250 C CB   . LYS A 1 61 ? 5.501   2.321   -1.472  1.00 0.00 ? 61 LYS A CB   10 
ATOM 11251 C CG   . LYS A 1 61 ? 4.534   3.483   -1.328  1.00 0.00 ? 61 LYS A CG   10 
ATOM 11252 C CD   . LYS A 1 61 ? 3.093   3.005   -1.273  1.00 0.00 ? 61 LYS A CD   10 
ATOM 11253 C CE   . LYS A 1 61 ? 2.118   4.172   -1.297  1.00 0.00 ? 61 LYS A CE   10 
ATOM 11254 N NZ   . LYS A 1 61 ? 0.701   3.712   -1.291  1.00 0.00 ? 61 LYS A NZ   10 
ATOM 11255 H H    . LYS A 1 61 ? 7.555   0.716   -1.640  1.00 0.00 ? 61 LYS A H    10 
ATOM 11256 H HA   . LYS A 1 61 ? 7.113   3.547   -2.168  1.00 0.00 ? 61 LYS A HA   10 
ATOM 11257 H HB2  . LYS A 1 61 ? 5.291   1.818   -2.405  1.00 0.00 ? 61 LYS A HB2  10 
ATOM 11258 H HB3  . LYS A 1 61 ? 5.330   1.634   -0.656  1.00 0.00 ? 61 LYS A HB3  10 
ATOM 11259 H HG2  . LYS A 1 61 ? 4.760   4.017   -0.417  1.00 0.00 ? 61 LYS A HG2  10 
ATOM 11260 H HG3  . LYS A 1 61 ? 4.652   4.145   -2.174  1.00 0.00 ? 61 LYS A HG3  10 
ATOM 11261 H HD2  . LYS A 1 61 ? 2.899   2.372   -2.126  1.00 0.00 ? 61 LYS A HD2  10 
ATOM 11262 H HD3  . LYS A 1 61 ? 2.944   2.442   -0.363  1.00 0.00 ? 61 LYS A HD3  10 
ATOM 11263 H HE2  . LYS A 1 61 ? 2.291   4.787   -0.427  1.00 0.00 ? 61 LYS A HE2  10 
ATOM 11264 H HE3  . LYS A 1 61 ? 2.294   4.754   -2.189  1.00 0.00 ? 61 LYS A HE3  10 
ATOM 11265 H HZ1  . LYS A 1 61 ? 0.337   3.665   -2.264  1.00 0.00 ? 61 LYS A HZ1  10 
ATOM 11266 H HZ2  . LYS A 1 61 ? 0.113   4.373   -0.744  1.00 0.00 ? 61 LYS A HZ2  10 
ATOM 11267 H HZ3  . LYS A 1 61 ? 0.634   2.767   -0.861  1.00 0.00 ? 61 LYS A HZ3  10 
ATOM 11268 N N    . TRP A 1 62 ? 7.356   2.328   0.897   1.00 0.00 ? 62 TRP A N    10 
ATOM 11269 C CA   . TRP A 1 62 ? 7.709   2.672   2.270   1.00 0.00 ? 62 TRP A CA   10 
ATOM 11270 C C    . TRP A 1 62 ? 8.931   3.583   2.306   1.00 0.00 ? 62 TRP A C    10 
ATOM 11271 O O    . TRP A 1 62 ? 9.093   4.383   3.228   1.00 0.00 ? 62 TRP A O    10 
ATOM 11272 C CB   . TRP A 1 62 ? 7.979   1.404   3.082   1.00 0.00 ? 62 TRP A CB   10 
ATOM 11273 C CG   . TRP A 1 62 ? 8.694   1.666   4.373   1.00 0.00 ? 62 TRP A CG   10 
ATOM 11274 C CD1  . TRP A 1 62 ? 8.195   2.307   5.471   1.00 0.00 ? 62 TRP A CD1  10 
ATOM 11275 C CD2  . TRP A 1 62 ? 10.039  1.296   4.698   1.00 0.00 ? 62 TRP A CD2  10 
ATOM 11276 N NE1  . TRP A 1 62 ? 9.148   2.357   6.459   1.00 0.00 ? 62 TRP A NE1  10 
ATOM 11277 C CE2  . TRP A 1 62 ? 10.288  1.743   6.010   1.00 0.00 ? 62 TRP A CE2  10 
ATOM 11278 C CE3  . TRP A 1 62 ? 11.055  0.628   4.010   1.00 0.00 ? 62 TRP A CE3  10 
ATOM 11279 C CZ2  . TRP A 1 62 ? 11.511  1.545   6.644   1.00 0.00 ? 62 TRP A CZ2  10 
ATOM 11280 C CZ3  . TRP A 1 62 ? 12.269  0.432   4.640   1.00 0.00 ? 62 TRP A CZ3  10 
ATOM 11281 C CH2  . TRP A 1 62 ? 12.489  0.888   5.947   1.00 0.00 ? 62 TRP A CH2  10 
ATOM 11282 H H    . TRP A 1 62 ? 7.111   1.403   0.684   1.00 0.00 ? 62 TRP A H    10 
ATOM 11283 H HA   . TRP A 1 62 ? 6.871   3.195   2.705   1.00 0.00 ? 62 TRP A HA   10 
ATOM 11284 H HB2  . TRP A 1 62 ? 7.040   0.925   3.313   1.00 0.00 ? 62 TRP A HB2  10 
ATOM 11285 H HB3  . TRP A 1 62 ? 8.587   0.732   2.494   1.00 0.00 ? 62 TRP A HB3  10 
ATOM 11286 H HD1  . TRP A 1 62 ? 7.197   2.712   5.537   1.00 0.00 ? 62 TRP A HD1  10 
ATOM 11287 H HE1  . TRP A 1 62 ? 9.030   2.766   7.343   1.00 0.00 ? 62 TRP A HE1  10 
ATOM 11288 H HE3  . TRP A 1 62 ? 10.905  0.270   3.002   1.00 0.00 ? 62 TRP A HE3  10 
ATOM 11289 H HZ2  . TRP A 1 62 ? 11.696  1.890   7.651   1.00 0.00 ? 62 TRP A HZ2  10 
ATOM 11290 H HZ3  . TRP A 1 62 ? 13.067  -0.081  4.124   1.00 0.00 ? 62 TRP A HZ3  10 
ATOM 11291 H HH2  . TRP A 1 62 ? 13.452  0.713   6.400   1.00 0.00 ? 62 TRP A HH2  10 
ATOM 11292 N N    . ARG A 1 63 ? 9.787   3.458   1.297   1.00 0.00 ? 63 ARG A N    10 
ATOM 11293 C CA   . ARG A 1 63 ? 10.994  4.271   1.215   1.00 0.00 ? 63 ARG A CA   10 
ATOM 11294 C C    . ARG A 1 63 ? 10.663  5.694   0.774   1.00 0.00 ? 63 ARG A C    10 
ATOM 11295 O O    . ARG A 1 63 ? 11.242  6.659   1.273   1.00 0.00 ? 63 ARG A O    10 
ATOM 11296 C CB   . ARG A 1 63 ? 11.992  3.643   0.241   1.00 0.00 ? 63 ARG A CB   10 
ATOM 11297 C CG   . ARG A 1 63 ? 12.785  2.492   0.838   1.00 0.00 ? 63 ARG A CG   10 
ATOM 11298 C CD   . ARG A 1 63 ? 13.900  2.042   -0.093  1.00 0.00 ? 63 ARG A CD   10 
ATOM 11299 N NE   . ARG A 1 63 ? 14.980  3.022   -0.168  1.00 0.00 ? 63 ARG A NE   10 
ATOM 11300 C CZ   . ARG A 1 63 ? 16.114  2.817   -0.827  1.00 0.00 ? 63 ARG A CZ   10 
ATOM 11301 N NH1  . ARG A 1 63 ? 16.317  1.673   -1.465  1.00 0.00 ? 63 ARG A NH1  10 
ATOM 11302 N NH2  . ARG A 1 63 ? 17.049  3.758   -0.849  1.00 0.00 ? 63 ARG A NH2  10 
ATOM 11303 H H    . ARG A 1 63 ? 9.603   2.804   0.592   1.00 0.00 ? 63 ARG A H    10 
ATOM 11304 H HA   . ARG A 1 63 ? 11.439  4.306   2.199   1.00 0.00 ? 63 ARG A HA   10 
ATOM 11305 H HB2  . ARG A 1 63 ? 11.453  3.272   -0.619  1.00 0.00 ? 63 ARG A HB2  10 
ATOM 11306 H HB3  . ARG A 1 63 ? 12.689  4.402   -0.082  1.00 0.00 ? 63 ARG A HB3  10 
ATOM 11307 H HG2  . ARG A 1 63 ? 13.219  2.813   1.773   1.00 0.00 ? 63 ARG A HG2  10 
ATOM 11308 H HG3  . ARG A 1 63 ? 12.117  1.661   1.014   1.00 0.00 ? 63 ARG A HG3  10 
ATOM 11309 H HD2  . ARG A 1 63 ? 14.300  1.108   0.273   1.00 0.00 ? 63 ARG A HD2  10 
ATOM 11310 H HD3  . ARG A 1 63 ? 13.489  1.895   -1.080  1.00 0.00 ? 63 ARG A HD3  10 
ATOM 11311 H HE   . ARG A 1 63 ? 14.851  3.875   0.296   1.00 0.00 ? 63 ARG A HE   10 
ATOM 11312 H HH11 . ARG A 1 63 ? 15.613  0.962   -1.451  1.00 0.00 ? 63 ARG A HH11 10 
ATOM 11313 H HH12 . ARG A 1 63 ? 17.172  1.521   -1.962  1.00 0.00 ? 63 ARG A HH12 10 
ATOM 11314 H HH21 . ARG A 1 63 ? 16.900  4.623   -0.370  1.00 0.00 ? 63 ARG A HH21 10 
ATOM 11315 H HH22 . ARG A 1 63 ? 17.903  3.603   -1.346  1.00 0.00 ? 63 ARG A HH22 10 
ATOM 11316 N N    . ARG A 1 64 ? 9.730   5.815   -0.164  1.00 0.00 ? 64 ARG A N    10 
ATOM 11317 C CA   . ARG A 1 64 ? 9.323   7.119   -0.673  1.00 0.00 ? 64 ARG A CA   10 
ATOM 11318 C C    . ARG A 1 64 ? 8.539   7.894   0.381   1.00 0.00 ? 64 ARG A C    10 
ATOM 11319 O O    . ARG A 1 64 ? 8.712   9.103   0.535   1.00 0.00 ? 64 ARG A O    10 
ATOM 11320 C CB   . ARG A 1 64 ? 8.476   6.956   -1.936  1.00 0.00 ? 64 ARG A CB   10 
ATOM 11321 C CG   . ARG A 1 64 ? 8.345   8.232   -2.751  1.00 0.00 ? 64 ARG A CG   10 
ATOM 11322 C CD   . ARG A 1 64 ? 7.255   9.136   -2.198  1.00 0.00 ? 64 ARG A CD   10 
ATOM 11323 N NE   . ARG A 1 64 ? 6.656   9.970   -3.237  1.00 0.00 ? 64 ARG A NE   10 
ATOM 11324 C CZ   . ARG A 1 64 ? 5.956   11.071  -2.984  1.00 0.00 ? 64 ARG A CZ   10 
ATOM 11325 N NH1  . ARG A 1 64 ? 5.769   11.468  -1.733  1.00 0.00 ? 64 ARG A NH1  10 
ATOM 11326 N NH2  . ARG A 1 64 ? 5.443   11.776  -3.984  1.00 0.00 ? 64 ARG A NH2  10 
ATOM 11327 H H    . ARG A 1 64 ? 9.305   5.008   -0.523  1.00 0.00 ? 64 ARG A H    10 
ATOM 11328 H HA   . ARG A 1 64 ? 10.217  7.673   -0.919  1.00 0.00 ? 64 ARG A HA   10 
ATOM 11329 H HB2  . ARG A 1 64 ? 8.927   6.200   -2.563  1.00 0.00 ? 64 ARG A HB2  10 
ATOM 11330 H HB3  . ARG A 1 64 ? 7.486   6.633   -1.652  1.00 0.00 ? 64 ARG A HB3  10 
ATOM 11331 H HG2  . ARG A 1 64 ? 9.285   8.763   -2.725  1.00 0.00 ? 64 ARG A HG2  10 
ATOM 11332 H HG3  . ARG A 1 64 ? 8.103   7.973   -3.771  1.00 0.00 ? 64 ARG A HG3  10 
ATOM 11333 H HD2  . ARG A 1 64 ? 6.485   8.521   -1.756  1.00 0.00 ? 64 ARG A HD2  10 
ATOM 11334 H HD3  . ARG A 1 64 ? 7.685   9.774   -1.441  1.00 0.00 ? 64 ARG A HD3  10 
ATOM 11335 H HE   . ARG A 1 64 ? 6.782   9.695   -4.169  1.00 0.00 ? 64 ARG A HE   10 
ATOM 11336 H HH11 . ARG A 1 64 ? 6.156   10.939  -0.978  1.00 0.00 ? 64 ARG A HH11 10 
ATOM 11337 H HH12 . ARG A 1 64 ? 5.243   12.298  -1.545  1.00 0.00 ? 64 ARG A HH12 10 
ATOM 11338 H HH21 . ARG A 1 64 ? 5.582   11.480  -4.928  1.00 0.00 ? 64 ARG A HH21 10 
ATOM 11339 H HH22 . ARG A 1 64 ? 4.917   12.604  -3.792  1.00 0.00 ? 64 ARG A HH22 10 
ATOM 11340 N N    . SER A 1 65 ? 7.675   7.190   1.105   1.00 0.00 ? 65 SER A N    10 
ATOM 11341 C CA   . SER A 1 65 ? 6.860   7.812   2.142   1.00 0.00 ? 65 SER A CA   10 
ATOM 11342 C C    . SER A 1 65 ? 7.657   7.976   3.433   1.00 0.00 ? 65 SER A C    10 
ATOM 11343 O O    . SER A 1 65 ? 7.575   9.007   4.099   1.00 0.00 ? 65 SER A O    10 
ATOM 11344 C CB   . SER A 1 65 ? 5.607   6.976   2.406   1.00 0.00 ? 65 SER A CB   10 
ATOM 11345 O OG   . SER A 1 65 ? 4.701   7.056   1.319   1.00 0.00 ? 65 SER A OG   10 
ATOM 11346 H H    . SER A 1 65 ? 7.581   6.229   0.936   1.00 0.00 ? 65 SER A H    10 
ATOM 11347 H HA   . SER A 1 65 ? 6.563   8.788   1.790   1.00 0.00 ? 65 SER A HA   10 
ATOM 11348 H HB2  . SER A 1 65 ? 5.889   5.943   2.548   1.00 0.00 ? 65 SER A HB2  10 
ATOM 11349 H HB3  . SER A 1 65 ? 5.115   7.340   3.297   1.00 0.00 ? 65 SER A HB3  10 
ATOM 11350 H HG   . SER A 1 65 ? 4.452   7.973   1.178   1.00 0.00 ? 65 SER A HG   10 
ATOM 11351 N N    . GLY A 1 66 ? 8.428   6.950   3.780   1.00 0.00 ? 66 GLY A N    10 
ATOM 11352 C CA   . GLY A 1 66 ? 9.229   7.000   4.990   1.00 0.00 ? 66 GLY A CA   10 
ATOM 11353 C C    . GLY A 1 66 ? 10.312  8.058   4.925   1.00 0.00 ? 66 GLY A C    10 
ATOM 11354 O O    . GLY A 1 66 ? 10.084  9.229   5.231   1.00 0.00 ? 66 GLY A O    10 
ATOM 11355 H H    . GLY A 1 66 ? 8.454   6.153   3.210   1.00 0.00 ? 66 GLY A H    10 
ATOM 11356 H HA2  . GLY A 1 66 ? 8.582   7.212   5.828   1.00 0.00 ? 66 GLY A HA2  10 
ATOM 11357 H HA3  . GLY A 1 66 ? 9.692   6.036   5.140   1.00 0.00 ? 66 GLY A HA3  10 
ATOM 11358 N N    . PRO A 1 67 ? 11.523  7.647   4.520   1.00 0.00 ? 67 PRO A N    10 
ATOM 11359 C CA   . PRO A 1 67 ? 12.669  8.554   4.408   1.00 0.00 ? 67 PRO A CA   10 
ATOM 11360 C C    . PRO A 1 67 ? 12.514  9.546   3.261   1.00 0.00 ? 67 PRO A C    10 
ATOM 11361 O O    . PRO A 1 67 ? 11.889  9.242   2.245   1.00 0.00 ? 67 PRO A O    10 
ATOM 11362 C CB   . PRO A 1 67 ? 13.844  7.609   4.142   1.00 0.00 ? 67 PRO A CB   10 
ATOM 11363 C CG   . PRO A 1 67 ? 13.227  6.405   3.517   1.00 0.00 ? 67 PRO A CG   10 
ATOM 11364 C CD   . PRO A 1 67 ? 11.865  6.267   4.140   1.00 0.00 ? 67 PRO A CD   10 
ATOM 11365 H HA   . PRO A 1 67 ? 12.840  9.093   5.329   1.00 0.00 ? 67 PRO A HA   10 
ATOM 11366 H HB2  . PRO A 1 67 ? 14.548  8.085   3.475   1.00 0.00 ? 67 PRO A HB2  10 
ATOM 11367 H HB3  . PRO A 1 67 ? 14.331  7.364   5.074   1.00 0.00 ? 67 PRO A HB3  10 
ATOM 11368 H HG2  . PRO A 1 67 ? 13.140  6.549   2.451   1.00 0.00 ? 67 PRO A HG2  10 
ATOM 11369 H HG3  . PRO A 1 67 ? 13.827  5.533   3.732   1.00 0.00 ? 67 PRO A HG3  10 
ATOM 11370 H HD2  . PRO A 1 67 ? 11.160  5.879   3.420   1.00 0.00 ? 67 PRO A HD2  10 
ATOM 11371 H HD3  . PRO A 1 67 ? 11.911  5.628   5.009   1.00 0.00 ? 67 PRO A HD3  10 
ATOM 11372 N N    . SER A 1 68 ? 13.087  10.734  3.430   1.00 0.00 ? 68 SER A N    10 
ATOM 11373 C CA   . SER A 1 68 ? 13.009  11.772  2.410   1.00 0.00 ? 68 SER A CA   10 
ATOM 11374 C C    . SER A 1 68 ? 14.400  12.285  2.049   1.00 0.00 ? 68 SER A C    10 
ATOM 11375 O O    . SER A 1 68 ? 14.779  12.312  0.878   1.00 0.00 ? 68 SER A O    10 
ATOM 11376 C CB   . SER A 1 68 ? 12.137  12.931  2.897   1.00 0.00 ? 68 SER A CB   10 
ATOM 11377 O OG   . SER A 1 68 ? 11.725  13.749  1.815   1.00 0.00 ? 68 SER A OG   10 
ATOM 11378 H H    . SER A 1 68 ? 13.572  10.916  4.263   1.00 0.00 ? 68 SER A H    10 
ATOM 11379 H HA   . SER A 1 68 ? 12.559  11.339  1.529   1.00 0.00 ? 68 SER A HA   10 
ATOM 11380 H HB2  . SER A 1 68 ? 11.261  12.537  3.388   1.00 0.00 ? 68 SER A HB2  10 
ATOM 11381 H HB3  . SER A 1 68 ? 12.701  13.534  3.594   1.00 0.00 ? 68 SER A HB3  10 
ATOM 11382 H HG   . SER A 1 68 ? 10.793  13.957  1.908   1.00 0.00 ? 68 SER A HG   10 
ATOM 11383 N N    . SER A 1 69 ? 15.157  12.690  3.064   1.00 0.00 ? 69 SER A N    10 
ATOM 11384 C CA   . SER A 1 69 ? 16.505  13.205  2.855   1.00 0.00 ? 69 SER A CA   10 
ATOM 11385 C C    . SER A 1 69 ? 17.550  12.186  3.297   1.00 0.00 ? 69 SER A C    10 
ATOM 11386 O O    . SER A 1 69 ? 18.481  11.874  2.555   1.00 0.00 ? 69 SER A O    10 
ATOM 11387 C CB   . SER A 1 69 ? 16.697  14.515  3.622   1.00 0.00 ? 69 SER A CB   10 
ATOM 11388 O OG   . SER A 1 69 ? 16.394  14.351  4.997   1.00 0.00 ? 69 SER A OG   10 
ATOM 11389 H H    . SER A 1 69 ? 14.798  12.643  3.975   1.00 0.00 ? 69 SER A H    10 
ATOM 11390 H HA   . SER A 1 69 ? 16.627  13.395  1.799   1.00 0.00 ? 69 SER A HA   10 
ATOM 11391 H HB2  . SER A 1 69 ? 17.723  14.837  3.528   1.00 0.00 ? 69 SER A HB2  10 
ATOM 11392 H HB3  . SER A 1 69 ? 16.044  15.270  3.209   1.00 0.00 ? 69 SER A HB3  10 
ATOM 11393 H HG   . SER A 1 69 ? 17.181  14.516  5.520   1.00 0.00 ? 69 SER A HG   10 
ATOM 11394 N N    . GLY A 1 70 ? 17.389  11.670  4.512   1.00 0.00 ? 70 GLY A N    10 
ATOM 11395 C CA   . GLY A 1 70 ? 18.326  10.692  5.032   1.00 0.00 ? 70 GLY A CA   10 
ATOM 11396 C C    . GLY A 1 70 ? 18.380  9.434   4.188   1.00 0.00 ? 70 GLY A C    10 
ATOM 11397 O O    . GLY A 1 70 ? 19.399  8.745   4.153   1.00 0.00 ? 70 GLY A O    10 
ATOM 11398 H H    . GLY A 1 70 ? 16.628  11.956  5.059   1.00 0.00 ? 70 GLY A H    10 
ATOM 11399 H HA2  . GLY A 1 70 ? 19.311  11.134  5.064   1.00 0.00 ? 70 GLY A HA2  10 
ATOM 11400 H HA3  . GLY A 1 70 ? 18.029  10.425  6.036   1.00 0.00 ? 70 GLY A HA3  10 
ATOM 11401 N N    . GLY A 1 1  ? 13.262  14.656  -12.540 1.00 0.00 ? 1  GLY A N    11 
ATOM 11402 C CA   . GLY A 1 1  ? 12.076  14.369  -11.755 1.00 0.00 ? 1  GLY A CA   11 
ATOM 11403 C C    . GLY A 1 1  ? 11.079  13.506  -12.503 1.00 0.00 ? 1  GLY A C    11 
ATOM 11404 O O    . GLY A 1 1  ? 10.412  13.974  -13.425 1.00 0.00 ? 1  GLY A O    11 
ATOM 11405 H H1   . GLY A 1 1  ? 13.300  14.386  -13.482 1.00 0.00 ? 1  GLY A H1   11 
ATOM 11406 H HA2  . GLY A 1 1  ? 12.371  13.859  -10.850 1.00 0.00 ? 1  GLY A HA2  11 
ATOM 11407 H HA3  . GLY A 1 1  ? 11.599  15.302  -11.491 1.00 0.00 ? 1  GLY A HA3  11 
ATOM 11408 N N    . SER A 1 2  ? 10.980  12.241  -12.106 1.00 0.00 ? 2  SER A N    11 
ATOM 11409 C CA   . SER A 1 2  ? 10.062  11.308  -12.749 1.00 0.00 ? 2  SER A CA   11 
ATOM 11410 C C    . SER A 1 2  ? 9.813   10.092  -11.862 1.00 0.00 ? 2  SER A C    11 
ATOM 11411 O O    . SER A 1 2  ? 10.406  9.959   -10.792 1.00 0.00 ? 2  SER A O    11 
ATOM 11412 C CB   . SER A 1 2  ? 10.620  10.861  -14.102 1.00 0.00 ? 2  SER A CB   11 
ATOM 11413 O OG   . SER A 1 2  ? 10.468  11.878  -15.077 1.00 0.00 ? 2  SER A OG   11 
ATOM 11414 H H    . SER A 1 2  ? 11.539  11.927  -11.365 1.00 0.00 ? 2  SER A H    11 
ATOM 11415 H HA   . SER A 1 2  ? 9.125   11.821  -12.908 1.00 0.00 ? 2  SER A HA   11 
ATOM 11416 H HB2  . SER A 1 2  ? 11.669  10.633  -13.997 1.00 0.00 ? 2  SER A HB2  11 
ATOM 11417 H HB3  . SER A 1 2  ? 10.090  9.980   -14.433 1.00 0.00 ? 2  SER A HB3  11 
ATOM 11418 H HG   . SER A 1 2  ? 11.328  12.105  -15.439 1.00 0.00 ? 2  SER A HG   11 
ATOM 11419 N N    . SER A 1 3  ? 8.931   9.207   -12.316 1.00 0.00 ? 3  SER A N    11 
ATOM 11420 C CA   . SER A 1 3  ? 8.599   8.003   -11.563 1.00 0.00 ? 3  SER A CA   11 
ATOM 11421 C C    . SER A 1 3  ? 8.342   6.829   -12.502 1.00 0.00 ? 3  SER A C    11 
ATOM 11422 O O    . SER A 1 3  ? 8.204   7.005   -13.711 1.00 0.00 ? 3  SER A O    11 
ATOM 11423 C CB   . SER A 1 3  ? 7.371   8.248   -10.685 1.00 0.00 ? 3  SER A CB   11 
ATOM 11424 O OG   . SER A 1 3  ? 7.545   9.394   -9.871  1.00 0.00 ? 3  SER A OG   11 
ATOM 11425 H H    . SER A 1 3  ? 8.491   9.369   -13.177 1.00 0.00 ? 3  SER A H    11 
ATOM 11426 H HA   . SER A 1 3  ? 9.442   7.766   -10.930 1.00 0.00 ? 3  SER A HA   11 
ATOM 11427 H HB2  . SER A 1 3  ? 6.506   8.396   -11.313 1.00 0.00 ? 3  SER A HB2  11 
ATOM 11428 H HB3  . SER A 1 3  ? 7.210   7.390   -10.048 1.00 0.00 ? 3  SER A HB3  11 
ATOM 11429 H HG   . SER A 1 3  ? 7.315   10.181  -10.371 1.00 0.00 ? 3  SER A HG   11 
ATOM 11430 N N    . GLY A 1 4  ? 8.278   5.628   -11.934 1.00 0.00 ? 4  GLY A N    11 
ATOM 11431 C CA   . GLY A 1 4  ? 8.038   4.441   -12.733 1.00 0.00 ? 4  GLY A CA   11 
ATOM 11432 C C    . GLY A 1 4  ? 6.568   4.082   -12.810 1.00 0.00 ? 4  GLY A C    11 
ATOM 11433 O O    . GLY A 1 4  ? 6.065   3.316   -11.988 1.00 0.00 ? 4  GLY A O    11 
ATOM 11434 H H    . GLY A 1 4  ? 8.396   5.548   -10.964 1.00 0.00 ? 4  GLY A H    11 
ATOM 11435 H HA2  . GLY A 1 4  ? 8.409   4.613   -13.733 1.00 0.00 ? 4  GLY A HA2  11 
ATOM 11436 H HA3  . GLY A 1 4  ? 8.577   3.612   -12.298 1.00 0.00 ? 4  GLY A HA3  11 
ATOM 11437 N N    . SER A 1 5  ? 5.875   4.637   -13.800 1.00 0.00 ? 5  SER A N    11 
ATOM 11438 C CA   . SER A 1 5  ? 4.452   4.375   -13.977 1.00 0.00 ? 5  SER A CA   11 
ATOM 11439 C C    . SER A 1 5  ? 4.228   3.249   -14.982 1.00 0.00 ? 5  SER A C    11 
ATOM 11440 O O    . SER A 1 5  ? 4.013   3.494   -16.169 1.00 0.00 ? 5  SER A O    11 
ATOM 11441 C CB   . SER A 1 5  ? 3.733   5.642   -14.446 1.00 0.00 ? 5  SER A CB   11 
ATOM 11442 O OG   . SER A 1 5  ? 2.327   5.468   -14.424 1.00 0.00 ? 5  SER A OG   11 
ATOM 11443 H H    . SER A 1 5  ? 6.332   5.240   -14.423 1.00 0.00 ? 5  SER A H    11 
ATOM 11444 H HA   . SER A 1 5  ? 4.048   4.075   -13.022 1.00 0.00 ? 5  SER A HA   11 
ATOM 11445 H HB2  . SER A 1 5  ? 3.993   6.462   -13.795 1.00 0.00 ? 5  SER A HB2  11 
ATOM 11446 H HB3  . SER A 1 5  ? 4.040   5.873   -15.456 1.00 0.00 ? 5  SER A HB3  11 
ATOM 11447 H HG   . SER A 1 5  ? 1.901   6.319   -14.297 1.00 0.00 ? 5  SER A HG   11 
ATOM 11448 N N    . SER A 1 6  ? 4.280   2.012   -14.496 1.00 0.00 ? 6  SER A N    11 
ATOM 11449 C CA   . SER A 1 6  ? 4.087   0.847   -15.351 1.00 0.00 ? 6  SER A CA   11 
ATOM 11450 C C    . SER A 1 6  ? 2.678   0.829   -15.935 1.00 0.00 ? 6  SER A C    11 
ATOM 11451 O O    . SER A 1 6  ? 1.721   1.254   -15.290 1.00 0.00 ? 6  SER A O    11 
ATOM 11452 C CB   . SER A 1 6  ? 4.340   -0.439  -14.560 1.00 0.00 ? 6  SER A CB   11 
ATOM 11453 O OG   . SER A 1 6  ? 3.319   -0.657  -13.602 1.00 0.00 ? 6  SER A OG   11 
ATOM 11454 H H    . SER A 1 6  ? 4.455   1.882   -13.540 1.00 0.00 ? 6  SER A H    11 
ATOM 11455 H HA   . SER A 1 6  ? 4.799   0.908   -16.160 1.00 0.00 ? 6  SER A HA   11 
ATOM 11456 H HB2  . SER A 1 6  ? 4.364   -1.277  -15.240 1.00 0.00 ? 6  SER A HB2  11 
ATOM 11457 H HB3  . SER A 1 6  ? 5.288   -0.362  -14.048 1.00 0.00 ? 6  SER A HB3  11 
ATOM 11458 H HG   . SER A 1 6  ? 3.371   -1.560  -13.279 1.00 0.00 ? 6  SER A HG   11 
ATOM 11459 N N    . GLY A 1 7  ? 2.560   0.333   -17.163 1.00 0.00 ? 7  GLY A N    11 
ATOM 11460 C CA   . GLY A 1 7  ? 1.265   0.268   -17.815 1.00 0.00 ? 7  GLY A CA   11 
ATOM 11461 C C    . GLY A 1 7  ? 0.282   -0.611  -17.068 1.00 0.00 ? 7  GLY A C    11 
ATOM 11462 O O    . GLY A 1 7  ? 0.543   -1.027  -15.939 1.00 0.00 ? 7  GLY A O    11 
ATOM 11463 H H    . GLY A 1 7  ? 3.358   0.008   -17.630 1.00 0.00 ? 7  GLY A H    11 
ATOM 11464 H HA2  . GLY A 1 7  ? 0.858   1.266   -17.884 1.00 0.00 ? 7  GLY A HA2  11 
ATOM 11465 H HA3  . GLY A 1 7  ? 1.396   -0.126  -18.813 1.00 0.00 ? 7  GLY A HA3  11 
ATOM 11466 N N    . LYS A 1 8  ? -0.853  -0.895  -17.698 1.00 0.00 ? 8  LYS A N    11 
ATOM 11467 C CA   . LYS A 1 8  ? -1.879  -1.731  -17.086 1.00 0.00 ? 8  LYS A CA   11 
ATOM 11468 C C    . LYS A 1 8  ? -1.651  -3.202  -17.416 1.00 0.00 ? 8  LYS A C    11 
ATOM 11469 O O    . LYS A 1 8  ? -1.236  -3.543  -18.523 1.00 0.00 ? 8  LYS A O    11 
ATOM 11470 C CB   . LYS A 1 8  ? -3.268  -1.300  -17.564 1.00 0.00 ? 8  LYS A CB   11 
ATOM 11471 C CG   . LYS A 1 8  ? -3.454  -1.405  -19.067 1.00 0.00 ? 8  LYS A CG   11 
ATOM 11472 C CD   . LYS A 1 8  ? -4.812  -0.876  -19.499 1.00 0.00 ? 8  LYS A CD   11 
ATOM 11473 C CE   . LYS A 1 8  ? -5.172  -1.344  -20.901 1.00 0.00 ? 8  LYS A CE   11 
ATOM 11474 N NZ   . LYS A 1 8  ? -6.622  -1.168  -21.189 1.00 0.00 ? 8  LYS A NZ   11 
ATOM 11475 H H    . LYS A 1 8  ? -1.003  -0.535  -18.597 1.00 0.00 ? 8  LYS A H    11 
ATOM 11476 H HA   . LYS A 1 8  ? -1.819  -1.601  -16.017 1.00 0.00 ? 8  LYS A HA   11 
ATOM 11477 H HB2  . LYS A 1 8  ? -4.009  -1.923  -17.085 1.00 0.00 ? 8  LYS A HB2  11 
ATOM 11478 H HB3  . LYS A 1 8  ? -3.432  -0.272  -17.273 1.00 0.00 ? 8  LYS A HB3  11 
ATOM 11479 H HG2  . LYS A 1 8  ? -2.683  -0.830  -19.558 1.00 0.00 ? 8  LYS A HG2  11 
ATOM 11480 H HG3  . LYS A 1 8  ? -3.373  -2.443  -19.359 1.00 0.00 ? 8  LYS A HG3  11 
ATOM 11481 H HD2  . LYS A 1 8  ? -5.563  -1.231  -18.810 1.00 0.00 ? 8  LYS A HD2  11 
ATOM 11482 H HD3  . LYS A 1 8  ? -4.788  0.204   -19.485 1.00 0.00 ? 8  LYS A HD3  11 
ATOM 11483 H HE2  . LYS A 1 8  ? -4.599  -0.773  -21.616 1.00 0.00 ? 8  LYS A HE2  11 
ATOM 11484 H HE3  . LYS A 1 8  ? -4.920  -2.391  -20.993 1.00 0.00 ? 8  LYS A HE3  11 
ATOM 11485 H HZ1  . LYS A 1 8  ? -7.093  -2.094  -21.231 1.00 0.00 ? 8  LYS A HZ1  11 
ATOM 11486 H HZ2  . LYS A 1 8  ? -6.749  -0.686  -22.102 1.00 0.00 ? 8  LYS A HZ2  11 
ATOM 11487 H HZ3  . LYS A 1 8  ? -7.068  -0.598  -20.443 1.00 0.00 ? 8  LYS A HZ3  11 
ATOM 11488 N N    . GLY A 1 9  ? -1.926  -4.071  -16.448 1.00 0.00 ? 9  GLY A N    11 
ATOM 11489 C CA   . GLY A 1 9  ? -1.746  -5.496  -16.657 1.00 0.00 ? 9  GLY A CA   11 
ATOM 11490 C C    . GLY A 1 9  ? -1.057  -6.170  -15.487 1.00 0.00 ? 9  GLY A C    11 
ATOM 11491 O O    . GLY A 1 9  ? 0.142   -5.991  -15.276 1.00 0.00 ? 9  GLY A O    11 
ATOM 11492 H H    . GLY A 1 9  ? -2.254  -3.742  -15.585 1.00 0.00 ? 9  GLY A H    11 
ATOM 11493 H HA2  . GLY A 1 9  ? -2.713  -5.953  -16.804 1.00 0.00 ? 9  GLY A HA2  11 
ATOM 11494 H HA3  . GLY A 1 9  ? -1.150  -5.646  -17.545 1.00 0.00 ? 9  GLY A HA3  11 
ATOM 11495 N N    . GLY A 1 10 ? -1.818  -6.948  -14.722 1.00 0.00 ? 10 GLY A N    11 
ATOM 11496 C CA   . GLY A 1 10 ? -1.256  -7.639  -13.576 1.00 0.00 ? 10 GLY A CA   11 
ATOM 11497 C C    . GLY A 1 10 ? -2.311  -8.358  -12.759 1.00 0.00 ? 10 GLY A C    11 
ATOM 11498 O O    . GLY A 1 10 ? -3.368  -7.798  -12.468 1.00 0.00 ? 10 GLY A O    11 
ATOM 11499 H H    . GLY A 1 10 ? -2.768  -7.054  -14.939 1.00 0.00 ? 10 GLY A H    11 
ATOM 11500 H HA2  . GLY A 1 10 ? -0.531  -8.359  -13.923 1.00 0.00 ? 10 GLY A HA2  11 
ATOM 11501 H HA3  . GLY A 1 10 ? -0.758  -6.917  -12.944 1.00 0.00 ? 10 GLY A HA3  11 
ATOM 11502 N N    . GLN A 1 11 ? -2.024  -9.602  -12.388 1.00 0.00 ? 11 GLN A N    11 
ATOM 11503 C CA   . GLN A 1 11 ? -2.958  -10.399 -11.601 1.00 0.00 ? 11 GLN A CA   11 
ATOM 11504 C C    . GLN A 1 11 ? -2.589  -10.367 -10.122 1.00 0.00 ? 11 GLN A C    11 
ATOM 11505 O O    . GLN A 1 11 ? -1.979  -11.303 -9.604  1.00 0.00 ? 11 GLN A O    11 
ATOM 11506 C CB   . GLN A 1 11 ? -2.978  -11.843 -12.104 1.00 0.00 ? 11 GLN A CB   11 
ATOM 11507 C CG   . GLN A 1 11 ? -3.964  -12.080 -13.236 1.00 0.00 ? 11 GLN A CG   11 
ATOM 11508 C CD   . GLN A 1 11 ? -5.337  -11.508 -12.943 1.00 0.00 ? 11 GLN A CD   11 
ATOM 11509 O OE1  . GLN A 1 11 ? -5.870  -11.673 -11.845 1.00 0.00 ? 11 GLN A OE1  11 
ATOM 11510 N NE2  . GLN A 1 11 ? -5.918  -10.830 -13.926 1.00 0.00 ? 11 GLN A NE2  11 
ATOM 11511 H H    . GLN A 1 11 ? -1.165  -9.992  -12.650 1.00 0.00 ? 11 GLN A H    11 
ATOM 11512 H HA   . GLN A 1 11 ? -3.942  -9.972  -11.723 1.00 0.00 ? 11 GLN A HA   11 
ATOM 11513 H HB2  . GLN A 1 11 ? -1.990  -12.103 -12.455 1.00 0.00 ? 11 GLN A HB2  11 
ATOM 11514 H HB3  . GLN A 1 11 ? -3.242  -12.494 -11.283 1.00 0.00 ? 11 GLN A HB3  11 
ATOM 11515 H HG2  . GLN A 1 11 ? -3.582  -11.616 -14.133 1.00 0.00 ? 11 GLN A HG2  11 
ATOM 11516 H HG3  . GLN A 1 11 ? -4.060  -13.144 -13.395 1.00 0.00 ? 11 GLN A HG3  11 
ATOM 11517 H HE21 . GLN A 1 11 ? -5.435  -10.739 -14.774 1.00 0.00 ? 11 GLN A HE21 11 
ATOM 11518 H HE22 . GLN A 1 11 ? -6.806  -10.450 -13.764 1.00 0.00 ? 11 GLN A HE22 11 
ATOM 11519 N N    . VAL A 1 12 ? -2.961  -9.284  -9.447  1.00 0.00 ? 12 VAL A N    11 
ATOM 11520 C CA   . VAL A 1 12 ? -2.670  -9.131  -8.027  1.00 0.00 ? 12 VAL A CA   11 
ATOM 11521 C C    . VAL A 1 12 ? -3.937  -8.829  -7.235  1.00 0.00 ? 12 VAL A C    11 
ATOM 11522 O O    . VAL A 1 12 ? -4.775  -8.035  -7.665  1.00 0.00 ? 12 VAL A O    11 
ATOM 11523 C CB   . VAL A 1 12 ? -1.644  -8.008  -7.782  1.00 0.00 ? 12 VAL A CB   11 
ATOM 11524 C CG1  . VAL A 1 12 ? -1.343  -7.874  -6.297  1.00 0.00 ? 12 VAL A CG1  11 
ATOM 11525 C CG2  . VAL A 1 12 ? -0.370  -8.270  -8.571  1.00 0.00 ? 12 VAL A CG2  11 
ATOM 11526 H H    . VAL A 1 12 ? -3.444  -8.572  -9.915  1.00 0.00 ? 12 VAL A H    11 
ATOM 11527 H HA   . VAL A 1 12 ? -2.247  -10.060 -7.670  1.00 0.00 ? 12 VAL A HA   11 
ATOM 11528 H HB   . VAL A 1 12 ? -2.071  -7.078  -8.126  1.00 0.00 ? 12 VAL A HB   11 
ATOM 11529 H HG11 . VAL A 1 12 ? -2.268  -7.887  -5.740  1.00 0.00 ? 12 VAL A HG11 11 
ATOM 11530 H HG12 . VAL A 1 12 ? -0.719  -8.697  -5.980  1.00 0.00 ? 12 VAL A HG12 11 
ATOM 11531 H HG13 . VAL A 1 12 ? -0.829  -6.942  -6.117  1.00 0.00 ? 12 VAL A HG13 11 
ATOM 11532 H HG21 . VAL A 1 12 ? 0.203   -9.043  -8.083  1.00 0.00 ? 12 VAL A HG21 11 
ATOM 11533 H HG22 . VAL A 1 12 ? -0.625  -8.588  -9.572  1.00 0.00 ? 12 VAL A HG22 11 
ATOM 11534 H HG23 . VAL A 1 12 ? 0.215   -7.364  -8.621  1.00 0.00 ? 12 VAL A HG23 11 
ATOM 11535 N N    . ARG A 1 13 ? -4.071  -9.465  -6.076  1.00 0.00 ? 13 ARG A N    11 
ATOM 11536 C CA   . ARG A 1 13 ? -5.236  -9.265  -5.224  1.00 0.00 ? 13 ARG A CA   11 
ATOM 11537 C C    . ARG A 1 13 ? -5.015  -9.882  -3.846  1.00 0.00 ? 13 ARG A C    11 
ATOM 11538 O O    . ARG A 1 13 ? -4.412  -10.948 -3.721  1.00 0.00 ? 13 ARG A O    11 
ATOM 11539 C CB   . ARG A 1 13 ? -6.480  -9.874  -5.874  1.00 0.00 ? 13 ARG A CB   11 
ATOM 11540 C CG   . ARG A 1 13 ? -7.780  -9.475  -5.194  1.00 0.00 ? 13 ARG A CG   11 
ATOM 11541 C CD   . ARG A 1 13 ? -8.148  -10.445 -4.083  1.00 0.00 ? 13 ARG A CD   11 
ATOM 11542 N NE   . ARG A 1 13 ? -8.820  -11.636 -4.596  1.00 0.00 ? 13 ARG A NE   11 
ATOM 11543 C CZ   . ARG A 1 13 ? -10.009 -11.612 -5.187  1.00 0.00 ? 13 ARG A CZ   11 
ATOM 11544 N NH1  . ARG A 1 13 ? -10.654 -10.464 -5.338  1.00 0.00 ? 13 ARG A NH1  11 
ATOM 11545 N NH2  . ARG A 1 13 ? -10.555 -12.738 -5.628  1.00 0.00 ? 13 ARG A NH2  11 
ATOM 11546 H H    . ARG A 1 13 ? -3.369  -10.086 -5.788  1.00 0.00 ? 13 ARG A H    11 
ATOM 11547 H HA   . ARG A 1 13 ? -5.385  -8.202  -5.110  1.00 0.00 ? 13 ARG A HA   11 
ATOM 11548 H HB2  . ARG A 1 13 ? -6.526  -9.555  -6.905  1.00 0.00 ? 13 ARG A HB2  11 
ATOM 11549 H HB3  . ARG A 1 13 ? -6.398  -10.950 -5.841  1.00 0.00 ? 13 ARG A HB3  11 
ATOM 11550 H HG2  . ARG A 1 13 ? -7.666  -8.488  -4.771  1.00 0.00 ? 13 ARG A HG2  11 
ATOM 11551 H HG3  . ARG A 1 13 ? -8.571  -9.465  -5.929  1.00 0.00 ? 13 ARG A HG3  11 
ATOM 11552 H HD2  . ARG A 1 13 ? -7.246  -10.745 -3.571  1.00 0.00 ? 13 ARG A HD2  11 
ATOM 11553 H HD3  . ARG A 1 13 ? -8.805  -9.943  -3.388  1.00 0.00 ? 13 ARG A HD3  11 
ATOM 11554 H HE   . ARG A 1 13 ? -8.360  -12.495 -4.494  1.00 0.00 ? 13 ARG A HE   11 
ATOM 11555 H HH11 . ARG A 1 13 ? -10.245 -9.613  -5.008  1.00 0.00 ? 13 ARG A HH11 11 
ATOM 11556 H HH12 . ARG A 1 13 ? -11.549 -10.448 -5.785  1.00 0.00 ? 13 ARG A HH12 11 
ATOM 11557 H HH21 . ARG A 1 13 ? -10.072 -13.605 -5.515  1.00 0.00 ? 13 ARG A HH21 11 
ATOM 11558 H HH22 . ARG A 1 13 ? -11.450 -12.719 -6.072  1.00 0.00 ? 13 ARG A HH22 11 
ATOM 11559 N N    . PHE A 1 14 ? -5.507  -9.204  -2.814  1.00 0.00 ? 14 PHE A N    11 
ATOM 11560 C CA   . PHE A 1 14 ? -5.361  -9.684  -1.445  1.00 0.00 ? 14 PHE A CA   11 
ATOM 11561 C C    . PHE A 1 14 ? -6.629  -9.417  -0.638  1.00 0.00 ? 14 PHE A C    11 
ATOM 11562 O O    . PHE A 1 14 ? -7.091  -8.280  -0.546  1.00 0.00 ? 14 PHE A O    11 
ATOM 11563 C CB   . PHE A 1 14 ? -4.163  -9.013  -0.771  1.00 0.00 ? 14 PHE A CB   11 
ATOM 11564 C CG   . PHE A 1 14 ? -2.846  -9.367  -1.399  1.00 0.00 ? 14 PHE A CG   11 
ATOM 11565 C CD1  . PHE A 1 14 ? -2.353  -8.634  -2.466  1.00 0.00 ? 14 PHE A CD1  11 
ATOM 11566 C CD2  . PHE A 1 14 ? -2.101  -10.434 -0.923  1.00 0.00 ? 14 PHE A CD2  11 
ATOM 11567 C CE1  . PHE A 1 14 ? -1.140  -8.957  -3.047  1.00 0.00 ? 14 PHE A CE1  11 
ATOM 11568 C CE2  . PHE A 1 14 ? -0.888  -10.762 -1.499  1.00 0.00 ? 14 PHE A CE2  11 
ATOM 11569 C CZ   . PHE A 1 14 ? -0.408  -10.023 -2.563  1.00 0.00 ? 14 PHE A CZ   11 
ATOM 11570 H H    . PHE A 1 14 ? -5.978  -8.360  -2.978  1.00 0.00 ? 14 PHE A H    11 
ATOM 11571 H HA   . PHE A 1 14 ? -5.192  -10.749 -1.484  1.00 0.00 ? 14 PHE A HA   11 
ATOM 11572 H HB2  . PHE A 1 14 ? -4.280  -7.941  -0.829  1.00 0.00 ? 14 PHE A HB2  11 
ATOM 11573 H HB3  . PHE A 1 14 ? -4.129  -9.312  0.266   1.00 0.00 ? 14 PHE A HB3  11 
ATOM 11574 H HD1  . PHE A 1 14 ? -2.926  -7.799  -2.846  1.00 0.00 ? 14 PHE A HD1  11 
ATOM 11575 H HD2  . PHE A 1 14 ? -2.475  -11.014 -0.092  1.00 0.00 ? 14 PHE A HD2  11 
ATOM 11576 H HE1  . PHE A 1 14 ? -0.768  -8.377  -3.878  1.00 0.00 ? 14 PHE A HE1  11 
ATOM 11577 H HE2  . PHE A 1 14 ? -0.317  -11.596 -1.120  1.00 0.00 ? 14 PHE A HE2  11 
ATOM 11578 H HZ   . PHE A 1 14 ? 0.540   -10.277 -3.015  1.00 0.00 ? 14 PHE A HZ   11 
ATOM 11579 N N    . SER A 1 15 ? -7.185  -10.474 -0.055  1.00 0.00 ? 15 SER A N    11 
ATOM 11580 C CA   . SER A 1 15 ? -8.402  -10.356 0.741   1.00 0.00 ? 15 SER A CA   11 
ATOM 11581 C C    . SER A 1 15 ? -8.269  -9.240  1.773   1.00 0.00 ? 15 SER A C    11 
ATOM 11582 O O    . SER A 1 15 ? -7.165  -8.799  2.088   1.00 0.00 ? 15 SER A O    11 
ATOM 11583 C CB   . SER A 1 15 ? -8.708  -11.681 1.442   1.00 0.00 ? 15 SER A CB   11 
ATOM 11584 O OG   . SER A 1 15 ? -10.099 -11.824 1.676   1.00 0.00 ? 15 SER A OG   11 
ATOM 11585 H H    . SER A 1 15 ? -6.769  -11.355 -0.166  1.00 0.00 ? 15 SER A H    11 
ATOM 11586 H HA   . SER A 1 15 ? -9.214  -10.116 0.071   1.00 0.00 ? 15 SER A HA   11 
ATOM 11587 H HB2  . SER A 1 15 ? -8.374  -12.499 0.822   1.00 0.00 ? 15 SER A HB2  11 
ATOM 11588 H HB3  . SER A 1 15 ? -8.190  -11.712 2.389   1.00 0.00 ? 15 SER A HB3  11 
ATOM 11589 H HG   . SER A 1 15 ? -10.276 -11.739 2.616   1.00 0.00 ? 15 SER A HG   11 
ATOM 11590 N N    . ASN A 1 16 ? -9.404  -8.789  2.296   1.00 0.00 ? 16 ASN A N    11 
ATOM 11591 C CA   . ASN A 1 16 ? -9.417  -7.724  3.292   1.00 0.00 ? 16 ASN A CA   11 
ATOM 11592 C C    . ASN A 1 16 ? -8.429  -8.020  4.417   1.00 0.00 ? 16 ASN A C    11 
ATOM 11593 O O    . ASN A 1 16 ? -7.488  -7.260  4.647   1.00 0.00 ? 16 ASN A O    11 
ATOM 11594 C CB   . ASN A 1 16 ? -10.824 -7.551  3.867   1.00 0.00 ? 16 ASN A CB   11 
ATOM 11595 C CG   . ASN A 1 16 ? -10.823 -6.795  5.181   1.00 0.00 ? 16 ASN A CG   11 
ATOM 11596 O OD1  . ASN A 1 16 ? -10.442 -7.334  6.220   1.00 0.00 ? 16 ASN A OD1  11 
ATOM 11597 N ND2  . ASN A 1 16 ? -11.251 -5.538  5.141   1.00 0.00 ? 16 ASN A ND2  11 
ATOM 11598 H H    . ASN A 1 16 ? -10.254 -9.180  2.005   1.00 0.00 ? 16 ASN A H    11 
ATOM 11599 H HA   . ASN A 1 16 ? -9.122  -6.808  2.802   1.00 0.00 ? 16 ASN A HA   11 
ATOM 11600 H HB2  . ASN A 1 16 ? -11.430 -7.003  3.159   1.00 0.00 ? 16 ASN A HB2  11 
ATOM 11601 H HB3  . ASN A 1 16 ? -11.262 -8.524  4.032   1.00 0.00 ? 16 ASN A HB3  11 
ATOM 11602 H HD21 . ASN A 1 16 ? -11.539 -5.174  4.278   1.00 0.00 ? 16 ASN A HD21 11 
ATOM 11603 H HD22 . ASN A 1 16 ? -11.260 -5.026  5.976   1.00 0.00 ? 16 ASN A HD22 11 
ATOM 11604 N N    . ASP A 1 17 ? -8.650  -9.129  5.114   1.00 0.00 ? 17 ASP A N    11 
ATOM 11605 C CA   . ASP A 1 17 ? -7.779  -9.527  6.213   1.00 0.00 ? 17 ASP A CA   11 
ATOM 11606 C C    . ASP A 1 17 ? -6.354  -9.761  5.721   1.00 0.00 ? 17 ASP A C    11 
ATOM 11607 O O    . ASP A 1 17 ? -5.394  -9.267  6.312   1.00 0.00 ? 17 ASP A O    11 
ATOM 11608 C CB   . ASP A 1 17 ? -8.314  -10.794 6.883   1.00 0.00 ? 17 ASP A CB   11 
ATOM 11609 C CG   . ASP A 1 17 ? -9.410  -10.498 7.888   1.00 0.00 ? 17 ASP A CG   11 
ATOM 11610 O OD1  . ASP A 1 17 ? -9.166  -9.694  8.813   1.00 0.00 ? 17 ASP A OD1  11 
ATOM 11611 O OD2  . ASP A 1 17 ? -10.511 -11.070 7.750   1.00 0.00 ? 17 ASP A OD2  11 
ATOM 11612 H H    . ASP A 1 17 ? -9.416  -9.694  4.882   1.00 0.00 ? 17 ASP A H    11 
ATOM 11613 H HA   . ASP A 1 17 ? -7.769  -8.726  6.936   1.00 0.00 ? 17 ASP A HA   11 
ATOM 11614 H HB2  . ASP A 1 17 ? -8.714  -11.452 6.126   1.00 0.00 ? 17 ASP A HB2  11 
ATOM 11615 H HB3  . ASP A 1 17 ? -7.504  -11.292 7.396   1.00 0.00 ? 17 ASP A HB3  11 
ATOM 11616 N N    . GLN A 1 18 ? -6.225  -10.517 4.635   1.00 0.00 ? 18 GLN A N    11 
ATOM 11617 C CA   . GLN A 1 18 ? -4.917  -10.818 4.065   1.00 0.00 ? 18 GLN A CA   11 
ATOM 11618 C C    . GLN A 1 18 ? -4.048  -9.565  4.006   1.00 0.00 ? 18 GLN A C    11 
ATOM 11619 O O    . GLN A 1 18 ? -2.974  -9.513  4.606   1.00 0.00 ? 18 GLN A O    11 
ATOM 11620 C CB   . GLN A 1 18 ? -5.072  -11.411 2.664   1.00 0.00 ? 18 GLN A CB   11 
ATOM 11621 C CG   . GLN A 1 18 ? -5.252  -12.921 2.659   1.00 0.00 ? 18 GLN A CG   11 
ATOM 11622 C CD   . GLN A 1 18 ? -5.576  -13.465 1.282   1.00 0.00 ? 18 GLN A CD   11 
ATOM 11623 O OE1  . GLN A 1 18 ? -5.568  -12.731 0.294   1.00 0.00 ? 18 GLN A OE1  11 
ATOM 11624 N NE2  . GLN A 1 18 ? -5.864  -14.760 1.210   1.00 0.00 ? 18 GLN A NE2  11 
ATOM 11625 H H    . GLN A 1 18 ? -7.027  -10.882 4.209   1.00 0.00 ? 18 GLN A H    11 
ATOM 11626 H HA   . GLN A 1 18 ? -4.436  -11.544 4.703   1.00 0.00 ? 18 GLN A HA   11 
ATOM 11627 H HB2  . GLN A 1 18 ? -5.934  -10.966 2.191   1.00 0.00 ? 18 GLN A HB2  11 
ATOM 11628 H HB3  . GLN A 1 18 ? -4.191  -11.174 2.086   1.00 0.00 ? 18 GLN A HB3  11 
ATOM 11629 H HG2  . GLN A 1 18 ? -4.338  -13.381 3.005   1.00 0.00 ? 18 GLN A HG2  11 
ATOM 11630 H HG3  . GLN A 1 18 ? -6.059  -13.176 3.331   1.00 0.00 ? 18 GLN A HG3  11 
ATOM 11631 H HE21 . GLN A 1 18 ? -5.852  -15.283 2.039   1.00 0.00 ? 18 GLN A HE21 11 
ATOM 11632 H HE22 . GLN A 1 18 ? -6.078  -15.138 0.333   1.00 0.00 ? 18 GLN A HE22 11 
ATOM 11633 N N    . THR A 1 19 ? -4.520  -8.557  3.279   1.00 0.00 ? 19 THR A N    11 
ATOM 11634 C CA   . THR A 1 19 ? -3.786  -7.306  3.141   1.00 0.00 ? 19 THR A CA   11 
ATOM 11635 C C    . THR A 1 19 ? -3.420  -6.729  4.504   1.00 0.00 ? 19 THR A C    11 
ATOM 11636 O O    . THR A 1 19 ? -2.276  -6.336  4.735   1.00 0.00 ? 19 THR A O    11 
ATOM 11637 C CB   . THR A 1 19 ? -4.601  -6.261  2.356   1.00 0.00 ? 19 THR A CB   11 
ATOM 11638 O OG1  . THR A 1 19 ? -4.915  -6.763  1.052   1.00 0.00 ? 19 THR A OG1  11 
ATOM 11639 C CG2  . THR A 1 19 ? -3.829  -4.956  2.230   1.00 0.00 ? 19 THR A CG2  11 
ATOM 11640 H H    . THR A 1 19 ? -5.382  -8.660  2.825   1.00 0.00 ? 19 THR A H    11 
ATOM 11641 H HA   . THR A 1 19 ? -2.879  -7.510  2.592   1.00 0.00 ? 19 THR A HA   11 
ATOM 11642 H HB   . THR A 1 19 ? -5.520  -6.068  2.890   1.00 0.00 ? 19 THR A HB   11 
ATOM 11643 H HG1  . THR A 1 19 ? -5.012  -7.717  1.091   1.00 0.00 ? 19 THR A HG1  11 
ATOM 11644 H HG21 . THR A 1 19 ? -3.194  -4.996  1.357   1.00 0.00 ? 19 THR A HG21 11 
ATOM 11645 H HG22 . THR A 1 19 ? -3.222  -4.811  3.111   1.00 0.00 ? 19 THR A HG22 11 
ATOM 11646 H HG23 . THR A 1 19 ? -4.524  -4.135  2.132   1.00 0.00 ? 19 THR A HG23 11 
ATOM 11647 N N    . ILE A 1 20 ? -4.397  -6.682  5.403   1.00 0.00 ? 20 ILE A N    11 
ATOM 11648 C CA   . ILE A 1 20 ? -4.176  -6.155  6.744   1.00 0.00 ? 20 ILE A CA   11 
ATOM 11649 C C    . ILE A 1 20 ? -2.923  -6.757  7.371   1.00 0.00 ? 20 ILE A C    11 
ATOM 11650 O O    . ILE A 1 20 ? -1.944  -6.054  7.620   1.00 0.00 ? 20 ILE A O    11 
ATOM 11651 C CB   . ILE A 1 20 ? -5.380  -6.432  7.663   1.00 0.00 ? 20 ILE A CB   11 
ATOM 11652 C CG1  . ILE A 1 20 ? -6.610  -5.663  7.175   1.00 0.00 ? 20 ILE A CG1  11 
ATOM 11653 C CG2  . ILE A 1 20 ? -5.048  -6.054  9.099   1.00 0.00 ? 20 ILE A CG2  11 
ATOM 11654 C CD1  . ILE A 1 20 ? -7.910  -6.166  7.763   1.00 0.00 ? 20 ILE A CD1  11 
ATOM 11655 H H    . ILE A 1 20 ? -5.287  -7.011  5.159   1.00 0.00 ? 20 ILE A H    11 
ATOM 11656 H HA   . ILE A 1 20 ? -4.048  -5.085  6.664   1.00 0.00 ? 20 ILE A HA   11 
ATOM 11657 H HB   . ILE A 1 20 ? -5.591  -7.490  7.634   1.00 0.00 ? 20 ILE A HB   11 
ATOM 11658 H HG12 . ILE A 1 20 ? -6.506  -4.623  7.442   1.00 0.00 ? 20 ILE A HG12 11 
ATOM 11659 H HG13 . ILE A 1 20 ? -6.675  -5.750  6.100   1.00 0.00 ? 20 ILE A HG13 11 
ATOM 11660 H HG21 . ILE A 1 20 ? -4.118  -6.520  9.387   1.00 0.00 ? 20 ILE A HG21 11 
ATOM 11661 H HG22 . ILE A 1 20 ? -4.952  -4.982  9.175   1.00 0.00 ? 20 ILE A HG22 11 
ATOM 11662 H HG23 . ILE A 1 20 ? -5.838  -6.393  9.752   1.00 0.00 ? 20 ILE A HG23 11 
ATOM 11663 H HD11 . ILE A 1 20 ? -8.455  -6.719  7.012   1.00 0.00 ? 20 ILE A HD11 11 
ATOM 11664 H HD12 . ILE A 1 20 ? -7.700  -6.808  8.604   1.00 0.00 ? 20 ILE A HD12 11 
ATOM 11665 H HD13 . ILE A 1 20 ? -8.505  -5.325  8.091   1.00 0.00 ? 20 ILE A HD13 11 
ATOM 11666 N N    . GLU A 1 21 ? -2.961  -8.062  7.622   1.00 0.00 ? 21 GLU A N    11 
ATOM 11667 C CA   . GLU A 1 21 ? -1.828  -8.758  8.220   1.00 0.00 ? 21 GLU A CA   11 
ATOM 11668 C C    . GLU A 1 21 ? -0.556  -8.522  7.409   1.00 0.00 ? 21 GLU A C    11 
ATOM 11669 O O    . GLU A 1 21 ? 0.459   -8.071  7.942   1.00 0.00 ? 21 GLU A O    11 
ATOM 11670 C CB   . GLU A 1 21 ? -2.114  -10.258 8.315   1.00 0.00 ? 21 GLU A CB   11 
ATOM 11671 C CG   . GLU A 1 21 ? -3.062  -10.625 9.444   1.00 0.00 ? 21 GLU A CG   11 
ATOM 11672 C CD   . GLU A 1 21 ? -2.836  -12.033 9.961   1.00 0.00 ? 21 GLU A CD   11 
ATOM 11673 O OE1  . GLU A 1 21 ? -1.673  -12.376 10.260  1.00 0.00 ? 21 GLU A OE1  11 
ATOM 11674 O OE2  . GLU A 1 21 ? -3.822  -12.792 10.065  1.00 0.00 ? 21 GLU A OE2  11 
ATOM 11675 H H    . GLU A 1 21 ? -3.771  -8.568  7.401   1.00 0.00 ? 21 GLU A H    11 
ATOM 11676 H HA   . GLU A 1 21 ? -1.684  -8.364  9.214   1.00 0.00 ? 21 GLU A HA   11 
ATOM 11677 H HB2  . GLU A 1 21 ? -2.550  -10.589 7.384   1.00 0.00 ? 21 GLU A HB2  11 
ATOM 11678 H HB3  . GLU A 1 21 ? -1.182  -10.780 8.471   1.00 0.00 ? 21 GLU A HB3  11 
ATOM 11679 H HG2  . GLU A 1 21 ? -2.918  -9.932  10.259  1.00 0.00 ? 21 GLU A HG2  11 
ATOM 11680 H HG3  . GLU A 1 21 ? -4.078  -10.549 9.084   1.00 0.00 ? 21 GLU A HG3  11 
ATOM 11681 N N    . LEU A 1 22 ? -0.619  -8.831  6.119   1.00 0.00 ? 22 LEU A N    11 
ATOM 11682 C CA   . LEU A 1 22 ? 0.527   -8.654  5.233   1.00 0.00 ? 22 LEU A CA   11 
ATOM 11683 C C    . LEU A 1 22 ? 1.302   -7.391  5.592   1.00 0.00 ? 22 LEU A C    11 
ATOM 11684 O O    . LEU A 1 22 ? 2.532   -7.373  5.550   1.00 0.00 ? 22 LEU A O    11 
ATOM 11685 C CB   . LEU A 1 22 ? 0.065   -8.587  3.777   1.00 0.00 ? 22 LEU A CB   11 
ATOM 11686 C CG   . LEU A 1 22 ? -0.261  -9.925  3.113   1.00 0.00 ? 22 LEU A CG   11 
ATOM 11687 C CD1  . LEU A 1 22 ? -1.071  -9.709  1.844   1.00 0.00 ? 22 LEU A CD1  11 
ATOM 11688 C CD2  . LEU A 1 22 ? 1.016   -10.695 2.808   1.00 0.00 ? 22 LEU A CD2  11 
ATOM 11689 H H    . LEU A 1 22 ? -1.454  -9.187  5.752   1.00 0.00 ? 22 LEU A H    11 
ATOM 11690 H HA   . LEU A 1 22 ? 1.177   -9.508  5.358   1.00 0.00 ? 22 LEU A HA   11 
ATOM 11691 H HB2  . LEU A 1 22 ? -0.823  -7.975  3.739   1.00 0.00 ? 22 LEU A HB2  11 
ATOM 11692 H HB3  . LEU A 1 22 ? 0.850   -8.115  3.203   1.00 0.00 ? 22 LEU A HB3  11 
ATOM 11693 H HG   . LEU A 1 22 ? -0.857  -10.520 3.792   1.00 0.00 ? 22 LEU A HG   11 
ATOM 11694 H HD11 . LEU A 1 22 ? -0.755  -8.794  1.367   1.00 0.00 ? 22 LEU A HD11 11 
ATOM 11695 H HD12 . LEU A 1 22 ? -2.119  -9.641  2.094   1.00 0.00 ? 22 LEU A HD12 11 
ATOM 11696 H HD13 . LEU A 1 22 ? -0.914  -10.539 1.172   1.00 0.00 ? 22 LEU A HD13 11 
ATOM 11697 H HD21 . LEU A 1 22 ? 0.971   -11.082 1.801   1.00 0.00 ? 22 LEU A HD21 11 
ATOM 11698 H HD22 . LEU A 1 22 ? 1.118   -11.514 3.505   1.00 0.00 ? 22 LEU A HD22 11 
ATOM 11699 H HD23 . LEU A 1 22 ? 1.865   -10.034 2.902   1.00 0.00 ? 22 LEU A HD23 11 
ATOM 11700 N N    . GLU A 1 23 ? 0.574   -6.336  5.946   1.00 0.00 ? 23 GLU A N    11 
ATOM 11701 C CA   . GLU A 1 23 ? 1.195   -5.069  6.314   1.00 0.00 ? 23 GLU A CA   11 
ATOM 11702 C C    . GLU A 1 23 ? 1.865   -5.167  7.681   1.00 0.00 ? 23 GLU A C    11 
ATOM 11703 O O    . GLU A 1 23 ? 3.080   -5.008  7.803   1.00 0.00 ? 23 GLU A O    11 
ATOM 11704 C CB   . GLU A 1 23 ? 0.152   -3.949  6.324   1.00 0.00 ? 23 GLU A CB   11 
ATOM 11705 C CG   . GLU A 1 23 ? -0.461  -3.676  4.961   1.00 0.00 ? 23 GLU A CG   11 
ATOM 11706 C CD   . GLU A 1 23 ? -0.953  -2.248  4.818   1.00 0.00 ? 23 GLU A CD   11 
ATOM 11707 O OE1  . GLU A 1 23 ? -1.677  -1.778  5.721   1.00 0.00 ? 23 GLU A OE1  11 
ATOM 11708 O OE2  . GLU A 1 23 ? -0.615  -1.602  3.805   1.00 0.00 ? 23 GLU A OE2  11 
ATOM 11709 H H    . GLU A 1 23 ? -0.402  -6.412  5.960   1.00 0.00 ? 23 GLU A H    11 
ATOM 11710 H HA   . GLU A 1 23 ? 1.947   -4.841  5.573   1.00 0.00 ? 23 GLU A HA   11 
ATOM 11711 H HB2  . GLU A 1 23 ? -0.641  -4.218  7.006   1.00 0.00 ? 23 GLU A HB2  11 
ATOM 11712 H HB3  . GLU A 1 23 ? 0.621   -3.041  6.673   1.00 0.00 ? 23 GLU A HB3  11 
ATOM 11713 H HG2  . GLU A 1 23 ? 0.284   -3.861  4.202   1.00 0.00 ? 23 GLU A HG2  11 
ATOM 11714 H HG3  . GLU A 1 23 ? -1.296  -4.345  4.815   1.00 0.00 ? 23 GLU A HG3  11 
ATOM 11715 N N    . LYS A 1 24 ? 1.064   -5.431  8.708   1.00 0.00 ? 24 LYS A N    11 
ATOM 11716 C CA   . LYS A 1 24 ? 1.578   -5.552  10.068  1.00 0.00 ? 24 LYS A CA   11 
ATOM 11717 C C    . LYS A 1 24 ? 2.896   -6.319  10.085  1.00 0.00 ? 24 LYS A C    11 
ATOM 11718 O O    . LYS A 1 24 ? 3.710   -6.154  10.995  1.00 0.00 ? 24 LYS A O    11 
ATOM 11719 C CB   . LYS A 1 24 ? 0.553   -6.256  10.960  1.00 0.00 ? 24 LYS A CB   11 
ATOM 11720 C CG   . LYS A 1 24 ? -0.757  -5.500  11.096  1.00 0.00 ? 24 LYS A CG   11 
ATOM 11721 C CD   . LYS A 1 24 ? -1.702  -6.193  12.063  1.00 0.00 ? 24 LYS A CD   11 
ATOM 11722 C CE   . LYS A 1 24 ? -2.650  -5.202  12.722  1.00 0.00 ? 24 LYS A CE   11 
ATOM 11723 N NZ   . LYS A 1 24 ? -3.882  -4.990  11.912  1.00 0.00 ? 24 LYS A NZ   11 
ATOM 11724 H H    . LYS A 1 24 ? 0.104   -5.547  8.548   1.00 0.00 ? 24 LYS A H    11 
ATOM 11725 H HA   . LYS A 1 24 ? 1.749   -4.556  10.447  1.00 0.00 ? 24 LYS A HA   11 
ATOM 11726 H HB2  . LYS A 1 24 ? 0.342   -7.231  10.546  1.00 0.00 ? 24 LYS A HB2  11 
ATOM 11727 H HB3  . LYS A 1 24 ? 0.978   -6.378  11.947  1.00 0.00 ? 24 LYS A HB3  11 
ATOM 11728 H HG2  . LYS A 1 24 ? -0.552  -4.505  11.460  1.00 0.00 ? 24 LYS A HG2  11 
ATOM 11729 H HG3  . LYS A 1 24 ? -1.230  -5.441  10.126  1.00 0.00 ? 24 LYS A HG3  11 
ATOM 11730 H HD2  . LYS A 1 24 ? -2.284  -6.925  11.524  1.00 0.00 ? 24 LYS A HD2  11 
ATOM 11731 H HD3  . LYS A 1 24 ? -1.121  -6.686  12.830  1.00 0.00 ? 24 LYS A HD3  11 
ATOM 11732 H HE2  . LYS A 1 24 ? -2.929  -5.581  13.693  1.00 0.00 ? 24 LYS A HE2  11 
ATOM 11733 H HE3  . LYS A 1 24 ? -2.139  -4.258  12.837  1.00 0.00 ? 24 LYS A HE3  11 
ATOM 11734 H HZ1  . LYS A 1 24 ? -4.726  -5.171  12.492  1.00 0.00 ? 24 LYS A HZ1  11 
ATOM 11735 H HZ2  . LYS A 1 24 ? -3.890  -5.638  11.098  1.00 0.00 ? 24 LYS A HZ2  11 
ATOM 11736 H HZ3  . LYS A 1 24 ? -3.916  -4.011  11.563  1.00 0.00 ? 24 LYS A HZ3  11 
ATOM 11737 N N    . LYS A 1 25 ? 3.102   -7.156  9.074   1.00 0.00 ? 25 LYS A N    11 
ATOM 11738 C CA   . LYS A 1 25 ? 4.323   -7.946  8.971   1.00 0.00 ? 25 LYS A CA   11 
ATOM 11739 C C    . LYS A 1 25 ? 5.464   -7.112  8.400   1.00 0.00 ? 25 LYS A C    11 
ATOM 11740 O O    . LYS A 1 25 ? 6.493   -6.921  9.049   1.00 0.00 ? 25 LYS A O    11 
ATOM 11741 C CB   . LYS A 1 25 ? 4.085   -9.176  8.092   1.00 0.00 ? 25 LYS A CB   11 
ATOM 11742 C CG   . LYS A 1 25 ? 5.136   -10.259 8.265   1.00 0.00 ? 25 LYS A CG   11 
ATOM 11743 C CD   . LYS A 1 25 ? 5.184   -10.767 9.696   1.00 0.00 ? 25 LYS A CD   11 
ATOM 11744 C CE   . LYS A 1 25 ? 5.946   -12.079 9.797   1.00 0.00 ? 25 LYS A CE   11 
ATOM 11745 N NZ   . LYS A 1 25 ? 5.669   -12.785 11.079  1.00 0.00 ? 25 LYS A NZ   11 
ATOM 11746 H H    . LYS A 1 25 ? 2.416   -7.243  8.379   1.00 0.00 ? 25 LYS A H    11 
ATOM 11747 H HA   . LYS A 1 25 ? 4.592   -8.271  9.965   1.00 0.00 ? 25 LYS A HA   11 
ATOM 11748 H HB2  . LYS A 1 25 ? 3.121   -9.597  8.335   1.00 0.00 ? 25 LYS A HB2  11 
ATOM 11749 H HB3  . LYS A 1 25 ? 4.083   -8.868  7.056   1.00 0.00 ? 25 LYS A HB3  11 
ATOM 11750 H HG2  . LYS A 1 25 ? 4.901   -11.084 7.609   1.00 0.00 ? 25 LYS A HG2  11 
ATOM 11751 H HG3  . LYS A 1 25 ? 6.104   -9.854  8.004   1.00 0.00 ? 25 LYS A HG3  11 
ATOM 11752 H HD2  . LYS A 1 25 ? 5.675   -10.030 10.314  1.00 0.00 ? 25 LYS A HD2  11 
ATOM 11753 H HD3  . LYS A 1 25 ? 4.174   -10.919 10.048  1.00 0.00 ? 25 LYS A HD3  11 
ATOM 11754 H HE2  . LYS A 1 25 ? 5.652   -12.715 8.975   1.00 0.00 ? 25 LYS A HE2  11 
ATOM 11755 H HE3  . LYS A 1 25 ? 7.004   -11.872 9.731   1.00 0.00 ? 25 LYS A HE3  11 
ATOM 11756 H HZ1  . LYS A 1 25 ? 6.106   -12.271 11.870  1.00 0.00 ? 25 LYS A HZ1  11 
ATOM 11757 H HZ2  . LYS A 1 25 ? 6.059   -13.748 11.048  1.00 0.00 ? 25 LYS A HZ2  11 
ATOM 11758 H HZ3  . LYS A 1 25 ? 4.643   -12.843 11.240  1.00 0.00 ? 25 LYS A HZ3  11 
ATOM 11759 N N    . PHE A 1 26 ? 5.276   -6.616  7.181   1.00 0.00 ? 26 PHE A N    11 
ATOM 11760 C CA   . PHE A 1 26 ? 6.291   -5.801  6.523   1.00 0.00 ? 26 PHE A CA   11 
ATOM 11761 C C    . PHE A 1 26 ? 6.832   -4.735  7.470   1.00 0.00 ? 26 PHE A C    11 
ATOM 11762 O O    . PHE A 1 26 ? 8.001   -4.358  7.395   1.00 0.00 ? 26 PHE A O    11 
ATOM 11763 C CB   . PHE A 1 26 ? 5.711   -5.140  5.270   1.00 0.00 ? 26 PHE A CB   11 
ATOM 11764 C CG   . PHE A 1 26 ? 6.533   -3.989  4.765   1.00 0.00 ? 26 PHE A CG   11 
ATOM 11765 C CD1  . PHE A 1 26 ? 6.344   -2.712  5.268   1.00 0.00 ? 26 PHE A CD1  11 
ATOM 11766 C CD2  . PHE A 1 26 ? 7.494   -4.185  3.787   1.00 0.00 ? 26 PHE A CD2  11 
ATOM 11767 C CE1  . PHE A 1 26 ? 7.098   -1.652  4.803   1.00 0.00 ? 26 PHE A CE1  11 
ATOM 11768 C CE2  . PHE A 1 26 ? 8.252   -3.128  3.319   1.00 0.00 ? 26 PHE A CE2  11 
ATOM 11769 C CZ   . PHE A 1 26 ? 8.055   -1.860  3.828   1.00 0.00 ? 26 PHE A CZ   11 
ATOM 11770 H H    . PHE A 1 26 ? 4.435   -6.803  6.714   1.00 0.00 ? 26 PHE A H    11 
ATOM 11771 H HA   . PHE A 1 26 ? 7.101   -6.453  6.233   1.00 0.00 ? 26 PHE A HA   11 
ATOM 11772 H HB2  . PHE A 1 26 ? 5.647   -5.874  4.481   1.00 0.00 ? 26 PHE A HB2  11 
ATOM 11773 H HB3  . PHE A 1 26 ? 4.721   -4.771  5.493   1.00 0.00 ? 26 PHE A HB3  11 
ATOM 11774 H HD1  . PHE A 1 26 ? 5.597   -2.548  6.031   1.00 0.00 ? 26 PHE A HD1  11 
ATOM 11775 H HD2  . PHE A 1 26 ? 7.650   -5.177  3.387   1.00 0.00 ? 26 PHE A HD2  11 
ATOM 11776 H HE1  . PHE A 1 26 ? 6.942   -0.661  5.203   1.00 0.00 ? 26 PHE A