data_2E34
# 
_entry.id   2E34 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2E34         pdb_00002e34 10.2210/pdb2e34/pdb 
RCSB  RCSB026164   ?            ?                   
WWPDB D_1000026164 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2E35 . unspecified 
PDB 2E36 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E34 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-20 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, D.'                 1 
'Walsh, J.D.'             2 
'Yu, P.'                  3 
'Markus, M.A.'            4 
'Choli-Papadopoulous, T.' 5 
'Schwieters, C.D.'        6 
'Krueger, S.'             7 
'Draper, D.E.'            8 
'Wang, Y.X.'              9 
# 
_citation.id                        primary 
_citation.title                     
;The structure of free L11 and functional dynamics of L11 in free, L11-rRNA(58 nt) binary and L11-rRNA(58 nt)-thiostrepton ternary complexes
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            367 
_citation.page_first                1007 
_citation.page_last                 1022 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17292917 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.01.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lee, D.'                1 ? 
primary 'Walsh, J.D.'            2 ? 
primary 'Yu, P.'                 3 ? 
primary 'Markus, M.A.'           4 ? 
primary 'Choli-Papadopoulou, T.' 5 ? 
primary 'Schwieters, C.D.'       6 ? 
primary 'Krueger, S.'            7 ? 
primary 'Draper, D.E.'           8 ? 
primary 'Wang, Y.X.'             9 ? 
# 
_cell.entry_id           2E34 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2E34 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           '50S ribosomal protein L11' 
_entity.formula_weight             15526.111 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRK
AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRK
AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   LYS n 
1 4   VAL n 
1 5   VAL n 
1 6   ALA n 
1 7   VAL n 
1 8   VAL n 
1 9   LYS n 
1 10  LEU n 
1 11  GLN n 
1 12  LEU n 
1 13  PRO n 
1 14  ALA n 
1 15  GLY n 
1 16  LYS n 
1 17  ALA n 
1 18  THR n 
1 19  PRO n 
1 20  ALA n 
1 21  PRO n 
1 22  PRO n 
1 23  VAL n 
1 24  GLY n 
1 25  PRO n 
1 26  ALA n 
1 27  LEU n 
1 28  GLY n 
1 29  GLN n 
1 30  HIS n 
1 31  GLY n 
1 32  ALA n 
1 33  ASN n 
1 34  ILE n 
1 35  MET n 
1 36  GLU n 
1 37  PHE n 
1 38  VAL n 
1 39  LYS n 
1 40  ALA n 
1 41  PHE n 
1 42  ASN n 
1 43  ALA n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  MET n 
1 49  GLY n 
1 50  ASP n 
1 51  ALA n 
1 52  ILE n 
1 53  VAL n 
1 54  PRO n 
1 55  VAL n 
1 56  GLU n 
1 57  ILE n 
1 58  THR n 
1 59  ILE n 
1 60  TYR n 
1 61  ALA n 
1 62  ASP n 
1 63  ARG n 
1 64  SER n 
1 65  PHE n 
1 66  THR n 
1 67  PHE n 
1 68  VAL n 
1 69  THR n 
1 70  LYS n 
1 71  THR n 
1 72  PRO n 
1 73  PRO n 
1 74  ALA n 
1 75  SER n 
1 76  TYR n 
1 77  LEU n 
1 78  ILE n 
1 79  ARG n 
1 80  LYS n 
1 81  ALA n 
1 82  ALA n 
1 83  GLY n 
1 84  LEU n 
1 85  GLU n 
1 86  LYS n 
1 87  GLY n 
1 88  ALA n 
1 89  HIS n 
1 90  LYS n 
1 91  PRO n 
1 92  GLY n 
1 93  ARG n 
1 94  GLU n 
1 95  LYS n 
1 96  VAL n 
1 97  GLY n 
1 98  ARG n 
1 99  ILE n 
1 100 THR n 
1 101 TRP n 
1 102 GLU n 
1 103 GLN n 
1 104 VAL n 
1 105 LEU n 
1 106 GLU n 
1 107 ILE n 
1 108 ALA n 
1 109 LYS n 
1 110 GLN n 
1 111 LYS n 
1 112 MET n 
1 113 PRO n 
1 114 ASP n 
1 115 LEU n 
1 116 ASN n 
1 117 THR n 
1 118 THR n 
1 119 ASP n 
1 120 LEU n 
1 121 GLU n 
1 122 ALA n 
1 123 ALA n 
1 124 ALA n 
1 125 ARG n 
1 126 MET n 
1 127 ILE n 
1 128 ALA n 
1 129 GLY n 
1 130 SER n 
1 131 ALA n 
1 132 ARG n 
1 133 SER n 
1 134 MET n 
1 135 GLY n 
1 136 VAL n 
1 137 GLU n 
1 138 VAL n 
1 139 VAL n 
1 140 GLY n 
1 141 ALA n 
1 142 PRO n 
1 143 GLU n 
1 144 VAL n 
1 145 LYS n 
1 146 ASP n 
1 147 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     274 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RL11_THETH 
_struct_ref.pdbx_db_accession          P36238 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRK
AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2E34 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 147 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P36238 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  147 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       147 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            NOESY 
_pdbx_nmr_exptl.solution_id     1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         ? 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_refine.entry_id           2E34 
_pdbx_nmr_refine.method             'TORSION ANGLE DYNAMICS, RG refinement' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2E34 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2E34 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' CYANA  2.1.4 'P.GUNTERT ET AL.' 1 
refinement           X-PLOR ?     ?                  2 
# 
_exptl.entry_id          2E34 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2E34 
_struct.title                     'L11 structure with RDC and RG refinement' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E34 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            'L11, ribosome, RNA BINDING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 23  ? LEU A 27  ? VAL A 23  LEU A 27  5 ? 5  
HELX_P HELX_P2 2 ILE A 34  ? GLY A 49  ? ILE A 34  GLY A 49  1 ? 16 
HELX_P HELX_P3 3 ALA A 74  ? GLY A 83  ? ALA A 74  GLY A 83  1 ? 10 
HELX_P HELX_P4 4 THR A 100 ? GLN A 110 ? THR A 100 GLN A 110 1 ? 11 
HELX_P HELX_P5 5 ASP A 119 ? GLY A 135 ? ASP A 119 GLY A 135 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 4   ? VAL A 8   ? VAL A 4   VAL A 8   
A 2 ILE A 57  ? TYR A 60  ? ILE A 57  TYR A 60  
A 3 SER A 64  ? THR A 66  ? SER A 64  THR A 66  
B 1 GLN A 11  ? ALA A 14  ? GLN A 11  ALA A 14  
B 2 ALA A 51  ? PRO A 54  ? ALA A 51  PRO A 54  
C 1 ARG A 98  ? ILE A 99  ? ARG A 98  ILE A 99  
C 2 GLU A 137 ? VAL A 138 ? GLU A 137 VAL A 138 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 5  ? N VAL A 5  O ILE A 59  ? O ILE A 59  
A 2 3 N THR A 58 ? N THR A 58 O THR A 66  ? O THR A 66  
B 1 2 N ALA A 14 ? N ALA A 14 O ALA A 51  ? O ALA A 51  
C 1 2 N ILE A 99 ? N ILE A 99 O GLU A 137 ? O GLU A 137 
# 
_database_PDB_matrix.entry_id          2E34 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E34 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 131.259 21.274  -117.206 1.00 0.00 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 132.551 21.255  -117.949 1.00 0.00 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 133.466 20.183  -117.354 1.00 0.00 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 134.670 20.338  -117.305 1.00 0.00 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 133.227 22.623  -117.834 1.00 0.00 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 132.164 23.705  -117.632 1.00 0.00 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 131.110 23.797  -119.100 1.00 0.00 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 131.295 25.572  -119.402 1.00 0.00 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 130.811 20.338  -117.265 1.00 0.00 ? 1   MET A H1   1  
ATOM 10    H HA   . MET A 1 1   ? 132.365 21.032  -118.989 1.00 0.00 ? 1   MET A HA   1  
ATOM 11    H HB2  . MET A 1 1   ? 133.903 22.620  -116.991 1.00 0.00 ? 1   MET A HB2  1  
ATOM 12    H HB3  . MET A 1 1   ? 133.780 22.829  -118.738 1.00 0.00 ? 1   MET A HB3  1  
ATOM 13    H HG2  . MET A 1 1   ? 131.561 23.461  -116.770 1.00 0.00 ? 1   MET A HG2  1  
ATOM 14    H HG3  . MET A 1 1   ? 132.647 24.658  -117.475 1.00 0.00 ? 1   MET A HG3  1  
ATOM 15    H HE1  . MET A 1 1   ? 132.336 25.847  -119.302 1.00 0.00 ? 1   MET A HE1  1  
ATOM 16    H HE2  . MET A 1 1   ? 130.710 26.123  -118.683 1.00 0.00 ? 1   MET A HE2  1  
ATOM 17    H HE3  . MET A 1 1   ? 130.950 25.805  -120.399 1.00 0.00 ? 1   MET A HE3  1  
ATOM 18    N N    . LYS A 1 2   ? 132.905 19.095  -116.902 1.00 0.00 ? 2   LYS A N    1  
ATOM 19    C CA   . LYS A 1 2   ? 133.744 18.014  -116.311 1.00 0.00 ? 2   LYS A CA   1  
ATOM 20    C C    . LYS A 1 2   ? 132.985 16.686  -116.373 1.00 0.00 ? 2   LYS A C    1  
ATOM 21    O O    . LYS A 1 2   ? 132.005 16.487  -115.684 1.00 0.00 ? 2   LYS A O    1  
ATOM 22    C CB   . LYS A 1 2   ? 134.061 18.354  -114.852 1.00 0.00 ? 2   LYS A CB   1  
ATOM 23    C CG   . LYS A 1 2   ? 132.887 19.119  -114.237 1.00 0.00 ? 2   LYS A CG   1  
ATOM 24    C CD   . LYS A 1 2   ? 133.219 20.612  -114.190 1.00 0.00 ? 2   LYS A CD   1  
ATOM 25    C CE   . LYS A 1 2   ? 133.966 20.929  -112.893 1.00 0.00 ? 2   LYS A CE   1  
ATOM 26    N NZ   . LYS A 1 2   ? 133.032 20.809  -111.739 1.00 0.00 ? 2   LYS A NZ   1  
ATOM 27    H H    . LYS A 1 2   ? 131.932 18.988  -116.950 1.00 0.00 ? 2   LYS A H    1  
ATOM 28    H HA   . LYS A 1 2   ? 134.665 17.929  -116.868 1.00 0.00 ? 2   LYS A HA   1  
ATOM 29    H HB2  . LYS A 1 2   ? 134.227 17.441  -114.299 1.00 0.00 ? 2   LYS A HB2  1  
ATOM 30    H HB3  . LYS A 1 2   ? 134.949 18.967  -114.811 1.00 0.00 ? 2   LYS A HB3  1  
ATOM 31    H HG2  . LYS A 1 2   ? 132.003 18.964  -114.838 1.00 0.00 ? 2   LYS A HG2  1  
ATOM 32    H HG3  . LYS A 1 2   ? 132.709 18.760  -113.235 1.00 0.00 ? 2   LYS A HG3  1  
ATOM 33    H HD2  . LYS A 1 2   ? 133.838 20.870  -115.036 1.00 0.00 ? 2   LYS A HD2  1  
ATOM 34    H HD3  . LYS A 1 2   ? 132.304 21.185  -114.225 1.00 0.00 ? 2   LYS A HD3  1  
ATOM 35    H HE2  . LYS A 1 2   ? 134.783 20.234  -112.769 1.00 0.00 ? 2   LYS A HE2  1  
ATOM 36    H HE3  . LYS A 1 2   ? 134.355 21.936  -112.939 1.00 0.00 ? 2   LYS A HE3  1  
ATOM 37    H HZ1  . LYS A 1 2   ? 133.214 19.918  -111.236 1.00 0.00 ? 2   LYS A HZ1  1  
ATOM 38    H HZ2  . LYS A 1 2   ? 132.051 20.819  -112.085 1.00 0.00 ? 2   LYS A HZ2  1  
ATOM 39    H HZ3  . LYS A 1 2   ? 133.179 21.607  -111.089 1.00 0.00 ? 2   LYS A HZ3  1  
ATOM 40    N N    . LYS A 1 3   ? 133.432 15.776  -117.195 1.00 0.00 ? 3   LYS A N    1  
ATOM 41    C CA   . LYS A 1 3   ? 132.738 14.461  -117.302 1.00 0.00 ? 3   LYS A CA   1  
ATOM 42    C C    . LYS A 1 3   ? 133.775 13.341  -117.421 1.00 0.00 ? 3   LYS A C    1  
ATOM 43    O O    . LYS A 1 3   ? 134.590 13.332  -118.322 1.00 0.00 ? 3   LYS A O    1  
ATOM 44    C CB   . LYS A 1 3   ? 131.846 14.460  -118.545 1.00 0.00 ? 3   LYS A CB   1  
ATOM 45    C CG   . LYS A 1 3   ? 130.376 14.473  -118.123 1.00 0.00 ? 3   LYS A CG   1  
ATOM 46    C CD   . LYS A 1 3   ? 129.500 14.815  -119.330 1.00 0.00 ? 3   LYS A CD   1  
ATOM 47    C CE   . LYS A 1 3   ? 128.599 16.003  -118.990 1.00 0.00 ? 3   LYS A CE   1  
ATOM 48    N NZ   . LYS A 1 3   ? 129.386 17.266  -119.079 1.00 0.00 ? 3   LYS A NZ   1  
ATOM 49    H H    . LYS A 1 3   ? 134.225 15.957  -117.741 1.00 0.00 ? 3   LYS A H    1  
ATOM 50    H HA   . LYS A 1 3   ? 132.132 14.298  -116.423 1.00 0.00 ? 3   LYS A HA   1  
ATOM 51    H HB2  . LYS A 1 3   ? 132.059 15.337  -119.140 1.00 0.00 ? 3   LYS A HB2  1  
ATOM 52    H HB3  . LYS A 1 3   ? 132.043 13.573  -119.129 1.00 0.00 ? 3   LYS A HB3  1  
ATOM 53    H HG2  . LYS A 1 3   ? 130.102 13.500  -117.742 1.00 0.00 ? 3   LYS A HG2  1  
ATOM 54    H HG3  . LYS A 1 3   ? 130.229 15.216  -117.353 1.00 0.00 ? 3   LYS A HG3  1  
ATOM 55    H HD2  . LYS A 1 3   ? 130.130 15.069  -120.171 1.00 0.00 ? 3   LYS A HD2  1  
ATOM 56    H HD3  . LYS A 1 3   ? 128.888 13.963  -119.584 1.00 0.00 ? 3   LYS A HD3  1  
ATOM 57    H HE2  . LYS A 1 3   ? 127.776 16.043  -119.688 1.00 0.00 ? 3   LYS A HE2  1  
ATOM 58    H HE3  . LYS A 1 3   ? 128.215 15.888  -117.987 1.00 0.00 ? 3   LYS A HE3  1  
ATOM 59    H HZ1  . LYS A 1 3   ? 129.612 17.602  -118.121 1.00 0.00 ? 3   LYS A HZ1  1  
ATOM 60    H HZ2  . LYS A 1 3   ? 128.827 17.987  -119.578 1.00 0.00 ? 3   LYS A HZ2  1  
ATOM 61    H HZ3  . LYS A 1 3   ? 130.269 17.088  -119.598 1.00 0.00 ? 3   LYS A HZ3  1  
ATOM 62    N N    . VAL A 1 4   ? 133.746 12.391  -116.525 1.00 0.00 ? 4   VAL A N    1  
ATOM 63    C CA   . VAL A 1 4   ? 134.726 11.271  -116.599 1.00 0.00 ? 4   VAL A CA   1  
ATOM 64    C C    . VAL A 1 4   ? 134.826 10.778  -118.038 1.00 0.00 ? 4   VAL A C    1  
ATOM 65    O O    . VAL A 1 4   ? 133.832 10.588  -118.711 1.00 0.00 ? 4   VAL A O    1  
ATOM 66    C CB   . VAL A 1 4   ? 134.265 10.123  -115.700 1.00 0.00 ? 4   VAL A CB   1  
ATOM 67    C CG1  . VAL A 1 4   ? 132.770 9.896   -115.893 1.00 0.00 ? 4   VAL A CG1  1  
ATOM 68    C CG2  . VAL A 1 4   ? 135.024 8.848   -116.077 1.00 0.00 ? 4   VAL A CG2  1  
ATOM 69    H H    . VAL A 1 4   ? 133.076 12.412  -115.809 1.00 0.00 ? 4   VAL A H    1  
ATOM 70    H HA   . VAL A 1 4   ? 135.693 11.616  -116.274 1.00 0.00 ? 4   VAL A HA   1  
ATOM 71    H HB   . VAL A 1 4   ? 134.458 10.366  -114.670 1.00 0.00 ? 4   VAL A HB   1  
ATOM 72    H HG11 . VAL A 1 4   ? 132.440 9.105   -115.238 1.00 0.00 ? 4   VAL A HG11 1  
ATOM 73    H HG12 . VAL A 1 4   ? 132.578 9.623   -116.918 1.00 0.00 ? 4   VAL A HG12 1  
ATOM 74    H HG13 . VAL A 1 4   ? 132.238 10.806  -115.655 1.00 0.00 ? 4   VAL A HG13 1  
ATOM 75    H HG21 . VAL A 1 4   ? 134.665 8.484   -117.028 1.00 0.00 ? 4   VAL A HG21 1  
ATOM 76    H HG22 . VAL A 1 4   ? 134.863 8.096   -115.319 1.00 0.00 ? 4   VAL A HG22 1  
ATOM 77    H HG23 . VAL A 1 4   ? 136.079 9.066   -116.150 1.00 0.00 ? 4   VAL A HG23 1  
ATOM 78    N N    . VAL A 1 5   ? 136.019 10.564  -118.518 1.00 0.00 ? 5   VAL A N    1  
ATOM 79    C CA   . VAL A 1 5   ? 136.171 10.079  -119.914 1.00 0.00 ? 5   VAL A CA   1  
ATOM 80    C C    . VAL A 1 5   ? 136.812 8.692   -119.892 1.00 0.00 ? 5   VAL A C    1  
ATOM 81    O O    . VAL A 1 5   ? 136.644 7.911   -120.807 1.00 0.00 ? 5   VAL A O    1  
ATOM 82    C CB   . VAL A 1 5   ? 137.052 11.042  -120.715 1.00 0.00 ? 5   VAL A CB   1  
ATOM 83    C CG1  . VAL A 1 5   ? 136.361 12.401  -120.835 1.00 0.00 ? 5   VAL A CG1  1  
ATOM 84    C CG2  . VAL A 1 5   ? 138.394 11.216  -120.000 1.00 0.00 ? 5   VAL A CG2  1  
ATOM 85    H H    . VAL A 1 5   ? 136.810 10.718  -117.960 1.00 0.00 ? 5   VAL A H    1  
ATOM 86    H HA   . VAL A 1 5   ? 135.194 9.998   -120.363 1.00 0.00 ? 5   VAL A HA   1  
ATOM 87    H HB   . VAL A 1 5   ? 137.220 10.636  -121.702 1.00 0.00 ? 5   VAL A HB   1  
ATOM 88    H HG11 . VAL A 1 5   ? 135.343 12.260  -121.162 1.00 0.00 ? 5   VAL A HG11 1  
ATOM 89    H HG12 . VAL A 1 5   ? 136.890 13.010  -121.554 1.00 0.00 ? 5   VAL A HG12 1  
ATOM 90    H HG13 . VAL A 1 5   ? 136.367 12.893  -119.874 1.00 0.00 ? 5   VAL A HG13 1  
ATOM 91    H HG21 . VAL A 1 5   ? 139.045 11.833  -120.602 1.00 0.00 ? 5   VAL A HG21 1  
ATOM 92    H HG22 . VAL A 1 5   ? 138.851 10.248  -119.852 1.00 0.00 ? 5   VAL A HG22 1  
ATOM 93    H HG23 . VAL A 1 5   ? 138.233 11.688  -119.043 1.00 0.00 ? 5   VAL A HG23 1  
ATOM 94    N N    . ALA A 1 6   ? 137.541 8.370   -118.857 1.00 0.00 ? 6   ALA A N    1  
ATOM 95    C CA   . ALA A 1 6   ? 138.171 7.021   -118.807 1.00 0.00 ? 6   ALA A CA   1  
ATOM 96    C C    . ALA A 1 6   ? 138.077 6.440   -117.394 1.00 0.00 ? 6   ALA A C    1  
ATOM 97    O O    . ALA A 1 6   ? 138.752 6.874   -116.481 1.00 0.00 ? 6   ALA A O    1  
ATOM 98    C CB   . ALA A 1 6   ? 139.639 7.120   -119.223 1.00 0.00 ? 6   ALA A CB   1  
ATOM 99    H H    . ALA A 1 6   ? 137.668 9.006   -118.119 1.00 0.00 ? 6   ALA A H    1  
ATOM 100   H HA   . ALA A 1 6   ? 137.648 6.368   -119.489 1.00 0.00 ? 6   ALA A HA   1  
ATOM 101   H HB1  . ALA A 1 6   ? 140.202 6.334   -118.742 1.00 0.00 ? 6   ALA A HB1  1  
ATOM 102   H HB2  . ALA A 1 6   ? 140.033 8.080   -118.925 1.00 0.00 ? 6   ALA A HB2  1  
ATOM 103   H HB3  . ALA A 1 6   ? 139.716 7.015   -120.294 1.00 0.00 ? 6   ALA A HB3  1  
ATOM 104   N N    . VAL A 1 7   ? 137.253 5.443   -117.219 1.00 0.00 ? 7   VAL A N    1  
ATOM 105   C CA   . VAL A 1 7   ? 137.112 4.800   -115.882 1.00 0.00 ? 7   VAL A CA   1  
ATOM 106   C C    . VAL A 1 7   ? 137.992 3.556   -115.839 1.00 0.00 ? 7   VAL A C    1  
ATOM 107   O O    . VAL A 1 7   ? 137.509 2.447   -115.956 1.00 0.00 ? 7   VAL A O    1  
ATOM 108   C CB   . VAL A 1 7   ? 135.669 4.352   -115.688 1.00 0.00 ? 7   VAL A CB   1  
ATOM 109   C CG1  . VAL A 1 7   ? 135.169 3.660   -116.958 1.00 0.00 ? 7   VAL A CG1  1  
ATOM 110   C CG2  . VAL A 1 7   ? 135.625 3.373   -114.517 1.00 0.00 ? 7   VAL A CG2  1  
ATOM 111   H H    . VAL A 1 7   ? 136.734 5.106   -117.978 1.00 0.00 ? 7   VAL A H    1  
ATOM 112   H HA   . VAL A 1 7   ? 137.364 5.493   -115.094 1.00 0.00 ? 7   VAL A HA   1  
ATOM 113   H HB   . VAL A 1 7   ? 135.048 5.209   -115.471 1.00 0.00 ? 7   VAL A HB   1  
ATOM 114   H HG11 . VAL A 1 7   ? 134.435 2.912   -116.695 1.00 0.00 ? 7   VAL A HG11 1  
ATOM 115   H HG12 . VAL A 1 7   ? 135.999 3.187   -117.461 1.00 0.00 ? 7   VAL A HG12 1  
ATOM 116   H HG13 . VAL A 1 7   ? 134.719 4.391   -117.613 1.00 0.00 ? 7   VAL A HG13 1  
ATOM 117   H HG21 . VAL A 1 7   ? 135.594 2.363   -114.895 1.00 0.00 ? 7   VAL A HG21 1  
ATOM 118   H HG22 . VAL A 1 7   ? 134.748 3.565   -113.920 1.00 0.00 ? 7   VAL A HG22 1  
ATOM 119   H HG23 . VAL A 1 7   ? 136.510 3.503   -113.910 1.00 0.00 ? 7   VAL A HG23 1  
ATOM 120   N N    . VAL A 1 8   ? 139.273 3.713   -115.740 1.00 0.00 ? 8   VAL A N    1  
ATOM 121   C CA   . VAL A 1 8   ? 140.149 2.503   -115.772 1.00 0.00 ? 8   VAL A CA   1  
ATOM 122   C C    . VAL A 1 8   ? 139.619 1.438   -114.806 1.00 0.00 ? 8   VAL A C    1  
ATOM 123   O O    . VAL A 1 8   ? 140.028 1.374   -113.665 1.00 0.00 ? 8   VAL A O    1  
ATOM 124   C CB   . VAL A 1 8   ? 141.580 2.876   -115.398 1.00 0.00 ? 8   VAL A CB   1  
ATOM 125   C CG1  . VAL A 1 8   ? 142.479 1.653   -115.564 1.00 0.00 ? 8   VAL A CG1  1  
ATOM 126   C CG2  . VAL A 1 8   ? 142.070 3.999   -116.317 1.00 0.00 ? 8   VAL A CG2  1  
ATOM 127   H H    . VAL A 1 8   ? 139.657 4.616   -115.718 1.00 0.00 ? 8   VAL A H    1  
ATOM 128   H HA   . VAL A 1 8   ? 140.127 2.120   -116.781 1.00 0.00 ? 8   VAL A HA   1  
ATOM 129   H HB   . VAL A 1 8   ? 141.608 3.204   -114.372 1.00 0.00 ? 8   VAL A HB   1  
ATOM 130   H HG11 . VAL A 1 8   ? 142.049 0.987   -116.298 1.00 0.00 ? 8   VAL A HG11 1  
ATOM 131   H HG12 . VAL A 1 8   ? 142.562 1.140   -114.618 1.00 0.00 ? 8   VAL A HG12 1  
ATOM 132   H HG13 . VAL A 1 8   ? 143.458 1.966   -115.892 1.00 0.00 ? 8   VAL A HG13 1  
ATOM 133   H HG21 . VAL A 1 8   ? 142.554 4.762   -115.727 1.00 0.00 ? 8   VAL A HG21 1  
ATOM 134   H HG22 . VAL A 1 8   ? 141.229 4.428   -116.841 1.00 0.00 ? 8   VAL A HG22 1  
ATOM 135   H HG23 . VAL A 1 8   ? 142.773 3.597   -117.032 1.00 0.00 ? 8   VAL A HG23 1  
ATOM 136   N N    . LYS A 1 9   ? 138.725 0.594   -115.267 1.00 0.00 ? 9   LYS A N    1  
ATOM 137   C CA   . LYS A 1 9   ? 138.171 -0.487  -114.390 1.00 0.00 ? 9   LYS A CA   1  
ATOM 138   C C    . LYS A 1 9   ? 139.140 -1.674  -114.381 1.00 0.00 ? 9   LYS A C    1  
ATOM 139   O O    . LYS A 1 9   ? 138.745 -2.823  -114.372 1.00 0.00 ? 9   LYS A O    1  
ATOM 140   C CB   . LYS A 1 9   ? 136.814 -0.941  -114.934 1.00 0.00 ? 9   LYS A CB   1  
ATOM 141   C CG   . LYS A 1 9   ? 136.255 -2.058  -114.051 1.00 0.00 ? 9   LYS A CG   1  
ATOM 142   C CD   . LYS A 1 9   ? 136.108 -3.339  -114.875 1.00 0.00 ? 9   LYS A CD   1  
ATOM 143   C CE   . LYS A 1 9   ? 134.843 -3.254  -115.730 1.00 0.00 ? 9   LYS A CE   1  
ATOM 144   N NZ   . LYS A 1 9   ? 134.920 -4.255  -116.832 1.00 0.00 ? 9   LYS A NZ   1  
ATOM 145   H H    . LYS A 1 9   ? 138.426 0.665   -116.197 1.00 0.00 ? 9   LYS A H    1  
ATOM 146   H HA   . LYS A 1 9   ? 138.050 -0.114  -113.386 1.00 0.00 ? 9   LYS A HA   1  
ATOM 147   H HB2  . LYS A 1 9   ? 136.130 -0.104  -114.935 1.00 0.00 ? 9   LYS A HB2  1  
ATOM 148   H HB3  . LYS A 1 9   ? 136.935 -1.307  -115.943 1.00 0.00 ? 9   LYS A HB3  1  
ATOM 149   H HG2  . LYS A 1 9   ? 136.930 -2.236  -113.225 1.00 0.00 ? 9   LYS A HG2  1  
ATOM 150   H HG3  . LYS A 1 9   ? 135.289 -1.766  -113.669 1.00 0.00 ? 9   LYS A HG3  1  
ATOM 151   H HD2  . LYS A 1 9   ? 136.971 -3.456  -115.515 1.00 0.00 ? 9   LYS A HD2  1  
ATOM 152   H HD3  . LYS A 1 9   ? 136.035 -4.188  -114.211 1.00 0.00 ? 9   LYS A HD3  1  
ATOM 153   H HE2  . LYS A 1 9   ? 133.979 -3.460  -115.116 1.00 0.00 ? 9   LYS A HE2  1  
ATOM 154   H HE3  . LYS A 1 9   ? 134.758 -2.263  -116.150 1.00 0.00 ? 9   LYS A HE3  1  
ATOM 155   H HZ1  . LYS A 1 9   ? 134.292 -3.966  -117.608 1.00 0.00 ? 9   LYS A HZ1  1  
ATOM 156   H HZ2  . LYS A 1 9   ? 134.624 -5.187  -116.474 1.00 0.00 ? 9   LYS A HZ2  1  
ATOM 157   H HZ3  . LYS A 1 9   ? 135.897 -4.312  -117.182 1.00 0.00 ? 9   LYS A HZ3  1  
ATOM 158   N N    . LEU A 1 10  ? 140.406 -1.386  -114.408 1.00 0.00 ? 10  LEU A N    1  
ATOM 159   C CA   . LEU A 1 10  ? 141.449 -2.453  -114.428 1.00 0.00 ? 10  LEU A CA   1  
ATOM 160   C C    . LEU A 1 10  ? 141.665 -3.050  -113.040 1.00 0.00 ? 10  LEU A C    1  
ATOM 161   O O    . LEU A 1 10  ? 140.979 -2.729  -112.093 1.00 0.00 ? 10  LEU A O    1  
ATOM 162   C CB   . LEU A 1 10  ? 142.769 -1.833  -114.885 1.00 0.00 ? 10  LEU A CB   1  
ATOM 163   C CG   . LEU A 1 10  ? 143.328 -2.670  -116.042 1.00 0.00 ? 10  LEU A CG   1  
ATOM 164   C CD1  . LEU A 1 10  ? 142.656 -2.251  -117.351 1.00 0.00 ? 10  LEU A CD1  1  
ATOM 165   C CD2  . LEU A 1 10  ? 144.834 -2.454  -116.156 1.00 0.00 ? 10  LEU A CD2  1  
ATOM 166   H H    . LEU A 1 10  ? 140.680 -0.446  -114.435 1.00 0.00 ? 10  LEU A H    1  
ATOM 167   H HA   . LEU A 1 10  ? 141.205 -3.226  -115.144 1.00 0.00 ? 10  LEU A HA   1  
ATOM 168   H HB2  . LEU A 1 10  ? 142.595 -0.822  -115.219 1.00 0.00 ? 10  LEU A HB2  1  
ATOM 169   H HB3  . LEU A 1 10  ? 143.472 -1.832  -114.068 1.00 0.00 ? 10  LEU A HB3  1  
ATOM 170   H HG   . LEU A 1 10  ? 143.129 -3.716  -115.856 1.00 0.00 ? 10  LEU A HG   1  
ATOM 171   H HD11 . LEU A 1 10  ? 142.480 -1.186  -117.342 1.00 0.00 ? 10  LEU A HD11 1  
ATOM 172   H HD12 . LEU A 1 10  ? 141.715 -2.771  -117.455 1.00 0.00 ? 10  LEU A HD12 1  
ATOM 173   H HD13 . LEU A 1 10  ? 143.300 -2.502  -118.182 1.00 0.00 ? 10  LEU A HD13 1  
ATOM 174   H HD21 . LEU A 1 10  ? 145.037 -1.770  -116.966 1.00 0.00 ? 10  LEU A HD21 1  
ATOM 175   H HD22 . LEU A 1 10  ? 145.318 -3.399  -116.354 1.00 0.00 ? 10  LEU A HD22 1  
ATOM 176   H HD23 . LEU A 1 10  ? 145.211 -2.044  -115.232 1.00 0.00 ? 10  LEU A HD23 1  
ATOM 177   N N    . GLN A 1 11  ? 142.645 -3.908  -112.925 1.00 0.00 ? 11  GLN A N    1  
ATOM 178   C CA   . GLN A 1 11  ? 142.969 -4.533  -111.613 1.00 0.00 ? 11  GLN A CA   1  
ATOM 179   C C    . GLN A 1 11  ? 144.421 -4.203  -111.268 1.00 0.00 ? 11  GLN A C    1  
ATOM 180   O O    . GLN A 1 11  ? 145.143 -3.647  -112.070 1.00 0.00 ? 11  GLN A O    1  
ATOM 181   C CB   . GLN A 1 11  ? 142.795 -6.050  -111.708 1.00 0.00 ? 11  GLN A CB   1  
ATOM 182   C CG   . GLN A 1 11  ? 143.200 -6.524  -113.105 1.00 0.00 ? 11  GLN A CG   1  
ATOM 183   C CD   . GLN A 1 11  ? 141.994 -6.441  -114.042 1.00 0.00 ? 11  GLN A CD   1  
ATOM 184   O OE1  . GLN A 1 11  ? 142.010 -6.997  -115.122 1.00 0.00 ? 11  GLN A OE1  1  
ATOM 185   N NE2  . GLN A 1 11  ? 140.941 -5.764  -113.673 1.00 0.00 ? 11  GLN A NE2  1  
ATOM 186   H H    . GLN A 1 11  ? 143.187 -4.128  -113.711 1.00 0.00 ? 11  GLN A H    1  
ATOM 187   H HA   . GLN A 1 11  ? 142.323 -4.139  -110.848 1.00 0.00 ? 11  GLN A HA   1  
ATOM 188   H HB2  . GLN A 1 11  ? 143.419 -6.531  -110.969 1.00 0.00 ? 11  GLN A HB2  1  
ATOM 189   H HB3  . GLN A 1 11  ? 141.762 -6.306  -111.529 1.00 0.00 ? 11  GLN A HB3  1  
ATOM 190   H HG2  . GLN A 1 11  ? 143.994 -5.895  -113.482 1.00 0.00 ? 11  GLN A HG2  1  
ATOM 191   H HG3  . GLN A 1 11  ? 143.543 -7.546  -113.053 1.00 0.00 ? 11  GLN A HG3  1  
ATOM 192   H HE21 . GLN A 1 11  ? 140.929 -5.315  -112.802 1.00 0.00 ? 11  GLN A HE21 1  
ATOM 193   H HE22 . GLN A 1 11  ? 140.164 -5.705  -114.266 1.00 0.00 ? 11  GLN A HE22 1  
ATOM 194   N N    . LEU A 1 12  ? 144.866 -4.552  -110.094 1.00 0.00 ? 12  LEU A N    1  
ATOM 195   C CA   . LEU A 1 12  ? 146.281 -4.262  -109.730 1.00 0.00 ? 12  LEU A CA   1  
ATOM 196   C C    . LEU A 1 12  ? 146.690 -5.139  -108.546 1.00 0.00 ? 12  LEU A C    1  
ATOM 197   O O    . LEU A 1 12  ? 145.883 -5.466  -107.702 1.00 0.00 ? 12  LEU A O    1  
ATOM 198   C CB   . LEU A 1 12  ? 146.437 -2.788  -109.357 1.00 0.00 ? 12  LEU A CB   1  
ATOM 199   C CG   . LEU A 1 12  ? 147.177 -2.048  -110.477 1.00 0.00 ? 12  LEU A CG   1  
ATOM 200   C CD1  . LEU A 1 12  ? 146.218 -1.087  -111.178 1.00 0.00 ? 12  LEU A CD1  1  
ATOM 201   C CD2  . LEU A 1 12  ? 148.343 -1.258  -109.880 1.00 0.00 ? 12  LEU A CD2  1  
ATOM 202   H H    . LEU A 1 12  ? 144.281 -5.021  -109.461 1.00 0.00 ? 12  LEU A H    1  
ATOM 203   H HA   . LEU A 1 12  ? 146.909 -4.486  -110.575 1.00 0.00 ? 12  LEU A HA   1  
ATOM 204   H HB2  . LEU A 1 12  ? 145.462 -2.349  -109.215 1.00 0.00 ? 12  LEU A HB2  1  
ATOM 205   H HB3  . LEU A 1 12  ? 147.004 -2.709  -108.442 1.00 0.00 ? 12  LEU A HB3  1  
ATOM 206   H HG   . LEU A 1 12  ? 147.556 -2.760  -111.195 1.00 0.00 ? 12  LEU A HG   1  
ATOM 207   H HD11 . LEU A 1 12  ? 146.023 -0.242  -110.535 1.00 0.00 ? 12  LEU A HD11 1  
ATOM 208   H HD12 . LEU A 1 12  ? 145.293 -1.597  -111.395 1.00 0.00 ? 12  LEU A HD12 1  
ATOM 209   H HD13 . LEU A 1 12  ? 146.664 -0.744  -112.099 1.00 0.00 ? 12  LEU A HD13 1  
ATOM 210   H HD21 . LEU A 1 12  ? 148.616 -0.458  -110.552 1.00 0.00 ? 12  LEU A HD21 1  
ATOM 211   H HD22 . LEU A 1 12  ? 149.188 -1.915  -109.739 1.00 0.00 ? 12  LEU A HD22 1  
ATOM 212   H HD23 . LEU A 1 12  ? 148.046 -0.843  -108.928 1.00 0.00 ? 12  LEU A HD23 1  
ATOM 213   N N    . PRO A 1 13  ? 147.935 -5.532  -108.501 1.00 0.00 ? 13  PRO A N    1  
ATOM 214   C CA   . PRO A 1 13  ? 148.456 -6.407  -107.413 1.00 0.00 ? 13  PRO A CA   1  
ATOM 215   C C    . PRO A 1 13  ? 148.942 -5.629  -106.183 1.00 0.00 ? 13  PRO A C    1  
ATOM 216   O O    . PRO A 1 13  ? 149.776 -4.752  -106.292 1.00 0.00 ? 13  PRO A O    1  
ATOM 217   C CB   . PRO A 1 13  ? 149.648 -7.030  -108.125 1.00 0.00 ? 13  PRO A CB   1  
ATOM 218   C CG   . PRO A 1 13  ? 150.144 -5.992  -109.136 1.00 0.00 ? 13  PRO A CG   1  
ATOM 219   C CD   . PRO A 1 13  ? 148.936 -5.141  -109.536 1.00 0.00 ? 13  PRO A CD   1  
ATOM 220   H HA   . PRO A 1 13  ? 147.750 -7.170  -107.143 1.00 0.00 ? 13  PRO A HA   1  
ATOM 221   H HB2  . PRO A 1 13  ? 150.421 -7.261  -107.415 1.00 0.00 ? 13  PRO A HB2  1  
ATOM 222   H HB3  . PRO A 1 13  ? 149.344 -7.924  -108.646 1.00 0.00 ? 13  PRO A HB3  1  
ATOM 223   H HG2  . PRO A 1 13  ? 150.899 -5.368  -108.677 1.00 0.00 ? 13  PRO A HG2  1  
ATOM 224   H HG3  . PRO A 1 13  ? 150.550 -6.477  -110.005 1.00 0.00 ? 13  PRO A HG3  1  
ATOM 225   H HD2  . PRO A 1 13  ? 149.171 -4.086  -109.477 1.00 0.00 ? 13  PRO A HD2  1  
ATOM 226   H HD3  . PRO A 1 13  ? 148.588 -5.411  -110.519 1.00 0.00 ? 13  PRO A HD3  1  
ATOM 227   N N    . ALA A 1 14  ? 148.464 -5.957  -105.010 1.00 0.00 ? 14  ALA A N    1  
ATOM 228   C CA   . ALA A 1 14  ? 148.958 -5.239  -103.802 1.00 0.00 ? 14  ALA A CA   1  
ATOM 229   C C    . ALA A 1 14  ? 150.365 -5.772  -103.506 1.00 0.00 ? 14  ALA A C    1  
ATOM 230   O O    . ALA A 1 14  ? 150.632 -6.943  -103.687 1.00 0.00 ? 14  ALA A O    1  
ATOM 231   C CB   . ALA A 1 14  ? 148.021 -5.489  -102.617 1.00 0.00 ? 14  ALA A CB   1  
ATOM 232   H H    . ALA A 1 14  ? 147.811 -6.683  -104.925 1.00 0.00 ? 14  ALA A H    1  
ATOM 233   H HA   . ALA A 1 14  ? 149.008 -4.184  -104.025 1.00 0.00 ? 14  ALA A HA   1  
ATOM 234   H HB1  . ALA A 1 14  ? 147.545 -4.562  -102.333 1.00 0.00 ? 14  ALA A HB1  1  
ATOM 235   H HB2  . ALA A 1 14  ? 148.587 -5.873  -101.783 1.00 0.00 ? 14  ALA A HB2  1  
ATOM 236   H HB3  . ALA A 1 14  ? 147.266 -6.206  -102.901 1.00 0.00 ? 14  ALA A HB3  1  
ATOM 237   N N    . GLY A 1 15  ? 151.269 -4.936  -103.061 1.00 0.00 ? 15  GLY A N    1  
ATOM 238   C CA   . GLY A 1 15  ? 152.654 -5.429  -102.778 1.00 0.00 ? 15  GLY A CA   1  
ATOM 239   C C    . GLY A 1 15  ? 153.149 -6.179  -104.014 1.00 0.00 ? 15  GLY A C    1  
ATOM 240   O O    . GLY A 1 15  ? 153.449 -7.356  -103.970 1.00 0.00 ? 15  GLY A O    1  
ATOM 241   H H    . GLY A 1 15  ? 151.044 -3.992  -102.922 1.00 0.00 ? 15  GLY A H    1  
ATOM 242   H HA2  . GLY A 1 15  ? 153.304 -4.591  -102.570 1.00 0.00 ? 15  GLY A HA2  1  
ATOM 243   H HA3  . GLY A 1 15  ? 152.638 -6.099  -101.932 1.00 0.00 ? 15  GLY A HA3  1  
ATOM 244   N N    . LYS A 1 16  ? 153.186 -5.503  -105.125 1.00 0.00 ? 16  LYS A N    1  
ATOM 245   C CA   . LYS A 1 16  ? 153.602 -6.148  -106.400 1.00 0.00 ? 16  LYS A CA   1  
ATOM 246   C C    . LYS A 1 16  ? 153.410 -5.151  -107.543 1.00 0.00 ? 16  LYS A C    1  
ATOM 247   O O    . LYS A 1 16  ? 153.723 -5.431  -108.683 1.00 0.00 ? 16  LYS A O    1  
ATOM 248   C CB   . LYS A 1 16  ? 152.732 -7.380  -106.633 1.00 0.00 ? 16  LYS A CB   1  
ATOM 249   C CG   . LYS A 1 16  ? 152.859 -7.833  -108.089 1.00 0.00 ? 16  LYS A CG   1  
ATOM 250   C CD   . LYS A 1 16  ? 152.365 -9.275  -108.222 1.00 0.00 ? 16  LYS A CD   1  
ATOM 251   C CE   . LYS A 1 16  ? 152.791 -9.840  -109.578 1.00 0.00 ? 16  LYS A CE   1  
ATOM 252   N NZ   . LYS A 1 16  ? 153.689 -11.010 -109.368 1.00 0.00 ? 16  LYS A NZ   1  
ATOM 253   H H    . LYS A 1 16  ? 152.904 -4.565  -105.130 1.00 0.00 ? 16  LYS A H    1  
ATOM 254   H HA   . LYS A 1 16  ? 154.641 -6.445  -106.397 1.00 0.00 ? 16  LYS A HA   1  
ATOM 255   H HB2  . LYS A 1 16  ? 153.060 -8.177  -105.980 1.00 0.00 ? 16  LYS A HB2  1  
ATOM 256   H HB3  . LYS A 1 16  ? 151.708 -7.139  -106.416 1.00 0.00 ? 16  LYS A HB3  1  
ATOM 257   H HG2  . LYS A 1 16  ? 152.264 -7.188  -108.719 1.00 0.00 ? 16  LYS A HG2  1  
ATOM 258   H HG3  . LYS A 1 16  ? 153.894 -7.779  -108.394 1.00 0.00 ? 16  LYS A HG3  1  
ATOM 259   H HD2  . LYS A 1 16  ? 152.792 -9.875  -107.431 1.00 0.00 ? 16  LYS A HD2  1  
ATOM 260   H HD3  . LYS A 1 16  ? 151.288 -9.295  -108.148 1.00 0.00 ? 16  LYS A HD3  1  
ATOM 261   H HE2  . LYS A 1 16  ? 151.916 -10.151 -110.129 1.00 0.00 ? 16  LYS A HE2  1  
ATOM 262   H HE3  . LYS A 1 16  ? 153.316 -9.079  -110.137 1.00 0.00 ? 16  LYS A HE3  1  
ATOM 263   H HZ1  . LYS A 1 16  ? 154.670 -10.738 -109.579 1.00 0.00 ? 16  LYS A HZ1  1  
ATOM 264   H HZ2  . LYS A 1 16  ? 153.401 -11.786 -110.000 1.00 0.00 ? 16  LYS A HZ2  1  
ATOM 265   H HZ3  . LYS A 1 16  ? 153.624 -11.325 -108.380 1.00 0.00 ? 16  LYS A HZ3  1  
ATOM 266   N N    . ALA A 1 17  ? 152.921 -3.979  -107.244 1.00 0.00 ? 17  ALA A N    1  
ATOM 267   C CA   . ALA A 1 17  ? 152.738 -2.955  -108.310 1.00 0.00 ? 17  ALA A CA   1  
ATOM 268   C C    . ALA A 1 17  ? 154.072 -2.236  -108.520 1.00 0.00 ? 17  ALA A C    1  
ATOM 269   O O    . ALA A 1 17  ? 154.900 -2.177  -107.633 1.00 0.00 ? 17  ALA A O    1  
ATOM 270   C CB   . ALA A 1 17  ? 151.666 -1.955  -107.881 1.00 0.00 ? 17  ALA A CB   1  
ATOM 271   H H    . ALA A 1 17  ? 152.693 -3.766  -106.315 1.00 0.00 ? 17  ALA A H    1  
ATOM 272   H HA   . ALA A 1 17  ? 152.434 -3.433  -109.230 1.00 0.00 ? 17  ALA A HA   1  
ATOM 273   H HB1  . ALA A 1 17  ? 150.724 -2.471  -107.762 1.00 0.00 ? 17  ALA A HB1  1  
ATOM 274   H HB2  . ALA A 1 17  ? 151.565 -1.192  -108.638 1.00 0.00 ? 17  ALA A HB2  1  
ATOM 275   H HB3  . ALA A 1 17  ? 151.950 -1.502  -106.945 1.00 0.00 ? 17  ALA A HB3  1  
ATOM 276   N N    . THR A 1 18  ? 154.299 -1.703  -109.688 1.00 0.00 ? 18  THR A N    1  
ATOM 277   C CA   . THR A 1 18  ? 155.592 -1.009  -109.945 1.00 0.00 ? 18  THR A CA   1  
ATOM 278   C C    . THR A 1 18  ? 155.526 -0.279  -111.284 1.00 0.00 ? 18  THR A C    1  
ATOM 279   O O    . THR A 1 18  ? 154.647 -0.527  -112.082 1.00 0.00 ? 18  THR A O    1  
ATOM 280   C CB   . THR A 1 18  ? 156.710 -2.051  -110.000 1.00 0.00 ? 18  THR A CB   1  
ATOM 281   O OG1  . THR A 1 18  ? 156.138 -3.346  -110.125 1.00 0.00 ? 18  THR A OG1  1  
ATOM 282   C CG2  . THR A 1 18  ? 157.540 -1.984  -108.723 1.00 0.00 ? 18  THR A CG2  1  
ATOM 283   H H    . THR A 1 18  ? 153.629 -1.775  -110.398 1.00 0.00 ? 18  THR A H    1  
ATOM 284   H HA   . THR A 1 18  ? 155.789 -0.303  -109.155 1.00 0.00 ? 18  THR A HA   1  
ATOM 285   H HB   . THR A 1 18  ? 157.345 -1.857  -110.850 1.00 0.00 ? 18  THR A HB   1  
ATOM 286   H HG1  . THR A 1 18  ? 156.818 -3.940  -110.451 1.00 0.00 ? 18  THR A HG1  1  
ATOM 287   H HG21 . THR A 1 18  ? 157.083 -2.602  -107.967 1.00 0.00 ? 18  THR A HG21 1  
ATOM 288   H HG22 . THR A 1 18  ? 157.586 -0.963  -108.375 1.00 0.00 ? 18  THR A HG22 1  
ATOM 289   H HG23 . THR A 1 18  ? 158.538 -2.341  -108.926 1.00 0.00 ? 18  THR A HG23 1  
ATOM 290   N N    . PRO A 1 19  ? 156.461 0.605   -111.533 1.00 0.00 ? 19  PRO A N    1  
ATOM 291   C CA   . PRO A 1 19  ? 156.503 1.352   -112.816 1.00 0.00 ? 19  PRO A CA   1  
ATOM 292   C C    . PRO A 1 19  ? 156.372 0.414   -114.018 1.00 0.00 ? 19  PRO A C    1  
ATOM 293   O O    . PRO A 1 19  ? 156.940 0.639   -115.067 1.00 0.00 ? 19  PRO A O    1  
ATOM 294   C CB   . PRO A 1 19  ? 157.875 2.021   -112.771 1.00 0.00 ? 19  PRO A CB   1  
ATOM 295   C CG   . PRO A 1 19  ? 158.518 1.738   -111.405 1.00 0.00 ? 19  PRO A CG   1  
ATOM 296   C CD   . PRO A 1 19  ? 157.540 0.913   -110.561 1.00 0.00 ? 19  PRO A CD   1  
ATOM 297   H HA   . PRO A 1 19  ? 155.737 2.108   -112.866 1.00 0.00 ? 19  PRO A HA   1  
ATOM 298   H HB2  . PRO A 1 19  ? 158.493 1.626   -113.559 1.00 0.00 ? 19  PRO A HB2  1  
ATOM 299   H HB3  . PRO A 1 19  ? 157.762 3.087   -112.899 1.00 0.00 ? 19  PRO A HB3  1  
ATOM 300   H HG2  . PRO A 1 19  ? 159.436 1.184   -111.544 1.00 0.00 ? 19  PRO A HG2  1  
ATOM 301   H HG3  . PRO A 1 19  ? 158.729 2.670   -110.902 1.00 0.00 ? 19  PRO A HG3  1  
ATOM 302   H HD2  . PRO A 1 19  ? 158.014 0.010   -110.205 1.00 0.00 ? 19  PRO A HD2  1  
ATOM 303   H HD3  . PRO A 1 19  ? 157.151 1.495   -109.741 1.00 0.00 ? 19  PRO A HD3  1  
ATOM 304   N N    . ALA A 1 20  ? 155.610 -0.630  -113.865 1.00 0.00 ? 20  ALA A N    1  
ATOM 305   C CA   . ALA A 1 20  ? 155.413 -1.588  -114.984 1.00 0.00 ? 20  ALA A CA   1  
ATOM 306   C C    . ALA A 1 20  ? 154.124 -2.377  -114.751 1.00 0.00 ? 20  ALA A C    1  
ATOM 307   O O    . ALA A 1 20  ? 154.125 -3.592  -114.750 1.00 0.00 ? 20  ALA A O    1  
ATOM 308   C CB   . ALA A 1 20  ? 156.598 -2.553  -115.046 1.00 0.00 ? 20  ALA A CB   1  
ATOM 309   H H    . ALA A 1 20  ? 155.150 -0.763  -113.007 1.00 0.00 ? 20  ALA A H    1  
ATOM 310   H HA   . ALA A 1 20  ? 155.340 -1.045  -115.915 1.00 0.00 ? 20  ALA A HA   1  
ATOM 311   H HB1  . ALA A 1 20  ? 156.574 -3.209  -114.189 1.00 0.00 ? 20  ALA A HB1  1  
ATOM 312   H HB2  . ALA A 1 20  ? 157.521 -1.991  -115.043 1.00 0.00 ? 20  ALA A HB2  1  
ATOM 313   H HB3  . ALA A 1 20  ? 156.538 -3.140  -115.951 1.00 0.00 ? 20  ALA A HB3  1  
ATOM 314   N N    . PRO A 1 21  ? 153.029 -1.689  -114.561 1.00 0.00 ? 21  PRO A N    1  
ATOM 315   C CA   . PRO A 1 21  ? 151.722 -2.352  -114.331 1.00 0.00 ? 21  PRO A CA   1  
ATOM 316   C C    . PRO A 1 21  ? 151.082 -2.811  -115.641 1.00 0.00 ? 21  PRO A C    1  
ATOM 317   O O    . PRO A 1 21  ? 151.526 -2.451  -116.713 1.00 0.00 ? 21  PRO A O    1  
ATOM 318   C CB   . PRO A 1 21  ? 150.901 -1.224  -113.708 1.00 0.00 ? 21  PRO A CB   1  
ATOM 319   C CG   . PRO A 1 21  ? 151.624 0.104   -113.974 1.00 0.00 ? 21  PRO A CG   1  
ATOM 320   C CD   . PRO A 1 21  ? 153.010 -0.202  -114.554 1.00 0.00 ? 21  PRO A CD   1  
ATOM 321   H HA   . PRO A 1 21  ? 151.817 -3.168  -113.636 1.00 0.00 ? 21  PRO A HA   1  
ATOM 322   H HB2  . PRO A 1 21  ? 149.917 -1.200  -114.155 1.00 0.00 ? 21  PRO A HB2  1  
ATOM 323   H HB3  . PRO A 1 21  ? 150.815 -1.380  -112.643 1.00 0.00 ? 21  PRO A HB3  1  
ATOM 324   H HG2  . PRO A 1 21  ? 151.054 0.692   -114.679 1.00 0.00 ? 21  PRO A HG2  1  
ATOM 325   H HG3  . PRO A 1 21  ? 151.734 0.650   -113.049 1.00 0.00 ? 21  PRO A HG3  1  
ATOM 326   H HD2  . PRO A 1 21  ? 153.100 0.193   -115.558 1.00 0.00 ? 21  PRO A HD2  1  
ATOM 327   H HD3  . PRO A 1 21  ? 153.784 0.184   -113.915 1.00 0.00 ? 21  PRO A HD3  1  
ATOM 328   N N    . PRO A 1 22  ? 150.036 -3.581  -115.556 1.00 0.00 ? 22  PRO A N    1  
ATOM 329   C CA   . PRO A 1 22  ? 149.336 -4.056  -116.774 1.00 0.00 ? 22  PRO A CA   1  
ATOM 330   C C    . PRO A 1 22  ? 148.828 -2.879  -117.610 1.00 0.00 ? 22  PRO A C    1  
ATOM 331   O O    . PRO A 1 22  ? 148.288 -3.048  -118.685 1.00 0.00 ? 22  PRO A O    1  
ATOM 332   C CB   . PRO A 1 22  ? 148.171 -4.865  -116.199 1.00 0.00 ? 22  PRO A CB   1  
ATOM 333   C CG   . PRO A 1 22  ? 148.268 -4.858  -114.667 1.00 0.00 ? 22  PRO A CG   1  
ATOM 334   C CD   . PRO A 1 22  ? 149.484 -4.023  -114.251 1.00 0.00 ? 22  PRO A CD   1  
ATOM 335   H HA   . PRO A 1 22  ? 149.976 -4.696  -117.359 1.00 0.00 ? 22  PRO A HA   1  
ATOM 336   H HB2  . PRO A 1 22  ? 147.236 -4.421  -116.507 1.00 0.00 ? 22  PRO A HB2  1  
ATOM 337   H HB3  . PRO A 1 22  ? 148.225 -5.882  -116.557 1.00 0.00 ? 22  PRO A HB3  1  
ATOM 338   H HG2  . PRO A 1 22  ? 147.370 -4.424  -114.250 1.00 0.00 ? 22  PRO A HG2  1  
ATOM 339   H HG3  . PRO A 1 22  ? 148.385 -5.868  -114.305 1.00 0.00 ? 22  PRO A HG3  1  
ATOM 340   H HD2  . PRO A 1 22  ? 149.177 -3.177  -113.651 1.00 0.00 ? 22  PRO A HD2  1  
ATOM 341   H HD3  . PRO A 1 22  ? 150.204 -4.629  -113.725 1.00 0.00 ? 22  PRO A HD3  1  
ATOM 342   N N    . VAL A 1 23  ? 148.995 -1.685  -117.106 1.00 0.00 ? 23  VAL A N    1  
ATOM 343   C CA   . VAL A 1 23  ? 148.520 -0.481  -117.844 1.00 0.00 ? 23  VAL A CA   1  
ATOM 344   C C    . VAL A 1 23  ? 149.708 0.334   -118.345 1.00 0.00 ? 23  VAL A C    1  
ATOM 345   O O    . VAL A 1 23  ? 149.947 0.448   -119.534 1.00 0.00 ? 23  VAL A O    1  
ATOM 346   C CB   . VAL A 1 23  ? 147.711 0.403   -116.903 1.00 0.00 ? 23  VAL A CB   1  
ATOM 347   C CG1  . VAL A 1 23  ? 146.754 1.247   -117.728 1.00 0.00 ? 23  VAL A CG1  1  
ATOM 348   C CG2  . VAL A 1 23  ? 146.927 -0.462  -115.919 1.00 0.00 ? 23  VAL A CG2  1  
ATOM 349   H H    . VAL A 1 23  ? 149.427 -1.580  -116.232 1.00 0.00 ? 23  VAL A H    1  
ATOM 350   H HA   . VAL A 1 23  ? 147.905 -0.785  -118.677 1.00 0.00 ? 23  VAL A HA   1  
ATOM 351   H HB   . VAL A 1 23  ? 148.382 1.053   -116.359 1.00 0.00 ? 23  VAL A HB   1  
ATOM 352   H HG11 . VAL A 1 23  ? 146.153 1.857   -117.072 1.00 0.00 ? 23  VAL A HG11 1  
ATOM 353   H HG12 . VAL A 1 23  ? 146.117 0.601   -118.310 1.00 0.00 ? 23  VAL A HG12 1  
ATOM 354   H HG13 . VAL A 1 23  ? 147.325 1.880   -118.388 1.00 0.00 ? 23  VAL A HG13 1  
ATOM 355   H HG21 . VAL A 1 23  ? 145.890 -0.163  -115.927 1.00 0.00 ? 23  VAL A HG21 1  
ATOM 356   H HG22 . VAL A 1 23  ? 147.332 -0.332  -114.926 1.00 0.00 ? 23  VAL A HG22 1  
ATOM 357   H HG23 . VAL A 1 23  ? 147.010 -1.498  -116.207 1.00 0.00 ? 23  VAL A HG23 1  
ATOM 358   N N    . GLY A 1 24  ? 150.403 0.960   -117.432 1.00 0.00 ? 24  GLY A N    1  
ATOM 359   C CA   . GLY A 1 24  ? 151.551 1.832   -117.799 1.00 0.00 ? 24  GLY A CA   1  
ATOM 360   C C    . GLY A 1 24  ? 151.072 2.878   -118.801 1.00 0.00 ? 24  GLY A C    1  
ATOM 361   O O    . GLY A 1 24  ? 150.451 3.855   -118.429 1.00 0.00 ? 24  GLY A O    1  
ATOM 362   H H    . GLY A 1 24  ? 150.131 0.899   -116.492 1.00 0.00 ? 24  GLY A H    1  
ATOM 363   H HA2  . GLY A 1 24  ? 151.934 2.319   -116.915 1.00 0.00 ? 24  GLY A HA2  1  
ATOM 364   H HA3  . GLY A 1 24  ? 152.319 1.235   -118.246 1.00 0.00 ? 24  GLY A HA3  1  
ATOM 365   N N    . PRO A 1 25  ? 151.292 2.658   -120.070 1.00 0.00 ? 25  PRO A N    1  
ATOM 366   C CA   . PRO A 1 25  ? 150.790 3.609   -121.085 1.00 0.00 ? 25  PRO A CA   1  
ATOM 367   C C    . PRO A 1 25  ? 149.271 3.709   -120.998 1.00 0.00 ? 25  PRO A C    1  
ATOM 368   O O    . PRO A 1 25  ? 148.706 4.776   -120.860 1.00 0.00 ? 25  PRO A O    1  
ATOM 369   C CB   . PRO A 1 25  ? 151.226 2.962   -122.402 1.00 0.00 ? 25  PRO A CB   1  
ATOM 370   C CG   . PRO A 1 25  ? 151.953 1.646   -122.091 1.00 0.00 ? 25  PRO A CG   1  
ATOM 371   C CD   . PRO A 1 25  ? 152.059 1.486   -120.571 1.00 0.00 ? 25  PRO A CD   1  
ATOM 372   H HA   . PRO A 1 25  ? 151.252 4.576   -120.972 1.00 0.00 ? 25  PRO A HA   1  
ATOM 373   H HB2  . PRO A 1 25  ? 150.357 2.763   -123.012 1.00 0.00 ? 25  PRO A HB2  1  
ATOM 374   H HB3  . PRO A 1 25  ? 151.895 3.626   -122.928 1.00 0.00 ? 25  PRO A HB3  1  
ATOM 375   H HG2  . PRO A 1 25  ? 151.396 0.818   -122.507 1.00 0.00 ? 25  PRO A HG2  1  
ATOM 376   H HG3  . PRO A 1 25  ? 152.944 1.669   -122.520 1.00 0.00 ? 25  PRO A HG3  1  
ATOM 377   H HD2  . PRO A 1 25  ? 151.613 0.556   -120.254 1.00 0.00 ? 25  PRO A HD2  1  
ATOM 378   H HD3  . PRO A 1 25  ? 153.087 1.548   -120.251 1.00 0.00 ? 25  PRO A HD3  1  
ATOM 379   N N    . ALA A 1 26  ? 148.611 2.590   -121.103 1.00 0.00 ? 26  ALA A N    1  
ATOM 380   C CA   . ALA A 1 26  ? 147.124 2.591   -121.055 1.00 0.00 ? 26  ALA A CA   1  
ATOM 381   C C    . ALA A 1 26  ? 146.633 3.498   -119.924 1.00 0.00 ? 26  ALA A C    1  
ATOM 382   O O    . ALA A 1 26  ? 145.463 3.819   -119.850 1.00 0.00 ? 26  ALA A O    1  
ATOM 383   C CB   . ALA A 1 26  ? 146.622 1.166   -120.822 1.00 0.00 ? 26  ALA A CB   1  
ATOM 384   H H    . ALA A 1 26  ? 149.102 1.751   -121.259 1.00 0.00 ? 26  ALA A H    1  
ATOM 385   H HA   . ALA A 1 26  ? 146.738 2.954   -121.995 1.00 0.00 ? 26  ALA A HA   1  
ATOM 386   H HB1  . ALA A 1 26  ? 146.542 0.653   -121.769 1.00 0.00 ? 26  ALA A HB1  1  
ATOM 387   H HB2  . ALA A 1 26  ? 145.652 1.199   -120.348 1.00 0.00 ? 26  ALA A HB2  1  
ATOM 388   H HB3  . ALA A 1 26  ? 147.316 0.639   -120.185 1.00 0.00 ? 26  ALA A HB3  1  
ATOM 389   N N    . LEU A 1 27  ? 147.503 3.926   -119.042 1.00 0.00 ? 27  LEU A N    1  
ATOM 390   C CA   . LEU A 1 27  ? 147.035 4.815   -117.943 1.00 0.00 ? 27  LEU A CA   1  
ATOM 391   C C    . LEU A 1 27  ? 147.670 6.190   -118.136 1.00 0.00 ? 27  LEU A C    1  
ATOM 392   O O    . LEU A 1 27  ? 147.036 7.214   -117.973 1.00 0.00 ? 27  LEU A O    1  
ATOM 393   C CB   . LEU A 1 27  ? 147.471 4.237   -116.596 1.00 0.00 ? 27  LEU A CB   1  
ATOM 394   C CG   . LEU A 1 27  ? 146.357 4.316   -115.547 1.00 0.00 ? 27  LEU A CG   1  
ATOM 395   C CD1  . LEU A 1 27  ? 147.000 4.551   -114.182 1.00 0.00 ? 27  LEU A CD1  1  
ATOM 396   C CD2  . LEU A 1 27  ? 145.395 5.469   -115.847 1.00 0.00 ? 27  LEU A CD2  1  
ATOM 397   H H    . LEU A 1 27  ? 148.448 3.669   -119.111 1.00 0.00 ? 27  LEU A H    1  
ATOM 398   H HA   . LEU A 1 27  ? 145.963 4.883   -118.025 1.00 0.00 ? 27  LEU A HA   1  
ATOM 399   H HB2  . LEU A 1 27  ? 147.757 3.206   -116.730 1.00 0.00 ? 27  LEU A HB2  1  
ATOM 400   H HB3  . LEU A 1 27  ? 148.328 4.793   -116.243 1.00 0.00 ? 27  LEU A HB3  1  
ATOM 401   H HG   . LEU A 1 27  ? 145.813 3.382   -115.531 1.00 0.00 ? 27  LEU A HG   1  
ATOM 402   H HD11 . LEU A 1 27  ? 146.549 3.898   -113.453 1.00 0.00 ? 27  LEU A HD11 1  
ATOM 403   H HD12 . LEU A 1 27  ? 146.856 5.580   -113.888 1.00 0.00 ? 27  LEU A HD12 1  
ATOM 404   H HD13 . LEU A 1 27  ? 148.057 4.343   -114.248 1.00 0.00 ? 27  LEU A HD13 1  
ATOM 405   H HD21 . LEU A 1 27  ? 144.584 5.110   -116.463 1.00 0.00 ? 27  LEU A HD21 1  
ATOM 406   H HD22 . LEU A 1 27  ? 145.922 6.256   -116.362 1.00 0.00 ? 27  LEU A HD22 1  
ATOM 407   H HD23 . LEU A 1 27  ? 144.997 5.852   -114.918 1.00 0.00 ? 27  LEU A HD23 1  
ATOM 408   N N    . GLY A 1 28  ? 148.925 6.213   -118.490 1.00 0.00 ? 28  GLY A N    1  
ATOM 409   C CA   . GLY A 1 28  ? 149.616 7.510   -118.703 1.00 0.00 ? 28  GLY A CA   1  
ATOM 410   C C    . GLY A 1 28  ? 148.789 8.373   -119.652 1.00 0.00 ? 28  GLY A C    1  
ATOM 411   O O    . GLY A 1 28  ? 148.936 8.310   -120.856 1.00 0.00 ? 28  GLY A O    1  
ATOM 412   H H    . GLY A 1 28  ? 149.412 5.372   -118.620 1.00 0.00 ? 28  GLY A H    1  
ATOM 413   H HA2  . GLY A 1 28  ? 149.728 8.018   -117.755 1.00 0.00 ? 28  GLY A HA2  1  
ATOM 414   H HA3  . GLY A 1 28  ? 150.589 7.335   -119.135 1.00 0.00 ? 28  GLY A HA3  1  
ATOM 415   N N    . GLN A 1 29  ? 147.933 9.193   -119.115 1.00 0.00 ? 29  GLN A N    1  
ATOM 416   C CA   . GLN A 1 29  ? 147.097 10.087  -119.957 1.00 0.00 ? 29  GLN A CA   1  
ATOM 417   C C    . GLN A 1 29  ? 146.653 11.230  -119.050 1.00 0.00 ? 29  GLN A C    1  
ATOM 418   O O    . GLN A 1 29  ? 146.407 12.342  -119.474 1.00 0.00 ? 29  GLN A O    1  
ATOM 419   C CB   . GLN A 1 29  ? 145.874 9.325   -120.473 1.00 0.00 ? 29  GLN A CB   1  
ATOM 420   C CG   . GLN A 1 29  ? 146.258 8.529   -121.722 1.00 0.00 ? 29  GLN A CG   1  
ATOM 421   C CD   . GLN A 1 29  ? 144.990 8.078   -122.451 1.00 0.00 ? 29  GLN A CD   1  
ATOM 422   O OE1  . GLN A 1 29  ? 144.113 7.483   -121.856 1.00 0.00 ? 29  GLN A OE1  1  
ATOM 423   N NE2  . GLN A 1 29  ? 144.856 8.338   -123.722 1.00 0.00 ? 29  GLN A NE2  1  
ATOM 424   H H    . GLN A 1 29  ? 147.836 9.251   -118.141 1.00 0.00 ? 29  GLN A H    1  
ATOM 425   H HA   . GLN A 1 29  ? 147.685 10.457  -120.785 1.00 0.00 ? 29  GLN A HA   1  
ATOM 426   H HB2  . GLN A 1 29  ? 145.523 8.648   -119.708 1.00 0.00 ? 29  GLN A HB2  1  
ATOM 427   H HB3  . GLN A 1 29  ? 145.091 10.025  -120.721 1.00 0.00 ? 29  GLN A HB3  1  
ATOM 428   H HG2  . GLN A 1 29  ? 146.848 9.153   -122.378 1.00 0.00 ? 29  GLN A HG2  1  
ATOM 429   H HG3  . GLN A 1 29  ? 146.833 7.662   -121.435 1.00 0.00 ? 29  GLN A HG3  1  
ATOM 430   H HE21 . GLN A 1 29  ? 145.563 8.818   -124.202 1.00 0.00 ? 29  GLN A HE21 1  
ATOM 431   H HE22 . GLN A 1 29  ? 144.047 8.053   -124.198 1.00 0.00 ? 29  GLN A HE22 1  
ATOM 432   N N    . HIS A 1 30  ? 146.586 10.933  -117.780 1.00 0.00 ? 30  HIS A N    1  
ATOM 433   C CA   . HIS A 1 30  ? 146.202 11.940  -116.757 1.00 0.00 ? 30  HIS A CA   1  
ATOM 434   C C    . HIS A 1 30  ? 147.410 12.833  -116.479 1.00 0.00 ? 30  HIS A C    1  
ATOM 435   O O    . HIS A 1 30  ? 147.907 12.896  -115.372 1.00 0.00 ? 30  HIS A O    1  
ATOM 436   C CB   . HIS A 1 30  ? 145.821 11.200  -115.471 1.00 0.00 ? 30  HIS A CB   1  
ATOM 437   C CG   . HIS A 1 30  ? 147.067 10.740  -114.765 1.00 0.00 ? 30  HIS A CG   1  
ATOM 438   N ND1  . HIS A 1 30  ? 147.493 11.307  -113.574 1.00 0.00 ? 30  HIS A ND1  1  
ATOM 439   C CD2  . HIS A 1 30  ? 147.989 9.769   -115.069 1.00 0.00 ? 30  HIS A CD2  1  
ATOM 440   C CE1  . HIS A 1 30  ? 148.626 10.679  -113.209 1.00 0.00 ? 30  HIS A CE1  1  
ATOM 441   N NE2  . HIS A 1 30  ? 148.973 9.733   -114.086 1.00 0.00 ? 30  HIS A NE2  1  
ATOM 442   H H    . HIS A 1 30  ? 146.818 10.025  -117.492 1.00 0.00 ? 30  HIS A H    1  
ATOM 443   H HA   . HIS A 1 30  ? 145.358 12.532  -117.082 1.00 0.00 ? 30  HIS A HA   1  
ATOM 444   H HB2  . HIS A 1 30  ? 145.264 11.862  -114.825 1.00 0.00 ? 30  HIS A HB2  1  
ATOM 445   H HB3  . HIS A 1 30  ? 145.212 10.343  -115.717 1.00 0.00 ? 30  HIS A HB3  1  
ATOM 446   H HD1  . HIS A 1 30  ? 147.051 12.033  -113.087 1.00 0.00 ? 30  HIS A HD1  1  
ATOM 447   H HD2  . HIS A 1 30  ? 147.956 9.132   -115.940 1.00 0.00 ? 30  HIS A HD2  1  
ATOM 448   H HE1  . HIS A 1 30  ? 149.187 10.912  -112.316 1.00 0.00 ? 30  HIS A HE1  1  
ATOM 449   N N    . GLY A 1 31  ? 147.899 13.515  -117.475 1.00 0.00 ? 31  GLY A N    1  
ATOM 450   C CA   . GLY A 1 31  ? 149.086 14.386  -117.260 1.00 0.00 ? 31  GLY A CA   1  
ATOM 451   C C    . GLY A 1 31  ? 150.358 13.545  -117.395 1.00 0.00 ? 31  GLY A C    1  
ATOM 452   O O    . GLY A 1 31  ? 151.451 14.069  -117.482 1.00 0.00 ? 31  GLY A O    1  
ATOM 453   H H    . GLY A 1 31  ? 147.490 13.454  -118.363 1.00 0.00 ? 31  GLY A H    1  
ATOM 454   H HA2  . GLY A 1 31  ? 149.092 15.175  -117.998 1.00 0.00 ? 31  GLY A HA2  1  
ATOM 455   H HA3  . GLY A 1 31  ? 149.045 14.815  -116.270 1.00 0.00 ? 31  GLY A HA3  1  
ATOM 456   N N    . ALA A 1 32  ? 150.223 12.244  -117.464 1.00 0.00 ? 32  ALA A N    1  
ATOM 457   C CA   . ALA A 1 32  ? 151.419 11.371  -117.654 1.00 0.00 ? 32  ALA A CA   1  
ATOM 458   C C    . ALA A 1 32  ? 152.246 11.237  -116.372 1.00 0.00 ? 32  ALA A C    1  
ATOM 459   O O    . ALA A 1 32  ? 153.225 11.931  -116.185 1.00 0.00 ? 32  ALA A O    1  
ATOM 460   C CB   . ALA A 1 32  ? 152.299 11.968  -118.753 1.00 0.00 ? 32  ALA A CB   1  
ATOM 461   H H    . ALA A 1 32  ? 149.336 11.831  -117.428 1.00 0.00 ? 32  ALA A H    1  
ATOM 462   H HA   . ALA A 1 32  ? 151.093 10.391  -117.968 1.00 0.00 ? 32  ALA A HA   1  
ATOM 463   H HB1  . ALA A 1 32  ? 151.687 12.549  -119.428 1.00 0.00 ? 32  ALA A HB1  1  
ATOM 464   H HB2  . ALA A 1 32  ? 152.782 11.172  -119.299 1.00 0.00 ? 32  ALA A HB2  1  
ATOM 465   H HB3  . ALA A 1 32  ? 153.048 12.605  -118.307 1.00 0.00 ? 32  ALA A HB3  1  
ATOM 466   N N    . ASN A 1 33  ? 151.891 10.325  -115.503 1.00 0.00 ? 33  ASN A N    1  
ATOM 467   C CA   . ASN A 1 33  ? 152.696 10.130  -114.263 1.00 0.00 ? 33  ASN A CA   1  
ATOM 468   C C    . ASN A 1 33  ? 152.438 8.717   -113.723 1.00 0.00 ? 33  ASN A C    1  
ATOM 469   O O    . ASN A 1 33  ? 151.317 8.329   -113.461 1.00 0.00 ? 33  ASN A O    1  
ATOM 470   C CB   . ASN A 1 33  ? 152.324 11.180  -113.213 1.00 0.00 ? 33  ASN A CB   1  
ATOM 471   C CG   . ASN A 1 33  ? 152.771 12.562  -113.693 1.00 0.00 ? 33  ASN A CG   1  
ATOM 472   O OD1  . ASN A 1 33  ? 151.952 13.406  -113.998 1.00 0.00 ? 33  ASN A OD1  1  
ATOM 473   N ND2  . ASN A 1 33  ? 154.045 12.830  -113.773 1.00 0.00 ? 33  ASN A ND2  1  
ATOM 474   H H    . ASN A 1 33  ? 151.114 9.750   -115.666 1.00 0.00 ? 33  ASN A H    1  
ATOM 475   H HA   . ASN A 1 33  ? 153.741 10.208  -114.520 1.00 0.00 ? 33  ASN A HA   1  
ATOM 476   H HB2  . ASN A 1 33  ? 151.253 11.177  -113.066 1.00 0.00 ? 33  ASN A HB2  1  
ATOM 477   H HB3  . ASN A 1 33  ? 152.817 10.947  -112.281 1.00 0.00 ? 33  ASN A HB3  1  
ATOM 478   H HD21 . ASN A 1 33  ? 154.706 12.150  -113.527 1.00 0.00 ? 33  ASN A HD21 1  
ATOM 479   H HD22 . ASN A 1 33  ? 154.342 13.713  -114.078 1.00 0.00 ? 33  ASN A HD22 1  
ATOM 480   N N    . ILE A 1 34  ? 153.483 7.943   -113.578 1.00 0.00 ? 34  ILE A N    1  
ATOM 481   C CA   . ILE A 1 34  ? 153.339 6.541   -113.080 1.00 0.00 ? 34  ILE A CA   1  
ATOM 482   C C    . ILE A 1 34  ? 153.628 6.494   -111.573 1.00 0.00 ? 34  ILE A C    1  
ATOM 483   O O    . ILE A 1 34  ? 152.787 6.125   -110.781 1.00 0.00 ? 34  ILE A O    1  
ATOM 484   C CB   . ILE A 1 34  ? 154.349 5.656   -113.821 1.00 0.00 ? 34  ILE A CB   1  
ATOM 485   C CG1  . ILE A 1 34  ? 153.920 5.501   -115.285 1.00 0.00 ? 34  ILE A CG1  1  
ATOM 486   C CG2  . ILE A 1 34  ? 154.433 4.278   -113.161 1.00 0.00 ? 34  ILE A CG2  1  
ATOM 487   C CD1  . ILE A 1 34  ? 152.550 4.823   -115.360 1.00 0.00 ? 34  ILE A CD1  1  
ATOM 488   H H    . ILE A 1 34  ? 154.370 8.288   -113.810 1.00 0.00 ? 34  ILE A H    1  
ATOM 489   H HA   . ILE A 1 34  ? 152.330 6.185   -113.271 1.00 0.00 ? 34  ILE A HA   1  
ATOM 490   H HB   . ILE A 1 34  ? 155.322 6.125   -113.783 1.00 0.00 ? 34  ILE A HB   1  
ATOM 491   H HG12 . ILE A 1 34  ? 153.864 6.476   -115.746 1.00 0.00 ? 34  ILE A HG12 1  
ATOM 492   H HG13 . ILE A 1 34  ? 154.647 4.898   -115.809 1.00 0.00 ? 34  ILE A HG13 1  
ATOM 493   H HG21 . ILE A 1 34  ? 153.576 4.129   -112.521 1.00 0.00 ? 34  ILE A HG21 1  
ATOM 494   H HG22 . ILE A 1 34  ? 155.337 4.216   -112.572 1.00 0.00 ? 34  ILE A HG22 1  
ATOM 495   H HG23 . ILE A 1 34  ? 154.450 3.513   -113.925 1.00 0.00 ? 34  ILE A HG23 1  
ATOM 496   H HD11 . ILE A 1 34  ? 151.774 5.567   -115.270 1.00 0.00 ? 34  ILE A HD11 1  
ATOM 497   H HD12 . ILE A 1 34  ? 152.457 4.106   -114.558 1.00 0.00 ? 34  ILE A HD12 1  
ATOM 498   H HD13 . ILE A 1 34  ? 152.453 4.316   -116.308 1.00 0.00 ? 34  ILE A HD13 1  
ATOM 499   N N    . MET A 1 35  ? 154.831 6.802   -111.172 1.00 0.00 ? 35  MET A N    1  
ATOM 500   C CA   . MET A 1 35  ? 155.169 6.696   -109.723 1.00 0.00 ? 35  MET A CA   1  
ATOM 501   C C    . MET A 1 35  ? 153.997 7.212   -108.885 1.00 0.00 ? 35  MET A C    1  
ATOM 502   O O    . MET A 1 35  ? 153.472 6.500   -108.054 1.00 0.00 ? 35  MET A O    1  
ATOM 503   C CB   . MET A 1 35  ? 156.416 7.531   -109.427 1.00 0.00 ? 35  MET A CB   1  
ATOM 504   C CG   . MET A 1 35  ? 157.469 6.655   -108.745 1.00 0.00 ? 35  MET A CG   1  
ATOM 505   S SD   . MET A 1 35  ? 156.969 6.332   -107.035 1.00 0.00 ? 35  MET A SD   1  
ATOM 506   C CE   . MET A 1 35  ? 156.894 4.528   -107.158 1.00 0.00 ? 35  MET A CE   1  
ATOM 507   H H    . MET A 1 35  ? 155.527 7.009   -111.830 1.00 0.00 ? 35  MET A H    1  
ATOM 508   H HA   . MET A 1 35  ? 155.362 5.661   -109.484 1.00 0.00 ? 35  MET A HA   1  
ATOM 509   H HB2  . MET A 1 35  ? 156.816 7.920   -110.353 1.00 0.00 ? 35  MET A HB2  1  
ATOM 510   H HB3  . MET A 1 35  ? 156.155 8.351   -108.775 1.00 0.00 ? 35  MET A HB3  1  
ATOM 511   H HG2  . MET A 1 35  ? 157.558 5.719   -109.277 1.00 0.00 ? 35  MET A HG2  1  
ATOM 512   H HG3  . MET A 1 35  ? 158.421 7.165   -108.751 1.00 0.00 ? 35  MET A HG3  1  
ATOM 513   H HE1  . MET A 1 35  ? 157.826 4.157   -107.563 1.00 0.00 ? 35  MET A HE1  1  
ATOM 514   H HE2  . MET A 1 35  ? 156.083 4.244   -107.808 1.00 0.00 ? 35  MET A HE2  1  
ATOM 515   H HE3  . MET A 1 35  ? 156.730 4.108   -106.175 1.00 0.00 ? 35  MET A HE3  1  
ATOM 516   N N    . GLU A 1 36  ? 153.550 8.417   -109.101 1.00 0.00 ? 36  GLU A N    1  
ATOM 517   C CA   . GLU A 1 36  ? 152.384 8.898   -108.308 1.00 0.00 ? 36  GLU A CA   1  
ATOM 518   C C    . GLU A 1 36  ? 151.332 7.785   -108.316 1.00 0.00 ? 36  GLU A C    1  
ATOM 519   O O    . GLU A 1 36  ? 150.773 7.428   -107.298 1.00 0.00 ? 36  GLU A O    1  
ATOM 520   C CB   . GLU A 1 36  ? 151.806 10.158  -108.957 1.00 0.00 ? 36  GLU A CB   1  
ATOM 521   C CG   . GLU A 1 36  ? 152.403 11.398  -108.288 1.00 0.00 ? 36  GLU A CG   1  
ATOM 522   C CD   . GLU A 1 36  ? 152.378 12.571  -109.270 1.00 0.00 ? 36  GLU A CD   1  
ATOM 523   O OE1  . GLU A 1 36  ? 151.582 12.527  -110.194 1.00 0.00 ? 36  GLU A OE1  1  
ATOM 524   O OE2  . GLU A 1 36  ? 153.155 13.492  -109.082 1.00 0.00 ? 36  GLU A OE2  1  
ATOM 525   H H    . GLU A 1 36  ? 153.956 8.985   -109.788 1.00 0.00 ? 36  GLU A H    1  
ATOM 526   H HA   . GLU A 1 36  ? 152.688 9.112   -107.293 1.00 0.00 ? 36  GLU A HA   1  
ATOM 527   H HB2  . GLU A 1 36  ? 152.048 10.164  -110.011 1.00 0.00 ? 36  GLU A HB2  1  
ATOM 528   H HB3  . GLU A 1 36  ? 150.733 10.166  -108.834 1.00 0.00 ? 36  GLU A HB3  1  
ATOM 529   H HG2  . GLU A 1 36  ? 151.823 11.648  -107.412 1.00 0.00 ? 36  GLU A HG2  1  
ATOM 530   H HG3  . GLU A 1 36  ? 153.423 11.195  -107.999 1.00 0.00 ? 36  GLU A HG3  1  
ATOM 531   N N    . PHE A 1 37  ? 151.086 7.223   -109.467 1.00 0.00 ? 37  PHE A N    1  
ATOM 532   C CA   . PHE A 1 37  ? 150.099 6.110   -109.585 1.00 0.00 ? 37  PHE A CA   1  
ATOM 533   C C    . PHE A 1 37  ? 150.460 4.996   -108.600 1.00 0.00 ? 37  PHE A C    1  
ATOM 534   O O    . PHE A 1 37  ? 149.767 4.734   -107.632 1.00 0.00 ? 37  PHE A O    1  
ATOM 535   C CB   . PHE A 1 37  ? 150.181 5.548   -111.011 1.00 0.00 ? 37  PHE A CB   1  
ATOM 536   C CG   . PHE A 1 37  ? 149.262 4.357   -111.183 1.00 0.00 ? 37  PHE A CG   1  
ATOM 537   C CD1  . PHE A 1 37  ? 148.427 3.934   -110.142 1.00 0.00 ? 37  PHE A CD1  1  
ATOM 538   C CD2  . PHE A 1 37  ? 149.241 3.681   -112.407 1.00 0.00 ? 37  PHE A CD2  1  
ATOM 539   C CE1  . PHE A 1 37  ? 147.573 2.841   -110.326 1.00 0.00 ? 37  PHE A CE1  1  
ATOM 540   C CE2  . PHE A 1 37  ? 148.390 2.586   -112.591 1.00 0.00 ? 37  PHE A CE2  1  
ATOM 541   C CZ   . PHE A 1 37  ? 147.554 2.168   -111.551 1.00 0.00 ? 37  PHE A CZ   1  
ATOM 542   H H    . PHE A 1 37  ? 151.566 7.530   -110.264 1.00 0.00 ? 37  PHE A H    1  
ATOM 543   H HA   . PHE A 1 37  ? 149.097 6.471   -109.407 1.00 0.00 ? 37  PHE A HA   1  
ATOM 544   H HB2  . PHE A 1 37  ? 149.898 6.317   -111.713 1.00 0.00 ? 37  PHE A HB2  1  
ATOM 545   H HB3  . PHE A 1 37  ? 151.194 5.240   -111.215 1.00 0.00 ? 37  PHE A HB3  1  
ATOM 546   H HD1  . PHE A 1 37  ? 148.442 4.443   -109.199 1.00 0.00 ? 37  PHE A HD1  1  
ATOM 547   H HD2  . PHE A 1 37  ? 149.887 4.002   -113.211 1.00 0.00 ? 37  PHE A HD2  1  
ATOM 548   H HE1  . PHE A 1 37  ? 146.931 2.516   -109.522 1.00 0.00 ? 37  PHE A HE1  1  
ATOM 549   H HE2  . PHE A 1 37  ? 148.375 2.066   -113.537 1.00 0.00 ? 37  PHE A HE2  1  
ATOM 550   H HZ   . PHE A 1 37  ? 146.893 1.329   -111.694 1.00 0.00 ? 37  PHE A HZ   1  
ATOM 551   N N    . VAL A 1 38  ? 151.547 4.337   -108.858 1.00 0.00 ? 38  VAL A N    1  
ATOM 552   C CA   . VAL A 1 38  ? 151.977 3.226   -107.974 1.00 0.00 ? 38  VAL A CA   1  
ATOM 553   C C    . VAL A 1 38  ? 152.371 3.771   -106.604 1.00 0.00 ? 38  VAL A C    1  
ATOM 554   O O    . VAL A 1 38  ? 152.059 3.186   -105.586 1.00 0.00 ? 38  VAL A O    1  
ATOM 555   C CB   . VAL A 1 38  ? 153.143 2.501   -108.631 1.00 0.00 ? 38  VAL A CB   1  
ATOM 556   C CG1  . VAL A 1 38  ? 153.501 1.252   -107.822 1.00 0.00 ? 38  VAL A CG1  1  
ATOM 557   C CG2  . VAL A 1 38  ? 152.707 2.096   -110.039 1.00 0.00 ? 38  VAL A CG2  1  
ATOM 558   H H    . VAL A 1 38  ? 152.080 4.583   -109.644 1.00 0.00 ? 38  VAL A H    1  
ATOM 559   H HA   . VAL A 1 38  ? 151.156 2.535   -107.853 1.00 0.00 ? 38  VAL A HA   1  
ATOM 560   H HB   . VAL A 1 38  ? 153.997 3.158   -108.688 1.00 0.00 ? 38  VAL A HB   1  
ATOM 561   H HG11 . VAL A 1 38  ? 152.682 1.002   -107.164 1.00 0.00 ? 38  VAL A HG11 1  
ATOM 562   H HG12 . VAL A 1 38  ? 154.388 1.444   -107.237 1.00 0.00 ? 38  VAL A HG12 1  
ATOM 563   H HG13 . VAL A 1 38  ? 153.686 0.428   -108.496 1.00 0.00 ? 38  VAL A HG13 1  
ATOM 564   H HG21 . VAL A 1 38  ? 153.450 1.451   -110.477 1.00 0.00 ? 38  VAL A HG21 1  
ATOM 565   H HG22 . VAL A 1 38  ? 152.591 2.983   -110.646 1.00 0.00 ? 38  VAL A HG22 1  
ATOM 566   H HG23 . VAL A 1 38  ? 151.761 1.575   -109.984 1.00 0.00 ? 38  VAL A HG23 1  
ATOM 567   N N    . LYS A 1 39  ? 153.008 4.909   -106.554 1.00 0.00 ? 39  LYS A N    1  
ATOM 568   C CA   . LYS A 1 39  ? 153.349 5.483   -105.227 1.00 0.00 ? 39  LYS A CA   1  
ATOM 569   C C    . LYS A 1 39  ? 152.101 5.356   -104.356 1.00 0.00 ? 39  LYS A C    1  
ATOM 570   O O    . LYS A 1 39  ? 152.122 4.736   -103.313 1.00 0.00 ? 39  LYS A O    1  
ATOM 571   C CB   . LYS A 1 39  ? 153.749 6.954   -105.369 1.00 0.00 ? 39  LYS A CB   1  
ATOM 572   C CG   . LYS A 1 39  ? 154.164 7.505   -104.004 1.00 0.00 ? 39  LYS A CG   1  
ATOM 573   C CD   . LYS A 1 39  ? 155.541 6.954   -103.627 1.00 0.00 ? 39  LYS A CD   1  
ATOM 574   C CE   . LYS A 1 39  ? 156.457 8.108   -103.215 1.00 0.00 ? 39  LYS A CE   1  
ATOM 575   N NZ   . LYS A 1 39  ? 157.021 8.754   -104.434 1.00 0.00 ? 39  LYS A NZ   1  
ATOM 576   H H    . LYS A 1 39  ? 153.225 5.395   -107.377 1.00 0.00 ? 39  LYS A H    1  
ATOM 577   H HA   . LYS A 1 39  ? 154.143 4.919   -104.759 1.00 0.00 ? 39  LYS A HA   1  
ATOM 578   H HB2  . LYS A 1 39  ? 154.576 7.036   -106.059 1.00 0.00 ? 39  LYS A HB2  1  
ATOM 579   H HB3  . LYS A 1 39  ? 152.910 7.520   -105.744 1.00 0.00 ? 39  LYS A HB3  1  
ATOM 580   H HG2  . LYS A 1 39  ? 154.207 8.584   -104.050 1.00 0.00 ? 39  LYS A HG2  1  
ATOM 581   H HG3  . LYS A 1 39  ? 153.442 7.204   -103.260 1.00 0.00 ? 39  LYS A HG3  1  
ATOM 582   H HD2  . LYS A 1 39  ? 155.438 6.263   -102.803 1.00 0.00 ? 39  LYS A HD2  1  
ATOM 583   H HD3  . LYS A 1 39  ? 155.970 6.443   -104.476 1.00 0.00 ? 39  LYS A HD3  1  
ATOM 584   H HE2  . LYS A 1 39  ? 155.889 8.834   -102.653 1.00 0.00 ? 39  LYS A HE2  1  
ATOM 585   H HE3  . LYS A 1 39  ? 157.261 7.728   -102.604 1.00 0.00 ? 39  LYS A HE3  1  
ATOM 586   H HZ1  . LYS A 1 39  ? 156.724 9.750   -104.468 1.00 0.00 ? 39  LYS A HZ1  1  
ATOM 587   H HZ2  . LYS A 1 39  ? 156.674 8.258   -105.281 1.00 0.00 ? 39  LYS A HZ2  1  
ATOM 588   H HZ3  . LYS A 1 39  ? 158.059 8.705   -104.404 1.00 0.00 ? 39  LYS A HZ3  1  
ATOM 589   N N    . ALA A 1 40  ? 151.010 5.940   -104.776 1.00 0.00 ? 40  ALA A N    1  
ATOM 590   C CA   . ALA A 1 40  ? 149.768 5.848   -103.964 1.00 0.00 ? 40  ALA A CA   1  
ATOM 591   C C    . ALA A 1 40  ? 149.357 4.382   -103.844 1.00 0.00 ? 40  ALA A C    1  
ATOM 592   O O    . ALA A 1 40  ? 148.893 3.943   -102.803 1.00 0.00 ? 40  ALA A O    1  
ATOM 593   C CB   . ALA A 1 40  ? 148.647 6.657   -104.621 1.00 0.00 ? 40  ALA A CB   1  
ATOM 594   H H    . ALA A 1 40  ? 151.012 6.438   -105.621 1.00 0.00 ? 40  ALA A H    1  
ATOM 595   H HA   . ALA A 1 40  ? 149.970 6.232   -102.975 1.00 0.00 ? 40  ALA A HA   1  
ATOM 596   H HB1  . ALA A 1 40  ? 147.807 6.722   -103.946 1.00 0.00 ? 40  ALA A HB1  1  
ATOM 597   H HB2  . ALA A 1 40  ? 148.339 6.169   -105.534 1.00 0.00 ? 40  ALA A HB2  1  
ATOM 598   H HB3  . ALA A 1 40  ? 149.006 7.650   -104.848 1.00 0.00 ? 40  ALA A HB3  1  
ATOM 599   N N    . PHE A 1 41  ? 149.589 3.584   -104.852 1.00 0.00 ? 41  PHE A N    1  
ATOM 600   C CA   . PHE A 1 41  ? 149.264 2.144   -104.720 1.00 0.00 ? 41  PHE A CA   1  
ATOM 601   C C    . PHE A 1 41  ? 150.282 1.541   -103.765 1.00 0.00 ? 41  PHE A C    1  
ATOM 602   O O    . PHE A 1 41  ? 149.973 1.250   -102.626 1.00 0.00 ? 41  PHE A O    1  
ATOM 603   C CB   . PHE A 1 41  ? 149.389 1.464   -106.085 1.00 0.00 ? 41  PHE A CB   1  
ATOM 604   C CG   . PHE A 1 41  ? 148.345 0.379   -106.191 1.00 0.00 ? 41  PHE A CG   1  
ATOM 605   C CD1  . PHE A 1 41  ? 146.993 0.720   -106.314 1.00 0.00 ? 41  PHE A CD1  1  
ATOM 606   C CD2  . PHE A 1 41  ? 148.727 -0.967  -106.158 1.00 0.00 ? 41  PHE A CD2  1  
ATOM 607   C CE1  . PHE A 1 41  ? 146.023 -0.284  -106.404 1.00 0.00 ? 41  PHE A CE1  1  
ATOM 608   C CE2  . PHE A 1 41  ? 147.757 -1.972  -106.249 1.00 0.00 ? 41  PHE A CE2  1  
ATOM 609   C CZ   . PHE A 1 41  ? 146.405 -1.631  -106.372 1.00 0.00 ? 41  PHE A CZ   1  
ATOM 610   H H    . PHE A 1 41  ? 150.041 3.883   -105.672 1.00 0.00 ? 41  PHE A H    1  
ATOM 611   H HA   . PHE A 1 41  ? 148.264 1.993   -104.338 1.00 0.00 ? 41  PHE A HA   1  
ATOM 612   H HB2  . PHE A 1 41  ? 149.233 2.194   -106.867 1.00 0.00 ? 41  PHE A HB2  1  
ATOM 613   H HB3  . PHE A 1 41  ? 150.372 1.030   -106.185 1.00 0.00 ? 41  PHE A HB3  1  
ATOM 614   H HD1  . PHE A 1 41  ? 146.698 1.759   -106.339 1.00 0.00 ? 41  PHE A HD1  1  
ATOM 615   H HD2  . PHE A 1 41  ? 149.771 -1.230  -106.063 1.00 0.00 ? 41  PHE A HD2  1  
ATOM 616   H HE1  . PHE A 1 41  ? 144.980 -0.021  -106.499 1.00 0.00 ? 41  PHE A HE1  1  
ATOM 617   H HE2  . PHE A 1 41  ? 148.052 -3.011  -106.224 1.00 0.00 ? 41  PHE A HE2  1  
ATOM 618   H HZ   . PHE A 1 41  ? 145.656 -2.406  -106.441 1.00 0.00 ? 41  PHE A HZ   1  
ATOM 619   N N    . ASN A 1 42  ? 151.479 1.292   -104.218 1.00 0.00 ? 42  ASN A N    1  
ATOM 620   C CA   . ASN A 1 42  ? 152.482 0.645   -103.340 1.00 0.00 ? 42  ASN A CA   1  
ATOM 621   C C    . ASN A 1 42  ? 152.414 1.219   -101.927 1.00 0.00 ? 42  ASN A C    1  
ATOM 622   O O    . ASN A 1 42  ? 152.636 0.544   -100.943 1.00 0.00 ? 42  ASN A O    1  
ATOM 623   C CB   . ASN A 1 42  ? 153.870 0.961   -103.905 1.00 0.00 ? 42  ASN A CB   1  
ATOM 624   C CG   . ASN A 1 42  ? 154.746 -0.291  -103.837 1.00 0.00 ? 42  ASN A CG   1  
ATOM 625   O OD1  . ASN A 1 42  ? 154.556 -1.135  -102.983 1.00 0.00 ? 42  ASN A OD1  1  
ATOM 626   N ND2  . ASN A 1 42  ? 155.705 -0.449  -104.707 1.00 0.00 ? 42  ASN A ND2  1  
ATOM 627   H H    . ASN A 1 42  ? 151.719 1.434   -105.157 1.00 0.00 ? 42  ASN A H    1  
ATOM 628   H HA   . ASN A 1 42  ? 152.340 -0.424  -103.393 1.00 0.00 ? 42  ASN A HA   1  
ATOM 629   H HB2  . ASN A 1 42  ? 153.775 1.280   -104.933 1.00 0.00 ? 42  ASN A HB2  1  
ATOM 630   H HB3  . ASN A 1 42  ? 154.325 1.748   -103.323 1.00 0.00 ? 42  ASN A HB3  1  
ATOM 631   H HD21 . ASN A 1 42  ? 155.859 0.231   -105.396 1.00 0.00 ? 42  ASN A HD21 1  
ATOM 632   H HD22 . ASN A 1 42  ? 156.272 -1.248  -104.672 1.00 0.00 ? 42  ASN A HD22 1  
ATOM 633   N N    . ALA A 1 43  ? 152.105 2.490   -101.849 1.00 0.00 ? 43  ALA A N    1  
ATOM 634   C CA   . ALA A 1 43  ? 152.009 3.185   -100.537 1.00 0.00 ? 43  ALA A CA   1  
ATOM 635   C C    . ALA A 1 43  ? 150.808 2.658   -99.756  1.00 0.00 ? 43  ALA A C    1  
ATOM 636   O O    . ALA A 1 43  ? 150.833 2.565   -98.542  1.00 0.00 ? 43  ALA A O    1  
ATOM 637   C CB   . ALA A 1 43  ? 151.815 4.682   -100.783 1.00 0.00 ? 43  ALA A CB   1  
ATOM 638   H H    . ALA A 1 43  ? 151.938 2.994   -102.672 1.00 0.00 ? 43  ALA A H    1  
ATOM 639   H HA   . ALA A 1 43  ? 152.926 3.040   -99.985  1.00 0.00 ? 43  ALA A HA   1  
ATOM 640   H HB1  . ALA A 1 43  ? 152.708 5.092   -101.232 1.00 0.00 ? 43  ALA A HB1  1  
ATOM 641   H HB2  . ALA A 1 43  ? 151.623 5.180   -99.844  1.00 0.00 ? 43  ALA A HB2  1  
ATOM 642   H HB3  . ALA A 1 43  ? 150.976 4.832   -101.448 1.00 0.00 ? 43  ALA A HB3  1  
ATOM 643   N N    . ALA A 1 44  ? 149.762 2.276   -100.443 1.00 0.00 ? 44  ALA A N    1  
ATOM 644   C CA   . ALA A 1 44  ? 148.584 1.730   -99.718  1.00 0.00 ? 44  ALA A CA   1  
ATOM 645   C C    . ALA A 1 44  ? 148.746 0.223   -99.592  1.00 0.00 ? 44  ALA A C    1  
ATOM 646   O O    . ALA A 1 44  ? 148.613 -0.346  -98.526  1.00 0.00 ? 44  ALA A O    1  
ATOM 647   C CB   . ALA A 1 44  ? 147.286 2.060   -100.454 1.00 0.00 ? 44  ALA A CB   1  
ATOM 648   H H    . ALA A 1 44  ? 149.778 2.305   -101.428 1.00 0.00 ? 44  ALA A H    1  
ATOM 649   H HA   . ALA A 1 44  ? 148.577 2.126   -98.714  1.00 0.00 ? 44  ALA A HA   1  
ATOM 650   H HB1  . ALA A 1 44  ? 147.430 1.914   -101.515 1.00 0.00 ? 44  ALA A HB1  1  
ATOM 651   H HB2  . ALA A 1 44  ? 147.012 3.085   -100.264 1.00 0.00 ? 44  ALA A HB2  1  
ATOM 652   H HB3  . ALA A 1 44  ? 146.500 1.404   -100.106 1.00 0.00 ? 44  ALA A HB3  1  
ATOM 653   N N    . THR A 1 45  ? 149.063 -0.421  -100.676 1.00 0.00 ? 45  THR A N    1  
ATOM 654   C CA   . THR A 1 45  ? 149.271 -1.886  -100.636 1.00 0.00 ? 45  THR A CA   1  
ATOM 655   C C    . THR A 1 45  ? 150.392 -2.178  -99.643  1.00 0.00 ? 45  THR A C    1  
ATOM 656   O O    . THR A 1 45  ? 150.406 -3.198  -98.983  1.00 0.00 ? 45  THR A O    1  
ATOM 657   C CB   . THR A 1 45  ? 149.654 -2.367  -102.031 1.00 0.00 ? 45  THR A CB   1  
ATOM 658   O OG1  . THR A 1 45  ? 151.061 -2.258  -102.200 1.00 0.00 ? 45  THR A OG1  1  
ATOM 659   C CG2  . THR A 1 45  ? 148.938 -1.497  -103.067 1.00 0.00 ? 45  THR A CG2  1  
ATOM 660   H H    . THR A 1 45  ? 149.185 0.068   -101.517 1.00 0.00 ? 45  THR A H    1  
ATOM 661   H HA   . THR A 1 45  ? 148.363 -2.375  -100.316 1.00 0.00 ? 45  THR A HA   1  
ATOM 662   H HB   . THR A 1 45  ? 149.352 -3.393  -102.154 1.00 0.00 ? 45  THR A HB   1  
ATOM 663   H HG1  . THR A 1 45  ? 151.484 -2.676  -101.446 1.00 0.00 ? 45  THR A HG1  1  
ATOM 664   H HG21 . THR A 1 45  ? 149.627 -0.766  -103.460 1.00 0.00 ? 45  THR A HG21 1  
ATOM 665   H HG22 . THR A 1 45  ? 148.107 -0.990  -102.597 1.00 0.00 ? 45  THR A HG22 1  
ATOM 666   H HG23 . THR A 1 45  ? 148.572 -2.115  -103.870 1.00 0.00 ? 45  THR A HG23 1  
ATOM 667   N N    . ALA A 1 46  ? 151.315 -1.265  -99.508  1.00 0.00 ? 46  ALA A N    1  
ATOM 668   C CA   . ALA A 1 46  ? 152.415 -1.463  -98.529  1.00 0.00 ? 46  ALA A CA   1  
ATOM 669   C C    . ALA A 1 46  ? 151.864 -1.124  -97.147  1.00 0.00 ? 46  ALA A C    1  
ATOM 670   O O    . ALA A 1 46  ? 152.069 -1.843  -96.189  1.00 0.00 ? 46  ALA A O    1  
ATOM 671   C CB   . ALA A 1 46  ? 153.585 -0.535  -98.862  1.00 0.00 ? 46  ALA A CB   1  
ATOM 672   H H    . ALA A 1 46  ? 151.268 -0.439  -100.033 1.00 0.00 ? 46  ALA A H    1  
ATOM 673   H HA   . ALA A 1 46  ? 152.742 -2.492  -98.550  1.00 0.00 ? 46  ALA A HA   1  
ATOM 674   H HB1  . ALA A 1 46  ? 153.246 0.490   -98.852  1.00 0.00 ? 46  ALA A HB1  1  
ATOM 675   H HB2  . ALA A 1 46  ? 153.971 -0.778  -99.841  1.00 0.00 ? 46  ALA A HB2  1  
ATOM 676   H HB3  . ALA A 1 46  ? 154.365 -0.663  -98.126  1.00 0.00 ? 46  ALA A HB3  1  
ATOM 677   N N    . ASN A 1 47  ? 151.143 -0.037  -97.043  1.00 0.00 ? 47  ASN A N    1  
ATOM 678   C CA   . ASN A 1 47  ? 150.554 0.340   -95.731  1.00 0.00 ? 47  ASN A CA   1  
ATOM 679   C C    . ASN A 1 47  ? 149.664 -0.805  -95.241  1.00 0.00 ? 47  ASN A C    1  
ATOM 680   O O    . ASN A 1 47  ? 149.393 -0.936  -94.064  1.00 0.00 ? 47  ASN A O    1  
ATOM 681   C CB   . ASN A 1 47  ? 149.709 1.605   -95.897  1.00 0.00 ? 47  ASN A CB   1  
ATOM 682   C CG   . ASN A 1 47  ? 149.127 2.012   -94.542  1.00 0.00 ? 47  ASN A CG   1  
ATOM 683   O OD1  . ASN A 1 47  ? 149.804 2.616   -93.734  1.00 0.00 ? 47  ASN A OD1  1  
ATOM 684   N ND2  . ASN A 1 47  ? 147.892 1.704   -94.257  1.00 0.00 ? 47  ASN A ND2  1  
ATOM 685   H H    . ASN A 1 47  ? 150.977 0.524   -97.834  1.00 0.00 ? 47  ASN A H    1  
ATOM 686   H HA   . ASN A 1 47  ? 151.342 0.524   -95.015  1.00 0.00 ? 47  ASN A HA   1  
ATOM 687   H HB2  . ASN A 1 47  ? 150.329 2.404   -96.279  1.00 0.00 ? 47  ASN A HB2  1  
ATOM 688   H HB3  . ASN A 1 47  ? 148.903 1.412   -96.589  1.00 0.00 ? 47  ASN A HB3  1  
ATOM 689   H HD21 . ASN A 1 47  ? 147.346 1.216   -94.909  1.00 0.00 ? 47  ASN A HD21 1  
ATOM 690   H HD22 . ASN A 1 47  ? 147.510 1.960   -93.392  1.00 0.00 ? 47  ASN A HD22 1  
ATOM 691   N N    . MET A 1 48  ? 149.211 -1.642  -96.140  1.00 0.00 ? 48  MET A N    1  
ATOM 692   C CA   . MET A 1 48  ? 148.344 -2.784  -95.729  1.00 0.00 ? 48  MET A CA   1  
ATOM 693   C C    . MET A 1 48  ? 149.120 -4.095  -95.889  1.00 0.00 ? 48  MET A C    1  
ATOM 694   O O    . MET A 1 48  ? 149.521 -4.704  -94.917  1.00 0.00 ? 48  MET A O    1  
ATOM 695   C CB   . MET A 1 48  ? 147.085 -2.822  -96.600  1.00 0.00 ? 48  MET A CB   1  
ATOM 696   C CG   . MET A 1 48  ? 147.469 -2.631  -98.068  1.00 0.00 ? 48  MET A CG   1  
ATOM 697   S SD   . MET A 1 48  ? 147.007 -4.106  -99.011  1.00 0.00 ? 48  MET A SD   1  
ATOM 698   C CE   . MET A 1 48  ? 145.843 -3.307  -100.145 1.00 0.00 ? 48  MET A CE   1  
ATOM 699   H H    . MET A 1 48  ? 149.447 -1.522  -97.085  1.00 0.00 ? 48  MET A H    1  
ATOM 700   H HA   . MET A 1 48  ? 148.060 -2.662  -94.694  1.00 0.00 ? 48  MET A HA   1  
ATOM 701   H HB2  . MET A 1 48  ? 146.592 -3.776  -96.478  1.00 0.00 ? 48  MET A HB2  1  
ATOM 702   H HB3  . MET A 1 48  ? 146.415 -2.030  -96.299  1.00 0.00 ? 48  MET A HB3  1  
ATOM 703   H HG2  . MET A 1 48  ? 146.951 -1.771  -98.466  1.00 0.00 ? 48  MET A HG2  1  
ATOM 704   H HG3  . MET A 1 48  ? 148.533 -2.475  -98.141  1.00 0.00 ? 48  MET A HG3  1  
ATOM 705   H HE1  . MET A 1 48  ? 145.152 -4.044  -100.528 1.00 0.00 ? 48  MET A HE1  1  
ATOM 706   H HE2  . MET A 1 48  ? 146.383 -2.864  -100.967 1.00 0.00 ? 48  MET A HE2  1  
ATOM 707   H HE3  . MET A 1 48  ? 145.299 -2.536  -99.617  1.00 0.00 ? 48  MET A HE3  1  
ATOM 708   N N    . GLY A 1 49  ? 149.342 -4.540  -97.100  1.00 0.00 ? 49  GLY A N    1  
ATOM 709   C CA   . GLY A 1 49  ? 150.097 -5.814  -97.279  1.00 0.00 ? 49  GLY A CA   1  
ATOM 710   C C    . GLY A 1 49  ? 150.211 -6.182  -98.764  1.00 0.00 ? 49  GLY A C    1  
ATOM 711   O O    . GLY A 1 49  ? 150.563 -5.363  -99.590  1.00 0.00 ? 49  GLY A O    1  
ATOM 712   H H    . GLY A 1 49  ? 149.017 -4.043  -97.879  1.00 0.00 ? 49  GLY A H    1  
ATOM 713   H HA2  . GLY A 1 49  ? 151.088 -5.699  -96.864  1.00 0.00 ? 49  GLY A HA2  1  
ATOM 714   H HA3  . GLY A 1 49  ? 149.583 -6.607  -96.757  1.00 0.00 ? 49  GLY A HA3  1  
ATOM 715   N N    . ASP A 1 50  ? 149.905 -7.404  -99.109  1.00 0.00 ? 50  ASP A N    1  
ATOM 716   C CA   . ASP A 1 50  ? 149.982 -7.824  -100.541 1.00 0.00 ? 50  ASP A CA   1  
ATOM 717   C C    . ASP A 1 50  ? 148.600 -8.311  -100.987 1.00 0.00 ? 50  ASP A C    1  
ATOM 718   O O    . ASP A 1 50  ? 147.846 -8.847  -100.200 1.00 0.00 ? 50  ASP A O    1  
ATOM 719   C CB   . ASP A 1 50  ? 150.996 -8.961  -100.686 1.00 0.00 ? 50  ASP A CB   1  
ATOM 720   C CG   . ASP A 1 50  ? 150.471 -10.209 -99.975  1.00 0.00 ? 50  ASP A CG   1  
ATOM 721   O OD1  . ASP A 1 50  ? 150.729 -10.343 -98.790  1.00 0.00 ? 50  ASP A OD1  1  
ATOM 722   O OD2  . ASP A 1 50  ? 149.821 -11.009 -100.626 1.00 0.00 ? 50  ASP A OD2  1  
ATOM 723   H H    . ASP A 1 50  ? 149.615 -8.046  -98.427  1.00 0.00 ? 50  ASP A H    1  
ATOM 724   H HA   . ASP A 1 50  ? 150.287 -6.986  -101.149 1.00 0.00 ? 50  ASP A HA   1  
ATOM 725   H HB2  . ASP A 1 50  ? 151.145 -9.178  -101.735 1.00 0.00 ? 50  ASP A HB2  1  
ATOM 726   H HB3  . ASP A 1 50  ? 151.935 -8.664  -100.244 1.00 0.00 ? 50  ASP A HB3  1  
ATOM 727   N N    . ALA A 1 51  ? 148.246 -8.127  -102.234 1.00 0.00 ? 51  ALA A N    1  
ATOM 728   C CA   . ALA A 1 51  ? 146.894 -8.587  -102.678 1.00 0.00 ? 51  ALA A CA   1  
ATOM 729   C C    . ALA A 1 51  ? 146.623 -8.171  -104.129 1.00 0.00 ? 51  ALA A C    1  
ATOM 730   O O    . ALA A 1 51  ? 147.526 -7.971  -104.916 1.00 0.00 ? 51  ALA A O    1  
ATOM 731   C CB   . ALA A 1 51  ? 145.830 -7.969  -101.769 1.00 0.00 ? 51  ALA A CB   1  
ATOM 732   H H    . ALA A 1 51  ? 148.855 -7.684  -102.865 1.00 0.00 ? 51  ALA A H    1  
ATOM 733   H HA   . ALA A 1 51  ? 146.843 -9.662  -102.601 1.00 0.00 ? 51  ALA A HA   1  
ATOM 734   H HB1  . ALA A 1 51  ? 145.225 -7.279  -102.339 1.00 0.00 ? 51  ALA A HB1  1  
ATOM 735   H HB2  . ALA A 1 51  ? 146.311 -7.442  -100.958 1.00 0.00 ? 51  ALA A HB2  1  
ATOM 736   H HB3  . ALA A 1 51  ? 145.202 -8.751  -101.367 1.00 0.00 ? 51  ALA A HB3  1  
ATOM 737   N N    . ILE A 1 52  ? 145.368 -8.020  -104.467 1.00 0.00 ? 52  ILE A N    1  
ATOM 738   C CA   . ILE A 1 52  ? 144.977 -7.593  -105.843 1.00 0.00 ? 52  ILE A CA   1  
ATOM 739   C C    . ILE A 1 52  ? 143.720 -6.730  -105.730 1.00 0.00 ? 52  ILE A C    1  
ATOM 740   O O    . ILE A 1 52  ? 142.830 -7.019  -104.955 1.00 0.00 ? 52  ILE A O    1  
ATOM 741   C CB   . ILE A 1 52  ? 144.670 -8.809  -106.720 1.00 0.00 ? 52  ILE A CB   1  
ATOM 742   C CG1  . ILE A 1 52  ? 145.955 -9.598  -106.988 1.00 0.00 ? 52  ILE A CG1  1  
ATOM 743   C CG2  . ILE A 1 52  ? 144.066 -8.336  -108.047 1.00 0.00 ? 52  ILE A CG2  1  
ATOM 744   C CD1  . ILE A 1 52  ? 146.607 -9.103  -108.278 1.00 0.00 ? 52  ILE A CD1  1  
ATOM 745   H H    . ILE A 1 52  ? 144.670 -8.151  -103.796 1.00 0.00 ? 52  ILE A H    1  
ATOM 746   H HA   . ILE A 1 52  ? 145.758 -6.994  -106.283 1.00 0.00 ? 52  ILE A HA   1  
ATOM 747   H HB   . ILE A 1 52  ? 143.957 -9.443  -106.211 1.00 0.00 ? 52  ILE A HB   1  
ATOM 748   H HG12 . ILE A 1 52  ? 146.639 -9.463  -106.165 1.00 0.00 ? 52  ILE A HG12 1  
ATOM 749   H HG13 . ILE A 1 52  ? 145.717 -10.647 -107.088 1.00 0.00 ? 52  ILE A HG13 1  
ATOM 750   H HG21 . ILE A 1 52  ? 144.624 -7.486  -108.414 1.00 0.00 ? 52  ILE A HG21 1  
ATOM 751   H HG22 . ILE A 1 52  ? 143.036 -8.049  -107.892 1.00 0.00 ? 52  ILE A HG22 1  
ATOM 752   H HG23 . ILE A 1 52  ? 144.111 -9.136  -108.771 1.00 0.00 ? 52  ILE A HG23 1  
ATOM 753   H HD11 . ILE A 1 52  ? 147.676 -9.226  -108.209 1.00 0.00 ? 52  ILE A HD11 1  
ATOM 754   H HD12 . ILE A 1 52  ? 146.372 -8.059  -108.425 1.00 0.00 ? 52  ILE A HD12 1  
ATOM 755   H HD13 . ILE A 1 52  ? 146.232 -9.676  -109.112 1.00 0.00 ? 52  ILE A HD13 1  
ATOM 756   N N    . VAL A 1 53  ? 143.647 -5.658  -106.472 1.00 0.00 ? 53  VAL A N    1  
ATOM 757   C CA   . VAL A 1 53  ? 142.452 -4.775  -106.367 1.00 0.00 ? 53  VAL A CA   1  
ATOM 758   C C    . VAL A 1 53  ? 142.005 -4.295  -107.756 1.00 0.00 ? 53  VAL A C    1  
ATOM 759   O O    . VAL A 1 53  ? 142.811 -3.856  -108.554 1.00 0.00 ? 53  VAL A O    1  
ATOM 760   C CB   . VAL A 1 53  ? 142.820 -3.556  -105.518 1.00 0.00 ? 53  VAL A CB   1  
ATOM 761   C CG1  . VAL A 1 53  ? 141.549 -2.919  -104.954 1.00 0.00 ? 53  VAL A CG1  1  
ATOM 762   C CG2  . VAL A 1 53  ? 143.733 -3.992  -104.368 1.00 0.00 ? 53  VAL A CG2  1  
ATOM 763   H H    . VAL A 1 53  ? 144.381 -5.424  -107.077 1.00 0.00 ? 53  VAL A H    1  
ATOM 764   H HA   . VAL A 1 53  ? 141.652 -5.312  -105.886 1.00 0.00 ? 53  VAL A HA   1  
ATOM 765   H HB   . VAL A 1 53  ? 143.337 -2.835  -106.135 1.00 0.00 ? 53  VAL A HB   1  
ATOM 766   H HG11 . VAL A 1 53  ? 140.929 -3.684  -104.511 1.00 0.00 ? 53  VAL A HG11 1  
ATOM 767   H HG12 . VAL A 1 53  ? 141.006 -2.434  -105.752 1.00 0.00 ? 53  VAL A HG12 1  
ATOM 768   H HG13 . VAL A 1 53  ? 141.813 -2.189  -104.203 1.00 0.00 ? 53  VAL A HG13 1  
ATOM 769   H HG21 . VAL A 1 53  ? 144.668 -4.357  -104.769 1.00 0.00 ? 53  VAL A HG21 1  
ATOM 770   H HG22 . VAL A 1 53  ? 143.253 -4.778  -103.804 1.00 0.00 ? 53  VAL A HG22 1  
ATOM 771   H HG23 . VAL A 1 53  ? 143.925 -3.149  -103.720 1.00 0.00 ? 53  VAL A HG23 1  
ATOM 772   N N    . PRO A 1 54  ? 140.720 -4.350  -108.030 1.00 0.00 ? 54  PRO A N    1  
ATOM 773   C CA   . PRO A 1 54  ? 140.176 -3.871  -109.332 1.00 0.00 ? 54  PRO A CA   1  
ATOM 774   C C    . PRO A 1 54  ? 140.221 -2.342  -109.417 1.00 0.00 ? 54  PRO A C    1  
ATOM 775   O O    . PRO A 1 54  ? 139.463 -1.661  -108.756 1.00 0.00 ? 54  PRO A O    1  
ATOM 776   C CB   . PRO A 1 54  ? 138.728 -4.358  -109.285 1.00 0.00 ? 54  PRO A CB   1  
ATOM 777   C CG   . PRO A 1 54  ? 138.418 -4.839  -107.862 1.00 0.00 ? 54  PRO A CG   1  
ATOM 778   C CD   . PRO A 1 54  ? 139.727 -4.898  -107.068 1.00 0.00 ? 54  PRO A CD   1  
ATOM 779   H HA   . PRO A 1 54  ? 140.689 -4.325  -110.159 1.00 0.00 ? 54  PRO A HA   1  
ATOM 780   H HB2  . PRO A 1 54  ? 138.064 -3.547  -109.548 1.00 0.00 ? 54  PRO A HB2  1  
ATOM 781   H HB3  . PRO A 1 54  ? 138.596 -5.175  -109.977 1.00 0.00 ? 54  PRO A HB3  1  
ATOM 782   H HG2  . PRO A 1 54  ? 137.734 -4.149  -107.388 1.00 0.00 ? 54  PRO A HG2  1  
ATOM 783   H HG3  . PRO A 1 54  ? 137.976 -5.822  -107.900 1.00 0.00 ? 54  PRO A HG3  1  
ATOM 784   H HD2  . PRO A 1 54  ? 139.663 -4.282  -106.181 1.00 0.00 ? 54  PRO A HD2  1  
ATOM 785   H HD3  . PRO A 1 54  ? 139.973 -5.916  -106.816 1.00 0.00 ? 54  PRO A HD3  1  
ATOM 786   N N    . VAL A 1 55  ? 141.106 -1.786  -110.202 1.00 0.00 ? 55  VAL A N    1  
ATOM 787   C CA   . VAL A 1 55  ? 141.171 -0.300  -110.274 1.00 0.00 ? 55  VAL A CA   1  
ATOM 788   C C    . VAL A 1 55  ? 140.109 0.258   -111.204 1.00 0.00 ? 55  VAL A C    1  
ATOM 789   O O    . VAL A 1 55  ? 139.894 -0.211  -112.310 1.00 0.00 ? 55  VAL A O    1  
ATOM 790   C CB   . VAL A 1 55  ? 142.520 0.182   -110.790 1.00 0.00 ? 55  VAL A CB   1  
ATOM 791   C CG1  . VAL A 1 55  ? 143.573 0.066   -109.698 1.00 0.00 ? 55  VAL A CG1  1  
ATOM 792   C CG2  . VAL A 1 55  ? 142.923 -0.643  -112.010 1.00 0.00 ? 55  VAL A CG2  1  
ATOM 793   H H    . VAL A 1 55  ? 141.726 -2.338  -110.724 1.00 0.00 ? 55  VAL A H    1  
ATOM 794   H HA   . VAL A 1 55  ? 141.014 0.103   -109.285 1.00 0.00 ? 55  VAL A HA   1  
ATOM 795   H HB   . VAL A 1 55  ? 142.429 1.219   -111.074 1.00 0.00 ? 55  VAL A HB   1  
ATOM 796   H HG11 . VAL A 1 55  ? 144.073 -0.881  -109.783 1.00 0.00 ? 55  VAL A HG11 1  
ATOM 797   H HG12 . VAL A 1 55  ? 143.098 0.142   -108.732 1.00 0.00 ? 55  VAL A HG12 1  
ATOM 798   H HG13 . VAL A 1 55  ? 144.291 0.867   -109.811 1.00 0.00 ? 55  VAL A HG13 1  
ATOM 799   H HG21 . VAL A 1 55  ? 142.113 -0.642  -112.726 1.00 0.00 ? 55  VAL A HG21 1  
ATOM 800   H HG22 . VAL A 1 55  ? 143.134 -1.655  -111.706 1.00 0.00 ? 55  VAL A HG22 1  
ATOM 801   H HG23 . VAL A 1 55  ? 143.802 -0.209  -112.463 1.00 0.00 ? 55  VAL A HG23 1  
ATOM 802   N N    . GLU A 1 56  ? 139.501 1.303   -110.751 1.00 0.00 ? 56  GLU A N    1  
ATOM 803   C CA   . GLU A 1 56  ? 138.475 2.026   -111.533 1.00 0.00 ? 56  GLU A CA   1  
ATOM 804   C C    . GLU A 1 56  ? 138.861 3.494   -111.471 1.00 0.00 ? 56  GLU A C    1  
ATOM 805   O O    . GLU A 1 56  ? 138.205 4.310   -110.855 1.00 0.00 ? 56  GLU A O    1  
ATOM 806   C CB   . GLU A 1 56  ? 137.096 1.822   -110.901 1.00 0.00 ? 56  GLU A CB   1  
ATOM 807   C CG   . GLU A 1 56  ? 136.908 0.345   -110.549 1.00 0.00 ? 56  GLU A CG   1  
ATOM 808   C CD   . GLU A 1 56  ? 135.579 0.159   -109.815 1.00 0.00 ? 56  GLU A CD   1  
ATOM 809   O OE1  . GLU A 1 56  ? 134.888 1.146   -109.623 1.00 0.00 ? 56  GLU A OE1  1  
ATOM 810   O OE2  . GLU A 1 56  ? 135.275 -0.967  -109.457 1.00 0.00 ? 56  GLU A OE2  1  
ATOM 811   H H    . GLU A 1 56  ? 139.759 1.652   -109.871 1.00 0.00 ? 56  GLU A H    1  
ATOM 812   H HA   . GLU A 1 56  ? 138.462 1.716   -112.565 1.00 0.00 ? 56  GLU A HA   1  
ATOM 813   H HB2  . GLU A 1 56  ? 137.020 2.419   -110.003 1.00 0.00 ? 56  GLU A HB2  1  
ATOM 814   H HB3  . GLU A 1 56  ? 136.331 2.123   -111.600 1.00 0.00 ? 56  GLU A HB3  1  
ATOM 815   H HG2  . GLU A 1 56  ? 136.905 -0.243  -111.456 1.00 0.00 ? 56  GLU A HG2  1  
ATOM 816   H HG3  . GLU A 1 56  ? 137.717 0.021   -109.912 1.00 0.00 ? 56  GLU A HG3  1  
ATOM 817   N N    . ILE A 1 57  ? 139.955 3.816   -112.102 1.00 0.00 ? 57  ILE A N    1  
ATOM 818   C CA   . ILE A 1 57  ? 140.450 5.213   -112.094 1.00 0.00 ? 57  ILE A CA   1  
ATOM 819   C C    . ILE A 1 57  ? 139.503 6.114   -112.887 1.00 0.00 ? 57  ILE A C    1  
ATOM 820   O O    . ILE A 1 57  ? 139.626 6.275   -114.092 1.00 0.00 ? 57  ILE A O    1  
ATOM 821   C CB   . ILE A 1 57  ? 141.866 5.251   -112.671 1.00 0.00 ? 57  ILE A CB   1  
ATOM 822   C CG1  . ILE A 1 57  ? 142.729 4.218   -111.928 1.00 0.00 ? 57  ILE A CG1  1  
ATOM 823   C CG2  . ILE A 1 57  ? 142.463 6.644   -112.474 1.00 0.00 ? 57  ILE A CG2  1  
ATOM 824   C CD1  . ILE A 1 57  ? 143.576 3.417   -112.918 1.00 0.00 ? 57  ILE A CD1  1  
ATOM 825   H H    . ILE A 1 57  ? 140.463 3.121   -112.576 1.00 0.00 ? 57  ILE A H    1  
ATOM 826   H HA   . ILE A 1 57  ? 140.477 5.570   -111.082 1.00 0.00 ? 57  ILE A HA   1  
ATOM 827   H HB   . ILE A 1 57  ? 141.835 5.019   -113.722 1.00 0.00 ? 57  ILE A HB   1  
ATOM 828   H HG12 . ILE A 1 57  ? 143.381 4.725   -111.232 1.00 0.00 ? 57  ILE A HG12 1  
ATOM 829   H HG13 . ILE A 1 57  ? 142.086 3.542   -111.384 1.00 0.00 ? 57  ILE A HG13 1  
ATOM 830   H HG21 . ILE A 1 57  ? 143.068 6.900   -113.332 1.00 0.00 ? 57  ILE A HG21 1  
ATOM 831   H HG22 . ILE A 1 57  ? 143.076 6.650   -111.586 1.00 0.00 ? 57  ILE A HG22 1  
ATOM 832   H HG23 . ILE A 1 57  ? 141.666 7.364   -112.367 1.00 0.00 ? 57  ILE A HG23 1  
ATOM 833   H HD11 . ILE A 1 57  ? 144.580 3.320   -112.533 1.00 0.00 ? 57  ILE A HD11 1  
ATOM 834   H HD12 . ILE A 1 57  ? 143.603 3.925   -113.869 1.00 0.00 ? 57  ILE A HD12 1  
ATOM 835   H HD13 . ILE A 1 57  ? 143.145 2.435   -113.044 1.00 0.00 ? 57  ILE A HD13 1  
ATOM 836   N N    . THR A 1 58  ? 138.540 6.675   -112.195 1.00 0.00 ? 58  THR A N    1  
ATOM 837   C CA   . THR A 1 58  ? 137.557 7.564   -112.874 1.00 0.00 ? 58  THR A CA   1  
ATOM 838   C C    . THR A 1 58  ? 138.318 8.805   -113.331 1.00 0.00 ? 58  THR A C    1  
ATOM 839   O O    . THR A 1 58  ? 138.548 9.726   -112.572 1.00 0.00 ? 58  THR A O    1  
ATOM 840   C CB   . THR A 1 58  ? 136.427 7.947   -111.915 1.00 0.00 ? 58  THR A CB   1  
ATOM 841   O OG1  . THR A 1 58  ? 136.405 7.035   -110.825 1.00 0.00 ? 58  THR A OG1  1  
ATOM 842   C CG2  . THR A 1 58  ? 135.087 7.898   -112.650 1.00 0.00 ? 58  THR A CG2  1  
ATOM 843   H H    . THR A 1 58  ? 138.485 6.457   -111.237 1.00 0.00 ? 58  THR A H    1  
ATOM 844   H HA   . THR A 1 58  ? 137.170 7.039   -113.733 1.00 0.00 ? 58  THR A HA   1  
ATOM 845   H HB   . THR A 1 58  ? 136.592 8.946   -111.544 1.00 0.00 ? 58  THR A HB   1  
ATOM 846   H HG1  . THR A 1 58  ? 136.691 7.505   -110.039 1.00 0.00 ? 58  THR A HG1  1  
ATOM 847   H HG21 . THR A 1 58  ? 134.283 7.849   -111.931 1.00 0.00 ? 58  THR A HG21 1  
ATOM 848   H HG22 . THR A 1 58  ? 135.054 7.024   -113.285 1.00 0.00 ? 58  THR A HG22 1  
ATOM 849   H HG23 . THR A 1 58  ? 134.975 8.786   -113.254 1.00 0.00 ? 58  THR A HG23 1  
ATOM 850   N N    . ILE A 1 59  ? 138.730 8.819   -114.569 1.00 0.00 ? 59  ILE A N    1  
ATOM 851   C CA   . ILE A 1 59  ? 139.503 9.979   -115.087 1.00 0.00 ? 59  ILE A CA   1  
ATOM 852   C C    . ILE A 1 59  ? 138.606 10.902  -115.912 1.00 0.00 ? 59  ILE A C    1  
ATOM 853   O O    . ILE A 1 59  ? 137.732 10.460  -116.636 1.00 0.00 ? 59  ILE A O    1  
ATOM 854   C CB   . ILE A 1 59  ? 140.644 9.467   -115.974 1.00 0.00 ? 59  ILE A CB   1  
ATOM 855   C CG1  . ILE A 1 59  ? 141.760 8.891   -115.098 1.00 0.00 ? 59  ILE A CG1  1  
ATOM 856   C CG2  . ILE A 1 59  ? 141.200 10.619  -116.813 1.00 0.00 ? 59  ILE A CG2  1  
ATOM 857   C CD1  . ILE A 1 59  ? 142.767 8.139   -115.973 1.00 0.00 ? 59  ILE A CD1  1  
ATOM 858   H H    . ILE A 1 59  ? 138.545 8.055   -115.154 1.00 0.00 ? 59  ILE A H    1  
ATOM 859   H HA   . ILE A 1 59  ? 139.915 10.528  -114.259 1.00 0.00 ? 59  ILE A HA   1  
ATOM 860   H HB   . ILE A 1 59  ? 140.268 8.696   -116.631 1.00 0.00 ? 59  ILE A HB   1  
ATOM 861   H HG12 . ILE A 1 59  ? 142.263 9.697   -114.585 1.00 0.00 ? 59  ILE A HG12 1  
ATOM 862   H HG13 . ILE A 1 59  ? 141.337 8.212   -114.374 1.00 0.00 ? 59  ILE A HG13 1  
ATOM 863   H HG21 . ILE A 1 59  ? 141.476 11.437  -116.166 1.00 0.00 ? 59  ILE A HG21 1  
ATOM 864   H HG22 . ILE A 1 59  ? 140.447 10.952  -117.512 1.00 0.00 ? 59  ILE A HG22 1  
ATOM 865   H HG23 . ILE A 1 59  ? 142.070 10.281  -117.356 1.00 0.00 ? 59  ILE A HG23 1  
ATOM 866   H HD11 . ILE A 1 59  ? 142.271 7.317   -116.469 1.00 0.00 ? 59  ILE A HD11 1  
ATOM 867   H HD12 . ILE A 1 59  ? 143.567 7.756   -115.356 1.00 0.00 ? 59  ILE A HD12 1  
ATOM 868   H HD13 . ILE A 1 59  ? 143.175 8.812   -116.713 1.00 0.00 ? 59  ILE A HD13 1  
ATOM 869   N N    . TYR A 1 60  ? 138.856 12.184  -115.840 1.00 0.00 ? 60  TYR A N    1  
ATOM 870   C CA   . TYR A 1 60  ? 138.056 13.141  -116.654 1.00 0.00 ? 60  TYR A CA   1  
ATOM 871   C C    . TYR A 1 60  ? 139.007 13.821  -117.637 1.00 0.00 ? 60  TYR A C    1  
ATOM 872   O O    . TYR A 1 60  ? 140.146 14.129  -117.312 1.00 0.00 ? 60  TYR A O    1  
ATOM 873   C CB   . TYR A 1 60  ? 137.364 14.195  -115.779 1.00 0.00 ? 60  TYR A CB   1  
ATOM 874   C CG   . TYR A 1 60  ? 136.213 13.599  -115.001 1.00 0.00 ? 60  TYR A CG   1  
ATOM 875   C CD1  . TYR A 1 60  ? 136.400 12.457  -114.212 1.00 0.00 ? 60  TYR A CD1  1  
ATOM 876   C CD2  . TYR A 1 60  ? 134.954 14.207  -115.061 1.00 0.00 ? 60  TYR A CD2  1  
ATOM 877   C CE1  . TYR A 1 60  ? 135.327 11.927  -113.486 1.00 0.00 ? 60  TYR A CE1  1  
ATOM 878   C CE2  . TYR A 1 60  ? 133.882 13.675  -114.337 1.00 0.00 ? 60  TYR A CE2  1  
ATOM 879   C CZ   . TYR A 1 60  ? 134.068 12.535  -113.549 1.00 0.00 ? 60  TYR A CZ   1  
ATOM 880   O OH   . TYR A 1 60  ? 133.011 12.012  -112.833 1.00 0.00 ? 60  TYR A OH   1  
ATOM 881   H H    . TYR A 1 60  ? 139.604 12.491  -115.285 1.00 0.00 ? 60  TYR A H    1  
ATOM 882   H HA   . TYR A 1 60  ? 137.355 12.572  -117.242 1.00 0.00 ? 60  TYR A HA   1  
ATOM 883   H HB2  . TYR A 1 60  ? 138.083 14.605  -115.085 1.00 0.00 ? 60  TYR A HB2  1  
ATOM 884   H HB3  . TYR A 1 60  ? 136.992 14.989  -116.411 1.00 0.00 ? 60  TYR A HB3  1  
ATOM 885   H HD1  . TYR A 1 60  ? 137.368 11.985  -114.164 1.00 0.00 ? 60  TYR A HD1  1  
ATOM 886   H HD2  . TYR A 1 60  ? 134.811 15.087  -115.668 1.00 0.00 ? 60  TYR A HD2  1  
ATOM 887   H HE1  . TYR A 1 60  ? 135.466 11.045  -112.881 1.00 0.00 ? 60  TYR A HE1  1  
ATOM 888   H HE2  . TYR A 1 60  ? 132.911 14.145  -114.386 1.00 0.00 ? 60  TYR A HE2  1  
ATOM 889   H HH   . TYR A 1 60  ? 132.311 12.668  -112.815 1.00 0.00 ? 60  TYR A HH   1  
ATOM 890   N N    . ALA A 1 61  ? 138.549 14.014  -118.852 1.00 0.00 ? 61  ALA A N    1  
ATOM 891   C CA   . ALA A 1 61  ? 139.410 14.626  -119.900 1.00 0.00 ? 61  ALA A CA   1  
ATOM 892   C C    . ALA A 1 61  ? 140.100 15.871  -119.352 1.00 0.00 ? 61  ALA A C    1  
ATOM 893   O O    . ALA A 1 61  ? 141.224 16.169  -119.707 1.00 0.00 ? 61  ALA A O    1  
ATOM 894   C CB   . ALA A 1 61  ? 138.573 14.984  -121.128 1.00 0.00 ? 61  ALA A CB   1  
ATOM 895   H H    . ALA A 1 61  ? 137.640 13.724  -119.079 1.00 0.00 ? 61  ALA A H    1  
ATOM 896   H HA   . ALA A 1 61  ? 140.164 13.903  -120.167 1.00 0.00 ? 61  ALA A HA   1  
ATOM 897   H HB1  . ALA A 1 61  ? 138.723 14.239  -121.896 1.00 0.00 ? 61  ALA A HB1  1  
ATOM 898   H HB2  . ALA A 1 61  ? 138.875 15.951  -121.501 1.00 0.00 ? 61  ALA A HB2  1  
ATOM 899   H HB3  . ALA A 1 61  ? 137.528 15.013  -120.855 1.00 0.00 ? 61  ALA A HB3  1  
ATOM 900   N N    . ASP A 1 62  ? 139.464 16.590  -118.467 1.00 0.00 ? 62  ASP A N    1  
ATOM 901   C CA   . ASP A 1 62  ? 140.135 17.785  -117.892 1.00 0.00 ? 62  ASP A CA   1  
ATOM 902   C C    . ASP A 1 62  ? 141.510 17.333  -117.405 1.00 0.00 ? 62  ASP A C    1  
ATOM 903   O O    . ASP A 1 62  ? 142.303 18.103  -116.902 1.00 0.00 ? 62  ASP A O    1  
ATOM 904   C CB   . ASP A 1 62  ? 139.318 18.327  -116.717 1.00 0.00 ? 62  ASP A CB   1  
ATOM 905   C CG   . ASP A 1 62  ? 138.394 19.441  -117.209 1.00 0.00 ? 62  ASP A CG   1  
ATOM 906   O OD1  . ASP A 1 62  ? 138.348 19.660  -118.409 1.00 0.00 ? 62  ASP A OD1  1  
ATOM 907   O OD2  . ASP A 1 62  ? 137.747 20.058  -116.378 1.00 0.00 ? 62  ASP A OD2  1  
ATOM 908   H H    . ASP A 1 62  ? 138.567 16.331  -118.168 1.00 0.00 ? 62  ASP A H    1  
ATOM 909   H HA   . ASP A 1 62  ? 140.246 18.546  -118.651 1.00 0.00 ? 62  ASP A HA   1  
ATOM 910   H HB2  . ASP A 1 62  ? 138.727 17.528  -116.292 1.00 0.00 ? 62  ASP A HB2  1  
ATOM 911   H HB3  . ASP A 1 62  ? 139.986 18.721  -115.965 1.00 0.00 ? 62  ASP A HB3  1  
ATOM 912   N N    . ARG A 1 63  ? 141.776 16.064  -117.560 1.00 0.00 ? 63  ARG A N    1  
ATOM 913   C CA   . ARG A 1 63  ? 143.072 15.483  -117.129 1.00 0.00 ? 63  ARG A CA   1  
ATOM 914   C C    . ARG A 1 63  ? 143.097 15.342  -115.609 1.00 0.00 ? 63  ARG A C    1  
ATOM 915   O O    . ARG A 1 63  ? 143.833 16.013  -114.913 1.00 0.00 ? 63  ARG A O    1  
ATOM 916   C CB   . ARG A 1 63  ? 144.243 16.336  -117.618 1.00 0.00 ? 63  ARG A CB   1  
ATOM 917   C CG   . ARG A 1 63  ? 145.546 15.548  -117.478 1.00 0.00 ? 63  ARG A CG   1  
ATOM 918   C CD   . ARG A 1 63  ? 146.736 16.493  -117.655 1.00 0.00 ? 63  ARG A CD   1  
ATOM 919   N NE   . ARG A 1 63  ? 147.274 16.363  -119.038 1.00 0.00 ? 63  ARG A NE   1  
ATOM 920   C CZ   . ARG A 1 63  ? 148.082 17.271  -119.512 1.00 0.00 ? 63  ARG A CZ   1  
ATOM 921   N NH1  . ARG A 1 63  ? 148.417 18.295  -118.775 1.00 0.00 ? 63  ARG A NH1  1  
ATOM 922   N NH2  . ARG A 1 63  ? 148.554 17.157  -120.723 1.00 0.00 ? 63  ARG A NH2  1  
ATOM 923   H H    . ARG A 1 63  ? 141.104 15.480  -117.966 1.00 0.00 ? 63  ARG A H    1  
ATOM 924   H HA   . ARG A 1 63  ? 143.148 14.477  -117.513 1.00 0.00 ? 63  ARG A HA   1  
ATOM 925   H HB2  . ARG A 1 63  ? 144.089 16.597  -118.656 1.00 0.00 ? 63  ARG A HB2  1  
ATOM 926   H HB3  . ARG A 1 63  ? 144.304 17.236  -117.026 1.00 0.00 ? 63  ARG A HB3  1  
ATOM 927   H HG2  . ARG A 1 63  ? 145.588 15.093  -116.499 1.00 0.00 ? 63  ARG A HG2  1  
ATOM 928   H HG3  . ARG A 1 63  ? 145.585 14.778  -118.235 1.00 0.00 ? 63  ARG A HG3  1  
ATOM 929   H HD2  . ARG A 1 63  ? 146.415 17.511  -117.488 1.00 0.00 ? 63  ARG A HD2  1  
ATOM 930   H HD3  . ARG A 1 63  ? 147.507 16.238  -116.943 1.00 0.00 ? 63  ARG A HD3  1  
ATOM 931   H HE   . ARG A 1 63  ? 147.022 15.594  -119.591 1.00 0.00 ? 63  ARG A HE   1  
ATOM 932   H HH11 . ARG A 1 63  ? 148.055 18.383  -117.847 1.00 0.00 ? 63  ARG A HH11 1  
ATOM 933   H HH12 . ARG A 1 63  ? 149.036 18.991  -119.138 1.00 0.00 ? 63  ARG A HH12 1  
ATOM 934   H HH21 . ARG A 1 63  ? 148.297 16.373  -121.288 1.00 0.00 ? 63  ARG A HH21 1  
ATOM 935   H HH22 . ARG A 1 63  ? 149.173 17.854  -121.086 1.00 0.00 ? 63  ARG A HH22 1  
ATOM 936   N N    . SER A 1 64  ? 142.290 14.447  -115.102 1.00 0.00 ? 64  SER A N    1  
ATOM 937   C CA   . SER A 1 64  ? 142.241 14.214  -113.628 1.00 0.00 ? 64  SER A CA   1  
ATOM 938   C C    . SER A 1 64  ? 141.904 12.743  -113.370 1.00 0.00 ? 64  SER A C    1  
ATOM 939   O O    . SER A 1 64  ? 141.197 12.125  -114.137 1.00 0.00 ? 64  SER A O    1  
ATOM 940   C CB   . SER A 1 64  ? 141.165 15.104  -113.004 1.00 0.00 ? 64  SER A CB   1  
ATOM 941   O OG   . SER A 1 64  ? 141.524 15.405  -111.662 1.00 0.00 ? 64  SER A OG   1  
ATOM 942   H H    . SER A 1 64  ? 141.720 13.914  -115.705 1.00 0.00 ? 64  SER A H    1  
ATOM 943   H HA   . SER A 1 64  ? 143.202 14.447  -113.193 1.00 0.00 ? 64  SER A HA   1  
ATOM 944   H HB2  . SER A 1 64  ? 141.085 16.021  -113.564 1.00 0.00 ? 64  SER A HB2  1  
ATOM 945   H HB3  . SER A 1 64  ? 140.214 14.587  -113.027 1.00 0.00 ? 64  SER A HB3  1  
ATOM 946   H HG   . SER A 1 64  ? 141.616 16.357  -111.586 1.00 0.00 ? 64  SER A HG   1  
ATOM 947   N N    . PHE A 1 65  ? 142.403 12.169  -112.305 1.00 0.00 ? 65  PHE A N    1  
ATOM 948   C CA   . PHE A 1 65  ? 142.097 10.732  -112.031 1.00 0.00 ? 65  PHE A CA   1  
ATOM 949   C C    . PHE A 1 65  ? 141.503 10.575  -110.630 1.00 0.00 ? 65  PHE A C    1  
ATOM 950   O O    . PHE A 1 65  ? 142.207 10.617  -109.641 1.00 0.00 ? 65  PHE A O    1  
ATOM 951   C CB   . PHE A 1 65  ? 143.390 9.918   -112.122 1.00 0.00 ? 65  PHE A CB   1  
ATOM 952   C CG   . PHE A 1 65  ? 144.390 10.453  -111.126 1.00 0.00 ? 65  PHE A CG   1  
ATOM 953   C CD1  . PHE A 1 65  ? 145.148 11.589  -111.435 1.00 0.00 ? 65  PHE A CD1  1  
ATOM 954   C CD2  . PHE A 1 65  ? 144.559 9.813   -109.892 1.00 0.00 ? 65  PHE A CD2  1  
ATOM 955   C CE1  . PHE A 1 65  ? 146.075 12.085  -110.510 1.00 0.00 ? 65  PHE A CE1  1  
ATOM 956   C CE2  . PHE A 1 65  ? 145.486 10.309  -108.968 1.00 0.00 ? 65  PHE A CE2  1  
ATOM 957   C CZ   . PHE A 1 65  ? 146.244 11.445  -109.277 1.00 0.00 ? 65  PHE A CZ   1  
ATOM 958   H H    . PHE A 1 65  ? 142.977 12.676  -111.694 1.00 0.00 ? 65  PHE A H    1  
ATOM 959   H HA   . PHE A 1 65  ? 141.393 10.368  -112.761 1.00 0.00 ? 65  PHE A HA   1  
ATOM 960   H HB2  . PHE A 1 65  ? 143.180 8.883   -111.901 1.00 0.00 ? 65  PHE A HB2  1  
ATOM 961   H HB3  . PHE A 1 65  ? 143.799 9.999   -113.118 1.00 0.00 ? 65  PHE A HB3  1  
ATOM 962   H HD1  . PHE A 1 65  ? 145.017 12.083  -112.386 1.00 0.00 ? 65  PHE A HD1  1  
ATOM 963   H HD2  . PHE A 1 65  ? 143.974 8.937   -109.654 1.00 0.00 ? 65  PHE A HD2  1  
ATOM 964   H HE1  . PHE A 1 65  ? 146.659 12.961  -110.749 1.00 0.00 ? 65  PHE A HE1  1  
ATOM 965   H HE2  . PHE A 1 65  ? 145.616 9.815   -108.016 1.00 0.00 ? 65  PHE A HE2  1  
ATOM 966   H HZ   . PHE A 1 65  ? 146.959 11.827  -108.563 1.00 0.00 ? 65  PHE A HZ   1  
ATOM 967   N N    . THR A 1 66  ? 140.214 10.379  -110.532 1.00 0.00 ? 66  THR A N    1  
ATOM 968   C CA   . THR A 1 66  ? 139.596 10.204  -109.188 1.00 0.00 ? 66  THR A CA   1  
ATOM 969   C C    . THR A 1 66  ? 139.327 8.720   -108.923 1.00 0.00 ? 66  THR A C    1  
ATOM 970   O O    . THR A 1 66  ? 138.566 8.086   -109.638 1.00 0.00 ? 66  THR A O    1  
ATOM 971   C CB   . THR A 1 66  ? 138.250 10.928  -109.192 1.00 0.00 ? 66  THR A CB   1  
ATOM 972   O OG1  . THR A 1 66  ? 137.240 10.047  -109.664 1.00 0.00 ? 66  THR A OG1  1  
ATOM 973   C CG2  . THR A 1 66  ? 138.336 12.147  -110.106 1.00 0.00 ? 66  THR A CG2  1  
ATOM 974   H H    . THR A 1 66  ? 139.656 10.361  -111.337 1.00 0.00 ? 66  THR A H    1  
ATOM 975   H HA   . THR A 1 66  ? 140.210 10.644  -108.415 1.00 0.00 ? 66  THR A HA   1  
ATOM 976   H HB   . THR A 1 66  ? 138.009 11.251  -108.191 1.00 0.00 ? 66  THR A HB   1  
ATOM 977   H HG1  . THR A 1 66  ? 137.666 9.352   -110.172 1.00 0.00 ? 66  THR A HG1  1  
ATOM 978   H HG21 . THR A 1 66  ? 137.467 12.769  -109.958 1.00 0.00 ? 66  THR A HG21 1  
ATOM 979   H HG22 . THR A 1 66  ? 138.376 11.820  -111.135 1.00 0.00 ? 66  THR A HG22 1  
ATOM 980   H HG23 . THR A 1 66  ? 139.228 12.708  -109.871 1.00 0.00 ? 66  THR A HG23 1  
ATOM 981   N N    . PHE A 1 67  ? 139.897 8.166   -107.885 1.00 0.00 ? 67  PHE A N    1  
ATOM 982   C CA   . PHE A 1 67  ? 139.607 6.734   -107.566 1.00 0.00 ? 67  PHE A CA   1  
ATOM 983   C C    . PHE A 1 67  ? 140.547 6.214   -106.477 1.00 0.00 ? 67  PHE A C    1  
ATOM 984   O O    . PHE A 1 67  ? 141.702 6.579   -106.421 1.00 0.00 ? 67  PHE A O    1  
ATOM 985   C CB   . PHE A 1 67  ? 139.761 5.868   -108.815 1.00 0.00 ? 67  PHE A CB   1  
ATOM 986   C CG   . PHE A 1 67  ? 141.148 5.269   -108.844 1.00 0.00 ? 67  PHE A CG   1  
ATOM 987   C CD1  . PHE A 1 67  ? 142.273 6.102   -108.802 1.00 0.00 ? 67  PHE A CD1  1  
ATOM 988   C CD2  . PHE A 1 67  ? 141.307 3.880   -108.907 1.00 0.00 ? 67  PHE A CD2  1  
ATOM 989   C CE1  . PHE A 1 67  ? 143.557 5.545   -108.825 1.00 0.00 ? 67  PHE A CE1  1  
ATOM 990   C CE2  . PHE A 1 67  ? 142.591 3.323   -108.930 1.00 0.00 ? 67  PHE A CE2  1  
ATOM 991   C CZ   . PHE A 1 67  ? 143.716 4.155   -108.889 1.00 0.00 ? 67  PHE A CZ   1  
ATOM 992   H H    . PHE A 1 67  ? 140.476 8.697   -107.301 1.00 0.00 ? 67  PHE A H    1  
ATOM 993   H HA   . PHE A 1 67  ? 138.594 6.671   -107.204 1.00 0.00 ? 67  PHE A HA   1  
ATOM 994   H HB2  . PHE A 1 67  ? 139.026 5.076   -108.796 1.00 0.00 ? 67  PHE A HB2  1  
ATOM 995   H HB3  . PHE A 1 67  ? 139.613 6.473   -109.693 1.00 0.00 ? 67  PHE A HB3  1  
ATOM 996   H HD1  . PHE A 1 67  ? 142.150 7.174   -108.754 1.00 0.00 ? 67  PHE A HD1  1  
ATOM 997   H HD2  . PHE A 1 67  ? 140.439 3.238   -108.939 1.00 0.00 ? 67  PHE A HD2  1  
ATOM 998   H HE1  . PHE A 1 67  ? 144.425 6.187   -108.794 1.00 0.00 ? 67  PHE A HE1  1  
ATOM 999   H HE2  . PHE A 1 67  ? 142.713 2.252   -108.979 1.00 0.00 ? 67  PHE A HE2  1  
ATOM 1000  H HZ   . PHE A 1 67  ? 144.706 3.725   -108.906 1.00 0.00 ? 67  PHE A HZ   1  
ATOM 1001  N N    . VAL A 1 68  ? 140.079 5.306   -105.663 1.00 0.00 ? 68  VAL A N    1  
ATOM 1002  C CA   . VAL A 1 68  ? 140.967 4.695   -104.631 1.00 0.00 ? 68  VAL A CA   1  
ATOM 1003  C C    . VAL A 1 68  ? 140.243 3.494   -104.017 1.00 0.00 ? 68  VAL A C    1  
ATOM 1004  O O    . VAL A 1 68  ? 139.525 3.600   -103.042 1.00 0.00 ? 68  VAL A O    1  
ATOM 1005  C CB   . VAL A 1 68  ? 141.349 5.707   -103.547 1.00 0.00 ? 68  VAL A CB   1  
ATOM 1006  C CG1  . VAL A 1 68  ? 141.925 4.966   -102.340 1.00 0.00 ? 68  VAL A CG1  1  
ATOM 1007  C CG2  . VAL A 1 68  ? 142.400 6.678   -104.090 1.00 0.00 ? 68  VAL A CG2  1  
ATOM 1008  H H    . VAL A 1 68  ? 139.159 4.986   -105.767 1.00 0.00 ? 68  VAL A H    1  
ATOM 1009  H HA   . VAL A 1 68  ? 141.841 4.323   -105.143 1.00 0.00 ? 68  VAL A HA   1  
ATOM 1010  H HB   . VAL A 1 68  ? 140.470 6.258   -103.244 1.00 0.00 ? 68  VAL A HB   1  
ATOM 1011  H HG11 . VAL A 1 68  ? 142.425 4.068   -102.673 1.00 0.00 ? 68  VAL A HG11 1  
ATOM 1012  H HG12 . VAL A 1 68  ? 141.125 4.702   -101.663 1.00 0.00 ? 68  VAL A HG12 1  
ATOM 1013  H HG13 . VAL A 1 68  ? 142.633 5.603   -101.830 1.00 0.00 ? 68  VAL A HG13 1  
ATOM 1014  H HG21 . VAL A 1 68  ? 143.010 6.174   -104.825 1.00 0.00 ? 68  VAL A HG21 1  
ATOM 1015  H HG22 . VAL A 1 68  ? 143.024 7.021   -103.279 1.00 0.00 ? 68  VAL A HG22 1  
ATOM 1016  H HG23 . VAL A 1 68  ? 141.907 7.523   -104.547 1.00 0.00 ? 68  VAL A HG23 1  
ATOM 1017  N N    . THR A 1 69  ? 140.469 2.343   -104.594 1.00 0.00 ? 69  THR A N    1  
ATOM 1018  C CA   . THR A 1 69  ? 139.859 1.080   -104.091 1.00 0.00 ? 69  THR A CA   1  
ATOM 1019  C C    . THR A 1 69  ? 140.888 0.373   -103.210 1.00 0.00 ? 69  THR A C    1  
ATOM 1020  O O    . THR A 1 69  ? 142.074 0.460   -103.459 1.00 0.00 ? 69  THR A O    1  
ATOM 1021  C CB   . THR A 1 69  ? 139.530 0.181   -105.287 1.00 0.00 ? 69  THR A CB   1  
ATOM 1022  O OG1  . THR A 1 69  ? 139.477 -1.172  -104.858 1.00 0.00 ? 69  THR A OG1  1  
ATOM 1023  C CG2  . THR A 1 69  ? 140.610 0.338   -106.363 1.00 0.00 ? 69  THR A CG2  1  
ATOM 1024  H H    . THR A 1 69  ? 141.071 2.307   -105.366 1.00 0.00 ? 69  THR A H    1  
ATOM 1025  H HA   . THR A 1 69  ? 138.955 1.280   -103.533 1.00 0.00 ? 69  THR A HA   1  
ATOM 1026  H HB   . THR A 1 69  ? 138.575 0.464   -105.699 1.00 0.00 ? 69  THR A HB   1  
ATOM 1027  H HG1  . THR A 1 69  ? 138.957 -1.666  -105.496 1.00 0.00 ? 69  THR A HG1  1  
ATOM 1028  H HG21 . THR A 1 69  ? 140.658 -0.561  -106.961 1.00 0.00 ? 69  THR A HG21 1  
ATOM 1029  H HG22 . THR A 1 69  ? 141.568 0.507   -105.893 1.00 0.00 ? 69  THR A HG22 1  
ATOM 1030  H HG23 . THR A 1 69  ? 140.369 1.178   -106.998 1.00 0.00 ? 69  THR A HG23 1  
ATOM 1031  N N    . LYS A 1 70  ? 140.477 -0.328  -102.187 1.00 0.00 ? 70  LYS A N    1  
ATOM 1032  C CA   . LYS A 1 70  ? 141.500 -1.010  -101.342 1.00 0.00 ? 70  LYS A CA   1  
ATOM 1033  C C    . LYS A 1 70  ? 141.106 -2.466  -101.090 1.00 0.00 ? 70  LYS A C    1  
ATOM 1034  O O    . LYS A 1 70  ? 140.038 -2.762  -100.600 1.00 0.00 ? 70  LYS A O    1  
ATOM 1035  C CB   . LYS A 1 70  ? 141.653 -0.271  -100.013 1.00 0.00 ? 70  LYS A CB   1  
ATOM 1036  C CG   . LYS A 1 70  ? 142.944 -0.719  -99.326  1.00 0.00 ? 70  LYS A CG   1  
ATOM 1037  C CD   . LYS A 1 70  ? 143.871 0.484   -99.140  1.00 0.00 ? 70  LYS A CD   1  
ATOM 1038  C CE   . LYS A 1 70  ? 143.416 1.297   -97.927  1.00 0.00 ? 70  LYS A CE   1  
ATOM 1039  N NZ   . LYS A 1 70  ? 143.896 0.639   -96.680  1.00 0.00 ? 70  LYS A NZ   1  
ATOM 1040  H H    . LYS A 1 70  ? 139.518 -0.403  -101.977 1.00 0.00 ? 70  LYS A H    1  
ATOM 1041  H HA   . LYS A 1 70  ? 142.442 -1.015  -101.868 1.00 0.00 ? 70  LYS A HA   1  
ATOM 1042  H HB2  . LYS A 1 70  ? 141.690 0.794   -100.195 1.00 0.00 ? 70  LYS A HB2  1  
ATOM 1043  H HB3  . LYS A 1 70  ? 140.811 -0.497  -99.375  1.00 0.00 ? 70  LYS A HB3  1  
ATOM 1044  H HG2  . LYS A 1 70  ? 142.706 -1.145  -98.363  1.00 0.00 ? 70  LYS A HG2  1  
ATOM 1045  H HG3  . LYS A 1 70  ? 143.437 -1.460  -99.936  1.00 0.00 ? 70  LYS A HG3  1  
ATOM 1046  H HD2  . LYS A 1 70  ? 144.882 0.138   -98.983  1.00 0.00 ? 70  LYS A HD2  1  
ATOM 1047  H HD3  . LYS A 1 70  ? 143.836 1.107   -100.022 1.00 0.00 ? 70  LYS A HD3  1  
ATOM 1048  H HE2  . LYS A 1 70  ? 143.825 2.295   -97.989  1.00 0.00 ? 70  LYS A HE2  1  
ATOM 1049  H HE3  . LYS A 1 70  ? 142.337 1.351   -97.914  1.00 0.00 ? 70  LYS A HE3  1  
ATOM 1050  H HZ1  . LYS A 1 70  ? 144.549 1.276   -96.181  1.00 0.00 ? 70  LYS A HZ1  1  
ATOM 1051  H HZ2  . LYS A 1 70  ? 144.390 -0.244  -96.922  1.00 0.00 ? 70  LYS A HZ2  1  
ATOM 1052  H HZ3  . LYS A 1 70  ? 143.085 0.427   -96.065  1.00 0.00 ? 70  LYS A HZ3  1  
ATOM 1053  N N    . THR A 1 71  ? 141.994 -3.373  -101.418 1.00 0.00 ? 71  THR A N    1  
ATOM 1054  C CA   . THR A 1 71  ? 141.727 -4.827  -101.212 1.00 0.00 ? 71  THR A CA   1  
ATOM 1055  C C    . THR A 1 71  ? 140.766 -5.343  -102.295 1.00 0.00 ? 71  THR A C    1  
ATOM 1056  O O    . THR A 1 71  ? 139.949 -4.609  -102.814 1.00 0.00 ? 71  THR A O    1  
ATOM 1057  C CB   . THR A 1 71  ? 141.116 -5.029  -99.823  1.00 0.00 ? 71  THR A CB   1  
ATOM 1058  O OG1  . THR A 1 71  ? 139.757 -4.621  -99.836  1.00 0.00 ? 71  THR A OG1  1  
ATOM 1059  C CG2  . THR A 1 71  ? 141.891 -4.186  -98.809  1.00 0.00 ? 71  THR A CG2  1  
ATOM 1060  H H    . THR A 1 71  ? 142.851 -3.091  -101.801 1.00 0.00 ? 71  THR A H    1  
ATOM 1061  H HA   . THR A 1 71  ? 142.659 -5.368  -101.273 1.00 0.00 ? 71  THR A HA   1  
ATOM 1062  H HB   . THR A 1 71  ? 141.180 -6.066  -99.542  1.00 0.00 ? 71  THR A HB   1  
ATOM 1063  H HG1  . THR A 1 71  ? 139.660 -3.892  -99.219  1.00 0.00 ? 71  THR A HG1  1  
ATOM 1064  H HG21 . THR A 1 71  ? 141.338 -3.283  -98.594  1.00 0.00 ? 71  THR A HG21 1  
ATOM 1065  H HG22 . THR A 1 71  ? 142.855 -3.927  -99.220  1.00 0.00 ? 71  THR A HG22 1  
ATOM 1066  H HG23 . THR A 1 71  ? 142.027 -4.750  -97.900  1.00 0.00 ? 71  THR A HG23 1  
ATOM 1067  N N    . PRO A 1 72  ? 140.882 -6.606  -102.636 1.00 0.00 ? 72  PRO A N    1  
ATOM 1068  C CA   . PRO A 1 72  ? 140.028 -7.239  -103.684 1.00 0.00 ? 72  PRO A CA   1  
ATOM 1069  C C    . PRO A 1 72  ? 138.561 -6.793  -103.612 1.00 0.00 ? 72  PRO A C    1  
ATOM 1070  O O    . PRO A 1 72  ? 138.178 -6.051  -102.728 1.00 0.00 ? 72  PRO A O    1  
ATOM 1071  C CB   . PRO A 1 72  ? 140.186 -8.728  -103.360 1.00 0.00 ? 72  PRO A CB   1  
ATOM 1072  C CG   . PRO A 1 72  ? 141.329 -8.892  -102.347 1.00 0.00 ? 72  PRO A CG   1  
ATOM 1073  C CD   . PRO A 1 72  ? 141.870 -7.505  -101.989 1.00 0.00 ? 72  PRO A CD   1  
ATOM 1074  H HA   . PRO A 1 72  ? 140.430 -7.042  -104.663 1.00 0.00 ? 72  PRO A HA   1  
ATOM 1075  H HB2  . PRO A 1 72  ? 139.266 -9.109  -102.938 1.00 0.00 ? 72  PRO A HB2  1  
ATOM 1076  H HB3  . PRO A 1 72  ? 140.428 -9.273  -104.259 1.00 0.00 ? 72  PRO A HB3  1  
ATOM 1077  H HG2  . PRO A 1 72  ? 140.958 -9.380  -101.456 1.00 0.00 ? 72  PRO A HG2  1  
ATOM 1078  H HG3  . PRO A 1 72  ? 142.119 -9.485  -102.783 1.00 0.00 ? 72  PRO A HG3  1  
ATOM 1079  H HD2  . PRO A 1 72  ? 141.883 -7.367  -100.918 1.00 0.00 ? 72  PRO A HD2  1  
ATOM 1080  H HD3  . PRO A 1 72  ? 142.850 -7.352  -102.412 1.00 0.00 ? 72  PRO A HD3  1  
ATOM 1081  N N    . PRO A 1 73  ? 137.744 -7.228  -104.545 1.00 0.00 ? 73  PRO A N    1  
ATOM 1082  C CA   . PRO A 1 73  ? 136.312 -6.836  -104.568 1.00 0.00 ? 73  PRO A CA   1  
ATOM 1083  C C    . PRO A 1 73  ? 135.707 -6.807  -103.167 1.00 0.00 ? 73  PRO A C    1  
ATOM 1084  O O    . PRO A 1 73  ? 136.313 -7.259  -102.217 1.00 0.00 ? 73  PRO A O    1  
ATOM 1085  C CB   . PRO A 1 73  ? 135.698 -7.936  -105.432 1.00 0.00 ? 73  PRO A CB   1  
ATOM 1086  C CG   . PRO A 1 73  ? 136.834 -8.623  -106.207 1.00 0.00 ? 73  PRO A CG   1  
ATOM 1087  C CD   . PRO A 1 73  ? 138.176 -8.150  -105.628 1.00 0.00 ? 73  PRO A CD   1  
ATOM 1088  H HA   . PRO A 1 73  ? 136.189 -5.883  -105.054 1.00 0.00 ? 73  PRO A HA   1  
ATOM 1089  H HB2  . PRO A 1 73  ? 135.195 -8.656  -104.802 1.00 0.00 ? 73  PRO A HB2  1  
ATOM 1090  H HB3  . PRO A 1 73  ? 134.996 -7.505  -106.129 1.00 0.00 ? 73  PRO A HB3  1  
ATOM 1091  H HG2  . PRO A 1 73  ? 136.748 -9.695  -106.101 1.00 0.00 ? 73  PRO A HG2  1  
ATOM 1092  H HG3  . PRO A 1 73  ? 136.777 -8.354  -107.250 1.00 0.00 ? 73  PRO A HG3  1  
ATOM 1093  H HD2  . PRO A 1 73  ? 138.729 -8.987  -105.231 1.00 0.00 ? 73  PRO A HD2  1  
ATOM 1094  H HD3  . PRO A 1 73  ? 138.750 -7.619  -106.369 1.00 0.00 ? 73  PRO A HD3  1  
ATOM 1095  N N    . ALA A 1 74  ? 134.533 -6.256  -103.017 1.00 0.00 ? 74  ALA A N    1  
ATOM 1096  C CA   . ALA A 1 74  ? 133.938 -6.184  -101.657 1.00 0.00 ? 74  ALA A CA   1  
ATOM 1097  C C    . ALA A 1 74  ? 134.960 -5.503  -100.748 1.00 0.00 ? 74  ALA A C    1  
ATOM 1098  O O    . ALA A 1 74  ? 134.851 -4.335  -100.433 1.00 0.00 ? 74  ALA A O    1  
ATOM 1099  C CB   . ALA A 1 74  ? 133.648 -7.597  -101.146 1.00 0.00 ? 74  ALA A CB   1  
ATOM 1100  H H    . ALA A 1 74  ? 134.061 -5.875  -103.786 1.00 0.00 ? 74  ALA A H    1  
ATOM 1101  H HA   . ALA A 1 74  ? 133.027 -5.605  -101.684 1.00 0.00 ? 74  ALA A HA   1  
ATOM 1102  H HB1  . ALA A 1 74  ? 132.593 -7.695  -100.936 1.00 0.00 ? 74  ALA A HB1  1  
ATOM 1103  H HB2  . ALA A 1 74  ? 134.213 -7.778  -100.244 1.00 0.00 ? 74  ALA A HB2  1  
ATOM 1104  H HB3  . ALA A 1 74  ? 133.933 -8.317  -101.899 1.00 0.00 ? 74  ALA A HB3  1  
ATOM 1105  N N    . SER A 1 75  ? 135.952 -6.231  -100.325 1.00 0.00 ? 75  SER A N    1  
ATOM 1106  C CA   . SER A 1 75  ? 136.991 -5.650  -99.435  1.00 0.00 ? 75  SER A CA   1  
ATOM 1107  C C    . SER A 1 75  ? 137.392 -4.256  -99.928  1.00 0.00 ? 75  SER A C    1  
ATOM 1108  O O    . SER A 1 75  ? 137.898 -3.454  -99.161  1.00 0.00 ? 75  SER A O    1  
ATOM 1109  C CB   . SER A 1 75  ? 138.217 -6.563  -99.467  1.00 0.00 ? 75  SER A CB   1  
ATOM 1110  O OG   . SER A 1 75  ? 139.115 -6.187  -98.437  1.00 0.00 ? 75  SER A OG   1  
ATOM 1111  H H    . SER A 1 75  ? 136.003 -7.179  -100.568 1.00 0.00 ? 75  SER A H    1  
ATOM 1112  H HA   . SER A 1 75  ? 136.623 -5.586  -98.426  1.00 0.00 ? 75  SER A HA   1  
ATOM 1113  H HB2  . SER A 1 75  ? 137.912 -7.584  -99.315  1.00 0.00 ? 75  SER A HB2  1  
ATOM 1114  H HB3  . SER A 1 75  ? 138.702 -6.476  -100.431 1.00 0.00 ? 75  SER A HB3  1  
ATOM 1115  H HG   . SER A 1 75  ? 139.883 -6.760  -98.489  1.00 0.00 ? 75  SER A HG   1  
ATOM 1116  N N    . TYR A 1 76  ? 137.162 -3.954  -101.188 1.00 0.00 ? 76  TYR A N    1  
ATOM 1117  C CA   . TYR A 1 76  ? 137.544 -2.606  -101.715 1.00 0.00 ? 76  TYR A CA   1  
ATOM 1118  C C    . TYR A 1 76  ? 137.137 -1.543  -100.698 1.00 0.00 ? 76  TYR A C    1  
ATOM 1119  O O    . TYR A 1 76  ? 137.867 -0.595  -100.460 1.00 0.00 ? 76  TYR A O    1  
ATOM 1120  C CB   . TYR A 1 76  ? 136.862 -2.349  -103.066 1.00 0.00 ? 76  TYR A CB   1  
ATOM 1121  C CG   . TYR A 1 76  ? 135.396 -2.040  -102.876 1.00 0.00 ? 76  TYR A CG   1  
ATOM 1122  C CD1  . TYR A 1 76  ? 134.484 -3.079  -102.666 1.00 0.00 ? 76  TYR A CD1  1  
ATOM 1123  C CD2  . TYR A 1 76  ? 134.946 -0.715  -102.929 1.00 0.00 ? 76  TYR A CD2  1  
ATOM 1124  C CE1  . TYR A 1 76  ? 133.123 -2.795  -102.504 1.00 0.00 ? 76  TYR A CE1  1  
ATOM 1125  C CE2  . TYR A 1 76  ? 133.584 -0.431  -102.769 1.00 0.00 ? 76  TYR A CE2  1  
ATOM 1126  C CZ   . TYR A 1 76  ? 132.673 -1.471  -102.556 1.00 0.00 ? 76  TYR A CZ   1  
ATOM 1127  O OH   . TYR A 1 76  ? 131.330 -1.191  -102.399 1.00 0.00 ? 76  TYR A OH   1  
ATOM 1128  H H    . TYR A 1 76  ? 136.743 -4.612  -101.781 1.00 0.00 ? 76  TYR A H    1  
ATOM 1129  H HA   . TYR A 1 76  ? 138.613 -2.568  -101.846 1.00 0.00 ? 76  TYR A HA   1  
ATOM 1130  H HB2  . TYR A 1 76  ? 137.341 -1.513  -103.553 1.00 0.00 ? 76  TYR A HB2  1  
ATOM 1131  H HB3  . TYR A 1 76  ? 136.964 -3.227  -103.687 1.00 0.00 ? 76  TYR A HB3  1  
ATOM 1132  H HD1  . TYR A 1 76  ? 134.830 -4.099  -102.629 1.00 0.00 ? 76  TYR A HD1  1  
ATOM 1133  H HD2  . TYR A 1 76  ? 135.650 0.088   -103.091 1.00 0.00 ? 76  TYR A HD2  1  
ATOM 1134  H HE1  . TYR A 1 76  ? 132.420 -3.598  -102.339 1.00 0.00 ? 76  TYR A HE1  1  
ATOM 1135  H HE2  . TYR A 1 76  ? 133.237 0.591   -102.810 1.00 0.00 ? 76  TYR A HE2  1  
ATOM 1136  H HH   . TYR A 1 76  ? 131.158 -0.334  -102.794 1.00 0.00 ? 76  TYR A HH   1  
ATOM 1137  N N    . LEU A 1 77  ? 135.997 -1.719  -100.078 1.00 0.00 ? 77  LEU A N    1  
ATOM 1138  C CA   . LEU A 1 77  ? 135.533 -0.761  -99.034  1.00 0.00 ? 77  LEU A CA   1  
ATOM 1139  C C    . LEU A 1 77  ? 134.995 -1.582  -97.857  1.00 0.00 ? 77  LEU A C    1  
ATOM 1140  O O    . LEU A 1 77  ? 134.844 -1.095  -96.740  1.00 0.00 ? 77  LEU A O    1  
ATOM 1141  C CB   . LEU A 1 77  ? 134.441 0.155   -99.603  1.00 0.00 ? 77  LEU A CB   1  
ATOM 1142  C CG   . LEU A 1 77  ? 133.061 -0.251  -99.074  1.00 0.00 ? 77  LEU A CG   1  
ATOM 1143  C CD1  . LEU A 1 77  ? 132.028 0.781   -99.522  1.00 0.00 ? 77  LEU A CD1  1  
ATOM 1144  C CD2  . LEU A 1 77  ? 132.676 -1.624  -99.630  1.00 0.00 ? 77  LEU A CD2  1  
ATOM 1145  H H    . LEU A 1 77  ? 135.453 -2.506  -100.289 1.00 0.00 ? 77  LEU A H    1  
ATOM 1146  H HA   . LEU A 1 77  ? 136.370 -0.164  -98.700  1.00 0.00 ? 77  LEU A HA   1  
ATOM 1147  H HB2  . LEU A 1 77  ? 134.647 1.175   -99.312  1.00 0.00 ? 77  LEU A HB2  1  
ATOM 1148  H HB3  . LEU A 1 77  ? 134.445 0.086   -100.678 1.00 0.00 ? 77  LEU A HB3  1  
ATOM 1149  H HG   . LEU A 1 77  ? 133.083 -0.288  -97.994  1.00 0.00 ? 77  LEU A HG   1  
ATOM 1150  H HD11 . LEU A 1 77  ? 132.524 1.580   -100.053 1.00 0.00 ? 77  LEU A HD11 1  
ATOM 1151  H HD12 . LEU A 1 77  ? 131.523 1.183   -98.657  1.00 0.00 ? 77  LEU A HD12 1  
ATOM 1152  H HD13 . LEU A 1 77  ? 131.307 0.310   -100.173 1.00 0.00 ? 77  LEU A HD13 1  
ATOM 1153  H HD21 . LEU A 1 77  ? 132.457 -2.294  -98.813  1.00 0.00 ? 77  LEU A HD21 1  
ATOM 1154  H HD22 . LEU A 1 77  ? 133.493 -2.019  -100.213 1.00 0.00 ? 77  LEU A HD22 1  
ATOM 1155  H HD23 . LEU A 1 77  ? 131.801 -1.524  -100.258 1.00 0.00 ? 77  LEU A HD23 1  
ATOM 1156  N N    . ILE A 1 78  ? 134.730 -2.844  -98.096  1.00 0.00 ? 78  ILE A N    1  
ATOM 1157  C CA   . ILE A 1 78  ? 134.236 -3.712  -97.003  1.00 0.00 ? 78  ILE A CA   1  
ATOM 1158  C C    . ILE A 1 78  ? 135.280 -3.688  -95.893  1.00 0.00 ? 78  ILE A C    1  
ATOM 1159  O O    . ILE A 1 78  ? 134.970 -3.728  -94.718  1.00 0.00 ? 78  ILE A O    1  
ATOM 1160  C CB   . ILE A 1 78  ? 134.071 -5.150  -97.515  1.00 0.00 ? 78  ILE A CB   1  
ATOM 1161  C CG1  . ILE A 1 78  ? 132.804 -5.243  -98.377  1.00 0.00 ? 78  ILE A CG1  1  
ATOM 1162  C CG2  . ILE A 1 78  ? 133.952 -6.110  -96.328  1.00 0.00 ? 78  ILE A CG2  1  
ATOM 1163  C CD1  . ILE A 1 78  ? 132.268 -6.679  -98.356  1.00 0.00 ? 78  ILE A CD1  1  
ATOM 1164  H H    . ILE A 1 78  ? 134.879 -3.219  -98.990  1.00 0.00 ? 78  ILE A H    1  
ATOM 1165  H HA   . ILE A 1 78  ? 133.266 -3.353  -96.685  1.00 0.00 ? 78  ILE A HA   1  
ATOM 1166  H HB   . ILE A 1 78  ? 134.927 -5.419  -98.108  1.00 0.00 ? 78  ILE A HB   1  
ATOM 1167  H HG12 . ILE A 1 78  ? 132.053 -4.574  -97.985  1.00 0.00 ? 78  ILE A HG12 1  
ATOM 1168  H HG13 . ILE A 1 78  ? 133.038 -4.964  -99.392  1.00 0.00 ? 78  ILE A HG13 1  
ATOM 1169  H HG21 . ILE A 1 78  ? 133.897 -7.126  -96.689  1.00 0.00 ? 78  ILE A HG21 1  
ATOM 1170  H HG22 . ILE A 1 78  ? 133.059 -5.879  -95.766  1.00 0.00 ? 78  ILE A HG22 1  
ATOM 1171  H HG23 . ILE A 1 78  ? 134.816 -6.003  -95.689  1.00 0.00 ? 78  ILE A HG23 1  
ATOM 1172  H HD11 . ILE A 1 78  ? 133.092 -7.375  -98.416  1.00 0.00 ? 78  ILE A HD11 1  
ATOM 1173  H HD12 . ILE A 1 78  ? 131.608 -6.831  -99.197  1.00 0.00 ? 78  ILE A HD12 1  
ATOM 1174  H HD13 . ILE A 1 78  ? 131.723 -6.848  -97.438  1.00 0.00 ? 78  ILE A HD13 1  
ATOM 1175  N N    . ARG A 1 79  ? 136.537 -3.597  -96.284  1.00 0.00 ? 79  ARG A N    1  
ATOM 1176  C CA   . ARG A 1 79  ? 137.639 -3.549  -95.282  1.00 0.00 ? 79  ARG A CA   1  
ATOM 1177  C C    . ARG A 1 79  ? 137.355 -2.419  -94.303  1.00 0.00 ? 79  ARG A C    1  
ATOM 1178  O O    . ARG A 1 79  ? 137.384 -2.600  -93.102  1.00 0.00 ? 79  ARG A O    1  
ATOM 1179  C CB   . ARG A 1 79  ? 138.968 -3.293  -95.995  1.00 0.00 ? 79  ARG A CB   1  
ATOM 1180  C CG   . ARG A 1 79  ? 139.524 -4.620  -96.517  1.00 0.00 ? 79  ARG A CG   1  
ATOM 1181  C CD   . ARG A 1 79  ? 140.698 -5.059  -95.642  1.00 0.00 ? 79  ARG A CD   1  
ATOM 1182  N NE   . ARG A 1 79  ? 141.455 -6.163  -96.313  1.00 0.00 ? 79  ARG A NE   1  
ATOM 1183  C CZ   . ARG A 1 79  ? 140.836 -7.194  -96.822  1.00 0.00 ? 79  ARG A CZ   1  
ATOM 1184  N NH1  . ARG A 1 79  ? 139.556 -7.350  -96.639  1.00 0.00 ? 79  ARG A NH1  1  
ATOM 1185  N NH2  . ARG A 1 79  ? 141.511 -8.094  -97.484  1.00 0.00 ? 79  ARG A NH2  1  
ATOM 1186  H H    . ARG A 1 79  ? 136.744 -3.535  -97.247  1.00 0.00 ? 79  ARG A H    1  
ATOM 1187  H HA   . ARG A 1 79  ? 137.693 -4.486  -94.748  1.00 0.00 ? 79  ARG A HA   1  
ATOM 1188  H HB2  . ARG A 1 79  ? 138.810 -2.616  -96.822  1.00 0.00 ? 79  ARG A HB2  1  
ATOM 1189  H HB3  . ARG A 1 79  ? 139.672 -2.858  -95.301  1.00 0.00 ? 79  ARG A HB3  1  
ATOM 1190  H HG2  . ARG A 1 79  ? 138.745 -5.365  -96.486  1.00 0.00 ? 79  ARG A HG2  1  
ATOM 1191  H HG3  . ARG A 1 79  ? 139.862 -4.491  -97.532  1.00 0.00 ? 79  ARG A HG3  1  
ATOM 1192  H HD2  . ARG A 1 79  ? 141.367 -4.230  -95.507  1.00 0.00 ? 79  ARG A HD2  1  
ATOM 1193  H HD3  . ARG A 1 79  ? 140.323 -5.380  -94.675  1.00 0.00 ? 79  ARG A HD3  1  
ATOM 1194  H HE   . ARG A 1 79  ? 142.428 -6.092  -96.404  1.00 0.00 ? 79  ARG A HE   1  
ATOM 1195  H HH11 . ARG A 1 79  ? 139.042 -6.682  -96.104  1.00 0.00 ? 79  ARG A HH11 1  
ATOM 1196  H HH12 . ARG A 1 79  ? 139.087 -8.140  -97.035  1.00 0.00 ? 79  ARG A HH12 1  
ATOM 1197  H HH21 . ARG A 1 79  ? 142.499 -7.992  -97.600  1.00 0.00 ? 79  ARG A HH21 1  
ATOM 1198  H HH22 . ARG A 1 79  ? 141.040 -8.884  -97.875  1.00 0.00 ? 79  ARG A HH22 1  
ATOM 1199  N N    . LYS A 1 80  ? 137.059 -1.254  -94.806  1.00 0.00 ? 80  LYS A N    1  
ATOM 1200  C CA   . LYS A 1 80  ? 136.751 -0.123  -93.899  1.00 0.00 ? 80  LYS A CA   1  
ATOM 1201  C C    . LYS A 1 80  ? 135.568 -0.524  -93.022  1.00 0.00 ? 80  LYS A C    1  
ATOM 1202  O O    . LYS A 1 80  ? 135.688 -0.644  -91.818  1.00 0.00 ? 80  LYS A O    1  
ATOM 1203  C CB   . LYS A 1 80  ? 136.388 1.116   -94.720  1.00 0.00 ? 80  LYS A CB   1  
ATOM 1204  C CG   . LYS A 1 80  ? 136.203 2.312   -93.785  1.00 0.00 ? 80  LYS A CG   1  
ATOM 1205  C CD   . LYS A 1 80  ? 134.713 2.512   -93.500  1.00 0.00 ? 80  LYS A CD   1  
ATOM 1206  C CE   . LYS A 1 80  ? 134.513 3.810   -92.715  1.00 0.00 ? 80  LYS A CE   1  
ATOM 1207  N NZ   . LYS A 1 80  ? 133.212 4.428   -93.099  1.00 0.00 ? 80  LYS A NZ   1  
ATOM 1208  H H    . LYS A 1 80  ? 137.026 -1.131  -95.778  1.00 0.00 ? 80  LYS A H    1  
ATOM 1209  H HA   . LYS A 1 80  ? 137.609 0.087   -93.277  1.00 0.00 ? 80  LYS A HA   1  
ATOM 1210  H HB2  . LYS A 1 80  ? 137.181 1.326   -95.423  1.00 0.00 ? 80  LYS A HB2  1  
ATOM 1211  H HB3  . LYS A 1 80  ? 135.469 0.935   -95.257  1.00 0.00 ? 80  LYS A HB3  1  
ATOM 1212  H HG2  . LYS A 1 80  ? 136.727 2.129   -92.858  1.00 0.00 ? 80  LYS A HG2  1  
ATOM 1213  H HG3  . LYS A 1 80  ? 136.600 3.200   -94.254  1.00 0.00 ? 80  LYS A HG3  1  
ATOM 1214  H HD2  . LYS A 1 80  ? 134.172 2.568   -94.434  1.00 0.00 ? 80  LYS A HD2  1  
ATOM 1215  H HD3  . LYS A 1 80  ? 134.343 1.682   -92.918  1.00 0.00 ? 80  LYS A HD3  1  
ATOM 1216  H HE2  . LYS A 1 80  ? 134.511 3.594   -91.657  1.00 0.00 ? 80  LYS A HE2  1  
ATOM 1217  H HE3  . LYS A 1 80  ? 135.317 4.495   -92.941  1.00 0.00 ? 80  LYS A HE3  1  
ATOM 1218  H HZ1  . LYS A 1 80  ? 132.974 5.181   -92.424  1.00 0.00 ? 80  LYS A HZ1  1  
ATOM 1219  H HZ2  . LYS A 1 80  ? 132.467 3.701   -93.086  1.00 0.00 ? 80  LYS A HZ2  1  
ATOM 1220  H HZ3  . LYS A 1 80  ? 133.288 4.831   -94.053  1.00 0.00 ? 80  LYS A HZ3  1  
ATOM 1221  N N    . ALA A 1 81  ? 134.420 -0.730  -93.612  1.00 0.00 ? 81  ALA A N    1  
ATOM 1222  C CA   . ALA A 1 81  ? 133.231 -1.118  -92.793  1.00 0.00 ? 81  ALA A CA   1  
ATOM 1223  C C    . ALA A 1 81  ? 133.525 -2.414  -92.031  1.00 0.00 ? 81  ALA A C    1  
ATOM 1224  O O    . ALA A 1 81  ? 132.736 -2.868  -91.227  1.00 0.00 ? 81  ALA A O    1  
ATOM 1225  C CB   . ALA A 1 81  ? 132.032 -1.345  -93.712  1.00 0.00 ? 81  ALA A CB   1  
ATOM 1226  H H    . ALA A 1 81  ? 134.334 -0.615  -94.588  1.00 0.00 ? 81  ALA A H    1  
ATOM 1227  H HA   . ALA A 1 81  ? 133.005 -0.327  -92.094  1.00 0.00 ? 81  ALA A HA   1  
ATOM 1228  H HB1  . ALA A 1 81  ? 132.200 -2.231  -94.307  1.00 0.00 ? 81  ALA A HB1  1  
ATOM 1229  H HB2  . ALA A 1 81  ? 131.909 -0.492  -94.361  1.00 0.00 ? 81  ALA A HB2  1  
ATOM 1230  H HB3  . ALA A 1 81  ? 131.142 -1.477  -93.114  1.00 0.00 ? 81  ALA A HB3  1  
ATOM 1231  N N    . ALA A 1 82  ? 134.646 -3.019  -92.295  1.00 0.00 ? 82  ALA A N    1  
ATOM 1232  C CA   . ALA A 1 82  ? 134.991 -4.299  -91.612  1.00 0.00 ? 82  ALA A CA   1  
ATOM 1233  C C    . ALA A 1 82  ? 135.513 -4.074  -90.189  1.00 0.00 ? 82  ALA A C    1  
ATOM 1234  O O    . ALA A 1 82  ? 134.774 -4.182  -89.232  1.00 0.00 ? 82  ALA A O    1  
ATOM 1235  C CB   . ALA A 1 82  ? 136.066 -5.028  -92.414  1.00 0.00 ? 82  ALA A CB   1  
ATOM 1236  H H    . ALA A 1 82  ? 135.257 -2.635  -92.959  1.00 0.00 ? 82  ALA A H    1  
ATOM 1237  H HA   . ALA A 1 82  ? 134.123 -4.938  -91.551  1.00 0.00 ? 82  ALA A HA   1  
ATOM 1238  H HB1  . ALA A 1 82  ? 136.173 -4.563  -93.376  1.00 0.00 ? 82  ALA A HB1  1  
ATOM 1239  H HB2  . ALA A 1 82  ? 135.779 -6.062  -92.543  1.00 0.00 ? 82  ALA A HB2  1  
ATOM 1240  H HB3  . ALA A 1 82  ? 137.006 -4.979  -91.884  1.00 0.00 ? 82  ALA A HB3  1  
ATOM 1241  N N    . GLY A 1 83  ? 136.768 -3.761  -90.024  1.00 0.00 ? 83  GLY A N    1  
ATOM 1242  C CA   . GLY A 1 83  ? 137.281 -3.538  -88.641  1.00 0.00 ? 83  GLY A CA   1  
ATOM 1243  C C    . GLY A 1 83  ? 138.773 -3.211  -88.671  1.00 0.00 ? 83  GLY A C    1  
ATOM 1244  O O    . GLY A 1 83  ? 139.507 -3.552  -87.764  1.00 0.00 ? 83  GLY A O    1  
ATOM 1245  H H    . GLY A 1 83  ? 137.365 -3.674  -90.797  1.00 0.00 ? 83  GLY A H    1  
ATOM 1246  H HA2  . GLY A 1 83  ? 136.744 -2.716  -88.191  1.00 0.00 ? 83  GLY A HA2  1  
ATOM 1247  H HA3  . GLY A 1 83  ? 137.125 -4.430  -88.055  1.00 0.00 ? 83  GLY A HA3  1  
ATOM 1248  N N    . LEU A 1 84  ? 139.234 -2.551  -89.695  1.00 0.00 ? 84  LEU A N    1  
ATOM 1249  C CA   . LEU A 1 84  ? 140.682 -2.210  -89.756  1.00 0.00 ? 84  LEU A CA   1  
ATOM 1250  C C    . LEU A 1 84  ? 140.932 -0.914  -88.981  1.00 0.00 ? 84  LEU A C    1  
ATOM 1251  O O    . LEU A 1 84  ? 140.531 0.155   -89.395  1.00 0.00 ? 84  LEU A O    1  
ATOM 1252  C CB   . LEU A 1 84  ? 141.111 -2.023  -91.212  1.00 0.00 ? 84  LEU A CB   1  
ATOM 1253  C CG   . LEU A 1 84  ? 140.781 -3.278  -92.030  1.00 0.00 ? 84  LEU A CG   1  
ATOM 1254  C CD1  . LEU A 1 84  ? 141.832 -3.457  -93.126  1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1255  C CD2  . LEU A 1 84  ? 140.783 -4.519  -91.129  1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1256  H H    . LEU A 1 84  ? 138.632 -2.278  -90.419  1.00 0.00 ? 84  LEU A H    1  
ATOM 1257  H HA   . LEU A 1 84  ? 141.258 -3.007  -89.310  1.00 0.00 ? 84  LEU A HA   1  
ATOM 1258  H HB2  . LEU A 1 84  ? 140.587 -1.176  -91.631  1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1259  H HB3  . LEU A 1 84  ? 142.174 -1.839  -91.250  1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1260  H HG   . LEU A 1 84  ? 139.807 -3.163  -92.484  1.00 0.00 ? 84  LEU A HG   1  
ATOM 1261  H HD11 . LEU A 1 84  ? 142.806 -3.199  -92.738  1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1262  H HD12 . LEU A 1 84  ? 141.594 -2.813  -93.959  1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1263  H HD13 . LEU A 1 84  ? 141.837 -4.485  -93.453  1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1264  H HD21 . LEU A 1 84  ? 140.625 -5.400  -91.732  1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1265  H HD22 . LEU A 1 84  ? 139.992 -4.439  -90.400  1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1266  H HD23 . LEU A 1 84  ? 141.734 -4.597  -90.623  1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1267  N N    . GLU A 1 85  ? 141.594 -1.003  -87.860  1.00 0.00 ? 85  GLU A N    1  
ATOM 1268  C CA   . GLU A 1 85  ? 141.872 0.222   -87.057  1.00 0.00 ? 85  GLU A CA   1  
ATOM 1269  C C    . GLU A 1 85  ? 143.098 -0.019  -86.173  1.00 0.00 ? 85  GLU A C    1  
ATOM 1270  O O    . GLU A 1 85  ? 143.748 0.907   -85.731  1.00 0.00 ? 85  GLU A O    1  
ATOM 1271  C CB   . GLU A 1 85  ? 140.662 0.541   -86.177  1.00 0.00 ? 85  GLU A CB   1  
ATOM 1272  C CG   . GLU A 1 85  ? 140.916 1.842   -85.412  1.00 0.00 ? 85  GLU A CG   1  
ATOM 1273  C CD   . GLU A 1 85  ? 139.787 2.071   -84.406  1.00 0.00 ? 85  GLU A CD   1  
ATOM 1274  O OE1  . GLU A 1 85  ? 138.639 2.040   -84.817  1.00 0.00 ? 85  GLU A OE1  1  
ATOM 1275  O OE2  . GLU A 1 85  ? 140.090 2.275   -83.242  1.00 0.00 ? 85  GLU A OE2  1  
ATOM 1276  H H    . GLU A 1 85  ? 141.909 -1.876  -87.545  1.00 0.00 ? 85  GLU A H    1  
ATOM 1277  H HA   . GLU A 1 85  ? 142.065 1.051   -87.721  1.00 0.00 ? 85  GLU A HA   1  
ATOM 1278  H HB2  . GLU A 1 85  ? 139.785 0.653   -86.798  1.00 0.00 ? 85  GLU A HB2  1  
ATOM 1279  H HB3  . GLU A 1 85  ? 140.506 -0.263  -85.474  1.00 0.00 ? 85  GLU A HB3  1  
ATOM 1280  H HG2  . GLU A 1 85  ? 141.859 1.772   -84.888  1.00 0.00 ? 85  GLU A HG2  1  
ATOM 1281  H HG3  . GLU A 1 85  ? 140.950 2.668   -86.107  1.00 0.00 ? 85  GLU A HG3  1  
ATOM 1282  N N    . LYS A 1 86  ? 143.418 -1.257  -85.913  1.00 0.00 ? 86  LYS A N    1  
ATOM 1283  C CA   . LYS A 1 86  ? 144.602 -1.561  -85.059  1.00 0.00 ? 86  LYS A CA   1  
ATOM 1284  C C    . LYS A 1 86  ? 144.354 -1.053  -83.637  1.00 0.00 ? 86  LYS A C    1  
ATOM 1285  O O    . LYS A 1 86  ? 143.917 -1.789  -82.773  1.00 0.00 ? 86  LYS A O    1  
ATOM 1286  C CB   . LYS A 1 86  ? 145.840 -0.873  -85.639  1.00 0.00 ? 86  LYS A CB   1  
ATOM 1287  C CG   . LYS A 1 86  ? 147.099 -1.482  -85.019  1.00 0.00 ? 86  LYS A CG   1  
ATOM 1288  C CD   . LYS A 1 86  ? 148.282 -0.536  -85.232  1.00 0.00 ? 86  LYS A CD   1  
ATOM 1289  C CE   . LYS A 1 86  ? 149.550 -1.165  -84.650  1.00 0.00 ? 86  LYS A CE   1  
ATOM 1290  N NZ   . LYS A 1 86  ? 149.726 -0.713  -83.241  1.00 0.00 ? 86  LYS A NZ   1  
ATOM 1291  H H    . LYS A 1 86  ? 142.880 -1.989  -86.281  1.00 0.00 ? 86  LYS A H    1  
ATOM 1292  H HA   . LYS A 1 86  ? 144.762 -2.629  -85.036  1.00 0.00 ? 86  LYS A HA   1  
ATOM 1293  H HB2  . LYS A 1 86  ? 145.861 -1.014  -86.710  1.00 0.00 ? 86  LYS A HB2  1  
ATOM 1294  H HB3  . LYS A 1 86  ? 145.805 0.182   -85.415  1.00 0.00 ? 86  LYS A HB3  1  
ATOM 1295  H HG2  . LYS A 1 86  ? 146.942 -1.632  -83.961  1.00 0.00 ? 86  LYS A HG2  1  
ATOM 1296  H HG3  . LYS A 1 86  ? 147.310 -2.431  -85.490  1.00 0.00 ? 86  LYS A HG3  1  
ATOM 1297  H HD2  . LYS A 1 86  ? 148.419 -0.362  -86.289  1.00 0.00 ? 86  LYS A HD2  1  
ATOM 1298  H HD3  . LYS A 1 86  ? 148.088 0.402   -84.734  1.00 0.00 ? 86  LYS A HD3  1  
ATOM 1299  H HE2  . LYS A 1 86  ? 149.461 -2.241  -84.674  1.00 0.00 ? 86  LYS A HE2  1  
ATOM 1300  H HE3  . LYS A 1 86  ? 150.404 -0.861  -85.235  1.00 0.00 ? 86  LYS A HE3  1  
ATOM 1301  H HZ1  . LYS A 1 86  ? 150.662 -0.273  -83.132  1.00 0.00 ? 86  LYS A HZ1  1  
ATOM 1302  H HZ2  . LYS A 1 86  ? 149.651 -1.532  -82.602  1.00 0.00 ? 86  LYS A HZ2  1  
ATOM 1303  H HZ3  . LYS A 1 86  ? 148.990 -0.019  -83.004  1.00 0.00 ? 86  LYS A HZ3  1  
ATOM 1304  N N    . GLY A 1 87  ? 144.629 0.197   -83.384  1.00 0.00 ? 87  GLY A N    1  
ATOM 1305  C CA   . GLY A 1 87  ? 144.410 0.747   -82.016  1.00 0.00 ? 87  GLY A CA   1  
ATOM 1306  C C    . GLY A 1 87  ? 145.751 0.856   -81.288  1.00 0.00 ? 87  GLY A C    1  
ATOM 1307  O O    . GLY A 1 87  ? 146.802 0.693   -81.876  1.00 0.00 ? 87  GLY A O    1  
ATOM 1308  H H    . GLY A 1 87  ? 144.982 0.774   -84.093  1.00 0.00 ? 87  GLY A H    1  
ATOM 1309  H HA2  . GLY A 1 87  ? 143.958 1.726   -82.090  1.00 0.00 ? 87  GLY A HA2  1  
ATOM 1310  H HA3  . GLY A 1 87  ? 143.757 0.089   -81.463  1.00 0.00 ? 87  GLY A HA3  1  
ATOM 1311  N N    . ALA A 1 88  ? 145.725 1.130   -80.012  1.00 0.00 ? 88  ALA A N    1  
ATOM 1312  C CA   . ALA A 1 88  ? 147.000 1.249   -79.250  1.00 0.00 ? 88  ALA A CA   1  
ATOM 1313  C C    . ALA A 1 88  ? 146.849 0.567   -77.889  1.00 0.00 ? 88  ALA A C    1  
ATOM 1314  O O    . ALA A 1 88  ? 147.199 -0.584  -77.718  1.00 0.00 ? 88  ALA A O    1  
ATOM 1315  C CB   . ALA A 1 88  ? 147.336 2.728   -79.044  1.00 0.00 ? 88  ALA A CB   1  
ATOM 1316  H H    . ALA A 1 88  ? 144.867 1.258   -79.555  1.00 0.00 ? 88  ALA A H    1  
ATOM 1317  H HA   . ALA A 1 88  ? 147.796 0.773   -79.804  1.00 0.00 ? 88  ALA A HA   1  
ATOM 1318  H HB1  . ALA A 1 88  ? 148.181 2.816   -78.378  1.00 0.00 ? 88  ALA A HB1  1  
ATOM 1319  H HB2  . ALA A 1 88  ? 146.484 3.234   -78.614  1.00 0.00 ? 88  ALA A HB2  1  
ATOM 1320  H HB3  . ALA A 1 88  ? 147.579 3.177   -79.996  1.00 0.00 ? 88  ALA A HB3  1  
ATOM 1321  N N    . HIS A 1 89  ? 146.329 1.267   -76.918  1.00 0.00 ? 89  HIS A N    1  
ATOM 1322  C CA   . HIS A 1 89  ? 146.156 0.658   -75.569  1.00 0.00 ? 89  HIS A CA   1  
ATOM 1323  C C    . HIS A 1 89  ? 144.672 0.652   -75.198  1.00 0.00 ? 89  HIS A C    1  
ATOM 1324  O O    . HIS A 1 89  ? 144.137 1.633   -74.722  1.00 0.00 ? 89  HIS A O    1  
ATOM 1325  C CB   . HIS A 1 89  ? 146.937 1.474   -74.536  1.00 0.00 ? 89  HIS A CB   1  
ATOM 1326  C CG   . HIS A 1 89  ? 146.698 0.906   -73.164  1.00 0.00 ? 89  HIS A CG   1  
ATOM 1327  N ND1  . HIS A 1 89  ? 147.211 -0.321  -72.772  1.00 0.00 ? 89  HIS A ND1  1  
ATOM 1328  C CD2  . HIS A 1 89  ? 146.005 1.386   -72.080  1.00 0.00 ? 89  HIS A CD2  1  
ATOM 1329  C CE1  . HIS A 1 89  ? 146.821 -0.536  -71.502  1.00 0.00 ? 89  HIS A CE1  1  
ATOM 1330  N NE2  . HIS A 1 89  ? 146.084 0.473   -71.032  1.00 0.00 ? 89  HIS A NE2  1  
ATOM 1331  H H    . HIS A 1 89  ? 146.053 2.194   -77.075  1.00 0.00 ? 89  HIS A H    1  
ATOM 1332  H HA   . HIS A 1 89  ? 146.528 -0.356  -75.582  1.00 0.00 ? 89  HIS A HA   1  
ATOM 1333  H HB2  . HIS A 1 89  ? 147.991 1.431   -74.766  1.00 0.00 ? 89  HIS A HB2  1  
ATOM 1334  H HB3  . HIS A 1 89  ? 146.604 2.501   -74.563  1.00 0.00 ? 89  HIS A HB3  1  
ATOM 1335  H HD1  . HIS A 1 89  ? 147.757 -0.922  -73.320  1.00 0.00 ? 89  HIS A HD1  1  
ATOM 1336  H HD2  . HIS A 1 89  ? 145.477 2.328   -72.046  1.00 0.00 ? 89  HIS A HD2  1  
ATOM 1337  H HE1  . HIS A 1 89  ? 147.075 -1.418  -70.932  1.00 0.00 ? 89  HIS A HE1  1  
ATOM 1338  N N    . LYS A 1 90  ? 144.002 -0.447  -75.412  1.00 0.00 ? 90  LYS A N    1  
ATOM 1339  C CA   . LYS A 1 90  ? 142.553 -0.515  -75.072  1.00 0.00 ? 90  LYS A CA   1  
ATOM 1340  C C    . LYS A 1 90  ? 142.324 -1.626  -74.044  1.00 0.00 ? 90  LYS A C    1  
ATOM 1341  O O    . LYS A 1 90  ? 143.127 -2.527  -73.904  1.00 0.00 ? 90  LYS A O    1  
ATOM 1342  C CB   . LYS A 1 90  ? 141.748 -0.817  -76.338  1.00 0.00 ? 90  LYS A CB   1  
ATOM 1343  C CG   . LYS A 1 90  ? 141.159 0.482   -76.891  1.00 0.00 ? 90  LYS A CG   1  
ATOM 1344  C CD   . LYS A 1 90  ? 140.941 0.342   -78.399  1.00 0.00 ? 90  LYS A CD   1  
ATOM 1345  C CE   . LYS A 1 90  ? 139.880 -0.728  -78.664  1.00 0.00 ? 90  LYS A CE   1  
ATOM 1346  N NZ   . LYS A 1 90  ? 138.790 -0.607  -77.655  1.00 0.00 ? 90  LYS A NZ   1  
ATOM 1347  H H    . LYS A 1 90  ? 144.452 -1.228  -75.797  1.00 0.00 ? 90  LYS A H    1  
ATOM 1348  H HA   . LYS A 1 90  ? 142.236 0.430   -74.660  1.00 0.00 ? 90  LYS A HA   1  
ATOM 1349  H HB2  . LYS A 1 90  ? 142.396 -1.264  -77.078  1.00 0.00 ? 90  LYS A HB2  1  
ATOM 1350  H HB3  . LYS A 1 90  ? 140.947 -1.501  -76.101  1.00 0.00 ? 90  LYS A HB3  1  
ATOM 1351  H HG2  . LYS A 1 90  ? 140.215 0.684   -76.407  1.00 0.00 ? 90  LYS A HG2  1  
ATOM 1352  H HG3  . LYS A 1 90  ? 141.843 1.296   -76.703  1.00 0.00 ? 90  LYS A HG3  1  
ATOM 1353  H HD2  . LYS A 1 90  ? 140.609 1.287   -78.804  1.00 0.00 ? 90  LYS A HD2  1  
ATOM 1354  H HD3  . LYS A 1 90  ? 141.867 0.053   -78.872  1.00 0.00 ? 90  LYS A HD3  1  
ATOM 1355  H HE2  . LYS A 1 90  ? 139.471 -0.592  -79.654  1.00 0.00 ? 90  LYS A HE2  1  
ATOM 1356  H HE3  . LYS A 1 90  ? 140.330 -1.707  -78.592  1.00 0.00 ? 90  LYS A HE3  1  
ATOM 1357  H HZ1  . LYS A 1 90  ? 138.676 0.390   -77.384  1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 1358  H HZ2  . LYS A 1 90  ? 139.032 -1.170  -76.814  1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 1359  H HZ3  . LYS A 1 90  ? 137.900 -0.956  -78.062  1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 1360  N N    . PRO A 1 91  ? 141.231 -1.560  -73.332  1.00 0.00 ? 91  PRO A N    1  
ATOM 1361  C CA   . PRO A 1 91  ? 140.906 -2.588  -72.306  1.00 0.00 ? 91  PRO A CA   1  
ATOM 1362  C C    . PRO A 1 91  ? 140.869 -4.003  -72.891  1.00 0.00 ? 91  PRO A C    1  
ATOM 1363  O O    . PRO A 1 91  ? 140.823 -4.982  -72.172  1.00 0.00 ? 91  PRO A O    1  
ATOM 1364  C CB   . PRO A 1 91  ? 139.516 -2.161  -71.830  1.00 0.00 ? 91  PRO A CB   1  
ATOM 1365  C CG   . PRO A 1 91  ? 139.111 -0.875  -72.564  1.00 0.00 ? 91  PRO A CG   1  
ATOM 1366  C CD   . PRO A 1 91  ? 140.248 -0.460  -73.502  1.00 0.00 ? 91  PRO A CD   1  
ATOM 1367  H HA   . PRO A 1 91  ? 141.602 -2.536  -71.485  1.00 0.00 ? 91  PRO A HA   1  
ATOM 1368  H HB2  . PRO A 1 91  ? 138.804 -2.944  -72.048  1.00 0.00 ? 91  PRO A HB2  1  
ATOM 1369  H HB3  . PRO A 1 91  ? 139.538 -1.977  -70.767  1.00 0.00 ? 91  PRO A HB3  1  
ATOM 1370  H HG2  . PRO A 1 91  ? 138.212 -1.053  -73.137  1.00 0.00 ? 91  PRO A HG2  1  
ATOM 1371  H HG3  . PRO A 1 91  ? 138.933 -0.089  -71.845  1.00 0.00 ? 91  PRO A HG3  1  
ATOM 1372  H HD2  . PRO A 1 91  ? 139.898 -0.407  -74.525  1.00 0.00 ? 91  PRO A HD2  1  
ATOM 1373  H HD3  . PRO A 1 91  ? 140.678 0.478   -73.191  1.00 0.00 ? 91  PRO A HD3  1  
ATOM 1374  N N    . GLY A 1 92  ? 140.890 -4.118  -74.191  1.00 0.00 ? 92  GLY A N    1  
ATOM 1375  C CA   . GLY A 1 92  ? 140.857 -5.469  -74.821  1.00 0.00 ? 92  GLY A CA   1  
ATOM 1376  C C    . GLY A 1 92  ? 139.427 -5.798  -75.253  1.00 0.00 ? 92  GLY A C    1  
ATOM 1377  O O    . GLY A 1 92  ? 138.573 -4.935  -75.317  1.00 0.00 ? 92  GLY A O    1  
ATOM 1378  H H    . GLY A 1 92  ? 140.928 -3.316  -74.753  1.00 0.00 ? 92  GLY A H    1  
ATOM 1379  H HA2  . GLY A 1 92  ? 141.506 -5.478  -75.685  1.00 0.00 ? 92  GLY A HA2  1  
ATOM 1380  H HA3  . GLY A 1 92  ? 141.192 -6.207  -74.109  1.00 0.00 ? 92  GLY A HA3  1  
ATOM 1381  N N    . ARG A 1 93  ? 139.158 -7.040  -75.550  1.00 0.00 ? 93  ARG A N    1  
ATOM 1382  C CA   . ARG A 1 93  ? 137.783 -7.424  -75.977  1.00 0.00 ? 93  ARG A CA   1  
ATOM 1383  C C    . ARG A 1 93  ? 137.451 -6.740  -77.305  1.00 0.00 ? 93  ARG A C    1  
ATOM 1384  O O    . ARG A 1 93  ? 136.847 -5.687  -77.338  1.00 0.00 ? 93  ARG A O    1  
ATOM 1385  C CB   . ARG A 1 93  ? 136.777 -6.987  -74.910  1.00 0.00 ? 93  ARG A CB   1  
ATOM 1386  C CG   . ARG A 1 93  ? 137.313 -7.350  -73.524  1.00 0.00 ? 93  ARG A CG   1  
ATOM 1387  C CD   . ARG A 1 93  ? 137.287 -8.869  -73.350  1.00 0.00 ? 93  ARG A CD   1  
ATOM 1388  N NE   . ARG A 1 93  ? 136.704 -9.214  -72.019  1.00 0.00 ? 93  ARG A NE   1  
ATOM 1389  C CZ   . ARG A 1 93  ? 137.015 -8.521  -70.956  1.00 0.00 ? 93  ARG A CZ   1  
ATOM 1390  N NH1  . ARG A 1 93  ? 137.887 -7.553  -71.033  1.00 0.00 ? 93  ARG A NH1  1  
ATOM 1391  N NH2  . ARG A 1 93  ? 136.464 -8.808  -69.808  1.00 0.00 ? 93  ARG A NH2  1  
ATOM 1392  H H    . ARG A 1 93  ? 139.861 -7.720  -75.491  1.00 0.00 ? 93  ARG A H    1  
ATOM 1393  H HA   . ARG A 1 93  ? 137.732 -8.496  -76.102  1.00 0.00 ? 93  ARG A HA   1  
ATOM 1394  H HB2  . ARG A 1 93  ? 136.629 -5.918  -74.972  1.00 0.00 ? 93  ARG A HB2  1  
ATOM 1395  H HB3  . ARG A 1 93  ? 135.837 -7.491  -75.074  1.00 0.00 ? 93  ARG A HB3  1  
ATOM 1396  H HG2  . ARG A 1 93  ? 138.328 -6.992  -73.427  1.00 0.00 ? 93  ARG A HG2  1  
ATOM 1397  H HG3  . ARG A 1 93  ? 136.694 -6.891  -72.768  1.00 0.00 ? 93  ARG A HG3  1  
ATOM 1398  H HD2  . ARG A 1 93  ? 136.677 -9.307  -74.123  1.00 0.00 ? 93  ARG A HD2  1  
ATOM 1399  H HD3  . ARG A 1 93  ? 138.295 -9.257  -73.426  1.00 0.00 ? 93  ARG A HD3  1  
ATOM 1400  H HE   . ARG A 1 93  ? 136.069 -9.958  -71.945  1.00 0.00 ? 93  ARG A HE   1  
ATOM 1401  H HH11 . ARG A 1 93  ? 138.322 -7.340  -71.906  1.00 0.00 ? 93  ARG A HH11 1  
ATOM 1402  H HH12 . ARG A 1 93  ? 138.121 -7.025  -70.217  1.00 0.00 ? 93  ARG A HH12 1  
ATOM 1403  H HH21 . ARG A 1 93  ? 135.806 -9.558  -69.743  1.00 0.00 ? 93  ARG A HH21 1  
ATOM 1404  H HH22 . ARG A 1 93  ? 136.701 -8.279  -68.993  1.00 0.00 ? 93  ARG A HH22 1  
ATOM 1405  N N    . GLU A 1 94  ? 137.842 -7.331  -78.402  1.00 0.00 ? 94  GLU A N    1  
ATOM 1406  C CA   . GLU A 1 94  ? 137.549 -6.715  -79.727  1.00 0.00 ? 94  GLU A CA   1  
ATOM 1407  C C    . GLU A 1 94  ? 138.028 -7.649  -80.840  1.00 0.00 ? 94  GLU A C    1  
ATOM 1408  O O    . GLU A 1 94  ? 138.546 -8.718  -80.586  1.00 0.00 ? 94  GLU A O    1  
ATOM 1409  C CB   . GLU A 1 94  ? 138.278 -5.373  -79.837  1.00 0.00 ? 94  GLU A CB   1  
ATOM 1410  C CG   . GLU A 1 94  ? 137.704 -4.573  -81.008  1.00 0.00 ? 94  GLU A CG   1  
ATOM 1411  C CD   . GLU A 1 94  ? 137.798 -3.077  -80.699  1.00 0.00 ? 94  GLU A CD   1  
ATOM 1412  O OE1  . GLU A 1 94  ? 137.444 -2.698  -79.595  1.00 0.00 ? 94  GLU A OE1  1  
ATOM 1413  O OE2  . GLU A 1 94  ? 138.223 -2.338  -81.571  1.00 0.00 ? 94  GLU A OE2  1  
ATOM 1414  H H    . GLU A 1 94  ? 138.328 -8.181  -78.353  1.00 0.00 ? 94  GLU A H    1  
ATOM 1415  H HA   . GLU A 1 94  ? 136.485 -6.556  -79.822  1.00 0.00 ? 94  GLU A HA   1  
ATOM 1416  H HB2  . GLU A 1 94  ? 138.145 -4.816  -78.920  1.00 0.00 ? 94  GLU A HB2  1  
ATOM 1417  H HB3  . GLU A 1 94  ? 139.330 -5.548  -80.004  1.00 0.00 ? 94  GLU A HB3  1  
ATOM 1418  H HG2  . GLU A 1 94  ? 138.268 -4.792  -81.904  1.00 0.00 ? 94  GLU A HG2  1  
ATOM 1419  H HG3  . GLU A 1 94  ? 136.670 -4.843  -81.158  1.00 0.00 ? 94  GLU A HG3  1  
ATOM 1420  N N    . LYS A 1 95  ? 137.858 -7.257  -82.074  1.00 0.00 ? 95  LYS A N    1  
ATOM 1421  C CA   . LYS A 1 95  ? 138.304 -8.126  -83.200  1.00 0.00 ? 95  LYS A CA   1  
ATOM 1422  C C    . LYS A 1 95  ? 138.495 -7.277  -84.460  1.00 0.00 ? 95  LYS A C    1  
ATOM 1423  O O    . LYS A 1 95  ? 138.425 -6.065  -84.419  1.00 0.00 ? 95  LYS A O    1  
ATOM 1424  C CB   . LYS A 1 95  ? 137.247 -9.201  -83.464  1.00 0.00 ? 95  LYS A CB   1  
ATOM 1425  C CG   . LYS A 1 95  ? 137.194 -10.166 -82.277  1.00 0.00 ? 95  LYS A CG   1  
ATOM 1426  C CD   . LYS A 1 95  ? 136.431 -11.430 -82.679  1.00 0.00 ? 95  LYS A CD   1  
ATOM 1427  C CE   . LYS A 1 95  ? 134.929 -11.204 -82.495  1.00 0.00 ? 95  LYS A CE   1  
ATOM 1428  N NZ   . LYS A 1 95  ? 134.227 -12.519 -82.480  1.00 0.00 ? 95  LYS A NZ   1  
ATOM 1429  H H    . LYS A 1 95  ? 137.438 -6.391  -82.260  1.00 0.00 ? 95  LYS A H    1  
ATOM 1430  H HA   . LYS A 1 95  ? 139.240 -8.599  -82.940  1.00 0.00 ? 95  LYS A HA   1  
ATOM 1431  H HB2  . LYS A 1 95  ? 136.282 -8.732  -83.592  1.00 0.00 ? 95  LYS A HB2  1  
ATOM 1432  H HB3  . LYS A 1 95  ? 137.505 -9.747  -84.358  1.00 0.00 ? 95  LYS A HB3  1  
ATOM 1433  H HG2  . LYS A 1 95  ? 138.199 -10.429 -81.982  1.00 0.00 ? 95  LYS A HG2  1  
ATOM 1434  H HG3  . LYS A 1 95  ? 136.689 -9.691  -81.450  1.00 0.00 ? 95  LYS A HG3  1  
ATOM 1435  H HD2  . LYS A 1 95  ? 136.637 -11.661 -83.714  1.00 0.00 ? 95  LYS A HD2  1  
ATOM 1436  H HD3  . LYS A 1 95  ? 136.748 -12.254 -82.057  1.00 0.00 ? 95  LYS A HD3  1  
ATOM 1437  H HE2  . LYS A 1 95  ? 134.754 -10.692 -81.561  1.00 0.00 ? 95  LYS A HE2  1  
ATOM 1438  H HE3  . LYS A 1 95  ? 134.553 -10.604 -83.311  1.00 0.00 ? 95  LYS A HE3  1  
ATOM 1439  H HZ1  . LYS A 1 95  ? 134.839 -13.234 -82.038  1.00 0.00 ? 95  LYS A HZ1  1  
ATOM 1440  H HZ2  . LYS A 1 95  ? 134.008 -12.805 -83.456  1.00 0.00 ? 95  LYS A HZ2  1  
ATOM 1441  H HZ3  . LYS A 1 95  ? 133.346 -12.435 -81.936  1.00 0.00 ? 95  LYS A HZ3  1  
ATOM 1442  N N    . VAL A 1 96  ? 138.737 -7.905  -85.579  1.00 0.00 ? 96  VAL A N    1  
ATOM 1443  C CA   . VAL A 1 96  ? 138.933 -7.135  -86.840  1.00 0.00 ? 96  VAL A CA   1  
ATOM 1444  C C    . VAL A 1 96  ? 138.108 -7.769  -87.962  1.00 0.00 ? 96  VAL A C    1  
ATOM 1445  O O    . VAL A 1 96  ? 137.818 -8.949  -87.941  1.00 0.00 ? 96  VAL A O    1  
ATOM 1446  C CB   . VAL A 1 96  ? 140.414 -7.155  -87.226  1.00 0.00 ? 96  VAL A CB   1  
ATOM 1447  C CG1  . VAL A 1 96  ? 140.601 -6.474  -88.583  1.00 0.00 ? 96  VAL A CG1  1  
ATOM 1448  C CG2  . VAL A 1 96  ? 141.226 -6.407  -86.166  1.00 0.00 ? 96  VAL A CG2  1  
ATOM 1449  H H    . VAL A 1 96  ? 138.790 -8.884  -85.590  1.00 0.00 ? 96  VAL A H    1  
ATOM 1450  H HA   . VAL A 1 96  ? 138.614 -6.114  -86.692  1.00 0.00 ? 96  VAL A HA   1  
ATOM 1451  H HB   . VAL A 1 96  ? 140.756 -8.178  -87.288  1.00 0.00 ? 96  VAL A HB   1  
ATOM 1452  H HG11 . VAL A 1 96  ? 141.631 -6.568  -88.894  1.00 0.00 ? 96  VAL A HG11 1  
ATOM 1453  H HG12 . VAL A 1 96  ? 140.345 -5.430  -88.498  1.00 0.00 ? 96  VAL A HG12 1  
ATOM 1454  H HG13 . VAL A 1 96  ? 139.960 -6.945  -89.314  1.00 0.00 ? 96  VAL A HG13 1  
ATOM 1455  H HG21 . VAL A 1 96  ? 142.258 -6.345  -86.480  1.00 0.00 ? 96  VAL A HG21 1  
ATOM 1456  H HG22 . VAL A 1 96  ? 141.166 -6.936  -85.227  1.00 0.00 ? 96  VAL A HG22 1  
ATOM 1457  H HG23 . VAL A 1 96  ? 140.827 -5.411  -86.045  1.00 0.00 ? 96  VAL A HG23 1  
ATOM 1458  N N    . GLY A 1 97  ? 137.729 -6.996  -88.943  1.00 0.00 ? 97  GLY A N    1  
ATOM 1459  C CA   . GLY A 1 97  ? 136.925 -7.555  -90.066  1.00 0.00 ? 97  GLY A CA   1  
ATOM 1460  C C    . GLY A 1 97  ? 135.480 -7.764  -89.610  1.00 0.00 ? 97  GLY A C    1  
ATOM 1461  O O    . GLY A 1 97  ? 134.960 -8.865  -89.644  1.00 0.00 ? 97  GLY A O    1  
ATOM 1462  H H    . GLY A 1 97  ? 137.975 -6.047  -88.941  1.00 0.00 ? 97  GLY A H    1  
ATOM 1463  H HA2  . GLY A 1 97  ? 136.946 -6.869  -90.899  1.00 0.00 ? 97  GLY A HA2  1  
ATOM 1464  H HA3  . GLY A 1 97  ? 137.343 -8.502  -90.371  1.00 0.00 ? 97  GLY A HA3  1  
ATOM 1465  N N    . ARG A 1 98  ? 134.823 -6.720  -89.181  1.00 0.00 ? 98  ARG A N    1  
ATOM 1466  C CA   . ARG A 1 98  ? 133.415 -6.878  -88.724  1.00 0.00 ? 98  ARG A CA   1  
ATOM 1467  C C    . ARG A 1 98  ? 132.534 -5.778  -89.323  1.00 0.00 ? 98  ARG A C    1  
ATOM 1468  O O    . ARG A 1 98  ? 132.691 -4.608  -89.039  1.00 0.00 ? 98  ARG A O    1  
ATOM 1469  C CB   . ARG A 1 98  ? 133.361 -6.803  -87.196  1.00 0.00 ? 98  ARG A CB   1  
ATOM 1470  C CG   . ARG A 1 98  ? 132.914 -8.155  -86.634  1.00 0.00 ? 98  ARG A CG   1  
ATOM 1471  C CD   . ARG A 1 98  ? 132.531 -7.996  -85.162  1.00 0.00 ? 98  ARG A CD   1  
ATOM 1472  N NE   . ARG A 1 98  ? 132.342 -9.341  -84.550  1.00 0.00 ? 98  ARG A NE   1  
ATOM 1473  C CZ   . ARG A 1 98  ? 132.307 -9.469  -83.251  1.00 0.00 ? 98  ARG A CZ   1  
ATOM 1474  N NH1  . ARG A 1 98  ? 132.436 -8.418  -82.489  1.00 0.00 ? 98  ARG A NH1  1  
ATOM 1475  N NH2  . ARG A 1 98  ? 132.142 -10.647 -82.716  1.00 0.00 ? 98  ARG A NH2  1  
ATOM 1476  H H    . ARG A 1 98  ? 135.254 -5.840  -89.158  1.00 0.00 ? 98  ARG A H    1  
ATOM 1477  H HA   . ARG A 1 98  ? 133.050 -7.839  -89.048  1.00 0.00 ? 98  ARG A HA   1  
ATOM 1478  H HB2  . ARG A 1 98  ? 134.342 -6.560  -86.813  1.00 0.00 ? 98  ARG A HB2  1  
ATOM 1479  H HB3  . ARG A 1 98  ? 132.658 -6.041  -86.897  1.00 0.00 ? 98  ARG A HB3  1  
ATOM 1480  H HG2  . ARG A 1 98  ? 132.061 -8.512  -87.193  1.00 0.00 ? 98  ARG A HG2  1  
ATOM 1481  H HG3  . ARG A 1 98  ? 133.723 -8.865  -86.719  1.00 0.00 ? 98  ARG A HG3  1  
ATOM 1482  H HD2  . ARG A 1 98  ? 133.317 -7.470  -84.640  1.00 0.00 ? 98  ARG A HD2  1  
ATOM 1483  H HD3  . ARG A 1 98  ? 131.611 -7.435  -85.088  1.00 0.00 ? 98  ARG A HD3  1  
ATOM 1484  H HE   . ARG A 1 98  ? 132.245 -10.131 -85.122  1.00 0.00 ? 98  ARG A HE   1  
ATOM 1485  H HH11 . ARG A 1 98  ? 132.563 -7.515  -82.899  1.00 0.00 ? 98  ARG A HH11 1  
ATOM 1486  H HH12 . ARG A 1 98  ? 132.409 -8.515  -81.494  1.00 0.00 ? 98  ARG A HH12 1  
ATOM 1487  H HH21 . ARG A 1 98  ? 132.042 -11.453 -83.300  1.00 0.00 ? 98  ARG A HH21 1  
ATOM 1488  H HH22 . ARG A 1 98  ? 132.114 -10.745 -81.721  1.00 0.00 ? 98  ARG A HH22 1  
ATOM 1489  N N    . ILE A 1 99  ? 131.599 -6.161  -90.145  1.00 0.00 ? 99  ILE A N    1  
ATOM 1490  C CA   . ILE A 1 99  ? 130.682 -5.172  -90.777  1.00 0.00 ? 99  ILE A CA   1  
ATOM 1491  C C    . ILE A 1 99  ? 129.313 -5.264  -90.104  1.00 0.00 ? 99  ILE A C    1  
ATOM 1492  O O    . ILE A 1 99  ? 129.082 -6.119  -89.275  1.00 0.00 ? 99  ILE A O    1  
ATOM 1493  C CB   . ILE A 1 99  ? 130.533 -5.504  -92.265  1.00 0.00 ? 99  ILE A CB   1  
ATOM 1494  C CG1  . ILE A 1 99  ? 130.831 -6.992  -92.480  1.00 0.00 ? 99  ILE A CG1  1  
ATOM 1495  C CG2  . ILE A 1 99  ? 131.509 -4.662  -93.088  1.00 0.00 ? 99  ILE A CG2  1  
ATOM 1496  C CD1  . ILE A 1 99  ? 129.891 -7.560  -93.539  1.00 0.00 ? 99  ILE A CD1  1  
ATOM 1497  H H    . ILE A 1 99  ? 131.495 -7.112  -90.347  1.00 0.00 ? 99  ILE A H    1  
ATOM 1498  H HA   . ILE A 1 99  ? 131.080 -4.175  -90.663  1.00 0.00 ? 99  ILE A HA   1  
ATOM 1499  H HB   . ILE A 1 99  ? 129.523 -5.291  -92.579  1.00 0.00 ? 99  ILE A HB   1  
ATOM 1500  H HG12 . ILE A 1 99  ? 131.853 -7.111  -92.805  1.00 0.00 ? 99  ILE A HG12 1  
ATOM 1501  H HG13 . ILE A 1 99  ? 130.683 -7.526  -91.556  1.00 0.00 ? 99  ILE A HG13 1  
ATOM 1502  H HG21 . ILE A 1 99  ? 132.514 -5.019  -92.932  1.00 0.00 ? 99  ILE A HG21 1  
ATOM 1503  H HG22 . ILE A 1 99  ? 131.441 -3.629  -92.781  1.00 0.00 ? 99  ILE A HG22 1  
ATOM 1504  H HG23 . ILE A 1 99  ? 131.257 -4.743  -94.135  1.00 0.00 ? 99  ILE A HG23 1  
ATOM 1505  H HD11 . ILE A 1 99  ? 128.923 -7.738  -93.097  1.00 0.00 ? 99  ILE A HD11 1  
ATOM 1506  H HD12 . ILE A 1 99  ? 130.291 -8.489  -93.913  1.00 0.00 ? 99  ILE A HD12 1  
ATOM 1507  H HD13 . ILE A 1 99  ? 129.795 -6.856  -94.352  1.00 0.00 ? 99  ILE A HD13 1  
ATOM 1508  N N    . THR A 1 100 ? 128.396 -4.404  -90.456  1.00 0.00 ? 100 THR A N    1  
ATOM 1509  C CA   . THR A 1 100 ? 127.050 -4.479  -89.826  1.00 0.00 ? 100 THR A CA   1  
ATOM 1510  C C    . THR A 1 100 ? 126.002 -4.693  -90.914  1.00 0.00 ? 100 THR A C    1  
ATOM 1511  O O    . THR A 1 100 ? 126.215 -4.379  -92.067  1.00 0.00 ? 100 THR A O    1  
ATOM 1512  C CB   . THR A 1 100 ? 126.735 -3.194  -89.056  1.00 0.00 ? 100 THR A CB   1  
ATOM 1513  O OG1  . THR A 1 100 ? 125.977 -2.322  -89.882  1.00 0.00 ? 100 THR A OG1  1  
ATOM 1514  C CG2  . THR A 1 100 ? 128.027 -2.497  -88.637  1.00 0.00 ? 100 THR A CG2  1  
ATOM 1515  H H    . THR A 1 100 ? 128.590 -3.722  -91.133  1.00 0.00 ? 100 THR A H    1  
ATOM 1516  H HA   . THR A 1 100 ? 127.024 -5.318  -89.148  1.00 0.00 ? 100 THR A HA   1  
ATOM 1517  H HB   . THR A 1 100 ? 126.169 -3.444  -88.171  1.00 0.00 ? 100 THR A HB   1  
ATOM 1518  H HG1  . THR A 1 100 ? 125.139 -2.152  -89.444  1.00 0.00 ? 100 THR A HG1  1  
ATOM 1519  H HG21 . THR A 1 100 ? 128.100 -2.499  -87.561  1.00 0.00 ? 100 THR A HG21 1  
ATOM 1520  H HG22 . THR A 1 100 ? 128.015 -1.479  -88.994  1.00 0.00 ? 100 THR A HG22 1  
ATOM 1521  H HG23 . THR A 1 100 ? 128.873 -3.015  -89.057  1.00 0.00 ? 100 THR A HG23 1  
ATOM 1522  N N    . TRP A 1 101 ? 124.878 -5.236  -90.556  1.00 0.00 ? 101 TRP A N    1  
ATOM 1523  C CA   . TRP A 1 101 ? 123.815 -5.496  -91.563  1.00 0.00 ? 101 TRP A CA   1  
ATOM 1524  C C    . TRP A 1 101 ? 123.618 -4.289  -92.486  1.00 0.00 ? 101 TRP A C    1  
ATOM 1525  O O    . TRP A 1 101 ? 123.931 -4.343  -93.659  1.00 0.00 ? 101 TRP A O    1  
ATOM 1526  C CB   . TRP A 1 101 ? 122.501 -5.809  -90.846  1.00 0.00 ? 101 TRP A CB   1  
ATOM 1527  C CG   . TRP A 1 101 ? 121.563 -6.480  -91.799  1.00 0.00 ? 101 TRP A CG   1  
ATOM 1528  C CD1  . TRP A 1 101 ? 120.282 -6.105  -92.021  1.00 0.00 ? 101 TRP A CD1  1  
ATOM 1529  C CD2  . TRP A 1 101 ? 121.809 -7.629  -92.661  1.00 0.00 ? 101 TRP A CD2  1  
ATOM 1530  N NE1  . TRP A 1 101 ? 119.727 -6.949  -92.966  1.00 0.00 ? 101 TRP A NE1  1  
ATOM 1531  C CE2  . TRP A 1 101 ? 120.629 -7.905  -93.391  1.00 0.00 ? 101 TRP A CE2  1  
ATOM 1532  C CE3  . TRP A 1 101 ? 122.930 -8.451  -92.880  1.00 0.00 ? 101 TRP A CE3  1  
ATOM 1533  C CZ2  . TRP A 1 101 ? 120.563 -8.957  -94.305  1.00 0.00 ? 101 TRP A CZ2  1  
ATOM 1534  C CZ3  . TRP A 1 101 ? 122.868 -9.508  -93.798  1.00 0.00 ? 101 TRP A CZ3  1  
ATOM 1535  C CH2  . TRP A 1 101 ? 121.688 -9.762  -94.511  1.00 0.00 ? 101 TRP A CH2  1  
ATOM 1536  H H    . TRP A 1 101 ? 124.735 -5.488  -89.620  1.00 0.00 ? 101 TRP A H    1  
ATOM 1537  H HA   . TRP A 1 101 ? 124.100 -6.345  -92.159  1.00 0.00 ? 101 TRP A HA   1  
ATOM 1538  H HB2  . TRP A 1 101 ? 122.694 -6.464  -90.009  1.00 0.00 ? 101 TRP A HB2  1  
ATOM 1539  H HB3  . TRP A 1 101 ? 122.056 -4.891  -90.490  1.00 0.00 ? 101 TRP A HB3  1  
ATOM 1540  H HD1  . TRP A 1 101 ? 119.776 -5.281  -91.540  1.00 0.00 ? 101 TRP A HD1  1  
ATOM 1541  H HE1  . TRP A 1 101 ? 118.809 -6.893  -93.304  1.00 0.00 ? 101 TRP A HE1  1  
ATOM 1542  H HE3  . TRP A 1 101 ? 123.844 -8.270  -92.337  1.00 0.00 ? 101 TRP A HE3  1  
ATOM 1543  H HZ2  . TRP A 1 101 ? 119.651 -9.148  -94.852  1.00 0.00 ? 101 TRP A HZ2  1  
ATOM 1544  H HZ3  . TRP A 1 101 ? 123.737 -10.127 -93.958  1.00 0.00 ? 101 TRP A HZ3  1  
ATOM 1545  H HH2  . TRP A 1 101 ? 121.647 -10.578 -95.217  1.00 0.00 ? 101 TRP A HH2  1  
ATOM 1546  N N    . GLU A 1 102 ? 123.075 -3.212  -91.994  1.00 0.00 ? 102 GLU A N    1  
ATOM 1547  C CA   . GLU A 1 102 ? 122.827 -2.034  -92.877  1.00 0.00 ? 102 GLU A CA   1  
ATOM 1548  C C    . GLU A 1 102 ? 124.078 -1.660  -93.663  1.00 0.00 ? 102 GLU A C    1  
ATOM 1549  O O    . GLU A 1 102 ? 124.041 -1.498  -94.870  1.00 0.00 ? 102 GLU A O    1  
ATOM 1550  C CB   . GLU A 1 102 ? 122.391 -0.845  -92.017  1.00 0.00 ? 102 GLU A CB   1  
ATOM 1551  C CG   . GLU A 1 102 ? 122.751 0.463   -92.725  1.00 0.00 ? 102 GLU A CG   1  
ATOM 1552  C CD   . GLU A 1 102 ? 122.274 0.409   -94.178  1.00 0.00 ? 102 GLU A CD   1  
ATOM 1553  O OE1  . GLU A 1 102 ? 121.409 -0.400  -94.468  1.00 0.00 ? 102 GLU A OE1  1  
ATOM 1554  O OE2  . GLU A 1 102 ? 122.781 1.181   -94.975  1.00 0.00 ? 102 GLU A OE2  1  
ATOM 1555  H H    . GLU A 1 102 ? 122.802 -3.158  -91.056  1.00 0.00 ? 102 GLU A H    1  
ATOM 1556  H HA   . GLU A 1 102 ? 122.040 -2.289  -93.568  1.00 0.00 ? 102 GLU A HA   1  
ATOM 1557  H HB2  . GLU A 1 102 ? 121.323 -0.888  -91.860  1.00 0.00 ? 102 GLU A HB2  1  
ATOM 1558  H HB3  . GLU A 1 102 ? 122.896 -0.887  -91.064  1.00 0.00 ? 102 GLU A HB3  1  
ATOM 1559  H HG2  . GLU A 1 102 ? 122.272 1.288   -92.219  1.00 0.00 ? 102 GLU A HG2  1  
ATOM 1560  H HG3  . GLU A 1 102 ? 123.826 0.599   -92.703  1.00 0.00 ? 102 GLU A HG3  1  
ATOM 1561  N N    . GLN A 1 103 ? 125.174 -1.496  -92.995  1.00 0.00 ? 103 GLN A N    1  
ATOM 1562  C CA   . GLN A 1 103 ? 126.414 -1.105  -93.706  1.00 0.00 ? 103 GLN A CA   1  
ATOM 1563  C C    . GLN A 1 103 ? 126.632 -2.000  -94.927  1.00 0.00 ? 103 GLN A C    1  
ATOM 1564  O O    . GLN A 1 103 ? 126.965 -1.519  -95.996  1.00 0.00 ? 103 GLN A O    1  
ATOM 1565  C CB   . GLN A 1 103 ? 127.594 -1.210  -92.746  1.00 0.00 ? 103 GLN A CB   1  
ATOM 1566  C CG   . GLN A 1 103 ? 127.413 -0.169  -91.641  1.00 0.00 ? 103 GLN A CG   1  
ATOM 1567  C CD   . GLN A 1 103 ? 128.739 0.541   -91.377  1.00 0.00 ? 103 GLN A CD   1  
ATOM 1568  O OE1  . GLN A 1 103 ? 129.694 -0.070  -90.939  1.00 0.00 ? 103 GLN A OE1  1  
ATOM 1569  N NE2  . GLN A 1 103 ? 128.837 1.817   -91.628  1.00 0.00 ? 103 GLN A NE2  1  
ATOM 1570  H H    . GLN A 1 103 ? 125.180 -1.611  -92.022  1.00 0.00 ? 103 GLN A H    1  
ATOM 1571  H HA   . GLN A 1 103 ? 126.320 -0.081  -94.035  1.00 0.00 ? 103 GLN A HA   1  
ATOM 1572  H HB2  . GLN A 1 103 ? 127.624 -2.201  -92.314  1.00 0.00 ? 103 GLN A HB2  1  
ATOM 1573  H HB3  . GLN A 1 103 ? 128.514 -1.016  -93.276  1.00 0.00 ? 103 GLN A HB3  1  
ATOM 1574  H HG2  . GLN A 1 103 ? 126.675 0.557   -91.952  1.00 0.00 ? 103 GLN A HG2  1  
ATOM 1575  H HG3  . GLN A 1 103 ? 127.077 -0.653  -90.739  1.00 0.00 ? 103 GLN A HG3  1  
ATOM 1576  H HE21 . GLN A 1 103 ? 128.066 2.308   -91.980  1.00 0.00 ? 103 GLN A HE21 1  
ATOM 1577  H HE22 . GLN A 1 103 ? 129.680 2.285   -91.463  1.00 0.00 ? 103 GLN A HE22 1  
ATOM 1578  N N    . VAL A 1 104 ? 126.455 -3.293  -94.807  1.00 0.00 ? 104 VAL A N    1  
ATOM 1579  C CA   . VAL A 1 104 ? 126.681 -4.139  -96.009  1.00 0.00 ? 104 VAL A CA   1  
ATOM 1580  C C    . VAL A 1 104 ? 125.546 -3.867  -96.985  1.00 0.00 ? 104 VAL A C    1  
ATOM 1581  O O    . VAL A 1 104 ? 125.694 -4.015  -98.181  1.00 0.00 ? 104 VAL A O    1  
ATOM 1582  C CB   . VAL A 1 104 ? 126.666 -5.633  -95.679  1.00 0.00 ? 104 VAL A CB   1  
ATOM 1583  C CG1  . VAL A 1 104 ? 127.424 -5.910  -94.390  1.00 0.00 ? 104 VAL A CG1  1  
ATOM 1584  C CG2  . VAL A 1 104 ? 125.229 -6.121  -95.553  1.00 0.00 ? 104 VAL A CG2  1  
ATOM 1585  H H    . VAL A 1 104 ? 126.188 -3.691  -93.952  1.00 0.00 ? 104 VAL A H    1  
ATOM 1586  H HA   . VAL A 1 104 ? 127.620 -3.852  -96.454  1.00 0.00 ? 104 VAL A HA   1  
ATOM 1587  H HB   . VAL A 1 104 ? 127.146 -6.170  -96.483  1.00 0.00 ? 104 VAL A HB   1  
ATOM 1588  H HG11 . VAL A 1 104 ? 128.319 -5.312  -94.360  1.00 0.00 ? 104 VAL A HG11 1  
ATOM 1589  H HG12 . VAL A 1 104 ? 127.680 -6.956  -94.352  1.00 0.00 ? 104 VAL A HG12 1  
ATOM 1590  H HG13 . VAL A 1 104 ? 126.796 -5.666  -93.547  1.00 0.00 ? 104 VAL A HG13 1  
ATOM 1591  H HG21 . VAL A 1 104 ? 124.926 -6.573  -96.486  1.00 0.00 ? 104 VAL A HG21 1  
ATOM 1592  H HG22 . VAL A 1 104 ? 124.585 -5.288  -95.332  1.00 0.00 ? 104 VAL A HG22 1  
ATOM 1593  H HG23 . VAL A 1 104 ? 125.166 -6.849  -94.762  1.00 0.00 ? 104 VAL A HG23 1  
ATOM 1594  N N    . LEU A 1 105 ? 124.410 -3.449  -96.489  1.00 0.00 ? 105 LEU A N    1  
ATOM 1595  C CA   . LEU A 1 105 ? 123.282 -3.151  -97.404  1.00 0.00 ? 105 LEU A CA   1  
ATOM 1596  C C    . LEU A 1 105 ? 123.678 -1.964  -98.272  1.00 0.00 ? 105 LEU A C    1  
ATOM 1597  O O    . LEU A 1 105 ? 123.925 -2.109  -99.452  1.00 0.00 ? 105 LEU A O    1  
ATOM 1598  C CB   . LEU A 1 105 ? 122.027 -2.804  -96.599  1.00 0.00 ? 105 LEU A CB   1  
ATOM 1599  C CG   . LEU A 1 105 ? 121.658 -3.972  -95.680  1.00 0.00 ? 105 LEU A CG   1  
ATOM 1600  C CD1  . LEU A 1 105 ? 120.235 -3.781  -95.154  1.00 0.00 ? 105 LEU A CD1  1  
ATOM 1601  C CD2  . LEU A 1 105 ? 121.741 -5.287  -96.459  1.00 0.00 ? 105 LEU A CD2  1  
ATOM 1602  H H    . LEU A 1 105 ? 124.301 -3.307  -95.521  1.00 0.00 ? 105 LEU A H    1  
ATOM 1603  H HA   . LEU A 1 105 ? 123.088 -4.009  -98.032  1.00 0.00 ? 105 LEU A HA   1  
ATOM 1604  H HB2  . LEU A 1 105 ? 122.215 -1.923  -96.003  1.00 0.00 ? 105 LEU A HB2  1  
ATOM 1605  H HB3  . LEU A 1 105 ? 121.210 -2.610  -97.276  1.00 0.00 ? 105 LEU A HB3  1  
ATOM 1606  H HG   . LEU A 1 105 ? 122.343 -4.002  -94.850  1.00 0.00 ? 105 LEU A HG   1  
ATOM 1607  H HD11 . LEU A 1 105 ? 119.738 -3.011  -95.725  1.00 0.00 ? 105 LEU A HD11 1  
ATOM 1608  H HD12 . LEU A 1 105 ? 120.271 -3.491  -94.115  1.00 0.00 ? 105 LEU A HD12 1  
ATOM 1609  H HD13 . LEU A 1 105 ? 119.689 -4.708  -95.249  1.00 0.00 ? 105 LEU A HD13 1  
ATOM 1610  H HD21 . LEU A 1 105 ? 122.774 -5.586  -96.553  1.00 0.00 ? 105 LEU A HD21 1  
ATOM 1611  H HD22 . LEU A 1 105 ? 121.314 -5.153  -97.441  1.00 0.00 ? 105 LEU A HD22 1  
ATOM 1612  H HD23 . LEU A 1 105 ? 121.192 -6.053  -95.930  1.00 0.00 ? 105 LEU A HD23 1  
ATOM 1613  N N    . GLU A 1 106 ? 123.757 -0.788  -97.709  1.00 0.00 ? 106 GLU A N    1  
ATOM 1614  C CA   . GLU A 1 106 ? 124.154 0.384   -98.533  1.00 0.00 ? 106 GLU A CA   1  
ATOM 1615  C C    . GLU A 1 106 ? 125.335 -0.019  -99.415  1.00 0.00 ? 106 GLU A C    1  
ATOM 1616  O O    . GLU A 1 106 ? 125.354 0.252   -100.600 1.00 0.00 ? 106 GLU A O    1  
ATOM 1617  C CB   . GLU A 1 106 ? 124.570 1.538   -97.618  1.00 0.00 ? 106 GLU A CB   1  
ATOM 1618  C CG   . GLU A 1 106 ? 123.973 2.846   -98.140  1.00 0.00 ? 106 GLU A CG   1  
ATOM 1619  C CD   . GLU A 1 106 ? 122.446 2.765   -98.095  1.00 0.00 ? 106 GLU A CD   1  
ATOM 1620  O OE1  . GLU A 1 106 ? 121.936 2.039   -97.257  1.00 0.00 ? 106 GLU A OE1  1  
ATOM 1621  O OE2  . GLU A 1 106 ? 121.812 3.430   -98.898  1.00 0.00 ? 106 GLU A OE2  1  
ATOM 1622  H H    . GLU A 1 106 ? 123.549 -0.663  -96.757  1.00 0.00 ? 106 GLU A H    1  
ATOM 1623  H HA   . GLU A 1 106 ? 123.325 0.692   -99.151  1.00 0.00 ? 106 GLU A HA   1  
ATOM 1624  H HB2  . GLU A 1 106 ? 124.210 1.351   -96.617  1.00 0.00 ? 106 GLU A HB2  1  
ATOM 1625  H HB3  . GLU A 1 106 ? 125.647 1.617   -97.604  1.00 0.00 ? 106 GLU A HB3  1  
ATOM 1626  H HG2  . GLU A 1 106 ? 124.309 3.667   -97.523  1.00 0.00 ? 106 GLU A HG2  1  
ATOM 1627  H HG3  . GLU A 1 106 ? 124.292 3.007   -99.159  1.00 0.00 ? 106 GLU A HG3  1  
ATOM 1628  N N    . ILE A 1 107 ? 126.314 -0.684  -98.858  1.00 0.00 ? 107 ILE A N    1  
ATOM 1629  C CA   . ILE A 1 107 ? 127.470 -1.116  -99.691  1.00 0.00 ? 107 ILE A CA   1  
ATOM 1630  C C    . ILE A 1 107 ? 126.962 -2.058  -100.784 1.00 0.00 ? 107 ILE A C    1  
ATOM 1631  O O    . ILE A 1 107 ? 127.491 -2.101  -101.877 1.00 0.00 ? 107 ILE A O    1  
ATOM 1632  C CB   . ILE A 1 107 ? 128.490 -1.848  -98.825  1.00 0.00 ? 107 ILE A CB   1  
ATOM 1633  C CG1  . ILE A 1 107 ? 129.257 -0.835  -97.972  1.00 0.00 ? 107 ILE A CG1  1  
ATOM 1634  C CG2  . ILE A 1 107 ? 129.467 -2.596  -99.732  1.00 0.00 ? 107 ILE A CG2  1  
ATOM 1635  C CD1  . ILE A 1 107 ? 130.257 -1.571  -97.078  1.00 0.00 ? 107 ILE A CD1  1  
ATOM 1636  H H    . ILE A 1 107 ? 126.280 -0.911  -97.902  1.00 0.00 ? 107 ILE A H    1  
ATOM 1637  H HA   . ILE A 1 107 ? 127.938 -0.253  -100.145 1.00 0.00 ? 107 ILE A HA   1  
ATOM 1638  H HB   . ILE A 1 107 ? 127.979 -2.551  -98.183  1.00 0.00 ? 107 ILE A HB   1  
ATOM 1639  H HG12 . ILE A 1 107 ? 129.786 -0.149  -98.618  1.00 0.00 ? 107 ILE A HG12 1  
ATOM 1640  H HG13 . ILE A 1 107 ? 128.563 -0.285  -97.354  1.00 0.00 ? 107 ILE A HG13 1  
ATOM 1641  H HG21 . ILE A 1 107 ? 129.690 -1.989  -100.597 1.00 0.00 ? 107 ILE A HG21 1  
ATOM 1642  H HG22 . ILE A 1 107 ? 129.022 -3.526  -100.051 1.00 0.00 ? 107 ILE A HG22 1  
ATOM 1643  H HG23 . ILE A 1 107 ? 130.377 -2.800  -99.191  1.00 0.00 ? 107 ILE A HG23 1  
ATOM 1644  H HD11 . ILE A 1 107 ? 130.499 -2.526  -97.519  1.00 0.00 ? 107 ILE A HD11 1  
ATOM 1645  H HD12 . ILE A 1 107 ? 129.822 -1.724  -96.102  1.00 0.00 ? 107 ILE A HD12 1  
ATOM 1646  H HD13 . ILE A 1 107 ? 131.157 -0.980  -96.982  1.00 0.00 ? 107 ILE A HD13 1  
ATOM 1647  N N    . ALA A 1 108 ? 125.930 -2.809  -100.497 1.00 0.00 ? 108 ALA A N    1  
ATOM 1648  C CA   . ALA A 1 108 ? 125.378 -3.741  -101.521 1.00 0.00 ? 108 ALA A CA   1  
ATOM 1649  C C    . ALA A 1 108 ? 124.228 -3.057  -102.261 1.00 0.00 ? 108 ALA A C    1  
ATOM 1650  O O    . ALA A 1 108 ? 123.947 -3.369  -103.400 1.00 0.00 ? 108 ALA A O    1  
ATOM 1651  C CB   . ALA A 1 108 ? 124.852 -5.006  -100.838 1.00 0.00 ? 108 ALA A CB   1  
ATOM 1652  H H    . ALA A 1 108 ? 125.513 -2.751  -99.609  1.00 0.00 ? 108 ALA A H    1  
ATOM 1653  H HA   . ALA A 1 108 ? 126.153 -4.006  -102.224 1.00 0.00 ? 108 ALA A HA   1  
ATOM 1654  H HB1  . ALA A 1 108 ? 125.434 -5.211  -99.953  1.00 0.00 ? 108 ALA A HB1  1  
ATOM 1655  H HB2  . ALA A 1 108 ? 124.926 -5.840  -101.519 1.00 0.00 ? 108 ALA A HB2  1  
ATOM 1656  H HB3  . ALA A 1 108 ? 123.819 -4.860  -100.561 1.00 0.00 ? 108 ALA A HB3  1  
ATOM 1657  N N    . LYS A 1 109 ? 123.573 -2.114  -101.640 1.00 0.00 ? 109 LYS A N    1  
ATOM 1658  C CA   . LYS A 1 109 ? 122.463 -1.412  -102.341 1.00 0.00 ? 109 LYS A CA   1  
ATOM 1659  C C    . LYS A 1 109 ? 123.023 -0.783  -103.616 1.00 0.00 ? 109 LYS A C    1  
ATOM 1660  O O    . LYS A 1 109 ? 122.784 -1.254  -104.710 1.00 0.00 ? 109 LYS A O    1  
ATOM 1661  C CB   . LYS A 1 109 ? 121.889 -0.318  -101.440 1.00 0.00 ? 109 LYS A CB   1  
ATOM 1662  C CG   . LYS A 1 109 ? 121.262 -0.954  -100.199 1.00 0.00 ? 109 LYS A CG   1  
ATOM 1663  C CD   . LYS A 1 109 ? 119.777 -1.219  -100.458 1.00 0.00 ? 109 LYS A CD   1  
ATOM 1664  C CE   . LYS A 1 109 ? 118.961 0.012   -100.059 1.00 0.00 ? 109 LYS A CE   1  
ATOM 1665  N NZ   . LYS A 1 109 ? 118.317 -0.225  -98.737  1.00 0.00 ? 109 LYS A NZ   1  
ATOM 1666  H H    . LYS A 1 109 ? 123.819 -1.860  -100.727 1.00 0.00 ? 109 LYS A H    1  
ATOM 1667  H HA   . LYS A 1 109 ? 121.689 -2.119  -102.597 1.00 0.00 ? 109 LYS A HA   1  
ATOM 1668  H HB2  . LYS A 1 109 ? 122.680 0.355   -101.143 1.00 0.00 ? 109 LYS A HB2  1  
ATOM 1669  H HB3  . LYS A 1 109 ? 121.133 0.233   -101.980 1.00 0.00 ? 109 LYS A HB3  1  
ATOM 1670  H HG2  . LYS A 1 109 ? 121.762 -1.887  -99.981  1.00 0.00 ? 109 LYS A HG2  1  
ATOM 1671  H HG3  . LYS A 1 109 ? 121.365 -0.285  -99.359  1.00 0.00 ? 109 LYS A HG3  1  
ATOM 1672  H HD2  . LYS A 1 109 ? 119.627 -1.427  -101.507 1.00 0.00 ? 109 LYS A HD2  1  
ATOM 1673  H HD3  . LYS A 1 109 ? 119.455 -2.066  -99.873  1.00 0.00 ? 109 LYS A HD3  1  
ATOM 1674  H HE2  . LYS A 1 109 ? 119.613 0.871   -99.994  1.00 0.00 ? 109 LYS A HE2  1  
ATOM 1675  H HE3  . LYS A 1 109 ? 118.199 0.195   -100.803 1.00 0.00 ? 109 LYS A HE3  1  
ATOM 1676  H HZ1  . LYS A 1 109 ? 118.163 0.684   -98.257  1.00 0.00 ? 109 LYS A HZ1  1  
ATOM 1677  H HZ2  . LYS A 1 109 ? 118.936 -0.825  -98.153  1.00 0.00 ? 109 LYS A HZ2  1  
ATOM 1678  H HZ3  . LYS A 1 109 ? 117.403 -0.701  -98.876  1.00 0.00 ? 109 LYS A HZ3  1  
ATOM 1679  N N    . GLN A 1 110 ? 123.777 0.272   -103.488 1.00 0.00 ? 110 GLN A N    1  
ATOM 1680  C CA   . GLN A 1 110 ? 124.356 0.912   -104.699 1.00 0.00 ? 110 GLN A CA   1  
ATOM 1681  C C    . GLN A 1 110 ? 124.918 -0.179  -105.612 1.00 0.00 ? 110 GLN A C    1  
ATOM 1682  O O    . GLN A 1 110 ? 125.011 -0.011  -106.811 1.00 0.00 ? 110 GLN A O    1  
ATOM 1683  C CB   . GLN A 1 110 ? 125.480 1.865   -104.288 1.00 0.00 ? 110 GLN A CB   1  
ATOM 1684  C CG   . GLN A 1 110 ? 124.878 3.140   -103.694 1.00 0.00 ? 110 GLN A CG   1  
ATOM 1685  C CD   . GLN A 1 110 ? 123.698 2.775   -102.792 1.00 0.00 ? 110 GLN A CD   1  
ATOM 1686  O OE1  . GLN A 1 110 ? 122.570 2.720   -103.240 1.00 0.00 ? 110 GLN A OE1  1  
ATOM 1687  N NE2  . GLN A 1 110 ? 123.911 2.522   -101.529 1.00 0.00 ? 110 GLN A NE2  1  
ATOM 1688  H H    . GLN A 1 110 ? 123.964 0.641   -102.600 1.00 0.00 ? 110 GLN A H    1  
ATOM 1689  H HA   . GLN A 1 110 ? 123.587 1.462   -105.222 1.00 0.00 ? 110 GLN A HA   1  
ATOM 1690  H HB2  . GLN A 1 110 ? 126.107 1.385   -103.550 1.00 0.00 ? 110 GLN A HB2  1  
ATOM 1691  H HB3  . GLN A 1 110 ? 126.073 2.119   -105.154 1.00 0.00 ? 110 GLN A HB3  1  
ATOM 1692  H HG2  . GLN A 1 110 ? 125.630 3.656   -103.114 1.00 0.00 ? 110 GLN A HG2  1  
ATOM 1693  H HG3  . GLN A 1 110 ? 124.534 3.781   -104.491 1.00 0.00 ? 110 GLN A HG3  1  
ATOM 1694  H HE21 . GLN A 1 110 ? 124.821 2.566   -101.168 1.00 0.00 ? 110 GLN A HE21 1  
ATOM 1695  H HE22 . GLN A 1 110 ? 123.161 2.287   -100.943 1.00 0.00 ? 110 GLN A HE22 1  
ATOM 1696  N N    . LYS A 1 111 ? 125.293 -1.300  -105.051 1.00 0.00 ? 111 LYS A N    1  
ATOM 1697  C CA   . LYS A 1 111 ? 125.846 -2.403  -105.886 1.00 0.00 ? 111 LYS A CA   1  
ATOM 1698  C C    . LYS A 1 111 ? 124.712 -3.091  -106.655 1.00 0.00 ? 111 LYS A C    1  
ATOM 1699  O O    . LYS A 1 111 ? 124.949 -3.919  -107.513 1.00 0.00 ? 111 LYS A O    1  
ATOM 1700  C CB   . LYS A 1 111 ? 126.541 -3.425  -104.983 1.00 0.00 ? 111 LYS A CB   1  
ATOM 1701  C CG   . LYS A 1 111 ? 127.425 -4.340  -105.833 1.00 0.00 ? 111 LYS A CG   1  
ATOM 1702  C CD   . LYS A 1 111 ? 128.274 -5.224  -104.917 1.00 0.00 ? 111 LYS A CD   1  
ATOM 1703  C CE   . LYS A 1 111 ? 128.838 -6.399  -105.719 1.00 0.00 ? 111 LYS A CE   1  
ATOM 1704  N NZ   . LYS A 1 111 ? 127.716 -7.162  -106.336 1.00 0.00 ? 111 LYS A NZ   1  
ATOM 1705  H H    . LYS A 1 111 ? 125.213 -1.414  -104.079 1.00 0.00 ? 111 LYS A H    1  
ATOM 1706  H HA   . LYS A 1 111 ? 126.562 -1.999  -106.586 1.00 0.00 ? 111 LYS A HA   1  
ATOM 1707  H HB2  . LYS A 1 111 ? 127.151 -2.907  -104.257 1.00 0.00 ? 111 LYS A HB2  1  
ATOM 1708  H HB3  . LYS A 1 111 ? 125.798 -4.018  -104.472 1.00 0.00 ? 111 LYS A HB3  1  
ATOM 1709  H HG2  . LYS A 1 111 ? 126.801 -4.963  -106.458 1.00 0.00 ? 111 LYS A HG2  1  
ATOM 1710  H HG3  . LYS A 1 111 ? 128.073 -3.740  -106.453 1.00 0.00 ? 111 LYS A HG3  1  
ATOM 1711  H HD2  . LYS A 1 111 ? 129.088 -4.642  -104.510 1.00 0.00 ? 111 LYS A HD2  1  
ATOM 1712  H HD3  . LYS A 1 111 ? 127.663 -5.601  -104.111 1.00 0.00 ? 111 LYS A HD3  1  
ATOM 1713  H HE2  . LYS A 1 111 ? 129.489 -6.025  -106.495 1.00 0.00 ? 111 LYS A HE2  1  
ATOM 1714  H HE3  . LYS A 1 111 ? 129.397 -7.048  -105.062 1.00 0.00 ? 111 LYS A HE3  1  
ATOM 1715  H HZ1  . LYS A 1 111 ? 126.813 -6.832  -105.941 1.00 0.00 ? 111 LYS A HZ1  1  
ATOM 1716  H HZ2  . LYS A 1 111 ? 127.835 -8.176  -106.133 1.00 0.00 ? 111 LYS A HZ2  1  
ATOM 1717  H HZ3  . LYS A 1 111 ? 127.718 -7.011  -107.364 1.00 0.00 ? 111 LYS A HZ3  1  
ATOM 1718  N N    . MET A 1 112 ? 123.482 -2.757  -106.361 1.00 0.00 ? 112 MET A N    1  
ATOM 1719  C CA   . MET A 1 112 ? 122.345 -3.397  -107.087 1.00 0.00 ? 112 MET A CA   1  
ATOM 1720  C C    . MET A 1 112 ? 121.348 -2.326  -107.540 1.00 0.00 ? 112 MET A C    1  
ATOM 1721  O O    . MET A 1 112 ? 120.204 -2.321  -107.133 1.00 0.00 ? 112 MET A O    1  
ATOM 1722  C CB   . MET A 1 112 ? 121.635 -4.393  -106.162 1.00 0.00 ? 112 MET A CB   1  
ATOM 1723  C CG   . MET A 1 112 ? 121.213 -3.690  -104.870 1.00 0.00 ? 112 MET A CG   1  
ATOM 1724  S SD   . MET A 1 112 ? 120.542 -4.907  -103.709 1.00 0.00 ? 112 MET A SD   1  
ATOM 1725  C CE   . MET A 1 112 ? 118.790 -4.547  -103.981 1.00 0.00 ? 112 MET A CE   1  
ATOM 1726  H H    . MET A 1 112 ? 123.308 -2.086  -105.668 1.00 0.00 ? 112 MET A H    1  
ATOM 1727  H HA   . MET A 1 112 ? 122.723 -3.921  -107.952 1.00 0.00 ? 112 MET A HA   1  
ATOM 1728  H HB2  . MET A 1 112 ? 120.759 -4.784  -106.660 1.00 0.00 ? 112 MET A HB2  1  
ATOM 1729  H HB3  . MET A 1 112 ? 122.305 -5.205  -105.924 1.00 0.00 ? 112 MET A HB3  1  
ATOM 1730  H HG2  . MET A 1 112 ? 122.070 -3.210  -104.428 1.00 0.00 ? 112 MET A HG2  1  
ATOM 1731  H HG3  . MET A 1 112 ? 120.459 -2.950  -105.090 1.00 0.00 ? 112 MET A HG3  1  
ATOM 1732  H HE1  . MET A 1 112 ? 118.548 -4.706  -105.022 1.00 0.00 ? 112 MET A HE1  1  
ATOM 1733  H HE2  . MET A 1 112 ? 118.588 -3.521  -103.719 1.00 0.00 ? 112 MET A HE2  1  
ATOM 1734  H HE3  . MET A 1 112 ? 118.190 -5.199  -103.362 1.00 0.00 ? 112 MET A HE3  1  
ATOM 1735  N N    . PRO A 1 113 ? 121.781 -1.428  -108.384 1.00 0.00 ? 113 PRO A N    1  
ATOM 1736  C CA   . PRO A 1 113 ? 120.895 -0.346  -108.893 1.00 0.00 ? 113 PRO A CA   1  
ATOM 1737  C C    . PRO A 1 113 ? 119.777 -0.889  -109.787 1.00 0.00 ? 113 PRO A C    1  
ATOM 1738  O O    . PRO A 1 113 ? 118.670 -0.389  -109.793 1.00 0.00 ? 113 PRO A O    1  
ATOM 1739  C CB   . PRO A 1 113 ? 121.859 0.522   -109.704 1.00 0.00 ? 113 PRO A CB   1  
ATOM 1740  C CG   . PRO A 1 113 ? 123.226 -0.173  -109.759 1.00 0.00 ? 113 PRO A CG   1  
ATOM 1741  C CD   . PRO A 1 113 ? 123.178 -1.430  -108.885 1.00 0.00 ? 113 PRO A CD   1  
ATOM 1742  H HA   . PRO A 1 113 ? 120.486 0.228   -108.078 1.00 0.00 ? 113 PRO A HA   1  
ATOM 1743  H HB2  . PRO A 1 113 ? 121.475 0.649   -110.706 1.00 0.00 ? 113 PRO A HB2  1  
ATOM 1744  H HB3  . PRO A 1 113 ? 121.965 1.486   -109.231 1.00 0.00 ? 113 PRO A HB3  1  
ATOM 1745  H HG2  . PRO A 1 113 ? 123.452 -0.447  -110.779 1.00 0.00 ? 113 PRO A HG2  1  
ATOM 1746  H HG3  . PRO A 1 113 ? 123.987 0.495   -109.385 1.00 0.00 ? 113 PRO A HG3  1  
ATOM 1747  H HD2  . PRO A 1 113 ? 123.376 -2.314  -109.477 1.00 0.00 ? 113 PRO A HD2  1  
ATOM 1748  H HD3  . PRO A 1 113 ? 123.870 -1.352  -108.064 1.00 0.00 ? 113 PRO A HD3  1  
ATOM 1749  N N    . ASP A 1 114 ? 120.064 -1.913  -110.544 1.00 0.00 ? 114 ASP A N    1  
ATOM 1750  C CA   . ASP A 1 114 ? 119.029 -2.497  -111.441 1.00 0.00 ? 114 ASP A CA   1  
ATOM 1751  C C    . ASP A 1 114 ? 119.668 -3.593  -112.296 1.00 0.00 ? 114 ASP A C    1  
ATOM 1752  O O    . ASP A 1 114 ? 119.068 -4.105  -113.219 1.00 0.00 ? 114 ASP A O    1  
ATOM 1753  C CB   . ASP A 1 114 ? 118.465 -1.403  -112.351 1.00 0.00 ? 114 ASP A CB   1  
ATOM 1754  C CG   . ASP A 1 114 ? 117.731 -2.046  -113.529 1.00 0.00 ? 114 ASP A CG   1  
ATOM 1755  O OD1  . ASP A 1 114 ? 116.545 -2.297  -113.397 1.00 0.00 ? 114 ASP A OD1  1  
ATOM 1756  O OD2  . ASP A 1 114 ? 118.369 -2.276  -114.544 1.00 0.00 ? 114 ASP A OD2  1  
ATOM 1757  H H    . ASP A 1 114 ? 120.965 -2.299  -110.522 1.00 0.00 ? 114 ASP A H    1  
ATOM 1758  H HA   . ASP A 1 114 ? 118.233 -2.920  -110.847 1.00 0.00 ? 114 ASP A HA   1  
ATOM 1759  H HB2  . ASP A 1 114 ? 117.776 -0.788  -111.789 1.00 0.00 ? 114 ASP A HB2  1  
ATOM 1760  H HB3  . ASP A 1 114 ? 119.273 -0.791  -112.723 1.00 0.00 ? 114 ASP A HB3  1  
ATOM 1761  N N    . LEU A 1 115 ? 120.885 -3.954  -111.993 1.00 0.00 ? 115 LEU A N    1  
ATOM 1762  C CA   . LEU A 1 115 ? 121.571 -5.014  -112.783 1.00 0.00 ? 115 LEU A CA   1  
ATOM 1763  C C    . LEU A 1 115 ? 120.638 -6.215  -112.948 1.00 0.00 ? 115 LEU A C    1  
ATOM 1764  O O    . LEU A 1 115 ? 120.028 -6.401  -113.982 1.00 0.00 ? 115 LEU A O    1  
ATOM 1765  C CB   . LEU A 1 115 ? 122.842 -5.451  -112.053 1.00 0.00 ? 115 LEU A CB   1  
ATOM 1766  C CG   . LEU A 1 115 ? 124.051 -4.738  -112.661 1.00 0.00 ? 115 LEU A CG   1  
ATOM 1767  C CD1  . LEU A 1 115 ? 124.280 -5.245  -114.086 1.00 0.00 ? 115 LEU A CD1  1  
ATOM 1768  C CD2  . LEU A 1 115 ? 123.789 -3.230  -112.694 1.00 0.00 ? 115 LEU A CD2  1  
ATOM 1769  H H    . LEU A 1 115 ? 121.350 -3.525  -111.244 1.00 0.00 ? 115 LEU A H    1  
ATOM 1770  H HA   . LEU A 1 115 ? 121.831 -4.624  -113.757 1.00 0.00 ? 115 LEU A HA   1  
ATOM 1771  H HB2  . LEU A 1 115 ? 122.762 -5.195  -111.006 1.00 0.00 ? 115 LEU A HB2  1  
ATOM 1772  H HB3  . LEU A 1 115 ? 122.968 -6.518  -112.155 1.00 0.00 ? 115 LEU A HB3  1  
ATOM 1773  H HG   . LEU A 1 115 ? 124.927 -4.940  -112.062 1.00 0.00 ? 115 LEU A HG   1  
ATOM 1774  H HD11 . LEU A 1 115 ? 123.866 -6.238  -114.186 1.00 0.00 ? 115 LEU A HD11 1  
ATOM 1775  H HD12 . LEU A 1 115 ? 125.340 -5.275  -114.291 1.00 0.00 ? 115 LEU A HD12 1  
ATOM 1776  H HD13 . LEU A 1 115 ? 123.797 -4.581  -114.787 1.00 0.00 ? 115 LEU A HD13 1  
ATOM 1777  H HD21 . LEU A 1 115 ? 124.716 -2.700  -112.533 1.00 0.00 ? 115 LEU A HD21 1  
ATOM 1778  H HD22 . LEU A 1 115 ? 123.085 -2.970  -111.918 1.00 0.00 ? 115 LEU A HD22 1  
ATOM 1779  H HD23 . LEU A 1 115 ? 123.381 -2.957  -113.656 1.00 0.00 ? 115 LEU A HD23 1  
ATOM 1780  N N    . ASN A 1 116 ? 120.524 -7.035  -111.939 1.00 0.00 ? 116 ASN A N    1  
ATOM 1781  C CA   . ASN A 1 116 ? 119.632 -8.223  -112.046 1.00 0.00 ? 116 ASN A CA   1  
ATOM 1782  C C    . ASN A 1 116 ? 119.113 -8.604  -110.658 1.00 0.00 ? 116 ASN A C    1  
ATOM 1783  O O    . ASN A 1 116 ? 118.102 -9.265  -110.525 1.00 0.00 ? 116 ASN A O    1  
ATOM 1784  C CB   . ASN A 1 116 ? 120.417 -9.397  -112.636 1.00 0.00 ? 116 ASN A CB   1  
ATOM 1785  C CG   . ASN A 1 116 ? 119.441 -10.429 -113.205 1.00 0.00 ? 116 ASN A CG   1  
ATOM 1786  O OD1  . ASN A 1 116 ? 118.913 -10.252 -114.285 1.00 0.00 ? 116 ASN A OD1  1  
ATOM 1787  N ND2  . ASN A 1 116 ? 119.179 -11.508 -112.520 1.00 0.00 ? 116 ASN A ND2  1  
ATOM 1788  H H    . ASN A 1 116 ? 121.026 -6.870  -111.113 1.00 0.00 ? 116 ASN A H    1  
ATOM 1789  H HA   . ASN A 1 116 ? 118.798 -7.989  -112.690 1.00 0.00 ? 116 ASN A HA   1  
ATOM 1790  H HB2  . ASN A 1 116 ? 121.063 -9.038  -113.424 1.00 0.00 ? 116 ASN A HB2  1  
ATOM 1791  H HB3  . ASN A 1 116 ? 121.013 -9.857  -111.863 1.00 0.00 ? 116 ASN A HB3  1  
ATOM 1792  H HD21 . ASN A 1 116 ? 119.605 -11.651 -111.649 1.00 0.00 ? 116 ASN A HD21 1  
ATOM 1793  H HD22 . ASN A 1 116 ? 118.555 -12.175 -112.876 1.00 0.00 ? 116 ASN A HD22 1  
ATOM 1794  N N    . THR A 1 117 ? 119.794 -8.197  -109.621 1.00 0.00 ? 117 THR A N    1  
ATOM 1795  C CA   . THR A 1 117 ? 119.330 -8.543  -108.249 1.00 0.00 ? 117 THR A CA   1  
ATOM 1796  C C    . THR A 1 117 ? 117.977 -7.885  -107.984 1.00 0.00 ? 117 THR A C    1  
ATOM 1797  O O    . THR A 1 117 ? 117.300 -7.449  -108.893 1.00 0.00 ? 117 THR A O    1  
ATOM 1798  C CB   . THR A 1 117 ? 120.342 -8.057  -107.212 1.00 0.00 ? 117 THR A CB   1  
ATOM 1799  O OG1  . THR A 1 117 ? 121.639 -8.522  -107.561 1.00 0.00 ? 117 THR A OG1  1  
ATOM 1800  C CG2  . THR A 1 117 ? 119.950 -8.605  -105.839 1.00 0.00 ? 117 THR A CG2  1  
ATOM 1801  H H    . THR A 1 117 ? 120.608 -7.665  -109.746 1.00 0.00 ? 117 THR A H    1  
ATOM 1802  H HA   . THR A 1 117 ? 119.226 -9.616  -108.170 1.00 0.00 ? 117 THR A HA   1  
ATOM 1803  H HB   . THR A 1 117 ? 120.339 -6.979  -107.180 1.00 0.00 ? 117 THR A HB   1  
ATOM 1804  H HG1  . THR A 1 117 ? 121.556 -9.428  -107.868 1.00 0.00 ? 117 THR A HG1  1  
ATOM 1805  H HG21 . THR A 1 117 ? 120.826 -8.989  -105.340 1.00 0.00 ? 117 THR A HG21 1  
ATOM 1806  H HG22 . THR A 1 117 ? 119.228 -9.400  -105.963 1.00 0.00 ? 117 THR A HG22 1  
ATOM 1807  H HG23 . THR A 1 117 ? 119.514 -7.813  -105.247 1.00 0.00 ? 117 THR A HG23 1  
ATOM 1808  N N    . THR A 1 118 ? 117.568 -7.823  -106.745 1.00 0.00 ? 118 THR A N    1  
ATOM 1809  C CA   . THR A 1 118 ? 116.250 -7.208  -106.432 1.00 0.00 ? 118 THR A CA   1  
ATOM 1810  C C    . THR A 1 118 ? 116.070 -7.107  -104.915 1.00 0.00 ? 118 THR A C    1  
ATOM 1811  O O    . THR A 1 118 ? 115.970 -6.031  -104.361 1.00 0.00 ? 118 THR A O    1  
ATOM 1812  C CB   . THR A 1 118 ? 115.157 -8.102  -107.010 1.00 0.00 ? 118 THR A CB   1  
ATOM 1813  O OG1  . THR A 1 118 ? 114.025 -8.084  -106.150 1.00 0.00 ? 118 THR A OG1  1  
ATOM 1814  C CG2  . THR A 1 118 ? 115.698 -9.527  -107.125 1.00 0.00 ? 118 THR A CG2  1  
ATOM 1815  H H    . THR A 1 118 ? 118.120 -8.190  -106.026 1.00 0.00 ? 118 THR A H    1  
ATOM 1816  H HA   . THR A 1 118 ? 116.189 -6.226  -106.875 1.00 0.00 ? 118 THR A HA   1  
ATOM 1817  H HB   . THR A 1 118 ? 114.876 -7.747  -107.989 1.00 0.00 ? 118 THR A HB   1  
ATOM 1818  H HG1  . THR A 1 118 ? 113.397 -8.733  -106.474 1.00 0.00 ? 118 THR A HG1  1  
ATOM 1819  H HG21 . THR A 1 118 ? 116.370 -9.723  -106.300 1.00 0.00 ? 118 THR A HG21 1  
ATOM 1820  H HG22 . THR A 1 118 ? 116.235 -9.635  -108.056 1.00 0.00 ? 118 THR A HG22 1  
ATOM 1821  H HG23 . THR A 1 118 ? 114.880 -10.229 -107.096 1.00 0.00 ? 118 THR A HG23 1  
ATOM 1822  N N    . ASP A 1 119 ? 116.018 -8.225  -104.243 1.00 0.00 ? 119 ASP A N    1  
ATOM 1823  C CA   . ASP A 1 119 ? 115.831 -8.204  -102.764 1.00 0.00 ? 119 ASP A CA   1  
ATOM 1824  C C    . ASP A 1 119 ? 117.131 -7.783  -102.076 1.00 0.00 ? 119 ASP A C    1  
ATOM 1825  O O    . ASP A 1 119 ? 118.212 -8.165  -102.478 1.00 0.00 ? 119 ASP A O    1  
ATOM 1826  C CB   . ASP A 1 119 ? 115.435 -9.602  -102.285 1.00 0.00 ? 119 ASP A CB   1  
ATOM 1827  C CG   . ASP A 1 119 ? 113.936 -9.633  -101.983 1.00 0.00 ? 119 ASP A CG   1  
ATOM 1828  O OD1  . ASP A 1 119 ? 113.443 -8.665  -101.428 1.00 0.00 ? 119 ASP A OD1  1  
ATOM 1829  O OD2  . ASP A 1 119 ? 113.306 -10.625 -102.311 1.00 0.00 ? 119 ASP A OD2  1  
ATOM 1830  H H    . ASP A 1 119 ? 116.093 -9.082  -104.713 1.00 0.00 ? 119 ASP A H    1  
ATOM 1831  H HA   . ASP A 1 119 ? 115.048 -7.504  -102.511 1.00 0.00 ? 119 ASP A HA   1  
ATOM 1832  H HB2  . ASP A 1 119 ? 115.664 -10.324 -103.056 1.00 0.00 ? 119 ASP A HB2  1  
ATOM 1833  H HB3  . ASP A 1 119 ? 115.987 -9.845  -101.389 1.00 0.00 ? 119 ASP A HB3  1  
ATOM 1834  N N    . LEU A 1 120 ? 117.030 -7.001  -101.036 1.00 0.00 ? 120 LEU A N    1  
ATOM 1835  C CA   . LEU A 1 120 ? 118.252 -6.556  -100.310 1.00 0.00 ? 120 LEU A CA   1  
ATOM 1836  C C    . LEU A 1 120 ? 118.996 -7.783  -99.783  1.00 0.00 ? 120 LEU A C    1  
ATOM 1837  O O    . LEU A 1 120 ? 120.188 -7.768  -99.554  1.00 0.00 ? 120 LEU A O    1  
ATOM 1838  C CB   . LEU A 1 120 ? 117.835 -5.687  -99.122  1.00 0.00 ? 120 LEU A CB   1  
ATOM 1839  C CG   . LEU A 1 120 ? 118.521 -4.322  -99.225  1.00 0.00 ? 120 LEU A CG   1  
ATOM 1840  C CD1  . LEU A 1 120 ? 118.406 -3.595  -97.885  1.00 0.00 ? 120 LEU A CD1  1  
ATOM 1841  C CD2  . LEU A 1 120 ? 120.002 -4.516  -99.578  1.00 0.00 ? 120 LEU A CD2  1  
ATOM 1842  H H    . LEU A 1 120 ? 116.147 -6.709  -100.729 1.00 0.00 ? 120 LEU A H    1  
ATOM 1843  H HA   . LEU A 1 120 ? 118.861 -5.959  -100.973 1.00 0.00 ? 120 LEU A HA   1  
ATOM 1844  H HB2  . LEU A 1 120 ? 116.762 -5.554  -99.133  1.00 0.00 ? 120 LEU A HB2  1  
ATOM 1845  H HB3  . LEU A 1 120 ? 118.129 -6.168  -98.201  1.00 0.00 ? 120 LEU A HB3  1  
ATOM 1846  H HG   . LEU A 1 120 ? 118.040 -3.736  -99.994  1.00 0.00 ? 120 LEU A HG   1  
ATOM 1847  H HD11 . LEU A 1 120 ? 118.590 -4.291  -97.081  1.00 0.00 ? 120 LEU A HD11 1  
ATOM 1848  H HD12 . LEU A 1 120 ? 117.413 -3.183  -97.784  1.00 0.00 ? 120 LEU A HD12 1  
ATOM 1849  H HD13 . LEU A 1 120 ? 119.132 -2.797  -97.844  1.00 0.00 ? 120 LEU A HD13 1  
ATOM 1850  H HD21 . LEU A 1 120 ? 120.154 -4.305  -100.628 1.00 0.00 ? 120 LEU A HD21 1  
ATOM 1851  H HD22 . LEU A 1 120 ? 120.293 -5.537  -99.373  1.00 0.00 ? 120 LEU A HD22 1  
ATOM 1852  H HD23 . LEU A 1 120 ? 120.606 -3.844  -98.987  1.00 0.00 ? 120 LEU A HD23 1  
ATOM 1853  N N    . GLU A 1 121 ? 118.265 -8.848  -99.597  1.00 0.00 ? 121 GLU A N    1  
ATOM 1854  C CA   . GLU A 1 121 ? 118.844 -10.123 -99.089  1.00 0.00 ? 121 GLU A CA   1  
ATOM 1855  C C    . GLU A 1 121 ? 119.844 -10.693 -100.088 1.00 0.00 ? 121 GLU A C    1  
ATOM 1856  O O    . GLU A 1 121 ? 120.842 -11.272 -99.703  1.00 0.00 ? 121 GLU A O    1  
ATOM 1857  C CB   . GLU A 1 121 ? 117.712 -11.134 -98.897  1.00 0.00 ? 121 GLU A CB   1  
ATOM 1858  C CG   . GLU A 1 121 ? 118.283 -12.445 -98.353  1.00 0.00 ? 121 GLU A CG   1  
ATOM 1859  C CD   . GLU A 1 121 ? 117.185 -13.510 -98.331  1.00 0.00 ? 121 GLU A CD   1  
ATOM 1860  O OE1  . GLU A 1 121 ? 116.174 -13.278 -97.689  1.00 0.00 ? 121 GLU A OE1  1  
ATOM 1861  O OE2  . GLU A 1 121 ? 117.374 -14.540 -98.957  1.00 0.00 ? 121 GLU A OE2  1  
ATOM 1862  H H    . GLU A 1 121 ? 117.310 -8.809  -99.817  1.00 0.00 ? 121 GLU A H    1  
ATOM 1863  H HA   . GLU A 1 121 ? 119.354 -9.992  -98.146  1.00 0.00 ? 121 GLU A HA   1  
ATOM 1864  H HB2  . GLU A 1 121 ? 116.990 -10.737 -98.197  1.00 0.00 ? 121 GLU A HB2  1  
ATOM 1865  H HB3  . GLU A 1 121 ? 117.230 -11.319 -99.845  1.00 0.00 ? 121 GLU A HB3  1  
ATOM 1866  H HG2  . GLU A 1 121 ? 119.093 -12.774 -98.987  1.00 0.00 ? 121 GLU A HG2  1  
ATOM 1867  H HG3  . GLU A 1 121 ? 118.650 -12.289 -97.350  1.00 0.00 ? 121 GLU A HG3  1  
ATOM 1868  N N    . ALA A 1 122 ? 119.622 -10.534 -101.359 1.00 0.00 ? 122 ALA A N    1  
ATOM 1869  C CA   . ALA A 1 122 ? 120.615 -11.079 -102.318 1.00 0.00 ? 122 ALA A CA   1  
ATOM 1870  C C    . ALA A 1 122 ? 121.871 -10.208 -102.246 1.00 0.00 ? 122 ALA A C    1  
ATOM 1871  O O    . ALA A 1 122 ? 122.864 -10.603 -101.665 1.00 0.00 ? 122 ALA A O    1  
ATOM 1872  C CB   . ALA A 1 122 ? 120.040 -11.070 -103.736 1.00 0.00 ? 122 ALA A CB   1  
ATOM 1873  H H    . ALA A 1 122 ? 118.827 -10.056 -101.675 1.00 0.00 ? 122 ALA A H    1  
ATOM 1874  H HA   . ALA A 1 122 ? 120.857 -12.087 -102.017 1.00 0.00 ? 122 ALA A HA   1  
ATOM 1875  H HB1  . ALA A 1 122 ? 119.479 -10.160 -103.892 1.00 0.00 ? 122 ALA A HB1  1  
ATOM 1876  H HB2  . ALA A 1 122 ? 119.387 -11.921 -103.865 1.00 0.00 ? 122 ALA A HB2  1  
ATOM 1877  H HB3  . ALA A 1 122 ? 120.846 -11.122 -104.452 1.00 0.00 ? 122 ALA A HB3  1  
ATOM 1878  N N    . ALA A 1 123 ? 121.855 -9.030  -102.805 1.00 0.00 ? 123 ALA A N    1  
ATOM 1879  C CA   . ALA A 1 123 ? 123.070 -8.175  -102.723 1.00 0.00 ? 123 ALA A CA   1  
ATOM 1880  C C    . ALA A 1 123 ? 123.611 -8.209  -101.290 1.00 0.00 ? 123 ALA A C    1  
ATOM 1881  O O    . ALA A 1 123 ? 124.805 -8.282  -101.070 1.00 0.00 ? 123 ALA A O    1  
ATOM 1882  C CB   . ALA A 1 123 ? 122.709 -6.739  -103.104 1.00 0.00 ? 123 ALA A CB   1  
ATOM 1883  H H    . ALA A 1 123 ? 121.062 -8.701  -103.277 1.00 0.00 ? 123 ALA A H    1  
ATOM 1884  H HA   . ALA A 1 123 ? 123.821 -8.551  -103.401 1.00 0.00 ? 123 ALA A HA   1  
ATOM 1885  H HB1  . ALA A 1 123 ? 122.094 -6.305  -102.331 1.00 0.00 ? 123 ALA A HB1  1  
ATOM 1886  H HB2  . ALA A 1 123 ? 122.167 -6.743  -104.038 1.00 0.00 ? 123 ALA A HB2  1  
ATOM 1887  H HB3  . ALA A 1 123 ? 123.612 -6.158  -103.216 1.00 0.00 ? 123 ALA A HB3  1  
ATOM 1888  N N    . ALA A 1 124 ? 122.744 -8.166  -100.309 1.00 0.00 ? 124 ALA A N    1  
ATOM 1889  C CA   . ALA A 1 124 ? 123.221 -8.209  -98.896  1.00 0.00 ? 124 ALA A CA   1  
ATOM 1890  C C    . ALA A 1 124 ? 124.150 -9.408  -98.731  1.00 0.00 ? 124 ALA A C    1  
ATOM 1891  O O    . ALA A 1 124 ? 125.343 -9.261  -98.555  1.00 0.00 ? 124 ALA A O    1  
ATOM 1892  C CB   . ALA A 1 124 ? 122.030 -8.355  -97.945  1.00 0.00 ? 124 ALA A CB   1  
ATOM 1893  H H    . ALA A 1 124 ? 121.785 -8.115  -100.503 1.00 0.00 ? 124 ALA A H    1  
ATOM 1894  H HA   . ALA A 1 124 ? 123.759 -7.300  -98.668  1.00 0.00 ? 124 ALA A HA   1  
ATOM 1895  H HB1  . ALA A 1 124 ? 121.508 -7.413  -97.873  1.00 0.00 ? 124 ALA A HB1  1  
ATOM 1896  H HB2  . ALA A 1 124 ? 122.386 -8.645  -96.967  1.00 0.00 ? 124 ALA A HB2  1  
ATOM 1897  H HB3  . ALA A 1 124 ? 121.359 -9.113  -98.321  1.00 0.00 ? 124 ALA A HB3  1  
ATOM 1898  N N    . ARG A 1 125 ? 123.614 -10.598 -98.782  1.00 0.00 ? 125 ARG A N    1  
ATOM 1899  C CA   . ARG A 1 125 ? 124.480 -11.795 -98.620  1.00 0.00 ? 125 ARG A CA   1  
ATOM 1900  C C    . ARG A 1 125 ? 125.749 -11.577 -99.441  1.00 0.00 ? 125 ARG A C    1  
ATOM 1901  O O    . ARG A 1 125 ? 126.831 -11.955 -99.045  1.00 0.00 ? 125 ARG A O    1  
ATOM 1902  C CB   . ARG A 1 125 ? 123.743 -13.036 -99.130  1.00 0.00 ? 125 ARG A CB   1  
ATOM 1903  C CG   . ARG A 1 125 ? 124.121 -14.245 -98.273  1.00 0.00 ? 125 ARG A CG   1  
ATOM 1904  C CD   . ARG A 1 125 ? 123.271 -15.449 -98.687  1.00 0.00 ? 125 ARG A CD   1  
ATOM 1905  N NE   . ARG A 1 125 ? 123.585 -16.606 -97.802  1.00 0.00 ? 125 ARG A NE   1  
ATOM 1906  C CZ   . ARG A 1 125 ? 122.786 -17.637 -97.770  1.00 0.00 ? 125 ARG A CZ   1  
ATOM 1907  N NH1  . ARG A 1 125 ? 121.712 -17.655 -98.512  1.00 0.00 ? 125 ARG A NH1  1  
ATOM 1908  N NH2  . ARG A 1 125 ? 123.060 -18.651 -96.995  1.00 0.00 ? 125 ARG A NH2  1  
ATOM 1909  H H    . ARG A 1 125 ? 122.645 -10.696 -98.904  1.00 0.00 ? 125 ARG A H    1  
ATOM 1910  H HA   . ARG A 1 125 ? 124.737 -11.923 -97.579  1.00 0.00 ? 125 ARG A HA   1  
ATOM 1911  H HB2  . ARG A 1 125 ? 122.677 -12.870 -99.070  1.00 0.00 ? 125 ARG A HB2  1  
ATOM 1912  H HB3  . ARG A 1 125 ? 124.021 -13.223 -100.156 1.00 0.00 ? 125 ARG A HB3  1  
ATOM 1913  H HG2  . ARG A 1 125 ? 125.167 -14.475 -98.417  1.00 0.00 ? 125 ARG A HG2  1  
ATOM 1914  H HG3  . ARG A 1 125 ? 123.941 -14.021 -97.233  1.00 0.00 ? 125 ARG A HG3  1  
ATOM 1915  H HD2  . ARG A 1 125 ? 122.225 -15.199 -98.595  1.00 0.00 ? 125 ARG A HD2  1  
ATOM 1916  H HD3  . ARG A 1 125 ? 123.491 -15.709 -99.712  1.00 0.00 ? 125 ARG A HD3  1  
ATOM 1917  H HE   . ARG A 1 125 ? 124.391 -16.593 -97.245  1.00 0.00 ? 125 ARG A HE   1  
ATOM 1918  H HH11 . ARG A 1 125 ? 121.502 -16.878 -99.106  1.00 0.00 ? 125 ARG A HH11 1  
ATOM 1919  H HH12 . ARG A 1 125 ? 121.100 -18.445 -98.488  1.00 0.00 ? 125 ARG A HH12 1  
ATOM 1920  H HH21 . ARG A 1 125 ? 123.882 -18.638 -96.427  1.00 0.00 ? 125 ARG A HH21 1  
ATOM 1921  H HH22 . ARG A 1 125 ? 122.447 -19.442 -96.971  1.00 0.00 ? 125 ARG A HH22 1  
ATOM 1922  N N    . MET A 1 126 ? 125.629 -10.938 -100.570 1.00 0.00 ? 126 MET A N    1  
ATOM 1923  C CA   . MET A 1 126 ? 126.835 -10.665 -101.397 1.00 0.00 ? 126 MET A CA   1  
ATOM 1924  C C    . MET A 1 126 ? 127.838 -9.870  -100.558 1.00 0.00 ? 126 MET A C    1  
ATOM 1925  O O    . MET A 1 126 ? 128.802 -10.403 -100.049 1.00 0.00 ? 126 MET A O    1  
ATOM 1926  C CB   . MET A 1 126 ? 126.431 -9.840  -102.621 1.00 0.00 ? 126 MET A CB   1  
ATOM 1927  C CG   . MET A 1 126 ? 127.237 -10.301 -103.837 1.00 0.00 ? 126 MET A CG   1  
ATOM 1928  S SD   . MET A 1 126 ? 126.635 -11.919 -104.381 1.00 0.00 ? 126 MET A SD   1  
ATOM 1929  C CE   . MET A 1 126 ? 125.242 -11.322 -105.371 1.00 0.00 ? 126 MET A CE   1  
ATOM 1930  H H    . MET A 1 126 ? 124.749 -10.618 -100.864 1.00 0.00 ? 126 MET A H    1  
ATOM 1931  H HA   . MET A 1 126 ? 127.282 -11.594 -101.722 1.00 0.00 ? 126 MET A HA   1  
ATOM 1932  H HB2  . MET A 1 126 ? 125.376 -9.977  -102.814 1.00 0.00 ? 126 MET A HB2  1  
ATOM 1933  H HB3  . MET A 1 126 ? 126.631 -8.796  -102.434 1.00 0.00 ? 126 MET A HB3  1  
ATOM 1934  H HG2  . MET A 1 126 ? 127.122 -9.586  -104.638 1.00 0.00 ? 126 MET A HG2  1  
ATOM 1935  H HG3  . MET A 1 126 ? 128.280 -10.377 -103.569 1.00 0.00 ? 126 MET A HG3  1  
ATOM 1936  H HE1  . MET A 1 126 ? 124.423 -11.059 -104.716 1.00 0.00 ? 126 MET A HE1  1  
ATOM 1937  H HE2  . MET A 1 126 ? 124.923 -12.097 -106.049 1.00 0.00 ? 126 MET A HE2  1  
ATOM 1938  H HE3  . MET A 1 126 ? 125.550 -10.454 -105.938 1.00 0.00 ? 126 MET A HE3  1  
ATOM 1939  N N    . ILE A 1 127 ? 127.607 -8.594  -100.409 1.00 0.00 ? 127 ILE A N    1  
ATOM 1940  C CA   . ILE A 1 127 ? 128.532 -7.742  -99.605  1.00 0.00 ? 127 ILE A CA   1  
ATOM 1941  C C    . ILE A 1 127 ? 128.825 -8.412  -98.260  1.00 0.00 ? 127 ILE A C    1  
ATOM 1942  O O    . ILE A 1 127 ? 129.959 -8.674  -97.913  1.00 0.00 ? 127 ILE A O    1  
ATOM 1943  C CB   . ILE A 1 127 ? 127.862 -6.394  -99.353  1.00 0.00 ? 127 ILE A CB   1  
ATOM 1944  C CG1  . ILE A 1 127 ? 127.663 -5.662  -100.682 1.00 0.00 ? 127 ILE A CG1  1  
ATOM 1945  C CG2  . ILE A 1 127 ? 128.732 -5.550  -98.426  1.00 0.00 ? 127 ILE A CG2  1  
ATOM 1946  C CD1  . ILE A 1 127 ? 128.981 -5.605  -101.445 1.00 0.00 ? 127 ILE A CD1  1  
ATOM 1947  H H    . ILE A 1 127 ? 126.818 -8.191  -100.830 1.00 0.00 ? 127 ILE A H    1  
ATOM 1948  H HA   . ILE A 1 127 ? 129.454 -7.598  -100.147 1.00 0.00 ? 127 ILE A HA   1  
ATOM 1949  H HB   . ILE A 1 127 ? 126.901 -6.557  -98.887  1.00 0.00 ? 127 ILE A HB   1  
ATOM 1950  H HG12 . ILE A 1 127 ? 126.932 -6.189  -101.274 1.00 0.00 ? 127 ILE A HG12 1  
ATOM 1951  H HG13 . ILE A 1 127 ? 127.319 -4.659  -100.492 1.00 0.00 ? 127 ILE A HG13 1  
ATOM 1952  H HG21 . ILE A 1 127 ? 128.205 -4.646  -98.172  1.00 0.00 ? 127 ILE A HG21 1  
ATOM 1953  H HG22 . ILE A 1 127 ? 129.655 -5.302  -98.924  1.00 0.00 ? 127 ILE A HG22 1  
ATOM 1954  H HG23 . ILE A 1 127 ? 128.946 -6.107  -97.525  1.00 0.00 ? 127 ILE A HG23 1  
ATOM 1955  H HD11 . ILE A 1 127 ? 129.797 -5.517  -100.745 1.00 0.00 ? 127 ILE A HD11 1  
ATOM 1956  H HD12 . ILE A 1 127 ? 128.975 -4.749  -102.104 1.00 0.00 ? 127 ILE A HD12 1  
ATOM 1957  H HD13 . ILE A 1 127 ? 129.097 -6.507  -102.025 1.00 0.00 ? 127 ILE A HD13 1  
ATOM 1958  N N    . ALA A 1 128 ? 127.803 -8.698  -97.508  1.00 0.00 ? 128 ALA A N    1  
ATOM 1959  C CA   . ALA A 1 128 ? 128.029 -9.362  -96.195  1.00 0.00 ? 128 ALA A CA   1  
ATOM 1960  C C    . ALA A 1 128 ? 128.552 -10.769 -96.473  1.00 0.00 ? 128 ALA A C    1  
ATOM 1961  O O    . ALA A 1 128 ? 129.706 -11.070 -96.231  1.00 0.00 ? 128 ALA A O    1  
ATOM 1962  C CB   . ALA A 1 128 ? 126.730 -9.419  -95.388  1.00 0.00 ? 128 ALA A CB   1  
ATOM 1963  H H    . ALA A 1 128 ? 126.906 -8.480  -97.837  1.00 0.00 ? 128 ALA A H    1  
ATOM 1964  H HA   . ALA A 1 128 ? 128.791 -8.821  -95.653  1.00 0.00 ? 128 ALA A HA   1  
ATOM 1965  H HB1  . ALA A 1 128 ? 126.942 -9.217  -94.349  1.00 0.00 ? 128 ALA A HB1  1  
ATOM 1966  H HB2  . ALA A 1 128 ? 126.291 -10.401 -95.482  1.00 0.00 ? 128 ALA A HB2  1  
ATOM 1967  H HB3  . ALA A 1 128 ? 126.040 -8.678  -95.765  1.00 0.00 ? 128 ALA A HB3  1  
ATOM 1968  N N    . GLY A 1 129 ? 127.723 -11.638 -96.967  1.00 0.00 ? 129 GLY A N    1  
ATOM 1969  C CA   . GLY A 1 129 ? 128.202 -13.020 -97.241  1.00 0.00 ? 129 GLY A CA   1  
ATOM 1970  C C    . GLY A 1 129 ? 129.588 -12.942 -97.892  1.00 0.00 ? 129 GLY A C    1  
ATOM 1971  O O    . GLY A 1 129 ? 130.489 -13.677 -97.536  1.00 0.00 ? 129 GLY A O    1  
ATOM 1972  H H    . GLY A 1 129 ? 126.788 -11.388 -97.120  1.00 0.00 ? 129 GLY A H    1  
ATOM 1973  H HA2  . GLY A 1 129 ? 128.267 -13.568 -96.312  1.00 0.00 ? 129 GLY A HA2  1  
ATOM 1974  H HA3  . GLY A 1 129 ? 127.519 -13.520 -97.909  1.00 0.00 ? 129 GLY A HA3  1  
ATOM 1975  N N    . SER A 1 130 ? 129.792 -12.038 -98.817  1.00 0.00 ? 130 SER A N    1  
ATOM 1976  C CA   . SER A 1 130 ? 131.147 -11.921 -99.427  1.00 0.00 ? 130 SER A CA   1  
ATOM 1977  C C    . SER A 1 130 ? 132.147 -11.726 -98.290  1.00 0.00 ? 130 SER A C    1  
ATOM 1978  O O    . SER A 1 130 ? 133.163 -12.392 -98.213  1.00 0.00 ? 130 SER A O    1  
ATOM 1979  C CB   . SER A 1 130 ? 131.205 -10.713 -100.366 1.00 0.00 ? 130 SER A CB   1  
ATOM 1980  O OG   . SER A 1 130 ? 130.812 -9.547  -99.657  1.00 0.00 ? 130 SER A OG   1  
ATOM 1981  H H    . SER A 1 130 ? 129.076 -11.428 -99.090  1.00 0.00 ? 130 SER A H    1  
ATOM 1982  H HA   . SER A 1 130 ? 131.383 -12.824 -99.972  1.00 0.00 ? 130 SER A HA   1  
ATOM 1983  H HB2  . SER A 1 130 ? 132.211 -10.584 -100.727 1.00 0.00 ? 130 SER A HB2  1  
ATOM 1984  H HB3  . SER A 1 130 ? 130.544 -10.876 -101.205 1.00 0.00 ? 130 SER A HB3  1  
ATOM 1985  H HG   . SER A 1 130 ? 130.556 -9.811  -98.770  1.00 0.00 ? 130 SER A HG   1  
ATOM 1986  N N    . ALA A 1 131 ? 131.848 -10.829 -97.386  1.00 0.00 ? 131 ALA A N    1  
ATOM 1987  C CA   . ALA A 1 131 ? 132.757 -10.607 -96.233  1.00 0.00 ? 131 ALA A CA   1  
ATOM 1988  C C    . ALA A 1 131 ? 133.040 -11.968 -95.603  1.00 0.00 ? 131 ALA A C    1  
ATOM 1989  O O    . ALA A 1 131 ? 134.177 -12.341 -95.389  1.00 0.00 ? 131 ALA A O    1  
ATOM 1990  C CB   . ALA A 1 131 ? 132.080 -9.684  -95.220  1.00 0.00 ? 131 ALA A CB   1  
ATOM 1991  H H    . ALA A 1 131 ? 131.014 -10.318 -97.459  1.00 0.00 ? 131 ALA A H    1  
ATOM 1992  H HA   . ALA A 1 131 ? 133.682 -10.164 -96.576  1.00 0.00 ? 131 ALA A HA   1  
ATOM 1993  H HB1  . ALA A 1 131 ? 131.217 -9.224  -95.679  1.00 0.00 ? 131 ALA A HB1  1  
ATOM 1994  H HB2  . ALA A 1 131 ? 132.774 -8.917  -94.911  1.00 0.00 ? 131 ALA A HB2  1  
ATOM 1995  H HB3  . ALA A 1 131 ? 131.768 -10.258 -94.361  1.00 0.00 ? 131 ALA A HB3  1  
ATOM 1996  N N    . ARG A 1 132 ? 132.013 -12.741 -95.358  1.00 0.00 ? 132 ARG A N    1  
ATOM 1997  C CA   . ARG A 1 132 ? 132.239 -14.104 -94.807  1.00 0.00 ? 132 ARG A CA   1  
ATOM 1998  C C    . ARG A 1 132 ? 133.362 -14.732 -95.622  1.00 0.00 ? 132 ARG A C    1  
ATOM 1999  O O    . ARG A 1 132 ? 134.366 -15.155 -95.083  1.00 0.00 ? 132 ARG A O    1  
ATOM 2000  C CB   . ARG A 1 132 ? 130.966 -14.945 -94.938  1.00 0.00 ? 132 ARG A CB   1  
ATOM 2001  C CG   . ARG A 1 132 ? 131.237 -16.362 -94.426  1.00 0.00 ? 132 ARG A CG   1  
ATOM 2002  C CD   . ARG A 1 132 ? 132.032 -17.142 -95.475  1.00 0.00 ? 132 ARG A CD   1  
ATOM 2003  N NE   . ARG A 1 132 ? 131.418 -18.489 -95.673  1.00 0.00 ? 132 ARG A NE   1  
ATOM 2004  C CZ   . ARG A 1 132 ? 130.982 -19.179 -94.652  1.00 0.00 ? 132 ARG A CZ   1  
ATOM 2005  N NH1  . ARG A 1 132 ? 131.135 -18.726 -93.437  1.00 0.00 ? 132 ARG A NH1  1  
ATOM 2006  N NH2  . ARG A 1 132 ? 130.408 -20.334 -94.846  1.00 0.00 ? 132 ARG A NH2  1  
ATOM 2007  H H    . ARG A 1 132 ? 131.106 -12.440 -95.584  1.00 0.00 ? 132 ARG A H    1  
ATOM 2008  H HA   . ARG A 1 132 ? 132.555 -14.072 -93.773  1.00 0.00 ? 132 ARG A HA   1  
ATOM 2009  H HB2  . ARG A 1 132 ? 130.177 -14.495 -94.353  1.00 0.00 ? 132 ARG A HB2  1  
ATOM 2010  H HB3  . ARG A 1 132 ? 130.667 -14.991 -95.972  1.00 0.00 ? 132 ARG A HB3  1  
ATOM 2011  H HG2  . ARG A 1 132 ? 131.805 -16.308 -93.508  1.00 0.00 ? 132 ARG A HG2  1  
ATOM 2012  H HG3  . ARG A 1 132 ? 130.298 -16.862 -94.241  1.00 0.00 ? 132 ARG A HG3  1  
ATOM 2013  H HD2  . ARG A 1 132 ? 132.011 -16.609 -96.412  1.00 0.00 ? 132 ARG A HD2  1  
ATOM 2014  H HD3  . ARG A 1 132 ? 133.057 -17.246 -95.145  1.00 0.00 ? 132 ARG A HD3  1  
ATOM 2015  H HE   . ARG A 1 132 ? 131.325 -18.852 -96.579  1.00 0.00 ? 132 ARG A HE   1  
ATOM 2016  H HH11 . ARG A 1 132 ? 131.588 -17.849 -93.284  1.00 0.00 ? 132 ARG A HH11 1  
ATOM 2017  H HH12 . ARG A 1 132 ? 130.799 -19.257 -92.660  1.00 0.00 ? 132 ARG A HH12 1  
ATOM 2018  H HH21 . ARG A 1 132 ? 130.302 -20.690 -95.774  1.00 0.00 ? 132 ARG A HH21 1  
ATOM 2019  H HH22 . ARG A 1 132 ? 130.073 -20.864 -94.066  1.00 0.00 ? 132 ARG A HH22 1  
ATOM 2020  N N    . SER A 1 133 ? 133.236 -14.755 -96.920  1.00 0.00 ? 133 SER A N    1  
ATOM 2021  C CA   . SER A 1 133 ? 134.346 -15.309 -97.737  1.00 0.00 ? 133 SER A CA   1  
ATOM 2022  C C    . SER A 1 133 ? 135.638 -14.726 -97.169  1.00 0.00 ? 133 SER A C    1  
ATOM 2023  O O    . SER A 1 133 ? 136.444 -15.416 -96.578  1.00 0.00 ? 133 SER A O    1  
ATOM 2024  C CB   . SER A 1 133 ? 134.179 -14.872 -99.193  1.00 0.00 ? 133 SER A CB   1  
ATOM 2025  O OG   . SER A 1 133 ? 135.010 -15.674 -100.022 1.00 0.00 ? 133 SER A OG   1  
ATOM 2026  H H    . SER A 1 133 ? 132.439 -14.376 -97.351  1.00 0.00 ? 133 SER A H    1  
ATOM 2027  H HA   . SER A 1 133 ? 134.363 -16.389 -97.676  1.00 0.00 ? 133 SER A HA   1  
ATOM 2028  H HB2  . SER A 1 133 ? 133.153 -14.998 -99.492  1.00 0.00 ? 133 SER A HB2  1  
ATOM 2029  H HB3  . SER A 1 133 ? 134.455 -13.830 -99.288  1.00 0.00 ? 133 SER A HB3  1  
ATOM 2030  H HG   . SER A 1 133 ? 135.625 -16.148 -99.457  1.00 0.00 ? 133 SER A HG   1  
ATOM 2031  N N    . MET A 1 134 ? 135.811 -13.441 -97.318  1.00 0.00 ? 134 MET A N    1  
ATOM 2032  C CA   . MET A 1 134 ? 137.018 -12.767 -96.762  1.00 0.00 ? 134 MET A CA   1  
ATOM 2033  C C    . MET A 1 134 ? 137.189 -13.173 -95.296  1.00 0.00 ? 134 MET A C    1  
ATOM 2034  O O    . MET A 1 134 ? 138.135 -12.786 -94.640  1.00 0.00 ? 134 MET A O    1  
ATOM 2035  C CB   . MET A 1 134 ? 136.811 -11.250 -96.835  1.00 0.00 ? 134 MET A CB   1  
ATOM 2036  C CG   . MET A 1 134 ? 138.135 -10.535 -96.559  1.00 0.00 ? 134 MET A CG   1  
ATOM 2037  S SD   . MET A 1 134 ? 137.816 -8.964  -95.720  1.00 0.00 ? 134 MET A SD   1  
ATOM 2038  C CE   . MET A 1 134 ? 136.642 -8.286  -96.919  1.00 0.00 ? 134 MET A CE   1  
ATOM 2039  H H    . MET A 1 134 ? 135.130 -12.908 -97.784  1.00 0.00 ? 134 MET A H    1  
ATOM 2040  H HA   . MET A 1 134 ? 137.903 -13.035 -97.320  1.00 0.00 ? 134 MET A HA   1  
ATOM 2041  H HB2  . MET A 1 134 ? 136.455 -10.982 -97.819  1.00 0.00 ? 134 MET A HB2  1  
ATOM 2042  H HB3  . MET A 1 134 ? 136.083 -10.950 -96.095  1.00 0.00 ? 134 MET A HB3  1  
ATOM 2043  H HG2  . MET A 1 134 ? 138.753 -11.156 -95.929  1.00 0.00 ? 134 MET A HG2  1  
ATOM 2044  H HG3  . MET A 1 134 ? 138.643 -10.348 -97.493  1.00 0.00 ? 134 MET A HG3  1  
ATOM 2045  H HE1  . MET A 1 134 ? 136.779 -8.776  -97.873  1.00 0.00 ? 134 MET A HE1  1  
ATOM 2046  H HE2  . MET A 1 134 ? 136.812 -7.228  -97.033  1.00 0.00 ? 134 MET A HE2  1  
ATOM 2047  H HE3  . MET A 1 134 ? 135.633 -8.450  -96.566  1.00 0.00 ? 134 MET A HE3  1  
ATOM 2048  N N    . GLY A 1 135 ? 136.269 -13.936 -94.772  1.00 0.00 ? 135 GLY A N    1  
ATOM 2049  C CA   . GLY A 1 135 ? 136.368 -14.347 -93.343  1.00 0.00 ? 135 GLY A CA   1  
ATOM 2050  C C    . GLY A 1 135 ? 135.664 -13.293 -92.490  1.00 0.00 ? 135 GLY A C    1  
ATOM 2051  O O    . GLY A 1 135 ? 135.178 -13.566 -91.410  1.00 0.00 ? 135 GLY A O    1  
ATOM 2052  H H    . GLY A 1 135 ? 135.505 -14.226 -95.313  1.00 0.00 ? 135 GLY A H    1  
ATOM 2053  H HA2  . GLY A 1 135 ? 135.890 -15.308 -93.207  1.00 0.00 ? 135 GLY A HA2  1  
ATOM 2054  H HA3  . GLY A 1 135 ? 137.405 -14.410 -93.052  1.00 0.00 ? 135 GLY A HA3  1  
ATOM 2055  N N    . VAL A 1 136 ? 135.602 -12.089 -92.985  1.00 0.00 ? 136 VAL A N    1  
ATOM 2056  C CA   . VAL A 1 136 ? 134.925 -10.993 -92.237  1.00 0.00 ? 136 VAL A CA   1  
ATOM 2057  C C    . VAL A 1 136 ? 133.549 -11.469 -91.774  1.00 0.00 ? 136 VAL A C    1  
ATOM 2058  O O    . VAL A 1 136 ? 133.039 -12.467 -92.243  1.00 0.00 ? 136 VAL A O    1  
ATOM 2059  C CB   . VAL A 1 136 ? 134.758 -9.792  -93.165  1.00 0.00 ? 136 VAL A CB   1  
ATOM 2060  C CG1  . VAL A 1 136 ? 133.753 -8.809  -92.564  1.00 0.00 ? 136 VAL A CG1  1  
ATOM 2061  C CG2  . VAL A 1 136 ? 136.108 -9.095  -93.340  1.00 0.00 ? 136 VAL A CG2  1  
ATOM 2062  H H    . VAL A 1 136 ? 135.998 -11.907 -93.863  1.00 0.00 ? 136 VAL A H    1  
ATOM 2063  H HA   . VAL A 1 136 ? 135.522 -10.712 -91.382  1.00 0.00 ? 136 VAL A HA   1  
ATOM 2064  H HB   . VAL A 1 136 ? 134.399 -10.132 -94.125  1.00 0.00 ? 136 VAL A HB   1  
ATOM 2065  H HG11 . VAL A 1 136 ? 133.875 -7.843  -93.029  1.00 0.00 ? 136 VAL A HG11 1  
ATOM 2066  H HG12 . VAL A 1 136 ? 133.926 -8.722  -91.503  1.00 0.00 ? 136 VAL A HG12 1  
ATOM 2067  H HG13 . VAL A 1 136 ? 132.750 -9.169  -92.737  1.00 0.00 ? 136 VAL A HG13 1  
ATOM 2068  H HG21 . VAL A 1 136 ? 136.388 -8.615  -92.414  1.00 0.00 ? 136 VAL A HG21 1  
ATOM 2069  H HG22 . VAL A 1 136 ? 136.030 -8.352  -94.120  1.00 0.00 ? 136 VAL A HG22 1  
ATOM 2070  H HG23 . VAL A 1 136 ? 136.857 -9.825  -93.608  1.00 0.00 ? 136 VAL A HG23 1  
ATOM 2071  N N    . GLU A 1 137 ? 132.937 -10.762 -90.864  1.00 0.00 ? 137 GLU A N    1  
ATOM 2072  C CA   . GLU A 1 137 ? 131.589 -11.191 -90.394  1.00 0.00 ? 137 GLU A CA   1  
ATOM 2073  C C    . GLU A 1 137 ? 130.714 -9.961  -90.140  1.00 0.00 ? 137 GLU A C    1  
ATOM 2074  O O    . GLU A 1 137 ? 131.208 -8.863  -89.983  1.00 0.00 ? 137 GLU A O    1  
ATOM 2075  C CB   . GLU A 1 137 ? 131.733 -11.989 -89.097  1.00 0.00 ? 137 GLU A CB   1  
ATOM 2076  C CG   . GLU A 1 137 ? 132.650 -13.190 -89.335  1.00 0.00 ? 137 GLU A CG   1  
ATOM 2077  C CD   . GLU A 1 137 ? 132.884 -13.924 -88.013  1.00 0.00 ? 137 GLU A CD   1  
ATOM 2078  O OE1  . GLU A 1 137 ? 132.303 -13.516 -87.021  1.00 0.00 ? 137 GLU A OE1  1  
ATOM 2079  O OE2  . GLU A 1 137 ? 133.640 -14.882 -88.016  1.00 0.00 ? 137 GLU A OE2  1  
ATOM 2080  H H    . GLU A 1 137 ? 133.361 -9.953  -90.501  1.00 0.00 ? 137 GLU A H    1  
ATOM 2081  H HA   . GLU A 1 137 ? 131.145 -11.818 -91.153  1.00 0.00 ? 137 GLU A HA   1  
ATOM 2082  H HB2  . GLU A 1 137 ? 132.158 -11.356 -88.330  1.00 0.00 ? 137 GLU A HB2  1  
ATOM 2083  H HB3  . GLU A 1 137 ? 130.762 -12.338 -88.779  1.00 0.00 ? 137 GLU A HB3  1  
ATOM 2084  H HG2  . GLU A 1 137 ? 132.187 -13.861 -90.044  1.00 0.00 ? 137 GLU A HG2  1  
ATOM 2085  H HG3  . GLU A 1 137 ? 133.596 -12.848 -89.727  1.00 0.00 ? 137 GLU A HG3  1  
ATOM 2086  N N    . VAL A 1 138 ? 129.422 -10.137 -90.061  1.00 0.00 ? 138 VAL A N    1  
ATOM 2087  C CA   . VAL A 1 138 ? 128.533 -8.975  -89.778  1.00 0.00 ? 138 VAL A CA   1  
ATOM 2088  C C    . VAL A 1 138 ? 128.597 -8.708  -88.276  1.00 0.00 ? 138 VAL A C    1  
ATOM 2089  O O    . VAL A 1 138 ? 129.060 -9.522  -87.501  1.00 0.00 ? 138 VAL A O    1  
ATOM 2090  C CB   . VAL A 1 138 ? 127.098 -9.311  -90.188  1.00 0.00 ? 138 VAL A CB   1  
ATOM 2091  C CG1  . VAL A 1 138 ? 126.339 -8.020  -90.500  1.00 0.00 ? 138 VAL A CG1  1  
ATOM 2092  C CG2  . VAL A 1 138 ? 127.119 -10.202 -91.432  1.00 0.00 ? 138 VAL A CG2  1  
ATOM 2093  H H    . VAL A 1 138 ? 129.041 -11.035 -90.155  1.00 0.00 ? 138 VAL A H    1  
ATOM 2094  H HA   . VAL A 1 138 ? 128.880 -8.107  -90.320  1.00 0.00 ? 138 VAL A HA   1  
ATOM 2095  H HB   . VAL A 1 138 ? 126.605 -9.831  -89.378  1.00 0.00 ? 138 VAL A HB   1  
ATOM 2096  H HG11 . VAL A 1 138 ? 126.778 -7.545  -91.365  1.00 0.00 ? 138 VAL A HG11 1  
ATOM 2097  H HG12 . VAL A 1 138 ? 126.399 -7.353  -89.653  1.00 0.00 ? 138 VAL A HG12 1  
ATOM 2098  H HG13 . VAL A 1 138 ? 125.304 -8.251  -90.704  1.00 0.00 ? 138 VAL A HG13 1  
ATOM 2099  H HG21 . VAL A 1 138 ? 126.112 -10.330 -91.800  1.00 0.00 ? 138 VAL A HG21 1  
ATOM 2100  H HG22 . VAL A 1 138 ? 127.534 -11.166 -91.176  1.00 0.00 ? 138 VAL A HG22 1  
ATOM 2101  H HG23 . VAL A 1 138 ? 127.726 -9.740  -92.195  1.00 0.00 ? 138 VAL A HG23 1  
ATOM 2102  N N    . VAL A 1 139 ? 128.132 -7.558  -87.867  1.00 0.00 ? 139 VAL A N    1  
ATOM 2103  C CA   . VAL A 1 139 ? 128.153 -7.202  -86.423  1.00 0.00 ? 139 VAL A CA   1  
ATOM 2104  C C    . VAL A 1 139 ? 126.759 -6.733  -86.001  1.00 0.00 ? 139 VAL A C    1  
ATOM 2105  O O    . VAL A 1 139 ? 126.576 -5.618  -85.553  1.00 0.00 ? 139 VAL A O    1  
ATOM 2106  C CB   . VAL A 1 139 ? 129.168 -6.077  -86.201  1.00 0.00 ? 139 VAL A CB   1  
ATOM 2107  C CG1  . VAL A 1 139 ? 128.604 -4.754  -86.717  1.00 0.00 ? 139 VAL A CG1  1  
ATOM 2108  C CG2  . VAL A 1 139 ? 129.478 -5.954  -84.708  1.00 0.00 ? 139 VAL A CG2  1  
ATOM 2109  H H    . VAL A 1 139 ? 127.768 -6.923  -88.518  1.00 0.00 ? 139 VAL A H    1  
ATOM 2110  H HA   . VAL A 1 139 ? 128.437 -8.066  -85.840  1.00 0.00 ? 139 VAL A HA   1  
ATOM 2111  H HB   . VAL A 1 139 ? 130.071 -6.301  -86.741  1.00 0.00 ? 139 VAL A HB   1  
ATOM 2112  H HG11 . VAL A 1 139 ? 128.379 -4.108  -85.883  1.00 0.00 ? 139 VAL A HG11 1  
ATOM 2113  H HG12 . VAL A 1 139 ? 127.705 -4.941  -87.281  1.00 0.00 ? 139 VAL A HG12 1  
ATOM 2114  H HG13 . VAL A 1 139 ? 129.336 -4.279  -87.353  1.00 0.00 ? 139 VAL A HG13 1  
ATOM 2115  H HG21 . VAL A 1 139 ? 128.717 -5.356  -84.230  1.00 0.00 ? 139 VAL A HG21 1  
ATOM 2116  H HG22 . VAL A 1 139 ? 130.441 -5.481  -84.578  1.00 0.00 ? 139 VAL A HG22 1  
ATOM 2117  H HG23 . VAL A 1 139 ? 129.497 -6.937  -84.261  1.00 0.00 ? 139 VAL A HG23 1  
ATOM 2118  N N    . GLY A 1 140 ? 125.772 -7.576  -86.140  1.00 0.00 ? 140 GLY A N    1  
ATOM 2119  C CA   . GLY A 1 140 ? 124.390 -7.178  -85.749  1.00 0.00 ? 140 GLY A CA   1  
ATOM 2120  C C    . GLY A 1 140 ? 123.377 -8.056  -86.487  1.00 0.00 ? 140 GLY A C    1  
ATOM 2121  O O    . GLY A 1 140 ? 123.294 -9.247  -86.263  1.00 0.00 ? 140 GLY A O    1  
ATOM 2122  H H    . GLY A 1 140 ? 125.939 -8.473  -86.500  1.00 0.00 ? 140 GLY A H    1  
ATOM 2123  H HA2  . GLY A 1 140 ? 124.268 -7.303  -84.683  1.00 0.00 ? 140 GLY A HA2  1  
ATOM 2124  H HA3  . GLY A 1 140 ? 124.225 -6.145  -86.013  1.00 0.00 ? 140 GLY A HA3  1  
ATOM 2125  N N    . ALA A 1 141 ? 122.602 -7.478  -87.365  1.00 0.00 ? 141 ALA A N    1  
ATOM 2126  C CA   . ALA A 1 141 ? 121.594 -8.282  -88.113  1.00 0.00 ? 141 ALA A CA   1  
ATOM 2127  C C    . ALA A 1 141 ? 120.866 -9.212  -87.139  1.00 0.00 ? 141 ALA A C    1  
ATOM 2128  O O    . ALA A 1 141 ? 120.929 -10.420 -87.255  1.00 0.00 ? 141 ALA A O    1  
ATOM 2129  C CB   . ALA A 1 141 ? 122.297 -9.114  -89.190  1.00 0.00 ? 141 ALA A CB   1  
ATOM 2130  H H    . ALA A 1 141 ? 122.683 -6.516  -87.531  1.00 0.00 ? 141 ALA A H    1  
ATOM 2131  H HA   . ALA A 1 141 ? 120.880 -7.619  -88.579  1.00 0.00 ? 141 ALA A HA   1  
ATOM 2132  H HB1  . ALA A 1 141 ? 123.346 -9.204  -88.949  1.00 0.00 ? 141 ALA A HB1  1  
ATOM 2133  H HB2  . ALA A 1 141 ? 122.191 -8.626  -90.149  1.00 0.00 ? 141 ALA A HB2  1  
ATOM 2134  H HB3  . ALA A 1 141 ? 121.852 -10.096 -89.236  1.00 0.00 ? 141 ALA A HB3  1  
ATOM 2135  N N    . PRO A 1 142 ? 120.184 -8.644  -86.181  1.00 0.00 ? 142 PRO A N    1  
ATOM 2136  C CA   . PRO A 1 142 ? 119.438 -9.442  -85.169  1.00 0.00 ? 142 PRO A CA   1  
ATOM 2137  C C    . PRO A 1 142 ? 118.339 -10.307 -85.794  1.00 0.00 ? 142 PRO A C    1  
ATOM 2138  O O    . PRO A 1 142 ? 117.831 -10.013 -86.857  1.00 0.00 ? 142 PRO A O    1  
ATOM 2139  C CB   . PRO A 1 142 ? 118.829 -8.363  -84.272  1.00 0.00 ? 142 PRO A CB   1  
ATOM 2140  C CG   . PRO A 1 142 ? 119.220 -6.982  -84.815  1.00 0.00 ? 142 PRO A CG   1  
ATOM 2141  C CD   . PRO A 1 142 ? 120.112 -7.167  -86.046  1.00 0.00 ? 142 PRO A CD   1  
ATOM 2142  H HA   . PRO A 1 142 ? 120.116 -10.050 -84.593  1.00 0.00 ? 142 PRO A HA   1  
ATOM 2143  H HB2  . PRO A 1 142 ? 117.753 -8.461  -84.268  1.00 0.00 ? 142 PRO A HB2  1  
ATOM 2144  H HB3  . PRO A 1 142 ? 119.207 -8.472  -83.266  1.00 0.00 ? 142 PRO A HB3  1  
ATOM 2145  H HG2  . PRO A 1 142 ? 118.328 -6.436  -85.091  1.00 0.00 ? 142 PRO A HG2  1  
ATOM 2146  H HG3  . PRO A 1 142 ? 119.761 -6.434  -84.059  1.00 0.00 ? 142 PRO A HG3  1  
ATOM 2147  H HD2  . PRO A 1 142 ? 119.655 -6.720  -86.919  1.00 0.00 ? 142 PRO A HD2  1  
ATOM 2148  H HD3  . PRO A 1 142 ? 121.095 -6.759  -85.872  1.00 0.00 ? 142 PRO A HD3  1  
ATOM 2149  N N    . GLU A 1 143 ? 117.968 -11.373 -85.136  1.00 0.00 ? 143 GLU A N    1  
ATOM 2150  C CA   . GLU A 1 143 ? 116.902 -12.258 -85.686  1.00 0.00 ? 143 GLU A CA   1  
ATOM 2151  C C    . GLU A 1 143 ? 116.258 -13.045 -84.542  1.00 0.00 ? 143 GLU A C    1  
ATOM 2152  O O    . GLU A 1 143 ? 116.702 -14.120 -84.189  1.00 0.00 ? 143 GLU A O    1  
ATOM 2153  C CB   . GLU A 1 143 ? 117.516 -13.235 -86.693  1.00 0.00 ? 143 GLU A CB   1  
ATOM 2154  C CG   . GLU A 1 143 ? 118.012 -12.466 -87.920  1.00 0.00 ? 143 GLU A CG   1  
ATOM 2155  C CD   . GLU A 1 143 ? 116.872 -11.621 -88.491  1.00 0.00 ? 143 GLU A CD   1  
ATOM 2156  O OE1  . GLU A 1 143 ? 115.729 -12.011 -88.321  1.00 0.00 ? 143 GLU A OE1  1  
ATOM 2157  O OE2  . GLU A 1 143 ? 117.162 -10.598 -89.089  1.00 0.00 ? 143 GLU A OE2  1  
ATOM 2158  H H    . GLU A 1 143 ? 118.390 -11.590 -84.279  1.00 0.00 ? 143 GLU A H    1  
ATOM 2159  H HA   . GLU A 1 143 ? 116.151 -11.657 -86.177  1.00 0.00 ? 143 GLU A HA   1  
ATOM 2160  H HB2  . GLU A 1 143 ? 118.345 -13.752 -86.232  1.00 0.00 ? 143 GLU A HB2  1  
ATOM 2161  H HB3  . GLU A 1 143 ? 116.769 -13.952 -86.998  1.00 0.00 ? 143 GLU A HB3  1  
ATOM 2162  H HG2  . GLU A 1 143 ? 118.831 -11.822 -87.634  1.00 0.00 ? 143 GLU A HG2  1  
ATOM 2163  H HG3  . GLU A 1 143 ? 118.349 -13.165 -88.670  1.00 0.00 ? 143 GLU A HG3  1  
ATOM 2164  N N    . VAL A 1 144 ? 115.214 -12.520 -83.959  1.00 0.00 ? 144 VAL A N    1  
ATOM 2165  C CA   . VAL A 1 144 ? 114.546 -13.240 -82.839  1.00 0.00 ? 144 VAL A CA   1  
ATOM 2166  C C    . VAL A 1 144 ? 113.031 -13.229 -83.054  1.00 0.00 ? 144 VAL A C    1  
ATOM 2167  O O    . VAL A 1 144 ? 112.536 -12.690 -84.024  1.00 0.00 ? 144 VAL A O    1  
ATOM 2168  C CB   . VAL A 1 144 ? 114.878 -12.547 -81.517  1.00 0.00 ? 144 VAL A CB   1  
ATOM 2169  C CG1  . VAL A 1 144 ? 116.218 -13.063 -80.991  1.00 0.00 ? 144 VAL A CG1  1  
ATOM 2170  C CG2  . VAL A 1 144 ? 114.968 -11.036 -81.743  1.00 0.00 ? 144 VAL A CG2  1  
ATOM 2171  H H    . VAL A 1 144 ? 114.871 -11.652 -84.258  1.00 0.00 ? 144 VAL A H    1  
ATOM 2172  H HA   . VAL A 1 144 ? 114.897 -14.261 -82.807  1.00 0.00 ? 144 VAL A HA   1  
ATOM 2173  H HB   . VAL A 1 144 ? 114.102 -12.759 -80.795  1.00 0.00 ? 144 VAL A HB   1  
ATOM 2174  H HG11 . VAL A 1 144 ? 116.473 -12.541 -80.080  1.00 0.00 ? 144 VAL A HG11 1  
ATOM 2175  H HG12 . VAL A 1 144 ? 116.986 -12.891 -81.731  1.00 0.00 ? 144 VAL A HG12 1  
ATOM 2176  H HG13 . VAL A 1 144 ? 116.142 -14.121 -80.789  1.00 0.00 ? 144 VAL A HG13 1  
ATOM 2177  H HG21 . VAL A 1 144 ? 114.124 -10.709 -82.333  1.00 0.00 ? 144 VAL A HG21 1  
ATOM 2178  H HG22 . VAL A 1 144 ? 115.884 -10.804 -82.267  1.00 0.00 ? 144 VAL A HG22 1  
ATOM 2179  H HG23 . VAL A 1 144 ? 114.960 -10.527 -80.790  1.00 0.00 ? 144 VAL A HG23 1  
ATOM 2180  N N    . LYS A 1 145 ? 112.291 -13.820 -82.156  1.00 0.00 ? 145 LYS A N    1  
ATOM 2181  C CA   . LYS A 1 145 ? 110.809 -13.844 -82.309  1.00 0.00 ? 145 LYS A CA   1  
ATOM 2182  C C    . LYS A 1 145 ? 110.160 -14.121 -80.951  1.00 0.00 ? 145 LYS A C    1  
ATOM 2183  O O    . LYS A 1 145 ? 108.975 -13.925 -80.767  1.00 0.00 ? 145 LYS A O    1  
ATOM 2184  C CB   . LYS A 1 145 ? 110.415 -14.945 -83.296  1.00 0.00 ? 145 LYS A CB   1  
ATOM 2185  C CG   . LYS A 1 145 ? 110.220 -14.339 -84.688  1.00 0.00 ? 145 LYS A CG   1  
ATOM 2186  C CD   . LYS A 1 145 ? 109.548 -15.366 -85.602  1.00 0.00 ? 145 LYS A CD   1  
ATOM 2187  C CE   . LYS A 1 145 ? 109.758 -14.963 -87.063  1.00 0.00 ? 145 LYS A CE   1  
ATOM 2188  N NZ   . LYS A 1 145 ? 108.950 -15.853 -87.944  1.00 0.00 ? 145 LYS A NZ   1  
ATOM 2189  H H    . LYS A 1 145 ? 112.710 -14.249 -81.381  1.00 0.00 ? 145 LYS A H    1  
ATOM 2190  H HA   . LYS A 1 145 ? 110.470 -12.888 -82.681  1.00 0.00 ? 145 LYS A HA   1  
ATOM 2191  H HB2  . LYS A 1 145 ? 111.196 -15.690 -83.333  1.00 0.00 ? 145 LYS A HB2  1  
ATOM 2192  H HB3  . LYS A 1 145 ? 109.493 -15.404 -82.974  1.00 0.00 ? 145 LYS A HB3  1  
ATOM 2193  H HG2  . LYS A 1 145 ? 109.597 -13.459 -84.613  1.00 0.00 ? 145 LYS A HG2  1  
ATOM 2194  H HG3  . LYS A 1 145 ? 111.180 -14.067 -85.100  1.00 0.00 ? 145 LYS A HG3  1  
ATOM 2195  H HD2  . LYS A 1 145 ? 109.983 -16.340 -85.429  1.00 0.00 ? 145 LYS A HD2  1  
ATOM 2196  H HD3  . LYS A 1 145 ? 108.491 -15.400 -85.388  1.00 0.00 ? 145 LYS A HD3  1  
ATOM 2197  H HE2  . LYS A 1 145 ? 109.447 -13.939 -87.202  1.00 0.00 ? 145 LYS A HE2  1  
ATOM 2198  H HE3  . LYS A 1 145 ? 110.804 -15.060 -87.316  1.00 0.00 ? 145 LYS A HE3  1  
ATOM 2199  H HZ1  . LYS A 1 145 ? 107.953 -15.561 -87.912  1.00 0.00 ? 145 LYS A HZ1  1  
ATOM 2200  H HZ2  . LYS A 1 145 ? 109.035 -16.836 -87.614  1.00 0.00 ? 145 LYS A HZ2  1  
ATOM 2201  H HZ3  . LYS A 1 145 ? 109.298 -15.783 -88.921  1.00 0.00 ? 145 LYS A HZ3  1  
ATOM 2202  N N    . ASP A 1 146 ? 110.926 -14.578 -79.999  1.00 0.00 ? 146 ASP A N    1  
ATOM 2203  C CA   . ASP A 1 146 ? 110.351 -14.869 -78.655  1.00 0.00 ? 146 ASP A CA   1  
ATOM 2204  C C    . ASP A 1 146 ? 110.250 -13.571 -77.851  1.00 0.00 ? 146 ASP A C    1  
ATOM 2205  O O    . ASP A 1 146 ? 110.329 -13.573 -76.638  1.00 0.00 ? 146 ASP A O    1  
ATOM 2206  C CB   . ASP A 1 146 ? 111.256 -15.857 -77.916  1.00 0.00 ? 146 ASP A CB   1  
ATOM 2207  C CG   . ASP A 1 146 ? 112.439 -15.106 -77.303  1.00 0.00 ? 146 ASP A CG   1  
ATOM 2208  O OD1  . ASP A 1 146 ? 112.294 -14.614 -76.196  1.00 0.00 ? 146 ASP A OD1  1  
ATOM 2209  O OD2  . ASP A 1 146 ? 113.471 -15.036 -77.951  1.00 0.00 ? 146 ASP A OD2  1  
ATOM 2210  H H    . ASP A 1 146 ? 111.879 -14.731 -80.167  1.00 0.00 ? 146 ASP A H    1  
ATOM 2211  H HA   . ASP A 1 146 ? 109.367 -15.299 -78.770  1.00 0.00 ? 146 ASP A HA   1  
ATOM 2212  H HB2  . ASP A 1 146 ? 110.692 -16.344 -77.133  1.00 0.00 ? 146 ASP A HB2  1  
ATOM 2213  H HB3  . ASP A 1 146 ? 111.623 -16.598 -78.610  1.00 0.00 ? 146 ASP A HB3  1  
ATOM 2214  N N    . ALA A 1 147 ? 110.075 -12.462 -78.515  1.00 0.00 ? 147 ALA A N    1  
ATOM 2215  C CA   . ALA A 1 147 ? 109.968 -11.166 -77.787  1.00 0.00 ? 147 ALA A CA   1  
ATOM 2216  C C    . ALA A 1 147 ? 111.058 -11.092 -76.716  1.00 0.00 ? 147 ALA A C    1  
ATOM 2217  O O    . ALA A 1 147 ? 111.910 -11.965 -76.704  1.00 0.00 ? 147 ALA A O    1  
ATOM 2218  C CB   . ALA A 1 147 ? 108.594 -11.065 -77.123  1.00 0.00 ? 147 ALA A CB   1  
ATOM 2219  H H    . ALA A 1 147 ? 110.013 -12.481 -79.493  1.00 0.00 ? 147 ALA A H    1  
ATOM 2220  H HA   . ALA A 1 147 ? 110.092 -10.350 -78.484  1.00 0.00 ? 147 ALA A HA   1  
ATOM 2221  H HB1  . ALA A 1 147 ? 107.824 -11.245 -77.859  1.00 0.00 ? 147 ALA A HB1  1  
ATOM 2222  H HB2  . ALA A 1 147 ? 108.467 -10.078 -76.705  1.00 0.00 ? 147 ALA A HB2  1  
ATOM 2223  H HB3  . ALA A 1 147 ? 108.519 -11.802 -76.337  1.00 0.00 ? 147 ALA A HB3  1  
ATOM 2224  N N    . MET A 1 1   ? 133.788 20.044  -119.737 1.00 0.00 ? 1   MET A N    2  
ATOM 2225  C CA   . MET A 1 1   ? 134.826 20.355  -118.714 1.00 0.00 ? 1   MET A CA   2  
ATOM 2226  C C    . MET A 1 1   ? 134.417 19.747  -117.371 1.00 0.00 ? 1   MET A C    2  
ATOM 2227  O O    . MET A 1 1   ? 134.921 20.121  -116.331 1.00 0.00 ? 1   MET A O    2  
ATOM 2228  C CB   . MET A 1 1   ? 134.959 21.873  -118.567 1.00 0.00 ? 1   MET A CB   2  
ATOM 2229  C CG   . MET A 1 1   ? 136.432 22.271  -118.669 1.00 0.00 ? 1   MET A CG   2  
ATOM 2230  S SD   . MET A 1 1   ? 136.605 24.039  -118.321 1.00 0.00 ? 1   MET A SD   2  
ATOM 2231  C CE   . MET A 1 1   ? 138.251 24.252  -119.041 1.00 0.00 ? 1   MET A CE   2  
ATOM 2232  H H1   . MET A 1 1   ? 132.845 20.217  -119.338 1.00 0.00 ? 1   MET A H1   2  
ATOM 2233  H HA   . MET A 1 1   ? 135.773 19.940  -119.024 1.00 0.00 ? 1   MET A HA   2  
ATOM 2234  H HB2  . MET A 1 1   ? 134.398 22.361  -119.351 1.00 0.00 ? 1   MET A HB2  2  
ATOM 2235  H HB3  . MET A 1 1   ? 134.571 22.177  -117.605 1.00 0.00 ? 1   MET A HB3  2  
ATOM 2236  H HG2  . MET A 1 1   ? 137.008 21.705  -117.951 1.00 0.00 ? 1   MET A HG2  2  
ATOM 2237  H HG3  . MET A 1 1   ? 136.793 22.062  -119.665 1.00 0.00 ? 1   MET A HG3  2  
ATOM 2238  H HE1  . MET A 1 1   ? 138.895 23.448  -118.711 1.00 0.00 ? 1   MET A HE1  2  
ATOM 2239  H HE2  . MET A 1 1   ? 138.666 25.194  -118.722 1.00 0.00 ? 1   MET A HE2  2  
ATOM 2240  H HE3  . MET A 1 1   ? 138.176 24.240  -120.120 1.00 0.00 ? 1   MET A HE3  2  
ATOM 2241  N N    . LYS A 1 2   ? 133.506 18.812  -117.384 1.00 0.00 ? 2   LYS A N    2  
ATOM 2242  C CA   . LYS A 1 2   ? 133.068 18.182  -116.106 1.00 0.00 ? 2   LYS A CA   2  
ATOM 2243  C C    . LYS A 1 2   ? 132.396 16.839  -116.400 1.00 0.00 ? 2   LYS A C    2  
ATOM 2244  O O    . LYS A 1 2   ? 131.196 16.694  -116.274 1.00 0.00 ? 2   LYS A O    2  
ATOM 2245  C CB   . LYS A 1 2   ? 132.074 19.106  -115.400 1.00 0.00 ? 2   LYS A CB   2  
ATOM 2246  C CG   . LYS A 1 2   ? 131.374 19.991  -116.434 1.00 0.00 ? 2   LYS A CG   2  
ATOM 2247  C CD   . LYS A 1 2   ? 130.413 20.945  -115.722 1.00 0.00 ? 2   LYS A CD   2  
ATOM 2248  C CE   . LYS A 1 2   ? 130.619 22.366  -116.252 1.00 0.00 ? 2   LYS A CE   2  
ATOM 2249  N NZ   . LYS A 1 2   ? 130.068 22.466  -117.632 1.00 0.00 ? 2   LYS A NZ   2  
ATOM 2250  H H    . LYS A 1 2   ? 133.111 18.523  -118.233 1.00 0.00 ? 2   LYS A H    2  
ATOM 2251  H HA   . LYS A 1 2   ? 133.927 18.024  -115.470 1.00 0.00 ? 2   LYS A HA   2  
ATOM 2252  H HB2  . LYS A 1 2   ? 131.337 18.510  -114.878 1.00 0.00 ? 2   LYS A HB2  2  
ATOM 2253  H HB3  . LYS A 1 2   ? 132.599 19.729  -114.692 1.00 0.00 ? 2   LYS A HB3  2  
ATOM 2254  H HG2  . LYS A 1 2   ? 132.114 20.561  -116.977 1.00 0.00 ? 2   LYS A HG2  2  
ATOM 2255  H HG3  . LYS A 1 2   ? 130.819 19.371  -117.122 1.00 0.00 ? 2   LYS A HG3  2  
ATOM 2256  H HD2  . LYS A 1 2   ? 129.394 20.635  -115.908 1.00 0.00 ? 2   LYS A HD2  2  
ATOM 2257  H HD3  . LYS A 1 2   ? 130.607 20.928  -114.660 1.00 0.00 ? 2   LYS A HD3  2  
ATOM 2258  H HE2  . LYS A 1 2   ? 130.108 23.067  -115.608 1.00 0.00 ? 2   LYS A HE2  2  
ATOM 2259  H HE3  . LYS A 1 2   ? 131.674 22.595  -116.267 1.00 0.00 ? 2   LYS A HE3  2  
ATOM 2260  H HZ1  . LYS A 1 2   ? 130.739 22.045  -118.305 1.00 0.00 ? 2   LYS A HZ1  2  
ATOM 2261  H HZ2  . LYS A 1 2   ? 129.918 23.467  -117.873 1.00 0.00 ? 2   LYS A HZ2  2  
ATOM 2262  H HZ3  . LYS A 1 2   ? 129.163 21.956  -117.684 1.00 0.00 ? 2   LYS A HZ3  2  
ATOM 2263  N N    . LYS A 1 3   ? 133.160 15.854  -116.789 1.00 0.00 ? 3   LYS A N    2  
ATOM 2264  C CA   . LYS A 1 3   ? 132.560 14.523  -117.088 1.00 0.00 ? 3   LYS A CA   2  
ATOM 2265  C C    . LYS A 1 3   ? 133.673 13.484  -117.250 1.00 0.00 ? 3   LYS A C    2  
ATOM 2266  O O    . LYS A 1 3   ? 134.472 13.554  -118.164 1.00 0.00 ? 3   LYS A O    2  
ATOM 2267  C CB   . LYS A 1 3   ? 131.752 14.609  -118.385 1.00 0.00 ? 3   LYS A CB   2  
ATOM 2268  C CG   . LYS A 1 3   ? 131.455 13.197  -118.896 1.00 0.00 ? 3   LYS A CG   2  
ATOM 2269  C CD   . LYS A 1 3   ? 130.350 13.259  -119.954 1.00 0.00 ? 3   LYS A CD   2  
ATOM 2270  C CE   . LYS A 1 3   ? 130.784 12.468  -121.189 1.00 0.00 ? 3   LYS A CE   2  
ATOM 2271  N NZ   . LYS A 1 3   ? 129.835 12.736  -122.307 1.00 0.00 ? 3   LYS A NZ   2  
ATOM 2272  H H    . LYS A 1 3   ? 134.125 15.990  -116.884 1.00 0.00 ? 3   LYS A H    2  
ATOM 2273  H HA   . LYS A 1 3   ? 131.911 14.230  -116.278 1.00 0.00 ? 3   LYS A HA   2  
ATOM 2274  H HB2  . LYS A 1 3   ? 130.824 15.128  -118.197 1.00 0.00 ? 3   LYS A HB2  2  
ATOM 2275  H HB3  . LYS A 1 3   ? 132.321 15.145  -119.129 1.00 0.00 ? 3   LYS A HB3  2  
ATOM 2276  H HG2  . LYS A 1 3   ? 132.349 12.776  -119.331 1.00 0.00 ? 3   LYS A HG2  2  
ATOM 2277  H HG3  . LYS A 1 3   ? 131.128 12.578  -118.073 1.00 0.00 ? 3   LYS A HG3  2  
ATOM 2278  H HD2  . LYS A 1 3   ? 129.443 12.832  -119.551 1.00 0.00 ? 3   LYS A HD2  2  
ATOM 2279  H HD3  . LYS A 1 3   ? 130.174 14.287  -120.230 1.00 0.00 ? 3   LYS A HD3  2  
ATOM 2280  H HE2  . LYS A 1 3   ? 131.778 12.770  -121.480 1.00 0.00 ? 3   LYS A HE2  2  
ATOM 2281  H HE3  . LYS A 1 3   ? 130.780 11.412  -120.960 1.00 0.00 ? 3   LYS A HE3  2  
ATOM 2282  H HZ1  . LYS A 1 3   ? 130.256 12.416  -123.203 1.00 0.00 ? 3   LYS A HZ1  2  
ATOM 2283  H HZ2  . LYS A 1 3   ? 129.640 13.756  -122.359 1.00 0.00 ? 3   LYS A HZ2  2  
ATOM 2284  H HZ3  . LYS A 1 3   ? 128.948 12.221  -122.142 1.00 0.00 ? 3   LYS A HZ3  2  
ATOM 2285  N N    . VAL A 1 4   ? 133.728 12.516  -116.376 1.00 0.00 ? 4   VAL A N    2  
ATOM 2286  C CA   . VAL A 1 4   ? 134.786 11.471  -116.487 1.00 0.00 ? 4   VAL A CA   2  
ATOM 2287  C C    . VAL A 1 4   ? 134.900 11.012  -117.936 1.00 0.00 ? 4   VAL A C    2  
ATOM 2288  O O    . VAL A 1 4   ? 133.913 10.813  -118.615 1.00 0.00 ? 4   VAL A O    2  
ATOM 2289  C CB   . VAL A 1 4   ? 134.422 10.275  -115.603 1.00 0.00 ? 4   VAL A CB   2  
ATOM 2290  C CG1  . VAL A 1 4   ? 132.946 9.939   -115.785 1.00 0.00 ? 4   VAL A CG1  2  
ATOM 2291  C CG2  . VAL A 1 4   ? 135.268 9.063   -116.006 1.00 0.00 ? 4   VAL A CG2  2  
ATOM 2292  H H    . VAL A 1 4   ? 133.072 12.475  -115.649 1.00 0.00 ? 4   VAL A H    2  
ATOM 2293  H HA   . VAL A 1 4   ? 135.731 11.879  -116.167 1.00 0.00 ? 4   VAL A HA   2  
ATOM 2294  H HB   . VAL A 1 4   ? 134.606 10.516  -114.571 1.00 0.00 ? 4   VAL A HB   2  
ATOM 2295  H HG11 . VAL A 1 4   ? 132.349 10.800  -115.523 1.00 0.00 ? 4   VAL A HG11 2  
ATOM 2296  H HG12 . VAL A 1 4   ? 132.686 9.110   -115.142 1.00 0.00 ? 4   VAL A HG12 2  
ATOM 2297  H HG13 . VAL A 1 4   ? 132.762 9.671   -116.813 1.00 0.00 ? 4   VAL A HG13 2  
ATOM 2298  H HG21 . VAL A 1 4   ? 135.041 8.788   -117.025 1.00 0.00 ? 4   VAL A HG21 2  
ATOM 2299  H HG22 . VAL A 1 4   ? 135.043 8.235   -115.351 1.00 0.00 ? 4   VAL A HG22 2  
ATOM 2300  H HG23 . VAL A 1 4   ? 136.314 9.313   -115.925 1.00 0.00 ? 4   VAL A HG23 2  
ATOM 2301  N N    . VAL A 1 5   ? 136.099 10.827  -118.414 1.00 0.00 ? 5   VAL A N    2  
ATOM 2302  C CA   . VAL A 1 5   ? 136.268 10.363  -119.815 1.00 0.00 ? 5   VAL A CA   2  
ATOM 2303  C C    . VAL A 1 5   ? 136.904 8.976   -119.789 1.00 0.00 ? 5   VAL A C    2  
ATOM 2304  O O    . VAL A 1 5   ? 136.750 8.196   -120.709 1.00 0.00 ? 5   VAL A O    2  
ATOM 2305  C CB   . VAL A 1 5   ? 137.162 11.332  -120.595 1.00 0.00 ? 5   VAL A CB   2  
ATOM 2306  C CG1  . VAL A 1 5   ? 136.480 12.696  -120.706 1.00 0.00 ? 5   VAL A CG1  2  
ATOM 2307  C CG2  . VAL A 1 5   ? 138.499 11.488  -119.867 1.00 0.00 ? 5   VAL A CG2  2  
ATOM 2308  H H    . VAL A 1 5   ? 136.884 10.979  -117.848 1.00 0.00 ? 5   VAL A H    2  
ATOM 2309  H HA   . VAL A 1 5   ? 135.295 10.284  -120.276 1.00 0.00 ? 5   VAL A HA   2  
ATOM 2310  H HB   . VAL A 1 5   ? 137.335 10.938  -121.587 1.00 0.00 ? 5   VAL A HB   2  
ATOM 2311  H HG11 . VAL A 1 5   ? 135.453 12.564  -121.010 1.00 0.00 ? 5   VAL A HG11 2  
ATOM 2312  H HG12 . VAL A 1 5   ? 136.998 13.298  -121.437 1.00 0.00 ? 5   VAL A HG12 2  
ATOM 2313  H HG13 . VAL A 1 5   ? 136.511 13.192  -119.746 1.00 0.00 ? 5   VAL A HG13 2  
ATOM 2314  H HG21 . VAL A 1 5   ? 139.161 12.102  -120.458 1.00 0.00 ? 5   VAL A HG21 2  
ATOM 2315  H HG22 . VAL A 1 5   ? 138.944 10.515  -119.720 1.00 0.00 ? 5   VAL A HG22 2  
ATOM 2316  H HG23 . VAL A 1 5   ? 138.333 11.956  -118.909 1.00 0.00 ? 5   VAL A HG23 2  
ATOM 2317  N N    . ALA A 1 6   ? 137.612 8.650   -118.741 1.00 0.00 ? 6   ALA A N    2  
ATOM 2318  C CA   . ALA A 1 6   ? 138.239 7.301   -118.678 1.00 0.00 ? 6   ALA A CA   2  
ATOM 2319  C C    . ALA A 1 6   ? 138.158 6.745   -117.254 1.00 0.00 ? 6   ALA A C    2  
ATOM 2320  O O    . ALA A 1 6   ? 138.950 7.080   -116.395 1.00 0.00 ? 6   ALA A O    2  
ATOM 2321  C CB   . ALA A 1 6   ? 139.700 7.387   -119.107 1.00 0.00 ? 6   ALA A CB   2  
ATOM 2322  H H    . ALA A 1 6   ? 137.725 9.285   -118.001 1.00 0.00 ? 6   ALA A H    2  
ATOM 2323  H HA   . ALA A 1 6   ? 137.707 6.637   -119.343 1.00 0.00 ? 6   ALA A HA   2  
ATOM 2324  H HB1  . ALA A 1 6   ? 139.768 7.242   -120.175 1.00 0.00 ? 6   ALA A HB1  2  
ATOM 2325  H HB2  . ALA A 1 6   ? 140.268 6.619   -118.601 1.00 0.00 ? 6   ALA A HB2  2  
ATOM 2326  H HB3  . ALA A 1 6   ? 140.093 8.358   -118.848 1.00 0.00 ? 6   ALA A HB3  2  
ATOM 2327  N N    . VAL A 1 7   ? 137.217 5.877   -117.014 1.00 0.00 ? 7   VAL A N    2  
ATOM 2328  C CA   . VAL A 1 7   ? 137.082 5.259   -115.664 1.00 0.00 ? 7   VAL A CA   2  
ATOM 2329  C C    . VAL A 1 7   ? 137.963 4.019   -115.608 1.00 0.00 ? 7   VAL A C    2  
ATOM 2330  O O    . VAL A 1 7   ? 137.483 2.908   -115.715 1.00 0.00 ? 7   VAL A O    2  
ATOM 2331  C CB   . VAL A 1 7   ? 135.640 4.815   -115.454 1.00 0.00 ? 7   VAL A CB   2  
ATOM 2332  C CG1  . VAL A 1 7   ? 135.134 4.097   -116.706 1.00 0.00 ? 7   VAL A CG1  2  
ATOM 2333  C CG2  . VAL A 1 7   ? 135.606 3.858   -114.263 1.00 0.00 ? 7   VAL A CG2  2  
ATOM 2334  H H    . VAL A 1 7   ? 136.610 5.613   -117.735 1.00 0.00 ? 7   VAL A H    2  
ATOM 2335  H HA   . VAL A 1 7   ? 137.340 5.965   -114.891 1.00 0.00 ? 7   VAL A HA   2  
ATOM 2336  H HB   . VAL A 1 7   ? 135.019 5.674   -115.249 1.00 0.00 ? 7   VAL A HB   2  
ATOM 2337  H HG11 . VAL A 1 7   ? 134.711 4.818   -117.388 1.00 0.00 ? 7   VAL A HG11 2  
ATOM 2338  H HG12 . VAL A 1 7   ? 134.378 3.377   -116.428 1.00 0.00 ? 7   VAL A HG12 2  
ATOM 2339  H HG13 . VAL A 1 7   ? 135.957 3.587   -117.186 1.00 0.00 ? 7   VAL A HG13 2  
ATOM 2340  H HG21 . VAL A 1 7   ? 136.494 4.004   -113.662 1.00 0.00 ? 7   VAL A HG21 2  
ATOM 2341  H HG22 . VAL A 1 7   ? 135.579 2.840   -114.622 1.00 0.00 ? 7   VAL A HG22 2  
ATOM 2342  H HG23 . VAL A 1 7   ? 134.731 4.056   -113.667 1.00 0.00 ? 7   VAL A HG23 2  
ATOM 2343  N N    . VAL A 1 8   ? 139.245 4.180   -115.518 1.00 0.00 ? 8   VAL A N    2  
ATOM 2344  C CA   . VAL A 1 8   ? 140.120 2.972   -115.546 1.00 0.00 ? 8   VAL A CA   2  
ATOM 2345  C C    . VAL A 1 8   ? 139.599 1.909   -114.578 1.00 0.00 ? 8   VAL A C    2  
ATOM 2346  O O    . VAL A 1 8   ? 140.017 1.843   -113.440 1.00 0.00 ? 8   VAL A O    2  
ATOM 2347  C CB   . VAL A 1 8   ? 141.555 3.336   -115.181 1.00 0.00 ? 8   VAL A CB   2  
ATOM 2348  C CG1  . VAL A 1 8   ? 142.459 2.153   -115.511 1.00 0.00 ? 8   VAL A CG1  2  
ATOM 2349  C CG2  . VAL A 1 8   ? 141.996 4.561   -115.987 1.00 0.00 ? 8   VAL A CG2  2  
ATOM 2350  H H    . VAL A 1 8   ? 139.629 5.084   -115.510 1.00 0.00 ? 8   VAL A H    2  
ATOM 2351  H HA   . VAL A 1 8   ? 140.094 2.586   -116.555 1.00 0.00 ? 8   VAL A HA   2  
ATOM 2352  H HB   . VAL A 1 8   ? 141.614 3.549   -114.125 1.00 0.00 ? 8   VAL A HB   2  
ATOM 2353  H HG11 . VAL A 1 8   ? 141.850 1.281   -115.703 1.00 0.00 ? 8   VAL A HG11 2  
ATOM 2354  H HG12 . VAL A 1 8   ? 143.116 1.957   -114.678 1.00 0.00 ? 8   VAL A HG12 2  
ATOM 2355  H HG13 . VAL A 1 8   ? 143.045 2.381   -116.388 1.00 0.00 ? 8   VAL A HG13 2  
ATOM 2356  H HG21 . VAL A 1 8   ? 142.665 5.163   -115.391 1.00 0.00 ? 8   VAL A HG21 2  
ATOM 2357  H HG22 . VAL A 1 8   ? 141.130 5.147   -116.257 1.00 0.00 ? 8   VAL A HG22 2  
ATOM 2358  H HG23 . VAL A 1 8   ? 142.505 4.237   -116.883 1.00 0.00 ? 8   VAL A HG23 2  
ATOM 2359  N N    . LYS A 1 9   ? 138.707 1.062   -115.029 1.00 0.00 ? 9   LYS A N    2  
ATOM 2360  C CA   . LYS A 1 9   ? 138.176 -0.017  -114.141 1.00 0.00 ? 9   LYS A CA   2  
ATOM 2361  C C    . LYS A 1 9   ? 139.170 -1.180  -114.129 1.00 0.00 ? 9   LYS A C    2  
ATOM 2362  O O    . LYS A 1 9   ? 138.803 -2.338  -114.104 1.00 0.00 ? 9   LYS A O    2  
ATOM 2363  C CB   . LYS A 1 9   ? 136.824 -0.499  -114.671 1.00 0.00 ? 9   LYS A CB   2  
ATOM 2364  C CG   . LYS A 1 9   ? 136.304 -1.635  -113.788 1.00 0.00 ? 9   LYS A CG   2  
ATOM 2365  C CD   . LYS A 1 9   ? 136.177 -2.914  -114.619 1.00 0.00 ? 9   LYS A CD   2  
ATOM 2366  C CE   . LYS A 1 9   ? 134.910 -2.844  -115.474 1.00 0.00 ? 9   LYS A CE   2  
ATOM 2367  N NZ   . LYS A 1 9   ? 134.752 -1.464  -116.015 1.00 0.00 ? 9   LYS A NZ   2  
ATOM 2368  H H    . LYS A 1 9   ? 138.399 1.128   -115.956 1.00 0.00 ? 9   LYS A H    2  
ATOM 2369  H HA   . LYS A 1 9   ? 138.061 0.365   -113.141 1.00 0.00 ? 9   LYS A HA   2  
ATOM 2370  H HB2  . LYS A 1 9   ? 136.120 0.320   -114.658 1.00 0.00 ? 9   LYS A HB2  2  
ATOM 2371  H HB3  . LYS A 1 9   ? 136.940 -0.857  -115.683 1.00 0.00 ? 9   LYS A HB3  2  
ATOM 2372  H HG2  . LYS A 1 9   ? 136.991 -1.801  -112.972 1.00 0.00 ? 9   LYS A HG2  2  
ATOM 2373  H HG3  . LYS A 1 9   ? 135.334 -1.369  -113.392 1.00 0.00 ? 9   LYS A HG3  2  
ATOM 2374  H HD2  . LYS A 1 9   ? 137.041 -3.011  -115.261 1.00 0.00 ? 9   LYS A HD2  2  
ATOM 2375  H HD3  . LYS A 1 9   ? 136.118 -3.767  -113.961 1.00 0.00 ? 9   LYS A HD3  2  
ATOM 2376  H HE2  . LYS A 1 9   ? 134.988 -3.545  -116.292 1.00 0.00 ? 9   LYS A HE2  2  
ATOM 2377  H HE3  . LYS A 1 9   ? 134.053 -3.092  -114.868 1.00 0.00 ? 9   LYS A HE3  2  
ATOM 2378  H HZ1  . LYS A 1 9   ? 134.913 -0.772  -115.256 1.00 0.00 ? 9   LYS A HZ1  2  
ATOM 2379  H HZ2  . LYS A 1 9   ? 133.789 -1.348  -116.392 1.00 0.00 ? 9   LYS A HZ2  2  
ATOM 2380  H HZ3  . LYS A 1 9   ? 135.444 -1.308  -116.776 1.00 0.00 ? 9   LYS A HZ3  2  
ATOM 2381  N N    . LEU A 1 10  ? 140.428 -0.860  -114.173 1.00 0.00 ? 10  LEU A N    2  
ATOM 2382  C CA   . LEU A 1 10  ? 141.498 -1.901  -114.197 1.00 0.00 ? 10  LEU A CA   2  
ATOM 2383  C C    . LEU A 1 10  ? 141.713 -2.492  -112.807 1.00 0.00 ? 10  LEU A C    2  
ATOM 2384  O O    . LEU A 1 10  ? 141.009 -2.186  -111.868 1.00 0.00 ? 10  LEU A O    2  
ATOM 2385  C CB   . LEU A 1 10  ? 142.797 -1.240  -114.659 1.00 0.00 ? 10  LEU A CB   2  
ATOM 2386  C CG   . LEU A 1 10  ? 142.968 -1.477  -116.165 1.00 0.00 ? 10  LEU A CG   2  
ATOM 2387  C CD1  . LEU A 1 10  ? 143.577 -0.238  -116.826 1.00 0.00 ? 10  LEU A CD1  2  
ATOM 2388  C CD2  . LEU A 1 10  ? 143.885 -2.683  -116.392 1.00 0.00 ? 10  LEU A CD2  2  
ATOM 2389  H H    . LEU A 1 10  ? 140.679 0.085   -114.216 1.00 0.00 ? 10  LEU A H    2  
ATOM 2390  H HA   . LEU A 1 10  ? 141.257 -2.682  -114.903 1.00 0.00 ? 10  LEU A HA   2  
ATOM 2391  H HB2  . LEU A 1 10  ? 142.754 -0.181  -114.460 1.00 0.00 ? 10  LEU A HB2  2  
ATOM 2392  H HB3  . LEU A 1 10  ? 143.631 -1.674  -114.130 1.00 0.00 ? 10  LEU A HB3  2  
ATOM 2393  H HG   . LEU A 1 10  ? 142.002 -1.674  -116.607 1.00 0.00 ? 10  LEU A HG   2  
ATOM 2394  H HD11 . LEU A 1 10  ? 144.004 0.403   -116.070 1.00 0.00 ? 10  LEU A HD11 2  
ATOM 2395  H HD12 . LEU A 1 10  ? 142.807 0.299   -117.360 1.00 0.00 ? 10  LEU A HD12 2  
ATOM 2396  H HD13 . LEU A 1 10  ? 144.346 -0.543  -117.517 1.00 0.00 ? 10  LEU A HD13 2  
ATOM 2397  H HD21 . LEU A 1 10  ? 144.701 -2.654  -115.686 1.00 0.00 ? 10  LEU A HD21 2  
ATOM 2398  H HD22 . LEU A 1 10  ? 144.278 -2.651  -117.398 1.00 0.00 ? 10  LEU A HD22 2  
ATOM 2399  H HD23 . LEU A 1 10  ? 143.322 -3.593  -116.255 1.00 0.00 ? 10  LEU A HD23 2  
ATOM 2400  N N    . GLN A 1 11  ? 142.703 -3.335  -112.680 1.00 0.00 ? 11  GLN A N    2  
ATOM 2401  C CA   . GLN A 1 11  ? 143.013 -3.957  -111.364 1.00 0.00 ? 11  GLN A CA   2  
ATOM 2402  C C    . GLN A 1 11  ? 144.491 -3.730  -111.058 1.00 0.00 ? 11  GLN A C    2  
ATOM 2403  O O    . GLN A 1 11  ? 145.222 -3.184  -111.860 1.00 0.00 ? 11  GLN A O    2  
ATOM 2404  C CB   . GLN A 1 11  ? 142.726 -5.459  -111.425 1.00 0.00 ? 11  GLN A CB   2  
ATOM 2405  C CG   . GLN A 1 11  ? 143.256 -6.027  -112.743 1.00 0.00 ? 11  GLN A CG   2  
ATOM 2406  C CD   . GLN A 1 11  ? 142.202 -5.847  -113.838 1.00 0.00 ? 11  GLN A CD   2  
ATOM 2407  O OE1  . GLN A 1 11  ? 142.373 -6.319  -114.944 1.00 0.00 ? 11  GLN A OE1  2  
ATOM 2408  N NE2  . GLN A 1 11  ? 141.111 -5.180  -113.573 1.00 0.00 ? 11  GLN A NE2  2  
ATOM 2409  H H    . GLN A 1 11  ? 143.256 -3.550  -113.460 1.00 0.00 ? 11  GLN A H    2  
ATOM 2410  H HA   . GLN A 1 11  ? 142.416 -3.503  -110.592 1.00 0.00 ? 11  GLN A HA   2  
ATOM 2411  H HB2  . GLN A 1 11  ? 143.214 -5.953  -110.597 1.00 0.00 ? 11  GLN A HB2  2  
ATOM 2412  H HB3  . GLN A 1 11  ? 141.660 -5.625  -111.366 1.00 0.00 ? 11  GLN A HB3  2  
ATOM 2413  H HG2  . GLN A 1 11  ? 144.160 -5.505  -113.023 1.00 0.00 ? 11  GLN A HG2  2  
ATOM 2414  H HG3  . GLN A 1 11  ? 143.469 -7.078  -112.622 1.00 0.00 ? 11  GLN A HG3  2  
ATOM 2415  H HE21 . GLN A 1 11  ? 140.974 -4.800  -112.681 1.00 0.00 ? 11  GLN A HE21 2  
ATOM 2416  H HE22 . GLN A 1 11  ? 140.432 -5.059  -114.268 1.00 0.00 ? 11  GLN A HE22 2  
ATOM 2417  N N    . LEU A 1 12  ? 144.947 -4.155  -109.916 1.00 0.00 ? 12  LEU A N    2  
ATOM 2418  C CA   . LEU A 1 12  ? 146.387 -3.969  -109.585 1.00 0.00 ? 12  LEU A CA   2  
ATOM 2419  C C    . LEU A 1 12  ? 146.739 -4.828  -108.371 1.00 0.00 ? 12  LEU A C    2  
ATOM 2420  O O    . LEU A 1 12  ? 145.923 -5.044  -107.498 1.00 0.00 ? 12  LEU A O    2  
ATOM 2421  C CB   . LEU A 1 12  ? 146.669 -2.497  -109.282 1.00 0.00 ? 12  LEU A CB   2  
ATOM 2422  C CG   . LEU A 1 12  ? 147.250 -1.816  -110.527 1.00 0.00 ? 12  LEU A CG   2  
ATOM 2423  C CD1  . LEU A 1 12  ? 146.321 -0.688  -110.970 1.00 0.00 ? 12  LEU A CD1  2  
ATOM 2424  C CD2  . LEU A 1 12  ? 148.629 -1.237  -110.200 1.00 0.00 ? 12  LEU A CD2  2  
ATOM 2425  H H    . LEU A 1 12  ? 144.351 -4.613  -109.284 1.00 0.00 ? 12  LEU A H    2  
ATOM 2426  H HA   . LEU A 1 12  ? 146.979 -4.282  -110.428 1.00 0.00 ? 12  LEU A HA   2  
ATOM 2427  H HB2  . LEU A 1 12  ? 145.750 -2.005  -108.997 1.00 0.00 ? 12  LEU A HB2  2  
ATOM 2428  H HB3  . LEU A 1 12  ? 147.380 -2.429  -108.474 1.00 0.00 ? 12  LEU A HB3  2  
ATOM 2429  H HG   . LEU A 1 12  ? 147.341 -2.536  -111.327 1.00 0.00 ? 12  LEU A HG   2  
ATOM 2430  H HD11 . LEU A 1 12  ? 145.359 -1.096  -111.236 1.00 0.00 ? 12  LEU A HD11 2  
ATOM 2431  H HD12 . LEU A 1 12  ? 146.749 -0.188  -111.826 1.00 0.00 ? 12  LEU A HD12 2  
ATOM 2432  H HD13 . LEU A 1 12  ? 146.202 0.017   -110.160 1.00 0.00 ? 12  LEU A HD13 2  
ATOM 2433  H HD21 . LEU A 1 12  ? 149.367 -2.025  -110.234 1.00 0.00 ? 12  LEU A HD21 2  
ATOM 2434  H HD22 . LEU A 1 12  ? 148.612 -0.803  -109.211 1.00 0.00 ? 12  LEU A HD22 2  
ATOM 2435  H HD23 . LEU A 1 12  ? 148.880 -0.477  -110.923 1.00 0.00 ? 12  LEU A HD23 2  
ATOM 2436  N N    . PRO A 1 13  ? 147.944 -5.329  -108.328 1.00 0.00 ? 13  PRO A N    2  
ATOM 2437  C CA   . PRO A 1 13  ? 148.404 -6.202  -107.210 1.00 0.00 ? 13  PRO A CA   2  
ATOM 2438  C C    . PRO A 1 13  ? 148.904 -5.424  -105.992 1.00 0.00 ? 13  PRO A C    2  
ATOM 2439  O O    . PRO A 1 13  ? 149.749 -4.558  -106.110 1.00 0.00 ? 13  PRO A O    2  
ATOM 2440  C CB   . PRO A 1 13  ? 149.582 -6.902  -107.869 1.00 0.00 ? 13  PRO A CB   2  
ATOM 2441  C CG   . PRO A 1 13  ? 150.122 -5.948  -108.937 1.00 0.00 ? 13  PRO A CG   2  
ATOM 2442  C CD   . PRO A 1 13  ? 148.953 -5.072  -109.395 1.00 0.00 ? 13  PRO A CD   2  
ATOM 2443  H HA   . PRO A 1 13  ? 147.656 -6.923  -106.936 1.00 0.00 ? 13  PRO A HA   2  
ATOM 2444  H HB2  . PRO A 1 13  ? 150.341 -7.107  -107.132 1.00 0.00 ? 13  PRO A HB2  2  
ATOM 2445  H HB3  . PRO A 1 13  ? 149.258 -7.819  -108.332 1.00 0.00 ? 13  PRO A HB3  2  
ATOM 2446  H HG2  . PRO A 1 13  ? 150.901 -5.330  -108.513 1.00 0.00 ? 13  PRO A HG2  2  
ATOM 2447  H HG3  . PRO A 1 13  ? 150.510 -6.501  -109.773 1.00 0.00 ? 13  PRO A HG3  2  
ATOM 2448  H HD2  . PRO A 1 13  ? 149.242 -4.029  -109.419 1.00 0.00 ? 13  PRO A HD2  2  
ATOM 2449  H HD3  . PRO A 1 13  ? 148.584 -5.399  -110.351 1.00 0.00 ? 13  PRO A HD3  2  
ATOM 2450  N N    . ALA A 1 14  ? 148.437 -5.746  -104.817 1.00 0.00 ? 14  ALA A N    2  
ATOM 2451  C CA   . ALA A 1 14  ? 148.954 -5.035  -103.620 1.00 0.00 ? 14  ALA A CA   2  
ATOM 2452  C C    . ALA A 1 14  ? 150.343 -5.617  -103.337 1.00 0.00 ? 14  ALA A C    2  
ATOM 2453  O O    . ALA A 1 14  ? 150.564 -6.801  -103.507 1.00 0.00 ? 14  ALA A O    2  
ATOM 2454  C CB   . ALA A 1 14  ? 148.015 -5.248  -102.430 1.00 0.00 ? 14  ALA A CB   2  
ATOM 2455  H H    . ALA A 1 14  ? 147.781 -6.469  -104.723 1.00 0.00 ? 14  ALA A H    2  
ATOM 2456  H HA   . ALA A 1 14  ? 149.039 -3.985  -103.855 1.00 0.00 ? 14  ALA A HA   2  
ATOM 2457  H HB1  . ALA A 1 14  ? 147.242 -5.951  -102.703 1.00 0.00 ? 14  ALA A HB1  2  
ATOM 2458  H HB2  . ALA A 1 14  ? 147.562 -4.305  -102.157 1.00 0.00 ? 14  ALA A HB2  2  
ATOM 2459  H HB3  . ALA A 1 14  ? 148.573 -5.634  -101.592 1.00 0.00 ? 14  ALA A HB3  2  
ATOM 2460  N N    . GLY A 1 15  ? 151.285 -4.815  -102.913 1.00 0.00 ? 15  GLY A N    2  
ATOM 2461  C CA   . GLY A 1 15  ? 152.650 -5.360  -102.642 1.00 0.00 ? 15  GLY A CA   2  
ATOM 2462  C C    . GLY A 1 15  ? 153.116 -6.143  -103.872 1.00 0.00 ? 15  GLY A C    2  
ATOM 2463  O O    . GLY A 1 15  ? 153.441 -7.312  -103.797 1.00 0.00 ? 15  GLY A O    2  
ATOM 2464  H H    . GLY A 1 15  ? 151.097 -3.862  -102.778 1.00 0.00 ? 15  GLY A H    2  
ATOM 2465  H HA2  . GLY A 1 15  ? 153.334 -4.545  -102.446 1.00 0.00 ? 15  GLY A HA2  2  
ATOM 2466  H HA3  . GLY A 1 15  ? 152.616 -6.019  -101.788 1.00 0.00 ? 15  GLY A HA3  2  
ATOM 2467  N N    . LYS A 1 16  ? 153.114 -5.505  -105.007 1.00 0.00 ? 16  LYS A N    2  
ATOM 2468  C CA   . LYS A 1 16  ? 153.515 -6.186  -106.271 1.00 0.00 ? 16  LYS A CA   2  
ATOM 2469  C C    . LYS A 1 16  ? 153.285 -5.238  -107.448 1.00 0.00 ? 16  LYS A C    2  
ATOM 2470  O O    . LYS A 1 16  ? 153.304 -5.641  -108.594 1.00 0.00 ? 16  LYS A O    2  
ATOM 2471  C CB   . LYS A 1 16  ? 152.670 -7.447  -106.460 1.00 0.00 ? 16  LYS A CB   2  
ATOM 2472  C CG   . LYS A 1 16  ? 153.536 -8.685  -106.218 1.00 0.00 ? 16  LYS A CG   2  
ATOM 2473  C CD   . LYS A 1 16  ? 152.652 -9.844  -105.756 1.00 0.00 ? 16  LYS A CD   2  
ATOM 2474  C CE   . LYS A 1 16  ? 153.260 -11.168 -106.226 1.00 0.00 ? 16  LYS A CE   2  
ATOM 2475  N NZ   . LYS A 1 16  ? 154.606 -11.343 -105.610 1.00 0.00 ? 16  LYS A NZ   2  
ATOM 2476  H H    . LYS A 1 16  ? 152.821 -4.569  -105.030 1.00 0.00 ? 16  LYS A H    2  
ATOM 2477  H HA   . LYS A 1 16  ? 154.560 -6.462  -106.276 1.00 0.00 ? 16  LYS A HA   2  
ATOM 2478  H HB2  . LYS A 1 16  ? 151.849 -7.439  -105.756 1.00 0.00 ? 16  LYS A HB2  2  
ATOM 2479  H HB3  . LYS A 1 16  ? 152.284 -7.473  -107.467 1.00 0.00 ? 16  LYS A HB3  2  
ATOM 2480  H HG2  . LYS A 1 16  ? 154.037 -8.956  -107.137 1.00 0.00 ? 16  LYS A HG2  2  
ATOM 2481  H HG3  . LYS A 1 16  ? 154.270 -8.469  -105.458 1.00 0.00 ? 16  LYS A HG3  2  
ATOM 2482  H HD2  . LYS A 1 16  ? 152.588 -9.840  -104.677 1.00 0.00 ? 16  LYS A HD2  2  
ATOM 2483  H HD3  . LYS A 1 16  ? 151.665 -9.735  -106.177 1.00 0.00 ? 16  LYS A HD3  2  
ATOM 2484  H HE2  . LYS A 1 16  ? 152.618 -11.985 -105.928 1.00 0.00 ? 16  LYS A HE2  2  
ATOM 2485  H HE3  . LYS A 1 16  ? 153.354 -11.159 -107.302 1.00 0.00 ? 16  LYS A HE3  2  
ATOM 2486  H HZ1  . LYS A 1 16  ? 155.065 -12.183 -106.015 1.00 0.00 ? 16  LYS A HZ1  2  
ATOM 2487  H HZ2  . LYS A 1 16  ? 154.503 -11.464 -104.582 1.00 0.00 ? 16  LYS A HZ2  2  
ATOM 2488  H HZ3  . LYS A 1 16  ? 155.188 -10.504 -105.805 1.00 0.00 ? 16  LYS A HZ3  2  
ATOM 2489  N N    . ALA A 1 17  ? 153.093 -3.977  -107.179 1.00 0.00 ? 17  ALA A N    2  
ATOM 2490  C CA   . ALA A 1 17  ? 152.892 -3.006  -108.289 1.00 0.00 ? 17  ALA A CA   2  
ATOM 2491  C C    . ALA A 1 17  ? 154.238 -2.348  -108.602 1.00 0.00 ? 17  ALA A C    2  
ATOM 2492  O O    . ALA A 1 17  ? 155.116 -2.285  -107.765 1.00 0.00 ? 17  ALA A O    2  
ATOM 2493  C CB   . ALA A 1 17  ? 151.871 -1.948  -107.876 1.00 0.00 ? 17  ALA A CB   2  
ATOM 2494  H H    . ALA A 1 17  ? 153.099 -3.666  -106.250 1.00 0.00 ? 17  ALA A H    2  
ATOM 2495  H HA   . ALA A 1 17  ? 152.537 -3.528  -109.164 1.00 0.00 ? 17  ALA A HA   2  
ATOM 2496  H HB1  . ALA A 1 17  ? 151.888 -1.136  -108.587 1.00 0.00 ? 17  ALA A HB1  2  
ATOM 2497  H HB2  . ALA A 1 17  ? 152.116 -1.575  -106.894 1.00 0.00 ? 17  ALA A HB2  2  
ATOM 2498  H HB3  . ALA A 1 17  ? 150.885 -2.391  -107.860 1.00 0.00 ? 17  ALA A HB3  2  
ATOM 2499  N N    . THR A 1 18  ? 154.417 -1.873  -109.802 1.00 0.00 ? 18  THR A N    2  
ATOM 2500  C CA   . THR A 1 18  ? 155.717 -1.242  -110.163 1.00 0.00 ? 18  THR A CA   2  
ATOM 2501  C C    . THR A 1 18  ? 155.603 -0.593  -111.539 1.00 0.00 ? 18  THR A C    2  
ATOM 2502  O O    . THR A 1 18  ? 154.676 -0.860  -112.277 1.00 0.00 ? 18  THR A O    2  
ATOM 2503  C CB   . THR A 1 18  ? 156.797 -2.324  -110.205 1.00 0.00 ? 18  THR A CB   2  
ATOM 2504  O OG1  . THR A 1 18  ? 156.178 -3.603  -110.225 1.00 0.00 ? 18  THR A OG1  2  
ATOM 2505  C CG2  . THR A 1 18  ? 157.690 -2.211  -108.974 1.00 0.00 ? 18  THR A CG2  2  
ATOM 2506  H H    . THR A 1 18  ? 153.706 -1.947  -110.470 1.00 0.00 ? 18  THR A H    2  
ATOM 2507  H HA   . THR A 1 18  ? 155.976 -0.496  -109.428 1.00 0.00 ? 18  THR A HA   2  
ATOM 2508  H HB   . THR A 1 18  ? 157.396 -2.203  -111.094 1.00 0.00 ? 18  THR A HB   2  
ATOM 2509  H HG1  . THR A 1 18  ? 156.711 -4.182  -110.774 1.00 0.00 ? 18  THR A HG1  2  
ATOM 2510  H HG21 . THR A 1 18  ? 157.806 -1.173  -108.704 1.00 0.00 ? 18  THR A HG21 2  
ATOM 2511  H HG22 . THR A 1 18  ? 158.657 -2.638  -109.193 1.00 0.00 ? 18  THR A HG22 2  
ATOM 2512  H HG23 . THR A 1 18  ? 157.237 -2.748  -108.153 1.00 0.00 ? 18  THR A HG23 2  
ATOM 2513  N N    . PRO A 1 19  ? 156.546 0.244   -111.889 1.00 0.00 ? 19  PRO A N    2  
ATOM 2514  C CA   . PRO A 1 19  ? 156.537 0.911   -113.216 1.00 0.00 ? 19  PRO A CA   2  
ATOM 2515  C C    . PRO A 1 19  ? 156.360 -0.100  -114.353 1.00 0.00 ? 19  PRO A C    2  
ATOM 2516  O O    . PRO A 1 19  ? 156.868 0.077   -115.441 1.00 0.00 ? 19  PRO A O    2  
ATOM 2517  C CB   . PRO A 1 19  ? 157.909 1.579   -113.269 1.00 0.00 ? 19  PRO A CB   2  
ATOM 2518  C CG   . PRO A 1 19  ? 158.622 1.349   -111.928 1.00 0.00 ? 19  PRO A CG   2  
ATOM 2519  C CD   . PRO A 1 19  ? 157.683 0.578   -110.994 1.00 0.00 ? 19  PRO A CD   2  
ATOM 2520  H HA   . PRO A 1 19  ? 155.768 1.661   -113.272 1.00 0.00 ? 19  PRO A HA   2  
ATOM 2521  H HB2  . PRO A 1 19  ? 158.486 1.153   -114.072 1.00 0.00 ? 19  PRO A HB2  2  
ATOM 2522  H HB3  . PRO A 1 19  ? 157.788 2.639   -113.432 1.00 0.00 ? 19  PRO A HB3  2  
ATOM 2523  H HG2  . PRO A 1 19  ? 159.525 0.777   -112.092 1.00 0.00 ? 19  PRO A HG2  2  
ATOM 2524  H HG3  . PRO A 1 19  ? 158.871 2.299   -111.482 1.00 0.00 ? 19  PRO A HG3  2  
ATOM 2525  H HD2  . PRO A 1 19  ? 158.164 -0.316  -110.625 1.00 0.00 ? 19  PRO A HD2  2  
ATOM 2526  H HD3  . PRO A 1 19  ? 157.349 1.202   -110.182 1.00 0.00 ? 19  PRO A HD3  2  
ATOM 2527  N N    . ALA A 1 20  ? 155.629 -1.148  -114.108 1.00 0.00 ? 20  ALA A N    2  
ATOM 2528  C CA   . ALA A 1 20  ? 155.402 -2.163  -115.172 1.00 0.00 ? 20  ALA A CA   2  
ATOM 2529  C C    . ALA A 1 20  ? 154.091 -2.903  -114.905 1.00 0.00 ? 20  ALA A C    2  
ATOM 2530  O O    . ALA A 1 20  ? 154.056 -4.115  -114.848 1.00 0.00 ? 20  ALA A O    2  
ATOM 2531  C CB   . ALA A 1 20  ? 156.560 -3.163  -115.176 1.00 0.00 ? 20  ALA A CB   2  
ATOM 2532  H H    . ALA A 1 20  ? 155.213 -1.250  -113.225 1.00 0.00 ? 20  ALA A H    2  
ATOM 2533  H HA   . ALA A 1 20  ? 155.349 -1.671  -116.132 1.00 0.00 ? 20  ALA A HA   2  
ATOM 2534  H HB1  . ALA A 1 20  ? 157.497 -2.629  -115.199 1.00 0.00 ? 20  ALA A HB1  2  
ATOM 2535  H HB2  . ALA A 1 20  ? 156.486 -3.796  -116.049 1.00 0.00 ? 20  ALA A HB2  2  
ATOM 2536  H HB3  . ALA A 1 20  ? 156.513 -3.772  -114.286 1.00 0.00 ? 20  ALA A HB3  2  
ATOM 2537  N N    . PRO A 1 21  ? 153.015 -2.174  -114.756 1.00 0.00 ? 21  PRO A N    2  
ATOM 2538  C CA   . PRO A 1 21  ? 151.686 -2.786  -114.506 1.00 0.00 ? 21  PRO A CA   2  
ATOM 2539  C C    . PRO A 1 21  ? 151.008 -3.219  -115.807 1.00 0.00 ? 21  PRO A C    2  
ATOM 2540  O O    . PRO A 1 21  ? 151.438 -2.859  -116.885 1.00 0.00 ? 21  PRO A O    2  
ATOM 2541  C CB   . PRO A 1 21  ? 150.924 -1.620  -113.878 1.00 0.00 ? 21  PRO A CB   2  
ATOM 2542  C CG   . PRO A 1 21  ? 151.674 -0.322  -114.216 1.00 0.00 ? 21  PRO A CG   2  
ATOM 2543  C CD   . PRO A 1 21  ? 153.038 -0.690  -114.813 1.00 0.00 ? 21  PRO A CD   2  
ATOM 2544  H HA   . PRO A 1 21  ? 151.755 -3.602  -113.809 1.00 0.00 ? 21  PRO A HA   2  
ATOM 2545  H HB2  . PRO A 1 21  ? 149.922 -1.580  -114.281 1.00 0.00 ? 21  PRO A HB2  2  
ATOM 2546  H HB3  . PRO A 1 21  ? 150.885 -1.745  -112.807 1.00 0.00 ? 21  PRO A HB3  2  
ATOM 2547  H HG2  . PRO A 1 21  ? 151.103 0.250   -114.932 1.00 0.00 ? 21  PRO A HG2  2  
ATOM 2548  H HG3  . PRO A 1 21  ? 151.818 0.258   -113.318 1.00 0.00 ? 21  PRO A HG3  2  
ATOM 2549  H HD2  . PRO A 1 21  ? 153.116 -0.339  -115.834 1.00 0.00 ? 21  PRO A HD2  2  
ATOM 2550  H HD3  . PRO A 1 21  ? 153.836 -0.301  -114.207 1.00 0.00 ? 21  PRO A HD3  2  
ATOM 2551  N N    . PRO A 1 22  ? 149.943 -3.962  -115.708 1.00 0.00 ? 22  PRO A N    2  
ATOM 2552  C CA   . PRO A 1 22  ? 149.205 -4.408  -116.916 1.00 0.00 ? 22  PRO A CA   2  
ATOM 2553  C C    . PRO A 1 22  ? 148.689 -3.209  -117.716 1.00 0.00 ? 22  PRO A C    2  
ATOM 2554  O O    . PRO A 1 22  ? 148.118 -3.350  -118.780 1.00 0.00 ? 22  PRO A O    2  
ATOM 2555  C CB   . PRO A 1 22  ? 148.045 -5.212  -116.325 1.00 0.00 ? 22  PRO A CB   2  
ATOM 2556  C CG   . PRO A 1 22  ? 148.167 -5.212  -114.795 1.00 0.00 ? 22  PRO A CG   2  
ATOM 2557  C CD   . PRO A 1 22  ? 149.407 -4.405  -114.397 1.00 0.00 ? 22  PRO A CD   2  
ATOM 2558  H HA   . PRO A 1 22  ? 149.820 -5.044  -117.530 1.00 0.00 ? 22  PRO A HA   2  
ATOM 2559  H HB2  . PRO A 1 22  ? 147.107 -4.762  -116.615 1.00 0.00 ? 22  PRO A HB2  2  
ATOM 2560  H HB3  . PRO A 1 22  ? 148.086 -6.228  -116.688 1.00 0.00 ? 22  PRO A HB3  2  
ATOM 2561  H HG2  . PRO A 1 22  ? 147.286 -4.759  -114.362 1.00 0.00 ? 22  PRO A HG2  2  
ATOM 2562  H HG3  . PRO A 1 22  ? 148.267 -6.225  -114.438 1.00 0.00 ? 22  PRO A HG3  2  
ATOM 2563  H HD2  . PRO A 1 22  ? 149.130 -3.557  -113.784 1.00 0.00 ? 22  PRO A HD2  2  
ATOM 2564  H HD3  . PRO A 1 22  ? 150.125 -5.029  -113.889 1.00 0.00 ? 22  PRO A HD3  2  
ATOM 2565  N N    . VAL A 1 23  ? 148.882 -2.028  -117.192 1.00 0.00 ? 23  VAL A N    2  
ATOM 2566  C CA   . VAL A 1 23  ? 148.405 -0.802  -117.889 1.00 0.00 ? 23  VAL A CA   2  
ATOM 2567  C C    . VAL A 1 23  ? 149.602 0.045   -118.325 1.00 0.00 ? 23  VAL A C    2  
ATOM 2568  O O    . VAL A 1 23  ? 149.892 0.174   -119.500 1.00 0.00 ? 23  VAL A O    2  
ATOM 2569  C CB   . VAL A 1 23  ? 147.551 0.010   -116.922 1.00 0.00 ? 23  VAL A CB   2  
ATOM 2570  C CG1  . VAL A 1 23  ? 146.745 1.046   -117.699 1.00 0.00 ? 23  VAL A CG1  2  
ATOM 2571  C CG2  . VAL A 1 23  ? 146.608 -0.932  -116.174 1.00 0.00 ? 23  VAL A CG2  2  
ATOM 2572  H H    . VAL A 1 23  ? 149.338 -1.949  -116.328 1.00 0.00 ? 23  VAL A H    2  
ATOM 2573  H HA   . VAL A 1 23  ? 147.819 -1.081  -118.751 1.00 0.00 ? 23  VAL A HA   2  
ATOM 2574  H HB   . VAL A 1 23  ? 148.194 0.514   -116.214 1.00 0.00 ? 23  VAL A HB   2  
ATOM 2575  H HG11 . VAL A 1 23  ? 146.039 0.543   -118.341 1.00 0.00 ? 23  VAL A HG11 2  
ATOM 2576  H HG12 . VAL A 1 23  ? 147.415 1.644   -118.299 1.00 0.00 ? 23  VAL A HG12 2  
ATOM 2577  H HG13 . VAL A 1 23  ? 146.214 1.683   -117.008 1.00 0.00 ? 23  VAL A HG13 2  
ATOM 2578  H HG21 . VAL A 1 23  ? 146.097 -1.564  -116.884 1.00 0.00 ? 23  VAL A HG21 2  
ATOM 2579  H HG22 . VAL A 1 23  ? 145.887 -0.354  -115.619 1.00 0.00 ? 23  VAL A HG22 2  
ATOM 2580  H HG23 . VAL A 1 23  ? 147.179 -1.546  -115.493 1.00 0.00 ? 23  VAL A HG23 2  
ATOM 2581  N N    . GLY A 1 24  ? 150.248 0.676   -117.377 1.00 0.00 ? 24  GLY A N    2  
ATOM 2582  C CA   . GLY A 1 24  ? 151.399 1.571   -117.693 1.00 0.00 ? 24  GLY A CA   2  
ATOM 2583  C C    . GLY A 1 24  ? 150.940 2.621   -118.698 1.00 0.00 ? 24  GLY A C    2  
ATOM 2584  O O    . GLY A 1 24  ? 150.295 3.588   -118.335 1.00 0.00 ? 24  GLY A O    2  
ATOM 2585  H H    . GLY A 1 24  ? 149.937 0.610   -116.451 1.00 0.00 ? 24  GLY A H    2  
ATOM 2586  H HA2  . GLY A 1 24  ? 151.740 2.055   -116.788 1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2587  H HA3  . GLY A 1 24  ? 152.197 0.991   -118.119 1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2588  N N    . PRO A 1 25  ? 151.203 2.420   -119.960 1.00 0.00 ? 25  PRO A N    2  
ATOM 2589  C CA   . PRO A 1 25  ? 150.722 3.376   -120.979 1.00 0.00 ? 25  PRO A CA   2  
ATOM 2590  C C    . PRO A 1 25  ? 149.200 3.477   -120.923 1.00 0.00 ? 25  PRO A C    2  
ATOM 2591  O O    . PRO A 1 25  ? 148.633 4.544   -120.790 1.00 0.00 ? 25  PRO A O    2  
ATOM 2592  C CB   . PRO A 1 25  ? 151.185 2.737   -122.290 1.00 0.00 ? 25  PRO A CB   2  
ATOM 2593  C CG   . PRO A 1 25  ? 151.927 1.431   -121.970 1.00 0.00 ? 25  PRO A CG   2  
ATOM 2594  C CD   . PRO A 1 25  ? 152.000 1.263   -120.449 1.00 0.00 ? 25  PRO A CD   2  
ATOM 2595  H HA   . PRO A 1 25  ? 151.181 4.343   -120.852 1.00 0.00 ? 25  PRO A HA   2  
ATOM 2596  H HB2  . PRO A 1 25  ? 150.326 2.525   -122.913 1.00 0.00 ? 25  PRO A HB2  2  
ATOM 2597  H HB3  . PRO A 1 25  ? 151.851 3.410   -122.807 1.00 0.00 ? 25  PRO A HB3  2  
ATOM 2598  H HG2  . PRO A 1 25  ? 151.394 0.596   -122.403 1.00 0.00 ? 25  PRO A HG2  2  
ATOM 2599  H HG3  . PRO A 1 25  ? 152.926 1.472   -122.376 1.00 0.00 ? 25  PRO A HG3  2  
ATOM 2600  H HD2  . PRO A 1 25  ? 151.563 0.325   -120.148 1.00 0.00 ? 25  PRO A HD2  2  
ATOM 2601  H HD3  . PRO A 1 25  ? 153.019 1.341   -120.106 1.00 0.00 ? 25  PRO A HD3  2  
ATOM 2602  N N    . ALA A 1 26  ? 148.541 2.359   -121.047 1.00 0.00 ? 26  ALA A N    2  
ATOM 2603  C CA   . ALA A 1 26  ? 147.053 2.358   -121.031 1.00 0.00 ? 26  ALA A CA   2  
ATOM 2604  C C    . ALA A 1 26  ? 146.530 3.254   -119.903 1.00 0.00 ? 26  ALA A C    2  
ATOM 2605  O O    . ALA A 1 26  ? 145.343 3.493   -119.802 1.00 0.00 ? 26  ALA A O    2  
ATOM 2606  C CB   . ALA A 1 26  ? 146.548 0.930   -120.826 1.00 0.00 ? 26  ALA A CB   2  
ATOM 2607  H H    . ALA A 1 26  ? 149.035 1.519   -121.196 1.00 0.00 ? 26  ALA A H    2  
ATOM 2608  H HA   . ALA A 1 26  ? 146.688 2.729   -121.976 1.00 0.00 ? 26  ALA A HA   2  
ATOM 2609  H HB1  . ALA A 1 26  ? 145.556 0.956   -120.402 1.00 0.00 ? 26  ALA A HB1  2  
ATOM 2610  H HB2  . ALA A 1 26  ? 147.213 0.407   -120.157 1.00 0.00 ? 26  ALA A HB2  2  
ATOM 2611  H HB3  . ALA A 1 26  ? 146.520 0.418   -121.777 1.00 0.00 ? 26  ALA A HB3  2  
ATOM 2612  N N    . LEU A 1 27  ? 147.390 3.763   -119.059 1.00 0.00 ? 27  LEU A N    2  
ATOM 2613  C CA   . LEU A 1 27  ? 146.888 4.646   -117.967 1.00 0.00 ? 27  LEU A CA   2  
ATOM 2614  C C    . LEU A 1 27  ? 147.362 6.072   -118.239 1.00 0.00 ? 27  LEU A C    2  
ATOM 2615  O O    . LEU A 1 27  ? 146.616 7.025   -118.122 1.00 0.00 ? 27  LEU A O    2  
ATOM 2616  C CB   . LEU A 1 27  ? 147.440 4.161   -116.626 1.00 0.00 ? 27  LEU A CB   2  
ATOM 2617  C CG   . LEU A 1 27  ? 146.373 4.221   -115.531 1.00 0.00 ? 27  LEU A CG   2  
ATOM 2618  C CD1  . LEU A 1 27  ? 147.070 4.441   -114.192 1.00 0.00 ? 27  LEU A CD1  2  
ATOM 2619  C CD2  . LEU A 1 27  ? 145.403 5.378   -115.783 1.00 0.00 ? 27  LEU A CD2  2  
ATOM 2620  H H    . LEU A 1 27  ? 148.349 3.573   -119.150 1.00 0.00 ? 27  LEU A H    2  
ATOM 2621  H HA   . LEU A 1 27  ? 145.809 4.594   -117.987 1.00 0.00 ? 27  LEU A HA   2  
ATOM 2622  H HB2  . LEU A 1 27  ? 147.782 3.142   -116.731 1.00 0.00 ? 27  LEU A HB2  2  
ATOM 2623  H HB3  . LEU A 1 27  ? 148.275 4.785   -116.342 1.00 0.00 ? 27  LEU A HB3  2  
ATOM 2624  H HG   . LEU A 1 27  ? 145.829 3.287   -115.505 1.00 0.00 ? 27  LEU A HG   2  
ATOM 2625  H HD11 . LEU A 1 27  ? 148.050 3.988   -114.225 1.00 0.00 ? 27  LEU A HD11 2  
ATOM 2626  H HD12 . LEU A 1 27  ? 146.488 3.991   -113.404 1.00 0.00 ? 27  LEU A HD12 2  
ATOM 2627  H HD13 . LEU A 1 27  ? 147.170 5.500   -114.008 1.00 0.00 ? 27  LEU A HD13 2  
ATOM 2628  H HD21 . LEU A 1 27  ? 144.572 5.029   -116.379 1.00 0.00 ? 27  LEU A HD21 2  
ATOM 2629  H HD22 . LEU A 1 27  ? 145.914 6.170   -116.305 1.00 0.00 ? 27  LEU A HD22 2  
ATOM 2630  H HD23 . LEU A 1 27  ? 145.034 5.749   -114.839 1.00 0.00 ? 27  LEU A HD23 2  
ATOM 2631  N N    . GLY A 1 28  ? 148.603 6.223   -118.615 1.00 0.00 ? 28  GLY A N    2  
ATOM 2632  C CA   . GLY A 1 28  ? 149.134 7.580   -118.907 1.00 0.00 ? 28  GLY A CA   2  
ATOM 2633  C C    . GLY A 1 28  ? 148.210 8.278   -119.905 1.00 0.00 ? 28  GLY A C    2  
ATOM 2634  O O    . GLY A 1 28  ? 148.400 8.205   -121.102 1.00 0.00 ? 28  GLY A O    2  
ATOM 2635  H H    . GLY A 1 28  ? 149.184 5.440   -118.713 1.00 0.00 ? 28  GLY A H    2  
ATOM 2636  H HA2  . GLY A 1 28  ? 149.179 8.154   -117.991 1.00 0.00 ? 28  GLY A HA2  2  
ATOM 2637  H HA3  . GLY A 1 28  ? 150.123 7.497   -119.331 1.00 0.00 ? 28  GLY A HA3  2  
ATOM 2638  N N    . GLN A 1 29  ? 147.213 8.960   -119.415 1.00 0.00 ? 29  GLN A N    2  
ATOM 2639  C CA   . GLN A 1 29  ? 146.270 9.676   -120.318 1.00 0.00 ? 29  GLN A CA   2  
ATOM 2640  C C    . GLN A 1 29  ? 145.727 10.888  -119.563 1.00 0.00 ? 29  GLN A C    2  
ATOM 2641  O O    . GLN A 1 29  ? 145.132 11.781  -120.132 1.00 0.00 ? 29  GLN A O    2  
ATOM 2642  C CB   . GLN A 1 29  ? 145.116 8.747   -120.702 1.00 0.00 ? 29  GLN A CB   2  
ATOM 2643  C CG   . GLN A 1 29  ? 144.235 9.432   -121.749 1.00 0.00 ? 29  GLN A CG   2  
ATOM 2644  C CD   . GLN A 1 29  ? 143.287 8.405   -122.370 1.00 0.00 ? 29  GLN A CD   2  
ATOM 2645  O OE1  . GLN A 1 29  ? 142.802 7.520   -121.692 1.00 0.00 ? 29  GLN A OE1  2  
ATOM 2646  N NE2  . GLN A 1 29  ? 143.000 8.485   -123.641 1.00 0.00 ? 29  GLN A NE2  2  
ATOM 2647  H H    . GLN A 1 29  ? 147.084 9.014   -118.446 1.00 0.00 ? 29  GLN A H    2  
ATOM 2648  H HA   . GLN A 1 29  ? 146.790 10.004  -121.205 1.00 0.00 ? 29  GLN A HA   2  
ATOM 2649  H HB2  . GLN A 1 29  ? 145.514 7.829   -121.110 1.00 0.00 ? 29  GLN A HB2  2  
ATOM 2650  H HB3  . GLN A 1 29  ? 144.525 8.525   -119.827 1.00 0.00 ? 29  GLN A HB3  2  
ATOM 2651  H HG2  . GLN A 1 29  ? 143.661 10.216  -121.278 1.00 0.00 ? 29  GLN A HG2  2  
ATOM 2652  H HG3  . GLN A 1 29  ? 144.858 9.857   -122.522 1.00 0.00 ? 29  GLN A HG3  2  
ATOM 2653  H HE21 . GLN A 1 29  ? 143.390 9.198   -124.187 1.00 0.00 ? 29  GLN A HE21 2  
ATOM 2654  H HE22 . GLN A 1 29  ? 142.392 7.832   -124.048 1.00 0.00 ? 29  GLN A HE22 2  
ATOM 2655  N N    . HIS A 1 30  ? 145.951 10.921  -118.280 1.00 0.00 ? 30  HIS A N    2  
ATOM 2656  C CA   . HIS A 1 30  ? 145.482 12.065  -117.454 1.00 0.00 ? 30  HIS A CA   2  
ATOM 2657  C C    . HIS A 1 30  ? 146.561 13.146  -117.469 1.00 0.00 ? 30  HIS A C    2  
ATOM 2658  O O    . HIS A 1 30  ? 146.281 14.327  -117.487 1.00 0.00 ? 30  HIS A O    2  
ATOM 2659  C CB   . HIS A 1 30  ? 145.260 11.586  -116.016 1.00 0.00 ? 30  HIS A CB   2  
ATOM 2660  C CG   . HIS A 1 30  ? 146.543 11.709  -115.239 1.00 0.00 ? 30  HIS A CG   2  
ATOM 2661  N ND1  . HIS A 1 30  ? 147.578 10.797  -115.372 1.00 0.00 ? 30  HIS A ND1  2  
ATOM 2662  C CD2  . HIS A 1 30  ? 146.973 12.631  -114.318 1.00 0.00 ? 30  HIS A CD2  2  
ATOM 2663  C CE1  . HIS A 1 30  ? 148.570 11.186  -114.551 1.00 0.00 ? 30  HIS A CE1  2  
ATOM 2664  N NE2  . HIS A 1 30  ? 148.253 12.299  -113.884 1.00 0.00 ? 30  HIS A NE2  2  
ATOM 2665  H H    . HIS A 1 30  ? 146.447 10.189  -117.855 1.00 0.00 ? 30  HIS A H    2  
ATOM 2666  H HA   . HIS A 1 30  ? 144.554 12.455  -117.848 1.00 0.00 ? 30  HIS A HA   2  
ATOM 2667  H HB2  . HIS A 1 30  ? 144.497 12.189  -115.549 1.00 0.00 ? 30  HIS A HB2  2  
ATOM 2668  H HB3  . HIS A 1 30  ? 144.946 10.553  -116.026 1.00 0.00 ? 30  HIS A HB3  2  
ATOM 2669  H HD1  . HIS A 1 30  ? 147.585 10.010  -115.958 1.00 0.00 ? 30  HIS A HD1  2  
ATOM 2670  H HD2  . HIS A 1 30  ? 146.404 13.485  -113.980 1.00 0.00 ? 30  HIS A HD2  2  
ATOM 2671  H HE1  . HIS A 1 30  ? 149.508 10.662  -114.444 1.00 0.00 ? 30  HIS A HE1  2  
ATOM 2672  N N    . GLY A 1 31  ? 147.798 12.733  -117.466 1.00 0.00 ? 31  GLY A N    2  
ATOM 2673  C CA   . GLY A 1 31  ? 148.924 13.706  -117.483 1.00 0.00 ? 31  GLY A CA   2  
ATOM 2674  C C    . GLY A 1 31  ? 150.236 12.936  -117.649 1.00 0.00 ? 31  GLY A C    2  
ATOM 2675  O O    . GLY A 1 31  ? 151.299 13.513  -117.766 1.00 0.00 ? 31  GLY A O    2  
ATOM 2676  H H    . GLY A 1 31  ? 147.989 11.773  -117.454 1.00 0.00 ? 31  GLY A H    2  
ATOM 2677  H HA2  . GLY A 1 31  ? 148.797 14.393  -118.308 1.00 0.00 ? 31  GLY A HA2  2  
ATOM 2678  H HA3  . GLY A 1 31  ? 148.945 14.253  -116.553 1.00 0.00 ? 31  GLY A HA3  2  
ATOM 2679  N N    . ALA A 1 32  ? 150.155 11.634  -117.712 1.00 0.00 ? 32  ALA A N    2  
ATOM 2680  C CA   . ALA A 1 32  ? 151.376 10.806  -117.933 1.00 0.00 ? 32  ALA A CA   2  
ATOM 2681  C C    . ALA A 1 32  ? 152.242 10.712  -116.675 1.00 0.00 ? 32  ALA A C    2  
ATOM 2682  O O    . ALA A 1 32  ? 153.217 11.423  -116.531 1.00 0.00 ? 32  ALA A O    2  
ATOM 2683  C CB   . ALA A 1 32  ? 152.196 11.421  -119.065 1.00 0.00 ? 32  ALA A CB   2  
ATOM 2684  H H    . ALA A 1 32  ? 149.283 11.191  -117.652 1.00 0.00 ? 32  ALA A H    2  
ATOM 2685  H HA   . ALA A 1 32  ? 151.074 9.811   -118.223 1.00 0.00 ? 32  ALA A HA   2  
ATOM 2686  H HB1  . ALA A 1 32  ? 152.935 12.091  -118.652 1.00 0.00 ? 32  ALA A HB1  2  
ATOM 2687  H HB2  . ALA A 1 32  ? 151.542 11.971  -119.726 1.00 0.00 ? 32  ALA A HB2  2  
ATOM 2688  H HB3  . ALA A 1 32  ? 152.690 10.637  -119.620 1.00 0.00 ? 32  ALA A HB3  2  
ATOM 2689  N N    . ASN A 1 33  ? 151.926 9.815   -115.780 1.00 0.00 ? 33  ASN A N    2  
ATOM 2690  C CA   . ASN A 1 33  ? 152.767 9.654   -114.560 1.00 0.00 ? 33  ASN A CA   2  
ATOM 2691  C C    . ASN A 1 33  ? 152.542 8.249   -113.993 1.00 0.00 ? 33  ASN A C    2  
ATOM 2692  O O    . ASN A 1 33  ? 151.440 7.865   -113.654 1.00 0.00 ? 33  ASN A O    2  
ATOM 2693  C CB   . ASN A 1 33  ? 152.409 10.717  -113.518 1.00 0.00 ? 33  ASN A CB   2  
ATOM 2694  C CG   . ASN A 1 33  ? 152.547 12.109  -114.141 1.00 0.00 ? 33  ASN A CG   2  
ATOM 2695  O OD1  . ASN A 1 33  ? 151.564 12.788  -114.362 1.00 0.00 ? 33  ASN A OD1  2  
ATOM 2696  N ND2  . ASN A 1 33  ? 153.734 12.564  -114.435 1.00 0.00 ? 33  ASN A ND2  2  
ATOM 2697  H H    . ASN A 1 33  ? 151.153 9.227   -115.914 1.00 0.00 ? 33  ASN A H    2  
ATOM 2698  H HA   . ASN A 1 33  ? 153.804 9.740   -114.846 1.00 0.00 ? 33  ASN A HA   2  
ATOM 2699  H HB2  . ASN A 1 33  ? 151.391 10.569  -113.187 1.00 0.00 ? 33  ASN A HB2  2  
ATOM 2700  H HB3  . ASN A 1 33  ? 153.079 10.634  -112.675 1.00 0.00 ? 33  ASN A HB3  2  
ATOM 2701  H HD21 . ASN A 1 33  ? 154.527 12.016  -114.257 1.00 0.00 ? 33  ASN A HD21 2  
ATOM 2702  H HD22 . ASN A 1 33  ? 153.832 13.453  -114.834 1.00 0.00 ? 33  ASN A HD22 2  
ATOM 2703  N N    . ILE A 1 34  ? 153.592 7.477   -113.913 1.00 0.00 ? 34  ILE A N    2  
ATOM 2704  C CA   . ILE A 1 34  ? 153.477 6.080   -113.397 1.00 0.00 ? 34  ILE A CA   2  
ATOM 2705  C C    . ILE A 1 34  ? 153.865 6.039   -111.914 1.00 0.00 ? 34  ILE A C    2  
ATOM 2706  O O    . ILE A 1 34  ? 153.063 5.710   -111.064 1.00 0.00 ? 34  ILE A O    2  
ATOM 2707  C CB   . ILE A 1 34  ? 154.428 5.185   -114.200 1.00 0.00 ? 34  ILE A CB   2  
ATOM 2708  C CG1  . ILE A 1 34  ? 153.984 5.143   -115.667 1.00 0.00 ? 34  ILE A CG1  2  
ATOM 2709  C CG2  . ILE A 1 34  ? 154.429 3.767   -113.624 1.00 0.00 ? 34  ILE A CG2  2  
ATOM 2710  C CD1  . ILE A 1 34  ? 152.489 4.829   -115.753 1.00 0.00 ? 34  ILE A CD1  2  
ATOM 2711  H H    . ILE A 1 34  ? 154.463 7.818   -114.208 1.00 0.00 ? 34  ILE A H    2  
ATOM 2712  H HA   . ILE A 1 34  ? 152.458 5.730   -113.517 1.00 0.00 ? 34  ILE A HA   2  
ATOM 2713  H HB   . ILE A 1 34  ? 155.429 5.590   -114.141 1.00 0.00 ? 34  ILE A HB   2  
ATOM 2714  H HG12 . ILE A 1 34  ? 154.177 6.103   -116.126 1.00 0.00 ? 34  ILE A HG12 2  
ATOM 2715  H HG13 . ILE A 1 34  ? 154.541 4.378   -116.188 1.00 0.00 ? 34  ILE A HG13 2  
ATOM 2716  H HG21 . ILE A 1 34  ? 155.205 3.683   -112.877 1.00 0.00 ? 34  ILE A HG21 2  
ATOM 2717  H HG22 . ILE A 1 34  ? 154.617 3.058   -114.418 1.00 0.00 ? 34  ILE A HG22 2  
ATOM 2718  H HG23 . ILE A 1 34  ? 153.472 3.558   -113.174 1.00 0.00 ? 34  ILE A HG23 2  
ATOM 2719  H HD11 . ILE A 1 34  ? 152.223 4.129   -114.975 1.00 0.00 ? 34  ILE A HD11 2  
ATOM 2720  H HD12 . ILE A 1 34  ? 152.267 4.397   -116.718 1.00 0.00 ? 34  ILE A HD12 2  
ATOM 2721  H HD13 . ILE A 1 34  ? 151.922 5.739   -115.628 1.00 0.00 ? 34  ILE A HD13 2  
ATOM 2722  N N    . MET A 1 35  ? 155.101 6.317   -111.597 1.00 0.00 ? 35  MET A N    2  
ATOM 2723  C CA   . MET A 1 35  ? 155.530 6.226   -110.171 1.00 0.00 ? 35  MET A CA   2  
ATOM 2724  C C    . MET A 1 35  ? 154.440 6.807   -109.271 1.00 0.00 ? 35  MET A C    2  
ATOM 2725  O O    . MET A 1 35  ? 153.931 6.131   -108.400 1.00 0.00 ? 35  MET A O    2  
ATOM 2726  C CB   . MET A 1 35  ? 156.827 7.016   -109.979 1.00 0.00 ? 35  MET A CB   2  
ATOM 2727  C CG   . MET A 1 35  ? 157.699 6.319   -108.934 1.00 0.00 ? 35  MET A CG   2  
ATOM 2728  S SD   . MET A 1 35  ? 156.947 6.505   -107.298 1.00 0.00 ? 35  MET A SD   2  
ATOM 2729  C CE   . MET A 1 35  ? 156.800 4.742   -106.915 1.00 0.00 ? 35  MET A CE   2  
ATOM 2730  H H    . MET A 1 35  ? 155.757 6.505   -112.300 1.00 0.00 ? 35  MET A H    2  
ATOM 2731  H HA   . MET A 1 35  ? 155.701 5.189   -109.923 1.00 0.00 ? 35  MET A HA   2  
ATOM 2732  H HB2  . MET A 1 35  ? 157.359 7.069   -110.917 1.00 0.00 ? 35  MET A HB2  2  
ATOM 2733  H HB3  . MET A 1 35  ? 156.593 8.015   -109.641 1.00 0.00 ? 35  MET A HB3  2  
ATOM 2734  H HG2  . MET A 1 35  ? 157.781 5.270   -109.175 1.00 0.00 ? 35  MET A HG2  2  
ATOM 2735  H HG3  . MET A 1 35  ? 158.683 6.765   -108.930 1.00 0.00 ? 35  MET A HG3  2  
ATOM 2736  H HE1  . MET A 1 35  ? 156.675 4.616   -105.848 1.00 0.00 ? 35  MET A HE1  2  
ATOM 2737  H HE2  . MET A 1 35  ? 157.692 4.228   -107.234 1.00 0.00 ? 35  MET A HE2  2  
ATOM 2738  H HE3  . MET A 1 35  ? 155.944 4.332   -107.434 1.00 0.00 ? 35  MET A HE3  2  
ATOM 2739  N N    . GLU A 1 36  ? 154.045 8.031   -109.481 1.00 0.00 ? 36  GLU A N    2  
ATOM 2740  C CA   . GLU A 1 36  ? 152.957 8.595   -108.634 1.00 0.00 ? 36  GLU A CA   2  
ATOM 2741  C C    . GLU A 1 36  ? 151.857 7.536   -108.520 1.00 0.00 ? 36  GLU A C    2  
ATOM 2742  O O    . GLU A 1 36  ? 151.389 7.217   -107.444 1.00 0.00 ? 36  GLU A O    2  
ATOM 2743  C CB   . GLU A 1 36  ? 152.389 9.848   -109.304 1.00 0.00 ? 36  GLU A CB   2  
ATOM 2744  C CG   . GLU A 1 36  ? 153.081 11.090  -108.736 1.00 0.00 ? 36  GLU A CG   2  
ATOM 2745  C CD   . GLU A 1 36  ? 153.149 12.174  -109.813 1.00 0.00 ? 36  GLU A CD   2  
ATOM 2746  O OE1  . GLU A 1 36  ? 152.457 12.037  -110.808 1.00 0.00 ? 36  GLU A OE1  2  
ATOM 2747  O OE2  . GLU A 1 36  ? 153.893 13.122  -109.623 1.00 0.00 ? 36  GLU A OE2  2  
ATOM 2748  H H    . GLU A 1 36  ? 154.440 8.565   -110.201 1.00 0.00 ? 36  GLU A H    2  
ATOM 2749  H HA   . GLU A 1 36  ? 153.335 8.846   -107.653 1.00 0.00 ? 36  GLU A HA   2  
ATOM 2750  H HB2  . GLU A 1 36  ? 152.560 9.795   -110.370 1.00 0.00 ? 36  GLU A HB2  2  
ATOM 2751  H HB3  . GLU A 1 36  ? 151.328 9.911   -109.111 1.00 0.00 ? 36  GLU A HB3  2  
ATOM 2752  H HG2  . GLU A 1 36  ? 152.521 11.457  -107.888 1.00 0.00 ? 36  GLU A HG2  2  
ATOM 2753  H HG3  . GLU A 1 36  ? 154.082 10.832  -108.423 1.00 0.00 ? 36  GLU A HG3  2  
ATOM 2754  N N    . PHE A 1 37  ? 151.469 6.972   -109.630 1.00 0.00 ? 37  PHE A N    2  
ATOM 2755  C CA   . PHE A 1 37  ? 150.427 5.908   -109.622 1.00 0.00 ? 37  PHE A CA   2  
ATOM 2756  C C    . PHE A 1 37  ? 150.791 4.828   -108.609 1.00 0.00 ? 37  PHE A C    2  
ATOM 2757  O O    . PHE A 1 37  ? 150.142 4.623   -107.599 1.00 0.00 ? 37  PHE A O    2  
ATOM 2758  C CB   . PHE A 1 37  ? 150.420 5.210   -110.976 1.00 0.00 ? 37  PHE A CB   2  
ATOM 2759  C CG   . PHE A 1 37  ? 149.262 4.236   -111.040 1.00 0.00 ? 37  PHE A CG   2  
ATOM 2760  C CD1  . PHE A 1 37  ? 148.344 4.133   -109.980 1.00 0.00 ? 37  PHE A CD1  2  
ATOM 2761  C CD2  . PHE A 1 37  ? 149.091 3.454   -112.182 1.00 0.00 ? 37  PHE A CD2  2  
ATOM 2762  C CE1  . PHE A 1 37  ? 147.269 3.244   -110.071 1.00 0.00 ? 37  PHE A CE1  2  
ATOM 2763  C CE2  . PHE A 1 37  ? 148.013 2.568   -112.274 1.00 0.00 ? 37  PHE A CE2  2  
ATOM 2764  C CZ   . PHE A 1 37  ? 147.102 2.462   -111.218 1.00 0.00 ? 37  PHE A CZ   2  
ATOM 2765  H H    . PHE A 1 37  ? 151.881 7.241   -110.478 1.00 0.00 ? 37  PHE A H    2  
ATOM 2766  H HA   . PHE A 1 37  ? 149.446 6.325   -109.448 1.00 0.00 ? 37  PHE A HA   2  
ATOM 2767  H HB2  . PHE A 1 37  ? 150.317 5.945   -111.761 1.00 0.00 ? 37  PHE A HB2  2  
ATOM 2768  H HB3  . PHE A 1 37  ? 151.344 4.669   -111.108 1.00 0.00 ? 37  PHE A HB3  2  
ATOM 2769  H HD1  . PHE A 1 37  ? 148.465 4.730   -109.092 1.00 0.00 ? 37  PHE A HD1  2  
ATOM 2770  H HD2  . PHE A 1 37  ? 149.799 3.528   -112.989 1.00 0.00 ? 37  PHE A HD2  2  
ATOM 2771  H HE1  . PHE A 1 37  ? 146.566 3.161   -109.256 1.00 0.00 ? 37  PHE A HE1  2  
ATOM 2772  H HE2  . PHE A 1 37  ? 147.883 1.963   -113.160 1.00 0.00 ? 37  PHE A HE2  2  
ATOM 2773  H HZ   . PHE A 1 37  ? 146.268 1.783   -111.291 1.00 0.00 ? 37  PHE A HZ   2  
ATOM 2774  N N    . VAL A 1 38  ? 151.840 4.119   -108.926 1.00 0.00 ? 38  VAL A N    2  
ATOM 2775  C CA   . VAL A 1 38  ? 152.302 3.008   -108.061 1.00 0.00 ? 38  VAL A CA   2  
ATOM 2776  C C    . VAL A 1 38  ? 152.631 3.540   -106.666 1.00 0.00 ? 38  VAL A C    2  
ATOM 2777  O O    . VAL A 1 38  ? 152.356 2.904   -105.668 1.00 0.00 ? 38  VAL A O    2  
ATOM 2778  C CB   . VAL A 1 38  ? 153.546 2.360   -108.675 1.00 0.00 ? 38  VAL A CB   2  
ATOM 2779  C CG1  . VAL A 1 38  ? 153.935 1.124   -107.860 1.00 0.00 ? 38  VAL A CG1  2  
ATOM 2780  C CG2  . VAL A 1 38  ? 153.238 1.938   -110.113 1.00 0.00 ? 38  VAL A CG2  2  
ATOM 2781  H H    . VAL A 1 38  ? 152.314 4.331   -109.758 1.00 0.00 ? 38  VAL A H    2  
ATOM 2782  H HA   . VAL A 1 38  ? 151.516 2.272   -107.993 1.00 0.00 ? 38  VAL A HA   2  
ATOM 2783  H HB   . VAL A 1 38  ? 154.361 3.068   -108.671 1.00 0.00 ? 38  VAL A HB   2  
ATOM 2784  H HG11 . VAL A 1 38  ? 155.001 1.131   -107.683 1.00 0.00 ? 38  VAL A HG11 2  
ATOM 2785  H HG12 . VAL A 1 38  ? 153.668 0.233   -108.408 1.00 0.00 ? 38  VAL A HG12 2  
ATOM 2786  H HG13 . VAL A 1 38  ? 153.413 1.136   -106.915 1.00 0.00 ? 38  VAL A HG13 2  
ATOM 2787  H HG21 . VAL A 1 38  ? 152.432 1.217   -110.111 1.00 0.00 ? 38  VAL A HG21 2  
ATOM 2788  H HG22 . VAL A 1 38  ? 154.118 1.492   -110.553 1.00 0.00 ? 38  VAL A HG22 2  
ATOM 2789  H HG23 . VAL A 1 38  ? 152.946 2.803   -110.688 1.00 0.00 ? 38  VAL A HG23 2  
ATOM 2790  N N    . LYS A 1 39  ? 153.188 4.721   -106.586 1.00 0.00 ? 39  LYS A N    2  
ATOM 2791  C CA   . LYS A 1 39  ? 153.492 5.299   -105.250 1.00 0.00 ? 39  LYS A CA   2  
ATOM 2792  C C    . LYS A 1 39  ? 152.234 5.179   -104.396 1.00 0.00 ? 39  LYS A C    2  
ATOM 2793  O O    . LYS A 1 39  ? 152.206 4.470   -103.409 1.00 0.00 ? 39  LYS A O    2  
ATOM 2794  C CB   . LYS A 1 39  ? 153.891 6.771   -105.389 1.00 0.00 ? 39  LYS A CB   2  
ATOM 2795  C CG   . LYS A 1 39  ? 155.117 7.053   -104.519 1.00 0.00 ? 39  LYS A CG   2  
ATOM 2796  C CD   . LYS A 1 39  ? 155.739 8.390   -104.930 1.00 0.00 ? 39  LYS A CD   2  
ATOM 2797  C CE   . LYS A 1 39  ? 154.997 9.534   -104.234 1.00 0.00 ? 39  LYS A CE   2  
ATOM 2798  N NZ   . LYS A 1 39  ? 155.764 10.800  -104.407 1.00 0.00 ? 39  LYS A NZ   2  
ATOM 2799  H H    . LYS A 1 39  ? 153.381 5.232   -107.401 1.00 0.00 ? 39  LYS A H    2  
ATOM 2800  H HA   . LYS A 1 39  ? 154.286 4.742   -104.773 1.00 0.00 ? 39  LYS A HA   2  
ATOM 2801  H HB2  . LYS A 1 39  ? 154.125 6.985   -106.421 1.00 0.00 ? 39  LYS A HB2  2  
ATOM 2802  H HB3  . LYS A 1 39  ? 153.072 7.397   -105.068 1.00 0.00 ? 39  LYS A HB3  2  
ATOM 2803  H HG2  . LYS A 1 39  ? 154.819 7.098   -103.481 1.00 0.00 ? 39  LYS A HG2  2  
ATOM 2804  H HG3  . LYS A 1 39  ? 155.844 6.266   -104.651 1.00 0.00 ? 39  LYS A HG3  2  
ATOM 2805  H HD2  . LYS A 1 39  ? 156.780 8.407   -104.641 1.00 0.00 ? 39  LYS A HD2  2  
ATOM 2806  H HD3  . LYS A 1 39  ? 155.658 8.510   -105.999 1.00 0.00 ? 39  LYS A HD3  2  
ATOM 2807  H HE2  . LYS A 1 39  ? 154.016 9.645   -104.671 1.00 0.00 ? 39  LYS A HE2  2  
ATOM 2808  H HE3  . LYS A 1 39  ? 154.900 9.312   -103.181 1.00 0.00 ? 39  LYS A HE3  2  
ATOM 2809  H HZ1  . LYS A 1 39  ? 155.302 11.562  -103.871 1.00 0.00 ? 39  LYS A HZ1  2  
ATOM 2810  H HZ2  . LYS A 1 39  ? 155.794 11.053  -105.416 1.00 0.00 ? 39  LYS A HZ2  2  
ATOM 2811  H HZ3  . LYS A 1 39  ? 156.734 10.670  -104.054 1.00 0.00 ? 39  LYS A HZ3  2  
ATOM 2812  N N    . ALA A 1 40  ? 151.189 5.874   -104.761 1.00 0.00 ? 40  ALA A N    2  
ATOM 2813  C CA   . ALA A 1 40  ? 149.942 5.797   -103.954 1.00 0.00 ? 40  ALA A CA   2  
ATOM 2814  C C    . ALA A 1 40  ? 149.520 4.336   -103.828 1.00 0.00 ? 40  ALA A C    2  
ATOM 2815  O O    . ALA A 1 40  ? 149.025 3.911   -102.796 1.00 0.00 ? 40  ALA A O    2  
ATOM 2816  C CB   . ALA A 1 40  ? 148.832 6.615   -104.617 1.00 0.00 ? 40  ALA A CB   2  
ATOM 2817  H H    . ALA A 1 40  ? 151.230 6.447   -105.557 1.00 0.00 ? 40  ALA A H    2  
ATOM 2818  H HA   . ALA A 1 40  ? 150.148 6.180   -102.966 1.00 0.00 ? 40  ALA A HA   2  
ATOM 2819  H HB1  . ALA A 1 40  ? 149.176 7.627   -104.774 1.00 0.00 ? 40  ALA A HB1  2  
ATOM 2820  H HB2  . ALA A 1 40  ? 147.962 6.627   -103.976 1.00 0.00 ? 40  ALA A HB2  2  
ATOM 2821  H HB3  . ALA A 1 40  ? 148.575 6.171   -105.566 1.00 0.00 ? 40  ALA A HB3  2  
ATOM 2822  N N    . PHE A 1 41  ? 149.773 3.527   -104.822 1.00 0.00 ? 41  PHE A N    2  
ATOM 2823  C CA   . PHE A 1 41  ? 149.438 2.090   -104.689 1.00 0.00 ? 41  PHE A CA   2  
ATOM 2824  C C    . PHE A 1 41  ? 150.456 1.479   -103.738 1.00 0.00 ? 41  PHE A C    2  
ATOM 2825  O O    . PHE A 1 41  ? 150.156 1.213   -102.591 1.00 0.00 ? 41  PHE A O    2  
ATOM 2826  C CB   . PHE A 1 41  ? 149.550 1.412   -106.056 1.00 0.00 ? 41  PHE A CB   2  
ATOM 2827  C CG   . PHE A 1 41  ? 148.484 0.350   -106.168 1.00 0.00 ? 41  PHE A CG   2  
ATOM 2828  C CD1  . PHE A 1 41  ? 147.144 0.718   -106.343 1.00 0.00 ? 41  PHE A CD1  2  
ATOM 2829  C CD2  . PHE A 1 41  ? 148.832 -1.003  -106.090 1.00 0.00 ? 41  PHE A CD2  2  
ATOM 2830  C CE1  . PHE A 1 41  ? 146.154 -0.266  -106.439 1.00 0.00 ? 41  PHE A CE1  2  
ATOM 2831  C CE2  . PHE A 1 41  ? 147.842 -1.987  -106.185 1.00 0.00 ? 41  PHE A CE2  2  
ATOM 2832  C CZ   . PHE A 1 41  ? 146.503 -1.620  -106.360 1.00 0.00 ? 41  PHE A CZ   2  
ATOM 2833  H H    . PHE A 1 41  ? 150.249 3.818   -105.632 1.00 0.00 ? 41  PHE A H    2  
ATOM 2834  H HA   . PHE A 1 41  ? 148.439 1.950   -104.300 1.00 0.00 ? 41  PHE A HA   2  
ATOM 2835  H HB2  . PHE A 1 41  ? 149.413 2.147   -106.836 1.00 0.00 ? 41  PHE A HB2  2  
ATOM 2836  H HB3  . PHE A 1 41  ? 150.523 0.956   -106.155 1.00 0.00 ? 41  PHE A HB3  2  
ATOM 2837  H HD1  . PHE A 1 41  ? 146.875 1.763   -106.404 1.00 0.00 ? 41  PHE A HD1  2  
ATOM 2838  H HD2  . PHE A 1 41  ? 149.865 -1.287  -105.955 1.00 0.00 ? 41  PHE A HD2  2  
ATOM 2839  H HE1  . PHE A 1 41  ? 145.120 0.018   -106.573 1.00 0.00 ? 41  PHE A HE1  2  
ATOM 2840  H HE2  . PHE A 1 41  ? 148.112 -3.032  -106.125 1.00 0.00 ? 41  PHE A HE2  2  
ATOM 2841  H HZ   . PHE A 1 41  ? 145.739 -2.379  -106.434 1.00 0.00 ? 41  PHE A HZ   2  
ATOM 2842  N N    . ASN A 1 42  ? 151.642 1.199   -104.201 1.00 0.00 ? 42  ASN A N    2  
ATOM 2843  C CA   . ASN A 1 42  ? 152.643 0.546   -103.325 1.00 0.00 ? 42  ASN A CA   2  
ATOM 2844  C C    . ASN A 1 42  ? 152.604 1.143   -101.921 1.00 0.00 ? 42  ASN A C    2  
ATOM 2845  O O    . ASN A 1 42  ? 152.851 0.486   -100.930 1.00 0.00 ? 42  ASN A O    2  
ATOM 2846  C CB   . ASN A 1 42  ? 154.028 0.829   -103.911 1.00 0.00 ? 42  ASN A CB   2  
ATOM 2847  C CG   . ASN A 1 42  ? 154.415 -0.291  -104.877 1.00 0.00 ? 42  ASN A CG   2  
ATOM 2848  O OD1  . ASN A 1 42  ? 153.569 -1.035  -105.332 1.00 0.00 ? 42  ASN A OD1  2  
ATOM 2849  N ND2  . ASN A 1 42  ? 155.667 -0.446  -105.211 1.00 0.00 ? 42  ASN A ND2  2  
ATOM 2850  H H    . ASN A 1 42  ? 151.874 1.323   -105.146 1.00 0.00 ? 42  ASN A H    2  
ATOM 2851  H HA   . ASN A 1 42  ? 152.483 -0.522  -103.364 1.00 0.00 ? 42  ASN A HA   2  
ATOM 2852  H HB2  . ASN A 1 42  ? 154.010 1.772   -104.439 1.00 0.00 ? 42  ASN A HB2  2  
ATOM 2853  H HB3  . ASN A 1 42  ? 154.753 0.879   -103.112 1.00 0.00 ? 42  ASN A HB3  2  
ATOM 2854  H HD21 . ASN A 1 42  ? 156.350 0.154   -104.843 1.00 0.00 ? 42  ASN A HD21 2  
ATOM 2855  H HD22 . ASN A 1 42  ? 155.925 -1.161  -105.829 1.00 0.00 ? 42  ASN A HD22 2  
ATOM 2856  N N    . ALA A 1 43  ? 152.297 2.415   -101.861 1.00 0.00 ? 43  ALA A N    2  
ATOM 2857  C CA   . ALA A 1 43  ? 152.231 3.140   -100.564 1.00 0.00 ? 43  ALA A CA   2  
ATOM 2858  C C    . ALA A 1 43  ? 151.025 2.665   -99.757  1.00 0.00 ? 43  ALA A C    2  
ATOM 2859  O O    . ALA A 1 43  ? 151.065 2.593   -98.542  1.00 0.00 ? 43  ALA A O    2  
ATOM 2860  C CB   . ALA A 1 43  ? 152.073 4.636   -100.846 1.00 0.00 ? 43  ALA A CB   2  
ATOM 2861  H H    . ALA A 1 43  ? 152.113 2.903   -102.692 1.00 0.00 ? 43  ALA A H    2  
ATOM 2862  H HA   . ALA A 1 43  ? 153.150 2.986   -100.018 1.00 0.00 ? 43  ALA A HA   2  
ATOM 2863  H HB1  . ALA A 1 43  ? 152.942 4.996   -101.375 1.00 0.00 ? 43  ALA A HB1  2  
ATOM 2864  H HB2  . ALA A 1 43  ? 151.971 5.169   -99.913  1.00 0.00 ? 43  ALA A HB2  2  
ATOM 2865  H HB3  . ALA A 1 43  ? 151.192 4.797   -101.450 1.00 0.00 ? 43  ALA A HB3  2  
ATOM 2866  N N    . ALA A 1 44  ? 149.957 2.304   -100.420 1.00 0.00 ? 44  ALA A N    2  
ATOM 2867  C CA   . ALA A 1 44  ? 148.772 1.810   -99.668  1.00 0.00 ? 44  ALA A CA   2  
ATOM 2868  C C    . ALA A 1 44  ? 148.895 0.303   -99.511  1.00 0.00 ? 44  ALA A C    2  
ATOM 2869  O O    . ALA A 1 44  ? 148.736 -0.241  -98.436  1.00 0.00 ? 44  ALA A O    2  
ATOM 2870  C CB   . ALA A 1 44  ? 147.476 2.156   -100.398 1.00 0.00 ? 44  ALA A CB   2  
ATOM 2871  H H    . ALA A 1 44  ? 149.957 2.317   -101.406 1.00 0.00 ? 44  ALA A H    2  
ATOM 2872  H HA   . ALA A 1 44  ? 148.791 2.224   -98.673  1.00 0.00 ? 44  ALA A HA   2  
ATOM 2873  H HB1  . ALA A 1 44  ? 147.059 3.060   -99.986  1.00 0.00 ? 44  ALA A HB1  2  
ATOM 2874  H HB2  . ALA A 1 44  ? 146.771 1.345   -100.280 1.00 0.00 ? 44  ALA A HB2  2  
ATOM 2875  H HB3  . ALA A 1 44  ? 147.684 2.299   -101.449 1.00 0.00 ? 44  ALA A HB3  2  
ATOM 2876  N N    . THR A 1 45  ? 149.207 -0.370  -100.576 1.00 0.00 ? 45  THR A N    2  
ATOM 2877  C CA   . THR A 1 45  ? 149.375 -1.838  -100.500 1.00 0.00 ? 45  THR A CA   2  
ATOM 2878  C C    . THR A 1 45  ? 150.486 -2.131  -99.497  1.00 0.00 ? 45  THR A C    2  
ATOM 2879  O O    . THR A 1 45  ? 150.481 -3.139  -98.819  1.00 0.00 ? 45  THR A O    2  
ATOM 2880  C CB   . THR A 1 45  ? 149.750 -2.364  -101.880 1.00 0.00 ? 45  THR A CB   2  
ATOM 2881  O OG1  . THR A 1 45  ? 151.127 -2.111  -102.126 1.00 0.00 ? 45  THR A OG1  2  
ATOM 2882  C CG2  . THR A 1 45  ? 148.895 -1.649  -102.930 1.00 0.00 ? 45  THR A CG2  2  
ATOM 2883  H H    . THR A 1 45  ? 149.352 0.097   -101.424 1.00 0.00 ? 45  THR A H    2  
ATOM 2884  H HA   . THR A 1 45  ? 148.454 -2.295  -100.171 1.00 0.00 ? 45  THR A HA   2  
ATOM 2885  H HB   . THR A 1 45  ? 149.561 -3.423  -101.925 1.00 0.00 ? 45  THR A HB   2  
ATOM 2886  H HG1  . THR A 1 45  ? 151.605 -2.935  -102.011 1.00 0.00 ? 45  THR A HG1  2  
ATOM 2887  H HG21 . THR A 1 45  ? 147.876 -1.998  -102.863 1.00 0.00 ? 45  THR A HG21 2  
ATOM 2888  H HG22 . THR A 1 45  ? 149.285 -1.856  -103.912 1.00 0.00 ? 45  THR A HG22 2  
ATOM 2889  H HG23 . THR A 1 45  ? 148.921 -0.583  -102.752 1.00 0.00 ? 45  THR A HG23 2  
ATOM 2890  N N    . ALA A 1 46  ? 151.422 -1.229  -99.375  1.00 0.00 ? 46  ALA A N    2  
ATOM 2891  C CA   . ALA A 1 46  ? 152.517 -1.423  -98.390  1.00 0.00 ? 46  ALA A CA   2  
ATOM 2892  C C    . ALA A 1 46  ? 151.967 -1.056  -97.014  1.00 0.00 ? 46  ALA A C    2  
ATOM 2893  O O    . ALA A 1 46  ? 152.154 -1.769  -96.047  1.00 0.00 ? 46  ALA A O    2  
ATOM 2894  C CB   . ALA A 1 46  ? 153.696 -0.511  -98.736  1.00 0.00 ? 46  ALA A CB   2  
ATOM 2895  H H    . ALA A 1 46  ? 151.388 -0.413  -99.915  1.00 0.00 ? 46  ALA A H    2  
ATOM 2896  H HA   . ALA A 1 46  ? 152.835 -2.456  -98.394  1.00 0.00 ? 46  ALA A HA   2  
ATOM 2897  H HB1  . ALA A 1 46  ? 154.114 -0.807  -99.687  1.00 0.00 ? 46  ALA A HB1  2  
ATOM 2898  H HB2  . ALA A 1 46  ? 154.452 -0.595  -97.969  1.00 0.00 ? 46  ALA A HB2  2  
ATOM 2899  H HB3  . ALA A 1 46  ? 153.355 0.511   -98.795  1.00 0.00 ? 46  ALA A HB3  2  
ATOM 2900  N N    . ASN A 1 47  ? 151.266 0.045   -96.926  1.00 0.00 ? 47  ASN A N    2  
ATOM 2901  C CA   . ASN A 1 47  ? 150.680 0.448   -95.619  1.00 0.00 ? 47  ASN A CA   2  
ATOM 2902  C C    . ASN A 1 47  ? 149.769 -0.676  -95.120  1.00 0.00 ? 47  ASN A C    2  
ATOM 2903  O O    . ASN A 1 47  ? 149.496 -0.792  -93.942  1.00 0.00 ? 47  ASN A O    2  
ATOM 2904  C CB   . ASN A 1 47  ? 149.856 1.724   -95.802  1.00 0.00 ? 47  ASN A CB   2  
ATOM 2905  C CG   . ASN A 1 47  ? 150.790 2.893   -96.119  1.00 0.00 ? 47  ASN A CG   2  
ATOM 2906  O OD1  . ASN A 1 47  ? 150.404 3.830   -96.791  1.00 0.00 ? 47  ASN A OD1  2  
ATOM 2907  N ND2  . ASN A 1 47  ? 152.012 2.880   -95.662  1.00 0.00 ? 47  ASN A ND2  2  
ATOM 2908  H H    . ASN A 1 47  ? 151.115 0.600   -97.724  1.00 0.00 ? 47  ASN A H    2  
ATOM 2909  H HA   . ASN A 1 47  ? 151.469 0.626   -94.904  1.00 0.00 ? 47  ASN A HA   2  
ATOM 2910  H HB2  . ASN A 1 47  ? 149.157 1.588   -96.615  1.00 0.00 ? 47  ASN A HB2  2  
ATOM 2911  H HB3  . ASN A 1 47  ? 149.315 1.936   -94.893  1.00 0.00 ? 47  ASN A HB3  2  
ATOM 2912  H HD21 . ASN A 1 47  ? 152.324 2.124   -95.122  1.00 0.00 ? 47  ASN A HD21 2  
ATOM 2913  H HD22 . ASN A 1 47  ? 152.618 3.624   -95.861  1.00 0.00 ? 47  ASN A HD22 2  
ATOM 2914  N N    . MET A 1 48  ? 149.301 -1.513  -96.012  1.00 0.00 ? 48  MET A N    2  
ATOM 2915  C CA   . MET A 1 48  ? 148.413 -2.634  -95.590  1.00 0.00 ? 48  MET A CA   2  
ATOM 2916  C C    . MET A 1 48  ? 149.161 -3.962  -95.748  1.00 0.00 ? 48  MET A C    2  
ATOM 2917  O O    . MET A 1 48  ? 149.574 -4.563  -94.776  1.00 0.00 ? 48  MET A O    2  
ATOM 2918  C CB   . MET A 1 48  ? 147.149 -2.650  -96.455  1.00 0.00 ? 48  MET A CB   2  
ATOM 2919  C CG   . MET A 1 48  ? 147.531 -2.482  -97.925  1.00 0.00 ? 48  MET A CG   2  
ATOM 2920  S SD   . MET A 1 48  ? 147.017 -3.949  -98.854  1.00 0.00 ? 48  MET A SD   2  
ATOM 2921  C CE   . MET A 1 48  ? 145.843 -3.123  -99.957  1.00 0.00 ? 48  MET A CE   2  
ATOM 2922  H H    . MET A 1 48  ? 149.538 -1.405  -96.958  1.00 0.00 ? 48  MET A H    2  
ATOM 2923  H HA   . MET A 1 48  ? 148.138 -2.501  -94.555  1.00 0.00 ? 48  MET A HA   2  
ATOM 2924  H HB2  . MET A 1 48  ? 146.634 -3.590  -96.321  1.00 0.00 ? 48  MET A HB2  2  
ATOM 2925  H HB3  . MET A 1 48  ? 146.501 -1.839  -96.159  1.00 0.00 ? 48  MET A HB3  2  
ATOM 2926  H HG2  . MET A 1 48  ? 147.037 -1.611  -98.328  1.00 0.00 ? 48  MET A HG2  2  
ATOM 2927  H HG3  . MET A 1 48  ? 148.600 -2.362  -98.006  1.00 0.00 ? 48  MET A HG3  2  
ATOM 2928  H HE1  . MET A 1 48  ? 145.163 -3.855  -100.371 1.00 0.00 ? 48  MET A HE1  2  
ATOM 2929  H HE2  . MET A 1 48  ? 146.379 -2.641  -100.759 1.00 0.00 ? 48  MET A HE2  2  
ATOM 2930  H HE3  . MET A 1 48  ? 145.287 -2.381  -99.401  1.00 0.00 ? 48  MET A HE3  2  
ATOM 2931  N N    . GLY A 1 49  ? 149.343 -4.434  -96.956  1.00 0.00 ? 49  GLY A N    2  
ATOM 2932  C CA   . GLY A 1 49  ? 150.070 -5.725  -97.130  1.00 0.00 ? 49  GLY A CA   2  
ATOM 2933  C C    . GLY A 1 49  ? 150.185 -6.097  -98.614  1.00 0.00 ? 49  GLY A C    2  
ATOM 2934  O O    . GLY A 1 49  ? 150.621 -5.308  -99.429  1.00 0.00 ? 49  GLY A O    2  
ATOM 2935  H H    . GLY A 1 49  ? 149.009 -3.944  -97.735  1.00 0.00 ? 49  GLY A H    2  
ATOM 2936  H HA2  . GLY A 1 49  ? 151.060 -5.634  -96.709  1.00 0.00 ? 49  GLY A HA2  2  
ATOM 2937  H HA3  . GLY A 1 49  ? 149.534 -6.506  -96.611  1.00 0.00 ? 49  GLY A HA3  2  
ATOM 2938  N N    . ASP A 1 50  ? 149.788 -7.289  -98.971  1.00 0.00 ? 50  ASP A N    2  
ATOM 2939  C CA   . ASP A 1 50  ? 149.862 -7.711  -100.402 1.00 0.00 ? 50  ASP A CA   2  
ATOM 2940  C C    . ASP A 1 50  ? 148.466 -8.146  -100.862 1.00 0.00 ? 50  ASP A C    2  
ATOM 2941  O O    . ASP A 1 50  ? 147.690 -8.664  -100.085 1.00 0.00 ? 50  ASP A O    2  
ATOM 2942  C CB   . ASP A 1 50  ? 150.833 -8.886  -100.539 1.00 0.00 ? 50  ASP A CB   2  
ATOM 2943  C CG   . ASP A 1 50  ? 151.000 -9.242  -102.018 1.00 0.00 ? 50  ASP A CG   2  
ATOM 2944  O OD1  . ASP A 1 50  ? 151.814 -8.608  -102.671 1.00 0.00 ? 50  ASP A OD1  2  
ATOM 2945  O OD2  . ASP A 1 50  ? 150.312 -10.141 -102.472 1.00 0.00 ? 50  ASP A OD2  2  
ATOM 2946  H H    . ASP A 1 50  ? 149.432 -7.907  -98.298  1.00 0.00 ? 50  ASP A H    2  
ATOM 2947  H HA   . ASP A 1 50  ? 150.203 -6.885  -101.007 1.00 0.00 ? 50  ASP A HA   2  
ATOM 2948  H HB2  . ASP A 1 50  ? 151.792 -8.610  -100.124 1.00 0.00 ? 50  ASP A HB2  2  
ATOM 2949  H HB3  . ASP A 1 50  ? 150.443 -9.740  -100.008 1.00 0.00 ? 50  ASP A HB3  2  
ATOM 2950  N N    . ALA A 1 51  ? 148.126 -7.935  -102.108 1.00 0.00 ? 51  ALA A N    2  
ATOM 2951  C CA   . ALA A 1 51  ? 146.762 -8.343  -102.564 1.00 0.00 ? 51  ALA A CA   2  
ATOM 2952  C C    . ALA A 1 51  ? 146.511 -7.900  -104.011 1.00 0.00 ? 51  ALA A C    2  
ATOM 2953  O O    . ALA A 1 51  ? 147.425 -7.717  -104.790 1.00 0.00 ? 51  ALA A O    2  
ATOM 2954  C CB   . ALA A 1 51  ? 145.714 -7.702  -101.653 1.00 0.00 ? 51  ALA A CB   2  
ATOM 2955  H H    . ALA A 1 51  ? 148.754 -7.506  -102.731 1.00 0.00 ? 51  ALA A H    2  
ATOM 2956  H HA   . ALA A 1 51  ? 146.674 -9.416  -102.502 1.00 0.00 ? 51  ALA A HA   2  
ATOM 2957  H HB1  . ALA A 1 51  ? 145.056 -8.467  -101.268 1.00 0.00 ? 51  ALA A HB1  2  
ATOM 2958  H HB2  . ALA A 1 51  ? 145.138 -6.982  -102.216 1.00 0.00 ? 51  ALA A HB2  2  
ATOM 2959  H HB3  . ALA A 1 51  ? 146.207 -7.204  -100.831 1.00 0.00 ? 51  ALA A HB3  2  
ATOM 2960  N N    . ILE A 1 52  ? 145.263 -7.703  -104.354 1.00 0.00 ? 52  ILE A N    2  
ATOM 2961  C CA   . ILE A 1 52  ? 144.891 -7.245  -105.725 1.00 0.00 ? 52  ILE A CA   2  
ATOM 2962  C C    . ILE A 1 52  ? 143.653 -6.359  -105.605 1.00 0.00 ? 52  ILE A C    2  
ATOM 2963  O O    . ILE A 1 52  ? 142.760 -6.630  -104.827 1.00 0.00 ? 52  ILE A O    2  
ATOM 2964  C CB   . ILE A 1 52  ? 144.557 -8.434  -106.628 1.00 0.00 ? 52  ILE A CB   2  
ATOM 2965  C CG1  . ILE A 1 52  ? 145.815 -9.265  -106.890 1.00 0.00 ? 52  ILE A CG1  2  
ATOM 2966  C CG2  . ILE A 1 52  ? 143.992 -7.911  -107.955 1.00 0.00 ? 52  ILE A CG2  2  
ATOM 2967  C CD1  . ILE A 1 52  ? 146.459 -8.826  -108.204 1.00 0.00 ? 52  ILE A CD1  2  
ATOM 2968  H H    . ILE A 1 52  ? 144.559 -7.820  -103.688 1.00 0.00 ? 52  ILE A H    2  
ATOM 2969  H HA   . ILE A 1 52  ? 145.685 -6.654  -106.152 1.00 0.00 ? 52  ILE A HA   2  
ATOM 2970  H HB   . ILE A 1 52  ? 143.811 -9.049  -106.143 1.00 0.00 ? 52  ILE A HB   2  
ATOM 2971  H HG12 . ILE A 1 52  ? 146.515 -9.126  -106.082 1.00 0.00 ? 52  ILE A HG12 2  
ATOM 2972  H HG13 . ILE A 1 52  ? 145.547 -10.310 -106.956 1.00 0.00 ? 52  ILE A HG13 2  
ATOM 2973  H HG21 . ILE A 1 52  ? 144.576 -7.063  -108.286 1.00 0.00 ? 52  ILE A HG21 2  
ATOM 2974  H HG22 . ILE A 1 52  ? 142.965 -7.606  -107.816 1.00 0.00 ? 52  ILE A HG22 2  
ATOM 2975  H HG23 . ILE A 1 52  ? 144.038 -8.691  -108.701 1.00 0.00 ? 52  ILE A HG23 2  
ATOM 2976  H HD11 . ILE A 1 52  ? 146.338 -7.761  -108.327 1.00 0.00 ? 52  ILE A HD11 2  
ATOM 2977  H HD12 . ILE A 1 52  ? 145.983 -9.340  -109.025 1.00 0.00 ? 52  ILE A HD12 2  
ATOM 2978  H HD13 . ILE A 1 52  ? 147.510 -9.071  -108.187 1.00 0.00 ? 52  ILE A HD13 2  
ATOM 2979  N N    . VAL A 1 53  ? 143.598 -5.287  -106.347 1.00 0.00 ? 53  VAL A N    2  
ATOM 2980  C CA   . VAL A 1 53  ? 142.421 -4.383  -106.239 1.00 0.00 ? 53  VAL A CA   2  
ATOM 2981  C C    . VAL A 1 53  ? 141.980 -3.902  -107.628 1.00 0.00 ? 53  VAL A C    2  
ATOM 2982  O O    . VAL A 1 53  ? 142.792 -3.471  -108.427 1.00 0.00 ? 53  VAL A O    2  
ATOM 2983  C CB   . VAL A 1 53  ? 142.813 -3.172  -105.391 1.00 0.00 ? 53  VAL A CB   2  
ATOM 2984  C CG1  . VAL A 1 53  ? 141.560 -2.556  -104.765 1.00 0.00 ? 53  VAL A CG1  2  
ATOM 2985  C CG2  . VAL A 1 53  ? 143.777 -3.615  -104.284 1.00 0.00 ? 53  VAL A CG2  2  
ATOM 2986  H H    . VAL A 1 53  ? 144.334 -5.069  -106.957 1.00 0.00 ? 53  VAL A H    2  
ATOM 2987  H HA   . VAL A 1 53  ? 141.614 -4.907  -105.756 1.00 0.00 ? 53  VAL A HA   2  
ATOM 2988  H HB   . VAL A 1 53  ? 143.297 -2.437  -106.019 1.00 0.00 ? 53  VAL A HB   2  
ATOM 2989  H HG11 . VAL A 1 53  ? 141.015 -2.008  -105.520 1.00 0.00 ? 53  VAL A HG11 2  
ATOM 2990  H HG12 . VAL A 1 53  ? 141.847 -1.886  -103.969 1.00 0.00 ? 53  VAL A HG12 2  
ATOM 2991  H HG13 . VAL A 1 53  ? 140.933 -3.341  -104.369 1.00 0.00 ? 53  VAL A HG13 2  
ATOM 2992  H HG21 . VAL A 1 53  ? 143.948 -2.793  -103.604 1.00 0.00 ? 53  VAL A HG21 2  
ATOM 2993  H HG22 . VAL A 1 53  ? 144.716 -3.917  -104.725 1.00 0.00 ? 53  VAL A HG22 2  
ATOM 2994  H HG23 . VAL A 1 53  ? 143.350 -4.447  -103.745 1.00 0.00 ? 53  VAL A HG23 2  
ATOM 2995  N N    . PRO A 1 54  ? 140.695 -3.948  -107.903 1.00 0.00 ? 54  PRO A N    2  
ATOM 2996  C CA   . PRO A 1 54  ? 140.153 -3.471  -109.208 1.00 0.00 ? 54  PRO A CA   2  
ATOM 2997  C C    . PRO A 1 54  ? 140.186 -1.941  -109.291 1.00 0.00 ? 54  PRO A C    2  
ATOM 2998  O O    . PRO A 1 54  ? 139.314 -1.273  -108.772 1.00 0.00 ? 54  PRO A O    2  
ATOM 2999  C CB   . PRO A 1 54  ? 138.709 -3.969  -109.166 1.00 0.00 ? 54  PRO A CB   2  
ATOM 3000  C CG   . PRO A 1 54  ? 138.394 -4.442  -107.742 1.00 0.00 ? 54  PRO A CG   2  
ATOM 3001  C CD   . PRO A 1 54  ? 139.699 -4.487  -106.940 1.00 0.00 ? 54  PRO A CD   2  
ATOM 3002  H HA   . PRO A 1 54  ? 140.673 -3.920  -110.033 1.00 0.00 ? 54  PRO A HA   2  
ATOM 3003  H HB2  . PRO A 1 54  ? 138.039 -3.166  -109.441 1.00 0.00 ? 54  PRO A HB2  2  
ATOM 3004  H HB3  . PRO A 1 54  ? 138.588 -4.794  -109.853 1.00 0.00 ? 54  PRO A HB3  2  
ATOM 3005  H HG2  . PRO A 1 54  ? 137.703 -3.753  -107.276 1.00 0.00 ? 54  PRO A HG2  2  
ATOM 3006  H HG3  . PRO A 1 54  ? 137.958 -5.429  -107.774 1.00 0.00 ? 54  PRO A HG3  2  
ATOM 3007  H HD2  . PRO A 1 54  ? 139.629 -3.859  -106.061 1.00 0.00 ? 54  PRO A HD2  2  
ATOM 3008  H HD3  . PRO A 1 54  ? 139.945 -5.500  -106.674 1.00 0.00 ? 54  PRO A HD3  2  
ATOM 3009  N N    . VAL A 1 55  ? 141.188 -1.372  -109.906 1.00 0.00 ? 55  VAL A N    2  
ATOM 3010  C CA   . VAL A 1 55  ? 141.248 0.115   -109.963 1.00 0.00 ? 55  VAL A CA   2  
ATOM 3011  C C    . VAL A 1 55  ? 140.185 0.684   -110.888 1.00 0.00 ? 55  VAL A C    2  
ATOM 3012  O O    . VAL A 1 55  ? 139.999 0.260   -112.019 1.00 0.00 ? 55  VAL A O    2  
ATOM 3013  C CB   . VAL A 1 55  ? 142.599 0.601   -110.467 1.00 0.00 ? 55  VAL A CB   2  
ATOM 3014  C CG1  . VAL A 1 55  ? 143.651 0.449   -109.378 1.00 0.00 ? 55  VAL A CG1  2  
ATOM 3015  C CG2  . VAL A 1 55  ? 142.992 -0.198  -111.705 1.00 0.00 ? 55  VAL A CG2  2  
ATOM 3016  H H    . VAL A 1 55  ? 141.900 -1.915  -110.302 1.00 0.00 ? 55  VAL A H    2  
ATOM 3017  H HA   . VAL A 1 55  ? 141.089 0.507   -108.969 1.00 0.00 ? 55  VAL A HA   2  
ATOM 3018  H HB   . VAL A 1 55  ? 142.515 1.644   -110.726 1.00 0.00 ? 55  VAL A HB   2  
ATOM 3019  H HG11 . VAL A 1 55  ? 143.171 0.468   -108.412 1.00 0.00 ? 55  VAL A HG11 2  
ATOM 3020  H HG12 . VAL A 1 55  ? 144.353 1.269   -109.447 1.00 0.00 ? 55  VAL A HG12 2  
ATOM 3021  H HG13 . VAL A 1 55  ? 144.170 -0.485  -109.508 1.00 0.00 ? 55  VAL A HG13 2  
ATOM 3022  H HG21 . VAL A 1 55  ? 142.176 -0.178  -112.414 1.00 0.00 ? 55  VAL A HG21 2  
ATOM 3023  H HG22 . VAL A 1 55  ? 143.200 -1.218  -111.424 1.00 0.00 ? 55  VAL A HG22 2  
ATOM 3024  H HG23 . VAL A 1 55  ? 143.868 0.242   -112.155 1.00 0.00 ? 55  VAL A HG23 2  
ATOM 3025  N N    . GLU A 1 56  ? 139.542 1.692   -110.401 1.00 0.00 ? 56  GLU A N    2  
ATOM 3026  C CA   . GLU A 1 56  ? 138.510 2.419   -111.175 1.00 0.00 ? 56  GLU A CA   2  
ATOM 3027  C C    . GLU A 1 56  ? 138.903 3.886   -111.122 1.00 0.00 ? 56  GLU A C    2  
ATOM 3028  O O    . GLU A 1 56  ? 138.282 4.698   -110.465 1.00 0.00 ? 56  GLU A O    2  
ATOM 3029  C CB   . GLU A 1 56  ? 137.136 2.221   -110.530 1.00 0.00 ? 56  GLU A CB   2  
ATOM 3030  C CG   . GLU A 1 56  ? 136.910 0.734   -110.254 1.00 0.00 ? 56  GLU A CG   2  
ATOM 3031  C CD   . GLU A 1 56  ? 135.529 0.534   -109.629 1.00 0.00 ? 56  GLU A CD   2  
ATOM 3032  O OE1  . GLU A 1 56  ? 135.406 0.731   -108.431 1.00 0.00 ? 56  GLU A OE1  2  
ATOM 3033  O OE2  . GLU A 1 56  ? 134.615 0.186   -110.360 1.00 0.00 ? 56  GLU A OE2  2  
ATOM 3034  H H    . GLU A 1 56  ? 139.776 2.011   -109.503 1.00 0.00 ? 56  GLU A H    2  
ATOM 3035  H HA   . GLU A 1 56  ? 138.489 2.104   -112.204 1.00 0.00 ? 56  GLU A HA   2  
ATOM 3036  H HB2  . GLU A 1 56  ? 137.091 2.772   -109.601 1.00 0.00 ? 56  GLU A HB2  2  
ATOM 3037  H HB3  . GLU A 1 56  ? 136.370 2.582   -111.199 1.00 0.00 ? 56  GLU A HB3  2  
ATOM 3038  H HG2  . GLU A 1 56  ? 136.972 0.183   -111.180 1.00 0.00 ? 56  GLU A HG2  2  
ATOM 3039  H HG3  . GLU A 1 56  ? 137.667 0.376   -109.571 1.00 0.00 ? 56  GLU A HG3  2  
ATOM 3040  N N    . ILE A 1 57  ? 139.965 4.211   -111.803 1.00 0.00 ? 57  ILE A N    2  
ATOM 3041  C CA   . ILE A 1 57  ? 140.467 5.604   -111.806 1.00 0.00 ? 57  ILE A CA   2  
ATOM 3042  C C    . ILE A 1 57  ? 139.532 6.508   -112.608 1.00 0.00 ? 57  ILE A C    2  
ATOM 3043  O O    . ILE A 1 57  ? 139.675 6.674   -113.809 1.00 0.00 ? 57  ILE A O    2  
ATOM 3044  C CB   . ILE A 1 57  ? 141.883 5.623   -112.382 1.00 0.00 ? 57  ILE A CB   2  
ATOM 3045  C CG1  . ILE A 1 57  ? 142.734 4.599   -111.614 1.00 0.00 ? 57  ILE A CG1  2  
ATOM 3046  C CG2  . ILE A 1 57  ? 142.488 7.016   -112.215 1.00 0.00 ? 57  ILE A CG2  2  
ATOM 3047  C CD1  . ILE A 1 57  ? 143.580 3.774   -112.586 1.00 0.00 ? 57  ILE A CD1  2  
ATOM 3048  H H    . ILE A 1 57  ? 140.447 3.519   -112.305 1.00 0.00 ? 57  ILE A H    2  
ATOM 3049  H HA   . ILE A 1 57  ? 140.501 5.966   -110.796 1.00 0.00 ? 57  ILE A HA   2  
ATOM 3050  H HB   . ILE A 1 57  ? 141.851 5.367   -113.427 1.00 0.00 ? 57  ILE A HB   2  
ATOM 3051  H HG12 . ILE A 1 57  ? 143.383 5.114   -110.924 1.00 0.00 ? 57  ILE A HG12 2  
ATOM 3052  H HG13 . ILE A 1 57  ? 142.082 3.936   -111.064 1.00 0.00 ? 57  ILE A HG13 2  
ATOM 3053  H HG21 . ILE A 1 57  ? 142.895 7.347   -113.158 1.00 0.00 ? 57  ILE A HG21 2  
ATOM 3054  H HG22 . ILE A 1 57  ? 143.276 6.980   -111.477 1.00 0.00 ? 57  ILE A HG22 2  
ATOM 3055  H HG23 . ILE A 1 57  ? 141.723 7.705   -111.891 1.00 0.00 ? 57  ILE A HG23 2  
ATOM 3056  H HD11 . ILE A 1 57  ? 143.126 2.804   -112.720 1.00 0.00 ? 57  ILE A HD11 2  
ATOM 3057  H HD12 . ILE A 1 57  ? 144.574 3.653   -112.180 1.00 0.00 ? 57  ILE A HD12 2  
ATOM 3058  H HD13 . ILE A 1 57  ? 143.640 4.281   -113.537 1.00 0.00 ? 57  ILE A HD13 2  
ATOM 3059  N N    . THR A 1 58  ? 138.556 7.067   -111.933 1.00 0.00 ? 58  THR A N    2  
ATOM 3060  C CA   . THR A 1 58  ? 137.594 7.958   -112.635 1.00 0.00 ? 58  THR A CA   2  
ATOM 3061  C C    . THR A 1 58  ? 138.394 9.148   -113.155 1.00 0.00 ? 58  THR A C    2  
ATOM 3062  O O    . THR A 1 58  ? 138.652 10.100  -112.445 1.00 0.00 ? 58  THR A O    2  
ATOM 3063  C CB   . THR A 1 58  ? 136.486 8.417   -111.686 1.00 0.00 ? 58  THR A CB   2  
ATOM 3064  O OG1  . THR A 1 58  ? 136.523 7.633   -110.502 1.00 0.00 ? 58  THR A OG1  2  
ATOM 3065  C CG2  . THR A 1 58  ? 135.130 8.250   -112.371 1.00 0.00 ? 58  THR A CG2  2  
ATOM 3066  H H    . THR A 1 58  ? 138.480 6.849   -110.977 1.00 0.00 ? 58  THR A H    2  
ATOM 3067  H HA   . THR A 1 58  ? 137.184 7.411   -113.470 1.00 0.00 ? 58  THR A HA   2  
ATOM 3068  H HB   . THR A 1 58  ? 136.633 9.457   -111.437 1.00 0.00 ? 58  THR A HB   2  
ATOM 3069  H HG1  . THR A 1 58  ? 135.789 7.902   -109.946 1.00 0.00 ? 58  THR A HG1  2  
ATOM 3070  H HG21 . THR A 1 58  ? 135.099 8.859   -113.260 1.00 0.00 ? 58  THR A HG21 2  
ATOM 3071  H HG22 . THR A 1 58  ? 134.346 8.558   -111.695 1.00 0.00 ? 58  THR A HG22 2  
ATOM 3072  H HG23 . THR A 1 58  ? 134.989 7.214   -112.640 1.00 0.00 ? 58  THR A HG23 2  
ATOM 3073  N N    . ILE A 1 59  ? 138.808 9.083   -114.389 1.00 0.00 ? 59  ILE A N    2  
ATOM 3074  C CA   . ILE A 1 59  ? 139.620 10.186  -114.967 1.00 0.00 ? 59  ILE A CA   2  
ATOM 3075  C C    . ILE A 1 59  ? 138.736 11.132  -115.782 1.00 0.00 ? 59  ILE A C    2  
ATOM 3076  O O    . ILE A 1 59  ? 137.861 10.710  -116.515 1.00 0.00 ? 59  ILE A O    2  
ATOM 3077  C CB   . ILE A 1 59  ? 140.697 9.593   -115.885 1.00 0.00 ? 59  ILE A CB   2  
ATOM 3078  C CG1  . ILE A 1 59  ? 141.715 8.810   -115.049 1.00 0.00 ? 59  ILE A CG1  2  
ATOM 3079  C CG2  . ILE A 1 59  ? 141.415 10.720  -116.630 1.00 0.00 ? 59  ILE A CG2  2  
ATOM 3080  C CD1  . ILE A 1 59  ? 142.652 8.025   -115.978 1.00 0.00 ? 59  ILE A CD1  2  
ATOM 3081  H H    . ILE A 1 59  ? 138.599 8.294   -114.932 1.00 0.00 ? 59  ILE A H    2  
ATOM 3082  H HA   . ILE A 1 59  ? 140.093 10.735  -114.171 1.00 0.00 ? 59  ILE A HA   2  
ATOM 3083  H HB   . ILE A 1 59  ? 140.232 8.931   -116.601 1.00 0.00 ? 59  ILE A HB   2  
ATOM 3084  H HG12 . ILE A 1 59  ? 142.294 9.499   -114.453 1.00 0.00 ? 59  ILE A HG12 2  
ATOM 3085  H HG13 . ILE A 1 59  ? 141.195 8.121   -114.402 1.00 0.00 ? 59  ILE A HG13 2  
ATOM 3086  H HG21 . ILE A 1 59  ? 140.698 11.280  -117.212 1.00 0.00 ? 59  ILE A HG21 2  
ATOM 3087  H HG22 . ILE A 1 59  ? 142.161 10.299  -117.287 1.00 0.00 ? 59  ILE A HG22 2  
ATOM 3088  H HG23 . ILE A 1 59  ? 141.891 11.377  -115.917 1.00 0.00 ? 59  ILE A HG23 2  
ATOM 3089  H HD11 . ILE A 1 59  ? 143.369 7.475   -115.385 1.00 0.00 ? 59  ILE A HD11 2  
ATOM 3090  H HD12 . ILE A 1 59  ? 143.175 8.711   -116.627 1.00 0.00 ? 59  ILE A HD12 2  
ATOM 3091  H HD13 . ILE A 1 59  ? 142.074 7.335   -116.575 1.00 0.00 ? 59  ILE A HD13 2  
ATOM 3092  N N    . TYR A 1 60  ? 138.995 12.410  -115.694 1.00 0.00 ? 60  TYR A N    2  
ATOM 3093  C CA   . TYR A 1 60  ? 138.201 13.378  -116.502 1.00 0.00 ? 60  TYR A CA   2  
ATOM 3094  C C    . TYR A 1 60  ? 139.153 14.055  -117.486 1.00 0.00 ? 60  TYR A C    2  
ATOM 3095  O O    . TYR A 1 60  ? 140.296 14.354  -117.166 1.00 0.00 ? 60  TYR A O    2  
ATOM 3096  C CB   . TYR A 1 60  ? 137.517 14.431  -115.620 1.00 0.00 ? 60  TYR A CB   2  
ATOM 3097  C CG   . TYR A 1 60  ? 136.336 13.843  -114.884 1.00 0.00 ? 60  TYR A CG   2  
ATOM 3098  C CD1  . TYR A 1 60  ? 136.491 12.699  -114.090 1.00 0.00 ? 60  TYR A CD1  2  
ATOM 3099  C CD2  . TYR A 1 60  ? 135.084 14.459  -114.982 1.00 0.00 ? 60  TYR A CD2  2  
ATOM 3100  C CE1  . TYR A 1 60  ? 135.394 12.176  -113.398 1.00 0.00 ? 60  TYR A CE1  2  
ATOM 3101  C CE2  . TYR A 1 60  ? 133.986 13.933  -114.293 1.00 0.00 ? 60  TYR A CE2  2  
ATOM 3102  C CZ   . TYR A 1 60  ? 134.141 12.791  -113.500 1.00 0.00 ? 60  TYR A CZ   2  
ATOM 3103  O OH   . TYR A 1 60  ? 133.059 12.275  -112.818 1.00 0.00 ? 60  TYR A OH   2  
ATOM 3104  H H    . TYR A 1 60  ? 139.742 12.708  -115.132 1.00 0.00 ? 60  TYR A H    2  
ATOM 3105  H HA   . TYR A 1 60  ? 137.493 12.815  -117.087 1.00 0.00 ? 60  TYR A HA   2  
ATOM 3106  H HB2  . TYR A 1 60  ? 138.229 14.808  -114.902 1.00 0.00 ? 60  TYR A HB2  2  
ATOM 3107  H HB3  . TYR A 1 60  ? 137.177 15.246  -116.242 1.00 0.00 ? 60  TYR A HB3  2  
ATOM 3108  H HD1  . TYR A 1 60  ? 137.455 12.219  -114.014 1.00 0.00 ? 60  TYR A HD1  2  
ATOM 3109  H HD2  . TYR A 1 60  ? 134.965 15.341  -115.593 1.00 0.00 ? 60  TYR A HD2  2  
ATOM 3110  H HE1  . TYR A 1 60  ? 135.510 11.292  -112.788 1.00 0.00 ? 60  TYR A HE1  2  
ATOM 3111  H HE2  . TYR A 1 60  ? 133.020 14.408  -114.373 1.00 0.00 ? 60  TYR A HE2  2  
ATOM 3112  H HH   . TYR A 1 60  ? 132.303 12.840  -112.987 1.00 0.00 ? 60  TYR A HH   2  
ATOM 3113  N N    . ALA A 1 61  ? 138.690 14.255  -118.698 1.00 0.00 ? 61  ALA A N    2  
ATOM 3114  C CA   . ALA A 1 61  ? 139.551 14.864  -119.748 1.00 0.00 ? 61  ALA A CA   2  
ATOM 3115  C C    . ALA A 1 61  ? 140.247 16.108  -119.205 1.00 0.00 ? 61  ALA A C    2  
ATOM 3116  O O    . ALA A 1 61  ? 141.356 16.421  -119.589 1.00 0.00 ? 61  ALA A O    2  
ATOM 3117  C CB   . ALA A 1 61  ? 138.714 15.220  -120.977 1.00 0.00 ? 61  ALA A CB   2  
ATOM 3118  H H    . ALA A 1 61  ? 137.780 13.972  -118.923 1.00 0.00 ? 61  ALA A H    2  
ATOM 3119  H HA   . ALA A 1 61  ? 140.304 14.138  -120.015 1.00 0.00 ? 61  ALA A HA   2  
ATOM 3120  H HB1  . ALA A 1 61  ? 138.842 14.460  -121.734 1.00 0.00 ? 61  ALA A HB1  2  
ATOM 3121  H HB2  . ALA A 1 61  ? 139.035 16.174  -121.368 1.00 0.00 ? 61  ALA A HB2  2  
ATOM 3122  H HB3  . ALA A 1 61  ? 137.672 15.278  -120.698 1.00 0.00 ? 61  ALA A HB3  2  
ATOM 3123  N N    . ASP A 1 62  ? 139.631 16.807  -118.289 1.00 0.00 ? 62  ASP A N    2  
ATOM 3124  C CA   . ASP A 1 62  ? 140.308 17.999  -117.715 1.00 0.00 ? 62  ASP A CA   2  
ATOM 3125  C C    . ASP A 1 62  ? 141.677 17.538  -117.219 1.00 0.00 ? 62  ASP A C    2  
ATOM 3126  O O    . ASP A 1 62  ? 142.436 18.284  -116.636 1.00 0.00 ? 62  ASP A O    2  
ATOM 3127  C CB   . ASP A 1 62  ? 139.488 18.550  -116.545 1.00 0.00 ? 62  ASP A CB   2  
ATOM 3128  C CG   . ASP A 1 62  ? 138.612 19.704  -117.035 1.00 0.00 ? 62  ASP A CG   2  
ATOM 3129  O OD1  . ASP A 1 62  ? 138.550 19.906  -118.237 1.00 0.00 ? 62  ASP A OD1  2  
ATOM 3130  O OD2  . ASP A 1 62  ? 138.017 20.365  -116.200 1.00 0.00 ? 62  ASP A OD2  2  
ATOM 3131  H H    . ASP A 1 62  ? 138.747 16.532  -117.966 1.00 0.00 ? 62  ASP A H    2  
ATOM 3132  H HA   . ASP A 1 62  ? 140.428 18.756  -118.476 1.00 0.00 ? 62  ASP A HA   2  
ATOM 3133  H HB2  . ASP A 1 62  ? 138.863 17.766  -116.143 1.00 0.00 ? 62  ASP A HB2  2  
ATOM 3134  H HB3  . ASP A 1 62  ? 140.156 18.909  -115.776 1.00 0.00 ? 62  ASP A HB3  2  
ATOM 3135  N N    . ARG A 1 63  ? 141.968 16.285  -117.451 1.00 0.00 ? 63  ARG A N    2  
ATOM 3136  C CA   . ARG A 1 63  ? 143.260 15.688  -117.018 1.00 0.00 ? 63  ARG A CA   2  
ATOM 3137  C C    . ARG A 1 63  ? 143.285 15.557  -115.498 1.00 0.00 ? 63  ARG A C    2  
ATOM 3138  O O    . ARG A 1 63  ? 144.028 16.225  -114.807 1.00 0.00 ? 63  ARG A O    2  
ATOM 3139  C CB   . ARG A 1 63  ? 144.449 16.512  -117.522 1.00 0.00 ? 63  ARG A CB   2  
ATOM 3140  C CG   . ARG A 1 63  ? 144.651 16.255  -119.016 1.00 0.00 ? 63  ARG A CG   2  
ATOM 3141  C CD   . ARG A 1 63  ? 145.554 17.342  -119.603 1.00 0.00 ? 63  ARG A CD   2  
ATOM 3142  N NE   . ARG A 1 63  ? 146.920 17.222  -119.018 1.00 0.00 ? 63  ARG A NE   2  
ATOM 3143  C CZ   . ARG A 1 63  ? 147.925 17.837  -119.578 1.00 0.00 ? 63  ARG A CZ   2  
ATOM 3144  N NH1  . ARG A 1 63  ? 147.736 18.559  -120.649 1.00 0.00 ? 63  ARG A NH1  2  
ATOM 3145  N NH2  . ARG A 1 63  ? 149.121 17.732  -119.066 1.00 0.00 ? 63  ARG A NH2  2  
ATOM 3146  H H    . ARG A 1 63  ? 141.318 15.721  -117.915 1.00 0.00 ? 63  ARG A H    2  
ATOM 3147  H HA   . ARG A 1 63  ? 143.314 14.677  -117.392 1.00 0.00 ? 63  ARG A HA   2  
ATOM 3148  H HB2  . ARG A 1 63  ? 144.256 17.561  -117.359 1.00 0.00 ? 63  ARG A HB2  2  
ATOM 3149  H HB3  . ARG A 1 63  ? 145.339 16.223  -116.985 1.00 0.00 ? 63  ARG A HB3  2  
ATOM 3150  H HG2  . ARG A 1 63  ? 145.112 15.287  -119.155 1.00 0.00 ? 63  ARG A HG2  2  
ATOM 3151  H HG3  . ARG A 1 63  ? 143.695 16.274  -119.517 1.00 0.00 ? 63  ARG A HG3  2  
ATOM 3152  H HD2  . ARG A 1 63  ? 145.610 17.223  -120.675 1.00 0.00 ? 63  ARG A HD2  2  
ATOM 3153  H HD3  . ARG A 1 63  ? 145.146 18.314  -119.369 1.00 0.00 ? 63  ARG A HD3  2  
ATOM 3154  H HE   . ARG A 1 63  ? 147.062 16.680  -118.214 1.00 0.00 ? 63  ARG A HE   2  
ATOM 3155  H HH11 . ARG A 1 63  ? 146.819 18.639  -121.042 1.00 0.00 ? 63  ARG A HH11 2  
ATOM 3156  H HH12 . ARG A 1 63  ? 148.506 19.029  -121.078 1.00 0.00 ? 63  ARG A HH12 2  
ATOM 3157  H HH21 . ARG A 1 63  ? 149.267 17.180  -118.245 1.00 0.00 ? 63  ARG A HH21 2  
ATOM 3158  H HH22 . ARG A 1 63  ? 149.891 18.204  -119.494 1.00 0.00 ? 63  ARG A HH22 2  
ATOM 3159  N N    . SER A 1 64  ? 142.469 14.672  -114.984 1.00 0.00 ? 64  SER A N    2  
ATOM 3160  C CA   . SER A 1 64  ? 142.422 14.449  -113.509 1.00 0.00 ? 64  SER A CA   2  
ATOM 3161  C C    . SER A 1 64  ? 142.059 12.985  -113.239 1.00 0.00 ? 64  SER A C    2  
ATOM 3162  O O    . SER A 1 64  ? 141.381 12.359  -114.026 1.00 0.00 ? 64  SER A O    2  
ATOM 3163  C CB   . SER A 1 64  ? 141.365 15.362  -112.887 1.00 0.00 ? 64  SER A CB   2  
ATOM 3164  O OG   . SER A 1 64  ? 140.089 14.742  -112.990 1.00 0.00 ? 64  SER A OG   2  
ATOM 3165  H H    . SER A 1 64  ? 141.894 14.140  -115.583 1.00 0.00 ? 64  SER A H    2  
ATOM 3166  H HA   . SER A 1 64  ? 143.389 14.668  -113.078 1.00 0.00 ? 64  SER A HA   2  
ATOM 3167  H HB2  . SER A 1 64  ? 141.596 15.527  -111.848 1.00 0.00 ? 64  SER A HB2  2  
ATOM 3168  H HB3  . SER A 1 64  ? 141.359 16.311  -113.408 1.00 0.00 ? 64  SER A HB3  2  
ATOM 3169  H HG   . SER A 1 64  ? 139.438 15.341  -112.618 1.00 0.00 ? 64  SER A HG   2  
ATOM 3170  N N    . PHE A 1 65  ? 142.503 12.429  -112.141 1.00 0.00 ? 65  PHE A N    2  
ATOM 3171  C CA   . PHE A 1 65  ? 142.172 11.001  -111.850 1.00 0.00 ? 65  PHE A CA   2  
ATOM 3172  C C    . PHE A 1 65  ? 141.579 10.874  -110.443 1.00 0.00 ? 65  PHE A C    2  
ATOM 3173  O O    . PHE A 1 65  ? 142.288 10.917  -109.458 1.00 0.00 ? 65  PHE A O    2  
ATOM 3174  C CB   . PHE A 1 65  ? 143.451 10.164  -111.931 1.00 0.00 ? 65  PHE A CB   2  
ATOM 3175  C CG   . PHE A 1 65  ? 144.562 10.868  -111.188 1.00 0.00 ? 65  PHE A CG   2  
ATOM 3176  C CD1  . PHE A 1 65  ? 145.225 11.950  -111.779 1.00 0.00 ? 65  PHE A CD1  2  
ATOM 3177  C CD2  . PHE A 1 65  ? 144.928 10.438  -109.907 1.00 0.00 ? 65  PHE A CD2  2  
ATOM 3178  C CE1  . PHE A 1 65  ? 146.254 12.602  -111.089 1.00 0.00 ? 65  PHE A CE1  2  
ATOM 3179  C CE2  . PHE A 1 65  ? 145.957 11.091  -109.217 1.00 0.00 ? 65  PHE A CE2  2  
ATOM 3180  C CZ   . PHE A 1 65  ? 146.620 12.172  -109.809 1.00 0.00 ? 65  PHE A CZ   2  
ATOM 3181  H H    . PHE A 1 65  ? 143.054 12.945  -111.515 1.00 0.00 ? 65  PHE A H    2  
ATOM 3182  H HA   . PHE A 1 65  ? 141.462 10.640  -112.574 1.00 0.00 ? 65  PHE A HA   2  
ATOM 3183  H HB2  . PHE A 1 65  ? 143.277 9.197   -111.486 1.00 0.00 ? 65  PHE A HB2  2  
ATOM 3184  H HB3  . PHE A 1 65  ? 143.737 10.039  -112.965 1.00 0.00 ? 65  PHE A HB3  2  
ATOM 3185  H HD1  . PHE A 1 65  ? 144.941 12.282  -112.767 1.00 0.00 ? 65  PHE A HD1  2  
ATOM 3186  H HD2  . PHE A 1 65  ? 144.417 9.603   -109.450 1.00 0.00 ? 65  PHE A HD2  2  
ATOM 3187  H HE1  . PHE A 1 65  ? 146.765 13.437  -111.546 1.00 0.00 ? 65  PHE A HE1  2  
ATOM 3188  H HE2  . PHE A 1 65  ? 146.241 10.759  -108.229 1.00 0.00 ? 65  PHE A HE2  2  
ATOM 3189  H HZ   . PHE A 1 65  ? 147.415 12.675  -109.277 1.00 0.00 ? 65  PHE A HZ   2  
ATOM 3190  N N    . THR A 1 66  ? 140.286 10.705  -110.338 1.00 0.00 ? 66  THR A N    2  
ATOM 3191  C CA   . THR A 1 66  ? 139.669 10.563  -108.988 1.00 0.00 ? 66  THR A CA   2  
ATOM 3192  C C    . THR A 1 66  ? 139.372 9.089   -108.696 1.00 0.00 ? 66  THR A C    2  
ATOM 3193  O O    . THR A 1 66  ? 138.595 8.459   -109.397 1.00 0.00 ? 66  THR A O    2  
ATOM 3194  C CB   . THR A 1 66  ? 138.337 11.312  -109.000 1.00 0.00 ? 66  THR A CB   2  
ATOM 3195  O OG1  . THR A 1 66  ? 137.318 10.460  -109.504 1.00 0.00 ? 66  THR A OG1  2  
ATOM 3196  C CG2  . THR A 1 66  ? 138.460 12.546  -109.890 1.00 0.00 ? 66  THR A CG2  2  
ATOM 3197  H H    . THR A 1 66  ? 139.724 10.688  -111.140 1.00 0.00 ? 66  THR A H    2  
ATOM 3198  H HA   . THR A 1 66  ? 140.292 11.004  -108.223 1.00 0.00 ? 66  THR A HA   2  
ATOM 3199  H HB   . THR A 1 66  ? 138.087 11.622  -107.997 1.00 0.00 ? 66  THR A HB   2  
ATOM 3200  H HG1  . THR A 1 66  ? 136.686 11.002  -109.981 1.00 0.00 ? 66  THR A HG1  2  
ATOM 3201  H HG21 . THR A 1 66  ? 137.610 13.190  -109.731 1.00 0.00 ? 66  THR A HG21 2  
ATOM 3202  H HG22 . THR A 1 66  ? 138.493 12.239  -110.925 1.00 0.00 ? 66  THR A HG22 2  
ATOM 3203  H HG23 . THR A 1 66  ? 139.367 13.077  -109.643 1.00 0.00 ? 66  THR A HG23 2  
ATOM 3204  N N    . PHE A 1 67  ? 139.934 8.541   -107.650 1.00 0.00 ? 67  PHE A N    2  
ATOM 3205  C CA   . PHE A 1 67  ? 139.619 7.120   -107.307 1.00 0.00 ? 67  PHE A CA   2  
ATOM 3206  C C    . PHE A 1 67  ? 140.554 6.600   -106.214 1.00 0.00 ? 67  PHE A C    2  
ATOM 3207  O O    . PHE A 1 67  ? 141.711 6.958   -106.158 1.00 0.00 ? 67  PHE A O    2  
ATOM 3208  C CB   . PHE A 1 67  ? 139.754 6.232   -108.542 1.00 0.00 ? 67  PHE A CB   2  
ATOM 3209  C CG   . PHE A 1 67  ? 141.129 5.605   -108.563 1.00 0.00 ? 67  PHE A CG   2  
ATOM 3210  C CD1  . PHE A 1 67  ? 142.269 6.416   -108.517 1.00 0.00 ? 67  PHE A CD1  2  
ATOM 3211  C CD2  . PHE A 1 67  ? 141.261 4.214   -108.625 1.00 0.00 ? 67  PHE A CD2  2  
ATOM 3212  C CE1  . PHE A 1 67  ? 143.543 5.834   -108.533 1.00 0.00 ? 67  PHE A CE1  2  
ATOM 3213  C CE2  . PHE A 1 67  ? 142.533 3.631   -108.642 1.00 0.00 ? 67  PHE A CE2  2  
ATOM 3214  C CZ   . PHE A 1 67  ? 143.674 4.441   -108.595 1.00 0.00 ? 67  PHE A CZ   2  
ATOM 3215  H H    . PHE A 1 67  ? 140.527 9.070   -107.077 1.00 0.00 ? 67  PHE A H    2  
ATOM 3216  H HA   . PHE A 1 67  ? 138.604 7.075   -106.944 1.00 0.00 ? 67  PHE A HA   2  
ATOM 3217  H HB2  . PHE A 1 67  ? 139.006 5.453   -108.511 1.00 0.00 ? 67  PHE A HB2  2  
ATOM 3218  H HB3  . PHE A 1 67  ? 139.617 6.825   -109.429 1.00 0.00 ? 67  PHE A HB3  2  
ATOM 3219  H HD1  . PHE A 1 67  ? 142.168 7.490   -108.469 1.00 0.00 ? 67  PHE A HD1  2  
ATOM 3220  H HD2  . PHE A 1 67  ? 140.380 3.589   -108.661 1.00 0.00 ? 67  PHE A HD2  2  
ATOM 3221  H HE1  . PHE A 1 67  ? 144.423 6.457   -108.498 1.00 0.00 ? 67  PHE A HE1  2  
ATOM 3222  H HE2  . PHE A 1 67  ? 142.635 2.558   -108.689 1.00 0.00 ? 67  PHE A HE2  2  
ATOM 3223  H HZ   . PHE A 1 67  ? 144.655 3.992   -108.607 1.00 0.00 ? 67  PHE A HZ   2  
ATOM 3224  N N    . VAL A 1 68  ? 140.081 5.697   -105.398 1.00 0.00 ? 68  VAL A N    2  
ATOM 3225  C CA   . VAL A 1 68  ? 140.965 5.084   -104.364 1.00 0.00 ? 68  VAL A CA   2  
ATOM 3226  C C    . VAL A 1 68  ? 140.235 3.884   -103.756 1.00 0.00 ? 68  VAL A C    2  
ATOM 3227  O O    . VAL A 1 68  ? 139.403 4.007   -102.878 1.00 0.00 ? 68  VAL A O    2  
ATOM 3228  C CB   . VAL A 1 68  ? 141.350 6.095   -103.281 1.00 0.00 ? 68  VAL A CB   2  
ATOM 3229  C CG1  . VAL A 1 68  ? 141.923 5.353   -102.072 1.00 0.00 ? 68  VAL A CG1  2  
ATOM 3230  C CG2  . VAL A 1 68  ? 142.405 7.061   -103.824 1.00 0.00 ? 68  VAL A CG2  2  
ATOM 3231  H H    . VAL A 1 68  ? 139.159 5.380   -105.503 1.00 0.00 ? 68  VAL A H    2  
ATOM 3232  H HA   . VAL A 1 68  ? 141.836 4.706   -104.877 1.00 0.00 ? 68  VAL A HA   2  
ATOM 3233  H HB   . VAL A 1 68  ? 140.473 6.649   -102.979 1.00 0.00 ? 68  VAL A HB   2  
ATOM 3234  H HG11 . VAL A 1 68  ? 142.770 5.897   -101.683 1.00 0.00 ? 68  VAL A HG11 2  
ATOM 3235  H HG12 . VAL A 1 68  ? 142.238 4.364   -102.373 1.00 0.00 ? 68  VAL A HG12 2  
ATOM 3236  H HG13 . VAL A 1 68  ? 141.164 5.271   -101.307 1.00 0.00 ? 68  VAL A HG13 2  
ATOM 3237  H HG21 . VAL A 1 68  ? 143.027 7.406   -103.012 1.00 0.00 ? 68  VAL A HG21 2  
ATOM 3238  H HG22 . VAL A 1 68  ? 141.916 7.906   -104.286 1.00 0.00 ? 68  VAL A HG22 2  
ATOM 3239  H HG23 . VAL A 1 68  ? 143.017 6.553   -104.554 1.00 0.00 ? 68  VAL A HG23 2  
ATOM 3240  N N    . THR A 1 69  ? 140.579 2.718   -104.235 1.00 0.00 ? 69  THR A N    2  
ATOM 3241  C CA   . THR A 1 69  ? 139.973 1.451   -103.738 1.00 0.00 ? 69  THR A CA   2  
ATOM 3242  C C    . THR A 1 69  ? 141.016 0.713   -102.896 1.00 0.00 ? 69  THR A C    2  
ATOM 3243  O O    . THR A 1 69  ? 142.199 0.805   -103.160 1.00 0.00 ? 69  THR A O    2  
ATOM 3244  C CB   . THR A 1 69  ? 139.606 0.578   -104.945 1.00 0.00 ? 69  THR A CB   2  
ATOM 3245  O OG1  . THR A 1 69  ? 139.527 -0.780  -104.535 1.00 0.00 ? 69  THR A OG1  2  
ATOM 3246  C CG2  . THR A 1 69  ? 140.675 0.726   -106.034 1.00 0.00 ? 69  THR A CG2  2  
ATOM 3247  H H    . THR A 1 69  ? 141.263 2.675   -104.936 1.00 0.00 ? 69  THR A H    2  
ATOM 3248  H HA   . THR A 1 69  ? 139.086 1.645   -103.154 1.00 0.00 ? 69  THR A HA   2  
ATOM 3249  H HB   . THR A 1 69  ? 138.652 0.891   -105.338 1.00 0.00 ? 69  THR A HB   2  
ATOM 3250  H HG1  . THR A 1 69  ? 139.377 -1.317  -105.316 1.00 0.00 ? 69  THR A HG1  2  
ATOM 3251  H HG21 . THR A 1 69  ? 140.555 1.677   -106.531 1.00 0.00 ? 69  THR A HG21 2  
ATOM 3252  H HG22 . THR A 1 69  ? 140.568 -0.071  -106.756 1.00 0.00 ? 69  THR A HG22 2  
ATOM 3253  H HG23 . THR A 1 69  ? 141.657 0.676   -105.588 1.00 0.00 ? 69  THR A HG23 2  
ATOM 3254  N N    . LYS A 1 70  ? 140.615 -0.021  -101.891 1.00 0.00 ? 70  LYS A N    2  
ATOM 3255  C CA   . LYS A 1 70  ? 141.641 -0.740  -101.081 1.00 0.00 ? 70  LYS A CA   2  
ATOM 3256  C C    . LYS A 1 70  ? 141.215 -2.191  -100.861 1.00 0.00 ? 70  LYS A C    2  
ATOM 3257  O O    . LYS A 1 70  ? 140.146 -2.468  -100.366 1.00 0.00 ? 70  LYS A O    2  
ATOM 3258  C CB   . LYS A 1 70  ? 141.832 -0.040  -99.735  1.00 0.00 ? 70  LYS A CB   2  
ATOM 3259  C CG   . LYS A 1 70  ? 143.156 0.724   -99.738  1.00 0.00 ? 70  LYS A CG   2  
ATOM 3260  C CD   . LYS A 1 70  ? 143.095 1.851   -100.772 1.00 0.00 ? 70  LYS A CD   2  
ATOM 3261  C CE   . LYS A 1 70  ? 143.711 3.120   -100.181 1.00 0.00 ? 70  LYS A CE   2  
ATOM 3262  N NZ   . LYS A 1 70  ? 144.272 3.957   -101.279 1.00 0.00 ? 70  LYS A NZ   2  
ATOM 3263  H H    . LYS A 1 70  ? 139.658 -0.102  -101.675 1.00 0.00 ? 70  LYS A H    2  
ATOM 3264  H HA   . LYS A 1 70  ? 142.574 -0.753  -101.624 1.00 0.00 ? 70  LYS A HA   2  
ATOM 3265  H HB2  . LYS A 1 70  ? 141.017 0.650   -99.570  1.00 0.00 ? 70  LYS A HB2  2  
ATOM 3266  H HB3  . LYS A 1 70  ? 141.846 -0.776  -98.946  1.00 0.00 ? 70  LYS A HB3  2  
ATOM 3267  H HG2  . LYS A 1 70  ? 143.332 1.143   -98.759  1.00 0.00 ? 70  LYS A HG2  2  
ATOM 3268  H HG3  . LYS A 1 70  ? 143.961 0.050   -99.991  1.00 0.00 ? 70  LYS A HG3  2  
ATOM 3269  H HD2  . LYS A 1 70  ? 143.646 1.559   -101.655 1.00 0.00 ? 70  LYS A HD2  2  
ATOM 3270  H HD3  . LYS A 1 70  ? 142.066 2.041   -101.037 1.00 0.00 ? 70  LYS A HD3  2  
ATOM 3271  H HE2  . LYS A 1 70  ? 142.949 3.679   -99.657  1.00 0.00 ? 70  LYS A HE2  2  
ATOM 3272  H HE3  . LYS A 1 70  ? 144.499 2.852   -99.493  1.00 0.00 ? 70  LYS A HE3  2  
ATOM 3273  H HZ1  . LYS A 1 70  ? 145.291 3.771   -101.371 1.00 0.00 ? 70  LYS A HZ1  2  
ATOM 3274  H HZ2  . LYS A 1 70  ? 144.120 4.964   -101.059 1.00 0.00 ? 70  LYS A HZ2  2  
ATOM 3275  H HZ3  . LYS A 1 70  ? 143.797 3.722   -102.173 1.00 0.00 ? 70  LYS A HZ3  2  
ATOM 3276  N N    . THR A 1 71  ? 142.070 -3.115  -101.227 1.00 0.00 ? 71  THR A N    2  
ATOM 3277  C CA   . THR A 1 71  ? 141.753 -4.564  -101.056 1.00 0.00 ? 71  THR A CA   2  
ATOM 3278  C C    . THR A 1 71  ? 140.763 -5.014  -102.142 1.00 0.00 ? 71  THR A C    2  
ATOM 3279  O O    . THR A 1 71  ? 139.963 -4.239  -102.626 1.00 0.00 ? 71  THR A O    2  
ATOM 3280  C CB   . THR A 1 71  ? 141.140 -4.782  -99.670  1.00 0.00 ? 71  THR A CB   2  
ATOM 3281  O OG1  . THR A 1 71  ? 139.801 -4.315  -99.669  1.00 0.00 ? 71  THR A OG1  2  
ATOM 3282  C CG2  . THR A 1 71  ? 141.953 -4.011  -98.628  1.00 0.00 ? 71  THR A CG2  2  
ATOM 3283  H H    . THR A 1 71  ? 142.928 -2.852  -101.617 1.00 0.00 ? 71  THR A H    2  
ATOM 3284  H HA   . THR A 1 71  ? 142.664 -5.138  -101.138 1.00 0.00 ? 71  THR A HA   2  
ATOM 3285  H HB   . THR A 1 71  ? 141.157 -5.830  -99.426  1.00 0.00 ? 71  THR A HB   2  
ATOM 3286  H HG1  . THR A 1 71  ? 139.402 -4.556  -100.508 1.00 0.00 ? 71  THR A HG1  2  
ATOM 3287  H HG21 . THR A 1 71  ? 141.572 -3.003  -98.548  1.00 0.00 ? 71  THR A HG21 2  
ATOM 3288  H HG22 . THR A 1 71  ? 142.990 -3.980  -98.931  1.00 0.00 ? 71  THR A HG22 2  
ATOM 3289  H HG23 . THR A 1 71  ? 141.872 -4.503  -97.671  1.00 0.00 ? 71  THR A HG23 2  
ATOM 3290  N N    . PRO A 1 72  ? 140.833 -6.269  -102.523 1.00 0.00 ? 72  PRO A N    2  
ATOM 3291  C CA   . PRO A 1 72  ? 139.941 -6.840  -103.576 1.00 0.00 ? 72  PRO A CA   2  
ATOM 3292  C C    . PRO A 1 72  ? 138.482 -6.386  -103.430 1.00 0.00 ? 72  PRO A C    2  
ATOM 3293  O O    . PRO A 1 72  ? 138.138 -5.690  -102.495 1.00 0.00 ? 72  PRO A O    2  
ATOM 3294  C CB   . PRO A 1 72  ? 140.090 -8.346  -103.337 1.00 0.00 ? 72  PRO A CB   2  
ATOM 3295  C CG   . PRO A 1 72  ? 141.231 -8.576  -102.334 1.00 0.00 ? 72  PRO A CG   2  
ATOM 3296  C CD   . PRO A 1 72  ? 141.803 -7.218  -101.921 1.00 0.00 ? 72  PRO A CD   2  
ATOM 3297  H HA   . PRO A 1 72  ? 140.313 -6.594  -104.556 1.00 0.00 ? 72  PRO A HA   2  
ATOM 3298  H HB2  . PRO A 1 72  ? 139.168 -8.745  -102.939 1.00 0.00 ? 72  PRO A HB2  2  
ATOM 3299  H HB3  . PRO A 1 72  ? 140.330 -8.839  -104.266 1.00 0.00 ? 72  PRO A HB3  2  
ATOM 3300  H HG2  . PRO A 1 72  ? 140.849 -9.092  -101.463 1.00 0.00 ? 72  PRO A HG2  2  
ATOM 3301  H HG3  . PRO A 1 72  ? 142.007 -9.168  -102.796 1.00 0.00 ? 72  PRO A HG3  2  
ATOM 3302  H HD2  . PRO A 1 72  ? 141.824 -7.126  -100.844 1.00 0.00 ? 72  PRO A HD2  2  
ATOM 3303  H HD3  . PRO A 1 72  ? 142.784 -7.068  -102.341 1.00 0.00 ? 72  PRO A HD3  2  
ATOM 3304  N N    . PRO A 1 73  ? 137.629 -6.766  -104.355 1.00 0.00 ? 73  PRO A N    2  
ATOM 3305  C CA   . PRO A 1 73  ? 136.201 -6.363  -104.306 1.00 0.00 ? 73  PRO A CA   2  
ATOM 3306  C C    . PRO A 1 73  ? 135.644 -6.421  -102.885 1.00 0.00 ? 73  PRO A C    2  
ATOM 3307  O O    . PRO A 1 73  ? 136.330 -6.812  -101.964 1.00 0.00 ? 73  PRO A O    2  
ATOM 3308  C CB   . PRO A 1 73  ? 135.548 -7.400  -105.218 1.00 0.00 ? 73  PRO A CB   2  
ATOM 3309  C CG   . PRO A 1 73  ? 136.650 -8.053  -106.064 1.00 0.00 ? 73  PRO A CG   2  
ATOM 3310  C CD   . PRO A 1 73  ? 138.015 -7.630  -105.501 1.00 0.00 ? 73  PRO A CD   2  
ATOM 3311  H HA   . PRO A 1 73  ? 136.070 -5.378  -104.723 1.00 0.00 ? 73  PRO A HA   2  
ATOM 3312  H HB2  . PRO A 1 73  ? 135.050 -8.150  -104.619 1.00 0.00 ? 73  PRO A HB2  2  
ATOM 3313  H HB3  . PRO A 1 73  ? 134.833 -6.917  -105.868 1.00 0.00 ? 73  PRO A HB3  2  
ATOM 3314  H HG2  . PRO A 1 73  ? 136.554 -9.129  -106.017 1.00 0.00 ? 73  PRO A HG2  2  
ATOM 3315  H HG3  . PRO A 1 73  ? 136.567 -7.724  -107.088 1.00 0.00 ? 73  PRO A HG3  2  
ATOM 3316  H HD2  . PRO A 1 73  ? 138.569 -8.495  -105.168 1.00 0.00 ? 73  PRO A HD2  2  
ATOM 3317  H HD3  . PRO A 1 73  ? 138.574 -7.066  -106.227 1.00 0.00 ? 73  PRO A HD3  2  
ATOM 3318  N N    . ALA A 1 74  ? 134.420 -6.017  -102.686 1.00 0.00 ? 74  ALA A N    2  
ATOM 3319  C CA   . ALA A 1 74  ? 133.873 -6.035  -101.304 1.00 0.00 ? 74  ALA A CA   2  
ATOM 3320  C C    . ALA A 1 74  ? 134.912 -5.385  -100.393 1.00 0.00 ? 74  ALA A C    2  
ATOM 3321  O O    . ALA A 1 74  ? 134.847 -4.207  -100.098 1.00 0.00 ? 74  ALA A O    2  
ATOM 3322  C CB   . ALA A 1 74  ? 133.629 -7.481  -100.865 1.00 0.00 ? 74  ALA A CB   2  
ATOM 3323  H H    . ALA A 1 74  ? 133.878 -5.685  -103.432 1.00 0.00 ? 74  ALA A H    2  
ATOM 3324  H HA   . ALA A 1 74  ? 132.949 -5.476  -101.267 1.00 0.00 ? 74  ALA A HA   2  
ATOM 3325  H HB1  . ALA A 1 74  ? 134.219 -8.148  -101.478 1.00 0.00 ? 74  ALA A HB1  2  
ATOM 3326  H HB2  . ALA A 1 74  ? 132.581 -7.720  -100.978 1.00 0.00 ? 74  ALA A HB2  2  
ATOM 3327  H HB3  . ALA A 1 74  ? 133.914 -7.597  -99.831  1.00 0.00 ? 74  ALA A HB3  2  
ATOM 3328  N N    . SER A 1 75  ? 135.874 -6.142  -99.950  1.00 0.00 ? 75  SER A N    2  
ATOM 3329  C CA   . SER A 1 75  ? 136.926 -5.578  -99.063  1.00 0.00 ? 75  SER A CA   2  
ATOM 3330  C C    . SER A 1 75  ? 137.385 -4.216  -99.595  1.00 0.00 ? 75  SER A C    2  
ATOM 3331  O O    . SER A 1 75  ? 137.902 -3.403  -98.850  1.00 0.00 ? 75  SER A O    2  
ATOM 3332  C CB   . SER A 1 75  ? 138.113 -6.541  -99.037  1.00 0.00 ? 75  SER A CB   2  
ATOM 3333  O OG   . SER A 1 75  ? 138.601 -6.650  -97.708  1.00 0.00 ? 75  SER A OG   2  
ATOM 3334  H H    . SER A 1 75  ? 135.897 -7.093  -100.184 1.00 0.00 ? 75  SER A H    2  
ATOM 3335  H HA   . SER A 1 75  ? 136.542 -5.464  -98.064  1.00 0.00 ? 75  SER A HA   2  
ATOM 3336  H HB2  . SER A 1 75  ? 137.799 -7.513  -99.378  1.00 0.00 ? 75  SER A HB2  2  
ATOM 3337  H HB3  . SER A 1 75  ? 138.892 -6.172  -99.690  1.00 0.00 ? 75  SER A HB3  2  
ATOM 3338  H HG   . SER A 1 75  ? 139.470 -7.055  -97.742  1.00 0.00 ? 75  SER A HG   2  
ATOM 3339  N N    . TYR A 1 76  ? 137.192 -3.949  -100.869 1.00 0.00 ? 76  TYR A N    2  
ATOM 3340  C CA   . TYR A 1 76  ? 137.630 -2.633  -101.430 1.00 0.00 ? 76  TYR A CA   2  
ATOM 3341  C C    . TYR A 1 76  ? 137.232 -1.523  -100.460 1.00 0.00 ? 76  TYR A C    2  
ATOM 3342  O O    . TYR A 1 76  ? 137.974 -0.576  -100.251 1.00 0.00 ? 76  TYR A O    2  
ATOM 3343  C CB   . TYR A 1 76  ? 136.988 -2.401  -102.806 1.00 0.00 ? 76  TYR A CB   2  
ATOM 3344  C CG   . TYR A 1 76  ? 135.554 -1.942  -102.660 1.00 0.00 ? 76  TYR A CG   2  
ATOM 3345  C CD1  . TYR A 1 76  ? 134.546 -2.873  -102.390 1.00 0.00 ? 76  TYR A CD1  2  
ATOM 3346  C CD2  . TYR A 1 76  ? 135.230 -0.589  -102.820 1.00 0.00 ? 76  TYR A CD2  2  
ATOM 3347  C CE1  . TYR A 1 76  ? 133.216 -2.452  -102.273 1.00 0.00 ? 76  TYR A CE1  2  
ATOM 3348  C CE2  . TYR A 1 76  ? 133.900 -0.169  -102.707 1.00 0.00 ? 76  TYR A CE2  2  
ATOM 3349  C CZ   . TYR A 1 76  ? 132.892 -1.100  -102.432 1.00 0.00 ? 76  TYR A CZ   2  
ATOM 3350  O OH   . TYR A 1 76  ? 131.580 -0.686  -102.322 1.00 0.00 ? 76  TYR A OH   2  
ATOM 3351  H H    . TYR A 1 76  ? 136.766 -4.613  -101.450 1.00 0.00 ? 76  TYR A H    2  
ATOM 3352  H HA   . TYR A 1 76  ? 138.702 -2.636  -101.538 1.00 0.00 ? 76  TYR A HA   2  
ATOM 3353  H HB2  . TYR A 1 76  ? 137.548 -1.647  -103.336 1.00 0.00 ? 76  TYR A HB2  2  
ATOM 3354  H HB3  . TYR A 1 76  ? 137.011 -3.323  -103.368 1.00 0.00 ? 76  TYR A HB3  2  
ATOM 3355  H HD1  . TYR A 1 76  ? 134.796 -3.915  -102.268 1.00 0.00 ? 76  TYR A HD1  2  
ATOM 3356  H HD2  . TYR A 1 76  ? 136.007 0.131   -103.027 1.00 0.00 ? 76  TYR A HD2  2  
ATOM 3357  H HE1  . TYR A 1 76  ? 132.439 -3.172  -102.060 1.00 0.00 ? 76  TYR A HE1  2  
ATOM 3358  H HE2  . TYR A 1 76  ? 133.650 0.875   -102.830 1.00 0.00 ? 76  TYR A HE2  2  
ATOM 3359  H HH   . TYR A 1 76  ? 131.570 0.273   -102.339 1.00 0.00 ? 76  TYR A HH   2  
ATOM 3360  N N    . LEU A 1 77  ? 136.080 -1.660  -99.852  1.00 0.00 ? 77  LEU A N    2  
ATOM 3361  C CA   . LEU A 1 77  ? 135.609 -0.656  -98.855  1.00 0.00 ? 77  LEU A CA   2  
ATOM 3362  C C    . LEU A 1 77  ? 135.050 -1.418  -97.648  1.00 0.00 ? 77  LEU A C    2  
ATOM 3363  O O    . LEU A 1 77  ? 134.878 -0.874  -96.560  1.00 0.00 ? 77  LEU A O    2  
ATOM 3364  C CB   . LEU A 1 77  ? 134.530 0.237   -99.481  1.00 0.00 ? 77  LEU A CB   2  
ATOM 3365  C CG   . LEU A 1 77  ? 133.141 -0.139  -98.955  1.00 0.00 ? 77  LEU A CG   2  
ATOM 3366  C CD1  . LEU A 1 77  ? 132.120 0.879   -99.458  1.00 0.00 ? 77  LEU A CD1  2  
ATOM 3367  C CD2  . LEU A 1 77  ? 132.751 -1.532  -99.460  1.00 0.00 ? 77  LEU A CD2  2  
ATOM 3368  H H    . LEU A 1 77  ? 135.528 -2.446  -100.048 1.00 0.00 ? 77  LEU A H    2  
ATOM 3369  H HA   . LEU A 1 77  ? 136.445 -0.048  -98.539  1.00 0.00 ? 77  LEU A HA   2  
ATOM 3370  H HB2  . LEU A 1 77  ? 134.735 1.268   -99.233  1.00 0.00 ? 77  LEU A HB2  2  
ATOM 3371  H HB3  . LEU A 1 77  ? 134.549 0.118   -100.550 1.00 0.00 ? 77  LEU A HB3  2  
ATOM 3372  H HG   . LEU A 1 77  ? 133.148 -0.133  -97.876  1.00 0.00 ? 77  LEU A HG   2  
ATOM 3373  H HD11 . LEU A 1 77  ? 132.628 1.793   -99.726  1.00 0.00 ? 77  LEU A HD11 2  
ATOM 3374  H HD12 . LEU A 1 77  ? 131.400 1.081   -98.680  1.00 0.00 ? 77  LEU A HD12 2  
ATOM 3375  H HD13 . LEU A 1 77  ? 131.612 0.481   -100.325 1.00 0.00 ? 77  LEU A HD13 2  
ATOM 3376  H HD21 . LEU A 1 77  ? 131.967 -1.439  -100.198 1.00 0.00 ? 77  LEU A HD21 2  
ATOM 3377  H HD22 . LEU A 1 77  ? 132.397 -2.129  -98.633  1.00 0.00 ? 77  LEU A HD22 2  
ATOM 3378  H HD23 . LEU A 1 77  ? 133.611 -2.007  -99.906  1.00 0.00 ? 77  LEU A HD23 2  
ATOM 3379  N N    . ILE A 1 78  ? 134.788 -2.692  -97.826  1.00 0.00 ? 78  ILE A N    2  
ATOM 3380  C CA   . ILE A 1 78  ? 134.273 -3.499  -96.697  1.00 0.00 ? 78  ILE A CA   2  
ATOM 3381  C C    . ILE A 1 78  ? 135.324 -3.448  -95.594  1.00 0.00 ? 78  ILE A C    2  
ATOM 3382  O O    . ILE A 1 78  ? 135.026 -3.478  -94.415  1.00 0.00 ? 78  ILE A O    2  
ATOM 3383  C CB   . ILE A 1 78  ? 134.069 -4.951  -97.148  1.00 0.00 ? 78  ILE A CB   2  
ATOM 3384  C CG1  . ILE A 1 78  ? 132.804 -5.042  -98.010  1.00 0.00 ? 78  ILE A CG1  2  
ATOM 3385  C CG2  . ILE A 1 78  ? 133.918 -5.856  -95.923  1.00 0.00 ? 78  ILE A CG2  2  
ATOM 3386  C CD1  . ILE A 1 78  ? 132.344 -6.501  -98.101  1.00 0.00 ? 78  ILE A CD1  2  
ATOM 3387  H H    . ILE A 1 78  ? 134.952 -3.113  -98.696  1.00 0.00 ? 78  ILE A H    2  
ATOM 3388  H HA   . ILE A 1 78  ? 133.316 -3.095  -96.396  1.00 0.00 ? 78  ILE A HA   2  
ATOM 3389  H HB   . ILE A 1 78  ? 134.917 -5.270  -97.725  1.00 0.00 ? 78  ILE A HB   2  
ATOM 3390  H HG12 . ILE A 1 78  ? 132.022 -4.446  -97.563  1.00 0.00 ? 78  ILE A HG12 2  
ATOM 3391  H HG13 . ILE A 1 78  ? 133.016 -4.672  -99.001  1.00 0.00 ? 78  ILE A HG13 2  
ATOM 3392  H HG21 . ILE A 1 78  ? 134.788 -5.759  -95.291  1.00 0.00 ? 78  ILE A HG21 2  
ATOM 3393  H HG22 . ILE A 1 78  ? 133.820 -6.883  -96.242  1.00 0.00 ? 78  ILE A HG22 2  
ATOM 3394  H HG23 . ILE A 1 78  ? 133.037 -5.568  -95.369  1.00 0.00 ? 78  ILE A HG23 2  
ATOM 3395  H HD11 . ILE A 1 78  ? 133.160 -7.156  -97.832  1.00 0.00 ? 78  ILE A HD11 2  
ATOM 3396  H HD12 . ILE A 1 78  ? 132.028 -6.719  -99.111  1.00 0.00 ? 78  ILE A HD12 2  
ATOM 3397  H HD13 . ILE A 1 78  ? 131.517 -6.662  -97.424  1.00 0.00 ? 78  ILE A HD13 2  
ATOM 3398  N N    . ARG A 1 79  ? 136.575 -3.353  -96.000  1.00 0.00 ? 79  ARG A N    2  
ATOM 3399  C CA   . ARG A 1 79  ? 137.690 -3.280  -95.015  1.00 0.00 ? 79  ARG A CA   2  
ATOM 3400  C C    . ARG A 1 79  ? 137.436 -2.106  -94.079  1.00 0.00 ? 79  ARG A C    2  
ATOM 3401  O O    . ARG A 1 79  ? 137.581 -2.209  -92.877  1.00 0.00 ? 79  ARG A O    2  
ATOM 3402  C CB   . ARG A 1 79  ? 139.011 -3.067  -95.755  1.00 0.00 ? 79  ARG A CB   2  
ATOM 3403  C CG   . ARG A 1 79  ? 139.225 -4.207  -96.752  1.00 0.00 ? 79  ARG A CG   2  
ATOM 3404  C CD   . ARG A 1 79  ? 140.008 -5.341  -96.087  1.00 0.00 ? 79  ARG A CD   2  
ATOM 3405  N NE   . ARG A 1 79  ? 139.088 -6.150  -95.239  1.00 0.00 ? 79  ARG A NE   2  
ATOM 3406  C CZ   . ARG A 1 79  ? 139.452 -7.333  -94.825  1.00 0.00 ? 79  ARG A CZ   2  
ATOM 3407  N NH1  . ARG A 1 79  ? 140.620 -7.811  -95.158  1.00 0.00 ? 79  ARG A NH1  2  
ATOM 3408  N NH2  . ARG A 1 79  ? 138.647 -8.040  -94.079  1.00 0.00 ? 79  ARG A NH2  2  
ATOM 3409  H H    . ARG A 1 79  ? 136.771 -3.308  -96.964  1.00 0.00 ? 79  ARG A H    2  
ATOM 3410  H HA   . ARG A 1 79  ? 137.737 -4.198  -94.447  1.00 0.00 ? 79  ARG A HA   2  
ATOM 3411  H HB2  . ARG A 1 79  ? 138.977 -2.126  -96.284  1.00 0.00 ? 79  ARG A HB2  2  
ATOM 3412  H HB3  . ARG A 1 79  ? 139.823 -3.052  -95.046  1.00 0.00 ? 79  ARG A HB3  2  
ATOM 3413  H HG2  . ARG A 1 79  ? 138.265 -4.578  -97.081  1.00 0.00 ? 79  ARG A HG2  2  
ATOM 3414  H HG3  . ARG A 1 79  ? 139.778 -3.839  -97.601  1.00 0.00 ? 79  ARG A HG3  2  
ATOM 3415  H HD2  . ARG A 1 79  ? 140.445 -5.971  -96.848  1.00 0.00 ? 79  ARG A HD2  2  
ATOM 3416  H HD3  . ARG A 1 79  ? 140.791 -4.927  -95.473  1.00 0.00 ? 79  ARG A HD3  2  
ATOM 3417  H HE   . ARG A 1 79  ? 138.210 -5.793  -94.991  1.00 0.00 ? 79  ARG A HE   2  
ATOM 3418  H HH11 . ARG A 1 79  ? 141.237 -7.270  -95.730  1.00 0.00 ? 79  ARG A HH11 2  
ATOM 3419  H HH12 . ARG A 1 79  ? 140.899 -8.717  -94.841  1.00 0.00 ? 79  ARG A HH12 2  
ATOM 3420  H HH21 . ARG A 1 79  ? 137.752 -7.675  -93.825  1.00 0.00 ? 79  ARG A HH21 2  
ATOM 3421  H HH22 . ARG A 1 79  ? 138.926 -8.946  -93.762  1.00 0.00 ? 79  ARG A HH22 2  
ATOM 3422  N N    . LYS A 1 80  ? 137.039 -0.990  -94.622  1.00 0.00 ? 80  LYS A N    2  
ATOM 3423  C CA   . LYS A 1 80  ? 136.757 0.183   -93.760  1.00 0.00 ? 80  LYS A CA   2  
ATOM 3424  C C    . LYS A 1 80  ? 135.561 -0.158  -92.877  1.00 0.00 ? 80  LYS A C    2  
ATOM 3425  O O    . LYS A 1 80  ? 135.680 -0.273  -91.673  1.00 0.00 ? 80  LYS A O    2  
ATOM 3426  C CB   . LYS A 1 80  ? 136.432 1.400   -94.629  1.00 0.00 ? 80  LYS A CB   2  
ATOM 3427  C CG   . LYS A 1 80  ? 136.331 2.645   -93.745  1.00 0.00 ? 80  LYS A CG   2  
ATOM 3428  C CD   . LYS A 1 80  ? 134.866 2.900   -93.388  1.00 0.00 ? 80  LYS A CD   2  
ATOM 3429  C CE   . LYS A 1 80  ? 134.735 4.266   -92.709  1.00 0.00 ? 80  LYS A CE   2  
ATOM 3430  N NZ   . LYS A 1 80  ? 135.361 4.210   -91.358  1.00 0.00 ? 80  LYS A NZ   2  
ATOM 3431  H H    . LYS A 1 80  ? 136.918 -0.930  -95.592  1.00 0.00 ? 80  LYS A H    2  
ATOM 3432  H HA   . LYS A 1 80  ? 137.618 0.391   -93.141  1.00 0.00 ? 80  LYS A HA   2  
ATOM 3433  H HB2  . LYS A 1 80  ? 137.215 1.539   -95.360  1.00 0.00 ? 80  LYS A HB2  2  
ATOM 3434  H HB3  . LYS A 1 80  ? 135.491 1.242   -95.133  1.00 0.00 ? 80  LYS A HB3  2  
ATOM 3435  H HG2  . LYS A 1 80  ? 136.902 2.492   -92.840  1.00 0.00 ? 80  LYS A HG2  2  
ATOM 3436  H HG3  . LYS A 1 80  ? 136.723 3.498   -94.279  1.00 0.00 ? 80  LYS A HG3  2  
ATOM 3437  H HD2  . LYS A 1 80  ? 134.268 2.886   -94.288  1.00 0.00 ? 80  LYS A HD2  2  
ATOM 3438  H HD3  . LYS A 1 80  ? 134.520 2.132   -92.714  1.00 0.00 ? 80  LYS A HD3  2  
ATOM 3439  H HE2  . LYS A 1 80  ? 135.236 5.014   -93.308  1.00 0.00 ? 80  LYS A HE2  2  
ATOM 3440  H HE3  . LYS A 1 80  ? 133.691 4.521   -92.613  1.00 0.00 ? 80  LYS A HE3  2  
ATOM 3441  H HZ1  . LYS A 1 80  ? 136.359 4.492   -91.426  1.00 0.00 ? 80  LYS A HZ1  2  
ATOM 3442  H HZ2  . LYS A 1 80  ? 135.299 3.240   -90.988  1.00 0.00 ? 80  LYS A HZ2  2  
ATOM 3443  H HZ3  . LYS A 1 80  ? 134.862 4.859   -90.718  1.00 0.00 ? 80  LYS A HZ3  2  
ATOM 3444  N N    . ALA A 1 81  ? 134.403 -0.320  -93.461  1.00 0.00 ? 81  ALA A N    2  
ATOM 3445  C CA   . ALA A 1 81  ? 133.205 -0.654  -92.632  1.00 0.00 ? 81  ALA A CA   2  
ATOM 3446  C C    . ALA A 1 81  ? 133.460 -1.955  -91.866  1.00 0.00 ? 81  ALA A C    2  
ATOM 3447  O O    . ALA A 1 81  ? 132.658 -2.384  -91.061  1.00 0.00 ? 81  ALA A O    2  
ATOM 3448  C CB   . ALA A 1 81  ? 131.992 -0.840  -93.540  1.00 0.00 ? 81  ALA A CB   2  
ATOM 3449  H H    . ALA A 1 81  ? 134.318 -0.212  -94.439  1.00 0.00 ? 81  ALA A H    2  
ATOM 3450  H HA   . ALA A 1 81  ? 133.016 0.147   -91.933  1.00 0.00 ? 81  ALA A HA   2  
ATOM 3451  H HB1  . ALA A 1 81  ? 131.319 -1.559  -93.095  1.00 0.00 ? 81  ALA A HB1  2  
ATOM 3452  H HB2  . ALA A 1 81  ? 132.316 -1.198  -94.504  1.00 0.00 ? 81  ALA A HB2  2  
ATOM 3453  H HB3  . ALA A 1 81  ? 131.484 0.105   -93.656  1.00 0.00 ? 81  ALA A HB3  2  
ATOM 3454  N N    . ALA A 1 82  ? 134.567 -2.586  -92.126  1.00 0.00 ? 82  ALA A N    2  
ATOM 3455  C CA   . ALA A 1 82  ? 134.888 -3.867  -91.440  1.00 0.00 ? 82  ALA A CA   2  
ATOM 3456  C C    . ALA A 1 82  ? 135.533 -3.627  -90.071  1.00 0.00 ? 82  ALA A C    2  
ATOM 3457  O O    . ALA A 1 82  ? 134.878 -3.695  -89.051  1.00 0.00 ? 82  ALA A O    2  
ATOM 3458  C CB   . ALA A 1 82  ? 135.865 -4.666  -92.298  1.00 0.00 ? 82  ALA A CB   2  
ATOM 3459  H H    . ALA A 1 82  ? 135.188 -2.214  -92.788  1.00 0.00 ? 82  ALA A H    2  
ATOM 3460  H HA   . ALA A 1 82  ? 133.998 -4.464  -91.301  1.00 0.00 ? 82  ALA A HA   2  
ATOM 3461  H HB1  . ALA A 1 82  ? 135.317 -5.352  -92.927  1.00 0.00 ? 82  ALA A HB1  2  
ATOM 3462  H HB2  . ALA A 1 82  ? 136.533 -5.221  -91.656  1.00 0.00 ? 82  ALA A HB2  2  
ATOM 3463  H HB3  . ALA A 1 82  ? 136.436 -3.992  -92.910  1.00 0.00 ? 82  ALA A HB3  2  
ATOM 3464  N N    . GLY A 1 83  ? 136.804 -3.341  -90.029  1.00 0.00 ? 83  GLY A N    2  
ATOM 3465  C CA   . GLY A 1 83  ? 137.453 -3.098  -88.708  1.00 0.00 ? 83  GLY A CA   2  
ATOM 3466  C C    . GLY A 1 83  ? 138.975 -3.115  -88.854  1.00 0.00 ? 83  GLY A C    2  
ATOM 3467  O O    . GLY A 1 83  ? 139.666 -3.823  -88.149  1.00 0.00 ? 83  GLY A O    2  
ATOM 3468  H H    . GLY A 1 83  ? 137.327 -3.282  -90.856  1.00 0.00 ? 83  GLY A H    2  
ATOM 3469  H HA2  . GLY A 1 83  ? 137.140 -2.135  -88.329  1.00 0.00 ? 83  GLY A HA2  2  
ATOM 3470  H HA3  . GLY A 1 83  ? 137.154 -3.870  -88.015  1.00 0.00 ? 83  GLY A HA3  2  
ATOM 3471  N N    . LEU A 1 84  ? 139.507 -2.337  -89.754  1.00 0.00 ? 84  LEU A N    2  
ATOM 3472  C CA   . LEU A 1 84  ? 140.987 -2.310  -89.927  1.00 0.00 ? 84  LEU A CA   2  
ATOM 3473  C C    . LEU A 1 84  ? 141.482 -0.865  -89.836  1.00 0.00 ? 84  LEU A C    2  
ATOM 3474  O O    . LEU A 1 84  ? 141.320 -0.083  -90.752  1.00 0.00 ? 84  LEU A O    2  
ATOM 3475  C CB   . LEU A 1 84  ? 141.350 -2.895  -91.294  1.00 0.00 ? 84  LEU A CB   2  
ATOM 3476  C CG   . LEU A 1 84  ? 140.307 -3.941  -91.693  1.00 0.00 ? 84  LEU A CG   2  
ATOM 3477  C CD1  . LEU A 1 84  ? 140.652 -4.506  -93.070  1.00 0.00 ? 84  LEU A CD1  2  
ATOM 3478  C CD2  . LEU A 1 84  ? 140.301 -5.077  -90.667  1.00 0.00 ? 84  LEU A CD2  2  
ATOM 3479  H H    . LEU A 1 84  ? 138.937 -1.767  -90.312  1.00 0.00 ? 84  LEU A H    2  
ATOM 3480  H HA   . LEU A 1 84  ? 141.450 -2.898  -89.149  1.00 0.00 ? 84  LEU A HA   2  
ATOM 3481  H HB2  . LEU A 1 84  ? 141.369 -2.105  -92.030  1.00 0.00 ? 84  LEU A HB2  2  
ATOM 3482  H HB3  . LEU A 1 84  ? 142.322 -3.361  -91.239  1.00 0.00 ? 84  LEU A HB3  2  
ATOM 3483  H HG   . LEU A 1 84  ? 139.330 -3.480  -91.728  1.00 0.00 ? 84  LEU A HG   2  
ATOM 3484  H HD11 . LEU A 1 84  ? 141.256 -3.793  -93.612  1.00 0.00 ? 84  LEU A HD11 2  
ATOM 3485  H HD12 . LEU A 1 84  ? 139.741 -4.696  -93.618  1.00 0.00 ? 84  LEU A HD12 2  
ATOM 3486  H HD13 . LEU A 1 84  ? 141.201 -5.428  -92.953  1.00 0.00 ? 84  LEU A HD13 2  
ATOM 3487  H HD21 . LEU A 1 84  ? 139.335 -5.123  -90.187  1.00 0.00 ? 84  LEU A HD21 2  
ATOM 3488  H HD22 . LEU A 1 84  ? 141.065 -4.897  -89.925  1.00 0.00 ? 84  LEU A HD22 2  
ATOM 3489  H HD23 . LEU A 1 84  ? 140.499 -6.014  -91.167  1.00 0.00 ? 84  LEU A HD23 2  
ATOM 3490  N N    . GLU A 1 85  ? 142.085 -0.505  -88.735  1.00 0.00 ? 85  GLU A N    2  
ATOM 3491  C CA   . GLU A 1 85  ? 142.591 0.888   -88.582  1.00 0.00 ? 85  GLU A CA   2  
ATOM 3492  C C    . GLU A 1 85  ? 143.135 1.080   -87.164  1.00 0.00 ? 85  GLU A C    2  
ATOM 3493  O O    . GLU A 1 85  ? 144.243 1.541   -86.970  1.00 0.00 ? 85  GLU A O    2  
ATOM 3494  C CB   . GLU A 1 85  ? 141.448 1.876   -88.827  1.00 0.00 ? 85  GLU A CB   2  
ATOM 3495  C CG   . GLU A 1 85  ? 141.770 3.209   -88.149  1.00 0.00 ? 85  GLU A CG   2  
ATOM 3496  C CD   . GLU A 1 85  ? 143.197 3.632   -88.506  1.00 0.00 ? 85  GLU A CD   2  
ATOM 3497  O OE1  . GLU A 1 85  ? 143.648 3.275   -89.581  1.00 0.00 ? 85  GLU A OE1  2  
ATOM 3498  O OE2  . GLU A 1 85  ? 143.813 4.304   -87.695  1.00 0.00 ? 85  GLU A OE2  2  
ATOM 3499  H H    . GLU A 1 85  ? 142.205 -1.152  -88.009  1.00 0.00 ? 85  GLU A H    2  
ATOM 3500  H HA   . GLU A 1 85  ? 143.379 1.067   -89.298  1.00 0.00 ? 85  GLU A HA   2  
ATOM 3501  H HB2  . GLU A 1 85  ? 141.328 2.030   -89.890  1.00 0.00 ? 85  GLU A HB2  2  
ATOM 3502  H HB3  . GLU A 1 85  ? 140.533 1.477   -88.415  1.00 0.00 ? 85  GLU A HB3  2  
ATOM 3503  H HG2  . GLU A 1 85  ? 141.075 3.963   -88.490  1.00 0.00 ? 85  GLU A HG2  2  
ATOM 3504  H HG3  . GLU A 1 85  ? 141.686 3.099   -87.078  1.00 0.00 ? 85  GLU A HG3  2  
ATOM 3505  N N    . LYS A 1 86  ? 142.364 0.731   -86.170  1.00 0.00 ? 86  LYS A N    2  
ATOM 3506  C CA   . LYS A 1 86  ? 142.835 0.893   -84.765  1.00 0.00 ? 86  LYS A CA   2  
ATOM 3507  C C    . LYS A 1 86  ? 142.779 2.371   -84.375  1.00 0.00 ? 86  LYS A C    2  
ATOM 3508  O O    . LYS A 1 86  ? 143.037 3.246   -85.178  1.00 0.00 ? 86  LYS A O    2  
ATOM 3509  C CB   . LYS A 1 86  ? 144.275 0.389   -84.648  1.00 0.00 ? 86  LYS A CB   2  
ATOM 3510  C CG   . LYS A 1 86  ? 144.485 -0.247  -83.273  1.00 0.00 ? 86  LYS A CG   2  
ATOM 3511  C CD   . LYS A 1 86  ? 144.521 0.849   -82.204  1.00 0.00 ? 86  LYS A CD   2  
ATOM 3512  C CE   . LYS A 1 86  ? 145.397 0.393   -81.036  1.00 0.00 ? 86  LYS A CE   2  
ATOM 3513  N NZ   . LYS A 1 86  ? 144.679 -0.654  -80.254  1.00 0.00 ? 86  LYS A NZ   2  
ATOM 3514  H H    . LYS A 1 86  ? 141.473 0.361   -86.349  1.00 0.00 ? 86  LYS A H    2  
ATOM 3515  H HA   . LYS A 1 86  ? 142.200 0.322   -84.105  1.00 0.00 ? 86  LYS A HA   2  
ATOM 3516  H HB2  . LYS A 1 86  ? 144.462 -0.348  -85.418  1.00 0.00 ? 86  LYS A HB2  2  
ATOM 3517  H HB3  . LYS A 1 86  ? 144.957 1.216   -84.768  1.00 0.00 ? 86  LYS A HB3  2  
ATOM 3518  H HG2  . LYS A 1 86  ? 143.673 -0.928  -83.063  1.00 0.00 ? 86  LYS A HG2  2  
ATOM 3519  H HG3  . LYS A 1 86  ? 145.420 -0.786  -83.263  1.00 0.00 ? 86  LYS A HG3  2  
ATOM 3520  H HD2  . LYS A 1 86  ? 144.931 1.753   -82.631  1.00 0.00 ? 86  LYS A HD2  2  
ATOM 3521  H HD3  . LYS A 1 86  ? 143.520 1.039   -81.849  1.00 0.00 ? 86  LYS A HD3  2  
ATOM 3522  H HE2  . LYS A 1 86  ? 146.323 -0.013  -81.415  1.00 0.00 ? 86  LYS A HE2  2  
ATOM 3523  H HE3  . LYS A 1 86  ? 145.610 1.237   -80.395  1.00 0.00 ? 86  LYS A HE3  2  
ATOM 3524  H HZ1  . LYS A 1 86  ? 144.621 -1.527  -80.816  1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 3525  H HZ2  . LYS A 1 86  ? 143.718 -0.320  -80.031  1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 3526  H HZ3  . LYS A 1 86  ? 145.195 -0.845  -79.372  1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 3527  N N    . GLY A 1 87  ? 142.445 2.658   -83.146  1.00 0.00 ? 87  GLY A N    2  
ATOM 3528  C CA   . GLY A 1 87  ? 142.372 4.080   -82.704  1.00 0.00 ? 87  GLY A CA   2  
ATOM 3529  C C    . GLY A 1 87  ? 142.625 4.162   -81.197  1.00 0.00 ? 87  GLY A C    2  
ATOM 3530  O O    . GLY A 1 87  ? 143.243 3.295   -80.614  1.00 0.00 ? 87  GLY A O    2  
ATOM 3531  H H    . GLY A 1 87  ? 142.240 1.938   -82.513  1.00 0.00 ? 87  GLY A H    2  
ATOM 3532  H HA2  . GLY A 1 87  ? 143.121 4.658   -83.228  1.00 0.00 ? 87  GLY A HA2  2  
ATOM 3533  H HA3  . GLY A 1 87  ? 141.392 4.476   -82.923  1.00 0.00 ? 87  GLY A HA3  2  
ATOM 3534  N N    . ALA A 1 88  ? 142.150 5.199   -80.562  1.00 0.00 ? 88  ALA A N    2  
ATOM 3535  C CA   . ALA A 1 88  ? 142.362 5.336   -79.093  1.00 0.00 ? 88  ALA A CA   2  
ATOM 3536  C C    . ALA A 1 88  ? 141.368 4.445   -78.347  1.00 0.00 ? 88  ALA A C    2  
ATOM 3537  O O    . ALA A 1 88  ? 141.671 3.324   -77.989  1.00 0.00 ? 88  ALA A O    2  
ATOM 3538  C CB   . ALA A 1 88  ? 142.151 6.793   -78.680  1.00 0.00 ? 88  ALA A CB   2  
ATOM 3539  H H    . ALA A 1 88  ? 141.652 5.888   -81.051  1.00 0.00 ? 88  ALA A H    2  
ATOM 3540  H HA   . ALA A 1 88  ? 143.370 5.035   -78.847  1.00 0.00 ? 88  ALA A HA   2  
ATOM 3541  H HB1  . ALA A 1 88  ? 141.284 7.189   -79.189  1.00 0.00 ? 88  ALA A HB1  2  
ATOM 3542  H HB2  . ALA A 1 88  ? 143.021 7.374   -78.949  1.00 0.00 ? 88  ALA A HB2  2  
ATOM 3543  H HB3  . ALA A 1 88  ? 141.997 6.847   -77.612  1.00 0.00 ? 88  ALA A HB3  2  
ATOM 3544  N N    . HIS A 1 89  ? 140.180 4.933   -78.111  1.00 0.00 ? 89  HIS A N    2  
ATOM 3545  C CA   . HIS A 1 89  ? 139.168 4.111   -77.390  1.00 0.00 ? 89  HIS A CA   2  
ATOM 3546  C C    . HIS A 1 89  ? 138.894 2.831   -78.183  1.00 0.00 ? 89  HIS A C    2  
ATOM 3547  O O    . HIS A 1 89  ? 138.242 2.853   -79.208  1.00 0.00 ? 89  HIS A O    2  
ATOM 3548  C CB   . HIS A 1 89  ? 137.871 4.910   -77.245  1.00 0.00 ? 89  HIS A CB   2  
ATOM 3549  C CG   . HIS A 1 89  ? 137.990 5.853   -76.079  1.00 0.00 ? 89  HIS A CG   2  
ATOM 3550  N ND1  . HIS A 1 89  ? 138.305 5.414   -74.803  1.00 0.00 ? 89  HIS A ND1  2  
ATOM 3551  C CD2  . HIS A 1 89  ? 137.839 7.214   -75.982  1.00 0.00 ? 89  HIS A CD2  2  
ATOM 3552  C CE1  . HIS A 1 89  ? 138.333 6.493   -73.999  1.00 0.00 ? 89  HIS A CE1  2  
ATOM 3553  N NE2  . HIS A 1 89  ? 138.056 7.616   -74.667  1.00 0.00 ? 89  HIS A NE2  2  
ATOM 3554  H H    . HIS A 1 89  ? 139.954 5.838   -78.409  1.00 0.00 ? 89  HIS A H    2  
ATOM 3555  H HA   . HIS A 1 89  ? 139.544 3.854   -76.410  1.00 0.00 ? 89  HIS A HA   2  
ATOM 3556  H HB2  . HIS A 1 89  ? 137.693 5.475   -78.148  1.00 0.00 ? 89  HIS A HB2  2  
ATOM 3557  H HB3  . HIS A 1 89  ? 137.048 4.232   -77.076  1.00 0.00 ? 89  HIS A HB3  2  
ATOM 3558  H HD1  . HIS A 1 89  ? 138.476 4.488   -74.535  1.00 0.00 ? 89  HIS A HD1  2  
ATOM 3559  H HD2  . HIS A 1 89  ? 137.589 7.872   -76.800  1.00 0.00 ? 89  HIS A HD2  2  
ATOM 3560  H HE1  . HIS A 1 89  ? 138.553 6.456   -72.942  1.00 0.00 ? 89  HIS A HE1  2  
ATOM 3561  N N    . LYS A 1 90  ? 139.387 1.717   -77.717  1.00 0.00 ? 90  LYS A N    2  
ATOM 3562  C CA   . LYS A 1 90  ? 139.155 0.439   -78.447  1.00 0.00 ? 90  LYS A CA   2  
ATOM 3563  C C    . LYS A 1 90  ? 137.786 -0.129  -78.060  1.00 0.00 ? 90  LYS A C    2  
ATOM 3564  O O    . LYS A 1 90  ? 137.318 0.066   -76.956  1.00 0.00 ? 90  LYS A O    2  
ATOM 3565  C CB   . LYS A 1 90  ? 140.247 -0.566  -78.073  1.00 0.00 ? 90  LYS A CB   2  
ATOM 3566  C CG   . LYS A 1 90  ? 141.569 0.173   -77.860  1.00 0.00 ? 90  LYS A CG   2  
ATOM 3567  C CD   . LYS A 1 90  ? 142.624 -0.807  -77.341  1.00 0.00 ? 90  LYS A CD   2  
ATOM 3568  C CE   . LYS A 1 90  ? 143.589 -0.074  -76.408  1.00 0.00 ? 90  LYS A CE   2  
ATOM 3569  N NZ   . LYS A 1 90  ? 142.823 0.552   -75.294  1.00 0.00 ? 90  LYS A NZ   2  
ATOM 3570  H H    . LYS A 1 90  ? 139.911 1.720   -76.890  1.00 0.00 ? 90  LYS A H    2  
ATOM 3571  H HA   . LYS A 1 90  ? 139.184 0.624   -79.510  1.00 0.00 ? 90  LYS A HA   2  
ATOM 3572  H HB2  . LYS A 1 90  ? 139.968 -1.078  -77.164  1.00 0.00 ? 90  LYS A HB2  2  
ATOM 3573  H HB3  . LYS A 1 90  ? 140.364 -1.285  -78.871  1.00 0.00 ? 90  LYS A HB3  2  
ATOM 3574  H HG2  . LYS A 1 90  ? 141.901 0.597   -78.797  1.00 0.00 ? 90  LYS A HG2  2  
ATOM 3575  H HG3  . LYS A 1 90  ? 141.429 0.962   -77.137  1.00 0.00 ? 90  LYS A HG3  2  
ATOM 3576  H HD2  . LYS A 1 90  ? 142.137 -1.607  -76.800  1.00 0.00 ? 90  LYS A HD2  2  
ATOM 3577  H HD3  . LYS A 1 90  ? 143.174 -1.219  -78.174  1.00 0.00 ? 90  LYS A HD3  2  
ATOM 3578  H HE2  . LYS A 1 90  ? 144.303 -0.775  -76.005  1.00 0.00 ? 90  LYS A HE2  2  
ATOM 3579  H HE3  . LYS A 1 90  ? 144.111 0.693   -76.962  1.00 0.00 ? 90  LYS A HE3  2  
ATOM 3580  H HZ1  . LYS A 1 90  ? 142.258 1.344   -75.662  1.00 0.00 ? 90  LYS A HZ1  2  
ATOM 3581  H HZ2  . LYS A 1 90  ? 143.486 0.905   -74.573  1.00 0.00 ? 90  LYS A HZ2  2  
ATOM 3582  H HZ3  . LYS A 1 90  ? 142.191 -0.153  -74.867  1.00 0.00 ? 90  LYS A HZ3  2  
ATOM 3583  N N    . PRO A 1 91  ? 137.149 -0.831  -78.963  1.00 0.00 ? 91  PRO A N    2  
ATOM 3584  C CA   . PRO A 1 91  ? 135.815 -1.429  -78.683  1.00 0.00 ? 91  PRO A CA   2  
ATOM 3585  C C    . PRO A 1 91  ? 135.848 -2.401  -77.501  1.00 0.00 ? 91  PRO A C    2  
ATOM 3586  O O    . PRO A 1 91  ? 135.087 -2.279  -76.562  1.00 0.00 ? 91  PRO A O    2  
ATOM 3587  C CB   . PRO A 1 91  ? 135.500 -2.171  -79.984  1.00 0.00 ? 91  PRO A CB   2  
ATOM 3588  C CG   . PRO A 1 91  ? 136.684 -2.013  -80.946  1.00 0.00 ? 91  PRO A CG   2  
ATOM 3589  C CD   . PRO A 1 91  ? 137.714 -1.074  -80.314  1.00 0.00 ? 91  PRO A CD   2  
ATOM 3590  H HA   . PRO A 1 91  ? 135.080 -0.657  -78.520  1.00 0.00 ? 91  PRO A HA   2  
ATOM 3591  H HB2  . PRO A 1 91  ? 135.341 -3.219  -79.772  1.00 0.00 ? 91  PRO A HB2  2  
ATOM 3592  H HB3  . PRO A 1 91  ? 134.613 -1.754  -80.434  1.00 0.00 ? 91  PRO A HB3  2  
ATOM 3593  H HG2  . PRO A 1 91  ? 137.135 -2.978  -81.128  1.00 0.00 ? 91  PRO A HG2  2  
ATOM 3594  H HG3  . PRO A 1 91  ? 136.339 -1.593  -81.879  1.00 0.00 ? 91  PRO A HG3  2  
ATOM 3595  H HD2  . PRO A 1 91  ? 138.682 -1.555  -80.251  1.00 0.00 ? 91  PRO A HD2  2  
ATOM 3596  H HD3  . PRO A 1 91  ? 137.777 -0.150  -80.867  1.00 0.00 ? 91  PRO A HD3  2  
ATOM 3597  N N    . GLY A 1 92  ? 136.724 -3.368  -77.542  1.00 0.00 ? 92  GLY A N    2  
ATOM 3598  C CA   . GLY A 1 92  ? 136.807 -4.349  -76.424  1.00 0.00 ? 92  GLY A CA   2  
ATOM 3599  C C    . GLY A 1 92  ? 137.251 -5.707  -76.968  1.00 0.00 ? 92  GLY A C    2  
ATOM 3600  O O    . GLY A 1 92  ? 136.893 -6.093  -78.063  1.00 0.00 ? 92  GLY A O    2  
ATOM 3601  H H    . GLY A 1 92  ? 137.328 -3.449  -78.310  1.00 0.00 ? 92  GLY A H    2  
ATOM 3602  H HA2  . GLY A 1 92  ? 137.522 -4.001  -75.692  1.00 0.00 ? 92  GLY A HA2  2  
ATOM 3603  H HA3  . GLY A 1 92  ? 135.837 -4.452  -75.961  1.00 0.00 ? 92  GLY A HA3  2  
ATOM 3604  N N    . ARG A 1 93  ? 138.024 -6.436  -76.211  1.00 0.00 ? 93  ARG A N    2  
ATOM 3605  C CA   . ARG A 1 93  ? 138.487 -7.770  -76.688  1.00 0.00 ? 93  ARG A CA   2  
ATOM 3606  C C    . ARG A 1 93  ? 139.351 -7.594  -77.939  1.00 0.00 ? 93  ARG A C    2  
ATOM 3607  O O    . ARG A 1 93  ? 139.795 -6.507  -78.249  1.00 0.00 ? 93  ARG A O    2  
ATOM 3608  C CB   . ARG A 1 93  ? 137.273 -8.640  -77.022  1.00 0.00 ? 93  ARG A CB   2  
ATOM 3609  C CG   . ARG A 1 93  ? 136.267 -8.576  -75.869  1.00 0.00 ? 93  ARG A CG   2  
ATOM 3610  C CD   . ARG A 1 93  ? 134.856 -8.846  -76.396  1.00 0.00 ? 93  ARG A CD   2  
ATOM 3611  N NE   . ARG A 1 93  ? 133.909 -7.829  -75.848  1.00 0.00 ? 93  ARG A NE   2  
ATOM 3612  C CZ   . ARG A 1 93  ? 133.993 -7.448  -74.600  1.00 0.00 ? 93  ARG A CZ   2  
ATOM 3613  N NH1  . ARG A 1 93  ? 134.866 -7.997  -73.800  1.00 0.00 ? 93  ARG A NH1  2  
ATOM 3614  N NH2  . ARG A 1 93  ? 133.188 -6.527  -74.147  1.00 0.00 ? 93  ARG A NH2  2  
ATOM 3615  H H    . ARG A 1 93  ? 138.301 -6.108  -75.331  1.00 0.00 ? 93  ARG A H    2  
ATOM 3616  H HA   . ARG A 1 93  ? 139.070 -8.247  -75.913  1.00 0.00 ? 93  ARG A HA   2  
ATOM 3617  H HB2  . ARG A 1 93  ? 136.813 -8.277  -77.928  1.00 0.00 ? 93  ARG A HB2  2  
ATOM 3618  H HB3  . ARG A 1 93  ? 137.591 -9.662  -77.163  1.00 0.00 ? 93  ARG A HB3  2  
ATOM 3619  H HG2  . ARG A 1 93  ? 136.524 -9.320  -75.129  1.00 0.00 ? 93  ARG A HG2  2  
ATOM 3620  H HG3  . ARG A 1 93  ? 136.299 -7.595  -75.418  1.00 0.00 ? 93  ARG A HG3  2  
ATOM 3621  H HD2  . ARG A 1 93  ? 134.853 -8.779  -77.472  1.00 0.00 ? 93  ARG A HD2  2  
ATOM 3622  H HD3  . ARG A 1 93  ? 134.546 -9.840  -76.099  1.00 0.00 ? 93  ARG A HD3  2  
ATOM 3623  H HE   . ARG A 1 93  ? 133.231 -7.431  -76.432  1.00 0.00 ? 93  ARG A HE   2  
ATOM 3624  H HH11 . ARG A 1 93  ? 135.474 -8.714  -74.139  1.00 0.00 ? 93  ARG A HH11 2  
ATOM 3625  H HH12 . ARG A 1 93  ? 134.927 -7.702  -72.847  1.00 0.00 ? 93  ARG A HH12 2  
ATOM 3626  H HH21 . ARG A 1 93  ? 132.509 -6.113  -74.754  1.00 0.00 ? 93  ARG A HH21 2  
ATOM 3627  H HH22 . ARG A 1 93  ? 133.250 -6.233  -73.193  1.00 0.00 ? 93  ARG A HH22 2  
ATOM 3628  N N    . GLU A 1 94  ? 139.591 -8.654  -78.660  1.00 0.00 ? 94  GLU A N    2  
ATOM 3629  C CA   . GLU A 1 94  ? 140.426 -8.546  -79.889  1.00 0.00 ? 94  GLU A CA   2  
ATOM 3630  C C    . GLU A 1 94  ? 139.673 -9.152  -81.075  1.00 0.00 ? 94  GLU A C    2  
ATOM 3631  O O    . GLU A 1 94  ? 139.460 -10.346 -81.141  1.00 0.00 ? 94  GLU A O    2  
ATOM 3632  C CB   . GLU A 1 94  ? 141.742 -9.299  -79.681  1.00 0.00 ? 94  GLU A CB   2  
ATOM 3633  C CG   . GLU A 1 94  ? 142.278 -9.013  -78.277  1.00 0.00 ? 94  GLU A CG   2  
ATOM 3634  C CD   . GLU A 1 94  ? 143.546 -9.834  -78.037  1.00 0.00 ? 94  GLU A CD   2  
ATOM 3635  O OE1  . GLU A 1 94  ? 143.419 -10.998 -77.690  1.00 0.00 ? 94  GLU A OE1  2  
ATOM 3636  O OE2  . GLU A 1 94  ? 144.623 -9.286  -78.204  1.00 0.00 ? 94  GLU A OE2  2  
ATOM 3637  H H    . GLU A 1 94  ? 139.224 -9.523  -78.392  1.00 0.00 ? 94  GLU A H    2  
ATOM 3638  H HA   . GLU A 1 94  ? 140.636 -7.505  -80.091  1.00 0.00 ? 94  GLU A HA   2  
ATOM 3639  H HB2  . GLU A 1 94  ? 141.569 -10.361 -79.793  1.00 0.00 ? 94  GLU A HB2  2  
ATOM 3640  H HB3  . GLU A 1 94  ? 142.464 -8.972  -80.413  1.00 0.00 ? 94  GLU A HB3  2  
ATOM 3641  H HG2  . GLU A 1 94  ? 142.506 -7.961  -78.186  1.00 0.00 ? 94  GLU A HG2  2  
ATOM 3642  H HG3  . GLU A 1 94  ? 141.531 -9.285  -77.545  1.00 0.00 ? 94  GLU A HG3  2  
ATOM 3643  N N    . LYS A 1 95  ? 139.268 -8.339  -82.011  1.00 0.00 ? 95  LYS A N    2  
ATOM 3644  C CA   . LYS A 1 95  ? 138.529 -8.869  -83.193  1.00 0.00 ? 95  LYS A CA   2  
ATOM 3645  C C    . LYS A 1 95  ? 138.900 -8.055  -84.434  1.00 0.00 ? 95  LYS A C    2  
ATOM 3646  O O    . LYS A 1 95  ? 139.483 -6.993  -84.339  1.00 0.00 ? 95  LYS A O    2  
ATOM 3647  C CB   . LYS A 1 95  ? 137.023 -8.761  -82.942  1.00 0.00 ? 95  LYS A CB   2  
ATOM 3648  C CG   . LYS A 1 95  ? 136.602 -9.800  -81.901  1.00 0.00 ? 95  LYS A CG   2  
ATOM 3649  C CD   . LYS A 1 95  ? 136.558 -11.186 -82.549  1.00 0.00 ? 95  LYS A CD   2  
ATOM 3650  C CE   . LYS A 1 95  ? 135.109 -11.667 -82.633  1.00 0.00 ? 95  LYS A CE   2  
ATOM 3651  N NZ   . LYS A 1 95  ? 134.697 -12.233 -81.317  1.00 0.00 ? 95  LYS A NZ   2  
ATOM 3652  H H    . LYS A 1 95  ? 139.451 -7.378  -81.939  1.00 0.00 ? 95  LYS A H    2  
ATOM 3653  H HA   . LYS A 1 95  ? 138.795 -9.905  -83.348  1.00 0.00 ? 95  LYS A HA   2  
ATOM 3654  H HB2  . LYS A 1 95  ? 136.789 -7.770  -82.580  1.00 0.00 ? 95  LYS A HB2  2  
ATOM 3655  H HB3  . LYS A 1 95  ? 136.492 -8.942  -83.864  1.00 0.00 ? 95  LYS A HB3  2  
ATOM 3656  H HG2  . LYS A 1 95  ? 137.314 -9.804  -81.088  1.00 0.00 ? 95  LYS A HG2  2  
ATOM 3657  H HG3  . LYS A 1 95  ? 135.622 -9.552  -81.521  1.00 0.00 ? 95  LYS A HG3  2  
ATOM 3658  H HD2  . LYS A 1 95  ? 136.979 -11.131 -83.544  1.00 0.00 ? 95  LYS A HD2  2  
ATOM 3659  H HD3  . LYS A 1 95  ? 137.133 -11.880 -81.954  1.00 0.00 ? 95  LYS A HD3  2  
ATOM 3660  H HE2  . LYS A 1 95  ? 134.468 -10.835 -82.885  1.00 0.00 ? 95  LYS A HE2  2  
ATOM 3661  H HE3  . LYS A 1 95  ? 135.026 -12.428 -83.395  1.00 0.00 ? 95  LYS A HE3  2  
ATOM 3662  H HZ1  . LYS A 1 95  ? 134.200 -13.133 -81.467  1.00 0.00 ? 95  LYS A HZ1  2  
ATOM 3663  H HZ2  . LYS A 1 95  ? 134.063 -11.561 -80.836  1.00 0.00 ? 95  LYS A HZ2  2  
ATOM 3664  H HZ3  . LYS A 1 95  ? 135.539 -12.397 -80.731  1.00 0.00 ? 95  LYS A HZ3  2  
ATOM 3665  N N    . VAL A 1 96  ? 138.568 -8.543  -85.598  1.00 0.00 ? 96  VAL A N    2  
ATOM 3666  C CA   . VAL A 1 96  ? 138.903 -7.795  -86.842  1.00 0.00 ? 96  VAL A CA   2  
ATOM 3667  C C    . VAL A 1 96  ? 137.971 -8.236  -87.973  1.00 0.00 ? 96  VAL A C    2  
ATOM 3668  O O    . VAL A 1 96  ? 137.304 -9.247  -87.882  1.00 0.00 ? 96  VAL A O    2  
ATOM 3669  C CB   . VAL A 1 96  ? 140.353 -8.083  -87.235  1.00 0.00 ? 96  VAL A CB   2  
ATOM 3670  C CG1  . VAL A 1 96  ? 140.678 -7.372  -88.549  1.00 0.00 ? 96  VAL A CG1  2  
ATOM 3671  C CG2  . VAL A 1 96  ? 141.289 -7.575  -86.136  1.00 0.00 ? 96  VAL A CG2  2  
ATOM 3672  H H    . VAL A 1 96  ? 138.098 -9.402  -85.653  1.00 0.00 ? 96  VAL A H    2  
ATOM 3673  H HA   . VAL A 1 96  ? 138.782 -6.736  -86.669  1.00 0.00 ? 96  VAL A HA   2  
ATOM 3674  H HB   . VAL A 1 96  ? 140.486 -9.148  -87.361  1.00 0.00 ? 96  VAL A HB   2  
ATOM 3675  H HG11 . VAL A 1 96  ? 140.122 -6.447  -88.605  1.00 0.00 ? 96  VAL A HG11 2  
ATOM 3676  H HG12 . VAL A 1 96  ? 140.405 -8.005  -89.379  1.00 0.00 ? 96  VAL A HG12 2  
ATOM 3677  H HG13 . VAL A 1 96  ? 141.736 -7.159  -88.591  1.00 0.00 ? 96  VAL A HG13 2  
ATOM 3678  H HG21 . VAL A 1 96  ? 142.308 -7.596  -86.493  1.00 0.00 ? 96  VAL A HG21 2  
ATOM 3679  H HG22 . VAL A 1 96  ? 141.199 -8.207  -85.266  1.00 0.00 ? 96  VAL A HG22 2  
ATOM 3680  H HG23 . VAL A 1 96  ? 141.020 -6.563  -85.875  1.00 0.00 ? 96  VAL A HG23 2  
ATOM 3681  N N    . GLY A 1 97  ? 137.919 -7.483  -89.039  1.00 0.00 ? 97  GLY A N    2  
ATOM 3682  C CA   . GLY A 1 97  ? 137.029 -7.858  -90.174  1.00 0.00 ? 97  GLY A CA   2  
ATOM 3683  C C    . GLY A 1 97  ? 135.588 -7.986  -89.677  1.00 0.00 ? 97  GLY A C    2  
ATOM 3684  O O    . GLY A 1 97  ? 135.015 -9.060  -89.674  1.00 0.00 ? 97  GLY A O    2  
ATOM 3685  H H    . GLY A 1 97  ? 138.465 -6.671  -89.091  1.00 0.00 ? 97  GLY A H    2  
ATOM 3686  H HA2  . GLY A 1 97  ? 137.083 -7.098  -90.937  1.00 0.00 ? 97  GLY A HA2  2  
ATOM 3687  H HA3  . GLY A 1 97  ? 137.349 -8.802  -90.587  1.00 0.00 ? 97  GLY A HA3  2  
ATOM 3688  N N    . ARG A 1 98  ? 134.996 -6.902  -89.255  1.00 0.00 ? 98  ARG A N    2  
ATOM 3689  C CA   . ARG A 1 98  ? 133.594 -6.975  -88.759  1.00 0.00 ? 98  ARG A CA   2  
ATOM 3690  C C    . ARG A 1 98  ? 132.768 -5.831  -89.353  1.00 0.00 ? 98  ARG A C    2  
ATOM 3691  O O    . ARG A 1 98  ? 133.000 -4.670  -89.081  1.00 0.00 ? 98  ARG A O    2  
ATOM 3692  C CB   . ARG A 1 98  ? 133.585 -6.876  -87.232  1.00 0.00 ? 98  ARG A CB   2  
ATOM 3693  C CG   . ARG A 1 98  ? 132.783 -8.041  -86.650  1.00 0.00 ? 98  ARG A CG   2  
ATOM 3694  C CD   . ARG A 1 98  ? 132.533 -7.795  -85.161  1.00 0.00 ? 98  ARG A CD   2  
ATOM 3695  N NE   . ARG A 1 98  ? 131.590 -8.825  -84.639  1.00 0.00 ? 98  ARG A NE   2  
ATOM 3696  C CZ   . ARG A 1 98  ? 131.461 -8.997  -83.352  1.00 0.00 ? 98  ARG A CZ   2  
ATOM 3697  N NH1  . ARG A 1 98  ? 132.153 -8.266  -82.522  1.00 0.00 ? 98  ARG A NH1  2  
ATOM 3698  N NH2  . ARG A 1 98  ? 130.637 -9.902  -82.895  1.00 0.00 ? 98  ARG A NH2  2  
ATOM 3699  H H    . ARG A 1 98  ? 135.471 -6.044  -89.264  1.00 0.00 ? 98  ARG A H    2  
ATOM 3700  H HA   . ARG A 1 98  ? 133.163 -7.916  -89.061  1.00 0.00 ? 98  ARG A HA   2  
ATOM 3701  H HB2  . ARG A 1 98  ? 134.600 -6.916  -86.864  1.00 0.00 ? 98  ARG A HB2  2  
ATOM 3702  H HB3  . ARG A 1 98  ? 133.130 -5.944  -86.934  1.00 0.00 ? 98  ARG A HB3  2  
ATOM 3703  H HG2  . ARG A 1 98  ? 131.837 -8.121  -87.167  1.00 0.00 ? 98  ARG A HG2  2  
ATOM 3704  H HG3  . ARG A 1 98  ? 133.339 -8.958  -86.772  1.00 0.00 ? 98  ARG A HG3  2  
ATOM 3705  H HD2  . ARG A 1 98  ? 133.467 -7.857  -84.624  1.00 0.00 ? 98  ARG A HD2  2  
ATOM 3706  H HD3  . ARG A 1 98  ? 132.104 -6.813  -85.026  1.00 0.00 ? 98  ARG A HD3  2  
ATOM 3707  H HE   . ARG A 1 98  ? 131.069 -9.373  -85.262  1.00 0.00 ? 98  ARG A HE   2  
ATOM 3708  H HH11 . ARG A 1 98  ? 132.783 -7.574  -82.873  1.00 0.00 ? 98  ARG A HH11 2  
ATOM 3709  H HH12 . ARG A 1 98  ? 132.053 -8.399  -81.536  1.00 0.00 ? 98  ARG A HH12 2  
ATOM 3710  H HH21 . ARG A 1 98  ? 130.106 -10.461 -83.531  1.00 0.00 ? 98  ARG A HH21 2  
ATOM 3711  H HH22 . ARG A 1 98  ? 130.538 -10.034 -81.908  1.00 0.00 ? 98  ARG A HH22 2  
ATOM 3712  N N    . ILE A 1 99  ? 131.803 -6.159  -90.162  1.00 0.00 ? 99  ILE A N    2  
ATOM 3713  C CA   . ILE A 1 99  ? 130.946 -5.114  -90.789  1.00 0.00 ? 99  ILE A CA   2  
ATOM 3714  C C    . ILE A 1 99  ? 129.566 -5.146  -90.136  1.00 0.00 ? 99  ILE A C    2  
ATOM 3715  O O    . ILE A 1 99  ? 129.363 -5.802  -89.135  1.00 0.00 ? 99  ILE A O    2  
ATOM 3716  C CB   . ILE A 1 99  ? 130.802 -5.413  -92.285  1.00 0.00 ? 99  ILE A CB   2  
ATOM 3717  C CG1  . ILE A 1 99  ? 131.023 -6.910  -92.525  1.00 0.00 ? 99  ILE A CG1  2  
ATOM 3718  C CG2  . ILE A 1 99  ? 131.839 -4.616  -93.078  1.00 0.00 ? 99  ILE A CG2  2  
ATOM 3719  C CD1  . ILE A 1 99  ? 130.039 -7.410  -93.579  1.00 0.00 ? 99  ILE A CD1  2  
ATOM 3720  H H    . ILE A 1 99  ? 131.639 -7.100  -90.363  1.00 0.00 ? 99  ILE A H    2  
ATOM 3721  H HA   . ILE A 1 99  ? 131.393 -4.143  -90.651  1.00 0.00 ? 99  ILE A HA   2  
ATOM 3722  H HB   . ILE A 1 99  ? 129.810 -5.138  -92.612  1.00 0.00 ? 99  ILE A HB   2  
ATOM 3723  H HG12 . ILE A 1 99  ? 132.032 -7.074  -92.867  1.00 0.00 ? 99  ILE A HG12 2  
ATOM 3724  H HG13 . ILE A 1 99  ? 130.860 -7.450  -91.606  1.00 0.00 ? 99  ILE A HG13 2  
ATOM 3725  H HG21 . ILE A 1 99  ? 132.802 -5.097  -92.998  1.00 0.00 ? 99  ILE A HG21 2  
ATOM 3726  H HG22 . ILE A 1 99  ? 131.902 -3.614  -92.683  1.00 0.00 ? 99  ILE A HG22 2  
ATOM 3727  H HG23 . ILE A 1 99  ? 131.542 -4.574  -94.115  1.00 0.00 ? 99  ILE A HG23 2  
ATOM 3728  H HD11 . ILE A 1 99  ? 129.053 -7.467  -93.145  1.00 0.00 ? 99  ILE A HD11 2  
ATOM 3729  H HD12 . ILE A 1 99  ? 130.341 -8.390  -93.916  1.00 0.00 ? 99  ILE A HD12 2  
ATOM 3730  H HD13 . ILE A 1 99  ? 130.030 -6.727  -94.415  1.00 0.00 ? 99  ILE A HD13 2  
ATOM 3731  N N    . THR A 1 100 ? 128.611 -4.453  -90.693  1.00 0.00 ? 100 THR A N    2  
ATOM 3732  C CA   . THR A 1 100 ? 127.252 -4.470  -90.088  1.00 0.00 ? 100 THR A CA   2  
ATOM 3733  C C    . THR A 1 100 ? 126.220 -4.737  -91.179  1.00 0.00 ? 100 THR A C    2  
ATOM 3734  O O    . THR A 1 100 ? 126.475 -4.548  -92.351  1.00 0.00 ? 100 THR A O    2  
ATOM 3735  C CB   . THR A 1 100 ? 126.952 -3.127  -89.421  1.00 0.00 ? 100 THR A CB   2  
ATOM 3736  O OG1  . THR A 1 100 ? 126.212 -2.310  -90.316  1.00 0.00 ? 100 THR A OG1  2  
ATOM 3737  C CG2  . THR A 1 100 ? 128.257 -2.421  -89.066  1.00 0.00 ? 100 THR A CG2  2  
ATOM 3738  H H    . THR A 1 100 ? 128.786 -3.933  -91.505  1.00 0.00 ? 100 THR A H    2  
ATOM 3739  H HA   . THR A 1 100 ? 127.199 -5.257  -89.353  1.00 0.00 ? 100 THR A HA   2  
ATOM 3740  H HB   . THR A 1 100 ? 126.386 -3.296  -88.518  1.00 0.00 ? 100 THR A HB   2  
ATOM 3741  H HG1  . THR A 1 100 ? 125.347 -2.154  -89.931  1.00 0.00 ? 100 THR A HG1  2  
ATOM 3742  H HG21 . THR A 1 100 ? 128.519 -1.737  -89.859  1.00 0.00 ? 100 THR A HG21 2  
ATOM 3743  H HG22 . THR A 1 100 ? 129.041 -3.151  -88.946  1.00 0.00 ? 100 THR A HG22 2  
ATOM 3744  H HG23 . THR A 1 100 ? 128.129 -1.872  -88.147  1.00 0.00 ? 100 THR A HG23 2  
ATOM 3745  N N    . TRP A 1 101 ? 125.061 -5.189  -90.800  1.00 0.00 ? 101 TRP A N    2  
ATOM 3746  C CA   . TRP A 1 101 ? 124.011 -5.494  -91.806  1.00 0.00 ? 101 TRP A CA   2  
ATOM 3747  C C    . TRP A 1 101 ? 123.805 -4.310  -92.756  1.00 0.00 ? 101 TRP A C    2  
ATOM 3748  O O    . TRP A 1 101 ? 124.113 -4.391  -93.928  1.00 0.00 ? 101 TRP A O    2  
ATOM 3749  C CB   . TRP A 1 101 ? 122.695 -5.807  -91.092  1.00 0.00 ? 101 TRP A CB   2  
ATOM 3750  C CG   . TRP A 1 101 ? 121.756 -6.469  -92.048  1.00 0.00 ? 101 TRP A CG   2  
ATOM 3751  C CD1  . TRP A 1 101 ? 120.490 -6.063  -92.299  1.00 0.00 ? 101 TRP A CD1  2  
ATOM 3752  C CD2  . TRP A 1 101 ? 121.985 -7.639  -92.886  1.00 0.00 ? 101 TRP A CD2  2  
ATOM 3753  N NE1  . TRP A 1 101 ? 119.928 -6.909  -93.239  1.00 0.00 ? 101 TRP A NE1  2  
ATOM 3754  C CE2  . TRP A 1 101 ? 120.810 -7.897  -93.631  1.00 0.00 ? 101 TRP A CE2  2  
ATOM 3755  C CE3  . TRP A 1 101 ? 123.087 -8.495  -93.070  1.00 0.00 ? 101 TRP A CE3  2  
ATOM 3756  C CZ2  . TRP A 1 101 ? 120.731 -8.964  -94.527  1.00 0.00 ? 101 TRP A CZ2  2  
ATOM 3757  C CZ3  . TRP A 1 101 ? 123.012 -9.568  -93.970  1.00 0.00 ? 101 TRP A CZ3  2  
ATOM 3758  C CH2  . TRP A 1 101 ? 121.836 -9.802  -94.698  1.00 0.00 ? 101 TRP A CH2  2  
ATOM 3759  H H    . TRP A 1 101 ? 124.885 -5.344  -89.848  1.00 0.00 ? 101 TRP A H    2  
ATOM 3760  H HA   . TRP A 1 101 ? 124.313 -6.353  -92.380  1.00 0.00 ? 101 TRP A HA   2  
ATOM 3761  H HB2  . TRP A 1 101 ? 122.887 -6.468  -90.259  1.00 0.00 ? 101 TRP A HB2  2  
ATOM 3762  H HB3  . TRP A 1 101 ? 122.254 -4.891  -90.729  1.00 0.00 ? 101 TRP A HB3  2  
ATOM 3763  H HD1  . TRP A 1 101 ? 119.999 -5.217  -91.842  1.00 0.00 ? 101 TRP A HD1  2  
ATOM 3764  H HE1  . TRP A 1 101 ? 119.018 -6.835  -93.594  1.00 0.00 ? 101 TRP A HE1  2  
ATOM 3765  H HE3  . TRP A 1 101 ? 123.997 -8.328  -92.514  1.00 0.00 ? 101 TRP A HE3  2  
ATOM 3766  H HZ2  . TRP A 1 101 ? 119.823 -9.140  -95.085  1.00 0.00 ? 101 TRP A HZ2  2  
ATOM 3767  H HZ3  . TRP A 1 101 ? 123.865 -10.214 -94.104  1.00 0.00 ? 101 TRP A HZ3  2  
ATOM 3768  H HH2  . TRP A 1 101 ? 121.785 -10.631 -95.389  1.00 0.00 ? 101 TRP A HH2  2  
ATOM 3769  N N    . GLU A 1 102 ? 123.272 -3.221  -92.283  1.00 0.00 ? 102 GLU A N    2  
ATOM 3770  C CA   . GLU A 1 102 ? 123.025 -2.061  -93.189  1.00 0.00 ? 102 GLU A CA   2  
ATOM 3771  C C    . GLU A 1 102 ? 124.289 -1.716  -93.965  1.00 0.00 ? 102 GLU A C    2  
ATOM 3772  O O    . GLU A 1 102 ? 124.254 -1.490  -95.161  1.00 0.00 ? 102 GLU A O    2  
ATOM 3773  C CB   . GLU A 1 102 ? 122.592 -0.852  -92.357  1.00 0.00 ? 102 GLU A CB   2  
ATOM 3774  C CG   . GLU A 1 102 ? 122.938 0.437   -93.104  1.00 0.00 ? 102 GLU A CG   2  
ATOM 3775  C CD   . GLU A 1 102 ? 122.591 0.279   -94.586  1.00 0.00 ? 102 GLU A CD   2  
ATOM 3776  O OE1  . GLU A 1 102 ? 121.504 -0.196  -94.872  1.00 0.00 ? 102 GLU A OE1  2  
ATOM 3777  O OE2  . GLU A 1 102 ? 123.418 0.634   -95.410  1.00 0.00 ? 102 GLU A OE2  2  
ATOM 3778  H H    . GLU A 1 102 ? 123.010 -3.147  -91.345  1.00 0.00 ? 102 GLU A H    2  
ATOM 3779  H HA   . GLU A 1 102 ? 122.241 -2.319  -93.883  1.00 0.00 ? 102 GLU A HA   2  
ATOM 3780  H HB2  . GLU A 1 102 ? 121.526 -0.896  -92.187  1.00 0.00 ? 102 GLU A HB2  2  
ATOM 3781  H HB3  . GLU A 1 102 ? 123.108 -0.864  -91.408  1.00 0.00 ? 102 GLU A HB3  2  
ATOM 3782  H HG2  . GLU A 1 102 ? 122.372 1.258   -92.687  1.00 0.00 ? 102 GLU A HG2  2  
ATOM 3783  H HG3  . GLU A 1 102 ? 123.996 0.640   -93.003  1.00 0.00 ? 102 GLU A HG3  2  
ATOM 3784  N N    . GLN A 1 103 ? 125.402 -1.658  -93.302  1.00 0.00 ? 103 GLN A N    2  
ATOM 3785  C CA   . GLN A 1 103 ? 126.657 -1.312  -94.010  1.00 0.00 ? 103 GLN A CA   2  
ATOM 3786  C C    . GLN A 1 103 ? 126.813 -2.195  -95.247  1.00 0.00 ? 103 GLN A C    2  
ATOM 3787  O O    . GLN A 1 103 ? 127.114 -1.712  -96.326  1.00 0.00 ? 103 GLN A O    2  
ATOM 3788  C CB   . GLN A 1 103 ? 127.849 -1.520  -93.073  1.00 0.00 ? 103 GLN A CB   2  
ATOM 3789  C CG   . GLN A 1 103 ? 128.602 -0.197  -92.906  1.00 0.00 ? 103 GLN A CG   2  
ATOM 3790  C CD   . GLN A 1 103 ? 129.293 -0.171  -91.543  1.00 0.00 ? 103 GLN A CD   2  
ATOM 3791  O OE1  . GLN A 1 103 ? 130.286 -0.840  -91.338  1.00 0.00 ? 103 GLN A OE1  2  
ATOM 3792  N NE2  . GLN A 1 103 ? 128.805 0.578   -90.595  1.00 0.00 ? 103 GLN A NE2  2  
ATOM 3793  H H    . GLN A 1 103 ? 125.411 -1.833  -92.338  1.00 0.00 ? 103 GLN A H    2  
ATOM 3794  H HA   . GLN A 1 103 ? 126.617 -0.279  -94.316  1.00 0.00 ? 103 GLN A HA   2  
ATOM 3795  H HB2  . GLN A 1 103 ? 127.495 -1.858  -92.110  1.00 0.00 ? 103 GLN A HB2  2  
ATOM 3796  H HB3  . GLN A 1 103 ? 128.514 -2.259  -93.493  1.00 0.00 ? 103 GLN A HB3  2  
ATOM 3797  H HG2  . GLN A 1 103 ? 129.340 -0.102  -93.687  1.00 0.00 ? 103 GLN A HG2  2  
ATOM 3798  H HG3  . GLN A 1 103 ? 127.905 0.626   -92.966  1.00 0.00 ? 103 GLN A HG3  2  
ATOM 3799  H HE21 . GLN A 1 103 ? 128.003 1.118   -90.760  1.00 0.00 ? 103 GLN A HE21 2  
ATOM 3800  H HE22 . GLN A 1 103 ? 129.239 0.602   -89.720  1.00 0.00 ? 103 GLN A HE22 2  
ATOM 3801  N N    . VAL A 1 104 ? 126.628 -3.486  -95.122  1.00 0.00 ? 104 VAL A N    2  
ATOM 3802  C CA   . VAL A 1 104 ? 126.802 -4.339  -96.326  1.00 0.00 ? 104 VAL A CA   2  
ATOM 3803  C C    . VAL A 1 104 ? 125.640 -4.062  -97.269  1.00 0.00 ? 104 VAL A C    2  
ATOM 3804  O O    . VAL A 1 104 ? 125.741 -4.251  -98.464  1.00 0.00 ? 104 VAL A O    2  
ATOM 3805  C CB   . VAL A 1 104 ? 126.783 -5.825  -95.971  1.00 0.00 ? 104 VAL A CB   2  
ATOM 3806  C CG1  . VAL A 1 104 ? 127.576 -6.082  -94.698  1.00 0.00 ? 104 VAL A CG1  2  
ATOM 3807  C CG2  . VAL A 1 104 ? 125.344 -6.295  -95.796  1.00 0.00 ? 104 VAL A CG2  2  
ATOM 3808  H H    . VAL A 1 104 ? 126.395 -3.879  -94.255  1.00 0.00 ? 104 VAL A H    2  
ATOM 3809  H HA   . VAL A 1 104 ? 127.730 -4.063  -96.801  1.00 0.00 ? 104 VAL A HA   2  
ATOM 3810  H HB   . VAL A 1 104 ? 127.235 -6.380  -96.780  1.00 0.00 ? 104 VAL A HB   2  
ATOM 3811  H HG11 . VAL A 1 104 ? 126.923 -5.976  -93.843  1.00 0.00 ? 104 VAL A HG11 2  
ATOM 3812  H HG12 . VAL A 1 104 ? 128.384 -5.372  -94.623  1.00 0.00 ? 104 VAL A HG12 2  
ATOM 3813  H HG13 . VAL A 1 104 ? 127.968 -7.084  -94.726  1.00 0.00 ? 104 VAL A HG13 2  
ATOM 3814  H HG21 . VAL A 1 104 ? 125.297 -7.014  -94.993  1.00 0.00 ? 104 VAL A HG21 2  
ATOM 3815  H HG22 . VAL A 1 104 ? 125.006 -6.755  -96.713  1.00 0.00 ? 104 VAL A HG22 2  
ATOM 3816  H HG23 . VAL A 1 104 ? 124.716 -5.452  -95.565  1.00 0.00 ? 104 VAL A HG23 2  
ATOM 3817  N N    . LEU A 1 105 ? 124.536 -3.594  -96.746  1.00 0.00 ? 105 LEU A N    2  
ATOM 3818  C CA   . LEU A 1 105 ? 123.385 -3.289  -97.632  1.00 0.00 ? 105 LEU A CA   2  
ATOM 3819  C C    . LEU A 1 105 ? 123.775 -2.118  -98.522  1.00 0.00 ? 105 LEU A C    2  
ATOM 3820  O O    . LEU A 1 105 ? 123.998 -2.282  -99.705  1.00 0.00 ? 105 LEU A O    2  
ATOM 3821  C CB   . LEU A 1 105 ? 122.159 -2.916  -96.792  1.00 0.00 ? 105 LEU A CB   2  
ATOM 3822  C CG   . LEU A 1 105 ? 121.760 -4.087  -95.888  1.00 0.00 ? 105 LEU A CG   2  
ATOM 3823  C CD1  . LEU A 1 105 ? 120.322 -3.894  -95.409  1.00 0.00 ? 105 LEU A CD1  2  
ATOM 3824  C CD2  . LEU A 1 105 ? 121.862 -5.405  -96.662  1.00 0.00 ? 105 LEU A CD2  2  
ATOM 3825  H H    . LEU A 1 105 ? 124.467 -3.418  -95.782  1.00 0.00 ? 105 LEU A H    2  
ATOM 3826  H HA   . LEU A 1 105 ? 123.161 -4.149  -98.245  1.00 0.00 ? 105 LEU A HA   2  
ATOM 3827  H HB2  . LEU A 1 105 ? 122.392 -2.055  -96.181  1.00 0.00 ? 105 LEU A HB2  2  
ATOM 3828  H HB3  . LEU A 1 105 ? 121.337 -2.674  -97.449  1.00 0.00 ? 105 LEU A HB3  2  
ATOM 3829  H HG   . LEU A 1 105 ? 122.417 -4.120  -95.035  1.00 0.00 ? 105 LEU A HG   2  
ATOM 3830  H HD11 . LEU A 1 105 ? 120.274 -4.051  -94.341  1.00 0.00 ? 105 LEU A HD11 2  
ATOM 3831  H HD12 . LEU A 1 105 ? 119.677 -4.603  -95.907  1.00 0.00 ? 105 LEU A HD12 2  
ATOM 3832  H HD13 . LEU A 1 105 ? 119.997 -2.889  -95.639  1.00 0.00 ? 105 LEU A HD13 2  
ATOM 3833  H HD21 . LEU A 1 105 ? 121.330 -6.178  -96.127  1.00 0.00 ? 105 LEU A HD21 2  
ATOM 3834  H HD22 . LEU A 1 105 ? 122.899 -5.686  -96.760  1.00 0.00 ? 105 LEU A HD22 2  
ATOM 3835  H HD23 . LEU A 1 105 ? 121.427 -5.283  -97.642  1.00 0.00 ? 105 LEU A HD23 2  
ATOM 3836  N N    . GLU A 1 106 ? 123.876 -0.934  -97.978  1.00 0.00 ? 106 GLU A N    2  
ATOM 3837  C CA   . GLU A 1 106 ? 124.269 0.219   -98.827  1.00 0.00 ? 106 GLU A CA   2  
ATOM 3838  C C    . GLU A 1 106 ? 125.421 -0.218  -99.729  1.00 0.00 ? 106 GLU A C    2  
ATOM 3839  O O    . GLU A 1 106 ? 125.440 0.069   -100.908 1.00 0.00 ? 106 GLU A O    2  
ATOM 3840  C CB   . GLU A 1 106 ? 124.723 1.380   -97.940  1.00 0.00 ? 106 GLU A CB   2  
ATOM 3841  C CG   . GLU A 1 106 ? 125.235 2.523   -98.817  1.00 0.00 ? 106 GLU A CG   2  
ATOM 3842  C CD   . GLU A 1 106 ? 126.623 2.172   -99.356  1.00 0.00 ? 106 GLU A CD   2  
ATOM 3843  O OE1  . GLU A 1 106 ? 127.466 1.789   -98.561  1.00 0.00 ? 106 GLU A OE1  2  
ATOM 3844  O OE2  . GLU A 1 106 ? 126.820 2.292   -100.554 1.00 0.00 ? 106 GLU A OE2  2  
ATOM 3845  H H    . GLU A 1 106 ? 123.685 -0.789  -97.027  1.00 0.00 ? 106 GLU A H    2  
ATOM 3846  H HA   . GLU A 1 106 ? 123.430 0.529   -99.431  1.00 0.00 ? 106 GLU A HA   2  
ATOM 3847  H HB2  . GLU A 1 106 ? 123.888 1.726   -97.346  1.00 0.00 ? 106 GLU A HB2  2  
ATOM 3848  H HB3  . GLU A 1 106 ? 125.515 1.046   -97.287  1.00 0.00 ? 106 GLU A HB3  2  
ATOM 3849  H HG2  . GLU A 1 106 ? 124.555 2.676   -99.643  1.00 0.00 ? 106 GLU A HG2  2  
ATOM 3850  H HG3  . GLU A 1 106 ? 125.297 3.428   -98.231  1.00 0.00 ? 106 GLU A HG3  2  
ATOM 3851  N N    . ILE A 1 107 ? 126.376 -0.935  -99.194  1.00 0.00 ? 107 ILE A N    2  
ATOM 3852  C CA   . ILE A 1 107 ? 127.500 -1.404  -100.050 1.00 0.00 ? 107 ILE A CA   2  
ATOM 3853  C C    . ILE A 1 107 ? 126.933 -2.337  -101.121 1.00 0.00 ? 107 ILE A C    2  
ATOM 3854  O O    . ILE A 1 107 ? 127.434 -2.412  -102.225 1.00 0.00 ? 107 ILE A O    2  
ATOM 3855  C CB   . ILE A 1 107 ? 128.519 -2.168  -99.208  1.00 0.00 ? 107 ILE A CB   2  
ATOM 3856  C CG1  . ILE A 1 107 ? 129.337 -1.179  -98.373  1.00 0.00 ? 107 ILE A CG1  2  
ATOM 3857  C CG2  . ILE A 1 107 ? 129.450 -2.945  -100.138 1.00 0.00 ? 107 ILE A CG2  2  
ATOM 3858  C CD1  . ILE A 1 107 ? 130.082 -1.934  -97.271  1.00 0.00 ? 107 ILE A CD1  2  
ATOM 3859  H H    . ILE A 1 107 ? 126.344 -1.179  -98.241  1.00 0.00 ? 107 ILE A H    2  
ATOM 3860  H HA   . ILE A 1 107 ? 127.981 -0.558  -100.521 1.00 0.00 ? 107 ILE A HA   2  
ATOM 3861  H HB   . ILE A 1 107 ? 128.003 -2.855  -98.555  1.00 0.00 ? 107 ILE A HB   2  
ATOM 3862  H HG12 . ILE A 1 107 ? 130.049 -0.674  -99.011  1.00 0.00 ? 107 ILE A HG12 2  
ATOM 3863  H HG13 . ILE A 1 107 ? 128.676 -0.452  -97.926  1.00 0.00 ? 107 ILE A HG13 2  
ATOM 3864  H HG21 . ILE A 1 107 ? 128.890 -3.719  -100.643 1.00 0.00 ? 107 ILE A HG21 2  
ATOM 3865  H HG22 . ILE A 1 107 ? 130.244 -3.393  -99.562  1.00 0.00 ? 107 ILE A HG22 2  
ATOM 3866  H HG23 . ILE A 1 107 ? 129.870 -2.271  -100.871 1.00 0.00 ? 107 ILE A HG23 2  
ATOM 3867  H HD11 . ILE A 1 107 ? 130.433 -2.879  -97.657  1.00 0.00 ? 107 ILE A HD11 2  
ATOM 3868  H HD12 . ILE A 1 107 ? 129.415 -2.110  -96.441  1.00 0.00 ? 107 ILE A HD12 2  
ATOM 3869  H HD13 . ILE A 1 107 ? 130.924 -1.346  -96.939  1.00 0.00 ? 107 ILE A HD13 2  
ATOM 3870  N N    . ALA A 1 108 ? 125.881 -3.046  -100.798 1.00 0.00 ? 108 ALA A N    2  
ATOM 3871  C CA   . ALA A 1 108 ? 125.270 -3.973  -101.794 1.00 0.00 ? 108 ALA A CA   2  
ATOM 3872  C C    . ALA A 1 108 ? 124.129 -3.260  -102.521 1.00 0.00 ? 108 ALA A C    2  
ATOM 3873  O O    . ALA A 1 108 ? 123.831 -3.565  -103.658 1.00 0.00 ? 108 ALA A O    2  
ATOM 3874  C CB   . ALA A 1 108 ? 124.715 -5.206  -101.077 1.00 0.00 ? 108 ALA A CB   2  
ATOM 3875  H H    . ALA A 1 108 ? 125.492 -2.965  -99.901  1.00 0.00 ? 108 ALA A H    2  
ATOM 3876  H HA   . ALA A 1 108 ? 126.018 -4.278  -102.511 1.00 0.00 ? 108 ALA A HA   2  
ATOM 3877  H HB1  . ALA A 1 108 ? 124.697 -6.041  -101.761 1.00 0.00 ? 108 ALA A HB1  2  
ATOM 3878  H HB2  . ALA A 1 108 ? 123.714 -5.000  -100.734 1.00 0.00 ? 108 ALA A HB2  2  
ATOM 3879  H HB3  . ALA A 1 108 ? 125.340 -5.447  -100.232 1.00 0.00 ? 108 ALA A HB3  2  
ATOM 3880  N N    . LYS A 1 109 ? 123.500 -2.300  -101.899 1.00 0.00 ? 109 LYS A N    2  
ATOM 3881  C CA   . LYS A 1 109 ? 122.402 -1.574  -102.599 1.00 0.00 ? 109 LYS A CA   2  
ATOM 3882  C C    . LYS A 1 109 ? 122.969 -0.984  -103.888 1.00 0.00 ? 109 LYS A C    2  
ATOM 3883  O O    . LYS A 1 109 ? 122.708 -1.466  -104.972 1.00 0.00 ? 109 LYS A O    2  
ATOM 3884  C CB   . LYS A 1 109 ? 121.869 -0.449  -101.712 1.00 0.00 ? 109 LYS A CB   2  
ATOM 3885  C CG   . LYS A 1 109 ? 121.095 -1.045  -100.532 1.00 0.00 ? 109 LYS A CG   2  
ATOM 3886  C CD   . LYS A 1 109 ? 119.657 -1.355  -100.959 1.00 0.00 ? 109 LYS A CD   2  
ATOM 3887  C CE   . LYS A 1 109 ? 118.694 -0.941  -99.846  1.00 0.00 ? 109 LYS A CE   2  
ATOM 3888  N NZ   . LYS A 1 109 ? 117.347 -1.522  -100.113 1.00 0.00 ? 109 LYS A NZ   2  
ATOM 3889  H H    . LYS A 1 109 ? 123.756 -2.044  -100.988 1.00 0.00 ? 109 LYS A H    2  
ATOM 3890  H HA   . LYS A 1 109 ? 121.605 -2.262  -102.840 1.00 0.00 ? 109 LYS A HA   2  
ATOM 3891  H HB2  . LYS A 1 109 ? 122.697 0.137   -101.341 1.00 0.00 ? 109 LYS A HB2  2  
ATOM 3892  H HB3  . LYS A 1 109 ? 121.213 0.184   -102.289 1.00 0.00 ? 109 LYS A HB3  2  
ATOM 3893  H HG2  . LYS A 1 109 ? 121.578 -1.956  -100.210 1.00 0.00 ? 109 LYS A HG2  2  
ATOM 3894  H HG3  . LYS A 1 109 ? 121.080 -0.337  -99.717  1.00 0.00 ? 109 LYS A HG3  2  
ATOM 3895  H HD2  . LYS A 1 109 ? 119.421 -0.810  -101.861 1.00 0.00 ? 109 LYS A HD2  2  
ATOM 3896  H HD3  . LYS A 1 109 ? 119.557 -2.414  -101.142 1.00 0.00 ? 109 LYS A HD3  2  
ATOM 3897  H HE2  . LYS A 1 109 ? 119.061 -1.304  -98.898  1.00 0.00 ? 109 LYS A HE2  2  
ATOM 3898  H HE3  . LYS A 1 109 ? 118.621 0.137   -99.815  1.00 0.00 ? 109 LYS A HE3  2  
ATOM 3899  H HZ1  . LYS A 1 109 ? 116.901 -1.793  -99.214  1.00 0.00 ? 109 LYS A HZ1  2  
ATOM 3900  H HZ2  . LYS A 1 109 ? 117.447 -2.363  -100.718 1.00 0.00 ? 109 LYS A HZ2  2  
ATOM 3901  H HZ3  . LYS A 1 109 ? 116.753 -0.817  -100.592 1.00 0.00 ? 109 LYS A HZ3  2  
ATOM 3902  N N    . GLN A 1 110 ? 123.754 0.052   -103.785 1.00 0.00 ? 110 GLN A N    2  
ATOM 3903  C CA   . GLN A 1 110 ? 124.341 0.653   -105.011 1.00 0.00 ? 110 GLN A CA   2  
ATOM 3904  C C    . GLN A 1 110 ? 124.863 -0.470  -105.908 1.00 0.00 ? 110 GLN A C    2  
ATOM 3905  O O    . GLN A 1 110 ? 124.971 -0.319  -107.109 1.00 0.00 ? 110 GLN A O    2  
ATOM 3906  C CB   . GLN A 1 110 ? 125.494 1.582   -104.625 1.00 0.00 ? 110 GLN A CB   2  
ATOM 3907  C CG   . GLN A 1 110 ? 124.947 2.778   -103.845 1.00 0.00 ? 110 GLN A CG   2  
ATOM 3908  C CD   . GLN A 1 110 ? 126.095 3.722   -103.485 1.00 0.00 ? 110 GLN A CD   2  
ATOM 3909  O OE1  . GLN A 1 110 ? 126.975 3.963   -104.289 1.00 0.00 ? 110 GLN A OE1  2  
ATOM 3910  N NE2  . GLN A 1 110 ? 126.126 4.271   -102.301 1.00 0.00 ? 110 GLN A NE2  2  
ATOM 3911  H H    . GLN A 1 110 ? 123.960 0.430   -102.903 1.00 0.00 ? 110 GLN A H    2  
ATOM 3912  H HA   . GLN A 1 110 ? 123.583 1.215   -105.537 1.00 0.00 ? 110 GLN A HA   2  
ATOM 3913  H HB2  . GLN A 1 110 ? 126.201 1.042   -104.011 1.00 0.00 ? 110 GLN A HB2  2  
ATOM 3914  H HB3  . GLN A 1 110 ? 125.988 1.933   -105.519 1.00 0.00 ? 110 GLN A HB3  2  
ATOM 3915  H HG2  . GLN A 1 110 ? 124.225 3.304   -104.452 1.00 0.00 ? 110 GLN A HG2  2  
ATOM 3916  H HG3  . GLN A 1 110 ? 124.472 2.431   -102.940 1.00 0.00 ? 110 GLN A HG3  2  
ATOM 3917  H HE21 . GLN A 1 110 ? 125.418 4.077   -101.652 1.00 0.00 ? 110 GLN A HE21 2  
ATOM 3918  H HE22 . GLN A 1 110 ? 126.858 4.877   -102.061 1.00 0.00 ? 110 GLN A HE22 2  
ATOM 3919  N N    . LYS A 1 111 ? 125.189 -1.599  -105.333 1.00 0.00 ? 111 LYS A N    2  
ATOM 3920  C CA   . LYS A 1 111 ? 125.702 -2.734  -106.150 1.00 0.00 ? 111 LYS A CA   2  
ATOM 3921  C C    . LYS A 1 111 ? 124.541 -3.418  -106.881 1.00 0.00 ? 111 LYS A C    2  
ATOM 3922  O O    . LYS A 1 111 ? 124.745 -4.271  -107.721 1.00 0.00 ? 111 LYS A O    2  
ATOM 3923  C CB   . LYS A 1 111 ? 126.395 -3.746  -105.236 1.00 0.00 ? 111 LYS A CB   2  
ATOM 3924  C CG   . LYS A 1 111 ? 127.316 -4.641  -106.069 1.00 0.00 ? 111 LYS A CG   2  
ATOM 3925  C CD   . LYS A 1 111 ? 128.732 -4.061  -106.066 1.00 0.00 ? 111 LYS A CD   2  
ATOM 3926  C CE   . LYS A 1 111 ? 129.709 -5.097  -106.626 1.00 0.00 ? 111 LYS A CE   2  
ATOM 3927  N NZ   . LYS A 1 111 ? 131.090 -4.537  -106.609 1.00 0.00 ? 111 LYS A NZ   2  
ATOM 3928  H H    . LYS A 1 111 ? 125.097 -1.699  -104.360 1.00 0.00 ? 111 LYS A H    2  
ATOM 3929  H HA   . LYS A 1 111 ? 126.412 -2.361  -106.875 1.00 0.00 ? 111 LYS A HA   2  
ATOM 3930  H HB2  . LYS A 1 111 ? 126.978 -3.221  -104.493 1.00 0.00 ? 111 LYS A HB2  2  
ATOM 3931  H HB3  . LYS A 1 111 ? 125.652 -4.357  -104.745 1.00 0.00 ? 111 LYS A HB3  2  
ATOM 3932  H HG2  . LYS A 1 111 ? 127.332 -5.635  -105.645 1.00 0.00 ? 111 LYS A HG2  2  
ATOM 3933  H HG3  . LYS A 1 111 ? 126.951 -4.688  -107.084 1.00 0.00 ? 111 LYS A HG3  2  
ATOM 3934  H HD2  . LYS A 1 111 ? 128.758 -3.172  -106.679 1.00 0.00 ? 111 LYS A HD2  2  
ATOM 3935  H HD3  . LYS A 1 111 ? 129.017 -3.811  -105.056 1.00 0.00 ? 111 LYS A HD3  2  
ATOM 3936  H HE2  . LYS A 1 111 ? 129.676 -5.990  -106.019 1.00 0.00 ? 111 LYS A HE2  2  
ATOM 3937  H HE3  . LYS A 1 111 ? 129.432 -5.341  -107.641 1.00 0.00 ? 111 LYS A HE3  2  
ATOM 3938  H HZ1  . LYS A 1 111 ? 131.775 -5.295  -106.801 1.00 0.00 ? 111 LYS A HZ1  2  
ATOM 3939  H HZ2  . LYS A 1 111 ? 131.284 -4.123  -105.674 1.00 0.00 ? 111 LYS A HZ2  2  
ATOM 3940  H HZ3  . LYS A 1 111 ? 131.176 -3.802  -107.339 1.00 0.00 ? 111 LYS A HZ3  2  
ATOM 3941  N N    . MET A 1 112 ? 123.323 -3.051  -106.574 1.00 0.00 ? 112 MET A N    2  
ATOM 3942  C CA   . MET A 1 112 ? 122.160 -3.687  -107.262 1.00 0.00 ? 112 MET A CA   2  
ATOM 3943  C C    . MET A 1 112 ? 121.184 -2.607  -107.739 1.00 0.00 ? 112 MET A C    2  
ATOM 3944  O O    . MET A 1 112 ? 120.039 -2.573  -107.335 1.00 0.00 ? 112 MET A O    2  
ATOM 3945  C CB   . MET A 1 112 ? 121.438 -4.633  -106.295 1.00 0.00 ? 112 MET A CB   2  
ATOM 3946  C CG   . MET A 1 112 ? 121.046 -3.872  -105.027 1.00 0.00 ? 112 MET A CG   2  
ATOM 3947  S SD   . MET A 1 112 ? 120.405 -5.035  -103.795 1.00 0.00 ? 112 MET A SD   2  
ATOM 3948  C CE   . MET A 1 112 ? 118.647 -4.682  -104.034 1.00 0.00 ? 112 MET A CE   2  
ATOM 3949  H H    . MET A 1 112 ? 123.175 -2.360  -105.896 1.00 0.00 ? 112 MET A H    2  
ATOM 3950  H HA   . MET A 1 112 ? 122.513 -4.250  -108.115 1.00 0.00 ? 112 MET A HA   2  
ATOM 3951  H HB2  . MET A 1 112 ? 120.549 -5.023  -106.769 1.00 0.00 ? 112 MET A HB2  2  
ATOM 3952  H HB3  . MET A 1 112 ? 122.093 -5.450  -106.033 1.00 0.00 ? 112 MET A HB3  2  
ATOM 3953  H HG2  . MET A 1 112 ? 121.913 -3.373  -104.629 1.00 0.00 ? 112 MET A HG2  2  
ATOM 3954  H HG3  . MET A 1 112 ? 120.286 -3.143  -105.263 1.00 0.00 ? 112 MET A HG3  2  
ATOM 3955  H HE1  . MET A 1 112 ? 118.063 -5.299  -103.364 1.00 0.00 ? 112 MET A HE1  2  
ATOM 3956  H HE2  . MET A 1 112 ? 118.369 -4.900  -105.052 1.00 0.00 ? 112 MET A HE2  2  
ATOM 3957  H HE3  . MET A 1 112 ? 118.458 -3.638  -103.826 1.00 0.00 ? 112 MET A HE3  2  
ATOM 3958  N N    . PRO A 1 113 ? 121.636 -1.731  -108.597 1.00 0.00 ? 113 PRO A N    2  
ATOM 3959  C CA   . PRO A 1 113 ? 120.771 -0.643  -109.128 1.00 0.00 ? 113 PRO A CA   2  
ATOM 3960  C C    . PRO A 1 113 ? 119.627 -1.184  -109.991 1.00 0.00 ? 113 PRO A C    2  
ATOM 3961  O O    . PRO A 1 113 ? 118.510 -0.712  -109.928 1.00 0.00 ? 113 PRO A O    2  
ATOM 3962  C CB   . PRO A 1 113 ? 121.746 0.176   -109.977 1.00 0.00 ? 113 PRO A CB   2  
ATOM 3963  C CG   . PRO A 1 113 ? 123.096 -0.553  -110.023 1.00 0.00 ? 113 PRO A CG   2  
ATOM 3964  C CD   . PRO A 1 113 ? 123.035 -1.768  -109.094 1.00 0.00 ? 113 PRO A CD   2  
ATOM 3965  H HA   . PRO A 1 113 ? 120.388 -0.034  -108.326 1.00 0.00 ? 113 PRO A HA   2  
ATOM 3966  H HB2  . PRO A 1 113 ? 121.354 0.278   -110.980 1.00 0.00 ? 113 PRO A HB2  2  
ATOM 3967  H HB3  . PRO A 1 113 ? 121.878 1.152   -109.538 1.00 0.00 ? 113 PRO A HB3  2  
ATOM 3968  H HG2  . PRO A 1 113 ? 123.298 -0.877  -111.035 1.00 0.00 ? 113 PRO A HG2  2  
ATOM 3969  H HG3  . PRO A 1 113 ? 123.878 0.114   -109.693 1.00 0.00 ? 113 PRO A HG3  2  
ATOM 3970  H HD2  . PRO A 1 113 ? 123.227 -2.680  -109.645 1.00 0.00 ? 113 PRO A HD2  2  
ATOM 3971  H HD3  . PRO A 1 113 ? 123.725 -1.658  -108.276 1.00 0.00 ? 113 PRO A HD3  2  
ATOM 3972  N N    . ASP A 1 114 ? 119.904 -2.170  -110.798 1.00 0.00 ? 114 ASP A N    2  
ATOM 3973  C CA   . ASP A 1 114 ? 118.840 -2.747  -111.667 1.00 0.00 ? 114 ASP A CA   2  
ATOM 3974  C C    . ASP A 1 114 ? 119.429 -3.901  -112.482 1.00 0.00 ? 114 ASP A C    2  
ATOM 3975  O O    . ASP A 1 114 ? 118.797 -4.431  -113.374 1.00 0.00 ? 114 ASP A O    2  
ATOM 3976  C CB   . ASP A 1 114 ? 118.314 -1.668  -112.616 1.00 0.00 ? 114 ASP A CB   2  
ATOM 3977  C CG   . ASP A 1 114 ? 117.434 -2.315  -113.687 1.00 0.00 ? 114 ASP A CG   2  
ATOM 3978  O OD1  . ASP A 1 114 ? 116.250 -2.469  -113.438 1.00 0.00 ? 114 ASP A OD1  2  
ATOM 3979  O OD2  . ASP A 1 114 ? 117.960 -2.643  -114.738 1.00 0.00 ? 114 ASP A OD2  2  
ATOM 3980  H H    . ASP A 1 114 ? 120.813 -2.535  -110.831 1.00 0.00 ? 114 ASP A H    2  
ATOM 3981  H HA   . ASP A 1 114 ? 118.032 -3.115  -111.053 1.00 0.00 ? 114 ASP A HA   2  
ATOM 3982  H HB2  . ASP A 1 114 ? 117.733 -0.950  -112.056 1.00 0.00 ? 114 ASP A HB2  2  
ATOM 3983  H HB3  . ASP A 1 114 ? 119.146 -1.168  -113.089 1.00 0.00 ? 114 ASP A HB3  2  
ATOM 3984  N N    . LEU A 1 115 ? 120.638 -4.291  -112.180 1.00 0.00 ? 115 LEU A N    2  
ATOM 3985  C CA   . LEU A 1 115 ? 121.273 -5.409  -112.934 1.00 0.00 ? 115 LEU A CA   2  
ATOM 3986  C C    . LEU A 1 115 ? 120.285 -6.569  -113.058 1.00 0.00 ? 115 LEU A C    2  
ATOM 3987  O O    . LEU A 1 115 ? 119.624 -6.730  -114.065 1.00 0.00 ? 115 LEU A O    2  
ATOM 3988  C CB   . LEU A 1 115 ? 122.523 -5.881  -112.189 1.00 0.00 ? 115 LEU A CB   2  
ATOM 3989  C CG   . LEU A 1 115 ? 123.764 -5.257  -112.827 1.00 0.00 ? 115 LEU A CG   2  
ATOM 3990  C CD1  . LEU A 1 115 ? 123.968 -5.841  -114.227 1.00 0.00 ? 115 LEU A CD1  2  
ATOM 3991  C CD2  . LEU A 1 115 ? 123.576 -3.741  -112.931 1.00 0.00 ? 115 LEU A CD2  2  
ATOM 3992  H H    . LEU A 1 115 ? 121.129 -3.848  -111.457 1.00 0.00 ? 115 LEU A H    2  
ATOM 3993  H HA   . LEU A 1 115 ? 121.550 -5.066  -113.920 1.00 0.00 ? 115 LEU A HA   2  
ATOM 3994  H HB2  . LEU A 1 115 ? 122.458 -5.580  -111.153 1.00 0.00 ? 115 LEU A HB2  2  
ATOM 3995  H HB3  . LEU A 1 115 ? 122.592 -6.957  -112.248 1.00 0.00 ? 115 LEU A HB3  2  
ATOM 3996  H HG   . LEU A 1 115 ? 124.629 -5.474  -112.217 1.00 0.00 ? 115 LEU A HG   2  
ATOM 3997  H HD11 . LEU A 1 115 ? 123.530 -5.179  -114.960 1.00 0.00 ? 115 LEU A HD11 2  
ATOM 3998  H HD12 . LEU A 1 115 ? 123.493 -6.809  -114.285 1.00 0.00 ? 115 LEU A HD12 2  
ATOM 3999  H HD13 . LEU A 1 115 ? 125.025 -5.945  -114.422 1.00 0.00 ? 115 LEU A HD13 2  
ATOM 4000  H HD21 . LEU A 1 115 ? 122.874 -3.414  -112.177 1.00 0.00 ? 115 LEU A HD21 2  
ATOM 4001  H HD22 . LEU A 1 115 ? 123.196 -3.492  -113.910 1.00 0.00 ? 115 LEU A HD22 2  
ATOM 4002  H HD23 . LEU A 1 115 ? 124.525 -3.249  -112.776 1.00 0.00 ? 115 LEU A HD23 2  
ATOM 4003  N N    . ASN A 1 116 ? 120.177 -7.382  -112.043 1.00 0.00 ? 116 ASN A N    2  
ATOM 4004  C CA   . ASN A 1 116 ? 119.231 -8.531  -112.108 1.00 0.00 ? 116 ASN A CA   2  
ATOM 4005  C C    . ASN A 1 116 ? 118.741 -8.876  -110.700 1.00 0.00 ? 116 ASN A C    2  
ATOM 4006  O O    . ASN A 1 116 ? 117.737 -9.539  -110.531 1.00 0.00 ? 116 ASN A O    2  
ATOM 4007  C CB   . ASN A 1 116 ? 119.945 -9.743  -112.710 1.00 0.00 ? 116 ASN A CB   2  
ATOM 4008  C CG   . ASN A 1 116 ? 120.759 -10.449 -111.623 1.00 0.00 ? 116 ASN A CG   2  
ATOM 4009  O OD1  . ASN A 1 116 ? 121.772 -9.943  -111.183 1.00 0.00 ? 116 ASN A OD1  2  
ATOM 4010  N ND2  . ASN A 1 116 ? 120.356 -11.605 -111.170 1.00 0.00 ? 116 ASN A ND2  2  
ATOM 4011  H H    . ASN A 1 116 ? 120.719 -7.237  -111.239 1.00 0.00 ? 116 ASN A H    2  
ATOM 4012  H HA   . ASN A 1 116 ? 118.388 -8.267  -112.728 1.00 0.00 ? 116 ASN A HA   2  
ATOM 4013  H HB2  . ASN A 1 116 ? 119.212 -10.428 -113.114 1.00 0.00 ? 116 ASN A HB2  2  
ATOM 4014  H HB3  . ASN A 1 116 ? 120.606 -9.418  -113.498 1.00 0.00 ? 116 ASN A HB3  2  
ATOM 4015  H HD21 . ASN A 1 116 ? 119.539 -12.012 -111.527 1.00 0.00 ? 116 ASN A HD21 2  
ATOM 4016  H HD22 . ASN A 1 116 ? 120.870 -12.064 -110.475 1.00 0.00 ? 116 ASN A HD22 2  
ATOM 4017  N N    . THR A 1 117 ? 119.439 -8.435  -109.689 1.00 0.00 ? 117 THR A N    2  
ATOM 4018  C CA   . THR A 1 117 ? 119.003 -8.745  -108.299 1.00 0.00 ? 117 THR A CA   2  
ATOM 4019  C C    . THR A 1 117 ? 117.670 -8.052  -108.012 1.00 0.00 ? 117 THR A C    2  
ATOM 4020  O O    . THR A 1 117 ? 116.978 -7.620  -108.912 1.00 0.00 ? 117 THR A O    2  
ATOM 4021  C CB   . THR A 1 117 ? 120.050 -8.263  -107.297 1.00 0.00 ? 117 THR A CB   2  
ATOM 4022  O OG1  . THR A 1 117 ? 121.326 -8.764  -107.668 1.00 0.00 ? 117 THR A OG1  2  
ATOM 4023  C CG2  . THR A 1 117 ? 119.679 -8.774  -105.905 1.00 0.00 ? 117 THR A CG2  2  
ATOM 4024  H H    . THR A 1 117 ? 120.246 -7.902  -109.844 1.00 0.00 ? 117 THR A H    2  
ATOM 4025  H HA   . THR A 1 117 ? 118.876 -9.813  -108.197 1.00 0.00 ? 117 THR A HA   2  
ATOM 4026  H HB   . THR A 1 117 ? 120.072 -7.184  -107.287 1.00 0.00 ? 117 THR A HB   2  
ATOM 4027  H HG1  . THR A 1 117 ? 121.195 -9.592  -108.136 1.00 0.00 ? 117 THR A HG1  2  
ATOM 4028  H HG21 . THR A 1 117 ? 119.274 -7.963  -105.318 1.00 0.00 ? 117 THR A HG21 2  
ATOM 4029  H HG22 . THR A 1 117 ? 120.558 -9.168  -105.419 1.00 0.00 ? 117 THR A HG22 2  
ATOM 4030  H HG23 . THR A 1 117 ? 118.937 -9.556  -105.995 1.00 0.00 ? 117 THR A HG23 2  
ATOM 4031  N N    . THR A 1 118 ? 117.296 -7.958  -106.765 1.00 0.00 ? 118 THR A N    2  
ATOM 4032  C CA   . THR A 1 118 ? 115.999 -7.311  -106.429 1.00 0.00 ? 118 THR A CA   2  
ATOM 4033  C C    . THR A 1 118 ? 115.846 -7.211  -104.910 1.00 0.00 ? 118 THR A C    2  
ATOM 4034  O O    . THR A 1 118 ? 115.754 -6.135  -104.352 1.00 0.00 ? 118 THR A O    2  
ATOM 4035  C CB   . THR A 1 118 ? 114.875 -8.174  -106.994 1.00 0.00 ? 118 THR A CB   2  
ATOM 4036  O OG1  . THR A 1 118 ? 113.758 -8.131  -106.117 1.00 0.00 ? 118 THR A OG1  2  
ATOM 4037  C CG2  . THR A 1 118 ? 115.381 -9.612  -107.120 1.00 0.00 ? 118 THR A CG2  2  
ATOM 4038  H H    . THR A 1 118 ? 117.859 -8.324  -106.053 1.00 0.00 ? 118 THR A H    2  
ATOM 4039  H HA   . THR A 1 118 ? 115.957 -6.326  -106.868 1.00 0.00 ? 118 THR A HA   2  
ATOM 4040  H HB   . THR A 1 118 ? 114.589 -7.809  -107.967 1.00 0.00 ? 118 THR A HB   2  
ATOM 4041  H HG1  . THR A 1 118 ? 113.083 -8.718  -106.468 1.00 0.00 ? 118 THR A HG1  2  
ATOM 4042  H HG21 . THR A 1 118 ? 116.075 -9.820  -106.317 1.00 0.00 ? 118 THR A HG21 2  
ATOM 4043  H HG22 . THR A 1 118 ? 115.884 -9.734  -108.068 1.00 0.00 ? 118 THR A HG22 2  
ATOM 4044  H HG23 . THR A 1 118 ? 114.548 -10.294 -107.061 1.00 0.00 ? 118 THR A HG23 2  
ATOM 4045  N N    . ASP A 1 119 ? 115.805 -8.329  -104.238 1.00 0.00 ? 119 ASP A N    2  
ATOM 4046  C CA   . ASP A 1 119 ? 115.644 -8.310  -102.757 1.00 0.00 ? 119 ASP A CA   2  
ATOM 4047  C C    . ASP A 1 119 ? 116.958 -7.900  -102.091 1.00 0.00 ? 119 ASP A C    2  
ATOM 4048  O O    . ASP A 1 119 ? 118.029 -8.298  -102.504 1.00 0.00 ? 119 ASP A O    2  
ATOM 4049  C CB   . ASP A 1 119 ? 115.249 -9.708  -102.274 1.00 0.00 ? 119 ASP A CB   2  
ATOM 4050  C CG   . ASP A 1 119 ? 113.753 -9.736  -101.958 1.00 0.00 ? 119 ASP A CG   2  
ATOM 4051  O OD1  . ASP A 1 119 ? 113.274 -8.781  -101.367 1.00 0.00 ? 119 ASP A OD1  2  
ATOM 4052  O OD2  . ASP A 1 119 ? 113.110 -10.711 -102.311 1.00 0.00 ? 119 ASP A OD2  2  
ATOM 4053  H H    . ASP A 1 119 ? 115.872 -9.186  -104.712 1.00 0.00 ? 119 ASP A H    2  
ATOM 4054  H HA   . ASP A 1 119 ? 114.870 -7.607  -102.489 1.00 0.00 ? 119 ASP A HA   2  
ATOM 4055  H HB2  . ASP A 1 119 ? 115.468 -10.431 -103.047 1.00 0.00 ? 119 ASP A HB2  2  
ATOM 4056  H HB3  . ASP A 1 119 ? 115.809 -9.952  -101.383 1.00 0.00 ? 119 ASP A HB3  2  
ATOM 4057  N N    . LEU A 1 120 ? 116.881 -7.109  -101.055 1.00 0.00 ? 120 LEU A N    2  
ATOM 4058  C CA   . LEU A 1 120 ? 118.119 -6.673  -100.350 1.00 0.00 ? 120 LEU A CA   2  
ATOM 4059  C C    . LEU A 1 120 ? 118.851 -7.904  -99.817  1.00 0.00 ? 120 LEU A C    2  
ATOM 4060  O O    . LEU A 1 120 ? 120.045 -7.899  -99.593  1.00 0.00 ? 120 LEU A O    2  
ATOM 4061  C CB   . LEU A 1 120 ? 117.729 -5.783  -99.170  1.00 0.00 ? 120 LEU A CB   2  
ATOM 4062  C CG   . LEU A 1 120 ? 118.439 -4.432  -99.299  1.00 0.00 ? 120 LEU A CG   2  
ATOM 4063  C CD1  . LEU A 1 120 ? 118.339 -3.675  -97.973  1.00 0.00 ? 120 LEU A CD1  2  
ATOM 4064  C CD2  . LEU A 1 120 ? 119.914 -4.659  -99.651  1.00 0.00 ? 120 LEU A CD2  2  
ATOM 4065  H H    . LEU A 1 120 ? 116.006 -6.803  -100.738 1.00 0.00 ? 120 LEU A H    2  
ATOM 4066  H HA   . LEU A 1 120 ? 118.726 -6.093  -101.029 1.00 0.00 ? 120 LEU A HA   2  
ATOM 4067  H HB2  . LEU A 1 120 ? 116.659 -5.631  -99.170  1.00 0.00 ? 120 LEU A HB2  2  
ATOM 4068  H HB3  . LEU A 1 120 ? 118.026 -6.257  -98.246  1.00 0.00 ? 120 LEU A HB3  2  
ATOM 4069  H HG   . LEU A 1 120 ? 117.965 -3.852  -100.078 1.00 0.00 ? 120 LEU A HG   2  
ATOM 4070  H HD11 . LEU A 1 120 ? 119.320 -3.342  -97.674  1.00 0.00 ? 120 LEU A HD11 2  
ATOM 4071  H HD12 . LEU A 1 120 ? 117.934 -4.328  -97.214  1.00 0.00 ? 120 LEU A HD12 2  
ATOM 4072  H HD13 . LEU A 1 120 ? 117.690 -2.820  -98.095  1.00 0.00 ? 120 LEU A HD13 2  
ATOM 4073  H HD21 . LEU A 1 120 ? 120.065 -4.485  -100.708 1.00 0.00 ? 120 LEU A HD21 2  
ATOM 4074  H HD22 . LEU A 1 120 ? 120.190 -5.677  -99.414  1.00 0.00 ? 120 LEU A HD22 2  
ATOM 4075  H HD23 . LEU A 1 120 ? 120.531 -3.978  -99.084  1.00 0.00 ? 120 LEU A HD23 2  
ATOM 4076  N N    . GLU A 1 121 ? 118.110 -8.959  -99.623  1.00 0.00 ? 121 GLU A N    2  
ATOM 4077  C CA   . GLU A 1 121 ? 118.678 -10.237 -99.109  1.00 0.00 ? 121 GLU A CA   2  
ATOM 4078  C C    . GLU A 1 121 ? 119.667 -10.823 -100.111 1.00 0.00 ? 121 GLU A C    2  
ATOM 4079  O O    . GLU A 1 121 ? 120.658 -11.416 -99.727  1.00 0.00 ? 121 GLU A O    2  
ATOM 4080  C CB   . GLU A 1 121 ? 117.534 -11.234 -98.909  1.00 0.00 ? 121 GLU A CB   2  
ATOM 4081  C CG   . GLU A 1 121 ? 116.577 -10.705 -97.839  1.00 0.00 ? 121 GLU A CG   2  
ATOM 4082  C CD   . GLU A 1 121 ? 115.417 -11.687 -97.662  1.00 0.00 ? 121 GLU A CD   2  
ATOM 4083  O OE1  . GLU A 1 121 ? 115.408 -12.694 -98.350  1.00 0.00 ? 121 GLU A OE1  2  
ATOM 4084  O OE2  . GLU A 1 121 ? 114.556 -11.414 -96.842  1.00 0.00 ? 121 GLU A OE2  2  
ATOM 4085  H H    . GLU A 1 121 ? 117.156 -8.912  -99.841  1.00 0.00 ? 121 GLU A H    2  
ATOM 4086  H HA   . GLU A 1 121 ? 119.192 -10.107 -98.168  1.00 0.00 ? 121 GLU A HA   2  
ATOM 4087  H HB2  . GLU A 1 121 ? 117.001 -11.362 -99.840  1.00 0.00 ? 121 GLU A HB2  2  
ATOM 4088  H HB3  . GLU A 1 121 ? 117.937 -12.185 -98.590  1.00 0.00 ? 121 GLU A HB3  2  
ATOM 4089  H HG2  . GLU A 1 121 ? 117.106 -10.600 -96.903  1.00 0.00 ? 121 GLU A HG2  2  
ATOM 4090  H HG3  . GLU A 1 121 ? 116.190 -9.745  -98.145  1.00 0.00 ? 121 GLU A HG3  2  
ATOM 4091  N N    . ALA A 1 122 ? 119.443 -10.663 -101.380 1.00 0.00 ? 122 ALA A N    2  
ATOM 4092  C CA   . ALA A 1 122 ? 120.423 -11.223 -102.344 1.00 0.00 ? 122 ALA A CA   2  
ATOM 4093  C C    . ALA A 1 122 ? 121.683 -10.355 -102.300 1.00 0.00 ? 122 ALA A C    2  
ATOM 4094  O O    . ALA A 1 122 ? 122.678 -10.743 -101.719 1.00 0.00 ? 122 ALA A O    2  
ATOM 4095  C CB   . ALA A 1 122 ? 119.831 -11.233 -103.755 1.00 0.00 ? 122 ALA A CB   2  
ATOM 4096  H H    . ALA A 1 122 ? 118.653 -10.174 -101.694 1.00 0.00 ? 122 ALA A H    2  
ATOM 4097  H HA   . ALA A 1 122 ? 120.665 -12.227 -102.030 1.00 0.00 ? 122 ALA A HA   2  
ATOM 4098  H HB1  . ALA A 1 122 ? 119.267 -10.326 -103.915 1.00 0.00 ? 122 ALA A HB1  2  
ATOM 4099  H HB2  . ALA A 1 122 ? 119.178 -12.087 -103.864 1.00 0.00 ? 122 ALA A HB2  2  
ATOM 4100  H HB3  . ALA A 1 122 ? 120.629 -11.294 -104.480 1.00 0.00 ? 122 ALA A HB3  2  
ATOM 4101  N N    . ALA A 1 123 ? 121.671 -9.189  -102.885 1.00 0.00 ? 123 ALA A N    2  
ATOM 4102  C CA   . ALA A 1 123 ? 122.892 -8.339  -102.834 1.00 0.00 ? 123 ALA A CA   2  
ATOM 4103  C C    . ALA A 1 123 ? 123.449 -8.339  -101.406 1.00 0.00 ? 123 ALA A C    2  
ATOM 4104  O O    . ALA A 1 123 ? 124.642 -8.243  -101.195 1.00 0.00 ? 123 ALA A O    2  
ATOM 4105  C CB   . ALA A 1 123 ? 122.537 -6.914  -103.254 1.00 0.00 ? 123 ALA A CB   2  
ATOM 4106  H H    . ALA A 1 123 ? 120.877 -8.866  -103.361 1.00 0.00 ? 123 ALA A H    2  
ATOM 4107  H HA   . ALA A 1 123 ? 123.635 -8.738  -103.509 1.00 0.00 ? 123 ALA A HA   2  
ATOM 4108  H HB1  . ALA A 1 123 ? 122.011 -6.422  -102.449 1.00 0.00 ? 123 ALA A HB1  2  
ATOM 4109  H HB2  . ALA A 1 123 ? 121.908 -6.946  -104.130 1.00 0.00 ? 123 ALA A HB2  2  
ATOM 4110  H HB3  . ALA A 1 123 ? 123.440 -6.368  -103.480 1.00 0.00 ? 123 ALA A HB3  2  
ATOM 4111  N N    . ALA A 1 124 ? 122.597 -8.457  -100.419 1.00 0.00 ? 124 ALA A N    2  
ATOM 4112  C CA   . ALA A 1 124 ? 123.094 -8.476  -99.013  1.00 0.00 ? 124 ALA A CA   2  
ATOM 4113  C C    . ALA A 1 124 ? 124.029 -9.671  -98.846  1.00 0.00 ? 124 ALA A C    2  
ATOM 4114  O O    . ALA A 1 124 ? 125.225 -9.520  -98.692  1.00 0.00 ? 124 ALA A O    2  
ATOM 4115  C CB   . ALA A 1 124 ? 121.919 -8.611  -98.043  1.00 0.00 ? 124 ALA A CB   2  
ATOM 4116  H H    . ALA A 1 124 ? 121.639 -8.542  -100.603 1.00 0.00 ? 124 ALA A H    2  
ATOM 4117  H HA   . ALA A 1 124 ? 123.634 -7.563  -98.807  1.00 0.00 ? 124 ALA A HA   2  
ATOM 4118  H HB1  . ALA A 1 124 ? 122.283 -8.945  -97.082  1.00 0.00 ? 124 ALA A HB1  2  
ATOM 4119  H HB2  . ALA A 1 124 ? 121.214 -9.330  -98.429  1.00 0.00 ? 124 ALA A HB2  2  
ATOM 4120  H HB3  . ALA A 1 124 ? 121.433 -7.653  -97.930  1.00 0.00 ? 124 ALA A HB3  2  
ATOM 4121  N N    . ARG A 1 125 ? 123.493 -10.862 -98.874  1.00 0.00 ? 125 ARG A N    2  
ATOM 4122  C CA   . ARG A 1 125 ? 124.362 -12.059 -98.716  1.00 0.00 ? 125 ARG A CA   2  
ATOM 4123  C C    . ARG A 1 125 ? 125.612 -11.856 -99.569  1.00 0.00 ? 125 ARG A C    2  
ATOM 4124  O O    . ARG A 1 125 ? 126.720 -12.093 -99.133  1.00 0.00 ? 125 ARG A O    2  
ATOM 4125  C CB   . ARG A 1 125 ? 123.611 -13.306 -99.191  1.00 0.00 ? 125 ARG A CB   2  
ATOM 4126  C CG   . ARG A 1 125 ? 124.116 -14.531 -98.428  1.00 0.00 ? 125 ARG A CG   2  
ATOM 4127  C CD   . ARG A 1 125 ? 123.144 -15.695 -98.631  1.00 0.00 ? 125 ARG A CD   2  
ATOM 4128  N NE   . ARG A 1 125 ? 123.395 -16.326 -99.957  1.00 0.00 ? 125 ARG A NE   2  
ATOM 4129  C CZ   . ARG A 1 125 ? 122.896 -17.501 -100.225 1.00 0.00 ? 125 ARG A CZ   2  
ATOM 4130  N NH1  . ARG A 1 125 ? 122.175 -18.124 -99.333  1.00 0.00 ? 125 ARG A NH1  2  
ATOM 4131  N NH2  . ARG A 1 125 ? 123.117 -18.055 -101.387 1.00 0.00 ? 125 ARG A NH2  2  
ATOM 4132  H H    . ARG A 1 125 ? 122.523 -10.962 -98.984  1.00 0.00 ? 125 ARG A H    2  
ATOM 4133  H HA   . ARG A 1 125 ? 124.642 -12.173 -97.679  1.00 0.00 ? 125 ARG A HA   2  
ATOM 4134  H HB2  . ARG A 1 125 ? 122.553 -13.179 -99.010  1.00 0.00 ? 125 ARG A HB2  2  
ATOM 4135  H HB3  . ARG A 1 125 ? 123.780 -13.447 -100.248 1.00 0.00 ? 125 ARG A HB3  2  
ATOM 4136  H HG2  . ARG A 1 125 ? 125.093 -14.809 -98.798  1.00 0.00 ? 125 ARG A HG2  2  
ATOM 4137  H HG3  . ARG A 1 125 ? 124.183 -14.299 -97.377  1.00 0.00 ? 125 ARG A HG3  2  
ATOM 4138  H HD2  . ARG A 1 125 ? 123.291 -16.427 -97.851  1.00 0.00 ? 125 ARG A HD2  2  
ATOM 4139  H HD3  . ARG A 1 125 ? 122.130 -15.327 -98.592  1.00 0.00 ? 125 ARG A HD3  2  
ATOM 4140  H HE   . ARG A 1 125 ? 123.934 -15.858 -100.628 1.00 0.00 ? 125 ARG A HE   2  
ATOM 4141  H HH11 . ARG A 1 125 ? 122.004 -17.700 -98.443  1.00 0.00 ? 125 ARG A HH11 2  
ATOM 4142  H HH12 . ARG A 1 125 ? 121.793 -19.024 -99.538  1.00 0.00 ? 125 ARG A HH12 2  
ATOM 4143  H HH21 . ARG A 1 125 ? 123.669 -17.578 -102.070 1.00 0.00 ? 125 ARG A HH21 2  
ATOM 4144  H HH22 . ARG A 1 125 ? 122.735 -18.956 -101.592 1.00 0.00 ? 125 ARG A HH22 2  
ATOM 4145  N N    . MET A 1 126 ? 125.449 -11.387 -100.773 1.00 0.00 ? 126 MET A N    2  
ATOM 4146  C CA   . MET A 1 126 ? 126.634 -11.138 -101.634 1.00 0.00 ? 126 MET A CA   2  
ATOM 4147  C C    . MET A 1 126 ? 127.657 -10.323 -100.839 1.00 0.00 ? 126 MET A C    2  
ATOM 4148  O O    . MET A 1 126 ? 128.609 -10.853 -100.308 1.00 0.00 ? 126 MET A O    2  
ATOM 4149  C CB   . MET A 1 126 ? 126.204 -10.343 -102.870 1.00 0.00 ? 126 MET A CB   2  
ATOM 4150  C CG   . MET A 1 126 ? 125.184 -11.154 -103.669 1.00 0.00 ? 126 MET A CG   2  
ATOM 4151  S SD   . MET A 1 126 ? 125.428 -10.857 -105.438 1.00 0.00 ? 126 MET A SD   2  
ATOM 4152  C CE   . MET A 1 126 ? 123.715 -10.428 -105.836 1.00 0.00 ? 126 MET A CE   2  
ATOM 4153  H H    . MET A 1 126 ? 124.549 -11.179 -101.100 1.00 0.00 ? 126 MET A H    2  
ATOM 4154  H HA   . MET A 1 126 ? 127.074 -12.072 -101.950 1.00 0.00 ? 126 MET A HA   2  
ATOM 4155  H HB2  . MET A 1 126 ? 125.762 -9.408  -102.562 1.00 0.00 ? 126 MET A HB2  2  
ATOM 4156  H HB3  . MET A 1 126 ? 127.067 -10.146 -103.488 1.00 0.00 ? 126 MET A HB3  2  
ATOM 4157  H HG2  . MET A 1 126 ? 125.315 -12.205 -103.459 1.00 0.00 ? 126 MET A HG2  2  
ATOM 4158  H HG3  . MET A 1 126 ? 124.186 -10.854 -103.388 1.00 0.00 ? 126 MET A HG3  2  
ATOM 4159  H HE1  . MET A 1 126 ? 123.543 -9.385  -105.605 1.00 0.00 ? 126 MET A HE1  2  
ATOM 4160  H HE2  . MET A 1 126 ? 123.045 -11.038 -105.254 1.00 0.00 ? 126 MET A HE2  2  
ATOM 4161  H HE3  . MET A 1 126 ? 123.537 -10.603 -106.888 1.00 0.00 ? 126 MET A HE3  2  
ATOM 4162  N N    . ILE A 1 127 ? 127.451 -9.036  -100.745 1.00 0.00 ? 127 ILE A N    2  
ATOM 4163  C CA   . ILE A 1 127 ? 128.395 -8.165  -99.982  1.00 0.00 ? 127 ILE A CA   2  
ATOM 4164  C C    . ILE A 1 127 ? 128.706 -8.793  -98.621  1.00 0.00 ? 127 ILE A C    2  
ATOM 4165  O O    . ILE A 1 127 ? 129.811 -9.223  -98.354  1.00 0.00 ? 127 ILE A O    2  
ATOM 4166  C CB   . ILE A 1 127 ? 127.733 -6.805  -99.753  1.00 0.00 ? 127 ILE A CB   2  
ATOM 4167  C CG1  . ILE A 1 127 ? 127.472 -6.119  -101.095 1.00 0.00 ? 127 ILE A CG1  2  
ATOM 4168  C CG2  . ILE A 1 127 ? 128.637 -5.924  -98.894  1.00 0.00 ? 127 ILE A CG2  2  
ATOM 4169  C CD1  . ILE A 1 127 ? 128.711 -6.209  -101.980 1.00 0.00 ? 127 ILE A CD1  2  
ATOM 4170  H H    . ILE A 1 127 ? 126.663 -8.639  -101.175 1.00 0.00 ? 127 ILE A H    2  
ATOM 4171  H HA   . ILE A 1 127 ? 129.308 -8.036  -100.539 1.00 0.00 ? 127 ILE A HA   2  
ATOM 4172  H HB   . ILE A 1 127 ? 126.793 -6.952  -99.239  1.00 0.00 ? 127 ILE A HB   2  
ATOM 4173  H HG12 . ILE A 1 127 ? 126.646 -6.603  -101.590 1.00 0.00 ? 127 ILE A HG12 2  
ATOM 4174  H HG13 . ILE A 1 127 ? 127.234 -5.080  -100.926 1.00 0.00 ? 127 ILE A HG13 2  
ATOM 4175  H HG21 . ILE A 1 127 ? 128.093 -5.044  -98.591  1.00 0.00 ? 127 ILE A HG21 2  
ATOM 4176  H HG22 . ILE A 1 127 ? 129.504 -5.633  -99.466  1.00 0.00 ? 127 ILE A HG22 2  
ATOM 4177  H HG23 . ILE A 1 127 ? 128.950 -6.472  -98.018  1.00 0.00 ? 127 ILE A HG23 2  
ATOM 4178  H HD11 . ILE A 1 127 ? 128.747 -7.182  -102.446 1.00 0.00 ? 127 ILE A HD11 2  
ATOM 4179  H HD12 . ILE A 1 127 ? 129.593 -6.061  -101.379 1.00 0.00 ? 127 ILE A HD12 2  
ATOM 4180  H HD13 . ILE A 1 127 ? 128.659 -5.447  -102.743 1.00 0.00 ? 127 ILE A HD13 2  
ATOM 4181  N N    . ALA A 1 128 ? 127.729 -8.847  -97.766  1.00 0.00 ? 128 ALA A N    2  
ATOM 4182  C CA   . ALA A 1 128 ? 127.971 -9.450  -96.425  1.00 0.00 ? 128 ALA A CA   2  
ATOM 4183  C C    . ALA A 1 128 ? 128.522 -10.856 -96.655  1.00 0.00 ? 128 ALA A C    2  
ATOM 4184  O O    . ALA A 1 128 ? 129.676 -11.136 -96.380  1.00 0.00 ? 128 ALA A O    2  
ATOM 4185  C CB   . ALA A 1 128 ? 126.680 -9.496  -95.605  1.00 0.00 ? 128 ALA A CB   2  
ATOM 4186  H H    . ALA A 1 128 ? 126.859 -8.494  -98.048  1.00 0.00 ? 128 ALA A H    2  
ATOM 4187  H HA   . ALA A 1 128 ? 128.731 -8.873  -95.918  1.00 0.00 ? 128 ALA A HA   2  
ATOM 4188  H HB1  . ALA A 1 128 ? 125.911 -8.931  -96.112  1.00 0.00 ? 128 ALA A HB1  2  
ATOM 4189  H HB2  . ALA A 1 128 ? 126.856 -9.068  -94.629  1.00 0.00 ? 128 ALA A HB2  2  
ATOM 4190  H HB3  . ALA A 1 128 ? 126.360 -10.522 -95.496  1.00 0.00 ? 128 ALA A HB3  2  
ATOM 4191  N N    . GLY A 1 129 ? 127.714 -11.750 -97.139  1.00 0.00 ? 129 GLY A N    2  
ATOM 4192  C CA   . GLY A 1 129 ? 128.215 -13.132 -97.361  1.00 0.00 ? 129 GLY A CA   2  
ATOM 4193  C C    . GLY A 1 129 ? 129.618 -13.057 -97.975  1.00 0.00 ? 129 GLY A C    2  
ATOM 4194  O O    . GLY A 1 129 ? 130.489 -13.833 -97.635  1.00 0.00 ? 129 GLY A O    2  
ATOM 4195  H H    . GLY A 1 129 ? 126.775 -11.521 -97.301  1.00 0.00 ? 129 GLY A H    2  
ATOM 4196  H HA2  . GLY A 1 129 ? 128.259 -13.655 -96.416  1.00 0.00 ? 129 GLY A HA2  2  
ATOM 4197  H HA3  . GLY A 1 129 ? 127.557 -13.656 -98.035  1.00 0.00 ? 129 GLY A HA3  2  
ATOM 4198  N N    . SER A 1 130 ? 129.874 -12.111 -98.846  1.00 0.00 ? 130 SER A N    2  
ATOM 4199  C CA   . SER A 1 130 ? 131.252 -12.002 -99.408  1.00 0.00 ? 130 SER A CA   2  
ATOM 4200  C C    . SER A 1 130 ? 132.211 -11.835 -98.232  1.00 0.00 ? 130 SER A C    2  
ATOM 4201  O O    . SER A 1 130 ? 133.148 -12.593 -98.066  1.00 0.00 ? 130 SER A O    2  
ATOM 4202  C CB   . SER A 1 130 ? 131.367 -10.780 -100.324 1.00 0.00 ? 130 SER A CB   2  
ATOM 4203  O OG   . SER A 1 130 ? 131.623 -9.625  -99.535  1.00 0.00 ? 130 SER A OG   2  
ATOM 4204  H H    . SER A 1 130 ? 129.185 -11.466 -99.108  1.00 0.00 ? 130 SER A H    2  
ATOM 4205  H HA   . SER A 1 130 ? 131.495 -12.900 -99.956  1.00 0.00 ? 130 SER A HA   2  
ATOM 4206  H HB2  . SER A 1 130 ? 132.181 -10.922 -101.014 1.00 0.00 ? 130 SER A HB2  2  
ATOM 4207  H HB3  . SER A 1 130 ? 130.451 -10.652 -100.878 1.00 0.00 ? 130 SER A HB3  2  
ATOM 4208  H HG   . SER A 1 130 ? 132.334 -9.835  -98.924  1.00 0.00 ? 130 SER A HG   2  
ATOM 4209  N N    . ALA A 1 131 ? 131.966 -10.861 -97.393  1.00 0.00 ? 131 ALA A N    2  
ATOM 4210  C CA   . ALA A 1 131 ? 132.844 -10.669 -96.211  1.00 0.00 ? 131 ALA A CA   2  
ATOM 4211  C C    . ALA A 1 131 ? 133.079 -12.041 -95.591  1.00 0.00 ? 131 ALA A C    2  
ATOM 4212  O O    . ALA A 1 131 ? 134.202 -12.452 -95.375  1.00 0.00 ? 131 ALA A O    2  
ATOM 4213  C CB   . ALA A 1 131 ? 132.153 -9.748  -95.204  1.00 0.00 ? 131 ALA A CB   2  
ATOM 4214  H H    . ALA A 1 131 ? 131.192 -10.275 -97.534  1.00 0.00 ? 131 ALA A H    2  
ATOM 4215  H HA   . ALA A 1 131 ? 133.790 -10.240 -96.518  1.00 0.00 ? 131 ALA A HA   2  
ATOM 4216  H HB1  . ALA A 1 131 ? 131.832 -10.325 -94.350  1.00 0.00 ? 131 ALA A HB1  2  
ATOM 4217  H HB2  . ALA A 1 131 ? 131.294 -9.287  -95.670  1.00 0.00 ? 131 ALA A HB2  2  
ATOM 4218  H HB3  . ALA A 1 131 ? 132.843 -8.981  -94.883  1.00 0.00 ? 131 ALA A HB3  2  
ATOM 4219  N N    . ARG A 1 132 ? 132.027 -12.782 -95.352  1.00 0.00 ? 132 ARG A N    2  
ATOM 4220  C CA   . ARG A 1 132 ? 132.217 -14.154 -94.806  1.00 0.00 ? 132 ARG A CA   2  
ATOM 4221  C C    . ARG A 1 132 ? 133.343 -14.798 -95.606  1.00 0.00 ? 132 ARG A C    2  
ATOM 4222  O O    . ARG A 1 132 ? 134.348 -15.204 -95.058  1.00 0.00 ? 132 ARG A O    2  
ATOM 4223  C CB   . ARG A 1 132 ? 130.931 -14.971 -94.963  1.00 0.00 ? 132 ARG A CB   2  
ATOM 4224  C CG   . ARG A 1 132 ? 131.150 -16.377 -94.399  1.00 0.00 ? 132 ARG A CG   2  
ATOM 4225  C CD   . ARG A 1 132 ? 132.005 -17.191 -95.373  1.00 0.00 ? 132 ARG A CD   2  
ATOM 4226  N NE   . ARG A 1 132 ? 131.517 -18.600 -95.402  1.00 0.00 ? 132 ARG A NE   2  
ATOM 4227  C CZ   . ARG A 1 132 ? 131.892 -19.400 -96.362  1.00 0.00 ? 132 ARG A CZ   2  
ATOM 4228  N NH1  . ARG A 1 132 ? 132.696 -18.969 -97.295  1.00 0.00 ? 132 ARG A NH1  2  
ATOM 4229  N NH2  . ARG A 1 132 ? 131.463 -20.632 -96.390  1.00 0.00 ? 132 ARG A NH2  2  
ATOM 4230  H H    . ARG A 1 132 ? 131.128 -12.453 -95.574  1.00 0.00 ? 132 ARG A H    2  
ATOM 4231  H HA   . ARG A 1 132 ? 132.516 -14.131 -93.767  1.00 0.00 ? 132 ARG A HA   2  
ATOM 4232  H HB2  . ARG A 1 132 ? 130.130 -14.487 -94.424  1.00 0.00 ? 132 ARG A HB2  2  
ATOM 4233  H HB3  . ARG A 1 132 ? 130.673 -15.041 -96.006  1.00 0.00 ? 132 ARG A HB3  2  
ATOM 4234  H HG2  . ARG A 1 132 ? 131.655 -16.307 -93.446  1.00 0.00 ? 132 ARG A HG2  2  
ATOM 4235  H HG3  . ARG A 1 132 ? 130.196 -16.864 -94.267  1.00 0.00 ? 132 ARG A HG3  2  
ATOM 4236  H HD2  . ARG A 1 132 ? 131.932 -16.765 -96.362  1.00 0.00 ? 132 ARG A HD2  2  
ATOM 4237  H HD3  . ARG A 1 132 ? 133.036 -17.174 -95.049  1.00 0.00 ? 132 ARG A HD3  2  
ATOM 4238  H HE   . ARG A 1 132 ? 130.914 -18.924 -94.701  1.00 0.00 ? 132 ARG A HE   2  
ATOM 4239  H HH11 . ARG A 1 132 ? 133.026 -18.025 -97.274  1.00 0.00 ? 132 ARG A HH11 2  
ATOM 4240  H HH12 . ARG A 1 132 ? 132.983 -19.582 -98.031  1.00 0.00 ? 132 ARG A HH12 2  
ATOM 4241  H HH21 . ARG A 1 132 ? 130.846 -20.962 -95.674  1.00 0.00 ? 132 ARG A HH21 2  
ATOM 4242  H HH22 . ARG A 1 132 ? 131.750 -21.246 -97.125  1.00 0.00 ? 132 ARG A HH22 2  
ATOM 4243  N N    . SER A 1 133 ? 133.216 -14.850 -96.903  1.00 0.00 ? 133 SER A N    2  
ATOM 4244  C CA   . SER A 1 133 ? 134.325 -15.419 -97.711  1.00 0.00 ? 133 SER A CA   2  
ATOM 4245  C C    . SER A 1 133 ? 135.617 -14.820 -97.162  1.00 0.00 ? 133 SER A C    2  
ATOM 4246  O O    . SER A 1 133 ? 136.431 -15.495 -96.562  1.00 0.00 ? 133 SER A O    2  
ATOM 4247  C CB   . SER A 1 133 ? 134.152 -15.008 -99.174  1.00 0.00 ? 133 SER A CB   2  
ATOM 4248  O OG   . SER A 1 133 ? 135.016 -15.792 -99.986  1.00 0.00 ? 133 SER A OG   2  
ATOM 4249  H H    . SER A 1 133 ? 132.417 -14.484 -97.341  1.00 0.00 ? 133 SER A H    2  
ATOM 4250  H HA   . SER A 1 133 ? 134.345 -16.496 -97.632  1.00 0.00 ? 133 SER A HA   2  
ATOM 4251  H HB2  . SER A 1 133 ? 133.132 -15.177 -99.478  1.00 0.00 ? 133 SER A HB2  2  
ATOM 4252  H HB3  . SER A 1 133 ? 134.390 -13.959 -99.284  1.00 0.00 ? 133 SER A HB3  2  
ATOM 4253  H HG   . SER A 1 133 ? 135.221 -16.599 -99.510  1.00 0.00 ? 133 SER A HG   2  
ATOM 4254  N N    . MET A 1 134 ? 135.786 -13.538 -97.341  1.00 0.00 ? 134 MET A N    2  
ATOM 4255  C CA   . MET A 1 134 ? 136.993 -12.847 -96.813  1.00 0.00 ? 134 MET A CA   2  
ATOM 4256  C C    . MET A 1 134 ? 137.214 -13.257 -95.354  1.00 0.00 ? 134 MET A C    2  
ATOM 4257  O O    . MET A 1 134 ? 138.169 -12.848 -94.723  1.00 0.00 ? 134 MET A O    2  
ATOM 4258  C CB   . MET A 1 134 ? 136.746 -11.335 -96.875  1.00 0.00 ? 134 MET A CB   2  
ATOM 4259  C CG   . MET A 1 134 ? 137.971 -10.587 -96.352  1.00 0.00 ? 134 MET A CG   2  
ATOM 4260  S SD   . MET A 1 134 ? 138.264 -9.122  -97.373  1.00 0.00 ? 134 MET A SD   2  
ATOM 4261  C CE   . MET A 1 134 ? 136.799 -8.188  -96.865  1.00 0.00 ? 134 MET A CE   2  
ATOM 4262  H H    . MET A 1 134 ? 135.103 -13.018 -97.815  1.00 0.00 ? 134 MET A H    2  
ATOM 4263  H HA   . MET A 1 134 ? 137.862 -13.095 -97.402  1.00 0.00 ? 134 MET A HA   2  
ATOM 4264  H HB2  . MET A 1 134 ? 136.555 -11.042 -97.897  1.00 0.00 ? 134 MET A HB2  2  
ATOM 4265  H HB3  . MET A 1 134 ? 135.889 -11.086 -96.264  1.00 0.00 ? 134 MET A HB3  2  
ATOM 4266  H HG2  . MET A 1 134 ? 137.798 -10.285 -95.329  1.00 0.00 ? 134 MET A HG2  2  
ATOM 4267  H HG3  . MET A 1 134 ? 138.830 -11.235 -96.395  1.00 0.00 ? 134 MET A HG3  2  
ATOM 4268  H HE1  . MET A 1 134 ? 136.411 -7.638  -97.711  1.00 0.00 ? 134 MET A HE1  2  
ATOM 4269  H HE2  . MET A 1 134 ? 137.065 -7.495  -96.082  1.00 0.00 ? 134 MET A HE2  2  
ATOM 4270  H HE3  . MET A 1 134 ? 136.046 -8.872  -96.498  1.00 0.00 ? 134 MET A HE3  2  
ATOM 4271  N N    . GLY A 1 135 ? 136.324 -14.040 -94.806  1.00 0.00 ? 135 GLY A N    2  
ATOM 4272  C CA   . GLY A 1 135 ? 136.468 -14.449 -93.380  1.00 0.00 ? 135 GLY A CA   2  
ATOM 4273  C C    . GLY A 1 135 ? 135.771 -13.398 -92.519  1.00 0.00 ? 135 GLY A C    2  
ATOM 4274  O O    . GLY A 1 135 ? 135.331 -13.658 -91.417  1.00 0.00 ? 135 GLY A O    2  
ATOM 4275  H H    . GLY A 1 135 ? 135.550 -14.339 -95.326  1.00 0.00 ? 135 GLY A H    2  
ATOM 4276  H HA2  . GLY A 1 135 ? 136.004 -15.416 -93.230  1.00 0.00 ? 135 GLY A HA2  2  
ATOM 4277  H HA3  . GLY A 1 135 ? 137.512 -14.498 -93.116  1.00 0.00 ? 135 GLY A HA3  2  
ATOM 4278  N N    . VAL A 1 136 ? 135.664 -12.210 -93.042  1.00 0.00 ? 136 VAL A N    2  
ATOM 4279  C CA   . VAL A 1 136 ? 134.991 -11.110 -92.301  1.00 0.00 ? 136 VAL A CA   2  
ATOM 4280  C C    . VAL A 1 136 ? 133.607 -11.575 -91.852  1.00 0.00 ? 136 VAL A C    2  
ATOM 4281  O O    . VAL A 1 136 ? 133.095 -12.572 -92.321  1.00 0.00 ? 136 VAL A O    2  
ATOM 4282  C CB   . VAL A 1 136 ? 134.841 -9.903  -93.222  1.00 0.00 ? 136 VAL A CB   2  
ATOM 4283  C CG1  . VAL A 1 136 ? 133.839 -8.917  -92.619  1.00 0.00 ? 136 VAL A CG1  2  
ATOM 4284  C CG2  . VAL A 1 136 ? 136.197 -9.212  -93.379  1.00 0.00 ? 136 VAL A CG2  2  
ATOM 4285  H H    . VAL A 1 136 ? 136.027 -12.053 -93.938  1.00 0.00 ? 136 VAL A H    2  
ATOM 4286  H HA   . VAL A 1 136 ? 135.581 -10.838 -91.439  1.00 0.00 ? 136 VAL A HA   2  
ATOM 4287  H HB   . VAL A 1 136 ? 134.486 -10.233 -94.188  1.00 0.00 ? 136 VAL A HB   2  
ATOM 4288  H HG11 . VAL A 1 136 ? 133.913 -7.971  -93.135  1.00 0.00 ? 136 VAL A HG11 2  
ATOM 4289  H HG12 . VAL A 1 136 ? 134.059 -8.774  -91.572  1.00 0.00 ? 136 VAL A HG12 2  
ATOM 4290  H HG13 . VAL A 1 136 ? 132.839 -9.308  -92.725  1.00 0.00 ? 136 VAL A HG13 2  
ATOM 4291  H HG21 . VAL A 1 136 ? 136.238 -8.713  -94.335  1.00 0.00 ? 136 VAL A HG21 2  
ATOM 4292  H HG22 . VAL A 1 136 ? 136.984 -9.949  -93.322  1.00 0.00 ? 136 VAL A HG22 2  
ATOM 4293  H HG23 . VAL A 1 136 ? 136.325 -8.487  -92.589  1.00 0.00 ? 136 VAL A HG23 2  
ATOM 4294  N N    . GLU A 1 137 ? 132.991 -10.858 -90.955  1.00 0.00 ? 137 GLU A N    2  
ATOM 4295  C CA   . GLU A 1 137 ? 131.636 -11.268 -90.495  1.00 0.00 ? 137 GLU A CA   2  
ATOM 4296  C C    . GLU A 1 137 ? 130.777 -10.027 -90.256  1.00 0.00 ? 137 GLU A C    2  
ATOM 4297  O O    . GLU A 1 137 ? 131.284 -8.932  -90.112  1.00 0.00 ? 137 GLU A O    2  
ATOM 4298  C CB   . GLU A 1 137 ? 131.758 -12.059 -89.191  1.00 0.00 ? 137 GLU A CB   2  
ATOM 4299  C CG   . GLU A 1 137 ? 132.685 -13.257 -89.404  1.00 0.00 ? 137 GLU A CG   2  
ATOM 4300  C CD   . GLU A 1 137 ? 132.907 -13.976 -88.072  1.00 0.00 ? 137 GLU A CD   2  
ATOM 4301  O OE1  . GLU A 1 137 ? 133.616 -13.434 -87.241  1.00 0.00 ? 137 GLU A OE1  2  
ATOM 4302  O OE2  . GLU A 1 137 ? 132.364 -15.056 -87.907  1.00 0.00 ? 137 GLU A OE2  2  
ATOM 4303  H H    . GLU A 1 137 ? 133.421 -10.049 -90.600  1.00 0.00 ? 137 GLU A H    2  
ATOM 4304  H HA   . GLU A 1 137 ? 131.187 -11.893 -91.253  1.00 0.00 ? 137 GLU A HA   2  
ATOM 4305  H HB2  . GLU A 1 137 ? 132.166 -11.422 -88.420  1.00 0.00 ? 137 GLU A HB2  2  
ATOM 4306  H HB3  . GLU A 1 137 ? 130.783 -12.411 -88.889  1.00 0.00 ? 137 GLU A HB3  2  
ATOM 4307  H HG2  . GLU A 1 137 ? 132.234 -13.940 -90.111  1.00 0.00 ? 137 GLU A HG2  2  
ATOM 4308  H HG3  . GLU A 1 137 ? 133.633 -12.916 -89.789  1.00 0.00 ? 137 GLU A HG3  2  
ATOM 4309  N N    . VAL A 1 138 ? 129.484 -10.188 -90.175  1.00 0.00 ? 138 VAL A N    2  
ATOM 4310  C CA   . VAL A 1 138 ? 128.610 -9.014  -89.905  1.00 0.00 ? 138 VAL A CA   2  
ATOM 4311  C C    . VAL A 1 138 ? 128.624 -8.790  -88.395  1.00 0.00 ? 138 VAL A C    2  
ATOM 4312  O O    . VAL A 1 138 ? 128.665 -9.720  -87.613  1.00 0.00 ? 138 VAL A O    2  
ATOM 4313  C CB   . VAL A 1 138 ? 127.185 -9.311  -90.380  1.00 0.00 ? 138 VAL A CB   2  
ATOM 4314  C CG1  . VAL A 1 138 ? 126.467 -7.999  -90.701  1.00 0.00 ? 138 VAL A CG1  2  
ATOM 4315  C CG2  . VAL A 1 138 ? 127.240 -10.181 -91.639  1.00 0.00 ? 138 VAL A CG2  2  
ATOM 4316  H H    . VAL A 1 138 ? 129.093 -11.083 -90.257  1.00 0.00 ? 138 VAL A H    2  
ATOM 4317  H HA   . VAL A 1 138 ? 128.997 -8.141  -90.411  1.00 0.00 ? 138 VAL A HA   2  
ATOM 4318  H HB   . VAL A 1 138 ? 126.648 -9.834  -89.602  1.00 0.00 ? 138 VAL A HB   2  
ATOM 4319  H HG11 . VAL A 1 138 ? 126.877 -7.577  -91.607  1.00 0.00 ? 138 VAL A HG11 2  
ATOM 4320  H HG12 . VAL A 1 138 ? 126.603 -7.304  -89.887  1.00 0.00 ? 138 VAL A HG12 2  
ATOM 4321  H HG13 . VAL A 1 138 ? 125.413 -8.191  -90.839  1.00 0.00 ? 138 VAL A HG13 2  
ATOM 4322  H HG21 . VAL A 1 138 ? 127.864 -9.703  -92.379  1.00 0.00 ? 138 VAL A HG21 2  
ATOM 4323  H HG22 . VAL A 1 138 ? 126.242 -10.306 -92.033  1.00 0.00 ? 138 VAL A HG22 2  
ATOM 4324  H HG23 . VAL A 1 138 ? 127.653 -11.147 -91.390  1.00 0.00 ? 138 VAL A HG23 2  
ATOM 4325  N N    . VAL A 1 139 ? 128.591 -7.552  -87.983  1.00 0.00 ? 139 VAL A N    2  
ATOM 4326  C CA   . VAL A 1 139 ? 128.602 -7.242  -86.529  1.00 0.00 ? 139 VAL A CA   2  
ATOM 4327  C C    . VAL A 1 139 ? 127.166 -7.017  -86.049  1.00 0.00 ? 139 VAL A C    2  
ATOM 4328  O O    . VAL A 1 139 ? 126.908 -6.891  -84.869  1.00 0.00 ? 139 VAL A O    2  
ATOM 4329  C CB   . VAL A 1 139 ? 129.430 -5.977  -86.294  1.00 0.00 ? 139 VAL A CB   2  
ATOM 4330  C CG1  . VAL A 1 139 ? 128.633 -4.753  -86.727  1.00 0.00 ? 139 VAL A CG1  2  
ATOM 4331  C CG2  . VAL A 1 139 ? 129.779 -5.860  -84.809  1.00 0.00 ? 139 VAL A CG2  2  
ATOM 4332  H H    . VAL A 1 139 ? 128.557 -6.823  -88.636  1.00 0.00 ? 139 VAL A H    2  
ATOM 4333  H HA   . VAL A 1 139 ? 129.040 -8.067  -85.986  1.00 0.00 ? 139 VAL A HA   2  
ATOM 4334  H HB   . VAL A 1 139 ? 130.333 -6.027  -86.877  1.00 0.00 ? 139 VAL A HB   2  
ATOM 4335  H HG11 . VAL A 1 139 ? 129.314 -3.962  -87.001  1.00 0.00 ? 139 VAL A HG11 2  
ATOM 4336  H HG12 . VAL A 1 139 ? 128.005 -4.425  -85.915  1.00 0.00 ? 139 VAL A HG12 2  
ATOM 4337  H HG13 . VAL A 1 139 ? 128.020 -5.008  -87.576  1.00 0.00 ? 139 VAL A HG13 2  
ATOM 4338  H HG21 . VAL A 1 139 ? 128.940 -5.438  -84.273  1.00 0.00 ? 139 VAL A HG21 2  
ATOM 4339  H HG22 . VAL A 1 139 ? 130.640 -5.220  -84.690  1.00 0.00 ? 139 VAL A HG22 2  
ATOM 4340  H HG23 . VAL A 1 139 ? 130.000 -6.840  -84.413  1.00 0.00 ? 139 VAL A HG23 2  
ATOM 4341  N N    . GLY A 1 140 ? 126.231 -6.970  -86.958  1.00 0.00 ? 140 GLY A N    2  
ATOM 4342  C CA   . GLY A 1 140 ? 124.811 -6.756  -86.558  1.00 0.00 ? 140 GLY A CA   2  
ATOM 4343  C C    . GLY A 1 140 ? 123.982 -7.983  -86.945  1.00 0.00 ? 140 GLY A C    2  
ATOM 4344  O O    . GLY A 1 140 ? 124.276 -9.092  -86.547  1.00 0.00 ? 140 GLY A O    2  
ATOM 4345  H H    . GLY A 1 140 ? 126.462 -7.075  -87.904  1.00 0.00 ? 140 GLY A H    2  
ATOM 4346  H HA2  . GLY A 1 140 ? 124.757 -6.604  -85.490  1.00 0.00 ? 140 GLY A HA2  2  
ATOM 4347  H HA3  . GLY A 1 140 ? 124.421 -5.887  -87.066  1.00 0.00 ? 140 GLY A HA3  2  
ATOM 4348  N N    . ALA A 1 141 ? 122.947 -7.793  -87.717  1.00 0.00 ? 141 ALA A N    2  
ATOM 4349  C CA   . ALA A 1 141 ? 122.102 -8.950  -88.126  1.00 0.00 ? 141 ALA A CA   2  
ATOM 4350  C C    . ALA A 1 141 ? 121.828 -9.834  -86.907  1.00 0.00 ? 141 ALA A C    2  
ATOM 4351  O O    . ALA A 1 141 ? 122.211 -10.986 -86.866  1.00 0.00 ? 141 ALA A O    2  
ATOM 4352  C CB   . ALA A 1 141 ? 122.832 -9.764  -89.197  1.00 0.00 ? 141 ALA A CB   2  
ATOM 4353  H H    . ALA A 1 141 ? 122.726 -6.890  -88.028  1.00 0.00 ? 141 ALA A H    2  
ATOM 4354  H HA   . ALA A 1 141 ? 121.166 -8.588  -88.526  1.00 0.00 ? 141 ALA A HA   2  
ATOM 4355  H HB1  . ALA A 1 141 ? 123.617 -10.345 -88.736  1.00 0.00 ? 141 ALA A HB1  2  
ATOM 4356  H HB2  . ALA A 1 141 ? 123.261 -9.095  -89.929  1.00 0.00 ? 141 ALA A HB2  2  
ATOM 4357  H HB3  . ALA A 1 141 ? 122.133 -10.427 -89.685  1.00 0.00 ? 141 ALA A HB3  2  
ATOM 4358  N N    . PRO A 1 142 ? 121.170 -9.288  -85.919  1.00 0.00 ? 142 PRO A N    2  
ATOM 4359  C CA   . PRO A 1 142 ? 120.848 -10.046 -84.678  1.00 0.00 ? 142 PRO A CA   2  
ATOM 4360  C C    . PRO A 1 142 ? 119.923 -11.239 -84.940  1.00 0.00 ? 142 PRO A C    2  
ATOM 4361  O O    . PRO A 1 142 ? 119.669 -11.606 -86.070  1.00 0.00 ? 142 PRO A O    2  
ATOM 4362  C CB   . PRO A 1 142 ? 120.141 -8.997  -83.819  1.00 0.00 ? 142 PRO A CB   2  
ATOM 4363  C CG   . PRO A 1 142 ? 120.020 -7.693  -84.620  1.00 0.00 ? 142 PRO A CG   2  
ATOM 4364  C CD   . PRO A 1 142 ? 120.706 -7.879  -85.977  1.00 0.00 ? 142 PRO A CD   2  
ATOM 4365  H HA   . PRO A 1 142 ? 121.751 -10.367 -84.187  1.00 0.00 ? 142 PRO A HA   2  
ATOM 4366  H HB2  . PRO A 1 142 ? 119.156 -9.352  -83.551  1.00 0.00 ? 142 PRO A HB2  2  
ATOM 4367  H HB3  . PRO A 1 142 ? 120.716 -8.815  -82.923  1.00 0.00 ? 142 PRO A HB3  2  
ATOM 4368  H HG2  . PRO A 1 142 ? 118.977 -7.456  -84.769  1.00 0.00 ? 142 PRO A HG2  2  
ATOM 4369  H HG3  . PRO A 1 142 ? 120.500 -6.891  -84.082  1.00 0.00 ? 142 PRO A HG3  2  
ATOM 4370  H HD2  . PRO A 1 142 ? 119.999 -7.737  -86.783  1.00 0.00 ? 142 PRO A HD2  2  
ATOM 4371  H HD3  . PRO A 1 142 ? 121.546 -7.212  -86.076  1.00 0.00 ? 142 PRO A HD3  2  
ATOM 4372  N N    . GLU A 1 143 ? 119.418 -11.845 -83.900  1.00 0.00 ? 143 GLU A N    2  
ATOM 4373  C CA   . GLU A 1 143 ? 118.509 -13.013 -84.082  1.00 0.00 ? 143 GLU A CA   2  
ATOM 4374  C C    . GLU A 1 143 ? 117.535 -13.084 -82.903  1.00 0.00 ? 143 GLU A C    2  
ATOM 4375  O O    . GLU A 1 143 ? 117.524 -12.225 -82.044  1.00 0.00 ? 143 GLU A O    2  
ATOM 4376  C CB   . GLU A 1 143 ? 119.336 -14.299 -84.139  1.00 0.00 ? 143 GLU A CB   2  
ATOM 4377  C CG   . GLU A 1 143 ? 118.408 -15.494 -84.359  1.00 0.00 ? 143 GLU A CG   2  
ATOM 4378  C CD   . GLU A 1 143 ? 119.177 -16.616 -85.058  1.00 0.00 ? 143 GLU A CD   2  
ATOM 4379  O OE1  . GLU A 1 143 ? 119.812 -16.336 -86.062  1.00 0.00 ? 143 GLU A OE1  2  
ATOM 4380  O OE2  . GLU A 1 143 ? 119.118 -17.737 -84.579  1.00 0.00 ? 143 GLU A OE2  2  
ATOM 4381  H H    . GLU A 1 143 ? 119.636 -11.532 -82.997  1.00 0.00 ? 143 GLU A H    2  
ATOM 4382  H HA   . GLU A 1 143 ? 117.955 -12.898 -85.001  1.00 0.00 ? 143 GLU A HA   2  
ATOM 4383  H HB2  . GLU A 1 143 ? 120.043 -14.235 -84.955  1.00 0.00 ? 143 GLU A HB2  2  
ATOM 4384  H HB3  . GLU A 1 143 ? 119.870 -14.426 -83.209  1.00 0.00 ? 143 GLU A HB3  2  
ATOM 4385  H HG2  . GLU A 1 143 ? 118.044 -15.847 -83.405  1.00 0.00 ? 143 GLU A HG2  2  
ATOM 4386  H HG3  . GLU A 1 143 ? 117.574 -15.195 -84.975  1.00 0.00 ? 143 GLU A HG3  2  
ATOM 4387  N N    . VAL A 1 144 ? 116.716 -14.099 -82.855  1.00 0.00 ? 144 VAL A N    2  
ATOM 4388  C CA   . VAL A 1 144 ? 115.746 -14.218 -81.731  1.00 0.00 ? 144 VAL A CA   2  
ATOM 4389  C C    . VAL A 1 144 ? 115.446 -15.696 -81.466  1.00 0.00 ? 144 VAL A C    2  
ATOM 4390  O O    . VAL A 1 144 ? 115.763 -16.556 -82.263  1.00 0.00 ? 144 VAL A O    2  
ATOM 4391  C CB   . VAL A 1 144 ? 114.449 -13.493 -82.096  1.00 0.00 ? 144 VAL A CB   2  
ATOM 4392  C CG1  . VAL A 1 144 ? 114.687 -11.982 -82.077  1.00 0.00 ? 144 VAL A CG1  2  
ATOM 4393  C CG2  . VAL A 1 144 ? 114.005 -13.921 -83.497  1.00 0.00 ? 144 VAL A CG2  2  
ATOM 4394  H H    . VAL A 1 144 ? 116.739 -14.782 -83.558  1.00 0.00 ? 144 VAL A H    2  
ATOM 4395  H HA   . VAL A 1 144 ? 116.168 -13.773 -80.842  1.00 0.00 ? 144 VAL A HA   2  
ATOM 4396  H HB   . VAL A 1 144 ? 113.681 -13.746 -81.379  1.00 0.00 ? 144 VAL A HB   2  
ATOM 4397  H HG11 . VAL A 1 144 ? 113.772 -11.470 -82.339  1.00 0.00 ? 144 VAL A HG11 2  
ATOM 4398  H HG12 . VAL A 1 144 ? 115.457 -11.729 -82.790  1.00 0.00 ? 144 VAL A HG12 2  
ATOM 4399  H HG13 . VAL A 1 144 ? 114.998 -11.678 -81.088  1.00 0.00 ? 144 VAL A HG13 2  
ATOM 4400  H HG21 . VAL A 1 144 ? 113.942 -14.998 -83.540  1.00 0.00 ? 144 VAL A HG21 2  
ATOM 4401  H HG22 . VAL A 1 144 ? 114.723 -13.572 -84.224  1.00 0.00 ? 144 VAL A HG22 2  
ATOM 4402  H HG23 . VAL A 1 144 ? 113.036 -13.495 -83.712  1.00 0.00 ? 144 VAL A HG23 2  
ATOM 4403  N N    . LYS A 1 145 ? 114.837 -15.995 -80.351  1.00 0.00 ? 145 LYS A N    2  
ATOM 4404  C CA   . LYS A 1 145 ? 114.516 -17.416 -80.034  1.00 0.00 ? 145 LYS A CA   2  
ATOM 4405  C C    . LYS A 1 145 ? 113.843 -17.491 -78.662  1.00 0.00 ? 145 LYS A C    2  
ATOM 4406  O O    . LYS A 1 145 ? 113.974 -16.601 -77.846  1.00 0.00 ? 145 LYS A O    2  
ATOM 4407  C CB   . LYS A 1 145 ? 115.806 -18.239 -80.016  1.00 0.00 ? 145 LYS A CB   2  
ATOM 4408  C CG   . LYS A 1 145 ? 115.522 -19.618 -79.418  1.00 0.00 ? 145 LYS A CG   2  
ATOM 4409  C CD   . LYS A 1 145 ? 116.468 -20.649 -80.039  1.00 0.00 ? 145 LYS A CD   2  
ATOM 4410  C CE   . LYS A 1 145 ? 116.032 -22.056 -79.626  1.00 0.00 ? 145 LYS A CE   2  
ATOM 4411  N NZ   . LYS A 1 145 ? 114.548 -22.162 -79.715  1.00 0.00 ? 145 LYS A NZ   2  
ATOM 4412  H H    . LYS A 1 145 ? 114.589 -15.285 -79.722  1.00 0.00 ? 145 LYS A H    2  
ATOM 4413  H HA   . LYS A 1 145 ? 113.847 -17.809 -80.785  1.00 0.00 ? 145 LYS A HA   2  
ATOM 4414  H HB2  . LYS A 1 145 ? 116.174 -18.352 -81.026  1.00 0.00 ? 145 LYS A HB2  2  
ATOM 4415  H HB3  . LYS A 1 145 ? 116.547 -17.734 -79.416  1.00 0.00 ? 145 LYS A HB3  2  
ATOM 4416  H HG2  . LYS A 1 145 ? 115.676 -19.585 -78.349  1.00 0.00 ? 145 LYS A HG2  2  
ATOM 4417  H HG3  . LYS A 1 145 ? 114.501 -19.899 -79.626  1.00 0.00 ? 145 LYS A HG3  2  
ATOM 4418  H HD2  . LYS A 1 145 ? 116.437 -20.562 -81.115  1.00 0.00 ? 145 LYS A HD2  2  
ATOM 4419  H HD3  . LYS A 1 145 ? 117.475 -20.470 -79.691  1.00 0.00 ? 145 LYS A HD3  2  
ATOM 4420  H HE2  . LYS A 1 145 ? 116.485 -22.781 -80.285  1.00 0.00 ? 145 LYS A HE2  2  
ATOM 4421  H HE3  . LYS A 1 145 ? 116.346 -22.247 -78.610  1.00 0.00 ? 145 LYS A HE3  2  
ATOM 4422  H HZ1  . LYS A 1 145 ? 114.290 -23.092 -80.102  1.00 0.00 ? 145 LYS A HZ1  2  
ATOM 4423  H HZ2  . LYS A 1 145 ? 114.184 -21.412 -80.338  1.00 0.00 ? 145 LYS A HZ2  2  
ATOM 4424  H HZ3  . LYS A 1 145 ? 114.135 -22.058 -78.766  1.00 0.00 ? 145 LYS A HZ3  2  
ATOM 4425  N N    . ASP A 1 146 ? 113.122 -18.547 -78.401  1.00 0.00 ? 146 ASP A N    2  
ATOM 4426  C CA   . ASP A 1 146 ? 112.443 -18.678 -77.081  1.00 0.00 ? 146 ASP A CA   2  
ATOM 4427  C C    . ASP A 1 146 ? 113.176 -19.714 -76.228  1.00 0.00 ? 146 ASP A C    2  
ATOM 4428  O O    . ASP A 1 146 ? 114.025 -19.383 -75.425  1.00 0.00 ? 146 ASP A O    2  
ATOM 4429  C CB   . ASP A 1 146 ? 110.995 -19.125 -77.295  1.00 0.00 ? 146 ASP A CB   2  
ATOM 4430  C CG   . ASP A 1 146 ? 110.048 -17.972 -76.961  1.00 0.00 ? 146 ASP A CG   2  
ATOM 4431  O OD1  . ASP A 1 146 ? 110.362 -17.217 -76.055  1.00 0.00 ? 146 ASP A OD1  2  
ATOM 4432  O OD2  . ASP A 1 146 ? 109.025 -17.861 -77.615  1.00 0.00 ? 146 ASP A OD2  2  
ATOM 4433  H H    . ASP A 1 146 ? 113.028 -19.255 -79.072  1.00 0.00 ? 146 ASP A H    2  
ATOM 4434  H HA   . ASP A 1 146 ? 112.453 -17.723 -76.575  1.00 0.00 ? 146 ASP A HA   2  
ATOM 4435  H HB2  . ASP A 1 146 ? 110.857 -19.418 -78.326  1.00 0.00 ? 146 ASP A HB2  2  
ATOM 4436  H HB3  . ASP A 1 146 ? 110.779 -19.964 -76.651  1.00 0.00 ? 146 ASP A HB3  2  
ATOM 4437  N N    . ALA A 1 147 ? 112.857 -20.968 -76.397  1.00 0.00 ? 147 ALA A N    2  
ATOM 4438  C CA   . ALA A 1 147 ? 113.537 -22.024 -75.594  1.00 0.00 ? 147 ALA A CA   2  
ATOM 4439  C C    . ALA A 1 147 ? 113.192 -21.843 -74.115  1.00 0.00 ? 147 ALA A C    2  
ATOM 4440  O O    . ALA A 1 147 ? 112.112 -21.349 -73.835  1.00 0.00 ? 147 ALA A O    2  
ATOM 4441  C CB   . ALA A 1 147 ? 115.051 -21.913 -75.783  1.00 0.00 ? 147 ALA A CB   2  
ATOM 4442  H H    . ALA A 1 147 ? 112.169 -21.215 -77.050  1.00 0.00 ? 147 ALA A H    2  
ATOM 4443  H HA   . ALA A 1 147 ? 113.204 -22.997 -75.925  1.00 0.00 ? 147 ALA A HA   2  
ATOM 4444  H HB1  . ALA A 1 147 ? 115.510 -22.870 -75.586  1.00 0.00 ? 147 ALA A HB1  2  
ATOM 4445  H HB2  . ALA A 1 147 ? 115.446 -21.176 -75.100  1.00 0.00 ? 147 ALA A HB2  2  
ATOM 4446  H HB3  . ALA A 1 147 ? 115.266 -21.613 -76.798  1.00 0.00 ? 147 ALA A HB3  2  
ATOM 4447  N N    . MET A 1 1   ? 130.129 18.770  -118.606 1.00 0.00 ? 1   MET A N    3  
ATOM 4448  C CA   . MET A 1 1   ? 130.274 19.330  -117.232 1.00 0.00 ? 1   MET A CA   3  
ATOM 4449  C C    . MET A 1 1   ? 130.215 18.193  -116.209 1.00 0.00 ? 1   MET A C    3  
ATOM 4450  O O    . MET A 1 1   ? 130.254 18.417  -115.016 1.00 0.00 ? 1   MET A O    3  
ATOM 4451  C CB   . MET A 1 1   ? 129.139 20.320  -116.962 1.00 0.00 ? 1   MET A CB   3  
ATOM 4452  C CG   . MET A 1 1   ? 129.544 21.263  -115.827 1.00 0.00 ? 1   MET A CG   3  
ATOM 4453  S SD   . MET A 1 1   ? 129.804 22.928  -116.489 1.00 0.00 ? 1   MET A SD   3  
ATOM 4454  C CE   . MET A 1 1   ? 128.752 23.808  -115.309 1.00 0.00 ? 1   MET A CE   3  
ATOM 4455  H H1   . MET A 1 1   ? 129.940 19.542  -119.277 1.00 0.00 ? 1   MET A H1   3  
ATOM 4456  H HA   . MET A 1 1   ? 131.224 19.839  -117.150 1.00 0.00 ? 1   MET A HA   3  
ATOM 4457  H HB2  . MET A 1 1   ? 128.941 20.893  -117.855 1.00 0.00 ? 1   MET A HB2  3  
ATOM 4458  H HB3  . MET A 1 1   ? 128.249 19.778  -116.677 1.00 0.00 ? 1   MET A HB3  3  
ATOM 4459  H HG2  . MET A 1 1   ? 128.759 21.290  -115.084 1.00 0.00 ? 1   MET A HG2  3  
ATOM 4460  H HG3  . MET A 1 1   ? 130.457 20.909  -115.372 1.00 0.00 ? 1   MET A HG3  3  
ATOM 4461  H HE1  . MET A 1 1   ? 128.852 23.356  -114.332 1.00 0.00 ? 1   MET A HE1  3  
ATOM 4462  H HE2  . MET A 1 1   ? 127.723 23.749  -115.627 1.00 0.00 ? 1   MET A HE2  3  
ATOM 4463  H HE3  . MET A 1 1   ? 129.054 24.846  -115.264 1.00 0.00 ? 1   MET A HE3  3  
ATOM 4464  N N    . LYS A 1 2   ? 130.121 16.974  -116.666 1.00 0.00 ? 2   LYS A N    3  
ATOM 4465  C CA   . LYS A 1 2   ? 130.058 15.827  -115.718 1.00 0.00 ? 2   LYS A CA   3  
ATOM 4466  C C    . LYS A 1 2   ? 130.058 14.513  -116.502 1.00 0.00 ? 2   LYS A C    3  
ATOM 4467  O O    . LYS A 1 2   ? 129.176 13.689  -116.353 1.00 0.00 ? 2   LYS A O    3  
ATOM 4468  C CB   . LYS A 1 2   ? 128.780 15.923  -114.883 1.00 0.00 ? 2   LYS A CB   3  
ATOM 4469  C CG   . LYS A 1 2   ? 127.727 16.724  -115.654 1.00 0.00 ? 2   LYS A CG   3  
ATOM 4470  C CD   . LYS A 1 2   ? 126.333 16.371  -115.132 1.00 0.00 ? 2   LYS A CD   3  
ATOM 4471  C CE   . LYS A 1 2   ? 125.622 15.472  -116.145 1.00 0.00 ? 2   LYS A CE   3  
ATOM 4472  N NZ   . LYS A 1 2   ? 124.220 15.234  -115.700 1.00 0.00 ? 2   LYS A NZ   3  
ATOM 4473  H H    . LYS A 1 2   ? 130.090 16.814  -117.633 1.00 0.00 ? 2   LYS A H    3  
ATOM 4474  H HA   . LYS A 1 2   ? 130.917 15.854  -115.064 1.00 0.00 ? 2   LYS A HA   3  
ATOM 4475  H HB2  . LYS A 1 2   ? 128.403 14.930  -114.685 1.00 0.00 ? 2   LYS A HB2  3  
ATOM 4476  H HB3  . LYS A 1 2   ? 128.994 16.421  -113.950 1.00 0.00 ? 2   LYS A HB3  3  
ATOM 4477  H HG2  . LYS A 1 2   ? 127.907 17.781  -115.514 1.00 0.00 ? 2   LYS A HG2  3  
ATOM 4478  H HG3  . LYS A 1 2   ? 127.789 16.484  -116.704 1.00 0.00 ? 2   LYS A HG3  3  
ATOM 4479  H HD2  . LYS A 1 2   ? 126.422 15.852  -114.189 1.00 0.00 ? 2   LYS A HD2  3  
ATOM 4480  H HD3  . LYS A 1 2   ? 125.761 17.275  -114.993 1.00 0.00 ? 2   LYS A HD3  3  
ATOM 4481  H HE2  . LYS A 1 2   ? 125.616 15.952  -117.112 1.00 0.00 ? 2   LYS A HE2  3  
ATOM 4482  H HE3  . LYS A 1 2   ? 126.142 14.528  -116.215 1.00 0.00 ? 2   LYS A HE3  3  
ATOM 4483  H HZ1  . LYS A 1 2   ? 124.183 14.383  -115.105 1.00 0.00 ? 2   LYS A HZ1  3  
ATOM 4484  H HZ2  . LYS A 1 2   ? 123.610 15.103  -116.532 1.00 0.00 ? 2   LYS A HZ2  3  
ATOM 4485  H HZ3  . LYS A 1 2   ? 123.886 16.053  -115.151 1.00 0.00 ? 2   LYS A HZ3  3  
ATOM 4486  N N    . LYS A 1 3   ? 131.039 14.310  -117.340 1.00 0.00 ? 3   LYS A N    3  
ATOM 4487  C CA   . LYS A 1 3   ? 131.094 13.051  -118.133 1.00 0.00 ? 3   LYS A CA   3  
ATOM 4488  C C    . LYS A 1 3   ? 132.448 12.367  -117.932 1.00 0.00 ? 3   LYS A C    3  
ATOM 4489  O O    . LYS A 1 3   ? 133.477 12.881  -118.326 1.00 0.00 ? 3   LYS A O    3  
ATOM 4490  C CB   . LYS A 1 3   ? 130.917 13.382  -119.617 1.00 0.00 ? 3   LYS A CB   3  
ATOM 4491  C CG   . LYS A 1 3   ? 129.904 12.419  -120.241 1.00 0.00 ? 3   LYS A CG   3  
ATOM 4492  C CD   . LYS A 1 3   ? 129.476 12.946  -121.611 1.00 0.00 ? 3   LYS A CD   3  
ATOM 4493  C CE   . LYS A 1 3   ? 128.386 14.006  -121.433 1.00 0.00 ? 3   LYS A CE   3  
ATOM 4494  N NZ   . LYS A 1 3   ? 127.047 13.357  -121.493 1.00 0.00 ? 3   LYS A NZ   3  
ATOM 4495  H H    . LYS A 1 3   ? 131.737 14.987  -117.448 1.00 0.00 ? 3   LYS A H    3  
ATOM 4496  H HA   . LYS A 1 3   ? 130.304 12.387  -117.816 1.00 0.00 ? 3   LYS A HA   3  
ATOM 4497  H HB2  . LYS A 1 3   ? 130.561 14.397  -119.719 1.00 0.00 ? 3   LYS A HB2  3  
ATOM 4498  H HB3  . LYS A 1 3   ? 131.867 13.281  -120.123 1.00 0.00 ? 3   LYS A HB3  3  
ATOM 4499  H HG2  . LYS A 1 3   ? 130.357 11.444  -120.355 1.00 0.00 ? 3   LYS A HG2  3  
ATOM 4500  H HG3  . LYS A 1 3   ? 129.039 12.341  -119.601 1.00 0.00 ? 3   LYS A HG3  3  
ATOM 4501  H HD2  . LYS A 1 3   ? 130.327 13.385  -122.111 1.00 0.00 ? 3   LYS A HD2  3  
ATOM 4502  H HD3  . LYS A 1 3   ? 129.088 12.133  -122.206 1.00 0.00 ? 3   LYS A HD3  3  
ATOM 4503  H HE2  . LYS A 1 3   ? 128.509 14.492  -120.476 1.00 0.00 ? 3   LYS A HE2  3  
ATOM 4504  H HE3  . LYS A 1 3   ? 128.466 14.740  -122.222 1.00 0.00 ? 3   LYS A HE3  3  
ATOM 4505  H HZ1  . LYS A 1 3   ? 126.521 13.565  -120.621 1.00 0.00 ? 3   LYS A HZ1  3  
ATOM 4506  H HZ2  . LYS A 1 3   ? 127.165 12.328  -121.592 1.00 0.00 ? 3   LYS A HZ2  3  
ATOM 4507  H HZ3  . LYS A 1 3   ? 126.518 13.726  -122.308 1.00 0.00 ? 3   LYS A HZ3  3  
ATOM 4508  N N    . VAL A 1 4   ? 132.457 11.207  -117.335 1.00 0.00 ? 4   VAL A N    3  
ATOM 4509  C CA   . VAL A 1 4   ? 133.745 10.488  -117.129 1.00 0.00 ? 4   VAL A CA   3  
ATOM 4510  C C    . VAL A 1 4   ? 134.318 10.108  -118.493 1.00 0.00 ? 4   VAL A C    3  
ATOM 4511  O O    . VAL A 1 4   ? 133.596 9.992   -119.463 1.00 0.00 ? 4   VAL A O    3  
ATOM 4512  C CB   . VAL A 1 4   ? 133.500 9.222   -116.307 1.00 0.00 ? 4   VAL A CB   3  
ATOM 4513  C CG1  . VAL A 1 4   ? 132.265 8.500   -116.843 1.00 0.00 ? 4   VAL A CG1  3  
ATOM 4514  C CG2  . VAL A 1 4   ? 134.716 8.300   -116.417 1.00 0.00 ? 4   VAL A CG2  3  
ATOM 4515  H H    . VAL A 1 4   ? 131.617 10.802  -117.035 1.00 0.00 ? 4   VAL A H    3  
ATOM 4516  H HA   . VAL A 1 4   ? 134.442 11.130  -116.612 1.00 0.00 ? 4   VAL A HA   3  
ATOM 4517  H HB   . VAL A 1 4   ? 133.340 9.489   -115.272 1.00 0.00 ? 4   VAL A HB   3  
ATOM 4518  H HG11 . VAL A 1 4   ? 132.189 7.526   -116.385 1.00 0.00 ? 4   VAL A HG11 3  
ATOM 4519  H HG12 . VAL A 1 4   ? 132.350 8.390   -117.914 1.00 0.00 ? 4   VAL A HG12 3  
ATOM 4520  H HG13 . VAL A 1 4   ? 131.382 9.077   -116.610 1.00 0.00 ? 4   VAL A HG13 3  
ATOM 4521  H HG21 . VAL A 1 4   ? 134.677 7.558   -115.632 1.00 0.00 ? 4   VAL A HG21 3  
ATOM 4522  H HG22 . VAL A 1 4   ? 135.620 8.882   -116.316 1.00 0.00 ? 4   VAL A HG22 3  
ATOM 4523  H HG23 . VAL A 1 4   ? 134.709 7.809   -117.378 1.00 0.00 ? 4   VAL A HG23 3  
ATOM 4524  N N    . VAL A 1 5   ? 135.605 9.917   -118.589 1.00 0.00 ? 5   VAL A N    3  
ATOM 4525  C CA   . VAL A 1 5   ? 136.186 9.553   -119.908 1.00 0.00 ? 5   VAL A CA   3  
ATOM 4526  C C    . VAL A 1 5   ? 136.966 8.243   -119.808 1.00 0.00 ? 5   VAL A C    3  
ATOM 4527  O O    . VAL A 1 5   ? 137.110 7.532   -120.783 1.00 0.00 ? 5   VAL A O    3  
ATOM 4528  C CB   . VAL A 1 5   ? 137.112 10.663  -120.408 1.00 0.00 ? 5   VAL A CB   3  
ATOM 4529  C CG1  . VAL A 1 5   ? 136.301 11.935  -120.663 1.00 0.00 ? 5   VAL A CG1  3  
ATOM 4530  C CG2  . VAL A 1 5   ? 138.190 10.940  -119.360 1.00 0.00 ? 5   VAL A CG2  3  
ATOM 4531  H H    . VAL A 1 5   ? 136.181 10.017  -117.803 1.00 0.00 ? 5   VAL A H    3  
ATOM 4532  H HA   . VAL A 1 5   ? 135.390 9.397   -120.619 1.00 0.00 ? 5   VAL A HA   3  
ATOM 4533  H HB   . VAL A 1 5   ? 137.579 10.348  -121.330 1.00 0.00 ? 5   VAL A HB   3  
ATOM 4534  H HG11 . VAL A 1 5   ? 135.331 11.671  -121.055 1.00 0.00 ? 5   VAL A HG11 3  
ATOM 4535  H HG12 . VAL A 1 5   ? 136.822 12.556  -121.376 1.00 0.00 ? 5   VAL A HG12 3  
ATOM 4536  H HG13 . VAL A 1 5   ? 136.180 12.476  -119.735 1.00 0.00 ? 5   VAL A HG13 3  
ATOM 4537  H HG21 . VAL A 1 5   ? 137.769 11.526  -118.560 1.00 0.00 ? 5   VAL A HG21 3  
ATOM 4538  H HG22 . VAL A 1 5   ? 139.004 11.485  -119.816 1.00 0.00 ? 5   VAL A HG22 3  
ATOM 4539  H HG23 . VAL A 1 5   ? 138.558 10.005  -118.966 1.00 0.00 ? 5   VAL A HG23 3  
ATOM 4540  N N    . ALA A 1 6   ? 137.452 7.890   -118.645 1.00 0.00 ? 6   ALA A N    3  
ATOM 4541  C CA   . ALA A 1 6   ? 138.186 6.596   -118.545 1.00 0.00 ? 6   ALA A CA   3  
ATOM 4542  C C    . ALA A 1 6   ? 138.136 6.053   -117.112 1.00 0.00 ? 6   ALA A C    3  
ATOM 4543  O O    . ALA A 1 6   ? 138.733 6.589   -116.200 1.00 0.00 ? 6   ALA A O    3  
ATOM 4544  C CB   . ALA A 1 6   ? 139.637 6.775   -118.991 1.00 0.00 ? 6   ALA A CB   3  
ATOM 4545  H H    . ALA A 1 6   ? 137.320 8.457   -117.852 1.00 0.00 ? 6   ALA A H    3  
ATOM 4546  H HA   . ALA A 1 6   ? 137.690 5.882   -119.184 1.00 0.00 ? 6   ALA A HA   3  
ATOM 4547  H HB1  . ALA A 1 6   ? 139.942 7.799   -118.825 1.00 0.00 ? 6   ALA A HB1  3  
ATOM 4548  H HB2  . ALA A 1 6   ? 139.722 6.541   -120.043 1.00 0.00 ? 6   ALA A HB2  3  
ATOM 4549  H HB3  . ALA A 1 6   ? 140.274 6.114   -118.423 1.00 0.00 ? 6   ALA A HB3  3  
ATOM 4550  N N    . VAL A 1 7   ? 137.432 4.966   -116.934 1.00 0.00 ? 7   VAL A N    3  
ATOM 4551  C CA   . VAL A 1 7   ? 137.322 4.322   -115.593 1.00 0.00 ? 7   VAL A CA   3  
ATOM 4552  C C    . VAL A 1 7   ? 138.217 3.086   -115.568 1.00 0.00 ? 7   VAL A C    3  
ATOM 4553  O O    . VAL A 1 7   ? 137.742 1.973   -115.688 1.00 0.00 ? 7   VAL A O    3  
ATOM 4554  C CB   . VAL A 1 7   ? 135.886 3.858   -115.386 1.00 0.00 ? 7   VAL A CB   3  
ATOM 4555  C CG1  . VAL A 1 7   ? 135.383 3.162   -116.651 1.00 0.00 ? 7   VAL A CG1  3  
ATOM 4556  C CG2  . VAL A 1 7   ? 135.867 2.876   -114.219 1.00 0.00 ? 7   VAL A CG2  3  
ATOM 4557  H H    . VAL A 1 7   ? 136.980 4.557   -117.701 1.00 0.00 ? 7   VAL A H    3  
ATOM 4558  H HA   . VAL A 1 7   ? 137.574 5.016   -114.807 1.00 0.00 ? 7   VAL A HA   3  
ATOM 4559  H HB   . VAL A 1 7   ? 135.257 4.706   -115.160 1.00 0.00 ? 7   VAL A HB   3  
ATOM 4560  H HG11 . VAL A 1 7   ? 134.904 3.886   -117.294 1.00 0.00 ? 7   VAL A HG11 3  
ATOM 4561  H HG12 . VAL A 1 7   ? 134.672 2.394   -116.381 1.00 0.00 ? 7   VAL A HG12 3  
ATOM 4562  H HG13 . VAL A 1 7   ? 136.216 2.714   -117.172 1.00 0.00 ? 7   VAL A HG13 3  
ATOM 4563  H HG21 . VAL A 1 7   ? 135.827 1.867   -114.599 1.00 0.00 ? 7   VAL A HG21 3  
ATOM 4564  H HG22 . VAL A 1 7   ? 135.005 3.066   -113.600 1.00 0.00 ? 7   VAL A HG22 3  
ATOM 4565  H HG23 . VAL A 1 7   ? 136.767 3.002   -113.633 1.00 0.00 ? 7   VAL A HG23 3  
ATOM 4566  N N    . VAL A 1 8   ? 139.499 3.253   -115.482 1.00 0.00 ? 8   VAL A N    3  
ATOM 4567  C CA   . VAL A 1 8   ? 140.386 2.049   -115.534 1.00 0.00 ? 8   VAL A CA   3  
ATOM 4568  C C    . VAL A 1 8   ? 139.899 0.973   -114.556 1.00 0.00 ? 8   VAL A C    3  
ATOM 4569  O O    . VAL A 1 8   ? 140.338 0.915   -113.425 1.00 0.00 ? 8   VAL A O    3  
ATOM 4570  C CB   . VAL A 1 8   ? 141.824 2.434   -115.203 1.00 0.00 ? 8   VAL A CB   3  
ATOM 4571  C CG1  . VAL A 1 8   ? 142.738 1.246   -115.494 1.00 0.00 ? 8   VAL A CG1  3  
ATOM 4572  C CG2  . VAL A 1 8   ? 142.245 3.627   -116.065 1.00 0.00 ? 8   VAL A CG2  3  
ATOM 4573  H H    . VAL A 1 8   ? 139.875 4.159   -115.456 1.00 0.00 ? 8   VAL A H    3  
ATOM 4574  H HA   . VAL A 1 8   ? 140.340 1.666   -116.543 1.00 0.00 ? 8   VAL A HA   3  
ATOM 4575  H HB   . VAL A 1 8   ? 141.895 2.692   -114.159 1.00 0.00 ? 8   VAL A HB   3  
ATOM 4576  H HG11 . VAL A 1 8   ? 143.124 0.853   -114.565 1.00 0.00 ? 8   VAL A HG11 3  
ATOM 4577  H HG12 . VAL A 1 8   ? 143.558 1.565   -116.118 1.00 0.00 ? 8   VAL A HG12 3  
ATOM 4578  H HG13 . VAL A 1 8   ? 142.176 0.476   -116.004 1.00 0.00 ? 8   VAL A HG13 3  
ATOM 4579  H HG21 . VAL A 1 8   ? 142.817 4.319   -115.465 1.00 0.00 ? 8   VAL A HG21 3  
ATOM 4580  H HG22 . VAL A 1 8   ? 141.365 4.123   -116.448 1.00 0.00 ? 8   VAL A HG22 3  
ATOM 4581  H HG23 . VAL A 1 8   ? 142.851 3.279   -116.888 1.00 0.00 ? 8   VAL A HG23 3  
ATOM 4582  N N    . LYS A 1 9   ? 139.010 0.112   -114.992 1.00 0.00 ? 9   LYS A N    3  
ATOM 4583  C CA   . LYS A 1 9   ? 138.504 -0.977  -114.097 1.00 0.00 ? 9   LYS A CA   3  
ATOM 4584  C C    . LYS A 1 9   ? 139.499 -2.143  -114.103 1.00 0.00 ? 9   LYS A C    3  
ATOM 4585  O O    . LYS A 1 9   ? 139.128 -3.300  -114.108 1.00 0.00 ? 9   LYS A O    3  
ATOM 4586  C CB   . LYS A 1 9   ? 137.143 -1.463  -114.603 1.00 0.00 ? 9   LYS A CB   3  
ATOM 4587  C CG   . LYS A 1 9   ? 136.256 -1.835  -113.413 1.00 0.00 ? 9   LYS A CG   3  
ATOM 4588  C CD   . LYS A 1 9   ? 136.751 -3.146  -112.798 1.00 0.00 ? 9   LYS A CD   3  
ATOM 4589  C CE   . LYS A 1 9   ? 135.728 -3.651  -111.779 1.00 0.00 ? 9   LYS A CE   3  
ATOM 4590  N NZ   . LYS A 1 9   ? 134.379 -3.697  -112.410 1.00 0.00 ? 9   LYS A NZ   3  
ATOM 4591  H H    . LYS A 1 9   ? 138.682 0.181   -115.912 1.00 0.00 ? 9   LYS A H    3  
ATOM 4592  H HA   . LYS A 1 9   ? 138.401 -0.598  -113.094 1.00 0.00 ? 9   LYS A HA   3  
ATOM 4593  H HB2  . LYS A 1 9   ? 136.671 -0.677  -115.174 1.00 0.00 ? 9   LYS A HB2  3  
ATOM 4594  H HB3  . LYS A 1 9   ? 137.282 -2.330  -115.230 1.00 0.00 ? 9   LYS A HB3  3  
ATOM 4595  H HG2  . LYS A 1 9   ? 136.299 -1.049  -112.672 1.00 0.00 ? 9   LYS A HG2  3  
ATOM 4596  H HG3  . LYS A 1 9   ? 135.238 -1.959  -113.747 1.00 0.00 ? 9   LYS A HG3  3  
ATOM 4597  H HD2  . LYS A 1 9   ? 136.879 -3.882  -113.577 1.00 0.00 ? 9   LYS A HD2  3  
ATOM 4598  H HD3  . LYS A 1 9   ? 137.695 -2.978  -112.303 1.00 0.00 ? 9   LYS A HD3  3  
ATOM 4599  H HE2  . LYS A 1 9   ? 136.005 -4.642  -111.451 1.00 0.00 ? 9   LYS A HE2  3  
ATOM 4600  H HE3  . LYS A 1 9   ? 135.705 -2.985  -110.930 1.00 0.00 ? 9   LYS A HE3  3  
ATOM 4601  H HZ1  . LYS A 1 9   ? 133.932 -2.761  -112.342 1.00 0.00 ? 9   LYS A HZ1  3  
ATOM 4602  H HZ2  . LYS A 1 9   ? 133.790 -4.401  -111.919 1.00 0.00 ? 9   LYS A HZ2  3  
ATOM 4603  H HZ3  . LYS A 1 9   ? 134.473 -3.961  -113.411 1.00 0.00 ? 9   LYS A HZ3  3  
ATOM 4604  N N    . LEU A 1 10  ? 140.760 -1.829  -114.128 1.00 0.00 ? 10  LEU A N    3  
ATOM 4605  C CA   . LEU A 1 10  ? 141.827 -2.874  -114.162 1.00 0.00 ? 10  LEU A CA   3  
ATOM 4606  C C    . LEU A 1 10  ? 142.054 -3.485  -112.781 1.00 0.00 ? 10  LEU A C    3  
ATOM 4607  O O    . LEU A 1 10  ? 141.361 -3.192  -111.830 1.00 0.00 ? 10  LEU A O    3  
ATOM 4608  C CB   . LEU A 1 10  ? 143.131 -2.218  -114.609 1.00 0.00 ? 10  LEU A CB   3  
ATOM 4609  C CG   . LEU A 1 10  ? 143.695 -2.996  -115.798 1.00 0.00 ? 10  LEU A CG   3  
ATOM 4610  C CD1  . LEU A 1 10  ? 142.684 -2.978  -116.946 1.00 0.00 ? 10  LEU A CD1  3  
ATOM 4611  C CD2  . LEU A 1 10  ? 144.994 -2.343  -116.258 1.00 0.00 ? 10  LEU A CD2  3  
ATOM 4612  H H    . LEU A 1 10  ? 141.014 -0.883  -114.148 1.00 0.00 ? 10  LEU A H    3  
ATOM 4613  H HA   . LEU A 1 10  ? 141.594 -3.644  -114.885 1.00 0.00 ? 10  LEU A HA   3  
ATOM 4614  H HB2  . LEU A 1 10  ? 142.939 -1.198  -114.900 1.00 0.00 ? 10  LEU A HB2  3  
ATOM 4615  H HB3  . LEU A 1 10  ? 143.844 -2.235  -113.799 1.00 0.00 ? 10  LEU A HB3  3  
ATOM 4616  H HG   . LEU A 1 10  ? 143.886 -4.016  -115.503 1.00 0.00 ? 10  LEU A HG   3  
ATOM 4617  H HD11 . LEU A 1 10  ? 142.199 -3.940  -117.014 1.00 0.00 ? 10  LEU A HD11 3  
ATOM 4618  H HD12 . LEU A 1 10  ? 143.195 -2.765  -117.874 1.00 0.00 ? 10  LEU A HD12 3  
ATOM 4619  H HD13 . LEU A 1 10  ? 141.942 -2.214  -116.762 1.00 0.00 ? 10  LEU A HD13 3  
ATOM 4620  H HD21 . LEU A 1 10  ? 145.256 -1.549  -115.577 1.00 0.00 ? 10  LEU A HD21 3  
ATOM 4621  H HD22 . LEU A 1 10  ? 144.860 -1.941  -117.251 1.00 0.00 ? 10  LEU A HD22 3  
ATOM 4622  H HD23 . LEU A 1 10  ? 145.783 -3.081  -116.272 1.00 0.00 ? 10  LEU A HD23 3  
ATOM 4623  N N    . GLN A 1 11  ? 143.054 -4.323  -112.678 1.00 0.00 ? 11  GLN A N    3  
ATOM 4624  C CA   . GLN A 1 11  ? 143.396 -4.959  -111.375 1.00 0.00 ? 11  GLN A CA   3  
ATOM 4625  C C    . GLN A 1 11  ? 144.858 -4.645  -111.061 1.00 0.00 ? 11  GLN A C    3  
ATOM 4626  O O    . GLN A 1 11  ? 145.557 -4.066  -111.869 1.00 0.00 ? 11  GLN A O    3  
ATOM 4627  C CB   . GLN A 1 11  ? 143.203 -6.474  -111.473 1.00 0.00 ? 11  GLN A CB   3  
ATOM 4628  C CG   . GLN A 1 11  ? 143.687 -6.962  -112.840 1.00 0.00 ? 11  GLN A CG   3  
ATOM 4629  C CD   . GLN A 1 11  ? 142.551 -6.845  -113.856 1.00 0.00 ? 11  GLN A CD   3  
ATOM 4630  O OE1  . GLN A 1 11  ? 142.673 -7.296  -114.978 1.00 0.00 ? 11  GLN A OE1  3  
ATOM 4631  N NE2  . GLN A 1 11  ? 141.440 -6.253  -113.510 1.00 0.00 ? 11  GLN A NE2  3  
ATOM 4632  H H    . GLN A 1 11  ? 143.600 -4.518  -113.468 1.00 0.00 ? 11  GLN A H    3  
ATOM 4633  H HA   . GLN A 1 11  ? 142.772 -4.560  -110.595 1.00 0.00 ? 11  GLN A HA   3  
ATOM 4634  H HB2  . GLN A 1 11  ? 143.771 -6.960  -110.694 1.00 0.00 ? 11  GLN A HB2  3  
ATOM 4635  H HB3  . GLN A 1 11  ? 142.157 -6.712  -111.358 1.00 0.00 ? 11  GLN A HB3  3  
ATOM 4636  H HG2  . GLN A 1 11  ? 144.523 -6.358  -113.162 1.00 0.00 ? 11  GLN A HG2  3  
ATOM 4637  H HG3  . GLN A 1 11  ? 143.995 -7.995  -112.765 1.00 0.00 ? 11  GLN A HG3  3  
ATOM 4638  H HE21 . GLN A 1 11  ? 141.341 -5.889  -112.606 1.00 0.00 ? 11  GLN A HE21 3  
ATOM 4639  H HE22 . GLN A 1 11  ? 140.706 -6.172  -114.154 1.00 0.00 ? 11  GLN A HE22 3  
ATOM 4640  N N    . LEU A 1 12  ? 145.339 -5.022  -109.910 1.00 0.00 ? 12  LEU A N    3  
ATOM 4641  C CA   . LEU A 1 12  ? 146.768 -4.734  -109.590 1.00 0.00 ? 12  LEU A CA   3  
ATOM 4642  C C    . LEU A 1 12  ? 147.198 -5.516  -108.347 1.00 0.00 ? 12  LEU A C    3  
ATOM 4643  O O    . LEU A 1 12  ? 146.381 -5.935  -107.549 1.00 0.00 ? 12  LEU A O    3  
ATOM 4644  C CB   . LEU A 1 12  ? 146.945 -3.234  -109.326 1.00 0.00 ? 12  LEU A CB   3  
ATOM 4645  C CG   . LEU A 1 12  ? 147.534 -2.545  -110.567 1.00 0.00 ? 12  LEU A CG   3  
ATOM 4646  C CD1  . LEU A 1 12  ? 146.545 -1.502  -111.083 1.00 0.00 ? 12  LEU A CD1  3  
ATOM 4647  C CD2  . LEU A 1 12  ? 148.853 -1.852  -110.206 1.00 0.00 ? 12  LEU A CD2  3  
ATOM 4648  H H    . LEU A 1 12  ? 144.773 -5.504  -109.267 1.00 0.00 ? 12  LEU A H    3  
ATOM 4649  H HA   . LEU A 1 12  ? 147.385 -5.027  -110.424 1.00 0.00 ? 12  LEU A HA   3  
ATOM 4650  H HB2  . LEU A 1 12  ? 145.983 -2.798  -109.095 1.00 0.00 ? 12  LEU A HB2  3  
ATOM 4651  H HB3  . LEU A 1 12  ? 147.610 -3.096  -108.487 1.00 0.00 ? 12  LEU A HB3  3  
ATOM 4652  H HG   . LEU A 1 12  ? 147.711 -3.279  -111.339 1.00 0.00 ? 12  LEU A HG   3  
ATOM 4653  H HD11 . LEU A 1 12  ? 146.932 -1.058  -111.989 1.00 0.00 ? 12  LEU A HD11 3  
ATOM 4654  H HD12 . LEU A 1 12  ? 146.409 -0.734  -110.336 1.00 0.00 ? 12  LEU A HD12 3  
ATOM 4655  H HD13 . LEU A 1 12  ? 145.599 -1.974  -111.289 1.00 0.00 ? 12  LEU A HD13 3  
ATOM 4656  H HD21 . LEU A 1 12  ? 148.873 -0.868  -110.653 1.00 0.00 ? 12  LEU A HD21 3  
ATOM 4657  H HD22 . LEU A 1 12  ? 149.681 -2.432  -110.585 1.00 0.00 ? 12  LEU A HD22 3  
ATOM 4658  H HD23 . LEU A 1 12  ? 148.938 -1.759  -109.135 1.00 0.00 ? 12  LEU A HD23 3  
ATOM 4659  N N    . PRO A 1 13  ? 148.486 -5.694  -108.185 1.00 0.00 ? 13  PRO A N    3  
ATOM 4660  C CA   . PRO A 1 13  ? 149.041 -6.424  -107.012 1.00 0.00 ? 13  PRO A CA   3  
ATOM 4661  C C    . PRO A 1 13  ? 148.848 -5.632  -105.722 1.00 0.00 ? 13  PRO A C    3  
ATOM 4662  O O    . PRO A 1 13  ? 149.464 -4.604  -105.521 1.00 0.00 ? 13  PRO A O    3  
ATOM 4663  C CB   . PRO A 1 13  ? 150.526 -6.517  -107.362 1.00 0.00 ? 13  PRO A CB   3  
ATOM 4664  C CG   . PRO A 1 13  ? 150.810 -5.531  -108.498 1.00 0.00 ? 13  PRO A CG   3  
ATOM 4665  C CD   . PRO A 1 13  ? 149.477 -5.175  -109.164 1.00 0.00 ? 13  PRO A CD   3  
ATOM 4666  H HA   . PRO A 1 13  ? 148.617 -7.410  -106.931 1.00 0.00 ? 13  PRO A HA   3  
ATOM 4667  H HB2  . PRO A 1 13  ? 151.121 -6.261  -106.496 1.00 0.00 ? 13  PRO A HB2  3  
ATOM 4668  H HB3  . PRO A 1 13  ? 150.763 -7.519  -107.686 1.00 0.00 ? 13  PRO A HB3  3  
ATOM 4669  H HG2  . PRO A 1 13  ? 151.267 -4.638  -108.097 1.00 0.00 ? 13  PRO A HG2  3  
ATOM 4670  H HG3  . PRO A 1 13  ? 151.468 -5.982  -109.223 1.00 0.00 ? 13  PRO A HG3  3  
ATOM 4671  H HD2  . PRO A 1 13  ? 149.383 -4.105  -109.283 1.00 0.00 ? 13  PRO A HD2  3  
ATOM 4672  H HD3  . PRO A 1 13  ? 149.373 -5.683  -110.110 1.00 0.00 ? 13  PRO A HD3  3  
ATOM 4673  N N    . ALA A 1 14  ? 147.991 -6.078  -104.850 1.00 0.00 ? 14  ALA A N    3  
ATOM 4674  C CA   . ALA A 1 14  ? 147.774 -5.313  -103.597 1.00 0.00 ? 14  ALA A CA   3  
ATOM 4675  C C    . ALA A 1 14  ? 149.014 -5.384  -102.708 1.00 0.00 ? 14  ALA A C    3  
ATOM 4676  O O    . ALA A 1 14  ? 148.897 -5.517  -101.507 1.00 0.00 ? 14  ALA A O    3  
ATOM 4677  C CB   . ALA A 1 14  ? 146.570 -5.854  -102.837 1.00 0.00 ? 14  ALA A CB   3  
ATOM 4678  H H    . ALA A 1 14  ? 147.486 -6.902  -105.024 1.00 0.00 ? 14  ALA A H    3  
ATOM 4679  H HA   . ALA A 1 14  ? 147.589 -4.278  -103.849 1.00 0.00 ? 14  ALA A HA   3  
ATOM 4680  H HB1  . ALA A 1 14  ? 146.907 -6.550  -102.090 1.00 0.00 ? 14  ALA A HB1  3  
ATOM 4681  H HB2  . ALA A 1 14  ? 145.901 -6.346  -103.525 1.00 0.00 ? 14  ALA A HB2  3  
ATOM 4682  H HB3  . ALA A 1 14  ? 146.053 -5.035  -102.359 1.00 0.00 ? 14  ALA A HB3  3  
ATOM 4683  N N    . GLY A 1 15  ? 150.201 -5.338  -103.256 1.00 0.00 ? 15  GLY A N    3  
ATOM 4684  C CA   . GLY A 1 15  ? 151.397 -5.434  -102.369 1.00 0.00 ? 15  GLY A CA   3  
ATOM 4685  C C    . GLY A 1 15  ? 152.690 -5.187  -103.148 1.00 0.00 ? 15  GLY A C    3  
ATOM 4686  O O    . GLY A 1 15  ? 153.712 -4.879  -102.567 1.00 0.00 ? 15  GLY A O    3  
ATOM 4687  H H    . GLY A 1 15  ? 150.306 -5.270  -104.227 1.00 0.00 ? 15  GLY A H    3  
ATOM 4688  H HA2  . GLY A 1 15  ? 151.314 -4.701  -101.581 1.00 0.00 ? 15  GLY A HA2  3  
ATOM 4689  H HA3  . GLY A 1 15  ? 151.437 -6.419  -101.934 1.00 0.00 ? 15  GLY A HA3  3  
ATOM 4690  N N    . LYS A 1 16  ? 152.677 -5.319  -104.444 1.00 0.00 ? 16  LYS A N    3  
ATOM 4691  C CA   . LYS A 1 16  ? 153.941 -5.085  -105.198 1.00 0.00 ? 16  LYS A CA   3  
ATOM 4692  C C    . LYS A 1 16  ? 153.644 -4.429  -106.545 1.00 0.00 ? 16  LYS A C    3  
ATOM 4693  O O    . LYS A 1 16  ? 153.623 -5.077  -107.572 1.00 0.00 ? 16  LYS A O    3  
ATOM 4694  C CB   . LYS A 1 16  ? 154.659 -6.418  -105.421 1.00 0.00 ? 16  LYS A CB   3  
ATOM 4695  C CG   . LYS A 1 16  ? 155.909 -6.190  -106.273 1.00 0.00 ? 16  LYS A CG   3  
ATOM 4696  C CD   . LYS A 1 16  ? 155.810 -7.014  -107.558 1.00 0.00 ? 16  LYS A CD   3  
ATOM 4697  C CE   . LYS A 1 16  ? 156.087 -8.485  -107.244 1.00 0.00 ? 16  LYS A CE   3  
ATOM 4698  N NZ   . LYS A 1 16  ? 156.013 -9.283  -108.500 1.00 0.00 ? 16  LYS A NZ   3  
ATOM 4699  H H    . LYS A 1 16  ? 151.854 -5.568  -104.913 1.00 0.00 ? 16  LYS A H    3  
ATOM 4700  H HA   . LYS A 1 16  ? 154.571 -4.432  -104.613 1.00 0.00 ? 16  LYS A HA   3  
ATOM 4701  H HB2  . LYS A 1 16  ? 154.943 -6.838  -104.467 1.00 0.00 ? 16  LYS A HB2  3  
ATOM 4702  H HB3  . LYS A 1 16  ? 153.997 -7.101  -105.932 1.00 0.00 ? 16  LYS A HB3  3  
ATOM 4703  H HG2  . LYS A 1 16  ? 155.988 -5.141  -106.521 1.00 0.00 ? 16  LYS A HG2  3  
ATOM 4704  H HG3  . LYS A 1 16  ? 156.783 -6.496  -105.718 1.00 0.00 ? 16  LYS A HG3  3  
ATOM 4705  H HD2  . LYS A 1 16  ? 154.817 -6.913  -107.974 1.00 0.00 ? 16  LYS A HD2  3  
ATOM 4706  H HD3  . LYS A 1 16  ? 156.538 -6.656  -108.271 1.00 0.00 ? 16  LYS A HD3  3  
ATOM 4707  H HE2  . LYS A 1 16  ? 157.072 -8.581  -106.813 1.00 0.00 ? 16  LYS A HE2  3  
ATOM 4708  H HE3  . LYS A 1 16  ? 155.350 -8.848  -106.543 1.00 0.00 ? 16  LYS A HE3  3  
ATOM 4709  H HZ1  . LYS A 1 16  ? 155.993 -8.642  -109.318 1.00 0.00 ? 16  LYS A HZ1  3  
ATOM 4710  H HZ2  . LYS A 1 16  ? 155.148 -9.863  -108.492 1.00 0.00 ? 16  LYS A HZ2  3  
ATOM 4711  H HZ3  . LYS A 1 16  ? 156.845 -9.902  -108.568 1.00 0.00 ? 16  LYS A HZ3  3  
ATOM 4712  N N    . ALA A 1 17  ? 153.435 -3.143  -106.550 1.00 0.00 ? 17  ALA A N    3  
ATOM 4713  C CA   . ALA A 1 17  ? 153.164 -2.439  -107.832 1.00 0.00 ? 17  ALA A CA   3  
ATOM 4714  C C    . ALA A 1 17  ? 154.476 -1.839  -108.339 1.00 0.00 ? 17  ALA A C    3  
ATOM 4715  O O    . ALA A 1 17  ? 155.446 -1.759  -107.613 1.00 0.00 ? 17  ALA A O    3  
ATOM 4716  C CB   . ALA A 1 17  ? 152.141 -1.329  -107.599 1.00 0.00 ? 17  ALA A CB   3  
ATOM 4717  H H    . ALA A 1 17  ? 153.471 -2.637  -105.711 1.00 0.00 ? 17  ALA A H    3  
ATOM 4718  H HA   . ALA A 1 17  ? 152.775 -3.142  -108.554 1.00 0.00 ? 17  ALA A HA   3  
ATOM 4719  H HB1  . ALA A 1 17  ? 152.304 -0.887  -106.628 1.00 0.00 ? 17  ALA A HB1  3  
ATOM 4720  H HB2  . ALA A 1 17  ? 151.145 -1.745  -107.642 1.00 0.00 ? 17  ALA A HB2  3  
ATOM 4721  H HB3  . ALA A 1 17  ? 152.248 -0.574  -108.362 1.00 0.00 ? 17  ALA A HB3  3  
ATOM 4722  N N    . THR A 1 18  ? 154.527 -1.420  -109.571 1.00 0.00 ? 18  THR A N    3  
ATOM 4723  C CA   . THR A 1 18  ? 155.795 -0.837  -110.090 1.00 0.00 ? 18  THR A CA   3  
ATOM 4724  C C    . THR A 1 18  ? 155.568 -0.238  -111.477 1.00 0.00 ? 18  THR A C    3  
ATOM 4725  O O    . THR A 1 18  ? 154.588 -0.525  -112.132 1.00 0.00 ? 18  THR A O    3  
ATOM 4726  C CB   . THR A 1 18  ? 156.845 -1.947  -110.192 1.00 0.00 ? 18  THR A CB   3  
ATOM 4727  O OG1  . THR A 1 18  ? 156.200 -3.211  -110.117 1.00 0.00 ? 18  THR A OG1  3  
ATOM 4728  C CG2  . THR A 1 18  ? 157.848 -1.820  -109.046 1.00 0.00 ? 18  THR A CG2  3  
ATOM 4729  H H    . THR A 1 18  ? 153.743 -1.493  -110.152 1.00 0.00 ? 18  THR A H    3  
ATOM 4730  H HA   . THR A 1 18  ? 156.143 -0.070  -109.417 1.00 0.00 ? 18  THR A HA   3  
ATOM 4731  H HB   . THR A 1 18  ? 157.367 -1.866  -111.132 1.00 0.00 ? 18  THR A HB   3  
ATOM 4732  H HG1  . THR A 1 18  ? 156.711 -3.835  -110.637 1.00 0.00 ? 18  THR A HG1  3  
ATOM 4733  H HG21 . THR A 1 18  ? 158.794 -2.241  -109.352 1.00 0.00 ? 18  THR A HG21 3  
ATOM 4734  H HG22 . THR A 1 18  ? 157.477 -2.356  -108.185 1.00 0.00 ? 18  THR A HG22 3  
ATOM 4735  H HG23 . THR A 1 18  ? 157.980 -0.780  -108.792 1.00 0.00 ? 18  THR A HG23 3  
ATOM 4736  N N    . PRO A 1 19  ? 156.489 0.576   -111.923 1.00 0.00 ? 19  PRO A N    3  
ATOM 4737  C CA   . PRO A 1 19  ? 156.392 1.202   -113.266 1.00 0.00 ? 19  PRO A CA   3  
ATOM 4738  C C    . PRO A 1 19  ? 156.199 0.155   -114.365 1.00 0.00 ? 19  PRO A C    3  
ATOM 4739  O O    . PRO A 1 19  ? 156.646 0.327   -115.482 1.00 0.00 ? 19  PRO A O    3  
ATOM 4740  C CB   . PRO A 1 19  ? 157.739 1.912   -113.406 1.00 0.00 ? 19  PRO A CB   3  
ATOM 4741  C CG   . PRO A 1 19  ? 158.557 1.678   -112.129 1.00 0.00 ? 19  PRO A CG   3  
ATOM 4742  C CD   . PRO A 1 19  ? 157.685 0.928   -111.117 1.00 0.00 ? 19  PRO A CD   3  
ATOM 4743  H HA   . PRO A 1 19  ? 155.597 1.926   -113.304 1.00 0.00 ? 19  PRO A HA   3  
ATOM 4744  H HB2  . PRO A 1 19  ? 158.268 1.516   -114.258 1.00 0.00 ? 19  PRO A HB2  3  
ATOM 4745  H HB3  . PRO A 1 19  ? 157.577 2.970   -113.540 1.00 0.00 ? 19  PRO A HB3  3  
ATOM 4746  H HG2  . PRO A 1 19  ? 159.433 1.090   -112.361 1.00 0.00 ? 19  PRO A HG2  3  
ATOM 4747  H HG3  . PRO A 1 19  ? 158.857 2.627   -111.711 1.00 0.00 ? 19  PRO A HG3  3  
ATOM 4748  H HD2  . PRO A 1 19  ? 158.189 0.042   -110.760 1.00 0.00 ? 19  PRO A HD2  3  
ATOM 4749  H HD3  . PRO A 1 19  ? 157.406 1.572   -110.298 1.00 0.00 ? 19  PRO A HD3  3  
ATOM 4750  N N    . ALA A 1 20  ? 155.533 -0.925  -114.066 1.00 0.00 ? 20  ALA A N    3  
ATOM 4751  C CA   . ALA A 1 20  ? 155.312 -1.962  -115.110 1.00 0.00 ? 20  ALA A CA   3  
ATOM 4752  C C    . ALA A 1 20  ? 153.894 -2.528  -115.002 1.00 0.00 ? 20  ALA A C    3  
ATOM 4753  O O    . ALA A 1 20  ? 153.705 -3.726  -114.922 1.00 0.00 ? 20  ALA A O    3  
ATOM 4754  C CB   . ALA A 1 20  ? 156.326 -3.092  -114.921 1.00 0.00 ? 20  ALA A CB   3  
ATOM 4755  H H    . ALA A 1 20  ? 155.168 -1.038  -113.161 1.00 0.00 ? 20  ALA A H    3  
ATOM 4756  H HA   . ALA A 1 20  ? 155.449 -1.520  -116.085 1.00 0.00 ? 20  ALA A HA   3  
ATOM 4757  H HB1  . ALA A 1 20  ? 157.324 -2.682  -114.903 1.00 0.00 ? 20  ALA A HB1  3  
ATOM 4758  H HB2  . ALA A 1 20  ? 156.240 -3.793  -115.738 1.00 0.00 ? 20  ALA A HB2  3  
ATOM 4759  H HB3  . ALA A 1 20  ? 156.129 -3.600  -113.989 1.00 0.00 ? 20  ALA A HB3  3  
ATOM 4760  N N    . PRO A 1 21  ? 152.901 -1.676  -115.023 1.00 0.00 ? 21  PRO A N    3  
ATOM 4761  C CA   . PRO A 1 21  ? 151.487 -2.123  -114.952 1.00 0.00 ? 21  PRO A CA   3  
ATOM 4762  C C    . PRO A 1 21  ? 150.944 -2.505  -116.331 1.00 0.00 ? 21  PRO A C    3  
ATOM 4763  O O    . PRO A 1 21  ? 151.415 -2.022  -117.341 1.00 0.00 ? 21  PRO A O    3  
ATOM 4764  C CB   . PRO A 1 21  ? 150.793 -0.859  -114.449 1.00 0.00 ? 21  PRO A CB   3  
ATOM 4765  C CG   . PRO A 1 21  ? 151.716 0.334   -114.734 1.00 0.00 ? 21  PRO A CG   3  
ATOM 4766  C CD   . PRO A 1 21  ? 153.105 -0.206  -115.103 1.00 0.00 ? 21  PRO A CD   3  
ATOM 4767  H HA   . PRO A 1 21  ? 151.365 -2.922  -114.243 1.00 0.00 ? 21  PRO A HA   3  
ATOM 4768  H HB2  . PRO A 1 21  ? 149.853 -0.729  -114.967 1.00 0.00 ? 21  PRO A HB2  3  
ATOM 4769  H HB3  . PRO A 1 21  ? 150.619 -0.936  -113.387 1.00 0.00 ? 21  PRO A HB3  3  
ATOM 4770  H HG2  . PRO A 1 21  ? 151.317 0.913   -115.555 1.00 0.00 ? 21  PRO A HG2  3  
ATOM 4771  H HG3  . PRO A 1 21  ? 151.793 0.954   -113.854 1.00 0.00 ? 21  PRO A HG3  3  
ATOM 4772  H HD2  . PRO A 1 21  ? 153.380 0.098   -116.106 1.00 0.00 ? 21  PRO A HD2  3  
ATOM 4773  H HD3  . PRO A 1 21  ? 153.837 0.113   -114.385 1.00 0.00 ? 21  PRO A HD3  3  
ATOM 4774  N N    . PRO A 1 22  ? 149.952 -3.349  -116.377 1.00 0.00 ? 22  PRO A N    3  
ATOM 4775  C CA   . PRO A 1 22  ? 149.351 -3.754  -117.673 1.00 0.00 ? 22  PRO A CA   3  
ATOM 4776  C C    . PRO A 1 22  ? 148.899 -2.532  -118.478 1.00 0.00 ? 22  PRO A C    3  
ATOM 4777  O O    . PRO A 1 22  ? 148.449 -2.640  -119.601 1.00 0.00 ? 22  PRO A O    3  
ATOM 4778  C CB   . PRO A 1 22  ? 148.155 -4.602  -117.238 1.00 0.00 ? 22  PRO A CB   3  
ATOM 4779  C CG   . PRO A 1 22  ? 148.179 -4.748  -115.709 1.00 0.00 ? 22  PRO A CG   3  
ATOM 4780  C CD   . PRO A 1 22  ? 149.363 -3.949  -115.154 1.00 0.00 ? 22  PRO A CD   3  
ATOM 4781  H HA   . PRO A 1 22  ? 150.041 -4.355  -118.243 1.00 0.00 ? 22  PRO A HA   3  
ATOM 4782  H HB2  . PRO A 1 22  ? 147.238 -4.118  -117.543 1.00 0.00 ? 22  PRO A HB2  3  
ATOM 4783  H HB3  . PRO A 1 22  ? 148.218 -5.579  -117.693 1.00 0.00 ? 22  PRO A HB3  3  
ATOM 4784  H HG2  . PRO A 1 22  ? 147.257 -4.367  -115.294 1.00 0.00 ? 22  PRO A HG2  3  
ATOM 4785  H HG3  . PRO A 1 22  ? 148.294 -5.788  -115.447 1.00 0.00 ? 22  PRO A HG3  3  
ATOM 4786  H HD2  . PRO A 1 22  ? 149.020 -3.182  -114.472 1.00 0.00 ? 22  PRO A HD2  3  
ATOM 4787  H HD3  . PRO A 1 22  ? 150.077 -4.601  -114.676 1.00 0.00 ? 22  PRO A HD3  3  
ATOM 4788  N N    . VAL A 1 23  ? 149.013 -1.368  -117.894 1.00 0.00 ? 23  VAL A N    3  
ATOM 4789  C CA   . VAL A 1 23  ? 148.592 -0.122  -118.593 1.00 0.00 ? 23  VAL A CA   3  
ATOM 4790  C C    . VAL A 1 23  ? 149.811 0.737   -118.916 1.00 0.00 ? 23  VAL A C    3  
ATOM 4791  O O    . VAL A 1 23  ? 150.154 0.944   -120.067 1.00 0.00 ? 23  VAL A O    3  
ATOM 4792  C CB   . VAL A 1 23  ? 147.674 0.679   -117.679 1.00 0.00 ? 23  VAL A CB   3  
ATOM 4793  C CG1  . VAL A 1 23  ? 146.895 1.676   -118.522 1.00 0.00 ? 23  VAL A CG1  3  
ATOM 4794  C CG2  . VAL A 1 23  ? 146.706 -0.264  -116.970 1.00 0.00 ? 23  VAL A CG2  3  
ATOM 4795  H H    . VAL A 1 23  ? 149.375 -1.316  -116.985 1.00 0.00 ? 23  VAL A H    3  
ATOM 4796  H HA   . VAL A 1 23  ? 148.066 -0.365  -119.503 1.00 0.00 ? 23  VAL A HA   3  
ATOM 4797  H HB   . VAL A 1 23  ? 148.267 1.208   -116.948 1.00 0.00 ? 23  VAL A HB   3  
ATOM 4798  H HG11 . VAL A 1 23  ? 146.031 1.191   -118.947 1.00 0.00 ? 23  VAL A HG11 3  
ATOM 4799  H HG12 . VAL A 1 23  ? 147.533 2.036   -119.313 1.00 0.00 ? 23  VAL A HG12 3  
ATOM 4800  H HG13 . VAL A 1 23  ? 146.580 2.503   -117.908 1.00 0.00 ? 23  VAL A HG13 3  
ATOM 4801  H HG21 . VAL A 1 23  ? 146.878 -0.218  -115.904 1.00 0.00 ? 23  VAL A HG21 3  
ATOM 4802  H HG22 . VAL A 1 23  ? 146.868 -1.273  -117.317 1.00 0.00 ? 23  VAL A HG22 3  
ATOM 4803  H HG23 . VAL A 1 23  ? 145.690 0.034   -117.183 1.00 0.00 ? 23  VAL A HG23 3  
ATOM 4804  N N    . GLY A 1 24  ? 150.416 1.300   -117.901 1.00 0.00 ? 24  GLY A N    3  
ATOM 4805  C CA   . GLY A 1 24  ? 151.582 2.206   -118.107 1.00 0.00 ? 24  GLY A CA   3  
ATOM 4806  C C    . GLY A 1 24  ? 151.166 3.324   -119.052 1.00 0.00 ? 24  GLY A C    3  
ATOM 4807  O O    . GLY A 1 24  ? 150.519 4.270   -118.647 1.00 0.00 ? 24  GLY A O    3  
ATOM 4808  H H    . GLY A 1 24  ? 150.059 1.181   -116.996 1.00 0.00 ? 24  GLY A H    3  
ATOM 4809  H HA2  . GLY A 1 24  ? 151.889 2.623   -117.157 1.00 0.00 ? 24  GLY A HA2  3  
ATOM 4810  H HA3  . GLY A 1 24  ? 152.394 1.652   -118.539 1.00 0.00 ? 24  GLY A HA3  3  
ATOM 4811  N N    . PRO A 1 25  ? 151.473 3.205   -120.316 1.00 0.00 ? 25  PRO A N    3  
ATOM 4812  C CA   . PRO A 1 25  ? 151.039 4.231   -121.287 1.00 0.00 ? 25  PRO A CA   3  
ATOM 4813  C C    . PRO A 1 25  ? 149.519 4.372   -121.264 1.00 0.00 ? 25  PRO A C    3  
ATOM 4814  O O    . PRO A 1 25  ? 148.979 5.445   -121.085 1.00 0.00 ? 25  PRO A O    3  
ATOM 4815  C CB   . PRO A 1 25  ? 151.522 3.660   -122.622 1.00 0.00 ? 25  PRO A CB   3  
ATOM 4816  C CG   . PRO A 1 25  ? 152.237 2.326   -122.363 1.00 0.00 ? 25  PRO A CG   3  
ATOM 4817  C CD   . PRO A 1 25  ? 152.277 2.073   -120.852 1.00 0.00 ? 25  PRO A CD   3  
ATOM 4818  H HA   . PRO A 1 25  ? 151.520 5.176   -121.090 1.00 0.00 ? 25  PRO A HA   3  
ATOM 4819  H HB2  . PRO A 1 25  ? 150.674 3.498   -123.273 1.00 0.00 ? 25  PRO A HB2  3  
ATOM 4820  H HB3  . PRO A 1 25  ? 152.208 4.351   -123.085 1.00 0.00 ? 25  PRO A HB3  3  
ATOM 4821  H HG2  . PRO A 1 25  ? 151.699 1.526   -122.852 1.00 0.00 ? 25  PRO A HG2  3  
ATOM 4822  H HG3  . PRO A 1 25  ? 153.244 2.374   -122.747 1.00 0.00 ? 25  PRO A HG3  3  
ATOM 4823  H HD2  . PRO A 1 25  ? 151.833 1.121   -120.613 1.00 0.00 ? 25  PRO A HD2  3  
ATOM 4824  H HD3  . PRO A 1 25  ? 153.289 2.128   -120.484 1.00 0.00 ? 25  PRO A HD3  3  
ATOM 4825  N N    . ALA A 1 26  ? 148.830 3.283   -121.473 1.00 0.00 ? 26  ALA A N    3  
ATOM 4826  C CA   . ALA A 1 26  ? 147.340 3.333   -121.497 1.00 0.00 ? 26  ALA A CA   3  
ATOM 4827  C C    . ALA A 1 26  ? 146.802 4.006   -120.230 1.00 0.00 ? 26  ALA A C    3  
ATOM 4828  O O    . ALA A 1 26  ? 145.637 4.342   -120.152 1.00 0.00 ? 26  ALA A O    3  
ATOM 4829  C CB   . ALA A 1 26  ? 146.784 1.911   -121.605 1.00 0.00 ? 26  ALA A CB   3  
ATOM 4830  H H    . ALA A 1 26  ? 149.299 2.435   -121.655 1.00 0.00 ? 26  ALA A H    3  
ATOM 4831  H HA   . ALA A 1 26  ? 147.022 3.901   -122.359 1.00 0.00 ? 26  ALA A HA   3  
ATOM 4832  H HB1  . ALA A 1 26  ? 145.905 1.820   -120.984 1.00 0.00 ? 26  ALA A HB1  3  
ATOM 4833  H HB2  . ALA A 1 26  ? 147.532 1.205   -121.279 1.00 0.00 ? 26  ALA A HB2  3  
ATOM 4834  H HB3  . ALA A 1 26  ? 146.520 1.706   -122.633 1.00 0.00 ? 26  ALA A HB3  3  
ATOM 4835  N N    . LEU A 1 27  ? 147.627 4.217   -119.235 1.00 0.00 ? 27  LEU A N    3  
ATOM 4836  C CA   . LEU A 1 27  ? 147.110 4.879   -118.003 1.00 0.00 ? 27  LEU A CA   3  
ATOM 4837  C C    . LEU A 1 27  ? 147.427 6.368   -118.088 1.00 0.00 ? 27  LEU A C    3  
ATOM 4838  O O    . LEU A 1 27  ? 146.562 7.212   -117.965 1.00 0.00 ? 27  LEU A O    3  
ATOM 4839  C CB   . LEU A 1 27  ? 147.777 4.286   -116.758 1.00 0.00 ? 27  LEU A CB   3  
ATOM 4840  C CG   . LEU A 1 27  ? 146.723 3.972   -115.688 1.00 0.00 ? 27  LEU A CG   3  
ATOM 4841  C CD1  . LEU A 1 27  ? 147.402 3.910   -114.323 1.00 0.00 ? 27  LEU A CD1  3  
ATOM 4842  C CD2  . LEU A 1 27  ? 145.652 5.065   -115.664 1.00 0.00 ? 27  LEU A CD2  3  
ATOM 4843  H H    . LEU A 1 27  ? 148.568 3.949   -119.309 1.00 0.00 ? 27  LEU A H    3  
ATOM 4844  H HA   . LEU A 1 27  ? 146.042 4.717   -117.970 1.00 0.00 ? 27  LEU A HA   3  
ATOM 4845  H HB2  . LEU A 1 27  ? 148.298 3.379   -117.027 1.00 0.00 ? 27  LEU A HB2  3  
ATOM 4846  H HB3  . LEU A 1 27  ? 148.485 4.998   -116.360 1.00 0.00 ? 27  LEU A HB3  3  
ATOM 4847  H HG   . LEU A 1 27  ? 146.264 3.018   -115.902 1.00 0.00 ? 27  LEU A HG   3  
ATOM 4848  H HD11 . LEU A 1 27  ? 147.432 4.899   -113.890 1.00 0.00 ? 27  LEU A HD11 3  
ATOM 4849  H HD12 . LEU A 1 27  ? 148.408 3.539   -114.442 1.00 0.00 ? 27  LEU A HD12 3  
ATOM 4850  H HD13 . LEU A 1 27  ? 146.847 3.249   -113.675 1.00 0.00 ? 27  LEU A HD13 3  
ATOM 4851  H HD21 . LEU A 1 27  ? 146.049 5.970   -116.096 1.00 0.00 ? 27  LEU A HD21 3  
ATOM 4852  H HD22 . LEU A 1 27  ? 145.356 5.254   -114.642 1.00 0.00 ? 27  LEU A HD22 3  
ATOM 4853  H HD23 . LEU A 1 27  ? 144.793 4.740   -116.232 1.00 0.00 ? 27  LEU A HD23 3  
ATOM 4854  N N    . GLY A 1 28  ? 148.673 6.688   -118.308 1.00 0.00 ? 28  GLY A N    3  
ATOM 4855  C CA   . GLY A 1 28  ? 149.070 8.115   -118.416 1.00 0.00 ? 28  GLY A CA   3  
ATOM 4856  C C    . GLY A 1 28  ? 148.168 8.809   -119.436 1.00 0.00 ? 28  GLY A C    3  
ATOM 4857  O O    . GLY A 1 28  ? 148.447 8.829   -120.618 1.00 0.00 ? 28  GLY A O    3  
ATOM 4858  H H    . GLY A 1 28  ? 149.347 5.985   -118.408 1.00 0.00 ? 28  GLY A H    3  
ATOM 4859  H HA2  . GLY A 1 28  ? 148.963 8.593   -117.452 1.00 0.00 ? 28  GLY A HA2  3  
ATOM 4860  H HA3  . GLY A 1 28  ? 150.096 8.181   -118.741 1.00 0.00 ? 28  GLY A HA3  3  
ATOM 4861  N N    . GLN A 1 29  ? 147.096 9.389   -118.980 1.00 0.00 ? 29  GLN A N    3  
ATOM 4862  C CA   . GLN A 1 29  ? 146.167 10.100  -119.897 1.00 0.00 ? 29  GLN A CA   3  
ATOM 4863  C C    . GLN A 1 29  ? 145.570 11.267  -119.118 1.00 0.00 ? 29  GLN A C    3  
ATOM 4864  O O    . GLN A 1 29  ? 145.006 12.190  -119.672 1.00 0.00 ? 29  GLN A O    3  
ATOM 4865  C CB   . GLN A 1 29  ? 145.054 9.152   -120.350 1.00 0.00 ? 29  GLN A CB   3  
ATOM 4866  C CG   . GLN A 1 29  ? 144.339 9.747   -121.565 1.00 0.00 ? 29  GLN A CG   3  
ATOM 4867  C CD   . GLN A 1 29  ? 145.224 9.596   -122.803 1.00 0.00 ? 29  GLN A CD   3  
ATOM 4868  O OE1  . GLN A 1 29  ? 145.942 8.625   -122.937 1.00 0.00 ? 29  GLN A OE1  3  
ATOM 4869  N NE2  . GLN A 1 29  ? 145.206 10.524  -123.721 1.00 0.00 ? 29  GLN A NE2  3  
ATOM 4870  H H    . GLN A 1 29  ? 146.899 9.375   -118.020 1.00 0.00 ? 29  GLN A H    3  
ATOM 4871  H HA   . GLN A 1 29  ? 146.709 10.474  -120.754 1.00 0.00 ? 29  GLN A HA   3  
ATOM 4872  H HB2  . GLN A 1 29  ? 145.482 8.196   -120.615 1.00 0.00 ? 29  GLN A HB2  3  
ATOM 4873  H HB3  . GLN A 1 29  ? 144.345 9.020   -119.547 1.00 0.00 ? 29  GLN A HB3  3  
ATOM 4874  H HG2  . GLN A 1 29  ? 143.405 9.227   -121.723 1.00 0.00 ? 29  GLN A HG2  3  
ATOM 4875  H HG3  . GLN A 1 29  ? 144.143 10.794  -121.391 1.00 0.00 ? 29  GLN A HG3  3  
ATOM 4876  H HE21 . GLN A 1 29  ? 144.627 11.309  -123.613 1.00 0.00 ? 29  GLN A HE21 3  
ATOM 4877  H HE22 . GLN A 1 29  ? 145.769 10.437  -124.518 1.00 0.00 ? 29  GLN A HE22 3  
ATOM 4878  N N    . HIS A 1 30  ? 145.722 11.226  -117.824 1.00 0.00 ? 30  HIS A N    3  
ATOM 4879  C CA   . HIS A 1 30  ? 145.208 12.317  -116.958 1.00 0.00 ? 30  HIS A CA   3  
ATOM 4880  C C    . HIS A 1 30  ? 146.254 13.430  -116.928 1.00 0.00 ? 30  HIS A C    3  
ATOM 4881  O O    . HIS A 1 30  ? 145.942 14.602  -116.921 1.00 0.00 ? 30  HIS A O    3  
ATOM 4882  C CB   . HIS A 1 30  ? 145.001 11.768  -115.543 1.00 0.00 ? 30  HIS A CB   3  
ATOM 4883  C CG   . HIS A 1 30  ? 146.258 11.953  -114.737 1.00 0.00 ? 30  HIS A CG   3  
ATOM 4884  N ND1  . HIS A 1 30  ? 147.191 10.940  -114.584 1.00 0.00 ? 30  HIS A ND1  3  
ATOM 4885  C CD2  . HIS A 1 30  ? 146.749 13.025  -114.035 1.00 0.00 ? 30  HIS A CD2  3  
ATOM 4886  C CE1  . HIS A 1 30  ? 148.187 11.418  -113.816 1.00 0.00 ? 30  HIS A CE1  3  
ATOM 4887  N NE2  . HIS A 1 30  ? 147.968 12.686  -113.454 1.00 0.00 ? 30  HIS A NE2  3  
ATOM 4888  H H    . HIS A 1 30  ? 146.201 10.473  -117.418 1.00 0.00 ? 30  HIS A H    3  
ATOM 4889  H HA   . HIS A 1 30  ? 144.268 12.691  -117.337 1.00 0.00 ? 30  HIS A HA   3  
ATOM 4890  H HB2  . HIS A 1 30  ? 144.187 12.295  -115.068 1.00 0.00 ? 30  HIS A HB2  3  
ATOM 4891  H HB3  . HIS A 1 30  ? 144.763 10.717  -115.598 1.00 0.00 ? 30  HIS A HB3  3  
ATOM 4892  H HD1  . HIS A 1 30  ? 147.135 10.038  -114.965 1.00 0.00 ? 30  HIS A HD1  3  
ATOM 4893  H HD2  . HIS A 1 30  ? 146.265 13.986  -113.947 1.00 0.00 ? 30  HIS A HD2  3  
ATOM 4894  H HE1  . HIS A 1 30  ? 149.057 10.847  -113.528 1.00 0.00 ? 30  HIS A HE1  3  
ATOM 4895  N N    . GLY A 1 31  ? 147.503 13.052  -116.917 1.00 0.00 ? 31  GLY A N    3  
ATOM 4896  C CA   . GLY A 1 31  ? 148.602 14.054  -116.893 1.00 0.00 ? 31  GLY A CA   3  
ATOM 4897  C C    . GLY A 1 31  ? 149.932 13.328  -117.097 1.00 0.00 ? 31  GLY A C    3  
ATOM 4898  O O    . GLY A 1 31  ? 150.981 13.936  -117.183 1.00 0.00 ? 31  GLY A O    3  
ATOM 4899  H H    . GLY A 1 31  ? 147.719 12.096  -116.925 1.00 0.00 ? 31  GLY A H    3  
ATOM 4900  H HA2  . GLY A 1 31  ? 148.452 14.774  -117.687 1.00 0.00 ? 31  GLY A HA2  3  
ATOM 4901  H HA3  . GLY A 1 31  ? 148.612 14.560  -115.941 1.00 0.00 ? 31  GLY A HA3  3  
ATOM 4902  N N    . ALA A 1 32  ? 149.883 12.029  -117.230 1.00 0.00 ? 32  ALA A N    3  
ATOM 4903  C CA   . ALA A 1 32  ? 151.123 11.242  -117.492 1.00 0.00 ? 32  ALA A CA   3  
ATOM 4904  C C    . ALA A 1 32  ? 152.012 11.141  -116.251 1.00 0.00 ? 32  ALA A C    3  
ATOM 4905  O O    . ALA A 1 32  ? 152.951 11.892  -116.089 1.00 0.00 ? 32  ALA A O    3  
ATOM 4906  C CB   . ALA A 1 32  ? 151.908 11.912  -118.620 1.00 0.00 ? 32  ALA A CB   3  
ATOM 4907  H H    . ALA A 1 32  ? 149.022 11.563  -117.193 1.00 0.00 ? 32  ALA A H    3  
ATOM 4908  H HA   . ALA A 1 32  ? 150.845 10.247  -117.804 1.00 0.00 ? 32  ALA A HA   3  
ATOM 4909  H HB1  . ALA A 1 32  ? 152.445 11.160  -119.179 1.00 0.00 ? 32  ALA A HB1  3  
ATOM 4910  H HB2  . ALA A 1 32  ? 152.608 12.619  -118.201 1.00 0.00 ? 32  ALA A HB2  3  
ATOM 4911  H HB3  . ALA A 1 32  ? 151.224 12.428  -119.276 1.00 0.00 ? 32  ALA A HB3  3  
ATOM 4912  N N    . ASN A 1 33  ? 151.748 10.197  -115.387 1.00 0.00 ? 33  ASN A N    3  
ATOM 4913  C CA   . ASN A 1 33  ? 152.610 10.030  -114.184 1.00 0.00 ? 33  ASN A CA   3  
ATOM 4914  C C    . ASN A 1 33  ? 152.425 8.611   -113.637 1.00 0.00 ? 33  ASN A C    3  
ATOM 4915  O O    . ASN A 1 33  ? 151.337 8.197   -113.294 1.00 0.00 ? 33  ASN A O    3  
ATOM 4916  C CB   . ASN A 1 33  ? 152.243 11.065  -113.117 1.00 0.00 ? 33  ASN A CB   3  
ATOM 4917  C CG   . ASN A 1 33  ? 152.866 12.415  -113.481 1.00 0.00 ? 33  ASN A CG   3  
ATOM 4918  O OD1  . ASN A 1 33  ? 154.061 12.598  -113.360 1.00 0.00 ? 33  ASN A OD1  3  
ATOM 4919  N ND2  . ASN A 1 33  ? 152.101 13.374  -113.923 1.00 0.00 ? 33  ASN A ND2  3  
ATOM 4920  H H    . ASN A 1 33  ? 151.000 9.579   -115.534 1.00 0.00 ? 33  ASN A H    3  
ATOM 4921  H HA   . ASN A 1 33  ? 153.641 10.148  -114.481 1.00 0.00 ? 33  ASN A HA   3  
ATOM 4922  H HB2  . ASN A 1 33  ? 151.170 11.165  -113.068 1.00 0.00 ? 33  ASN A HB2  3  
ATOM 4923  H HB3  . ASN A 1 33  ? 152.622 10.743  -112.158 1.00 0.00 ? 33  ASN A HB3  3  
ATOM 4924  H HD21 . ASN A 1 33  ? 151.137 13.228  -114.020 1.00 0.00 ? 33  ASN A HD21 3  
ATOM 4925  H HD22 . ASN A 1 33  ? 152.490 14.243  -114.158 1.00 0.00 ? 33  ASN A HD22 3  
ATOM 4926  N N    . ILE A 1 34  ? 153.495 7.865   -113.573 1.00 0.00 ? 34  ILE A N    3  
ATOM 4927  C CA   . ILE A 1 34  ? 153.419 6.463   -113.071 1.00 0.00 ? 34  ILE A CA   3  
ATOM 4928  C C    . ILE A 1 34  ? 153.747 6.432   -111.572 1.00 0.00 ? 34  ILE A C    3  
ATOM 4929  O O    . ILE A 1 34  ? 152.936 6.043   -110.759 1.00 0.00 ? 34  ILE A O    3  
ATOM 4930  C CB   . ILE A 1 34  ? 154.440 5.612   -113.834 1.00 0.00 ? 34  ILE A CB   3  
ATOM 4931  C CG1  . ILE A 1 34  ? 154.141 5.676   -115.335 1.00 0.00 ? 34  ILE A CG1  3  
ATOM 4932  C CG2  . ILE A 1 34  ? 154.372 4.159   -113.360 1.00 0.00 ? 34  ILE A CG2  3  
ATOM 4933  C CD1  . ILE A 1 34  ? 152.713 5.194   -115.601 1.00 0.00 ? 34  ILE A CD1  3  
ATOM 4934  H H    . ILE A 1 34  ? 154.354 8.234   -113.865 1.00 0.00 ? 34  ILE A H    3  
ATOM 4935  H HA   . ILE A 1 34  ? 152.421 6.067   -113.236 1.00 0.00 ? 34  ILE A HA   3  
ATOM 4936  H HB   . ILE A 1 34  ? 155.433 5.999   -113.650 1.00 0.00 ? 34  ILE A HB   3  
ATOM 4937  H HG12 . ILE A 1 34  ? 154.247 6.695   -115.680 1.00 0.00 ? 34  ILE A HG12 3  
ATOM 4938  H HG13 . ILE A 1 34  ? 154.836 5.043   -115.867 1.00 0.00 ? 34  ILE A HG13 3  
ATOM 4939  H HG21 . ILE A 1 34  ? 154.427 3.500   -114.216 1.00 0.00 ? 34  ILE A HG21 3  
ATOM 4940  H HG22 . ILE A 1 34  ? 153.444 3.992   -112.835 1.00 0.00 ? 34  ILE A HG22 3  
ATOM 4941  H HG23 . ILE A 1 34  ? 155.202 3.957   -112.700 1.00 0.00 ? 34  ILE A HG23 3  
ATOM 4942  H HD11 . ILE A 1 34  ? 152.027 6.020   -115.489 1.00 0.00 ? 34  ILE A HD11 3  
ATOM 4943  H HD12 . ILE A 1 34  ? 152.458 4.415   -114.898 1.00 0.00 ? 34  ILE A HD12 3  
ATOM 4944  H HD13 . ILE A 1 34  ? 152.646 4.806   -116.608 1.00 0.00 ? 34  ILE A HD13 3  
ATOM 4945  N N    . MET A 1 35  ? 154.948 6.779   -111.203 1.00 0.00 ? 35  MET A N    3  
ATOM 4946  C CA   . MET A 1 35  ? 155.328 6.694   -109.763 1.00 0.00 ? 35  MET A CA   3  
ATOM 4947  C C    . MET A 1 35  ? 154.168 7.185   -108.891 1.00 0.00 ? 35  MET A C    3  
ATOM 4948  O O    . MET A 1 35  ? 153.703 6.474   -108.023 1.00 0.00 ? 35  MET A O    3  
ATOM 4949  C CB   . MET A 1 35  ? 156.560 7.564   -109.507 1.00 0.00 ? 35  MET A CB   3  
ATOM 4950  C CG   . MET A 1 35  ? 157.785 6.669   -109.303 1.00 0.00 ? 35  MET A CG   3  
ATOM 4951  S SD   . MET A 1 35  ? 157.857 6.132   -107.576 1.00 0.00 ? 35  MET A SD   3  
ATOM 4952  C CE   . MET A 1 35  ? 157.509 4.380   -107.866 1.00 0.00 ? 35  MET A CE   3  
ATOM 4953  H H    . MET A 1 35  ? 155.620 7.004   -111.880 1.00 0.00 ? 35  MET A H    3  
ATOM 4954  H HA   . MET A 1 35  ? 155.559 5.665   -109.527 1.00 0.00 ? 35  MET A HA   3  
ATOM 4955  H HB2  . MET A 1 35  ? 156.725 8.212   -110.356 1.00 0.00 ? 35  MET A HB2  3  
ATOM 4956  H HB3  . MET A 1 35  ? 156.402 8.161   -108.623 1.00 0.00 ? 35  MET A HB3  3  
ATOM 4957  H HG2  . MET A 1 35  ? 157.710 5.804   -109.947 1.00 0.00 ? 35  MET A HG2  3  
ATOM 4958  H HG3  . MET A 1 35  ? 158.679 7.222   -109.547 1.00 0.00 ? 35  MET A HG3  3  
ATOM 4959  H HE1  . MET A 1 35  ? 158.121 4.022   -108.682 1.00 0.00 ? 35  MET A HE1  3  
ATOM 4960  H HE2  . MET A 1 35  ? 156.468 4.255   -108.118 1.00 0.00 ? 35  MET A HE2  3  
ATOM 4961  H HE3  . MET A 1 35  ? 157.731 3.817   -106.969 1.00 0.00 ? 35  MET A HE3  3  
ATOM 4962  N N    . GLU A 1 36  ? 153.669 8.367   -109.118 1.00 0.00 ? 36  GLU A N    3  
ATOM 4963  C CA   . GLU A 1 36  ? 152.518 8.833   -108.292 1.00 0.00 ? 36  GLU A CA   3  
ATOM 4964  C C    . GLU A 1 36  ? 151.476 7.710   -108.269 1.00 0.00 ? 36  GLU A C    3  
ATOM 4965  O O    . GLU A 1 36  ? 150.971 7.332   -107.230 1.00 0.00 ? 36  GLU A O    3  
ATOM 4966  C CB   . GLU A 1 36  ? 151.908 10.090  -108.919 1.00 0.00 ? 36  GLU A CB   3  
ATOM 4967  C CG   . GLU A 1 36  ? 152.508 11.332  -108.258 1.00 0.00 ? 36  GLU A CG   3  
ATOM 4968  C CD   . GLU A 1 36  ? 152.684 12.434  -109.304 1.00 0.00 ? 36  GLU A CD   3  
ATOM 4969  O OE1  . GLU A 1 36  ? 151.863 12.505  -110.204 1.00 0.00 ? 36  GLU A OE1  3  
ATOM 4970  O OE2  . GLU A 1 36  ? 153.636 13.187  -109.189 1.00 0.00 ? 36  GLU A OE2  3  
ATOM 4971  H H    . GLU A 1 36  ? 154.030 8.932   -109.833 1.00 0.00 ? 36  GLU A H    3  
ATOM 4972  H HA   . GLU A 1 36  ? 152.849 9.048   -107.287 1.00 0.00 ? 36  GLU A HA   3  
ATOM 4973  H HB2  . GLU A 1 36  ? 152.124 10.103  -109.978 1.00 0.00 ? 36  GLU A HB2  3  
ATOM 4974  H HB3  . GLU A 1 36  ? 150.840 10.085  -108.770 1.00 0.00 ? 36  GLU A HB3  3  
ATOM 4975  H HG2  . GLU A 1 36  ? 151.848 11.678  -107.476 1.00 0.00 ? 36  GLU A HG2  3  
ATOM 4976  H HG3  . GLU A 1 36  ? 153.470 11.086  -107.834 1.00 0.00 ? 36  GLU A HG3  3  
ATOM 4977  N N    . PHE A 1 37  ? 151.183 7.156   -109.412 1.00 0.00 ? 37  PHE A N    3  
ATOM 4978  C CA   . PHE A 1 37  ? 150.208 6.029   -109.488 1.00 0.00 ? 37  PHE A CA   3  
ATOM 4979  C C    . PHE A 1 37  ? 150.628 4.932   -108.508 1.00 0.00 ? 37  PHE A C    3  
ATOM 4980  O O    . PHE A 1 37  ? 149.984 4.663   -107.509 1.00 0.00 ? 37  PHE A O    3  
ATOM 4981  C CB   . PHE A 1 37  ? 150.254 5.451   -110.912 1.00 0.00 ? 37  PHE A CB   3  
ATOM 4982  C CG   . PHE A 1 37  ? 149.406 4.198   -111.018 1.00 0.00 ? 37  PHE A CG   3  
ATOM 4983  C CD1  . PHE A 1 37  ? 148.634 3.759   -109.937 1.00 0.00 ? 37  PHE A CD1  3  
ATOM 4984  C CD2  . PHE A 1 37  ? 149.392 3.478   -112.218 1.00 0.00 ? 37  PHE A CD2  3  
ATOM 4985  C CE1  . PHE A 1 37  ? 147.847 2.608   -110.055 1.00 0.00 ? 37  PHE A CE1  3  
ATOM 4986  C CE2  . PHE A 1 37  ? 148.608 2.322   -112.335 1.00 0.00 ? 37  PHE A CE2  3  
ATOM 4987  C CZ   . PHE A 1 37  ? 147.835 1.889   -111.253 1.00 0.00 ? 37  PHE A CZ   3  
ATOM 4988  H H    . PHE A 1 37  ? 151.624 7.471   -110.228 1.00 0.00 ? 37  PHE A H    3  
ATOM 4989  H HA   . PHE A 1 37  ? 149.203 6.373   -109.286 1.00 0.00 ? 37  PHE A HA   3  
ATOM 4990  H HB2  . PHE A 1 37  ? 149.882 6.189   -111.607 1.00 0.00 ? 37  PHE A HB2  3  
ATOM 4991  H HB3  . PHE A 1 37  ? 151.272 5.210   -111.167 1.00 0.00 ? 37  PHE A HB3  3  
ATOM 4992  H HD1  . PHE A 1 37  ? 148.643 4.303   -109.014 1.00 0.00 ? 37  PHE A HD1  3  
ATOM 4993  H HD2  . PHE A 1 37  ? 149.991 3.810   -113.053 1.00 0.00 ? 37  PHE A HD2  3  
ATOM 4994  H HE1  . PHE A 1 37  ? 147.253 2.272   -109.218 1.00 0.00 ? 37  PHE A HE1  3  
ATOM 4995  H HE2  . PHE A 1 37  ? 148.600 1.766   -113.260 1.00 0.00 ? 37  PHE A HE2  3  
ATOM 4996  H HZ   . PHE A 1 37  ? 147.225 1.003   -111.345 1.00 0.00 ? 37  PHE A HZ   3  
ATOM 4997  N N    . VAL A 1 38  ? 151.716 4.295   -108.816 1.00 0.00 ? 38  VAL A N    3  
ATOM 4998  C CA   . VAL A 1 38  ? 152.225 3.194   -107.964 1.00 0.00 ? 38  VAL A CA   3  
ATOM 4999  C C    . VAL A 1 38  ? 152.602 3.714   -106.577 1.00 0.00 ? 38  VAL A C    3  
ATOM 5000  O O    . VAL A 1 38  ? 152.367 3.059   -105.580 1.00 0.00 ? 38  VAL A O    3  
ATOM 5001  C CB   . VAL A 1 38  ? 153.432 2.584   -108.662 1.00 0.00 ? 38  VAL A CB   3  
ATOM 5002  C CG1  . VAL A 1 38  ? 153.919 1.354   -107.895 1.00 0.00 ? 38  VAL A CG1  3  
ATOM 5003  C CG2  . VAL A 1 38  ? 152.998 2.182   -110.071 1.00 0.00 ? 38  VAL A CG2  3  
ATOM 5004  H H    . VAL A 1 38  ? 152.199 4.550   -109.630 1.00 0.00 ? 38  VAL A H    3  
ATOM 5005  H HA   . VAL A 1 38  ? 151.458 2.440   -107.863 1.00 0.00 ? 38  VAL A HA   3  
ATOM 5006  H HB   . VAL A 1 38  ? 154.226 3.314   -108.721 1.00 0.00 ? 38  VAL A HB   3  
ATOM 5007  H HG11 . VAL A 1 38  ? 154.826 1.598   -107.362 1.00 0.00 ? 38  VAL A HG11 3  
ATOM 5008  H HG12 . VAL A 1 38  ? 154.116 0.553   -108.590 1.00 0.00 ? 38  VAL A HG12 3  
ATOM 5009  H HG13 . VAL A 1 38  ? 153.160 1.043   -107.193 1.00 0.00 ? 38  VAL A HG13 3  
ATOM 5010  H HG21 . VAL A 1 38  ? 152.823 3.072   -110.660 1.00 0.00 ? 38  VAL A HG21 3  
ATOM 5011  H HG22 . VAL A 1 38  ? 152.082 1.608   -110.013 1.00 0.00 ? 38  VAL A HG22 3  
ATOM 5012  H HG23 . VAL A 1 38  ? 153.768 1.588   -110.532 1.00 0.00 ? 38  VAL A HG23 3  
ATOM 5013  N N    . LYS A 1 39  ? 153.143 4.898   -106.489 1.00 0.00 ? 39  LYS A N    3  
ATOM 5014  C CA   . LYS A 1 39  ? 153.474 5.444   -105.146 1.00 0.00 ? 39  LYS A CA   3  
ATOM 5015  C C    . LYS A 1 39  ? 152.237 5.274   -104.266 1.00 0.00 ? 39  LYS A C    3  
ATOM 5016  O O    . LYS A 1 39  ? 152.295 4.686   -103.204 1.00 0.00 ? 39  LYS A O    3  
ATOM 5017  C CB   . LYS A 1 39  ? 153.847 6.925   -105.253 1.00 0.00 ? 39  LYS A CB   3  
ATOM 5018  C CG   . LYS A 1 39  ? 155.214 7.061   -105.925 1.00 0.00 ? 39  LYS A CG   3  
ATOM 5019  C CD   . LYS A 1 39  ? 156.297 7.217   -104.855 1.00 0.00 ? 39  LYS A CD   3  
ATOM 5020  C CE   . LYS A 1 39  ? 156.529 8.702   -104.576 1.00 0.00 ? 39  LYS A CE   3  
ATOM 5021  N NZ   . LYS A 1 39  ? 157.721 8.862   -103.694 1.00 0.00 ? 39  LYS A NZ   3  
ATOM 5022  H H    . LYS A 1 39  ? 153.302 5.432   -107.296 1.00 0.00 ? 39  LYS A H    3  
ATOM 5023  H HA   . LYS A 1 39  ? 154.282 4.885   -104.696 1.00 0.00 ? 39  LYS A HA   3  
ATOM 5024  H HB2  . LYS A 1 39  ? 153.102 7.441   -105.840 1.00 0.00 ? 39  LYS A HB2  3  
ATOM 5025  H HB3  . LYS A 1 39  ? 153.889 7.357   -104.265 1.00 0.00 ? 39  LYS A HB3  3  
ATOM 5026  H HG2  . LYS A 1 39  ? 155.414 6.178   -106.516 1.00 0.00 ? 39  LYS A HG2  3  
ATOM 5027  H HG3  . LYS A 1 39  ? 155.216 7.930   -106.565 1.00 0.00 ? 39  LYS A HG3  3  
ATOM 5028  H HD2  . LYS A 1 39  ? 155.980 6.724   -103.948 1.00 0.00 ? 39  LYS A HD2  3  
ATOM 5029  H HD3  . LYS A 1 39  ? 157.216 6.770   -105.206 1.00 0.00 ? 39  LYS A HD3  3  
ATOM 5030  H HE2  . LYS A 1 39  ? 156.701 9.222   -105.508 1.00 0.00 ? 39  LYS A HE2  3  
ATOM 5031  H HE3  . LYS A 1 39  ? 155.660 9.117   -104.087 1.00 0.00 ? 39  LYS A HE3  3  
ATOM 5032  H HZ1  . LYS A 1 39  ? 157.441 9.349   -102.819 1.00 0.00 ? 39  LYS A HZ1  3  
ATOM 5033  H HZ2  . LYS A 1 39  ? 158.445 9.421   -104.187 1.00 0.00 ? 39  LYS A HZ2  3  
ATOM 5034  H HZ3  . LYS A 1 39  ? 158.105 7.925   -103.458 1.00 0.00 ? 39  LYS A HZ3  3  
ATOM 5035  N N    . ALA A 1 40  ? 151.116 5.792   -104.692 1.00 0.00 ? 40  ALA A N    3  
ATOM 5036  C CA   . ALA A 1 40  ? 149.885 5.662   -103.866 1.00 0.00 ? 40  ALA A CA   3  
ATOM 5037  C C    . ALA A 1 40  ? 149.492 4.188   -103.765 1.00 0.00 ? 40  ALA A C    3  
ATOM 5038  O O    . ALA A 1 40  ? 149.024 3.733   -102.731 1.00 0.00 ? 40  ALA A O    3  
ATOM 5039  C CB   . ALA A 1 40  ? 148.744 6.466   -104.494 1.00 0.00 ? 40  ALA A CB   3  
ATOM 5040  H H    . ALA A 1 40  ? 151.087 6.268   -105.548 1.00 0.00 ? 40  ALA A H    3  
ATOM 5041  H HA   . ALA A 1 40  ? 150.092 6.031   -102.873 1.00 0.00 ? 40  ALA A HA   3  
ATOM 5042  H HB1  . ALA A 1 40  ? 149.099 7.453   -104.752 1.00 0.00 ? 40  ALA A HB1  3  
ATOM 5043  H HB2  . ALA A 1 40  ? 147.931 6.550   -103.787 1.00 0.00 ? 40  ALA A HB2  3  
ATOM 5044  H HB3  . ALA A 1 40  ? 148.397 5.964   -105.384 1.00 0.00 ? 40  ALA A HB3  3  
ATOM 5045  N N    . PHE A 1 41  ? 149.735 3.405   -104.782 1.00 0.00 ? 41  PHE A N    3  
ATOM 5046  C CA   . PHE A 1 41  ? 149.420 1.959   -104.672 1.00 0.00 ? 41  PHE A CA   3  
ATOM 5047  C C    . PHE A 1 41  ? 150.416 1.352   -103.696 1.00 0.00 ? 41  PHE A C    3  
ATOM 5048  O O    . PHE A 1 41  ? 150.081 1.042   -102.570 1.00 0.00 ? 41  PHE A O    3  
ATOM 5049  C CB   . PHE A 1 41  ? 149.589 1.299   -106.043 1.00 0.00 ? 41  PHE A CB   3  
ATOM 5050  C CG   . PHE A 1 41  ? 148.470 0.312   -106.267 1.00 0.00 ? 41  PHE A CG   3  
ATOM 5051  C CD1  . PHE A 1 41  ? 147.208 0.765   -106.670 1.00 0.00 ? 41  PHE A CD1  3  
ATOM 5052  C CD2  . PHE A 1 41  ? 148.692 -1.057  -106.072 1.00 0.00 ? 41  PHE A CD2  3  
ATOM 5053  C CE1  . PHE A 1 41  ? 146.168 -0.150  -106.876 1.00 0.00 ? 41  PHE A CE1  3  
ATOM 5054  C CE2  . PHE A 1 41  ? 147.654 -1.972  -106.279 1.00 0.00 ? 41  PHE A CE2  3  
ATOM 5055  C CZ   . PHE A 1 41  ? 146.392 -1.518  -106.682 1.00 0.00 ? 41  PHE A CZ   3  
ATOM 5056  H H    . PHE A 1 41  ? 150.185 3.722   -105.597 1.00 0.00 ? 41  PHE A H    3  
ATOM 5057  H HA   . PHE A 1 41  ? 148.410 1.803   -104.319 1.00 0.00 ? 41  PHE A HA   3  
ATOM 5058  H HB2  . PHE A 1 41  ? 149.562 2.057   -106.813 1.00 0.00 ? 41  PHE A HB2  3  
ATOM 5059  H HB3  . PHE A 1 41  ? 150.537 0.782   -106.079 1.00 0.00 ? 41  PHE A HB3  3  
ATOM 5060  H HD1  . PHE A 1 41  ? 147.036 1.821   -106.820 1.00 0.00 ? 41  PHE A HD1  3  
ATOM 5061  H HD2  . PHE A 1 41  ? 149.666 -1.406  -105.762 1.00 0.00 ? 41  PHE A HD2  3  
ATOM 5062  H HE1  . PHE A 1 41  ? 145.196 0.201   -107.186 1.00 0.00 ? 41  PHE A HE1  3  
ATOM 5063  H HE2  . PHE A 1 41  ? 147.825 -3.027  -106.129 1.00 0.00 ? 41  PHE A HE2  3  
ATOM 5064  H HZ   . PHE A 1 41  ? 145.590 -2.224  -106.841 1.00 0.00 ? 41  PHE A HZ   3  
ATOM 5065  N N    . ASN A 1 42  ? 151.625 1.123   -104.123 1.00 0.00 ? 42  ASN A N    3  
ATOM 5066  C CA   . ASN A 1 42  ? 152.616 0.475   -103.233 1.00 0.00 ? 42  ASN A CA   3  
ATOM 5067  C C    . ASN A 1 42  ? 152.521 1.032   -101.814 1.00 0.00 ? 42  ASN A C    3  
ATOM 5068  O O    . ASN A 1 42  ? 152.737 0.350   -100.833 1.00 0.00 ? 42  ASN A O    3  
ATOM 5069  C CB   . ASN A 1 42  ? 154.013 0.799   -103.769 1.00 0.00 ? 42  ASN A CB   3  
ATOM 5070  C CG   . ASN A 1 42  ? 154.927 -0.412  -103.578 1.00 0.00 ? 42  ASN A CG   3  
ATOM 5071  O OD1  . ASN A 1 42  ? 154.589 -1.337  -102.866 1.00 0.00 ? 42  ASN A OD1  3  
ATOM 5072  N ND2  . ASN A 1 42  ? 156.081 -0.446  -104.187 1.00 0.00 ? 42  ASN A ND2  3  
ATOM 5073  H H    . ASN A 1 42  ? 151.883 1.289   -105.054 1.00 0.00 ? 42  ASN A H    3  
ATOM 5074  H HA   . ASN A 1 42  ? 152.478 -0.595  -103.296 1.00 0.00 ? 42  ASN A HA   3  
ATOM 5075  H HB2  . ASN A 1 42  ? 153.946 1.039   -104.821 1.00 0.00 ? 42  ASN A HB2  3  
ATOM 5076  H HB3  . ASN A 1 42  ? 154.418 1.643   -103.233 1.00 0.00 ? 42  ASN A HB3  3  
ATOM 5077  H HD21 . ASN A 1 42  ? 156.355 0.300   -104.761 1.00 0.00 ? 42  ASN A HD21 3  
ATOM 5078  H HD22 . ASN A 1 42  ? 156.674 -1.217  -104.070 1.00 0.00 ? 42  ASN A HD22 3  
ATOM 5079  N N    . ALA A 1 43  ? 152.199 2.299   -101.729 1.00 0.00 ? 43  ALA A N    3  
ATOM 5080  C CA   . ALA A 1 43  ? 152.079 2.991   -100.415 1.00 0.00 ? 43  ALA A CA   3  
ATOM 5081  C C    . ALA A 1 43  ? 150.884 2.448   -99.634  1.00 0.00 ? 43  ALA A C    3  
ATOM 5082  O O    . ALA A 1 43  ? 150.918 2.336   -98.421  1.00 0.00 ? 43  ALA A O    3  
ATOM 5083  C CB   . ALA A 1 43  ? 151.858 4.483   -100.668 1.00 0.00 ? 43  ALA A CB   3  
ATOM 5084  H H    . ALA A 1 43  ? 152.042 2.809   -102.552 1.00 0.00 ? 43  ALA A H    3  
ATOM 5085  H HA   . ALA A 1 43  ? 152.996 2.869   -99.858  1.00 0.00 ? 43  ALA A HA   3  
ATOM 5086  H HB1  . ALA A 1 43  ? 151.057 4.612   -101.381 1.00 0.00 ? 43  ALA A HB1  3  
ATOM 5087  H HB2  . ALA A 1 43  ? 152.764 4.919   -101.062 1.00 0.00 ? 43  ALA A HB2  3  
ATOM 5088  H HB3  . ALA A 1 43  ? 151.597 4.970   -99.742  1.00 0.00 ? 43  ALA A HB3  3  
ATOM 5089  N N    . ALA A 1 44  ? 149.833 2.076   -100.317 1.00 0.00 ? 44  ALA A N    3  
ATOM 5090  C CA   . ALA A 1 44  ? 148.660 1.520   -99.588  1.00 0.00 ? 44  ALA A CA   3  
ATOM 5091  C C    . ALA A 1 44  ? 148.817 0.012   -99.490  1.00 0.00 ? 44  ALA A C    3  
ATOM 5092  O O    . ALA A 1 44  ? 148.775 -0.572  -98.424  1.00 0.00 ? 44  ALA A O    3  
ATOM 5093  C CB   . ALA A 1 44  ? 147.356 1.852   -100.311 1.00 0.00 ? 44  ALA A CB   3  
ATOM 5094  H H    . ALA A 1 44  ? 149.841 2.118   -101.301 1.00 0.00 ? 44  ALA A H    3  
ATOM 5095  H HA   . ALA A 1 44  ? 148.658 1.900   -98.579  1.00 0.00 ? 44  ALA A HA   3  
ATOM 5096  H HB1  . ALA A 1 44  ? 147.561 2.030   -101.356 1.00 0.00 ? 44  ALA A HB1  3  
ATOM 5097  H HB2  . ALA A 1 44  ? 146.914 2.732   -99.873  1.00 0.00 ? 44  ALA A HB2  3  
ATOM 5098  H HB3  . ALA A 1 44  ? 146.675 1.018   -100.217 1.00 0.00 ? 44  ALA A HB3  3  
ATOM 5099  N N    . THR A 1 45  ? 149.026 -0.612  -100.606 1.00 0.00 ? 45  THR A N    3  
ATOM 5100  C CA   . THR A 1 45  ? 149.218 -2.075  -100.618 1.00 0.00 ? 45  THR A CA   3  
ATOM 5101  C C    . THR A 1 45  ? 150.330 -2.425  -99.632  1.00 0.00 ? 45  THR A C    3  
ATOM 5102  O O    . THR A 1 45  ? 150.319 -3.467  -99.008  1.00 0.00 ? 45  THR A O    3  
ATOM 5103  C CB   . THR A 1 45  ? 149.601 -2.489  -102.031 1.00 0.00 ? 45  THR A CB   3  
ATOM 5104  O OG1  . THR A 1 45  ? 150.930 -2.067  -102.306 1.00 0.00 ? 45  THR A OG1  3  
ATOM 5105  C CG2  . THR A 1 45  ? 148.633 -1.827  -103.013 1.00 0.00 ? 45  THR A CG2  3  
ATOM 5106  H H    . THR A 1 45  ? 149.071 -0.109  -101.445 1.00 0.00 ? 45  THR A H    3  
ATOM 5107  H HA   . THR A 1 45  ? 148.302 -2.569  -100.328 1.00 0.00 ? 45  THR A HA   3  
ATOM 5108  H HB   . THR A 1 45  ? 149.533 -3.552  -102.125 1.00 0.00 ? 45  THR A HB   3  
ATOM 5109  H HG1  . THR A 1 45  ? 151.512 -2.820  -102.184 1.00 0.00 ? 45  THR A HG1  3  
ATOM 5110  H HG21 . THR A 1 45  ? 148.917 -0.795  -103.159 1.00 0.00 ? 45  THR A HG21 3  
ATOM 5111  H HG22 . THR A 1 45  ? 147.630 -1.868  -102.609 1.00 0.00 ? 45  THR A HG22 3  
ATOM 5112  H HG23 . THR A 1 45  ? 148.663 -2.348  -103.958 1.00 0.00 ? 45  THR A HG23 3  
ATOM 5113  N N    . ALA A 1 46  ? 151.278 -1.543  -99.466  1.00 0.00 ? 46  ALA A N    3  
ATOM 5114  C CA   . ALA A 1 46  ? 152.371 -1.803  -98.495  1.00 0.00 ? 46  ALA A CA   3  
ATOM 5115  C C    . ALA A 1 46  ? 151.858 -1.444  -97.103  1.00 0.00 ? 46  ALA A C    3  
ATOM 5116  O O    . ALA A 1 46  ? 152.041 -2.178  -96.152  1.00 0.00 ? 46  ALA A O    3  
ATOM 5117  C CB   . ALA A 1 46  ? 153.591 -0.942  -98.834  1.00 0.00 ? 46  ALA A CB   3  
ATOM 5118  H H    . ALA A 1 46  ? 151.255 -0.699  -99.964  1.00 0.00 ? 46  ALA A H    3  
ATOM 5119  H HA   . ALA A 1 46  ? 152.643 -2.850  -98.524  1.00 0.00 ? 46  ALA A HA   3  
ATOM 5120  H HB1  . ALA A 1 46  ? 153.922 -1.165  -99.837  1.00 0.00 ? 46  ALA A HB1  3  
ATOM 5121  H HB2  . ALA A 1 46  ? 154.387 -1.155  -98.136  1.00 0.00 ? 46  ALA A HB2  3  
ATOM 5122  H HB3  . ALA A 1 46  ? 153.323 0.102   -98.765  1.00 0.00 ? 46  ALA A HB3  3  
ATOM 5123  N N    . ASN A 1 47  ? 151.197 -0.322  -96.979  1.00 0.00 ? 47  ASN A N    3  
ATOM 5124  C CA   . ASN A 1 47  ? 150.654 0.075   -95.653  1.00 0.00 ? 47  ASN A CA   3  
ATOM 5125  C C    . ASN A 1 47  ? 149.775 -1.056  -95.110  1.00 0.00 ? 47  ASN A C    3  
ATOM 5126  O O    . ASN A 1 47  ? 149.562 -1.172  -93.919  1.00 0.00 ? 47  ASN A O    3  
ATOM 5127  C CB   . ASN A 1 47  ? 149.812 1.344   -95.807  1.00 0.00 ? 47  ASN A CB   3  
ATOM 5128  C CG   . ASN A 1 47  ? 149.345 1.817   -94.429  1.00 0.00 ? 47  ASN A CG   3  
ATOM 5129  O OD1  . ASN A 1 47  ? 149.864 2.778   -93.896  1.00 0.00 ? 47  ASN A OD1  3  
ATOM 5130  N ND2  . ASN A 1 47  ? 148.381 1.179   -93.826  1.00 0.00 ? 47  ASN A ND2  3  
ATOM 5131  H H    . ASN A 1 47  ? 151.049 0.255   -97.763  1.00 0.00 ? 47  ASN A H    3  
ATOM 5132  H HA   . ASN A 1 47  ? 151.468 0.264   -94.969  1.00 0.00 ? 47  ASN A HA   3  
ATOM 5133  H HB2  . ASN A 1 47  ? 150.408 2.116   -96.271  1.00 0.00 ? 47  ASN A HB2  3  
ATOM 5134  H HB3  . ASN A 1 47  ? 148.951 1.132   -96.423  1.00 0.00 ? 47  ASN A HB3  3  
ATOM 5135  H HD21 . ASN A 1 47  ? 147.962 0.403   -94.255  1.00 0.00 ? 47  ASN A HD21 3  
ATOM 5136  H HD22 . ASN A 1 47  ? 148.074 1.474   -92.943  1.00 0.00 ? 47  ASN A HD22 3  
ATOM 5137  N N    . MET A 1 48  ? 149.261 -1.893  -95.975  1.00 0.00 ? 48  MET A N    3  
ATOM 5138  C CA   . MET A 1 48  ? 148.397 -3.016  -95.503  1.00 0.00 ? 48  MET A CA   3  
ATOM 5139  C C    . MET A 1 48  ? 149.145 -4.345  -95.661  1.00 0.00 ? 48  MET A C    3  
ATOM 5140  O O    . MET A 1 48  ? 149.757 -4.825  -94.728  1.00 0.00 ? 48  MET A O    3  
ATOM 5141  C CB   . MET A 1 48  ? 147.108 -3.053  -96.329  1.00 0.00 ? 48  MET A CB   3  
ATOM 5142  C CG   . MET A 1 48  ? 147.443 -2.915  -97.816  1.00 0.00 ? 48  MET A CG   3  
ATOM 5143  S SD   . MET A 1 48  ? 146.822 -4.362  -98.713  1.00 0.00 ? 48  MET A SD   3  
ATOM 5144  C CE   . MET A 1 48  ? 145.653 -3.489  -99.785  1.00 0.00 ? 48  MET A CE   3  
ATOM 5145  H H    . MET A 1 48  ? 149.445 -1.785  -96.932  1.00 0.00 ? 48  MET A H    3  
ATOM 5146  H HA   . MET A 1 48  ? 148.152 -2.865  -94.462  1.00 0.00 ? 48  MET A HA   3  
ATOM 5147  H HB2  . MET A 1 48  ? 146.600 -3.992  -96.160  1.00 0.00 ? 48  MET A HB2  3  
ATOM 5148  H HB3  . MET A 1 48  ? 146.466 -2.239  -96.031  1.00 0.00 ? 48  MET A HB3  3  
ATOM 5149  H HG2  . MET A 1 48  ? 146.980 -2.022  -98.208  1.00 0.00 ? 48  MET A HG2  3  
ATOM 5150  H HG3  . MET A 1 48  ? 148.513 -2.849  -97.939  1.00 0.00 ? 48  MET A HG3  3  
ATOM 5151  H HE1  . MET A 1 48  ? 146.185 -3.051  -100.618 1.00 0.00 ? 48  MET A HE1  3  
ATOM 5152  H HE2  . MET A 1 48  ? 145.162 -2.708  -99.227  1.00 0.00 ? 48  MET A HE2  3  
ATOM 5153  H HE3  . MET A 1 48  ? 144.912 -4.186  -100.151 1.00 0.00 ? 48  MET A HE3  3  
ATOM 5154  N N    . GLY A 1 49  ? 149.099 -4.958  -96.814  1.00 0.00 ? 49  GLY A N    3  
ATOM 5155  C CA   . GLY A 1 49  ? 149.812 -6.260  -96.968  1.00 0.00 ? 49  GLY A CA   3  
ATOM 5156  C C    . GLY A 1 49  ? 149.964 -6.633  -98.446  1.00 0.00 ? 49  GLY A C    3  
ATOM 5157  O O    . GLY A 1 49  ? 150.204 -5.789  -99.288  1.00 0.00 ? 49  GLY A O    3  
ATOM 5158  H H    . GLY A 1 49  ? 148.596 -4.574  -97.563  1.00 0.00 ? 49  GLY A H    3  
ATOM 5159  H HA2  . GLY A 1 49  ? 150.792 -6.182  -96.520  1.00 0.00 ? 49  GLY A HA2  3  
ATOM 5160  H HA3  . GLY A 1 49  ? 149.252 -7.034  -96.465  1.00 0.00 ? 49  GLY A HA3  3  
ATOM 5161  N N    . ASP A 1 50  ? 149.828 -7.893  -98.767  1.00 0.00 ? 50  ASP A N    3  
ATOM 5162  C CA   . ASP A 1 50  ? 149.969 -8.322  -100.188 1.00 0.00 ? 50  ASP A CA   3  
ATOM 5163  C C    . ASP A 1 50  ? 148.654 -8.933  -100.677 1.00 0.00 ? 50  ASP A C    3  
ATOM 5164  O O    . ASP A 1 50  ? 148.159 -9.894  -100.123 1.00 0.00 ? 50  ASP A O    3  
ATOM 5165  C CB   . ASP A 1 50  ? 151.086 -9.361  -100.299 1.00 0.00 ? 50  ASP A CB   3  
ATOM 5166  C CG   . ASP A 1 50  ? 152.419 -8.726  -99.898  1.00 0.00 ? 50  ASP A CG   3  
ATOM 5167  O OD1  . ASP A 1 50  ? 152.476 -7.508  -99.835  1.00 0.00 ? 50  ASP A OD1  3  
ATOM 5168  O OD2  . ASP A 1 50  ? 153.358 -9.466  -99.658  1.00 0.00 ? 50  ASP A OD2  3  
ATOM 5169  H H    . ASP A 1 50  ? 149.637 -8.557  -98.071  1.00 0.00 ? 50  ASP A H    3  
ATOM 5170  H HA   . ASP A 1 50  ? 150.211 -7.468  -100.796 1.00 0.00 ? 50  ASP A HA   3  
ATOM 5171  H HB2  . ASP A 1 50  ? 150.871 -10.193 -99.642  1.00 0.00 ? 50  ASP A HB2  3  
ATOM 5172  H HB3  . ASP A 1 50  ? 151.150 -9.714  -101.317 1.00 0.00 ? 50  ASP A HB3  3  
ATOM 5173  N N    . ALA A 1 51  ? 148.080 -8.373  -101.709 1.00 0.00 ? 51  ALA A N    3  
ATOM 5174  C CA   . ALA A 1 51  ? 146.788 -8.915  -102.227 1.00 0.00 ? 51  ALA A CA   3  
ATOM 5175  C C    . ALA A 1 51  ? 146.609 -8.528  -103.702 1.00 0.00 ? 51  ALA A C    3  
ATOM 5176  O O    . ALA A 1 51  ? 147.562 -8.287  -104.417 1.00 0.00 ? 51  ALA A O    3  
ATOM 5177  C CB   . ALA A 1 51  ? 145.630 -8.347  -101.402 1.00 0.00 ? 51  ALA A CB   3  
ATOM 5178  H H    . ALA A 1 51  ? 148.492 -7.587  -102.134 1.00 0.00 ? 51  ALA A H    3  
ATOM 5179  H HA   . ALA A 1 51  ? 146.794 -9.992  -102.140 1.00 0.00 ? 51  ALA A HA   3  
ATOM 5180  H HB1  . ALA A 1 51  ? 144.986 -9.152  -101.080 1.00 0.00 ? 51  ALA A HB1  3  
ATOM 5181  H HB2  . ALA A 1 51  ? 145.063 -7.655  -102.007 1.00 0.00 ? 51  ALA A HB2  3  
ATOM 5182  H HB3  . ALA A 1 51  ? 146.022 -7.831  -100.538 1.00 0.00 ? 51  ALA A HB3  3  
ATOM 5183  N N    . ILE A 1 52  ? 145.381 -8.432  -104.140 1.00 0.00 ? 52  ILE A N    3  
ATOM 5184  C CA   . ILE A 1 52  ? 145.086 -8.021  -105.547 1.00 0.00 ? 52  ILE A CA   3  
ATOM 5185  C C    . ILE A 1 52  ? 143.778 -7.232  -105.523 1.00 0.00 ? 52  ILE A C    3  
ATOM 5186  O O    . ILE A 1 52  ? 142.868 -7.545  -104.782 1.00 0.00 ? 52  ILE A O    3  
ATOM 5187  C CB   . ILE A 1 52  ? 144.919 -9.247  -106.449 1.00 0.00 ? 52  ILE A CB   3  
ATOM 5188  C CG1  . ILE A 1 52  ? 146.263 -9.963  -106.607 1.00 0.00 ? 52  ILE A CG1  3  
ATOM 5189  C CG2  . ILE A 1 52  ? 144.417 -8.794  -107.823 1.00 0.00 ? 52  ILE A CG2  3  
ATOM 5190  C CD1  . ILE A 1 52  ? 147.057 -9.313  -107.740 1.00 0.00 ? 52  ILE A CD1  3  
ATOM 5191  H H    . ILE A 1 52  ? 144.638 -8.577  -103.519 1.00 0.00 ? 52  ILE A H    3  
ATOM 5192  H HA   . ILE A 1 52  ? 145.873 -7.382  -105.921 1.00 0.00 ? 52  ILE A HA   3  
ATOM 5193  H HB   . ILE A 1 52  ? 144.198 -9.922  -106.008 1.00 0.00 ? 52  ILE A HB   3  
ATOM 5194  H HG12 . ILE A 1 52  ? 146.822 -9.889  -105.687 1.00 0.00 ? 52  ILE A HG12 3  
ATOM 5195  H HG13 . ILE A 1 52  ? 146.092 -11.002 -106.842 1.00 0.00 ? 52  ILE A HG13 3  
ATOM 5196  H HG21 . ILE A 1 52  ? 144.998 -7.946  -108.158 1.00 0.00 ? 52  ILE A HG21 3  
ATOM 5197  H HG22 . ILE A 1 52  ? 143.377 -8.510  -107.753 1.00 0.00 ? 52  ILE A HG22 3  
ATOM 5198  H HG23 . ILE A 1 52  ? 144.521 -9.603  -108.531 1.00 0.00 ? 52  ILE A HG23 3  
ATOM 5199  H HD11 . ILE A 1 52  ? 148.114 -9.428  -107.551 1.00 0.00 ? 52  ILE A HD11 3  
ATOM 5200  H HD12 . ILE A 1 52  ? 146.812 -8.262  -107.793 1.00 0.00 ? 52  ILE A HD12 3  
ATOM 5201  H HD13 . ILE A 1 52  ? 146.803 -9.788  -108.675 1.00 0.00 ? 52  ILE A HD13 3  
ATOM 5202  N N    . VAL A 1 53  ? 143.678 -6.202  -106.320 1.00 0.00 ? 53  VAL A N    3  
ATOM 5203  C CA   . VAL A 1 53  ? 142.428 -5.392  -106.324 1.00 0.00 ? 53  VAL A CA   3  
ATOM 5204  C C    . VAL A 1 53  ? 142.133 -4.877  -107.741 1.00 0.00 ? 53  VAL A C    3  
ATOM 5205  O O    . VAL A 1 53  ? 143.024 -4.421  -108.437 1.00 0.00 ? 53  VAL A O    3  
ATOM 5206  C CB   . VAL A 1 53  ? 142.611 -4.199  -105.384 1.00 0.00 ? 53  VAL A CB   3  
ATOM 5207  C CG1  . VAL A 1 53  ? 141.249 -3.588  -105.051 1.00 0.00 ? 53  VAL A CG1  3  
ATOM 5208  C CG2  . VAL A 1 53  ? 143.288 -4.668  -104.094 1.00 0.00 ? 53  VAL A CG2  3  
ATOM 5209  H H    . VAL A 1 53  ? 144.426 -5.953  -106.905 1.00 0.00 ? 53  VAL A H    3  
ATOM 5210  H HA   . VAL A 1 53  ? 141.610 -6.000  -105.974 1.00 0.00 ? 53  VAL A HA   3  
ATOM 5211  H HB   . VAL A 1 53  ? 143.229 -3.455  -105.866 1.00 0.00 ? 53  VAL A HB   3  
ATOM 5212  H HG11 . VAL A 1 53  ? 140.600 -4.350  -104.648 1.00 0.00 ? 53  VAL A HG11 3  
ATOM 5213  H HG12 . VAL A 1 53  ? 140.809 -3.177  -105.949 1.00 0.00 ? 53  VAL A HG12 3  
ATOM 5214  H HG13 . VAL A 1 53  ? 141.376 -2.801  -104.321 1.00 0.00 ? 53  VAL A HG13 3  
ATOM 5215  H HG21 . VAL A 1 53  ? 142.800 -5.562  -103.736 1.00 0.00 ? 53  VAL A HG21 3  
ATOM 5216  H HG22 . VAL A 1 53  ? 143.214 -3.893  -103.346 1.00 0.00 ? 53  VAL A HG22 3  
ATOM 5217  H HG23 . VAL A 1 53  ? 144.329 -4.881  -104.291 1.00 0.00 ? 53  VAL A HG23 3  
ATOM 5218  N N    . PRO A 1 54  ? 140.883 -4.930  -108.158 1.00 0.00 ? 54  PRO A N    3  
ATOM 5219  C CA   . PRO A 1 54  ? 140.479 -4.424  -109.501 1.00 0.00 ? 54  PRO A CA   3  
ATOM 5220  C C    . PRO A 1 54  ? 140.479 -2.891  -109.548 1.00 0.00 ? 54  PRO A C    3  
ATOM 5221  O O    . PRO A 1 54  ? 139.518 -2.259  -109.157 1.00 0.00 ? 54  PRO A O    3  
ATOM 5222  C CB   . PRO A 1 54  ? 139.053 -4.957  -109.639 1.00 0.00 ? 54  PRO A CB   3  
ATOM 5223  C CG   . PRO A 1 54  ? 138.591 -5.478  -108.273 1.00 0.00 ? 54  PRO A CG   3  
ATOM 5224  C CD   . PRO A 1 54  ? 139.794 -5.509  -107.327 1.00 0.00 ? 54  PRO A CD   3  
ATOM 5225  H HA   . PRO A 1 54  ? 141.098 -4.838  -110.276 1.00 0.00 ? 54  PRO A HA   3  
ATOM 5226  H HB2  . PRO A 1 54  ? 138.399 -4.160  -109.966 1.00 0.00 ? 54  PRO A HB2  3  
ATOM 5227  H HB3  . PRO A 1 54  ? 139.033 -5.762  -110.357 1.00 0.00 ? 54  PRO A HB3  3  
ATOM 5228  H HG2  . PRO A 1 54  ? 137.830 -4.823  -107.874 1.00 0.00 ? 54  PRO A HG2  3  
ATOM 5229  H HG3  . PRO A 1 54  ? 138.192 -6.475  -108.382 1.00 0.00 ? 54  PRO A HG3  3  
ATOM 5230  H HD2  . PRO A 1 54  ? 139.606 -4.902  -106.452 1.00 0.00 ? 54  PRO A HD2  3  
ATOM 5231  H HD3  . PRO A 1 54  ? 140.032 -6.523  -107.051 1.00 0.00 ? 54  PRO A HD3  3  
ATOM 5232  N N    . VAL A 1 55  ? 141.544 -2.279  -109.996 1.00 0.00 ? 55  VAL A N    3  
ATOM 5233  C CA   . VAL A 1 55  ? 141.567 -0.790  -110.021 1.00 0.00 ? 55  VAL A CA   3  
ATOM 5234  C C    . VAL A 1 55  ? 140.475 -0.235  -110.919 1.00 0.00 ? 55  VAL A C    3  
ATOM 5235  O O    . VAL A 1 55  ? 140.242 -0.692  -112.026 1.00 0.00 ? 55  VAL A O    3  
ATOM 5236  C CB   . VAL A 1 55  ? 142.892 -0.253  -110.544 1.00 0.00 ? 55  VAL A CB   3  
ATOM 5237  C CG1  . VAL A 1 55  ? 143.962 -0.357  -109.466 1.00 0.00 ? 55  VAL A CG1  3  
ATOM 5238  C CG2  . VAL A 1 55  ? 143.304 -1.042  -111.784 1.00 0.00 ? 55  VAL A CG2  3  
ATOM 5239  H H    . VAL A 1 55  ? 142.323 -2.793  -110.295 1.00 0.00 ? 55  VAL A H    3  
ATOM 5240  H HA   . VAL A 1 55  ? 141.414 -0.421  -109.018 1.00 0.00 ? 55  VAL A HA   3  
ATOM 5241  H HB   . VAL A 1 55  ? 142.764 0.784   -110.807 1.00 0.00 ? 55  VAL A HB   3  
ATOM 5242  H HG11 . VAL A 1 55  ? 144.452 -1.312  -109.536 1.00 0.00 ? 55  VAL A HG11 3  
ATOM 5243  H HG12 . VAL A 1 55  ? 143.501 -0.252  -108.495 1.00 0.00 ? 55  VAL A HG12 3  
ATOM 5244  H HG13 . VAL A 1 55  ? 144.685 0.434   -109.607 1.00 0.00 ? 55  VAL A HG13 3  
ATOM 5245  H HG21 . VAL A 1 55  ? 144.190 -0.602  -112.212 1.00 0.00 ? 55  VAL A HG21 3  
ATOM 5246  H HG22 . VAL A 1 55  ? 142.501 -1.012  -112.508 1.00 0.00 ? 55  VAL A HG22 3  
ATOM 5247  H HG23 . VAL A 1 55  ? 143.501 -2.065  -111.509 1.00 0.00 ? 55  VAL A HG23 3  
ATOM 5248  N N    . GLU A 1 56  ? 139.857 0.792   -110.438 1.00 0.00 ? 56  GLU A N    3  
ATOM 5249  C CA   . GLU A 1 56  ? 138.799 1.500   -111.191 1.00 0.00 ? 56  GLU A CA   3  
ATOM 5250  C C    . GLU A 1 56  ? 139.155 2.976   -111.131 1.00 0.00 ? 56  GLU A C    3  
ATOM 5251  O O    . GLU A 1 56  ? 138.518 3.770   -110.468 1.00 0.00 ? 56  GLU A O    3  
ATOM 5252  C CB   . GLU A 1 56  ? 137.442 1.256   -110.523 1.00 0.00 ? 56  GLU A CB   3  
ATOM 5253  C CG   . GLU A 1 56  ? 136.354 2.034   -111.266 1.00 0.00 ? 56  GLU A CG   3  
ATOM 5254  C CD   . GLU A 1 56  ? 135.095 2.101   -110.400 1.00 0.00 ? 56  GLU A CD   3  
ATOM 5255  O OE1  . GLU A 1 56  ? 134.560 1.051   -110.085 1.00 0.00 ? 56  GLU A OE1  3  
ATOM 5256  O OE2  . GLU A 1 56  ? 134.687 3.201   -110.068 1.00 0.00 ? 56  GLU A OE2  3  
ATOM 5257  H H    . GLU A 1 56  ? 140.124 1.133   -109.559 1.00 0.00 ? 56  GLU A H    3  
ATOM 5258  H HA   . GLU A 1 56  ? 138.769 1.195   -112.223 1.00 0.00 ? 56  GLU A HA   3  
ATOM 5259  H HB2  . GLU A 1 56  ? 137.213 0.202   -110.549 1.00 0.00 ? 56  GLU A HB2  3  
ATOM 5260  H HB3  . GLU A 1 56  ? 137.482 1.590   -109.496 1.00 0.00 ? 56  GLU A HB3  3  
ATOM 5261  H HG2  . GLU A 1 56  ? 136.705 3.034   -111.472 1.00 0.00 ? 56  GLU A HG2  3  
ATOM 5262  H HG3  . GLU A 1 56  ? 136.125 1.532   -112.193 1.00 0.00 ? 56  GLU A HG3  3  
ATOM 5263  N N    . ILE A 1 57  ? 140.204 3.329   -111.823 1.00 0.00 ? 57  ILE A N    3  
ATOM 5264  C CA   . ILE A 1 57  ? 140.671 4.736   -111.829 1.00 0.00 ? 57  ILE A CA   3  
ATOM 5265  C C    . ILE A 1 57  ? 139.693 5.619   -112.607 1.00 0.00 ? 57  ILE A C    3  
ATOM 5266  O O    . ILE A 1 57  ? 139.810 5.801   -113.808 1.00 0.00 ? 57  ILE A O    3  
ATOM 5267  C CB   . ILE A 1 57  ? 142.075 4.791   -112.435 1.00 0.00 ? 57  ILE A CB   3  
ATOM 5268  C CG1  . ILE A 1 57  ? 142.965 3.777   -111.696 1.00 0.00 ? 57  ILE A CG1  3  
ATOM 5269  C CG2  . ILE A 1 57  ? 142.651 6.197   -112.264 1.00 0.00 ? 57  ILE A CG2  3  
ATOM 5270  C CD1  . ILE A 1 57  ? 143.855 3.019   -112.684 1.00 0.00 ? 57  ILE A CD1  3  
ATOM 5271  H H    . ILE A 1 57  ? 140.697 2.652   -112.333 1.00 0.00 ? 57  ILE A H    3  
ATOM 5272  H HA   . ILE A 1 57  ? 140.719 5.092   -110.818 1.00 0.00 ? 57  ILE A HA   3  
ATOM 5273  H HB   . ILE A 1 57  ? 142.027 4.546   -113.483 1.00 0.00 ? 57  ILE A HB   3  
ATOM 5274  H HG12 . ILE A 1 57  ? 143.589 4.295   -110.984 1.00 0.00 ? 57  ILE A HG12 3  
ATOM 5275  H HG13 . ILE A 1 57  ? 142.339 3.071   -111.170 1.00 0.00 ? 57  ILE A HG13 3  
ATOM 5276  H HG21 . ILE A 1 57  ? 143.284 6.431   -113.106 1.00 0.00 ? 57  ILE A HG21 3  
ATOM 5277  H HG22 . ILE A 1 57  ? 143.231 6.239   -111.354 1.00 0.00 ? 57  ILE A HG22 3  
ATOM 5278  H HG23 . ILE A 1 57  ? 141.844 6.912   -112.210 1.00 0.00 ? 57  ILE A HG23 3  
ATOM 5279  H HD11 . ILE A 1 57  ? 144.861 2.968   -112.294 1.00 0.00 ? 57  ILE A HD11 3  
ATOM 5280  H HD12 . ILE A 1 57  ? 143.863 3.528   -113.634 1.00 0.00 ? 57  ILE A HD12 3  
ATOM 5281  H HD13 . ILE A 1 57  ? 143.473 2.017   -112.813 1.00 0.00 ? 57  ILE A HD13 3  
ATOM 5282  N N    . THR A 1 58  ? 138.711 6.140   -111.907 1.00 0.00 ? 58  THR A N    3  
ATOM 5283  C CA   . THR A 1 58  ? 137.700 7.006   -112.575 1.00 0.00 ? 58  THR A CA   3  
ATOM 5284  C C    . THR A 1 58  ? 138.429 8.254   -113.068 1.00 0.00 ? 58  THR A C    3  
ATOM 5285  O O    . THR A 1 58  ? 138.724 9.157   -112.312 1.00 0.00 ? 58  THR A O    3  
ATOM 5286  C CB   . THR A 1 58  ? 136.588 7.387   -111.594 1.00 0.00 ? 58  THR A CB   3  
ATOM 5287  O OG1  . THR A 1 58  ? 136.542 6.433   -110.541 1.00 0.00 ? 58  THR A OG1  3  
ATOM 5288  C CG2  . THR A 1 58  ? 135.244 7.407   -112.325 1.00 0.00 ? 58  THR A CG2  3  
ATOM 5289  H H    . THR A 1 58  ? 138.662 5.908   -110.952 1.00 0.00 ? 58  THR A H    3  
ATOM 5290  H HA   . THR A 1 58  ? 137.297 6.469   -113.418 1.00 0.00 ? 58  THR A HA   3  
ATOM 5291  H HB   . THR A 1 58  ? 136.785 8.365   -111.185 1.00 0.00 ? 58  THR A HB   3  
ATOM 5292  H HG1  . THR A 1 58  ? 135.686 6.504   -110.113 1.00 0.00 ? 58  THR A HG1  3  
ATOM 5293  H HG21 . THR A 1 58  ? 134.451 7.588   -111.616 1.00 0.00 ? 58  THR A HG21 3  
ATOM 5294  H HG22 . THR A 1 58  ? 135.084 6.455   -112.810 1.00 0.00 ? 58  THR A HG22 3  
ATOM 5295  H HG23 . THR A 1 58  ? 135.251 8.193   -113.067 1.00 0.00 ? 58  THR A HG23 3  
ATOM 5296  N N    . ILE A 1 59  ? 138.736 8.296   -114.336 1.00 0.00 ? 59  ILE A N    3  
ATOM 5297  C CA   . ILE A 1 59  ? 139.466 9.469   -114.887 1.00 0.00 ? 59  ILE A CA   3  
ATOM 5298  C C    . ILE A 1 59  ? 138.506 10.402  -115.626 1.00 0.00 ? 59  ILE A C    3  
ATOM 5299  O O    . ILE A 1 59  ? 137.660 9.970   -116.392 1.00 0.00 ? 59  ILE A O    3  
ATOM 5300  C CB   . ILE A 1 59  ? 140.542 8.985   -115.864 1.00 0.00 ? 59  ILE A CB   3  
ATOM 5301  C CG1  . ILE A 1 59  ? 141.718 8.391   -115.084 1.00 0.00 ? 59  ILE A CG1  3  
ATOM 5302  C CG2  . ILE A 1 59  ? 141.036 10.167  -116.701 1.00 0.00 ? 59  ILE A CG2  3  
ATOM 5303  C CD1  . ILE A 1 59  ? 142.824 7.973   -116.057 1.00 0.00 ? 59  ILE A CD1  3  
ATOM 5304  H H    . ILE A 1 59  ? 138.498 7.549   -114.923 1.00 0.00 ? 59  ILE A H    3  
ATOM 5305  H HA   . ILE A 1 59  ? 139.935 10.008  -114.081 1.00 0.00 ? 59  ILE A HA   3  
ATOM 5306  H HB   . ILE A 1 59  ? 140.124 8.234   -116.517 1.00 0.00 ? 59  ILE A HB   3  
ATOM 5307  H HG12 . ILE A 1 59  ? 142.103 9.130   -114.399 1.00 0.00 ? 59  ILE A HG12 3  
ATOM 5308  H HG13 . ILE A 1 59  ? 141.382 7.527   -114.530 1.00 0.00 ? 59  ILE A HG13 3  
ATOM 5309  H HG21 . ILE A 1 59  ? 140.243 10.505  -117.351 1.00 0.00 ? 59  ILE A HG21 3  
ATOM 5310  H HG22 . ILE A 1 59  ? 141.882 9.858   -117.297 1.00 0.00 ? 59  ILE A HG22 3  
ATOM 5311  H HG23 . ILE A 1 59  ? 141.334 10.973  -116.046 1.00 0.00 ? 59  ILE A HG23 3  
ATOM 5312  H HD11 . ILE A 1 59  ? 142.432 7.253   -116.760 1.00 0.00 ? 59  ILE A HD11 3  
ATOM 5313  H HD12 . ILE A 1 59  ? 143.640 7.531   -115.506 1.00 0.00 ? 59  ILE A HD12 3  
ATOM 5314  H HD13 . ILE A 1 59  ? 143.179 8.842   -116.592 1.00 0.00 ? 59  ILE A HD13 3  
ATOM 5315  N N    . TYR A 1 60  ? 138.665 11.683  -115.420 1.00 0.00 ? 60  TYR A N    3  
ATOM 5316  C CA   . TYR A 1 60  ? 137.792 12.662  -116.126 1.00 0.00 ? 60  TYR A CA   3  
ATOM 5317  C C    . TYR A 1 60  ? 138.672 13.453  -117.094 1.00 0.00 ? 60  TYR A C    3  
ATOM 5318  O O    . TYR A 1 60  ? 139.800 13.806  -116.784 1.00 0.00 ? 60  TYR A O    3  
ATOM 5319  C CB   . TYR A 1 60  ? 137.104 13.597  -115.126 1.00 0.00 ? 60  TYR A CB   3  
ATOM 5320  C CG   . TYR A 1 60  ? 135.607 13.418  -115.163 1.00 0.00 ? 60  TYR A CG   3  
ATOM 5321  C CD1  . TYR A 1 60  ? 135.016 12.294  -114.574 1.00 0.00 ? 60  TYR A CD1  3  
ATOM 5322  C CD2  . TYR A 1 60  ? 134.807 14.393  -115.768 1.00 0.00 ? 60  TYR A CD2  3  
ATOM 5323  C CE1  . TYR A 1 60  ? 133.624 12.146  -114.591 1.00 0.00 ? 60  TYR A CE1  3  
ATOM 5324  C CE2  . TYR A 1 60  ? 133.417 14.245  -115.787 1.00 0.00 ? 60  TYR A CE2  3  
ATOM 5325  C CZ   . TYR A 1 60  ? 132.824 13.121  -115.199 1.00 0.00 ? 60  TYR A CZ   3  
ATOM 5326  O OH   . TYR A 1 60  ? 131.453 12.975  -115.215 1.00 0.00 ? 60  TYR A OH   3  
ATOM 5327  H H    . TYR A 1 60  ? 139.387 11.975  -114.827 1.00 0.00 ? 60  TYR A H    3  
ATOM 5328  H HA   . TYR A 1 60  ? 137.088 12.102  -116.718 1.00 0.00 ? 60  TYR A HA   3  
ATOM 5329  H HB2  . TYR A 1 60  ? 137.463 13.378  -114.132 1.00 0.00 ? 60  TYR A HB2  3  
ATOM 5330  H HB3  . TYR A 1 60  ? 137.346 14.620  -115.374 1.00 0.00 ? 60  TYR A HB3  3  
ATOM 5331  H HD1  . TYR A 1 60  ? 135.632 11.539  -114.108 1.00 0.00 ? 60  TYR A HD1  3  
ATOM 5332  H HD2  . TYR A 1 60  ? 135.263 15.261  -116.222 1.00 0.00 ? 60  TYR A HD2  3  
ATOM 5333  H HE1  . TYR A 1 60  ? 133.166 11.281  -114.136 1.00 0.00 ? 60  TYR A HE1  3  
ATOM 5334  H HE2  . TYR A 1 60  ? 132.803 14.998  -116.253 1.00 0.00 ? 60  TYR A HE2  3  
ATOM 5335  H HH   . TYR A 1 60  ? 131.061 13.820  -114.980 1.00 0.00 ? 60  TYR A HH   3  
ATOM 5336  N N    . ALA A 1 61  ? 138.172 13.681  -118.288 1.00 0.00 ? 61  ALA A N    3  
ATOM 5337  C CA   . ALA A 1 61  ? 138.978 14.389  -119.321 1.00 0.00 ? 61  ALA A CA   3  
ATOM 5338  C C    . ALA A 1 61  ? 139.589 15.661  -118.745 1.00 0.00 ? 61  ALA A C    3  
ATOM 5339  O O    . ALA A 1 61  ? 140.674 16.056  -119.121 1.00 0.00 ? 61  ALA A O    3  
ATOM 5340  C CB   . ALA A 1 61  ? 138.112 14.719  -120.538 1.00 0.00 ? 61  ALA A CB   3  
ATOM 5341  H H    . ALA A 1 61  ? 137.277 13.346  -118.514 1.00 0.00 ? 61  ALA A H    3  
ATOM 5342  H HA   . ALA A 1 61  ? 139.783 13.732  -119.609 1.00 0.00 ? 61  ALA A HA   3  
ATOM 5343  H HB1  . ALA A 1 61  ? 137.078 14.493  -120.317 1.00 0.00 ? 61  ALA A HB1  3  
ATOM 5344  H HB2  . ALA A 1 61  ? 138.436 14.129  -121.382 1.00 0.00 ? 61  ALA A HB2  3  
ATOM 5345  H HB3  . ALA A 1 61  ? 138.208 15.769  -120.774 1.00 0.00 ? 61  ALA A HB3  3  
ATOM 5346  N N    . ASP A 1 62  ? 138.938 16.288  -117.803 1.00 0.00 ? 62  ASP A N    3  
ATOM 5347  C CA   . ASP A 1 62  ? 139.552 17.498  -117.197 1.00 0.00 ? 62  ASP A CA   3  
ATOM 5348  C C    . ASP A 1 62  ? 140.946 17.085  -116.732 1.00 0.00 ? 62  ASP A C    3  
ATOM 5349  O O    . ASP A 1 62  ? 141.694 17.856  -116.164 1.00 0.00 ? 62  ASP A O    3  
ATOM 5350  C CB   . ASP A 1 62  ? 138.718 17.965  -116.002 1.00 0.00 ? 62  ASP A CB   3  
ATOM 5351  C CG   . ASP A 1 62  ? 137.702 19.011  -116.466 1.00 0.00 ? 62  ASP A CG   3  
ATOM 5352  O OD1  . ASP A 1 62  ? 137.691 19.314  -117.648 1.00 0.00 ? 62  ASP A OD1  3  
ATOM 5353  O OD2  . ASP A 1 62  ? 136.952 19.492  -115.633 1.00 0.00 ? 62  ASP A OD2  3  
ATOM 5354  H H    . ASP A 1 62  ? 138.079 15.948  -117.478 1.00 0.00 ? 62  ASP A H    3  
ATOM 5355  H HA   . ASP A 1 62  ? 139.625 18.285  -117.934 1.00 0.00 ? 62  ASP A HA   3  
ATOM 5356  H HB2  . ASP A 1 62  ? 138.196 17.122  -115.575 1.00 0.00 ? 62  ASP A HB2  3  
ATOM 5357  H HB3  . ASP A 1 62  ? 139.366 18.403  -115.259 1.00 0.00 ? 62  ASP A HB3  3  
ATOM 5358  N N    . ARG A 1 63  ? 141.275 15.845  -116.982 1.00 0.00 ? 63  ARG A N    3  
ATOM 5359  C CA   . ARG A 1 63  ? 142.594 15.285  -116.591 1.00 0.00 ? 63  ARG A CA   3  
ATOM 5360  C C    . ARG A 1 63  ? 142.662 15.122  -115.074 1.00 0.00 ? 63  ARG A C    3  
ATOM 5361  O O    . ARG A 1 63  ? 143.384 15.814  -114.383 1.00 0.00 ? 63  ARG A O    3  
ATOM 5362  C CB   . ARG A 1 63  ? 143.737 16.163  -117.106 1.00 0.00 ? 63  ARG A CB   3  
ATOM 5363  C CG   . ARG A 1 63  ? 144.201 15.652  -118.471 1.00 0.00 ? 63  ARG A CG   3  
ATOM 5364  C CD   . ARG A 1 63  ? 145.502 16.353  -118.866 1.00 0.00 ? 63  ARG A CD   3  
ATOM 5365  N NE   . ARG A 1 63  ? 145.277 17.157  -120.101 1.00 0.00 ? 63  ARG A NE   3  
ATOM 5366  C CZ   . ARG A 1 63  ? 146.142 18.067  -120.454 1.00 0.00 ? 63  ARG A CZ   3  
ATOM 5367  N NH1  . ARG A 1 63  ? 147.205 18.275  -119.726 1.00 0.00 ? 63  ARG A NH1  3  
ATOM 5368  N NH2  . ARG A 1 63  ? 145.945 18.771  -121.536 1.00 0.00 ? 63  ARG A NH2  3  
ATOM 5369  H H    . ARG A 1 63  ? 140.632 15.264  -117.436 1.00 0.00 ? 63  ARG A H    3  
ATOM 5370  H HA   . ARG A 1 63  ? 142.675 14.285  -116.987 1.00 0.00 ? 63  ARG A HA   3  
ATOM 5371  H HB2  . ARG A 1 63  ? 143.393 17.183  -117.203 1.00 0.00 ? 63  ARG A HB2  3  
ATOM 5372  H HB3  . ARG A 1 63  ? 144.561 16.128  -116.409 1.00 0.00 ? 63  ARG A HB3  3  
ATOM 5373  H HG2  . ARG A 1 63  ? 144.367 14.585  -118.419 1.00 0.00 ? 63  ARG A HG2  3  
ATOM 5374  H HG3  . ARG A 1 63  ? 143.443 15.861  -119.210 1.00 0.00 ? 63  ARG A HG3  3  
ATOM 5375  H HD2  . ARG A 1 63  ? 145.817 17.005  -118.064 1.00 0.00 ? 63  ARG A HD2  3  
ATOM 5376  H HD3  . ARG A 1 63  ? 146.268 15.614  -119.053 1.00 0.00 ? 63  ARG A HD3  3  
ATOM 5377  H HE   . ARG A 1 63  ? 144.478 17.001  -120.648 1.00 0.00 ? 63  ARG A HE   3  
ATOM 5378  H HH11 . ARG A 1 63  ? 147.356 17.736  -118.897 1.00 0.00 ? 63  ARG A HH11 3  
ATOM 5379  H HH12 . ARG A 1 63  ? 147.868 18.972  -119.997 1.00 0.00 ? 63  ARG A HH12 3  
ATOM 5380  H HH21 . ARG A 1 63  ? 145.130 18.612  -122.093 1.00 0.00 ? 63  ARG A HH21 3  
ATOM 5381  H HH22 . ARG A 1 63  ? 146.608 19.469  -121.806 1.00 0.00 ? 63  ARG A HH22 3  
ATOM 5382  N N    . SER A 1 64  ? 141.905 14.184  -114.564 1.00 0.00 ? 64  SER A N    3  
ATOM 5383  C CA   . SER A 1 64  ? 141.901 13.925  -113.093 1.00 0.00 ? 64  SER A CA   3  
ATOM 5384  C C    . SER A 1 64  ? 141.564 12.449  -112.843 1.00 0.00 ? 64  SER A C    3  
ATOM 5385  O O    . SER A 1 64  ? 140.566 11.947  -113.320 1.00 0.00 ? 64  SER A O    3  
ATOM 5386  C CB   . SER A 1 64  ? 140.852 14.811  -112.421 1.00 0.00 ? 64  SER A CB   3  
ATOM 5387  O OG   . SER A 1 64  ? 141.393 16.110  -112.219 1.00 0.00 ? 64  SER A OG   3  
ATOM 5388  H H    . SER A 1 64  ? 141.341 13.638  -115.161 1.00 0.00 ? 64  SER A H    3  
ATOM 5389  H HA   . SER A 1 64  ? 142.877 14.147  -112.685 1.00 0.00 ? 64  SER A HA   3  
ATOM 5390  H HB2  . SER A 1 64  ? 139.982 14.883  -113.052 1.00 0.00 ? 64  SER A HB2  3  
ATOM 5391  H HB3  . SER A 1 64  ? 140.569 14.375  -111.471 1.00 0.00 ? 64  SER A HB3  3  
ATOM 5392  H HG   . SER A 1 64  ? 141.938 16.325  -112.980 1.00 0.00 ? 64  SER A HG   3  
ATOM 5393  N N    . PHE A 1 65  ? 142.388 11.747  -112.106 1.00 0.00 ? 65  PHE A N    3  
ATOM 5394  C CA   . PHE A 1 65  ? 142.103 10.303  -111.844 1.00 0.00 ? 65  PHE A CA   3  
ATOM 5395  C C    . PHE A 1 65  ? 141.536 10.128  -110.433 1.00 0.00 ? 65  PHE A C    3  
ATOM 5396  O O    . PHE A 1 65  ? 142.257 10.173  -109.456 1.00 0.00 ? 65  PHE A O    3  
ATOM 5397  C CB   . PHE A 1 65  ? 143.401 9.503   -111.968 1.00 0.00 ? 65  PHE A CB   3  
ATOM 5398  C CG   . PHE A 1 65  ? 144.478 10.156  -111.133 1.00 0.00 ? 65  PHE A CG   3  
ATOM 5399  C CD1  . PHE A 1 65  ? 145.173 11.264  -111.631 1.00 0.00 ? 65  PHE A CD1  3  
ATOM 5400  C CD2  . PHE A 1 65  ? 144.780 9.652   -109.863 1.00 0.00 ? 65  PHE A CD2  3  
ATOM 5401  C CE1  . PHE A 1 65  ? 146.172 11.869  -110.858 1.00 0.00 ? 65  PHE A CE1  3  
ATOM 5402  C CE2  . PHE A 1 65  ? 145.777 10.258  -109.089 1.00 0.00 ? 65  PHE A CE2  3  
ATOM 5403  C CZ   . PHE A 1 65  ? 146.473 11.366  -109.587 1.00 0.00 ? 65  PHE A CZ   3  
ATOM 5404  H H    . PHE A 1 65  ? 143.191 12.165  -111.733 1.00 0.00 ? 65  PHE A H    3  
ATOM 5405  H HA   . PHE A 1 65  ? 141.389 9.939   -112.564 1.00 0.00 ? 65  PHE A HA   3  
ATOM 5406  H HB2  . PHE A 1 65  ? 143.238 8.493   -111.620 1.00 0.00 ? 65  PHE A HB2  3  
ATOM 5407  H HB3  . PHE A 1 65  ? 143.714 9.480   -113.002 1.00 0.00 ? 65  PHE A HB3  3  
ATOM 5408  H HD1  . PHE A 1 65  ? 144.940 11.652  -112.612 1.00 0.00 ? 65  PHE A HD1  3  
ATOM 5409  H HD2  . PHE A 1 65  ? 144.243 8.797   -109.479 1.00 0.00 ? 65  PHE A HD2  3  
ATOM 5410  H HE1  . PHE A 1 65  ? 146.707 12.725  -111.241 1.00 0.00 ? 65  PHE A HE1  3  
ATOM 5411  H HE2  . PHE A 1 65  ? 146.011 9.869   -108.108 1.00 0.00 ? 65  PHE A HE2  3  
ATOM 5412  H HZ   . PHE A 1 65  ? 147.243 11.833  -108.990 1.00 0.00 ? 65  PHE A HZ   3  
ATOM 5413  N N    . THR A 1 66  ? 140.252 9.918   -110.315 1.00 0.00 ? 66  THR A N    3  
ATOM 5414  C CA   . THR A 1 66  ? 139.655 9.728   -108.962 1.00 0.00 ? 66  THR A CA   3  
ATOM 5415  C C    . THR A 1 66  ? 139.409 8.240   -108.696 1.00 0.00 ? 66  THR A C    3  
ATOM 5416  O O    . THR A 1 66  ? 138.653 7.595   -109.405 1.00 0.00 ? 66  THR A O    3  
ATOM 5417  C CB   . THR A 1 66  ? 138.302 10.437  -108.939 1.00 0.00 ? 66  THR A CB   3  
ATOM 5418  O OG1  . THR A 1 66  ? 137.284 9.525   -109.326 1.00 0.00 ? 66  THR A OG1  3  
ATOM 5419  C CG2  . THR A 1 66  ? 138.334 11.612  -109.911 1.00 0.00 ? 66  THR A CG2  3  
ATOM 5420  H H    . THR A 1 66  ? 139.680 9.901   -111.110 1.00 0.00 ? 66  THR A H    3  
ATOM 5421  H HA   . THR A 1 66  ? 140.277 10.170  -108.196 1.00 0.00 ? 66  THR A HA   3  
ATOM 5422  H HB   . THR A 1 66  ? 138.101 10.804  -107.944 1.00 0.00 ? 66  THR A HB   3  
ATOM 5423  H HG1  . THR A 1 66  ? 136.702 9.975   -109.944 1.00 0.00 ? 66  THR A HG1  3  
ATOM 5424  H HG21 . THR A 1 66  ? 138.316 11.240  -110.924 1.00 0.00 ? 66  THR A HG21 3  
ATOM 5425  H HG22 . THR A 1 66  ? 139.238 12.183  -109.753 1.00 0.00 ? 66  THR A HG22 3  
ATOM 5426  H HG23 . THR A 1 66  ? 137.475 12.242  -109.742 1.00 0.00 ? 66  THR A HG23 3  
ATOM 5427  N N    . PHE A 1 67  ? 139.992 7.694   -107.661 1.00 0.00 ? 67  PHE A N    3  
ATOM 5428  C CA   . PHE A 1 67  ? 139.724 6.259   -107.342 1.00 0.00 ? 67  PHE A CA   3  
ATOM 5429  C C    . PHE A 1 67  ? 140.668 5.747   -106.254 1.00 0.00 ? 67  PHE A C    3  
ATOM 5430  O O    . PHE A 1 67  ? 141.819 6.125   -106.194 1.00 0.00 ? 67  PHE A O    3  
ATOM 5431  C CB   . PHE A 1 67  ? 139.896 5.394   -108.590 1.00 0.00 ? 67  PHE A CB   3  
ATOM 5432  C CG   . PHE A 1 67  ? 141.296 4.825   -108.609 1.00 0.00 ? 67  PHE A CG   3  
ATOM 5433  C CD1  . PHE A 1 67  ? 142.401 5.682   -108.555 1.00 0.00 ? 67  PHE A CD1  3  
ATOM 5434  C CD2  . PHE A 1 67  ? 141.487 3.439   -108.678 1.00 0.00 ? 67  PHE A CD2  3  
ATOM 5435  C CE1  . PHE A 1 67  ? 143.698 5.154   -108.569 1.00 0.00 ? 67  PHE A CE1  3  
ATOM 5436  C CE2  . PHE A 1 67  ? 142.784 2.911   -108.692 1.00 0.00 ? 67  PHE A CE2  3  
ATOM 5437  C CZ   . PHE A 1 67  ? 143.890 3.769   -108.637 1.00 0.00 ? 67  PHE A CZ   3  
ATOM 5438  H H    . PHE A 1 67  ? 140.568 8.233   -107.081 1.00 0.00 ? 67  PHE A H    3  
ATOM 5439  H HA   . PHE A 1 67  ? 138.711 6.182   -106.982 1.00 0.00 ? 67  PHE A HA   3  
ATOM 5440  H HB2  . PHE A 1 67  ? 139.179 4.587   -108.570 1.00 0.00 ? 67  PHE A HB2  3  
ATOM 5441  H HB3  . PHE A 1 67  ? 139.740 5.993   -109.469 1.00 0.00 ? 67  PHE A HB3  3  
ATOM 5442  H HD1  . PHE A 1 67  ? 142.253 6.750   -108.502 1.00 0.00 ? 67  PHE A HD1  3  
ATOM 5443  H HD2  . PHE A 1 67  ? 140.635 2.778   -108.720 1.00 0.00 ? 67  PHE A HD2  3  
ATOM 5444  H HE1  . PHE A 1 67  ? 144.551 5.816   -108.527 1.00 0.00 ? 67  PHE A HE1  3  
ATOM 5445  H HE2  . PHE A 1 67  ? 142.931 1.843   -108.745 1.00 0.00 ? 67  PHE A HE2  3  
ATOM 5446  H HZ   . PHE A 1 67  ? 144.889 3.362   -108.648 1.00 0.00 ? 67  PHE A HZ   3  
ATOM 5447  N N    . VAL A 1 68  ? 140.208 4.828   -105.450 1.00 0.00 ? 68  VAL A N    3  
ATOM 5448  C CA   . VAL A 1 68  ? 141.095 4.216   -104.421 1.00 0.00 ? 68  VAL A CA   3  
ATOM 5449  C C    . VAL A 1 68  ? 140.378 2.998   -103.834 1.00 0.00 ? 68  VAL A C    3  
ATOM 5450  O O    . VAL A 1 68  ? 139.671 3.074   -102.848 1.00 0.00 ? 68  VAL A O    3  
ATOM 5451  C CB   . VAL A 1 68  ? 141.465 5.218   -103.324 1.00 0.00 ? 68  VAL A CB   3  
ATOM 5452  C CG1  . VAL A 1 68  ? 142.045 4.470   -102.125 1.00 0.00 ? 68  VAL A CG1  3  
ATOM 5453  C CG2  . VAL A 1 68  ? 142.506 6.206   -103.855 1.00 0.00 ? 68  VAL A CG2  3  
ATOM 5454  H H    . VAL A 1 68  ? 139.291 4.497   -105.561 1.00 0.00 ? 68  VAL A H    3  
ATOM 5455  H HA   . VAL A 1 68  ? 141.972 3.857   -104.940 1.00 0.00 ? 68  VAL A HA   3  
ATOM 5456  H HB   . VAL A 1 68  ? 140.579 5.757   -103.018 1.00 0.00 ? 68  VAL A HB   3  
ATOM 5457  H HG11 . VAL A 1 68  ? 142.925 4.985   -101.771 1.00 0.00 ? 68  VAL A HG11 3  
ATOM 5458  H HG12 . VAL A 1 68  ? 142.309 3.466   -102.421 1.00 0.00 ? 68  VAL A HG12 3  
ATOM 5459  H HG13 . VAL A 1 68  ? 141.308 4.430   -101.335 1.00 0.00 ? 68  VAL A HG13 3  
ATOM 5460  H HG21 . VAL A 1 68  ? 143.122 6.550   -103.038 1.00 0.00 ? 68  VAL A HG21 3  
ATOM 5461  H HG22 . VAL A 1 68  ? 142.006 7.049   -104.307 1.00 0.00 ? 68  VAL A HG22 3  
ATOM 5462  H HG23 . VAL A 1 68  ? 143.125 5.715   -104.590 1.00 0.00 ? 68  VAL A HG23 3  
ATOM 5463  N N    . THR A 1 69  ? 140.593 1.868   -104.455 1.00 0.00 ? 69  THR A N    3  
ATOM 5464  C CA   . THR A 1 69  ? 139.985 0.587   -103.996 1.00 0.00 ? 69  THR A CA   3  
ATOM 5465  C C    . THR A 1 69  ? 141.020 -0.170  -103.164 1.00 0.00 ? 69  THR A C    3  
ATOM 5466  O O    . THR A 1 69  ? 142.156 -0.304  -103.570 1.00 0.00 ? 69  THR A O    3  
ATOM 5467  C CB   . THR A 1 69  ? 139.640 -0.255  -105.228 1.00 0.00 ? 69  THR A CB   3  
ATOM 5468  O OG1  . THR A 1 69  ? 139.393 -1.596  -104.829 1.00 0.00 ? 69  THR A OG1  3  
ATOM 5469  C CG2  . THR A 1 69  ? 140.812 -0.220  -106.215 1.00 0.00 ? 69  THR A CG2  3  
ATOM 5470  H H    . THR A 1 69  ? 141.183 1.861   -105.237 1.00 0.00 ? 69  THR A H    3  
ATOM 5471  H HA   . THR A 1 69  ? 139.088 0.762   -103.420 1.00 0.00 ? 69  THR A HA   3  
ATOM 5472  H HB   . THR A 1 69  ? 138.761 0.148   -105.706 1.00 0.00 ? 69  THR A HB   3  
ATOM 5473  H HG1  . THR A 1 69  ? 138.673 -1.936  -105.365 1.00 0.00 ? 69  THR A HG1  3  
ATOM 5474  H HG21 . THR A 1 69  ? 140.935 0.783   -106.596 1.00 0.00 ? 69  THR A HG21 3  
ATOM 5475  H HG22 . THR A 1 69  ? 140.613 -0.893  -107.036 1.00 0.00 ? 69  THR A HG22 3  
ATOM 5476  H HG23 . THR A 1 69  ? 141.718 -0.526  -105.712 1.00 0.00 ? 69  THR A HG23 3  
ATOM 5477  N N    . LYS A 1 70  ? 140.662 -0.671  -102.012 1.00 0.00 ? 70  LYS A N    3  
ATOM 5478  C CA   . LYS A 1 70  ? 141.689 -1.408  -101.211 1.00 0.00 ? 70  LYS A CA   3  
ATOM 5479  C C    . LYS A 1 70  ? 141.308 -2.881  -101.055 1.00 0.00 ? 70  LYS A C    3  
ATOM 5480  O O    . LYS A 1 70  ? 140.160 -3.242  -100.906 1.00 0.00 ? 70  LYS A O    3  
ATOM 5481  C CB   . LYS A 1 70  ? 141.855 -0.775  -99.830  1.00 0.00 ? 70  LYS A CB   3  
ATOM 5482  C CG   . LYS A 1 70  ? 142.368 0.658   -99.964  1.00 0.00 ? 70  LYS A CG   3  
ATOM 5483  C CD   . LYS A 1 70  ? 143.525 0.712   -100.962 1.00 0.00 ? 70  LYS A CD   3  
ATOM 5484  C CE   . LYS A 1 70  ? 144.338 1.986   -100.725 1.00 0.00 ? 70  LYS A CE   3  
ATOM 5485  N NZ   . LYS A 1 70  ? 144.836 2.001   -99.320  1.00 0.00 ? 70  LYS A NZ   3  
ATOM 5486  H H    . LYS A 1 70  ? 139.742 -0.565  -101.681 1.00 0.00 ? 70  LYS A H    3  
ATOM 5487  H HA   . LYS A 1 70  ? 142.626 -1.389  -101.742 1.00 0.00 ? 70  LYS A HA   3  
ATOM 5488  H HB2  . LYS A 1 70  ? 140.900 -0.767  -99.324  1.00 0.00 ? 70  LYS A HB2  3  
ATOM 5489  H HB3  . LYS A 1 70  ? 142.560 -1.354  -99.253  1.00 0.00 ? 70  LYS A HB3  3  
ATOM 5490  H HG2  . LYS A 1 70  ? 141.567 1.298   -100.305 1.00 0.00 ? 70  LYS A HG2  3  
ATOM 5491  H HG3  . LYS A 1 70  ? 142.715 0.996   -99.003  1.00 0.00 ? 70  LYS A HG3  3  
ATOM 5492  H HD2  . LYS A 1 70  ? 144.159 -0.153  -100.826 1.00 0.00 ? 70  LYS A HD2  3  
ATOM 5493  H HD3  . LYS A 1 70  ? 143.136 0.719   -101.968 1.00 0.00 ? 70  LYS A HD3  3  
ATOM 5494  H HE2  . LYS A 1 70  ? 145.176 2.012   -101.405 1.00 0.00 ? 70  LYS A HE2  3  
ATOM 5495  H HE3  . LYS A 1 70  ? 143.711 2.848   -100.892 1.00 0.00 ? 70  LYS A HE3  3  
ATOM 5496  H HZ1  . LYS A 1 70  ? 145.413 1.155   -99.147  1.00 0.00 ? 70  LYS A HZ1  3  
ATOM 5497  H HZ2  . LYS A 1 70  ? 144.027 2.010   -98.666  1.00 0.00 ? 70  LYS A HZ2  3  
ATOM 5498  H HZ3  . LYS A 1 70  ? 145.415 2.850   -99.166  1.00 0.00 ? 70  LYS A HZ3  3  
ATOM 5499  N N    . THR A 1 71  ? 142.303 -3.728  -101.086 1.00 0.00 ? 71  THR A N    3  
ATOM 5500  C CA   . THR A 1 71  ? 142.073 -5.195  -100.943 1.00 0.00 ? 71  THR A CA   3  
ATOM 5501  C C    . THR A 1 71  ? 141.072 -5.674  -102.003 1.00 0.00 ? 71  THR A C    3  
ATOM 5502  O O    . THR A 1 71  ? 140.316 -4.897  -102.551 1.00 0.00 ? 71  THR A O    3  
ATOM 5503  C CB   . THR A 1 71  ? 141.540 -5.483  -99.536  1.00 0.00 ? 71  THR A CB   3  
ATOM 5504  O OG1  . THR A 1 71  ? 140.660 -4.442  -99.145  1.00 0.00 ? 71  THR A OG1  3  
ATOM 5505  C CG2  . THR A 1 71  ? 142.710 -5.563  -98.553  1.00 0.00 ? 71  THR A CG2  3  
ATOM 5506  H H    . THR A 1 71  ? 143.217 -3.389  -101.202 1.00 0.00 ? 71  THR A H    3  
ATOM 5507  H HA   . THR A 1 71  ? 143.009 -5.714  -101.082 1.00 0.00 ? 71  THR A HA   3  
ATOM 5508  H HB   . THR A 1 71  ? 141.011 -6.419  -99.533  1.00 0.00 ? 71  THR A HB   3  
ATOM 5509  H HG1  . THR A 1 71  ? 141.185 -3.654  -98.983  1.00 0.00 ? 71  THR A HG1  3  
ATOM 5510  H HG21 . THR A 1 71  ? 142.962 -4.570  -98.212  1.00 0.00 ? 71  THR A HG21 3  
ATOM 5511  H HG22 . THR A 1 71  ? 143.565 -6.001  -99.043  1.00 0.00 ? 71  THR A HG22 3  
ATOM 5512  H HG23 . THR A 1 71  ? 142.430 -6.173  -97.707  1.00 0.00 ? 71  THR A HG23 3  
ATOM 5513  N N    . PRO A 1 72  ? 141.078 -6.954  -102.289 1.00 0.00 ? 72  PRO A N    3  
ATOM 5514  C CA   . PRO A 1 72  ? 140.165 -7.554  -103.302 1.00 0.00 ? 72  PRO A CA   3  
ATOM 5515  C C    . PRO A 1 72  ? 138.761 -6.935  -103.281 1.00 0.00 ? 72  PRO A C    3  
ATOM 5516  O O    . PRO A 1 72  ? 138.462 -6.097  -102.454 1.00 0.00 ? 72  PRO A O    3  
ATOM 5517  C CB   . PRO A 1 72  ? 140.150 -9.023  -102.869 1.00 0.00 ? 72  PRO A CB   3  
ATOM 5518  C CG   . PRO A 1 72  ? 141.272 -9.242  -101.841 1.00 0.00 ? 72  PRO A CG   3  
ATOM 5519  C CD   . PRO A 1 72  ? 141.990 -7.907  -101.614 1.00 0.00 ? 72  PRO A CD   3  
ATOM 5520  H HA   . PRO A 1 72  ? 140.595 -7.476  -104.287 1.00 0.00 ? 72  PRO A HA   3  
ATOM 5521  H HB2  . PRO A 1 72  ? 139.194 -9.262  -102.425 1.00 0.00 ? 72  PRO A HB2  3  
ATOM 5522  H HB3  . PRO A 1 72  ? 140.324 -9.659  -103.725 1.00 0.00 ? 72  PRO A HB3  3  
ATOM 5523  H HG2  . PRO A 1 72  ? 140.849 -9.593  -100.910 1.00 0.00 ? 72  PRO A HG2  3  
ATOM 5524  H HG3  . PRO A 1 72  ? 141.976 -9.970  -102.219 1.00 0.00 ? 72  PRO A HG3  3  
ATOM 5525  H HD2  . PRO A 1 72  ? 142.076 -7.695  -100.558 1.00 0.00 ? 72  PRO A HD2  3  
ATOM 5526  H HD3  . PRO A 1 72  ? 142.955 -7.904  -102.091 1.00 0.00 ? 72  PRO A HD3  3  
ATOM 5527  N N    . PRO A 1 73  ? 137.910 -7.334  -104.195 1.00 0.00 ? 73  PRO A N    3  
ATOM 5528  C CA   . PRO A 1 73  ? 136.532 -6.781  -104.270 1.00 0.00 ? 73  PRO A CA   3  
ATOM 5529  C C    . PRO A 1 73  ? 135.893 -6.637  -102.890 1.00 0.00 ? 73  PRO A C    3  
ATOM 5530  O O    . PRO A 1 73  ? 136.422 -7.109  -101.903 1.00 0.00 ? 73  PRO A O    3  
ATOM 5531  C CB   . PRO A 1 73  ? 135.814 -7.827  -105.121 1.00 0.00 ? 73  PRO A CB   3  
ATOM 5532  C CG   . PRO A 1 73  ? 136.875 -8.686  -105.821 1.00 0.00 ? 73  PRO A CG   3  
ATOM 5533  C CD   . PRO A 1 73  ? 138.245 -8.370  -105.206 1.00 0.00 ? 73  PRO A CD   3  
ATOM 5534  H HA   . PRO A 1 73  ? 136.533 -5.834  -104.785 1.00 0.00 ? 73  PRO A HA   3  
ATOM 5535  H HB2  . PRO A 1 73  ? 135.197 -8.449  -104.488 1.00 0.00 ? 73  PRO A HB2  3  
ATOM 5536  H HB3  . PRO A 1 73  ? 135.201 -7.336  -105.862 1.00 0.00 ? 73  PRO A HB3  3  
ATOM 5537  H HG2  . PRO A 1 73  ? 136.645 -9.732  -105.681 1.00 0.00 ? 73  PRO A HG2  3  
ATOM 5538  H HG3  . PRO A 1 73  ? 136.893 -8.455  -106.876 1.00 0.00 ? 73  PRO A HG3  3  
ATOM 5539  H HD2  . PRO A 1 73  ? 138.658 -9.251  -104.740 1.00 0.00 ? 73  PRO A HD2  3  
ATOM 5540  H HD3  . PRO A 1 73  ? 138.919 -7.970  -105.946 1.00 0.00 ? 73  PRO A HD3  3  
ATOM 5541  N N    . ALA A 1 74  ? 134.773 -5.975  -102.801 1.00 0.00 ? 74  ALA A N    3  
ATOM 5542  C CA   . ALA A 1 74  ? 134.138 -5.794  -101.470 1.00 0.00 ? 74  ALA A CA   3  
ATOM 5543  C C    . ALA A 1 74  ? 135.138 -5.069  -100.570 1.00 0.00 ? 74  ALA A C    3  
ATOM 5544  O O    . ALA A 1 74  ? 134.996 -3.900  -100.274 1.00 0.00 ? 74  ALA A O    3  
ATOM 5545  C CB   . ALA A 1 74  ? 133.803 -7.163  -100.875 1.00 0.00 ? 74  ALA A CB   3  
ATOM 5546  H H    . ALA A 1 74  ? 134.364 -5.585  -103.602 1.00 0.00 ? 74  ALA A H    3  
ATOM 5547  H HA   . ALA A 1 74  ? 133.239 -5.205  -101.568 1.00 0.00 ? 74  ALA A HA   3  
ATOM 5548  H HB1  . ALA A 1 74  ? 132.787 -7.159  -100.510 1.00 0.00 ? 74  ALA A HB1  3  
ATOM 5549  H HB2  . ALA A 1 74  ? 134.479 -7.377  -100.059 1.00 0.00 ? 74  ALA A HB2  3  
ATOM 5550  H HB3  . ALA A 1 74  ? 133.909 -7.922  -101.636 1.00 0.00 ? 74  ALA A HB3  3  
ATOM 5551  N N    . SER A 1 75  ? 136.154 -5.761  -100.140 1.00 0.00 ? 75  SER A N    3  
ATOM 5552  C CA   . SER A 1 75  ? 137.177 -5.135  -99.261  1.00 0.00 ? 75  SER A CA   3  
ATOM 5553  C C    . SER A 1 75  ? 137.543 -3.744  -99.783  1.00 0.00 ? 75  SER A C    3  
ATOM 5554  O O    . SER A 1 75  ? 138.036 -2.914  -99.038  1.00 0.00 ? 75  SER A O    3  
ATOM 5555  C CB   . SER A 1 75  ? 138.428 -6.009  -99.275  1.00 0.00 ? 75  SER A CB   3  
ATOM 5556  O OG   . SER A 1 75  ? 139.248 -5.624  -100.370 1.00 0.00 ? 75  SER A OG   3  
ATOM 5557  H H    . SER A 1 75  ? 136.237 -6.707  -100.380 1.00 0.00 ? 75  SER A H    3  
ATOM 5558  H HA   . SER A 1 75  ? 136.807 -5.061  -98.254  1.00 0.00 ? 75  SER A HA   3  
ATOM 5559  H HB2  . SER A 1 75  ? 138.974 -5.877  -98.358  1.00 0.00 ? 75  SER A HB2  3  
ATOM 5560  H HB3  . SER A 1 75  ? 138.142 -7.047  -99.376  1.00 0.00 ? 75  SER A HB3  3  
ATOM 5561  H HG   . SER A 1 75  ? 139.261 -6.348  -101.000 1.00 0.00 ? 75  SER A HG   3  
ATOM 5562  N N    . TYR A 1 76  ? 137.307 -3.474  -101.047 1.00 0.00 ? 76  TYR A N    3  
ATOM 5563  C CA   . TYR A 1 76  ? 137.665 -2.134  -101.599 1.00 0.00 ? 76  TYR A CA   3  
ATOM 5564  C C    . TYR A 1 76  ? 137.247 -1.057  -100.604 1.00 0.00 ? 76  TYR A C    3  
ATOM 5565  O O    . TYR A 1 76  ? 138.002 -0.142  -100.331 1.00 0.00 ? 76  TYR A O    3  
ATOM 5566  C CB   . TYR A 1 76  ? 136.986 -1.918  -102.958 1.00 0.00 ? 76  TYR A CB   3  
ATOM 5567  C CG   . TYR A 1 76  ? 135.508 -1.648  -102.790 1.00 0.00 ? 76  TYR A CG   3  
ATOM 5568  C CD1  . TYR A 1 76  ? 134.620 -2.711  -102.580 1.00 0.00 ? 76  TYR A CD1  3  
ATOM 5569  C CD2  . TYR A 1 76  ? 135.023 -0.337  -102.867 1.00 0.00 ? 76  TYR A CD2  3  
ATOM 5570  C CE1  . TYR A 1 76  ? 133.250 -2.461  -102.443 1.00 0.00 ? 76  TYR A CE1  3  
ATOM 5571  C CE2  . TYR A 1 76  ? 133.651 -0.088  -102.734 1.00 0.00 ? 76  TYR A CE2  3  
ATOM 5572  C CZ   . TYR A 1 76  ? 132.765 -1.150  -102.520 1.00 0.00 ? 76  TYR A CZ   3  
ATOM 5573  O OH   . TYR A 1 76  ? 131.413 -0.905  -102.390 1.00 0.00 ? 76  TYR A OH   3  
ATOM 5574  H H    . TYR A 1 76  ? 136.905 -4.155  -101.627 1.00 0.00 ? 76  TYR A H    3  
ATOM 5575  H HA   . TYR A 1 76  ? 138.736 -2.085  -101.732 1.00 0.00 ? 76  TYR A HA   3  
ATOM 5576  H HB2  . TYR A 1 76  ? 137.443 -1.075  -103.454 1.00 0.00 ? 76  TYR A HB2  3  
ATOM 5577  H HB3  . TYR A 1 76  ? 137.118 -2.801  -103.566 1.00 0.00 ? 76  TYR A HB3  3  
ATOM 5578  H HD1  . TYR A 1 76  ? 134.994 -3.721  -102.522 1.00 0.00 ? 76  TYR A HD1  3  
ATOM 5579  H HD2  . TYR A 1 76  ? 135.706 0.483   -103.029 1.00 0.00 ? 76  TYR A HD2  3  
ATOM 5580  H HE1  . TYR A 1 76  ? 132.565 -3.280  -102.279 1.00 0.00 ? 76  TYR A HE1  3  
ATOM 5581  H HE2  . TYR A 1 76  ? 133.278 0.923   -102.794 1.00 0.00 ? 76  TYR A HE2  3  
ATOM 5582  H HH   . TYR A 1 76  ? 131.153 -0.296  -103.086 1.00 0.00 ? 76  TYR A HH   3  
ATOM 5583  N N    . LEU A 1 77  ? 136.073 -1.186  -100.033 1.00 0.00 ? 77  LEU A N    3  
ATOM 5584  C CA   . LEU A 1 77  ? 135.606 -0.204  -99.011  1.00 0.00 ? 77  LEU A CA   3  
ATOM 5585  C C    . LEU A 1 77  ? 135.083 -0.999  -97.810  1.00 0.00 ? 77  LEU A C    3  
ATOM 5586  O O    . LEU A 1 77  ? 134.885 -0.476  -96.716  1.00 0.00 ? 77  LEU A O    3  
ATOM 5587  C CB   . LEU A 1 77  ? 134.500 0.686   -99.597  1.00 0.00 ? 77  LEU A CB   3  
ATOM 5588  C CG   . LEU A 1 77  ? 133.126 0.286   -99.046  1.00 0.00 ? 77  LEU A CG   3  
ATOM 5589  C CD1  . LEU A 1 77  ? 132.099 1.344   -99.448  1.00 0.00 ? 77  LEU A CD1  3  
ATOM 5590  C CD2  . LEU A 1 77  ? 132.701 -1.066  -99.623  1.00 0.00 ? 77  LEU A CD2  3  
ATOM 5591  H H    . LEU A 1 77  ? 135.507 -1.953  -100.260 1.00 0.00 ? 77  LEU A H    3  
ATOM 5592  H HA   . LEU A 1 77  ? 136.440 0.410   -98.697  1.00 0.00 ? 77  LEU A HA   3  
ATOM 5593  H HB2  . LEU A 1 77  ? 134.701 1.715   -99.339  1.00 0.00 ? 77  LEU A HB2  3  
ATOM 5594  H HB3  . LEU A 1 77  ? 134.495 0.584   -100.670 1.00 0.00 ? 77  LEU A HB3  3  
ATOM 5595  H HG   . LEU A 1 77  ? 133.169 0.227   -97.967  1.00 0.00 ? 77  LEU A HG   3  
ATOM 5596  H HD11 . LEU A 1 77  ? 132.607 2.268   -99.680  1.00 0.00 ? 77  LEU A HD11 3  
ATOM 5597  H HD12 . LEU A 1 77  ? 131.410 1.505   -98.633  1.00 0.00 ? 77  LEU A HD12 3  
ATOM 5598  H HD13 . LEU A 1 77  ? 131.557 1.003   -100.318 1.00 0.00 ? 77  LEU A HD13 3  
ATOM 5599  H HD21 . LEU A 1 77  ? 131.824 -0.935  -100.242 1.00 0.00 ? 77  LEU A HD21 3  
ATOM 5600  H HD22 . LEU A 1 77  ? 132.469 -1.746  -98.816  1.00 0.00 ? 77  LEU A HD22 3  
ATOM 5601  H HD23 . LEU A 1 77  ? 133.504 -1.473  -100.218 1.00 0.00 ? 77  LEU A HD23 3  
ATOM 5602  N N    . ILE A 1 78  ? 134.878 -2.279  -98.006  1.00 0.00 ? 78  ILE A N    3  
ATOM 5603  C CA   . ILE A 1 78  ? 134.397 -3.125  -96.890  1.00 0.00 ? 78  ILE A CA   3  
ATOM 5604  C C    . ILE A 1 78  ? 135.448 -3.068  -95.786  1.00 0.00 ? 78  ILE A C    3  
ATOM 5605  O O    . ILE A 1 78  ? 135.147 -3.138  -94.610  1.00 0.00 ? 78  ILE A O    3  
ATOM 5606  C CB   . ILE A 1 78  ? 134.227 -4.571  -97.377  1.00 0.00 ? 78  ILE A CB   3  
ATOM 5607  C CG1  . ILE A 1 78  ? 132.954 -4.672  -98.228  1.00 0.00 ? 78  ILE A CG1  3  
ATOM 5608  C CG2  . ILE A 1 78  ? 134.116 -5.513  -96.177  1.00 0.00 ? 78  ILE A CG2  3  
ATOM 5609  C CD1  . ILE A 1 78  ? 132.415 -6.105  -98.185  1.00 0.00 ? 78  ILE A CD1  3  
ATOM 5610  H H    . ILE A 1 78  ? 135.059 -2.680  -98.881  1.00 0.00 ? 78  ILE A H    3  
ATOM 5611  H HA   . ILE A 1 78  ? 133.431 -2.755  -96.572  1.00 0.00 ? 78  ILE A HA   3  
ATOM 5612  H HB   . ILE A 1 78  ? 135.078 -4.850  -97.975  1.00 0.00 ? 78  ILE A HB   3  
ATOM 5613  H HG12 . ILE A 1 78  ? 132.206 -3.997  -97.838  1.00 0.00 ? 78  ILE A HG12 3  
ATOM 5614  H HG13 . ILE A 1 78  ? 133.179 -4.406  -99.248  1.00 0.00 ? 78  ILE A HG13 3  
ATOM 5615  H HG21 . ILE A 1 78  ? 134.969 -5.375  -95.528  1.00 0.00 ? 78  ILE A HG21 3  
ATOM 5616  H HG22 . ILE A 1 78  ? 134.092 -6.536  -96.523  1.00 0.00 ? 78  ILE A HG22 3  
ATOM 5617  H HG23 . ILE A 1 78  ? 133.210 -5.297  -95.631  1.00 0.00 ? 78  ILE A HG23 3  
ATOM 5618  H HD11 . ILE A 1 78  ? 133.216 -6.799  -98.393  1.00 0.00 ? 78  ILE A HD11 3  
ATOM 5619  H HD12 . ILE A 1 78  ? 131.639 -6.221  -98.928  1.00 0.00 ? 78  ILE A HD12 3  
ATOM 5620  H HD13 . ILE A 1 78  ? 132.008 -6.309  -97.206  1.00 0.00 ? 78  ILE A HD13 3  
ATOM 5621  N N    . ARG A 1 79  ? 136.696 -2.916  -96.179  1.00 0.00 ? 79  ARG A N    3  
ATOM 5622  C CA   . ARG A 1 79  ? 137.794 -2.829  -95.175  1.00 0.00 ? 79  ARG A CA   3  
ATOM 5623  C C    . ARG A 1 79  ? 137.452 -1.721  -94.188  1.00 0.00 ? 79  ARG A C    3  
ATOM 5624  O O    . ARG A 1 79  ? 137.559 -1.884  -92.990  1.00 0.00 ? 79  ARG A O    3  
ATOM 5625  C CB   . ARG A 1 79  ? 139.111 -2.486  -95.874  1.00 0.00 ? 79  ARG A CB   3  
ATOM 5626  C CG   . ARG A 1 79  ? 139.425 -3.543  -96.930  1.00 0.00 ? 79  ARG A CG   3  
ATOM 5627  C CD   . ARG A 1 79  ? 140.516 -4.480  -96.408  1.00 0.00 ? 79  ARG A CD   3  
ATOM 5628  N NE   . ARG A 1 79  ? 141.829 -3.774  -96.436  1.00 0.00 ? 79  ARG A NE   3  
ATOM 5629  C CZ   . ARG A 1 79  ? 142.849 -4.264  -95.786  1.00 0.00 ? 79  ARG A CZ   3  
ATOM 5630  N NH1  . ARG A 1 79  ? 142.726 -5.380  -95.123  1.00 0.00 ? 79  ARG A NH1  3  
ATOM 5631  N NH2  . ARG A 1 79  ? 143.995 -3.638  -95.803  1.00 0.00 ? 79  ARG A NH2  3  
ATOM 5632  H H    . ARG A 1 79  ? 136.902 -2.836  -97.141  1.00 0.00 ? 79  ARG A H    3  
ATOM 5633  H HA   . ARG A 1 79  ? 137.892 -3.768  -94.651  1.00 0.00 ? 79  ARG A HA   3  
ATOM 5634  H HB2  . ARG A 1 79  ? 139.025 -1.519  -96.348  1.00 0.00 ? 79  ARG A HB2  3  
ATOM 5635  H HB3  . ARG A 1 79  ? 139.908 -2.459  -95.146  1.00 0.00 ? 79  ARG A HB3  3  
ATOM 5636  H HG2  . ARG A 1 79  ? 138.532 -4.112  -97.148  1.00 0.00 ? 79  ARG A HG2  3  
ATOM 5637  H HG3  . ARG A 1 79  ? 139.773 -3.058  -97.828  1.00 0.00 ? 79  ARG A HG3  3  
ATOM 5638  H HD2  . ARG A 1 79  ? 140.285 -4.771  -95.395  1.00 0.00 ? 79  ARG A HD2  3  
ATOM 5639  H HD3  . ARG A 1 79  ? 140.563 -5.360  -97.030  1.00 0.00 ? 79  ARG A HD3  3  
ATOM 5640  H HE   . ARG A 1 79  ? 141.924 -2.939  -96.940  1.00 0.00 ? 79  ARG A HE   3  
ATOM 5641  H HH11 . ARG A 1 79  ? 141.850 -5.861  -95.111  1.00 0.00 ? 79  ARG A HH11 3  
ATOM 5642  H HH12 . ARG A 1 79  ? 143.509 -5.754  -94.624  1.00 0.00 ? 79  ARG A HH12 3  
ATOM 5643  H HH21 . ARG A 1 79  ? 144.089 -2.783  -96.314  1.00 0.00 ? 79  ARG A HH21 3  
ATOM 5644  H HH22 . ARG A 1 79  ? 144.776 -4.012  -95.305  1.00 0.00 ? 79  ARG A HH22 3  
ATOM 5645  N N    . LYS A 1 80  ? 137.028 -0.595  -94.686  1.00 0.00 ? 80  LYS A N    3  
ATOM 5646  C CA   . LYS A 1 80  ? 136.664 0.515   -93.775  1.00 0.00 ? 80  LYS A CA   3  
ATOM 5647  C C    . LYS A 1 80  ? 135.452 0.080   -92.956  1.00 0.00 ? 80  LYS A C    3  
ATOM 5648  O O    . LYS A 1 80  ? 135.529 -0.070  -91.753  1.00 0.00 ? 80  LYS A O    3  
ATOM 5649  C CB   . LYS A 1 80  ? 136.321 1.765   -94.588  1.00 0.00 ? 80  LYS A CB   3  
ATOM 5650  C CG   . LYS A 1 80  ? 135.881 2.885   -93.643  1.00 0.00 ? 80  LYS A CG   3  
ATOM 5651  C CD   . LYS A 1 80  ? 134.366 3.076   -93.745  1.00 0.00 ? 80  LYS A CD   3  
ATOM 5652  C CE   . LYS A 1 80  ? 134.048 4.024   -94.903  1.00 0.00 ? 80  LYS A CE   3  
ATOM 5653  N NZ   . LYS A 1 80  ? 134.424 5.415   -94.523  1.00 0.00 ? 80  LYS A NZ   3  
ATOM 5654  H H    . LYS A 1 80  ? 136.940 -0.486  -95.656  1.00 0.00 ? 80  LYS A H    3  
ATOM 5655  H HA   . LYS A 1 80  ? 137.493 0.721   -93.114  1.00 0.00 ? 80  LYS A HA   3  
ATOM 5656  H HB2  . LYS A 1 80  ? 137.192 2.082   -95.144  1.00 0.00 ? 80  LYS A HB2  3  
ATOM 5657  H HB3  . LYS A 1 80  ? 135.519 1.540   -95.275  1.00 0.00 ? 80  LYS A HB3  3  
ATOM 5658  H HG2  . LYS A 1 80  ? 136.144 2.623   -92.628  1.00 0.00 ? 80  LYS A HG2  3  
ATOM 5659  H HG3  . LYS A 1 80  ? 136.377 3.803   -93.918  1.00 0.00 ? 80  LYS A HG3  3  
ATOM 5660  H HD2  . LYS A 1 80  ? 133.894 2.120   -93.921  1.00 0.00 ? 80  LYS A HD2  3  
ATOM 5661  H HD3  . LYS A 1 80  ? 133.994 3.498   -92.824  1.00 0.00 ? 80  LYS A HD3  3  
ATOM 5662  H HE2  . LYS A 1 80  ? 134.607 3.726   -95.777  1.00 0.00 ? 80  LYS A HE2  3  
ATOM 5663  H HE3  . LYS A 1 80  ? 132.991 3.984   -95.120  1.00 0.00 ? 80  LYS A HE3  3  
ATOM 5664  H HZ1  . LYS A 1 80  ? 134.456 5.496   -93.486  1.00 0.00 ? 80  LYS A HZ1  3  
ATOM 5665  H HZ2  . LYS A 1 80  ? 133.720 6.081   -94.902  1.00 0.00 ? 80  LYS A HZ2  3  
ATOM 5666  H HZ3  . LYS A 1 80  ? 135.361 5.640   -94.914  1.00 0.00 ? 80  LYS A HZ3  3  
ATOM 5667  N N    . ALA A 1 81  ? 134.327 -0.117  -93.590  1.00 0.00 ? 81  ALA A N    3  
ATOM 5668  C CA   . ALA A 1 81  ? 133.118 -0.532  -92.815  1.00 0.00 ? 81  ALA A CA   3  
ATOM 5669  C C    . ALA A 1 81  ? 133.412 -1.829  -92.057  1.00 0.00 ? 81  ALA A C    3  
ATOM 5670  O O    . ALA A 1 81  ? 132.601 -2.314  -91.293  1.00 0.00 ? 81  ALA A O    3  
ATOM 5671  C CB   . ALA A 1 81  ? 131.950 -0.770  -93.769  1.00 0.00 ? 81  ALA A CB   3  
ATOM 5672  H H    . ALA A 1 81  ? 134.269 0.027   -94.566  1.00 0.00 ? 81  ALA A H    3  
ATOM 5673  H HA   . ALA A 1 81  ? 132.862 0.252   -92.119  1.00 0.00 ? 81  ALA A HA   3  
ATOM 5674  H HB1  . ALA A 1 81  ? 131.446 0.164   -93.960  1.00 0.00 ? 81  ALA A HB1  3  
ATOM 5675  H HB2  . ALA A 1 81  ? 131.259 -1.469  -93.321  1.00 0.00 ? 81  ALA A HB2  3  
ATOM 5676  H HB3  . ALA A 1 81  ? 132.321 -1.177  -94.696  1.00 0.00 ? 81  ALA A HB3  3  
ATOM 5677  N N    . ALA A 1 82  ? 134.561 -2.401  -92.278  1.00 0.00 ? 82  ALA A N    3  
ATOM 5678  C CA   . ALA A 1 82  ? 134.914 -3.678  -91.596  1.00 0.00 ? 82  ALA A CA   3  
ATOM 5679  C C    . ALA A 1 82  ? 135.527 -3.431  -90.214  1.00 0.00 ? 82  ALA A C    3  
ATOM 5680  O O    . ALA A 1 82  ? 134.858 -3.539  -89.206  1.00 0.00 ? 82  ALA A O    3  
ATOM 5681  C CB   . ALA A 1 82  ? 135.929 -4.442  -92.443  1.00 0.00 ? 82  ALA A CB   3  
ATOM 5682  H H    . ALA A 1 82  ? 135.190 -1.992  -92.909  1.00 0.00 ? 82  ALA A H    3  
ATOM 5683  H HA   . ALA A 1 82  ? 134.040 -4.301  -91.476  1.00 0.00 ? 82  ALA A HA   3  
ATOM 5684  H HB1  . ALA A 1 82  ? 136.485 -3.749  -93.052  1.00 0.00 ? 82  ALA A HB1  3  
ATOM 5685  H HB2  . ALA A 1 82  ? 135.412 -5.148  -93.076  1.00 0.00 ? 82  ALA A HB2  3  
ATOM 5686  H HB3  . ALA A 1 82  ? 136.608 -4.974  -91.793  1.00 0.00 ? 82  ALA A HB3  3  
ATOM 5687  N N    . GLY A 1 83  ? 136.786 -3.090  -90.142  1.00 0.00 ? 83  GLY A N    3  
ATOM 5688  C CA   . GLY A 1 83  ? 137.392 -2.833  -88.804  1.00 0.00 ? 83  GLY A CA   3  
ATOM 5689  C C    . GLY A 1 83  ? 138.899 -3.096  -88.834  1.00 0.00 ? 83  GLY A C    3  
ATOM 5690  O O    . GLY A 1 83  ? 139.411 -3.888  -88.068  1.00 0.00 ? 83  GLY A O    3  
ATOM 5691  H H    . GLY A 1 83  ? 137.321 -2.994  -90.957  1.00 0.00 ? 83  GLY A H    3  
ATOM 5692  H HA2  . GLY A 1 83  ? 137.216 -1.804  -88.525  1.00 0.00 ? 83  GLY A HA2  3  
ATOM 5693  H HA3  . GLY A 1 83  ? 136.934 -3.483  -88.074  1.00 0.00 ? 83  GLY A HA3  3  
ATOM 5694  N N    . LEU A 1 84  ? 139.616 -2.435  -89.699  1.00 0.00 ? 84  LEU A N    3  
ATOM 5695  C CA   . LEU A 1 84  ? 141.090 -2.650  -89.752  1.00 0.00 ? 84  LEU A CA   3  
ATOM 5696  C C    . LEU A 1 84  ? 141.794 -1.477  -89.062  1.00 0.00 ? 84  LEU A C    3  
ATOM 5697  O O    . LEU A 1 84  ? 141.884 -0.393  -89.603  1.00 0.00 ? 84  LEU A O    3  
ATOM 5698  C CB   . LEU A 1 84  ? 141.551 -2.734  -91.209  1.00 0.00 ? 84  LEU A CB   3  
ATOM 5699  C CG   . LEU A 1 84  ? 140.764 -3.824  -91.941  1.00 0.00 ? 84  LEU A CG   3  
ATOM 5700  C CD1  . LEU A 1 84  ? 141.541 -4.264  -93.181  1.00 0.00 ? 84  LEU A CD1  3  
ATOM 5701  C CD2  . LEU A 1 84  ? 140.566 -5.029  -91.019  1.00 0.00 ? 84  LEU A CD2  3  
ATOM 5702  H H    . LEU A 1 84  ? 139.190 -1.793  -90.305  1.00 0.00 ? 84  LEU A H    3  
ATOM 5703  H HA   . LEU A 1 84  ? 141.340 -3.568  -89.239  1.00 0.00 ? 84  LEU A HA   3  
ATOM 5704  H HB2  . LEU A 1 84  ? 141.383 -1.782  -91.692  1.00 0.00 ? 84  LEU A HB2  3  
ATOM 5705  H HB3  . LEU A 1 84  ? 142.604 -2.971  -91.238  1.00 0.00 ? 84  LEU A HB3  3  
ATOM 5706  H HG   . LEU A 1 84  ? 139.802 -3.433  -92.240  1.00 0.00 ? 84  LEU A HG   3  
ATOM 5707  H HD11 . LEU A 1 84  ? 141.389 -3.548  -93.975  1.00 0.00 ? 84  LEU A HD11 3  
ATOM 5708  H HD12 . LEU A 1 84  ? 141.191 -5.236  -93.498  1.00 0.00 ? 84  LEU A HD12 3  
ATOM 5709  H HD13 . LEU A 1 84  ? 142.594 -4.322  -92.946  1.00 0.00 ? 84  LEU A HD13 3  
ATOM 5710  H HD21 . LEU A 1 84  ? 140.213 -5.870  -91.598  1.00 0.00 ? 84  LEU A HD21 3  
ATOM 5711  H HD22 . LEU A 1 84  ? 139.838 -4.785  -90.260  1.00 0.00 ? 84  LEU A HD22 3  
ATOM 5712  H HD23 . LEU A 1 84  ? 141.505 -5.283  -90.551  1.00 0.00 ? 84  LEU A HD23 3  
ATOM 5713  N N    . GLU A 1 85  ? 142.290 -1.683  -87.872  1.00 0.00 ? 85  GLU A N    3  
ATOM 5714  C CA   . GLU A 1 85  ? 142.983 -0.578  -87.152  1.00 0.00 ? 85  GLU A CA   3  
ATOM 5715  C C    . GLU A 1 85  ? 144.004 -1.161  -86.171  1.00 0.00 ? 85  GLU A C    3  
ATOM 5716  O O    . GLU A 1 85  ? 144.827 -0.455  -85.625  1.00 0.00 ? 85  GLU A O    3  
ATOM 5717  C CB   . GLU A 1 85  ? 141.954 0.251   -86.379  1.00 0.00 ? 85  GLU A CB   3  
ATOM 5718  C CG   . GLU A 1 85  ? 141.107 1.062   -87.361  1.00 0.00 ? 85  GLU A CG   3  
ATOM 5719  C CD   . GLU A 1 85  ? 142.015 1.974   -88.188  1.00 0.00 ? 85  GLU A CD   3  
ATOM 5720  O OE1  . GLU A 1 85  ? 143.121 2.237   -87.743  1.00 0.00 ? 85  GLU A OE1  3  
ATOM 5721  O OE2  . GLU A 1 85  ? 141.591 2.392   -89.253  1.00 0.00 ? 85  GLU A OE2  3  
ATOM 5722  H H    . GLU A 1 85  ? 142.205 -2.565  -87.452  1.00 0.00 ? 85  GLU A H    3  
ATOM 5723  H HA   . GLU A 1 85  ? 143.491 0.055   -87.865  1.00 0.00 ? 85  GLU A HA   3  
ATOM 5724  H HB2  . GLU A 1 85  ? 141.314 -0.410  -85.811  1.00 0.00 ? 85  GLU A HB2  3  
ATOM 5725  H HB3  . GLU A 1 85  ? 142.464 0.924   -85.707  1.00 0.00 ? 85  GLU A HB3  3  
ATOM 5726  H HG2  . GLU A 1 85  ? 140.574 0.390   -88.019  1.00 0.00 ? 85  GLU A HG2  3  
ATOM 5727  H HG3  . GLU A 1 85  ? 140.399 1.666   -86.813  1.00 0.00 ? 85  GLU A HG3  3  
ATOM 5728  N N    . LYS A 1 86  ? 143.955 -2.445  -85.942  1.00 0.00 ? 86  LYS A N    3  
ATOM 5729  C CA   . LYS A 1 86  ? 144.922 -3.073  -84.996  1.00 0.00 ? 86  LYS A CA   3  
ATOM 5730  C C    . LYS A 1 86  ? 144.659 -2.563  -83.577  1.00 0.00 ? 86  LYS A C    3  
ATOM 5731  O O    . LYS A 1 86  ? 145.490 -1.909  -82.978  1.00 0.00 ? 86  LYS A O    3  
ATOM 5732  C CB   . LYS A 1 86  ? 146.351 -2.715  -85.409  1.00 0.00 ? 86  LYS A CB   3  
ATOM 5733  C CG   . LYS A 1 86  ? 146.507 -2.886  -86.922  1.00 0.00 ? 86  LYS A CG   3  
ATOM 5734  C CD   . LYS A 1 86  ? 147.789 -2.190  -87.385  1.00 0.00 ? 86  LYS A CD   3  
ATOM 5735  C CE   . LYS A 1 86  ? 148.905 -2.448  -86.372  1.00 0.00 ? 86  LYS A CE   3  
ATOM 5736  N NZ   . LYS A 1 86  ? 148.937 -3.897  -86.025  1.00 0.00 ? 86  LYS A NZ   3  
ATOM 5737  H H    . LYS A 1 86  ? 143.282 -2.998  -86.393  1.00 0.00 ? 86  LYS A H    3  
ATOM 5738  H HA   . LYS A 1 86  ? 144.800 -4.147  -85.020  1.00 0.00 ? 86  LYS A HA   3  
ATOM 5739  H HB2  . LYS A 1 86  ? 146.557 -1.689  -85.139  1.00 0.00 ? 86  LYS A HB2  3  
ATOM 5740  H HB3  . LYS A 1 86  ? 147.046 -3.367  -84.902  1.00 0.00 ? 86  LYS A HB3  3  
ATOM 5741  H HG2  . LYS A 1 86  ? 146.562 -3.938  -87.160  1.00 0.00 ? 86  LYS A HG2  3  
ATOM 5742  H HG3  . LYS A 1 86  ? 145.660 -2.446  -87.424  1.00 0.00 ? 86  LYS A HG3  3  
ATOM 5743  H HD2  . LYS A 1 86  ? 148.081 -2.578  -88.351  1.00 0.00 ? 86  LYS A HD2  3  
ATOM 5744  H HD3  . LYS A 1 86  ? 147.614 -1.128  -87.462  1.00 0.00 ? 86  LYS A HD3  3  
ATOM 5745  H HE2  . LYS A 1 86  ? 149.855 -2.160  -86.800  1.00 0.00 ? 86  LYS A HE2  3  
ATOM 5746  H HE3  . LYS A 1 86  ? 148.724 -1.868  -85.479  1.00 0.00 ? 86  LYS A HE3  3  
ATOM 5747  H HZ1  . LYS A 1 86  ? 148.312 -4.422  -86.668  1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 5748  H HZ2  . LYS A 1 86  ? 148.613 -4.025  -85.044  1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 5749  H HZ3  . LYS A 1 86  ? 149.908 -4.256  -86.120  1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 5750  N N    . GLY A 1 87  ? 143.509 -2.858  -83.034  1.00 0.00 ? 87  GLY A N    3  
ATOM 5751  C CA   . GLY A 1 87  ? 143.196 -2.392  -81.653  1.00 0.00 ? 87  GLY A CA   3  
ATOM 5752  C C    . GLY A 1 87  ? 143.600 -0.925  -81.500  1.00 0.00 ? 87  GLY A C    3  
ATOM 5753  O O    . GLY A 1 87  ? 143.764 -0.212  -82.470  1.00 0.00 ? 87  GLY A O    3  
ATOM 5754  H H    . GLY A 1 87  ? 142.853 -3.388  -83.533  1.00 0.00 ? 87  GLY A H    3  
ATOM 5755  H HA2  . GLY A 1 87  ? 142.134 -2.495  -81.472  1.00 0.00 ? 87  GLY A HA2  3  
ATOM 5756  H HA3  . GLY A 1 87  ? 143.742 -2.988  -80.939  1.00 0.00 ? 87  GLY A HA3  3  
ATOM 5757  N N    . ALA A 1 88  ? 143.761 -0.468  -80.287  1.00 0.00 ? 88  ALA A N    3  
ATOM 5758  C CA   . ALA A 1 88  ? 144.154 0.953   -80.072  1.00 0.00 ? 88  ALA A CA   3  
ATOM 5759  C C    . ALA A 1 88  ? 144.850 1.092   -78.716  1.00 0.00 ? 88  ALA A C    3  
ATOM 5760  O O    . ALA A 1 88  ? 146.060 1.055   -78.622  1.00 0.00 ? 88  ALA A O    3  
ATOM 5761  C CB   . ALA A 1 88  ? 142.906 1.837   -80.098  1.00 0.00 ? 88  ALA A CB   3  
ATOM 5762  H H    . ALA A 1 88  ? 143.624 -1.059  -79.518  1.00 0.00 ? 88  ALA A H    3  
ATOM 5763  H HA   . ALA A 1 88  ? 144.829 1.263   -80.856  1.00 0.00 ? 88  ALA A HA   3  
ATOM 5764  H HB1  . ALA A 1 88  ? 143.160 2.831   -79.758  1.00 0.00 ? 88  ALA A HB1  3  
ATOM 5765  H HB2  . ALA A 1 88  ? 142.153 1.416   -79.446  1.00 0.00 ? 88  ALA A HB2  3  
ATOM 5766  H HB3  . ALA A 1 88  ? 142.522 1.889   -81.106  1.00 0.00 ? 88  ALA A HB3  3  
ATOM 5767  N N    . HIS A 1 89  ? 144.093 1.255   -77.664  1.00 0.00 ? 89  HIS A N    3  
ATOM 5768  C CA   . HIS A 1 89  ? 144.713 1.398   -76.316  1.00 0.00 ? 89  HIS A CA   3  
ATOM 5769  C C    . HIS A 1 89  ? 144.513 0.106   -75.520  1.00 0.00 ? 89  HIS A C    3  
ATOM 5770  O O    . HIS A 1 89  ? 145.452 -0.610  -75.234  1.00 0.00 ? 89  HIS A O    3  
ATOM 5771  C CB   . HIS A 1 89  ? 144.053 2.562   -75.572  1.00 0.00 ? 89  HIS A CB   3  
ATOM 5772  C CG   . HIS A 1 89  ? 144.441 2.513   -74.120  1.00 0.00 ? 89  HIS A CG   3  
ATOM 5773  N ND1  . HIS A 1 89  ? 145.360 3.394   -73.571  1.00 0.00 ? 89  HIS A ND1  3  
ATOM 5774  C CD2  . HIS A 1 89  ? 144.044 1.696   -73.090  1.00 0.00 ? 89  HIS A CD2  3  
ATOM 5775  C CE1  . HIS A 1 89  ? 145.484 3.089   -72.266  1.00 0.00 ? 89  HIS A CE1  3  
ATOM 5776  N NE2  . HIS A 1 89  ? 144.703 2.061   -71.921  1.00 0.00 ? 89  HIS A NE2  3  
ATOM 5777  H H    . HIS A 1 89  ? 143.119 1.283   -77.760  1.00 0.00 ? 89  HIS A H    3  
ATOM 5778  H HA   . HIS A 1 89  ? 145.770 1.594   -76.424  1.00 0.00 ? 89  HIS A HA   3  
ATOM 5779  H HB2  . HIS A 1 89  ? 144.382 3.496   -76.002  1.00 0.00 ? 89  HIS A HB2  3  
ATOM 5780  H HB3  . HIS A 1 89  ? 142.980 2.482   -75.660  1.00 0.00 ? 89  HIS A HB3  3  
ATOM 5781  H HD1  . HIS A 1 89  ? 145.833 4.108   -74.045  1.00 0.00 ? 89  HIS A HD1  3  
ATOM 5782  H HD2  . HIS A 1 89  ? 143.327 0.893   -73.175  1.00 0.00 ? 89  HIS A HD2  3  
ATOM 5783  H HE1  . HIS A 1 89  ? 146.135 3.611   -71.581  1.00 0.00 ? 89  HIS A HE1  3  
ATOM 5784  N N    . LYS A 1 90  ? 143.296 -0.197  -75.160  1.00 0.00 ? 90  LYS A N    3  
ATOM 5785  C CA   . LYS A 1 90  ? 143.039 -1.443  -74.383  1.00 0.00 ? 90  LYS A CA   3  
ATOM 5786  C C    . LYS A 1 90  ? 143.821 -2.602  -75.006  1.00 0.00 ? 90  LYS A C    3  
ATOM 5787  O O    . LYS A 1 90  ? 144.227 -2.541  -76.150  1.00 0.00 ? 90  LYS A O    3  
ATOM 5788  C CB   . LYS A 1 90  ? 141.542 -1.761  -74.412  1.00 0.00 ? 90  LYS A CB   3  
ATOM 5789  C CG   . LYS A 1 90  ? 140.902 -1.337  -73.088  1.00 0.00 ? 90  LYS A CG   3  
ATOM 5790  C CD   . LYS A 1 90  ? 139.493 -1.925  -72.989  1.00 0.00 ? 90  LYS A CD   3  
ATOM 5791  C CE   . LYS A 1 90  ? 138.464 -0.792  -73.006  1.00 0.00 ? 90  LYS A CE   3  
ATOM 5792  N NZ   . LYS A 1 90  ? 137.137 -1.320  -72.582  1.00 0.00 ? 90  LYS A NZ   3  
ATOM 5793  H H    . LYS A 1 90  ? 142.552 0.393   -75.399  1.00 0.00 ? 90  LYS A H    3  
ATOM 5794  H HA   . LYS A 1 90  ? 143.358 -1.300  -73.360  1.00 0.00 ? 90  LYS A HA   3  
ATOM 5795  H HB2  . LYS A 1 90  ? 141.077 -1.222  -75.225  1.00 0.00 ? 90  LYS A HB2  3  
ATOM 5796  H HB3  . LYS A 1 90  ? 141.401 -2.821  -74.555  1.00 0.00 ? 90  LYS A HB3  3  
ATOM 5797  H HG2  . LYS A 1 90  ? 141.503 -1.700  -72.266  1.00 0.00 ? 90  LYS A HG2  3  
ATOM 5798  H HG3  . LYS A 1 90  ? 140.845 -0.260  -73.043  1.00 0.00 ? 90  LYS A HG3  3  
ATOM 5799  H HD2  . LYS A 1 90  ? 139.318 -2.584  -73.827  1.00 0.00 ? 90  LYS A HD2  3  
ATOM 5800  H HD3  . LYS A 1 90  ? 139.398 -2.480  -72.068  1.00 0.00 ? 90  LYS A HD3  3  
ATOM 5801  H HE2  . LYS A 1 90  ? 138.775 -0.013  -72.327  1.00 0.00 ? 90  LYS A HE2  3  
ATOM 5802  H HE3  . LYS A 1 90  ? 138.388 -0.390  -74.006  1.00 0.00 ? 90  LYS A HE3  3  
ATOM 5803  H HZ1  . LYS A 1 90  ? 137.208 -1.702  -71.617  1.00 0.00 ? 90  LYS A HZ1  3  
ATOM 5804  H HZ2  . LYS A 1 90  ? 136.841 -2.076  -73.233  1.00 0.00 ? 90  LYS A HZ2  3  
ATOM 5805  H HZ3  . LYS A 1 90  ? 136.436 -0.552  -72.598  1.00 0.00 ? 90  LYS A HZ3  3  
ATOM 5806  N N    . PRO A 1 91  ? 144.030 -3.651  -74.255  1.00 0.00 ? 91  PRO A N    3  
ATOM 5807  C CA   . PRO A 1 91  ? 144.779 -4.833  -74.759  1.00 0.00 ? 91  PRO A CA   3  
ATOM 5808  C C    . PRO A 1 91  ? 144.166 -5.412  -76.038  1.00 0.00 ? 91  PRO A C    3  
ATOM 5809  O O    . PRO A 1 91  ? 144.842 -5.610  -77.028  1.00 0.00 ? 91  PRO A O    3  
ATOM 5810  C CB   . PRO A 1 91  ? 144.657 -5.827  -73.601  1.00 0.00 ? 91  PRO A CB   3  
ATOM 5811  C CG   . PRO A 1 91  ? 143.909 -5.153  -72.443  1.00 0.00 ? 91  PRO A CG   3  
ATOM 5812  C CD   . PRO A 1 91  ? 143.535 -3.726  -72.857  1.00 0.00 ? 91  PRO A CD   3  
ATOM 5813  H HA   . PRO A 1 91  ? 145.815 -4.586  -74.915  1.00 0.00 ? 91  PRO A HA   3  
ATOM 5814  H HB2  . PRO A 1 91  ? 144.110 -6.698  -73.930  1.00 0.00 ? 91  PRO A HB2  3  
ATOM 5815  H HB3  . PRO A 1 91  ? 145.642 -6.120  -73.271  1.00 0.00 ? 91  PRO A HB3  3  
ATOM 5816  H HG2  . PRO A 1 91  ? 143.013 -5.713  -72.217  1.00 0.00 ? 91  PRO A HG2  3  
ATOM 5817  H HG3  . PRO A 1 91  ? 144.546 -5.119  -71.572  1.00 0.00 ? 91  PRO A HG3  3  
ATOM 5818  H HD2  . PRO A 1 91  ? 142.463 -3.587  -72.816  1.00 0.00 ? 91  PRO A HD2  3  
ATOM 5819  H HD3  . PRO A 1 91  ? 144.042 -3.003  -72.240  1.00 0.00 ? 91  PRO A HD3  3  
ATOM 5820  N N    . GLY A 1 92  ? 142.889 -5.685  -76.026  1.00 0.00 ? 92  GLY A N    3  
ATOM 5821  C CA   . GLY A 1 92  ? 142.238 -6.250  -77.242  1.00 0.00 ? 92  GLY A CA   3  
ATOM 5822  C C    . GLY A 1 92  ? 140.810 -6.683  -76.906  1.00 0.00 ? 92  GLY A C    3  
ATOM 5823  O O    . GLY A 1 92  ? 139.894 -5.884  -76.902  1.00 0.00 ? 92  GLY A O    3  
ATOM 5824  H H    . GLY A 1 92  ? 142.360 -5.518  -75.219  1.00 0.00 ? 92  GLY A H    3  
ATOM 5825  H HA2  . GLY A 1 92  ? 142.214 -5.499  -78.019  1.00 0.00 ? 92  GLY A HA2  3  
ATOM 5826  H HA3  . GLY A 1 92  ? 142.798 -7.106  -77.585  1.00 0.00 ? 92  GLY A HA3  3  
ATOM 5827  N N    . ARG A 1 93  ? 140.612 -7.941  -76.624  1.00 0.00 ? 93  ARG A N    3  
ATOM 5828  C CA   . ARG A 1 93  ? 139.242 -8.424  -76.290  1.00 0.00 ? 93  ARG A CA   3  
ATOM 5829  C C    . ARG A 1 93  ? 138.304 -8.152  -77.468  1.00 0.00 ? 93  ARG A C    3  
ATOM 5830  O O    . ARG A 1 93  ? 137.163 -7.772  -77.290  1.00 0.00 ? 93  ARG A O    3  
ATOM 5831  C CB   . ARG A 1 93  ? 138.731 -7.687  -75.050  1.00 0.00 ? 93  ARG A CB   3  
ATOM 5832  C CG   . ARG A 1 93  ? 139.057 -8.505  -73.797  1.00 0.00 ? 93  ARG A CG   3  
ATOM 5833  C CD   . ARG A 1 93  ? 140.557 -8.428  -73.516  1.00 0.00 ? 93  ARG A CD   3  
ATOM 5834  N NE   . ARG A 1 93  ? 141.086 -9.792  -73.217  1.00 0.00 ? 93  ARG A NE   3  
ATOM 5835  C CZ   . ARG A 1 93  ? 140.403 -10.620 -72.471  1.00 0.00 ? 93  ARG A CZ   3  
ATOM 5836  N NH1  . ARG A 1 93  ? 139.278 -10.244 -71.928  1.00 0.00 ? 93  ARG A NH1  3  
ATOM 5837  N NH2  . ARG A 1 93  ? 140.858 -11.825 -72.255  1.00 0.00 ? 93  ARG A NH2  3  
ATOM 5838  H H    . ARG A 1 93  ? 141.364 -8.570  -76.634  1.00 0.00 ? 93  ARG A H    3  
ATOM 5839  H HA   . ARG A 1 93  ? 139.273 -9.485  -76.092  1.00 0.00 ? 93  ARG A HA   3  
ATOM 5840  H HB2  . ARG A 1 93  ? 139.207 -6.720  -74.983  1.00 0.00 ? 93  ARG A HB2  3  
ATOM 5841  H HB3  . ARG A 1 93  ? 137.661 -7.558  -75.124  1.00 0.00 ? 93  ARG A HB3  3  
ATOM 5842  H HG2  . ARG A 1 93  ? 138.509 -8.104  -72.957  1.00 0.00 ? 93  ARG A HG2  3  
ATOM 5843  H HG3  . ARG A 1 93  ? 138.774 -9.534  -73.956  1.00 0.00 ? 93  ARG A HG3  3  
ATOM 5844  H HD2  . ARG A 1 93  ? 141.064 -8.039  -74.384  1.00 0.00 ? 93  ARG A HD2  3  
ATOM 5845  H HD3  . ARG A 1 93  ? 140.732 -7.769  -72.675  1.00 0.00 ? 93  ARG A HD3  3  
ATOM 5846  H HE   . ARG A 1 93  ? 141.943 -10.074 -73.597  1.00 0.00 ? 93  ARG A HE   3  
ATOM 5847  H HH11 . ARG A 1 93  ? 138.934 -9.318  -72.080  1.00 0.00 ? 93  ARG A HH11 3  
ATOM 5848  H HH12 . ARG A 1 93  ? 138.759 -10.882 -71.360  1.00 0.00 ? 93  ARG A HH12 3  
ATOM 5849  H HH21 . ARG A 1 93  ? 141.727 -12.111 -72.658  1.00 0.00 ? 93  ARG A HH21 3  
ATOM 5850  H HH22 . ARG A 1 93  ? 140.337 -12.460 -71.684  1.00 0.00 ? 93  ARG A HH22 3  
ATOM 5851  N N    . GLU A 1 94  ? 138.775 -8.340  -78.671  1.00 0.00 ? 94  GLU A N    3  
ATOM 5852  C CA   . GLU A 1 94  ? 137.907 -8.090  -79.857  1.00 0.00 ? 94  GLU A CA   3  
ATOM 5853  C C    . GLU A 1 94  ? 138.466 -8.840  -81.068  1.00 0.00 ? 94  GLU A C    3  
ATOM 5854  O O    . GLU A 1 94  ? 139.335 -9.682  -80.942  1.00 0.00 ? 94  GLU A O    3  
ATOM 5855  C CB   . GLU A 1 94  ? 137.874 -6.590  -80.157  1.00 0.00 ? 94  GLU A CB   3  
ATOM 5856  C CG   . GLU A 1 94  ? 137.153 -5.858  -79.024  1.00 0.00 ? 94  GLU A CG   3  
ATOM 5857  C CD   . GLU A 1 94  ? 136.800 -4.439  -79.475  1.00 0.00 ? 94  GLU A CD   3  
ATOM 5858  O OE1  . GLU A 1 94  ? 137.702 -3.622  -79.554  1.00 0.00 ? 94  GLU A OE1  3  
ATOM 5859  O OE2  . GLU A 1 94  ? 135.633 -4.194  -79.735  1.00 0.00 ? 94  GLU A OE2  3  
ATOM 5860  H H    . GLU A 1 94  ? 139.698 -8.645  -78.794  1.00 0.00 ? 94  GLU A H    3  
ATOM 5861  H HA   . GLU A 1 94  ? 136.906 -8.437  -79.649  1.00 0.00 ? 94  GLU A HA   3  
ATOM 5862  H HB2  . GLU A 1 94  ? 138.885 -6.218  -80.242  1.00 0.00 ? 94  GLU A HB2  3  
ATOM 5863  H HB3  . GLU A 1 94  ? 137.349 -6.420  -81.085  1.00 0.00 ? 94  GLU A HB3  3  
ATOM 5864  H HG2  . GLU A 1 94  ? 136.248 -6.391  -78.769  1.00 0.00 ? 94  GLU A HG2  3  
ATOM 5865  H HG3  . GLU A 1 94  ? 137.798 -5.808  -78.159  1.00 0.00 ? 94  GLU A HG3  3  
ATOM 5866  N N    . LYS A 1 95  ? 137.976 -8.541  -82.240  1.00 0.00 ? 95  LYS A N    3  
ATOM 5867  C CA   . LYS A 1 95  ? 138.479 -9.238  -83.458  1.00 0.00 ? 95  LYS A CA   3  
ATOM 5868  C C    . LYS A 1 95  ? 138.685 -8.217  -84.581  1.00 0.00 ? 95  LYS A C    3  
ATOM 5869  O O    . LYS A 1 95  ? 138.714 -7.025  -84.351  1.00 0.00 ? 95  LYS A O    3  
ATOM 5870  C CB   . LYS A 1 95  ? 137.459 -10.288 -83.904  1.00 0.00 ? 95  LYS A CB   3  
ATOM 5871  C CG   . LYS A 1 95  ? 138.177 -11.608 -84.192  1.00 0.00 ? 95  LYS A CG   3  
ATOM 5872  C CD   . LYS A 1 95  ? 138.720 -12.191 -82.885  1.00 0.00 ? 95  LYS A CD   3  
ATOM 5873  C CE   . LYS A 1 95  ? 137.972 -13.483 -82.552  1.00 0.00 ? 95  LYS A CE   3  
ATOM 5874  N NZ   . LYS A 1 95  ? 138.682 -14.200 -81.456  1.00 0.00 ? 95  LYS A NZ   3  
ATOM 5875  H H    . LYS A 1 95  ? 137.276 -7.860  -82.319  1.00 0.00 ? 95  LYS A H    3  
ATOM 5876  H HA   . LYS A 1 95  ? 139.418 -9.721  -83.234  1.00 0.00 ? 95  LYS A HA   3  
ATOM 5877  H HB2  . LYS A 1 95  ? 136.731 -10.437 -83.119  1.00 0.00 ? 95  LYS A HB2  3  
ATOM 5878  H HB3  . LYS A 1 95  ? 136.961 -9.949  -84.799  1.00 0.00 ? 95  LYS A HB3  3  
ATOM 5879  H HG2  . LYS A 1 95  ? 137.483 -12.305 -84.638  1.00 0.00 ? 95  LYS A HG2  3  
ATOM 5880  H HG3  . LYS A 1 95  ? 138.996 -11.431 -84.872  1.00 0.00 ? 95  LYS A HG3  3  
ATOM 5881  H HD2  . LYS A 1 95  ? 139.774 -12.402 -82.997  1.00 0.00 ? 95  LYS A HD2  3  
ATOM 5882  H HD3  . LYS A 1 95  ? 138.578 -11.479 -82.086  1.00 0.00 ? 95  LYS A HD3  3  
ATOM 5883  H HE2  . LYS A 1 95  ? 136.967 -13.245 -82.236  1.00 0.00 ? 95  LYS A HE2  3  
ATOM 5884  H HE3  . LYS A 1 95  ? 137.934 -14.113 -83.428  1.00 0.00 ? 95  LYS A HE3  3  
ATOM 5885  H HZ1  . LYS A 1 95  ? 139.094 -13.508 -80.798  1.00 0.00 ? 95  LYS A HZ1  3  
ATOM 5886  H HZ2  . LYS A 1 95  ? 139.439 -14.788 -81.860  1.00 0.00 ? 95  LYS A HZ2  3  
ATOM 5887  H HZ3  . LYS A 1 95  ? 138.009 -14.804 -80.943  1.00 0.00 ? 95  LYS A HZ3  3  
ATOM 5888  N N    . VAL A 1 96  ? 138.831 -8.676  -85.795  1.00 0.00 ? 96  VAL A N    3  
ATOM 5889  C CA   . VAL A 1 96  ? 139.036 -7.732  -86.930  1.00 0.00 ? 96  VAL A CA   3  
ATOM 5890  C C    . VAL A 1 96  ? 138.162 -8.152  -88.113  1.00 0.00 ? 96  VAL A C    3  
ATOM 5891  O O    . VAL A 1 96  ? 137.649 -9.253  -88.159  1.00 0.00 ? 96  VAL A O    3  
ATOM 5892  C CB   . VAL A 1 96  ? 140.506 -7.752  -87.351  1.00 0.00 ? 96  VAL A CB   3  
ATOM 5893  C CG1  . VAL A 1 96  ? 140.693 -6.877  -88.592  1.00 0.00 ? 96  VAL A CG1  3  
ATOM 5894  C CG2  . VAL A 1 96  ? 141.371 -7.210  -86.211  1.00 0.00 ? 96  VAL A CG2  3  
ATOM 5895  H H    . VAL A 1 96  ? 138.805 -9.643  -85.960  1.00 0.00 ? 96  VAL A H    3  
ATOM 5896  H HA   . VAL A 1 96  ? 138.766 -6.733  -86.620  1.00 0.00 ? 96  VAL A HA   3  
ATOM 5897  H HB   . VAL A 1 96  ? 140.802 -8.767  -87.578  1.00 0.00 ? 96  VAL A HB   3  
ATOM 5898  H HG11 . VAL A 1 96  ? 140.222 -7.351  -89.440  1.00 0.00 ? 96  VAL A HG11 3  
ATOM 5899  H HG12 . VAL A 1 96  ? 141.747 -6.753  -88.788  1.00 0.00 ? 96  VAL A HG12 3  
ATOM 5900  H HG13 . VAL A 1 96  ? 140.242 -5.911  -88.421  1.00 0.00 ? 96  VAL A HG13 3  
ATOM 5901  H HG21 . VAL A 1 96  ? 140.991 -6.248  -85.897  1.00 0.00 ? 96  VAL A HG21 3  
ATOM 5902  H HG22 . VAL A 1 96  ? 142.390 -7.099  -86.552  1.00 0.00 ? 96  VAL A HG22 3  
ATOM 5903  H HG23 . VAL A 1 96  ? 141.343 -7.897  -85.378  1.00 0.00 ? 96  VAL A HG23 3  
ATOM 5904  N N    . GLY A 1 97  ? 137.989 -7.283  -89.071  1.00 0.00 ? 97  GLY A N    3  
ATOM 5905  C CA   . GLY A 1 97  ? 137.149 -7.629  -90.254  1.00 0.00 ? 97  GLY A CA   3  
ATOM 5906  C C    . GLY A 1 97  ? 135.698 -7.820  -89.811  1.00 0.00 ? 97  GLY A C    3  
ATOM 5907  O O    . GLY A 1 97  ? 135.152 -8.907  -89.885  1.00 0.00 ? 97  GLY A O    3  
ATOM 5908  H H    . GLY A 1 97  ? 138.413 -6.401  -89.013  1.00 0.00 ? 97  GLY A H    3  
ATOM 5909  H HA2  . GLY A 1 97  ? 137.205 -6.830  -90.978  1.00 0.00 ? 97  GLY A HA2  3  
ATOM 5910  H HA3  . GLY A 1 97  ? 137.510 -8.542  -90.699  1.00 0.00 ? 97  GLY A HA3  3  
ATOM 5911  N N    . ARG A 1 98  ? 135.065 -6.773  -89.353  1.00 0.00 ? 98  ARG A N    3  
ATOM 5912  C CA   . ARG A 1 98  ? 133.651 -6.905  -88.909  1.00 0.00 ? 98  ARG A CA   3  
ATOM 5913  C C    . ARG A 1 98  ? 132.809 -5.776  -89.507  1.00 0.00 ? 98  ARG A C    3  
ATOM 5914  O O    . ARG A 1 98  ? 133.002 -4.614  -89.213  1.00 0.00 ? 98  ARG A O    3  
ATOM 5915  C CB   . ARG A 1 98  ? 133.582 -6.843  -87.381  1.00 0.00 ? 98  ARG A CB   3  
ATOM 5916  C CG   . ARG A 1 98  ? 133.022 -8.160  -86.839  1.00 0.00 ? 98  ARG A CG   3  
ATOM 5917  C CD   . ARG A 1 98  ? 132.572 -7.965  -85.390  1.00 0.00 ? 98  ARG A CD   3  
ATOM 5918  N NE   . ARG A 1 98  ? 131.766 -9.141  -84.957  1.00 0.00 ? 98  ARG A NE   3  
ATOM 5919  C CZ   . ARG A 1 98  ? 131.529 -9.340  -83.690  1.00 0.00 ? 98  ARG A CZ   3  
ATOM 5920  N NH1  . ARG A 1 98  ? 131.997 -8.507  -82.800  1.00 0.00 ? 98  ARG A NH1  3  
ATOM 5921  N NH2  . ARG A 1 98  ? 130.824 -10.370 -83.311  1.00 0.00 ? 98  ARG A NH2  3  
ATOM 5922  H H    . ARG A 1 98  ? 135.519 -5.907  -89.300  1.00 0.00 ? 98  ARG A H    3  
ATOM 5923  H HA   . ARG A 1 98  ? 133.265 -7.852  -89.251  1.00 0.00 ? 98  ARG A HA   3  
ATOM 5924  H HB2  . ARG A 1 98  ? 134.573 -6.681  -86.982  1.00 0.00 ? 98  ARG A HB2  3  
ATOM 5925  H HB3  . ARG A 1 98  ? 132.936 -6.031  -87.082  1.00 0.00 ? 98  ARG A HB3  3  
ATOM 5926  H HG2  . ARG A 1 98  ? 132.179 -8.467  -87.441  1.00 0.00 ? 98  ARG A HG2  3  
ATOM 5927  H HG3  . ARG A 1 98  ? 133.788 -8.920  -86.877  1.00 0.00 ? 98  ARG A HG3  3  
ATOM 5928  H HD2  . ARG A 1 98  ? 133.440 -7.870  -84.753  1.00 0.00 ? 98  ARG A HD2  3  
ATOM 5929  H HD3  . ARG A 1 98  ? 131.972 -7.070  -85.317  1.00 0.00 ? 98  ARG A HD3  3  
ATOM 5930  H HE   . ARG A 1 98  ? 131.413 -9.766  -85.626  1.00 0.00 ? 98  ARG A HE   3  
ATOM 5931  H HH11 . ARG A 1 98  ? 132.538 -7.718  -83.090  1.00 0.00 ? 98  ARG A HH11 3  
ATOM 5932  H HH12 . ARG A 1 98  ? 131.816 -8.660  -81.828  1.00 0.00 ? 98  ARG A HH12 3  
ATOM 5933  H HH21 . ARG A 1 98  ? 130.465 -11.008 -83.994  1.00 0.00 ? 98  ARG A HH21 3  
ATOM 5934  H HH22 . ARG A 1 98  ? 130.642 -10.522 -82.340  1.00 0.00 ? 98  ARG A HH22 3  
ATOM 5935  N N    . ILE A 1 99  ? 131.876 -6.120  -90.346  1.00 0.00 ? 99  ILE A N    3  
ATOM 5936  C CA   . ILE A 1 99  ? 131.006 -5.093  -90.983  1.00 0.00 ? 99  ILE A CA   3  
ATOM 5937  C C    . ILE A 1 99  ? 129.628 -5.110  -90.323  1.00 0.00 ? 99  ILE A C    3  
ATOM 5938  O O    . ILE A 1 99  ? 129.332 -5.960  -89.509  1.00 0.00 ? 99  ILE A O    3  
ATOM 5939  C CB   . ILE A 1 99  ? 130.862 -5.418  -92.472  1.00 0.00 ? 99  ILE A CB   3  
ATOM 5940  C CG1  . ILE A 1 99  ? 131.106 -6.917  -92.685  1.00 0.00 ? 99  ILE A CG1  3  
ATOM 5941  C CG2  . ILE A 1 99  ? 131.884 -4.616  -93.278  1.00 0.00 ? 99  ILE A CG2  3  
ATOM 5942  C CD1  . ILE A 1 99  ? 130.111 -7.466  -93.703  1.00 0.00 ? 99  ILE A CD1  3  
ATOM 5943  H H    . ILE A 1 99  ? 131.747 -7.064  -90.565  1.00 0.00 ? 99  ILE A H    3  
ATOM 5944  H HA   . ILE A 1 99  ? 131.452 -4.116  -90.867  1.00 0.00 ? 99  ILE A HA   3  
ATOM 5945  H HB   . ILE A 1 99  ? 129.864 -5.164  -92.800  1.00 0.00 ? 99  ILE A HB   3  
ATOM 5946  H HG12 . ILE A 1 99  ? 132.109 -7.066  -93.050  1.00 0.00 ? 99  ILE A HG12 3  
ATOM 5947  H HG13 . ILE A 1 99  ? 130.980 -7.441  -91.752  1.00 0.00 ? 99  ILE A HG13 3  
ATOM 5948  H HG21 . ILE A 1 99  ? 131.904 -3.597  -92.924  1.00 0.00 ? 99  ILE A HG21 3  
ATOM 5949  H HG22 . ILE A 1 99  ? 131.608 -4.628  -94.322  1.00 0.00 ? 99  ILE A HG22 3  
ATOM 5950  H HG23 . ILE A 1 99  ? 132.862 -5.058  -93.161  1.00 0.00 ? 99  ILE A HG23 3  
ATOM 5951  H HD11 . ILE A 1 99  ? 130.430 -8.444  -94.026  1.00 0.00 ? 99  ILE A HD11 3  
ATOM 5952  H HD12 . ILE A 1 99  ? 130.062 -6.802  -94.553  1.00 0.00 ? 99  ILE A HD12 3  
ATOM 5953  H HD13 . ILE A 1 99  ? 129.136 -7.541  -93.242  1.00 0.00 ? 99  ILE A HD13 3  
ATOM 5954  N N    . THR A 1 100 ? 128.776 -4.181  -90.667  1.00 0.00 ? 100 THR A N    3  
ATOM 5955  C CA   . THR A 1 100 ? 127.422 -4.164  -90.052  1.00 0.00 ? 100 THR A CA   3  
ATOM 5956  C C    . THR A 1 100 ? 126.382 -4.454  -91.128  1.00 0.00 ? 100 THR A C    3  
ATOM 5957  O O    . THR A 1 100 ? 126.573 -4.154  -92.290  1.00 0.00 ? 100 THR A O    3  
ATOM 5958  C CB   . THR A 1 100 ? 127.138 -2.796  -89.430  1.00 0.00 ? 100 THR A CB   3  
ATOM 5959  O OG1  . THR A 1 100 ? 126.398 -2.006  -90.350  1.00 0.00 ? 100 THR A OG1  3  
ATOM 5960  C CG2  . THR A 1 100 ? 128.453 -2.091  -89.117  1.00 0.00 ? 100 THR A CG2  3  
ATOM 5961  H H    . THR A 1 100 ? 129.027 -3.501  -91.328  1.00 0.00 ? 100 THR A H    3  
ATOM 5962  H HA   . THR A 1 100 ? 127.364 -4.926  -89.289  1.00 0.00 ? 100 THR A HA   3  
ATOM 5963  H HB   . THR A 1 100 ? 126.579 -2.926  -88.517  1.00 0.00 ? 100 THR A HB   3  
ATOM 5964  H HG1  . THR A 1 100 ? 125.525 -1.856  -89.976  1.00 0.00 ? 100 THR A HG1  3  
ATOM 5965  H HG21 . THR A 1 100 ? 128.711 -1.437  -89.937  1.00 0.00 ? 100 THR A HG21 3  
ATOM 5966  H HG22 . THR A 1 100 ? 129.233 -2.823  -88.981  1.00 0.00 ? 100 THR A HG22 3  
ATOM 5967  H HG23 . THR A 1 100 ? 128.340 -1.510  -88.215  1.00 0.00 ? 100 THR A HG23 3  
ATOM 5968  N N    . TRP A 1 101 ? 125.288 -5.046  -90.754  1.00 0.00 ? 101 TRP A N    3  
ATOM 5969  C CA   . TRP A 1 101 ? 124.238 -5.379  -91.752  1.00 0.00 ? 101 TRP A CA   3  
ATOM 5970  C C    . TRP A 1 101 ? 123.965 -4.188  -92.676  1.00 0.00 ? 101 TRP A C    3  
ATOM 5971  O O    . TRP A 1 101 ? 124.241 -4.240  -93.857  1.00 0.00 ? 101 TRP A O    3  
ATOM 5972  C CB   . TRP A 1 101 ? 122.947 -5.770  -91.028  1.00 0.00 ? 101 TRP A CB   3  
ATOM 5973  C CG   . TRP A 1 101 ? 122.003 -6.397  -92.004  1.00 0.00 ? 101 TRP A CG   3  
ATOM 5974  C CD1  . TRP A 1 101 ? 120.724 -6.004  -92.208  1.00 0.00 ? 101 TRP A CD1  3  
ATOM 5975  C CD2  . TRP A 1 101 ? 122.237 -7.515  -92.911  1.00 0.00 ? 101 TRP A CD2  3  
ATOM 5976  N NE1  . TRP A 1 101 ? 120.159 -6.808  -93.182  1.00 0.00 ? 101 TRP A NE1  3  
ATOM 5977  C CE2  . TRP A 1 101 ? 121.051 -7.754  -93.647  1.00 0.00 ? 101 TRP A CE2  3  
ATOM 5978  C CE3  . TRP A 1 101 ? 123.351 -8.337  -93.166  1.00 0.00 ? 101 TRP A CE3  3  
ATOM 5979  C CZ2  . TRP A 1 101 ? 120.975 -8.770  -94.600  1.00 0.00 ? 101 TRP A CZ2  3  
ATOM 5980  C CZ3  . TRP A 1 101 ? 123.276 -9.359  -94.124  1.00 0.00 ? 101 TRP A CZ3  3  
ATOM 5981  C CH2  . TRP A 1 101 ? 122.091 -9.575  -94.840  1.00 0.00 ? 101 TRP A CH2  3  
ATOM 5982  H H    . TRP A 1 101 ? 125.160 -5.287  -89.812  1.00 0.00 ? 101 TRP A H    3  
ATOM 5983  H HA   . TRP A 1 101 ? 124.573 -6.212  -92.348  1.00 0.00 ? 101 TRP A HA   3  
ATOM 5984  H HB2  . TRP A 1 101 ? 123.174 -6.474  -90.242  1.00 0.00 ? 101 TRP A HB2  3  
ATOM 5985  H HB3  . TRP A 1 101 ? 122.492 -4.888  -90.602  1.00 0.00 ? 101 TRP A HB3  3  
ATOM 5986  H HD1  . TRP A 1 101 ? 120.226 -5.195  -91.695  1.00 0.00 ? 101 TRP A HD1  3  
ATOM 5987  H HE1  . TRP A 1 101 ? 119.240 -6.731  -93.516  1.00 0.00 ? 101 TRP A HE1  3  
ATOM 5988  H HE3  . TRP A 1 101 ? 124.269 -8.183  -92.620  1.00 0.00 ? 101 TRP A HE3  3  
ATOM 5989  H HZ2  . TRP A 1 101 ? 120.059 -8.931  -95.149  1.00 0.00 ? 101 TRP A HZ2  3  
ATOM 5990  H HZ3  . TRP A 1 101 ? 124.139 -9.980  -94.311  1.00 0.00 ? 101 TRP A HZ3  3  
ATOM 5991  H HH2  . TRP A 1 101 ? 122.041 -10.363 -95.576  1.00 0.00 ? 101 TRP A HH2  3  
ATOM 5992  N N    . GLU A 1 102 ? 123.410 -3.123  -92.172  1.00 0.00 ? 102 GLU A N    3  
ATOM 5993  C CA   . GLU A 1 102 ? 123.102 -1.958  -93.055  1.00 0.00 ? 102 GLU A CA   3  
ATOM 5994  C C    . GLU A 1 102 ? 124.325 -1.565  -93.873  1.00 0.00 ? 102 GLU A C    3  
ATOM 5995  O O    . GLU A 1 102 ? 124.248 -1.379  -95.074  1.00 0.00 ? 102 GLU A O    3  
ATOM 5996  C CB   . GLU A 1 102 ? 122.666 -0.773  -92.190  1.00 0.00 ? 102 GLU A CB   3  
ATOM 5997  C CG   . GLU A 1 102 ? 122.956 0.535   -92.929  1.00 0.00 ? 102 GLU A CG   3  
ATOM 5998  C CD   . GLU A 1 102 ? 122.557 0.392   -94.400  1.00 0.00 ? 102 GLU A CD   3  
ATOM 5999  O OE1  . GLU A 1 102 ? 121.570 -0.275  -94.663  1.00 0.00 ? 102 GLU A OE1  3  
ATOM 6000  O OE2  . GLU A 1 102 ? 123.246 0.952   -95.237  1.00 0.00 ? 102 GLU A OE2  3  
ATOM 6001  H H    . GLU A 1 102 ? 123.170 -3.067  -91.226  1.00 0.00 ? 102 GLU A H    3  
ATOM 6002  H HA   . GLU A 1 102 ? 122.298 -2.229  -93.723  1.00 0.00 ? 102 GLU A HA   3  
ATOM 6003  H HB2  . GLU A 1 102 ? 121.608 -0.845  -91.987  1.00 0.00 ? 102 GLU A HB2  3  
ATOM 6004  H HB3  . GLU A 1 102 ? 123.213 -0.786  -91.259  1.00 0.00 ? 102 GLU A HB3  3  
ATOM 6005  H HG2  . GLU A 1 102 ? 122.389 1.337   -92.477  1.00 0.00 ? 102 GLU A HG2  3  
ATOM 6006  H HG3  . GLU A 1 102 ? 124.012 0.759   -92.865  1.00 0.00 ? 102 GLU A HG3  3  
ATOM 6007  N N    . GLN A 1 103 ? 125.448 -1.417  -93.239  1.00 0.00 ? 103 GLN A N    3  
ATOM 6008  C CA   . GLN A 1 103 ? 126.660 -1.016  -93.990  1.00 0.00 ? 103 GLN A CA   3  
ATOM 6009  C C    . GLN A 1 103 ? 126.820 -1.897  -95.226  1.00 0.00 ? 103 GLN A C    3  
ATOM 6010  O O    . GLN A 1 103 ? 127.092 -1.408  -96.310  1.00 0.00 ? 103 GLN A O    3  
ATOM 6011  C CB   . GLN A 1 103 ? 127.893 -1.152  -93.095  1.00 0.00 ? 103 GLN A CB   3  
ATOM 6012  C CG   . GLN A 1 103 ? 128.636 0.185   -93.051  1.00 0.00 ? 103 GLN A CG   3  
ATOM 6013  C CD   . GLN A 1 103 ? 129.470 0.264   -91.773  1.00 0.00 ? 103 GLN A CD   3  
ATOM 6014  O OE1  . GLN A 1 103 ? 130.643 -0.051  -91.776  1.00 0.00 ? 103 GLN A OE1  3  
ATOM 6015  N NE2  . GLN A 1 103 ? 128.909 0.676   -90.671  1.00 0.00 ? 103 GLN A NE2  3  
ATOM 6016  H H    . GLN A 1 103 ? 125.489 -1.556  -92.270  1.00 0.00 ? 103 GLN A H    3  
ATOM 6017  H HA   . GLN A 1 103 ? 126.558 0.013   -94.302  1.00 0.00 ? 103 GLN A HA   3  
ATOM 6018  H HB2  . GLN A 1 103 ? 127.585 -1.428  -92.097  1.00 0.00 ? 103 GLN A HB2  3  
ATOM 6019  H HB3  . GLN A 1 103 ? 128.547 -1.912  -93.495  1.00 0.00 ? 103 GLN A HB3  3  
ATOM 6020  H HG2  . GLN A 1 103 ? 129.284 0.265   -93.911  1.00 0.00 ? 103 GLN A HG2  3  
ATOM 6021  H HG3  . GLN A 1 103 ? 127.923 0.995   -93.061  1.00 0.00 ? 103 GLN A HG3  3  
ATOM 6022  H HE21 . GLN A 1 103 ? 127.962 0.931   -90.669  1.00 0.00 ? 103 GLN A HE21 3  
ATOM 6023  H HE22 . GLN A 1 103 ? 129.431 0.730   -89.848  1.00 0.00 ? 103 GLN A HE22 3  
ATOM 6024  N N    . VAL A 1 104 ? 126.670 -3.192  -95.098  1.00 0.00 ? 104 VAL A N    3  
ATOM 6025  C CA   . VAL A 1 104 ? 126.847 -4.037  -96.307  1.00 0.00 ? 104 VAL A CA   3  
ATOM 6026  C C    . VAL A 1 104 ? 125.654 -3.797  -97.221  1.00 0.00 ? 104 VAL A C    3  
ATOM 6027  O O    . VAL A 1 104 ? 125.736 -3.971  -98.420  1.00 0.00 ? 104 VAL A O    3  
ATOM 6028  C CB   . VAL A 1 104 ? 126.893 -5.525  -95.960  1.00 0.00 ? 104 VAL A CB   3  
ATOM 6029  C CG1  . VAL A 1 104 ? 127.729 -5.757  -94.708  1.00 0.00 ? 104 VAL A CG1  3  
ATOM 6030  C CG2  . VAL A 1 104 ? 125.479 -6.054  -95.752  1.00 0.00 ? 104 VAL A CG2  3  
ATOM 6031  H H    . VAL A 1 104 ? 126.460 -3.592  -94.228  1.00 0.00 ? 104 VAL A H    3  
ATOM 6032  H HA   . VAL A 1 104 ? 127.751 -3.723  -96.801  1.00 0.00 ? 104 VAL A HA   3  
ATOM 6033  H HB   . VAL A 1 104 ? 127.347 -6.057  -96.782  1.00 0.00 ? 104 VAL A HB   3  
ATOM 6034  H HG11 . VAL A 1 104 ? 128.652 -5.202  -94.779  1.00 0.00 ? 104 VAL A HG11 3  
ATOM 6035  H HG12 . VAL A 1 104 ? 127.942 -6.810  -94.618  1.00 0.00 ? 104 VAL A HG12 3  
ATOM 6036  H HG13 . VAL A 1 104 ? 127.175 -5.430  -93.842  1.00 0.00 ? 104 VAL A HG13 3  
ATOM 6037  H HG21 . VAL A 1 104 ? 125.151 -6.553  -96.653  1.00 0.00 ? 104 VAL A HG21 3  
ATOM 6038  H HG22 . VAL A 1 104 ? 124.816 -5.234  -95.535  1.00 0.00 ? 104 VAL A HG22 3  
ATOM 6039  H HG23 . VAL A 1 104 ? 125.474 -6.751  -94.931  1.00 0.00 ? 104 VAL A HG23 3  
ATOM 6040  N N    . LEU A 1 105 ? 124.544 -3.377  -96.671  1.00 0.00 ? 105 LEU A N    3  
ATOM 6041  C CA   . LEU A 1 105 ? 123.363 -3.111  -97.527  1.00 0.00 ? 105 LEU A CA   3  
ATOM 6042  C C    . LEU A 1 105 ? 123.692 -1.929  -98.427  1.00 0.00 ? 105 LEU A C    3  
ATOM 6043  O O    . LEU A 1 105 ? 123.898 -2.087  -99.613  1.00 0.00 ? 105 LEU A O    3  
ATOM 6044  C CB   . LEU A 1 105 ? 122.145 -2.774  -96.660  1.00 0.00 ? 105 LEU A CB   3  
ATOM 6045  C CG   . LEU A 1 105 ? 121.796 -3.963  -95.760  1.00 0.00 ? 105 LEU A CG   3  
ATOM 6046  C CD1  . LEU A 1 105 ? 120.397 -3.766  -95.175  1.00 0.00 ? 105 LEU A CD1  3  
ATOM 6047  C CD2  . LEU A 1 105 ? 121.827 -5.258  -96.575  1.00 0.00 ? 105 LEU A CD2  3  
ATOM 6048  H H    . LEU A 1 105 ? 124.489 -3.212  -95.703  1.00 0.00 ? 105 LEU A H    3  
ATOM 6049  H HA   . LEU A 1 105 ? 123.151 -3.978  -98.135  1.00 0.00 ? 105 LEU A HA   3  
ATOM 6050  H HB2  . LEU A 1 105 ? 122.368 -1.913  -96.048  1.00 0.00 ? 105 LEU A HB2  3  
ATOM 6051  H HB3  . LEU A 1 105 ? 121.302 -2.550  -97.298  1.00 0.00 ? 105 LEU A HB3  3  
ATOM 6052  H HG   . LEU A 1 105 ? 122.512 -4.025  -94.956  1.00 0.00 ? 105 LEU A HG   3  
ATOM 6053  H HD11 . LEU A 1 105 ? 120.110 -2.729  -95.267  1.00 0.00 ? 105 LEU A HD11 3  
ATOM 6054  H HD12 . LEU A 1 105 ? 120.399 -4.049  -94.133  1.00 0.00 ? 105 LEU A HD12 3  
ATOM 6055  H HD13 . LEU A 1 105 ? 119.692 -4.383  -95.715  1.00 0.00 ? 105 LEU A HD13 3  
ATOM 6056  H HD21 . LEU A 1 105 ? 121.273 -6.024  -96.054  1.00 0.00 ? 105 LEU A HD21 3  
ATOM 6057  H HD22 . LEU A 1 105 ? 122.850 -5.580  -96.702  1.00 0.00 ? 105 LEU A HD22 3  
ATOM 6058  H HD23 . LEU A 1 105 ? 121.379 -5.087  -97.543  1.00 0.00 ? 105 LEU A HD23 3  
ATOM 6059  N N    . GLU A 1 106 ? 123.760 -0.742  -97.887  1.00 0.00 ? 106 GLU A N    3  
ATOM 6060  C CA   . GLU A 1 106 ? 124.095 0.424   -98.746  1.00 0.00 ? 106 GLU A CA   3  
ATOM 6061  C C    . GLU A 1 106 ? 125.251 0.032   -99.665  1.00 0.00 ? 106 GLU A C    3  
ATOM 6062  O O    . GLU A 1 106 ? 125.225 0.291   -100.851 1.00 0.00 ? 106 GLU A O    3  
ATOM 6063  C CB   . GLU A 1 106 ? 124.512 1.607   -97.869  1.00 0.00 ? 106 GLU A CB   3  
ATOM 6064  C CG   . GLU A 1 106 ? 124.912 2.785   -98.758  1.00 0.00 ? 106 GLU A CG   3  
ATOM 6065  C CD   . GLU A 1 106 ? 125.338 3.965   -97.883  1.00 0.00 ? 106 GLU A CD   3  
ATOM 6066  O OE1  . GLU A 1 106 ? 125.290 3.826   -96.672  1.00 0.00 ? 106 GLU A OE1  3  
ATOM 6067  O OE2  . GLU A 1 106 ? 125.703 4.988   -98.438  1.00 0.00 ? 106 GLU A OE2  3  
ATOM 6068  H H    . GLU A 1 106 ? 123.589 -0.607  -96.930  1.00 0.00 ? 106 GLU A H    3  
ATOM 6069  H HA   . GLU A 1 106 ? 123.234 0.697   -99.341  1.00 0.00 ? 106 GLU A HA   3  
ATOM 6070  H HB2  . GLU A 1 106 ? 123.684 1.895   -97.237  1.00 0.00 ? 106 GLU A HB2  3  
ATOM 6071  H HB3  . GLU A 1 106 ? 125.352 1.320   -97.254  1.00 0.00 ? 106 GLU A HB3  3  
ATOM 6072  H HG2  . GLU A 1 106 ? 125.736 2.493   -99.394  1.00 0.00 ? 106 GLU A HG2  3  
ATOM 6073  H HG3  . GLU A 1 106 ? 124.072 3.078   -99.369  1.00 0.00 ? 106 GLU A HG3  3  
ATOM 6074  N N    . ILE A 1 107 ? 126.260 -0.612  -99.137  1.00 0.00 ? 107 ILE A N    3  
ATOM 6075  C CA   . ILE A 1 107 ? 127.391 -1.033  -100.009 1.00 0.00 ? 107 ILE A CA   3  
ATOM 6076  C C    . ILE A 1 107 ? 126.855 -1.998  -101.066 1.00 0.00 ? 107 ILE A C    3  
ATOM 6077  O O    . ILE A 1 107 ? 127.327 -2.039  -102.185 1.00 0.00 ? 107 ILE A O    3  
ATOM 6078  C CB   . ILE A 1 107 ? 128.458 -1.739  -99.178  1.00 0.00 ? 107 ILE A CB   3  
ATOM 6079  C CG1  . ILE A 1 107 ? 129.200 -0.714  -98.318  1.00 0.00 ? 107 ILE A CG1  3  
ATOM 6080  C CG2  . ILE A 1 107 ? 129.448 -2.427  -100.121 1.00 0.00 ? 107 ILE A CG2  3  
ATOM 6081  C CD1  . ILE A 1 107 ? 130.070 -1.441  -97.292  1.00 0.00 ? 107 ILE A CD1  3  
ATOM 6082  H H    . ILE A 1 107 ? 126.265 -0.832  -98.178  1.00 0.00 ? 107 ILE A H    3  
ATOM 6083  H HA   . ILE A 1 107 ? 127.824 -0.168  -100.492 1.00 0.00 ? 107 ILE A HA   3  
ATOM 6084  H HB   . ILE A 1 107 ? 127.991 -2.477  -98.543  1.00 0.00 ? 107 ILE A HB   3  
ATOM 6085  H HG12 . ILE A 1 107 ? 129.825 -0.099  -98.950  1.00 0.00 ? 107 ILE A HG12 3  
ATOM 6086  H HG13 . ILE A 1 107 ? 128.484 -0.090  -97.804  1.00 0.00 ? 107 ILE A HG13 3  
ATOM 6087  H HG21 . ILE A 1 107 ? 128.939 -3.206  -100.669 1.00 0.00 ? 107 ILE A HG21 3  
ATOM 6088  H HG22 . ILE A 1 107 ? 130.254 -2.857  -99.546  1.00 0.00 ? 107 ILE A HG22 3  
ATOM 6089  H HG23 . ILE A 1 107 ? 129.845 -1.701  -100.814 1.00 0.00 ? 107 ILE A HG23 3  
ATOM 6090  H HD11 . ILE A 1 107 ? 129.516 -1.562  -96.373  1.00 0.00 ? 107 ILE A HD11 3  
ATOM 6091  H HD12 . ILE A 1 107 ? 130.962 -0.863  -97.101  1.00 0.00 ? 107 ILE A HD12 3  
ATOM 6092  H HD13 . ILE A 1 107 ? 130.345 -2.412  -97.677  1.00 0.00 ? 107 ILE A HD13 3  
ATOM 6093  N N    . ALA A 1 108 ? 125.858 -2.772  -100.719 1.00 0.00 ? 108 ALA A N    3  
ATOM 6094  C CA   . ALA A 1 108 ? 125.277 -3.728  -101.704 1.00 0.00 ? 108 ALA A CA   3  
ATOM 6095  C C    . ALA A 1 108 ? 124.056 -3.089  -102.363 1.00 0.00 ? 108 ALA A C    3  
ATOM 6096  O O    . ALA A 1 108 ? 123.692 -3.432  -103.469 1.00 0.00 ? 108 ALA A O    3  
ATOM 6097  C CB   . ALA A 1 108 ? 124.850 -5.012  -100.990 1.00 0.00 ? 108 ALA A CB   3  
ATOM 6098  H H    . ALA A 1 108 ? 125.487 -2.715  -99.812  1.00 0.00 ? 108 ALA A H    3  
ATOM 6099  H HA   . ALA A 1 108 ? 126.014 -3.961  -102.459 1.00 0.00 ? 108 ALA A HA   3  
ATOM 6100  H HB1  . ALA A 1 108 ? 125.514 -5.207  -100.164 1.00 0.00 ? 108 ALA A HB1  3  
ATOM 6101  H HB2  . ALA A 1 108 ? 124.887 -5.839  -101.685 1.00 0.00 ? 108 ALA A HB2  3  
ATOM 6102  H HB3  . ALA A 1 108 ? 123.843 -4.899  -100.622 1.00 0.00 ? 108 ALA A HB3  3  
ATOM 6103  N N    . LYS A 1 109 ? 123.428 -2.153  -101.703 1.00 0.00 ? 109 LYS A N    3  
ATOM 6104  C CA   . LYS A 1 109 ? 122.243 -1.490  -102.311 1.00 0.00 ? 109 LYS A CA   3  
ATOM 6105  C C    . LYS A 1 109 ? 122.695 -0.757  -103.572 1.00 0.00 ? 109 LYS A C    3  
ATOM 6106  O O    . LYS A 1 109 ? 122.446 -1.193  -104.677 1.00 0.00 ? 109 LYS A O    3  
ATOM 6107  C CB   . LYS A 1 109 ? 121.648 -0.491  -101.312 1.00 0.00 ? 109 LYS A CB   3  
ATOM 6108  C CG   . LYS A 1 109 ? 120.157 -0.290  -101.600 1.00 0.00 ? 109 LYS A CG   3  
ATOM 6109  C CD   . LYS A 1 109 ? 119.421 -1.626  -101.477 1.00 0.00 ? 109 LYS A CD   3  
ATOM 6110  C CE   . LYS A 1 109 ? 118.004 -1.382  -100.956 1.00 0.00 ? 109 LYS A CE   3  
ATOM 6111  N NZ   . LYS A 1 109 ? 117.572 -0.001  -101.315 1.00 0.00 ? 109 LYS A NZ   3  
ATOM 6112  H H    . LYS A 1 109 ? 123.739 -1.877  -100.817 1.00 0.00 ? 109 LYS A H    3  
ATOM 6113  H HA   . LYS A 1 109 ? 121.504 -2.234  -102.568 1.00 0.00 ? 109 LYS A HA   3  
ATOM 6114  H HB2  . LYS A 1 109 ? 121.773 -0.870  -100.308 1.00 0.00 ? 109 LYS A HB2  3  
ATOM 6115  H HB3  . LYS A 1 109 ? 122.160 0.456   -101.404 1.00 0.00 ? 109 LYS A HB3  3  
ATOM 6116  H HG2  . LYS A 1 109 ? 119.747 0.409   -100.886 1.00 0.00 ? 109 LYS A HG2  3  
ATOM 6117  H HG3  . LYS A 1 109 ? 120.031 0.099   -102.599 1.00 0.00 ? 109 LYS A HG3  3  
ATOM 6118  H HD2  . LYS A 1 109 ? 119.371 -2.100  -102.447 1.00 0.00 ? 109 LYS A HD2  3  
ATOM 6119  H HD3  . LYS A 1 109 ? 119.951 -2.265  -100.789 1.00 0.00 ? 109 LYS A HD3  3  
ATOM 6120  H HE2  . LYS A 1 109 ? 117.328 -2.097  -101.401 1.00 0.00 ? 109 LYS A HE2  3  
ATOM 6121  H HE3  . LYS A 1 109 ? 117.991 -1.495  -99.881  1.00 0.00 ? 109 LYS A HE3  3  
ATOM 6122  H HZ1  . LYS A 1 109 ? 116.556 -0.003  -101.536 1.00 0.00 ? 109 LYS A HZ1  3  
ATOM 6123  H HZ2  . LYS A 1 109 ? 118.109 0.324   -102.145 1.00 0.00 ? 109 LYS A HZ2  3  
ATOM 6124  H HZ3  . LYS A 1 109 ? 117.750 0.637   -100.514 1.00 0.00 ? 109 LYS A HZ3  3  
ATOM 6125  N N    . GLN A 1 110 ? 123.365 0.353   -103.423 1.00 0.00 ? 110 GLN A N    3  
ATOM 6126  C CA   . GLN A 1 110 ? 123.829 1.094   -104.625 1.00 0.00 ? 110 GLN A CA   3  
ATOM 6127  C C    . GLN A 1 110 ? 124.424 0.096   -105.619 1.00 0.00 ? 110 GLN A C    3  
ATOM 6128  O O    . GLN A 1 110 ? 124.410 0.312   -106.814 1.00 0.00 ? 110 GLN A O    3  
ATOM 6129  C CB   . GLN A 1 110 ? 124.896 2.113   -104.219 1.00 0.00 ? 110 GLN A CB   3  
ATOM 6130  C CG   . GLN A 1 110 ? 124.266 3.182   -103.323 1.00 0.00 ? 110 GLN A CG   3  
ATOM 6131  C CD   . GLN A 1 110 ? 125.349 4.148   -102.841 1.00 0.00 ? 110 GLN A CD   3  
ATOM 6132  O OE1  . GLN A 1 110 ? 125.056 5.142   -102.208 1.00 0.00 ? 110 GLN A OE1  3  
ATOM 6133  N NE2  . GLN A 1 110 ? 126.600 3.896   -103.114 1.00 0.00 ? 110 GLN A NE2  3  
ATOM 6134  H H    . GLN A 1 110 ? 123.554 0.702   -102.527 1.00 0.00 ? 110 GLN A H    3  
ATOM 6135  H HA   . GLN A 1 110 ? 122.993 1.605   -105.082 1.00 0.00 ? 110 GLN A HA   3  
ATOM 6136  H HB2  . GLN A 1 110 ? 125.686 1.611   -103.680 1.00 0.00 ? 110 GLN A HB2  3  
ATOM 6137  H HB3  . GLN A 1 110 ? 125.302 2.581   -105.103 1.00 0.00 ? 110 GLN A HB3  3  
ATOM 6138  H HG2  . GLN A 1 110 ? 123.520 3.727   -103.884 1.00 0.00 ? 110 GLN A HG2  3  
ATOM 6139  H HG3  . GLN A 1 110 ? 123.802 2.710   -102.471 1.00 0.00 ? 110 GLN A HG3  3  
ATOM 6140  H HE21 . GLN A 1 110 ? 126.839 3.093   -103.625 1.00 0.00 ? 110 GLN A HE21 3  
ATOM 6141  H HE22 . GLN A 1 110 ? 127.303 4.508   -102.810 1.00 0.00 ? 110 GLN A HE22 3  
ATOM 6142  N N    . LYS A 1 111 ? 124.944 -1.002  -105.133 1.00 0.00 ? 111 LYS A N    3  
ATOM 6143  C CA   . LYS A 1 111 ? 125.531 -2.016  -106.053 1.00 0.00 ? 111 LYS A CA   3  
ATOM 6144  C C    . LYS A 1 111 ? 124.420 -2.632  -106.911 1.00 0.00 ? 111 LYS A C    3  
ATOM 6145  O O    . LYS A 1 111 ? 124.680 -3.294  -107.896 1.00 0.00 ? 111 LYS A O    3  
ATOM 6146  C CB   . LYS A 1 111 ? 126.211 -3.116  -105.233 1.00 0.00 ? 111 LYS A CB   3  
ATOM 6147  C CG   . LYS A 1 111 ? 127.077 -3.978  -106.153 1.00 0.00 ? 111 LYS A CG   3  
ATOM 6148  C CD   . LYS A 1 111 ? 127.803 -5.040  -105.323 1.00 0.00 ? 111 LYS A CD   3  
ATOM 6149  C CE   . LYS A 1 111 ? 128.010 -6.296  -106.170 1.00 0.00 ? 111 LYS A CE   3  
ATOM 6150  N NZ   . LYS A 1 111 ? 129.048 -6.032  -107.207 1.00 0.00 ? 111 LYS A NZ   3  
ATOM 6151  H H    . LYS A 1 111 ? 124.945 -1.160  -104.163 1.00 0.00 ? 111 LYS A H    3  
ATOM 6152  H HA   . LYS A 1 111 ? 126.260 -1.543  -106.693 1.00 0.00 ? 111 LYS A HA   3  
ATOM 6153  H HB2  . LYS A 1 111 ? 126.830 -2.666  -104.470 1.00 0.00 ? 111 LYS A HB2  3  
ATOM 6154  H HB3  . LYS A 1 111 ? 125.458 -3.734  -104.766 1.00 0.00 ? 111 LYS A HB3  3  
ATOM 6155  H HG2  . LYS A 1 111 ? 126.449 -4.461  -106.888 1.00 0.00 ? 111 LYS A HG2  3  
ATOM 6156  H HG3  . LYS A 1 111 ? 127.803 -3.355  -106.651 1.00 0.00 ? 111 LYS A HG3  3  
ATOM 6157  H HD2  . LYS A 1 111 ? 128.762 -4.654  -105.008 1.00 0.00 ? 111 LYS A HD2  3  
ATOM 6158  H HD3  . LYS A 1 111 ? 127.211 -5.285  -104.455 1.00 0.00 ? 111 LYS A HD3  3  
ATOM 6159  H HE2  . LYS A 1 111 ? 128.333 -7.109  -105.536 1.00 0.00 ? 111 LYS A HE2  3  
ATOM 6160  H HE3  . LYS A 1 111 ? 127.080 -6.564  -106.651 1.00 0.00 ? 111 LYS A HE3  3  
ATOM 6161  H HZ1  . LYS A 1 111 ? 129.829 -6.708  -107.096 1.00 0.00 ? 111 LYS A HZ1  3  
ATOM 6162  H HZ2  . LYS A 1 111 ? 129.408 -5.062  -107.096 1.00 0.00 ? 111 LYS A HZ2  3  
ATOM 6163  H HZ3  . LYS A 1 111 ? 128.630 -6.141  -108.151 1.00 0.00 ? 111 LYS A HZ3  3  
ATOM 6164  N N    . MET A 1 112 ? 123.182 -2.417  -106.547 1.00 0.00 ? 112 MET A N    3  
ATOM 6165  C CA   . MET A 1 112 ? 122.059 -2.988  -107.347 1.00 0.00 ? 112 MET A CA   3  
ATOM 6166  C C    . MET A 1 112 ? 121.026 -1.896  -107.636 1.00 0.00 ? 112 MET A C    3  
ATOM 6167  O O    . MET A 1 112 ? 119.927 -1.920  -107.120 1.00 0.00 ? 112 MET A O    3  
ATOM 6168  C CB   . MET A 1 112 ? 121.389 -4.123  -106.563 1.00 0.00 ? 112 MET A CB   3  
ATOM 6169  C CG   . MET A 1 112 ? 121.071 -3.648  -105.144 1.00 0.00 ? 112 MET A CG   3  
ATOM 6170  S SD   . MET A 1 112 ? 120.486 -5.049  -104.158 1.00 0.00 ? 112 MET A SD   3  
ATOM 6171  C CE   . MET A 1 112 ? 118.730 -4.613  -104.164 1.00 0.00 ? 112 MET A CE   3  
ATOM 6172  H H    . MET A 1 112 ? 122.993 -1.878  -105.751 1.00 0.00 ? 112 MET A H    3  
ATOM 6173  H HA   . MET A 1 112 ? 122.442 -3.375  -108.281 1.00 0.00 ? 112 MET A HA   3  
ATOM 6174  H HB2  . MET A 1 112 ? 120.474 -4.410  -107.059 1.00 0.00 ? 112 MET A HB2  3  
ATOM 6175  H HB3  . MET A 1 112 ? 122.056 -4.970  -106.514 1.00 0.00 ? 112 MET A HB3  3  
ATOM 6176  H HG2  . MET A 1 112 ? 121.961 -3.241  -104.694 1.00 0.00 ? 112 MET A HG2  3  
ATOM 6177  H HG3  . MET A 1 112 ? 120.304 -2.888  -105.181 1.00 0.00 ? 112 MET A HG3  3  
ATOM 6178  H HE1  . MET A 1 112 ? 118.209 -5.215  -103.433 1.00 0.00 ? 112 MET A HE1  3  
ATOM 6179  H HE2  . MET A 1 112 ? 118.316 -4.799  -105.142 1.00 0.00 ? 112 MET A HE2  3  
ATOM 6180  H HE3  . MET A 1 112 ? 118.620 -3.565  -103.922 1.00 0.00 ? 112 MET A HE3  3  
ATOM 6181  N N    . PRO A 1 113 ? 121.379 -0.946  -108.459 1.00 0.00 ? 113 PRO A N    3  
ATOM 6182  C CA   . PRO A 1 113 ? 120.454 0.164   -108.814 1.00 0.00 ? 113 PRO A CA   3  
ATOM 6183  C C    . PRO A 1 113 ? 119.275 -0.318  -109.664 1.00 0.00 ? 113 PRO A C    3  
ATOM 6184  O O    . PRO A 1 113 ? 118.134 0.015   -109.411 1.00 0.00 ? 113 PRO A O    3  
ATOM 6185  C CB   . PRO A 1 113 ? 121.353 1.101   -109.622 1.00 0.00 ? 113 PRO A CB   3  
ATOM 6186  C CG   . PRO A 1 113 ? 122.713 0.422   -109.839 1.00 0.00 ? 113 PRO A CG   3  
ATOM 6187  C CD   . PRO A 1 113 ? 122.721 -0.916  -109.091 1.00 0.00 ? 113 PRO A CD   3  
ATOM 6188  H HA   . PRO A 1 113 ? 120.105 0.668   -107.928 1.00 0.00 ? 113 PRO A HA   3  
ATOM 6189  H HB2  . PRO A 1 113 ? 120.893 1.308   -110.578 1.00 0.00 ? 113 PRO A HB2  3  
ATOM 6190  H HB3  . PRO A 1 113 ? 121.496 2.024   -109.080 1.00 0.00 ? 113 PRO A HB3  3  
ATOM 6191  H HG2  . PRO A 1 113 ? 122.866 0.249   -110.894 1.00 0.00 ? 113 PRO A HG2  3  
ATOM 6192  H HG3  . PRO A 1 113 ? 123.499 1.053   -109.455 1.00 0.00 ? 113 PRO A HG3  3  
ATOM 6193  H HD2  . PRO A 1 113 ? 122.843 -1.739  -109.783 1.00 0.00 ? 113 PRO A HD2  3  
ATOM 6194  H HD3  . PRO A 1 113 ? 123.491 -0.929  -108.337 1.00 0.00 ? 113 PRO A HD3  3  
ATOM 6195  N N    . ASP A 1 114 ? 119.548 -1.102  -110.670 1.00 0.00 ? 114 ASP A N    3  
ATOM 6196  C CA   . ASP A 1 114 ? 118.453 -1.614  -111.541 1.00 0.00 ? 114 ASP A CA   3  
ATOM 6197  C C    . ASP A 1 114 ? 119.024 -2.671  -112.487 1.00 0.00 ? 114 ASP A C    3  
ATOM 6198  O O    . ASP A 1 114 ? 118.350 -3.159  -113.371 1.00 0.00 ? 114 ASP A O    3  
ATOM 6199  C CB   . ASP A 1 114 ? 117.867 -0.459  -112.358 1.00 0.00 ? 114 ASP A CB   3  
ATOM 6200  C CG   . ASP A 1 114 ? 118.876 -0.024  -113.422 1.00 0.00 ? 114 ASP A CG   3  
ATOM 6201  O OD1  . ASP A 1 114 ? 119.942 -0.615  -113.478 1.00 0.00 ? 114 ASP A OD1  3  
ATOM 6202  O OD2  . ASP A 1 114 ? 118.566 0.894   -114.164 1.00 0.00 ? 114 ASP A OD2  3  
ATOM 6203  H H    . ASP A 1 114 ? 120.476 -1.358  -110.852 1.00 0.00 ? 114 ASP A H    3  
ATOM 6204  H HA   . ASP A 1 114 ? 117.680 -2.054  -110.930 1.00 0.00 ? 114 ASP A HA   3  
ATOM 6205  H HB2  . ASP A 1 114 ? 116.955 -0.785  -112.837 1.00 0.00 ? 114 ASP A HB2  3  
ATOM 6206  H HB3  . ASP A 1 114 ? 117.654 0.373   -111.704 1.00 0.00 ? 114 ASP A HB3  3  
ATOM 6207  N N    . LEU A 1 115 ? 120.266 -3.027  -112.303 1.00 0.00 ? 115 LEU A N    3  
ATOM 6208  C CA   . LEU A 1 115 ? 120.890 -4.052  -113.185 1.00 0.00 ? 115 LEU A CA   3  
ATOM 6209  C C    . LEU A 1 115 ? 119.927 -5.225  -113.368 1.00 0.00 ? 115 LEU A C    3  
ATOM 6210  O O    . LEU A 1 115 ? 119.196 -5.295  -114.335 1.00 0.00 ? 115 LEU A O    3  
ATOM 6211  C CB   . LEU A 1 115 ? 122.187 -4.552  -112.544 1.00 0.00 ? 115 LEU A CB   3  
ATOM 6212  C CG   . LEU A 1 115 ? 123.381 -3.846  -113.188 1.00 0.00 ? 115 LEU A CG   3  
ATOM 6213  C CD1  . LEU A 1 115 ? 123.541 -4.328  -114.631 1.00 0.00 ? 115 LEU A CD1  3  
ATOM 6214  C CD2  . LEU A 1 115 ? 123.143 -2.334  -113.181 1.00 0.00 ? 115 LEU A CD2  3  
ATOM 6215  H H    . LEU A 1 115 ? 120.790 -2.618  -111.582 1.00 0.00 ? 115 LEU A H    3  
ATOM 6216  H HA   . LEU A 1 115 ? 121.111 -3.613  -114.147 1.00 0.00 ? 115 LEU A HA   3  
ATOM 6217  H HB2  . LEU A 1 115 ? 122.170 -4.337  -111.485 1.00 0.00 ? 115 LEU A HB2  3  
ATOM 6218  H HB3  . LEU A 1 115 ? 122.277 -5.616  -112.694 1.00 0.00 ? 115 LEU A HB3  3  
ATOM 6219  H HG   . LEU A 1 115 ? 124.278 -4.075  -112.631 1.00 0.00 ? 115 LEU A HG   3  
ATOM 6220  H HD11 . LEU A 1 115 ? 124.586 -4.315  -114.901 1.00 0.00 ? 115 LEU A HD11 3  
ATOM 6221  H HD12 . LEU A 1 115 ? 122.990 -3.675  -115.291 1.00 0.00 ? 115 LEU A HD12 3  
ATOM 6222  H HD13 . LEU A 1 115 ? 123.158 -5.335  -114.719 1.00 0.00 ? 115 LEU A HD13 3  
ATOM 6223  H HD21 . LEU A 1 115 ? 122.696 -2.035  -114.117 1.00 0.00 ? 115 LEU A HD21 3  
ATOM 6224  H HD22 . LEU A 1 115 ? 124.086 -1.823  -113.052 1.00 0.00 ? 115 LEU A HD22 3  
ATOM 6225  H HD23 . LEU A 1 115 ? 122.481 -2.078  -112.368 1.00 0.00 ? 115 LEU A HD23 3  
ATOM 6226  N N    . ASN A 1 116 ? 119.920 -6.150  -112.447 1.00 0.00 ? 116 ASN A N    3  
ATOM 6227  C CA   . ASN A 1 116 ? 119.004 -7.316  -112.572 1.00 0.00 ? 116 ASN A CA   3  
ATOM 6228  C C    . ASN A 1 116 ? 118.631 -7.828  -111.181 1.00 0.00 ? 116 ASN A C    3  
ATOM 6229  O O    . ASN A 1 116 ? 117.731 -8.630  -111.026 1.00 0.00 ? 116 ASN A O    3  
ATOM 6230  C CB   . ASN A 1 116 ? 119.702 -8.430  -113.356 1.00 0.00 ? 116 ASN A CB   3  
ATOM 6231  C CG   . ASN A 1 116 ? 120.560 -9.265  -112.403 1.00 0.00 ? 116 ASN A CG   3  
ATOM 6232  O OD1  . ASN A 1 116 ? 120.840 -10.417 -112.669 1.00 0.00 ? 116 ASN A OD1  3  
ATOM 6233  N ND2  . ASN A 1 116 ? 120.993 -8.729  -111.295 1.00 0.00 ? 116 ASN A ND2  3  
ATOM 6234  H H    . ASN A 1 116 ? 120.519 -6.076  -111.674 1.00 0.00 ? 116 ASN A H    3  
ATOM 6235  H HA   . ASN A 1 116 ? 118.109 -7.016  -113.097 1.00 0.00 ? 116 ASN A HA   3  
ATOM 6236  H HB2  . ASN A 1 116 ? 118.959 -9.063  -113.820 1.00 0.00 ? 116 ASN A HB2  3  
ATOM 6237  H HB3  . ASN A 1 116 ? 120.332 -7.996  -114.117 1.00 0.00 ? 116 ASN A HB3  3  
ATOM 6238  H HD21 . ASN A 1 116 ? 120.768 -7.799  -111.080 1.00 0.00 ? 116 ASN A HD21 3  
ATOM 6239  H HD22 . ASN A 1 116 ? 121.543 -9.254  -110.678 1.00 0.00 ? 116 ASN A HD22 3  
ATOM 6240  N N    . THR A 1 117 ? 119.313 -7.376  -110.164 1.00 0.00 ? 117 THR A N    3  
ATOM 6241  C CA   . THR A 1 117 ? 118.988 -7.845  -108.787 1.00 0.00 ? 117 THR A CA   3  
ATOM 6242  C C    . THR A 1 117 ? 117.742 -7.122  -108.278 1.00 0.00 ? 117 THR A C    3  
ATOM 6243  O O    . THR A 1 117 ? 116.998 -6.536  -109.038 1.00 0.00 ? 117 THR A O    3  
ATOM 6244  C CB   . THR A 1 117 ? 120.156 -7.567  -107.843 1.00 0.00 ? 117 THR A CB   3  
ATOM 6245  O OG1  . THR A 1 117 ? 121.347 -8.118  -108.387 1.00 0.00 ? 117 THR A OG1  3  
ATOM 6246  C CG2  . THR A 1 117 ? 119.861 -8.211  -106.488 1.00 0.00 ? 117 THR A CG2  3  
ATOM 6247  H H    . THR A 1 117 ? 120.037 -6.729  -110.305 1.00 0.00 ? 117 THR A H    3  
ATOM 6248  H HA   . THR A 1 117 ? 118.796 -8.908  -108.812 1.00 0.00 ? 117 THR A HA   3  
ATOM 6249  H HB   . THR A 1 117 ? 120.273 -6.502  -107.714 1.00 0.00 ? 117 THR A HB   3  
ATOM 6250  H HG1  . THR A 1 117 ? 121.119 -8.936  -108.834 1.00 0.00 ? 117 THR A HG1  3  
ATOM 6251  H HG21 . THR A 1 117 ? 119.559 -7.449  -105.785 1.00 0.00 ? 117 THR A HG21 3  
ATOM 6252  H HG22 . THR A 1 117 ? 120.746 -8.708  -106.124 1.00 0.00 ? 117 THR A HG22 3  
ATOM 6253  H HG23 . THR A 1 117 ? 119.063 -8.933  -106.599 1.00 0.00 ? 117 THR A HG23 3  
ATOM 6254  N N    . THR A 1 118 ? 117.496 -7.177  -106.997 1.00 0.00 ? 118 THR A N    3  
ATOM 6255  C CA   . THR A 1 118 ? 116.287 -6.513  -106.446 1.00 0.00 ? 118 THR A CA   3  
ATOM 6256  C C    . THR A 1 118 ? 116.212 -6.755  -104.936 1.00 0.00 ? 118 THR A C    3  
ATOM 6257  O O    . THR A 1 118 ? 116.159 -5.833  -104.147 1.00 0.00 ? 118 THR A O    3  
ATOM 6258  C CB   . THR A 1 118 ? 115.063 -7.130  -107.114 1.00 0.00 ? 118 THR A CB   3  
ATOM 6259  O OG1  . THR A 1 118 ? 113.977 -7.146  -106.197 1.00 0.00 ? 118 THR A OG1  3  
ATOM 6260  C CG2  . THR A 1 118 ? 115.410 -8.561  -107.533 1.00 0.00 ? 118 THR A CG2  3  
ATOM 6261  H H    . THR A 1 118 ? 118.097 -7.668  -106.402 1.00 0.00 ? 118 THR A H    3  
ATOM 6262  H HA   . THR A 1 118 ? 116.320 -5.453  -106.650 1.00 0.00 ? 118 THR A HA   3  
ATOM 6263  H HB   . THR A 1 118 ? 114.796 -6.557  -107.987 1.00 0.00 ? 118 THR A HB   3  
ATOM 6264  H HG1  . THR A 1 118 ? 113.355 -7.818  -106.486 1.00 0.00 ? 118 THR A HG1  3  
ATOM 6265  H HG21 . THR A 1 118 ? 114.526 -9.175  -107.487 1.00 0.00 ? 118 THR A HG21 3  
ATOM 6266  H HG22 . THR A 1 118 ? 116.160 -8.959  -106.862 1.00 0.00 ? 118 THR A HG22 3  
ATOM 6267  H HG23 . THR A 1 118 ? 115.798 -8.557  -108.541 1.00 0.00 ? 118 THR A HG23 3  
ATOM 6268  N N    . ASP A 1 119 ? 116.198 -7.996  -104.536 1.00 0.00 ? 119 ASP A N    3  
ATOM 6269  C CA   . ASP A 1 119 ? 116.116 -8.321  -103.083 1.00 0.00 ? 119 ASP A CA   3  
ATOM 6270  C C    . ASP A 1 119 ? 117.355 -7.795  -102.359 1.00 0.00 ? 119 ASP A C    3  
ATOM 6271  O O    . ASP A 1 119 ? 118.472 -8.009  -102.786 1.00 0.00 ? 119 ASP A O    3  
ATOM 6272  C CB   . ASP A 1 119 ? 116.045 -9.840  -102.913 1.00 0.00 ? 119 ASP A CB   3  
ATOM 6273  C CG   . ASP A 1 119 ? 116.911 -10.514 -103.977 1.00 0.00 ? 119 ASP A CG   3  
ATOM 6274  O OD1  . ASP A 1 119 ? 117.601 -9.802  -104.689 1.00 0.00 ? 119 ASP A OD1  3  
ATOM 6275  O OD2  . ASP A 1 119 ? 116.870 -11.730 -104.064 1.00 0.00 ? 119 ASP A OD2  3  
ATOM 6276  H H    . ASP A 1 119 ? 116.235 -8.721  -105.194 1.00 0.00 ? 119 ASP A H    3  
ATOM 6277  H HA   . ASP A 1 119 ? 115.232 -7.870  -102.662 1.00 0.00 ? 119 ASP A HA   3  
ATOM 6278  H HB2  . ASP A 1 119 ? 116.404 -10.109 -101.930 1.00 0.00 ? 119 ASP A HB2  3  
ATOM 6279  H HB3  . ASP A 1 119 ? 115.025 -10.168 -103.025 1.00 0.00 ? 119 ASP A HB3  3  
ATOM 6280  N N    . LEU A 1 120 ? 117.170 -7.121  -101.256 1.00 0.00 ? 120 LEU A N    3  
ATOM 6281  C CA   . LEU A 1 120 ? 118.344 -6.605  -100.503 1.00 0.00 ? 120 LEU A CA   3  
ATOM 6282  C C    . LEU A 1 120 ? 119.118 -7.794  -99.940  1.00 0.00 ? 120 LEU A C    3  
ATOM 6283  O O    . LEU A 1 120 ? 120.318 -7.766  -99.764  1.00 0.00 ? 120 LEU A O    3  
ATOM 6284  C CB   . LEU A 1 120 ? 117.863 -5.727  -99.346  1.00 0.00 ? 120 LEU A CB   3  
ATOM 6285  C CG   . LEU A 1 120 ? 118.545 -4.359  -99.452  1.00 0.00 ? 120 LEU A CG   3  
ATOM 6286  C CD1  . LEU A 1 120 ? 118.377 -3.590  -98.141  1.00 0.00 ? 120 LEU A CD1  3  
ATOM 6287  C CD2  . LEU A 1 120 ? 120.038 -4.557  -99.744  1.00 0.00 ? 120 LEU A CD2  3  
ATOM 6288  H H    . LEU A 1 120 ? 116.263 -6.968  -100.919 1.00 0.00 ? 120 LEU A H    3  
ATOM 6289  H HA   . LEU A 1 120 ? 118.942 -5.992  -101.162 1.00 0.00 ? 120 LEU A HA   3  
ATOM 6290  H HB2  . LEU A 1 120 ? 116.789 -5.606  -99.405  1.00 0.00 ? 120 LEU A HB2  3  
ATOM 6291  H HB3  . LEU A 1 120 ? 118.125 -6.189  -98.406  1.00 0.00 ? 120 LEU A HB3  3  
ATOM 6292  H HG   . LEU A 1 120 ? 118.093 -3.796  -100.256 1.00 0.00 ? 120 LEU A HG   3  
ATOM 6293  H HD11 . LEU A 1 120 ? 118.213 -4.287  -97.332  1.00 0.00 ? 120 LEU A HD11 3  
ATOM 6294  H HD12 . LEU A 1 120 ? 117.530 -2.924  -98.220  1.00 0.00 ? 120 LEU A HD12 3  
ATOM 6295  H HD13 . LEU A 1 120 ? 119.269 -3.015  -97.945  1.00 0.00 ? 120 LEU A HD13 3  
ATOM 6296  H HD21 . LEU A 1 120 ? 120.227 -4.385  -100.795 1.00 0.00 ? 120 LEU A HD21 3  
ATOM 6297  H HD22 . LEU A 1 120 ? 120.324 -5.567  -99.490  1.00 0.00 ? 120 LEU A HD22 3  
ATOM 6298  H HD23 . LEU A 1 120 ? 120.616 -3.861  -99.157  1.00 0.00 ? 120 LEU A HD23 3  
ATOM 6299  N N    . GLU A 1 121 ? 118.396 -8.853  -99.689  1.00 0.00 ? 121 GLU A N    3  
ATOM 6300  C CA   . GLU A 1 121 ? 118.990 -10.113 -99.163  1.00 0.00 ? 121 GLU A CA   3  
ATOM 6301  C C    . GLU A 1 121 ? 119.943 -10.699 -100.195 1.00 0.00 ? 121 GLU A C    3  
ATOM 6302  O O    . GLU A 1 121 ? 120.962 -11.266 -99.848  1.00 0.00 ? 121 GLU A O    3  
ATOM 6303  C CB   . GLU A 1 121 ? 117.864 -11.117 -98.907  1.00 0.00 ? 121 GLU A CB   3  
ATOM 6304  C CG   . GLU A 1 121 ? 118.340 -12.177 -97.912  1.00 0.00 ? 121 GLU A CG   3  
ATOM 6305  C CD   . GLU A 1 121 ? 117.203 -13.160 -97.630  1.00 0.00 ? 121 GLU A CD   3  
ATOM 6306  O OE1  . GLU A 1 121 ? 116.135 -12.977 -98.191  1.00 0.00 ? 121 GLU A OE1  3  
ATOM 6307  O OE2  . GLU A 1 121 ? 117.418 -14.078 -96.856  1.00 0.00 ? 121 GLU A OE2  3  
ATOM 6308  H H    . GLU A 1 121 ? 117.438 -8.824  -99.891  1.00 0.00 ? 121 GLU A H    3  
ATOM 6309  H HA   . GLU A 1 121 ? 119.543 -9.970  -98.247  1.00 0.00 ? 121 GLU A HA   3  
ATOM 6310  H HB2  . GLU A 1 121 ? 117.006 -10.600 -98.502  1.00 0.00 ? 121 GLU A HB2  3  
ATOM 6311  H HB3  . GLU A 1 121 ? 117.590 -11.595 -99.836  1.00 0.00 ? 121 GLU A HB3  3  
ATOM 6312  H HG2  . GLU A 1 121 ? 119.183 -12.709 -98.330  1.00 0.00 ? 121 GLU A HG2  3  
ATOM 6313  H HG3  . GLU A 1 121 ? 118.637 -11.698 -96.991  1.00 0.00 ? 121 GLU A HG3  3  
ATOM 6314  N N    . ALA A 1 122 ? 119.656 -10.560 -101.454 1.00 0.00 ? 122 ALA A N    3  
ATOM 6315  C CA   . ALA A 1 122 ? 120.597 -11.111 -102.457 1.00 0.00 ? 122 ALA A CA   3  
ATOM 6316  C C    . ALA A 1 122 ? 121.858 -10.245 -102.436 1.00 0.00 ? 122 ALA A C    3  
ATOM 6317  O O    . ALA A 1 122 ? 122.869 -10.637 -101.883 1.00 0.00 ? 122 ALA A O    3  
ATOM 6318  C CB   . ALA A 1 122 ? 119.952 -11.092 -103.845 1.00 0.00 ? 122 ALA A CB   3  
ATOM 6319  H H    . ALA A 1 122 ? 118.843 -10.089 -101.734 1.00 0.00 ? 122 ALA A H    3  
ATOM 6320  H HA   . ALA A 1 122 ? 120.845 -12.122 -102.169 1.00 0.00 ? 122 ALA A HA   3  
ATOM 6321  H HB1  . ALA A 1 122 ? 120.643 -11.496 -104.569 1.00 0.00 ? 122 ALA A HB1  3  
ATOM 6322  H HB2  . ALA A 1 122 ? 119.703 -10.076 -104.112 1.00 0.00 ? 122 ALA A HB2  3  
ATOM 6323  H HB3  . ALA A 1 122 ? 119.054 -11.691 -103.832 1.00 0.00 ? 122 ALA A HB3  3  
ATOM 6324  N N    . ALA A 1 123 ? 121.829 -9.073  -103.009 1.00 0.00 ? 123 ALA A N    3  
ATOM 6325  C CA   . ALA A 1 123 ? 123.050 -8.222  -102.979 1.00 0.00 ? 123 ALA A CA   3  
ATOM 6326  C C    . ALA A 1 123 ? 123.636 -8.225  -101.563 1.00 0.00 ? 123 ALA A C    3  
ATOM 6327  O O    . ALA A 1 123 ? 124.834 -8.320  -101.378 1.00 0.00 ? 123 ALA A O    3  
ATOM 6328  C CB   . ALA A 1 123 ? 122.683 -6.794  -103.381 1.00 0.00 ? 123 ALA A CB   3  
ATOM 6329  H H    . ALA A 1 123 ? 121.024 -8.745  -103.461 1.00 0.00 ? 123 ALA A H    3  
ATOM 6330  H HA   . ALA A 1 123 ? 123.780 -8.615  -103.671 1.00 0.00 ? 123 ALA A HA   3  
ATOM 6331  H HB1  . ALA A 1 123 ? 122.233 -6.803  -104.364 1.00 0.00 ? 123 ALA A HB1  3  
ATOM 6332  H HB2  . ALA A 1 123 ? 123.573 -6.184  -103.399 1.00 0.00 ? 123 ALA A HB2  3  
ATOM 6333  H HB3  . ALA A 1 123 ? 121.981 -6.388  -102.668 1.00 0.00 ? 123 ALA A HB3  3  
ATOM 6334  N N    . ALA A 1 124 ? 122.801 -8.130  -100.557 1.00 0.00 ? 124 ALA A N    3  
ATOM 6335  C CA   . ALA A 1 124 ? 123.325 -8.139  -99.158  1.00 0.00 ? 124 ALA A CA   3  
ATOM 6336  C C    . ALA A 1 124 ? 124.263 -9.330  -98.992  1.00 0.00 ? 124 ALA A C    3  
ATOM 6337  O O    . ALA A 1 124 ? 125.459 -9.173  -98.846  1.00 0.00 ? 124 ALA A O    3  
ATOM 6338  C CB   . ALA A 1 124 ? 122.166 -8.263  -98.166  1.00 0.00 ? 124 ALA A CB   3  
ATOM 6339  H H    . ALA A 1 124 ? 121.839 -8.060  -100.722 1.00 0.00 ? 124 ALA A H    3  
ATOM 6340  H HA   . ALA A 1 124 ? 123.866 -7.223  -98.970  1.00 0.00 ? 124 ALA A HA   3  
ATOM 6341  H HB1  . ALA A 1 124 ? 121.631 -7.327  -98.116  1.00 0.00 ? 124 ALA A HB1  3  
ATOM 6342  H HB2  . ALA A 1 124 ? 122.556 -8.508  -97.189  1.00 0.00 ? 124 ALA A HB2  3  
ATOM 6343  H HB3  . ALA A 1 124 ? 121.496 -9.046  -98.491  1.00 0.00 ? 124 ALA A HB3  3  
ATOM 6344  N N    . ARG A 1 125 ? 123.733 -10.524 -99.011  1.00 0.00 ? 125 ARG A N    3  
ATOM 6345  C CA   . ARG A 1 125 ? 124.611 -11.713 -98.851  1.00 0.00 ? 125 ARG A CA   3  
ATOM 6346  C C    . ARG A 1 125 ? 125.853 -11.496 -99.710  1.00 0.00 ? 125 ARG A C    3  
ATOM 6347  O O    . ARG A 1 125 ? 126.957 -11.807 -99.316  1.00 0.00 ? 125 ARG A O    3  
ATOM 6348  C CB   . ARG A 1 125 ? 123.870 -12.968 -99.320  1.00 0.00 ? 125 ARG A CB   3  
ATOM 6349  C CG   . ARG A 1 125 ? 124.157 -14.124 -98.358  1.00 0.00 ? 125 ARG A CG   3  
ATOM 6350  C CD   . ARG A 1 125 ? 125.575 -14.645 -98.597  1.00 0.00 ? 125 ARG A CD   3  
ATOM 6351  N NE   . ARG A 1 125 ? 125.509 -16.022 -99.163  1.00 0.00 ? 125 ARG A NE   3  
ATOM 6352  C CZ   . ARG A 1 125 ? 126.564 -16.549 -99.721  1.00 0.00 ? 125 ARG A CZ   3  
ATOM 6353  N NH1  . ARG A 1 125 ? 127.678 -15.871 -99.784  1.00 0.00 ? 125 ARG A NH1  3  
ATOM 6354  N NH2  . ARG A 1 125 ? 126.507 -17.755 -100.217 1.00 0.00 ? 125 ARG A NH2  3  
ATOM 6355  H H    . ARG A 1 125 ? 122.763 -10.631 -99.115  1.00 0.00 ? 125 ARG A H    3  
ATOM 6356  H HA   . ARG A 1 125 ? 124.896 -11.820 -97.815  1.00 0.00 ? 125 ARG A HA   3  
ATOM 6357  H HB2  . ARG A 1 125 ? 122.808 -12.772 -99.340  1.00 0.00 ? 125 ARG A HB2  3  
ATOM 6358  H HB3  . ARG A 1 125 ? 124.205 -13.236 -100.311 1.00 0.00 ? 125 ARG A HB3  3  
ATOM 6359  H HG2  . ARG A 1 125 ? 124.065 -13.776 -97.340  1.00 0.00 ? 125 ARG A HG2  3  
ATOM 6360  H HG3  . ARG A 1 125 ? 123.449 -14.920 -98.532  1.00 0.00 ? 125 ARG A HG3  3  
ATOM 6361  H HD2  . ARG A 1 125 ? 126.087 -13.995 -99.289  1.00 0.00 ? 125 ARG A HD2  3  
ATOM 6362  H HD3  . ARG A 1 125 ? 126.113 -14.668 -97.660  1.00 0.00 ? 125 ARG A HD3  3  
ATOM 6363  H HE   . ARG A 1 125 ? 124.673 -16.531 -99.118  1.00 0.00 ? 125 ARG A HE   3  
ATOM 6364  H HH11 . ARG A 1 125 ? 127.722 -14.947 -99.404  1.00 0.00 ? 125 ARG A HH11 3  
ATOM 6365  H HH12 . ARG A 1 125 ? 128.487 -16.275 -100.211 1.00 0.00 ? 125 ARG A HH12 3  
ATOM 6366  H HH21 . ARG A 1 125 ? 125.654 -18.275 -100.170 1.00 0.00 ? 125 ARG A HH21 3  
ATOM 6367  H HH22 . ARG A 1 125 ? 127.316 -18.159 -100.646 1.00 0.00 ? 125 ARG A HH22 3  
ATOM 6368  N N    . MET A 1 126 ? 125.683 -10.928 -100.869 1.00 0.00 ? 126 MET A N    3  
ATOM 6369  C CA   . MET A 1 126 ? 126.858 -10.653 -101.737 1.00 0.00 ? 126 MET A CA   3  
ATOM 6370  C C    . MET A 1 126 ? 127.884 -9.850  -100.932 1.00 0.00 ? 126 MET A C    3  
ATOM 6371  O O    . MET A 1 126 ? 128.849 -10.383 -100.428 1.00 0.00 ? 126 MET A O    3  
ATOM 6372  C CB   . MET A 1 126 ? 126.407 -9.828  -102.945 1.00 0.00 ? 126 MET A CB   3  
ATOM 6373  C CG   . MET A 1 126 ? 127.243 -10.214 -104.167 1.00 0.00 ? 126 MET A CG   3  
ATOM 6374  S SD   . MET A 1 126 ? 126.732 -11.848 -104.754 1.00 0.00 ? 126 MET A SD   3  
ATOM 6375  C CE   . MET A 1 126 ? 125.166 -11.340 -105.506 1.00 0.00 ? 126 MET A CE   3  
ATOM 6376  H H    . MET A 1 126 ? 124.786 -10.659 -101.159 1.00 0.00 ? 126 MET A H    3  
ATOM 6377  H HA   . MET A 1 126 ? 127.299 -11.577 -102.080 1.00 0.00 ? 126 MET A HA   3  
ATOM 6378  H HB2  . MET A 1 126 ? 125.364 -10.026 -103.144 1.00 0.00 ? 126 MET A HB2  3  
ATOM 6379  H HB3  . MET A 1 126 ? 126.542 -8.778  -102.737 1.00 0.00 ? 126 MET A HB3  3  
ATOM 6380  H HG2  . MET A 1 126 ? 127.092 -9.487  -104.950 1.00 0.00 ? 126 MET A HG2  3  
ATOM 6381  H HG3  . MET A 1 126 ? 128.287 -10.240 -103.895 1.00 0.00 ? 126 MET A HG3  3  
ATOM 6382  H HE1  . MET A 1 126 ? 125.303 -10.398 -106.019 1.00 0.00 ? 126 MET A HE1  3  
ATOM 6383  H HE2  . MET A 1 126 ? 124.418 -11.224 -104.739 1.00 0.00 ? 126 MET A HE2  3  
ATOM 6384  H HE3  . MET A 1 126 ? 124.843 -12.096 -106.209 1.00 0.00 ? 126 MET A HE3  3  
ATOM 6385  N N    . ILE A 1 127 ? 127.661 -8.571  -100.799 1.00 0.00 ? 127 ILE A N    3  
ATOM 6386  C CA   . ILE A 1 127 ? 128.600 -7.706  -100.023 1.00 0.00 ? 127 ILE A CA   3  
ATOM 6387  C C    . ILE A 1 127 ? 128.940 -8.361  -98.683  1.00 0.00 ? 127 ILE A C    3  
ATOM 6388  O O    . ILE A 1 127 ? 130.067 -8.737  -98.424  1.00 0.00 ? 127 ILE A O    3  
ATOM 6389  C CB   . ILE A 1 127 ? 127.913 -6.367  -99.751  1.00 0.00 ? 127 ILE A CB   3  
ATOM 6390  C CG1  . ILE A 1 127 ? 127.665 -5.635  -101.072 1.00 0.00 ? 127 ILE A CG1  3  
ATOM 6391  C CG2  . ILE A 1 127 ? 128.791 -5.508  -98.844  1.00 0.00 ? 127 ILE A CG2  3  
ATOM 6392  C CD1  . ILE A 1 127 ? 128.947 -5.593  -101.894 1.00 0.00 ? 127 ILE A CD1  3  
ATOM 6393  H H    . ILE A 1 127 ? 126.862 -8.175  -101.206 1.00 0.00 ? 127 ILE A H    3  
ATOM 6394  H HA   . ILE A 1 127 ? 129.502 -7.540  -100.588 1.00 0.00 ? 127 ILE A HA   3  
ATOM 6395  H HB   . ILE A 1 127 ? 126.968 -6.549  -99.260  1.00 0.00 ? 127 ILE A HB   3  
ATOM 6396  H HG12 . ILE A 1 127 ? 126.902 -6.154  -101.630 1.00 0.00 ? 127 ILE A HG12 3  
ATOM 6397  H HG13 . ILE A 1 127 ? 127.341 -4.627  -100.867 1.00 0.00 ? 127 ILE A HG13 3  
ATOM 6398  H HG21 . ILE A 1 127 ? 129.677 -5.207  -99.380  1.00 0.00 ? 127 ILE A HG21 3  
ATOM 6399  H HG22 . ILE A 1 127 ? 129.072 -6.074  -97.969  1.00 0.00 ? 127 ILE A HG22 3  
ATOM 6400  H HG23 . ILE A 1 127 ? 128.239 -4.633  -98.542  1.00 0.00 ? 127 ILE A HG23 3  
ATOM 6401  H HD11 . ILE A 1 127 ? 128.904 -4.757  -102.576 1.00 0.00 ? 127 ILE A HD11 3  
ATOM 6402  H HD12 . ILE A 1 127 ? 129.043 -6.511  -102.453 1.00 0.00 ? 127 ILE A HD12 3  
ATOM 6403  H HD13 . ILE A 1 127 ? 129.792 -5.479  -101.234 1.00 0.00 ? 127 ILE A HD13 3  
ATOM 6404  N N    . ALA A 1 128 ? 127.965 -8.498  -97.835  1.00 0.00 ? 128 ALA A N    3  
ATOM 6405  C CA   . ALA A 1 128 ? 128.233 -9.131  -96.514  1.00 0.00 ? 128 ALA A CA   3  
ATOM 6406  C C    . ALA A 1 128 ? 128.809 -10.521 -96.783  1.00 0.00 ? 128 ALA A C    3  
ATOM 6407  O O    . ALA A 1 128 ? 129.972 -10.784 -96.527  1.00 0.00 ? 128 ALA A O    3  
ATOM 6408  C CB   . ALA A 1 128 ? 126.950 -9.224  -95.684  1.00 0.00 ? 128 ALA A CB   3  
ATOM 6409  H H    . ALA A 1 128 ? 127.076 -8.185  -98.109  1.00 0.00 ? 128 ALA A H    3  
ATOM 6410  H HA   . ALA A 1 128 ? 128.984 -8.552  -95.998  1.00 0.00 ? 128 ALA A HA   3  
ATOM 6411  H HB1  . ALA A 1 128 ? 127.166 -8.965  -94.658  1.00 0.00 ? 128 ALA A HB1  3  
ATOM 6412  H HB2  . ALA A 1 128 ? 126.568 -10.234 -95.727  1.00 0.00 ? 128 ALA A HB2  3  
ATOM 6413  H HB3  . ALA A 1 128 ? 126.214 -8.543  -96.082  1.00 0.00 ? 128 ALA A HB3  3  
ATOM 6414  N N    . GLY A 1 129 ? 128.013 -11.417 -97.277  1.00 0.00 ? 129 GLY A N    3  
ATOM 6415  C CA   . GLY A 1 129 ? 128.535 -12.784 -97.537  1.00 0.00 ? 129 GLY A CA   3  
ATOM 6416  C C    . GLY A 1 129 ? 129.930 -12.672 -98.165  1.00 0.00 ? 129 GLY A C    3  
ATOM 6417  O O    . GLY A 1 129 ? 130.820 -13.435 -97.846  1.00 0.00 ? 129 GLY A O    3  
ATOM 6418  H H    . GLY A 1 129 ? 127.068 -11.201 -97.425  1.00 0.00 ? 129 GLY A H    3  
ATOM 6419  H HA2  . GLY A 1 129 ? 128.599 -13.329 -96.605  1.00 0.00 ? 129 GLY A HA2  3  
ATOM 6420  H HA3  . GLY A 1 129 ? 127.879 -13.305 -98.215  1.00 0.00 ? 129 GLY A HA3  3  
ATOM 6421  N N    . SER A 1 130 ? 130.156 -11.708 -99.024  1.00 0.00 ? 130 SER A N    3  
ATOM 6422  C CA   . SER A 1 130 ? 131.523 -11.563 -99.600  1.00 0.00 ? 130 SER A CA   3  
ATOM 6423  C C    . SER A 1 130 ? 132.495 -11.392 -98.435  1.00 0.00 ? 130 SER A C    3  
ATOM 6424  O O    . SER A 1 130 ? 133.453 -12.127 -98.296  1.00 0.00 ? 130 SER A O    3  
ATOM 6425  C CB   . SER A 1 130 ? 131.600 -10.329 -100.503 1.00 0.00 ? 130 SER A CB   3  
ATOM 6426  O OG   . SER A 1 130 ? 131.796 -9.172  -99.698  1.00 0.00 ? 130 SER A OG   3  
ATOM 6427  H H    . SER A 1 130 ? 129.449 -11.075 -99.269  1.00 0.00 ? 130 SER A H    3  
ATOM 6428  H HA   . SER A 1 130 ? 131.779 -12.449 -100.164 1.00 0.00 ? 130 SER A HA   3  
ATOM 6429  H HB2  . SER A 1 130 ? 132.430 -10.429 -101.182 1.00 0.00 ? 130 SER A HB2  3  
ATOM 6430  H HB3  . SER A 1 130 ? 130.688 -10.235 -101.069 1.00 0.00 ? 130 SER A HB3  3  
ATOM 6431  H HG   . SER A 1 130 ? 132.514 -9.354  -99.088  1.00 0.00 ? 130 SER A HG   3  
ATOM 6432  N N    . ALA A 1 131 ? 132.234 -10.439 -97.577  1.00 0.00 ? 131 ALA A N    3  
ATOM 6433  C CA   . ALA A 1 131 ? 133.123 -10.242 -96.402  1.00 0.00 ? 131 ALA A CA   3  
ATOM 6434  C C    . ALA A 1 131 ? 133.405 -11.615 -95.806  1.00 0.00 ? 131 ALA A C    3  
ATOM 6435  O O    . ALA A 1 131 ? 134.540 -11.998 -95.609  1.00 0.00 ? 131 ALA A O    3  
ATOM 6436  C CB   . ALA A 1 131 ? 132.421 -9.359  -95.370  1.00 0.00 ? 131 ALA A CB   3  
ATOM 6437  H H    . ALA A 1 131 ? 131.445 -9.871  -97.696  1.00 0.00 ? 131 ALA A H    3  
ATOM 6438  H HA   . ALA A 1 131 ? 134.052 -9.782  -96.714  1.00 0.00 ? 131 ALA A HA   3  
ATOM 6439  H HB1  . ALA A 1 131 ? 131.534 -8.928  -95.813  1.00 0.00 ? 131 ALA A HB1  3  
ATOM 6440  H HB2  . ALA A 1 131 ? 133.087 -8.569  -95.058  1.00 0.00 ? 131 ALA A HB2  3  
ATOM 6441  H HB3  . ALA A 1 131 ? 132.142 -9.956  -94.515  1.00 0.00 ? 131 ALA A HB3  3  
ATOM 6442  N N    . ARG A 1 132 ? 132.376 -12.388 -95.567  1.00 0.00 ? 132 ARG A N    3  
ATOM 6443  C CA   . ARG A 1 132 ? 132.609 -13.759 -95.042  1.00 0.00 ? 132 ARG A CA   3  
ATOM 6444  C C    . ARG A 1 132 ? 133.732 -14.368 -95.873  1.00 0.00 ? 132 ARG A C    3  
ATOM 6445  O O    . ARG A 1 132 ? 134.753 -14.769 -95.349  1.00 0.00 ? 132 ARG A O    3  
ATOM 6446  C CB   . ARG A 1 132 ? 131.339 -14.604 -95.179  1.00 0.00 ? 132 ARG A CB   3  
ATOM 6447  C CG   . ARG A 1 132 ? 131.611 -16.020 -94.668  1.00 0.00 ? 132 ARG A CG   3  
ATOM 6448  C CD   . ARG A 1 132 ? 132.417 -16.795 -95.712  1.00 0.00 ? 132 ARG A CD   3  
ATOM 6449  N NE   . ARG A 1 132 ? 131.818 -18.149 -95.908  1.00 0.00 ? 132 ARG A NE   3  
ATOM 6450  C CZ   . ARG A 1 132 ? 131.386 -18.840 -94.886  1.00 0.00 ? 132 ARG A CZ   3  
ATOM 6451  N NH1  . ARG A 1 132 ? 131.527 -18.380 -93.672  1.00 0.00 ? 132 ARG A NH1  3  
ATOM 6452  N NH2  . ARG A 1 132 ? 130.826 -20.004 -95.078  1.00 0.00 ? 132 ARG A NH2  3  
ATOM 6453  H H    . ARG A 1 132 ? 131.467 -12.078 -95.773  1.00 0.00 ? 132 ARG A H    3  
ATOM 6454  H HA   . ARG A 1 132 ? 132.930 -13.739 -94.009  1.00 0.00 ? 132 ARG A HA   3  
ATOM 6455  H HB2  . ARG A 1 132 ? 130.545 -14.156 -94.598  1.00 0.00 ? 132 ARG A HB2  3  
ATOM 6456  H HB3  . ARG A 1 132 ? 131.044 -14.649 -96.214  1.00 0.00 ? 132 ARG A HB3  3  
ATOM 6457  H HG2  . ARG A 1 132 ? 132.172 -15.966 -93.745  1.00 0.00 ? 132 ARG A HG2  3  
ATOM 6458  H HG3  . ARG A 1 132 ? 130.673 -16.524 -94.491  1.00 0.00 ? 132 ARG A HG3  3  
ATOM 6459  H HD2  . ARG A 1 132 ? 132.393 -16.264 -96.651  1.00 0.00 ? 132 ARG A HD2  3  
ATOM 6460  H HD3  . ARG A 1 132 ? 133.442 -16.888 -95.380  1.00 0.00 ? 132 ARG A HD3  3  
ATOM 6461  H HE   . ARG A 1 132 ? 131.732 -18.516 -96.812  1.00 0.00 ? 132 ARG A HE   3  
ATOM 6462  H HH11 . ARG A 1 132 ? 131.968 -17.497 -93.520  1.00 0.00 ? 132 ARG A HH11 3  
ATOM 6463  H HH12 . ARG A 1 132 ? 131.193 -18.912 -92.895  1.00 0.00 ? 132 ARG A HH12 3  
ATOM 6464  H HH21 . ARG A 1 132 ? 130.729 -20.364 -96.006  1.00 0.00 ? 132 ARG A HH21 3  
ATOM 6465  H HH22 . ARG A 1 132 ? 130.494 -20.534 -94.297  1.00 0.00 ? 132 ARG A HH22 3  
ATOM 6466  N N    . SER A 1 133 ? 133.587 -14.397 -97.170  1.00 0.00 ? 133 SER A N    3  
ATOM 6467  C CA   . SER A 1 133 ? 134.694 -14.928 -98.003  1.00 0.00 ? 133 SER A CA   3  
ATOM 6468  C C    . SER A 1 133 ? 135.981 -14.318 -97.457  1.00 0.00 ? 133 SER A C    3  
ATOM 6469  O O    . SER A 1 133 ? 136.812 -14.988 -96.878  1.00 0.00 ? 133 SER A O    3  
ATOM 6470  C CB   . SER A 1 133 ? 134.494 -14.491 -99.456  1.00 0.00 ? 133 SER A CB   3  
ATOM 6471  O OG   . SER A 1 133 ? 135.354 -15.248 -100.297 1.00 0.00 ? 133 SER A OG   3  
ATOM 6472  H H    . SER A 1 133 ? 132.775 -14.034 -97.588  1.00 0.00 ? 133 SER A H    3  
ATOM 6473  H HA   . SER A 1 133 ? 134.735 -16.008 -97.949  1.00 0.00 ? 133 SER A HA   3  
ATOM 6474  H HB2  . SER A 1 133 ? 133.472 -14.661 -99.747  1.00 0.00 ? 133 SER A HB2  3  
ATOM 6475  H HB3  . SER A 1 133 ? 134.721 -13.436 -99.547  1.00 0.00 ? 133 SER A HB3  3  
ATOM 6476  H HG   . SER A 1 133 ? 135.377 -16.148 -99.964  1.00 0.00 ? 133 SER A HG   3  
ATOM 6477  N N    . MET A 1 134 ? 136.123 -13.030 -97.613  1.00 0.00 ? 134 MET A N    3  
ATOM 6478  C CA   . MET A 1 134 ? 137.321 -12.324 -97.080  1.00 0.00 ? 134 MET A CA   3  
ATOM 6479  C C    . MET A 1 134 ? 137.559 -12.758 -95.632  1.00 0.00 ? 134 MET A C    3  
ATOM 6480  O O    . MET A 1 134 ? 138.509 -12.344 -94.998  1.00 0.00 ? 134 MET A O    3  
ATOM 6481  C CB   . MET A 1 134 ? 137.046 -10.816 -97.108  1.00 0.00 ? 134 MET A CB   3  
ATOM 6482  C CG   . MET A 1 134 ? 138.213 -10.065 -96.470  1.00 0.00 ? 134 MET A CG   3  
ATOM 6483  S SD   . MET A 1 134 ? 138.542 -8.551  -97.408  1.00 0.00 ? 134 MET A SD   3  
ATOM 6484  C CE   . MET A 1 134 ? 137.003 -7.686  -97.001  1.00 0.00 ? 134 MET A CE   3  
ATOM 6485  H H    . MET A 1 134 ? 135.425 -12.515 -98.068  1.00 0.00 ? 134 MET A H    3  
ATOM 6486  H HA   . MET A 1 134 ? 138.193 -12.544 -97.678  1.00 0.00 ? 134 MET A HA   3  
ATOM 6487  H HB2  . MET A 1 134 ? 136.924 -10.491 -98.129  1.00 0.00 ? 134 MET A HB2  3  
ATOM 6488  H HB3  . MET A 1 134 ? 136.142 -10.607 -96.552  1.00 0.00 ? 134 MET A HB3  3  
ATOM 6489  H HG2  . MET A 1 134 ? 137.965 -9.811  -95.451  1.00 0.00 ? 134 MET A HG2  3  
ATOM 6490  H HG3  . MET A 1 134 ? 139.089 -10.692 -96.480  1.00 0.00 ? 134 MET A HG3  3  
ATOM 6491  H HE1  . MET A 1 134 ? 136.287 -8.392  -96.606  1.00 0.00 ? 134 MET A HE1  3  
ATOM 6492  H HE2  . MET A 1 134 ? 136.599 -7.229  -97.890  1.00 0.00 ? 134 MET A HE2  3  
ATOM 6493  H HE3  . MET A 1 134 ? 137.206 -6.920  -96.265  1.00 0.00 ? 134 MET A HE3  3  
ATOM 6494  N N    . GLY A 1 135 ? 136.686 -13.568 -95.095  1.00 0.00 ? 135 GLY A N    3  
ATOM 6495  C CA   . GLY A 1 135 ? 136.845 -14.001 -93.677  1.00 0.00 ? 135 GLY A CA   3  
ATOM 6496  C C    . GLY A 1 135 ? 136.157 -12.965 -92.792  1.00 0.00 ? 135 GLY A C    3  
ATOM 6497  O O    . GLY A 1 135 ? 135.908 -13.180 -91.623  1.00 0.00 ? 135 GLY A O    3  
ATOM 6498  H H    . GLY A 1 135 ? 135.914 -13.870 -95.615  1.00 0.00 ? 135 GLY A H    3  
ATOM 6499  H HA2  . GLY A 1 135 ? 136.383 -14.970 -93.538  1.00 0.00 ? 135 GLY A HA2  3  
ATOM 6500  H HA3  . GLY A 1 135 ? 137.892 -14.054 -93.424  1.00 0.00 ? 135 GLY A HA3  3  
ATOM 6501  N N    . VAL A 1 136 ? 135.848 -11.837 -93.368  1.00 0.00 ? 136 VAL A N    3  
ATOM 6502  C CA   . VAL A 1 136 ? 135.169 -10.755 -92.606  1.00 0.00 ? 136 VAL A CA   3  
ATOM 6503  C C    . VAL A 1 136 ? 133.741 -11.183 -92.279  1.00 0.00 ? 136 VAL A C    3  
ATOM 6504  O O    . VAL A 1 136 ? 133.034 -11.708 -93.116  1.00 0.00 ? 136 VAL A O    3  
ATOM 6505  C CB   . VAL A 1 136 ? 135.126 -9.493  -93.459  1.00 0.00 ? 136 VAL A CB   3  
ATOM 6506  C CG1  . VAL A 1 136 ? 134.131 -8.501  -92.855  1.00 0.00 ? 136 VAL A CG1  3  
ATOM 6507  C CG2  . VAL A 1 136 ? 136.516 -8.856  -93.501  1.00 0.00 ? 136 VAL A CG2  3  
ATOM 6508  H H    . VAL A 1 136 ? 136.067 -11.713 -94.315  1.00 0.00 ? 136 VAL A H    3  
ATOM 6509  H HA   . VAL A 1 136 ? 135.709 -10.558 -91.691  1.00 0.00 ? 136 VAL A HA   3  
ATOM 6510  H HB   . VAL A 1 136 ? 134.815 -9.754  -94.461  1.00 0.00 ? 136 VAL A HB   3  
ATOM 6511  H HG11 . VAL A 1 136 ? 134.152 -7.581  -93.422  1.00 0.00 ? 136 VAL A HG11 3  
ATOM 6512  H HG12 . VAL A 1 136 ? 134.402 -8.298  -91.830  1.00 0.00 ? 136 VAL A HG12 3  
ATOM 6513  H HG13 . VAL A 1 136 ? 133.138 -8.922  -92.889  1.00 0.00 ? 136 VAL A HG13 3  
ATOM 6514  H HG21 . VAL A 1 136 ? 137.267 -9.624  -93.381  1.00 0.00 ? 136 VAL A HG21 3  
ATOM 6515  H HG22 . VAL A 1 136 ? 136.605 -8.137  -92.700  1.00 0.00 ? 136 VAL A HG22 3  
ATOM 6516  H HG23 . VAL A 1 136 ? 136.656 -8.359  -94.449  1.00 0.00 ? 136 VAL A HG23 3  
ATOM 6517  N N    . GLU A 1 137 ? 133.309 -10.968 -91.070  1.00 0.00 ? 137 GLU A N    3  
ATOM 6518  C CA   . GLU A 1 137 ? 131.922 -11.371 -90.704  1.00 0.00 ? 137 GLU A CA   3  
ATOM 6519  C C    . GLU A 1 137 ? 131.082 -10.124 -90.430  1.00 0.00 ? 137 GLU A C    3  
ATOM 6520  O O    . GLU A 1 137 ? 131.603 -9.039  -90.267  1.00 0.00 ? 137 GLU A O    3  
ATOM 6521  C CB   . GLU A 1 137 ? 131.963 -12.241 -89.447  1.00 0.00 ? 137 GLU A CB   3  
ATOM 6522  C CG   . GLU A 1 137 ? 130.972 -13.397 -89.593  1.00 0.00 ? 137 GLU A CG   3  
ATOM 6523  C CD   . GLU A 1 137 ? 130.736 -14.043 -88.227  1.00 0.00 ? 137 GLU A CD   3  
ATOM 6524  O OE1  . GLU A 1 137 ? 131.573 -13.867 -87.357  1.00 0.00 ? 137 GLU A OE1  3  
ATOM 6525  O OE2  . GLU A 1 137 ? 129.721 -14.704 -88.074  1.00 0.00 ? 137 GLU A OE2  3  
ATOM 6526  H H    . GLU A 1 137 ? 133.899 -10.548 -90.405  1.00 0.00 ? 137 GLU A H    3  
ATOM 6527  H HA   . GLU A 1 137 ? 131.495 -11.937 -91.519  1.00 0.00 ? 137 GLU A HA   3  
ATOM 6528  H HB2  . GLU A 1 137 ? 132.961 -12.633 -89.313  1.00 0.00 ? 137 GLU A HB2  3  
ATOM 6529  H HB3  . GLU A 1 137 ? 131.693 -11.644 -88.588  1.00 0.00 ? 137 GLU A HB3  3  
ATOM 6530  H HG2  . GLU A 1 137 ? 130.036 -13.022 -89.982  1.00 0.00 ? 137 GLU A HG2  3  
ATOM 6531  H HG3  . GLU A 1 137 ? 131.375 -14.133 -90.272  1.00 0.00 ? 137 GLU A HG3  3  
ATOM 6532  N N    . VAL A 1 138 ? 129.788 -10.270 -90.345  1.00 0.00 ? 138 VAL A N    3  
ATOM 6533  C CA   . VAL A 1 138 ? 128.934 -9.091  -90.042  1.00 0.00 ? 138 VAL A CA   3  
ATOM 6534  C C    . VAL A 1 138 ? 128.971 -8.897  -88.527  1.00 0.00 ? 138 VAL A C    3  
ATOM 6535  O O    . VAL A 1 138 ? 128.692 -9.801  -87.764  1.00 0.00 ? 138 VAL A O    3  
ATOM 6536  C CB   . VAL A 1 138 ? 127.499 -9.356  -90.507  1.00 0.00 ? 138 VAL A CB   3  
ATOM 6537  C CG1  . VAL A 1 138 ? 126.802 -8.025  -90.796  1.00 0.00 ? 138 VAL A CG1  3  
ATOM 6538  C CG2  . VAL A 1 138 ? 127.526 -10.204 -91.781  1.00 0.00 ? 138 VAL A CG2  3  
ATOM 6539  H H    . VAL A 1 138 ? 129.384 -11.158 -90.448  1.00 0.00 ? 138 VAL A H    3  
ATOM 6540  H HA   . VAL A 1 138 ? 129.329 -8.214  -90.535  1.00 0.00 ? 138 VAL A HA   3  
ATOM 6541  H HB   . VAL A 1 138 ? 126.962 -9.884  -89.732  1.00 0.00 ? 138 VAL A HB   3  
ATOM 6542  H HG11 . VAL A 1 138 ? 125.741 -8.192  -90.913  1.00 0.00 ? 138 VAL A HG11 3  
ATOM 6543  H HG12 . VAL A 1 138 ? 127.200 -7.601  -91.706  1.00 0.00 ? 138 VAL A HG12 3  
ATOM 6544  H HG13 . VAL A 1 138 ? 126.970 -7.343  -89.977  1.00 0.00 ? 138 VAL A HG13 3  
ATOM 6545  H HG21 . VAL A 1 138 ? 127.903 -11.189 -91.550  1.00 0.00 ? 138 VAL A HG21 3  
ATOM 6546  H HG22 . VAL A 1 138 ? 128.168 -9.734  -92.512  1.00 0.00 ? 138 VAL A HG22 3  
ATOM 6547  H HG23 . VAL A 1 138 ? 126.526 -10.285 -92.180  1.00 0.00 ? 138 VAL A HG23 3  
ATOM 6548  N N    . VAL A 1 139 ? 129.318 -7.719  -88.091  1.00 0.00 ? 139 VAL A N    3  
ATOM 6549  C CA   . VAL A 1 139 ? 129.382 -7.445  -86.630  1.00 0.00 ? 139 VAL A CA   3  
ATOM 6550  C C    . VAL A 1 139 ? 128.067 -7.865  -85.967  1.00 0.00 ? 139 VAL A C    3  
ATOM 6551  O O    . VAL A 1 139 ? 127.885 -7.708  -84.776  1.00 0.00 ? 139 VAL A O    3  
ATOM 6552  C CB   . VAL A 1 139 ? 129.604 -5.947  -86.416  1.00 0.00 ? 139 VAL A CB   3  
ATOM 6553  C CG1  . VAL A 1 139 ? 128.428 -5.175  -87.005  1.00 0.00 ? 139 VAL A CG1  3  
ATOM 6554  C CG2  . VAL A 1 139 ? 129.715 -5.654  -84.919  1.00 0.00 ? 139 VAL A CG2  3  
ATOM 6555  H H    . VAL A 1 139 ? 129.540 -7.010  -88.730  1.00 0.00 ? 139 VAL A H    3  
ATOM 6556  H HA   . VAL A 1 139 ? 130.200 -7.997  -86.193  1.00 0.00 ? 139 VAL A HA   3  
ATOM 6557  H HB   . VAL A 1 139 ? 130.509 -5.641  -86.915  1.00 0.00 ? 139 VAL A HB   3  
ATOM 6558  H HG11 . VAL A 1 139 ? 128.787 -4.530  -87.793  1.00 0.00 ? 139 VAL A HG11 3  
ATOM 6559  H HG12 . VAL A 1 139 ? 127.964 -4.581  -86.235  1.00 0.00 ? 139 VAL A HG12 3  
ATOM 6560  H HG13 . VAL A 1 139 ? 127.708 -5.871  -87.409  1.00 0.00 ? 139 VAL A HG13 3  
ATOM 6561  H HG21 . VAL A 1 139 ? 128.788 -5.227  -84.565  1.00 0.00 ? 139 VAL A HG21 3  
ATOM 6562  H HG22 . VAL A 1 139 ? 130.520 -4.956  -84.747  1.00 0.00 ? 139 VAL A HG22 3  
ATOM 6563  H HG23 . VAL A 1 139 ? 129.915 -6.572  -84.386  1.00 0.00 ? 139 VAL A HG23 3  
ATOM 6564  N N    . GLY A 1 140 ? 127.146 -8.398  -86.725  1.00 0.00 ? 140 GLY A N    3  
ATOM 6565  C CA   . GLY A 1 140 ? 125.847 -8.822  -86.130  1.00 0.00 ? 140 GLY A CA   3  
ATOM 6566  C C    . GLY A 1 140 ? 125.163 -9.834  -87.050  1.00 0.00 ? 140 GLY A C    3  
ATOM 6567  O O    . GLY A 1 140 ? 125.747 -10.825 -87.444  1.00 0.00 ? 140 GLY A O    3  
ATOM 6568  H H    . GLY A 1 140 ? 127.309 -8.517  -87.684  1.00 0.00 ? 140 GLY A H    3  
ATOM 6569  H HA2  . GLY A 1 140 ? 126.026 -9.274  -85.165  1.00 0.00 ? 140 GLY A HA2  3  
ATOM 6570  H HA3  . GLY A 1 140 ? 125.207 -7.960  -86.010  1.00 0.00 ? 140 GLY A HA3  3  
ATOM 6571  N N    . ALA A 1 141 ? 123.927 -9.596  -87.394  1.00 0.00 ? 141 ALA A N    3  
ATOM 6572  C CA   . ALA A 1 141 ? 123.202 -10.544 -88.287  1.00 0.00 ? 141 ALA A CA   3  
ATOM 6573  C C    . ALA A 1 141 ? 122.809 -11.793 -87.493  1.00 0.00 ? 141 ALA A C    3  
ATOM 6574  O O    . ALA A 1 141 ? 123.251 -12.887 -87.783  1.00 0.00 ? 141 ALA A O    3  
ATOM 6575  C CB   . ALA A 1 141 ? 124.110 -10.944 -89.452  1.00 0.00 ? 141 ALA A CB   3  
ATOM 6576  H H    . ALA A 1 141 ? 123.474 -8.791  -87.064  1.00 0.00 ? 141 ALA A H    3  
ATOM 6577  H HA   . ALA A 1 141 ? 122.312 -10.067 -88.671  1.00 0.00 ? 141 ALA A HA   3  
ATOM 6578  H HB1  . ALA A 1 141 ? 124.747 -10.112 -89.713  1.00 0.00 ? 141 ALA A HB1  3  
ATOM 6579  H HB2  . ALA A 1 141 ? 123.504 -11.216 -90.304  1.00 0.00 ? 141 ALA A HB2  3  
ATOM 6580  H HB3  . ALA A 1 141 ? 124.720 -11.787 -89.160  1.00 0.00 ? 141 ALA A HB3  3  
ATOM 6581  N N    . PRO A 1 142 ? 121.981 -11.623 -86.497  1.00 0.00 ? 142 PRO A N    3  
ATOM 6582  C CA   . PRO A 1 142 ? 121.526 -12.762 -85.653  1.00 0.00 ? 142 PRO A CA   3  
ATOM 6583  C C    . PRO A 1 142 ? 120.679 -13.771 -86.435  1.00 0.00 ? 142 PRO A C    3  
ATOM 6584  O O    . PRO A 1 142 ? 120.653 -13.767 -87.650  1.00 0.00 ? 142 PRO A O    3  
ATOM 6585  C CB   . PRO A 1 142 ? 120.684 -12.069 -84.580  1.00 0.00 ? 142 PRO A CB   3  
ATOM 6586  C CG   . PRO A 1 142 ? 120.596 -10.572 -84.905  1.00 0.00 ? 142 PRO A CG   3  
ATOM 6587  C CD   . PRO A 1 142 ? 121.445 -10.283 -86.148  1.00 0.00 ? 142 PRO A CD   3  
ATOM 6588  H HA   . PRO A 1 142 ? 122.368 -13.251 -85.191  1.00 0.00 ? 142 PRO A HA   3  
ATOM 6589  H HB2  . PRO A 1 142 ? 119.692 -12.497 -84.568  1.00 0.00 ? 142 PRO A HB2  3  
ATOM 6590  H HB3  . PRO A 1 142 ? 121.148 -12.200 -83.615  1.00 0.00 ? 142 PRO A HB3  3  
ATOM 6591  H HG2  . PRO A 1 142 ? 119.568 -10.303 -85.098  1.00 0.00 ? 142 PRO A HG2  3  
ATOM 6592  H HG3  . PRO A 1 142 ? 120.972 -9.998  -84.073  1.00 0.00 ? 142 PRO A HG3  3  
ATOM 6593  H HD2  . PRO A 1 142 ? 120.830 -9.891  -86.947  1.00 0.00 ? 142 PRO A HD2  3  
ATOM 6594  H HD3  . PRO A 1 142 ? 122.252 -9.607  -85.913  1.00 0.00 ? 142 PRO A HD3  3  
ATOM 6595  N N    . GLU A 1 143 ? 119.985 -14.636 -85.745  1.00 0.00 ? 143 GLU A N    3  
ATOM 6596  C CA   . GLU A 1 143 ? 119.138 -15.644 -86.445  1.00 0.00 ? 143 GLU A CA   3  
ATOM 6597  C C    . GLU A 1 143 ? 118.251 -16.359 -85.424  1.00 0.00 ? 143 GLU A C    3  
ATOM 6598  O O    . GLU A 1 143 ? 118.601 -16.490 -84.267  1.00 0.00 ? 143 GLU A O    3  
ATOM 6599  C CB   . GLU A 1 143 ? 120.036 -16.666 -87.145  1.00 0.00 ? 143 GLU A CB   3  
ATOM 6600  C CG   . GLU A 1 143 ? 119.170 -17.763 -87.768  1.00 0.00 ? 143 GLU A CG   3  
ATOM 6601  C CD   . GLU A 1 143 ? 118.681 -18.712 -86.673  1.00 0.00 ? 143 GLU A CD   3  
ATOM 6602  O OE1  . GLU A 1 143 ? 119.204 -18.635 -85.573  1.00 0.00 ? 143 GLU A OE1  3  
ATOM 6603  O OE2  . GLU A 1 143 ? 117.792 -19.500 -86.953  1.00 0.00 ? 143 GLU A OE2  3  
ATOM 6604  H H    . GLU A 1 143 ? 120.020 -14.622 -84.766  1.00 0.00 ? 143 GLU A H    3  
ATOM 6605  H HA   . GLU A 1 143 ? 118.518 -15.147 -87.177  1.00 0.00 ? 143 GLU A HA   3  
ATOM 6606  H HB2  . GLU A 1 143 ? 120.607 -16.173 -87.919  1.00 0.00 ? 143 GLU A HB2  3  
ATOM 6607  H HB3  . GLU A 1 143 ? 120.709 -17.107 -86.426  1.00 0.00 ? 143 GLU A HB3  3  
ATOM 6608  H HG2  . GLU A 1 143 ? 118.321 -17.314 -88.263  1.00 0.00 ? 143 GLU A HG2  3  
ATOM 6609  H HG3  . GLU A 1 143 ? 119.754 -18.317 -88.488  1.00 0.00 ? 143 GLU A HG3  3  
ATOM 6610  N N    . VAL A 1 144 ? 117.103 -16.822 -85.840  1.00 0.00 ? 144 VAL A N    3  
ATOM 6611  C CA   . VAL A 1 144 ? 116.197 -17.527 -84.890  1.00 0.00 ? 144 VAL A CA   3  
ATOM 6612  C C    . VAL A 1 144 ? 115.361 -18.559 -85.651  1.00 0.00 ? 144 VAL A C    3  
ATOM 6613  O O    . VAL A 1 144 ? 115.573 -18.804 -86.821  1.00 0.00 ? 144 VAL A O    3  
ATOM 6614  C CB   . VAL A 1 144 ? 115.269 -16.511 -84.222  1.00 0.00 ? 144 VAL A CB   3  
ATOM 6615  C CG1  . VAL A 1 144 ? 116.079 -15.290 -83.784  1.00 0.00 ? 144 VAL A CG1  3  
ATOM 6616  C CG2  . VAL A 1 144 ? 114.190 -16.077 -85.218  1.00 0.00 ? 144 VAL A CG2  3  
ATOM 6617  H H    . VAL A 1 144 ? 116.839 -16.706 -86.776  1.00 0.00 ? 144 VAL A H    3  
ATOM 6618  H HA   . VAL A 1 144 ? 116.786 -18.028 -84.135  1.00 0.00 ? 144 VAL A HA   3  
ATOM 6619  H HB   . VAL A 1 144 ? 114.803 -16.964 -83.359  1.00 0.00 ? 144 VAL A HB   3  
ATOM 6620  H HG11 . VAL A 1 144 ? 116.866 -15.602 -83.113  1.00 0.00 ? 144 VAL A HG11 3  
ATOM 6621  H HG12 . VAL A 1 144 ? 115.430 -14.592 -83.277  1.00 0.00 ? 144 VAL A HG12 3  
ATOM 6622  H HG13 . VAL A 1 144 ? 116.511 -14.815 -84.651  1.00 0.00 ? 144 VAL A HG13 3  
ATOM 6623  H HG21 . VAL A 1 144 ? 114.649 -15.853 -86.169  1.00 0.00 ? 144 VAL A HG21 3  
ATOM 6624  H HG22 . VAL A 1 144 ? 113.688 -15.197 -84.843  1.00 0.00 ? 144 VAL A HG22 3  
ATOM 6625  H HG23 . VAL A 1 144 ? 113.473 -16.875 -85.342  1.00 0.00 ? 144 VAL A HG23 3  
ATOM 6626  N N    . LYS A 1 145 ? 114.410 -19.167 -84.993  1.00 0.00 ? 145 LYS A N    3  
ATOM 6627  C CA   . LYS A 1 145 ? 113.561 -20.183 -85.677  1.00 0.00 ? 145 LYS A CA   3  
ATOM 6628  C C    . LYS A 1 145 ? 112.135 -20.108 -85.126  1.00 0.00 ? 145 LYS A C    3  
ATOM 6629  O O    . LYS A 1 145 ? 111.878 -19.471 -84.125  1.00 0.00 ? 145 LYS A O    3  
ATOM 6630  C CB   . LYS A 1 145 ? 114.134 -21.579 -85.426  1.00 0.00 ? 145 LYS A CB   3  
ATOM 6631  C CG   . LYS A 1 145 ? 113.047 -22.629 -85.667  1.00 0.00 ? 145 LYS A CG   3  
ATOM 6632  C CD   . LYS A 1 145 ? 113.665 -24.026 -85.616  1.00 0.00 ? 145 LYS A CD   3  
ATOM 6633  C CE   . LYS A 1 145 ? 113.488 -24.615 -84.216  1.00 0.00 ? 145 LYS A CE   3  
ATOM 6634  N NZ   . LYS A 1 145 ? 113.836 -26.064 -84.238  1.00 0.00 ? 145 LYS A NZ   3  
ATOM 6635  H H    . LYS A 1 145 ? 114.256 -18.955 -84.049  1.00 0.00 ? 145 LYS A H    3  
ATOM 6636  H HA   . LYS A 1 145 ? 113.547 -19.985 -86.739  1.00 0.00 ? 145 LYS A HA   3  
ATOM 6637  H HB2  . LYS A 1 145 ? 114.961 -21.755 -86.098  1.00 0.00 ? 145 LYS A HB2  3  
ATOM 6638  H HB3  . LYS A 1 145 ? 114.477 -21.649 -84.404  1.00 0.00 ? 145 LYS A HB3  3  
ATOM 6639  H HG2  . LYS A 1 145 ? 112.288 -22.542 -84.902  1.00 0.00 ? 145 LYS A HG2  3  
ATOM 6640  H HG3  . LYS A 1 145 ? 112.601 -22.470 -86.637  1.00 0.00 ? 145 LYS A HG3  3  
ATOM 6641  H HD2  . LYS A 1 145 ? 113.176 -24.663 -86.340  1.00 0.00 ? 145 LYS A HD2  3  
ATOM 6642  H HD3  . LYS A 1 145 ? 114.719 -23.963 -85.847  1.00 0.00 ? 145 LYS A HD3  3  
ATOM 6643  H HE2  . LYS A 1 145 ? 114.138 -24.099 -83.524  1.00 0.00 ? 145 LYS A HE2  3  
ATOM 6644  H HE3  . LYS A 1 145 ? 112.461 -24.495 -83.903  1.00 0.00 ? 145 LYS A HE3  3  
ATOM 6645  H HZ1  . LYS A 1 145 ? 113.175 -26.569 -84.862  1.00 0.00 ? 145 LYS A HZ1  3  
ATOM 6646  H HZ2  . LYS A 1 145 ? 113.768 -26.451 -83.273  1.00 0.00 ? 145 LYS A HZ2  3  
ATOM 6647  H HZ3  . LYS A 1 145 ? 114.805 -26.183 -84.593  1.00 0.00 ? 145 LYS A HZ3  3  
ATOM 6648  N N    . ASP A 1 146 ? 111.204 -20.756 -85.773  1.00 0.00 ? 146 ASP A N    3  
ATOM 6649  C CA   . ASP A 1 146 ? 109.797 -20.722 -85.285  1.00 0.00 ? 146 ASP A CA   3  
ATOM 6650  C C    . ASP A 1 146 ? 109.182 -22.119 -85.403  1.00 0.00 ? 146 ASP A C    3  
ATOM 6651  O O    . ASP A 1 146 ? 109.176 -22.885 -84.460  1.00 0.00 ? 146 ASP A O    3  
ATOM 6652  C CB   . ASP A 1 146 ? 108.988 -19.736 -86.131  1.00 0.00 ? 146 ASP A CB   3  
ATOM 6653  C CG   . ASP A 1 146 ? 108.599 -18.528 -85.275  1.00 0.00 ? 146 ASP A CG   3  
ATOM 6654  O OD1  . ASP A 1 146 ? 109.309 -18.248 -84.324  1.00 0.00 ? 146 ASP A OD1  3  
ATOM 6655  O OD2  . ASP A 1 146 ? 107.597 -17.906 -85.587  1.00 0.00 ? 146 ASP A OD2  3  
ATOM 6656  H H    . ASP A 1 146 ? 111.431 -21.265 -86.579  1.00 0.00 ? 146 ASP A H    3  
ATOM 6657  H HA   . ASP A 1 146 ? 109.781 -20.408 -84.252  1.00 0.00 ? 146 ASP A HA   3  
ATOM 6658  H HB2  . ASP A 1 146 ? 109.585 -19.407 -86.969  1.00 0.00 ? 146 ASP A HB2  3  
ATOM 6659  H HB3  . ASP A 1 146 ? 108.094 -20.221 -86.494  1.00 0.00 ? 146 ASP A HB3  3  
ATOM 6660  N N    . ALA A 1 147 ? 108.664 -22.454 -86.553  1.00 0.00 ? 147 ALA A N    3  
ATOM 6661  C CA   . ALA A 1 147 ? 108.049 -23.801 -86.728  1.00 0.00 ? 147 ALA A CA   3  
ATOM 6662  C C    . ALA A 1 147 ? 106.689 -23.837 -86.028  1.00 0.00 ? 147 ALA A C    3  
ATOM 6663  O O    . ALA A 1 147 ? 106.008 -24.841 -86.151  1.00 0.00 ? 147 ALA A O    3  
ATOM 6664  C CB   . ALA A 1 147 ? 108.965 -24.863 -86.119  1.00 0.00 ? 147 ALA A CB   3  
ATOM 6665  H H    . ALA A 1 147 ? 108.678 -21.821 -87.300  1.00 0.00 ? 147 ALA A H    3  
ATOM 6666  H HA   . ALA A 1 147 ? 107.917 -24.001 -87.781  1.00 0.00 ? 147 ALA A HA   3  
ATOM 6667  H HB1  . ALA A 1 147 ? 108.650 -25.072 -85.107  1.00 0.00 ? 147 ALA A HB1  3  
ATOM 6668  H HB2  . ALA A 1 147 ? 109.982 -24.501 -86.111  1.00 0.00 ? 147 ALA A HB2  3  
ATOM 6669  H HB3  . ALA A 1 147 ? 108.909 -25.767 -86.707  1.00 0.00 ? 147 ALA A HB3  3  
ATOM 6670  N N    . MET A 1 1   ? 132.689 20.999  -118.956 1.00 0.00 ? 1   MET A N    4  
ATOM 6671  C CA   . MET A 1 1   ? 134.098 20.875  -118.490 1.00 0.00 ? 1   MET A CA   4  
ATOM 6672  C C    . MET A 1 1   ? 134.139 20.039  -117.209 1.00 0.00 ? 1   MET A C    4  
ATOM 6673  O O    . MET A 1 1   ? 134.894 20.318  -116.298 1.00 0.00 ? 1   MET A O    4  
ATOM 6674  C CB   . MET A 1 1   ? 134.667 22.267  -118.209 1.00 0.00 ? 1   MET A CB   4  
ATOM 6675  C CG   . MET A 1 1   ? 134.719 23.071  -119.510 1.00 0.00 ? 1   MET A CG   4  
ATOM 6676  S SD   . MET A 1 1   ? 136.445 23.371  -119.964 1.00 0.00 ? 1   MET A SD   4  
ATOM 6677  C CE   . MET A 1 1   ? 136.503 25.118  -119.492 1.00 0.00 ? 1   MET A CE   4  
ATOM 6678  H H1   . MET A 1 1   ? 132.651 21.624  -119.786 1.00 0.00 ? 1   MET A H1   4  
ATOM 6679  H HA   . MET A 1 1   ? 134.689 20.392  -119.254 1.00 0.00 ? 1   MET A HA   4  
ATOM 6680  H HB2  . MET A 1 1   ? 134.036 22.776  -117.495 1.00 0.00 ? 1   MET A HB2  4  
ATOM 6681  H HB3  . MET A 1 1   ? 135.665 22.174  -117.806 1.00 0.00 ? 1   MET A HB3  4  
ATOM 6682  H HG2  . MET A 1 1   ? 134.232 22.513  -120.297 1.00 0.00 ? 1   MET A HG2  4  
ATOM 6683  H HG3  . MET A 1 1   ? 134.214 24.014  -119.371 1.00 0.00 ? 1   MET A HG3  4  
ATOM 6684  H HE1  . MET A 1 1   ? 135.633 25.625  -119.885 1.00 0.00 ? 1   MET A HE1  4  
ATOM 6685  H HE2  . MET A 1 1   ? 137.393 25.571  -119.895 1.00 0.00 ? 1   MET A HE2  4  
ATOM 6686  H HE3  . MET A 1 1   ? 136.516 25.197  -118.413 1.00 0.00 ? 1   MET A HE3  4  
ATOM 6687  N N    . LYS A 1 2   ? 133.334 19.015  -117.131 1.00 0.00 ? 2   LYS A N    4  
ATOM 6688  C CA   . LYS A 1 2   ? 133.327 18.163  -115.909 1.00 0.00 ? 2   LYS A CA   4  
ATOM 6689  C C    . LYS A 1 2   ? 132.655 16.824  -116.224 1.00 0.00 ? 2   LYS A C    4  
ATOM 6690  O O    . LYS A 1 2   ? 131.454 16.681  -116.111 1.00 0.00 ? 2   LYS A O    4  
ATOM 6691  C CB   . LYS A 1 2   ? 132.553 18.873  -114.796 1.00 0.00 ? 2   LYS A CB   4  
ATOM 6692  C CG   . LYS A 1 2   ? 131.548 19.848  -115.412 1.00 0.00 ? 2   LYS A CG   4  
ATOM 6693  C CD   . LYS A 1 2   ? 130.799 20.584  -114.299 1.00 0.00 ? 2   LYS A CD   4  
ATOM 6694  C CE   . LYS A 1 2   ? 130.920 22.094  -114.513 1.00 0.00 ? 2   LYS A CE   4  
ATOM 6695  N NZ   . LYS A 1 2   ? 130.202 22.478  -115.761 1.00 0.00 ? 2   LYS A NZ   4  
ATOM 6696  H H    . LYS A 1 2   ? 132.733 18.807  -117.877 1.00 0.00 ? 2   LYS A H    4  
ATOM 6697  H HA   . LYS A 1 2   ? 134.343 17.989  -115.586 1.00 0.00 ? 2   LYS A HA   4  
ATOM 6698  H HB2  . LYS A 1 2   ? 132.027 18.140  -114.201 1.00 0.00 ? 2   LYS A HB2  4  
ATOM 6699  H HB3  . LYS A 1 2   ? 133.242 19.419  -114.169 1.00 0.00 ? 2   LYS A HB3  4  
ATOM 6700  H HG2  . LYS A 1 2   ? 132.072 20.563  -116.029 1.00 0.00 ? 2   LYS A HG2  4  
ATOM 6701  H HG3  . LYS A 1 2   ? 130.840 19.301  -116.018 1.00 0.00 ? 2   LYS A HG3  4  
ATOM 6702  H HD2  . LYS A 1 2   ? 129.757 20.299  -114.317 1.00 0.00 ? 2   LYS A HD2  4  
ATOM 6703  H HD3  . LYS A 1 2   ? 131.227 20.323  -113.343 1.00 0.00 ? 2   LYS A HD3  4  
ATOM 6704  H HE2  . LYS A 1 2   ? 130.483 22.613  -113.672 1.00 0.00 ? 2   LYS A HE2  4  
ATOM 6705  H HE3  . LYS A 1 2   ? 131.963 22.362  -114.599 1.00 0.00 ? 2   LYS A HE3  4  
ATOM 6706  H HZ1  . LYS A 1 2   ? 129.494 23.208  -115.544 1.00 0.00 ? 2   LYS A HZ1  4  
ATOM 6707  H HZ2  . LYS A 1 2   ? 129.729 21.642  -116.160 1.00 0.00 ? 2   LYS A HZ2  4  
ATOM 6708  H HZ3  . LYS A 1 2   ? 130.882 22.855  -116.451 1.00 0.00 ? 2   LYS A HZ3  4  
ATOM 6709  N N    . LYS A 1 3   ? 133.421 15.843  -116.618 1.00 0.00 ? 3   LYS A N    4  
ATOM 6710  C CA   . LYS A 1 3   ? 132.824 14.516  -116.940 1.00 0.00 ? 3   LYS A CA   4  
ATOM 6711  C C    . LYS A 1 3   ? 133.938 13.479  -117.108 1.00 0.00 ? 3   LYS A C    4  
ATOM 6712  O O    . LYS A 1 3   ? 134.740 13.558  -118.018 1.00 0.00 ? 3   LYS A O    4  
ATOM 6713  C CB   . LYS A 1 3   ? 132.029 14.622  -118.244 1.00 0.00 ? 3   LYS A CB   4  
ATOM 6714  C CG   . LYS A 1 3   ? 130.660 13.957  -118.072 1.00 0.00 ? 3   LYS A CG   4  
ATOM 6715  C CD   . LYS A 1 3   ? 129.650 14.988  -117.564 1.00 0.00 ? 3   LYS A CD   4  
ATOM 6716  C CE   . LYS A 1 3   ? 128.230 14.453  -117.758 1.00 0.00 ? 3   LYS A CE   4  
ATOM 6717  N NZ   . LYS A 1 3   ? 127.412 15.465  -118.484 1.00 0.00 ? 3   LYS A NZ   4  
ATOM 6718  H H    . LYS A 1 3   ? 134.388 15.980  -116.703 1.00 0.00 ? 3   LYS A H    4  
ATOM 6719  H HA   . LYS A 1 3   ? 132.166 14.212  -116.139 1.00 0.00 ? 3   LYS A HA   4  
ATOM 6720  H HB2  . LYS A 1 3   ? 131.895 15.663  -118.498 1.00 0.00 ? 3   LYS A HB2  4  
ATOM 6721  H HB3  . LYS A 1 3   ? 132.571 14.125  -119.036 1.00 0.00 ? 3   LYS A HB3  4  
ATOM 6722  H HG2  . LYS A 1 3   ? 130.330 13.566  -119.023 1.00 0.00 ? 3   LYS A HG2  4  
ATOM 6723  H HG3  . LYS A 1 3   ? 130.738 13.150  -117.359 1.00 0.00 ? 3   LYS A HG3  4  
ATOM 6724  H HD2  . LYS A 1 3   ? 129.825 15.176  -116.514 1.00 0.00 ? 3   LYS A HD2  4  
ATOM 6725  H HD3  . LYS A 1 3   ? 129.764 15.907  -118.117 1.00 0.00 ? 3   LYS A HD3  4  
ATOM 6726  H HE2  . LYS A 1 3   ? 128.264 13.539  -118.332 1.00 0.00 ? 3   LYS A HE2  4  
ATOM 6727  H HE3  . LYS A 1 3   ? 127.785 14.256  -116.794 1.00 0.00 ? 3   LYS A HE3  4  
ATOM 6728  H HZ1  . LYS A 1 3   ? 127.087 15.067  -119.387 1.00 0.00 ? 3   LYS A HZ1  4  
ATOM 6729  H HZ2  . LYS A 1 3   ? 127.991 16.311  -118.666 1.00 0.00 ? 3   LYS A HZ2  4  
ATOM 6730  H HZ3  . LYS A 1 3   ? 126.589 15.726  -117.906 1.00 0.00 ? 3   LYS A HZ3  4  
ATOM 6731  N N    . VAL A 1 4   ? 133.993 12.501  -116.244 1.00 0.00 ? 4   VAL A N    4  
ATOM 6732  C CA   . VAL A 1 4   ? 135.052 11.459  -116.365 1.00 0.00 ? 4   VAL A CA   4  
ATOM 6733  C C    . VAL A 1 4   ? 135.146 10.995  -117.815 1.00 0.00 ? 4   VAL A C    4  
ATOM 6734  O O    . VAL A 1 4   ? 134.147 10.791  -118.476 1.00 0.00 ? 4   VAL A O    4  
ATOM 6735  C CB   . VAL A 1 4   ? 134.703 10.264  -115.474 1.00 0.00 ? 4   VAL A CB   4  
ATOM 6736  C CG1  . VAL A 1 4   ? 133.227 9.922   -115.635 1.00 0.00 ? 4   VAL A CG1  4  
ATOM 6737  C CG2  . VAL A 1 4   ? 135.549 9.055   -115.886 1.00 0.00 ? 4   VAL A CG2  4  
ATOM 6738  H H    . VAL A 1 4   ? 133.334 12.450  -115.518 1.00 0.00 ? 4   VAL A H    4  
ATOM 6739  H HA   . VAL A 1 4   ? 135.999 11.869  -116.060 1.00 0.00 ? 4   VAL A HA   4  
ATOM 6740  H HB   . VAL A 1 4   ? 134.901 10.508  -114.447 1.00 0.00 ? 4   VAL A HB   4  
ATOM 6741  H HG11 . VAL A 1 4   ? 132.979 9.092   -114.989 1.00 0.00 ? 4   VAL A HG11 4  
ATOM 6742  H HG12 . VAL A 1 4   ? 133.029 9.653   -116.661 1.00 0.00 ? 4   VAL A HG12 4  
ATOM 6743  H HG13 . VAL A 1 4   ? 132.629 10.780  -115.364 1.00 0.00 ? 4   VAL A HG13 4  
ATOM 6744  H HG21 . VAL A 1 4   ? 135.310 8.775   -116.901 1.00 0.00 ? 4   VAL A HG21 4  
ATOM 6745  H HG22 . VAL A 1 4   ? 135.338 8.227   -115.226 1.00 0.00 ? 4   VAL A HG22 4  
ATOM 6746  H HG23 . VAL A 1 4   ? 136.596 9.308   -115.819 1.00 0.00 ? 4   VAL A HG23 4  
ATOM 6747  N N    . VAL A 1 5   ? 136.336 10.815  -118.316 1.00 0.00 ? 5   VAL A N    4  
ATOM 6748  C CA   . VAL A 1 5   ? 136.473 10.350  -119.721 1.00 0.00 ? 5   VAL A CA   4  
ATOM 6749  C C    . VAL A 1 5   ? 137.077 8.946   -119.711 1.00 0.00 ? 5   VAL A C    4  
ATOM 6750  O O    . VAL A 1 5   ? 136.889 8.178   -120.634 1.00 0.00 ? 5   VAL A O    4  
ATOM 6751  C CB   . VAL A 1 5   ? 137.377 11.300  -120.513 1.00 0.00 ? 5   VAL A CB   4  
ATOM 6752  C CG1  . VAL A 1 5   ? 136.728 12.681  -120.611 1.00 0.00 ? 5   VAL A CG1  4  
ATOM 6753  C CG2  . VAL A 1 5   ? 138.727 11.423  -119.802 1.00 0.00 ? 5   VAL A CG2  4  
ATOM 6754  H H    . VAL A 1 5   ? 137.133 10.972  -117.768 1.00 0.00 ? 5   VAL A H    4  
ATOM 6755  H HA   . VAL A 1 5   ? 135.489 10.298  -120.161 1.00 0.00 ? 5   VAL A HA   4  
ATOM 6756  H HB   . VAL A 1 5   ? 137.528 10.904  -121.506 1.00 0.00 ? 5   VAL A HB   4  
ATOM 6757  H HG11 . VAL A 1 5   ? 135.697 12.575  -120.906 1.00 0.00 ? 5   VAL A HG11 4  
ATOM 6758  H HG12 . VAL A 1 5   ? 137.256 13.273  -121.344 1.00 0.00 ? 5   VAL A HG12 4  
ATOM 6759  H HG13 . VAL A 1 5   ? 136.780 13.171  -119.649 1.00 0.00 ? 5   VAL A HG13 4  
ATOM 6760  H HG21 . VAL A 1 5   ? 139.388 12.043  -120.390 1.00 0.00 ? 5   VAL A HG21 4  
ATOM 6761  H HG22 . VAL A 1 5   ? 139.163 10.443  -119.684 1.00 0.00 ? 5   VAL A HG22 4  
ATOM 6762  H HG23 . VAL A 1 5   ? 138.583 11.873  -118.830 1.00 0.00 ? 5   VAL A HG23 4  
ATOM 6763  N N    . ALA A 1 6   ? 137.796 8.595   -118.678 1.00 0.00 ? 6   ALA A N    4  
ATOM 6764  C CA   . ALA A 1 6   ? 138.393 7.231   -118.638 1.00 0.00 ? 6   ALA A CA   4  
ATOM 6765  C C    . ALA A 1 6   ? 138.265 6.637   -117.233 1.00 0.00 ? 6   ALA A C    4  
ATOM 6766  O O    . ALA A 1 6   ? 138.892 7.088   -116.295 1.00 0.00 ? 6   ALA A O    4  
ATOM 6767  C CB   . ALA A 1 6   ? 139.868 7.304   -119.029 1.00 0.00 ? 6   ALA A CB   4  
ATOM 6768  H H    . ALA A 1 6   ? 137.938 9.223   -117.935 1.00 0.00 ? 6   ALA A H    4  
ATOM 6769  H HA   . ALA A 1 6   ? 137.866 6.598   -119.337 1.00 0.00 ? 6   ALA A HA   4  
ATOM 6770  H HB1  . ALA A 1 6   ? 140.251 8.289   -118.808 1.00 0.00 ? 6   ALA A HB1  4  
ATOM 6771  H HB2  . ALA A 1 6   ? 139.971 7.106   -120.086 1.00 0.00 ? 6   ALA A HB2  4  
ATOM 6772  H HB3  . ALA A 1 6   ? 140.426 6.568   -118.470 1.00 0.00 ? 6   ALA A HB3  4  
ATOM 6773  N N    . VAL A 1 7   ? 137.465 5.614   -117.088 1.00 0.00 ? 7   VAL A N    4  
ATOM 6774  C CA   . VAL A 1 7   ? 137.302 4.969   -115.754 1.00 0.00 ? 7   VAL A CA   4  
ATOM 6775  C C    . VAL A 1 7   ? 138.150 3.701   -115.704 1.00 0.00 ? 7   VAL A C    4  
ATOM 6776  O O    . VAL A 1 7   ? 137.634 2.606   -115.812 1.00 0.00 ? 7   VAL A O    4  
ATOM 6777  C CB   . VAL A 1 7   ? 135.849 4.551   -115.573 1.00 0.00 ? 7   VAL A CB   4  
ATOM 6778  C CG1  . VAL A 1 7   ? 135.344 3.870   -116.847 1.00 0.00 ? 7   VAL A CG1  4  
ATOM 6779  C CG2  . VAL A 1 7   ? 135.781 3.571   -114.403 1.00 0.00 ? 7   VAL A CG2  4  
ATOM 6780  H H    . VAL A 1 7   ? 136.981 5.262   -117.863 1.00 0.00 ? 7   VAL A H    4  
ATOM 6781  H HA   . VAL A 1 7   ? 137.556 5.656   -114.962 1.00 0.00 ? 7   VAL A HA   4  
ATOM 6782  H HB   . VAL A 1 7   ? 135.244 5.418   -115.359 1.00 0.00 ? 7   VAL A HB   4  
ATOM 6783  H HG11 . VAL A 1 7   ? 134.931 2.904   -116.599 1.00 0.00 ? 7   VAL A HG11 4  
ATOM 6784  H HG12 . VAL A 1 7   ? 136.166 3.743   -117.537 1.00 0.00 ? 7   VAL A HG12 4  
ATOM 6785  H HG13 . VAL A 1 7   ? 134.581 4.482   -117.305 1.00 0.00 ? 7   VAL A HG13 4  
ATOM 6786  H HG21 . VAL A 1 7   ? 135.708 2.563   -114.781 1.00 0.00 ? 7   VAL A HG21 4  
ATOM 6787  H HG22 . VAL A 1 7   ? 134.919 3.795   -113.795 1.00 0.00 ? 7   VAL A HG22 4  
ATOM 6788  H HG23 . VAL A 1 7   ? 136.677 3.666   -113.805 1.00 0.00 ? 7   VAL A HG23 4  
ATOM 6789  N N    . VAL A 1 8   ? 139.434 3.819   -115.605 1.00 0.00 ? 8   VAL A N    4  
ATOM 6790  C CA   . VAL A 1 8   ? 140.269 2.581   -115.627 1.00 0.00 ? 8   VAL A CA   4  
ATOM 6791  C C    . VAL A 1 8   ? 139.729 1.553   -114.626 1.00 0.00 ? 8   VAL A C    4  
ATOM 6792  O O    . VAL A 1 8   ? 140.157 1.505   -113.492 1.00 0.00 ? 8   VAL A O    4  
ATOM 6793  C CB   . VAL A 1 8   ? 141.720 2.909   -115.294 1.00 0.00 ? 8   VAL A CB   4  
ATOM 6794  C CG1  . VAL A 1 8   ? 142.587 1.688   -115.592 1.00 0.00 ? 8   VAL A CG1  4  
ATOM 6795  C CG2  . VAL A 1 8   ? 142.188 4.089   -116.150 1.00 0.00 ? 8   VAL A CG2  4  
ATOM 6796  H H    . VAL A 1 8   ? 139.847 4.709   -115.594 1.00 0.00 ? 8   VAL A H    4  
ATOM 6797  H HA   . VAL A 1 8   ? 140.215 2.169   -116.624 1.00 0.00 ? 8   VAL A HA   4  
ATOM 6798  H HB   . VAL A 1 8   ? 141.801 3.160   -114.248 1.00 0.00 ? 8   VAL A HB   4  
ATOM 6799  H HG11 . VAL A 1 8   ? 143.000 1.308   -114.671 1.00 0.00 ? 8   VAL A HG11 4  
ATOM 6800  H HG12 . VAL A 1 8   ? 143.387 1.967   -116.260 1.00 0.00 ? 8   VAL A HG12 4  
ATOM 6801  H HG13 . VAL A 1 8   ? 141.981 0.923   -116.057 1.00 0.00 ? 8   VAL A HG13 4  
ATOM 6802  H HG21 . VAL A 1 8   ? 142.708 3.717   -117.020 1.00 0.00 ? 8   VAL A HG21 4  
ATOM 6803  H HG22 . VAL A 1 8   ? 142.854 4.712   -115.572 1.00 0.00 ? 8   VAL A HG22 4  
ATOM 6804  H HG23 . VAL A 1 8   ? 141.333 4.669   -116.462 1.00 0.00 ? 8   VAL A HG23 4  
ATOM 6805  N N    . LYS A 1 9   ? 138.806 0.722   -115.049 1.00 0.00 ? 9   LYS A N    4  
ATOM 6806  C CA   . LYS A 1 9   ? 138.245 -0.320  -114.132 1.00 0.00 ? 9   LYS A CA   4  
ATOM 6807  C C    . LYS A 1 9   ? 139.182 -1.531  -114.114 1.00 0.00 ? 9   LYS A C    4  
ATOM 6808  O O    . LYS A 1 9   ? 138.759 -2.669  -114.085 1.00 0.00 ? 9   LYS A O    4  
ATOM 6809  C CB   . LYS A 1 9   ? 136.862 -0.749  -114.628 1.00 0.00 ? 9   LYS A CB   4  
ATOM 6810  C CG   . LYS A 1 9   ? 135.960 -1.050  -113.431 1.00 0.00 ? 9   LYS A CG   4  
ATOM 6811  C CD   . LYS A 1 9   ? 136.402 -2.361  -112.775 1.00 0.00 ? 9   LYS A CD   4  
ATOM 6812  C CE   . LYS A 1 9   ? 135.310 -2.850  -111.822 1.00 0.00 ? 9   LYS A CE   4  
ATOM 6813  N NZ   . LYS A 1 9   ? 133.981 -2.741  -112.489 1.00 0.00 ? 9   LYS A NZ   4  
ATOM 6814  H H    . LYS A 1 9   ? 138.489 0.778   -115.974 1.00 0.00 ? 9   LYS A H    4  
ATOM 6815  H HA   . LYS A 1 9   ? 138.164 0.084   -113.138 1.00 0.00 ? 9   LYS A HA   4  
ATOM 6816  H HB2  . LYS A 1 9   ? 136.428 0.047   -115.216 1.00 0.00 ? 9   LYS A HB2  4  
ATOM 6817  H HB3  . LYS A 1 9   ? 136.958 -1.635  -115.238 1.00 0.00 ? 9   LYS A HB3  4  
ATOM 6818  H HG2  . LYS A 1 9   ? 136.033 -0.245  -112.714 1.00 0.00 ? 9   LYS A HG2  4  
ATOM 6819  H HG3  . LYS A 1 9   ? 134.937 -1.144  -113.765 1.00 0.00 ? 9   LYS A HG3  4  
ATOM 6820  H HD2  . LYS A 1 9   ? 136.574 -3.105  -113.540 1.00 0.00 ? 9   LYS A HD2  4  
ATOM 6821  H HD3  . LYS A 1 9   ? 137.314 -2.196  -112.221 1.00 0.00 ? 9   LYS A HD3  4  
ATOM 6822  H HE2  . LYS A 1 9   ? 135.497 -3.880  -111.560 1.00 0.00 ? 9   LYS A HE2  4  
ATOM 6823  H HE3  . LYS A 1 9   ? 135.315 -2.244  -110.928 1.00 0.00 ? 9   LYS A HE3  4  
ATOM 6824  H HZ1  . LYS A 1 9   ? 134.095 -2.878  -113.513 1.00 0.00 ? 9   LYS A HZ1  4  
ATOM 6825  H HZ2  . LYS A 1 9   ? 133.580 -1.798  -112.307 1.00 0.00 ? 9   LYS A HZ2  4  
ATOM 6826  H HZ3  . LYS A 1 9   ? 133.343 -3.469  -112.112 1.00 0.00 ? 9   LYS A HZ3  4  
ATOM 6827  N N    . LEU A 1 10  ? 140.453 -1.273  -114.153 1.00 0.00 ? 10  LEU A N    4  
ATOM 6828  C CA   . LEU A 1 10  ? 141.475 -2.361  -114.163 1.00 0.00 ? 10  LEU A CA   4  
ATOM 6829  C C    . LEU A 1 10  ? 141.666 -2.958  -112.772 1.00 0.00 ? 10  LEU A C    4  
ATOM 6830  O O    . LEU A 1 10  ? 140.986 -2.618  -111.828 1.00 0.00 ? 10  LEU A O    4  
ATOM 6831  C CB   . LEU A 1 10  ? 142.808 -1.762  -114.602 1.00 0.00 ? 10  LEU A CB   4  
ATOM 6832  C CG   . LEU A 1 10  ? 143.344 -2.568  -115.787 1.00 0.00 ? 10  LEU A CG   4  
ATOM 6833  C CD1  . LEU A 1 10  ? 142.339 -2.511  -116.940 1.00 0.00 ? 10  LEU A CD1  4  
ATOM 6834  C CD2  . LEU A 1 10  ? 144.670 -1.972  -116.243 1.00 0.00 ? 10  LEU A CD2  4  
ATOM 6835  H H    . LEU A 1 10  ? 140.749 -0.339  -114.195 1.00 0.00 ? 10  LEU A H    4  
ATOM 6836  H HA   . LEU A 1 10  ? 141.226 -3.133  -114.878 1.00 0.00 ? 10  LEU A HA   4  
ATOM 6837  H HB2  . LEU A 1 10  ? 142.662 -0.736  -114.898 1.00 0.00 ? 10  LEU A HB2  4  
ATOM 6838  H HB3  . LEU A 1 10  ? 143.516 -1.810  -113.790 1.00 0.00 ? 10  LEU A HB3  4  
ATOM 6839  H HG   . LEU A 1 10  ? 143.491 -3.594  -115.487 1.00 0.00 ? 10  LEU A HG   4  
ATOM 6840  H HD11 . LEU A 1 10  ? 141.606 -1.743  -116.742 1.00 0.00 ? 10  LEU A HD11 4  
ATOM 6841  H HD12 . LEU A 1 10  ? 141.844 -3.467  -117.033 1.00 0.00 ? 10  LEU A HD12 4  
ATOM 6842  H HD13 . LEU A 1 10  ? 142.859 -2.285  -117.860 1.00 0.00 ? 10  LEU A HD13 4  
ATOM 6843  H HD21 . LEU A 1 10  ? 145.375 -2.767  -116.434 1.00 0.00 ? 10  LEU A HD21 4  
ATOM 6844  H HD22 . LEU A 1 10  ? 145.055 -1.325  -115.469 1.00 0.00 ? 10  LEU A HD22 4  
ATOM 6845  H HD23 . LEU A 1 10  ? 144.512 -1.404  -117.148 1.00 0.00 ? 10  LEU A HD23 4  
ATOM 6846  N N    . GLN A 1 11  ? 142.626 -3.836  -112.657 1.00 0.00 ? 11  GLN A N    4  
ATOM 6847  C CA   . GLN A 1 11  ? 142.940 -4.467  -111.346 1.00 0.00 ? 11  GLN A CA   4  
ATOM 6848  C C    . GLN A 1 11  ? 144.413 -4.204  -111.041 1.00 0.00 ? 11  GLN A C    4  
ATOM 6849  O O    . GLN A 1 11  ? 145.134 -3.672  -111.860 1.00 0.00 ? 11  GLN A O    4  
ATOM 6850  C CB   . GLN A 1 11  ? 142.688 -5.974  -111.425 1.00 0.00 ? 11  GLN A CB   4  
ATOM 6851  C CG   . GLN A 1 11  ? 143.144 -6.498  -112.789 1.00 0.00 ? 11  GLN A CG   4  
ATOM 6852  C CD   . GLN A 1 11  ? 142.069 -6.200  -113.836 1.00 0.00 ? 11  GLN A CD   4  
ATOM 6853  O OE1  . GLN A 1 11  ? 142.197 -6.585  -114.981 1.00 0.00 ? 11  GLN A OE1  4  
ATOM 6854  N NE2  . GLN A 1 11  ? 141.005 -5.527  -113.490 1.00 0.00 ? 11  GLN A NE2  4  
ATOM 6855  H H    . GLN A 1 11  ? 143.164 -4.067  -113.442 1.00 0.00 ? 11  GLN A H    4  
ATOM 6856  H HA   . GLN A 1 11  ? 142.331 -4.033  -110.573 1.00 0.00 ? 11  GLN A HA   4  
ATOM 6857  H HB2  . GLN A 1 11  ? 143.241 -6.473  -110.644 1.00 0.00 ? 11  GLN A HB2  4  
ATOM 6858  H HB3  . GLN A 1 11  ? 141.633 -6.169  -111.302 1.00 0.00 ? 11  GLN A HB3  4  
ATOM 6859  H HG2  . GLN A 1 11  ? 144.066 -6.010  -113.070 1.00 0.00 ? 11  GLN A HG2  4  
ATOM 6860  H HG3  . GLN A 1 11  ? 143.302 -7.563  -112.731 1.00 0.00 ? 11  GLN A HG3  4  
ATOM 6861  H HE21 . GLN A 1 11  ? 140.902 -5.217  -112.566 1.00 0.00 ? 11  GLN A HE21 4  
ATOM 6862  H HE22 . GLN A 1 11  ? 140.311 -5.332  -114.153 1.00 0.00 ? 11  GLN A HE22 4  
ATOM 6863  N N    . LEU A 1 12  ? 144.878 -4.585  -109.887 1.00 0.00 ? 12  LEU A N    4  
ATOM 6864  C CA   . LEU A 1 12  ? 146.317 -4.359  -109.571 1.00 0.00 ? 12  LEU A CA   4  
ATOM 6865  C C    . LEU A 1 12  ? 146.711 -5.212  -108.367 1.00 0.00 ? 12  LEU A C    4  
ATOM 6866  O O    . LEU A 1 12  ? 145.913 -5.463  -107.489 1.00 0.00 ? 12  LEU A O    4  
ATOM 6867  C CB   . LEU A 1 12  ? 146.561 -2.881  -109.258 1.00 0.00 ? 12  LEU A CB   4  
ATOM 6868  C CG   . LEU A 1 12  ? 147.233 -2.203  -110.458 1.00 0.00 ? 12  LEU A CG   4  
ATOM 6869  C CD1  . LEU A 1 12  ? 146.271 -1.190  -111.077 1.00 0.00 ? 12  LEU A CD1  4  
ATOM 6870  C CD2  . LEU A 1 12  ? 148.500 -1.482  -109.993 1.00 0.00 ? 12  LEU A CD2  4  
ATOM 6871  H H    . LEU A 1 12  ? 144.297 -5.038  -109.240 1.00 0.00 ? 12  LEU A H    4  
ATOM 6872  H HA   . LEU A 1 12  ? 146.907 -4.648  -110.424 1.00 0.00 ? 12  LEU A HA   4  
ATOM 6873  H HB2  . LEU A 1 12  ? 145.619 -2.397  -109.050 1.00 0.00 ? 12  LEU A HB2  4  
ATOM 6874  H HB3  . LEU A 1 12  ? 147.205 -2.801  -108.398 1.00 0.00 ? 12  LEU A HB3  4  
ATOM 6875  H HG   . LEU A 1 12  ? 147.492 -2.946  -111.198 1.00 0.00 ? 12  LEU A HG   4  
ATOM 6876  H HD11 . LEU A 1 12  ? 146.653 -0.873  -112.037 1.00 0.00 ? 12  LEU A HD11 4  
ATOM 6877  H HD12 . LEU A 1 12  ? 146.179 -0.336  -110.424 1.00 0.00 ? 12  LEU A HD12 4  
ATOM 6878  H HD13 . LEU A 1 12  ? 145.304 -1.647  -111.209 1.00 0.00 ? 12  LEU A HD13 4  
ATOM 6879  H HD21 . LEU A 1 12  ? 148.318 -1.016  -109.035 1.00 0.00 ? 12  LEU A HD21 4  
ATOM 6880  H HD22 . LEU A 1 12  ? 148.770 -0.725  -110.715 1.00 0.00 ? 12  LEU A HD22 4  
ATOM 6881  H HD23 . LEU A 1 12  ? 149.306 -2.194  -109.900 1.00 0.00 ? 12  LEU A HD23 4  
ATOM 6882  N N    . PRO A 1 13  ? 147.935 -5.667  -108.341 1.00 0.00 ? 13  PRO A N    4  
ATOM 6883  C CA   . PRO A 1 13  ? 148.442 -6.529  -107.235 1.00 0.00 ? 13  PRO A CA   4  
ATOM 6884  C C    . PRO A 1 13  ? 148.974 -5.729  -106.041 1.00 0.00 ? 13  PRO A C    4  
ATOM 6885  O O    . PRO A 1 13  ? 149.842 -4.892  -106.189 1.00 0.00 ? 13  PRO A O    4  
ATOM 6886  C CB   . PRO A 1 13  ? 149.599 -7.217  -107.944 1.00 0.00 ? 13  PRO A CB   4  
ATOM 6887  C CG   . PRO A 1 13  ? 150.110 -6.232  -109.000 1.00 0.00 ? 13  PRO A CG   4  
ATOM 6888  C CD   . PRO A 1 13  ? 148.921 -5.365  -109.418 1.00 0.00 ? 13  PRO A CD   4  
ATOM 6889  H HA   . PRO A 1 13  ? 147.713 -7.256  -106.931 1.00 0.00 ? 13  PRO A HA   4  
ATOM 6890  H HB2  . PRO A 1 13  ? 150.376 -7.452  -107.238 1.00 0.00 ? 13  PRO A HB2  4  
ATOM 6891  H HB3  . PRO A 1 13  ? 149.254 -8.117  -108.427 1.00 0.00 ? 13  PRO A HB3  4  
ATOM 6892  H HG2  . PRO A 1 13  ? 150.887 -5.611  -108.574 1.00 0.00 ? 13  PRO A HG2  4  
ATOM 6893  H HG3  . PRO A 1 13  ? 150.492 -6.761  -109.854 1.00 0.00 ? 13  PRO A HG3  4  
ATOM 6894  H HD2  . PRO A 1 13  ? 149.191 -4.317  -109.422 1.00 0.00 ? 13  PRO A HD2  4  
ATOM 6895  H HD3  . PRO A 1 13  ? 148.541 -5.676  -110.376 1.00 0.00 ? 13  PRO A HD3  4  
ATOM 6896  N N    . ALA A 1 14  ? 148.493 -5.992  -104.856 1.00 0.00 ? 14  ALA A N    4  
ATOM 6897  C CA   . ALA A 1 14  ? 149.024 -5.252  -103.679 1.00 0.00 ? 14  ALA A CA   4  
ATOM 6898  C C    . ALA A 1 14  ? 150.436 -5.780  -103.407 1.00 0.00 ? 14  ALA A C    4  
ATOM 6899  O O    . ALA A 1 14  ? 150.698 -6.957  -103.562 1.00 0.00 ? 14  ALA A O    4  
ATOM 6900  C CB   . ALA A 1 14  ? 148.117 -5.474  -102.466 1.00 0.00 ? 14  ALA A CB   4  
ATOM 6901  H H    . ALA A 1 14  ? 147.809 -6.685  -104.740 1.00 0.00 ? 14  ALA A H    4  
ATOM 6902  H HA   . ALA A 1 14  ? 149.069 -4.200  -103.922 1.00 0.00 ? 14  ALA A HA   4  
ATOM 6903  H HB1  . ALA A 1 14  ? 147.649 -4.541  -102.189 1.00 0.00 ? 14  ALA A HB1  4  
ATOM 6904  H HB2  . ALA A 1 14  ? 148.704 -5.841  -101.638 1.00 0.00 ? 14  ALA A HB2  4  
ATOM 6905  H HB3  . ALA A 1 14  ? 147.354 -6.197  -102.715 1.00 0.00 ? 14  ALA A HB3  4  
ATOM 6906  N N    . GLY A 1 15  ? 151.352 -4.933  -103.006 1.00 0.00 ? 15  GLY A N    4  
ATOM 6907  C CA   . GLY A 1 15  ? 152.745 -5.415  -102.743 1.00 0.00 ? 15  GLY A CA   4  
ATOM 6908  C C    . GLY A 1 15  ? 153.237 -6.164  -103.981 1.00 0.00 ? 15  GLY A C    4  
ATOM 6909  O O    . GLY A 1 15  ? 153.499 -7.350  -103.945 1.00 0.00 ? 15  GLY A O    4  
ATOM 6910  H H    . GLY A 1 15  ? 151.127 -3.987  -102.883 1.00 0.00 ? 15  GLY A H    4  
ATOM 6911  H HA2  . GLY A 1 15  ? 153.390 -4.571  -102.544 1.00 0.00 ? 15  GLY A HA2  4  
ATOM 6912  H HA3  . GLY A 1 15  ? 152.745 -6.084  -101.895 1.00 0.00 ? 15  GLY A HA3  4  
ATOM 6913  N N    . LYS A 1 16  ? 153.322 -5.479  -105.088 1.00 0.00 ? 16  LYS A N    4  
ATOM 6914  C CA   . LYS A 1 16  ? 153.747 -6.129  -106.358 1.00 0.00 ? 16  LYS A CA   4  
ATOM 6915  C C    . LYS A 1 16  ? 153.609 -5.120  -107.499 1.00 0.00 ? 16  LYS A C    4  
ATOM 6916  O O    . LYS A 1 16  ? 154.294 -5.208  -108.499 1.00 0.00 ? 16  LYS A O    4  
ATOM 6917  C CB   . LYS A 1 16  ? 152.846 -7.331  -106.625 1.00 0.00 ? 16  LYS A CB   4  
ATOM 6918  C CG   . LYS A 1 16  ? 153.008 -7.781  -108.079 1.00 0.00 ? 16  LYS A CG   4  
ATOM 6919  C CD   . LYS A 1 16  ? 152.787 -9.292  -108.175 1.00 0.00 ? 16  LYS A CD   4  
ATOM 6920  C CE   . LYS A 1 16  ? 153.192 -9.780  -109.568 1.00 0.00 ? 16  LYS A CE   4  
ATOM 6921  N NZ   . LYS A 1 16  ? 154.527 -10.437 -109.496 1.00 0.00 ? 16  LYS A NZ   4  
ATOM 6922  H H    . LYS A 1 16  ? 153.075 -4.531  -105.094 1.00 0.00 ? 16  LYS A H    4  
ATOM 6923  H HA   . LYS A 1 16  ? 154.776 -6.458  -106.342 1.00 0.00 ? 16  LYS A HA   4  
ATOM 6924  H HB2  . LYS A 1 16  ? 153.123 -8.140  -105.965 1.00 0.00 ? 16  LYS A HB2  4  
ATOM 6925  H HB3  . LYS A 1 16  ? 151.823 -7.054  -106.444 1.00 0.00 ? 16  LYS A HB3  4  
ATOM 6926  H HG2  . LYS A 1 16  ? 152.283 -7.271  -108.696 1.00 0.00 ? 16  LYS A HG2  4  
ATOM 6927  H HG3  . LYS A 1 16  ? 154.003 -7.544  -108.421 1.00 0.00 ? 16  LYS A HG3  4  
ATOM 6928  H HD2  . LYS A 1 16  ? 153.387 -9.792  -107.429 1.00 0.00 ? 16  LYS A HD2  4  
ATOM 6929  H HD3  . LYS A 1 16  ? 151.744 -9.515  -108.007 1.00 0.00 ? 16  LYS A HD3  4  
ATOM 6930  H HE2  . LYS A 1 16  ? 152.460 -10.488 -109.928 1.00 0.00 ? 16  LYS A HE2  4  
ATOM 6931  H HE3  . LYS A 1 16  ? 153.240 -8.938  -110.244 1.00 0.00 ? 16  LYS A HE3  4  
ATOM 6932  H HZ1  . LYS A 1 16  ? 154.633 -11.096 -110.292 1.00 0.00 ? 16  LYS A HZ1  4  
ATOM 6933  H HZ2  . LYS A 1 16  ? 154.609 -10.958 -108.600 1.00 0.00 ? 16  LYS A HZ2  4  
ATOM 6934  H HZ3  . LYS A 1 16  ? 155.272 -9.714  -109.546 1.00 0.00 ? 16  LYS A HZ3  4  
ATOM 6935  N N    . ALA A 1 17  ? 152.747 -4.150  -107.360 1.00 0.00 ? 17  ALA A N    4  
ATOM 6936  C CA   . ALA A 1 17  ? 152.605 -3.136  -108.442 1.00 0.00 ? 17  ALA A CA   4  
ATOM 6937  C C    . ALA A 1 17  ? 153.960 -2.458  -108.648 1.00 0.00 ? 17  ALA A C    4  
ATOM 6938  O O    . ALA A 1 17  ? 154.771 -2.393  -107.745 1.00 0.00 ? 17  ALA A O    4  
ATOM 6939  C CB   . ALA A 1 17  ? 151.558 -2.099  -108.043 1.00 0.00 ? 17  ALA A CB   4  
ATOM 6940  H H    . ALA A 1 17  ? 152.211 -4.079  -106.543 1.00 0.00 ? 17  ALA A H    4  
ATOM 6941  H HA   . ALA A 1 17  ? 152.300 -3.619  -109.358 1.00 0.00 ? 17  ALA A HA   4  
ATOM 6942  H HB1  . ALA A 1 17  ? 151.328 -1.475  -108.895 1.00 0.00 ? 17  ALA A HB1  4  
ATOM 6943  H HB2  . ALA A 1 17  ? 151.942 -1.489  -107.240 1.00 0.00 ? 17  ALA A HB2  4  
ATOM 6944  H HB3  . ALA A 1 17  ? 150.660 -2.605  -107.716 1.00 0.00 ? 17  ALA A HB3  4  
ATOM 6945  N N    . THR A 1 18  ? 154.226 -1.970  -109.826 1.00 0.00 ? 18  THR A N    4  
ATOM 6946  C CA   . THR A 1 18  ? 155.543 -1.322  -110.074 1.00 0.00 ? 18  THR A CA   4  
ATOM 6947  C C    . THR A 1 18  ? 155.510 -0.562  -111.396 1.00 0.00 ? 18  THR A C    4  
ATOM 6948  O O    . THR A 1 18  ? 154.628 -0.757  -112.208 1.00 0.00 ? 18  THR A O    4  
ATOM 6949  C CB   . THR A 1 18  ? 156.618 -2.408  -110.154 1.00 0.00 ? 18  THR A CB   4  
ATOM 6950  O OG1  . THR A 1 18  ? 155.991 -3.680  -110.248 1.00 0.00 ? 18  THR A OG1  4  
ATOM 6951  C CG2  . THR A 1 18  ? 157.494 -2.365  -108.907 1.00 0.00 ? 18  THR A CG2  4  
ATOM 6952  H H    . THR A 1 18  ? 153.571 -2.046  -110.549 1.00 0.00 ? 18  THR A H    4  
ATOM 6953  H HA   . THR A 1 18  ? 155.772 -0.642  -109.270 1.00 0.00 ? 18  THR A HA   4  
ATOM 6954  H HB   . THR A 1 18  ? 157.231 -2.245  -111.027 1.00 0.00 ? 18  THR A HB   4  
ATOM 6955  H HG1  . THR A 1 18  ? 156.605 -4.282  -110.676 1.00 0.00 ? 18  THR A HG1  4  
ATOM 6956  H HG21 . THR A 1 18  ? 158.512 -2.595  -109.180 1.00 0.00 ? 18  THR A HG21 4  
ATOM 6957  H HG22 . THR A 1 18  ? 157.136 -3.093  -108.196 1.00 0.00 ? 18  THR A HG22 4  
ATOM 6958  H HG23 . THR A 1 18  ? 157.451 -1.380  -108.468 1.00 0.00 ? 18  THR A HG23 4  
ATOM 6959  N N    . PRO A 1 19  ? 156.482 0.287   -111.616 1.00 0.00 ? 19  PRO A N    4  
ATOM 6960  C CA   . PRO A 1 19  ? 156.571 1.061   -112.879 1.00 0.00 ? 19  PRO A CA   4  
ATOM 6961  C C    . PRO A 1 19  ? 156.442 0.158   -114.107 1.00 0.00 ? 19  PRO A C    4  
ATOM 6962  O O    . PRO A 1 19  ? 157.067 0.375   -115.125 1.00 0.00 ? 19  PRO A O    4  
ATOM 6963  C CB   . PRO A 1 19  ? 157.961 1.690   -112.792 1.00 0.00 ? 19  PRO A CB   4  
ATOM 6964  C CG   . PRO A 1 19  ? 158.580 1.335   -111.433 1.00 0.00 ? 19  PRO A CG   4  
ATOM 6965  C CD   . PRO A 1 19  ? 157.559 0.528   -110.623 1.00 0.00 ? 19  PRO A CD   4  
ATOM 6966  H HA   . PRO A 1 19  ? 155.828 1.840   -112.930 1.00 0.00 ? 19  PRO A HA   4  
ATOM 6967  H HB2  . PRO A 1 19  ? 158.577 1.309   -113.589 1.00 0.00 ? 19  PRO A HB2  4  
ATOM 6968  H HB3  . PRO A 1 19  ? 157.879 2.763   -112.880 1.00 0.00 ? 19  PRO A HB3  4  
ATOM 6969  H HG2  . PRO A 1 19  ? 159.473 0.747   -111.584 1.00 0.00 ? 19  PRO A HG2  4  
ATOM 6970  H HG3  . PRO A 1 19  ? 158.827 2.241   -110.900 1.00 0.00 ? 19  PRO A HG3  4  
ATOM 6971  H HD2  . PRO A 1 19  ? 157.992 -0.402  -110.285 1.00 0.00 ? 19  PRO A HD2  4  
ATOM 6972  H HD3  . PRO A 1 19  ? 157.182 1.105   -109.794 1.00 0.00 ? 19  PRO A HD3  4  
ATOM 6973  N N    . ALA A 1 20  ? 155.621 -0.847  -114.012 1.00 0.00 ? 20  ALA A N    4  
ATOM 6974  C CA   . ALA A 1 20  ? 155.427 -1.765  -115.167 1.00 0.00 ? 20  ALA A CA   4  
ATOM 6975  C C    . ALA A 1 20  ? 154.090 -2.495  -115.026 1.00 0.00 ? 20  ALA A C    4  
ATOM 6976  O O    . ALA A 1 20  ? 154.031 -3.708  -115.070 1.00 0.00 ? 20  ALA A O    4  
ATOM 6977  C CB   . ALA A 1 20  ? 156.564 -2.787  -115.200 1.00 0.00 ? 20  ALA A CB   4  
ATOM 6978  H H    . ALA A 1 20  ? 155.117 -0.976  -113.179 1.00 0.00 ? 20  ALA A H    4  
ATOM 6979  H HA   . ALA A 1 20  ? 155.431 -1.195  -116.083 1.00 0.00 ? 20  ALA A HA   4  
ATOM 6980  H HB1  . ALA A 1 20  ? 156.433 -3.499  -114.399 1.00 0.00 ? 20  ALA A HB1  4  
ATOM 6981  H HB2  . ALA A 1 20  ? 157.509 -2.279  -115.080 1.00 0.00 ? 20  ALA A HB2  4  
ATOM 6982  H HB3  . ALA A 1 20  ? 156.554 -3.307  -116.148 1.00 0.00 ? 20  ALA A HB3  4  
ATOM 6983  N N    . PRO A 1 21  ? 153.022 -1.758  -114.871 1.00 0.00 ? 21  PRO A N    4  
ATOM 6984  C CA   . PRO A 1 21  ? 151.671 -2.361  -114.740 1.00 0.00 ? 21  PRO A CA   4  
ATOM 6985  C C    . PRO A 1 21  ? 151.099 -2.777  -116.097 1.00 0.00 ? 21  PRO A C    4  
ATOM 6986  O O    . PRO A 1 21  ? 151.630 -2.428  -117.132 1.00 0.00 ? 21  PRO A O    4  
ATOM 6987  C CB   . PRO A 1 21  ? 150.862 -1.203  -114.155 1.00 0.00 ? 21  PRO A CB   4  
ATOM 6988  C CG   . PRO A 1 21  ? 151.668 0.092   -114.338 1.00 0.00 ? 21  PRO A CG   4  
ATOM 6989  C CD   . PRO A 1 21  ? 153.081 -0.274  -114.807 1.00 0.00 ? 21  PRO A CD   4  
ATOM 6990  H HA   . PRO A 1 21  ? 151.681 -3.188  -114.050 1.00 0.00 ? 21  PRO A HA   4  
ATOM 6991  H HB2  . PRO A 1 21  ? 149.917 -1.121  -114.675 1.00 0.00 ? 21  PRO A HB2  4  
ATOM 6992  H HB3  . PRO A 1 21  ? 150.687 -1.373  -113.105 1.00 0.00 ? 21  PRO A HB3  4  
ATOM 6993  H HG2  . PRO A 1 21  ? 151.188 0.717   -115.076 1.00 0.00 ? 21  PRO A HG2  4  
ATOM 6994  H HG3  . PRO A 1 21  ? 151.726 0.619   -113.397 1.00 0.00 ? 21  PRO A HG3  4  
ATOM 6995  H HD2  . PRO A 1 21  ? 153.281 0.151   -115.782 1.00 0.00 ? 21  PRO A HD2  4  
ATOM 6996  H HD3  . PRO A 1 21  ? 153.814 0.045   -114.087 1.00 0.00 ? 21  PRO A HD3  4  
ATOM 6997  N N    . PRO A 1 22  ? 150.016 -3.501  -116.093 1.00 0.00 ? 22  PRO A N    4  
ATOM 6998  C CA   . PRO A 1 22  ? 149.376 -3.937  -117.360 1.00 0.00 ? 22  PRO A CA   4  
ATOM 6999  C C    . PRO A 1 22  ? 148.944 -2.737  -118.206 1.00 0.00 ? 22  PRO A C    4  
ATOM 7000  O O    . PRO A 1 22  ? 148.464 -2.878  -119.314 1.00 0.00 ? 22  PRO A O    4  
ATOM 7001  C CB   . PRO A 1 22  ? 148.161 -4.728  -116.870 1.00 0.00 ? 22  PRO A CB   4  
ATOM 7002  C CG   . PRO A 1 22  ? 148.155 -4.732  -115.335 1.00 0.00 ? 22  PRO A CG   4  
ATOM 7003  C CD   . PRO A 1 22  ? 149.358 -3.930  -114.832 1.00 0.00 ? 22  PRO A CD   4  
ATOM 7004  H HA   . PRO A 1 22  ? 150.033 -4.583  -117.918 1.00 0.00 ? 22  PRO A HA   4  
ATOM 7005  H HB2  . PRO A 1 22  ? 147.256 -4.264  -117.237 1.00 0.00 ? 22  PRO A HB2  4  
ATOM 7006  H HB3  . PRO A 1 22  ? 148.219 -5.743  -117.232 1.00 0.00 ? 22  PRO A HB3  4  
ATOM 7007  H HG2  . PRO A 1 22  ? 147.241 -4.280  -114.975 1.00 0.00 ? 22  PRO A HG2  4  
ATOM 7008  H HG3  . PRO A 1 22  ? 148.224 -5.748  -114.975 1.00 0.00 ? 22  PRO A HG3  4  
ATOM 7009  H HD2  . PRO A 1 22  ? 149.031 -3.075  -114.254 1.00 0.00 ? 22  PRO A HD2  4  
ATOM 7010  H HD3  . PRO A 1 22  ? 150.022 -4.555  -114.255 1.00 0.00 ? 22  PRO A HD3  4  
ATOM 7011  N N    . VAL A 1 23  ? 149.103 -1.555  -117.674 1.00 0.00 ? 23  VAL A N    4  
ATOM 7012  C CA   . VAL A 1 23  ? 148.700 -0.328  -118.416 1.00 0.00 ? 23  VAL A CA   4  
ATOM 7013  C C    . VAL A 1 23  ? 149.930 0.503   -118.774 1.00 0.00 ? 23  VAL A C    4  
ATOM 7014  O O    . VAL A 1 23  ? 150.268 0.665   -119.933 1.00 0.00 ? 23  VAL A O    4  
ATOM 7015  C CB   . VAL A 1 23  ? 147.795 0.515   -117.529 1.00 0.00 ? 23  VAL A CB   4  
ATOM 7016  C CG1  . VAL A 1 23  ? 147.102 1.560   -118.390 1.00 0.00 ? 23  VAL A CG1  4  
ATOM 7017  C CG2  . VAL A 1 23  ? 146.750 -0.378  -116.871 1.00 0.00 ? 23  VAL A CG2  4  
ATOM 7018  H H    . VAL A 1 23  ? 149.484 -1.475  -116.775 1.00 0.00 ? 23  VAL A H    4  
ATOM 7019  H HA   . VAL A 1 23  ? 148.166 -0.594  -119.317 1.00 0.00 ? 23  VAL A HA   4  
ATOM 7020  H HB   . VAL A 1 23  ? 148.386 1.006   -116.770 1.00 0.00 ? 23  VAL A HB   4  
ATOM 7021  H HG11 . VAL A 1 23  ? 146.346 1.082   -118.993 1.00 0.00 ? 23  VAL A HG11 4  
ATOM 7022  H HG12 . VAL A 1 23  ? 147.833 2.027   -119.030 1.00 0.00 ? 23  VAL A HG12 4  
ATOM 7023  H HG13 . VAL A 1 23  ? 146.643 2.304   -117.760 1.00 0.00 ? 23  VAL A HG13 4  
ATOM 7024  H HG21 . VAL A 1 23  ? 145.820 0.164   -116.790 1.00 0.00 ? 23  VAL A HG21 4  
ATOM 7025  H HG22 . VAL A 1 23  ? 147.090 -0.662  -115.885 1.00 0.00 ? 23  VAL A HG22 4  
ATOM 7026  H HG23 . VAL A 1 23  ? 146.605 -1.262  -117.472 1.00 0.00 ? 23  VAL A HG23 4  
ATOM 7027  N N    . GLY A 1 24  ? 150.546 1.097   -117.783 1.00 0.00 ? 24  GLY A N    4  
ATOM 7028  C CA   . GLY A 1 24  ? 151.719 1.983   -118.030 1.00 0.00 ? 24  GLY A CA   4  
ATOM 7029  C C    . GLY A 1 24  ? 151.296 3.069   -119.010 1.00 0.00 ? 24  GLY A C    4  
ATOM 7030  O O    . GLY A 1 24  ? 150.655 4.031   -118.633 1.00 0.00 ? 24  GLY A O    4  
ATOM 7031  H H    . GLY A 1 24  ? 150.193 1.014   -116.872 1.00 0.00 ? 24  GLY A H    4  
ATOM 7032  H HA2  . GLY A 1 24  ? 152.036 2.432   -117.098 1.00 0.00 ? 24  GLY A HA2  4  
ATOM 7033  H HA3  . GLY A 1 24  ? 152.525 1.409   -118.450 1.00 0.00 ? 24  GLY A HA3  4  
ATOM 7034  N N    . PRO A 1 25  ? 151.588 2.903   -120.271 1.00 0.00 ? 25  PRO A N    4  
ATOM 7035  C CA   . PRO A 1 25  ? 151.144 3.895   -121.273 1.00 0.00 ? 25  PRO A CA   4  
ATOM 7036  C C    . PRO A 1 25  ? 149.621 4.026   -121.254 1.00 0.00 ? 25  PRO A C    4  
ATOM 7037  O O    . PRO A 1 25  ? 149.074 5.101   -121.111 1.00 0.00 ? 25  PRO A O    4  
ATOM 7038  C CB   . PRO A 1 25  ? 151.627 3.286   -122.592 1.00 0.00 ? 25  PRO A CB   4  
ATOM 7039  C CG   . PRO A 1 25  ? 152.341 1.959   -122.293 1.00 0.00 ? 25  PRO A CG   4  
ATOM 7040  C CD   . PRO A 1 25  ? 152.384 1.752   -120.775 1.00 0.00 ? 25  PRO A CD   4  
ATOM 7041  H HA   . PRO A 1 25  ? 151.616 4.850   -121.109 1.00 0.00 ? 25  PRO A HA   4  
ATOM 7042  H HB2  . PRO A 1 25  ? 150.782 3.106   -123.240 1.00 0.00 ? 25  PRO A HB2  4  
ATOM 7043  H HB3  . PRO A 1 25  ? 152.316 3.963   -123.073 1.00 0.00 ? 25  PRO A HB3  4  
ATOM 7044  H HG2  . PRO A 1 25  ? 151.800 1.145   -122.755 1.00 0.00 ? 25  PRO A HG2  4  
ATOM 7045  H HG3  . PRO A 1 25  ? 153.348 1.993   -122.680 1.00 0.00 ? 25  PRO A HG3  4  
ATOM 7046  H HD2  . PRO A 1 25  ? 151.934 0.810   -120.506 1.00 0.00 ? 25  PRO A HD2  4  
ATOM 7047  H HD3  . PRO A 1 25  ? 153.398 1.813   -120.411 1.00 0.00 ? 25  PRO A HD3  4  
ATOM 7048  N N    . ALA A 1 26  ? 148.938 2.927   -121.426 1.00 0.00 ? 26  ALA A N    4  
ATOM 7049  C CA   . ALA A 1 26  ? 147.448 2.962   -121.450 1.00 0.00 ? 26  ALA A CA   4  
ATOM 7050  C C    . ALA A 1 26  ? 146.903 3.756   -120.256 1.00 0.00 ? 26  ALA A C    4  
ATOM 7051  O O    . ALA A 1 26  ? 145.729 4.063   -120.199 1.00 0.00 ? 26  ALA A O    4  
ATOM 7052  C CB   . ALA A 1 26  ? 146.901 1.532   -121.415 1.00 0.00 ? 26  ALA A CB   4  
ATOM 7053  H H    . ALA A 1 26  ? 149.415 2.078   -121.579 1.00 0.00 ? 26  ALA A H    4  
ATOM 7054  H HA   . ALA A 1 26  ? 147.124 3.437   -122.364 1.00 0.00 ? 26  ALA A HA   4  
ATOM 7055  H HB1  . ALA A 1 26  ? 146.872 1.135   -122.418 1.00 0.00 ? 26  ALA A HB1  4  
ATOM 7056  H HB2  . ALA A 1 26  ? 145.905 1.538   -121.001 1.00 0.00 ? 26  ALA A HB2  4  
ATOM 7057  H HB3  . ALA A 1 26  ? 147.544 0.915   -120.805 1.00 0.00 ? 26  ALA A HB3  4  
ATOM 7058  N N    . LEU A 1 27  ? 147.732 4.106   -119.305 1.00 0.00 ? 27  LEU A N    4  
ATOM 7059  C CA   . LEU A 1 27  ? 147.208 4.889   -118.148 1.00 0.00 ? 27  LEU A CA   4  
ATOM 7060  C C    . LEU A 1 27  ? 147.627 6.343   -118.336 1.00 0.00 ? 27  LEU A C    4  
ATOM 7061  O O    . LEU A 1 27  ? 146.832 7.255   -118.227 1.00 0.00 ? 27  LEU A O    4  
ATOM 7062  C CB   . LEU A 1 27  ? 147.792 4.350   -116.840 1.00 0.00 ? 27  LEU A CB   4  
ATOM 7063  C CG   . LEU A 1 27  ? 146.689 4.160   -115.793 1.00 0.00 ? 27  LEU A CG   4  
ATOM 7064  C CD1  . LEU A 1 27  ? 147.326 4.161   -114.407 1.00 0.00 ? 27  LEU A CD1  4  
ATOM 7065  C CD2  . LEU A 1 27  ? 145.672 5.301   -115.876 1.00 0.00 ? 27  LEU A CD2  4  
ATOM 7066  H H    . LEU A 1 27  ? 148.681 3.863   -119.365 1.00 0.00 ? 27  LEU A H    4  
ATOM 7067  H HA   . LEU A 1 27  ? 146.132 4.796   -118.157 1.00 0.00 ? 27  LEU A HA   4  
ATOM 7068  H HB2  . LEU A 1 27  ? 148.275 3.402   -117.026 1.00 0.00 ? 27  LEU A HB2  4  
ATOM 7069  H HB3  . LEU A 1 27  ? 148.521 5.050   -116.462 1.00 0.00 ? 27  LEU A HB3  4  
ATOM 7070  H HG   . LEU A 1 27  ? 146.190 3.217   -115.957 1.00 0.00 ? 27  LEU A HG   4  
ATOM 7071  H HD11 . LEU A 1 27  ? 146.792 3.478   -113.764 1.00 0.00 ? 27  LEU A HD11 4  
ATOM 7072  H HD12 . LEU A 1 27  ? 147.287 5.157   -113.992 1.00 0.00 ? 27  LEU A HD12 4  
ATOM 7073  H HD13 . LEU A 1 27  ? 148.355 3.847   -114.492 1.00 0.00 ? 27  LEU A HD13 4  
ATOM 7074  H HD21 . LEU A 1 27  ? 146.128 6.157   -116.348 1.00 0.00 ? 27  LEU A HD21 4  
ATOM 7075  H HD22 . LEU A 1 27  ? 145.351 5.568   -114.879 1.00 0.00 ? 27  LEU A HD22 4  
ATOM 7076  H HD23 . LEU A 1 27  ? 144.819 4.981   -116.454 1.00 0.00 ? 27  LEU A HD23 4  
ATOM 7077  N N    . GLY A 1 28  ? 148.880 6.555   -118.630 1.00 0.00 ? 28  GLY A N    4  
ATOM 7078  C CA   . GLY A 1 28  ? 149.374 7.939   -118.841 1.00 0.00 ? 28  GLY A CA   4  
ATOM 7079  C C    . GLY A 1 28  ? 148.512 8.619   -119.903 1.00 0.00 ? 28  GLY A C    4  
ATOM 7080  O O    . GLY A 1 28  ? 148.832 8.621   -121.075 1.00 0.00 ? 28  GLY A O    4  
ATOM 7081  H H    . GLY A 1 28  ? 149.496 5.798   -118.717 1.00 0.00 ? 28  GLY A H    4  
ATOM 7082  H HA2  . GLY A 1 28  ? 149.311 8.491   -117.914 1.00 0.00 ? 28  GLY A HA2  4  
ATOM 7083  H HA3  . GLY A 1 28  ? 150.400 7.909   -119.176 1.00 0.00 ? 28  GLY A HA3  4  
ATOM 7084  N N    . GLN A 1 29  ? 147.427 9.208   -119.493 1.00 0.00 ? 29  GLN A N    4  
ATOM 7085  C CA   . GLN A 1 29  ? 146.531 9.911   -120.450 1.00 0.00 ? 29  GLN A CA   4  
ATOM 7086  C C    . GLN A 1 29  ? 145.936 11.102  -119.709 1.00 0.00 ? 29  GLN A C    4  
ATOM 7087  O O    . GLN A 1 29  ? 145.483 12.066  -120.294 1.00 0.00 ? 29  GLN A O    4  
ATOM 7088  C CB   . GLN A 1 29  ? 145.414 8.970   -120.906 1.00 0.00 ? 29  GLN A CB   4  
ATOM 7089  C CG   . GLN A 1 29  ? 145.947 8.031   -121.989 1.00 0.00 ? 29  GLN A CG   4  
ATOM 7090  C CD   . GLN A 1 29  ? 144.778 7.299   -122.652 1.00 0.00 ? 29  GLN A CD   4  
ATOM 7091  O OE1  . GLN A 1 29  ? 143.658 7.770   -122.625 1.00 0.00 ? 29  GLN A OE1  4  
ATOM 7092  N NE2  . GLN A 1 29  ? 144.992 6.160   -123.253 1.00 0.00 ? 29  GLN A NE2  4  
ATOM 7093  H H    . GLN A 1 29  ? 147.198 9.210   -118.540 1.00 0.00 ? 29  GLN A H    4  
ATOM 7094  H HA   . GLN A 1 29  ? 147.100 10.254  -121.302 1.00 0.00 ? 29  GLN A HA   4  
ATOM 7095  H HB2  . GLN A 1 29  ? 145.066 8.389   -120.064 1.00 0.00 ? 29  GLN A HB2  4  
ATOM 7096  H HB3  . GLN A 1 29  ? 144.596 9.550   -121.307 1.00 0.00 ? 29  GLN A HB3  4  
ATOM 7097  H HG2  . GLN A 1 29  ? 146.482 8.605   -122.732 1.00 0.00 ? 29  GLN A HG2  4  
ATOM 7098  H HG3  . GLN A 1 29  ? 146.614 7.308   -121.543 1.00 0.00 ? 29  GLN A HG3  4  
ATOM 7099  H HE21 . GLN A 1 29  ? 145.895 5.781   -123.276 1.00 0.00 ? 29  GLN A HE21 4  
ATOM 7100  H HE22 . GLN A 1 29  ? 144.250 5.685   -123.681 1.00 0.00 ? 29  GLN A HE22 4  
ATOM 7101  N N    . HIS A 1 30  ? 145.968 11.034  -118.407 1.00 0.00 ? 30  HIS A N    4  
ATOM 7102  C CA   . HIS A 1 30  ? 145.448 12.144  -117.569 1.00 0.00 ? 30  HIS A CA   4  
ATOM 7103  C C    . HIS A 1 30  ? 146.510 13.237  -117.521 1.00 0.00 ? 30  HIS A C    4  
ATOM 7104  O O    . HIS A 1 30  ? 146.217 14.415  -117.551 1.00 0.00 ? 30  HIS A O    4  
ATOM 7105  C CB   . HIS A 1 30  ? 145.202 11.619  -116.151 1.00 0.00 ? 30  HIS A CB   4  
ATOM 7106  C CG   . HIS A 1 30  ? 146.483 11.668  -115.366 1.00 0.00 ? 30  HIS A CG   4  
ATOM 7107  N ND1  . HIS A 1 30  ? 146.951 12.837  -114.786 1.00 0.00 ? 30  HIS A ND1  4  
ATOM 7108  C CD2  . HIS A 1 30  ? 147.408 10.701  -115.057 1.00 0.00 ? 30  HIS A CD2  4  
ATOM 7109  C CE1  . HIS A 1 30  ? 148.108 12.547  -114.163 1.00 0.00 ? 30  HIS A CE1  4  
ATOM 7110  N NE2  . HIS A 1 30  ? 148.433 11.258  -114.298 1.00 0.00 ? 30  HIS A NE2  4  
ATOM 7111  H H    . HIS A 1 30  ? 146.363 10.248  -117.975 1.00 0.00 ? 30  HIS A H    4  
ATOM 7112  H HA   . HIS A 1 30  ? 144.521 12.527  -117.971 1.00 0.00 ? 30  HIS A HA   4  
ATOM 7113  H HB2  . HIS A 1 30  ? 144.457 12.231  -115.665 1.00 0.00 ? 30  HIS A HB2  4  
ATOM 7114  H HB3  . HIS A 1 30  ? 144.852 10.598  -116.201 1.00 0.00 ? 30  HIS A HB3  4  
ATOM 7115  H HD1  . HIS A 1 30  ? 146.516 13.715  -114.821 1.00 0.00 ? 30  HIS A HD1  4  
ATOM 7116  H HD2  . HIS A 1 30  ? 147.350 9.665   -115.358 1.00 0.00 ? 30  HIS A HD2  4  
ATOM 7117  H HE1  . HIS A 1 30  ? 148.702 13.268  -113.621 1.00 0.00 ? 30  HIS A HE1  4  
ATOM 7118  N N    . GLY A 1 31  ? 147.750 12.835  -117.451 1.00 0.00 ? 31  GLY A N    4  
ATOM 7119  C CA   . GLY A 1 31  ? 148.871 13.812  -117.402 1.00 0.00 ? 31  GLY A CA   4  
ATOM 7120  C C    . GLY A 1 31  ? 150.190 13.051  -117.554 1.00 0.00 ? 31  GLY A C    4  
ATOM 7121  O O    . GLY A 1 31  ? 151.248 13.635  -117.675 1.00 0.00 ? 31  GLY A O    4  
ATOM 7122  H H    . GLY A 1 31  ? 147.946 11.875  -117.435 1.00 0.00 ? 31  GLY A H    4  
ATOM 7123  H HA2  . GLY A 1 31  ? 148.764 14.526  -118.208 1.00 0.00 ? 31  GLY A HA2  4  
ATOM 7124  H HA3  . GLY A 1 31  ? 148.862 14.328  -116.455 1.00 0.00 ? 31  GLY A HA3  4  
ATOM 7125  N N    . ALA A 1 32  ? 150.119 11.746  -117.603 1.00 0.00 ? 32  ALA A N    4  
ATOM 7126  C CA   . ALA A 1 32  ? 151.347 10.926  -117.811 1.00 0.00 ? 32  ALA A CA   4  
ATOM 7127  C C    . ALA A 1 32  ? 152.215 10.847  -116.551 1.00 0.00 ? 32  ALA A C    4  
ATOM 7128  O O    . ALA A 1 32  ? 153.169 11.585  -116.402 1.00 0.00 ? 32  ALA A O    4  
ATOM 7129  C CB   . ALA A 1 32  ? 152.166 11.538  -118.947 1.00 0.00 ? 32  ALA A CB   4  
ATOM 7130  H H    . ALA A 1 32  ? 149.250 11.299  -117.540 1.00 0.00 ? 32  ALA A H    4  
ATOM 7131  H HA   . ALA A 1 32  ? 151.054 9.926   -118.095 1.00 0.00 ? 32  ALA A HA   4  
ATOM 7132  H HB1  . ALA A 1 32  ? 152.896 12.219  -118.537 1.00 0.00 ? 32  ALA A HB1  4  
ATOM 7133  H HB2  . ALA A 1 32  ? 151.508 12.074  -119.615 1.00 0.00 ? 32  ALA A HB2  4  
ATOM 7134  H HB3  . ALA A 1 32  ? 152.669 10.753  -119.491 1.00 0.00 ? 32  ALA A HB3  4  
ATOM 7135  N N    . ASN A 1 33  ? 151.922 9.936   -115.662 1.00 0.00 ? 33  ASN A N    4  
ATOM 7136  C CA   . ASN A 1 33  ? 152.766 9.793   -114.440 1.00 0.00 ? 33  ASN A CA   4  
ATOM 7137  C C    . ASN A 1 33  ? 152.559 8.389   -113.861 1.00 0.00 ? 33  ASN A C    4  
ATOM 7138  O O    . ASN A 1 33  ? 151.462 7.995   -113.520 1.00 0.00 ? 33  ASN A O    4  
ATOM 7139  C CB   . ASN A 1 33  ? 152.398 10.859  -113.406 1.00 0.00 ? 33  ASN A CB   4  
ATOM 7140  C CG   . ASN A 1 33  ? 152.963 12.212  -113.844 1.00 0.00 ? 33  ASN A CG   4  
ATOM 7141  O OD1  . ASN A 1 33  ? 152.227 13.083  -114.264 1.00 0.00 ? 33  ASN A OD1  4  
ATOM 7142  N ND2  . ASN A 1 33  ? 154.247 12.426  -113.763 1.00 0.00 ? 33  ASN A ND2  4  
ATOM 7143  H H    . ASN A 1 33  ? 151.167 9.327   -115.799 1.00 0.00 ? 33  ASN A H    4  
ATOM 7144  H HA   . ASN A 1 33  ? 153.803 9.888   -114.728 1.00 0.00 ? 33  ASN A HA   4  
ATOM 7145  H HB2  . ASN A 1 33  ? 151.322 10.925  -113.326 1.00 0.00 ? 33  ASN A HB2  4  
ATOM 7146  H HB3  . ASN A 1 33  ? 152.815 10.590  -112.448 1.00 0.00 ? 33  ASN A HB3  4  
ATOM 7147  H HD21 . ASN A 1 33  ? 154.841 11.724  -113.425 1.00 0.00 ? 33  ASN A HD21 4  
ATOM 7148  H HD22 . ASN A 1 33  ? 154.618 13.290  -114.042 1.00 0.00 ? 33  ASN A HD22 4  
ATOM 7149  N N    . ILE A 1 34  ? 153.619 7.630   -113.775 1.00 0.00 ? 34  ILE A N    4  
ATOM 7150  C CA   . ILE A 1 34  ? 153.522 6.236   -113.248 1.00 0.00 ? 34  ILE A CA   4  
ATOM 7151  C C    . ILE A 1 34  ? 153.813 6.221   -111.741 1.00 0.00 ? 34  ILE A C    4  
ATOM 7152  O O    . ILE A 1 34  ? 152.971 5.871   -110.942 1.00 0.00 ? 34  ILE A O    4  
ATOM 7153  C CB   . ILE A 1 34  ? 154.558 5.370   -113.974 1.00 0.00 ? 34  ILE A CB   4  
ATOM 7154  C CG1  . ILE A 1 34  ? 154.262 5.368   -115.479 1.00 0.00 ? 34  ILE A CG1  4  
ATOM 7155  C CG2  . ILE A 1 34  ? 154.512 3.935   -113.444 1.00 0.00 ? 34  ILE A CG2  4  
ATOM 7156  C CD1  . ILE A 1 34  ? 152.784 5.053   -115.719 1.00 0.00 ? 34  ILE A CD1  4  
ATOM 7157  H H    . ILE A 1 34  ? 154.485 7.978   -114.073 1.00 0.00 ? 34  ILE A H    4  
ATOM 7158  H HA   . ILE A 1 34  ? 152.527 5.843   -113.431 1.00 0.00 ? 34  ILE A HA   4  
ATOM 7159  H HB   . ILE A 1 34  ? 155.543 5.779   -113.806 1.00 0.00 ? 34  ILE A HB   4  
ATOM 7160  H HG12 . ILE A 1 34  ? 154.494 6.339   -115.891 1.00 0.00 ? 34  ILE A HG12 4  
ATOM 7161  H HG13 . ILE A 1 34  ? 154.870 4.617   -115.963 1.00 0.00 ? 34  ILE A HG13 4  
ATOM 7162  H HG21 . ILE A 1 34  ? 154.860 3.257   -114.211 1.00 0.00 ? 34  ILE A HG21 4  
ATOM 7163  H HG22 . ILE A 1 34  ? 153.500 3.682   -113.170 1.00 0.00 ? 34  ILE A HG22 4  
ATOM 7164  H HG23 . ILE A 1 34  ? 155.152 3.852   -112.577 1.00 0.00 ? 34  ILE A HG23 4  
ATOM 7165  H HD11 . ILE A 1 34  ? 152.451 4.314   -115.007 1.00 0.00 ? 34  ILE A HD11 4  
ATOM 7166  H HD12 . ILE A 1 34  ? 152.656 4.670   -116.722 1.00 0.00 ? 34  ILE A HD12 4  
ATOM 7167  H HD13 . ILE A 1 34  ? 152.200 5.955   -115.603 1.00 0.00 ? 34  ILE A HD13 4  
ATOM 7168  N N    . MET A 1 35  ? 155.016 6.532   -111.346 1.00 0.00 ? 35  MET A N    4  
ATOM 7169  C CA   . MET A 1 35  ? 155.354 6.454   -109.895 1.00 0.00 ? 35  MET A CA   4  
ATOM 7170  C C    . MET A 1 35  ? 154.190 7.000   -109.063 1.00 0.00 ? 35  MET A C    4  
ATOM 7171  O O    . MET A 1 35  ? 153.638 6.300   -108.238 1.00 0.00 ? 35  MET A O    4  
ATOM 7172  C CB   . MET A 1 35  ? 156.611 7.280   -109.618 1.00 0.00 ? 35  MET A CB   4  
ATOM 7173  C CG   . MET A 1 35  ? 157.402 6.640   -108.475 1.00 0.00 ? 35  MET A CG   4  
ATOM 7174  S SD   . MET A 1 35  ? 157.978 5.002   -108.983 1.00 0.00 ? 35  MET A SD   4  
ATOM 7175  C CE   . MET A 1 35  ? 157.088 4.049   -107.728 1.00 0.00 ? 35  MET A CE   4  
ATOM 7176  H H    . MET A 1 35  ? 155.713 6.724   -112.008 1.00 0.00 ? 35  MET A H    4  
ATOM 7177  H HA   . MET A 1 35  ? 155.538 5.421   -109.640 1.00 0.00 ? 35  MET A HA   4  
ATOM 7178  H HB2  . MET A 1 35  ? 157.224 7.311   -110.507 1.00 0.00 ? 35  MET A HB2  4  
ATOM 7179  H HB3  . MET A 1 35  ? 156.328 8.284   -109.339 1.00 0.00 ? 35  MET A HB3  4  
ATOM 7180  H HG2  . MET A 1 35  ? 158.251 7.262   -108.233 1.00 0.00 ? 35  MET A HG2  4  
ATOM 7181  H HG3  . MET A 1 35  ? 156.766 6.544   -107.607 1.00 0.00 ? 35  MET A HG3  4  
ATOM 7182  H HE1  . MET A 1 35  ? 156.036 4.290   -107.773 1.00 0.00 ? 35  MET A HE1  4  
ATOM 7183  H HE2  . MET A 1 35  ? 157.470 4.294   -106.751 1.00 0.00 ? 35  MET A HE2  4  
ATOM 7184  H HE3  . MET A 1 35  ? 157.229 2.993   -107.913 1.00 0.00 ? 35  MET A HE3  4  
ATOM 7185  N N    . GLU A 1 36  ? 153.784 8.220   -109.275 1.00 0.00 ? 36  GLU A N    4  
ATOM 7186  C CA   . GLU A 1 36  ? 152.630 8.742   -108.488 1.00 0.00 ? 36  GLU A CA   4  
ATOM 7187  C C    . GLU A 1 36  ? 151.546 7.660   -108.473 1.00 0.00 ? 36  GLU A C    4  
ATOM 7188  O O    . GLU A 1 36  ? 150.995 7.324   -107.443 1.00 0.00 ? 36  GLU A O    4  
ATOM 7189  C CB   . GLU A 1 36  ? 152.084 10.007  -109.157 1.00 0.00 ? 36  GLU A CB   4  
ATOM 7190  C CG   . GLU A 1 36  ? 152.715 11.241  -108.508 1.00 0.00 ? 36  GLU A CG   4  
ATOM 7191  C CD   . GLU A 1 36  ? 152.325 11.296  -107.031 1.00 0.00 ? 36  GLU A CD   4  
ATOM 7192  O OE1  . GLU A 1 36  ? 151.353 10.651  -106.670 1.00 0.00 ? 36  GLU A OE1  4  
ATOM 7193  O OE2  . GLU A 1 36  ? 153.004 11.982  -106.285 1.00 0.00 ? 36  GLU A OE2  4  
ATOM 7194  H H    . GLU A 1 36  ? 154.217 8.777   -109.956 1.00 0.00 ? 36  GLU A H    4  
ATOM 7195  H HA   . GLU A 1 36  ? 152.942 8.966   -107.479 1.00 0.00 ? 36  GLU A HA   4  
ATOM 7196  H HB2  . GLU A 1 36  ? 152.325 9.989   -110.211 1.00 0.00 ? 36  GLU A HB2  4  
ATOM 7197  H HB3  . GLU A 1 36  ? 151.012 10.045  -109.034 1.00 0.00 ? 36  GLU A HB3  4  
ATOM 7198  H HG2  . GLU A 1 36  ? 153.789 11.183  -108.597 1.00 0.00 ? 36  GLU A HG2  4  
ATOM 7199  H HG3  . GLU A 1 36  ? 152.359 12.131  -109.006 1.00 0.00 ? 36  GLU A HG3  4  
ATOM 7200  N N    . PHE A 1 37  ? 151.261 7.104   -109.617 1.00 0.00 ? 37  PHE A N    4  
ATOM 7201  C CA   . PHE A 1 37  ? 150.239 6.022   -109.713 1.00 0.00 ? 37  PHE A CA   4  
ATOM 7202  C C    . PHE A 1 37  ? 150.564 4.908   -108.714 1.00 0.00 ? 37  PHE A C    4  
ATOM 7203  O O    . PHE A 1 37  ? 149.871 4.683   -107.736 1.00 0.00 ? 37  PHE A O    4  
ATOM 7204  C CB   . PHE A 1 37  ? 150.304 5.435   -111.129 1.00 0.00 ? 37  PHE A CB   4  
ATOM 7205  C CG   . PHE A 1 37  ? 149.393 4.231   -111.259 1.00 0.00 ? 37  PHE A CG   4  
ATOM 7206  C CD1  . PHE A 1 37  ? 148.530 3.869   -110.217 1.00 0.00 ? 37  PHE A CD1  4  
ATOM 7207  C CD2  . PHE A 1 37  ? 149.407 3.484   -112.440 1.00 0.00 ? 37  PHE A CD2  4  
ATOM 7208  C CE1  . PHE A 1 37  ? 147.682 2.767   -110.361 1.00 0.00 ? 37  PHE A CE1  4  
ATOM 7209  C CE2  . PHE A 1 37  ? 148.562 2.379   -112.581 1.00 0.00 ? 37  PHE A CE2  4  
ATOM 7210  C CZ   . PHE A 1 37  ? 147.698 2.022   -111.542 1.00 0.00 ? 37  PHE A CZ   4  
ATOM 7211  H H    . PHE A 1 37  ? 151.736 7.393   -110.423 1.00 0.00 ? 37  PHE A H    4  
ATOM 7212  H HA   . PHE A 1 37  ? 149.247 6.417   -109.549 1.00 0.00 ? 37  PHE A HA   4  
ATOM 7213  H HB2  . PHE A 1 37  ? 149.999 6.187   -111.841 1.00 0.00 ? 37  PHE A HB2  4  
ATOM 7214  H HB3  . PHE A 1 37  ? 151.315 5.133   -111.346 1.00 0.00 ? 37  PHE A HB3  4  
ATOM 7215  H HD1  . PHE A 1 37  ? 148.518 4.433   -109.307 1.00 0.00 ? 37  PHE A HD1  4  
ATOM 7216  H HD2  . PHE A 1 37  ? 150.076 3.759   -113.242 1.00 0.00 ? 37  PHE A HD2  4  
ATOM 7217  H HE1  . PHE A 1 37  ? 147.017 2.489   -109.556 1.00 0.00 ? 37  PHE A HE1  4  
ATOM 7218  H HE2  . PHE A 1 37  ? 148.574 1.803   -113.495 1.00 0.00 ? 37  PHE A HE2  4  
ATOM 7219  H HZ   . PHE A 1 37  ? 147.040 1.176   -111.653 1.00 0.00 ? 37  PHE A HZ   4  
ATOM 7220  N N    . VAL A 1 38  ? 151.626 4.212   -108.976 1.00 0.00 ? 38  VAL A N    4  
ATOM 7221  C CA   . VAL A 1 38  ? 152.033 3.097   -108.087 1.00 0.00 ? 38  VAL A CA   4  
ATOM 7222  C C    . VAL A 1 38  ? 152.444 3.647   -106.724 1.00 0.00 ? 38  VAL A C    4  
ATOM 7223  O O    . VAL A 1 38  ? 152.130 3.075   -105.699 1.00 0.00 ? 38  VAL A O    4  
ATOM 7224  C CB   . VAL A 1 38  ? 153.175 2.342   -108.748 1.00 0.00 ? 38  VAL A CB   4  
ATOM 7225  C CG1  . VAL A 1 38  ? 153.491 1.075   -107.950 1.00 0.00 ? 38  VAL A CG1  4  
ATOM 7226  C CG2  . VAL A 1 38  ? 152.729 1.964   -110.159 1.00 0.00 ? 38  VAL A CG2  4  
ATOM 7227  H H    . VAL A 1 38  ? 152.157 4.439   -109.768 1.00 0.00 ? 38  VAL A H    4  
ATOM 7228  H HA   . VAL A 1 38  ? 151.195 2.427   -107.957 1.00 0.00 ? 38  VAL A HA   4  
ATOM 7229  H HB   . VAL A 1 38  ? 154.052 2.972   -108.797 1.00 0.00 ? 38  VAL A HB   4  
ATOM 7230  H HG11 . VAL A 1 38  ? 152.577 0.668   -107.545 1.00 0.00 ? 38  VAL A HG11 4  
ATOM 7231  H HG12 . VAL A 1 38  ? 154.169 1.316   -107.145 1.00 0.00 ? 38  VAL A HG12 4  
ATOM 7232  H HG13 . VAL A 1 38  ? 153.951 0.347   -108.602 1.00 0.00 ? 38  VAL A HG13 4  
ATOM 7233  H HG21 . VAL A 1 38  ? 152.665 2.856   -110.765 1.00 0.00 ? 38  VAL A HG21 4  
ATOM 7234  H HG22 . VAL A 1 38  ? 151.754 1.495   -110.112 1.00 0.00 ? 38  VAL A HG22 4  
ATOM 7235  H HG23 . VAL A 1 38  ? 153.438 1.280   -110.593 1.00 0.00 ? 38  VAL A HG23 4  
ATOM 7236  N N    . LYS A 1 39  ? 153.096 4.777   -106.689 1.00 0.00 ? 39  LYS A N    4  
ATOM 7237  C CA   . LYS A 1 39  ? 153.454 5.359   -105.369 1.00 0.00 ? 39  LYS A CA   4  
ATOM 7238  C C    . LYS A 1 39  ? 152.207 5.264   -104.493 1.00 0.00 ? 39  LYS A C    4  
ATOM 7239  O O    . LYS A 1 39  ? 152.203 4.611   -103.468 1.00 0.00 ? 39  LYS A O    4  
ATOM 7240  C CB   . LYS A 1 39  ? 153.880 6.819   -105.530 1.00 0.00 ? 39  LYS A CB   4  
ATOM 7241  C CG   . LYS A 1 39  ? 154.265 7.393   -104.165 1.00 0.00 ? 39  LYS A CG   4  
ATOM 7242  C CD   . LYS A 1 39  ? 155.717 7.030   -103.849 1.00 0.00 ? 39  LYS A CD   4  
ATOM 7243  C CE   . LYS A 1 39  ? 156.173 7.788   -102.600 1.00 0.00 ? 39  LYS A CE   4  
ATOM 7244  N NZ   . LYS A 1 39  ? 157.530 7.317   -102.201 1.00 0.00 ? 39  LYS A NZ   4  
ATOM 7245  H H    . LYS A 1 39  ? 153.314 5.251   -107.518 1.00 0.00 ? 39  LYS A H    4  
ATOM 7246  H HA   . LYS A 1 39  ? 154.240 4.784   -104.900 1.00 0.00 ? 39  LYS A HA   4  
ATOM 7247  H HB2  . LYS A 1 39  ? 154.728 6.875   -106.197 1.00 0.00 ? 39  LYS A HB2  4  
ATOM 7248  H HB3  . LYS A 1 39  ? 153.061 7.390   -105.940 1.00 0.00 ? 39  LYS A HB3  4  
ATOM 7249  H HG2  . LYS A 1 39  ? 154.157 8.468   -104.183 1.00 0.00 ? 39  LYS A HG2  4  
ATOM 7250  H HG3  . LYS A 1 39  ? 153.619 6.979   -103.405 1.00 0.00 ? 39  LYS A HG3  4  
ATOM 7251  H HD2  . LYS A 1 39  ? 155.793 5.967   -103.673 1.00 0.00 ? 39  LYS A HD2  4  
ATOM 7252  H HD3  . LYS A 1 39  ? 156.346 7.303   -104.682 1.00 0.00 ? 39  LYS A HD3  4  
ATOM 7253  H HE2  . LYS A 1 39  ? 156.207 8.846   -102.814 1.00 0.00 ? 39  LYS A HE2  4  
ATOM 7254  H HE3  . LYS A 1 39  ? 155.477 7.606   -101.795 1.00 0.00 ? 39  LYS A HE3  4  
ATOM 7255  H HZ1  . LYS A 1 39  ? 157.626 7.372   -101.168 1.00 0.00 ? 39  LYS A HZ1  4  
ATOM 7256  H HZ2  . LYS A 1 39  ? 158.251 7.918   -102.649 1.00 0.00 ? 39  LYS A HZ2  4  
ATOM 7257  H HZ3  . LYS A 1 39  ? 157.659 6.332   -102.508 1.00 0.00 ? 39  LYS A HZ3  4  
ATOM 7258  N N    . ALA A 1 40  ? 151.144 5.915   -104.888 1.00 0.00 ? 40  ALA A N    4  
ATOM 7259  C CA   . ALA A 1 40  ? 149.902 5.860   -104.072 1.00 0.00 ? 40  ALA A CA   4  
ATOM 7260  C C    . ALA A 1 40  ? 149.471 4.402   -103.927 1.00 0.00 ? 40  ALA A C    4  
ATOM 7261  O O    . ALA A 1 40  ? 148.997 3.988   -102.881 1.00 0.00 ? 40  ALA A O    4  
ATOM 7262  C CB   . ALA A 1 40  ? 148.794 6.674   -104.741 1.00 0.00 ? 40  ALA A CB   4  
ATOM 7263  H H    . ALA A 1 40  ? 151.167 6.438   -105.716 1.00 0.00 ? 40  ALA A H    4  
ATOM 7264  H HA   . ALA A 1 40  ? 150.114 6.256   -103.090 1.00 0.00 ? 40  ALA A HA   4  
ATOM 7265  H HB1  . ALA A 1 40  ? 149.123 7.696   -104.865 1.00 0.00 ? 40  ALA A HB1  4  
ATOM 7266  H HB2  . ALA A 1 40  ? 147.909 6.652   -104.123 1.00 0.00 ? 40  ALA A HB2  4  
ATOM 7267  H HB3  . ALA A 1 40  ? 148.569 6.248   -105.708 1.00 0.00 ? 40  ALA A HB3  4  
ATOM 7268  N N    . PHE A 1 41  ? 149.700 3.586   -104.921 1.00 0.00 ? 41  PHE A N    4  
ATOM 7269  C CA   . PHE A 1 41  ? 149.359 2.151   -104.770 1.00 0.00 ? 41  PHE A CA   4  
ATOM 7270  C C    . PHE A 1 41  ? 150.359 1.555   -103.790 1.00 0.00 ? 41  PHE A C    4  
ATOM 7271  O O    . PHE A 1 41  ? 150.031 1.282   -102.653 1.00 0.00 ? 41  PHE A O    4  
ATOM 7272  C CB   . PHE A 1 41  ? 149.497 1.450   -106.123 1.00 0.00 ? 41  PHE A CB   4  
ATOM 7273  C CG   . PHE A 1 41  ? 148.491 0.328   -106.199 1.00 0.00 ? 41  PHE A CG   4  
ATOM 7274  C CD1  . PHE A 1 41  ? 147.126 0.621   -106.314 1.00 0.00 ? 41  PHE A CD1  4  
ATOM 7275  C CD2  . PHE A 1 41  ? 148.919 -1.004  -106.150 1.00 0.00 ? 41  PHE A CD2  4  
ATOM 7276  C CE1  . PHE A 1 41  ? 146.190 -0.418  -106.379 1.00 0.00 ? 41  PHE A CE1  4  
ATOM 7277  C CE2  . PHE A 1 41  ? 147.983 -2.043  -106.215 1.00 0.00 ? 41  PHE A CE2  4  
ATOM 7278  C CZ   . PHE A 1 41  ? 146.619 -1.750  -106.329 1.00 0.00 ? 41  PHE A CZ   4  
ATOM 7279  H H    . PHE A 1 41  ? 150.159 3.870   -105.744 1.00 0.00 ? 41  PHE A H    4  
ATOM 7280  H HA   . PHE A 1 41  ? 148.352 2.016   -104.400 1.00 0.00 ? 41  PHE A HA   4  
ATOM 7281  H HB2  . PHE A 1 41  ? 149.311 2.158   -106.916 1.00 0.00 ? 41  PHE A HB2  4  
ATOM 7282  H HB3  . PHE A 1 41  ? 150.494 1.047   -106.222 1.00 0.00 ? 41  PHE A HB3  4  
ATOM 7283  H HD1  . PHE A 1 41  ? 146.795 1.648   -106.352 1.00 0.00 ? 41  PHE A HD1  4  
ATOM 7284  H HD2  . PHE A 1 41  ? 149.972 -1.230  -106.062 1.00 0.00 ? 41  PHE A HD2  4  
ATOM 7285  H HE1  . PHE A 1 41  ? 145.138 -0.193  -106.467 1.00 0.00 ? 41  PHE A HE1  4  
ATOM 7286  H HE2  . PHE A 1 41  ? 148.315 -3.070  -106.177 1.00 0.00 ? 41  PHE A HE2  4  
ATOM 7287  H HZ   . PHE A 1 41  ? 145.897 -2.552  -106.379 1.00 0.00 ? 41  PHE A HZ   4  
ATOM 7288  N N    . ASN A 1 42  ? 151.561 1.292   -104.223 1.00 0.00 ? 42  ASN A N    4  
ATOM 7289  C CA   . ASN A 1 42  ? 152.548 0.649   -103.322 1.00 0.00 ? 42  ASN A CA   4  
ATOM 7290  C C    . ASN A 1 42  ? 152.469 1.246   -101.919 1.00 0.00 ? 42  ASN A C    4  
ATOM 7291  O O    . ASN A 1 42  ? 152.702 0.593   -100.922 1.00 0.00 ? 42  ASN A O    4  
ATOM 7292  C CB   . ASN A 1 42  ? 153.947 0.941   -103.872 1.00 0.00 ? 42  ASN A CB   4  
ATOM 7293  C CG   . ASN A 1 42  ? 154.356 -0.171  -104.838 1.00 0.00 ? 42  ASN A CG   4  
ATOM 7294  O OD1  . ASN A 1 42  ? 155.381 -0.800  -104.662 1.00 0.00 ? 42  ASN A OD1  4  
ATOM 7295  N ND2  . ASN A 1 42  ? 153.593 -0.442  -105.861 1.00 0.00 ? 42  ASN A ND2  4  
ATOM 7296  H H    . ASN A 1 42  ? 151.814 1.422   -105.161 1.00 0.00 ? 42  ASN A H    4  
ATOM 7297  H HA   . ASN A 1 42  ? 152.394 -0.419  -103.357 1.00 0.00 ? 42  ASN A HA   4  
ATOM 7298  H HB2  . ASN A 1 42  ? 153.939 1.887   -104.392 1.00 0.00 ? 42  ASN A HB2  4  
ATOM 7299  H HB3  . ASN A 1 42  ? 154.653 0.983   -103.055 1.00 0.00 ? 42  ASN A HB3  4  
ATOM 7300  H HD21 . ASN A 1 42  ? 152.767 0.067   -106.002 1.00 0.00 ? 42  ASN A HD21 4  
ATOM 7301  H HD22 . ASN A 1 42  ? 153.845 -1.152  -106.487 1.00 0.00 ? 42  ASN A HD22 4  
ATOM 7302  N N    . ALA A 1 43  ? 152.137 2.512   -101.867 1.00 0.00 ? 43  ALA A N    4  
ATOM 7303  C CA   . ALA A 1 43  ? 152.024 3.235   -100.573 1.00 0.00 ? 43  ALA A CA   4  
ATOM 7304  C C    . ALA A 1 43  ? 150.813 2.725   -99.796  1.00 0.00 ? 43  ALA A C    4  
ATOM 7305  O O    . ALA A 1 43  ? 150.826 2.644   -98.582  1.00 0.00 ? 43  ALA A O    4  
ATOM 7306  C CB   . ALA A 1 43  ? 151.831 4.726   -100.859 1.00 0.00 ? 43  ALA A CB   4  
ATOM 7307  H H    . ALA A 1 43  ? 151.962 2.996   -102.702 1.00 0.00 ? 43  ALA A H    4  
ATOM 7308  H HA   . ALA A 1 43  ? 152.935 3.106   -100.006 1.00 0.00 ? 43  ALA A HA   4  
ATOM 7309  H HB1  . ALA A 1 43  ? 151.008 4.856   -101.545 1.00 0.00 ? 43  ALA A HB1  4  
ATOM 7310  H HB2  . ALA A 1 43  ? 152.733 5.128   -101.296 1.00 0.00 ? 43  ALA A HB2  4  
ATOM 7311  H HB3  . ALA A 1 43  ? 151.616 5.244   -99.936  1.00 0.00 ? 43  ALA A HB3  4  
ATOM 7312  N N    . ALA A 1 44  ? 149.771 2.345   -100.489 1.00 0.00 ? 44  ALA A N    4  
ATOM 7313  C CA   . ALA A 1 44  ? 148.579 1.817   -99.772  1.00 0.00 ? 44  ALA A CA   4  
ATOM 7314  C C    . ALA A 1 44  ? 148.725 0.310   -99.632  1.00 0.00 ? 44  ALA A C    4  
ATOM 7315  O O    . ALA A 1 44  ? 148.550 -0.252  -98.569  1.00 0.00 ? 44  ALA A O    4  
ATOM 7316  C CB   . ALA A 1 44  ? 147.291 2.151   -100.524 1.00 0.00 ? 44  ALA A CB   4  
ATOM 7317  H H    . ALA A 1 44  ? 149.794 2.366   -101.475 1.00 0.00 ? 44  ALA A H    4  
ATOM 7318  H HA   . ALA A 1 44  ? 148.568 2.217   -98.771  1.00 0.00 ? 44  ALA A HA   4  
ATOM 7319  H HB1  . ALA A 1 44  ? 147.433 1.956   -101.579 1.00 0.00 ? 44  ALA A HB1  4  
ATOM 7320  H HB2  . ALA A 1 44  ? 147.047 3.190   -100.380 1.00 0.00 ? 44  ALA A HB2  4  
ATOM 7321  H HB3  . ALA A 1 44  ? 146.488 1.533   -100.152 1.00 0.00 ? 44  ALA A HB3  4  
ATOM 7322  N N    . THR A 1 45  ? 149.076 -0.341  -100.700 1.00 0.00 ? 45  THR A N    4  
ATOM 7323  C CA   . THR A 1 45  ? 149.271 -1.806  -100.644 1.00 0.00 ? 45  THR A CA   4  
ATOM 7324  C C    . THR A 1 45  ? 150.347 -2.095  -99.603  1.00 0.00 ? 45  THR A C    4  
ATOM 7325  O O    . THR A 1 45  ? 150.323 -3.103  -98.925  1.00 0.00 ? 45  THR A O    4  
ATOM 7326  C CB   . THR A 1 45  ? 149.714 -2.293  -102.018 1.00 0.00 ? 45  THR A CB   4  
ATOM 7327  O OG1  . THR A 1 45  ? 151.122 -2.147  -102.142 1.00 0.00 ? 45  THR A OG1  4  
ATOM 7328  C CG2  . THR A 1 45  ? 149.010 -1.455  -103.087 1.00 0.00 ? 45  THR A CG2  4  
ATOM 7329  H H    . THR A 1 45  ? 149.232 0.142   -101.539 1.00 0.00 ? 45  THR A H    4  
ATOM 7330  H HA   . THR A 1 45  ? 148.348 -2.288  -100.363 1.00 0.00 ? 45  THR A HA   4  
ATOM 7331  H HB   . THR A 1 45  ? 149.445 -3.329  -102.138 1.00 0.00 ? 45  THR A HB   4  
ATOM 7332  H HG1  . THR A 1 45  ? 151.514 -3.024  -102.137 1.00 0.00 ? 45  THR A HG1  4  
ATOM 7333  H HG21 . THR A 1 45  ? 149.707 -0.743  -103.504 1.00 0.00 ? 45  THR A HG21 4  
ATOM 7334  H HG22 . THR A 1 45  ? 148.180 -0.924  -102.640 1.00 0.00 ? 45  THR A HG22 4  
ATOM 7335  H HG23 . THR A 1 45  ? 148.643 -2.099  -103.870 1.00 0.00 ? 45  THR A HG23 4  
ATOM 7336  N N    . ALA A 1 46  ? 151.277 -1.191  -99.451  1.00 0.00 ? 46  ALA A N    4  
ATOM 7337  C CA   . ALA A 1 46  ? 152.339 -1.379  -98.429  1.00 0.00 ? 46  ALA A CA   4  
ATOM 7338  C C    . ALA A 1 46  ? 151.740 -1.028  -97.070  1.00 0.00 ? 46  ALA A C    4  
ATOM 7339  O O    . ALA A 1 46  ? 151.894 -1.749  -96.104  1.00 0.00 ? 46  ALA A O    4  
ATOM 7340  C CB   . ALA A 1 46  ? 153.520 -0.454  -98.730  1.00 0.00 ? 46  ALA A CB   4  
ATOM 7341  H H    . ALA A 1 46  ? 151.259 -0.374  -99.992  1.00 0.00 ? 46  ALA A H    4  
ATOM 7342  H HA   . ALA A 1 46  ? 152.668 -2.408  -98.429  1.00 0.00 ? 46  ALA A HA   4  
ATOM 7343  H HB1  . ALA A 1 46  ? 153.175 0.568   -98.770  1.00 0.00 ? 46  ALA A HB1  4  
ATOM 7344  H HB2  . ALA A 1 46  ? 153.956 -0.725  -99.680  1.00 0.00 ? 46  ALA A HB2  4  
ATOM 7345  H HB3  . ALA A 1 46  ? 154.261 -0.553  -97.952  1.00 0.00 ? 46  ALA A HB3  4  
ATOM 7346  N N    . ASN A 1 47  ? 151.037 0.073   -96.994  1.00 0.00 ? 47  ASN A N    4  
ATOM 7347  C CA   . ASN A 1 47  ? 150.404 0.461   -95.706  1.00 0.00 ? 47  ASN A CA   4  
ATOM 7348  C C    . ASN A 1 47  ? 149.489 -0.674  -95.241  1.00 0.00 ? 47  ASN A C    4  
ATOM 7349  O O    . ASN A 1 47  ? 149.181 -0.798  -94.072  1.00 0.00 ? 47  ASN A O    4  
ATOM 7350  C CB   . ASN A 1 47  ? 149.575 1.732   -95.909  1.00 0.00 ? 47  ASN A CB   4  
ATOM 7351  C CG   . ASN A 1 47  ? 148.850 2.082   -94.608  1.00 0.00 ? 47  ASN A CG   4  
ATOM 7352  O OD1  . ASN A 1 47  ? 147.750 2.595   -94.632  1.00 0.00 ? 47  ASN A OD1  4  
ATOM 7353  N ND2  . ASN A 1 47  ? 149.425 1.823   -93.465  1.00 0.00 ? 47  ASN A ND2  4  
ATOM 7354  H H    . ASN A 1 47  ? 150.913 0.636   -97.792  1.00 0.00 ? 47  ASN A H    4  
ATOM 7355  H HA   . ASN A 1 47  ? 151.168 0.644   -94.964  1.00 0.00 ? 47  ASN A HA   4  
ATOM 7356  H HB2  . ASN A 1 47  ? 150.229 2.547   -96.189  1.00 0.00 ? 47  ASN A HB2  4  
ATOM 7357  H HB3  . ASN A 1 47  ? 148.850 1.567   -96.690  1.00 0.00 ? 47  ASN A HB3  4  
ATOM 7358  H HD21 . ASN A 1 47  ? 150.313 1.408   -93.446  1.00 0.00 ? 47  ASN A HD21 4  
ATOM 7359  H HD22 . ASN A 1 47  ? 148.969 2.043   -92.626  1.00 0.00 ? 47  ASN A HD22 4  
ATOM 7360  N N    . MET A 1 48  ? 149.054 -1.507  -96.152  1.00 0.00 ? 48  MET A N    4  
ATOM 7361  C CA   . MET A 1 48  ? 148.162 -2.638  -95.766  1.00 0.00 ? 48  MET A CA   4  
ATOM 7362  C C    . MET A 1 48  ? 148.921 -3.960  -95.919  1.00 0.00 ? 48  MET A C    4  
ATOM 7363  O O    . MET A 1 48  ? 149.315 -4.568  -94.944  1.00 0.00 ? 48  MET A O    4  
ATOM 7364  C CB   . MET A 1 48  ? 146.922 -2.648  -96.664  1.00 0.00 ? 48  MET A CB   4  
ATOM 7365  C CG   . MET A 1 48  ? 147.350 -2.694  -98.131  1.00 0.00 ? 48  MET A CG   4  
ATOM 7366  S SD   . MET A 1 48  ? 146.296 -1.588  -99.102  1.00 0.00 ? 48  MET A SD   4  
ATOM 7367  C CE   . MET A 1 48  ? 145.726 -2.811  -100.308 1.00 0.00 ? 48  MET A CE   4  
ATOM 7368  H H    . MET A 1 48  ? 149.319 -1.391  -97.088  1.00 0.00 ? 48  MET A H    4  
ATOM 7369  H HA   . MET A 1 48  ? 147.859 -2.517  -94.737  1.00 0.00 ? 48  MET A HA   4  
ATOM 7370  H HB2  . MET A 1 48  ? 146.321 -3.517  -96.436  1.00 0.00 ? 48  MET A HB2  4  
ATOM 7371  H HB3  . MET A 1 48  ? 146.343 -1.753  -96.487  1.00 0.00 ? 48  MET A HB3  4  
ATOM 7372  H HG2  . MET A 1 48  ? 148.377 -2.378  -98.213  1.00 0.00 ? 48  MET A HG2  4  
ATOM 7373  H HG3  . MET A 1 48  ? 147.251 -3.703  -98.502  1.00 0.00 ? 48  MET A HG3  4  
ATOM 7374  H HE1  . MET A 1 48  ? 146.541 -3.475  -100.559 1.00 0.00 ? 48  MET A HE1  4  
ATOM 7375  H HE2  . MET A 1 48  ? 145.387 -2.309  -101.199 1.00 0.00 ? 48  MET A HE2  4  
ATOM 7376  H HE3  . MET A 1 48  ? 144.909 -3.379  -99.884  1.00 0.00 ? 48  MET A HE3  4  
ATOM 7377  N N    . GLY A 1 49  ? 149.135 -4.418  -97.127  1.00 0.00 ? 49  GLY A N    4  
ATOM 7378  C CA   . GLY A 1 49  ? 149.874 -5.702  -97.298  1.00 0.00 ? 49  GLY A CA   4  
ATOM 7379  C C    . GLY A 1 49  ? 149.915 -6.122  -98.772  1.00 0.00 ? 49  GLY A C    4  
ATOM 7380  O O    . GLY A 1 49  ? 149.812 -5.300  -99.661  1.00 0.00 ? 49  GLY A O    4  
ATOM 7381  H H    . GLY A 1 49  ? 148.816 -3.923  -97.909  1.00 0.00 ? 49  GLY A H    4  
ATOM 7382  H HA2  . GLY A 1 49  ? 150.884 -5.581  -96.934  1.00 0.00 ? 49  GLY A HA2  4  
ATOM 7383  H HA3  . GLY A 1 49  ? 149.380 -6.473  -96.726  1.00 0.00 ? 49  GLY A HA3  4  
ATOM 7384  N N    . ASP A 1 50  ? 150.053 -7.393  -99.043  1.00 0.00 ? 50  ASP A N    4  
ATOM 7385  C CA   . ASP A 1 50  ? 150.087 -7.857  -100.462 1.00 0.00 ? 50  ASP A CA   4  
ATOM 7386  C C    . ASP A 1 50  ? 148.685 -8.320  -100.867 1.00 0.00 ? 50  ASP A C    4  
ATOM 7387  O O    . ASP A 1 50  ? 147.942 -8.838  -100.056 1.00 0.00 ? 50  ASP A O    4  
ATOM 7388  C CB   . ASP A 1 50  ? 151.070 -9.021  -100.596 1.00 0.00 ? 50  ASP A CB   4  
ATOM 7389  C CG   . ASP A 1 50  ? 150.913 -9.665  -101.975 1.00 0.00 ? 50  ASP A CG   4  
ATOM 7390  O OD1  . ASP A 1 50  ? 149.825 -10.132 -102.269 1.00 0.00 ? 50  ASP A OD1  4  
ATOM 7391  O OD2  . ASP A 1 50  ? 151.884 -9.681  -102.714 1.00 0.00 ? 50  ASP A OD2  4  
ATOM 7392  H H    . ASP A 1 50  ? 150.127 -8.043  -98.313  1.00 0.00 ? 50  ASP A H    4  
ATOM 7393  H HA   . ASP A 1 50  ? 150.400 -7.044  -101.101 1.00 0.00 ? 50  ASP A HA   4  
ATOM 7394  H HB2  . ASP A 1 50  ? 152.079 -8.656  -100.481 1.00 0.00 ? 50  ASP A HB2  4  
ATOM 7395  H HB3  . ASP A 1 50  ? 150.863 -9.756  -99.833  1.00 0.00 ? 50  ASP A HB3  4  
ATOM 7396  N N    . ALA A 1 51  ? 148.302 -8.135  -102.105 1.00 0.00 ? 51  ALA A N    4  
ATOM 7397  C CA   . ALA A 1 51  ? 146.931 -8.572  -102.514 1.00 0.00 ? 51  ALA A CA   4  
ATOM 7398  C C    . ALA A 1 51  ? 146.634 -8.157  -103.961 1.00 0.00 ? 51  ALA A C    4  
ATOM 7399  O O    . ALA A 1 51  ? 147.525 -7.976  -104.766 1.00 0.00 ? 51  ALA A O    4  
ATOM 7400  C CB   . ALA A 1 51  ? 145.900 -7.929  -101.584 1.00 0.00 ? 51  ALA A CB   4  
ATOM 7401  H H    . ALA A 1 51  ? 148.903 -7.706  -102.753 1.00 0.00 ? 51  ALA A H    4  
ATOM 7402  H HA   . ALA A 1 51  ? 146.862 -9.646  -102.432 1.00 0.00 ? 51  ALA A HA   4  
ATOM 7403  H HB1  . ALA A 1 51  ? 145.305 -7.221  -102.140 1.00 0.00 ? 51  ALA A HB1  4  
ATOM 7404  H HB2  . ALA A 1 51  ? 146.409 -7.419  -100.779 1.00 0.00 ? 51  ALA A HB2  4  
ATOM 7405  H HB3  . ALA A 1 51  ? 145.258 -8.696  -101.175 1.00 0.00 ? 51  ALA A HB3  4  
ATOM 7406  N N    . ILE A 1 52  ? 145.375 -7.985  -104.275 1.00 0.00 ? 52  ILE A N    4  
ATOM 7407  C CA   . ILE A 1 52  ? 144.968 -7.558  -105.646 1.00 0.00 ? 52  ILE A CA   4  
ATOM 7408  C C    . ILE A 1 52  ? 143.729 -6.669  -105.522 1.00 0.00 ? 52  ILE A C    4  
ATOM 7409  O O    . ILE A 1 52  ? 142.835 -6.943  -104.746 1.00 0.00 ? 52  ILE A O    4  
ATOM 7410  C CB   . ILE A 1 52  ? 144.622 -8.771  -106.512 1.00 0.00 ? 52  ILE A CB   4  
ATOM 7411  C CG1  . ILE A 1 52  ? 145.884 -9.591  -106.792 1.00 0.00 ? 52  ILE A CG1  4  
ATOM 7412  C CG2  . ILE A 1 52  ? 144.012 -8.289  -107.833 1.00 0.00 ? 52  ILE A CG2  4  
ATOM 7413  C CD1  . ILE A 1 52  ? 146.494 -9.158  -108.125 1.00 0.00 ? 52  ILE A CD1  4  
ATOM 7414  H H    . ILE A 1 52  ? 144.687 -8.102  -103.591 1.00 0.00 ? 52  ILE A H    4  
ATOM 7415  H HA   . ILE A 1 52  ? 145.747 -6.973  -106.102 1.00 0.00 ? 52  ILE A HA   4  
ATOM 7416  H HB   . ILE A 1 52  ? 143.901 -9.386  -105.992 1.00 0.00 ? 52  ILE A HB   4  
ATOM 7417  H HG12 . ILE A 1 52  ? 146.600 -9.435  -106.002 1.00 0.00 ? 52  ILE A HG12 4  
ATOM 7418  H HG13 . ILE A 1 52  ? 145.628 -10.639 -106.843 1.00 0.00 ? 52  ILE A HG13 4  
ATOM 7419  H HG21 . ILE A 1 52  ? 144.062 -9.081  -108.565 1.00 0.00 ? 52  ILE A HG21 4  
ATOM 7420  H HG22 . ILE A 1 52  ? 144.564 -7.432  -108.193 1.00 0.00 ? 52  ILE A HG22 4  
ATOM 7421  H HG23 . ILE A 1 52  ? 142.981 -8.010  -107.675 1.00 0.00 ? 52  ILE A HG23 4  
ATOM 7422  H HD11 . ILE A 1 52  ? 146.347 -8.097  -108.261 1.00 0.00 ? 52  ILE A HD11 4  
ATOM 7423  H HD12 . ILE A 1 52  ? 146.016 -9.694  -108.930 1.00 0.00 ? 52  ILE A HD12 4  
ATOM 7424  H HD13 . ILE A 1 52  ? 147.551 -9.378  -108.122 1.00 0.00 ? 52  ILE A HD13 4  
ATOM 7425  N N    . VAL A 1 53  ? 143.678 -5.591  -106.257 1.00 0.00 ? 53  VAL A N    4  
ATOM 7426  C CA   . VAL A 1 53  ? 142.505 -4.680  -106.143 1.00 0.00 ? 53  VAL A CA   4  
ATOM 7427  C C    . VAL A 1 53  ? 142.052 -4.197  -107.530 1.00 0.00 ? 53  VAL A C    4  
ATOM 7428  O O    . VAL A 1 53  ? 142.862 -3.810  -108.351 1.00 0.00 ? 53  VAL A O    4  
ATOM 7429  C CB   . VAL A 1 53  ? 142.911 -3.466  -105.306 1.00 0.00 ? 53  VAL A CB   4  
ATOM 7430  C CG1  . VAL A 1 53  ? 141.661 -2.780  -104.755 1.00 0.00 ? 53  VAL A CG1  4  
ATOM 7431  C CG2  . VAL A 1 53  ? 143.803 -3.922  -104.145 1.00 0.00 ? 53  VAL A CG2  4  
ATOM 7432  H H    . VAL A 1 53  ? 144.415 -5.369  -106.862 1.00 0.00 ? 53  VAL A H    4  
ATOM 7433  H HA   . VAL A 1 53  ? 141.699 -5.196  -105.650 1.00 0.00 ? 53  VAL A HA   4  
ATOM 7434  H HB   . VAL A 1 53  ? 143.457 -2.770  -105.927 1.00 0.00 ? 53  VAL A HB   4  
ATOM 7435  H HG11 . VAL A 1 53  ? 141.951 -1.999  -104.067 1.00 0.00 ? 53  VAL A HG11 4  
ATOM 7436  H HG12 . VAL A 1 53  ? 141.049 -3.505  -104.240 1.00 0.00 ? 53  VAL A HG12 4  
ATOM 7437  H HG13 . VAL A 1 53  ? 141.099 -2.350  -105.571 1.00 0.00 ? 53  VAL A HG13 4  
ATOM 7438  H HG21 . VAL A 1 53  ? 143.345 -4.763  -103.646 1.00 0.00 ? 53  VAL A HG21 4  
ATOM 7439  H HG22 . VAL A 1 53  ? 143.927 -3.110  -103.444 1.00 0.00 ? 53  VAL A HG22 4  
ATOM 7440  H HG23 . VAL A 1 53  ? 144.771 -4.215  -104.529 1.00 0.00 ? 53  VAL A HG23 4  
ATOM 7441  N N    . PRO A 1 54  ? 140.761 -4.191  -107.776 1.00 0.00 ? 54  PRO A N    4  
ATOM 7442  C CA   . PRO A 1 54  ? 140.211 -3.704  -109.072 1.00 0.00 ? 54  PRO A CA   4  
ATOM 7443  C C    . PRO A 1 54  ? 140.308 -2.178  -109.173 1.00 0.00 ? 54  PRO A C    4  
ATOM 7444  O O    . PRO A 1 54  ? 139.555 -1.465  -108.539 1.00 0.00 ? 54  PRO A O    4  
ATOM 7445  C CB   . PRO A 1 54  ? 138.748 -4.138  -108.994 1.00 0.00 ? 54  PRO A CB   4  
ATOM 7446  C CG   . PRO A 1 54  ? 138.444 -4.580  -107.558 1.00 0.00 ? 54  PRO A CG   4  
ATOM 7447  C CD   . PRO A 1 54  ? 139.764 -4.677  -106.786 1.00 0.00 ? 54  PRO A CD   4  
ATOM 7448  H HA   . PRO A 1 54  ? 140.692 -4.183  -109.904 1.00 0.00 ? 54  PRO A HA   4  
ATOM 7449  H HB2  . PRO A 1 54  ? 138.109 -3.308  -109.263 1.00 0.00 ? 54  PRO A HB2  4  
ATOM 7450  H HB3  . PRO A 1 54  ? 138.577 -4.963  -109.669 1.00 0.00 ? 54  PRO A HB3  4  
ATOM 7451  H HG2  . PRO A 1 54  ? 137.796 -3.856  -107.086 1.00 0.00 ? 54  PRO A HG2  4  
ATOM 7452  H HG3  . PRO A 1 54  ? 137.963 -5.546  -107.571 1.00 0.00 ? 54  PRO A HG3  4  
ATOM 7453  H HD2  . PRO A 1 54  ? 139.741 -4.039  -105.911 1.00 0.00 ? 54  PRO A HD2  4  
ATOM 7454  H HD3  . PRO A 1 54  ? 139.971 -5.699  -106.516 1.00 0.00 ? 54  PRO A HD3  4  
ATOM 7455  N N    . VAL A 1 55  ? 141.231 -1.660  -109.940 1.00 0.00 ? 55  VAL A N    4  
ATOM 7456  C CA   . VAL A 1 55  ? 141.347 -0.176  -110.025 1.00 0.00 ? 55  VAL A CA   4  
ATOM 7457  C C    . VAL A 1 55  ? 140.285 0.410   -110.936 1.00 0.00 ? 55  VAL A C    4  
ATOM 7458  O O    . VAL A 1 55  ? 140.041 -0.049  -112.043 1.00 0.00 ? 55  VAL A O    4  
ATOM 7459  C CB   . VAL A 1 55  ? 142.699 0.253   -110.578 1.00 0.00 ? 55  VAL A CB   4  
ATOM 7460  C CG1  . VAL A 1 55  ? 143.770 0.127   -109.504 1.00 0.00 ? 55  VAL A CG1  4  
ATOM 7461  C CG2  . VAL A 1 55  ? 143.048 -0.612  -111.785 1.00 0.00 ? 55  VAL A CG2  4  
ATOM 7462  H H    . VAL A 1 55  ? 141.847 -2.236  -110.438 1.00 0.00 ? 55  VAL A H    4  
ATOM 7463  H HA   . VAL A 1 55  ? 141.227 0.241   -109.036 1.00 0.00 ? 55  VAL A HA   4  
ATOM 7464  H HB   . VAL A 1 55  ? 142.634 1.285   -110.883 1.00 0.00 ? 55  VAL A HB   4  
ATOM 7465  H HG11 . VAL A 1 55  ? 143.324 0.279   -108.534 1.00 0.00 ? 55  VAL A HG11 4  
ATOM 7466  H HG12 . VAL A 1 55  ? 144.530 0.878   -109.672 1.00 0.00 ? 55  VAL A HG12 4  
ATOM 7467  H HG13 . VAL A 1 55  ? 144.212 -0.853  -109.551 1.00 0.00 ? 55  VAL A HG13 4  
ATOM 7468  H HG21 . VAL A 1 55  ? 142.245 -0.557  -112.507 1.00 0.00 ? 55  VAL A HG21 4  
ATOM 7469  H HG22 . VAL A 1 55  ? 143.180 -1.633  -111.468 1.00 0.00 ? 55  VAL A HG22 4  
ATOM 7470  H HG23 . VAL A 1 55  ? 143.960 -0.248  -112.235 1.00 0.00 ? 55  VAL A HG23 4  
ATOM 7471  N N    . GLU A 1 56  ? 139.708 1.467   -110.474 1.00 0.00 ? 56  GLU A N    4  
ATOM 7472  C CA   . GLU A 1 56  ? 138.690 2.210   -111.247 1.00 0.00 ? 56  GLU A CA   4  
ATOM 7473  C C    . GLU A 1 56  ? 139.131 3.663   -111.227 1.00 0.00 ? 56  GLU A C    4  
ATOM 7474  O O    . GLU A 1 56  ? 138.539 4.510   -110.589 1.00 0.00 ? 56  GLU A O    4  
ATOM 7475  C CB   . GLU A 1 56  ? 137.321 2.065   -110.577 1.00 0.00 ? 56  GLU A CB   4  
ATOM 7476  C CG   . GLU A 1 56  ? 136.285 2.892   -111.340 1.00 0.00 ? 56  GLU A CG   4  
ATOM 7477  C CD   . GLU A 1 56  ? 135.074 3.150   -110.442 1.00 0.00 ? 56  GLU A CD   4  
ATOM 7478  O OE1  . GLU A 1 56  ? 135.244 3.132   -109.234 1.00 0.00 ? 56  GLU A OE1  4  
ATOM 7479  O OE2  . GLU A 1 56  ? 133.999 3.361   -110.977 1.00 0.00 ? 56  GLU A OE2  4  
ATOM 7480  H H    . GLU A 1 56  ? 139.985 1.810   -109.598 1.00 0.00 ? 56  GLU A H    4  
ATOM 7481  H HA   . GLU A 1 56  ? 138.646 1.872   -112.268 1.00 0.00 ? 56  GLU A HA   4  
ATOM 7482  H HB2  . GLU A 1 56  ? 137.026 1.026   -110.581 1.00 0.00 ? 56  GLU A HB2  4  
ATOM 7483  H HB3  . GLU A 1 56  ? 137.380 2.418   -109.558 1.00 0.00 ? 56  GLU A HB3  4  
ATOM 7484  H HG2  . GLU A 1 56  ? 136.724 3.835   -111.635 1.00 0.00 ? 56  GLU A HG2  4  
ATOM 7485  H HG3  . GLU A 1 56  ? 135.970 2.351   -112.220 1.00 0.00 ? 56  GLU A HG3  4  
ATOM 7486  N N    . ILE A 1 57  ? 140.198 3.935   -111.924 1.00 0.00 ? 57  ILE A N    4  
ATOM 7487  C CA   . ILE A 1 57  ? 140.744 5.313   -111.966 1.00 0.00 ? 57  ILE A CA   4  
ATOM 7488  C C    . ILE A 1 57  ? 139.808 6.221   -112.762 1.00 0.00 ? 57  ILE A C    4  
ATOM 7489  O O    . ILE A 1 57  ? 139.911 6.351   -113.972 1.00 0.00 ? 57  ILE A O    4  
ATOM 7490  C CB   . ILE A 1 57  ? 142.148 5.283   -112.576 1.00 0.00 ? 57  ILE A CB   4  
ATOM 7491  C CG1  . ILE A 1 57  ? 142.990 4.238   -111.826 1.00 0.00 ? 57  ILE A CG1  4  
ATOM 7492  C CG2  . ILE A 1 57  ? 142.800 6.659   -112.433 1.00 0.00 ? 57  ILE A CG2  4  
ATOM 7493  C CD1  . ILE A 1 57  ? 143.803 3.396   -112.811 1.00 0.00 ? 57  ILE A CD1  4  
ATOM 7494  H H    . ILE A 1 57  ? 140.652 3.216   -112.415 1.00 0.00 ? 57  ILE A H    4  
ATOM 7495  H HA   . ILE A 1 57  ? 140.805 5.699   -110.966 1.00 0.00 ? 57  ILE A HA   4  
ATOM 7496  H HB   . ILE A 1 57  ? 142.083 5.024   -113.619 1.00 0.00 ? 57  ILE A HB   4  
ATOM 7497  H HG12 . ILE A 1 57  ? 143.664 4.737   -111.145 1.00 0.00 ? 57  ILE A HG12 4  
ATOM 7498  H HG13 . ILE A 1 57  ? 142.334 3.590   -111.264 1.00 0.00 ? 57  ILE A HG13 4  
ATOM 7499  H HG21 . ILE A 1 57  ? 143.435 6.846   -113.286 1.00 0.00 ? 57  ILE A HG21 4  
ATOM 7500  H HG22 . ILE A 1 57  ? 143.393 6.683   -111.531 1.00 0.00 ? 57  ILE A HG22 4  
ATOM 7501  H HG23 . ILE A 1 57  ? 142.033 7.417   -112.381 1.00 0.00 ? 57  ILE A HG23 4  
ATOM 7502  H HD11 . ILE A 1 57  ? 143.351 2.419   -112.903 1.00 0.00 ? 57  ILE A HD11 4  
ATOM 7503  H HD12 . ILE A 1 57  ? 144.813 3.290   -112.443 1.00 0.00 ? 57  ILE A HD12 4  
ATOM 7504  H HD13 . ILE A 1 57  ? 143.820 3.879   -113.775 1.00 0.00 ? 57  ILE A HD13 4  
ATOM 7505  N N    . THR A 1 58  ? 138.875 6.822   -112.065 1.00 0.00 ? 58  THR A N    4  
ATOM 7506  C CA   . THR A 1 58  ? 137.903 7.721   -112.743 1.00 0.00 ? 58  THR A CA   4  
ATOM 7507  C C    . THR A 1 58  ? 138.665 8.972   -113.166 1.00 0.00 ? 58  THR A C    4  
ATOM 7508  O O    . THR A 1 58  ? 138.871 9.886   -112.391 1.00 0.00 ? 58  THR A O    4  
ATOM 7509  C CB   . THR A 1 58  ? 136.755 8.081   -111.796 1.00 0.00 ? 58  THR A CB   4  
ATOM 7510  O OG1  . THR A 1 58  ? 136.762 7.192   -110.688 1.00 0.00 ? 58  THR A OG1  4  
ATOM 7511  C CG2  . THR A 1 58  ? 135.422 7.967   -112.536 1.00 0.00 ? 58  THR A CG2  4  
ATOM 7512  H H    . THR A 1 58  ? 138.835 6.627   -111.102 1.00 0.00 ? 58  THR A H    4  
ATOM 7513  H HA   . THR A 1 58  ? 137.533 7.209   -113.617 1.00 0.00 ? 58  THR A HA   4  
ATOM 7514  H HB   . THR A 1 58  ? 136.881 9.094   -111.446 1.00 0.00 ? 58  THR A HB   4  
ATOM 7515  H HG1  . THR A 1 58  ? 136.078 6.534   -110.832 1.00 0.00 ? 58  THR A HG1  4  
ATOM 7516  H HG21 . THR A 1 58  ? 135.431 7.087   -113.163 1.00 0.00 ? 58  THR A HG21 4  
ATOM 7517  H HG22 . THR A 1 58  ? 135.276 8.843   -113.148 1.00 0.00 ? 58  THR A HG22 4  
ATOM 7518  H HG23 . THR A 1 58  ? 134.619 7.890   -111.819 1.00 0.00 ? 58  THR A HG23 4  
ATOM 7519  N N    . ILE A 1 59  ? 139.109 9.003   -114.393 1.00 0.00 ? 59  ILE A N    4  
ATOM 7520  C CA   . ILE A 1 59  ? 139.887 10.173  -114.878 1.00 0.00 ? 59  ILE A CA   4  
ATOM 7521  C C    . ILE A 1 59  ? 138.998 11.111  -115.696 1.00 0.00 ? 59  ILE A C    4  
ATOM 7522  O O    . ILE A 1 59  ? 138.154 10.682  -116.460 1.00 0.00 ? 59  ILE A O    4  
ATOM 7523  C CB   . ILE A 1 59  ? 141.041 9.686   -115.765 1.00 0.00 ? 59  ILE A CB   4  
ATOM 7524  C CG1  . ILE A 1 59  ? 141.889 8.663   -115.001 1.00 0.00 ? 59  ILE A CG1  4  
ATOM 7525  C CG2  . ILE A 1 59  ? 141.917 10.875  -116.160 1.00 0.00 ? 59  ILE A CG2  4  
ATOM 7526  C CD1  . ILE A 1 59  ? 142.843 7.957   -115.973 1.00 0.00 ? 59  ILE A CD1  4  
ATOM 7527  H H    . ILE A 1 59  ? 138.944 8.244   -114.990 1.00 0.00 ? 59  ILE A H    4  
ATOM 7528  H HA   . ILE A 1 59  ? 140.288 10.707  -114.035 1.00 0.00 ? 59  ILE A HA   4  
ATOM 7529  H HB   . ILE A 1 59  ? 140.637 9.227   -116.656 1.00 0.00 ? 59  ILE A HB   4  
ATOM 7530  H HG12 . ILE A 1 59  ? 142.461 9.169   -114.238 1.00 0.00 ? 59  ILE A HG12 4  
ATOM 7531  H HG13 . ILE A 1 59  ? 141.243 7.933   -114.541 1.00 0.00 ? 59  ILE A HG13 4  
ATOM 7532  H HG21 . ILE A 1 59  ? 142.311 11.344  -115.271 1.00 0.00 ? 59  ILE A HG21 4  
ATOM 7533  H HG22 . ILE A 1 59  ? 141.326 11.591  -116.713 1.00 0.00 ? 59  ILE A HG22 4  
ATOM 7534  H HG23 . ILE A 1 59  ? 142.733 10.531  -116.777 1.00 0.00 ? 59  ILE A HG23 4  
ATOM 7535  H HD11 . ILE A 1 59  ? 143.229 8.673   -116.685 1.00 0.00 ? 59  ILE A HD11 4  
ATOM 7536  H HD12 . ILE A 1 59  ? 142.314 7.176   -116.498 1.00 0.00 ? 59  ILE A HD12 4  
ATOM 7537  H HD13 . ILE A 1 59  ? 143.666 7.524   -115.420 1.00 0.00 ? 59  ILE A HD13 4  
ATOM 7538  N N    . TYR A 1 60  ? 139.225 12.393  -115.571 1.00 0.00 ? 60  TYR A N    4  
ATOM 7539  C CA   . TYR A 1 60  ? 138.430 13.362  -116.375 1.00 0.00 ? 60  TYR A CA   4  
ATOM 7540  C C    . TYR A 1 60  ? 139.385 14.055  -117.343 1.00 0.00 ? 60  TYR A C    4  
ATOM 7541  O O    . TYR A 1 60  ? 140.512 14.386  -117.000 1.00 0.00 ? 60  TYR A O    4  
ATOM 7542  C CB   . TYR A 1 60  ? 137.732 14.402  -115.490 1.00 0.00 ? 60  TYR A CB   4  
ATOM 7543  C CG   . TYR A 1 60  ? 136.580 13.790  -114.729 1.00 0.00 ? 60  TYR A CG   4  
ATOM 7544  C CD1  . TYR A 1 60  ? 136.772 12.644  -113.948 1.00 0.00 ? 60  TYR A CD1  4  
ATOM 7545  C CD2  . TYR A 1 60  ? 135.317 14.389  -114.792 1.00 0.00 ? 60  TYR A CD2  4  
ATOM 7546  C CE1  . TYR A 1 60  ? 135.698 12.098  -113.234 1.00 0.00 ? 60  TYR A CE1  4  
ATOM 7547  C CE2  . TYR A 1 60  ? 134.244 13.841  -114.081 1.00 0.00 ? 60  TYR A CE2  4  
ATOM 7548  C CZ   . TYR A 1 60  ? 134.434 12.697  -113.302 1.00 0.00 ? 60  TYR A CZ   4  
ATOM 7549  O OH   . TYR A 1 60  ? 133.377 12.157  -112.597 1.00 0.00 ? 60  TYR A OH   4  
ATOM 7550  H H    . TYR A 1 60  ? 139.951 12.691  -114.984 1.00 0.00 ? 60  TYR A H    4  
ATOM 7551  H HA   . TYR A 1 60  ? 137.731 12.797  -116.971 1.00 0.00 ? 60  TYR A HA   4  
ATOM 7552  H HB2  . TYR A 1 60  ? 138.446 14.804  -114.786 1.00 0.00 ? 60  TYR A HB2  4  
ATOM 7553  H HB3  . TYR A 1 60  ? 137.361 15.204  -116.113 1.00 0.00 ? 60  TYR A HB3  4  
ATOM 7554  H HD1  . TYR A 1 60  ? 137.743 12.179  -113.899 1.00 0.00 ? 60  TYR A HD1  4  
ATOM 7555  H HD2  . TYR A 1 60  ? 135.170 15.273  -115.394 1.00 0.00 ? 60  TYR A HD2  4  
ATOM 7556  H HE1  . TYR A 1 60  ? 135.841 11.212  -112.636 1.00 0.00 ? 60  TYR A HE1  4  
ATOM 7557  H HE2  . TYR A 1 60  ? 133.269 14.304  -114.134 1.00 0.00 ? 60  TYR A HE2  4  
ATOM 7558  H HH   . TYR A 1 60  ? 132.564 12.494  -112.980 1.00 0.00 ? 60  TYR A HH   4  
ATOM 7559  N N    . ALA A 1 61  ? 138.947 14.231  -118.567 1.00 0.00 ? 61  ALA A N    4  
ATOM 7560  C CA   . ALA A 1 61  ? 139.818 14.853  -119.600 1.00 0.00 ? 61  ALA A CA   4  
ATOM 7561  C C    . ALA A 1 61  ? 140.493 16.101  -119.039 1.00 0.00 ? 61  ALA A C    4  
ATOM 7562  O O    . ALA A 1 61  ? 141.609 16.422  -119.394 1.00 0.00 ? 61  ALA A O    4  
ATOM 7563  C CB   . ALA A 1 61  ? 138.994 15.210  -120.839 1.00 0.00 ? 61  ALA A CB   4  
ATOM 7564  H H    . ALA A 1 61  ? 138.049 13.922  -118.810 1.00 0.00 ? 61  ALA A H    4  
ATOM 7565  H HA   . ALA A 1 61  ? 140.579 14.136  -119.860 1.00 0.00 ? 61  ALA A HA   4  
ATOM 7566  H HB1  . ALA A 1 61  ? 139.280 16.191  -121.190 1.00 0.00 ? 61  ALA A HB1  4  
ATOM 7567  H HB2  . ALA A 1 61  ? 137.944 15.211  -120.586 1.00 0.00 ? 61  ALA A HB2  4  
ATOM 7568  H HB3  . ALA A 1 61  ? 139.177 14.483  -121.615 1.00 0.00 ? 61  ALA A HB3  4  
ATOM 7569  N N    . ASP A 1 62  ? 139.845 16.793  -118.141 1.00 0.00 ? 62  ASP A N    4  
ATOM 7570  C CA   . ASP A 1 62  ? 140.492 17.993  -117.545 1.00 0.00 ? 62  ASP A CA   4  
ATOM 7571  C C    . ASP A 1 62  ? 141.853 17.557  -117.011 1.00 0.00 ? 62  ASP A C    4  
ATOM 7572  O O    . ASP A 1 62  ? 142.586 18.324  -116.418 1.00 0.00 ? 62  ASP A O    4  
ATOM 7573  C CB   . ASP A 1 62  ? 139.632 18.532  -116.399 1.00 0.00 ? 62  ASP A CB   4  
ATOM 7574  C CG   . ASP A 1 62  ? 138.679 19.602  -116.936 1.00 0.00 ? 62  ASP A CG   4  
ATOM 7575  O OD1  . ASP A 1 62  ? 138.726 19.867  -118.126 1.00 0.00 ? 62  ASP A OD1  4  
ATOM 7576  O OD2  . ASP A 1 62  ? 137.920 20.139  -116.146 1.00 0.00 ? 62  ASP A OD2  4  
ATOM 7577  H H    . ASP A 1 62  ? 138.956 16.511  -117.843 1.00 0.00 ? 62  ASP A H    4  
ATOM 7578  H HA   . ASP A 1 62  ? 140.620 18.754  -118.302 1.00 0.00 ? 62  ASP A HA   4  
ATOM 7579  H HB2  . ASP A 1 62  ? 139.060 17.724  -115.968 1.00 0.00 ? 62  ASP A HB2  4  
ATOM 7580  H HB3  . ASP A 1 62  ? 140.270 18.966  -115.644 1.00 0.00 ? 62  ASP A HB3  4  
ATOM 7581  N N    . ARG A 1 63  ? 142.173 16.306  -117.215 1.00 0.00 ? 63  ARG A N    4  
ATOM 7582  C CA   . ARG A 1 63  ? 143.463 15.745  -116.735 1.00 0.00 ? 63  ARG A CA   4  
ATOM 7583  C C    . ARG A 1 63  ? 143.428 15.606  -115.213 1.00 0.00 ? 63  ARG A C    4  
ATOM 7584  O O    . ARG A 1 63  ? 144.136 16.272  -114.488 1.00 0.00 ? 63  ARG A O    4  
ATOM 7585  C CB   . ARG A 1 63  ? 144.647 16.604  -117.212 1.00 0.00 ? 63  ARG A CB   4  
ATOM 7586  C CG   . ARG A 1 63  ? 145.854 16.446  -116.273 1.00 0.00 ? 63  ARG A CG   4  
ATOM 7587  C CD   . ARG A 1 63  ? 145.971 17.669  -115.353 1.00 0.00 ? 63  ARG A CD   4  
ATOM 7588  N NE   . ARG A 1 63  ? 147.338 18.259  -115.473 1.00 0.00 ? 63  ARG A NE   4  
ATOM 7589  C CZ   . ARG A 1 63  ? 148.393 17.490  -115.503 1.00 0.00 ? 63  ARG A CZ   4  
ATOM 7590  N NH1  . ARG A 1 63  ? 148.266 16.199  -115.366 1.00 0.00 ? 63  ARG A NH1  4  
ATOM 7591  N NH2  . ARG A 1 63  ? 149.578 18.016  -115.651 1.00 0.00 ? 63  ARG A NH2  4  
ATOM 7592  H H    . ARG A 1 63  ? 141.546 15.721  -117.686 1.00 0.00 ? 63  ARG A H    4  
ATOM 7593  H HA   . ARG A 1 63  ? 143.556 14.733  -117.095 1.00 0.00 ? 63  ARG A HA   4  
ATOM 7594  H HB2  . ARG A 1 63  ? 144.931 16.289  -118.206 1.00 0.00 ? 63  ARG A HB2  4  
ATOM 7595  H HB3  . ARG A 1 63  ? 144.350 17.639  -117.244 1.00 0.00 ? 63  ARG A HB3  4  
ATOM 7596  H HG2  . ARG A 1 63  ? 145.738 15.553  -115.678 1.00 0.00 ? 63  ARG A HG2  4  
ATOM 7597  H HG3  . ARG A 1 63  ? 146.751 16.364  -116.867 1.00 0.00 ? 63  ARG A HG3  4  
ATOM 7598  H HD2  . ARG A 1 63  ? 145.248 18.412  -115.641 1.00 0.00 ? 63  ARG A HD2  4  
ATOM 7599  H HD3  . ARG A 1 63  ? 145.785 17.368  -114.329 1.00 0.00 ? 63  ARG A HD3  4  
ATOM 7600  H HE   . ARG A 1 63  ? 147.442 19.231  -115.548 1.00 0.00 ? 63  ARG A HE   4  
ATOM 7601  H HH11 . ARG A 1 63  ? 147.361 15.795  -115.239 1.00 0.00 ? 63  ARG A HH11 4  
ATOM 7602  H HH12 . ARG A 1 63  ? 149.076 15.613  -115.389 1.00 0.00 ? 63  ARG A HH12 4  
ATOM 7603  H HH21 . ARG A 1 63  ? 149.677 19.007  -115.742 1.00 0.00 ? 63  ARG A HH21 4  
ATOM 7604  H HH22 . ARG A 1 63  ? 150.387 17.428  -115.675 1.00 0.00 ? 63  ARG A HH22 4  
ATOM 7605  N N    . SER A 1 64  ? 142.588 14.722  -114.735 1.00 0.00 ? 64  SER A N    4  
ATOM 7606  C CA   . SER A 1 64  ? 142.478 14.498  -113.262 1.00 0.00 ? 64  SER A CA   4  
ATOM 7607  C C    . SER A 1 64  ? 142.095 13.035  -113.003 1.00 0.00 ? 64  SER A C    4  
ATOM 7608  O O    . SER A 1 64  ? 141.114 12.548  -113.523 1.00 0.00 ? 64  SER A O    4  
ATOM 7609  C CB   . SER A 1 64  ? 141.402 15.418  -112.684 1.00 0.00 ? 64  SER A CB   4  
ATOM 7610  O OG   . SER A 1 64  ? 142.022 16.563  -112.113 1.00 0.00 ? 64  SER A OG   4  
ATOM 7611  H H    . SER A 1 64  ? 142.029 14.198  -115.356 1.00 0.00 ? 64  SER A H    4  
ATOM 7612  H HA   . SER A 1 64  ? 143.428 14.711  -112.793 1.00 0.00 ? 64  SER A HA   4  
ATOM 7613  H HB2  . SER A 1 64  ? 140.734 15.731  -113.468 1.00 0.00 ? 64  SER A HB2  4  
ATOM 7614  H HB3  . SER A 1 64  ? 140.842 14.884  -111.928 1.00 0.00 ? 64  SER A HB3  4  
ATOM 7615  H HG   . SER A 1 64  ? 142.016 17.262  -112.770 1.00 0.00 ? 64  SER A HG   4  
ATOM 7616  N N    . PHE A 1 65  ? 142.862 12.329  -112.211 1.00 0.00 ? 65  PHE A N    4  
ATOM 7617  C CA   . PHE A 1 65  ? 142.534 10.894  -111.937 1.00 0.00 ? 65  PHE A CA   4  
ATOM 7618  C C    . PHE A 1 65  ? 141.917 10.751  -110.542 1.00 0.00 ? 65  PHE A C    4  
ATOM 7619  O O    . PHE A 1 65  ? 142.607 10.795  -109.544 1.00 0.00 ? 65  PHE A O    4  
ATOM 7620  C CB   . PHE A 1 65  ? 143.817 10.064  -112.006 1.00 0.00 ? 65  PHE A CB   4  
ATOM 7621  C CG   . PHE A 1 65  ? 144.922 10.779  -111.267 1.00 0.00 ? 65  PHE A CG   4  
ATOM 7622  C CD1  . PHE A 1 65  ? 145.580 11.858  -111.867 1.00 0.00 ? 65  PHE A CD1  4  
ATOM 7623  C CD2  . PHE A 1 65  ? 145.287 10.363  -109.980 1.00 0.00 ? 65  PHE A CD2  4  
ATOM 7624  C CE1  . PHE A 1 65  ? 146.605 12.522  -111.183 1.00 0.00 ? 65  PHE A CE1  4  
ATOM 7625  C CE2  . PHE A 1 65  ? 146.311 11.028  -109.296 1.00 0.00 ? 65  PHE A CE2  4  
ATOM 7626  C CZ   . PHE A 1 65  ? 146.970 12.107  -109.896 1.00 0.00 ? 65  PHE A CZ   4  
ATOM 7627  H H    . PHE A 1 65  ? 143.654 12.736  -111.803 1.00 0.00 ? 65  PHE A H    4  
ATOM 7628  H HA   . PHE A 1 65  ? 141.838 10.534  -112.676 1.00 0.00 ? 65  PHE A HA   4  
ATOM 7629  H HB2  . PHE A 1 65  ? 143.646 9.098   -111.553 1.00 0.00 ? 65  PHE A HB2  4  
ATOM 7630  H HB3  . PHE A 1 65  ? 144.104 9.931   -113.039 1.00 0.00 ? 65  PHE A HB3  4  
ATOM 7631  H HD1  . PHE A 1 65  ? 145.298 12.179  -112.859 1.00 0.00 ? 65  PHE A HD1  4  
ATOM 7632  H HD2  . PHE A 1 65  ? 144.779 9.531   -109.517 1.00 0.00 ? 65  PHE A HD2  4  
ATOM 7633  H HE1  . PHE A 1 65  ? 147.113 13.355  -111.646 1.00 0.00 ? 65  PHE A HE1  4  
ATOM 7634  H HE2  . PHE A 1 65  ? 146.593 10.708  -108.303 1.00 0.00 ? 65  PHE A HE2  4  
ATOM 7635  H HZ   . PHE A 1 65  ? 147.761 12.620  -109.367 1.00 0.00 ? 65  PHE A HZ   4  
ATOM 7636  N N    . THR A 1 66  ? 140.625 10.565  -110.461 1.00 0.00 ? 66  THR A N    4  
ATOM 7637  C CA   . THR A 1 66  ? 139.984 10.405  -109.123 1.00 0.00 ? 66  THR A CA   4  
ATOM 7638  C C    . THR A 1 66  ? 139.688 8.926   -108.850 1.00 0.00 ? 66  THR A C    4  
ATOM 7639  O O    . THR A 1 66  ? 138.929 8.299   -109.572 1.00 0.00 ? 66  THR A O    4  
ATOM 7640  C CB   . THR A 1 66  ? 138.648 11.145  -109.152 1.00 0.00 ? 66  THR A CB   4  
ATOM 7641  O OG1  . THR A 1 66  ? 137.631 10.267  -109.616 1.00 0.00 ? 66  THR A OG1  4  
ATOM 7642  C CG2  . THR A 1 66  ? 138.757 12.344  -110.089 1.00 0.00 ? 66  THR A CG2  4  
ATOM 7643  H H    . THR A 1 66  ? 140.078 10.545  -111.274 1.00 0.00 ? 66  THR A H    4  
ATOM 7644  H HA   . THR A 1 66  ? 140.591 10.843  -108.343 1.00 0.00 ? 66  THR A HA   4  
ATOM 7645  H HB   . THR A 1 66  ? 138.403 11.490  -108.159 1.00 0.00 ? 66  THR A HB   4  
ATOM 7646  H HG1  . THR A 1 66  ? 137.126 10.728  -110.289 1.00 0.00 ? 66  THR A HG1  4  
ATOM 7647  H HG21 . THR A 1 66  ? 138.876 11.995  -111.104 1.00 0.00 ? 66  THR A HG21 4  
ATOM 7648  H HG22 . THR A 1 66  ? 139.613 12.940  -109.809 1.00 0.00 ? 66  THR A HG22 4  
ATOM 7649  H HG23 . THR A 1 66  ? 137.861 12.940  -110.014 1.00 0.00 ? 66  THR A HG23 4  
ATOM 7650  N N    . PHE A 1 67  ? 140.231 8.368   -107.797 1.00 0.00 ? 67  PHE A N    4  
ATOM 7651  C CA   . PHE A 1 67  ? 139.906 6.943   -107.477 1.00 0.00 ? 67  PHE A CA   4  
ATOM 7652  C C    . PHE A 1 67  ? 140.808 6.406   -106.365 1.00 0.00 ? 67  PHE A C    4  
ATOM 7653  O O    . PHE A 1 67  ? 141.969 6.750   -106.280 1.00 0.00 ? 67  PHE A O    4  
ATOM 7654  C CB   . PHE A 1 67  ? 140.070 6.068   -108.718 1.00 0.00 ? 67  PHE A CB   4  
ATOM 7655  C CG   . PHE A 1 67  ? 141.444 5.440   -108.712 1.00 0.00 ? 67  PHE A CG   4  
ATOM 7656  C CD1  . PHE A 1 67  ? 142.582 6.239   -108.886 1.00 0.00 ? 67  PHE A CD1  4  
ATOM 7657  C CD2  . PHE A 1 67  ? 141.581 4.059   -108.529 1.00 0.00 ? 67  PHE A CD2  4  
ATOM 7658  C CE1  . PHE A 1 67  ? 143.854 5.656   -108.878 1.00 0.00 ? 67  PHE A CE1  4  
ATOM 7659  C CE2  . PHE A 1 67  ? 142.854 3.477   -108.521 1.00 0.00 ? 67  PHE A CE2  4  
ATOM 7660  C CZ   . PHE A 1 67  ? 143.991 4.275   -108.696 1.00 0.00 ? 67  PHE A CZ   4  
ATOM 7661  H H    . PHE A 1 67  ? 140.808 8.892   -107.205 1.00 0.00 ? 67  PHE A H    4  
ATOM 7662  H HA   . PHE A 1 67  ? 138.884 6.901   -107.138 1.00 0.00 ? 67  PHE A HA   4  
ATOM 7663  H HB2  . PHE A 1 67  ? 139.320 5.290   -108.711 1.00 0.00 ? 67  PHE A HB2  4  
ATOM 7664  H HB3  . PHE A 1 67  ? 139.955 6.670   -109.601 1.00 0.00 ? 67  PHE A HB3  4  
ATOM 7665  H HD1  . PHE A 1 67  ? 142.476 7.304   -109.027 1.00 0.00 ? 67  PHE A HD1  4  
ATOM 7666  H HD2  . PHE A 1 67  ? 140.704 3.443   -108.395 1.00 0.00 ? 67  PHE A HD2  4  
ATOM 7667  H HE1  . PHE A 1 67  ? 144.731 6.272   -109.012 1.00 0.00 ? 67  PHE A HE1  4  
ATOM 7668  H HE2  . PHE A 1 67  ? 142.959 2.412   -108.380 1.00 0.00 ? 67  PHE A HE2  4  
ATOM 7669  H HZ   . PHE A 1 67  ? 144.972 3.825   -108.689 1.00 0.00 ? 67  PHE A HZ   4  
ATOM 7670  N N    . VAL A 1 68  ? 140.303 5.503   -105.565 1.00 0.00 ? 68  VAL A N    4  
ATOM 7671  C CA   . VAL A 1 68  ? 141.152 4.872   -104.512 1.00 0.00 ? 68  VAL A CA   4  
ATOM 7672  C C    . VAL A 1 68  ? 140.391 3.686   -103.916 1.00 0.00 ? 68  VAL A C    4  
ATOM 7673  O O    . VAL A 1 68  ? 139.545 3.825   -103.054 1.00 0.00 ? 68  VAL A O    4  
ATOM 7674  C CB   . VAL A 1 68  ? 141.532 5.877   -103.419 1.00 0.00 ? 68  VAL A CB   4  
ATOM 7675  C CG1  . VAL A 1 68  ? 142.063 5.124   -102.200 1.00 0.00 ? 68  VAL A CG1  4  
ATOM 7676  C CG2  . VAL A 1 68  ? 142.617 6.823   -103.937 1.00 0.00 ? 68  VAL A CG2  4  
ATOM 7677  H H    . VAL A 1 68  ? 139.381 5.200   -105.694 1.00 0.00 ? 68  VAL A H    4  
ATOM 7678  H HA   . VAL A 1 68  ? 142.029 4.482   -105.006 1.00 0.00 ? 68  VAL A HA   4  
ATOM 7679  H HB   . VAL A 1 68  ? 140.658 6.446   -103.138 1.00 0.00 ? 68  VAL A HB   4  
ATOM 7680  H HG11 . VAL A 1 68  ? 141.295 5.081   -101.441 1.00 0.00 ? 68  VAL A HG11 4  
ATOM 7681  H HG12 . VAL A 1 68  ? 142.927 5.637   -101.807 1.00 0.00 ? 68  VAL A HG12 4  
ATOM 7682  H HG13 . VAL A 1 68  ? 142.339 4.120   -102.488 1.00 0.00 ? 68  VAL A HG13 4  
ATOM 7683  H HG21 . VAL A 1 68  ? 143.230 7.152   -103.112 1.00 0.00 ? 68  VAL A HG21 4  
ATOM 7684  H HG22 . VAL A 1 68  ? 142.154 7.680   -104.404 1.00 0.00 ? 68  VAL A HG22 4  
ATOM 7685  H HG23 . VAL A 1 68  ? 143.232 6.305   -104.658 1.00 0.00 ? 68  VAL A HG23 4  
ATOM 7686  N N    . THR A 1 69  ? 140.722 2.510   -104.384 1.00 0.00 ? 69  THR A N    4  
ATOM 7687  C CA   . THR A 1 69  ? 140.085 1.255   -103.893 1.00 0.00 ? 69  THR A CA   4  
ATOM 7688  C C    . THR A 1 69  ? 141.094 0.513   -103.014 1.00 0.00 ? 69  THR A C    4  
ATOM 7689  O O    . THR A 1 69  ? 142.286 0.603   -103.235 1.00 0.00 ? 69  THR A O    4  
ATOM 7690  C CB   . THR A 1 69  ? 139.742 0.373   -105.099 1.00 0.00 ? 69  THR A CB   4  
ATOM 7691  O OG1  . THR A 1 69  ? 139.661 -0.982  -104.683 1.00 0.00 ? 69  THR A OG1  4  
ATOM 7692  C CG2  . THR A 1 69  ? 140.831 0.517   -106.171 1.00 0.00 ? 69  THR A CG2  4  
ATOM 7693  H H    . THR A 1 69  ? 141.419 2.453   -105.071 1.00 0.00 ? 69  THR A H    4  
ATOM 7694  H HA   . THR A 1 69  ? 139.181 1.464   -103.338 1.00 0.00 ? 69  THR A HA   4  
ATOM 7695  H HB   . THR A 1 69  ? 138.795 0.680   -105.513 1.00 0.00 ? 69  THR A HB   4  
ATOM 7696  H HG1  . THR A 1 69  ? 140.371 -1.144  -104.058 1.00 0.00 ? 69  THR A HG1  4  
ATOM 7697  H HG21 . THR A 1 69  ? 140.680 1.436   -106.718 1.00 0.00 ? 69  THR A HG21 4  
ATOM 7698  H HG22 . THR A 1 69  ? 140.778 -0.320  -106.853 1.00 0.00 ? 69  THR A HG22 4  
ATOM 7699  H HG23 . THR A 1 69  ? 141.802 0.534   -105.700 1.00 0.00 ? 69  THR A HG23 4  
ATOM 7700  N N    . LYS A 1 70  ? 140.659 -0.224  -102.024 1.00 0.00 ? 70  LYS A N    4  
ATOM 7701  C CA   . LYS A 1 70  ? 141.662 -0.943  -101.183 1.00 0.00 ? 70  LYS A CA   4  
ATOM 7702  C C    . LYS A 1 70  ? 141.236 -2.397  -100.965 1.00 0.00 ? 70  LYS A C    4  
ATOM 7703  O O    . LYS A 1 70  ? 140.175 -2.681  -100.455 1.00 0.00 ? 70  LYS A O    4  
ATOM 7704  C CB   . LYS A 1 70  ? 141.820 -0.236  -99.837  1.00 0.00 ? 70  LYS A CB   4  
ATOM 7705  C CG   . LYS A 1 70  ? 143.129 0.556   -99.827  1.00 0.00 ? 70  LYS A CG   4  
ATOM 7706  C CD   . LYS A 1 70  ? 143.051 1.687   -100.854 1.00 0.00 ? 70  LYS A CD   4  
ATOM 7707  C CE   . LYS A 1 70  ? 143.573 2.982   -100.228 1.00 0.00 ? 70  LYS A CE   4  
ATOM 7708  N NZ   . LYS A 1 70  ? 144.705 2.670   -99.311  1.00 0.00 ? 70  LYS A NZ   4  
ATOM 7709  H H    . LYS A 1 70  ? 139.694 -0.305  -101.839 1.00 0.00 ? 70  LYS A H    4  
ATOM 7710  H HA   . LYS A 1 70  ? 142.607 -0.960  -101.703 1.00 0.00 ? 70  LYS A HA   4  
ATOM 7711  H HB2  . LYS A 1 70  ? 140.990 0.439   -99.685  1.00 0.00 ? 70  LYS A HB2  4  
ATOM 7712  H HB3  . LYS A 1 70  ? 141.840 -0.969  -99.045  1.00 0.00 ? 70  LYS A HB3  4  
ATOM 7713  H HG2  . LYS A 1 70  ? 143.288 0.973   -98.843  1.00 0.00 ? 70  LYS A HG2  4  
ATOM 7714  H HG3  . LYS A 1 70  ? 143.949 -0.100  -100.078 1.00 0.00 ? 70  LYS A HG3  4  
ATOM 7715  H HD2  . LYS A 1 70  ? 143.653 1.433   -101.715 1.00 0.00 ? 70  LYS A HD2  4  
ATOM 7716  H HD3  . LYS A 1 70  ? 142.025 1.825   -101.160 1.00 0.00 ? 70  LYS A HD3  4  
ATOM 7717  H HE2  . LYS A 1 70  ? 143.914 3.646   -101.009 1.00 0.00 ? 70  LYS A HE2  4  
ATOM 7718  H HE3  . LYS A 1 70  ? 142.779 3.458   -99.671  1.00 0.00 ? 70  LYS A HE3  4  
ATOM 7719  H HZ1  . LYS A 1 70  ? 144.432 2.895   -98.334  1.00 0.00 ? 70  LYS A HZ1  4  
ATOM 7720  H HZ2  . LYS A 1 70  ? 145.534 3.237   -99.580  1.00 0.00 ? 70  LYS A HZ2  4  
ATOM 7721  H HZ3  . LYS A 1 70  ? 144.939 1.659   -99.379  1.00 0.00 ? 70  LYS A HZ3  4  
ATOM 7722  N N    . THR A 1 71  ? 142.092 -3.315  -101.345 1.00 0.00 ? 71  THR A N    4  
ATOM 7723  C CA   . THR A 1 71  ? 141.796 -4.768  -101.178 1.00 0.00 ? 71  THR A CA   4  
ATOM 7724  C C    . THR A 1 71  ? 140.792 -5.232  -102.245 1.00 0.00 ? 71  THR A C    4  
ATOM 7725  O O    . THR A 1 71  ? 139.952 -4.476  -102.692 1.00 0.00 ? 71  THR A O    4  
ATOM 7726  C CB   . THR A 1 71  ? 141.216 -5.007  -99.782  1.00 0.00 ? 71  THR A CB   4  
ATOM 7727  O OG1  . THR A 1 71  ? 139.868 -4.562  -99.747  1.00 0.00 ? 71  THR A OG1  4  
ATOM 7728  C CG2  . THR A 1 71  ? 142.040 -4.233  -98.754  1.00 0.00 ? 71  THR A CG2  4  
ATOM 7729  H H    . THR A 1 71  ? 142.944 -3.042  -101.743 1.00 0.00 ? 71  THR A H    4  
ATOM 7730  H HA   . THR A 1 71  ? 142.713 -5.329  -101.282 1.00 0.00 ? 71  THR A HA   4  
ATOM 7731  H HB   . THR A 1 71  ? 141.255 -6.057  -99.548  1.00 0.00 ? 71  THR A HB   4  
ATOM 7732  H HG1  . THR A 1 71  ? 139.545 -4.664  -98.851  1.00 0.00 ? 71  THR A HG1  4  
ATOM 7733  H HG21 . THR A 1 71  ? 141.987 -4.734  -97.798  1.00 0.00 ? 71  THR A HG21 4  
ATOM 7734  H HG22 . THR A 1 71  ? 141.648 -3.230  -98.658  1.00 0.00 ? 71  THR A HG22 4  
ATOM 7735  H HG23 . THR A 1 71  ? 143.068 -4.187  -99.078  1.00 0.00 ? 71  THR A HG23 4  
ATOM 7736  N N    . PRO A 1 72  ? 140.895 -6.476  -102.652 1.00 0.00 ? 72  PRO A N    4  
ATOM 7737  C CA   . PRO A 1 72  ? 139.995 -7.059  -103.691 1.00 0.00 ? 72  PRO A CA   4  
ATOM 7738  C C    . PRO A 1 72  ? 138.528 -6.649  -103.505 1.00 0.00 ? 72  PRO A C    4  
ATOM 7739  O O    . PRO A 1 72  ? 138.190 -5.973  -102.554 1.00 0.00 ? 72  PRO A O    4  
ATOM 7740  C CB   . PRO A 1 72  ? 140.195 -8.563  -103.474 1.00 0.00 ? 72  PRO A CB   4  
ATOM 7741  C CG   . PRO A 1 72  ? 141.379 -8.771  -102.520 1.00 0.00 ? 72  PRO A CG   4  
ATOM 7742  C CD   . PRO A 1 72  ? 141.911 -7.401  -102.091 1.00 0.00 ? 72  PRO A CD   4  
ATOM 7743  H HA   . PRO A 1 72  ? 140.338 -6.790  -104.675 1.00 0.00 ? 72  PRO A HA   4  
ATOM 7744  H HB2  . PRO A 1 72  ? 139.300 -8.991  -103.046 1.00 0.00 ? 72  PRO A HB2  4  
ATOM 7745  H HB3  . PRO A 1 72  ? 140.412 -9.040  -104.417 1.00 0.00 ? 72  PRO A HB3  4  
ATOM 7746  H HG2  . PRO A 1 72  ? 141.051 -9.323  -101.650 1.00 0.00 ? 72  PRO A HG2  4  
ATOM 7747  H HG3  . PRO A 1 72  ? 142.161 -9.319  -103.024 1.00 0.00 ? 72  PRO A HG3  4  
ATOM 7748  H HD2  . PRO A 1 72  ? 141.953 -7.331  -101.014 1.00 0.00 ? 72  PRO A HD2  4  
ATOM 7749  H HD3  . PRO A 1 72  ? 142.877 -7.207  -102.530 1.00 0.00 ? 72  PRO A HD3  4  
ATOM 7750  N N    . PRO A 1 73  ? 137.664 -7.040  -104.414 1.00 0.00 ? 73  PRO A N    4  
ATOM 7751  C CA   . PRO A 1 73  ? 136.228 -6.678  -104.325 1.00 0.00 ? 73  PRO A CA   4  
ATOM 7752  C C    . PRO A 1 73  ? 135.717 -6.729  -102.887 1.00 0.00 ? 73  PRO A C    4  
ATOM 7753  O O    . PRO A 1 73  ? 136.434 -7.111  -101.984 1.00 0.00 ? 73  PRO A O    4  
ATOM 7754  C CB   . PRO A 1 73  ? 135.579 -7.750  -105.200 1.00 0.00 ? 73  PRO A CB   4  
ATOM 7755  C CG   . PRO A 1 73  ? 136.675 -8.369  -106.083 1.00 0.00 ? 73  PRO A CG   4  
ATOM 7756  C CD   . PRO A 1 73  ? 138.041 -7.881  -105.579 1.00 0.00 ? 73  PRO A CD   4  
ATOM 7757  H HA   . PRO A 1 73  ? 136.054 -5.706  -104.755 1.00 0.00 ? 73  PRO A HA   4  
ATOM 7758  H HB2  . PRO A 1 73  ? 135.136 -8.512  -104.574 1.00 0.00 ? 73  PRO A HB2  4  
ATOM 7759  H HB3  . PRO A 1 73  ? 134.822 -7.303  -105.824 1.00 0.00 ? 73  PRO A HB3  4  
ATOM 7760  H HG2  . PRO A 1 73  ? 136.625 -9.446  -106.019 1.00 0.00 ? 73  PRO A HG2  4  
ATOM 7761  H HG3  . PRO A 1 73  ? 136.536 -8.057  -107.106 1.00 0.00 ? 73  PRO A HG3  4  
ATOM 7762  H HD2  . PRO A 1 73  ? 138.651 -8.718  -105.277 1.00 0.00 ? 73  PRO A HD2  4  
ATOM 7763  H HD3  . PRO A 1 73  ? 138.538 -7.286  -106.328 1.00 0.00 ? 73  PRO A HD3  4  
ATOM 7764  N N    . ALA A 1 74  ? 134.502 -6.323  -102.650 1.00 0.00 ? 74  ALA A N    4  
ATOM 7765  C CA   . ALA A 1 74  ? 134.006 -6.333  -101.250 1.00 0.00 ? 74  ALA A CA   4  
ATOM 7766  C C    . ALA A 1 74  ? 135.019 -5.563  -100.402 1.00 0.00 ? 74  ALA A C    4  
ATOM 7767  O O    . ALA A 1 74  ? 134.870 -4.384  -100.147 1.00 0.00 ? 74  ALA A O    4  
ATOM 7768  C CB   . ALA A 1 74  ? 133.907 -7.778  -100.755 1.00 0.00 ? 74  ALA A CB   4  
ATOM 7769  H H    . ALA A 1 74  ? 133.934 -5.995  -103.378 1.00 0.00 ? 74  ALA A H    4  
ATOM 7770  H HA   . ALA A 1 74  ? 133.039 -5.857  -101.196 1.00 0.00 ? 74  ALA A HA   4  
ATOM 7771  H HB1  . ALA A 1 74  ? 134.552 -8.407  -101.352 1.00 0.00 ? 74  ALA A HB1  4  
ATOM 7772  H HB2  . ALA A 1 74  ? 132.888 -8.121  -100.843 1.00 0.00 ? 74  ALA A HB2  4  
ATOM 7773  H HB3  . ALA A 1 74  ? 134.217 -7.826  -99.721  1.00 0.00 ? 74  ALA A HB3  4  
ATOM 7774  N N    . SER A 1 75  ? 136.050 -6.229  -99.973  1.00 0.00 ? 75  SER A N    4  
ATOM 7775  C CA   . SER A 1 75  ? 137.095 -5.571  -99.143  1.00 0.00 ? 75  SER A CA   4  
ATOM 7776  C C    . SER A 1 75  ? 137.482 -4.199  -99.715  1.00 0.00 ? 75  SER A C    4  
ATOM 7777  O O    . SER A 1 75  ? 137.979 -3.354  -98.990  1.00 0.00 ? 75  SER A O    4  
ATOM 7778  C CB   . SER A 1 75  ? 138.335 -6.470  -99.126  1.00 0.00 ? 75  SER A CB   4  
ATOM 7779  O OG   . SER A 1 75  ? 138.949 -6.444  -100.407 1.00 0.00 ? 75  SER A OG   4  
ATOM 7780  H H    . SER A 1 75  ? 136.133 -7.182  -100.183 1.00 0.00 ? 75  SER A H    4  
ATOM 7781  H HA   . SER A 1 75  ? 136.737 -5.446  -98.137  1.00 0.00 ? 75  SER A HA   4  
ATOM 7782  H HB2  . SER A 1 75  ? 139.035 -6.114  -98.390  1.00 0.00 ? 75  SER A HB2  4  
ATOM 7783  H HB3  . SER A 1 75  ? 138.040 -7.480  -98.878  1.00 0.00 ? 75  SER A HB3  4  
ATOM 7784  H HG   . SER A 1 75  ? 138.270 -6.613  -101.064 1.00 0.00 ? 75  SER A HG   4  
ATOM 7785  N N    . TYR A 1 76  ? 137.269 -3.961  -100.994 1.00 0.00 ? 76  TYR A N    4  
ATOM 7786  C CA   . TYR A 1 76  ? 137.666 -2.637  -101.572 1.00 0.00 ? 76  TYR A CA   4  
ATOM 7787  C C    . TYR A 1 76  ? 137.245 -1.525  -100.615 1.00 0.00 ? 76  TYR A C    4  
ATOM 7788  O O    . TYR A 1 76  ? 137.986 -0.580  -100.392 1.00 0.00 ? 76  TYR A O    4  
ATOM 7789  C CB   . TYR A 1 76  ? 137.045 -2.430  -102.963 1.00 0.00 ? 76  TYR A CB   4  
ATOM 7790  C CG   . TYR A 1 76  ? 135.543 -2.297  -102.891 1.00 0.00 ? 76  TYR A CG   4  
ATOM 7791  C CD1  . TYR A 1 76  ? 134.756 -3.411  -102.597 1.00 0.00 ? 76  TYR A CD1  4  
ATOM 7792  C CD2  . TYR A 1 76  ? 134.937 -1.062  -103.156 1.00 0.00 ? 76  TYR A CD2  4  
ATOM 7793  C CE1  . TYR A 1 76  ? 133.361 -3.294  -102.559 1.00 0.00 ? 76  TYR A CE1  4  
ATOM 7794  C CE2  . TYR A 1 76  ? 133.544 -0.946  -103.125 1.00 0.00 ? 76  TYR A CE2  4  
ATOM 7795  C CZ   . TYR A 1 76  ? 132.755 -2.062  -102.825 1.00 0.00 ? 76  TYR A CZ   4  
ATOM 7796  O OH   . TYR A 1 76  ? 131.380 -1.949  -102.796 1.00 0.00 ? 76  TYR A OH   4  
ATOM 7797  H H    . TYR A 1 76  ? 136.865 -4.650  -101.563 1.00 0.00 ? 76  TYR A H    4  
ATOM 7798  H HA   . TYR A 1 76  ? 138.740 -2.620  -101.674 1.00 0.00 ? 76  TYR A HA   4  
ATOM 7799  H HB2  . TYR A 1 76  ? 137.456 -1.533  -103.402 1.00 0.00 ? 76  TYR A HB2  4  
ATOM 7800  H HB3  . TYR A 1 76  ? 137.296 -3.274  -103.589 1.00 0.00 ? 76  TYR A HB3  4  
ATOM 7801  H HD1  . TYR A 1 76  ? 135.225 -4.359  -102.394 1.00 0.00 ? 76  TYR A HD1  4  
ATOM 7802  H HD2  . TYR A 1 76  ? 135.547 -0.200  -103.381 1.00 0.00 ? 76  TYR A HD2  4  
ATOM 7803  H HE1  . TYR A 1 76  ? 132.752 -4.154  -102.331 1.00 0.00 ? 76  TYR A HE1  4  
ATOM 7804  H HE2  . TYR A 1 76  ? 133.077 0.005   -103.332 1.00 0.00 ? 76  TYR A HE2  4  
ATOM 7805  H HH   . TYR A 1 76  ? 131.133 -1.194  -103.335 1.00 0.00 ? 76  TYR A HH   4  
ATOM 7806  N N    . LEU A 1 77  ? 136.084 -1.658  -100.022 1.00 0.00 ? 77  LEU A N    4  
ATOM 7807  C CA   . LEU A 1 77  ? 135.610 -0.650  -99.030  1.00 0.00 ? 77  LEU A CA   4  
ATOM 7808  C C    . LEU A 1 77  ? 135.038 -1.398  -97.823  1.00 0.00 ? 77  LEU A C    4  
ATOM 7809  O O    . LEU A 1 77  ? 134.843 -0.839  -96.744  1.00 0.00 ? 77  LEU A O    4  
ATOM 7810  C CB   . LEU A 1 77  ? 134.549 0.264   -99.638  1.00 0.00 ? 77  LEU A CB   4  
ATOM 7811  C CG   . LEU A 1 77  ? 133.341 -0.542  -100.098 1.00 0.00 ? 77  LEU A CG   4  
ATOM 7812  C CD1  . LEU A 1 77  ? 132.559 -1.057  -98.888  1.00 0.00 ? 77  LEU A CD1  4  
ATOM 7813  C CD2  . LEU A 1 77  ? 132.443 0.375   -100.916 1.00 0.00 ? 77  LEU A CD2  4  
ATOM 7814  H H    . LEU A 1 77  ? 135.537 -2.446  -100.218 1.00 0.00 ? 77  LEU A H    4  
ATOM 7815  H HA   . LEU A 1 77  ? 136.444 -0.051  -98.710  1.00 0.00 ? 77  LEU A HA   4  
ATOM 7816  H HB2  . LEU A 1 77  ? 134.234 0.986   -98.898  1.00 0.00 ? 77  LEU A HB2  4  
ATOM 7817  H HB3  . LEU A 1 77  ? 134.971 0.785   -100.485 1.00 0.00 ? 77  LEU A HB3  4  
ATOM 7818  H HG   . LEU A 1 77  ? 133.666 -1.373  -100.704 1.00 0.00 ? 77  LEU A HG   4  
ATOM 7819  H HD11 . LEU A 1 77  ? 132.801 -2.095  -98.717  1.00 0.00 ? 77  LEU A HD11 4  
ATOM 7820  H HD12 . LEU A 1 77  ? 131.501 -0.964  -99.080  1.00 0.00 ? 77  LEU A HD12 4  
ATOM 7821  H HD13 . LEU A 1 77  ? 132.818 -0.476  -98.016  1.00 0.00 ? 77  LEU A HD13 4  
ATOM 7822  H HD21 . LEU A 1 77  ? 133.057 1.043   -101.502 1.00 0.00 ? 77  LEU A HD21 4  
ATOM 7823  H HD22 . LEU A 1 77  ? 131.821 0.950   -100.249 1.00 0.00 ? 77  LEU A HD22 4  
ATOM 7824  H HD23 . LEU A 1 77  ? 131.825 -0.215  -101.569 1.00 0.00 ? 77  LEU A HD23 4  
ATOM 7825  N N    . ILE A 1 78  ? 134.790 -2.677  -97.983  1.00 0.00 ? 78  ILE A N    4  
ATOM 7826  C CA   . ILE A 1 78  ? 134.263 -3.462  -96.844  1.00 0.00 ? 78  ILE A CA   4  
ATOM 7827  C C    . ILE A 1 78  ? 135.307 -3.398  -95.740  1.00 0.00 ? 78  ILE A C    4  
ATOM 7828  O O    . ILE A 1 78  ? 135.006 -3.411  -94.563  1.00 0.00 ? 78  ILE A O    4  
ATOM 7829  C CB   . ILE A 1 78  ? 134.051 -4.923  -97.259  1.00 0.00 ? 78  ILE A CB   4  
ATOM 7830  C CG1  . ILE A 1 78  ? 132.788 -5.031  -98.122  1.00 0.00 ? 78  ILE A CG1  4  
ATOM 7831  C CG2  . ILE A 1 78  ? 133.893 -5.787  -96.002  1.00 0.00 ? 78  ILE A CG2  4  
ATOM 7832  C CD1  . ILE A 1 78  ? 132.398 -6.504  -98.295  1.00 0.00 ? 78  ILE A CD1  4  
ATOM 7833  H H    . ILE A 1 78  ? 134.969 -3.112  -98.843  1.00 0.00 ? 78  ILE A H    4  
ATOM 7834  H HA   . ILE A 1 78  ? 133.306 -3.044  -96.559  1.00 0.00 ? 78  ILE A HA   4  
ATOM 7835  H HB   . ILE A 1 78  ? 134.902 -5.265  -97.823  1.00 0.00 ? 78  ILE A HB   4  
ATOM 7836  H HG12 . ILE A 1 78  ? 131.979 -4.500  -97.642  1.00 0.00 ? 78  ILE A HG12 4  
ATOM 7837  H HG13 . ILE A 1 78  ? 132.976 -4.596  -99.092  1.00 0.00 ? 78  ILE A HG13 4  
ATOM 7838  H HG21 . ILE A 1 78  ? 134.772 -6.400  -95.874  1.00 0.00 ? 78  ILE A HG21 4  
ATOM 7839  H HG22 . ILE A 1 78  ? 133.025 -6.420  -96.102  1.00 0.00 ? 78  ILE A HG22 4  
ATOM 7840  H HG23 . ILE A 1 78  ? 133.772 -5.148  -95.140  1.00 0.00 ? 78  ILE A HG23 4  
ATOM 7841  H HD11 . ILE A 1 78  ? 131.497 -6.707  -97.734  1.00 0.00 ? 78  ILE A HD11 4  
ATOM 7842  H HD12 . ILE A 1 78  ? 133.197 -7.135  -97.931  1.00 0.00 ? 78  ILE A HD12 4  
ATOM 7843  H HD13 . ILE A 1 78  ? 132.224 -6.712  -99.340  1.00 0.00 ? 78  ILE A HD13 4  
ATOM 7844  N N    . ARG A 1 79  ? 136.560 -3.304  -96.145  1.00 0.00 ? 79  ARG A N    4  
ATOM 7845  C CA   . ARG A 1 79  ? 137.668 -3.213  -95.156  1.00 0.00 ? 79  ARG A CA   4  
ATOM 7846  C C    . ARG A 1 79  ? 137.394 -2.037  -94.228  1.00 0.00 ? 79  ARG A C    4  
ATOM 7847  O O    . ARG A 1 79  ? 137.525 -2.134  -93.024  1.00 0.00 ? 79  ARG A O    4  
ATOM 7848  C CB   . ARG A 1 79  ? 138.989 -2.986  -95.887  1.00 0.00 ? 79  ARG A CB   4  
ATOM 7849  C CG   . ARG A 1 79  ? 139.354 -4.248  -96.663  1.00 0.00 ? 79  ARG A CG   4  
ATOM 7850  C CD   . ARG A 1 79  ? 140.116 -5.211  -95.749  1.00 0.00 ? 79  ARG A CD   4  
ATOM 7851  N NE   . ARG A 1 79  ? 139.887 -6.612  -96.204  1.00 0.00 ? 79  ARG A NE   4  
ATOM 7852  C CZ   . ARG A 1 79  ? 140.665 -7.572  -95.779  1.00 0.00 ? 79  ARG A CZ   4  
ATOM 7853  N NH1  . ARG A 1 79  ? 141.648 -7.304  -94.965  1.00 0.00 ? 79  ARG A NH1  4  
ATOM 7854  N NH2  . ARG A 1 79  ? 140.460 -8.799  -96.174  1.00 0.00 ? 79  ARG A NH2  4  
ATOM 7855  H H    . ARG A 1 79  ? 136.756 -3.265  -97.111  1.00 0.00 ? 79  ARG A H    4  
ATOM 7856  H HA   . ARG A 1 79  ? 137.723 -4.128  -94.584  1.00 0.00 ? 79  ARG A HA   4  
ATOM 7857  H HB2  . ARG A 1 79  ? 138.885 -2.157  -96.572  1.00 0.00 ? 79  ARG A HB2  4  
ATOM 7858  H HB3  . ARG A 1 79  ? 139.765 -2.768  -95.171  1.00 0.00 ? 79  ARG A HB3  4  
ATOM 7859  H HG2  . ARG A 1 79  ? 138.450 -4.723  -97.012  1.00 0.00 ? 79  ARG A HG2  4  
ATOM 7860  H HG3  . ARG A 1 79  ? 139.973 -3.986  -97.504  1.00 0.00 ? 79  ARG A HG3  4  
ATOM 7861  H HD2  . ARG A 1 79  ? 141.172 -4.987  -95.790  1.00 0.00 ? 79  ARG A HD2  4  
ATOM 7862  H HD3  . ARG A 1 79  ? 139.763 -5.102  -94.735  1.00 0.00 ? 79  ARG A HD3  4  
ATOM 7863  H HE   . ARG A 1 79  ? 139.152 -6.814  -96.819  1.00 0.00 ? 79  ARG A HE   4  
ATOM 7864  H HH11 . ARG A 1 79  ? 141.806 -6.365  -94.664  1.00 0.00 ? 79  ARG A HH11 4  
ATOM 7865  H HH12 . ARG A 1 79  ? 142.243 -8.040  -94.640  1.00 0.00 ? 79  ARG A HH12 4  
ATOM 7866  H HH21 . ARG A 1 79  ? 139.708 -9.004  -96.800  1.00 0.00 ? 79  ARG A HH21 4  
ATOM 7867  H HH22 . ARG A 1 79  ? 141.055 -9.534  -95.849  1.00 0.00 ? 79  ARG A HH22 4  
ATOM 7868  N N    . LYS A 1 80  ? 137.001 -0.925  -94.782  1.00 0.00 ? 80  LYS A N    4  
ATOM 7869  C CA   . LYS A 1 80  ? 136.703 0.250   -93.930  1.00 0.00 ? 80  LYS A CA   4  
ATOM 7870  C C    . LYS A 1 80  ? 135.512 -0.101  -93.044  1.00 0.00 ? 80  LYS A C    4  
ATOM 7871  O O    . LYS A 1 80  ? 135.634 -0.206  -91.840  1.00 0.00 ? 80  LYS A O    4  
ATOM 7872  C CB   . LYS A 1 80  ? 136.364 1.458   -94.805  1.00 0.00 ? 80  LYS A CB   4  
ATOM 7873  C CG   . LYS A 1 80  ? 136.005 2.649   -93.915  1.00 0.00 ? 80  LYS A CG   4  
ATOM 7874  C CD   . LYS A 1 80  ? 134.495 2.888   -93.964  1.00 0.00 ? 80  LYS A CD   4  
ATOM 7875  C CE   . LYS A 1 80  ? 134.155 3.760   -95.173  1.00 0.00 ? 80  LYS A CE   4  
ATOM 7876  N NZ   . LYS A 1 80  ? 135.139 3.505   -96.262  1.00 0.00 ? 80  LYS A NZ   4  
ATOM 7877  H H    . LYS A 1 80  ? 136.893 -0.869  -95.754  1.00 0.00 ? 80  LYS A H    4  
ATOM 7878  H HA   . LYS A 1 80  ? 137.561 0.470   -93.312  1.00 0.00 ? 80  LYS A HA   4  
ATOM 7879  H HB2  . LYS A 1 80  ? 137.218 1.708   -95.417  1.00 0.00 ? 80  LYS A HB2  4  
ATOM 7880  H HB3  . LYS A 1 80  ? 135.524 1.219   -95.440  1.00 0.00 ? 80  LYS A HB3  4  
ATOM 7881  H HG2  . LYS A 1 80  ? 136.304 2.441   -92.898  1.00 0.00 ? 80  LYS A HG2  4  
ATOM 7882  H HG3  . LYS A 1 80  ? 136.518 3.530   -94.268  1.00 0.00 ? 80  LYS A HG3  4  
ATOM 7883  H HD2  . LYS A 1 80  ? 133.983 1.939   -94.048  1.00 0.00 ? 80  LYS A HD2  4  
ATOM 7884  H HD3  . LYS A 1 80  ? 134.180 3.388   -93.061  1.00 0.00 ? 80  LYS A HD3  4  
ATOM 7885  H HE2  . LYS A 1 80  ? 133.161 3.522   -95.522  1.00 0.00 ? 80  LYS A HE2  4  
ATOM 7886  H HE3  . LYS A 1 80  ? 134.195 4.801   -94.887  1.00 0.00 ? 80  LYS A HE3  4  
ATOM 7887  H HZ1  . LYS A 1 80  ? 135.066 2.516   -96.571  1.00 0.00 ? 80  LYS A HZ1  4  
ATOM 7888  H HZ2  . LYS A 1 80  ? 136.101 3.690   -95.910  1.00 0.00 ? 80  LYS A HZ2  4  
ATOM 7889  H HZ3  . LYS A 1 80  ? 134.938 4.134   -97.066  1.00 0.00 ? 80  LYS A HZ3  4  
ATOM 7890  N N    . ALA A 1 81  ? 134.355 -0.282  -93.623  1.00 0.00 ? 81  ALA A N    4  
ATOM 7891  C CA   . ALA A 1 81  ? 133.165 -0.624  -92.784  1.00 0.00 ? 81  ALA A CA   4  
ATOM 7892  C C    . ALA A 1 81  ? 133.442 -1.914  -92.010  1.00 0.00 ? 81  ALA A C    4  
ATOM 7893  O O    . ALA A 1 81  ? 132.648 -2.350  -91.201  1.00 0.00 ? 81  ALA A O    4  
ATOM 7894  C CB   . ALA A 1 81  ? 131.944 -0.831  -93.676  1.00 0.00 ? 81  ALA A CB   4  
ATOM 7895  H H    . ALA A 1 81  ? 134.263 -0.182  -94.603  1.00 0.00 ? 81  ALA A H    4  
ATOM 7896  H HA   . ALA A 1 81  ? 132.973 0.180   -92.089  1.00 0.00 ? 81  ALA A HA   4  
ATOM 7897  H HB1  . ALA A 1 81  ? 131.270 -1.531  -93.204  1.00 0.00 ? 81  ALA A HB1  4  
ATOM 7898  H HB2  . ALA A 1 81  ? 132.259 -1.224  -94.631  1.00 0.00 ? 81  ALA A HB2  4  
ATOM 7899  H HB3  . ALA A 1 81  ? 131.441 0.112   -93.821  1.00 0.00 ? 81  ALA A HB3  4  
ATOM 7900  N N    . ALA A 1 82  ? 134.559 -2.532  -92.265  1.00 0.00 ? 82  ALA A N    4  
ATOM 7901  C CA   . ALA A 1 82  ? 134.897 -3.805  -91.567  1.00 0.00 ? 82  ALA A CA   4  
ATOM 7902  C C    . ALA A 1 82  ? 135.542 -3.549  -90.202  1.00 0.00 ? 82  ALA A C    4  
ATOM 7903  O O    . ALA A 1 82  ? 134.889 -3.619  -89.180  1.00 0.00 ? 82  ALA A O    4  
ATOM 7904  C CB   . ALA A 1 82  ? 135.882 -4.600  -92.419  1.00 0.00 ? 82  ALA A CB   4  
ATOM 7905  H H    . ALA A 1 82  ? 135.176 -2.160  -92.930  1.00 0.00 ? 82  ALA A H    4  
ATOM 7906  H HA   . ALA A 1 82  ? 134.012 -4.407  -91.424  1.00 0.00 ? 82  ALA A HA   4  
ATOM 7907  H HB1  . ALA A 1 82  ? 136.606 -5.078  -91.777  1.00 0.00 ? 82  ALA A HB1  4  
ATOM 7908  H HB2  . ALA A 1 82  ? 136.389 -3.935  -93.094  1.00 0.00 ? 82  ALA A HB2  4  
ATOM 7909  H HB3  . ALA A 1 82  ? 135.349 -5.352  -92.983  1.00 0.00 ? 82  ALA A HB3  4  
ATOM 7910  N N    . GLY A 1 83  ? 136.812 -3.250  -90.165  1.00 0.00 ? 83  GLY A N    4  
ATOM 7911  C CA   . GLY A 1 83  ? 137.461 -2.994  -88.846  1.00 0.00 ? 83  GLY A CA   4  
ATOM 7912  C C    . GLY A 1 83  ? 138.964 -2.767  -89.025  1.00 0.00 ? 83  GLY A C    4  
ATOM 7913  O O    . GLY A 1 83  ? 139.747 -3.040  -88.138  1.00 0.00 ? 83  GLY A O    4  
ATOM 7914  H H    . GLY A 1 83  ? 137.332 -3.191  -90.992  1.00 0.00 ? 83  GLY A H    4  
ATOM 7915  H HA2  . GLY A 1 83  ? 137.018 -2.116  -88.396  1.00 0.00 ? 83  GLY A HA2  4  
ATOM 7916  H HA3  . GLY A 1 83  ? 137.305 -3.844  -88.200  1.00 0.00 ? 83  GLY A HA3  4  
ATOM 7917  N N    . LEU A 1 84  ? 139.379 -2.267  -90.157  1.00 0.00 ? 84  LEU A N    4  
ATOM 7918  C CA   . LEU A 1 84  ? 140.835 -2.025  -90.364  1.00 0.00 ? 84  LEU A CA   4  
ATOM 7919  C C    . LEU A 1 84  ? 141.178 -0.607  -89.904  1.00 0.00 ? 84  LEU A C    4  
ATOM 7920  O O    . LEU A 1 84  ? 140.875 0.363   -90.571  1.00 0.00 ? 84  LEU A O    4  
ATOM 7921  C CB   . LEU A 1 84  ? 141.186 -2.177  -91.847  1.00 0.00 ? 84  LEU A CB   4  
ATOM 7922  C CG   . LEU A 1 84  ? 140.816 -3.580  -92.346  1.00 0.00 ? 84  LEU A CG   4  
ATOM 7923  C CD1  . LEU A 1 84  ? 141.807 -4.006  -93.431  1.00 0.00 ? 84  LEU A CD1  4  
ATOM 7924  C CD2  . LEU A 1 84  ? 140.876 -4.587  -91.194  1.00 0.00 ? 84  LEU A CD2  4  
ATOM 7925  H H    . LEU A 1 84  ? 138.737 -2.046  -90.863  1.00 0.00 ? 84  LEU A H    4  
ATOM 7926  H HA   . LEU A 1 84  ? 141.404 -2.733  -89.781  1.00 0.00 ? 84  LEU A HA   4  
ATOM 7927  H HB2  . LEU A 1 84  ? 140.642 -1.440  -92.420  1.00 0.00 ? 84  LEU A HB2  4  
ATOM 7928  H HB3  . LEU A 1 84  ? 142.246 -2.021  -91.981  1.00 0.00 ? 84  LEU A HB3  4  
ATOM 7929  H HG   . LEU A 1 84  ? 139.818 -3.561  -92.760  1.00 0.00 ? 84  LEU A HG   4  
ATOM 7930  H HD11 . LEU A 1 84  ? 141.667 -5.052  -93.654  1.00 0.00 ? 84  LEU A HD11 4  
ATOM 7931  H HD12 . LEU A 1 84  ? 142.815 -3.843  -93.081  1.00 0.00 ? 84  LEU A HD12 4  
ATOM 7932  H HD13 . LEU A 1 84  ? 141.637 -3.421  -94.323  1.00 0.00 ? 84  LEU A HD13 4  
ATOM 7933  H HD21 . LEU A 1 84  ? 140.125 -4.342  -90.459  1.00 0.00 ? 84  LEU A HD21 4  
ATOM 7934  H HD22 . LEU A 1 84  ? 141.854 -4.555  -90.738  1.00 0.00 ? 84  LEU A HD22 4  
ATOM 7935  H HD23 . LEU A 1 84  ? 140.691 -5.580  -91.577  1.00 0.00 ? 84  LEU A HD23 4  
ATOM 7936  N N    . GLU A 1 85  ? 141.811 -0.479  -88.769  1.00 0.00 ? 85  GLU A N    4  
ATOM 7937  C CA   . GLU A 1 85  ? 142.173 0.875   -88.266  1.00 0.00 ? 85  GLU A CA   4  
ATOM 7938  C C    . GLU A 1 85  ? 142.966 0.737   -86.964  1.00 0.00 ? 85  GLU A C    4  
ATOM 7939  O O    . GLU A 1 85  ? 143.678 1.637   -86.562  1.00 0.00 ? 85  GLU A O    4  
ATOM 7940  C CB   . GLU A 1 85  ? 140.899 1.680   -88.003  1.00 0.00 ? 85  GLU A CB   4  
ATOM 7941  C CG   . GLU A 1 85  ? 141.265 3.028   -87.380  1.00 0.00 ? 85  GLU A CG   4  
ATOM 7942  C CD   . GLU A 1 85  ? 139.988 3.794   -87.029  1.00 0.00 ? 85  GLU A CD   4  
ATOM 7943  O OE1  . GLU A 1 85  ? 139.203 4.043   -87.931  1.00 0.00 ? 85  GLU A OE1  4  
ATOM 7944  O OE2  . GLU A 1 85  ? 139.814 4.117   -85.866  1.00 0.00 ? 85  GLU A OE2  4  
ATOM 7945  H H    . GLU A 1 85  ? 142.045 -1.275  -88.248  1.00 0.00 ? 85  GLU A H    4  
ATOM 7946  H HA   . GLU A 1 85  ? 142.776 1.384   -89.003  1.00 0.00 ? 85  GLU A HA   4  
ATOM 7947  H HB2  . GLU A 1 85  ? 140.378 1.843   -88.935  1.00 0.00 ? 85  GLU A HB2  4  
ATOM 7948  H HB3  . GLU A 1 85  ? 140.261 1.134   -87.325  1.00 0.00 ? 85  GLU A HB3  4  
ATOM 7949  H HG2  . GLU A 1 85  ? 141.844 2.864   -86.482  1.00 0.00 ? 85  GLU A HG2  4  
ATOM 7950  H HG3  . GLU A 1 85  ? 141.845 3.605   -88.084  1.00 0.00 ? 85  GLU A HG3  4  
ATOM 7951  N N    . LYS A 1 86  ? 142.850 -0.382  -86.304  1.00 0.00 ? 86  LYS A N    4  
ATOM 7952  C CA   . LYS A 1 86  ? 143.597 -0.577  -85.029  1.00 0.00 ? 86  LYS A CA   4  
ATOM 7953  C C    . LYS A 1 86  ? 142.924 0.228   -83.915  1.00 0.00 ? 86  LYS A C    4  
ATOM 7954  O O    . LYS A 1 86  ? 142.413 -0.323  -82.960  1.00 0.00 ? 86  LYS A O    4  
ATOM 7955  C CB   . LYS A 1 86  ? 145.039 -0.098  -85.204  1.00 0.00 ? 86  LYS A CB   4  
ATOM 7956  C CG   . LYS A 1 86  ? 145.948 -0.848  -84.229  1.00 0.00 ? 86  LYS A CG   4  
ATOM 7957  C CD   . LYS A 1 86  ? 147.303 -0.143  -84.149  1.00 0.00 ? 86  LYS A CD   4  
ATOM 7958  C CE   . LYS A 1 86  ? 148.223 -0.911  -83.197  1.00 0.00 ? 86  LYS A CE   4  
ATOM 7959  N NZ   . LYS A 1 86  ? 148.425 -0.117  -81.953  1.00 0.00 ? 86  LYS A NZ   4  
ATOM 7960  H H    . LYS A 1 86  ? 142.270 -1.095  -86.646  1.00 0.00 ? 86  LYS A H    4  
ATOM 7961  H HA   . LYS A 1 86  ? 143.594 -1.625  -84.767  1.00 0.00 ? 86  LYS A HA   4  
ATOM 7962  H HB2  . LYS A 1 86  ? 145.361 -0.290  -86.218  1.00 0.00 ? 86  LYS A HB2  4  
ATOM 7963  H HB3  . LYS A 1 86  ? 145.095 0.961   -85.003  1.00 0.00 ? 86  LYS A HB3  4  
ATOM 7964  H HG2  . LYS A 1 86  ? 145.490 -0.864  -83.251  1.00 0.00 ? 86  LYS A HG2  4  
ATOM 7965  H HG3  . LYS A 1 86  ? 146.091 -1.861  -84.576  1.00 0.00 ? 86  LYS A HG3  4  
ATOM 7966  H HD2  . LYS A 1 86  ? 147.750 -0.109  -85.133  1.00 0.00 ? 86  LYS A HD2  4  
ATOM 7967  H HD3  . LYS A 1 86  ? 147.165 0.862   -83.780  1.00 0.00 ? 86  LYS A HD3  4  
ATOM 7968  H HE2  . LYS A 1 86  ? 147.773 -1.861  -82.949  1.00 0.00 ? 86  LYS A HE2  4  
ATOM 7969  H HE3  . LYS A 1 86  ? 149.177 -1.079  -83.676  1.00 0.00 ? 86  LYS A HE3  4  
ATOM 7970  H HZ1  . LYS A 1 86  ? 148.023 0.833   -82.078  1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 7971  H HZ2  . LYS A 1 86  ? 149.443 -0.039  -81.753  1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 7972  H HZ3  . LYS A 1 86  ? 147.950 -0.590  -81.158  1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 7973  N N    . GLY A 1 87  ? 142.920 1.529   -84.029  1.00 0.00 ? 87  GLY A N    4  
ATOM 7974  C CA   . GLY A 1 87  ? 142.281 2.366   -82.975  1.00 0.00 ? 87  GLY A CA   4  
ATOM 7975  C C    . GLY A 1 87  ? 143.351 2.888   -82.015  1.00 0.00 ? 87  GLY A C    4  
ATOM 7976  O O    . GLY A 1 87  ? 144.524 2.607   -82.167  1.00 0.00 ? 87  GLY A O    4  
ATOM 7977  H H    . GLY A 1 87  ? 143.338 1.953   -84.807  1.00 0.00 ? 87  GLY A H    4  
ATOM 7978  H HA2  . GLY A 1 87  ? 141.772 3.200   -83.439  1.00 0.00 ? 87  GLY A HA2  4  
ATOM 7979  H HA3  . GLY A 1 87  ? 141.568 1.771   -82.424  1.00 0.00 ? 87  GLY A HA3  4  
ATOM 7980  N N    . ALA A 1 88  ? 142.958 3.646   -81.028  1.00 0.00 ? 88  ALA A N    4  
ATOM 7981  C CA   . ALA A 1 88  ? 143.955 4.184   -80.060  1.00 0.00 ? 88  ALA A CA   4  
ATOM 7982  C C    . ALA A 1 88  ? 143.232 4.988   -78.978  1.00 0.00 ? 88  ALA A C    4  
ATOM 7983  O O    . ALA A 1 88  ? 143.085 6.190   -79.078  1.00 0.00 ? 88  ALA A O    4  
ATOM 7984  C CB   . ALA A 1 88  ? 144.942 5.092   -80.797  1.00 0.00 ? 88  ALA A CB   4  
ATOM 7985  H H    . ALA A 1 88  ? 142.008 3.860   -80.924  1.00 0.00 ? 88  ALA A H    4  
ATOM 7986  H HA   . ALA A 1 88  ? 144.492 3.366   -79.604  1.00 0.00 ? 88  ALA A HA   4  
ATOM 7987  H HB1  . ALA A 1 88  ? 145.711 4.491   -81.256  1.00 0.00 ? 88  ALA A HB1  4  
ATOM 7988  H HB2  . ALA A 1 88  ? 145.392 5.779   -80.095  1.00 0.00 ? 88  ALA A HB2  4  
ATOM 7989  H HB3  . ALA A 1 88  ? 144.418 5.650   -81.559  1.00 0.00 ? 88  ALA A HB3  4  
ATOM 7990  N N    . HIS A 1 89  ? 142.779 4.335   -77.943  1.00 0.00 ? 89  HIS A N    4  
ATOM 7991  C CA   . HIS A 1 89  ? 142.067 5.062   -76.856  1.00 0.00 ? 89  HIS A CA   4  
ATOM 7992  C C    . HIS A 1 89  ? 142.351 4.381   -75.516  1.00 0.00 ? 89  HIS A C    4  
ATOM 7993  O O    . HIS A 1 89  ? 143.242 4.770   -74.787  1.00 0.00 ? 89  HIS A O    4  
ATOM 7994  C CB   . HIS A 1 89  ? 140.562 5.042   -77.129  1.00 0.00 ? 89  HIS A CB   4  
ATOM 7995  C CG   . HIS A 1 89  ? 140.155 6.329   -77.793  1.00 0.00 ? 89  HIS A CG   4  
ATOM 7996  N ND1  . HIS A 1 89  ? 139.440 6.354   -78.979  1.00 0.00 ? 89  HIS A ND1  4  
ATOM 7997  C CD2  . HIS A 1 89  ? 140.357 7.643   -77.448  1.00 0.00 ? 89  HIS A CD2  4  
ATOM 7998  C CE1  . HIS A 1 89  ? 139.238 7.645   -79.303  1.00 0.00 ? 89  HIS A CE1  4  
ATOM 7999  N NE2  . HIS A 1 89  ? 139.777 8.472   -78.404  1.00 0.00 ? 89  HIS A NE2  4  
ATOM 8000  H H    . HIS A 1 89  ? 142.909 3.365   -77.881  1.00 0.00 ? 89  HIS A H    4  
ATOM 8001  H HA   . HIS A 1 89  ? 142.412 6.085   -76.820  1.00 0.00 ? 89  HIS A HA   4  
ATOM 8002  H HB2  . HIS A 1 89  ? 140.325 4.211   -77.778  1.00 0.00 ? 89  HIS A HB2  4  
ATOM 8003  H HB3  . HIS A 1 89  ? 140.027 4.934   -76.197  1.00 0.00 ? 89  HIS A HB3  4  
ATOM 8004  H HD1  . HIS A 1 89  ? 139.136 5.575   -79.490  1.00 0.00 ? 89  HIS A HD1  4  
ATOM 8005  H HD2  . HIS A 1 89  ? 140.885 7.981   -76.569  1.00 0.00 ? 89  HIS A HD2  4  
ATOM 8006  H HE1  . HIS A 1 89  ? 138.706 7.972   -80.185  1.00 0.00 ? 89  HIS A HE1  4  
ATOM 8007  N N    . LYS A 1 90  ? 141.601 3.366   -75.185  1.00 0.00 ? 90  LYS A N    4  
ATOM 8008  C CA   . LYS A 1 90  ? 141.829 2.661   -73.892  1.00 0.00 ? 90  LYS A CA   4  
ATOM 8009  C C    . LYS A 1 90  ? 142.316 1.237   -74.169  1.00 0.00 ? 90  LYS A C    4  
ATOM 8010  O O    . LYS A 1 90  ? 142.131 0.710   -75.248  1.00 0.00 ? 90  LYS A O    4  
ATOM 8011  C CB   . LYS A 1 90  ? 140.518 2.608   -73.102  1.00 0.00 ? 90  LYS A CB   4  
ATOM 8012  C CG   . LYS A 1 90  ? 140.535 3.680   -72.010  1.00 0.00 ? 90  LYS A CG   4  
ATOM 8013  C CD   . LYS A 1 90  ? 139.377 3.441   -71.040  1.00 0.00 ? 90  LYS A CD   4  
ATOM 8014  C CE   . LYS A 1 90  ? 138.988 4.761   -70.374  1.00 0.00 ? 90  LYS A CE   4  
ATOM 8015  N NZ   . LYS A 1 90  ? 137.761 4.560   -69.552  1.00 0.00 ? 90  LYS A NZ   4  
ATOM 8016  H H    . LYS A 1 90  ? 140.887 3.067   -75.786  1.00 0.00 ? 90  LYS A H    4  
ATOM 8017  H HA   . LYS A 1 90  ? 142.573 3.193   -73.320  1.00 0.00 ? 90  LYS A HA   4  
ATOM 8018  H HB2  . LYS A 1 90  ? 139.689 2.788   -73.771  1.00 0.00 ? 90  LYS A HB2  4  
ATOM 8019  H HB3  . LYS A 1 90  ? 140.410 1.635   -72.647  1.00 0.00 ? 90  LYS A HB3  4  
ATOM 8020  H HG2  . LYS A 1 90  ? 141.473 3.633   -71.474  1.00 0.00 ? 90  LYS A HG2  4  
ATOM 8021  H HG3  . LYS A 1 90  ? 140.428 4.655   -72.461  1.00 0.00 ? 90  LYS A HG3  4  
ATOM 8022  H HD2  . LYS A 1 90  ? 138.531 3.045   -71.582  1.00 0.00 ? 90  LYS A HD2  4  
ATOM 8023  H HD3  . LYS A 1 90  ? 139.683 2.734   -70.283  1.00 0.00 ? 90  LYS A HD3  4  
ATOM 8024  H HE2  . LYS A 1 90  ? 139.794 5.097   -69.740  1.00 0.00 ? 90  LYS A HE2  4  
ATOM 8025  H HE3  . LYS A 1 90  ? 138.793 5.504   -71.134  1.00 0.00 ? 90  LYS A HE3  4  
ATOM 8026  H HZ1  . LYS A 1 90  ? 137.193 3.790   -69.959  1.00 0.00 ? 90  LYS A HZ1  4  
ATOM 8027  H HZ2  . LYS A 1 90  ? 137.201 5.437   -69.543  1.00 0.00 ? 90  LYS A HZ2  4  
ATOM 8028  H HZ3  . LYS A 1 90  ? 138.032 4.311   -68.580  1.00 0.00 ? 90  LYS A HZ3  4  
ATOM 8029  N N    . PRO A 1 91  ? 142.935 0.620   -73.197  1.00 0.00 ? 91  PRO A N    4  
ATOM 8030  C CA   . PRO A 1 91  ? 143.451 -0.767  -73.358  1.00 0.00 ? 91  PRO A CA   4  
ATOM 8031  C C    . PRO A 1 91  ? 142.350 -1.757  -73.756  1.00 0.00 ? 91  PRO A C    4  
ATOM 8032  O O    . PRO A 1 91  ? 142.575 -2.947  -73.842  1.00 0.00 ? 91  PRO A O    4  
ATOM 8033  C CB   . PRO A 1 91  ? 143.989 -1.089  -71.963  1.00 0.00 ? 91  PRO A CB   4  
ATOM 8034  C CG   . PRO A 1 91  ? 143.803 0.138   -71.060  1.00 0.00 ? 91  PRO A CG   4  
ATOM 8035  C CD   . PRO A 1 91  ? 143.161 1.263   -71.878  1.00 0.00 ? 91  PRO A CD   4  
ATOM 8036  H HA   . PRO A 1 91  ? 144.256 -0.791  -74.071  1.00 0.00 ? 91  PRO A HA   4  
ATOM 8037  H HB2  . PRO A 1 91  ? 143.447 -1.929  -71.551  1.00 0.00 ? 91  PRO A HB2  4  
ATOM 8038  H HB3  . PRO A 1 91  ? 145.039 -1.331  -72.026  1.00 0.00 ? 91  PRO A HB3  4  
ATOM 8039  H HG2  . PRO A 1 91  ? 143.162 -0.119  -70.228  1.00 0.00 ? 91  PRO A HG2  4  
ATOM 8040  H HG3  . PRO A 1 91  ? 144.762 0.466   -70.690  1.00 0.00 ? 91  PRO A HG3  4  
ATOM 8041  H HD2  . PRO A 1 91  ? 142.225 1.572   -71.431  1.00 0.00 ? 91  PRO A HD2  4  
ATOM 8042  H HD3  . PRO A 1 91  ? 143.836 2.098   -71.978  1.00 0.00 ? 91  PRO A HD3  4  
ATOM 8043  N N    . GLY A 1 92  ? 141.163 -1.274  -73.999  1.00 0.00 ? 92  GLY A N    4  
ATOM 8044  C CA   . GLY A 1 92  ? 140.052 -2.187  -74.391  1.00 0.00 ? 92  GLY A CA   4  
ATOM 8045  C C    . GLY A 1 92  ? 140.330 -2.764  -75.780  1.00 0.00 ? 92  GLY A C    4  
ATOM 8046  O O    . GLY A 1 92  ? 140.312 -3.962  -75.980  1.00 0.00 ? 92  GLY A O    4  
ATOM 8047  H H    . GLY A 1 92  ? 141.001 -0.309  -73.924  1.00 0.00 ? 92  GLY A H    4  
ATOM 8048  H HA2  . GLY A 1 92  ? 139.979 -2.991  -73.673  1.00 0.00 ? 92  GLY A HA2  4  
ATOM 8049  H HA3  . GLY A 1 92  ? 139.124 -1.636  -74.413  1.00 0.00 ? 92  GLY A HA3  4  
ATOM 8050  N N    . ARG A 1 93  ? 140.587 -1.920  -76.743  1.00 0.00 ? 93  ARG A N    4  
ATOM 8051  C CA   . ARG A 1 93  ? 140.867 -2.420  -78.118  1.00 0.00 ? 93  ARG A CA   4  
ATOM 8052  C C    . ARG A 1 93  ? 139.600 -3.053  -78.698  1.00 0.00 ? 93  ARG A C    4  
ATOM 8053  O O    . ARG A 1 93  ? 138.573 -3.114  -78.052  1.00 0.00 ? 93  ARG A O    4  
ATOM 8054  C CB   . ARG A 1 93  ? 141.982 -3.467  -78.066  1.00 0.00 ? 93  ARG A CB   4  
ATOM 8055  C CG   . ARG A 1 93  ? 143.071 -3.012  -77.089  1.00 0.00 ? 93  ARG A CG   4  
ATOM 8056  C CD   . ARG A 1 93  ? 143.367 -1.524  -77.292  1.00 0.00 ? 93  ARG A CD   4  
ATOM 8057  N NE   . ARG A 1 93  ? 143.369 -1.190  -78.751  1.00 0.00 ? 93  ARG A NE   4  
ATOM 8058  C CZ   . ARG A 1 93  ? 143.996 -1.943  -79.615  1.00 0.00 ? 93  ARG A CZ   4  
ATOM 8059  N NH1  . ARG A 1 93  ? 144.716 -2.952  -79.210  1.00 0.00 ? 93  ARG A NH1  4  
ATOM 8060  N NH2  . ARG A 1 93  ? 143.925 -1.668  -80.888  1.00 0.00 ? 93  ARG A NH2  4  
ATOM 8061  H H    . ARG A 1 93  ? 140.597 -0.958  -76.560  1.00 0.00 ? 93  ARG A H    4  
ATOM 8062  H HA   . ARG A 1 93  ? 141.175 -1.597  -78.745  1.00 0.00 ? 93  ARG A HA   4  
ATOM 8063  H HB2  . ARG A 1 93  ? 141.572 -4.410  -77.733  1.00 0.00 ? 93  ARG A HB2  4  
ATOM 8064  H HB3  . ARG A 1 93  ? 142.408 -3.590  -79.049  1.00 0.00 ? 93  ARG A HB3  4  
ATOM 8065  H HG2  . ARG A 1 93  ? 142.730 -3.173  -76.077  1.00 0.00 ? 93  ARG A HG2  4  
ATOM 8066  H HG3  . ARG A 1 93  ? 143.968 -3.586  -77.256  1.00 0.00 ? 93  ARG A HG3  4  
ATOM 8067  H HD2  . ARG A 1 93  ? 142.601 -0.940  -76.812  1.00 0.00 ? 93  ARG A HD2  4  
ATOM 8068  H HD3  . ARG A 1 93  ? 144.327 -1.286  -76.845  1.00 0.00 ? 93  ARG A HD3  4  
ATOM 8069  H HE   . ARG A 1 93  ? 142.868 -0.408  -79.067  1.00 0.00 ? 93  ARG A HE   4  
ATOM 8070  H HH11 . ARG A 1 93  ? 144.793 -3.152  -78.236  1.00 0.00 ? 93  ARG A HH11 4  
ATOM 8071  H HH12 . ARG A 1 93  ? 145.191 -3.526  -79.877  1.00 0.00 ? 93  ARG A HH12 4  
ATOM 8072  H HH21 . ARG A 1 93  ? 143.392 -0.881  -81.200  1.00 0.00 ? 93  ARG A HH21 4  
ATOM 8073  H HH22 . ARG A 1 93  ? 144.404 -2.242  -81.552  1.00 0.00 ? 93  ARG A HH22 4  
ATOM 8074  N N    . GLU A 1 94  ? 139.664 -3.526  -79.914  1.00 0.00 ? 94  GLU A N    4  
ATOM 8075  C CA   . GLU A 1 94  ? 138.465 -4.154  -80.534  1.00 0.00 ? 94  GLU A CA   4  
ATOM 8076  C C    . GLU A 1 94  ? 138.904 -5.286  -81.467  1.00 0.00 ? 94  GLU A C    4  
ATOM 8077  O O    . GLU A 1 94  ? 140.029 -5.741  -81.420  1.00 0.00 ? 94  GLU A O    4  
ATOM 8078  C CB   . GLU A 1 94  ? 137.695 -3.102  -81.336  1.00 0.00 ? 94  GLU A CB   4  
ATOM 8079  C CG   . GLU A 1 94  ? 137.399 -1.894  -80.445  1.00 0.00 ? 94  GLU A CG   4  
ATOM 8080  C CD   . GLU A 1 94  ? 136.469 -0.930  -81.184  1.00 0.00 ? 94  GLU A CD   4  
ATOM 8081  O OE1  . GLU A 1 94  ? 136.097 -1.238  -82.304  1.00 0.00 ? 94  GLU A OE1  4  
ATOM 8082  O OE2  . GLU A 1 94  ? 136.143 0.099   -80.615  1.00 0.00 ? 94  GLU A OE2  4  
ATOM 8083  H H    . GLU A 1 94  ? 140.503 -3.466  -80.419  1.00 0.00 ? 94  GLU A H    4  
ATOM 8084  H HA   . GLU A 1 94  ? 137.826 -4.553  -79.759  1.00 0.00 ? 94  GLU A HA   4  
ATOM 8085  H HB2  . GLU A 1 94  ? 138.290 -2.790  -82.182  1.00 0.00 ? 94  GLU A HB2  4  
ATOM 8086  H HB3  . GLU A 1 94  ? 136.765 -3.525  -81.687  1.00 0.00 ? 94  GLU A HB3  4  
ATOM 8087  H HG2  . GLU A 1 94  ? 136.924 -2.228  -79.533  1.00 0.00 ? 94  GLU A HG2  4  
ATOM 8088  H HG3  . GLU A 1 94  ? 138.323 -1.388  -80.205  1.00 0.00 ? 94  GLU A HG3  4  
ATOM 8089  N N    . LYS A 1 95  ? 138.022 -5.744  -82.314  1.00 0.00 ? 95  LYS A N    4  
ATOM 8090  C CA   . LYS A 1 95  ? 138.388 -6.846  -83.248  1.00 0.00 ? 95  LYS A CA   4  
ATOM 8091  C C    . LYS A 1 95  ? 138.672 -6.266  -84.636  1.00 0.00 ? 95  LYS A C    4  
ATOM 8092  O O    . LYS A 1 95  ? 138.854 -5.075  -84.796  1.00 0.00 ? 95  LYS A O    4  
ATOM 8093  C CB   . LYS A 1 95  ? 137.231 -7.842  -83.340  1.00 0.00 ? 95  LYS A CB   4  
ATOM 8094  C CG   . LYS A 1 95  ? 137.406 -8.929  -82.278  1.00 0.00 ? 95  LYS A CG   4  
ATOM 8095  C CD   . LYS A 1 95  ? 136.086 -9.678  -82.090  1.00 0.00 ? 95  LYS A CD   4  
ATOM 8096  C CE   . LYS A 1 95  ? 135.339 -9.105  -80.884  1.00 0.00 ? 95  LYS A CE   4  
ATOM 8097  N NZ   . LYS A 1 95  ? 136.251 -9.073  -79.705  1.00 0.00 ? 95  LYS A NZ   4  
ATOM 8098  H H    . LYS A 1 95  ? 137.119 -5.363  -82.336  1.00 0.00 ? 95  LYS A H    4  
ATOM 8099  H HA   . LYS A 1 95  ? 139.270 -7.351  -82.882  1.00 0.00 ? 95  LYS A HA   4  
ATOM 8100  H HB2  . LYS A 1 95  ? 136.297 -7.325  -83.176  1.00 0.00 ? 95  LYS A HB2  4  
ATOM 8101  H HB3  . LYS A 1 95  ? 137.224 -8.297  -84.319  1.00 0.00 ? 95  LYS A HB3  4  
ATOM 8102  H HG2  . LYS A 1 95  ? 138.173 -9.622  -82.594  1.00 0.00 ? 95  LYS A HG2  4  
ATOM 8103  H HG3  . LYS A 1 95  ? 137.695 -8.474  -81.342  1.00 0.00 ? 95  LYS A HG3  4  
ATOM 8104  H HD2  . LYS A 1 95  ? 135.479 -9.564  -82.977  1.00 0.00 ? 95  LYS A HD2  4  
ATOM 8105  H HD3  . LYS A 1 95  ? 136.287 -10.725 -81.922  1.00 0.00 ? 95  LYS A HD3  4  
ATOM 8106  H HE2  . LYS A 1 95  ? 135.008 -8.102  -81.109  1.00 0.00 ? 95  LYS A HE2  4  
ATOM 8107  H HE3  . LYS A 1 95  ? 134.485 -9.726  -80.662  1.00 0.00 ? 95  LYS A HE3  4  
ATOM 8108  H HZ1  . LYS A 1 95  ? 136.631 -8.113  -79.586  1.00 0.00 ? 95  LYS A HZ1  4  
ATOM 8109  H HZ2  . LYS A 1 95  ? 137.035 -9.742  -79.855  1.00 0.00 ? 95  LYS A HZ2  4  
ATOM 8110  H HZ3  . LYS A 1 95  ? 135.723 -9.343  -78.851  1.00 0.00 ? 95  LYS A HZ3  4  
ATOM 8111  N N    . VAL A 1 96  ? 138.713 -7.098  -85.641  1.00 0.00 ? 96  VAL A N    4  
ATOM 8112  C CA   . VAL A 1 96  ? 138.986 -6.592  -87.016  1.00 0.00 ? 96  VAL A CA   4  
ATOM 8113  C C    . VAL A 1 96  ? 138.173 -7.400  -88.030  1.00 0.00 ? 96  VAL A C    4  
ATOM 8114  O O    . VAL A 1 96  ? 137.853 -8.551  -87.809  1.00 0.00 ? 96  VAL A O    4  
ATOM 8115  C CB   . VAL A 1 96  ? 140.477 -6.738  -87.326  1.00 0.00 ? 96  VAL A CB   4  
ATOM 8116  C CG1  . VAL A 1 96  ? 140.798 -6.028  -88.643  1.00 0.00 ? 96  VAL A CG1  4  
ATOM 8117  C CG2  . VAL A 1 96  ? 141.295 -6.110  -86.196  1.00 0.00 ? 96  VAL A CG2  4  
ATOM 8118  H H    . VAL A 1 96  ? 138.565 -8.055  -85.491  1.00 0.00 ? 96  VAL A H    4  
ATOM 8119  H HA   . VAL A 1 96  ? 138.706 -5.551  -87.079  1.00 0.00 ? 96  VAL A HA   4  
ATOM 8120  H HB   . VAL A 1 96  ? 140.725 -7.786  -87.413  1.00 0.00 ? 96  VAL A HB   4  
ATOM 8121  H HG11 . VAL A 1 96  ? 140.842 -4.963  -88.475  1.00 0.00 ? 96  VAL A HG11 4  
ATOM 8122  H HG12 . VAL A 1 96  ? 140.027 -6.248  -89.367  1.00 0.00 ? 96  VAL A HG12 4  
ATOM 8123  H HG13 . VAL A 1 96  ? 141.751 -6.374  -89.015  1.00 0.00 ? 96  VAL A HG13 4  
ATOM 8124  H HG21 . VAL A 1 96  ? 140.849 -5.168  -85.909  1.00 0.00 ? 96  VAL A HG21 4  
ATOM 8125  H HG22 . VAL A 1 96  ? 142.306 -5.940  -86.535  1.00 0.00 ? 96  VAL A HG22 4  
ATOM 8126  H HG23 . VAL A 1 96  ? 141.307 -6.776  -85.346  1.00 0.00 ? 96  VAL A HG23 4  
ATOM 8127  N N    . GLY A 1 97  ? 137.838 -6.806  -89.144  1.00 0.00 ? 97  GLY A N    4  
ATOM 8128  C CA   . GLY A 1 97  ? 137.047 -7.539  -90.174  1.00 0.00 ? 97  GLY A CA   4  
ATOM 8129  C C    . GLY A 1 97  ? 135.606 -7.709  -89.692  1.00 0.00 ? 97  GLY A C    4  
ATOM 8130  O O    . GLY A 1 97  ? 135.057 -8.796  -89.707  1.00 0.00 ? 97  GLY A O    4  
ATOM 8131  H H    . GLY A 1 97  ? 138.108 -5.877  -89.303  1.00 0.00 ? 97  GLY A H    4  
ATOM 8132  H HA2  . GLY A 1 97  ? 137.057 -6.980  -91.097  1.00 0.00 ? 97  GLY A HA2  4  
ATOM 8133  H HA3  . GLY A 1 97  ? 137.484 -8.510  -90.339  1.00 0.00 ? 97  GLY A HA3  4  
ATOM 8134  N N    . ARG A 1 98  ? 134.984 -6.644  -89.261  1.00 0.00 ? 98  ARG A N    4  
ATOM 8135  C CA   . ARG A 1 98  ? 133.580 -6.756  -88.778  1.00 0.00 ? 98  ARG A CA   4  
ATOM 8136  C C    . ARG A 1 98  ? 132.724 -5.650  -89.399  1.00 0.00 ? 98  ARG A C    4  
ATOM 8137  O O    . ARG A 1 98  ? 132.915 -4.479  -89.140  1.00 0.00 ? 98  ARG A O    4  
ATOM 8138  C CB   . ARG A 1 98  ? 133.552 -6.630  -87.253  1.00 0.00 ? 98  ARG A CB   4  
ATOM 8139  C CG   . ARG A 1 98  ? 132.963 -7.904  -86.641  1.00 0.00 ? 98  ARG A CG   4  
ATOM 8140  C CD   . ARG A 1 98  ? 132.463 -7.605  -85.227  1.00 0.00 ? 98  ARG A CD   4  
ATOM 8141  N NE   . ARG A 1 98  ? 132.958 -8.652  -84.284  1.00 0.00 ? 98  ARG A NE   4  
ATOM 8142  C CZ   . ARG A 1 98  ? 132.962 -9.912  -84.632  1.00 0.00 ? 98  ARG A CZ   4  
ATOM 8143  N NH1  . ARG A 1 98  ? 132.479 -10.277 -85.789  1.00 0.00 ? 98  ARG A NH1  4  
ATOM 8144  N NH2  . ARG A 1 98  ? 133.437 -10.810 -83.814  1.00 0.00 ? 98  ARG A NH2  4  
ATOM 8145  H H    . ARG A 1 98  ? 135.439 -5.776  -89.254  1.00 0.00 ? 98  ARG A H    4  
ATOM 8146  H HA   . ARG A 1 98  ? 133.184 -7.717  -89.069  1.00 0.00 ? 98  ARG A HA   4  
ATOM 8147  H HB2  . ARG A 1 98  ? 134.558 -6.487  -86.886  1.00 0.00 ? 98  ARG A HB2  4  
ATOM 8148  H HB3  . ARG A 1 98  ? 132.942 -5.784  -86.972  1.00 0.00 ? 98  ARG A HB3  4  
ATOM 8149  H HG2  . ARG A 1 98  ? 132.138 -8.246  -87.250  1.00 0.00 ? 98  ARG A HG2  4  
ATOM 8150  H HG3  . ARG A 1 98  ? 133.724 -8.667  -86.599  1.00 0.00 ? 98  ARG A HG3  4  
ATOM 8151  H HD2  . ARG A 1 98  ? 132.840 -6.644  -84.910  1.00 0.00 ? 98  ARG A HD2  4  
ATOM 8152  H HD3  . ARG A 1 98  ? 131.381 -7.583  -85.225  1.00 0.00 ? 98  ARG A HD3  4  
ATOM 8153  H HE   . ARG A 1 98  ? 133.297 -8.391  -83.402  1.00 0.00 ? 98  ARG A HE   4  
ATOM 8154  H HH11 . ARG A 1 98  ? 132.101 -9.593  -86.411  1.00 0.00 ? 98  ARG A HH11 4  
ATOM 8155  H HH12 . ARG A 1 98  ? 132.485 -11.241 -86.051  1.00 0.00 ? 98  ARG A HH12 4  
ATOM 8156  H HH21 . ARG A 1 98  ? 133.796 -10.535 -82.922  1.00 0.00 ? 98  ARG A HH21 4  
ATOM 8157  H HH22 . ARG A 1 98  ? 133.441 -11.774 -84.078  1.00 0.00 ? 98  ARG A HH22 4  
ATOM 8158  N N    . ILE A 1 99  ? 131.779 -6.020  -90.216  1.00 0.00 ? 99  ILE A N    4  
ATOM 8159  C CA   . ILE A 1 99  ? 130.898 -5.011  -90.864  1.00 0.00 ? 99  ILE A CA   4  
ATOM 8160  C C    . ILE A 1 99  ? 129.529 -5.048  -90.189  1.00 0.00 ? 99  ILE A C    4  
ATOM 8161  O O    . ILE A 1 99  ? 129.331 -5.749  -89.217  1.00 0.00 ? 99  ILE A O    4  
ATOM 8162  C CB   . ILE A 1 99  ? 130.742 -5.353  -92.349  1.00 0.00 ? 99  ILE A CB   4  
ATOM 8163  C CG1  . ILE A 1 99  ? 130.933 -6.860  -92.542  1.00 0.00 ? 99  ILE A CG1  4  
ATOM 8164  C CG2  . ILE A 1 99  ? 131.790 -4.601  -93.168  1.00 0.00 ? 99  ILE A CG2  4  
ATOM 8165  C CD1  . ILE A 1 99  ? 129.940 -7.372  -93.580  1.00 0.00 ? 99  ILE A CD1  4  
ATOM 8166  H H    . ILE A 1 99  ? 131.647 -6.969  -90.406  1.00 0.00 ? 99  ILE A H    4  
ATOM 8167  H HA   . ILE A 1 99  ? 131.330 -4.027  -90.759  1.00 0.00 ? 99  ILE A HA   4  
ATOM 8168  H HB   . ILE A 1 99  ? 129.753 -5.069  -92.680  1.00 0.00 ? 99  ILE A HB   4  
ATOM 8169  H HG12 . ILE A 1 99  ? 131.940 -7.055  -92.878  1.00 0.00 ? 99  ILE A HG12 4  
ATOM 8170  H HG13 . ILE A 1 99  ? 130.761 -7.368  -91.608  1.00 0.00 ? 99  ILE A HG13 4  
ATOM 8171  H HG21 . ILE A 1 99  ? 131.502 -4.602  -94.209  1.00 0.00 ? 99  ILE A HG21 4  
ATOM 8172  H HG22 . ILE A 1 99  ? 132.748 -5.088  -93.060  1.00 0.00 ? 99  ILE A HG22 4  
ATOM 8173  H HG23 . ILE A 1 99  ? 131.862 -3.584  -92.817  1.00 0.00 ? 99  ILE A HG23 4  
ATOM 8174  H HD11 . ILE A 1 99  ? 128.962 -7.454  -93.128  1.00 0.00 ? 99  ILE A HD11 4  
ATOM 8175  H HD12 . ILE A 1 99  ? 130.254 -8.344  -93.933  1.00 0.00 ? 99  ILE A HD12 4  
ATOM 8176  H HD13 . ILE A 1 99  ? 129.899 -6.683  -94.410  1.00 0.00 ? 99  ILE A HD13 4  
ATOM 8177  N N    . THR A 1 100 ? 128.578 -4.309  -90.689  1.00 0.00 ? 100 THR A N    4  
ATOM 8178  C CA   . THR A 1 100 ? 127.231 -4.331  -90.055  1.00 0.00 ? 100 THR A CA   4  
ATOM 8179  C C    . THR A 1 100 ? 126.176 -4.622  -91.117  1.00 0.00 ? 100 THR A C    4  
ATOM 8180  O O    . THR A 1 100 ? 126.402 -4.453  -92.299  1.00 0.00 ? 100 THR A O    4  
ATOM 8181  C CB   . THR A 1 100 ? 126.930 -2.985  -89.394  1.00 0.00 ? 100 THR A CB   4  
ATOM 8182  O OG1  . THR A 1 100 ? 126.172 -2.180  -90.286  1.00 0.00 ? 100 THR A OG1  4  
ATOM 8183  C CG2  . THR A 1 100 ? 128.231 -2.265  -89.052  1.00 0.00 ? 100 THR A CG2  4  
ATOM 8184  H H    . THR A 1 100 ? 128.746 -3.749  -91.476  1.00 0.00 ? 100 THR A H    4  
ATOM 8185  H HA   . THR A 1 100 ? 127.204 -5.110  -89.310  1.00 0.00 ? 100 THR A HA   4  
ATOM 8186  H HB   . THR A 1 100 ? 126.371 -3.152  -88.486  1.00 0.00 ? 100 THR A HB   4  
ATOM 8187  H HG1  . THR A 1 100 ? 125.288 -2.086  -89.923  1.00 0.00 ? 100 THR A HG1  4  
ATOM 8188  H HG21 . THR A 1 100 ? 128.180 -1.898  -88.039  1.00 0.00 ? 100 THR A HG21 4  
ATOM 8189  H HG22 . THR A 1 100 ? 128.368 -1.435  -89.729  1.00 0.00 ? 100 THR A HG22 4  
ATOM 8190  H HG23 . THR A 1 100 ? 129.059 -2.948  -89.147  1.00 0.00 ? 100 THR A HG23 4  
ATOM 8191  N N    . TRP A 1 101 ? 125.028 -5.071  -90.702  1.00 0.00 ? 101 TRP A N    4  
ATOM 8192  C CA   . TRP A 1 101 ? 123.955 -5.396  -91.677  1.00 0.00 ? 101 TRP A CA   4  
ATOM 8193  C C    . TRP A 1 101 ? 123.728 -4.233  -92.644  1.00 0.00 ? 101 TRP A C    4  
ATOM 8194  O O    . TRP A 1 101 ? 124.024 -4.329  -93.818  1.00 0.00 ? 101 TRP A O    4  
ATOM 8195  C CB   . TRP A 1 101 ? 122.656 -5.693  -90.925  1.00 0.00 ? 101 TRP A CB   4  
ATOM 8196  C CG   . TRP A 1 101 ? 121.694 -6.368  -91.848  1.00 0.00 ? 101 TRP A CG   4  
ATOM 8197  C CD1  . TRP A 1 101 ? 120.424 -5.961  -92.081  1.00 0.00 ? 101 TRP A CD1  4  
ATOM 8198  C CD2  . TRP A 1 101 ? 121.899 -7.557  -92.665  1.00 0.00 ? 101 TRP A CD2  4  
ATOM 8199  N NE1  . TRP A 1 101 ? 119.838 -6.823  -92.990  1.00 0.00 ? 101 TRP A NE1  4  
ATOM 8200  C CE2  . TRP A 1 101 ? 120.707 -7.824  -93.380  1.00 0.00 ? 101 TRP A CE2  4  
ATOM 8201  C CE3  . TRP A 1 101 ? 122.992 -8.421  -92.854  1.00 0.00 ? 101 TRP A CE3  4  
ATOM 8202  C CZ2  . TRP A 1 101 ? 120.606 -8.908  -94.252  1.00 0.00 ? 101 TRP A CZ2  4  
ATOM 8203  C CZ3  . TRP A 1 101 ? 122.894 -9.510  -93.729  1.00 0.00 ? 101 TRP A CZ3  4  
ATOM 8204  C CH2  . TRP A 1 101 ? 121.703 -9.755  -94.428  1.00 0.00 ? 101 TRP A CH2  4  
ATOM 8205  H H    . TRP A 1 101 ? 124.875 -5.207  -89.744  1.00 0.00 ? 101 TRP A H    4  
ATOM 8206  H HA   . TRP A 1 101 ? 124.244 -6.267  -92.241  1.00 0.00 ? 101 TRP A HA   4  
ATOM 8207  H HB2  . TRP A 1 101 ? 122.866 -6.340  -90.086  1.00 0.00 ? 101 TRP A HB2  4  
ATOM 8208  H HB3  . TRP A 1 101 ? 122.226 -4.769  -90.570  1.00 0.00 ? 101 TRP A HB3  4  
ATOM 8209  H HD1  . TRP A 1 101 ? 119.948 -5.102  -91.631  1.00 0.00 ? 101 TRP A HD1  4  
ATOM 8210  H HE1  . TRP A 1 101 ? 118.922 -6.750  -93.329  1.00 0.00 ? 101 TRP A HE1  4  
ATOM 8211  H HE3  . TRP A 1 101 ? 123.913 -8.247  -92.321  1.00 0.00 ? 101 TRP A HE3  4  
ATOM 8212  H HZ2  . TRP A 1 101 ? 119.685 -9.092  -94.787  1.00 0.00 ? 101 TRP A HZ2  4  
ATOM 8213  H HZ3  . TRP A 1 101 ? 123.741 -10.163 -93.866  1.00 0.00 ? 101 TRP A HZ3  4  
ATOM 8214  H HH2  . TRP A 1 101 ? 121.633 -10.597 -95.101  1.00 0.00 ? 101 TRP A HH2  4  
ATOM 8215  N N    . GLU A 1 102 ? 123.189 -3.140  -92.181  1.00 0.00 ? 102 GLU A N    4  
ATOM 8216  C CA   . GLU A 1 102 ? 122.922 -1.996  -93.099  1.00 0.00 ? 102 GLU A CA   4  
ATOM 8217  C C    . GLU A 1 102 ? 124.167 -1.667  -93.911  1.00 0.00 ? 102 GLU A C    4  
ATOM 8218  O O    . GLU A 1 102 ? 124.106 -1.475  -95.113  1.00 0.00 ? 102 GLU A O    4  
ATOM 8219  C CB   . GLU A 1 102 ? 122.510 -0.772  -92.279  1.00 0.00 ? 102 GLU A CB   4  
ATOM 8220  C CG   . GLU A 1 102 ? 122.847 0.503   -93.054  1.00 0.00 ? 102 GLU A CG   4  
ATOM 8221  C CD   . GLU A 1 102 ? 122.465 0.325   -94.525  1.00 0.00 ? 102 GLU A CD   4  
ATOM 8222  O OE1  . GLU A 1 102 ? 121.385 -0.185  -94.779  1.00 0.00 ? 102 GLU A OE1  4  
ATOM 8223  O OE2  . GLU A 1 102 ? 123.257 0.701   -95.373  1.00 0.00 ? 102 GLU A OE2  4  
ATOM 8224  H H    . GLU A 1 102 ? 122.940 -3.056  -91.241  1.00 0.00 ? 102 GLU A H    4  
ATOM 8225  H HA   . GLU A 1 102 ? 122.122 -2.268  -93.771  1.00 0.00 ? 102 GLU A HA   4  
ATOM 8226  H HB2  . GLU A 1 102 ? 121.447 -0.808  -92.088  1.00 0.00 ? 102 GLU A HB2  4  
ATOM 8227  H HB3  . GLU A 1 102 ? 123.044 -0.772  -91.340  1.00 0.00 ? 102 GLU A HB3  4  
ATOM 8228  H HG2  . GLU A 1 102 ? 122.297 1.334   -92.636  1.00 0.00 ? 102 GLU A HG2  4  
ATOM 8229  H HG3  . GLU A 1 102 ? 123.909 0.699   -92.981  1.00 0.00 ? 102 GLU A HG3  4  
ATOM 8230  N N    . GLN A 1 103 ? 125.290 -1.585  -93.270  1.00 0.00 ? 103 GLN A N    4  
ATOM 8231  C CA   . GLN A 1 103 ? 126.530 -1.256  -94.007  1.00 0.00 ? 103 GLN A CA   4  
ATOM 8232  C C    . GLN A 1 103 ? 126.649 -2.150  -95.238  1.00 0.00 ? 103 GLN A C    4  
ATOM 8233  O O    . GLN A 1 103 ? 126.932 -1.680  -96.327  1.00 0.00 ? 103 GLN A O    4  
ATOM 8234  C CB   . GLN A 1 103 ? 127.741 -1.469  -93.099  1.00 0.00 ? 103 GLN A CB   4  
ATOM 8235  C CG   . GLN A 1 103 ? 128.526 -0.160  -92.980  1.00 0.00 ? 103 GLN A CG   4  
ATOM 8236  C CD   . GLN A 1 103 ? 129.245 -0.117  -91.634  1.00 0.00 ? 103 GLN A CD   4  
ATOM 8237  O OE1  . GLN A 1 103 ? 130.211 -0.824  -91.422  1.00 0.00 ? 103 GLN A OE1  4  
ATOM 8238  N NE2  . GLN A 1 103 ? 128.812 0.689   -90.707  1.00 0.00 ? 103 GLN A NE2  4  
ATOM 8239  H H    . GLN A 1 103 ? 125.317 -1.734  -92.300  1.00 0.00 ? 103 GLN A H    4  
ATOM 8240  H HA   . GLN A 1 103 ? 126.493 -0.224  -94.321  1.00 0.00 ? 103 GLN A HA   4  
ATOM 8241  H HB2  . GLN A 1 103 ? 127.406 -1.778  -92.119  1.00 0.00 ? 103 GLN A HB2  4  
ATOM 8242  H HB3  . GLN A 1 103 ? 128.379 -2.231  -93.518  1.00 0.00 ? 103 GLN A HB3  4  
ATOM 8243  H HG2  . GLN A 1 103 ? 129.250 -0.101  -93.779  1.00 0.00 ? 103 GLN A HG2  4  
ATOM 8244  H HG3  . GLN A 1 103 ? 127.846 0.676   -93.047  1.00 0.00 ? 103 GLN A HG3  4  
ATOM 8245  H HE21 . GLN A 1 103 ? 128.033 1.259   -90.876  1.00 0.00 ? 103 GLN A HE21 4  
ATOM 8246  H HE22 . GLN A 1 103 ? 129.265 0.726   -89.841  1.00 0.00 ? 103 GLN A HE22 4  
ATOM 8247  N N    . VAL A 1 104 ? 126.454 -3.437  -95.096  1.00 0.00 ? 104 VAL A N    4  
ATOM 8248  C CA   . VAL A 1 104 ? 126.596 -4.302  -96.294  1.00 0.00 ? 104 VAL A CA   4  
ATOM 8249  C C    . VAL A 1 104 ? 125.400 -4.047  -97.203  1.00 0.00 ? 104 VAL A C    4  
ATOM 8250  O O    . VAL A 1 104 ? 125.460 -4.265  -98.396  1.00 0.00 ? 104 VAL A O    4  
ATOM 8251  C CB   . VAL A 1 104 ? 126.607 -5.783  -95.925  1.00 0.00 ? 104 VAL A CB   4  
ATOM 8252  C CG1  . VAL A 1 104 ? 127.443 -6.016  -94.676  1.00 0.00 ? 104 VAL A CG1  4  
ATOM 8253  C CG2  . VAL A 1 104 ? 125.181 -6.268  -95.700  1.00 0.00 ? 104 VAL A CG2  4  
ATOM 8254  H H    . VAL A 1 104 ? 126.236 -3.821  -94.220  1.00 0.00 ? 104 VAL A H    4  
ATOM 8255  H HA   . VAL A 1 104 ? 127.502 -4.018  -96.801  1.00 0.00 ? 104 VAL A HA   4  
ATOM 8256  H HB   . VAL A 1 104 ? 127.039 -6.342  -96.742  1.00 0.00 ? 104 VAL A HB   4  
ATOM 8257  H HG11 . VAL A 1 104 ? 128.254 -5.305  -94.643  1.00 0.00 ? 104 VAL A HG11 4  
ATOM 8258  H HG12 . VAL A 1 104 ? 127.836 -7.019  -94.699  1.00 0.00 ? 104 VAL A HG12 4  
ATOM 8259  H HG13 . VAL A 1 104 ? 126.821 -5.895  -93.801  1.00 0.00 ? 104 VAL A HG13 4  
ATOM 8260  H HG21 . VAL A 1 104 ? 125.167 -6.968  -94.880  1.00 0.00 ? 104 VAL A HG21 4  
ATOM 8261  H HG22 . VAL A 1 104 ? 124.826 -6.754  -96.597  1.00 0.00 ? 104 VAL A HG22 4  
ATOM 8262  H HG23 . VAL A 1 104 ? 124.549 -5.428  -95.471  1.00 0.00 ? 104 VAL A HG23 4  
ATOM 8263  N N    . LEU A 1 105 ? 124.312 -3.571  -96.656  1.00 0.00 ? 105 LEU A N    4  
ATOM 8264  C CA   . LEU A 1 105 ? 123.131 -3.292  -97.510  1.00 0.00 ? 105 LEU A CA   4  
ATOM 8265  C C    . LEU A 1 105 ? 123.475 -2.121  -98.420  1.00 0.00 ? 105 LEU A C    4  
ATOM 8266  O O    . LEU A 1 105 ? 123.703 -2.295  -99.601  1.00 0.00 ? 105 LEU A O    4  
ATOM 8267  C CB   . LEU A 1 105 ? 121.924 -2.931  -96.638  1.00 0.00 ? 105 LEU A CB   4  
ATOM 8268  C CG   . LEU A 1 105 ? 121.603 -4.088  -95.687  1.00 0.00 ? 105 LEU A CG   4  
ATOM 8269  C CD1  . LEU A 1 105 ? 120.205 -3.893  -95.095  1.00 0.00 ? 105 LEU A CD1  4  
ATOM 8270  C CD2  . LEU A 1 105 ? 121.651 -5.415  -96.449  1.00 0.00 ? 105 LEU A CD2  4  
ATOM 8271  H H    . LEU A 1 105 ? 124.273 -3.371  -95.694  1.00 0.00 ? 105 LEU A H    4  
ATOM 8272  H HA   . LEU A 1 105 ? 122.903 -4.161  -98.109  1.00 0.00 ? 105 LEU A HA   4  
ATOM 8273  H HB2  . LEU A 1 105 ? 122.150 -2.045  -96.062  1.00 0.00 ? 105 LEU A HB2  4  
ATOM 8274  H HB3  . LEU A 1 105 ? 121.071 -2.739  -97.270  1.00 0.00 ? 105 LEU A HB3  4  
ATOM 8275  H HG   . LEU A 1 105 ? 122.326 -4.105  -94.889  1.00 0.00 ? 105 LEU A HG   4  
ATOM 8276  H HD11 . LEU A 1 105 ? 119.675 -3.141  -95.660  1.00 0.00 ? 105 LEU A HD11 4  
ATOM 8277  H HD12 . LEU A 1 105 ? 120.291 -3.578  -94.066  1.00 0.00 ? 105 LEU A HD12 4  
ATOM 8278  H HD13 . LEU A 1 105 ? 119.662 -4.827  -95.140  1.00 0.00 ? 105 LEU A HD13 4  
ATOM 8279  H HD21 . LEU A 1 105 ? 121.140 -6.176  -95.879  1.00 0.00 ? 105 LEU A HD21 4  
ATOM 8280  H HD22 . LEU A 1 105 ? 122.681 -5.708  -96.598  1.00 0.00 ? 105 LEU A HD22 4  
ATOM 8281  H HD23 . LEU A 1 105 ? 121.169 -5.299  -97.407  1.00 0.00 ? 105 LEU A HD23 4  
ATOM 8282  N N    . GLU A 1 106 ? 123.529 -0.927  -97.894  1.00 0.00 ? 106 GLU A N    4  
ATOM 8283  C CA   . GLU A 1 106 ? 123.874 0.230   -98.760  1.00 0.00 ? 106 GLU A CA   4  
ATOM 8284  C C    . GLU A 1 106 ? 125.048 -0.168  -99.653  1.00 0.00 ? 106 GLU A C    4  
ATOM 8285  O O    . GLU A 1 106 ? 125.074 0.137   -100.829 1.00 0.00 ? 106 GLU A O    4  
ATOM 8286  C CB   . GLU A 1 106 ? 124.274 1.421   -97.887  1.00 0.00 ? 106 GLU A CB   4  
ATOM 8287  C CG   . GLU A 1 106 ? 124.807 2.548   -98.774  1.00 0.00 ? 106 GLU A CG   4  
ATOM 8288  C CD   . GLU A 1 106 ? 125.192 3.746   -97.905  1.00 0.00 ? 106 GLU A CD   4  
ATOM 8289  O OE1  . GLU A 1 106 ? 125.155 3.610   -96.693  1.00 0.00 ? 106 GLU A OE1  4  
ATOM 8290  O OE2  . GLU A 1 106 ? 125.516 4.780   -98.466  1.00 0.00 ? 106 GLU A OE2  4  
ATOM 8291  H H    . GLU A 1 106 ? 123.337 -0.778  -96.943  1.00 0.00 ? 106 GLU A H    4  
ATOM 8292  H HA   . GLU A 1 106 ? 123.025 0.494   -99.369  1.00 0.00 ? 106 GLU A HA   4  
ATOM 8293  H HB2  . GLU A 1 106 ? 123.412 1.771   -97.339  1.00 0.00 ? 106 GLU A HB2  4  
ATOM 8294  H HB3  . GLU A 1 106 ? 125.044 1.118   -97.193  1.00 0.00 ? 106 GLU A HB3  4  
ATOM 8295  H HG2  . GLU A 1 106 ? 125.676 2.200   -99.315  1.00 0.00 ? 106 GLU A HG2  4  
ATOM 8296  H HG3  . GLU A 1 106 ? 124.043 2.845   -99.476  1.00 0.00 ? 106 GLU A HG3  4  
ATOM 8297  N N    . ILE A 1 107 ? 126.014 -0.865  -99.114  1.00 0.00 ? 107 ILE A N    4  
ATOM 8298  C CA   . ILE A 1 107 ? 127.164 -1.292  -99.957  1.00 0.00 ? 107 ILE A CA   4  
ATOM 8299  C C    . ILE A 1 107 ? 126.654 -2.260  -101.027 1.00 0.00 ? 107 ILE A C    4  
ATOM 8300  O O    . ILE A 1 107 ? 127.176 -2.323  -102.122 1.00 0.00 ? 107 ILE A O    4  
ATOM 8301  C CB   . ILE A 1 107 ? 128.207 -1.995  -99.095  1.00 0.00 ? 107 ILE A CB   4  
ATOM 8302  C CG1  . ILE A 1 107 ? 128.936 -0.963  -98.232  1.00 0.00 ? 107 ILE A CG1  4  
ATOM 8303  C CG2  . ILE A 1 107 ? 129.212 -2.705  -100.004 1.00 0.00 ? 107 ILE A CG2  4  
ATOM 8304  C CD1  . ILE A 1 107 ? 129.949 -1.673  -97.332  1.00 0.00 ? 107 ILE A CD1  4  
ATOM 8305  H H    . ILE A 1 107 ? 125.976 -1.118  -98.164  1.00 0.00 ? 107 ILE A H    4  
ATOM 8306  H HA   . ILE A 1 107 ? 127.608 -0.428  -100.430 1.00 0.00 ? 107 ILE A HA   4  
ATOM 8307  H HB   . ILE A 1 107 ? 127.720 -2.720  -98.461  1.00 0.00 ? 107 ILE A HB   4  
ATOM 8308  H HG12 . ILE A 1 107 ? 129.450 -0.260  -98.871  1.00 0.00 ? 107 ILE A HG12 4  
ATOM 8309  H HG13 . ILE A 1 107 ? 128.220 -0.436  -97.619  1.00 0.00 ? 107 ILE A HG13 4  
ATOM 8310  H HG21 . ILE A 1 107 ? 129.626 -1.995  -100.704 1.00 0.00 ? 107 ILE A HG21 4  
ATOM 8311  H HG22 . ILE A 1 107 ? 128.710 -3.493  -100.547 1.00 0.00 ? 107 ILE A HG22 4  
ATOM 8312  H HG23 . ILE A 1 107 ? 130.004 -3.127  -99.405  1.00 0.00 ? 107 ILE A HG23 4  
ATOM 8313  H HD11 . ILE A 1 107 ? 130.696 -0.966  -97.003  1.00 0.00 ? 107 ILE A HD11 4  
ATOM 8314  H HD12 . ILE A 1 107 ? 130.426 -2.469  -97.884  1.00 0.00 ? 107 ILE A HD12 4  
ATOM 8315  H HD13 . ILE A 1 107 ? 129.440 -2.084  -96.472  1.00 0.00 ? 107 ILE A HD13 4  
ATOM 8316  N N    . ALA A 1 108 ? 125.625 -3.008  -100.720 1.00 0.00 ? 108 ALA A N    4  
ATOM 8317  C CA   . ALA A 1 108 ? 125.073 -3.964  -101.723 1.00 0.00 ? 108 ALA A CA   4  
ATOM 8318  C C    . ALA A 1 108 ? 123.900 -3.309  -102.452 1.00 0.00 ? 108 ALA A C    4  
ATOM 8319  O O    . ALA A 1 108 ? 123.611 -3.633  -103.587 1.00 0.00 ? 108 ALA A O    4  
ATOM 8320  C CB   . ALA A 1 108 ? 124.584 -5.230  -101.018 1.00 0.00 ? 108 ALA A CB   4  
ATOM 8321  H H    . ALA A 1 108 ? 125.212 -2.933  -99.831  1.00 0.00 ? 108 ALA A H    4  
ATOM 8322  H HA   . ALA A 1 108 ? 125.842 -4.221  -102.437 1.00 0.00 ? 108 ALA A HA   4  
ATOM 8323  H HB1  . ALA A 1 108 ? 124.602 -6.057  -101.712 1.00 0.00 ? 108 ALA A HB1  4  
ATOM 8324  H HB2  . ALA A 1 108 ? 123.575 -5.078  -100.668 1.00 0.00 ? 108 ALA A HB2  4  
ATOM 8325  H HB3  . ALA A 1 108 ? 125.226 -5.451  -100.179 1.00 0.00 ? 108 ALA A HB3  4  
ATOM 8326  N N    . LYS A 1 109 ? 123.228 -2.381  -101.826 1.00 0.00 ? 109 LYS A N    4  
ATOM 8327  C CA   . LYS A 1 109 ? 122.092 -1.710  -102.516 1.00 0.00 ? 109 LYS A CA   4  
ATOM 8328  C C    . LYS A 1 109 ? 122.620 -1.060  -103.794 1.00 0.00 ? 109 LYS A C    4  
ATOM 8329  O O    . LYS A 1 109 ? 122.385 -1.533  -104.888 1.00 0.00 ? 109 LYS A O    4  
ATOM 8330  C CB   . LYS A 1 109 ? 121.492 -0.637  -101.607 1.00 0.00 ? 109 LYS A CB   4  
ATOM 8331  C CG   . LYS A 1 109 ? 120.855 -1.299  -100.383 1.00 0.00 ? 109 LYS A CG   4  
ATOM 8332  C CD   . LYS A 1 109 ? 120.488 -0.228  -99.354  1.00 0.00 ? 109 LYS A CD   4  
ATOM 8333  C CE   . LYS A 1 109 ? 118.970 -0.204  -99.162  1.00 0.00 ? 109 LYS A CE   4  
ATOM 8334  N NZ   . LYS A 1 109 ? 118.332 0.453   -100.338 1.00 0.00 ? 109 LYS A NZ   4  
ATOM 8335  H H    . LYS A 1 109 ? 123.478 -2.118  -100.916 1.00 0.00 ? 109 LYS A H    4  
ATOM 8336  H HA   . LYS A 1 109 ? 121.336 -2.441  -102.764 1.00 0.00 ? 109 LYS A HA   4  
ATOM 8337  H HB2  . LYS A 1 109 ? 122.270 0.041   -101.290 1.00 0.00 ? 109 LYS A HB2  4  
ATOM 8338  H HB3  . LYS A 1 109 ? 120.736 -0.088  -102.149 1.00 0.00 ? 109 LYS A HB3  4  
ATOM 8339  H HG2  . LYS A 1 109 ? 119.965 -1.831  -100.686 1.00 0.00 ? 109 LYS A HG2  4  
ATOM 8340  H HG3  . LYS A 1 109 ? 121.557 -1.993  -99.944  1.00 0.00 ? 109 LYS A HG3  4  
ATOM 8341  H HD2  . LYS A 1 109 ? 120.967 -0.456  -98.412  1.00 0.00 ? 109 LYS A HD2  4  
ATOM 8342  H HD3  . LYS A 1 109 ? 120.820 0.737   -99.703  1.00 0.00 ? 109 LYS A HD3  4  
ATOM 8343  H HE2  . LYS A 1 109 ? 118.602 -1.215  -99.071  1.00 0.00 ? 109 LYS A HE2  4  
ATOM 8344  H HE3  . LYS A 1 109 ? 118.730 0.350   -98.266  1.00 0.00 ? 109 LYS A HE3  4  
ATOM 8345  H HZ1  . LYS A 1 109 ? 118.273 -0.225  -101.124 1.00 0.00 ? 109 LYS A HZ1  4  
ATOM 8346  H HZ2  . LYS A 1 109 ? 118.902 1.274   -100.628 1.00 0.00 ? 109 LYS A HZ2  4  
ATOM 8347  H HZ3  . LYS A 1 109 ? 117.375 0.768   -100.083 1.00 0.00 ? 109 LYS A HZ3  4  
ATOM 8348  N N    . GLN A 1 110 ? 123.340 0.020   -103.669 1.00 0.00 ? 110 GLN A N    4  
ATOM 8349  C CA   . GLN A 1 110 ? 123.888 0.684   -104.882 1.00 0.00 ? 110 GLN A CA   4  
ATOM 8350  C C    . GLN A 1 110 ? 124.503 -0.379  -105.794 1.00 0.00 ? 110 GLN A C    4  
ATOM 8351  O O    . GLN A 1 110 ? 124.569 -0.217  -106.996 1.00 0.00 ? 110 GLN A O    4  
ATOM 8352  C CB   . GLN A 1 110 ? 124.963 1.693   -104.471 1.00 0.00 ? 110 GLN A CB   4  
ATOM 8353  C CG   . GLN A 1 110 ? 124.344 2.756   -103.562 1.00 0.00 ? 110 GLN A CG   4  
ATOM 8354  C CD   . GLN A 1 110 ? 125.455 3.602   -102.936 1.00 0.00 ? 110 GLN A CD   4  
ATOM 8355  O OE1  . GLN A 1 110 ? 126.252 4.194   -103.636 1.00 0.00 ? 110 GLN A OE1  4  
ATOM 8356  N NE2  . GLN A 1 110 ? 125.541 3.684   -101.636 1.00 0.00 ? 110 GLN A NE2  4  
ATOM 8357  H H    . GLN A 1 110 ? 123.523 0.391   -102.780 1.00 0.00 ? 110 GLN A H    4  
ATOM 8358  H HA   . GLN A 1 110 ? 123.093 1.194   -105.405 1.00 0.00 ? 110 GLN A HA   4  
ATOM 8359  H HB2  . GLN A 1 110 ? 125.753 1.181   -103.941 1.00 0.00 ? 110 GLN A HB2  4  
ATOM 8360  H HB3  . GLN A 1 110 ? 125.368 2.166   -105.353 1.00 0.00 ? 110 GLN A HB3  4  
ATOM 8361  H HG2  . GLN A 1 110 ? 123.692 3.392   -104.145 1.00 0.00 ? 110 GLN A HG2  4  
ATOM 8362  H HG3  . GLN A 1 110 ? 123.775 2.276   -102.780 1.00 0.00 ? 110 GLN A HG3  4  
ATOM 8363  H HE21 . GLN A 1 110 ? 124.898 3.206   -101.072 1.00 0.00 ? 110 GLN A HE21 4  
ATOM 8364  H HE22 . GLN A 1 110 ? 126.248 4.222   -101.225 1.00 0.00 ? 110 GLN A HE22 4  
ATOM 8365  N N    . LYS A 1 111 ? 124.956 -1.469  -105.229 1.00 0.00 ? 111 LYS A N    4  
ATOM 8366  C CA   . LYS A 1 111 ? 125.565 -2.543  -106.063 1.00 0.00 ? 111 LYS A CA   4  
ATOM 8367  C C    . LYS A 1 111 ? 124.475 -3.244  -106.883 1.00 0.00 ? 111 LYS A C    4  
ATOM 8368  O O    . LYS A 1 111 ? 124.757 -3.917  -107.854 1.00 0.00 ? 111 LYS A O    4  
ATOM 8369  C CB   . LYS A 1 111 ? 126.253 -3.565  -105.156 1.00 0.00 ? 111 LYS A CB   4  
ATOM 8370  C CG   . LYS A 1 111 ? 127.077 -4.532  -106.007 1.00 0.00 ? 111 LYS A CG   4  
ATOM 8371  C CD   . LYS A 1 111 ? 127.502 -5.731  -105.156 1.00 0.00 ? 111 LYS A CD   4  
ATOM 8372  C CE   . LYS A 1 111 ? 127.207 -7.026  -105.914 1.00 0.00 ? 111 LYS A CE   4  
ATOM 8373  N NZ   . LYS A 1 111 ? 128.030 -8.132  -105.348 1.00 0.00 ? 111 LYS A NZ   4  
ATOM 8374  H H    . LYS A 1 111 ? 124.895 -1.580  -104.256 1.00 0.00 ? 111 LYS A H    4  
ATOM 8375  H HA   . LYS A 1 111 ? 126.294 -2.109  -106.732 1.00 0.00 ? 111 LYS A HA   4  
ATOM 8376  H HB2  . LYS A 1 111 ? 126.903 -3.050  -104.463 1.00 0.00 ? 111 LYS A HB2  4  
ATOM 8377  H HB3  . LYS A 1 111 ? 125.507 -4.119  -104.607 1.00 0.00 ? 111 LYS A HB3  4  
ATOM 8378  H HG2  . LYS A 1 111 ? 126.481 -4.874  -106.841 1.00 0.00 ? 111 LYS A HG2  4  
ATOM 8379  H HG3  . LYS A 1 111 ? 127.957 -4.027  -106.376 1.00 0.00 ? 111 LYS A HG3  4  
ATOM 8380  H HD2  . LYS A 1 111 ? 128.560 -5.667  -104.947 1.00 0.00 ? 111 LYS A HD2  4  
ATOM 8381  H HD3  . LYS A 1 111 ? 126.951 -5.726  -104.228 1.00 0.00 ? 111 LYS A HD3  4  
ATOM 8382  H HE2  . LYS A 1 111 ? 126.159 -7.270  -105.817 1.00 0.00 ? 111 LYS A HE2  4  
ATOM 8383  H HE3  . LYS A 1 111 ? 127.450 -6.895  -106.959 1.00 0.00 ? 111 LYS A HE3  4  
ATOM 8384  H HZ1  . LYS A 1 111 ? 127.771 -8.282  -104.353 1.00 0.00 ? 111 LYS A HZ1  4  
ATOM 8385  H HZ2  . LYS A 1 111 ? 129.037 -7.881  -105.411 1.00 0.00 ? 111 LYS A HZ2  4  
ATOM 8386  H HZ3  . LYS A 1 111 ? 127.855 -9.004  -105.885 1.00 0.00 ? 111 LYS A HZ3  4  
ATOM 8387  N N    . MET A 1 112 ? 123.234 -3.090  -106.505 1.00 0.00 ? 112 MET A N    4  
ATOM 8388  C CA   . MET A 1 112 ? 122.137 -3.751  -107.271 1.00 0.00 ? 112 MET A CA   4  
ATOM 8389  C C    . MET A 1 112 ? 121.046 -2.728  -107.600 1.00 0.00 ? 112 MET A C    4  
ATOM 8390  O O    . MET A 1 112 ? 119.939 -2.809  -107.106 1.00 0.00 ? 112 MET A O    4  
ATOM 8391  C CB   . MET A 1 112 ? 121.533 -4.888  -106.438 1.00 0.00 ? 112 MET A CB   4  
ATOM 8392  C CG   . MET A 1 112 ? 121.207 -4.384  -105.032 1.00 0.00 ? 112 MET A CG   4  
ATOM 8393  S SD   . MET A 1 112 ? 119.451 -3.948  -104.934 1.00 0.00 ? 112 MET A SD   4  
ATOM 8394  C CE   . MET A 1 112 ? 118.898 -5.408  -104.019 1.00 0.00 ? 112 MET A CE   4  
ATOM 8395  H H    . MET A 1 112 ? 123.024 -2.543  -105.719 1.00 0.00 ? 112 MET A H    4  
ATOM 8396  H HA   . MET A 1 112 ? 122.536 -4.155  -108.190 1.00 0.00 ? 112 MET A HA   4  
ATOM 8397  H HB2  . MET A 1 112 ? 120.628 -5.239  -106.912 1.00 0.00 ? 112 MET A HB2  4  
ATOM 8398  H HB3  . MET A 1 112 ? 122.241 -5.700  -106.371 1.00 0.00 ? 112 MET A HB3  4  
ATOM 8399  H HG2  . MET A 1 112 ? 121.425 -5.158  -104.313 1.00 0.00 ? 112 MET A HG2  4  
ATOM 8400  H HG3  . MET A 1 112 ? 121.805 -3.515  -104.814 1.00 0.00 ? 112 MET A HG3  4  
ATOM 8401  H HE1  . MET A 1 112 ? 118.844 -6.253  -104.690 1.00 0.00 ? 112 MET A HE1  4  
ATOM 8402  H HE2  . MET A 1 112 ? 117.922 -5.223  -103.600 1.00 0.00 ? 112 MET A HE2  4  
ATOM 8403  H HE3  . MET A 1 112 ? 119.597 -5.619  -103.221 1.00 0.00 ? 112 MET A HE3  4  
ATOM 8404  N N    . PRO A 1 113 ? 121.358 -1.774  -108.436 1.00 0.00 ? 113 PRO A N    4  
ATOM 8405  C CA   . PRO A 1 113 ? 120.373 -0.730  -108.830 1.00 0.00 ? 113 PRO A CA   4  
ATOM 8406  C C    . PRO A 1 113 ? 119.218 -1.309  -109.652 1.00 0.00 ? 113 PRO A C    4  
ATOM 8407  O O    . PRO A 1 113 ? 118.093 -0.859  -109.570 1.00 0.00 ? 113 PRO A O    4  
ATOM 8408  C CB   . PRO A 1 113 ? 121.216 0.221   -109.682 1.00 0.00 ? 113 PRO A CB   4  
ATOM 8409  C CG   . PRO A 1 113 ? 122.615 -0.383  -109.863 1.00 0.00 ? 113 PRO A CG   4  
ATOM 8410  C CD   . PRO A 1 113 ? 122.709 -1.673  -109.041 1.00 0.00 ? 113 PRO A CD   4  
ATOM 8411  H HA   . PRO A 1 113 ? 120.001 -0.210  -107.963 1.00 0.00 ? 113 PRO A HA   4  
ATOM 8412  H HB2  . PRO A 1 113 ? 120.749 0.352   -110.646 1.00 0.00 ? 113 PRO A HB2  4  
ATOM 8413  H HB3  . PRO A 1 113 ? 121.299 1.175   -109.184 1.00 0.00 ? 113 PRO A HB3  4  
ATOM 8414  H HG2  . PRO A 1 113 ? 122.781 -0.605  -110.908 1.00 0.00 ? 113 PRO A HG2  4  
ATOM 8415  H HG3  . PRO A 1 113 ? 123.360 0.317   -109.519 1.00 0.00 ? 113 PRO A HG3  4  
ATOM 8416  H HD2  . PRO A 1 113 ? 122.911 -2.520  -109.682 1.00 0.00 ? 113 PRO A HD2  4  
ATOM 8417  H HD3  . PRO A 1 113 ? 123.458 -1.583  -108.272 1.00 0.00 ? 113 PRO A HD3  4  
ATOM 8418  N N    . ASP A 1 114 ? 119.493 -2.308  -110.445 1.00 0.00 ? 114 ASP A N    4  
ATOM 8419  C CA   . ASP A 1 114 ? 118.422 -2.924  -111.277 1.00 0.00 ? 114 ASP A CA   4  
ATOM 8420  C C    . ASP A 1 114 ? 119.042 -3.979  -112.195 1.00 0.00 ? 114 ASP A C    4  
ATOM 8421  O O    . ASP A 1 114 ? 118.432 -4.424  -113.147 1.00 0.00 ? 114 ASP A O    4  
ATOM 8422  C CB   . ASP A 1 114 ? 117.746 -1.842  -112.123 1.00 0.00 ? 114 ASP A CB   4  
ATOM 8423  C CG   . ASP A 1 114 ? 118.812 -0.925  -112.727 1.00 0.00 ? 114 ASP A CG   4  
ATOM 8424  O OD1  . ASP A 1 114 ? 119.981 -1.254  -112.612 1.00 0.00 ? 114 ASP A OD1  4  
ATOM 8425  O OD2  . ASP A 1 114 ? 118.440 0.088   -113.293 1.00 0.00 ? 114 ASP A OD2  4  
ATOM 8426  H H    . ASP A 1 114 ? 120.409 -2.655  -110.494 1.00 0.00 ? 114 ASP A H    4  
ATOM 8427  H HA   . ASP A 1 114 ? 117.689 -3.391  -110.635 1.00 0.00 ? 114 ASP A HA   4  
ATOM 8428  H HB2  . ASP A 1 114 ? 117.180 -2.308  -112.915 1.00 0.00 ? 114 ASP A HB2  4  
ATOM 8429  H HB3  . ASP A 1 114 ? 117.084 -1.260  -111.501 1.00 0.00 ? 114 ASP A HB3  4  
ATOM 8430  N N    . LEU A 1 115 ? 120.252 -4.380  -111.915 1.00 0.00 ? 115 LEU A N    4  
ATOM 8431  C CA   . LEU A 1 115 ? 120.917 -5.404  -112.770 1.00 0.00 ? 115 LEU A CA   4  
ATOM 8432  C C    . LEU A 1 115 ? 120.012 -6.631  -112.897 1.00 0.00 ? 115 LEU A C    4  
ATOM 8433  O O    . LEU A 1 115 ? 119.367 -6.835  -113.906 1.00 0.00 ? 115 LEU A O    4  
ATOM 8434  C CB   . LEU A 1 115 ? 122.246 -5.814  -112.133 1.00 0.00 ? 115 LEU A CB   4  
ATOM 8435  C CG   . LEU A 1 115 ? 123.379 -4.980  -112.733 1.00 0.00 ? 115 LEU A CG   4  
ATOM 8436  C CD1  . LEU A 1 115 ? 123.592 -5.381  -114.193 1.00 0.00 ? 115 LEU A CD1  4  
ATOM 8437  C CD2  . LEU A 1 115 ? 123.010 -3.496  -112.661 1.00 0.00 ? 115 LEU A CD2  4  
ATOM 8438  H H    . LEU A 1 115 ? 120.725 -4.006  -111.143 1.00 0.00 ? 115 LEU A H    4  
ATOM 8439  H HA   . LEU A 1 115 ? 121.100 -4.990  -113.750 1.00 0.00 ? 115 LEU A HA   4  
ATOM 8440  H HB2  . LEU A 1 115 ? 122.200 -5.647  -111.067 1.00 0.00 ? 115 LEU A HB2  4  
ATOM 8441  H HB3  . LEU A 1 115 ? 122.431 -6.860  -112.326 1.00 0.00 ? 115 LEU A HB3  4  
ATOM 8442  H HG   . LEU A 1 115 ? 124.288 -5.154  -112.175 1.00 0.00 ? 115 LEU A HG   4  
ATOM 8443  H HD11 . LEU A 1 115 ? 124.644 -5.327  -114.430 1.00 0.00 ? 115 LEU A HD11 4  
ATOM 8444  H HD12 . LEU A 1 115 ? 123.044 -4.708  -114.835 1.00 0.00 ? 115 LEU A HD12 4  
ATOM 8445  H HD13 . LEU A 1 115 ? 123.240 -6.391  -114.343 1.00 0.00 ? 115 LEU A HD13 4  
ATOM 8446  H HD21 . LEU A 1 115 ? 122.492 -3.210  -113.565 1.00 0.00 ? 115 LEU A HD21 4  
ATOM 8447  H HD22 . LEU A 1 115 ? 123.909 -2.906  -112.560 1.00 0.00 ? 115 LEU A HD22 4  
ATOM 8448  H HD23 . LEU A 1 115 ? 122.369 -3.325  -111.809 1.00 0.00 ? 115 LEU A HD23 4  
ATOM 8449  N N    . ASN A 1 116 ? 119.962 -7.452  -111.883 1.00 0.00 ? 116 ASN A N    4  
ATOM 8450  C CA   . ASN A 1 116 ? 119.099 -8.664  -111.952 1.00 0.00 ? 116 ASN A CA   4  
ATOM 8451  C C    . ASN A 1 116 ? 118.624 -9.034  -110.547 1.00 0.00 ? 116 ASN A C    4  
ATOM 8452  O O    . ASN A 1 116 ? 117.600 -9.665  -110.375 1.00 0.00 ? 116 ASN A O    4  
ATOM 8453  C CB   . ASN A 1 116 ? 119.900 -9.826  -112.543 1.00 0.00 ? 116 ASN A CB   4  
ATOM 8454  C CG   . ASN A 1 116 ? 118.951 -10.971 -112.901 1.00 0.00 ? 116 ASN A CG   4  
ATOM 8455  O OD1  . ASN A 1 116 ? 118.182 -10.868 -113.836 1.00 0.00 ? 116 ASN A OD1  4  
ATOM 8456  N ND2  . ASN A 1 116 ? 118.970 -12.066 -112.190 1.00 0.00 ? 116 ASN A ND2  4  
ATOM 8457  H H    . ASN A 1 116 ? 120.490 -7.272  -111.078 1.00 0.00 ? 116 ASN A H    4  
ATOM 8458  H HA   . ASN A 1 116 ? 118.244 -8.462  -112.580 1.00 0.00 ? 116 ASN A HA   4  
ATOM 8459  H HB2  . ASN A 1 116 ? 120.416 -9.494  -113.432 1.00 0.00 ? 116 ASN A HB2  4  
ATOM 8460  H HB3  . ASN A 1 116 ? 120.620 -10.173 -111.816 1.00 0.00 ? 116 ASN A HB3  4  
ATOM 8461  H HD21 . ASN A 1 116 ? 119.590 -12.149 -111.435 1.00 0.00 ? 116 ASN A HD21 4  
ATOM 8462  H HD22 . ASN A 1 116 ? 118.366 -12.805 -112.412 1.00 0.00 ? 116 ASN A HD22 4  
ATOM 8463  N N    . THR A 1 117 ? 119.358 -8.650  -109.538 1.00 0.00 ? 117 THR A N    4  
ATOM 8464  C CA   . THR A 1 117 ? 118.940 -8.985  -108.149 1.00 0.00 ? 117 THR A CA   4  
ATOM 8465  C C    . THR A 1 117 ? 117.638 -8.257  -107.816 1.00 0.00 ? 117 THR A C    4  
ATOM 8466  O O    . THR A 1 117 ? 116.944 -7.778  -108.690 1.00 0.00 ? 117 THR A O    4  
ATOM 8467  C CB   . THR A 1 117 ? 120.023 -8.564  -107.158 1.00 0.00 ? 117 THR A CB   4  
ATOM 8468  O OG1  . THR A 1 117 ? 121.279 -9.076  -107.583 1.00 0.00 ? 117 THR A OG1  4  
ATOM 8469  C CG2  . THR A 1 117 ? 119.679 -9.123  -105.778 1.00 0.00 ? 117 THR A CG2  4  
ATOM 8470  H H    . THR A 1 117 ? 120.181 -8.141  -109.696 1.00 0.00 ? 117 THR A H    4  
ATOM 8471  H HA   . THR A 1 117 ? 118.781 -10.050 -108.073 1.00 0.00 ? 117 THR A HA   4  
ATOM 8472  H HB   . THR A 1 117 ? 120.070 -7.488  -107.106 1.00 0.00 ? 117 THR A HB   4  
ATOM 8473  H HG1  . THR A 1 117 ? 121.171 -10.013 -107.764 1.00 0.00 ? 117 THR A HG1  4  
ATOM 8474  H HG21 . THR A 1 117 ? 119.323 -8.324  -105.144 1.00 0.00 ? 117 THR A HG21 4  
ATOM 8475  H HG22 . THR A 1 117 ? 120.558 -9.567  -105.339 1.00 0.00 ? 117 THR A HG22 4  
ATOM 8476  H HG23 . THR A 1 117 ? 118.907 -9.874  -105.877 1.00 0.00 ? 117 THR A HG23 4  
ATOM 8477  N N    . THR A 1 118 ? 117.292 -8.184  -106.559 1.00 0.00 ? 118 THR A N    4  
ATOM 8478  C CA   . THR A 1 118 ? 116.024 -7.503  -106.181 1.00 0.00 ? 118 THR A CA   4  
ATOM 8479  C C    . THR A 1 118 ? 115.920 -7.403  -104.658 1.00 0.00 ? 118 THR A C    4  
ATOM 8480  O O    . THR A 1 118 ? 116.087 -6.348  -104.081 1.00 0.00 ? 118 THR A O    4  
ATOM 8481  C CB   . THR A 1 118 ? 114.860 -8.333  -106.711 1.00 0.00 ? 118 THR A CB   4  
ATOM 8482  O OG1  . THR A 1 118 ? 113.772 -8.262  -105.801 1.00 0.00 ? 118 THR A OG1  4  
ATOM 8483  C CG2  . THR A 1 118 ? 115.319 -9.784  -106.858 1.00 0.00 ? 118 THR A CG2  4  
ATOM 8484  H H    . THR A 1 118 ? 117.856 -8.588  -105.869 1.00 0.00 ? 118 THR A H    4  
ATOM 8485  H HA   . THR A 1 118 ? 115.995 -6.516  -106.617 1.00 0.00 ? 118 THR A HA   4  
ATOM 8486  H HB   . THR A 1 118 ? 114.552 -7.956  -107.675 1.00 0.00 ? 118 THR A HB   4  
ATOM 8487  H HG1  . THR A 1 118 ? 113.282 -9.085  -105.858 1.00 0.00 ? 118 THR A HG1  4  
ATOM 8488  H HG21 . THR A 1 118 ? 116.015 -10.022 -106.066 1.00 0.00 ? 118 THR A HG21 4  
ATOM 8489  H HG22 . THR A 1 118 ? 115.806 -9.913  -107.814 1.00 0.00 ? 118 THR A HG22 4  
ATOM 8490  H HG23 . THR A 1 118 ? 114.466 -10.442 -106.797 1.00 0.00 ? 118 THR A HG23 4  
ATOM 8491  N N    . ASP A 1 119 ? 115.632 -8.496  -104.007 1.00 0.00 ? 119 ASP A N    4  
ATOM 8492  C CA   . ASP A 1 119 ? 115.501 -8.476  -102.523 1.00 0.00 ? 119 ASP A CA   4  
ATOM 8493  C C    . ASP A 1 119 ? 116.822 -8.043  -101.884 1.00 0.00 ? 119 ASP A C    4  
ATOM 8494  O O    . ASP A 1 119 ? 117.890 -8.423  -102.322 1.00 0.00 ? 119 ASP A O    4  
ATOM 8495  C CB   . ASP A 1 119 ? 115.136 -9.877  -102.028 1.00 0.00 ? 119 ASP A CB   4  
ATOM 8496  C CG   . ASP A 1 119 ? 113.647 -9.923  -101.677 1.00 0.00 ? 119 ASP A CG   4  
ATOM 8497  O OD1  . ASP A 1 119 ? 113.142 -8.922  -101.194 1.00 0.00 ? 119 ASP A OD1  4  
ATOM 8498  O OD2  . ASP A 1 119 ? 113.039 -10.958 -101.895 1.00 0.00 ? 119 ASP A OD2  4  
ATOM 8499  H H    . ASP A 1 119 ? 115.494 -9.334  -104.497 1.00 0.00 ? 119 ASP A H    4  
ATOM 8500  H HA   . ASP A 1 119 ? 114.723 -7.782  -102.241 1.00 0.00 ? 119 ASP A HA   4  
ATOM 8501  H HB2  . ASP A 1 119 ? 115.346 -10.598 -102.806 1.00 0.00 ? 119 ASP A HB2  4  
ATOM 8502  H HB3  . ASP A 1 119 ? 115.719 -10.113 -101.151 1.00 0.00 ? 119 ASP A HB3  4  
ATOM 8503  N N    . LEU A 1 120 ? 116.755 -7.257  -100.844 1.00 0.00 ? 120 LEU A N    4  
ATOM 8504  C CA   . LEU A 1 120 ? 118.000 -6.806  -100.167 1.00 0.00 ? 120 LEU A CA   4  
ATOM 8505  C C    . LEU A 1 120 ? 118.745 -8.029  -99.634  1.00 0.00 ? 120 LEU A C    4  
ATOM 8506  O O    . LEU A 1 120 ? 119.936 -8.010  -99.398  1.00 0.00 ? 120 LEU A O    4  
ATOM 8507  C CB   . LEU A 1 120 ? 117.628 -5.905  -98.987  1.00 0.00 ? 120 LEU A CB   4  
ATOM 8508  C CG   . LEU A 1 120 ? 118.340 -4.557  -99.131  1.00 0.00 ? 120 LEU A CG   4  
ATOM 8509  C CD1  . LEU A 1 120 ? 118.295 -3.815  -97.795  1.00 0.00 ? 120 LEU A CD1  4  
ATOM 8510  C CD2  . LEU A 1 120 ? 119.801 -4.784  -99.542  1.00 0.00 ? 120 LEU A CD2  4  
ATOM 8511  H H    . LEU A 1 120 ? 115.882 -6.969  -100.505 1.00 0.00 ? 120 LEU A H    4  
ATOM 8512  H HA   . LEU A 1 120 ? 118.593 -6.232  -100.862 1.00 0.00 ? 120 LEU A HA   4  
ATOM 8513  H HB2  . LEU A 1 120 ? 116.558 -5.750  -98.977  1.00 0.00 ? 120 LEU A HB2  4  
ATOM 8514  H HB3  . LEU A 1 120 ? 117.932 -6.374  -98.064  1.00 0.00 ? 120 LEU A HB3  4  
ATOM 8515  H HG   . LEU A 1 120 ? 117.839 -3.966  -99.886  1.00 0.00 ? 120 LEU A HG   4  
ATOM 8516  H HD11 . LEU A 1 120 ? 117.294 -3.453  -97.616  1.00 0.00 ? 120 LEU A HD11 4  
ATOM 8517  H HD12 . LEU A 1 120 ? 118.979 -2.979  -97.825  1.00 0.00 ? 120 LEU A HD12 4  
ATOM 8518  H HD13 . LEU A 1 120 ? 118.583 -4.487  -97.001  1.00 0.00 ? 120 LEU A HD13 4  
ATOM 8519  H HD21 . LEU A 1 120 ? 120.438 -4.103  -98.999  1.00 0.00 ? 120 LEU A HD21 4  
ATOM 8520  H HD22 . LEU A 1 120 ? 119.910 -4.607  -100.603 1.00 0.00 ? 120 LEU A HD22 4  
ATOM 8521  H HD23 . LEU A 1 120 ? 120.085 -5.802  -99.317  1.00 0.00 ? 120 LEU A HD23 4  
ATOM 8522  N N    . GLU A 1 121 ? 118.015 -9.095  -99.451  1.00 0.00 ? 121 GLU A N    4  
ATOM 8523  C CA   . GLU A 1 121 ? 118.594 -10.368 -98.936  1.00 0.00 ? 121 GLU A CA   4  
ATOM 8524  C C    . GLU A 1 121 ? 119.579 -10.952 -99.942  1.00 0.00 ? 121 GLU A C    4  
ATOM 8525  O O    . GLU A 1 121 ? 120.605 -11.484 -99.565  1.00 0.00 ? 121 GLU A O    4  
ATOM 8526  C CB   . GLU A 1 121 ? 117.461 -11.372 -98.719  1.00 0.00 ? 121 GLU A CB   4  
ATOM 8527  C CG   . GLU A 1 121 ? 116.673 -10.989 -97.465  1.00 0.00 ? 121 GLU A CG   4  
ATOM 8528  C CD   . GLU A 1 121 ? 115.670 -12.096 -97.134  1.00 0.00 ? 121 GLU A CD   4  
ATOM 8529  O OE1  . GLU A 1 121 ? 114.831 -12.377 -97.974  1.00 0.00 ? 121 GLU A OE1  4  
ATOM 8530  O OE2  . GLU A 1 121 ? 115.757 -12.643 -96.047  1.00 0.00 ? 121 GLU A OE2  4  
ATOM 8531  H H    . GLU A 1 121 ? 117.062 -9.059  -99.674  1.00 0.00 ? 121 GLU A H    4  
ATOM 8532  H HA   . GLU A 1 121 ? 119.115 -10.226 -98.001  1.00 0.00 ? 121 GLU A HA   4  
ATOM 8533  H HB2  . GLU A 1 121 ? 116.802 -11.361 -99.576  1.00 0.00 ? 121 GLU A HB2  4  
ATOM 8534  H HB3  . GLU A 1 121 ? 117.874 -12.361 -98.595  1.00 0.00 ? 121 GLU A HB3  4  
ATOM 8535  H HG2  . GLU A 1 121 ? 117.355 -10.861 -96.637  1.00 0.00 ? 121 GLU A HG2  4  
ATOM 8536  H HG3  . GLU A 1 121 ? 116.142 -10.066 -97.640  1.00 0.00 ? 121 GLU A HG3  4  
ATOM 8537  N N    . ALA A 1 122 ? 119.311 -10.859 -101.211 1.00 0.00 ? 122 ALA A N    4  
ATOM 8538  C CA   . ALA A 1 122 ? 120.287 -11.419 -102.177 1.00 0.00 ? 122 ALA A CA   4  
ATOM 8539  C C    . ALA A 1 122 ? 121.541 -10.542 -102.138 1.00 0.00 ? 122 ALA A C    4  
ATOM 8540  O O    . ALA A 1 122 ? 122.546 -10.927 -101.571 1.00 0.00 ? 122 ALA A O    4  
ATOM 8541  C CB   . ALA A 1 122 ? 119.688 -11.437 -103.585 1.00 0.00 ? 122 ALA A CB   4  
ATOM 8542  H H    . ALA A 1 122 ? 118.490 -10.420 -101.521 1.00 0.00 ? 122 ALA A H    4  
ATOM 8543  H HA   . ALA A 1 122 ? 120.537 -12.420 -101.859 1.00 0.00 ? 122 ALA A HA   4  
ATOM 8544  H HB1  . ALA A 1 122 ? 119.141 -10.521 -103.756 1.00 0.00 ? 122 ALA A HB1  4  
ATOM 8545  H HB2  . ALA A 1 122 ? 119.019 -12.279 -103.681 1.00 0.00 ? 122 ALA A HB2  4  
ATOM 8546  H HB3  . ALA A 1 122 ? 120.482 -11.522 -104.313 1.00 0.00 ? 122 ALA A HB3  4  
ATOM 8547  N N    . ALA A 1 123 ? 121.515 -9.374  -102.717 1.00 0.00 ? 123 ALA A N    4  
ATOM 8548  C CA   . ALA A 1 123 ? 122.729 -8.515  -102.675 1.00 0.00 ? 123 ALA A CA   4  
ATOM 8549  C C    . ALA A 1 123 ? 123.311 -8.529  -101.258 1.00 0.00 ? 123 ALA A C    4  
ATOM 8550  O O    . ALA A 1 123 ? 124.510 -8.616  -101.072 1.00 0.00 ? 123 ALA A O    4  
ATOM 8551  C CB   . ALA A 1 123 ? 122.346 -7.085  -103.060 1.00 0.00 ? 123 ALA A CB   4  
ATOM 8552  H H    . ALA A 1 123 ? 120.718 -9.054  -103.190 1.00 0.00 ? 123 ALA A H    4  
ATOM 8553  H HA   . ALA A 1 123 ? 123.463 -8.892  -103.372 1.00 0.00 ? 123 ALA A HA   4  
ATOM 8554  H HB1  . ALA A 1 123 ? 122.511 -6.429  -102.220 1.00 0.00 ? 123 ALA A HB1  4  
ATOM 8555  H HB2  . ALA A 1 123 ? 121.303 -7.058  -103.340 1.00 0.00 ? 123 ALA A HB2  4  
ATOM 8556  H HB3  . ALA A 1 123 ? 122.951 -6.763  -103.895 1.00 0.00 ? 123 ALA A HB3  4  
ATOM 8557  N N    . ALA A 1 124 ? 122.474 -8.451  -100.253 1.00 0.00 ? 124 ALA A N    4  
ATOM 8558  C CA   . ALA A 1 124 ? 122.996 -8.473  -98.857  1.00 0.00 ? 124 ALA A CA   4  
ATOM 8559  C C    . ALA A 1 124 ? 123.943 -9.660  -98.710  1.00 0.00 ? 124 ALA A C    4  
ATOM 8560  O O    . ALA A 1 124 ? 125.138 -9.499  -98.557  1.00 0.00 ? 124 ALA A O    4  
ATOM 8561  C CB   . ALA A 1 124 ? 121.839 -8.624  -97.866  1.00 0.00 ? 124 ALA A CB   4  
ATOM 8562  H H    . ALA A 1 124 ? 121.511 -8.388  -100.418 1.00 0.00 ? 124 ALA A H    4  
ATOM 8563  H HA   . ALA A 1 124 ? 123.529 -7.556  -98.655  1.00 0.00 ? 124 ALA A HA   4  
ATOM 8564  H HB1  . ALA A 1 124 ? 122.227 -8.926  -96.904  1.00 0.00 ? 124 ALA A HB1  4  
ATOM 8565  H HB2  . ALA A 1 124 ? 121.151 -9.374  -98.226  1.00 0.00 ? 124 ALA A HB2  4  
ATOM 8566  H HB3  . ALA A 1 124 ? 121.324 -7.679  -97.765  1.00 0.00 ? 124 ALA A HB3  4  
ATOM 8567  N N    . ARG A 1 125 ? 123.421 -10.856 -98.753  1.00 0.00 ? 125 ARG A N    4  
ATOM 8568  C CA   . ARG A 1 125 ? 124.303 -12.043 -98.613  1.00 0.00 ? 125 ARG A CA   4  
ATOM 8569  C C    . ARG A 1 125 ? 125.549 -11.814 -99.467  1.00 0.00 ? 125 ARG A C    4  
ATOM 8570  O O    . ARG A 1 125 ? 126.656 -12.087 -99.054  1.00 0.00 ? 125 ARG A O    4  
ATOM 8571  C CB   . ARG A 1 125 ? 123.567 -13.293 -99.099  1.00 0.00 ? 125 ARG A CB   4  
ATOM 8572  C CG   . ARG A 1 125 ? 123.708 -14.405 -98.058  1.00 0.00 ? 125 ARG A CG   4  
ATOM 8573  C CD   . ARG A 1 125 ? 125.166 -14.863 -97.992  1.00 0.00 ? 125 ARG A CD   4  
ATOM 8574  N NE   . ARG A 1 125 ? 125.217 -16.347 -97.881  1.00 0.00 ? 125 ARG A NE   4  
ATOM 8575  C CZ   . ARG A 1 125 ? 126.335 -16.981 -98.108  1.00 0.00 ? 125 ARG A CZ   4  
ATOM 8576  N NH1  . ARG A 1 125 ? 127.409 -16.313 -98.430  1.00 0.00 ? 125 ARG A NH1  4  
ATOM 8577  N NH2  . ARG A 1 125 ? 126.380 -18.282 -98.011  1.00 0.00 ? 125 ARG A NH2  4  
ATOM 8578  H H    . ARG A 1 125 ? 122.452 -10.965 -98.862  1.00 0.00 ? 125 ARG A H    4  
ATOM 8579  H HA   . ARG A 1 125 ? 124.589 -12.165 -97.578  1.00 0.00 ? 125 ARG A HA   4  
ATOM 8580  H HB2  . ARG A 1 125 ? 122.521 -13.062 -99.242  1.00 0.00 ? 125 ARG A HB2  4  
ATOM 8581  H HB3  . ARG A 1 125 ? 123.994 -13.622 -100.034 1.00 0.00 ? 125 ARG A HB3  4  
ATOM 8582  H HG2  . ARG A 1 125 ? 123.401 -14.034 -97.091  1.00 0.00 ? 125 ARG A HG2  4  
ATOM 8583  H HG3  . ARG A 1 125 ? 123.083 -15.241 -98.337  1.00 0.00 ? 125 ARG A HG3  4  
ATOM 8584  H HD2  . ARG A 1 125 ? 125.682 -14.551 -98.888  1.00 0.00 ? 125 ARG A HD2  4  
ATOM 8585  H HD3  . ARG A 1 125 ? 125.642 -14.420 -97.130  1.00 0.00 ? 125 ARG A HD3  4  
ATOM 8586  H HE   . ARG A 1 125 ? 124.410 -16.849 -97.639  1.00 0.00 ? 125 ARG A HE   4  
ATOM 8587  H HH11 . ARG A 1 125 ? 127.375 -15.317 -98.504  1.00 0.00 ? 125 ARG A HH11 4  
ATOM 8588  H HH12 . ARG A 1 125 ? 128.266 -16.798 -98.604  1.00 0.00 ? 125 ARG A HH12 4  
ATOM 8589  H HH21 . ARG A 1 125 ? 125.557 -18.793 -97.764  1.00 0.00 ? 125 ARG A HH21 4  
ATOM 8590  H HH22 . ARG A 1 125 ? 127.237 -18.766 -98.184  1.00 0.00 ? 125 ARG A HH22 4  
ATOM 8591  N N    . MET A 1 126 ? 125.382 -11.291 -100.649 1.00 0.00 ? 126 MET A N    4  
ATOM 8592  C CA   . MET A 1 126 ? 126.563 -11.021 -101.511 1.00 0.00 ? 126 MET A CA   4  
ATOM 8593  C C    . MET A 1 126 ? 127.578 -10.187 -100.723 1.00 0.00 ? 126 MET A C    4  
ATOM 8594  O O    . MET A 1 126 ? 128.534 -10.700 -100.183 1.00 0.00 ? 126 MET A O    4  
ATOM 8595  C CB   . MET A 1 126 ? 126.116 -10.238 -102.747 1.00 0.00 ? 126 MET A CB   4  
ATOM 8596  C CG   . MET A 1 126 ? 126.799 -10.812 -103.990 1.00 0.00 ? 126 MET A CG   4  
ATOM 8597  S SD   . MET A 1 126 ? 126.207 -12.497 -104.281 1.00 0.00 ? 126 MET A SD   4  
ATOM 8598  C CE   . MET A 1 126 ? 124.754 -12.060 -105.267 1.00 0.00 ? 126 MET A CE   4  
ATOM 8599  H H    . MET A 1 126 ? 124.483 -11.057 -100.966 1.00 0.00 ? 126 MET A H    4  
ATOM 8600  H HA   . MET A 1 126 ? 127.017 -11.951 -101.823 1.00 0.00 ? 126 MET A HA   4  
ATOM 8601  H HB2  . MET A 1 126 ? 125.043 -10.321 -102.856 1.00 0.00 ? 126 MET A HB2  4  
ATOM 8602  H HB3  . MET A 1 126 ? 126.388 -9.200  -102.637 1.00 0.00 ? 126 MET A HB3  4  
ATOM 8603  H HG2  . MET A 1 126 ? 126.567 -10.196 -104.846 1.00 0.00 ? 126 MET A HG2  4  
ATOM 8604  H HG3  . MET A 1 126 ? 127.869 -10.827 -103.837 1.00 0.00 ? 126 MET A HG3  4  
ATOM 8605  H HE1  . MET A 1 126 ? 125.040 -11.350 -106.031 1.00 0.00 ? 126 MET A HE1  4  
ATOM 8606  H HE2  . MET A 1 126 ? 124.004 -11.619 -104.630 1.00 0.00 ? 126 MET A HE2  4  
ATOM 8607  H HE3  . MET A 1 126 ? 124.353 -12.952 -105.729 1.00 0.00 ? 126 MET A HE3  4  
ATOM 8608  N N    . ILE A 1 127 ? 127.361 -8.901  -100.648 1.00 0.00 ? 127 ILE A N    4  
ATOM 8609  C CA   . ILE A 1 127 ? 128.299 -8.014  -99.894  1.00 0.00 ? 127 ILE A CA   4  
ATOM 8610  C C    . ILE A 1 127 ? 128.624 -8.632  -98.533  1.00 0.00 ? 127 ILE A C    4  
ATOM 8611  O O    . ILE A 1 127 ? 129.753 -8.967  -98.239  1.00 0.00 ? 127 ILE A O    4  
ATOM 8612  C CB   . ILE A 1 127 ? 127.623 -6.661  -99.673  1.00 0.00 ? 127 ILE A CB   4  
ATOM 8613  C CG1  . ILE A 1 127 ? 127.388 -5.969  -101.017 1.00 0.00 ? 127 ILE A CG1  4  
ATOM 8614  C CG2  . ILE A 1 127 ? 128.507 -5.780  -98.793  1.00 0.00 ? 127 ILE A CG2  4  
ATOM 8615  C CD1  . ILE A 1 127 ? 128.660 -6.004  -101.855 1.00 0.00 ? 127 ILE A CD1  4  
ATOM 8616  H H    . ILE A 1 127 ? 126.572 -8.515  -101.084 1.00 0.00 ? 127 ILE A H    4  
ATOM 8617  H HA   . ILE A 1 127 ? 129.207 -7.878  -100.458 1.00 0.00 ? 127 ILE A HA   4  
ATOM 8618  H HB   . ILE A 1 127 ? 126.674 -6.816  -99.179  1.00 0.00 ? 127 ILE A HB   4  
ATOM 8619  H HG12 . ILE A 1 127 ? 126.599 -6.478  -101.549 1.00 0.00 ? 127 ILE A HG12 4  
ATOM 8620  H HG13 . ILE A 1 127 ? 127.105 -4.942  -100.847 1.00 0.00 ? 127 ILE A HG13 4  
ATOM 8621  H HG21 . ILE A 1 127 ? 128.756 -6.309  -97.885  1.00 0.00 ? 127 ILE A HG21 4  
ATOM 8622  H HG22 . ILE A 1 127 ? 127.974 -4.875  -98.548  1.00 0.00 ? 127 ILE A HG22 4  
ATOM 8623  H HG23 . ILE A 1 127 ? 129.411 -5.532  -99.325  1.00 0.00 ? 127 ILE A HG23 4  
ATOM 8624  H HD11 . ILE A 1 127 ? 128.730 -6.956  -102.360 1.00 0.00 ? 127 ILE A HD11 4  
ATOM 8625  H HD12 . ILE A 1 127 ? 129.516 -5.871  -101.212 1.00 0.00 ? 127 ILE A HD12 4  
ATOM 8626  H HD13 . ILE A 1 127 ? 128.628 -5.210  -102.585 1.00 0.00 ? 127 ILE A HD13 4  
ATOM 8627  N N    . ALA A 1 128 ? 127.633 -8.783  -97.709  1.00 0.00 ? 128 ALA A N    4  
ATOM 8628  C CA   . ALA A 1 128 ? 127.888 -9.386  -96.371  1.00 0.00 ? 128 ALA A CA   4  
ATOM 8629  C C    . ALA A 1 128 ? 128.461 -10.784 -96.604  1.00 0.00 ? 128 ALA A C    4  
ATOM 8630  O O    . ALA A 1 128 ? 129.622 -11.042 -96.334  1.00 0.00 ? 128 ALA A O    4  
ATOM 8631  C CB   . ALA A 1 128 ? 126.599 -9.455  -95.549  1.00 0.00 ? 128 ALA A CB   4  
ATOM 8632  H H    . ALA A 1 128 ? 126.743 -8.505  -98.012  1.00 0.00 ? 128 ALA A H    4  
ATOM 8633  H HA   . ALA A 1 128 ? 128.638 -8.799  -95.864  1.00 0.00 ? 128 ALA A HA   4  
ATOM 8634  H HB1  . ALA A 1 128 ? 126.295 -10.486 -95.441  1.00 0.00 ? 128 ALA A HB1  4  
ATOM 8635  H HB2  . ALA A 1 128 ? 125.820 -8.902  -96.052  1.00 0.00 ? 128 ALA A HB2  4  
ATOM 8636  H HB3  . ALA A 1 128 ? 126.772 -9.027  -94.573  1.00 0.00 ? 128 ALA A HB3  4  
ATOM 8637  N N    . GLY A 1 129 ? 127.669 -11.691 -97.086  1.00 0.00 ? 129 GLY A N    4  
ATOM 8638  C CA   . GLY A 1 129 ? 128.193 -13.063 -97.313  1.00 0.00 ? 129 GLY A CA   4  
ATOM 8639  C C    . GLY A 1 129 ? 129.590 -12.968 -97.940  1.00 0.00 ? 129 GLY A C    4  
ATOM 8640  O O    . GLY A 1 129 ? 130.483 -13.711 -97.587  1.00 0.00 ? 129 GLY A O    4  
ATOM 8641  H H    . GLY A 1 129 ? 126.726 -11.478 -97.252  1.00 0.00 ? 129 GLY A H    4  
ATOM 8642  H HA2  . GLY A 1 129 ? 128.255 -13.585 -96.368  1.00 0.00 ? 129 GLY A HA2  4  
ATOM 8643  H HA3  . GLY A 1 129 ? 127.537 -13.601 -97.980  1.00 0.00 ? 129 GLY A HA3  4  
ATOM 8644  N N    . SER A 1 130 ? 129.812 -12.041 -98.840  1.00 0.00 ? 130 SER A N    4  
ATOM 8645  C CA   . SER A 1 130 ? 131.180 -11.913 -99.420  1.00 0.00 ? 130 SER A CA   4  
ATOM 8646  C C    . SER A 1 130 ? 132.154 -11.703 -98.263  1.00 0.00 ? 130 SER A C    4  
ATOM 8647  O O    . SER A 1 130 ? 133.134 -12.411 -98.119  1.00 0.00 ? 130 SER A O    4  
ATOM 8648  C CB   . SER A 1 130 ? 131.255 -10.708 -100.362 1.00 0.00 ? 130 SER A CB   4  
ATOM 8649  O OG   . SER A 1 130 ? 131.362 -9.518  -99.594  1.00 0.00 ? 130 SER A OG   4  
ATOM 8650  H H    . SER A 1 130 ? 129.103 -11.424 -99.115  1.00 0.00 ? 130 SER A H    4  
ATOM 8651  H HA   . SER A 1 130 ? 131.437 -12.816 -99.956  1.00 0.00 ? 130 SER A HA   4  
ATOM 8652  H HB2  . SER A 1 130 ? 132.123 -10.798 -100.995 1.00 0.00 ? 130 SER A HB2  4  
ATOM 8653  H HB3  . SER A 1 130 ? 130.370 -10.672 -100.978 1.00 0.00 ? 130 SER A HB3  4  
ATOM 8654  H HG   . SER A 1 130 ? 132.019 -9.665  -98.910  1.00 0.00 ? 130 SER A HG   4  
ATOM 8655  N N    . ALA A 1 131 ? 131.874 -10.746 -97.416  1.00 0.00 ? 131 ALA A N    4  
ATOM 8656  C CA   . ALA A 1 131 ? 132.764 -10.510 -96.252  1.00 0.00 ? 131 ALA A CA   4  
ATOM 8657  C C    . ALA A 1 131 ? 133.044 -11.867 -95.614  1.00 0.00 ? 131 ALA A C    4  
ATOM 8658  O O    . ALA A 1 131 ? 134.180 -12.237 -95.390  1.00 0.00 ? 131 ALA A O    4  
ATOM 8659  C CB   . ALA A 1 131 ? 132.068 -9.586  -95.251  1.00 0.00 ? 131 ALA A CB   4  
ATOM 8660  H H    . ALA A 1 131 ? 131.070 -10.200 -97.540  1.00 0.00 ? 131 ALA A H    4  
ATOM 8661  H HA   . ALA A 1 131 ? 133.692 -10.064 -96.584  1.00 0.00 ? 131 ALA A HA   4  
ATOM 8662  H HB1  . ALA A 1 131 ? 131.780 -10.152 -94.378  1.00 0.00 ? 131 ALA A HB1  4  
ATOM 8663  H HB2  . ALA A 1 131 ? 131.188 -9.159  -95.710  1.00 0.00 ? 131 ALA A HB2  4  
ATOM 8664  H HB3  . ALA A 1 131 ? 132.744 -8.794  -94.962  1.00 0.00 ? 131 ALA A HB3  4  
ATOM 8665  N N    . ARG A 1 132 ? 132.016 -12.639 -95.373  1.00 0.00 ? 132 ARG A N    4  
ATOM 8666  C CA   . ARG A 1 132 ? 132.241 -14.000 -94.814  1.00 0.00 ? 132 ARG A CA   4  
ATOM 8667  C C    . ARG A 1 132 ? 133.368 -14.634 -95.620  1.00 0.00 ? 132 ARG A C    4  
ATOM 8668  O O    . ARG A 1 132 ? 134.371 -15.048 -95.074  1.00 0.00 ? 132 ARG A O    4  
ATOM 8669  C CB   . ARG A 1 132 ? 130.971 -14.844 -94.949  1.00 0.00 ? 132 ARG A CB   4  
ATOM 8670  C CG   . ARG A 1 132 ? 131.215 -16.230 -94.348  1.00 0.00 ? 132 ARG A CG   4  
ATOM 8671  C CD   . ARG A 1 132 ? 131.652 -17.197 -95.451  1.00 0.00 ? 132 ARG A CD   4  
ATOM 8672  N NE   . ARG A 1 132 ? 131.579 -18.596 -94.943  1.00 0.00 ? 132 ARG A NE   4  
ATOM 8673  C CZ   . ARG A 1 132 ? 131.616 -19.598 -95.778  1.00 0.00 ? 132 ARG A CZ   4  
ATOM 8674  N NH1  . ARG A 1 132 ? 131.719 -19.376 -97.060  1.00 0.00 ? 132 ARG A NH1  4  
ATOM 8675  N NH2  . ARG A 1 132 ? 131.551 -20.823 -95.331  1.00 0.00 ? 132 ARG A NH2  4  
ATOM 8676  H H    . ARG A 1 132 ? 131.109 -12.340 -95.606  1.00 0.00 ? 132 ARG A H    4  
ATOM 8677  H HA   . ARG A 1 132 ? 132.551 -13.964 -93.779  1.00 0.00 ? 132 ARG A HA   4  
ATOM 8678  H HB2  . ARG A 1 132 ? 130.160 -14.361 -94.425  1.00 0.00 ? 132 ARG A HB2  4  
ATOM 8679  H HB3  . ARG A 1 132 ? 130.716 -14.948 -95.990  1.00 0.00 ? 132 ARG A HB3  4  
ATOM 8680  H HG2  . ARG A 1 132 ? 131.990 -16.165 -93.598  1.00 0.00 ? 132 ARG A HG2  4  
ATOM 8681  H HG3  . ARG A 1 132 ? 130.305 -16.592 -93.895  1.00 0.00 ? 132 ARG A HG3  4  
ATOM 8682  H HD2  . ARG A 1 132 ? 130.997 -17.091 -96.304  1.00 0.00 ? 132 ARG A HD2  4  
ATOM 8683  H HD3  . ARG A 1 132 ? 132.667 -16.973 -95.746  1.00 0.00 ? 132 ARG A HD3  4  
ATOM 8684  H HE   . ARG A 1 132 ? 131.504 -18.764 -93.980  1.00 0.00 ? 132 ARG A HE   4  
ATOM 8685  H HH11 . ARG A 1 132 ? 131.769 -18.438 -97.403  1.00 0.00 ? 132 ARG A HH11 4  
ATOM 8686  H HH12 . ARG A 1 132 ? 131.746 -20.144 -97.700  1.00 0.00 ? 132 ARG A HH12 4  
ATOM 8687  H HH21 . ARG A 1 132 ? 131.473 -20.993 -94.349  1.00 0.00 ? 132 ARG A HH21 4  
ATOM 8688  H HH22 . ARG A 1 132 ? 131.579 -21.591 -95.971  1.00 0.00 ? 132 ARG A HH22 4  
ATOM 8689  N N    . SER A 1 133 ? 133.244 -14.676 -96.918  1.00 0.00 ? 133 SER A N    4  
ATOM 8690  C CA   . SER A 1 133 ? 134.354 -15.242 -97.727  1.00 0.00 ? 133 SER A CA   4  
ATOM 8691  C C    . SER A 1 133 ? 135.646 -14.652 -97.169  1.00 0.00 ? 133 SER A C    4  
ATOM 8692  O O    . SER A 1 133 ? 136.452 -15.335 -96.569  1.00 0.00 ? 133 SER A O    4  
ATOM 8693  C CB   . SER A 1 133 ? 134.185 -14.830 -99.190  1.00 0.00 ? 133 SER A CB   4  
ATOM 8694  O OG   . SER A 1 133 ? 135.069 -15.595 -99.998  1.00 0.00 ? 133 SER A OG   4  
ATOM 8695  H H    . SER A 1 133 ? 132.445 -14.308 -97.355  1.00 0.00 ? 133 SER A H    4  
ATOM 8696  H HA   . SER A 1 133 ? 134.370 -16.320 -97.647  1.00 0.00 ? 133 SER A HA   4  
ATOM 8697  H HB2  . SER A 1 133 ? 133.170 -15.013 -99.501  1.00 0.00 ? 133 SER A HB2  4  
ATOM 8698  H HB3  . SER A 1 133 ? 134.407 -13.776 -99.293  1.00 0.00 ? 133 SER A HB3  4  
ATOM 8699  H HG   . SER A 1 133 ? 135.625 -16.119 -99.416  1.00 0.00 ? 133 SER A HG   4  
ATOM 8700  N N    . MET A 1 134 ? 135.824 -13.369 -97.334  1.00 0.00 ? 134 MET A N    4  
ATOM 8701  C CA   . MET A 1 134 ? 137.033 -12.696 -96.785  1.00 0.00 ? 134 MET A CA   4  
ATOM 8702  C C    . MET A 1 134 ? 137.210 -13.100 -95.320  1.00 0.00 ? 134 MET A C    4  
ATOM 8703  O O    . MET A 1 134 ? 138.152 -12.698 -94.664  1.00 0.00 ? 134 MET A O    4  
ATOM 8704  C CB   . MET A 1 134 ? 136.831 -11.177 -96.860  1.00 0.00 ? 134 MET A CB   4  
ATOM 8705  C CG   . MET A 1 134 ? 138.169 -10.472 -96.632  1.00 0.00 ? 134 MET A CG   4  
ATOM 8706  S SD   . MET A 1 134 ? 137.905 -8.912  -95.750  1.00 0.00 ? 134 MET A SD   4  
ATOM 8707  C CE   . MET A 1 134 ? 136.663 -8.207  -96.862  1.00 0.00 ? 134 MET A CE   4  
ATOM 8708  H H    . MET A 1 134 ? 135.144 -12.840 -97.805  1.00 0.00 ? 134 MET A H    4  
ATOM 8709  H HA   . MET A 1 134 ? 137.916 -12.965 -97.346  1.00 0.00 ? 134 MET A HA   4  
ATOM 8710  H HB2  . MET A 1 134 ? 136.445 -10.913 -97.834  1.00 0.00 ? 134 MET A HB2  4  
ATOM 8711  H HB3  . MET A 1 134 ? 136.130 -10.869 -96.099  1.00 0.00 ? 134 MET A HB3  4  
ATOM 8712  H HG2  . MET A 1 134 ? 138.811 -11.107 -96.042  1.00 0.00 ? 134 MET A HG2  4  
ATOM 8713  H HG3  . MET A 1 134 ? 138.637 -10.272 -97.584  1.00 0.00 ? 134 MET A HG3  4  
ATOM 8714  H HE1  . MET A 1 134 ? 135.684 -8.299  -96.411  1.00 0.00 ? 134 MET A HE1  4  
ATOM 8715  H HE2  . MET A 1 134 ? 136.675 -8.733  -97.801  1.00 0.00 ? 134 MET A HE2  4  
ATOM 8716  H HE3  . MET A 1 134 ? 136.888 -7.164  -97.032  1.00 0.00 ? 134 MET A HE3  4  
ATOM 8717  N N    . GLY A 1 135 ? 136.300 -13.875 -94.794  1.00 0.00 ? 135 GLY A N    4  
ATOM 8718  C CA   . GLY A 1 135 ? 136.401 -14.283 -93.364  1.00 0.00 ? 135 GLY A CA   4  
ATOM 8719  C C    . GLY A 1 135 ? 135.706 -13.223 -92.515  1.00 0.00 ? 135 GLY A C    4  
ATOM 8720  O O    . GLY A 1 135 ? 135.216 -13.486 -91.434  1.00 0.00 ? 135 GLY A O    4  
ATOM 8721  H H    . GLY A 1 135 ? 135.538 -14.171 -95.334  1.00 0.00 ? 135 GLY A H    4  
ATOM 8722  H HA2  . GLY A 1 135 ? 135.920 -15.241 -93.224  1.00 0.00 ? 135 GLY A HA2  4  
ATOM 8723  H HA3  . GLY A 1 135 ? 137.440 -14.351 -93.077  1.00 0.00 ? 135 GLY A HA3  4  
ATOM 8724  N N    . VAL A 1 136 ? 135.656 -12.021 -93.016  1.00 0.00 ? 136 VAL A N    4  
ATOM 8725  C CA   . VAL A 1 136 ? 134.991 -10.915 -92.276  1.00 0.00 ? 136 VAL A CA   4  
ATOM 8726  C C    . VAL A 1 136 ? 133.607 -11.370 -91.816  1.00 0.00 ? 136 VAL A C    4  
ATOM 8727  O O    . VAL A 1 136 ? 133.085 -12.364 -92.282  1.00 0.00 ? 136 VAL A O    4  
ATOM 8728  C CB   . VAL A 1 136 ? 134.842 -9.715  -93.207  1.00 0.00 ? 136 VAL A CB   4  
ATOM 8729  C CG1  . VAL A 1 136 ? 133.847 -8.718  -92.613  1.00 0.00 ? 136 VAL A CG1  4  
ATOM 8730  C CG2  . VAL A 1 136 ? 136.201 -9.038  -93.379  1.00 0.00 ? 136 VAL A CG2  4  
ATOM 8731  H H    . VAL A 1 136 ? 136.058 -11.853 -93.894  1.00 0.00 ? 136 VAL A H    4  
ATOM 8732  H HA   . VAL A 1 136 ? 135.587 -10.637 -91.420  1.00 0.00 ? 136 VAL A HA   4  
ATOM 8733  H HB   . VAL A 1 136 ? 134.480 -10.054 -94.169  1.00 0.00 ? 136 VAL A HB   4  
ATOM 8734  H HG11 . VAL A 1 136 ? 133.981 -7.755  -93.082  1.00 0.00 ? 136 VAL A HG11 4  
ATOM 8735  H HG12 . VAL A 1 136 ? 134.019 -8.628  -91.551  1.00 0.00 ? 136 VAL A HG12 4  
ATOM 8736  H HG13 . VAL A 1 136 ? 132.840 -9.068  -92.785  1.00 0.00 ? 136 VAL A HG13 4  
ATOM 8737  H HG21 . VAL A 1 136 ? 136.936 -9.776  -93.661  1.00 0.00 ? 136 VAL A HG21 4  
ATOM 8738  H HG22 . VAL A 1 136 ? 136.492 -8.578  -92.446  1.00 0.00 ? 136 VAL A HG22 4  
ATOM 8739  H HG23 . VAL A 1 136 ? 136.133 -8.284  -94.148  1.00 0.00 ? 136 VAL A HG23 4  
ATOM 8740  N N    . GLU A 1 137 ? 133.002 -10.649 -90.914  1.00 0.00 ? 137 GLU A N    4  
ATOM 8741  C CA   . GLU A 1 137 ? 131.647 -11.054 -90.446  1.00 0.00 ? 137 GLU A CA   4  
ATOM 8742  C C    . GLU A 1 137 ? 130.786 -9.808  -90.224  1.00 0.00 ? 137 GLU A C    4  
ATOM 8743  O O    . GLU A 1 137 ? 131.294 -8.715  -90.080  1.00 0.00 ? 137 GLU A O    4  
ATOM 8744  C CB   . GLU A 1 137 ? 131.772 -11.826 -89.130  1.00 0.00 ? 137 GLU A CB   4  
ATOM 8745  C CG   . GLU A 1 137 ? 132.736 -12.999 -89.317  1.00 0.00 ? 137 GLU A CG   4  
ATOM 8746  C CD   . GLU A 1 137 ? 134.160 -12.547 -88.986  1.00 0.00 ? 137 GLU A CD   4  
ATOM 8747  O OE1  . GLU A 1 137 ? 134.336 -11.373 -88.701  1.00 0.00 ? 137 GLU A OE1  4  
ATOM 8748  O OE2  . GLU A 1 137 ? 135.049 -13.381 -89.022  1.00 0.00 ? 137 GLU A OE2  4  
ATOM 8749  H H    . GLU A 1 137 ? 133.437 -9.844  -90.557  1.00 0.00 ? 137 GLU A H    4  
ATOM 8750  H HA   . GLU A 1 137 ? 131.203 -11.691 -91.195  1.00 0.00 ? 137 GLU A HA   4  
ATOM 8751  H HB2  . GLU A 1 137 ? 132.148 -11.168 -88.361  1.00 0.00 ? 137 GLU A HB2  4  
ATOM 8752  H HB3  . GLU A 1 137 ? 130.803 -12.203 -88.840  1.00 0.00 ? 137 GLU A HB3  4  
ATOM 8753  H HG2  . GLU A 1 137 ? 132.452 -13.807 -88.657  1.00 0.00 ? 137 GLU A HG2  4  
ATOM 8754  H HG3  . GLU A 1 137 ? 132.698 -13.338 -90.341  1.00 0.00 ? 137 GLU A HG3  4  
ATOM 8755  N N    . VAL A 1 138 ? 129.492 -9.966  -90.155  1.00 0.00 ? 138 VAL A N    4  
ATOM 8756  C CA   . VAL A 1 138 ? 128.617 -8.786  -89.900  1.00 0.00 ? 138 VAL A CA   4  
ATOM 8757  C C    . VAL A 1 138 ? 128.692 -8.484  -88.405  1.00 0.00 ? 138 VAL A C    4  
ATOM 8758  O O    . VAL A 1 138 ? 129.136 -9.289  -87.611  1.00 0.00 ? 138 VAL A O    4  
ATOM 8759  C CB   . VAL A 1 138 ? 127.176 -9.119  -90.295  1.00 0.00 ? 138 VAL A CB   4  
ATOM 8760  C CG1  . VAL A 1 138 ? 126.428 -7.831  -90.639  1.00 0.00 ? 138 VAL A CG1  4  
ATOM 8761  C CG2  . VAL A 1 138 ? 127.185 -10.043 -91.516  1.00 0.00 ? 138 VAL A CG2  4  
ATOM 8762  H H    . VAL A 1 138 ? 129.099 -10.859 -90.235  1.00 0.00 ? 138 VAL A H    4  
ATOM 8763  H HA   . VAL A 1 138 ? 128.970 -7.936  -90.465  1.00 0.00 ? 138 VAL A HA   4  
ATOM 8764  H HB   . VAL A 1 138 ? 126.683 -9.614  -89.471  1.00 0.00 ? 138 VAL A HB   4  
ATOM 8765  H HG11 . VAL A 1 138 ? 126.591 -7.102  -89.861  1.00 0.00 ? 138 VAL A HG11 4  
ATOM 8766  H HG12 . VAL A 1 138 ? 125.372 -8.040  -90.719  1.00 0.00 ? 138 VAL A HG12 4  
ATOM 8767  H HG13 . VAL A 1 138 ? 126.791 -7.444  -91.579  1.00 0.00 ? 138 VAL A HG13 4  
ATOM 8768  H HG21 . VAL A 1 138 ? 127.652 -10.981 -91.254  1.00 0.00 ? 138 VAL A HG21 4  
ATOM 8769  H HG22 . VAL A 1 138 ? 127.741 -9.576  -92.317  1.00 0.00 ? 138 VAL A HG22 4  
ATOM 8770  H HG23 . VAL A 1 138 ? 126.171 -10.222 -91.838  1.00 0.00 ? 138 VAL A HG23 4  
ATOM 8771  N N    . VAL A 1 139 ? 128.253 -7.314  -88.025  1.00 0.00 ? 139 VAL A N    4  
ATOM 8772  C CA   . VAL A 1 139 ? 128.281 -6.924  -86.590  1.00 0.00 ? 139 VAL A CA   4  
ATOM 8773  C C    . VAL A 1 139 ? 126.900 -6.401  -86.189  1.00 0.00 ? 139 VAL A C    4  
ATOM 8774  O O    . VAL A 1 139 ? 126.751 -5.279  -85.749  1.00 0.00 ? 139 VAL A O    4  
ATOM 8775  C CB   . VAL A 1 139 ? 129.333 -5.826  -86.387  1.00 0.00 ? 139 VAL A CB   4  
ATOM 8776  C CG1  . VAL A 1 139 ? 128.773 -4.477  -86.830  1.00 0.00 ? 139 VAL A CG1  4  
ATOM 8777  C CG2  . VAL A 1 139 ? 129.727 -5.753  -84.910  1.00 0.00 ? 139 VAL A CG2  4  
ATOM 8778  H H    . VAL A 1 139 ? 127.901 -6.688  -88.691  1.00 0.00 ? 139 VAL A H    4  
ATOM 8779  H HA   . VAL A 1 139 ? 128.533 -7.783  -85.987  1.00 0.00 ? 139 VAL A HA   4  
ATOM 8780  H HB   . VAL A 1 139 ? 130.201 -6.050  -86.983  1.00 0.00 ? 139 VAL A HB   4  
ATOM 8781  H HG11 . VAL A 1 139 ? 129.541 -3.927  -87.354  1.00 0.00 ? 139 VAL A HG11 4  
ATOM 8782  H HG12 . VAL A 1 139 ? 128.458 -3.916  -85.963  1.00 0.00 ? 139 VAL A HG12 4  
ATOM 8783  H HG13 . VAL A 1 139 ? 127.932 -4.633  -87.485  1.00 0.00 ? 139 VAL A HG13 4  
ATOM 8784  H HG21 . VAL A 1 139 ? 129.540 -6.707  -84.438  1.00 0.00 ? 139 VAL A HG21 4  
ATOM 8785  H HG22 . VAL A 1 139 ? 129.142 -4.989  -84.419  1.00 0.00 ? 139 VAL A HG22 4  
ATOM 8786  H HG23 . VAL A 1 139 ? 130.776 -5.511  -84.829  1.00 0.00 ? 139 VAL A HG23 4  
ATOM 8787  N N    . GLY A 1 140 ? 125.886 -7.210  -86.340  1.00 0.00 ? 140 GLY A N    4  
ATOM 8788  C CA   . GLY A 1 140 ? 124.514 -6.763  -85.972  1.00 0.00 ? 140 GLY A CA   4  
ATOM 8789  C C    . GLY A 1 140 ? 123.486 -7.721  -86.577  1.00 0.00 ? 140 GLY A C    4  
ATOM 8790  O O    . GLY A 1 140 ? 123.441 -8.889  -86.244  1.00 0.00 ? 140 GLY A O    4  
ATOM 8791  H H    . GLY A 1 140 ? 126.027 -8.113  -86.693  1.00 0.00 ? 140 GLY A H    4  
ATOM 8792  H HA2  . GLY A 1 140 ? 124.414 -6.756  -84.896  1.00 0.00 ? 140 GLY A HA2  4  
ATOM 8793  H HA3  . GLY A 1 140 ? 124.344 -5.768  -86.357  1.00 0.00 ? 140 GLY A HA3  4  
ATOM 8794  N N    . ALA A 1 141 ? 122.656 -7.237  -87.463  1.00 0.00 ? 141 ALA A N    4  
ATOM 8795  C CA   . ALA A 1 141 ? 121.630 -8.123  -88.082  1.00 0.00 ? 141 ALA A CA   4  
ATOM 8796  C C    . ALA A 1 141 ? 120.974 -8.976  -86.993  1.00 0.00 ? 141 ALA A C    4  
ATOM 8797  O O    . ALA A 1 141 ? 121.014 -10.189 -87.034  1.00 0.00 ? 141 ALA A O    4  
ATOM 8798  C CB   . ALA A 1 141 ? 122.297 -9.034  -89.119  1.00 0.00 ? 141 ALA A CB   4  
ATOM 8799  H H    . ALA A 1 141 ? 122.706 -6.292  -87.716  1.00 0.00 ? 141 ALA A H    4  
ATOM 8800  H HA   . ALA A 1 141 ? 120.878 -7.518  -88.567  1.00 0.00 ? 141 ALA A HA   4  
ATOM 8801  H HB1  . ALA A 1 141 ? 123.343 -9.150  -88.877  1.00 0.00 ? 141 ALA A HB1  4  
ATOM 8802  H HB2  . ALA A 1 141 ? 122.202 -8.592  -90.100  1.00 0.00 ? 141 ALA A HB2  4  
ATOM 8803  H HB3  . ALA A 1 141 ? 121.816 -10.001 -89.112  1.00 0.00 ? 141 ALA A HB3  4  
ATOM 8804  N N    . PRO A 1 142 ? 120.379 -8.336  -86.021  1.00 0.00 ? 142 PRO A N    4  
ATOM 8805  C CA   . PRO A 1 142 ? 119.710 -9.058  -84.902  1.00 0.00 ? 142 PRO A CA   4  
ATOM 8806  C C    . PRO A 1 142 ? 118.505 -9.883  -85.363  1.00 0.00 ? 142 PRO A C    4  
ATOM 8807  O O    . PRO A 1 142 ? 118.279 -10.066 -86.542  1.00 0.00 ? 142 PRO A O    4  
ATOM 8808  C CB   . PRO A 1 142 ? 119.260 -7.916  -83.989  1.00 0.00 ? 142 PRO A CB   4  
ATOM 8809  C CG   . PRO A 1 142 ? 119.565 -6.578  -84.677  1.00 0.00 ? 142 PRO A CG   4  
ATOM 8810  C CD   . PRO A 1 142 ? 120.332 -6.853  -85.974  1.00 0.00 ? 142 PRO A CD   4  
ATOM 8811  H HA   . PRO A 1 142 ? 120.416 -9.680  -84.378  1.00 0.00 ? 142 PRO A HA   4  
ATOM 8812  H HB2  . PRO A 1 142 ? 118.198 -7.997  -83.806  1.00 0.00 ? 142 PRO A HB2  4  
ATOM 8813  H HB3  . PRO A 1 142 ? 119.794 -7.967  -83.052  1.00 0.00 ? 142 PRO A HB3  4  
ATOM 8814  H HG2  . PRO A 1 142 ? 118.639 -6.069  -84.903  1.00 0.00 ? 142 PRO A HG2  4  
ATOM 8815  H HG3  . PRO A 1 142 ? 120.167 -5.965  -84.025  1.00 0.00 ? 142 PRO A HG3  4  
ATOM 8816  H HD2  . PRO A 1 142 ? 119.796 -6.454  -86.825  1.00 0.00 ? 142 PRO A HD2  4  
ATOM 8817  H HD3  . PRO A 1 142 ? 121.328 -6.448  -85.921  1.00 0.00 ? 142 PRO A HD3  4  
ATOM 8818  N N    . GLU A 1 143 ? 117.730 -10.377 -84.436  1.00 0.00 ? 143 GLU A N    4  
ATOM 8819  C CA   . GLU A 1 143 ? 116.537 -11.189 -84.809  1.00 0.00 ? 143 GLU A CA   4  
ATOM 8820  C C    . GLU A 1 143 ? 115.548 -11.196 -83.641  1.00 0.00 ? 143 GLU A C    4  
ATOM 8821  O O    . GLU A 1 143 ? 115.806 -10.633 -82.597  1.00 0.00 ? 143 GLU A O    4  
ATOM 8822  C CB   . GLU A 1 143 ? 116.970 -12.624 -85.119  1.00 0.00 ? 143 GLU A CB   4  
ATOM 8823  C CG   . GLU A 1 143 ? 117.899 -12.625 -86.335  1.00 0.00 ? 143 GLU A CG   4  
ATOM 8824  C CD   . GLU A 1 143 ? 118.102 -14.062 -86.821  1.00 0.00 ? 143 GLU A CD   4  
ATOM 8825  O OE1  . GLU A 1 143 ? 117.532 -14.956 -86.216  1.00 0.00 ? 143 GLU A OE1  4  
ATOM 8826  O OE2  . GLU A 1 143 ? 118.824 -14.243 -87.788  1.00 0.00 ? 143 GLU A OE2  4  
ATOM 8827  H H    . GLU A 1 143 ? 117.933 -10.214 -83.492  1.00 0.00 ? 143 GLU A H    4  
ATOM 8828  H HA   . GLU A 1 143 ? 116.065 -10.757 -85.680  1.00 0.00 ? 143 GLU A HA   4  
ATOM 8829  H HB2  . GLU A 1 143 ? 117.491 -13.033 -84.267  1.00 0.00 ? 143 GLU A HB2  4  
ATOM 8830  H HB3  . GLU A 1 143 ? 116.100 -13.224 -85.333  1.00 0.00 ? 143 GLU A HB3  4  
ATOM 8831  H HG2  . GLU A 1 143 ? 117.458 -12.035 -87.126  1.00 0.00 ? 143 GLU A HG2  4  
ATOM 8832  H HG3  . GLU A 1 143 ? 118.854 -12.203 -86.060  1.00 0.00 ? 143 GLU A HG3  4  
ATOM 8833  N N    . VAL A 1 144 ? 114.418 -11.828 -83.808  1.00 0.00 ? 144 VAL A N    4  
ATOM 8834  C CA   . VAL A 1 144 ? 113.419 -11.865 -82.702  1.00 0.00 ? 144 VAL A CA   4  
ATOM 8835  C C    . VAL A 1 144 ? 112.399 -12.973 -82.969  1.00 0.00 ? 144 VAL A C    4  
ATOM 8836  O O    . VAL A 1 144 ? 112.371 -13.563 -84.031  1.00 0.00 ? 144 VAL A O    4  
ATOM 8837  C CB   . VAL A 1 144 ? 112.698 -10.519 -82.621  1.00 0.00 ? 144 VAL A CB   4  
ATOM 8838  C CG1  . VAL A 1 144 ? 113.619 -9.483  -81.972  1.00 0.00 ? 144 VAL A CG1  4  
ATOM 8839  C CG2  . VAL A 1 144 ? 112.325 -10.055 -84.030  1.00 0.00 ? 144 VAL A CG2  4  
ATOM 8840  H H    . VAL A 1 144 ? 114.227 -12.276 -84.658  1.00 0.00 ? 144 VAL A H    4  
ATOM 8841  H HA   . VAL A 1 144 ? 113.925 -12.059 -81.768  1.00 0.00 ? 144 VAL A HA   4  
ATOM 8842  H HB   . VAL A 1 144 ? 111.802 -10.626 -82.026  1.00 0.00 ? 144 VAL A HB   4  
ATOM 8843  H HG11 . VAL A 1 144 ? 114.218 -9.960  -81.211  1.00 0.00 ? 144 VAL A HG11 4  
ATOM 8844  H HG12 . VAL A 1 144 ? 113.021 -8.703  -81.523  1.00 0.00 ? 144 VAL A HG12 4  
ATOM 8845  H HG13 . VAL A 1 144 ? 114.264 -9.054  -82.724  1.00 0.00 ? 144 VAL A HG13 4  
ATOM 8846  H HG21 . VAL A 1 144 ? 111.528 -10.674 -84.414  1.00 0.00 ? 144 VAL A HG21 4  
ATOM 8847  H HG22 . VAL A 1 144 ? 113.187 -10.138 -84.676  1.00 0.00 ? 144 VAL A HG22 4  
ATOM 8848  H HG23 . VAL A 1 144 ? 111.999 -9.026  -83.997  1.00 0.00 ? 144 VAL A HG23 4  
ATOM 8849  N N    . LYS A 1 145 ? 111.560 -13.262 -82.012  1.00 0.00 ? 145 LYS A N    4  
ATOM 8850  C CA   . LYS A 1 145 ? 110.541 -14.331 -82.209  1.00 0.00 ? 145 LYS A CA   4  
ATOM 8851  C C    . LYS A 1 145 ? 109.211 -13.698 -82.624  1.00 0.00 ? 145 LYS A C    4  
ATOM 8852  O O    . LYS A 1 145 ? 109.154 -12.547 -83.009  1.00 0.00 ? 145 LYS A O    4  
ATOM 8853  C CB   . LYS A 1 145 ? 110.350 -15.103 -80.901  1.00 0.00 ? 145 LYS A CB   4  
ATOM 8854  C CG   . LYS A 1 145 ? 111.612 -15.911 -80.595  1.00 0.00 ? 145 LYS A CG   4  
ATOM 8855  C CD   . LYS A 1 145 ? 112.706 -14.976 -80.073  1.00 0.00 ? 145 LYS A CD   4  
ATOM 8856  C CE   . LYS A 1 145 ? 113.624 -15.746 -79.122  1.00 0.00 ? 145 LYS A CE   4  
ATOM 8857  N NZ   . LYS A 1 145 ? 112.852 -16.168 -77.919  1.00 0.00 ? 145 LYS A NZ   4  
ATOM 8858  H H    . LYS A 1 145 ? 111.599 -12.774 -81.163  1.00 0.00 ? 145 LYS A H    4  
ATOM 8859  H HA   . LYS A 1 145 ? 110.874 -15.008 -82.981  1.00 0.00 ? 145 LYS A HA   4  
ATOM 8860  H HB2  . LYS A 1 145 ? 110.162 -14.406 -80.096  1.00 0.00 ? 145 LYS A HB2  4  
ATOM 8861  H HB3  . LYS A 1 145 ? 109.510 -15.774 -80.999  1.00 0.00 ? 145 LYS A HB3  4  
ATOM 8862  H HG2  . LYS A 1 145 ? 111.389 -16.657 -79.846  1.00 0.00 ? 145 LYS A HG2  4  
ATOM 8863  H HG3  . LYS A 1 145 ? 111.956 -16.396 -81.495  1.00 0.00 ? 145 LYS A HG3  4  
ATOM 8864  H HD2  . LYS A 1 145 ? 113.283 -14.598 -80.905  1.00 0.00 ? 145 LYS A HD2  4  
ATOM 8865  H HD3  . LYS A 1 145 ? 112.254 -14.150 -79.543  1.00 0.00 ? 145 LYS A HD3  4  
ATOM 8866  H HE2  . LYS A 1 145 ? 114.014 -16.618 -79.624  1.00 0.00 ? 145 LYS A HE2  4  
ATOM 8867  H HE3  . LYS A 1 145 ? 114.443 -15.110 -78.819  1.00 0.00 ? 145 LYS A HE3  4  
ATOM 8868  H HZ1  . LYS A 1 145 ? 112.447 -15.331 -77.455  1.00 0.00 ? 145 LYS A HZ1  4  
ATOM 8869  H HZ2  . LYS A 1 145 ? 113.485 -16.661 -77.257  1.00 0.00 ? 145 LYS A HZ2  4  
ATOM 8870  H HZ3  . LYS A 1 145 ? 112.085 -16.808 -78.207  1.00 0.00 ? 145 LYS A HZ3  4  
ATOM 8871  N N    . ASP A 1 146 ? 108.140 -14.439 -82.549  1.00 0.00 ? 146 ASP A N    4  
ATOM 8872  C CA   . ASP A 1 146 ? 106.816 -13.879 -82.939  1.00 0.00 ? 146 ASP A CA   4  
ATOM 8873  C C    . ASP A 1 146 ? 105.820 -14.077 -81.794  1.00 0.00 ? 146 ASP A C    4  
ATOM 8874  O O    . ASP A 1 146 ? 105.617 -13.201 -80.977  1.00 0.00 ? 146 ASP A O    4  
ATOM 8875  C CB   . ASP A 1 146 ? 106.306 -14.599 -84.190  1.00 0.00 ? 146 ASP A CB   4  
ATOM 8876  C CG   . ASP A 1 146 ? 106.928 -13.963 -85.434  1.00 0.00 ? 146 ASP A CG   4  
ATOM 8877  O OD1  . ASP A 1 146 ? 107.696 -13.028 -85.277  1.00 0.00 ? 146 ASP A OD1  4  
ATOM 8878  O OD2  . ASP A 1 146 ? 106.624 -14.421 -86.523  1.00 0.00 ? 146 ASP A OD2  4  
ATOM 8879  H H    . ASP A 1 146 ? 108.207 -15.366 -82.236  1.00 0.00 ? 146 ASP A H    4  
ATOM 8880  H HA   . ASP A 1 146 ? 106.919 -12.825 -83.148  1.00 0.00 ? 146 ASP A HA   4  
ATOM 8881  H HB2  . ASP A 1 146 ? 106.581 -15.643 -84.141  1.00 0.00 ? 146 ASP A HB2  4  
ATOM 8882  H HB3  . ASP A 1 146 ? 105.231 -14.512 -84.242  1.00 0.00 ? 146 ASP A HB3  4  
ATOM 8883  N N    . ALA A 1 147 ? 105.197 -15.222 -81.730  1.00 0.00 ? 147 ALA A N    4  
ATOM 8884  C CA   . ALA A 1 147 ? 104.214 -15.474 -80.638  1.00 0.00 ? 147 ALA A CA   4  
ATOM 8885  C C    . ALA A 1 147 ? 103.046 -14.493 -80.765  1.00 0.00 ? 147 ALA A C    4  
ATOM 8886  O O    . ALA A 1 147 ? 102.987 -13.801 -81.768  1.00 0.00 ? 147 ALA A O    4  
ATOM 8887  C CB   . ALA A 1 147 ? 104.897 -15.281 -79.282  1.00 0.00 ? 147 ALA A CB   4  
ATOM 8888  H H    . ALA A 1 147 ? 105.374 -15.915 -82.399  1.00 0.00 ? 147 ALA A H    4  
ATOM 8889  H HA   . ALA A 1 147 ? 103.845 -16.487 -80.713  1.00 0.00 ? 147 ALA A HA   4  
ATOM 8890  H HB1  . ALA A 1 147 ? 105.032 -14.226 -79.094  1.00 0.00 ? 147 ALA A HB1  4  
ATOM 8891  H HB2  . ALA A 1 147 ? 105.860 -15.771 -79.292  1.00 0.00 ? 147 ALA A HB2  4  
ATOM 8892  H HB3  . ALA A 1 147 ? 104.282 -15.710 -78.505  1.00 0.00 ? 147 ALA A HB3  4  
ATOM 8893  N N    . MET A 1 1   ? 131.579 21.472  -117.148 1.00 0.00 ? 1   MET A N    5  
ATOM 8894  C CA   . MET A 1 1   ? 131.266 20.279  -117.986 1.00 0.00 ? 1   MET A CA   5  
ATOM 8895  C C    . MET A 1 1   ? 132.080 19.082  -117.490 1.00 0.00 ? 1   MET A C    5  
ATOM 8896  O O    . MET A 1 1   ? 132.288 18.122  -118.205 1.00 0.00 ? 1   MET A O    5  
ATOM 8897  C CB   . MET A 1 1   ? 131.627 20.573  -119.444 1.00 0.00 ? 1   MET A CB   5  
ATOM 8898  C CG   . MET A 1 1   ? 131.496 22.074  -119.710 1.00 0.00 ? 1   MET A CG   5  
ATOM 8899  S SD   . MET A 1 1   ? 129.940 22.678  -119.010 1.00 0.00 ? 1   MET A SD   5  
ATOM 8900  C CE   . MET A 1 1   ? 129.491 23.780  -120.374 1.00 0.00 ? 1   MET A CE   5  
ATOM 8901  H H1   . MET A 1 1   ? 130.716 22.035  -117.009 1.00 0.00 ? 1   MET A H1   5  
ATOM 8902  H HA   . MET A 1 1   ? 130.213 20.054  -117.914 1.00 0.00 ? 1   MET A HA   5  
ATOM 8903  H HB2  . MET A 1 1   ? 132.644 20.260  -119.634 1.00 0.00 ? 1   MET A HB2  5  
ATOM 8904  H HB3  . MET A 1 1   ? 130.956 20.034  -120.096 1.00 0.00 ? 1   MET A HB3  5  
ATOM 8905  H HG2  . MET A 1 1   ? 132.324 22.595  -119.250 1.00 0.00 ? 1   MET A HG2  5  
ATOM 8906  H HG3  . MET A 1 1   ? 131.505 22.253  -120.775 1.00 0.00 ? 1   MET A HG3  5  
ATOM 8907  H HE1  . MET A 1 1   ? 130.188 24.605  -120.412 1.00 0.00 ? 1   MET A HE1  5  
ATOM 8908  H HE2  . MET A 1 1   ? 128.494 24.160  -120.217 1.00 0.00 ? 1   MET A HE2  5  
ATOM 8909  H HE3  . MET A 1 1   ? 129.522 23.231  -121.304 1.00 0.00 ? 1   MET A HE3  5  
ATOM 8910  N N    . LYS A 1 2   ? 132.541 19.131  -116.270 1.00 0.00 ? 2   LYS A N    5  
ATOM 8911  C CA   . LYS A 1 2   ? 133.340 17.996  -115.728 1.00 0.00 ? 2   LYS A CA   5  
ATOM 8912  C C    . LYS A 1 2   ? 132.649 16.674  -116.071 1.00 0.00 ? 2   LYS A C    5  
ATOM 8913  O O    . LYS A 1 2   ? 131.442 16.554  -115.993 1.00 0.00 ? 2   LYS A O    5  
ATOM 8914  C CB   . LYS A 1 2   ? 133.452 18.133  -114.208 1.00 0.00 ? 2   LYS A CB   5  
ATOM 8915  C CG   . LYS A 1 2   ? 132.085 17.876  -113.569 1.00 0.00 ? 2   LYS A CG   5  
ATOM 8916  C CD   . LYS A 1 2   ? 131.066 18.873  -114.124 1.00 0.00 ? 2   LYS A CD   5  
ATOM 8917  C CE   . LYS A 1 2   ? 129.883 18.983  -113.160 1.00 0.00 ? 2   LYS A CE   5  
ATOM 8918  N NZ   . LYS A 1 2   ? 129.005 17.788  -113.312 1.00 0.00 ? 2   LYS A NZ   5  
ATOM 8919  H H    . LYS A 1 2   ? 132.361 19.915  -115.710 1.00 0.00 ? 2   LYS A H    5  
ATOM 8920  H HA   . LYS A 1 2   ? 134.327 18.010  -116.164 1.00 0.00 ? 2   LYS A HA   5  
ATOM 8921  H HB2  . LYS A 1 2   ? 134.166 17.413  -113.833 1.00 0.00 ? 2   LYS A HB2  5  
ATOM 8922  H HB3  . LYS A 1 2   ? 133.781 19.130  -113.960 1.00 0.00 ? 2   LYS A HB3  5  
ATOM 8923  H HG2  . LYS A 1 2   ? 131.766 16.869  -113.795 1.00 0.00 ? 2   LYS A HG2  5  
ATOM 8924  H HG3  . LYS A 1 2   ? 132.159 17.998  -112.499 1.00 0.00 ? 2   LYS A HG3  5  
ATOM 8925  H HD2  . LYS A 1 2   ? 131.533 19.841  -114.235 1.00 0.00 ? 2   LYS A HD2  5  
ATOM 8926  H HD3  . LYS A 1 2   ? 130.713 18.530  -115.085 1.00 0.00 ? 2   LYS A HD3  5  
ATOM 8927  H HE2  . LYS A 1 2   ? 130.249 19.035  -112.145 1.00 0.00 ? 2   LYS A HE2  5  
ATOM 8928  H HE3  . LYS A 1 2   ? 129.317 19.876  -113.385 1.00 0.00 ? 2   LYS A HE3  5  
ATOM 8929  H HZ1  . LYS A 1 2   ? 129.228 17.097  -112.568 1.00 0.00 ? 2   LYS A HZ1  5  
ATOM 8930  H HZ2  . LYS A 1 2   ? 129.166 17.358  -114.246 1.00 0.00 ? 2   LYS A HZ2  5  
ATOM 8931  H HZ3  . LYS A 1 2   ? 128.010 18.075  -113.228 1.00 0.00 ? 2   LYS A HZ3  5  
ATOM 8932  N N    . LYS A 1 3   ? 133.405 15.679  -116.449 1.00 0.00 ? 3   LYS A N    5  
ATOM 8933  C CA   . LYS A 1 3   ? 132.792 14.366  -116.795 1.00 0.00 ? 3   LYS A CA   5  
ATOM 8934  C C    . LYS A 1 3   ? 133.890 13.315  -116.975 1.00 0.00 ? 3   LYS A C    5  
ATOM 8935  O O    . LYS A 1 3   ? 134.701 13.399  -117.875 1.00 0.00 ? 3   LYS A O    5  
ATOM 8936  C CB   . LYS A 1 3   ? 132.004 14.504  -118.101 1.00 0.00 ? 3   LYS A CB   5  
ATOM 8937  C CG   . LYS A 1 3   ? 130.513 14.304  -117.824 1.00 0.00 ? 3   LYS A CG   5  
ATOM 8938  C CD   . LYS A 1 3   ? 129.696 14.909  -118.969 1.00 0.00 ? 3   LYS A CD   5  
ATOM 8939  C CE   . LYS A 1 3   ? 128.250 15.110  -118.515 1.00 0.00 ? 3   LYS A CE   5  
ATOM 8940  N NZ   . LYS A 1 3   ? 127.594 16.131  -119.381 1.00 0.00 ? 3   LYS A NZ   5  
ATOM 8941  H H    . LYS A 1 3   ? 134.377 15.796  -116.505 1.00 0.00 ? 3   LYS A H    5  
ATOM 8942  H HA   . LYS A 1 3   ? 132.124 14.060  -116.004 1.00 0.00 ? 3   LYS A HA   5  
ATOM 8943  H HB2  . LYS A 1 3   ? 132.166 15.489  -118.515 1.00 0.00 ? 3   LYS A HB2  5  
ATOM 8944  H HB3  . LYS A 1 3   ? 132.341 13.758  -118.805 1.00 0.00 ? 3   LYS A HB3  5  
ATOM 8945  H HG2  . LYS A 1 3   ? 130.300 13.248  -117.747 1.00 0.00 ? 3   LYS A HG2  5  
ATOM 8946  H HG3  . LYS A 1 3   ? 130.249 14.794  -116.899 1.00 0.00 ? 3   LYS A HG3  5  
ATOM 8947  H HD2  . LYS A 1 3   ? 130.122 15.862  -119.250 1.00 0.00 ? 3   LYS A HD2  5  
ATOM 8948  H HD3  . LYS A 1 3   ? 129.716 14.242  -119.817 1.00 0.00 ? 3   LYS A HD3  5  
ATOM 8949  H HE2  . LYS A 1 3   ? 127.714 14.175  -118.592 1.00 0.00 ? 3   LYS A HE2  5  
ATOM 8950  H HE3  . LYS A 1 3   ? 128.238 15.447  -117.488 1.00 0.00 ? 3   LYS A HE3  5  
ATOM 8951  H HZ1  . LYS A 1 3   ? 126.904 16.670  -118.821 1.00 0.00 ? 3   LYS A HZ1  5  
ATOM 8952  H HZ2  . LYS A 1 3   ? 127.107 15.655  -120.169 1.00 0.00 ? 3   LYS A HZ2  5  
ATOM 8953  H HZ3  . LYS A 1 3   ? 128.313 16.779  -119.758 1.00 0.00 ? 3   LYS A HZ3  5  
ATOM 8954  N N    . VAL A 1 4   ? 133.921 12.321  -116.128 1.00 0.00 ? 4   VAL A N    5  
ATOM 8955  C CA   . VAL A 1 4   ? 134.964 11.264  -116.259 1.00 0.00 ? 4   VAL A CA   5  
ATOM 8956  C C    . VAL A 1 4   ? 135.087 10.847  -117.721 1.00 0.00 ? 4   VAL A C    5  
ATOM 8957  O O    . VAL A 1 4   ? 134.103 10.657  -118.408 1.00 0.00 ? 4   VAL A O    5  
ATOM 8958  C CB   . VAL A 1 4   ? 134.573 10.046  -115.418 1.00 0.00 ? 4   VAL A CB   5  
ATOM 8959  C CG1  . VAL A 1 4   ? 133.095 9.738   -115.625 1.00 0.00 ? 4   VAL A CG1  5  
ATOM 8960  C CG2  . VAL A 1 4   ? 135.405 8.836   -115.852 1.00 0.00 ? 4   VAL A CG2  5  
ATOM 8961  H H    . VAL A 1 4   ? 133.256 12.267  -115.410 1.00 0.00 ? 4   VAL A H    5  
ATOM 8962  H HA   . VAL A 1 4   ? 135.912 11.649  -115.917 1.00 0.00 ? 4   VAL A HA   5  
ATOM 8963  H HB   . VAL A 1 4   ? 134.752 10.251  -114.378 1.00 0.00 ? 4   VAL A HB   5  
ATOM 8964  H HG11 . VAL A 1 4   ? 132.911 9.547   -116.671 1.00 0.00 ? 4   VAL A HG11 5  
ATOM 8965  H HG12 . VAL A 1 4   ? 132.504 10.585  -115.303 1.00 0.00 ? 4   VAL A HG12 5  
ATOM 8966  H HG13 . VAL A 1 4   ? 132.825 8.870   -115.044 1.00 0.00 ? 4   VAL A HG13 5  
ATOM 8967  H HG21 . VAL A 1 4   ? 136.455 9.074   -115.773 1.00 0.00 ? 4   VAL A HG21 5  
ATOM 8968  H HG22 . VAL A 1 4   ? 135.169 8.586   -116.876 1.00 0.00 ? 4   VAL A HG22 5  
ATOM 8969  H HG23 . VAL A 1 4   ? 135.177 7.996   -115.215 1.00 0.00 ? 4   VAL A HG23 5  
ATOM 8970  N N    . VAL A 1 5   ? 136.288 10.688  -118.203 1.00 0.00 ? 5   VAL A N    5  
ATOM 8971  C CA   . VAL A 1 5   ? 136.461 10.266  -119.618 1.00 0.00 ? 5   VAL A CA   5  
ATOM 8972  C C    . VAL A 1 5   ? 137.112 8.883   -119.635 1.00 0.00 ? 5   VAL A C    5  
ATOM 8973  O O    . VAL A 1 5   ? 136.960 8.134   -120.578 1.00 0.00 ? 5   VAL A O    5  
ATOM 8974  C CB   . VAL A 1 5   ? 137.340 11.267  -120.372 1.00 0.00 ? 5   VAL A CB   5  
ATOM 8975  C CG1  . VAL A 1 5   ? 136.639 12.625  -120.445 1.00 0.00 ? 5   VAL A CG1  5  
ATOM 8976  C CG2  . VAL A 1 5   ? 138.674 11.425  -119.637 1.00 0.00 ? 5   VAL A CG2  5  
ATOM 8977  H H    . VAL A 1 5   ? 137.071 10.832  -117.633 1.00 0.00 ? 5   VAL A H    5  
ATOM 8978  H HA   . VAL A 1 5   ? 135.489 10.183  -120.078 1.00 0.00 ? 5   VAL A HA   5  
ATOM 8979  H HB   . VAL A 1 5   ? 137.521 10.903  -121.372 1.00 0.00 ? 5   VAL A HB   5  
ATOM 8980  H HG11 . VAL A 1 5   ? 137.121 13.238  -121.193 1.00 0.00 ? 5   VAL A HG11 5  
ATOM 8981  H HG12 . VAL A 1 5   ? 136.702 13.114  -119.485 1.00 0.00 ? 5   VAL A HG12 5  
ATOM 8982  H HG13 . VAL A 1 5   ? 135.603 12.481  -120.710 1.00 0.00 ? 5   VAL A HG13 5  
ATOM 8983  H HG21 . VAL A 1 5   ? 139.306 12.110  -120.183 1.00 0.00 ? 5   VAL A HG21 5  
ATOM 8984  H HG22 . VAL A 1 5   ? 139.161 10.464  -119.566 1.00 0.00 ? 5   VAL A HG22 5  
ATOM 8985  H HG23 . VAL A 1 5   ? 138.494 11.813  -118.645 1.00 0.00 ? 5   VAL A HG23 5  
ATOM 8986  N N    . ALA A 1 6   ? 137.828 8.527   -118.602 1.00 0.00 ? 6   ALA A N    5  
ATOM 8987  C CA   . ALA A 1 6   ? 138.460 7.178   -118.595 1.00 0.00 ? 6   ALA A CA   5  
ATOM 8988  C C    . ALA A 1 6   ? 138.379 6.562   -117.196 1.00 0.00 ? 6   ALA A C    5  
ATOM 8989  O O    . ALA A 1 6   ? 139.080 6.959   -116.286 1.00 0.00 ? 6   ALA A O    5  
ATOM 8990  C CB   . ALA A 1 6   ? 139.921 7.285   -119.027 1.00 0.00 ? 6   ALA A CB   5  
ATOM 8991  H H    . ALA A 1 6   ? 137.940 9.134   -117.839 1.00 0.00 ? 6   ALA A H    5  
ATOM 8992  H HA   . ALA A 1 6   ? 137.924 6.542   -119.285 1.00 0.00 ? 6   ALA A HA   5  
ATOM 8993  H HB1  . ALA A 1 6   ? 139.985 7.193   -120.102 1.00 0.00 ? 6   ALA A HB1  5  
ATOM 8994  H HB2  . ALA A 1 6   ? 140.492 6.495   -118.563 1.00 0.00 ? 6   ALA A HB2  5  
ATOM 8995  H HB3  . ALA A 1 6   ? 140.317 8.243   -118.724 1.00 0.00 ? 6   ALA A HB3  5  
ATOM 8996  N N    . VAL A 1 7   ? 137.538 5.580   -117.034 1.00 0.00 ? 7   VAL A N    5  
ATOM 8997  C CA   . VAL A 1 7   ? 137.406 4.903   -115.712 1.00 0.00 ? 7   VAL A CA   5  
ATOM 8998  C C    . VAL A 1 7   ? 138.285 3.658   -115.707 1.00 0.00 ? 7   VAL A C    5  
ATOM 8999  O O    . VAL A 1 7   ? 137.802 2.553   -115.851 1.00 0.00 ? 7   VAL A O    5  
ATOM 9000  C CB   . VAL A 1 7   ? 135.962 4.458   -115.518 1.00 0.00 ? 7   VAL A CB   5  
ATOM 9001  C CG1  . VAL A 1 7   ? 135.448 3.801   -116.800 1.00 0.00 ? 7   VAL A CG1  5  
ATOM 9002  C CG2  . VAL A 1 7   ? 135.921 3.450   -114.373 1.00 0.00 ? 7   VAL A CG2  5  
ATOM 9003  H H    . VAL A 1 7   ? 136.998 5.274   -117.793 1.00 0.00 ? 7   VAL A H    5  
ATOM 9004  H HA   . VAL A 1 7   ? 137.670 5.575   -114.912 1.00 0.00 ? 7   VAL A HA   5  
ATOM 9005  H HB   . VAL A 1 7   ? 135.346 5.313   -115.274 1.00 0.00 ? 7   VAL A HB   5  
ATOM 9006  H HG11 . VAL A 1 7   ? 134.876 4.520   -117.369 1.00 0.00 ? 7   VAL A HG11 5  
ATOM 9007  H HG12 . VAL A 1 7   ? 134.820 2.960   -116.547 1.00 0.00 ? 7   VAL A HG12 5  
ATOM 9008  H HG13 . VAL A 1 7   ? 136.286 3.460   -117.391 1.00 0.00 ? 7   VAL A HG13 5  
ATOM 9009  H HG21 . VAL A 1 7   ? 135.047 3.627   -113.768 1.00 0.00 ? 7   VAL A HG21 5  
ATOM 9010  H HG22 . VAL A 1 7   ? 136.809 3.562   -113.767 1.00 0.00 ? 7   VAL A HG22 5  
ATOM 9011  H HG23 . VAL A 1 7   ? 135.886 2.449   -114.776 1.00 0.00 ? 7   VAL A HG23 5  
ATOM 9012  N N    . VAL A 1 8   ? 139.566 3.818   -115.612 1.00 0.00 ? 8   VAL A N    5  
ATOM 9013  C CA   . VAL A 1 8   ? 140.449 2.615   -115.684 1.00 0.00 ? 8   VAL A CA   5  
ATOM 9014  C C    . VAL A 1 8   ? 139.916 1.499   -114.782 1.00 0.00 ? 8   VAL A C    5  
ATOM 9015  O O    . VAL A 1 8   ? 140.291 1.395   -113.631 1.00 0.00 ? 8   VAL A O    5  
ATOM 9016  C CB   . VAL A 1 8   ? 141.874 2.973   -115.274 1.00 0.00 ? 8   VAL A CB   5  
ATOM 9017  C CG1  . VAL A 1 8   ? 142.789 1.789   -115.582 1.00 0.00 ? 8   VAL A CG1  5  
ATOM 9018  C CG2  . VAL A 1 8   ? 142.339 4.200   -116.062 1.00 0.00 ? 8   VAL A CG2  5  
ATOM 9019  H H    . VAL A 1 8   ? 139.945 4.722   -115.572 1.00 0.00 ? 8   VAL A H    5  
ATOM 9020  H HA   . VAL A 1 8   ? 140.449 2.276   -116.709 1.00 0.00 ? 8   VAL A HA   5  
ATOM 9021  H HB   . VAL A 1 8   ? 141.901 3.183   -114.216 1.00 0.00 ? 8   VAL A HB   5  
ATOM 9022  H HG11 . VAL A 1 8   ? 143.368 1.543   -114.705 1.00 0.00 ? 8   VAL A HG11 5  
ATOM 9023  H HG12 . VAL A 1 8   ? 143.453 2.048   -116.392 1.00 0.00 ? 8   VAL A HG12 5  
ATOM 9024  H HG13 . VAL A 1 8   ? 142.188 0.938   -115.866 1.00 0.00 ? 8   VAL A HG13 5  
ATOM 9025  H HG21 . VAL A 1 8   ? 143.075 3.899   -116.794 1.00 0.00 ? 8   VAL A HG21 5  
ATOM 9026  H HG22 . VAL A 1 8   ? 142.776 4.919   -115.386 1.00 0.00 ? 8   VAL A HG22 5  
ATOM 9027  H HG23 . VAL A 1 8   ? 141.495 4.646   -116.565 1.00 0.00 ? 8   VAL A HG23 5  
ATOM 9028  N N    . LYS A 1 9   ? 139.063 0.652   -115.307 1.00 0.00 ? 9   LYS A N    5  
ATOM 9029  C CA   . LYS A 1 9   ? 138.514 -0.479  -114.496 1.00 0.00 ? 9   LYS A CA   5  
ATOM 9030  C C    . LYS A 1 9   ? 139.522 -1.632  -114.506 1.00 0.00 ? 9   LYS A C    5  
ATOM 9031  O O    . LYS A 1 9   ? 139.166 -2.793  -114.531 1.00 0.00 ? 9   LYS A O    5  
ATOM 9032  C CB   . LYS A 1 9   ? 137.195 -0.950  -115.113 1.00 0.00 ? 9   LYS A CB   5  
ATOM 9033  C CG   . LYS A 1 9   ? 136.640 -2.128  -114.305 1.00 0.00 ? 9   LYS A CG   5  
ATOM 9034  C CD   . LYS A 1 9   ? 136.517 -3.361  -115.205 1.00 0.00 ? 9   LYS A CD   5  
ATOM 9035  C CE   . LYS A 1 9   ? 135.444 -4.296  -114.646 1.00 0.00 ? 9   LYS A CE   5  
ATOM 9036  N NZ   . LYS A 1 9   ? 135.100 -5.324  -115.669 1.00 0.00 ? 9   LYS A NZ   5  
ATOM 9037  H H    . LYS A 1 9   ? 138.792 0.756   -116.244 1.00 0.00 ? 9   LYS A H    5  
ATOM 9038  H HA   . LYS A 1 9   ? 138.346 -0.154  -113.485 1.00 0.00 ? 9   LYS A HA   5  
ATOM 9039  H HB2  . LYS A 1 9   ? 136.482 -0.138  -115.100 1.00 0.00 ? 9   LYS A HB2  5  
ATOM 9040  H HB3  . LYS A 1 9   ? 137.366 -1.263  -116.131 1.00 0.00 ? 9   LYS A HB3  5  
ATOM 9041  H HG2  . LYS A 1 9   ? 137.306 -2.346  -113.483 1.00 0.00 ? 9   LYS A HG2  5  
ATOM 9042  H HG3  . LYS A 1 9   ? 135.665 -1.870  -113.919 1.00 0.00 ? 9   LYS A HG3  5  
ATOM 9043  H HD2  . LYS A 1 9   ? 136.243 -3.054  -116.204 1.00 0.00 ? 9   LYS A HD2  5  
ATOM 9044  H HD3  . LYS A 1 9   ? 137.463 -3.881  -115.236 1.00 0.00 ? 9   LYS A HD3  5  
ATOM 9045  H HE2  . LYS A 1 9   ? 135.817 -4.784  -113.758 1.00 0.00 ? 9   LYS A HE2  5  
ATOM 9046  H HE3  . LYS A 1 9   ? 134.561 -3.725  -114.399 1.00 0.00 ? 9   LYS A HE3  5  
ATOM 9047  H HZ1  . LYS A 1 9   ? 134.167 -5.729  -115.454 1.00 0.00 ? 9   LYS A HZ1  5  
ATOM 9048  H HZ2  . LYS A 1 9   ? 135.817 -6.078  -115.657 1.00 0.00 ? 9   LYS A HZ2  5  
ATOM 9049  H HZ3  . LYS A 1 9   ? 135.075 -4.883  -116.609 1.00 0.00 ? 9   LYS A HZ3  5  
ATOM 9050  N N    . LEU A 1 10  ? 140.779 -1.305  -114.516 1.00 0.00 ? 10  LEU A N    5  
ATOM 9051  C CA   . LEU A 1 10  ? 141.849 -2.345  -114.560 1.00 0.00 ? 10  LEU A CA   5  
ATOM 9052  C C    . LEU A 1 10  ? 142.065 -2.973  -113.184 1.00 0.00 ? 10  LEU A C    5  
ATOM 9053  O O    . LEU A 1 10  ? 141.364 -2.687  -112.236 1.00 0.00 ? 10  LEU A O    5  
ATOM 9054  C CB   . LEU A 1 10  ? 143.151 -1.677  -115.004 1.00 0.00 ? 10  LEU A CB   5  
ATOM 9055  C CG   . LEU A 1 10  ? 143.330 -1.887  -116.514 1.00 0.00 ? 10  LEU A CG   5  
ATOM 9056  C CD1  . LEU A 1 10  ? 143.909 -0.625  -117.153 1.00 0.00 ? 10  LEU A CD1  5  
ATOM 9057  C CD2  . LEU A 1 10  ? 144.276 -3.067  -116.763 1.00 0.00 ? 10  LEU A CD2  5  
ATOM 9058  H H    . LEU A 1 10  ? 141.026 -0.358  -114.525 1.00 0.00 ? 10  LEU A H    5  
ATOM 9059  H HA   . LEU A 1 10  ? 141.609 -3.107  -115.288 1.00 0.00 ? 10  LEU A HA   5  
ATOM 9060  H HB2  . LEU A 1 10  ? 143.106 -0.620  -114.786 1.00 0.00 ? 10  LEU A HB2  5  
ATOM 9061  H HB3  . LEU A 1 10  ? 143.982 -2.118  -114.476 1.00 0.00 ? 10  LEU A HB3  5  
ATOM 9062  H HG   . LEU A 1 10  ? 142.369 -2.099  -116.961 1.00 0.00 ? 10  LEU A HG   5  
ATOM 9063  H HD11 . LEU A 1 10  ? 144.462 -0.065  -116.414 1.00 0.00 ? 10  LEU A HD11 5  
ATOM 9064  H HD12 . LEU A 1 10  ? 143.105 -0.015  -117.538 1.00 0.00 ? 10  LEU A HD12 5  
ATOM 9065  H HD13 . LEU A 1 10  ? 144.567 -0.902  -117.962 1.00 0.00 ? 10  LEU A HD13 5  
ATOM 9066  H HD21 . LEU A 1 10  ? 144.816 -2.906  -117.684 1.00 0.00 ? 10  LEU A HD21 5  
ATOM 9067  H HD22 . LEU A 1 10  ? 143.701 -3.979  -116.839 1.00 0.00 ? 10  LEU A HD22 5  
ATOM 9068  H HD23 . LEU A 1 10  ? 144.976 -3.152  -115.947 1.00 0.00 ? 10  LEU A HD23 5  
ATOM 9069  N N    . GLN A 1 11  ? 143.055 -3.820  -113.080 1.00 0.00 ? 11  GLN A N    5  
ATOM 9070  C CA   . GLN A 1 11  ? 143.371 -4.475  -111.780 1.00 0.00 ? 11  GLN A CA   5  
ATOM 9071  C C    . GLN A 1 11  ? 144.816 -4.143  -111.416 1.00 0.00 ? 11  GLN A C    5  
ATOM 9072  O O    . GLN A 1 11  ? 145.542 -3.576  -112.207 1.00 0.00 ? 11  GLN A O    5  
ATOM 9073  C CB   . GLN A 1 11  ? 143.210 -5.991  -111.914 1.00 0.00 ? 11  GLN A CB   5  
ATOM 9074  C CG   . GLN A 1 11  ? 143.794 -6.450  -113.253 1.00 0.00 ? 11  GLN A CG   5  
ATOM 9075  C CD   . GLN A 1 11  ? 142.778 -6.194  -114.368 1.00 0.00 ? 11  GLN A CD   5  
ATOM 9076  O OE1  . GLN A 1 11  ? 143.020 -6.519  -115.513 1.00 0.00 ? 11  GLN A OE1  5  
ATOM 9077  N NE2  . GLN A 1 11  ? 141.642 -5.620  -114.079 1.00 0.00 ? 11  GLN A NE2  5  
ATOM 9078  H H    . GLN A 1 11  ? 143.607 -4.016  -113.866 1.00 0.00 ? 11  GLN A H    5  
ATOM 9079  H HA   . GLN A 1 11  ? 142.715 -4.105  -111.010 1.00 0.00 ? 11  GLN A HA   5  
ATOM 9080  H HB2  . GLN A 1 11  ? 143.733 -6.482  -111.105 1.00 0.00 ? 11  GLN A HB2  5  
ATOM 9081  H HB3  . GLN A 1 11  ? 142.163 -6.247  -111.874 1.00 0.00 ? 11  GLN A HB3  5  
ATOM 9082  H HG2  . GLN A 1 11  ? 144.701 -5.899  -113.457 1.00 0.00 ? 11  GLN A HG2  5  
ATOM 9083  H HG3  . GLN A 1 11  ? 144.016 -7.506  -113.206 1.00 0.00 ? 11  GLN A HG3  5  
ATOM 9084  H HE21 . GLN A 1 11  ? 141.447 -5.357  -113.155 1.00 0.00 ? 11  GLN A HE21 5  
ATOM 9085  H HE22 . GLN A 1 11  ? 140.984 -5.452  -114.786 1.00 0.00 ? 11  GLN A HE22 5  
ATOM 9086  N N    . LEU A 1 12  ? 145.256 -4.500  -110.243 1.00 0.00 ? 12  LEU A N    5  
ATOM 9087  C CA   . LEU A 1 12  ? 146.672 -4.198  -109.877 1.00 0.00 ? 12  LEU A CA   5  
ATOM 9088  C C    . LEU A 1 12  ? 147.069 -4.982  -108.623 1.00 0.00 ? 12  LEU A C    5  
ATOM 9089  O O    . LEU A 1 12  ? 146.230 -5.377  -107.834 1.00 0.00 ? 12  LEU A O    5  
ATOM 9090  C CB   . LEU A 1 12  ? 146.824 -2.696  -109.606 1.00 0.00 ? 12  LEU A CB   5  
ATOM 9091  C CG   . LEU A 1 12  ? 147.374 -1.988  -110.853 1.00 0.00 ? 12  LEU A CG   5  
ATOM 9092  C CD1  . LEU A 1 12  ? 146.330 -1.006  -111.386 1.00 0.00 ? 12  LEU A CD1  5  
ATOM 9093  C CD2  . LEU A 1 12  ? 148.649 -1.216  -110.495 1.00 0.00 ? 12  LEU A CD2  5  
ATOM 9094  H H    . LEU A 1 12  ? 144.672 -4.983  -109.616 1.00 0.00 ? 12  LEU A H    5  
ATOM 9095  H HA   . LEU A 1 12  ? 147.316 -4.482  -110.693 1.00 0.00 ? 12  LEU A HA   5  
ATOM 9096  H HB2  . LEU A 1 12  ? 145.861 -2.279  -109.351 1.00 0.00 ? 12  LEU A HB2  5  
ATOM 9097  H HB3  . LEU A 1 12  ? 147.506 -2.551  -108.781 1.00 0.00 ? 12  LEU A HB3  5  
ATOM 9098  H HG   . LEU A 1 12  ? 147.597 -2.719  -111.617 1.00 0.00 ? 12  LEU A HG   5  
ATOM 9099  H HD11 . LEU A 1 12  ? 146.802 -0.317  -112.070 1.00 0.00 ? 12  LEU A HD11 5  
ATOM 9100  H HD12 . LEU A 1 12  ? 145.898 -0.458  -110.562 1.00 0.00 ? 12  LEU A HD12 5  
ATOM 9101  H HD13 . LEU A 1 12  ? 145.555 -1.548  -111.901 1.00 0.00 ? 12  LEU A HD13 5  
ATOM 9102  H HD21 . LEU A 1 12  ? 148.616 -0.924  -109.456 1.00 0.00 ? 12  LEU A HD21 5  
ATOM 9103  H HD22 . LEU A 1 12  ? 148.719 -0.334  -111.114 1.00 0.00 ? 12  LEU A HD22 5  
ATOM 9104  H HD23 . LEU A 1 12  ? 149.510 -1.844  -110.667 1.00 0.00 ? 12  LEU A HD23 5  
ATOM 9105  N N    . PRO A 1 13  ? 148.349 -5.196  -108.446 1.00 0.00 ? 13  PRO A N    5  
ATOM 9106  C CA   . PRO A 1 13  ? 148.869 -5.939  -107.263 1.00 0.00 ? 13  PRO A CA   5  
ATOM 9107  C C    . PRO A 1 13  ? 148.678 -5.147  -105.971 1.00 0.00 ? 13  PRO A C    5  
ATOM 9108  O O    . PRO A 1 13  ? 149.301 -4.123  -105.768 1.00 0.00 ? 13  PRO A O    5  
ATOM 9109  C CB   . PRO A 1 13  ? 150.357 -6.069  -107.590 1.00 0.00 ? 13  PRO A CB   5  
ATOM 9110  C CG   . PRO A 1 13  ? 150.682 -5.103  -108.732 1.00 0.00 ? 13  PRO A CG   5  
ATOM 9111  C CD   . PRO A 1 13  ? 149.369 -4.708  -109.413 1.00 0.00 ? 13  PRO A CD   5  
ATOM 9112  H HA   . PRO A 1 13  ? 148.420 -6.914  -107.189 1.00 0.00 ? 13  PRO A HA   5  
ATOM 9113  H HB2  . PRO A 1 13  ? 150.944 -5.818  -106.718 1.00 0.00 ? 13  PRO A HB2  5  
ATOM 9114  H HB3  . PRO A 1 13  ? 150.575 -7.080  -107.899 1.00 0.00 ? 13  PRO A HB3  5  
ATOM 9115  H HG2  . PRO A 1 13  ? 151.166 -4.221  -108.335 1.00 0.00 ? 13  PRO A HG2  5  
ATOM 9116  H HG3  . PRO A 1 13  ? 151.331 -5.582  -109.447 1.00 0.00 ? 13  PRO A HG3  5  
ATOM 9117  H HD2  . PRO A 1 13  ? 149.308 -3.636  -109.534 1.00 0.00 ? 13  PRO A HD2  5  
ATOM 9118  H HD3  . PRO A 1 13  ? 149.261 -5.214  -110.358 1.00 0.00 ? 13  PRO A HD3  5  
ATOM 9119  N N    . ALA A 1 14  ? 147.819 -5.592  -105.101 1.00 0.00 ? 14  ALA A N    5  
ATOM 9120  C CA   . ALA A 1 14  ? 147.605 -4.832  -103.844 1.00 0.00 ? 14  ALA A CA   5  
ATOM 9121  C C    . ALA A 1 14  ? 148.833 -4.936  -102.940 1.00 0.00 ? 14  ALA A C    5  
ATOM 9122  O O    . ALA A 1 14  ? 148.697 -5.093  -101.744 1.00 0.00 ? 14  ALA A O    5  
ATOM 9123  C CB   . ALA A 1 14  ? 146.384 -5.357  -103.103 1.00 0.00 ? 14  ALA A CB   5  
ATOM 9124  H H    . ALA A 1 14  ? 147.311 -6.411  -105.277 1.00 0.00 ? 14  ALA A H    5  
ATOM 9125  H HA   . ALA A 1 14  ? 147.442 -3.792  -104.088 1.00 0.00 ? 14  ALA A HA   5  
ATOM 9126  H HB1  . ALA A 1 14  ? 145.725 -5.851  -103.798 1.00 0.00 ? 14  ALA A HB1  5  
ATOM 9127  H HB2  . ALA A 1 14  ? 145.864 -4.530  -102.641 1.00 0.00 ? 14  ALA A HB2  5  
ATOM 9128  H HB3  . ALA A 1 14  ? 146.701 -6.050  -102.344 1.00 0.00 ? 14  ALA A HB3  5  
ATOM 9129  N N    . GLY A 1 15  ? 150.029 -4.896  -103.470 1.00 0.00 ? 15  GLY A N    5  
ATOM 9130  C CA   . GLY A 1 15  ? 151.213 -5.030  -102.569 1.00 0.00 ? 15  GLY A CA   5  
ATOM 9131  C C    . GLY A 1 15  ? 152.522 -4.839  -103.333 1.00 0.00 ? 15  GLY A C    5  
ATOM 9132  O O    . GLY A 1 15  ? 153.543 -4.541  -102.745 1.00 0.00 ? 15  GLY A O    5  
ATOM 9133  H H    . GLY A 1 15  ? 150.150 -4.813  -104.438 1.00 0.00 ? 15  GLY A H    5  
ATOM 9134  H HA2  . GLY A 1 15  ? 151.150 -4.291  -101.785 1.00 0.00 ? 15  GLY A HA2  5  
ATOM 9135  H HA3  . GLY A 1 15  ? 151.209 -6.013  -102.127 1.00 0.00 ? 15  GLY A HA3  5  
ATOM 9136  N N    . LYS A 1 16  ? 152.525 -5.005  -104.626 1.00 0.00 ? 16  LYS A N    5  
ATOM 9137  C CA   . LYS A 1 16  ? 153.804 -4.823  -105.366 1.00 0.00 ? 16  LYS A CA   5  
ATOM 9138  C C    . LYS A 1 16  ? 153.545 -4.156  -106.715 1.00 0.00 ? 16  LYS A C    5  
ATOM 9139  O O    . LYS A 1 16  ? 153.359 -4.813  -107.720 1.00 0.00 ? 16  LYS A O    5  
ATOM 9140  C CB   . LYS A 1 16  ? 154.472 -6.182  -105.583 1.00 0.00 ? 16  LYS A CB   5  
ATOM 9141  C CG   . LYS A 1 16  ? 155.826 -5.983  -106.269 1.00 0.00 ? 16  LYS A CG   5  
ATOM 9142  C CD   . LYS A 1 16  ? 156.041 -7.088  -107.305 1.00 0.00 ? 16  LYS A CD   5  
ATOM 9143  C CE   . LYS A 1 16  ? 157.538 -7.363  -107.456 1.00 0.00 ? 16  LYS A CE   5  
ATOM 9144  N NZ   . LYS A 1 16  ? 157.758 -8.318  -108.578 1.00 0.00 ? 16  LYS A NZ   5  
ATOM 9145  H H    . LYS A 1 16  ? 151.702 -5.243  -105.100 1.00 0.00 ? 16  LYS A H    5  
ATOM 9146  H HA   . LYS A 1 16  ? 154.452 -4.194  -104.774 1.00 0.00 ? 16  LYS A HA   5  
ATOM 9147  H HB2  . LYS A 1 16  ? 154.618 -6.668  -104.629 1.00 0.00 ? 16  LYS A HB2  5  
ATOM 9148  H HB3  . LYS A 1 16  ? 153.841 -6.798  -106.208 1.00 0.00 ? 16  LYS A HB3  5  
ATOM 9149  H HG2  . LYS A 1 16  ? 155.843 -5.020  -106.758 1.00 0.00 ? 16  LYS A HG2  5  
ATOM 9150  H HG3  . LYS A 1 16  ? 156.613 -6.027  -105.531 1.00 0.00 ? 16  LYS A HG3  5  
ATOM 9151  H HD2  . LYS A 1 16  ? 155.540 -7.990  -106.979 1.00 0.00 ? 16  LYS A HD2  5  
ATOM 9152  H HD3  . LYS A 1 16  ? 155.637 -6.775  -108.255 1.00 0.00 ? 16  LYS A HD3  5  
ATOM 9153  H HE2  . LYS A 1 16  ? 158.055 -6.437  -107.664 1.00 0.00 ? 16  LYS A HE2  5  
ATOM 9154  H HE3  . LYS A 1 16  ? 157.921 -7.789  -106.540 1.00 0.00 ? 16  LYS A HE3  5  
ATOM 9155  H HZ1  . LYS A 1 16  ? 156.844 -8.709  -108.885 1.00 0.00 ? 16  LYS A HZ1  5  
ATOM 9156  H HZ2  . LYS A 1 16  ? 158.376 -9.092  -108.259 1.00 0.00 ? 16  LYS A HZ2  5  
ATOM 9157  H HZ3  . LYS A 1 16  ? 158.204 -7.822  -109.374 1.00 0.00 ? 16  LYS A HZ3  5  
ATOM 9158  N N    . ALA A 1 17  ? 153.547 -2.854  -106.746 1.00 0.00 ? 17  ALA A N    5  
ATOM 9159  C CA   . ALA A 1 17  ? 153.318 -2.140  -108.030 1.00 0.00 ? 17  ALA A CA   5  
ATOM 9160  C C    . ALA A 1 17  ? 154.654 -1.581  -108.524 1.00 0.00 ? 17  ALA A C    5  
ATOM 9161  O O    . ALA A 1 17  ? 155.613 -1.507  -107.782 1.00 0.00 ? 17  ALA A O    5  
ATOM 9162  C CB   . ALA A 1 17  ? 152.329 -0.995  -107.808 1.00 0.00 ? 17  ALA A CB   5  
ATOM 9163  H H    . ALA A 1 17  ? 153.711 -2.344  -105.925 1.00 0.00 ? 17  ALA A H    5  
ATOM 9164  H HA   . ALA A 1 17  ? 152.913 -2.828  -108.758 1.00 0.00 ? 17  ALA A HA   5  
ATOM 9165  H HB1  . ALA A 1 17  ? 152.656 -0.394  -106.974 1.00 0.00 ? 17  ALA A HB1  5  
ATOM 9166  H HB2  . ALA A 1 17  ? 151.351 -1.401  -107.598 1.00 0.00 ? 17  ALA A HB2  5  
ATOM 9167  H HB3  . ALA A 1 17  ? 152.283 -0.383  -108.697 1.00 0.00 ? 17  ALA A HB3  5  
ATOM 9168  N N    . THR A 1 18  ? 154.732 -1.193  -109.765 1.00 0.00 ? 18  THR A N    5  
ATOM 9169  C CA   . THR A 1 18  ? 156.016 -0.650  -110.288 1.00 0.00 ? 18  THR A CA   5  
ATOM 9170  C C    . THR A 1 18  ? 155.795 -0.091  -111.693 1.00 0.00 ? 18  THR A C    5  
ATOM 9171  O O    . THR A 1 18  ? 154.802 -0.378  -112.329 1.00 0.00 ? 18  THR A O    5  
ATOM 9172  C CB   . THR A 1 18  ? 157.049 -1.779  -110.349 1.00 0.00 ? 18  THR A CB   5  
ATOM 9173  O OG1  . THR A 1 18  ? 156.383 -3.028  -110.229 1.00 0.00 ? 18  THR A OG1  5  
ATOM 9174  C CG2  . THR A 1 18  ? 158.053 -1.625  -109.207 1.00 0.00 ? 18  THR A CG2  5  
ATOM 9175  H H    . THR A 1 18  ? 153.953 -1.261  -110.351 1.00 0.00 ? 18  THR A H    5  
ATOM 9176  H HA   . THR A 1 18  ? 156.371 0.135   -109.638 1.00 0.00 ? 18  THR A HA   5  
ATOM 9177  H HB   . THR A 1 18  ? 157.571 -1.740  -111.292 1.00 0.00 ? 18  THR A HB   5  
ATOM 9178  H HG1  . THR A 1 18  ? 156.673 -3.441  -109.413 1.00 0.00 ? 18  THR A HG1  5  
ATOM 9179  H HG21 . THR A 1 18  ? 158.249 -0.578  -109.036 1.00 0.00 ? 18  THR A HG21 5  
ATOM 9180  H HG22 . THR A 1 18  ? 158.973 -2.125  -109.470 1.00 0.00 ? 18  THR A HG22 5  
ATOM 9181  H HG23 . THR A 1 18  ? 157.647 -2.067  -108.311 1.00 0.00 ? 18  THR A HG23 5  
ATOM 9182  N N    . PRO A 1 19  ? 156.721 0.693   -112.176 1.00 0.00 ? 19  PRO A N    5  
ATOM 9183  C CA   . PRO A 1 19  ? 156.606 1.276   -113.538 1.00 0.00 ? 19  PRO A CA   5  
ATOM 9184  C C    . PRO A 1 19  ? 156.413 0.195   -114.604 1.00 0.00 ? 19  PRO A C    5  
ATOM 9185  O O    . PRO A 1 19  ? 156.816 0.353   -115.739 1.00 0.00 ? 19  PRO A O    5  
ATOM 9186  C CB   . PRO A 1 19  ? 157.941 1.999   -113.711 1.00 0.00 ? 19  PRO A CB   5  
ATOM 9187  C CG   . PRO A 1 19  ? 158.781 1.798   -112.441 1.00 0.00 ? 19  PRO A CG   5  
ATOM 9188  C CD   . PRO A 1 19  ? 157.937 1.051   -111.404 1.00 0.00 ? 19  PRO A CD   5  
ATOM 9189  H HA   . PRO A 1 19  ? 155.801 1.987   -113.578 1.00 0.00 ? 19  PRO A HA   5  
ATOM 9190  H HB2  . PRO A 1 19  ? 158.461 1.597   -114.564 1.00 0.00 ? 19  PRO A HB2  5  
ATOM 9191  H HB3  . PRO A 1 19  ? 157.764 3.054   -113.859 1.00 0.00 ? 19  PRO A HB3  5  
ATOM 9192  H HG2  . PRO A 1 19  ? 159.663 1.218   -112.679 1.00 0.00 ? 19  PRO A HG2  5  
ATOM 9193  H HG3  . PRO A 1 19  ? 159.075 2.757   -112.044 1.00 0.00 ? 19  PRO A HG3  5  
ATOM 9194  H HD2  . PRO A 1 19  ? 158.453 0.167   -111.057 1.00 0.00 ? 19  PRO A HD2  5  
ATOM 9195  H HD3  . PRO A 1 19  ? 157.680 1.697   -110.579 1.00 0.00 ? 19  PRO A HD3  5  
ATOM 9196  N N    . ALA A 1 20  ? 155.794 -0.897  -114.256 1.00 0.00 ? 20  ALA A N    5  
ATOM 9197  C CA   . ALA A 1 20  ? 155.574 -1.970  -115.264 1.00 0.00 ? 20  ALA A CA   5  
ATOM 9198  C C    . ALA A 1 20  ? 154.315 -2.765  -114.916 1.00 0.00 ? 20  ALA A C    5  
ATOM 9199  O O    . ALA A 1 20  ? 154.346 -3.976  -114.817 1.00 0.00 ? 20  ALA A O    5  
ATOM 9200  C CB   . ALA A 1 20  ? 156.782 -2.909  -115.277 1.00 0.00 ? 20  ALA A CB   5  
ATOM 9201  H H    . ALA A 1 20  ? 155.462 -1.000  -113.339 1.00 0.00 ? 20  ALA A H    5  
ATOM 9202  H HA   . ALA A 1 20  ? 155.457 -1.524  -116.241 1.00 0.00 ? 20  ALA A HA   5  
ATOM 9203  H HB1  . ALA A 1 20  ? 156.776 -3.515  -114.383 1.00 0.00 ? 20  ALA A HB1  5  
ATOM 9204  H HB2  . ALA A 1 20  ? 157.690 -2.326  -115.311 1.00 0.00 ? 20  ALA A HB2  5  
ATOM 9205  H HB3  . ALA A 1 20  ? 156.731 -3.548  -116.146 1.00 0.00 ? 20  ALA A HB3  5  
ATOM 9206  N N    . PRO A 1 21  ? 153.207 -2.091  -114.749 1.00 0.00 ? 21  PRO A N    5  
ATOM 9207  C CA   . PRO A 1 21  ? 151.922 -2.761  -114.431 1.00 0.00 ? 21  PRO A CA   5  
ATOM 9208  C C    . PRO A 1 21  ? 151.193 -3.212  -115.698 1.00 0.00 ? 21  PRO A C    5  
ATOM 9209  O O    . PRO A 1 21  ? 151.546 -2.820  -116.792 1.00 0.00 ? 21  PRO A O    5  
ATOM 9210  C CB   . PRO A 1 21  ? 151.150 -1.627  -113.757 1.00 0.00 ? 21  PRO A CB   5  
ATOM 9211  C CG   . PRO A 1 21  ? 151.815 -0.298  -114.152 1.00 0.00 ? 21  PRO A CG   5  
ATOM 9212  C CD   . PRO A 1 21  ? 153.146 -0.611  -114.850 1.00 0.00 ? 21  PRO A CD   5  
ATOM 9213  H HA   . PRO A 1 21  ? 152.062 -3.576  -113.743 1.00 0.00 ? 21  PRO A HA   5  
ATOM 9214  H HB2  . PRO A 1 21  ? 150.122 -1.638  -114.091 1.00 0.00 ? 21  PRO A HB2  5  
ATOM 9215  H HB3  . PRO A 1 21  ? 151.189 -1.744  -112.685 1.00 0.00 ? 21  PRO A HB3  5  
ATOM 9216  H HG2  . PRO A 1 21  ? 151.166 0.245   -114.826 1.00 0.00 ? 21  PRO A HG2  5  
ATOM 9217  H HG3  . PRO A 1 21  ? 151.999 0.294   -113.269 1.00 0.00 ? 21  PRO A HG3  5  
ATOM 9218  H HD2  . PRO A 1 21  ? 153.120 -0.289  -115.884 1.00 0.00 ? 21  PRO A HD2  5  
ATOM 9219  H HD3  . PRO A 1 21  ? 153.967 -0.160  -114.323 1.00 0.00 ? 21  PRO A HD3  5  
ATOM 9220  N N    . PRO A 1 22  ? 150.171 -4.006  -115.553 1.00 0.00 ? 22  PRO A N    5  
ATOM 9221  C CA   . PRO A 1 22  ? 149.392 -4.469  -116.728 1.00 0.00 ? 22  PRO A CA   5  
ATOM 9222  C C    . PRO A 1 22  ? 148.849 -3.279  -117.522 1.00 0.00 ? 22  PRO A C    5  
ATOM 9223  O O    . PRO A 1 22  ? 148.246 -3.428  -118.566 1.00 0.00 ? 22  PRO A O    5  
ATOM 9224  C CB   . PRO A 1 22  ? 148.255 -5.266  -116.084 1.00 0.00 ? 22  PRO A CB   5  
ATOM 9225  C CG   . PRO A 1 22  ? 148.461 -5.284  -114.563 1.00 0.00 ? 22  PRO A CG   5  
ATOM 9226  C CD   . PRO A 1 22  ? 149.727 -4.491  -114.223 1.00 0.00 ? 22  PRO A CD   5  
ATOM 9227  H HA   . PRO A 1 22  ? 149.986 -5.112  -117.355 1.00 0.00 ? 22  PRO A HA   5  
ATOM 9228  H HB2  . PRO A 1 22  ? 147.308 -4.799  -116.319 1.00 0.00 ? 22  PRO A HB2  5  
ATOM 9229  H HB3  . PRO A 1 22  ? 148.264 -6.278  -116.460 1.00 0.00 ? 22  PRO A HB3  5  
ATOM 9230  H HG2  . PRO A 1 22  ? 147.608 -4.832  -114.077 1.00 0.00 ? 22  PRO A HG2  5  
ATOM 9231  H HG3  . PRO A 1 22  ? 148.574 -6.303  -114.224 1.00 0.00 ? 22  PRO A HG3  5  
ATOM 9232  H HD2  . PRO A 1 22  ? 149.495 -3.663  -113.567 1.00 0.00 ? 22  PRO A HD2  5  
ATOM 9233  H HD3  . PRO A 1 22  ? 150.478 -5.131  -113.788 1.00 0.00 ? 22  PRO A HD3  5  
ATOM 9234  N N    . VAL A 1 23  ? 149.062 -2.095  -117.013 1.00 0.00 ? 23  VAL A N    5  
ATOM 9235  C CA   . VAL A 1 23  ? 148.569 -0.870  -117.700 1.00 0.00 ? 23  VAL A CA   5  
ATOM 9236  C C    . VAL A 1 23  ? 149.753 -0.017  -118.157 1.00 0.00 ? 23  VAL A C    5  
ATOM 9237  O O    . VAL A 1 23  ? 150.009 0.135   -119.338 1.00 0.00 ? 23  VAL A O    5  
ATOM 9238  C CB   . VAL A 1 23  ? 147.734 -0.055  -116.718 1.00 0.00 ? 23  VAL A CB   5  
ATOM 9239  C CG1  . VAL A 1 23  ? 146.919 0.977   -117.491 1.00 0.00 ? 23  VAL A CG1  5  
ATOM 9240  C CG2  . VAL A 1 23  ? 146.796 -0.989  -115.950 1.00 0.00 ? 23  VAL A CG2  5  
ATOM 9241  H H    . VAL A 1 23  ? 149.548 -2.012  -116.166 1.00 0.00 ? 23  VAL A H    5  
ATOM 9242  H HA   . VAL A 1 23  ? 147.963 -1.141  -118.551 1.00 0.00 ? 23  VAL A HA   5  
ATOM 9243  H HB   . VAL A 1 23  ? 148.388 0.452   -116.024 1.00 0.00 ? 23  VAL A HB   5  
ATOM 9244  H HG11 . VAL A 1 23  ? 147.585 1.581   -118.089 1.00 0.00 ? 23  VAL A HG11 5  
ATOM 9245  H HG12 . VAL A 1 23  ? 146.385 1.606   -116.797 1.00 0.00 ? 23  VAL A HG12 5  
ATOM 9246  H HG13 . VAL A 1 23  ? 146.217 0.471   -118.135 1.00 0.00 ? 23  VAL A HG13 5  
ATOM 9247  H HG21 . VAL A 1 23  ? 146.132 -1.480  -116.643 1.00 0.00 ? 23  VAL A HG21 5  
ATOM 9248  H HG22 . VAL A 1 23  ? 146.219 -0.415  -115.240 1.00 0.00 ? 23  VAL A HG22 5  
ATOM 9249  H HG23 . VAL A 1 23  ? 147.380 -1.730  -115.424 1.00 0.00 ? 23  VAL A HG23 5  
ATOM 9250  N N    . GLY A 1 24  ? 150.430 0.594   -117.216 1.00 0.00 ? 24  GLY A N    5  
ATOM 9251  C CA   . GLY A 1 24  ? 151.573 1.493   -117.546 1.00 0.00 ? 24  GLY A CA   5  
ATOM 9252  C C    . GLY A 1 24  ? 151.097 2.551   -118.536 1.00 0.00 ? 24  GLY A C    5  
ATOM 9253  O O    . GLY A 1 24  ? 150.459 3.514   -118.155 1.00 0.00 ? 24  GLY A O    5  
ATOM 9254  H H    . GLY A 1 24  ? 150.147 0.505   -116.282 1.00 0.00 ? 24  GLY A H    5  
ATOM 9255  H HA2  . GLY A 1 24  ? 151.930 1.971   -116.643 1.00 0.00 ? 24  GLY A HA2  5  
ATOM 9256  H HA3  . GLY A 1 24  ? 152.366 0.918   -117.988 1.00 0.00 ? 24  GLY A HA3  5  
ATOM 9257  N N    . PRO A 1 25  ? 151.340 2.360   -119.805 1.00 0.00 ? 25  PRO A N    5  
ATOM 9258  C CA   . PRO A 1 25  ? 150.841 3.326   -120.806 1.00 0.00 ? 25  PRO A CA   5  
ATOM 9259  C C    . PRO A 1 25  ? 149.320 3.418   -120.728 1.00 0.00 ? 25  PRO A C    5  
ATOM 9260  O O    . PRO A 1 25  ? 148.750 4.478   -120.570 1.00 0.00 ? 25  PRO A O    5  
ATOM 9261  C CB   . PRO A 1 25  ? 151.290 2.705   -122.131 1.00 0.00 ? 25  PRO A CB   5  
ATOM 9262  C CG   . PRO A 1 25  ? 152.036 1.395   -121.837 1.00 0.00 ? 25  PRO A CG   5  
ATOM 9263  C CD   . PRO A 1 25  ? 152.127 1.208   -120.319 1.00 0.00 ? 25  PRO A CD   5  
ATOM 9264  H HA   . PRO A 1 25  ? 151.297 4.293   -120.673 1.00 0.00 ? 25  PRO A HA   5  
ATOM 9265  H HB2  . PRO A 1 25  ? 150.425 2.501   -122.746 1.00 0.00 ? 25  PRO A HB2  5  
ATOM 9266  H HB3  . PRO A 1 25  ? 151.951 3.385   -122.646 1.00 0.00 ? 25  PRO A HB3  5  
ATOM 9267  H HG2  . PRO A 1 25  ? 151.498 0.566   -122.275 1.00 0.00 ? 25  PRO A HG2  5  
ATOM 9268  H HG3  . PRO A 1 25  ? 153.030 1.443   -122.253 1.00 0.00 ? 25  PRO A HG3  5  
ATOM 9269  H HD2  . PRO A 1 25  ? 151.690 0.266   -120.024 1.00 0.00 ? 25  PRO A HD2  5  
ATOM 9270  H HD3  . PRO A 1 25  ? 153.150 1.277   -119.987 1.00 0.00 ? 25  PRO A HD3  5  
ATOM 9271  N N    . ALA A 1 26  ? 148.667 2.297   -120.863 1.00 0.00 ? 26  ALA A N    5  
ATOM 9272  C CA   . ALA A 1 26  ? 147.180 2.286   -120.825 1.00 0.00 ? 26  ALA A CA   5  
ATOM 9273  C C    . ALA A 1 26  ? 146.670 3.158   -119.674 1.00 0.00 ? 26  ALA A C    5  
ATOM 9274  O O    . ALA A 1 26  ? 145.482 3.379   -119.544 1.00 0.00 ? 26  ALA A O    5  
ATOM 9275  C CB   . ALA A 1 26  ? 146.687 0.851   -120.637 1.00 0.00 ? 26  ALA A CB   5  
ATOM 9276  H H    . ALA A 1 26  ? 149.164 1.464   -121.033 1.00 0.00 ? 26  ALA A H    5  
ATOM 9277  H HA   . ALA A 1 26  ? 146.799 2.672   -121.758 1.00 0.00 ? 26  ALA A HA   5  
ATOM 9278  H HB1  . ALA A 1 26  ? 146.652 0.355   -121.595 1.00 0.00 ? 26  ALA A HB1  5  
ATOM 9279  H HB2  . ALA A 1 26  ? 145.698 0.864   -120.203 1.00 0.00 ? 26  ALA A HB2  5  
ATOM 9280  H HB3  . ALA A 1 26  ? 147.362 0.323   -119.982 1.00 0.00 ? 26  ALA A HB3  5  
ATOM 9281  N N    . LEU A 1 27  ? 147.541 3.667   -118.840 1.00 0.00 ? 27  LEU A N    5  
ATOM 9282  C CA   . LEU A 1 27  ? 147.048 4.525   -117.726 1.00 0.00 ? 27  LEU A CA   5  
ATOM 9283  C C    . LEU A 1 27  ? 147.491 5.964   -117.980 1.00 0.00 ? 27  LEU A C    5  
ATOM 9284  O O    . LEU A 1 27  ? 146.729 6.900   -117.835 1.00 0.00 ? 27  LEU A O    5  
ATOM 9285  C CB   . LEU A 1 27  ? 147.627 4.030   -116.400 1.00 0.00 ? 27  LEU A CB   5  
ATOM 9286  C CG   . LEU A 1 27  ? 146.566 4.055   -115.300 1.00 0.00 ? 27  LEU A CG   5  
ATOM 9287  C CD1  . LEU A 1 27  ? 147.273 4.120   -113.951 1.00 0.00 ? 27  LEU A CD1  5  
ATOM 9288  C CD2  . LEU A 1 27  ? 145.666 5.283   -115.455 1.00 0.00 ? 27  LEU A CD2  5  
ATOM 9289  H H    . LEU A 1 27  ? 148.500 3.491   -118.956 1.00 0.00 ? 27  LEU A H    5  
ATOM 9290  H HA   . LEU A 1 27  ? 145.972 4.456   -117.727 1.00 0.00 ? 27  LEU A HA   5  
ATOM 9291  H HB2  . LEU A 1 27  ? 147.989 3.021   -116.524 1.00 0.00 ? 27  LEU A HB2  5  
ATOM 9292  H HB3  . LEU A 1 27  ? 148.449 4.669   -116.114 1.00 0.00 ? 27  LEU A HB3  5  
ATOM 9293  H HG   . LEU A 1 27  ? 145.969 3.156   -115.352 1.00 0.00 ? 27  LEU A HG   5  
ATOM 9294  H HD11 . LEU A 1 27  ? 147.389 5.151   -113.653 1.00 0.00 ? 27  LEU A HD11 5  
ATOM 9295  H HD12 . LEU A 1 27  ? 148.245 3.660   -114.040 1.00 0.00 ? 27  LEU A HD12 5  
ATOM 9296  H HD13 . LEU A 1 27  ? 146.689 3.593   -113.212 1.00 0.00 ? 27  LEU A HD13 5  
ATOM 9297  H HD21 . LEU A 1 27  ? 145.316 5.595   -114.481 1.00 0.00 ? 27  LEU A HD21 5  
ATOM 9298  H HD22 . LEU A 1 27  ? 144.820 5.036   -116.076 1.00 0.00 ? 27  LEU A HD22 5  
ATOM 9299  H HD23 . LEU A 1 27  ? 146.226 6.086   -115.908 1.00 0.00 ? 27  LEU A HD23 5  
ATOM 9300  N N    . GLY A 1 28  ? 148.725 6.146   -118.367 1.00 0.00 ? 28  GLY A N    5  
ATOM 9301  C CA   . GLY A 1 28  ? 149.226 7.520   -118.639 1.00 0.00 ? 28  GLY A CA   5  
ATOM 9302  C C    . GLY A 1 28  ? 148.306 8.203   -119.651 1.00 0.00 ? 28  GLY A C    5  
ATOM 9303  O O    . GLY A 1 28  ? 148.567 8.211   -120.838 1.00 0.00 ? 28  GLY A O    5  
ATOM 9304  H H    . GLY A 1 28  ? 149.319 5.377   -118.484 1.00 0.00 ? 28  GLY A H    5  
ATOM 9305  H HA2  . GLY A 1 28  ? 149.239 8.088   -117.720 1.00 0.00 ? 28  GLY A HA2  5  
ATOM 9306  H HA3  . GLY A 1 28  ? 150.226 7.465   -119.044 1.00 0.00 ? 28  GLY A HA3  5  
ATOM 9307  N N    . GLN A 1 29  ? 147.235 8.782   -119.188 1.00 0.00 ? 29  GLN A N    5  
ATOM 9308  C CA   . GLN A 1 29  ? 146.294 9.475   -120.109 1.00 0.00 ? 29  GLN A CA   5  
ATOM 9309  C C    . GLN A 1 29  ? 145.649 10.633  -119.350 1.00 0.00 ? 29  GLN A C    5  
ATOM 9310  O O    . GLN A 1 29  ? 145.017 11.499  -119.921 1.00 0.00 ? 29  GLN A O    5  
ATOM 9311  C CB   . GLN A 1 29  ? 145.212 8.497   -120.572 1.00 0.00 ? 29  GLN A CB   5  
ATOM 9312  C CG   . GLN A 1 29  ? 144.398 9.134   -121.700 1.00 0.00 ? 29  GLN A CG   5  
ATOM 9313  C CD   . GLN A 1 29  ? 145.255 9.220   -122.964 1.00 0.00 ? 29  GLN A CD   5  
ATOM 9314  O OE1  . GLN A 1 29  ? 145.763 8.223   -123.437 1.00 0.00 ? 29  GLN A OE1  5  
ATOM 9315  N NE2  . GLN A 1 29  ? 145.437 10.379  -123.536 1.00 0.00 ? 29  GLN A NE2  5  
ATOM 9316  H H    . GLN A 1 29  ? 147.049 8.772   -118.226 1.00 0.00 ? 29  GLN A H    5  
ATOM 9317  H HA   . GLN A 1 29  ? 146.838 9.851   -120.965 1.00 0.00 ? 29  GLN A HA   5  
ATOM 9318  H HB2  . GLN A 1 29  ? 145.677 7.590   -120.931 1.00 0.00 ? 29  GLN A HB2  5  
ATOM 9319  H HB3  . GLN A 1 29  ? 144.558 8.265   -119.745 1.00 0.00 ? 29  GLN A HB3  5  
ATOM 9320  H HG2  . GLN A 1 29  ? 143.523 8.529   -121.897 1.00 0.00 ? 29  GLN A HG2  5  
ATOM 9321  H HG3  . GLN A 1 29  ? 144.091 10.126  -121.407 1.00 0.00 ? 29  GLN A HG3  5  
ATOM 9322  H HE21 . GLN A 1 29  ? 145.027 11.184  -123.155 1.00 0.00 ? 29  GLN A HE21 5  
ATOM 9323  H HE22 . GLN A 1 29  ? 145.985 10.445  -124.346 1.00 0.00 ? 29  GLN A HE22 5  
ATOM 9324  N N    . HIS A 1 30  ? 145.819 10.646  -118.057 1.00 0.00 ? 30  HIS A N    5  
ATOM 9325  C CA   . HIS A 1 30  ? 145.239 11.734  -117.224 1.00 0.00 ? 30  HIS A CA   5  
ATOM 9326  C C    . HIS A 1 30  ? 146.211 12.912  -117.210 1.00 0.00 ? 30  HIS A C    5  
ATOM 9327  O O    . HIS A 1 30  ? 145.821 14.061  -117.226 1.00 0.00 ? 30  HIS A O    5  
ATOM 9328  C CB   . HIS A 1 30  ? 145.040 11.215  -115.796 1.00 0.00 ? 30  HIS A CB   5  
ATOM 9329  C CG   . HIS A 1 30  ? 146.270 11.501  -114.978 1.00 0.00 ? 30  HIS A CG   5  
ATOM 9330  N ND1  . HIS A 1 30  ? 146.695 12.793  -114.707 1.00 0.00 ? 30  HIS A ND1  5  
ATOM 9331  C CD2  . HIS A 1 30  ? 147.177 10.672  -114.364 1.00 0.00 ? 30  HIS A CD2  5  
ATOM 9332  C CE1  . HIS A 1 30  ? 147.811 12.704  -113.959 1.00 0.00 ? 30  HIS A CE1  5  
ATOM 9333  N NE2  . HIS A 1 30  ? 148.149 11.434  -113.723 1.00 0.00 ? 30  HIS A NE2  5  
ATOM 9334  H H    . HIS A 1 30  ? 146.341 9.935   -117.631 1.00 0.00 ? 30  HIS A H    5  
ATOM 9335  H HA   . HIS A 1 30  ? 144.284 12.042  -117.627 1.00 0.00 ? 30  HIS A HA   5  
ATOM 9336  H HB2  . HIS A 1 30  ? 144.189 11.705  -115.350 1.00 0.00 ? 30  HIS A HB2  5  
ATOM 9337  H HB3  . HIS A 1 30  ? 144.868 10.150  -115.823 1.00 0.00 ? 30  HIS A HB3  5  
ATOM 9338  H HD1  . HIS A 1 30  ? 146.260 13.620  -115.004 1.00 0.00 ? 30  HIS A HD1  5  
ATOM 9339  H HD2  . HIS A 1 30  ? 147.141 9.593   -114.378 1.00 0.00 ? 30  HIS A HD2  5  
ATOM 9340  H HE1  . HIS A 1 30  ? 148.366 13.556  -113.597 1.00 0.00 ? 30  HIS A HE1  5  
ATOM 9341  N N    . GLY A 1 31  ? 147.481 12.620  -117.182 1.00 0.00 ? 31  GLY A N    5  
ATOM 9342  C CA   . GLY A 1 31  ? 148.511 13.696  -117.169 1.00 0.00 ? 31  GLY A CA   5  
ATOM 9343  C C    . GLY A 1 31  ? 149.882 13.056  -117.383 1.00 0.00 ? 31  GLY A C    5  
ATOM 9344  O O    . GLY A 1 31  ? 150.900 13.718  -117.419 1.00 0.00 ? 31  GLY A O    5  
ATOM 9345  H H    . GLY A 1 31  ? 147.762 11.682  -117.171 1.00 0.00 ? 31  GLY A H    5  
ATOM 9346  H HA2  . GLY A 1 31  ? 148.307 14.402  -117.961 1.00 0.00 ? 31  GLY A HA2  5  
ATOM 9347  H HA3  . GLY A 1 31  ? 148.497 14.202  -116.216 1.00 0.00 ? 31  GLY A HA3  5  
ATOM 9348  N N    . ALA A 1 32  ? 149.893 11.765  -117.575 1.00 0.00 ? 32  ALA A N    5  
ATOM 9349  C CA   . ALA A 1 32  ? 151.166 11.039  -117.847 1.00 0.00 ? 32  ALA A CA   5  
ATOM 9350  C C    . ALA A 1 32  ? 152.061 10.969  -116.608 1.00 0.00 ? 32  ALA A C    5  
ATOM 9351  O O    . ALA A 1 32  ? 153.031 11.691  -116.494 1.00 0.00 ? 32  ALA A O    5  
ATOM 9352  C CB   . ALA A 1 32  ? 151.913 11.743  -118.978 1.00 0.00 ? 32  ALA A CB   5  
ATOM 9353  H H    . ALA A 1 32  ? 149.048 11.268  -117.571 1.00 0.00 ? 32  ALA A H    5  
ATOM 9354  H HA   . ALA A 1 32  ? 150.928 10.032  -118.156 1.00 0.00 ? 32  ALA A HA   5  
ATOM 9355  H HB1  . ALA A 1 32  ? 152.604 12.462  -118.560 1.00 0.00 ? 32  ALA A HB1  5  
ATOM 9356  H HB2  . ALA A 1 32  ? 151.206 12.253  -119.614 1.00 0.00 ? 32  ALA A HB2  5  
ATOM 9357  H HB3  . ALA A 1 32  ? 152.459 11.014  -119.558 1.00 0.00 ? 32  ALA A HB3  5  
ATOM 9358  N N    . ASN A 1 33  ? 151.771 10.083  -115.694 1.00 0.00 ? 33  ASN A N    5  
ATOM 9359  C CA   . ASN A 1 33  ? 152.639 9.950   -114.492 1.00 0.00 ? 33  ASN A CA   5  
ATOM 9360  C C    . ASN A 1 33  ? 152.464 8.544   -113.914 1.00 0.00 ? 33  ASN A C    5  
ATOM 9361  O O    . ASN A 1 33  ? 151.379 8.131   -113.555 1.00 0.00 ? 33  ASN A O    5  
ATOM 9362  C CB   . ASN A 1 33  ? 152.275 11.009  -113.448 1.00 0.00 ? 33  ASN A CB   5  
ATOM 9363  C CG   . ASN A 1 33  ? 152.667 12.394  -113.967 1.00 0.00 ? 33  ASN A CG   5  
ATOM 9364  O OD1  . ASN A 1 33  ? 151.821 13.240  -114.172 1.00 0.00 ? 33  ASN A OD1  5  
ATOM 9365  N ND2  . ASN A 1 33  ? 153.925 12.660  -114.191 1.00 0.00 ? 33  ASN A ND2  5  
ATOM 9366  H H    . ASN A 1 33  ? 151.001 9.487   -115.807 1.00 0.00 ? 33  ASN A H    5  
ATOM 9367  H HA   . ASN A 1 33  ? 153.668 10.063  -114.799 1.00 0.00 ? 33  ASN A HA   5  
ATOM 9368  H HB2  . ASN A 1 33  ? 151.210 10.980  -113.263 1.00 0.00 ? 33  ASN A HB2  5  
ATOM 9369  H HB3  . ASN A 1 33  ? 152.806 10.807  -112.530 1.00 0.00 ? 33  ASN A HB3  5  
ATOM 9370  H HD21 . ASN A 1 33  ? 154.608 11.977  -114.025 1.00 0.00 ? 33  ASN A HD21 5  
ATOM 9371  H HD22 . ASN A 1 33  ? 154.186 13.544  -114.523 1.00 0.00 ? 33  ASN A HD22 5  
ATOM 9372  N N    . ILE A 1 34  ? 153.536 7.806   -113.843 1.00 0.00 ? 34  ILE A N    5  
ATOM 9373  C CA   . ILE A 1 34  ? 153.470 6.414   -113.314 1.00 0.00 ? 34  ILE A CA   5  
ATOM 9374  C C    . ILE A 1 34  ? 153.907 6.397   -111.846 1.00 0.00 ? 34  ILE A C    5  
ATOM 9375  O O    . ILE A 1 34  ? 153.155 6.029   -110.970 1.00 0.00 ? 34  ILE A O    5  
ATOM 9376  C CB   . ILE A 1 34  ? 154.412 5.532   -114.139 1.00 0.00 ? 34  ILE A CB   5  
ATOM 9377  C CG1  . ILE A 1 34  ? 153.870 5.398   -115.567 1.00 0.00 ? 34  ILE A CG1  5  
ATOM 9378  C CG2  . ILE A 1 34  ? 154.524 4.146   -113.503 1.00 0.00 ? 34  ILE A CG2  5  
ATOM 9379  C CD1  . ILE A 1 34  ? 152.474 4.772   -115.534 1.00 0.00 ? 34  ILE A CD1  5  
ATOM 9380  H H    . ILE A 1 34  ? 154.392 8.171   -114.151 1.00 0.00 ? 34  ILE A H    5  
ATOM 9381  H HA   . ILE A 1 34  ? 152.454 6.039   -113.398 1.00 0.00 ? 34  ILE A HA   5  
ATOM 9382  H HB   . ILE A 1 34  ? 155.391 5.988   -114.170 1.00 0.00 ? 34  ILE A HB   5  
ATOM 9383  H HG12 . ILE A 1 34  ? 153.815 6.376   -116.022 1.00 0.00 ? 34  ILE A HG12 5  
ATOM 9384  H HG13 . ILE A 1 34  ? 154.530 4.769   -116.144 1.00 0.00 ? 34  ILE A HG13 5  
ATOM 9385  H HG21 . ILE A 1 34  ? 155.510 4.026   -113.075 1.00 0.00 ? 34  ILE A HG21 5  
ATOM 9386  H HG22 . ILE A 1 34  ? 154.366 3.389   -114.258 1.00 0.00 ? 34  ILE A HG22 5  
ATOM 9387  H HG23 . ILE A 1 34  ? 153.781 4.042   -112.728 1.00 0.00 ? 34  ILE A HG23 5  
ATOM 9388  H HD11 . ILE A 1 34  ? 152.378 4.146   -114.660 1.00 0.00 ? 34  ILE A HD11 5  
ATOM 9389  H HD12 . ILE A 1 34  ? 152.327 4.173   -116.422 1.00 0.00 ? 34  ILE A HD12 5  
ATOM 9390  H HD13 . ILE A 1 34  ? 151.729 5.553   -115.502 1.00 0.00 ? 34  ILE A HD13 5  
ATOM 9391  N N    . MET A 1 35  ? 155.137 6.738   -111.570 1.00 0.00 ? 35  MET A N    5  
ATOM 9392  C CA   . MET A 1 35  ? 155.618 6.671   -110.160 1.00 0.00 ? 35  MET A CA   5  
ATOM 9393  C C    . MET A 1 35  ? 154.531 7.196   -109.220 1.00 0.00 ? 35  MET A C    5  
ATOM 9394  O O    . MET A 1 35  ? 154.106 6.505   -108.315 1.00 0.00 ? 35  MET A O    5  
ATOM 9395  C CB   . MET A 1 35  ? 156.878 7.527   -110.010 1.00 0.00 ? 35  MET A CB   5  
ATOM 9396  C CG   . MET A 1 35  ? 157.783 6.918   -108.937 1.00 0.00 ? 35  MET A CG   5  
ATOM 9397  S SD   . MET A 1 35  ? 158.327 5.275   -109.468 1.00 0.00 ? 35  MET A SD   5  
ATOM 9398  C CE   . MET A 1 35  ? 158.270 4.482   -107.843 1.00 0.00 ? 35  MET A CE   5  
ATOM 9399  H H    . MET A 1 35  ? 155.759 6.957   -112.295 1.00 0.00 ? 35  MET A H    5  
ATOM 9400  H HA   . MET A 1 35  ? 155.852 5.643   -109.926 1.00 0.00 ? 35  MET A HA   5  
ATOM 9401  H HB2  . MET A 1 35  ? 157.405 7.559   -110.952 1.00 0.00 ? 35  MET A HB2  5  
ATOM 9402  H HB3  . MET A 1 35  ? 156.601 8.528   -109.718 1.00 0.00 ? 35  MET A HB3  5  
ATOM 9403  H HG2  . MET A 1 35  ? 158.645 7.553   -108.791 1.00 0.00 ? 35  MET A HG2  5  
ATOM 9404  H HG3  . MET A 1 35  ? 157.237 6.834   -108.010 1.00 0.00 ? 35  MET A HG3  5  
ATOM 9405  H HE1  . MET A 1 35  ? 158.795 3.537   -107.886 1.00 0.00 ? 35  MET A HE1  5  
ATOM 9406  H HE2  . MET A 1 35  ? 157.244 4.307   -107.561 1.00 0.00 ? 35  MET A HE2  5  
ATOM 9407  H HE3  . MET A 1 35  ? 158.738 5.126   -107.112 1.00 0.00 ? 35  MET A HE3  5  
ATOM 9408  N N    . GLU A 1 36  ? 154.052 8.391   -109.428 1.00 0.00 ? 36  GLU A N    5  
ATOM 9409  C CA   . GLU A 1 36  ? 152.971 8.903   -108.538 1.00 0.00 ? 36  GLU A CA   5  
ATOM 9410  C C    . GLU A 1 36  ? 151.919 7.800   -108.400 1.00 0.00 ? 36  GLU A C    5  
ATOM 9411  O O    . GLU A 1 36  ? 151.513 7.442   -107.310 1.00 0.00 ? 36  GLU A O    5  
ATOM 9412  C CB   . GLU A 1 36  ? 152.333 10.144  -109.168 1.00 0.00 ? 36  GLU A CB   5  
ATOM 9413  C CG   . GLU A 1 36  ? 152.996 11.402  -108.604 1.00 0.00 ? 36  GLU A CG   5  
ATOM 9414  C CD   . GLU A 1 36  ? 152.792 12.566  -109.574 1.00 0.00 ? 36  GLU A CD   5  
ATOM 9415  O OE1  . GLU A 1 36  ? 152.091 12.378  -110.555 1.00 0.00 ? 36  GLU A OE1  5  
ATOM 9416  O OE2  . GLU A 1 36  ? 153.340 13.626  -109.320 1.00 0.00 ? 36  GLU A OE2  5  
ATOM 9417  H H    . GLU A 1 36  ? 154.383 8.936   -110.172 1.00 0.00 ? 36  GLU A H    5  
ATOM 9418  H HA   . GLU A 1 36  ? 153.378 9.147   -107.568 1.00 0.00 ? 36  GLU A HA   5  
ATOM 9419  H HB2  . GLU A 1 36  ? 152.467 10.115  -110.241 1.00 0.00 ? 36  GLU A HB2  5  
ATOM 9420  H HB3  . GLU A 1 36  ? 151.278 10.163  -108.937 1.00 0.00 ? 36  GLU A HB3  5  
ATOM 9421  H HG2  . GLU A 1 36  ? 152.552 11.645  -107.649 1.00 0.00 ? 36  GLU A HG2  5  
ATOM 9422  H HG3  . GLU A 1 36  ? 154.054 11.225  -108.475 1.00 0.00 ? 36  GLU A HG3  5  
ATOM 9423  N N    . PHE A 1 37  ? 151.512 7.232   -109.501 1.00 0.00 ? 37  PHE A N    5  
ATOM 9424  C CA   . PHE A 1 37  ? 150.525 6.117   -109.457 1.00 0.00 ? 37  PHE A CA   5  
ATOM 9425  C C    . PHE A 1 37  ? 151.001 5.066   -108.461 1.00 0.00 ? 37  PHE A C    5  
ATOM 9426  O O    . PHE A 1 37  ? 150.421 4.833   -107.417 1.00 0.00 ? 37  PHE A O    5  
ATOM 9427  C CB   . PHE A 1 37  ? 150.504 5.421   -110.815 1.00 0.00 ? 37  PHE A CB   5  
ATOM 9428  C CG   . PHE A 1 37  ? 149.487 4.297   -110.798 1.00 0.00 ? 37  PHE A CG   5  
ATOM 9429  C CD1  . PHE A 1 37  ? 148.677 4.068   -109.671 1.00 0.00 ? 37  PHE A CD1  5  
ATOM 9430  C CD2  . PHE A 1 37  ? 149.340 3.494   -111.931 1.00 0.00 ? 37  PHE A CD2  5  
ATOM 9431  C CE1  . PHE A 1 37  ? 147.735 3.034   -109.686 1.00 0.00 ? 37  PHE A CE1  5  
ATOM 9432  C CE2  . PHE A 1 37  ? 148.397 2.460   -111.944 1.00 0.00 ? 37  PHE A CE2  5  
ATOM 9433  C CZ   . PHE A 1 37  ? 147.595 2.230   -110.821 1.00 0.00 ? 37  PHE A CZ   5  
ATOM 9434  H H    . PHE A 1 37  ? 151.881 7.521   -110.362 1.00 0.00 ? 37  PHE A H    5  
ATOM 9435  H HA   . PHE A 1 37  ? 149.531 6.476   -109.240 1.00 0.00 ? 37  PHE A HA   5  
ATOM 9436  H HB2  . PHE A 1 37  ? 150.240 6.134   -111.581 1.00 0.00 ? 37  PHE A HB2  5  
ATOM 9437  H HB3  . PHE A 1 37  ? 151.479 5.012   -111.025 1.00 0.00 ? 37  PHE A HB3  5  
ATOM 9438  H HD1  . PHE A 1 37  ? 148.776 4.684   -108.794 1.00 0.00 ? 37  PHE A HD1  5  
ATOM 9439  H HD2  . PHE A 1 37  ? 149.966 3.665   -112.791 1.00 0.00 ? 37  PHE A HD2  5  
ATOM 9440  H HE1  . PHE A 1 37  ? 147.116 2.856   -108.819 1.00 0.00 ? 37  PHE A HE1  5  
ATOM 9441  H HE2  . PHE A 1 37  ? 148.286 1.841   -112.821 1.00 0.00 ? 37  PHE A HE2  5  
ATOM 9442  H HZ   . PHE A 1 37  ? 146.867 1.435   -110.830 1.00 0.00 ? 37  PHE A HZ   5  
ATOM 9443  N N    . VAL A 1 38  ? 152.070 4.415   -108.834 1.00 0.00 ? 38  VAL A N    5  
ATOM 9444  C CA   . VAL A 1 38  ? 152.656 3.336   -108.003 1.00 0.00 ? 38  VAL A CA   5  
ATOM 9445  C C    . VAL A 1 38  ? 152.932 3.838   -106.586 1.00 0.00 ? 38  VAL A C    5  
ATOM 9446  O O    . VAL A 1 38  ? 152.784 3.117   -105.619 1.00 0.00 ? 38  VAL A O    5  
ATOM 9447  C CB   . VAL A 1 38  ? 153.966 2.870   -108.640 1.00 0.00 ? 38  VAL A CB   5  
ATOM 9448  C CG1  . VAL A 1 38  ? 154.539 1.696   -107.845 1.00 0.00 ? 38  VAL A CG1  5  
ATOM 9449  C CG2  . VAL A 1 38  ? 153.700 2.425   -110.081 1.00 0.00 ? 38  VAL A CG2  5  
ATOM 9450  H H    . VAL A 1 38  ? 152.482 4.647   -109.693 1.00 0.00 ? 38  VAL A H    5  
ATOM 9451  H HA   . VAL A 1 38  ? 151.965 2.507   -107.966 1.00 0.00 ? 38  VAL A HA   5  
ATOM 9452  H HB   . VAL A 1 38  ? 154.676 3.684   -108.639 1.00 0.00 ? 38  VAL A HB   5  
ATOM 9453  H HG11 . VAL A 1 38  ? 154.078 0.777   -108.177 1.00 0.00 ? 38  VAL A HG11 5  
ATOM 9454  H HG12 . VAL A 1 38  ? 154.339 1.841   -106.794 1.00 0.00 ? 38  VAL A HG12 5  
ATOM 9455  H HG13 . VAL A 1 38  ? 155.606 1.641   -108.005 1.00 0.00 ? 38  VAL A HG13 5  
ATOM 9456  H HG21 . VAL A 1 38  ? 154.586 1.957   -110.483 1.00 0.00 ? 38  VAL A HG21 5  
ATOM 9457  H HG22 . VAL A 1 38  ? 153.444 3.285   -110.682 1.00 0.00 ? 38  VAL A HG22 5  
ATOM 9458  H HG23 . VAL A 1 38  ? 152.882 1.719   -110.094 1.00 0.00 ? 38  VAL A HG23 5  
ATOM 9459  N N    . LYS A 1 39  ? 153.308 5.083   -106.456 1.00 0.00 ? 39  LYS A N    5  
ATOM 9460  C CA   . LYS A 1 39  ? 153.567 5.642   -105.101 1.00 0.00 ? 39  LYS A CA   5  
ATOM 9461  C C    . LYS A 1 39  ? 152.309 5.460   -104.253 1.00 0.00 ? 39  LYS A C    5  
ATOM 9462  O O    . LYS A 1 39  ? 152.307 4.739   -103.276 1.00 0.00 ? 39  LYS A O    5  
ATOM 9463  C CB   . LYS A 1 39  ? 153.911 7.130   -105.210 1.00 0.00 ? 39  LYS A CB   5  
ATOM 9464  C CG   . LYS A 1 39  ? 155.335 7.287   -105.745 1.00 0.00 ? 39  LYS A CG   5  
ATOM 9465  C CD   . LYS A 1 39  ? 156.332 7.162   -104.591 1.00 0.00 ? 39  LYS A CD   5  
ATOM 9466  C CE   . LYS A 1 39  ? 156.930 8.536   -104.282 1.00 0.00 ? 39  LYS A CE   5  
ATOM 9467  N NZ   . LYS A 1 39  ? 155.852 9.564   -104.311 1.00 0.00 ? 39  LYS A NZ   5  
ATOM 9468  H H    . LYS A 1 39  ? 153.403 5.652   -107.247 1.00 0.00 ? 39  LYS A H    5  
ATOM 9469  H HA   . LYS A 1 39  ? 154.381 5.110   -104.631 1.00 0.00 ? 39  LYS A HA   5  
ATOM 9470  H HB2  . LYS A 1 39  ? 153.217 7.610   -105.885 1.00 0.00 ? 39  LYS A HB2  5  
ATOM 9471  H HB3  . LYS A 1 39  ? 153.842 7.588   -104.235 1.00 0.00 ? 39  LYS A HB3  5  
ATOM 9472  H HG2  . LYS A 1 39  ? 155.532 6.517   -106.476 1.00 0.00 ? 39  LYS A HG2  5  
ATOM 9473  H HG3  . LYS A 1 39  ? 155.442 8.258   -106.207 1.00 0.00 ? 39  LYS A HG3  5  
ATOM 9474  H HD2  . LYS A 1 39  ? 155.824 6.785   -103.715 1.00 0.00 ? 39  LYS A HD2  5  
ATOM 9475  H HD3  . LYS A 1 39  ? 157.123 6.483   -104.870 1.00 0.00 ? 39  LYS A HD3  5  
ATOM 9476  H HE2  . LYS A 1 39  ? 157.385 8.519   -103.302 1.00 0.00 ? 39  LYS A HE2  5  
ATOM 9477  H HE3  . LYS A 1 39  ? 157.678 8.778   -105.022 1.00 0.00 ? 39  LYS A HE3  5  
ATOM 9478  H HZ1  . LYS A 1 39  ? 155.058 9.253   -103.717 1.00 0.00 ? 39  LYS A HZ1  5  
ATOM 9479  H HZ2  . LYS A 1 39  ? 155.524 9.694   -105.290 1.00 0.00 ? 39  LYS A HZ2  5  
ATOM 9480  H HZ3  . LYS A 1 39  ? 156.222 10.465  -103.946 1.00 0.00 ? 39  LYS A HZ3  5  
ATOM 9481  N N    . ALA A 1 40  ? 151.240 6.124   -104.607 1.00 0.00 ? 40  ALA A N    5  
ATOM 9482  C CA   . ALA A 1 40  ? 149.994 5.996   -103.799 1.00 0.00 ? 40  ALA A CA   5  
ATOM 9483  C C    . ALA A 1 40  ? 149.582 4.526   -103.716 1.00 0.00 ? 40  ALA A C    5  
ATOM 9484  O O    . ALA A 1 40  ? 149.067 4.075   -102.706 1.00 0.00 ? 40  ALA A O    5  
ATOM 9485  C CB   . ALA A 1 40  ? 148.871 6.822   -104.428 1.00 0.00 ? 40  ALA A CB   5  
ATOM 9486  H H    . ALA A 1 40  ? 151.262 6.713   -105.393 1.00 0.00 ? 40  ALA A H    5  
ATOM 9487  H HA   . ALA A 1 40  ? 150.196 6.348   -102.799 1.00 0.00 ? 40  ALA A HA   5  
ATOM 9488  H HB1  . ALA A 1 40  ? 148.582 6.379   -105.369 1.00 0.00 ? 40  ALA A HB1  5  
ATOM 9489  H HB2  . ALA A 1 40  ? 149.218 7.832   -104.597 1.00 0.00 ? 40  ALA A HB2  5  
ATOM 9490  H HB3  . ALA A 1 40  ? 148.021 6.841   -103.762 1.00 0.00 ? 40  ALA A HB3  5  
ATOM 9491  N N    . PHE A 1 41  ? 149.855 3.745   -104.726 1.00 0.00 ? 41  PHE A N    5  
ATOM 9492  C CA   . PHE A 1 41  ? 149.514 2.303   -104.637 1.00 0.00 ? 41  PHE A CA   5  
ATOM 9493  C C    . PHE A 1 41  ? 150.481 1.673   -103.645 1.00 0.00 ? 41  PHE A C    5  
ATOM 9494  O O    . PHE A 1 41  ? 150.115 1.356   -102.531 1.00 0.00 ? 41  PHE A O    5  
ATOM 9495  C CB   . PHE A 1 41  ? 149.696 1.651   -106.009 1.00 0.00 ? 41  PHE A CB   5  
ATOM 9496  C CG   . PHE A 1 41  ? 148.528 0.737   -106.291 1.00 0.00 ? 41  PHE A CG   5  
ATOM 9497  C CD1  . PHE A 1 41  ? 147.264 1.278   -106.553 1.00 0.00 ? 41  PHE A CD1  5  
ATOM 9498  C CD2  . PHE A 1 41  ? 148.710 -0.651  -106.289 1.00 0.00 ? 41  PHE A CD2  5  
ATOM 9499  C CE1  . PHE A 1 41  ? 146.180 0.430   -106.813 1.00 0.00 ? 41  PHE A CE1  5  
ATOM 9500  C CE2  . PHE A 1 41  ? 147.627 -1.499  -106.550 1.00 0.00 ? 41  PHE A CE2  5  
ATOM 9501  C CZ   . PHE A 1 41  ? 146.361 -0.959  -106.811 1.00 0.00 ? 41  PHE A CZ   5  
ATOM 9502  H H    . PHE A 1 41  ? 150.332 4.066   -105.520 1.00 0.00 ? 41  PHE A H    5  
ATOM 9503  H HA   . PHE A 1 41  ? 148.495 2.167   -104.302 1.00 0.00 ? 41  PHE A HA   5  
ATOM 9504  H HB2  . PHE A 1 41  ? 149.745 2.419   -106.769 1.00 0.00 ? 41  PHE A HB2  5  
ATOM 9505  H HB3  . PHE A 1 41  ? 150.612 1.078   -106.017 1.00 0.00 ? 41  PHE A HB3  5  
ATOM 9506  H HD1  . PHE A 1 41  ? 147.124 2.348   -106.554 1.00 0.00 ? 41  PHE A HD1  5  
ATOM 9507  H HD2  . PHE A 1 41  ? 149.686 -1.068  -106.087 1.00 0.00 ? 41  PHE A HD2  5  
ATOM 9508  H HE1  . PHE A 1 41  ? 145.205 0.847   -107.015 1.00 0.00 ? 41  PHE A HE1  5  
ATOM 9509  H HE2  . PHE A 1 41  ? 147.766 -2.570  -106.548 1.00 0.00 ? 41  PHE A HE2  5  
ATOM 9510  H HZ   . PHE A 1 41  ? 145.526 -1.613  -107.012 1.00 0.00 ? 41  PHE A HZ   5  
ATOM 9511  N N    . ASN A 1 42  ? 151.697 1.435   -104.046 1.00 0.00 ? 42  ASN A N    5  
ATOM 9512  C CA   . ASN A 1 42  ? 152.657 0.766   -103.136 1.00 0.00 ? 42  ASN A CA   5  
ATOM 9513  C C    . ASN A 1 42  ? 152.527 1.319   -101.717 1.00 0.00 ? 42  ASN A C    5  
ATOM 9514  O O    . ASN A 1 42  ? 152.693 0.631   -100.731 1.00 0.00 ? 42  ASN A O    5  
ATOM 9515  C CB   . ASN A 1 42  ? 154.073 1.073   -103.631 1.00 0.00 ? 42  ASN A CB   5  
ATOM 9516  C CG   . ASN A 1 42  ? 154.650 -0.160  -104.330 1.00 0.00 ? 42  ASN A CG   5  
ATOM 9517  O OD1  . ASN A 1 42  ? 155.286 -0.985  -103.704 1.00 0.00 ? 42  ASN A OD1  5  
ATOM 9518  N ND2  . ASN A 1 42  ? 154.452 -0.323  -105.609 1.00 0.00 ? 42  ASN A ND2  5  
ATOM 9519  H H    . ASN A 1 42  ? 151.979 1.613   -104.967 1.00 0.00 ? 42  ASN A H    5  
ATOM 9520  H HA   . ASN A 1 42  ? 152.501 -0.300  -103.211 1.00 0.00 ? 42  ASN A HA   5  
ATOM 9521  H HB2  . ASN A 1 42  ? 154.040 1.899   -104.326 1.00 0.00 ? 42  ASN A HB2  5  
ATOM 9522  H HB3  . ASN A 1 42  ? 154.700 1.334   -102.792 1.00 0.00 ? 42  ASN A HB3  5  
ATOM 9523  H HD21 . ASN A 1 42  ? 153.938 0.342   -106.114 1.00 0.00 ? 42  ASN A HD21 5  
ATOM 9524  H HD22 . ASN A 1 42  ? 154.817 -1.108  -106.066 1.00 0.00 ? 42  ASN A HD22 5  
ATOM 9525  N N    . ALA A 1 43  ? 152.233 2.594   -101.646 1.00 0.00 ? 43  ALA A N    5  
ATOM 9526  C CA   . ALA A 1 43  ? 152.078 3.299   -100.344 1.00 0.00 ? 43  ALA A CA   5  
ATOM 9527  C C    . ALA A 1 43  ? 150.860 2.775   -99.586  1.00 0.00 ? 43  ALA A C    5  
ATOM 9528  O O    . ALA A 1 43  ? 150.873 2.651   -98.375  1.00 0.00 ? 43  ALA A O    5  
ATOM 9529  C CB   . ALA A 1 43  ? 151.863 4.788   -100.627 1.00 0.00 ? 43  ALA A CB   5  
ATOM 9530  H H    . ALA A 1 43  ? 152.115 3.101   -102.477 1.00 0.00 ? 43  ALA A H    5  
ATOM 9531  H HA   . ALA A 1 43  ? 152.981 3.193   -99.759  1.00 0.00 ? 43  ALA A HA   5  
ATOM 9532  H HB1  . ALA A 1 43  ? 151.701 5.311   -99.696  1.00 0.00 ? 43  ALA A HB1  5  
ATOM 9533  H HB2  . ALA A 1 43  ? 151.001 4.912   -101.265 1.00 0.00 ? 43  ALA A HB2  5  
ATOM 9534  H HB3  . ALA A 1 43  ? 152.736 5.191   -101.119 1.00 0.00 ? 43  ALA A HB3  5  
ATOM 9535  N N    . ALA A 1 44  ? 149.811 2.435   -100.289 1.00 0.00 ? 44  ALA A N    5  
ATOM 9536  C CA   . ALA A 1 44  ? 148.611 1.901   -99.586  1.00 0.00 ? 44  ALA A CA   5  
ATOM 9537  C C    . ALA A 1 44  ? 148.729 0.389   -99.502  1.00 0.00 ? 44  ALA A C    5  
ATOM 9538  O O    . ALA A 1 44  ? 148.632 -0.205  -98.446  1.00 0.00 ? 44  ALA A O    5  
ATOM 9539  C CB   . ALA A 1 44  ? 147.329 2.280   -100.324 1.00 0.00 ? 44  ALA A CB   5  
ATOM 9540  H H    . ALA A 1 44  ? 149.834 2.490   -101.273 1.00 0.00 ? 44  ALA A H    5  
ATOM 9541  H HA   . ALA A 1 44  ? 148.605 2.270   -98.573  1.00 0.00 ? 44  ALA A HA   5  
ATOM 9542  H HB1  . ALA A 1 44  ? 146.480 1.839   -99.821  1.00 0.00 ? 44  ALA A HB1  5  
ATOM 9543  H HB2  . ALA A 1 44  ? 147.376 1.906   -101.338 1.00 0.00 ? 44  ALA A HB2  5  
ATOM 9544  H HB3  . ALA A 1 44  ? 147.222 3.353   -100.339 1.00 0.00 ? 44  ALA A HB3  5  
ATOM 9545  N N    . THR A 1 45  ? 148.966 -0.229  -100.617 1.00 0.00 ? 45  THR A N    5  
ATOM 9546  C CA   . THR A 1 45  ? 149.123 -1.696  -100.635 1.00 0.00 ? 45  THR A CA   5  
ATOM 9547  C C    . THR A 1 45  ? 150.205 -2.077  -99.627  1.00 0.00 ? 45  THR A C    5  
ATOM 9548  O O    . THR A 1 45  ? 150.172 -3.136  -99.032  1.00 0.00 ? 45  THR A O    5  
ATOM 9549  C CB   . THR A 1 45  ? 149.524 -2.112  -102.042 1.00 0.00 ? 45  THR A CB   5  
ATOM 9550  O OG1  . THR A 1 45  ? 150.883 -1.766  -102.273 1.00 0.00 ? 45  THR A OG1  5  
ATOM 9551  C CG2  . THR A 1 45  ? 148.625 -1.385  -103.044 1.00 0.00 ? 45  THR A CG2  5  
ATOM 9552  H H    . THR A 1 45  ? 149.058 0.281   -101.449 1.00 0.00 ? 45  THR A H    5  
ATOM 9553  H HA   . THR A 1 45  ? 148.191 -2.167  -100.364 1.00 0.00 ? 45  THR A HA   5  
ATOM 9554  H HB   . THR A 1 45  ? 149.396 -3.168  -102.153 1.00 0.00 ? 45  THR A HB   5  
ATOM 9555  H HG1  . THR A 1 45  ? 151.151 -2.158  -103.107 1.00 0.00 ? 45  THR A HG1  5  
ATOM 9556  H HG21 . THR A 1 45  ? 147.626 -1.307  -102.638 1.00 0.00 ? 45  THR A HG21 5  
ATOM 9557  H HG22 . THR A 1 45  ? 148.595 -1.935  -103.970 1.00 0.00 ? 45  THR A HG22 5  
ATOM 9558  H HG23 . THR A 1 45  ? 149.015 -0.394  -103.225 1.00 0.00 ? 45  THR A HG23 5  
ATOM 9559  N N    . ALA A 1 46  ? 151.150 -1.202  -99.406  1.00 0.00 ? 46  ALA A N    5  
ATOM 9560  C CA   . ALA A 1 46  ? 152.213 -1.494  -98.410  1.00 0.00 ? 46  ALA A CA   5  
ATOM 9561  C C    . ALA A 1 46  ? 151.668 -1.149  -97.025  1.00 0.00 ? 46  ALA A C    5  
ATOM 9562  O O    . ALA A 1 46  ? 151.774 -1.921  -96.093  1.00 0.00 ? 46  ALA A O    5  
ATOM 9563  C CB   . ALA A 1 46  ? 153.454 -0.647  -98.701  1.00 0.00 ? 46  ALA A CB   5  
ATOM 9564  H H    . ALA A 1 46  ? 151.144 -0.343  -99.880  1.00 0.00 ? 46  ALA A H    5  
ATOM 9565  H HA   . ALA A 1 46  ? 152.470 -2.544  -98.448  1.00 0.00 ? 46  ALA A HA   5  
ATOM 9566  H HB1  . ALA A 1 46  ? 153.825 -0.877  -99.688  1.00 0.00 ? 46  ALA A HB1  5  
ATOM 9567  H HB2  . ALA A 1 46  ? 154.218 -0.865  -97.970  1.00 0.00 ? 46  ALA A HB2  5  
ATOM 9568  H HB3  . ALA A 1 46  ? 153.196 0.400   -98.647  1.00 0.00 ? 46  ALA A HB3  5  
ATOM 9569  N N    . ASN A 1 47  ? 151.064 0.004   -96.888  1.00 0.00 ? 47  ASN A N    5  
ATOM 9570  C CA   . ASN A 1 47  ? 150.492 0.386   -95.569  1.00 0.00 ? 47  ASN A CA   5  
ATOM 9571  C C    . ASN A 1 47  ? 149.580 -0.740  -95.077  1.00 0.00 ? 47  ASN A C    5  
ATOM 9572  O O    . ASN A 1 47  ? 149.329 -0.880  -93.896  1.00 0.00 ? 47  ASN A O    5  
ATOM 9573  C CB   . ASN A 1 47  ? 149.672 1.669   -95.723  1.00 0.00 ? 47  ASN A CB   5  
ATOM 9574  C CG   . ASN A 1 47  ? 150.614 2.853   -95.949  1.00 0.00 ? 47  ASN A CG   5  
ATOM 9575  O OD1  . ASN A 1 47  ? 150.184 3.918   -96.346  1.00 0.00 ? 47  ASN A OD1  5  
ATOM 9576  N ND2  . ASN A 1 47  ? 151.889 2.712   -95.711  1.00 0.00 ? 47  ASN A ND2  5  
ATOM 9577  H H    . ASN A 1 47  ? 150.977 0.612   -97.657  1.00 0.00 ? 47  ASN A H    5  
ATOM 9578  H HA   . ASN A 1 47  ? 151.288 0.553   -94.859  1.00 0.00 ? 47  ASN A HA   5  
ATOM 9579  H HB2  . ASN A 1 47  ? 149.005 1.571   -96.566  1.00 0.00 ? 47  ASN A HB2  5  
ATOM 9580  H HB3  . ASN A 1 47  ? 149.096 1.837   -94.826  1.00 0.00 ? 47  ASN A HB3  5  
ATOM 9581  H HD21 . ASN A 1 47  ? 152.236 1.853   -95.391  1.00 0.00 ? 47  ASN A HD21 5  
ATOM 9582  H HD22 . ASN A 1 47  ? 152.501 3.465   -95.854  1.00 0.00 ? 47  ASN A HD22 5  
ATOM 9583  N N    . MET A 1 48  ? 149.080 -1.547  -95.978  1.00 0.00 ? 48  MET A N    5  
ATOM 9584  C CA   . MET A 1 48  ? 148.183 -2.665  -95.566  1.00 0.00 ? 48  MET A CA   5  
ATOM 9585  C C    . MET A 1 48  ? 148.914 -4.000  -95.731  1.00 0.00 ? 48  MET A C    5  
ATOM 9586  O O    . MET A 1 48  ? 149.489 -4.514  -94.791  1.00 0.00 ? 48  MET A O    5  
ATOM 9587  C CB   . MET A 1 48  ? 146.927 -2.660  -96.442  1.00 0.00 ? 48  MET A CB   5  
ATOM 9588  C CG   . MET A 1 48  ? 147.323 -2.464  -97.908  1.00 0.00 ? 48  MET A CG   5  
ATOM 9589  S SD   . MET A 1 48  ? 146.785 -3.897  -98.876  1.00 0.00 ? 48  MET A SD   5  
ATOM 9590  C CE   . MET A 1 48  ? 145.605 -3.032  -99.944  1.00 0.00 ? 48  MET A CE   5  
ATOM 9591  H H    . MET A 1 48  ? 149.296 -1.417  -96.926  1.00 0.00 ? 48  MET A H    5  
ATOM 9592  H HA   . MET A 1 48  ? 147.900 -2.536  -94.532  1.00 0.00 ? 48  MET A HA   5  
ATOM 9593  H HB2  . MET A 1 48  ? 146.409 -3.603  -96.332  1.00 0.00 ? 48  MET A HB2  5  
ATOM 9594  H HB3  . MET A 1 48  ? 146.278 -1.855  -96.136  1.00 0.00 ? 48  MET A HB3  5  
ATOM 9595  H HG2  . MET A 1 48  ? 146.852 -1.572  -98.291  1.00 0.00 ? 48  MET A HG2  5  
ATOM 9596  H HG3  . MET A 1 48  ? 148.395 -2.363  -97.980  1.00 0.00 ? 48  MET A HG3  5  
ATOM 9597  H HE1  . MET A 1 48  ? 145.104 -2.260  -99.376  1.00 0.00 ? 48  MET A HE1  5  
ATOM 9598  H HE2  . MET A 1 48  ? 144.875 -3.731  -100.316 1.00 0.00 ? 48  MET A HE2  5  
ATOM 9599  H HE3  . MET A 1 48  ? 146.132 -2.587  -100.777 1.00 0.00 ? 48  MET A HE3  5  
ATOM 9600  N N    . GLY A 1 49  ? 148.899 -4.580  -96.902  1.00 0.00 ? 49  GLY A N    5  
ATOM 9601  C CA   . GLY A 1 49  ? 149.597 -5.888  -97.072  1.00 0.00 ? 49  GLY A CA   5  
ATOM 9602  C C    . GLY A 1 49  ? 149.781 -6.219  -98.556  1.00 0.00 ? 49  GLY A C    5  
ATOM 9603  O O    . GLY A 1 49  ? 150.158 -5.378  -99.347  1.00 0.00 ? 49  GLY A O    5  
ATOM 9604  H H    . GLY A 1 49  ? 148.428 -4.167  -97.656  1.00 0.00 ? 49  GLY A H    5  
ATOM 9605  H HA2  . GLY A 1 49  ? 150.566 -5.837  -96.596  1.00 0.00 ? 49  GLY A HA2  5  
ATOM 9606  H HA3  . GLY A 1 49  ? 149.013 -6.666  -96.606  1.00 0.00 ? 49  GLY A HA3  5  
ATOM 9607  N N    . ASP A 1 50  ? 149.517 -7.442  -98.938  1.00 0.00 ? 50  ASP A N    5  
ATOM 9608  C CA   . ASP A 1 50  ? 149.679 -7.825  -100.370 1.00 0.00 ? 50  ASP A CA   5  
ATOM 9609  C C    . ASP A 1 50  ? 148.373 -8.426  -100.893 1.00 0.00 ? 50  ASP A C    5  
ATOM 9610  O O    . ASP A 1 50  ? 147.830 -9.350  -100.321 1.00 0.00 ? 50  ASP A O    5  
ATOM 9611  C CB   . ASP A 1 50  ? 150.803 -8.856  -100.500 1.00 0.00 ? 50  ASP A CB   5  
ATOM 9612  C CG   . ASP A 1 50  ? 152.131 -8.217  -100.089 1.00 0.00 ? 50  ASP A CG   5  
ATOM 9613  O OD1  . ASP A 1 50  ? 152.135 -7.475  -99.122  1.00 0.00 ? 50  ASP A OD1  5  
ATOM 9614  O OD2  . ASP A 1 50  ? 153.122 -8.482  -100.750 1.00 0.00 ? 50  ASP A OD2  5  
ATOM 9615  H H    . ASP A 1 50  ? 149.215 -8.105  -98.284  1.00 0.00 ? 50  ASP A H    5  
ATOM 9616  H HA   . ASP A 1 50  ? 149.924 -6.951  -100.948 1.00 0.00 ? 50  ASP A HA   5  
ATOM 9617  H HB2  . ASP A 1 50  ? 150.594 -9.699  -99.857  1.00 0.00 ? 50  ASP A HB2  5  
ATOM 9618  H HB3  . ASP A 1 50  ? 150.868 -9.191  -101.524 1.00 0.00 ? 50  ASP A HB3  5  
ATOM 9619  N N    . ALA A 1 51  ? 147.855 -7.898  -101.970 1.00 0.00 ? 51  ALA A N    5  
ATOM 9620  C CA   . ALA A 1 51  ? 146.573 -8.433  -102.516 1.00 0.00 ? 51  ALA A CA   5  
ATOM 9621  C C    . ALA A 1 51  ? 146.421 -8.048  -103.996 1.00 0.00 ? 51  ALA A C    5  
ATOM 9622  O O    . ALA A 1 51  ? 147.386 -7.813  -104.695 1.00 0.00 ? 51  ALA A O    5  
ATOM 9623  C CB   . ALA A 1 51  ? 145.402 -7.861  -101.712 1.00 0.00 ? 51  ALA A CB   5  
ATOM 9624  H H    . ALA A 1 51  ? 148.301 -7.139  -102.410 1.00 0.00 ? 51  ALA A H    5  
ATOM 9625  H HA   . ALA A 1 51  ? 146.571 -9.510  -102.428 1.00 0.00 ? 51  ALA A HA   5  
ATOM 9626  H HB1  . ALA A 1 51  ? 144.850 -7.165  -102.324 1.00 0.00 ? 51  ALA A HB1  5  
ATOM 9627  H HB2  . ALA A 1 51  ? 145.780 -7.349  -100.839 1.00 0.00 ? 51  ALA A HB2  5  
ATOM 9628  H HB3  . ALA A 1 51  ? 144.749 -8.664  -101.403 1.00 0.00 ? 51  ALA A HB3  5  
ATOM 9629  N N    . ILE A 1 52  ? 145.201 -7.949  -104.454 1.00 0.00 ? 52  ILE A N    5  
ATOM 9630  C CA   . ILE A 1 52  ? 144.925 -7.542  -105.868 1.00 0.00 ? 52  ILE A CA   5  
ATOM 9631  C C    . ILE A 1 52  ? 143.611 -6.763  -105.859 1.00 0.00 ? 52  ILE A C    5  
ATOM 9632  O O    . ILE A 1 52  ? 142.704 -7.069  -105.111 1.00 0.00 ? 52  ILE A O    5  
ATOM 9633  C CB   . ILE A 1 52  ? 144.773 -8.770  -106.767 1.00 0.00 ? 52  ILE A CB   5  
ATOM 9634  C CG1  . ILE A 1 52  ? 146.122 -9.480  -106.910 1.00 0.00 ? 52  ILE A CG1  5  
ATOM 9635  C CG2  . ILE A 1 52  ? 144.285 -8.322  -108.149 1.00 0.00 ? 52  ILE A CG2  5  
ATOM 9636  C CD1  . ILE A 1 52  ? 146.921 -8.834  -108.040 1.00 0.00 ? 52  ILE A CD1  5  
ATOM 9637  H H    . ILE A 1 52  ? 144.448 -8.090  -103.844 1.00 0.00 ? 52  ILE A H    5  
ATOM 9638  H HA   . ILE A 1 52  ? 145.717 -6.903  -106.232 1.00 0.00 ? 52  ILE A HA   5  
ATOM 9639  H HB   . ILE A 1 52  ? 144.051 -9.447  -106.333 1.00 0.00 ? 52  ILE A HB   5  
ATOM 9640  H HG12 . ILE A 1 52  ? 146.672 -9.398  -105.984 1.00 0.00 ? 52  ILE A HG12 5  
ATOM 9641  H HG13 . ILE A 1 52  ? 145.957 -10.522 -107.139 1.00 0.00 ? 52  ILE A HG13 5  
ATOM 9642  H HG21 . ILE A 1 52  ? 143.226 -8.111  -108.106 1.00 0.00 ? 52  ILE A HG21 5  
ATOM 9643  H HG22 . ILE A 1 52  ? 144.466 -9.107  -108.869 1.00 0.00 ? 52  ILE A HG22 5  
ATOM 9644  H HG23 . ILE A 1 52  ? 144.817 -7.431  -108.448 1.00 0.00 ? 52  ILE A HG23 5  
ATOM 9645  H HD11 . ILE A 1 52  ? 146.681 -9.320  -108.974 1.00 0.00 ? 52  ILE A HD11 5  
ATOM 9646  H HD12 . ILE A 1 52  ? 147.976 -8.938  -107.839 1.00 0.00 ? 52  ILE A HD12 5  
ATOM 9647  H HD13 . ILE A 1 52  ? 146.668 -7.785  -108.105 1.00 0.00 ? 52  ILE A HD13 5  
ATOM 9648  N N    . VAL A 1 53  ? 143.498 -5.752  -106.680 1.00 0.00 ? 53  VAL A N    5  
ATOM 9649  C CA   . VAL A 1 53  ? 142.236 -4.962  -106.699 1.00 0.00 ? 53  VAL A CA   5  
ATOM 9650  C C    . VAL A 1 53  ? 141.925 -4.484  -108.126 1.00 0.00 ? 53  VAL A C    5  
ATOM 9651  O O    . VAL A 1 53  ? 142.802 -4.011  -108.830 1.00 0.00 ? 53  VAL A O    5  
ATOM 9652  C CB   . VAL A 1 53  ? 142.403 -3.740  -105.793 1.00 0.00 ? 53  VAL A CB   5  
ATOM 9653  C CG1  . VAL A 1 53  ? 141.034 -3.109  -105.515 1.00 0.00 ? 53  VAL A CG1  5  
ATOM 9654  C CG2  . VAL A 1 53  ? 143.049 -4.174  -104.475 1.00 0.00 ? 53  VAL A CG2  5  
ATOM 9655  H H    . VAL A 1 53  ? 144.241 -5.507  -107.273 1.00 0.00 ? 53  VAL A H    5  
ATOM 9656  H HA   . VAL A 1 53  ? 141.429 -5.570  -106.329 1.00 0.00 ? 53  VAL A HA   5  
ATOM 9657  H HB   . VAL A 1 53  ? 143.037 -3.016  -106.283 1.00 0.00 ? 53  VAL A HB   5  
ATOM 9658  H HG11 . VAL A 1 53  ? 140.591 -2.786  -106.445 1.00 0.00 ? 53  VAL A HG11 5  
ATOM 9659  H HG12 . VAL A 1 53  ? 141.156 -2.258  -104.860 1.00 0.00 ? 53  VAL A HG12 5  
ATOM 9660  H HG13 . VAL A 1 53  ? 140.391 -3.836  -105.043 1.00 0.00 ? 53  VAL A HG13 5  
ATOM 9661  H HG21 . VAL A 1 53  ? 142.960 -3.378  -103.750 1.00 0.00 ? 53  VAL A HG21 5  
ATOM 9662  H HG22 . VAL A 1 53  ? 144.093 -4.394  -104.641 1.00 0.00 ? 53  VAL A HG22 5  
ATOM 9663  H HG23 . VAL A 1 53  ? 142.551 -5.057  -104.103 1.00 0.00 ? 53  VAL A HG23 5  
ATOM 9664  N N    . PRO A 1 54  ? 140.677 -4.580  -108.536 1.00 0.00 ? 54  PRO A N    5  
ATOM 9665  C CA   . PRO A 1 54  ? 140.254 -4.105  -109.883 1.00 0.00 ? 54  PRO A CA   5  
ATOM 9666  C C    . PRO A 1 54  ? 140.200 -2.574  -109.927 1.00 0.00 ? 54  PRO A C    5  
ATOM 9667  O O    . PRO A 1 54  ? 139.195 -1.975  -109.600 1.00 0.00 ? 54  PRO A O    5  
ATOM 9668  C CB   . PRO A 1 54  ? 138.848 -4.689  -110.013 1.00 0.00 ? 54  PRO A CB   5  
ATOM 9669  C CG   . PRO A 1 54  ? 138.402 -5.197  -108.637 1.00 0.00 ? 54  PRO A CG   5  
ATOM 9670  C CD   . PRO A 1 54  ? 139.609 -5.180  -107.693 1.00 0.00 ? 54  PRO A CD   5  
ATOM 9671  H HA   . PRO A 1 54  ? 140.890 -4.498  -110.655 1.00 0.00 ? 54  PRO A HA   5  
ATOM 9672  H HB2  . PRO A 1 54  ? 138.167 -3.924  -110.358 1.00 0.00 ? 54  PRO A HB2  5  
ATOM 9673  H HB3  . PRO A 1 54  ? 138.858 -5.510  -110.713 1.00 0.00 ? 54  PRO A HB3  5  
ATOM 9674  H HG2  . PRO A 1 54  ? 137.625 -4.555  -108.248 1.00 0.00 ? 54  PRO A HG2  5  
ATOM 9675  H HG3  . PRO A 1 54  ? 138.028 -6.207  -108.726 1.00 0.00 ? 54  PRO A HG3  5  
ATOM 9676  H HD2  . PRO A 1 54  ? 139.406 -4.569  -106.825 1.00 0.00 ? 54  PRO A HD2  5  
ATOM 9677  H HD3  . PRO A 1 54  ? 139.878 -6.183  -107.407 1.00 0.00 ? 54  PRO A HD3  5  
ATOM 9678  N N    . VAL A 1 55  ? 141.279 -1.932  -110.280 1.00 0.00 ? 55  VAL A N    5  
ATOM 9679  C CA   . VAL A 1 55  ? 141.274 -0.442  -110.282 1.00 0.00 ? 55  VAL A CA   5  
ATOM 9680  C C    . VAL A 1 55  ? 140.261 0.131   -111.257 1.00 0.00 ? 55  VAL A C    5  
ATOM 9681  O O    . VAL A 1 55  ? 140.139 -0.279  -112.401 1.00 0.00 ? 55  VAL A O    5  
ATOM 9682  C CB   . VAL A 1 55  ? 142.635 0.112   -110.661 1.00 0.00 ? 55  VAL A CB   5  
ATOM 9683  C CG1  . VAL A 1 55  ? 143.601 -0.058  -109.494 1.00 0.00 ? 55  VAL A CG1  5  
ATOM 9684  C CG2  . VAL A 1 55  ? 143.149 -0.619  -111.899 1.00 0.00 ? 55  VAL A CG2  5  
ATOM 9685  H H    . VAL A 1 55  ? 142.094 -2.423  -110.510 1.00 0.00 ? 55  VAL A H    5  
ATOM 9686  H HA   . VAL A 1 55  ? 141.027 -0.098  -109.289 1.00 0.00 ? 55  VAL A HA   5  
ATOM 9687  H HB   . VAL A 1 55  ? 142.535 1.163   -110.881 1.00 0.00 ? 55  VAL A HB   5  
ATOM 9688  H HG11 . VAL A 1 55  ? 143.058 0.046   -108.565 1.00 0.00 ? 55  VAL A HG11 5  
ATOM 9689  H HG12 . VAL A 1 55  ? 144.365 0.702   -109.551 1.00 0.00 ? 55  VAL A HG12 5  
ATOM 9690  H HG13 . VAL A 1 55  ? 144.053 -1.035  -109.541 1.00 0.00 ? 55  VAL A HG13 5  
ATOM 9691  H HG21 . VAL A 1 55  ? 144.017 -0.107  -112.284 1.00 0.00 ? 55  VAL A HG21 5  
ATOM 9692  H HG22 . VAL A 1 55  ? 142.374 -0.628  -112.653 1.00 0.00 ? 55  VAL A HG22 5  
ATOM 9693  H HG23 . VAL A 1 55  ? 143.410 -1.632  -111.638 1.00 0.00 ? 55  VAL A HG23 5  
ATOM 9694  N N    . GLU A 1 56  ? 139.589 1.132   -110.786 1.00 0.00 ? 56  GLU A N    5  
ATOM 9695  C CA   . GLU A 1 56  ? 138.593 1.880   -111.583 1.00 0.00 ? 56  GLU A CA   5  
ATOM 9696  C C    . GLU A 1 56  ? 138.961 3.347   -111.441 1.00 0.00 ? 56  GLU A C    5  
ATOM 9697  O O    . GLU A 1 56  ? 138.238 4.142   -110.874 1.00 0.00 ? 56  GLU A O    5  
ATOM 9698  C CB   . GLU A 1 56  ? 137.190 1.640   -111.019 1.00 0.00 ? 56  GLU A CB   5  
ATOM 9699  C CG   . GLU A 1 56  ? 137.017 0.155   -110.693 1.00 0.00 ? 56  GLU A CG   5  
ATOM 9700  C CD   . GLU A 1 56  ? 135.585 -0.098  -110.219 1.00 0.00 ? 56  GLU A CD   5  
ATOM 9701  O OE1  . GLU A 1 56  ? 135.320 0.128   -109.049 1.00 0.00 ? 56  GLU A OE1  5  
ATOM 9702  O OE2  . GLU A 1 56  ? 134.776 -0.516  -111.032 1.00 0.00 ? 56  GLU A OE2  5  
ATOM 9703  H H    . GLU A 1 56  ? 139.781 1.431   -109.872 1.00 0.00 ? 56  GLU A H    5  
ATOM 9704  H HA   . GLU A 1 56  ? 138.624 1.623   -112.628 1.00 0.00 ? 56  GLU A HA   5  
ATOM 9705  H HB2  . GLU A 1 56  ? 137.059 2.226   -110.120 1.00 0.00 ? 56  GLU A HB2  5  
ATOM 9706  H HB3  . GLU A 1 56  ? 136.453 1.935   -111.752 1.00 0.00 ? 56  GLU A HB3  5  
ATOM 9707  H HG2  . GLU A 1 56  ? 137.213 -0.433  -111.578 1.00 0.00 ? 56  GLU A HG2  5  
ATOM 9708  H HG3  . GLU A 1 56  ? 137.707 -0.125  -109.913 1.00 0.00 ? 56  GLU A HG3  5  
ATOM 9709  N N    . ILE A 1 57  ? 140.115 3.695   -111.940 1.00 0.00 ? 57  ILE A N    5  
ATOM 9710  C CA   . ILE A 1 57  ? 140.593 5.094   -111.832 1.00 0.00 ? 57  ILE A CA   5  
ATOM 9711  C C    . ILE A 1 57  ? 139.686 6.032   -112.626 1.00 0.00 ? 57  ILE A C    5  
ATOM 9712  O O    . ILE A 1 57  ? 139.890 6.276   -113.807 1.00 0.00 ? 57  ILE A O    5  
ATOM 9713  C CB   . ILE A 1 57  ? 142.034 5.174   -112.334 1.00 0.00 ? 57  ILE A CB   5  
ATOM 9714  C CG1  . ILE A 1 57  ? 142.879 4.144   -111.572 1.00 0.00 ? 57  ILE A CG1  5  
ATOM 9715  C CG2  . ILE A 1 57  ? 142.591 6.574   -112.079 1.00 0.00 ? 57  ILE A CG2  5  
ATOM 9716  C CD1  . ILE A 1 57  ? 143.747 3.349   -112.547 1.00 0.00 ? 57  ILE A CD1  5  
ATOM 9717  H H    . ILE A 1 57  ? 140.679 3.018   -112.374 1.00 0.00 ? 57  ILE A H    5  
ATOM 9718  H HA   . ILE A 1 57  ? 140.568 5.391   -110.795 1.00 0.00 ? 57  ILE A HA   5  
ATOM 9719  H HB   . ILE A 1 57  ? 142.060 4.965   -113.389 1.00 0.00 ? 57  ILE A HB   5  
ATOM 9720  H HG12 . ILE A 1 57  ? 143.513 4.651   -110.861 1.00 0.00 ? 57  ILE A HG12 5  
ATOM 9721  H HG13 . ILE A 1 57  ? 142.224 3.465   -111.045 1.00 0.00 ? 57  ILE A HG13 5  
ATOM 9722  H HG21 . ILE A 1 57  ? 143.301 6.825   -112.853 1.00 0.00 ? 57  ILE A HG21 5  
ATOM 9723  H HG22 . ILE A 1 57  ? 143.084 6.596   -111.118 1.00 0.00 ? 57  ILE A HG22 5  
ATOM 9724  H HG23 . ILE A 1 57  ? 141.783 7.290   -112.086 1.00 0.00 ? 57  ILE A HG23 5  
ATOM 9725  H HD11 . ILE A 1 57  ? 143.284 2.392   -112.739 1.00 0.00 ? 57  ILE A HD11 5  
ATOM 9726  H HD12 . ILE A 1 57  ? 144.724 3.195   -112.113 1.00 0.00 ? 57  ILE A HD12 5  
ATOM 9727  H HD13 . ILE A 1 57  ? 143.847 3.894   -113.474 1.00 0.00 ? 57  ILE A HD13 5  
ATOM 9728  N N    . THR A 1 58  ? 138.675 6.538   -111.971 1.00 0.00 ? 58  THR A N    5  
ATOM 9729  C CA   . THR A 1 58  ? 137.732 7.467   -112.652 1.00 0.00 ? 58  THR A CA   5  
ATOM 9730  C C    . THR A 1 58  ? 138.532 8.704   -113.056 1.00 0.00 ? 58  THR A C    5  
ATOM 9731  O O    . THR A 1 58  ? 138.764 9.596   -112.264 1.00 0.00 ? 58  THR A O    5  
ATOM 9732  C CB   . THR A 1 58  ? 136.590 7.854   -111.710 1.00 0.00 ? 58  THR A CB   5  
ATOM 9733  O OG1  . THR A 1 58  ? 136.620 7.017   -110.562 1.00 0.00 ? 58  THR A OG1  5  
ATOM 9734  C CG2  . THR A 1 58  ? 135.253 7.685   -112.433 1.00 0.00 ? 58  THR A CG2  5  
ATOM 9735  H H    . THR A 1 58  ? 138.557 6.264   -111.037 1.00 0.00 ? 58  THR A H    5  
ATOM 9736  H HA   . THR A 1 58  ? 137.346 6.981   -113.533 1.00 0.00 ? 58  THR A HA   5  
ATOM 9737  H HB   . THR A 1 58  ? 136.703 8.882   -111.410 1.00 0.00 ? 58  THR A HB   5  
ATOM 9738  H HG1  . THR A 1 58  ? 137.430 7.201   -110.081 1.00 0.00 ? 58  THR A HG1  5  
ATOM 9739  H HG21 . THR A 1 58  ? 135.100 8.518   -113.102 1.00 0.00 ? 58  THR A HG21 5  
ATOM 9740  H HG22 . THR A 1 58  ? 134.454 7.654   -111.708 1.00 0.00 ? 58  THR A HG22 5  
ATOM 9741  H HG23 . THR A 1 58  ? 135.263 6.765   -112.999 1.00 0.00 ? 58  THR A HG23 5  
ATOM 9742  N N    . ILE A 1 59  ? 138.974 8.746   -114.282 1.00 0.00 ? 59  ILE A N    5  
ATOM 9743  C CA   . ILE A 1 59  ? 139.782 9.905   -114.748 1.00 0.00 ? 59  ILE A CA   5  
ATOM 9744  C C    . ILE A 1 59  ? 138.905 10.886  -115.529 1.00 0.00 ? 59  ILE A C    5  
ATOM 9745  O O    . ILE A 1 59  ? 138.029 10.493  -116.277 1.00 0.00 ? 59  ILE A O    5  
ATOM 9746  C CB   . ILE A 1 59  ? 140.899 9.405   -115.672 1.00 0.00 ? 59  ILE A CB   5  
ATOM 9747  C CG1  . ILE A 1 59  ? 141.860 8.503   -114.893 1.00 0.00 ? 59  ILE A CG1  5  
ATOM 9748  C CG2  . ILE A 1 59  ? 141.670 10.600  -116.233 1.00 0.00 ? 59  ILE A CG2  5  
ATOM 9749  C CD1  . ILE A 1 59  ? 142.546 7.531   -115.855 1.00 0.00 ? 59  ILE A CD1  5  
ATOM 9750  H H    . ILE A 1 59  ? 138.783 8.004   -114.894 1.00 0.00 ? 59  ILE A H    5  
ATOM 9751  H HA   . ILE A 1 59  ? 140.218 10.407  -113.899 1.00 0.00 ? 59  ILE A HA   5  
ATOM 9752  H HB   . ILE A 1 59  ? 140.463 8.847   -116.489 1.00 0.00 ? 59  ILE A HB   5  
ATOM 9753  H HG12 . ILE A 1 59  ? 142.608 9.110   -114.406 1.00 0.00 ? 59  ILE A HG12 5  
ATOM 9754  H HG13 . ILE A 1 59  ? 141.310 7.943   -114.151 1.00 0.00 ? 59  ILE A HG13 5  
ATOM 9755  H HG21 . ILE A 1 59  ? 142.491 10.246  -116.839 1.00 0.00 ? 59  ILE A HG21 5  
ATOM 9756  H HG22 . ILE A 1 59  ? 142.056 11.193  -115.418 1.00 0.00 ? 59  ILE A HG22 5  
ATOM 9757  H HG23 . ILE A 1 59  ? 141.010 11.203  -116.837 1.00 0.00 ? 59  ILE A HG23 5  
ATOM 9758  H HD11 . ILE A 1 59  ? 142.907 8.073   -116.717 1.00 0.00 ? 59  ILE A HD11 5  
ATOM 9759  H HD12 . ILE A 1 59  ? 141.839 6.779   -116.174 1.00 0.00 ? 59  ILE A HD12 5  
ATOM 9760  H HD13 . ILE A 1 59  ? 143.377 7.056   -115.356 1.00 0.00 ? 59  ILE A HD13 5  
ATOM 9761  N N    . TYR A 1 60  ? 139.168 12.160  -115.395 1.00 0.00 ? 60  TYR A N    5  
ATOM 9762  C CA   . TYR A 1 60  ? 138.376 13.156  -116.169 1.00 0.00 ? 60  TYR A CA   5  
ATOM 9763  C C    . TYR A 1 60  ? 139.325 13.866  -117.135 1.00 0.00 ? 60  TYR A C    5  
ATOM 9764  O O    . TYR A 1 60  ? 140.473 14.144  -116.815 1.00 0.00 ? 60  TYR A O    5  
ATOM 9765  C CB   . TYR A 1 60  ? 137.697 14.179  -115.252 1.00 0.00 ? 60  TYR A CB   5  
ATOM 9766  C CG   . TYR A 1 60  ? 136.506 13.572  -114.546 1.00 0.00 ? 60  TYR A CG   5  
ATOM 9767  C CD1  . TYR A 1 60  ? 136.646 12.398  -113.797 1.00 0.00 ? 60  TYR A CD1  5  
ATOM 9768  C CD2  . TYR A 1 60  ? 135.260 14.204  -114.629 1.00 0.00 ? 60  TYR A CD2  5  
ATOM 9769  C CE1  . TYR A 1 60  ? 135.538 11.857  -113.133 1.00 0.00 ? 60  TYR A CE1  5  
ATOM 9770  C CE2  . TYR A 1 60  ? 134.153 13.661  -113.968 1.00 0.00 ? 60  TYR A CE2  5  
ATOM 9771  C CZ   . TYR A 1 60  ? 134.292 12.487  -113.220 1.00 0.00 ? 60  TYR A CZ   5  
ATOM 9772  O OH   . TYR A 1 60  ? 133.201 11.953  -112.564 1.00 0.00 ? 60  TYR A OH   5  
ATOM 9773  H H    . TYR A 1 60  ? 139.914 12.436  -114.822 1.00 0.00 ? 60  TYR A H    5  
ATOM 9774  H HA   . TYR A 1 60  ? 137.664 12.614  -116.771 1.00 0.00 ? 60  TYR A HA   5  
ATOM 9775  H HB2  . TYR A 1 60  ? 138.408 14.521  -114.514 1.00 0.00 ? 60  TYR A HB2  5  
ATOM 9776  H HB3  . TYR A 1 60  ? 137.367 15.022  -115.843 1.00 0.00 ? 60  TYR A HB3  5  
ATOM 9777  H HD1  . TYR A 1 60  ? 137.605 11.908  -113.733 1.00 0.00 ? 60  TYR A HD1  5  
ATOM 9778  H HD2  . TYR A 1 60  ? 135.153 15.110  -115.205 1.00 0.00 ? 60  TYR A HD2  5  
ATOM 9779  H HE1  . TYR A 1 60  ? 135.643 10.950  -112.557 1.00 0.00 ? 60  TYR A HE1  5  
ATOM 9780  H HE2  . TYR A 1 60  ? 133.191 14.147  -114.035 1.00 0.00 ? 60  TYR A HE2  5  
ATOM 9781  H HH   . TYR A 1 60  ? 132.446 12.520  -112.733 1.00 0.00 ? 60  TYR A HH   5  
ATOM 9782  N N    . ALA A 1 61  ? 138.852 14.115  -118.335 1.00 0.00 ? 61  ALA A N    5  
ATOM 9783  C CA   . ALA A 1 61  ? 139.705 14.758  -119.372 1.00 0.00 ? 61  ALA A CA   5  
ATOM 9784  C C    . ALA A 1 61  ? 140.396 15.990  -118.797 1.00 0.00 ? 61  ALA A C    5  
ATOM 9785  O O    . ALA A 1 61  ? 141.493 16.331  -119.194 1.00 0.00 ? 61  ALA A O    5  
ATOM 9786  C CB   . ALA A 1 61  ? 138.858 15.148  -120.585 1.00 0.00 ? 61  ALA A CB   5  
ATOM 9787  H H    . ALA A 1 61  ? 137.935 13.846  -118.560 1.00 0.00 ? 61  ALA A H    5  
ATOM 9788  H HA   . ALA A 1 61  ? 140.458 14.046  -119.664 1.00 0.00 ? 61  ALA A HA   5  
ATOM 9789  H HB1  . ALA A 1 61  ? 139.180 16.110  -120.955 1.00 0.00 ? 61  ALA A HB1  5  
ATOM 9790  H HB2  . ALA A 1 61  ? 137.819 15.203  -120.296 1.00 0.00 ? 61  ALA A HB2  5  
ATOM 9791  H HB3  . ALA A 1 61  ? 138.977 14.405  -121.360 1.00 0.00 ? 61  ALA A HB3  5  
ATOM 9792  N N    . ASP A 1 62  ? 139.793 16.648  -117.845 1.00 0.00 ? 62  ASP A N    5  
ATOM 9793  C CA   . ASP A 1 62  ? 140.469 17.827  -117.242 1.00 0.00 ? 62  ASP A CA   5  
ATOM 9794  C C    . ASP A 1 62  ? 141.851 17.366  -116.786 1.00 0.00 ? 62  ASP A C    5  
ATOM 9795  O O    . ASP A 1 62  ? 142.604 18.094  -116.172 1.00 0.00 ? 62  ASP A O    5  
ATOM 9796  C CB   . ASP A 1 62  ? 139.666 18.332  -116.041 1.00 0.00 ? 62  ASP A CB   5  
ATOM 9797  C CG   . ASP A 1 62  ? 139.668 17.268  -114.942 1.00 0.00 ? 62  ASP A CG   5  
ATOM 9798  O OD1  . ASP A 1 62  ? 140.395 16.299  -115.084 1.00 0.00 ? 62  ASP A OD1  5  
ATOM 9799  O OD2  . ASP A 1 62  ? 138.942 17.440  -113.976 1.00 0.00 ? 62  ASP A OD2  5  
ATOM 9800  H H    . ASP A 1 62  ? 138.920 16.352  -117.512 1.00 0.00 ? 62  ASP A H    5  
ATOM 9801  H HA   . ASP A 1 62  ? 140.568 18.612  -117.979 1.00 0.00 ? 62  ASP A HA   5  
ATOM 9802  H HB2  . ASP A 1 62  ? 140.113 19.241  -115.665 1.00 0.00 ? 62  ASP A HB2  5  
ATOM 9803  H HB3  . ASP A 1 62  ? 138.648 18.530  -116.345 1.00 0.00 ? 62  ASP A HB3  5  
ATOM 9804  N N    . ARG A 1 63  ? 142.163 16.132  -117.087 1.00 0.00 ? 63  ARG A N    5  
ATOM 9805  C CA   . ARG A 1 63  ? 143.468 15.538  -116.698 1.00 0.00 ? 63  ARG A CA   5  
ATOM 9806  C C    . ARG A 1 63  ? 143.519 15.358  -115.183 1.00 0.00 ? 63  ARG A C    5  
ATOM 9807  O O    . ARG A 1 63  ? 144.268 16.010  -114.482 1.00 0.00 ? 63  ARG A O    5  
ATOM 9808  C CB   . ARG A 1 63  ? 144.635 16.396  -117.194 1.00 0.00 ? 63  ARG A CB   5  
ATOM 9809  C CG   . ARG A 1 63  ? 144.819 16.190  -118.698 1.00 0.00 ? 63  ARG A CG   5  
ATOM 9810  C CD   . ARG A 1 63  ? 146.082 16.917  -119.164 1.00 0.00 ? 63  ARG A CD   5  
ATOM 9811  N NE   . ARG A 1 63  ? 145.922 18.381  -118.939 1.00 0.00 ? 63  ARG A NE   5  
ATOM 9812  C CZ   . ARG A 1 63  ? 146.965 19.166  -118.982 1.00 0.00 ? 63  ARG A CZ   5  
ATOM 9813  N NH1  . ARG A 1 63  ? 148.147 18.667  -119.220 1.00 0.00 ? 63  ARG A NH1  5  
ATOM 9814  N NH2  . ARG A 1 63  ? 146.825 20.449  -118.786 1.00 0.00 ? 63  ARG A NH2  5  
ATOM 9815  H H    . ARG A 1 63  ? 141.517 15.581  -117.573 1.00 0.00 ? 63  ARG A H    5  
ATOM 9816  H HA   . ARG A 1 63  ? 143.526 14.542  -117.107 1.00 0.00 ? 63  ARG A HA   5  
ATOM 9817  H HB2  . ARG A 1 63  ? 144.427 17.438  -116.996 1.00 0.00 ? 63  ARG A HB2  5  
ATOM 9818  H HB3  . ARG A 1 63  ? 145.539 16.108  -116.679 1.00 0.00 ? 63  ARG A HB3  5  
ATOM 9819  H HG2  . ARG A 1 63  ? 144.912 15.135  -118.909 1.00 0.00 ? 63  ARG A HG2  5  
ATOM 9820  H HG3  . ARG A 1 63  ? 143.963 16.588  -119.223 1.00 0.00 ? 63  ARG A HG3  5  
ATOM 9821  H HD2  . ARG A 1 63  ? 146.932 16.557  -118.602 1.00 0.00 ? 63  ARG A HD2  5  
ATOM 9822  H HD3  . ARG A 1 63  ? 146.239 16.728  -120.215 1.00 0.00 ? 63  ARG A HD3  5  
ATOM 9823  H HE   . ARG A 1 63  ? 145.035 18.756  -118.761 1.00 0.00 ? 63  ARG A HE   5  
ATOM 9824  H HH11 . ARG A 1 63  ? 148.254 17.684  -119.370 1.00 0.00 ? 63  ARG A HH11 5  
ATOM 9825  H HH12 . ARG A 1 63  ? 148.945 19.268  -119.253 1.00 0.00 ? 63  ARG A HH12 5  
ATOM 9826  H HH21 . ARG A 1 63  ? 145.919 20.831  -118.603 1.00 0.00 ? 63  ARG A HH21 5  
ATOM 9827  H HH22 . ARG A 1 63  ? 147.624 21.049  -118.819 1.00 0.00 ? 63  ARG A HH22 5  
ATOM 9828  N N    . SER A 1 64  ? 142.721 14.449  -114.687 1.00 0.00 ? 64  SER A N    5  
ATOM 9829  C CA   . SER A 1 64  ? 142.699 14.172  -113.220 1.00 0.00 ? 64  SER A CA   5  
ATOM 9830  C C    . SER A 1 64  ? 142.383 12.689  -113.001 1.00 0.00 ? 64  SER A C    5  
ATOM 9831  O O    . SER A 1 64  ? 141.431 12.169  -113.547 1.00 0.00 ? 64  SER A O    5  
ATOM 9832  C CB   . SER A 1 64  ? 141.623 15.031  -112.552 1.00 0.00 ? 64  SER A CB   5  
ATOM 9833  O OG   . SER A 1 64  ? 140.339 14.535  -112.909 1.00 0.00 ? 64  SER A OG   5  
ATOM 9834  H H    . SER A 1 64  ? 142.141 13.931  -115.295 1.00 0.00 ? 64  SER A H    5  
ATOM 9835  H HA   . SER A 1 64  ? 143.665 14.403  -112.794 1.00 0.00 ? 64  SER A HA   5  
ATOM 9836  H HB2  . SER A 1 64  ? 141.736 14.985  -111.482 1.00 0.00 ? 64  SER A HB2  5  
ATOM 9837  H HB3  . SER A 1 64  ? 141.729 16.056  -112.880 1.00 0.00 ? 64  SER A HB3  5  
ATOM 9838  H HG   . SER A 1 64  ? 139.680 15.115  -112.522 1.00 0.00 ? 64  SER A HG   5  
ATOM 9839  N N    . PHE A 1 65  ? 143.172 11.997  -112.220 1.00 0.00 ? 65  PHE A N    5  
ATOM 9840  C CA   . PHE A 1 65  ? 142.896 10.545  -112.001 1.00 0.00 ? 65  PHE A CA   5  
ATOM 9841  C C    . PHE A 1 65  ? 142.306 10.318  -110.608 1.00 0.00 ? 65  PHE A C    5  
ATOM 9842  O O    . PHE A 1 65  ? 143.007 10.315  -109.616 1.00 0.00 ? 65  PHE A O    5  
ATOM 9843  C CB   . PHE A 1 65  ? 144.197 9.751   -112.140 1.00 0.00 ? 65  PHE A CB   5  
ATOM 9844  C CG   . PHE A 1 65  ? 145.309 10.478  -111.421 1.00 0.00 ? 65  PHE A CG   5  
ATOM 9845  C CD1  . PHE A 1 65  ? 145.778 11.703  -111.911 1.00 0.00 ? 65  PHE A CD1  5  
ATOM 9846  C CD2  . PHE A 1 65  ? 145.871 9.926   -110.262 1.00 0.00 ? 65  PHE A CD2  5  
ATOM 9847  C CE1  . PHE A 1 65  ? 146.809 12.375  -111.243 1.00 0.00 ? 65  PHE A CE1  5  
ATOM 9848  C CE2  . PHE A 1 65  ? 146.902 10.600  -109.595 1.00 0.00 ? 65  PHE A CE2  5  
ATOM 9849  C CZ   . PHE A 1 65  ? 147.370 11.824  -110.086 1.00 0.00 ? 65  PHE A CZ   5  
ATOM 9850  H H    . PHE A 1 65  ? 143.943 12.423  -111.792 1.00 0.00 ? 65  PHE A H    5  
ATOM 9851  H HA   . PHE A 1 65  ? 142.189 10.206  -112.742 1.00 0.00 ? 65  PHE A HA   5  
ATOM 9852  H HB2  . PHE A 1 65  ? 144.068 8.770   -111.707 1.00 0.00 ? 65  PHE A HB2  5  
ATOM 9853  H HB3  . PHE A 1 65  ? 144.450 9.654   -113.185 1.00 0.00 ? 65  PHE A HB3  5  
ATOM 9854  H HD1  . PHE A 1 65  ? 145.345 12.128  -112.804 1.00 0.00 ? 65  PHE A HD1  5  
ATOM 9855  H HD2  . PHE A 1 65  ? 145.510 8.981   -109.885 1.00 0.00 ? 65  PHE A HD2  5  
ATOM 9856  H HE1  . PHE A 1 65  ? 147.170 13.320  -111.622 1.00 0.00 ? 65  PHE A HE1  5  
ATOM 9857  H HE2  . PHE A 1 65  ? 147.335 10.174  -108.703 1.00 0.00 ? 65  PHE A HE2  5  
ATOM 9858  H HZ   . PHE A 1 65  ? 148.166 12.343  -109.571 1.00 0.00 ? 65  PHE A HZ   5  
ATOM 9859  N N    . THR A 1 66  ? 141.024 10.089  -110.535 1.00 0.00 ? 66  THR A N    5  
ATOM 9860  C CA   . THR A 1 66  ? 140.382 9.815   -109.219 1.00 0.00 ? 66  THR A CA   5  
ATOM 9861  C C    . THR A 1 66  ? 140.219 8.300   -109.066 1.00 0.00 ? 66  THR A C    5  
ATOM 9862  O O    . THR A 1 66  ? 139.622 7.654   -109.908 1.00 0.00 ? 66  THR A O    5  
ATOM 9863  C CB   . THR A 1 66  ? 139.000 10.470  -109.190 1.00 0.00 ? 66  THR A CB   5  
ATOM 9864  O OG1  . THR A 1 66  ? 138.084 9.668   -109.921 1.00 0.00 ? 66  THR A OG1  5  
ATOM 9865  C CG2  . THR A 1 66  ? 139.082 11.858  -109.820 1.00 0.00 ? 66  THR A CG2  5  
ATOM 9866  H H    . THR A 1 66  ? 140.481 10.092  -111.350 1.00 0.00 ? 66  THR A H    5  
ATOM 9867  H HA   . THR A 1 66  ? 140.983 10.219  -108.415 1.00 0.00 ? 66  THR A HA   5  
ATOM 9868  H HB   . THR A 1 66  ? 138.665 10.561  -108.169 1.00 0.00 ? 66  THR A HB   5  
ATOM 9869  H HG1  . THR A 1 66  ? 138.454 9.515   -110.794 1.00 0.00 ? 66  THR A HG1  5  
ATOM 9870  H HG21 . THR A 1 66  ? 139.983 12.352  -109.485 1.00 0.00 ? 66  THR A HG21 5  
ATOM 9871  H HG22 . THR A 1 66  ? 138.222 12.440  -109.523 1.00 0.00 ? 66  THR A HG22 5  
ATOM 9872  H HG23 . THR A 1 66  ? 139.101 11.765  -110.895 1.00 0.00 ? 66  THR A HG23 5  
ATOM 9873  N N    . PHE A 1 67  ? 140.729 7.712   -108.014 1.00 0.00 ? 67  PHE A N    5  
ATOM 9874  C CA   . PHE A 1 67  ? 140.565 6.235   -107.869 1.00 0.00 ? 67  PHE A CA   5  
ATOM 9875  C C    . PHE A 1 67  ? 139.573 5.942   -106.744 1.00 0.00 ? 67  PHE A C    5  
ATOM 9876  O O    . PHE A 1 67  ? 139.129 6.837   -106.052 1.00 0.00 ? 67  PHE A O    5  
ATOM 9877  C CB   . PHE A 1 67  ? 141.913 5.571   -107.585 1.00 0.00 ? 67  PHE A CB   5  
ATOM 9878  C CG   . PHE A 1 67  ? 142.782 6.516   -106.791 1.00 0.00 ? 67  PHE A CG   5  
ATOM 9879  C CD1  . PHE A 1 67  ? 143.476 7.543   -107.442 1.00 0.00 ? 67  PHE A CD1  5  
ATOM 9880  C CD2  . PHE A 1 67  ? 142.894 6.367   -105.404 1.00 0.00 ? 67  PHE A CD2  5  
ATOM 9881  C CE1  . PHE A 1 67  ? 144.282 8.421   -106.706 1.00 0.00 ? 67  PHE A CE1  5  
ATOM 9882  C CE2  . PHE A 1 67  ? 143.698 7.245   -104.667 1.00 0.00 ? 67  PHE A CE2  5  
ATOM 9883  C CZ   . PHE A 1 67  ? 144.392 8.271   -105.318 1.00 0.00 ? 67  PHE A CZ   5  
ATOM 9884  H H    . PHE A 1 67  ? 141.207 8.233   -107.337 1.00 0.00 ? 67  PHE A H    5  
ATOM 9885  H HA   . PHE A 1 67  ? 140.148 5.863   -108.791 1.00 0.00 ? 67  PHE A HA   5  
ATOM 9886  H HB2  . PHE A 1 67  ? 141.755 4.663   -107.019 1.00 0.00 ? 67  PHE A HB2  5  
ATOM 9887  H HB3  . PHE A 1 67  ? 142.401 5.332   -108.518 1.00 0.00 ? 67  PHE A HB3  5  
ATOM 9888  H HD1  . PHE A 1 67  ? 143.391 7.659   -108.513 1.00 0.00 ? 67  PHE A HD1  5  
ATOM 9889  H HD2  . PHE A 1 67  ? 142.358 5.575   -104.900 1.00 0.00 ? 67  PHE A HD2  5  
ATOM 9890  H HE1  . PHE A 1 67  ? 144.817 9.212   -107.208 1.00 0.00 ? 67  PHE A HE1  5  
ATOM 9891  H HE2  . PHE A 1 67  ? 143.784 7.129   -103.597 1.00 0.00 ? 67  PHE A HE2  5  
ATOM 9892  H HZ   . PHE A 1 67  ? 145.013 8.948   -104.750 1.00 0.00 ? 67  PHE A HZ   5  
ATOM 9893  N N    . VAL A 1 68  ? 139.185 4.704   -106.580 1.00 0.00 ? 68  VAL A N    5  
ATOM 9894  C CA   . VAL A 1 68  ? 138.180 4.384   -105.529 1.00 0.00 ? 68  VAL A CA   5  
ATOM 9895  C C    . VAL A 1 68  ? 138.145 2.893   -105.182 1.00 0.00 ? 68  VAL A C    5  
ATOM 9896  O O    . VAL A 1 68  ? 137.075 2.347   -104.999 1.00 0.00 ? 68  VAL A O    5  
ATOM 9897  C CB   . VAL A 1 68  ? 136.795 4.719   -106.073 1.00 0.00 ? 68  VAL A CB   5  
ATOM 9898  C CG1  . VAL A 1 68  ? 135.757 4.323   -105.021 1.00 0.00 ? 68  VAL A CG1  5  
ATOM 9899  C CG2  . VAL A 1 68  ? 136.690 6.222   -106.347 1.00 0.00 ? 68  VAL A CG2  5  
ATOM 9900  H H    . VAL A 1 68  ? 139.527 3.999   -107.167 1.00 0.00 ? 68  VAL A H    5  
ATOM 9901  H HA   . VAL A 1 68  ? 138.317 4.990   -104.645 1.00 0.00 ? 68  VAL A HA   5  
ATOM 9902  H HB   . VAL A 1 68  ? 136.618 4.166   -106.984 1.00 0.00 ? 68  VAL A HB   5  
ATOM 9903  H HG11 . VAL A 1 68  ? 136.256 4.128   -104.081 1.00 0.00 ? 68  VAL A HG11 5  
ATOM 9904  H HG12 . VAL A 1 68  ? 135.240 3.431   -105.342 1.00 0.00 ? 68  VAL A HG12 5  
ATOM 9905  H HG13 . VAL A 1 68  ? 135.049 5.125   -104.891 1.00 0.00 ? 68  VAL A HG13 5  
ATOM 9906  H HG21 . VAL A 1 68  ? 137.049 6.771   -105.490 1.00 0.00 ? 68  VAL A HG21 5  
ATOM 9907  H HG22 . VAL A 1 68  ? 135.658 6.482   -106.535 1.00 0.00 ? 68  VAL A HG22 5  
ATOM 9908  H HG23 . VAL A 1 68  ? 137.286 6.473   -107.212 1.00 0.00 ? 68  VAL A HG23 5  
ATOM 9909  N N    . THR A 1 69  ? 139.240 2.209   -105.012 1.00 0.00 ? 69  THR A N    5  
ATOM 9910  C CA   . THR A 1 69  ? 139.061 0.788   -104.591 1.00 0.00 ? 69  THR A CA   5  
ATOM 9911  C C    . THR A 1 69  ? 140.289 0.291   -103.841 1.00 0.00 ? 69  THR A C    5  
ATOM 9912  O O    . THR A 1 69  ? 141.380 0.223   -104.370 1.00 0.00 ? 69  THR A O    5  
ATOM 9913  C CB   . THR A 1 69  ? 138.747 -0.116  -105.787 1.00 0.00 ? 69  THR A CB   5  
ATOM 9914  O OG1  . THR A 1 69  ? 138.480 -1.433  -105.326 1.00 0.00 ? 69  THR A OG1  5  
ATOM 9915  C CG2  . THR A 1 69  ? 139.948 -0.133  -106.742 1.00 0.00 ? 69  THR A CG2  5  
ATOM 9916  H H    . THR A 1 69  ? 140.125 2.619   -105.096 1.00 0.00 ? 69  THR A H    5  
ATOM 9917  H HA   . THR A 1 69  ? 138.239 0.841   -103.898 1.00 0.00 ? 69  THR A HA   5  
ATOM 9918  H HB   . THR A 1 69  ? 137.885 0.262   -106.309 1.00 0.00 ? 69  THR A HB   5  
ATOM 9919  H HG1  . THR A 1 69  ? 139.313 -1.827  -105.059 1.00 0.00 ? 69  THR A HG1  5  
ATOM 9920  H HG21 . THR A 1 69  ? 139.685 -0.661  -107.647 1.00 0.00 ? 69  THR A HG21 5  
ATOM 9921  H HG22 . THR A 1 69  ? 140.782 -0.630  -106.268 1.00 0.00 ? 69  THR A HG22 5  
ATOM 9922  H HG23 . THR A 1 69  ? 140.230 0.882   -106.988 1.00 0.00 ? 69  THR A HG23 5  
ATOM 9923  N N    . LYS A 1 70  ? 140.105 -0.059  -102.597 1.00 0.00 ? 70  LYS A N    5  
ATOM 9924  C CA   . LYS A 1 70  ? 141.245 -0.556  -101.792 1.00 0.00 ? 70  LYS A CA   5  
ATOM 9925  C C    . LYS A 1 70  ? 140.981 -2.011  -101.430 1.00 0.00 ? 70  LYS A C    5  
ATOM 9926  O O    . LYS A 1 70  ? 139.996 -2.350  -100.811 1.00 0.00 ? 70  LYS A O    5  
ATOM 9927  C CB   . LYS A 1 70  ? 141.409 0.286   -100.525 1.00 0.00 ? 70  LYS A CB   5  
ATOM 9928  C CG   . LYS A 1 70  ? 141.409 1.773   -100.891 1.00 0.00 ? 70  LYS A CG   5  
ATOM 9929  C CD   . LYS A 1 70  ? 140.081 2.137   -101.559 1.00 0.00 ? 70  LYS A CD   5  
ATOM 9930  C CE   . LYS A 1 70  ? 139.603 3.497   -101.045 1.00 0.00 ? 70  LYS A CE   5  
ATOM 9931  N NZ   . LYS A 1 70  ? 140.782 4.359   -100.748 1.00 0.00 ? 70  LYS A NZ   5  
ATOM 9932  H H    . LYS A 1 70  ? 139.208 0.004   -102.195 1.00 0.00 ? 70  LYS A H    5  
ATOM 9933  H HA   . LYS A 1 70  ? 142.145 -0.519  -102.387 1.00 0.00 ? 70  LYS A HA   5  
ATOM 9934  H HB2  . LYS A 1 70  ? 140.591 0.082   -99.849  1.00 0.00 ? 70  LYS A HB2  5  
ATOM 9935  H HB3  . LYS A 1 70  ? 142.343 0.037   -100.045 1.00 0.00 ? 70  LYS A HB3  5  
ATOM 9936  H HG2  . LYS A 1 70  ? 141.536 2.363   -99.995  1.00 0.00 ? 70  LYS A HG2  5  
ATOM 9937  H HG3  . LYS A 1 70  ? 142.220 1.976   -101.575 1.00 0.00 ? 70  LYS A HG3  5  
ATOM 9938  H HD2  . LYS A 1 70  ? 140.218 2.185   -102.629 1.00 0.00 ? 70  LYS A HD2  5  
ATOM 9939  H HD3  . LYS A 1 70  ? 139.341 1.386   -101.324 1.00 0.00 ? 70  LYS A HD3  5  
ATOM 9940  H HE2  . LYS A 1 70  ? 138.991 3.972   -101.797 1.00 0.00 ? 70  LYS A HE2  5  
ATOM 9941  H HE3  . LYS A 1 70  ? 139.024 3.358   -100.144 1.00 0.00 ? 70  LYS A HE3  5  
ATOM 9942  H HZ1  . LYS A 1 70  ? 141.584 4.064   -101.339 1.00 0.00 ? 70  LYS A HZ1  5  
ATOM 9943  H HZ2  . LYS A 1 70  ? 141.037 4.262   -99.743  1.00 0.00 ? 70  LYS A HZ2  5  
ATOM 9944  H HZ3  . LYS A 1 70  ? 140.547 5.350   -100.954 1.00 0.00 ? 70  LYS A HZ3  5  
ATOM 9945  N N    . THR A 1 71  ? 141.869 -2.864  -101.837 1.00 0.00 ? 71  THR A N    5  
ATOM 9946  C CA   . THR A 1 71  ? 141.715 -4.325  -101.570 1.00 0.00 ? 71  THR A CA   5  
ATOM 9947  C C    . THR A 1 71  ? 140.677 -4.917  -102.542 1.00 0.00 ? 71  THR A C    5  
ATOM 9948  O O    . THR A 1 71  ? 139.777 -4.235  -102.990 1.00 0.00 ? 71  THR A O    5  
ATOM 9949  C CB   . THR A 1 71  ? 141.249 -4.530  -100.123 1.00 0.00 ? 71  THR A CB   5  
ATOM 9950  O OG1  . THR A 1 71  ? 139.873 -4.197  -100.016 1.00 0.00 ? 71  THR A OG1  5  
ATOM 9951  C CG2  . THR A 1 71  ? 142.064 -3.631  -99.193  1.00 0.00 ? 71  THR A CG2  5  
ATOM 9952  H H    . THR A 1 71  ? 142.637 -2.535  -102.344 1.00 0.00 ? 71  THR A H    5  
ATOM 9953  H HA   . THR A 1 71  ? 142.666 -4.816  -101.715 1.00 0.00 ? 71  THR A HA   5  
ATOM 9954  H HB   . THR A 1 71  ? 141.392 -5.558  -99.836  1.00 0.00 ? 71  THR A HB   5  
ATOM 9955  H HG1  . THR A 1 71  ? 139.451 -4.408  -100.852 1.00 0.00 ? 71  THR A HG1  5  
ATOM 9956  H HG21 . THR A 1 71  ? 142.832 -3.126  -99.760  1.00 0.00 ? 71  THR A HG21 5  
ATOM 9957  H HG22 . THR A 1 71  ? 142.523 -4.233  -98.421  1.00 0.00 ? 71  THR A HG22 5  
ATOM 9958  H HG23 . THR A 1 71  ? 141.413 -2.899  -98.738  1.00 0.00 ? 71  THR A HG23 5  
ATOM 9959  N N    . PRO A 1 72  ? 140.826 -6.179  -102.876 1.00 0.00 ? 72  PRO A N    5  
ATOM 9960  C CA   . PRO A 1 72  ? 139.911 -6.878  -103.827 1.00 0.00 ? 72  PRO A CA   5  
ATOM 9961  C C    . PRO A 1 72  ? 138.438 -6.475  -103.662 1.00 0.00 ? 72  PRO A C    5  
ATOM 9962  O O    . PRO A 1 72  ? 138.096 -5.709  -102.784 1.00 0.00 ? 72  PRO A O    5  
ATOM 9963  C CB   . PRO A 1 72  ? 140.145 -8.346  -103.458 1.00 0.00 ? 72  PRO A CB   5  
ATOM 9964  C CG   . PRO A 1 72  ? 141.388 -8.432  -102.559 1.00 0.00 ? 72  PRO A CG   5  
ATOM 9965  C CD   . PRO A 1 72  ? 141.915 -7.015  -102.316 1.00 0.00 ? 72  PRO A CD   5  
ATOM 9966  H HA   . PRO A 1 72  ? 140.230 -6.711  -104.842 1.00 0.00 ? 72  PRO A HA   5  
ATOM 9967  H HB2  . PRO A 1 72  ? 139.284 -8.732  -102.930 1.00 0.00 ? 72  PRO A HB2  5  
ATOM 9968  H HB3  . PRO A 1 72  ? 140.314 -8.925  -104.352 1.00 0.00 ? 72  PRO A HB3  5  
ATOM 9969  H HG2  . PRO A 1 72  ? 141.124 -8.890  -101.617 1.00 0.00 ? 72  PRO A HG2  5  
ATOM 9970  H HG3  . PRO A 1 72  ? 142.150 -9.020  -103.048 1.00 0.00 ? 72  PRO A HG3  5  
ATOM 9971  H HD2  . PRO A 1 72  ? 142.047 -6.833  -101.260 1.00 0.00 ? 72  PRO A HD2  5  
ATOM 9972  H HD3  . PRO A 1 72  ? 142.831 -6.845  -102.857 1.00 0.00 ? 72  PRO A HD3  5  
ATOM 9973  N N    . PRO A 1 73  ? 137.572 -6.976  -104.514 1.00 0.00 ? 73  PRO A N    5  
ATOM 9974  C CA   . PRO A 1 73  ? 136.128 -6.634  -104.447 1.00 0.00 ? 73  PRO A CA   5  
ATOM 9975  C C    . PRO A 1 73  ? 135.623 -6.587  -103.007 1.00 0.00 ? 73  PRO A C    5  
ATOM 9976  O O    . PRO A 1 73  ? 136.297 -7.020  -102.095 1.00 0.00 ? 73  PRO A O    5  
ATOM 9977  C CB   . PRO A 1 73  ? 135.494 -7.776  -105.237 1.00 0.00 ? 73  PRO A CB   5  
ATOM 9978  C CG   . PRO A 1 73  ? 136.596 -8.453  -106.064 1.00 0.00 ? 73  PRO A CG   5  
ATOM 9979  C CD   . PRO A 1 73  ? 137.958 -7.926  -105.590 1.00 0.00 ? 73  PRO A CD   5  
ATOM 9980  H HA   . PRO A 1 73  ? 135.938 -5.697  -104.946 1.00 0.00 ? 73  PRO A HA   5  
ATOM 9981  H HB2  . PRO A 1 73  ? 135.055 -8.490  -104.554 1.00 0.00 ? 73  PRO A HB2  5  
ATOM 9982  H HB3  . PRO A 1 73  ? 134.734 -7.387  -105.896 1.00 0.00 ? 73  PRO A HB3  5  
ATOM 9983  H HG2  . PRO A 1 73  ? 136.550 -9.524  -105.924 1.00 0.00 ? 73  PRO A HG2  5  
ATOM 9984  H HG3  . PRO A 1 73  ? 136.463 -8.217  -107.109 1.00 0.00 ? 73  PRO A HG3  5  
ATOM 9985  H HD2  . PRO A 1 73  ? 138.557 -8.734  -105.202 1.00 0.00 ? 73  PRO A HD2  5  
ATOM 9986  H HD3  . PRO A 1 73  ? 138.469 -7.409  -106.384 1.00 0.00 ? 73  PRO A HD3  5  
ATOM 9987  N N    . ALA A 1 74  ? 134.459 -6.043  -102.786 1.00 0.00 ? 74  ALA A N    5  
ATOM 9988  C CA   . ALA A 1 74  ? 133.956 -5.952  -101.391 1.00 0.00 ? 74  ALA A CA   5  
ATOM 9989  C C    . ALA A 1 74  ? 135.019 -5.227  -100.567 1.00 0.00 ? 74  ALA A C    5  
ATOM 9990  O O    . ALA A 1 74  ? 134.889 -4.063  -100.244 1.00 0.00 ? 74  ALA A O    5  
ATOM 9991  C CB   . ALA A 1 74  ? 133.734 -7.359  -100.830 1.00 0.00 ? 74  ALA A CB   5  
ATOM 9992  H H    . ALA A 1 74  ? 133.932 -5.678  -103.528 1.00 0.00 ? 74  ALA A H    5  
ATOM 9993  H HA   . ALA A 1 74  ? 133.030 -5.396  -101.370 1.00 0.00 ? 74  ALA A HA   5  
ATOM 9994  H HB1  . ALA A 1 74  ? 132.716 -7.452  -100.483 1.00 0.00 ? 74  ALA A HB1  5  
ATOM 9995  H HB2  . ALA A 1 74  ? 134.413 -7.530  -100.008 1.00 0.00 ? 74  ALA A HB2  5  
ATOM 9996  H HB3  . ALA A 1 74  ? 133.918 -8.088  -101.605 1.00 0.00 ? 74  ALA A HB3  5  
ATOM 9997  N N    . SER A 1 75  ? 136.071 -5.912  -100.226 1.00 0.00 ? 75  SER A N    5  
ATOM 9998  C CA   . SER A 1 75  ? 137.153 -5.283  -99.425  1.00 0.00 ? 75  SER A CA   5  
ATOM 9999  C C    . SER A 1 75  ? 137.453 -3.877  -99.956  1.00 0.00 ? 75  SER A C    5  
ATOM 10000 O O    . SER A 1 75  ? 137.945 -3.034  -99.226  1.00 0.00 ? 75  SER A O    5  
ATOM 10001 C CB   . SER A 1 75  ? 138.413 -6.143  -99.547  1.00 0.00 ? 75  SER A CB   5  
ATOM 10002 O OG   . SER A 1 75  ? 138.976 -5.969  -100.840 1.00 0.00 ? 75  SER A OG   5  
ATOM 10003 H H    . SER A 1 75  ? 136.141 -6.857  -100.478 1.00 0.00 ? 75  SER A H    5  
ATOM 10004 H HA   . SER A 1 75  ? 136.860 -5.226  -98.389  1.00 0.00 ? 75  SER A HA   5  
ATOM 10005 H HB2  . SER A 1 75  ? 139.131 -5.844  -98.806  1.00 0.00 ? 75  SER A HB2  5  
ATOM 10006 H HB3  . SER A 1 75  ? 138.154 -7.181  -99.395  1.00 0.00 ? 75  SER A HB3  5  
ATOM 10007 H HG   . SER A 1 75  ? 139.327 -6.815  -101.126 1.00 0.00 ? 75  SER A HG   5  
ATOM 10008 N N    . TYR A 1 76  ? 137.155 -3.613  -101.211 1.00 0.00 ? 76  TYR A N    5  
ATOM 10009 C CA   . TYR A 1 76  ? 137.442 -2.258  -101.779 1.00 0.00 ? 76  TYR A CA   5  
ATOM 10010 C C    . TYR A 1 76  ? 137.024 -1.191  -100.770 1.00 0.00 ? 76  TYR A C    5  
ATOM 10011 O O    . TYR A 1 76  ? 137.749 -0.243  -100.528 1.00 0.00 ? 76  TYR A O    5  
ATOM 10012 C CB   . TYR A 1 76  ? 136.696 -2.068  -103.109 1.00 0.00 ? 76  TYR A CB   5  
ATOM 10013 C CG   . TYR A 1 76  ? 135.225 -1.813  -102.877 1.00 0.00 ? 76  TYR A CG   5  
ATOM 10014 C CD1  . TYR A 1 76  ? 134.370 -2.876  -102.571 1.00 0.00 ? 76  TYR A CD1  5  
ATOM 10015 C CD2  . TYR A 1 76  ? 134.713 -0.515  -102.993 1.00 0.00 ? 76  TYR A CD2  5  
ATOM 10016 C CE1  . TYR A 1 76  ? 133.003 -2.642  -102.375 1.00 0.00 ? 76  TYR A CE1  5  
ATOM 10017 C CE2  . TYR A 1 76  ? 133.346 -0.282  -102.802 1.00 0.00 ? 76  TYR A CE2  5  
ATOM 10018 C CZ   . TYR A 1 76  ? 132.491 -1.345  -102.491 1.00 0.00 ? 76  TYR A CZ   5  
ATOM 10019 O OH   . TYR A 1 76  ? 131.143 -1.114  -102.303 1.00 0.00 ? 76  TYR A OH   5  
ATOM 10020 H H    . TYR A 1 76  ? 136.754 -4.306  -101.776 1.00 0.00 ? 76  TYR A H    5  
ATOM 10021 H HA   . TYR A 1 76  ? 138.502 -2.172  -101.961 1.00 0.00 ? 76  TYR A HA   5  
ATOM 10022 H HB2  . TYR A 1 76  ? 137.121 -1.228  -103.636 1.00 0.00 ? 76  TYR A HB2  5  
ATOM 10023 H HB3  . TYR A 1 76  ? 136.812 -2.959  -103.709 1.00 0.00 ? 76  TYR A HB3  5  
ATOM 10024 H HD1  . TYR A 1 76  ? 134.764 -3.876  -102.483 1.00 0.00 ? 76  TYR A HD1  5  
ATOM 10025 H HD2  . TYR A 1 76  ? 135.374 0.306   -103.230 1.00 0.00 ? 76  TYR A HD2  5  
ATOM 10026 H HE1  . TYR A 1 76  ? 132.344 -3.464  -102.135 1.00 0.00 ? 76  TYR A HE1  5  
ATOM 10027 H HE2  . TYR A 1 76  ? 132.952 0.720   -102.892 1.00 0.00 ? 76  TYR A HE2  5  
ATOM 10028 H HH   . TYR A 1 76  ? 130.970 -0.190  -102.498 1.00 0.00 ? 76  TYR A HH   5  
ATOM 10029 N N    . LEU A 1 77  ? 135.877 -1.364  -100.161 1.00 0.00 ? 77  LEU A N    5  
ATOM 10030 C CA   . LEU A 1 77  ? 135.407 -0.395  -99.128  1.00 0.00 ? 77  LEU A CA   5  
ATOM 10031 C C    . LEU A 1 77  ? 134.925 -1.205  -97.920  1.00 0.00 ? 77  LEU A C    5  
ATOM 10032 O O    . LEU A 1 77  ? 134.739 -0.687  -96.825  1.00 0.00 ? 77  LEU A O    5  
ATOM 10033 C CB   . LEU A 1 77  ? 134.270 0.470   -99.688  1.00 0.00 ? 77  LEU A CB   5  
ATOM 10034 C CG   . LEU A 1 77  ? 132.919 0.036   -99.105  1.00 0.00 ? 77  LEU A CG   5  
ATOM 10035 C CD1  . LEU A 1 77  ? 131.831 0.995   -99.588  1.00 0.00 ? 77  LEU A CD1  5  
ATOM 10036 C CD2  . LEU A 1 77  ? 132.583 -1.382  -99.572  1.00 0.00 ? 77  LEU A CD2  5  
ATOM 10037 H H    . LEU A 1 77  ? 135.333 -2.149  -100.378 1.00 0.00 ? 77  LEU A H    5  
ATOM 10038 H HA   . LEU A 1 77  ? 136.231 0.237   -98.830  1.00 0.00 ? 77  LEU A HA   5  
ATOM 10039 H HB2  . LEU A 1 77  ? 134.451 1.504   -99.431  1.00 0.00 ? 77  LEU A HB2  5  
ATOM 10040 H HB3  . LEU A 1 77  ? 134.242 0.371   -100.760 1.00 0.00 ? 77  LEU A HB3  5  
ATOM 10041 H HG   . LEU A 1 77  ? 132.965 0.063   -98.026  1.00 0.00 ? 77  LEU A HG   5  
ATOM 10042 H HD11 . LEU A 1 77  ? 132.288 1.837   -100.086 1.00 0.00 ? 77  LEU A HD11 5  
ATOM 10043 H HD12 . LEU A 1 77  ? 131.259 1.345   -98.740  1.00 0.00 ? 77  LEU A HD12 5  
ATOM 10044 H HD13 . LEU A 1 77  ? 131.177 0.481   -100.276 1.00 0.00 ? 77  LEU A HD13 5  
ATOM 10045 H HD21 . LEU A 1 77  ? 132.403 -2.010  -98.712  1.00 0.00 ? 77  LEU A HD21 5  
ATOM 10046 H HD22 . LEU A 1 77  ? 133.409 -1.779  -100.142 1.00 0.00 ? 77  LEU A HD22 5  
ATOM 10047 H HD23 . LEU A 1 77  ? 131.697 -1.357  -100.189 1.00 0.00 ? 77  LEU A HD23 5  
ATOM 10048 N N    . ILE A 1 78  ? 134.746 -2.488  -98.113  1.00 0.00 ? 78  ILE A N    5  
ATOM 10049 C CA   . ILE A 1 78  ? 134.306 -3.351  -96.993  1.00 0.00 ? 78  ILE A CA   5  
ATOM 10050 C C    . ILE A 1 78  ? 135.382 -3.309  -95.915  1.00 0.00 ? 78  ILE A C    5  
ATOM 10051 O O    . ILE A 1 78  ? 135.109 -3.368  -94.731  1.00 0.00 ? 78  ILE A O    5  
ATOM 10052 C CB   . ILE A 1 78  ? 134.138 -4.790  -97.494  1.00 0.00 ? 78  ILE A CB   5  
ATOM 10053 C CG1  . ILE A 1 78  ? 132.837 -4.895  -98.301  1.00 0.00 ? 78  ILE A CG1  5  
ATOM 10054 C CG2  . ILE A 1 78  ? 134.081 -5.753  -96.303  1.00 0.00 ? 78  ILE A CG2  5  
ATOM 10055 C CD1  . ILE A 1 78  ? 132.279 -6.316  -98.199  1.00 0.00 ? 78  ILE A CD1  5  
ATOM 10056 H H    . ILE A 1 78  ? 134.920 -2.881  -98.994  1.00 0.00 ? 78  ILE A H    5  
ATOM 10057 H HA   . ILE A 1 78  ? 133.343 -3.000  -96.647  1.00 0.00 ? 78  ILE A HA   5  
ATOM 10058 H HB   . ILE A 1 78  ? 134.971 -5.050  -98.125  1.00 0.00 ? 78  ILE A HB   5  
ATOM 10059 H HG12 . ILE A 1 78  ? 132.113 -4.197  -97.906  1.00 0.00 ? 78  ILE A HG12 5  
ATOM 10060 H HG13 . ILE A 1 78  ? 133.033 -4.660  -99.335  1.00 0.00 ? 78  ILE A HG13 5  
ATOM 10061 H HG21 . ILE A 1 78  ? 134.958 -5.620  -95.688  1.00 0.00 ? 78  ILE A HG21 5  
ATOM 10062 H HG22 . ILE A 1 78  ? 134.049 -6.771  -96.663  1.00 0.00 ? 78  ILE A HG22 5  
ATOM 10063 H HG23 . ILE A 1 78  ? 133.197 -5.550  -95.719  1.00 0.00 ? 78  ILE A HG23 5  
ATOM 10064 H HD11 . ILE A 1 78  ? 131.851 -6.466  -97.218  1.00 0.00 ? 78  ILE A HD11 5  
ATOM 10065 H HD12 . ILE A 1 78  ? 133.075 -7.028  -98.356  1.00 0.00 ? 78  ILE A HD12 5  
ATOM 10066 H HD13 . ILE A 1 78  ? 131.515 -6.458  -98.950  1.00 0.00 ? 78  ILE A HD13 5  
ATOM 10067 N N    . ARG A 1 79  ? 136.625 -3.188  -96.337  1.00 0.00 ? 79  ARG A N    5  
ATOM 10068 C CA   . ARG A 1 79  ? 137.744 -3.127  -95.357  1.00 0.00 ? 79  ARG A CA   5  
ATOM 10069 C C    . ARG A 1 79  ? 137.474 -1.984  -94.387  1.00 0.00 ? 79  ARG A C    5  
ATOM 10070 O O    . ARG A 1 79  ? 137.676 -2.104  -93.195  1.00 0.00 ? 79  ARG A O    5  
ATOM 10071 C CB   . ARG A 1 79  ? 139.063 -2.887  -96.092  1.00 0.00 ? 79  ARG A CB   5  
ATOM 10072 C CG   . ARG A 1 79  ? 139.666 -4.234  -96.490  1.00 0.00 ? 79  ARG A CG   5  
ATOM 10073 C CD   . ARG A 1 79  ? 140.023 -5.029  -95.231  1.00 0.00 ? 79  ARG A CD   5  
ATOM 10074 N NE   . ARG A 1 79  ? 141.383 -5.632  -95.381  1.00 0.00 ? 79  ARG A NE   5  
ATOM 10075 C CZ   . ARG A 1 79  ? 141.762 -6.147  -96.520  1.00 0.00 ? 79  ARG A CZ   5  
ATOM 10076 N NH1  . ARG A 1 79  ? 140.935 -6.198  -97.526  1.00 0.00 ? 79  ARG A NH1  5  
ATOM 10077 N NH2  . ARG A 1 79  ? 142.968 -6.631  -96.645  1.00 0.00 ? 79  ARG A NH2  5  
ATOM 10078 H H    . ARG A 1 79  ? 136.809 -3.118  -97.304  1.00 0.00 ? 79  ARG A H    5  
ATOM 10079 H HA   . ARG A 1 79  ? 137.799 -4.057  -94.812  1.00 0.00 ? 79  ARG A HA   5  
ATOM 10080 H HB2  . ARG A 1 79  ? 138.879 -2.295  -96.978  1.00 0.00 ? 79  ARG A HB2  5  
ATOM 10081 H HB3  . ARG A 1 79  ? 139.747 -2.363  -95.444  1.00 0.00 ? 79  ARG A HB3  5  
ATOM 10082 H HG2  . ARG A 1 79  ? 138.944 -4.788  -97.070  1.00 0.00 ? 79  ARG A HG2  5  
ATOM 10083 H HG3  . ARG A 1 79  ? 140.556 -4.072  -97.079  1.00 0.00 ? 79  ARG A HG3  5  
ATOM 10084 H HD2  . ARG A 1 79  ? 140.024 -4.368  -94.380  1.00 0.00 ? 79  ARG A HD2  5  
ATOM 10085 H HD3  . ARG A 1 79  ? 139.288 -5.808  -95.078  1.00 0.00 ? 79  ARG A HD3  5  
ATOM 10086 H HE   . ARG A 1 79  ? 142.002 -5.627  -94.621  1.00 0.00 ? 79  ARG A HE   5  
ATOM 10087 H HH11 . ARG A 1 79  ? 140.007 -5.845  -97.429  1.00 0.00 ? 79  ARG A HH11 5  
ATOM 10088 H HH12 . ARG A 1 79  ? 141.231 -6.593  -98.397  1.00 0.00 ? 79  ARG A HH12 5  
ATOM 10089 H HH21 . ARG A 1 79  ? 143.599 -6.606  -95.869  1.00 0.00 ? 79  ARG A HH21 5  
ATOM 10090 H HH22 . ARG A 1 79  ? 143.260 -7.026  -97.516  1.00 0.00 ? 79  ARG A HH22 5  
ATOM 10091 N N    . LYS A 1 80  ? 136.995 -0.880  -94.887  1.00 0.00 ? 80  LYS A N    5  
ATOM 10092 C CA   . LYS A 1 80  ? 136.690 0.258   -93.985  1.00 0.00 ? 80  LYS A CA   5  
ATOM 10093 C C    . LYS A 1 80  ? 135.494 -0.136  -93.123  1.00 0.00 ? 80  LYS A C    5  
ATOM 10094 O O    . LYS A 1 80  ? 135.608 -0.293  -91.924  1.00 0.00 ? 80  LYS A O    5  
ATOM 10095 C CB   . LYS A 1 80  ? 136.350 1.500   -94.812  1.00 0.00 ? 80  LYS A CB   5  
ATOM 10096 C CG   . LYS A 1 80  ? 136.111 2.687   -93.877  1.00 0.00 ? 80  LYS A CG   5  
ATOM 10097 C CD   . LYS A 1 80  ? 134.609 2.857   -93.641  1.00 0.00 ? 80  LYS A CD   5  
ATOM 10098 C CE   . LYS A 1 80  ? 134.362 4.125   -92.818  1.00 0.00 ? 80  LYS A CE   5  
ATOM 10099 N NZ   . LYS A 1 80  ? 134.980 5.293   -93.508  1.00 0.00 ? 80  LYS A NZ   5  
ATOM 10100 H H    . LYS A 1 80  ? 136.824 -0.807  -95.848  1.00 0.00 ? 80  LYS A H    5  
ATOM 10101 H HA   . LYS A 1 80  ? 137.543 0.456   -93.354  1.00 0.00 ? 80  LYS A HA   5  
ATOM 10102 H HB2  . LYS A 1 80  ? 137.170 1.724   -95.479  1.00 0.00 ? 80  LYS A HB2  5  
ATOM 10103 H HB3  . LYS A 1 80  ? 135.457 1.315   -95.390  1.00 0.00 ? 80  LYS A HB3  5  
ATOM 10104 H HG2  . LYS A 1 80  ? 136.607 2.507   -92.933  1.00 0.00 ? 80  LYS A HG2  5  
ATOM 10105 H HG3  . LYS A 1 80  ? 136.507 3.584   -94.326  1.00 0.00 ? 80  LYS A HG3  5  
ATOM 10106 H HD2  . LYS A 1 80  ? 134.103 2.940   -94.591  1.00 0.00 ? 80  LYS A HD2  5  
ATOM 10107 H HD3  . LYS A 1 80  ? 134.230 2.002   -93.102  1.00 0.00 ? 80  LYS A HD3  5  
ATOM 10108 H HE2  . LYS A 1 80  ? 133.299 4.287   -92.718  1.00 0.00 ? 80  LYS A HE2  5  
ATOM 10109 H HE3  . LYS A 1 80  ? 134.803 4.010   -91.839  1.00 0.00 ? 80  LYS A HE3  5  
ATOM 10110 H HZ1  . LYS A 1 80  ? 134.911 5.165   -94.537  1.00 0.00 ? 80  LYS A HZ1  5  
ATOM 10111 H HZ2  . LYS A 1 80  ? 135.982 5.367   -93.233  1.00 0.00 ? 80  LYS A HZ2  5  
ATOM 10112 H HZ3  . LYS A 1 80  ? 134.479 6.161   -93.234  1.00 0.00 ? 80  LYS A HZ3  5  
ATOM 10113 N N    . ALA A 1 81  ? 134.345 -0.304  -93.722  1.00 0.00 ? 81  ALA A N    5  
ATOM 10114 C CA   . ALA A 1 81  ? 133.148 -0.694  -92.918  1.00 0.00 ? 81  ALA A CA   5  
ATOM 10115 C C    . ALA A 1 81  ? 133.442 -1.991  -92.163  1.00 0.00 ? 81  ALA A C    5  
ATOM 10116 O O    . ALA A 1 81  ? 132.634 -2.475  -91.396  1.00 0.00 ? 81  ALA A O    5  
ATOM 10117 C CB   . ALA A 1 81  ? 131.959 -0.922  -93.849  1.00 0.00 ? 81  ALA A CB   5  
ATOM 10118 H H    . ALA A 1 81  ? 134.265 -0.166  -94.696  1.00 0.00 ? 81  ALA A H    5  
ATOM 10119 H HA   . ALA A 1 81  ? 132.913 0.092   -92.216  1.00 0.00 ? 81  ALA A HA   5  
ATOM 10120 H HB1  . ALA A 1 81  ? 131.857 -0.081  -94.517  1.00 0.00 ? 81  ALA A HB1  5  
ATOM 10121 H HB2  . ALA A 1 81  ? 131.059 -1.030  -93.262  1.00 0.00 ? 81  ALA A HB2  5  
ATOM 10122 H HB3  . ALA A 1 81  ? 132.122 -1.822  -94.424  1.00 0.00 ? 81  ALA A HB3  5  
ATOM 10123 N N    . ALA A 1 82  ? 134.588 -2.565  -92.393  1.00 0.00 ? 82  ALA A N    5  
ATOM 10124 C CA   . ALA A 1 82  ? 134.942 -3.843  -91.715  1.00 0.00 ? 82  ALA A CA   5  
ATOM 10125 C C    . ALA A 1 82  ? 135.543 -3.607  -90.325  1.00 0.00 ? 82  ALA A C    5  
ATOM 10126 O O    . ALA A 1 82  ? 134.859 -3.711  -89.328  1.00 0.00 ? 82  ALA A O    5  
ATOM 10127 C CB   . ALA A 1 82  ? 135.966 -4.594  -92.560  1.00 0.00 ? 82  ALA A CB   5  
ATOM 10128 H H    . ALA A 1 82  ? 135.213 -2.158  -93.029  1.00 0.00 ? 82  ALA A H    5  
ATOM 10129 H HA   . ALA A 1 82  ? 134.069 -4.469  -91.608  1.00 0.00 ? 82  ALA A HA   5  
ATOM 10130 H HB1  . ALA A 1 82  ? 135.462 -5.341  -93.157  1.00 0.00 ? 82  ALA A HB1  5  
ATOM 10131 H HB2  . ALA A 1 82  ? 136.681 -5.075  -91.910  1.00 0.00 ? 82  ALA A HB2  5  
ATOM 10132 H HB3  . ALA A 1 82  ? 136.477 -3.901  -93.204  1.00 0.00 ? 82  ALA A HB3  5  
ATOM 10133 N N    . GLY A 1 83  ? 136.802 -3.272  -90.234  1.00 0.00 ? 83  GLY A N    5  
ATOM 10134 C CA   . GLY A 1 83  ? 137.384 -3.021  -88.883  1.00 0.00 ? 83  GLY A CA   5  
ATOM 10135 C C    . GLY A 1 83  ? 138.884 -3.323  -88.866  1.00 0.00 ? 83  GLY A C    5  
ATOM 10136 O O    . GLY A 1 83  ? 139.366 -4.049  -88.019  1.00 0.00 ? 83  GLY A O    5  
ATOM 10137 H H    . GLY A 1 83  ? 137.351 -3.173  -91.040  1.00 0.00 ? 83  GLY A H    5  
ATOM 10138 H HA2  . GLY A 1 83  ? 137.226 -1.987  -88.616  1.00 0.00 ? 83  GLY A HA2  5  
ATOM 10139 H HA3  . GLY A 1 83  ? 136.889 -3.654  -88.161  1.00 0.00 ? 83  GLY A HA3  5  
ATOM 10140 N N    . LEU A 1 84  ? 139.636 -2.762  -89.773  1.00 0.00 ? 84  LEU A N    5  
ATOM 10141 C CA   . LEU A 1 84  ? 141.104 -3.017  -89.769  1.00 0.00 ? 84  LEU A CA   5  
ATOM 10142 C C    . LEU A 1 84  ? 141.750 -2.197  -88.651  1.00 0.00 ? 84  LEU A C    5  
ATOM 10143 O O    . LEU A 1 84  ? 141.909 -0.997  -88.762  1.00 0.00 ? 84  LEU A O    5  
ATOM 10144 C CB   . LEU A 1 84  ? 141.713 -2.600  -91.110  1.00 0.00 ? 84  LEU A CB   5  
ATOM 10145 C CG   . LEU A 1 84  ? 141.167 -3.479  -92.238  1.00 0.00 ? 84  LEU A CG   5  
ATOM 10146 C CD1  . LEU A 1 84  ? 142.039 -3.299  -93.482  1.00 0.00 ? 84  LEU A CD1  5  
ATOM 10147 C CD2  . LEU A 1 84  ? 141.192 -4.951  -91.810  1.00 0.00 ? 84  LEU A CD2  5  
ATOM 10148 H H    . LEU A 1 84  ? 139.239 -2.168  -90.445  1.00 0.00 ? 84  LEU A H    5  
ATOM 10149 H HA   . LEU A 1 84  ? 141.289 -4.067  -89.595  1.00 0.00 ? 84  LEU A HA   5  
ATOM 10150 H HB2  . LEU A 1 84  ? 141.465 -1.568  -91.308  1.00 0.00 ? 84  LEU A HB2  5  
ATOM 10151 H HB3  . LEU A 1 84  ? 142.786 -2.707  -91.062  1.00 0.00 ? 84  LEU A HB3  5  
ATOM 10152 H HG   . LEU A 1 84  ? 140.151 -3.184  -92.464  1.00 0.00 ? 84  LEU A HG   5  
ATOM 10153 H HD11 . LEU A 1 84  ? 142.325 -4.265  -93.864  1.00 0.00 ? 84  LEU A HD11 5  
ATOM 10154 H HD12 . LEU A 1 84  ? 142.924 -2.738  -93.223  1.00 0.00 ? 84  LEU A HD12 5  
ATOM 10155 H HD13 . LEU A 1 84  ? 141.482 -2.762  -94.237  1.00 0.00 ? 84  LEU A HD13 5  
ATOM 10156 H HD21 . LEU A 1 84  ? 142.100 -5.151  -91.261  1.00 0.00 ? 84  LEU A HD21 5  
ATOM 10157 H HD22 . LEU A 1 84  ? 141.156 -5.580  -92.686  1.00 0.00 ? 84  LEU A HD22 5  
ATOM 10158 H HD23 . LEU A 1 84  ? 140.337 -5.159  -91.183  1.00 0.00 ? 84  LEU A HD23 5  
ATOM 10159 N N    . GLU A 1 85  ? 142.125 -2.829  -87.571  1.00 0.00 ? 85  GLU A N    5  
ATOM 10160 C CA   . GLU A 1 85  ? 142.759 -2.075  -86.452  1.00 0.00 ? 85  GLU A CA   5  
ATOM 10161 C C    . GLU A 1 85  ? 143.037 -3.022  -85.283  1.00 0.00 ? 85  GLU A C    5  
ATOM 10162 O O    . GLU A 1 85  ? 143.909 -2.780  -84.472  1.00 0.00 ? 85  GLU A O    5  
ATOM 10163 C CB   . GLU A 1 85  ? 141.816 -0.961  -85.993  1.00 0.00 ? 85  GLU A CB   5  
ATOM 10164 C CG   . GLU A 1 85  ? 142.275 -0.431  -84.633  1.00 0.00 ? 85  GLU A CG   5  
ATOM 10165 C CD   . GLU A 1 85  ? 141.415 0.771   -84.236  1.00 0.00 ? 85  GLU A CD   5  
ATOM 10166 O OE1  . GLU A 1 85  ? 140.535 1.124   -85.005  1.00 0.00 ? 85  GLU A OE1  5  
ATOM 10167 O OE2  . GLU A 1 85  ? 141.650 1.317   -83.171  1.00 0.00 ? 85  GLU A OE2  5  
ATOM 10168 H H    . GLU A 1 85  ? 141.990 -3.796  -87.497  1.00 0.00 ? 85  GLU A H    5  
ATOM 10169 H HA   . GLU A 1 85  ? 143.688 -1.641  -86.792  1.00 0.00 ? 85  GLU A HA   5  
ATOM 10170 H HB2  . GLU A 1 85  ? 141.828 -0.158  -86.715  1.00 0.00 ? 85  GLU A HB2  5  
ATOM 10171 H HB3  . GLU A 1 85  ? 140.813 -1.350  -85.905  1.00 0.00 ? 85  GLU A HB3  5  
ATOM 10172 H HG2  . GLU A 1 85  ? 142.172 -1.208  -83.890  1.00 0.00 ? 85  GLU A HG2  5  
ATOM 10173 H HG3  . GLU A 1 85  ? 143.309 -0.125  -84.695  1.00 0.00 ? 85  GLU A HG3  5  
ATOM 10174 N N    . LYS A 1 86  ? 142.304 -4.097  -85.186  1.00 0.00 ? 86  LYS A N    5  
ATOM 10175 C CA   . LYS A 1 86  ? 142.528 -5.054  -84.066  1.00 0.00 ? 86  LYS A CA   5  
ATOM 10176 C C    . LYS A 1 86  ? 142.197 -4.371  -82.737  1.00 0.00 ? 86  LYS A C    5  
ATOM 10177 O O    . LYS A 1 86  ? 143.045 -4.215  -81.881  1.00 0.00 ? 86  LYS A O    5  
ATOM 10178 C CB   . LYS A 1 86  ? 143.993 -5.498  -84.056  1.00 0.00 ? 86  LYS A CB   5  
ATOM 10179 C CG   . LYS A 1 86  ? 144.442 -5.823  -85.483  1.00 0.00 ? 86  LYS A CG   5  
ATOM 10180 C CD   . LYS A 1 86  ? 145.967 -5.936  -85.526  1.00 0.00 ? 86  LYS A CD   5  
ATOM 10181 C CE   . LYS A 1 86  ? 146.514 -5.062  -86.655  1.00 0.00 ? 86  LYS A CE   5  
ATOM 10182 N NZ   . LYS A 1 86  ? 147.996 -4.957  -86.528  1.00 0.00 ? 86  LYS A NZ   5  
ATOM 10183 H H    . LYS A 1 86  ? 141.604 -4.274  -85.850  1.00 0.00 ? 86  LYS A H    5  
ATOM 10184 H HA   . LYS A 1 86  ? 141.891 -5.917  -84.196  1.00 0.00 ? 86  LYS A HA   5  
ATOM 10185 H HB2  . LYS A 1 86  ? 144.607 -4.704  -83.657  1.00 0.00 ? 86  LYS A HB2  5  
ATOM 10186 H HB3  . LYS A 1 86  ? 144.098 -6.377  -83.440  1.00 0.00 ? 86  LYS A HB3  5  
ATOM 10187 H HG2  . LYS A 1 86  ? 144.001 -6.759  -85.794  1.00 0.00 ? 86  LYS A HG2  5  
ATOM 10188 H HG3  . LYS A 1 86  ? 144.122 -5.035  -86.149  1.00 0.00 ? 86  LYS A HG3  5  
ATOM 10189 H HD2  . LYS A 1 86  ? 146.379 -5.608  -84.582  1.00 0.00 ? 86  LYS A HD2  5  
ATOM 10190 H HD3  . LYS A 1 86  ? 146.246 -6.964  -85.702  1.00 0.00 ? 86  LYS A HD3  5  
ATOM 10191 H HE2  . LYS A 1 86  ? 146.265 -5.504  -87.607  1.00 0.00 ? 86  LYS A HE2  5  
ATOM 10192 H HE3  . LYS A 1 86  ? 146.077 -4.076  -86.590  1.00 0.00 ? 86  LYS A HE3  5  
ATOM 10193 H HZ1  . LYS A 1 86  ? 148.389 -4.542  -87.396  1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 10194 H HZ2  . LYS A 1 86  ? 148.398 -5.905  -86.382  1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 10195 H HZ3  . LYS A 1 86  ? 148.233 -4.350  -85.718  1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 10196 N N    . GLY A 1 87  ? 140.972 -3.960  -82.557  1.00 0.00 ? 87  GLY A N    5  
ATOM 10197 C CA   . GLY A 1 87  ? 140.591 -3.287  -81.283  1.00 0.00 ? 87  GLY A CA   5  
ATOM 10198 C C    . GLY A 1 87  ? 139.114 -3.549  -80.986  1.00 0.00 ? 87  GLY A C    5  
ATOM 10199 O O    . GLY A 1 87  ? 138.407 -4.140  -81.777  1.00 0.00 ? 87  GLY A O    5  
ATOM 10200 H H    . GLY A 1 87  ? 140.302 -4.094  -83.260  1.00 0.00 ? 87  GLY A H    5  
ATOM 10201 H HA2  . GLY A 1 87  ? 141.197 -3.676  -80.476  1.00 0.00 ? 87  GLY A HA2  5  
ATOM 10202 H HA3  . GLY A 1 87  ? 140.753 -2.224  -81.374  1.00 0.00 ? 87  GLY A HA3  5  
ATOM 10203 N N    . ALA A 1 88  ? 138.642 -3.112  -79.849  1.00 0.00 ? 88  ALA A N    5  
ATOM 10204 C CA   . ALA A 1 88  ? 137.210 -3.337  -79.501  1.00 0.00 ? 88  ALA A CA   5  
ATOM 10205 C C    . ALA A 1 88  ? 136.801 -2.379  -78.379  1.00 0.00 ? 88  ALA A C    5  
ATOM 10206 O O    . ALA A 1 88  ? 136.268 -1.316  -78.622  1.00 0.00 ? 88  ALA A O    5  
ATOM 10207 C CB   . ALA A 1 88  ? 137.019 -4.780  -79.035  1.00 0.00 ? 88  ALA A CB   5  
ATOM 10208 H H    . ALA A 1 88  ? 139.229 -2.637  -79.224  1.00 0.00 ? 88  ALA A H    5  
ATOM 10209 H HA   . ALA A 1 88  ? 136.596 -3.154  -80.371  1.00 0.00 ? 88  ALA A HA   5  
ATOM 10210 H HB1  . ALA A 1 88  ? 137.326 -5.456  -79.819  1.00 0.00 ? 88  ALA A HB1  5  
ATOM 10211 H HB2  . ALA A 1 88  ? 135.977 -4.949  -78.802  1.00 0.00 ? 88  ALA A HB2  5  
ATOM 10212 H HB3  . ALA A 1 88  ? 137.617 -4.956  -78.153  1.00 0.00 ? 88  ALA A HB3  5  
ATOM 10213 N N    . HIS A 1 89  ? 137.047 -2.750  -77.152  1.00 0.00 ? 89  HIS A N    5  
ATOM 10214 C CA   . HIS A 1 89  ? 136.671 -1.860  -76.016  1.00 0.00 ? 89  HIS A CA   5  
ATOM 10215 C C    . HIS A 1 89  ? 137.735 -1.954  -74.922  1.00 0.00 ? 89  HIS A C    5  
ATOM 10216 O O    . HIS A 1 89  ? 138.290 -0.962  -74.496  1.00 0.00 ? 89  HIS A O    5  
ATOM 10217 C CB   . HIS A 1 89  ? 135.318 -2.298  -75.452  1.00 0.00 ? 89  HIS A CB   5  
ATOM 10218 C CG   . HIS A 1 89  ? 134.945 -1.410  -74.297  1.00 0.00 ? 89  HIS A CG   5  
ATOM 10219 N ND1  . HIS A 1 89  ? 135.689 -1.364  -73.129  1.00 0.00 ? 89  HIS A ND1  5  
ATOM 10220 C CD2  . HIS A 1 89  ? 133.908 -0.527  -74.116  1.00 0.00 ? 89  HIS A CD2  5  
ATOM 10221 C CE1  . HIS A 1 89  ? 135.096 -0.481  -72.305  1.00 0.00 ? 89  HIS A CE1  5  
ATOM 10222 N NE2  . HIS A 1 89  ? 134.006 0.058   -72.857  1.00 0.00 ? 89  HIS A NE2  5  
ATOM 10223 H H    . HIS A 1 89  ? 137.477 -3.613  -76.977  1.00 0.00 ? 89  HIS A H    5  
ATOM 10224 H HA   . HIS A 1 89  ? 136.602 -0.841  -76.365  1.00 0.00 ? 89  HIS A HA   5  
ATOM 10225 H HB2  . HIS A 1 89  ? 134.564 -2.223  -76.222  1.00 0.00 ? 89  HIS A HB2  5  
ATOM 10226 H HB3  . HIS A 1 89  ? 135.384 -3.322  -75.111  1.00 0.00 ? 89  HIS A HB3  5  
ATOM 10227 H HD1  . HIS A 1 89  ? 136.500 -1.880  -72.937  1.00 0.00 ? 89  HIS A HD1  5  
ATOM 10228 H HD2  . HIS A 1 89  ? 133.135 -0.319  -74.841  1.00 0.00 ? 89  HIS A HD2  5  
ATOM 10229 H HE1  . HIS A 1 89  ? 135.457 -0.237  -71.316  1.00 0.00 ? 89  HIS A HE1  5  
ATOM 10230 N N    . LYS A 1 90  ? 138.023 -3.141  -74.461  1.00 0.00 ? 90  LYS A N    5  
ATOM 10231 C CA   . LYS A 1 90  ? 139.051 -3.297  -73.394  1.00 0.00 ? 90  LYS A CA   5  
ATOM 10232 C C    . LYS A 1 90  ? 140.388 -3.691  -74.027  1.00 0.00 ? 90  LYS A C    5  
ATOM 10233 O O    . LYS A 1 90  ? 140.436 -4.174  -75.141  1.00 0.00 ? 90  LYS A O    5  
ATOM 10234 C CB   . LYS A 1 90  ? 138.608 -4.388  -72.416  1.00 0.00 ? 90  LYS A CB   5  
ATOM 10235 C CG   . LYS A 1 90  ? 138.037 -3.742  -71.152  1.00 0.00 ? 90  LYS A CG   5  
ATOM 10236 C CD   . LYS A 1 90  ? 137.872 -4.805  -70.065  1.00 0.00 ? 90  LYS A CD   5  
ATOM 10237 C CE   . LYS A 1 90  ? 136.711 -5.733  -70.429  1.00 0.00 ? 90  LYS A CE   5  
ATOM 10238 N NZ   . LYS A 1 90  ? 135.867 -5.971  -69.223  1.00 0.00 ? 90  LYS A NZ   5  
ATOM 10239 H H    . LYS A 1 90  ? 137.564 -3.930  -74.817  1.00 0.00 ? 90  LYS A H    5  
ATOM 10240 H HA   . LYS A 1 90  ? 139.163 -2.362  -72.865  1.00 0.00 ? 90  LYS A HA   5  
ATOM 10241 H HB2  . LYS A 1 90  ? 137.851 -5.001  -72.882  1.00 0.00 ? 90  LYS A HB2  5  
ATOM 10242 H HB3  . LYS A 1 90  ? 139.456 -5.002  -72.152  1.00 0.00 ? 90  LYS A HB3  5  
ATOM 10243 H HG2  . LYS A 1 90  ? 138.711 -2.972  -70.805  1.00 0.00 ? 90  LYS A HG2  5  
ATOM 10244 H HG3  . LYS A 1 90  ? 137.075 -3.305  -71.374  1.00 0.00 ? 90  LYS A HG3  5  
ATOM 10245 H HD2  . LYS A 1 90  ? 138.783 -5.382  -69.984  1.00 0.00 ? 90  LYS A HD2  5  
ATOM 10246 H HD3  . LYS A 1 90  ? 137.663 -4.326  -69.120  1.00 0.00 ? 90  LYS A HD3  5  
ATOM 10247 H HE2  . LYS A 1 90  ? 136.113 -5.274  -71.202  1.00 0.00 ? 90  LYS A HE2  5  
ATOM 10248 H HE3  . LYS A 1 90  ? 137.101 -6.674  -70.787  1.00 0.00 ? 90  LYS A HE3  5  
ATOM 10249 H HZ1  . LYS A 1 90  ? 135.010 -6.489  -69.497  1.00 0.00 ? 90  LYS A HZ1  5  
ATOM 10250 H HZ2  . LYS A 1 90  ? 135.602 -5.057  -68.800  1.00 0.00 ? 90  LYS A HZ2  5  
ATOM 10251 H HZ3  . LYS A 1 90  ? 136.403 -6.531  -68.531  1.00 0.00 ? 90  LYS A HZ3  5  
ATOM 10252 N N    . PRO A 1 91  ? 141.465 -3.484  -73.319  1.00 0.00 ? 91  PRO A N    5  
ATOM 10253 C CA   . PRO A 1 91  ? 142.817 -3.831  -73.836  1.00 0.00 ? 91  PRO A CA   5  
ATOM 10254 C C    . PRO A 1 91  ? 142.936 -5.312  -74.213  1.00 0.00 ? 91  PRO A C    5  
ATOM 10255 O O    . PRO A 1 91  ? 143.842 -5.713  -74.917  1.00 0.00 ? 91  PRO A O    5  
ATOM 10256 C CB   . PRO A 1 91  ? 143.727 -3.499  -72.652  1.00 0.00 ? 91  PRO A CB   5  
ATOM 10257 C CG   . PRO A 1 91  ? 142.871 -2.946  -71.504  1.00 0.00 ? 91  PRO A CG   5  
ATOM 10258 C CD   . PRO A 1 91  ? 141.408 -2.893  -71.957  1.00 0.00 ? 91  PRO A CD   5  
ATOM 10259 H HA   . PRO A 1 91  ? 143.074 -3.206  -74.675  1.00 0.00 ? 91  PRO A HA   5  
ATOM 10260 H HB2  . PRO A 1 91  ? 144.237 -4.395  -72.326  1.00 0.00 ? 91  PRO A HB2  5  
ATOM 10261 H HB3  . PRO A 1 91  ? 144.452 -2.756  -72.949  1.00 0.00 ? 91  PRO A HB3  5  
ATOM 10262 H HG2  . PRO A 1 91  ? 142.962 -3.591  -70.642  1.00 0.00 ? 91  PRO A HG2  5  
ATOM 10263 H HG3  . PRO A 1 91  ? 143.204 -1.952  -71.251  1.00 0.00 ? 91  PRO A HG3  5  
ATOM 10264 H HD2  . PRO A 1 91  ? 140.785 -3.488  -71.302  1.00 0.00 ? 91  PRO A HD2  5  
ATOM 10265 H HD3  . PRO A 1 91  ? 141.059 -1.875  -72.004  1.00 0.00 ? 91  PRO A HD3  5  
ATOM 10266 N N    . GLY A 1 92  ? 142.028 -6.126  -73.749  1.00 0.00 ? 92  GLY A N    5  
ATOM 10267 C CA   . GLY A 1 92  ? 142.091 -7.578  -74.080  1.00 0.00 ? 92  GLY A CA   5  
ATOM 10268 C C    . GLY A 1 92  ? 141.048 -7.904  -75.152  1.00 0.00 ? 92  GLY A C    5  
ATOM 10269 O O    . GLY A 1 92  ? 140.253 -7.067  -75.533  1.00 0.00 ? 92  GLY A O    5  
ATOM 10270 H H    . GLY A 1 92  ? 141.305 -5.783  -73.182  1.00 0.00 ? 92  GLY A H    5  
ATOM 10271 H HA2  . GLY A 1 92  ? 143.077 -7.820  -74.450  1.00 0.00 ? 92  GLY A HA2  5  
ATOM 10272 H HA3  . GLY A 1 92  ? 141.885 -8.158  -73.194  1.00 0.00 ? 92  GLY A HA3  5  
ATOM 10273 N N    . ARG A 1 93  ? 141.043 -9.114  -75.639  1.00 0.00 ? 93  ARG A N    5  
ATOM 10274 C CA   . ARG A 1 93  ? 140.051 -9.492  -76.685  1.00 0.00 ? 93  ARG A CA   5  
ATOM 10275 C C    . ARG A 1 93  ? 140.192 -8.554  -77.885  1.00 0.00 ? 93  ARG A C    5  
ATOM 10276 O O    . ARG A 1 93  ? 140.092 -7.350  -77.759  1.00 0.00 ? 93  ARG A O    5  
ATOM 10277 C CB   . ARG A 1 93  ? 138.637 -9.379  -76.110  1.00 0.00 ? 93  ARG A CB   5  
ATOM 10278 C CG   . ARG A 1 93  ? 138.326 -10.617 -75.267  1.00 0.00 ? 93  ARG A CG   5  
ATOM 10279 C CD   . ARG A 1 93  ? 139.078 -10.530 -73.937  1.00 0.00 ? 93  ARG A CD   5  
ATOM 10280 N NE   . ARG A 1 93  ? 138.366 -11.345 -72.912  1.00 0.00 ? 93  ARG A NE   5  
ATOM 10281 C CZ   . ARG A 1 93  ? 138.969 -11.663 -71.798  1.00 0.00 ? 93  ARG A CZ   5  
ATOM 10282 N NH1  . ARG A 1 93  ? 140.195 -11.269 -71.583  1.00 0.00 ? 93  ARG A NH1  5  
ATOM 10283 N NH2  . ARG A 1 93  ? 138.347 -12.377 -70.900  1.00 0.00 ? 93  ARG A NH2  5  
ATOM 10284 H H    . ARG A 1 93  ? 141.691 -9.774  -75.317  1.00 0.00 ? 93  ARG A H    5  
ATOM 10285 H HA   . ARG A 1 93  ? 140.231 -10.509 -77.000  1.00 0.00 ? 93  ARG A HA   5  
ATOM 10286 H HB2  . ARG A 1 93  ? 138.569 -8.494  -75.494  1.00 0.00 ? 93  ARG A HB2  5  
ATOM 10287 H HB3  . ARG A 1 93  ? 137.925 -9.309  -76.919  1.00 0.00 ? 93  ARG A HB3  5  
ATOM 10288 H HG2  . ARG A 1 93  ? 137.264 -10.666 -75.079  1.00 0.00 ? 93  ARG A HG2  5  
ATOM 10289 H HG3  . ARG A 1 93  ? 138.640 -11.503 -75.798  1.00 0.00 ? 93  ARG A HG3  5  
ATOM 10290 H HD2  . ARG A 1 93  ? 140.081 -10.909 -74.065  1.00 0.00 ? 93  ARG A HD2  5  
ATOM 10291 H HD3  . ARG A 1 93  ? 139.119 -9.501  -73.613  1.00 0.00 ? 93  ARG A HD3  5  
ATOM 10292 H HE   . ARG A 1 93  ? 137.447 -11.642 -73.072  1.00 0.00 ? 93  ARG A HE   5  
ATOM 10293 H HH11 . ARG A 1 93  ? 140.671 -10.722 -72.271  1.00 0.00 ? 93  ARG A HH11 5  
ATOM 10294 H HH12 . ARG A 1 93  ? 140.656 -11.512 -70.730  1.00 0.00 ? 93  ARG A HH12 5  
ATOM 10295 H HH21 . ARG A 1 93  ? 137.408 -12.680 -71.065  1.00 0.00 ? 93  ARG A HH21 5  
ATOM 10296 H HH22 . ARG A 1 93  ? 138.809 -12.621 -70.047  1.00 0.00 ? 93  ARG A HH22 5  
ATOM 10297 N N    . GLU A 1 94  ? 140.424 -9.096  -79.050  1.00 0.00 ? 94  GLU A N    5  
ATOM 10298 C CA   . GLU A 1 94  ? 140.571 -8.235  -80.258  1.00 0.00 ? 94  GLU A CA   5  
ATOM 10299 C C    . GLU A 1 94  ? 139.985 -8.957  -81.473  1.00 0.00 ? 94  GLU A C    5  
ATOM 10300 O O    . GLU A 1 94  ? 139.556 -10.090 -81.386  1.00 0.00 ? 94  GLU A O    5  
ATOM 10301 C CB   . GLU A 1 94  ? 142.055 -7.947  -80.500  1.00 0.00 ? 94  GLU A CB   5  
ATOM 10302 C CG   . GLU A 1 94  ? 142.781 -7.843  -79.158  1.00 0.00 ? 94  GLU A CG   5  
ATOM 10303 C CD   . GLU A 1 94  ? 144.281 -7.664  -79.401  1.00 0.00 ? 94  GLU A CD   5  
ATOM 10304 O OE1  . GLU A 1 94  ? 144.674 -7.629  -80.555  1.00 0.00 ? 94  GLU A OE1  5  
ATOM 10305 O OE2  . GLU A 1 94  ? 145.011 -7.564  -78.428  1.00 0.00 ? 94  GLU A OE2  5  
ATOM 10306 H H    . GLU A 1 94  ? 140.502 -10.070 -79.130  1.00 0.00 ? 94  GLU A H    5  
ATOM 10307 H HA   . GLU A 1 94  ? 140.045 -7.305  -80.102  1.00 0.00 ? 94  GLU A HA   5  
ATOM 10308 H HB2  . GLU A 1 94  ? 142.485 -8.749  -81.083  1.00 0.00 ? 94  GLU A HB2  5  
ATOM 10309 H HB3  . GLU A 1 94  ? 142.158 -7.016  -81.037  1.00 0.00 ? 94  GLU A HB3  5  
ATOM 10310 H HG2  . GLU A 1 94  ? 142.400 -6.994  -78.608  1.00 0.00 ? 94  GLU A HG2  5  
ATOM 10311 H HG3  . GLU A 1 94  ? 142.616 -8.745  -78.588  1.00 0.00 ? 94  GLU A HG3  5  
ATOM 10312 N N    . LYS A 1 95  ? 139.964 -8.310  -82.606  1.00 0.00 ? 95  LYS A N    5  
ATOM 10313 C CA   . LYS A 1 95  ? 139.405 -8.961  -83.825  1.00 0.00 ? 95  LYS A CA   5  
ATOM 10314 C C    . LYS A 1 95  ? 139.429 -7.970  -84.992  1.00 0.00 ? 95  LYS A C    5  
ATOM 10315 O O    . LYS A 1 95  ? 139.535 -6.775  -84.802  1.00 0.00 ? 95  LYS A O    5  
ATOM 10316 C CB   . LYS A 1 95  ? 137.962 -9.395  -83.555  1.00 0.00 ? 95  LYS A CB   5  
ATOM 10317 C CG   . LYS A 1 95  ? 137.781 -10.856 -83.969  1.00 0.00 ? 95  LYS A CG   5  
ATOM 10318 C CD   . LYS A 1 95  ? 136.457 -11.385 -83.414  1.00 0.00 ? 95  LYS A CD   5  
ATOM 10319 C CE   . LYS A 1 95  ? 135.790 -12.285 -84.456  1.00 0.00 ? 95  LYS A CE   5  
ATOM 10320 N NZ   . LYS A 1 95  ? 134.397 -12.592 -84.026  1.00 0.00 ? 95  LYS A NZ   5  
ATOM 10321 H H    . LYS A 1 95  ? 140.314 -7.396  -82.657  1.00 0.00 ? 95  LYS A H    5  
ATOM 10322 H HA   . LYS A 1 95  ? 140.000 -9.826  -84.076  1.00 0.00 ? 95  LYS A HA   5  
ATOM 10323 H HB2  . LYS A 1 95  ? 137.746 -9.290  -82.501  1.00 0.00 ? 95  LYS A HB2  5  
ATOM 10324 H HB3  . LYS A 1 95  ? 137.286 -8.775  -84.125  1.00 0.00 ? 95  LYS A HB3  5  
ATOM 10325 H HG2  . LYS A 1 95  ? 137.774 -10.926 -85.047  1.00 0.00 ? 95  LYS A HG2  5  
ATOM 10326 H HG3  . LYS A 1 95  ? 138.595 -11.445 -83.576  1.00 0.00 ? 95  LYS A HG3  5  
ATOM 10327 H HD2  . LYS A 1 95  ? 136.645 -11.953 -82.514  1.00 0.00 ? 95  LYS A HD2  5  
ATOM 10328 H HD3  . LYS A 1 95  ? 135.804 -10.556 -83.188  1.00 0.00 ? 95  LYS A HD3  5  
ATOM 10329 H HE2  . LYS A 1 95  ? 135.769 -11.779 -85.409  1.00 0.00 ? 95  LYS A HE2  5  
ATOM 10330 H HE3  . LYS A 1 95  ? 136.349 -13.205 -84.549  1.00 0.00 ? 95  LYS A HE3  5  
ATOM 10331 H HZ1  . LYS A 1 95  ? 134.402 -13.417 -83.394  1.00 0.00 ? 95  LYS A HZ1  5  
ATOM 10332 H HZ2  . LYS A 1 95  ? 133.814 -12.800 -84.864  1.00 0.00 ? 95  LYS A HZ2  5  
ATOM 10333 H HZ3  . LYS A 1 95  ? 134.000 -11.774 -83.523  1.00 0.00 ? 95  LYS A HZ3  5  
ATOM 10334 N N    . VAL A 1 96  ? 139.331 -8.459  -86.198  1.00 0.00 ? 96  VAL A N    5  
ATOM 10335 C CA   . VAL A 1 96  ? 139.348 -7.546  -87.377  1.00 0.00 ? 96  VAL A CA   5  
ATOM 10336 C C    . VAL A 1 96  ? 138.413 -8.088  -88.459  1.00 0.00 ? 96  VAL A C    5  
ATOM 10337 O O    . VAL A 1 96  ? 138.030 -9.241  -88.443  1.00 0.00 ? 96  VAL A O    5  
ATOM 10338 C CB   . VAL A 1 96  ? 140.769 -7.457  -87.936  1.00 0.00 ? 96  VAL A CB   5  
ATOM 10339 C CG1  . VAL A 1 96  ? 140.762 -6.626  -89.219  1.00 0.00 ? 96  VAL A CG1  5  
ATOM 10340 C CG2  . VAL A 1 96  ? 141.680 -6.789  -86.904  1.00 0.00 ? 96  VAL A CG2  5  
ATOM 10341 H H    . VAL A 1 96  ? 139.245 -9.427  -86.331  1.00 0.00 ? 96  VAL A H    5  
ATOM 10342 H HA   . VAL A 1 96  ? 139.017 -6.563  -87.076  1.00 0.00 ? 96  VAL A HA   5  
ATOM 10343 H HB   . VAL A 1 96  ? 141.134 -8.451  -88.152  1.00 0.00 ? 96  VAL A HB   5  
ATOM 10344 H HG11 . VAL A 1 96  ? 140.501 -7.256  -90.055  1.00 0.00 ? 96  VAL A HG11 5  
ATOM 10345 H HG12 . VAL A 1 96  ? 141.743 -6.203  -89.379  1.00 0.00 ? 96  VAL A HG12 5  
ATOM 10346 H HG13 . VAL A 1 96  ? 140.038 -5.829  -89.128  1.00 0.00 ? 96  VAL A HG13 5  
ATOM 10347 H HG21 . VAL A 1 96  ? 141.980 -7.516  -86.163  1.00 0.00 ? 96  VAL A HG21 5  
ATOM 10348 H HG22 . VAL A 1 96  ? 141.147 -5.983  -86.421  1.00 0.00 ? 96  VAL A HG22 5  
ATOM 10349 H HG23 . VAL A 1 96  ? 142.556 -6.397  -87.398  1.00 0.00 ? 96  VAL A HG23 5  
ATOM 10350 N N    . GLY A 1 97  ? 138.047 -7.266  -89.404  1.00 0.00 ? 97  GLY A N    5  
ATOM 10351 C CA   . GLY A 1 97  ? 137.141 -7.735  -90.490  1.00 0.00 ? 97  GLY A CA   5  
ATOM 10352 C C    . GLY A 1 97  ? 135.724 -7.911  -89.940  1.00 0.00 ? 97  GLY A C    5  
ATOM 10353 O O    . GLY A 1 97  ? 135.191 -9.006  -89.913  1.00 0.00 ? 97  GLY A O    5  
ATOM 10354 H H    . GLY A 1 97  ? 138.370 -6.341  -89.400  1.00 0.00 ? 97  GLY A H    5  
ATOM 10355 H HA2  . GLY A 1 97  ? 137.131 -7.008  -91.288  1.00 0.00 ? 97  GLY A HA2  5  
ATOM 10356 H HA3  . GLY A 1 97  ? 137.496 -8.680  -90.870  1.00 0.00 ? 97  GLY A HA3  5  
ATOM 10357 N N    . ARG A 1 98  ? 135.105 -6.847  -89.502  1.00 0.00 ? 98  ARG A N    5  
ATOM 10358 C CA   . ARG A 1 98  ? 133.724 -6.973  -88.959  1.00 0.00 ? 98  ARG A CA   5  
ATOM 10359 C C    . ARG A 1 98  ? 132.835 -5.860  -89.520  1.00 0.00 ? 98  ARG A C    5  
ATOM 10360 O O    . ARG A 1 98  ? 133.013 -4.695  -89.229  1.00 0.00 ? 98  ARG A O    5  
ATOM 10361 C CB   . ARG A 1 98  ? 133.757 -6.881  -87.431  1.00 0.00 ? 98  ARG A CB   5  
ATOM 10362 C CG   . ARG A 1 98  ? 133.198 -8.171  -86.828  1.00 0.00 ? 98  ARG A CG   5  
ATOM 10363 C CD   . ARG A 1 98  ? 132.825 -7.930  -85.364  1.00 0.00 ? 98  ARG A CD   5  
ATOM 10364 N NE   . ARG A 1 98  ? 132.091 -9.115  -84.837  1.00 0.00 ? 98  ARG A NE   5  
ATOM 10365 C CZ   . ARG A 1 98  ? 131.934 -9.265  -83.551  1.00 0.00 ? 98  ARG A CZ   5  
ATOM 10366 N NH1  . ARG A 1 98  ? 132.418 -8.377  -82.725  1.00 0.00 ? 98  ARG A NH1  5  
ATOM 10367 N NH2  . ARG A 1 98  ? 131.293 -10.304 -83.088  1.00 0.00 ? 98  ARG A NH2  5  
ATOM 10368 H H    . ARG A 1 98  ? 135.546 -5.973  -89.531  1.00 0.00 ? 98  ARG A H    5  
ATOM 10369 H HA   . ARG A 1 98  ? 133.322 -7.928  -89.255  1.00 0.00 ? 98  ARG A HA   5  
ATOM 10370 H HB2  . ARG A 1 98  ? 134.776 -6.741  -87.101  1.00 0.00 ? 98  ARG A HB2  5  
ATOM 10371 H HB3  . ARG A 1 98  ? 133.155 -6.046  -87.107  1.00 0.00 ? 98  ARG A HB3  5  
ATOM 10372 H HG2  . ARG A 1 98  ? 132.320 -8.475  -87.379  1.00 0.00 ? 98  ARG A HG2  5  
ATOM 10373 H HG3  . ARG A 1 98  ? 133.946 -8.948  -86.882  1.00 0.00 ? 98  ARG A HG3  5  
ATOM 10374 H HD2  . ARG A 1 98  ? 133.723 -7.775  -84.785  1.00 0.00 ? 98  ARG A HD2  5  
ATOM 10375 H HD3  . ARG A 1 98  ? 132.194 -7.055  -85.293  1.00 0.00 ? 98  ARG A HD3  5  
ATOM 10376 H HE   . ARG A 1 98  ? 131.726 -9.781  -85.457  1.00 0.00 ? 98  ARG A HE   5  
ATOM 10377 H HH11 . ARG A 1 98  ? 132.909 -7.581  -83.080  1.00 0.00 ? 98  ARG A HH11 5  
ATOM 10378 H HH12 . ARG A 1 98  ? 132.298 -8.493  -81.739  1.00 0.00 ? 98  ARG A HH12 5  
ATOM 10379 H HH21 . ARG A 1 98  ? 130.921 -10.984 -83.720  1.00 0.00 ? 98  ARG A HH21 5  
ATOM 10380 H HH22 . ARG A 1 98  ? 131.173 -10.420 -82.102  1.00 0.00 ? 98  ARG A HH22 5  
ATOM 10381 N N    . ILE A 1 99  ? 131.882 -6.221  -90.330  1.00 0.00 ? 99  ILE A N    5  
ATOM 10382 C CA   . ILE A 1 99  ? 130.971 -5.208  -90.934  1.00 0.00 ? 99  ILE A CA   5  
ATOM 10383 C C    . ILE A 1 99  ? 129.626 -5.227  -90.206  1.00 0.00 ? 99  ILE A C    5  
ATOM 10384 O O    . ILE A 1 99  ? 129.402 -6.026  -89.318  1.00 0.00 ? 99  ILE A O    5  
ATOM 10385 C CB   . ILE A 1 99  ? 130.757 -5.561  -92.406  1.00 0.00 ? 99  ILE A CB   5  
ATOM 10386 C CG1  . ILE A 1 99  ? 130.997 -7.063  -92.599  1.00 0.00 ? 99  ILE A CG1  5  
ATOM 10387 C CG2  . ILE A 1 99  ? 131.738 -4.772  -93.275  1.00 0.00 ? 99  ILE A CG2  5  
ATOM 10388 C CD1  . ILE A 1 99  ? 130.030 -7.610  -93.644  1.00 0.00 ? 99  ILE A CD1  5  
ATOM 10389 H H    . ILE A 1 99  ? 131.767 -7.166  -90.552  1.00 0.00 ? 99  ILE A H    5  
ATOM 10390 H HA   . ILE A 1 99  ? 131.415 -4.227  -90.856  1.00 0.00 ? 99  ILE A HA   5  
ATOM 10391 H HB   . ILE A 1 99  ? 129.745 -5.316  -92.692  1.00 0.00 ? 99  ILE A HB   5  
ATOM 10392 H HG12 . ILE A 1 99  ? 132.012 -7.225  -92.929  1.00 0.00 ? 99  ILE A HG12 5  
ATOM 10393 H HG13 . ILE A 1 99  ? 130.836 -7.577  -91.665  1.00 0.00 ? 99  ILE A HG13 5  
ATOM 10394 H HG21 . ILE A 1 99  ? 131.432 -4.833  -94.308  1.00 0.00 ? 99  ILE A HG21 5  
ATOM 10395 H HG22 . ILE A 1 99  ? 132.729 -5.189  -93.168  1.00 0.00 ? 99  ILE A HG22 5  
ATOM 10396 H HG23 . ILE A 1 99  ? 131.747 -3.739  -92.962  1.00 0.00 ? 99  ILE A HG23 5  
ATOM 10397 H HD11 . ILE A 1 99  ? 129.904 -6.884  -94.434  1.00 0.00 ? 99  ILE A HD11 5  
ATOM 10398 H HD12 . ILE A 1 99  ? 129.077 -7.810  -93.178  1.00 0.00 ? 99  ILE A HD12 5  
ATOM 10399 H HD13 . ILE A 1 99  ? 130.426 -8.526  -94.056  1.00 0.00 ? 99  ILE A HD13 5  
ATOM 10400 N N    . THR A 1 100 ? 128.722 -4.359  -90.578  1.00 0.00 ? 100 THR A N    5  
ATOM 10401 C CA   . THR A 1 100 ? 127.393 -4.344  -89.904  1.00 0.00 ? 100 THR A CA   5  
ATOM 10402 C C    . THR A 1 100 ? 126.308 -4.623  -90.940  1.00 0.00 ? 100 THR A C    5  
ATOM 10403 O O    . THR A 1 100 ? 126.462 -4.334  -92.108  1.00 0.00 ? 100 THR A O    5  
ATOM 10404 C CB   . THR A 1 100 ? 127.138 -2.978  -89.270  1.00 0.00 ? 100 THR A CB   5  
ATOM 10405 O OG1  . THR A 1 100 ? 126.361 -2.186  -90.156  1.00 0.00 ? 100 THR A OG1  5  
ATOM 10406 C CG2  . THR A 1 100 ? 128.467 -2.277  -89.009  1.00 0.00 ? 100 THR A CG2  5  
ATOM 10407 H H    . THR A 1 100 ? 128.916 -3.724  -91.299  1.00 0.00 ? 100 THR A H    5  
ATOM 10408 H HA   . THR A 1 100 ? 127.365 -5.109  -89.143  1.00 0.00 ? 100 THR A HA   5  
ATOM 10409 H HB   . THR A 1 100 ? 126.615 -3.107  -88.335  1.00 0.00 ? 100 THR A HB   5  
ATOM 10410 H HG1  . THR A 1 100 ? 125.559 -1.927  -89.698  1.00 0.00 ? 100 THR A HG1  5  
ATOM 10411 H HG21 . THR A 1 100 ? 128.377 -1.659  -88.129  1.00 0.00 ? 100 THR A HG21 5  
ATOM 10412 H HG22 . THR A 1 100 ? 128.719 -1.662  -89.859  1.00 0.00 ? 100 THR A HG22 5  
ATOM 10413 H HG23 . THR A 1 100 ? 129.239 -3.013  -88.857  1.00 0.00 ? 100 THR A HG23 5  
ATOM 10414 N N    . TRP A 1 101 ? 125.216 -5.191  -90.520  1.00 0.00 ? 101 TRP A N    5  
ATOM 10415 C CA   . TRP A 1 101 ? 124.123 -5.506  -91.479  1.00 0.00 ? 101 TRP A CA   5  
ATOM 10416 C C    . TRP A 1 101 ? 123.848 -4.317  -92.404  1.00 0.00 ? 101 TRP A C    5  
ATOM 10417 O O    . TRP A 1 101 ? 124.122 -4.370  -93.586  1.00 0.00 ? 101 TRP A O    5  
ATOM 10418 C CB   . TRP A 1 101 ? 122.848 -5.853  -90.704  1.00 0.00 ? 101 TRP A CB   5  
ATOM 10419 C CG   . TRP A 1 101 ? 121.856 -6.473  -91.636  1.00 0.00 ? 101 TRP A CG   5  
ATOM 10420 C CD1  . TRP A 1 101 ? 120.582 -6.053  -91.804  1.00 0.00 ? 101 TRP A CD1  5  
ATOM 10421 C CD2  . TRP A 1 101 ? 122.033 -7.611  -92.530  1.00 0.00 ? 101 TRP A CD2  5  
ATOM 10422 N NE1  . TRP A 1 101 ? 119.966 -6.860  -92.744  1.00 0.00 ? 101 TRP A NE1  5  
ATOM 10423 C CE2  . TRP A 1 101 ? 120.820 -7.833  -93.221  1.00 0.00 ? 101 TRP A CE2  5  
ATOM 10424 C CE3  . TRP A 1 101 ? 123.119 -8.462  -92.807  1.00 0.00 ? 101 TRP A CE3  5  
ATOM 10425 C CZ2  . TRP A 1 101 ? 120.688 -8.864  -94.154  1.00 0.00 ? 101 TRP A CZ2  5  
ATOM 10426 C CZ3  . TRP A 1 101 ? 122.991 -9.498  -93.742  1.00 0.00 ? 101 TRP A CZ3  5  
ATOM 10427 C CH2  . TRP A 1 101 ? 121.778 -9.699  -94.415  1.00 0.00 ? 101 TRP A CH2  5  
ATOM 10428 H H    . TRP A 1 101 ? 125.117 -5.421  -89.573  1.00 0.00 ? 101 TRP A H    5  
ATOM 10429 H HA   . TRP A 1 101 ? 124.414 -6.354  -92.076  1.00 0.00 ? 101 TRP A HA   5  
ATOM 10430 H HB2  . TRP A 1 101 ? 123.086 -6.550  -89.915  1.00 0.00 ? 101 TRP A HB2  5  
ATOM 10431 H HB3  . TRP A 1 101 ? 122.430 -4.954  -90.278  1.00 0.00 ? 101 TRP A HB3  5  
ATOM 10432 H HD1  . TRP A 1 101 ? 120.120 -5.224  -91.288  1.00 0.00 ? 101 TRP A HD1  5  
ATOM 10433 H HE1  . TRP A 1 101 ? 119.038 -6.767  -93.048  1.00 0.00 ? 101 TRP A HE1  5  
ATOM 10434 H HE3  . TRP A 1 101 ? 124.057 -8.320  -92.294  1.00 0.00 ? 101 TRP A HE3  5  
ATOM 10435 H HZ2  . TRP A 1 101 ? 119.751 -9.014  -94.669  1.00 0.00 ? 101 TRP A HZ2  5  
ATOM 10436 H HZ3  . TRP A 1 101 ? 123.833 -10.141 -93.946  1.00 0.00 ? 101 TRP A HZ3  5  
ATOM 10437 H HH2  . TRP A 1 101 ? 121.684 -10.499 -95.135  1.00 0.00 ? 101 TRP A HH2  5  
ATOM 10438 N N    . GLU A 1 102 ? 123.294 -3.252  -91.896  1.00 0.00 ? 102 GLU A N    5  
ATOM 10439 C CA   . GLU A 1 102 ? 122.981 -2.085  -92.773  1.00 0.00 ? 102 GLU A CA   5  
ATOM 10440 C C    . GLU A 1 102 ? 124.184 -1.704  -93.625  1.00 0.00 ? 102 GLU A C    5  
ATOM 10441 O O    . GLU A 1 102 ? 124.078 -1.524  -94.825  1.00 0.00 ? 102 GLU A O    5  
ATOM 10442 C CB   . GLU A 1 102 ? 122.583 -0.896  -91.894  1.00 0.00 ? 102 GLU A CB   5  
ATOM 10443 C CG   . GLU A 1 102 ? 122.888 0.419   -92.622  1.00 0.00 ? 102 GLU A CG   5  
ATOM 10444 C CD   . GLU A 1 102 ? 122.232 0.418   -94.006  1.00 0.00 ? 102 GLU A CD   5  
ATOM 10445 O OE1  . GLU A 1 102 ? 121.582 -0.560  -94.333  1.00 0.00 ? 102 GLU A OE1  5  
ATOM 10446 O OE2  . GLU A 1 102 ? 122.387 1.401   -94.711  1.00 0.00 ? 102 GLU A OE2  5  
ATOM 10447 H H    . GLU A 1 102 ? 123.059 -3.199  -90.948  1.00 0.00 ? 102 GLU A H    5  
ATOM 10448 H HA   . GLU A 1 102 ? 122.158 -2.349  -93.418  1.00 0.00 ? 102 GLU A HA   5  
ATOM 10449 H HB2  . GLU A 1 102 ? 121.526 -0.949  -91.677  1.00 0.00 ? 102 GLU A HB2  5  
ATOM 10450 H HB3  . GLU A 1 102 ? 123.141 -0.929  -90.970  1.00 0.00 ? 102 GLU A HB3  5  
ATOM 10451 H HG2  . GLU A 1 102 ? 122.501 1.245   -92.043  1.00 0.00 ? 102 GLU A HG2  5  
ATOM 10452 H HG3  . GLU A 1 102 ? 123.960 0.529   -92.732  1.00 0.00 ? 102 GLU A HG3  5  
ATOM 10453 N N    . GLN A 1 103 ? 125.315 -1.548  -93.017  1.00 0.00 ? 103 GLN A N    5  
ATOM 10454 C CA   . GLN A 1 103 ? 126.513 -1.147  -93.789  1.00 0.00 ? 103 GLN A CA   5  
ATOM 10455 C C    . GLN A 1 103 ? 126.709 -2.071  -94.993  1.00 0.00 ? 103 GLN A C    5  
ATOM 10456 O O    . GLN A 1 103 ? 127.026 -1.612  -96.076  1.00 0.00 ? 103 GLN A O    5  
ATOM 10457 C CB   . GLN A 1 103 ? 127.734 -1.183  -92.876  1.00 0.00 ? 103 GLN A CB   5  
ATOM 10458 C CG   . GLN A 1 103 ? 127.620 -0.035  -91.869  1.00 0.00 ? 103 GLN A CG   5  
ATOM 10459 C CD   . GLN A 1 103 ? 128.950 0.711   -91.784  1.00 0.00 ? 103 GLN A CD   5  
ATOM 10460 O OE1  . GLN A 1 103 ? 129.966 0.133   -91.449  1.00 0.00 ? 103 GLN A OE1  5  
ATOM 10461 N NE2  . GLN A 1 103 ? 128.986 1.981   -92.075  1.00 0.00 ? 103 GLN A NE2  5  
ATOM 10462 H H    . GLN A 1 103 ? 125.376 -1.677  -92.047  1.00 0.00 ? 103 GLN A H    5  
ATOM 10463 H HA   . GLN A 1 103 ? 126.373 -0.137  -94.147  1.00 0.00 ? 103 GLN A HA   5  
ATOM 10464 H HB2  . GLN A 1 103 ? 127.767 -2.127  -92.350  1.00 0.00 ? 103 GLN A HB2  5  
ATOM 10465 H HB3  . GLN A 1 103 ? 128.631 -1.060  -93.462  1.00 0.00 ? 103 GLN A HB3  5  
ATOM 10466 H HG2  . GLN A 1 103 ? 126.848 0.649   -92.192  1.00 0.00 ? 103 GLN A HG2  5  
ATOM 10467 H HG3  . GLN A 1 103 ? 127.364 -0.428  -90.900  1.00 0.00 ? 103 GLN A HG3  5  
ATOM 10468 H HE21 . GLN A 1 103 ? 128.164 2.445   -92.344  1.00 0.00 ? 103 GLN A HE21 5  
ATOM 10469 H HE22 . GLN A 1 103 ? 129.829 2.472   -92.025  1.00 0.00 ? 103 GLN A HE22 5  
ATOM 10470 N N    . VAL A 1 104 ? 126.531 -3.362  -94.848  1.00 0.00 ? 104 VAL A N    5  
ATOM 10471 C CA   . VAL A 1 104 ? 126.740 -4.222  -96.044  1.00 0.00 ? 104 VAL A CA   5  
ATOM 10472 C C    . VAL A 1 104 ? 125.576 -3.964  -96.993  1.00 0.00 ? 104 VAL A C    5  
ATOM 10473 O O    . VAL A 1 104 ? 125.691 -4.119  -98.192  1.00 0.00 ? 104 VAL A O    5  
ATOM 10474 C CB   . VAL A 1 104 ? 126.746 -5.713  -95.699  1.00 0.00 ? 104 VAL A CB   5  
ATOM 10475 C CG1  . VAL A 1 104 ? 127.528 -5.972  -94.419  1.00 0.00 ? 104 VAL A CG1  5  
ATOM 10476 C CG2  . VAL A 1 104 ? 125.315 -6.214  -95.548  1.00 0.00 ? 104 VAL A CG2  5  
ATOM 10477 H H    . VAL A 1 104 ? 126.276 -3.748  -93.984  1.00 0.00 ? 104 VAL A H    5  
ATOM 10478 H HA   . VAL A 1 104 ? 127.663 -3.921  -96.512  1.00 0.00 ? 104 VAL A HA   5  
ATOM 10479 H HB   . VAL A 1 104 ? 127.218 -6.251  -96.506  1.00 0.00 ? 104 VAL A HB   5  
ATOM 10480 H HG11 . VAL A 1 104 ? 127.795 -7.014  -94.377  1.00 0.00 ? 104 VAL A HG11 5  
ATOM 10481 H HG12 . VAL A 1 104 ? 126.910 -5.729  -93.568  1.00 0.00 ? 104 VAL A HG12 5  
ATOM 10482 H HG13 . VAL A 1 104 ? 128.418 -5.365  -94.407  1.00 0.00 ? 104 VAL A HG13 5  
ATOM 10483 H HG21 . VAL A 1 104 ? 124.989 -6.644  -96.485  1.00 0.00 ? 104 VAL A HG21 5  
ATOM 10484 H HG22 . VAL A 1 104 ? 124.672 -5.391  -95.289  1.00 0.00 ? 104 VAL A HG22 5  
ATOM 10485 H HG23 . VAL A 1 104 ? 125.278 -6.964  -94.776  1.00 0.00 ? 104 VAL A HG23 5  
ATOM 10486 N N    . LEU A 1 105 ? 124.451 -3.551  -96.463  1.00 0.00 ? 105 LEU A N    5  
ATOM 10487 C CA   . LEU A 1 105 ? 123.289 -3.266  -97.341  1.00 0.00 ? 105 LEU A CA   5  
ATOM 10488 C C    . LEU A 1 105 ? 123.639 -2.071  -98.218  1.00 0.00 ? 105 LEU A C    5  
ATOM 10489 O O    . LEU A 1 105 ? 123.859 -2.209  -99.405  1.00 0.00 ? 105 LEU A O    5  
ATOM 10490 C CB   . LEU A 1 105 ? 122.058 -2.935  -96.491  1.00 0.00 ? 105 LEU A CB   5  
ATOM 10491 C CG   . LEU A 1 105 ? 121.741 -4.106  -95.560  1.00 0.00 ? 105 LEU A CG   5  
ATOM 10492 C CD1  . LEU A 1 105 ? 120.352 -3.914  -94.950  1.00 0.00 ? 105 LEU A CD1  5  
ATOM 10493 C CD2  . LEU A 1 105 ? 121.774 -5.416  -96.351  1.00 0.00 ? 105 LEU A CD2  5  
ATOM 10494 H H    . LEU A 1 105 ? 124.374 -3.408  -95.493  1.00 0.00 ? 105 LEU A H    5  
ATOM 10495 H HA   . LEU A 1 105 ? 123.084 -4.125  -97.962  1.00 0.00 ? 105 LEU A HA   5  
ATOM 10496 H HB2  . LEU A 1 105 ? 122.255 -2.050  -95.904  1.00 0.00 ? 105 LEU A HB2  5  
ATOM 10497 H HB3  . LEU A 1 105 ? 121.214 -2.755  -97.139  1.00 0.00 ? 105 LEU A HB3  5  
ATOM 10498 H HG   . LEU A 1 105 ? 122.474 -4.143  -94.770  1.00 0.00 ? 105 LEU A HG   5  
ATOM 10499 H HD11 . LEU A 1 105 ? 120.450 -3.649  -93.908  1.00 0.00 ? 105 LEU A HD11 5  
ATOM 10500 H HD12 . LEU A 1 105 ? 119.791 -4.833  -95.038  1.00 0.00 ? 105 LEU A HD12 5  
ATOM 10501 H HD13 . LEU A 1 105 ? 119.834 -3.124  -95.475  1.00 0.00 ? 105 LEU A HD13 5  
ATOM 10502 H HD21 . LEU A 1 105 ? 121.315 -5.265  -97.316  1.00 0.00 ? 105 LEU A HD21 5  
ATOM 10503 H HD22 . LEU A 1 105 ? 121.233 -6.177  -95.809  1.00 0.00 ? 105 LEU A HD22 5  
ATOM 10504 H HD23 . LEU A 1 105 ? 122.799 -5.729  -96.486  1.00 0.00 ? 105 LEU A HD23 5  
ATOM 10505 N N    . GLU A 1 106 ? 123.707 -0.894  -97.655  1.00 0.00 ? 106 GLU A N    5  
ATOM 10506 C CA   . GLU A 1 106 ? 124.058 0.288   -98.485  1.00 0.00 ? 106 GLU A CA   5  
ATOM 10507 C C    . GLU A 1 106 ? 125.223 -0.089  -99.399  1.00 0.00 ? 106 GLU A C    5  
ATOM 10508 O O    . GLU A 1 106 ? 125.227 0.224   -100.573 1.00 0.00 ? 106 GLU A O    5  
ATOM 10509 C CB   . GLU A 1 106 ? 124.473 1.448   -97.577  1.00 0.00 ? 106 GLU A CB   5  
ATOM 10510 C CG   . GLU A 1 106 ? 123.226 2.205   -97.113  1.00 0.00 ? 106 GLU A CG   5  
ATOM 10511 C CD   . GLU A 1 106 ? 122.804 3.205   -98.190  1.00 0.00 ? 106 GLU A CD   5  
ATOM 10512 O OE1  . GLU A 1 106 ? 123.472 3.266   -99.209  1.00 0.00 ? 106 GLU A OE1  5  
ATOM 10513 O OE2  . GLU A 1 106 ? 121.821 3.895   -97.977  1.00 0.00 ? 106 GLU A OE2  5  
ATOM 10514 H H    . GLU A 1 106 ? 123.522 -0.776  -96.698  1.00 0.00 ? 106 GLU A H    5  
ATOM 10515 H HA   . GLU A 1 106 ? 123.207 0.579   -99.081  1.00 0.00 ? 106 GLU A HA   5  
ATOM 10516 H HB2  . GLU A 1 106 ? 125.002 1.061   -96.719  1.00 0.00 ? 106 GLU A HB2  5  
ATOM 10517 H HB3  . GLU A 1 106 ? 125.116 2.121   -98.124  1.00 0.00 ? 106 GLU A HB3  5  
ATOM 10518 H HG2  . GLU A 1 106 ? 122.424 1.502   -96.938  1.00 0.00 ? 106 GLU A HG2  5  
ATOM 10519 H HG3  . GLU A 1 106 ? 123.447 2.734   -96.198  1.00 0.00 ? 106 GLU A HG3  5  
ATOM 10520 N N    . ILE A 1 107 ? 126.205 -0.780  -98.880  1.00 0.00 ? 107 ILE A N    5  
ATOM 10521 C CA   . ILE A 1 107 ? 127.346 -1.190  -99.743  1.00 0.00 ? 107 ILE A CA   5  
ATOM 10522 C C    . ILE A 1 107 ? 126.823 -2.134  -100.827 1.00 0.00 ? 107 ILE A C    5  
ATOM 10523 O O    . ILE A 1 107 ? 127.323 -2.167  -101.934 1.00 0.00 ? 107 ILE A O    5  
ATOM 10524 C CB   . ILE A 1 107 ? 128.397 -1.915  -98.908  1.00 0.00 ? 107 ILE A CB   5  
ATOM 10525 C CG1  . ILE A 1 107 ? 129.166 -0.899  -98.060  1.00 0.00 ? 107 ILE A CG1  5  
ATOM 10526 C CG2  . ILE A 1 107 ? 129.368 -2.636  -99.844  1.00 0.00 ? 107 ILE A CG2  5  
ATOM 10527 C CD1  . ILE A 1 107 ? 130.053 -1.637  -97.056  1.00 0.00 ? 107 ILE A CD1  5  
ATOM 10528 H H    . ILE A 1 107 ? 126.183 -1.041  -97.932  1.00 0.00 ? 107 ILE A H    5  
ATOM 10529 H HA   . ILE A 1 107 ? 127.789 -0.318  -100.204 1.00 0.00 ? 107 ILE A HA   5  
ATOM 10530 H HB   . ILE A 1 107 ? 127.914 -2.635  -98.264  1.00 0.00 ? 107 ILE A HB   5  
ATOM 10531 H HG12 . ILE A 1 107 ? 129.781 -0.286  -98.703  1.00 0.00 ? 107 ILE A HG12 5  
ATOM 10532 H HG13 . ILE A 1 107 ? 128.466 -0.272  -97.526  1.00 0.00 ? 107 ILE A HG13 5  
ATOM 10533 H HG21 . ILE A 1 107 ? 130.302 -2.807  -99.333  1.00 0.00 ? 107 ILE A HG21 5  
ATOM 10534 H HG22 . ILE A 1 107 ? 129.542 -2.028  -100.719 1.00 0.00 ? 107 ILE A HG22 5  
ATOM 10535 H HG23 . ILE A 1 107 ? 128.943 -3.582  -100.144 1.00 0.00 ? 107 ILE A HG23 5  
ATOM 10536 H HD11 . ILE A 1 107 ? 130.968 -1.084  -96.908  1.00 0.00 ? 107 ILE A HD11 5  
ATOM 10537 H HD12 . ILE A 1 107 ? 130.284 -2.621  -97.436  1.00 0.00 ? 107 ILE A HD12 5  
ATOM 10538 H HD13 . ILE A 1 107 ? 129.531 -1.728  -96.115  1.00 0.00 ? 107 ILE A HD13 5  
ATOM 10539 N N    . ALA A 1 108 ? 125.810 -2.903  -100.515 1.00 0.00 ? 108 ALA A N    5  
ATOM 10540 C CA   . ALA A 1 108 ? 125.245 -3.843  -101.524 1.00 0.00 ? 108 ALA A CA   5  
ATOM 10541 C C    . ALA A 1 108 ? 124.063 -3.184  -102.234 1.00 0.00 ? 108 ALA A C    5  
ATOM 10542 O O    . ALA A 1 108 ? 123.830 -3.420  -103.402 1.00 0.00 ? 108 ALA A O    5  
ATOM 10543 C CB   . ALA A 1 108 ? 124.764 -5.118  -100.828 1.00 0.00 ? 108 ALA A CB   5  
ATOM 10544 H H    . ALA A 1 108 ? 125.419 -2.857  -99.615  1.00 0.00 ? 108 ALA A H    5  
ATOM 10545 H HA   . ALA A 1 108 ? 126.005 -4.093  -102.249 1.00 0.00 ? 108 ALA A HA   5  
ATOM 10546 H HB1  . ALA A 1 108 ? 124.806 -5.945  -101.522 1.00 0.00 ? 108 ALA A HB1  5  
ATOM 10547 H HB2  . ALA A 1 108 ? 123.749 -4.982  -100.494 1.00 0.00 ? 108 ALA A HB2  5  
ATOM 10548 H HB3  . ALA A 1 108 ? 125.396 -5.329  -99.979  1.00 0.00 ? 108 ALA A HB3  5  
ATOM 10549 N N    . LYS A 1 109 ? 123.323 -2.345  -101.560 1.00 0.00 ? 109 LYS A N    5  
ATOM 10550 C CA   . LYS A 1 109 ? 122.180 -1.674  -102.238 1.00 0.00 ? 109 LYS A CA   5  
ATOM 10551 C C    . LYS A 1 109 ? 122.698 -1.024  -103.520 1.00 0.00 ? 109 LYS A C    5  
ATOM 10552 O O    . LYS A 1 109 ? 122.424 -1.478  -104.612 1.00 0.00 ? 109 LYS A O    5  
ATOM 10553 C CB   . LYS A 1 109 ? 121.582 -0.604  -101.323 1.00 0.00 ? 109 LYS A CB   5  
ATOM 10554 C CG   . LYS A 1 109 ? 120.907 -1.271  -100.125 1.00 0.00 ? 109 LYS A CG   5  
ATOM 10555 C CD   . LYS A 1 109 ? 119.665 -0.470  -99.728  1.00 0.00 ? 109 LYS A CD   5  
ATOM 10556 C CE   . LYS A 1 109 ? 118.515 -0.807  -100.679 1.00 0.00 ? 109 LYS A CE   5  
ATOM 10557 N NZ   . LYS A 1 109 ? 117.671 0.405   -100.885 1.00 0.00 ? 109 LYS A NZ   5  
ATOM 10558 H H    . LYS A 1 109 ? 123.525 -2.143  -100.622 1.00 0.00 ? 109 LYS A H    5  
ATOM 10559 H HA   . LYS A 1 109 ? 121.425 -2.405  -102.490 1.00 0.00 ? 109 LYS A HA   5  
ATOM 10560 H HB2  . LYS A 1 109 ? 122.368 0.052   -100.978 1.00 0.00 ? 109 LYS A HB2  5  
ATOM 10561 H HB3  . LYS A 1 109 ? 120.851 -0.030  -101.873 1.00 0.00 ? 109 LYS A HB3  5  
ATOM 10562 H HG2  . LYS A 1 109 ? 120.618 -2.278  -100.389 1.00 0.00 ? 109 LYS A HG2  5  
ATOM 10563 H HG3  . LYS A 1 109 ? 121.595 -1.300  -99.293  1.00 0.00 ? 109 LYS A HG3  5  
ATOM 10564 H HD2  . LYS A 1 109 ? 119.383 -0.723  -98.716  1.00 0.00 ? 109 LYS A HD2  5  
ATOM 10565 H HD3  . LYS A 1 109 ? 119.883 0.586   -99.789  1.00 0.00 ? 109 LYS A HD3  5  
ATOM 10566 H HE2  . LYS A 1 109 ? 118.915 -1.131  -101.628 1.00 0.00 ? 109 LYS A HE2  5  
ATOM 10567 H HE3  . LYS A 1 109 ? 117.914 -1.595  -100.252 1.00 0.00 ? 109 LYS A HE3  5  
ATOM 10568 H HZ1  . LYS A 1 109 ? 116.862 0.379   -100.232 1.00 0.00 ? 109 LYS A HZ1  5  
ATOM 10569 H HZ2  . LYS A 1 109 ? 117.325 0.422   -101.867 1.00 0.00 ? 109 LYS A HZ2  5  
ATOM 10570 H HZ3  . LYS A 1 109 ? 118.236 1.257   -100.700 1.00 0.00 ? 109 LYS A HZ3  5  
ATOM 10571 N N    . GLN A 1 110 ? 123.453 0.031   -103.400 1.00 0.00 ? 110 GLN A N    5  
ATOM 10572 C CA   . GLN A 1 110 ? 123.991 0.692   -104.619 1.00 0.00 ? 110 GLN A CA   5  
ATOM 10573 C C    . GLN A 1 110 ? 124.521 -0.384  -105.568 1.00 0.00 ? 110 GLN A C    5  
ATOM 10574 O O    . GLN A 1 110 ? 124.531 -0.215  -106.771 1.00 0.00 ? 110 GLN A O    5  
ATOM 10575 C CB   . GLN A 1 110 ? 125.128 1.638   -104.231 1.00 0.00 ? 110 GLN A CB   5  
ATOM 10576 C CG   . GLN A 1 110 ? 125.430 2.580   -105.397 1.00 0.00 ? 110 GLN A CG   5  
ATOM 10577 C CD   . GLN A 1 110 ? 126.558 3.536   -105.006 1.00 0.00 ? 110 GLN A CD   5  
ATOM 10578 O OE1  . GLN A 1 110 ? 126.347 4.725   -104.879 1.00 0.00 ? 110 GLN A OE1  5  
ATOM 10579 N NE2  . GLN A 1 110 ? 127.758 3.062   -104.807 1.00 0.00 ? 110 GLN A NE2  5  
ATOM 10580 H H    . GLN A 1 110 ? 123.668 0.387   -102.512 1.00 0.00 ? 110 GLN A H    5  
ATOM 10581 H HA   . GLN A 1 110 ? 123.204 1.249   -105.106 1.00 0.00 ? 110 GLN A HA   5  
ATOM 10582 H HB2  . GLN A 1 110 ? 124.836 2.216   -103.365 1.00 0.00 ? 110 GLN A HB2  5  
ATOM 10583 H HB3  . GLN A 1 110 ? 126.012 1.063   -103.998 1.00 0.00 ? 110 GLN A HB3  5  
ATOM 10584 H HG2  . GLN A 1 110 ? 125.729 2.001   -106.259 1.00 0.00 ? 110 GLN A HG2  5  
ATOM 10585 H HG3  . GLN A 1 110 ? 124.545 3.151   -105.637 1.00 0.00 ? 110 GLN A HG3  5  
ATOM 10586 H HE21 . GLN A 1 110 ? 127.928 2.102   -104.910 1.00 0.00 ? 110 GLN A HE21 5  
ATOM 10587 H HE22 . GLN A 1 110 ? 128.488 3.665   -104.556 1.00 0.00 ? 110 GLN A HE22 5  
ATOM 10588 N N    . LYS A 1 111 ? 124.963 -1.493  -105.035 1.00 0.00 ? 111 LYS A N    5  
ATOM 10589 C CA   . LYS A 1 111 ? 125.489 -2.583  -105.905 1.00 0.00 ? 111 LYS A CA   5  
ATOM 10590 C C    . LYS A 1 111 ? 124.329 -3.266  -106.638 1.00 0.00 ? 111 LYS A C    5  
ATOM 10591 O O    . LYS A 1 111 ? 124.535 -4.100  -107.499 1.00 0.00 ? 111 LYS A O    5  
ATOM 10592 C CB   . LYS A 1 111 ? 126.224 -3.612  -105.044 1.00 0.00 ? 111 LYS A CB   5  
ATOM 10593 C CG   . LYS A 1 111 ? 127.152 -4.447  -105.929 1.00 0.00 ? 111 LYS A CG   5  
ATOM 10594 C CD   . LYS A 1 111 ? 128.535 -3.791  -105.980 1.00 0.00 ? 111 LYS A CD   5  
ATOM 10595 C CE   . LYS A 1 111 ? 129.525 -4.741  -106.655 1.00 0.00 ? 111 LYS A CE   5  
ATOM 10596 N NZ   . LYS A 1 111 ? 128.837 -5.480  -107.752 1.00 0.00 ? 111 LYS A NZ   5  
ATOM 10597 H H    . LYS A 1 111 ? 124.949 -1.610  -104.059 1.00 0.00 ? 111 LYS A H    5  
ATOM 10598 H HA   . LYS A 1 111 ? 126.174 -2.164  -106.628 1.00 0.00 ? 111 LYS A HA   5  
ATOM 10599 H HB2  . LYS A 1 111 ? 126.805 -3.101  -104.291 1.00 0.00 ? 111 LYS A HB2  5  
ATOM 10600 H HB3  . LYS A 1 111 ? 125.505 -4.261  -104.567 1.00 0.00 ? 111 LYS A HB3  5  
ATOM 10601 H HG2  . LYS A 1 111 ? 127.240 -5.443  -105.518 1.00 0.00 ? 111 LYS A HG2  5  
ATOM 10602 H HG3  . LYS A 1 111 ? 126.745 -4.504  -106.926 1.00 0.00 ? 111 LYS A HG3  5  
ATOM 10603 H HD2  . LYS A 1 111 ? 128.474 -2.872  -106.544 1.00 0.00 ? 111 LYS A HD2  5  
ATOM 10604 H HD3  . LYS A 1 111 ? 128.869 -3.579  -104.977 1.00 0.00 ? 111 LYS A HD3  5  
ATOM 10605 H HE2  . LYS A 1 111 ? 130.347 -4.173  -107.066 1.00 0.00 ? 111 LYS A HE2  5  
ATOM 10606 H HE3  . LYS A 1 111 ? 129.902 -5.445  -105.928 1.00 0.00 ? 111 LYS A HE3  5  
ATOM 10607 H HZ1  . LYS A 1 111 ? 129.533 -5.764  -108.469 1.00 0.00 ? 111 LYS A HZ1  5  
ATOM 10608 H HZ2  . LYS A 1 111 ? 128.121 -4.863  -108.188 1.00 0.00 ? 111 LYS A HZ2  5  
ATOM 10609 H HZ3  . LYS A 1 111 ? 128.376 -6.328  -107.364 1.00 0.00 ? 111 LYS A HZ3  5  
ATOM 10610 N N    . MET A 1 112 ? 123.111 -2.922  -106.311 1.00 0.00 ? 112 MET A N    5  
ATOM 10611 C CA   . MET A 1 112 ? 121.948 -3.558  -106.999 1.00 0.00 ? 112 MET A CA   5  
ATOM 10612 C C    . MET A 1 112 ? 120.932 -2.485  -107.401 1.00 0.00 ? 112 MET A C    5  
ATOM 10613 O O    . MET A 1 112 ? 119.813 -2.471  -106.927 1.00 0.00 ? 112 MET A O    5  
ATOM 10614 C CB   . MET A 1 112 ? 121.275 -4.564  -106.057 1.00 0.00 ? 112 MET A CB   5  
ATOM 10615 C CG   . MET A 1 112 ? 120.969 -3.893  -104.718 1.00 0.00 ? 112 MET A CG   5  
ATOM 10616 S SD   . MET A 1 112 ? 120.217 -5.097  -103.596 1.00 0.00 ? 112 MET A SD   5  
ATOM 10617 C CE   . MET A 1 112 ? 118.503 -4.553  -103.786 1.00 0.00 ? 112 MET A CE   5  
ATOM 10618 H H    . MET A 1 112 ? 122.961 -2.247  -105.616 1.00 0.00 ? 112 MET A H    5  
ATOM 10619 H HA   . MET A 1 112 ? 122.294 -4.073  -107.884 1.00 0.00 ? 112 MET A HA   5  
ATOM 10620 H HB2  . MET A 1 112 ? 120.354 -4.912  -106.503 1.00 0.00 ? 112 MET A HB2  5  
ATOM 10621 H HB3  . MET A 1 112 ? 121.935 -5.402  -105.894 1.00 0.00 ? 112 MET A HB3  5  
ATOM 10622 H HG2  . MET A 1 112 ? 121.885 -3.524  -104.286 1.00 0.00 ? 112 MET A HG2  5  
ATOM 10623 H HG3  . MET A 1 112 ? 120.287 -3.071  -104.873 1.00 0.00 ? 112 MET A HG3  5  
ATOM 10624 H HE1  . MET A 1 112 ? 118.147 -4.829  -104.769 1.00 0.00 ? 112 MET A HE1  5  
ATOM 10625 H HE2  . MET A 1 112 ? 118.450 -3.482  -103.674 1.00 0.00 ? 112 MET A HE2  5  
ATOM 10626 H HE3  . MET A 1 112 ? 117.892 -5.023  -103.029 1.00 0.00 ? 112 MET A HE3  5  
ATOM 10627 N N    . PRO A 1 113 ? 121.320 -1.596  -108.275 1.00 0.00 ? 113 PRO A N    5  
ATOM 10628 C CA   . PRO A 1 113 ? 120.413 -0.512  -108.740 1.00 0.00 ? 113 PRO A CA   5  
ATOM 10629 C C    . PRO A 1 113 ? 119.262 -1.052  -109.595 1.00 0.00 ? 113 PRO A C    5  
ATOM 10630 O O    . PRO A 1 113 ? 118.130 -0.629  -109.472 1.00 0.00 ? 113 PRO A O    5  
ATOM 10631 C CB   . PRO A 1 113 ? 121.344 0.363   -109.582 1.00 0.00 ? 113 PRO A CB   5  
ATOM 10632 C CG   . PRO A 1 113 ? 122.702 -0.338  -109.711 1.00 0.00 ? 113 PRO A CG   5  
ATOM 10633 C CD   . PRO A 1 113 ? 122.686 -1.609  -108.855 1.00 0.00 ? 113 PRO A CD   5  
ATOM 10634 H HA   . PRO A 1 113 ? 120.035 0.055   -107.906 1.00 0.00 ? 113 PRO A HA   5  
ATOM 10635 H HB2  . PRO A 1 113 ? 120.914 0.506   -110.564 1.00 0.00 ? 113 PRO A HB2  5  
ATOM 10636 H HB3  . PRO A 1 113 ? 121.476 1.320   -109.101 1.00 0.00 ? 113 PRO A HB3  5  
ATOM 10637 H HG2  . PRO A 1 113 ? 122.880 -0.598  -110.744 1.00 0.00 ? 113 PRO A HG2  5  
ATOM 10638 H HG3  . PRO A 1 113 ? 123.484 0.319   -109.362 1.00 0.00 ? 113 PRO A HG3  5  
ATOM 10639 H HD2  . PRO A 1 113 ? 122.837 -2.486  -109.471 1.00 0.00 ? 113 PRO A HD2  5  
ATOM 10640 H HD3  . PRO A 1 113 ? 123.426 -1.555  -108.074 1.00 0.00 ? 113 PRO A HD3  5  
ATOM 10641 N N    . ASP A 1 114 ? 119.549 -1.987  -110.458 1.00 0.00 ? 114 ASP A N    5  
ATOM 10642 C CA   . ASP A 1 114 ? 118.483 -2.563  -111.323 1.00 0.00 ? 114 ASP A CA   5  
ATOM 10643 C C    . ASP A 1 114 ? 119.084 -3.675  -112.184 1.00 0.00 ? 114 ASP A C    5  
ATOM 10644 O O    . ASP A 1 114 ? 118.440 -4.214  -113.063 1.00 0.00 ? 114 ASP A O    5  
ATOM 10645 C CB   . ASP A 1 114 ? 117.911 -1.469  -112.228 1.00 0.00 ? 114 ASP A CB   5  
ATOM 10646 C CG   . ASP A 1 114 ? 116.753 -2.039  -113.048 1.00 0.00 ? 114 ASP A CG   5  
ATOM 10647 O OD1  . ASP A 1 114 ? 116.457 -3.211  -112.886 1.00 0.00 ? 114 ASP A OD1  5  
ATOM 10648 O OD2  . ASP A 1 114 ? 116.180 -1.292  -113.826 1.00 0.00 ? 114 ASP A OD2  5  
ATOM 10649 H H    . ASP A 1 114 ? 120.471 -2.313  -110.537 1.00 0.00 ? 114 ASP A H    5  
ATOM 10650 H HA   . ASP A 1 114 ? 117.696 -2.971  -110.706 1.00 0.00 ? 114 ASP A HA   5  
ATOM 10651 H HB2  . ASP A 1 114 ? 117.553 -0.651  -111.619 1.00 0.00 ? 114 ASP A HB2  5  
ATOM 10652 H HB3  . ASP A 1 114 ? 118.682 -1.113  -112.895 1.00 0.00 ? 114 ASP A HB3  5  
ATOM 10653 N N    . LEU A 1 115 ? 120.318 -4.021  -111.937 1.00 0.00 ? 115 LEU A N    5  
ATOM 10654 C CA   . LEU A 1 115 ? 120.970 -5.096  -112.736 1.00 0.00 ? 115 LEU A CA   5  
ATOM 10655 C C    . LEU A 1 115 ? 120.023 -6.293  -112.855 1.00 0.00 ? 115 LEU A C    5  
ATOM 10656 O O    . LEU A 1 115 ? 119.319 -6.445  -113.833 1.00 0.00 ? 115 LEU A O    5  
ATOM 10657 C CB   . LEU A 1 115 ? 122.261 -5.534  -112.041 1.00 0.00 ? 115 LEU A CB   5  
ATOM 10658 C CG   . LEU A 1 115 ? 123.454 -4.833  -112.692 1.00 0.00 ? 115 LEU A CG   5  
ATOM 10659 C CD1  . LEU A 1 115 ? 123.672 -5.396  -114.097 1.00 0.00 ? 115 LEU A CD1  5  
ATOM 10660 C CD2  . LEU A 1 115 ? 123.174 -3.332  -112.783 1.00 0.00 ? 115 LEU A CD2  5  
ATOM 10661 H H    . LEU A 1 115 ? 120.818 -3.572  -111.223 1.00 0.00 ? 115 LEU A H    5  
ATOM 10662 H HA   . LEU A 1 115 ? 121.201 -4.722  -113.722 1.00 0.00 ? 115 LEU A HA   5  
ATOM 10663 H HB2  . LEU A 1 115 ? 122.213 -5.270  -110.994 1.00 0.00 ? 115 LEU A HB2  5  
ATOM 10664 H HB3  . LEU A 1 115 ? 122.377 -6.604  -112.137 1.00 0.00 ? 115 LEU A HB3  5  
ATOM 10665 H HG   . LEU A 1 115 ? 124.339 -5.001  -112.095 1.00 0.00 ? 115 LEU A HG   5  
ATOM 10666 H HD11 . LEU A 1 115 ? 124.724 -5.365  -114.339 1.00 0.00 ? 115 LEU A HD11 5  
ATOM 10667 H HD12 . LEU A 1 115 ? 123.122 -4.803  -114.812 1.00 0.00 ? 115 LEU A HD12 5  
ATOM 10668 H HD13 . LEU A 1 115 ? 123.324 -6.418  -114.134 1.00 0.00 ? 115 LEU A HD13 5  
ATOM 10669 H HD21 . LEU A 1 115 ? 122.776 -3.098  -113.760 1.00 0.00 ? 115 LEU A HD21 5  
ATOM 10670 H HD22 . LEU A 1 115 ? 124.092 -2.785  -112.627 1.00 0.00 ? 115 LEU A HD22 5  
ATOM 10671 H HD23 . LEU A 1 115 ? 122.455 -3.053  -112.026 1.00 0.00 ? 115 LEU A HD23 5  
ATOM 10672 N N    . ASN A 1 116 ? 120.001 -7.144  -111.866 1.00 0.00 ? 116 ASN A N    5  
ATOM 10673 C CA   . ASN A 1 116 ? 119.100 -8.328  -111.927 1.00 0.00 ? 116 ASN A CA   5  
ATOM 10674 C C    . ASN A 1 116 ? 118.649 -8.703  -110.514 1.00 0.00 ? 116 ASN A C    5  
ATOM 10675 O O    . ASN A 1 116 ? 117.664 -9.391  -110.330 1.00 0.00 ? 116 ASN A O    5  
ATOM 10676 C CB   . ASN A 1 116 ? 119.849 -9.508  -112.551 1.00 0.00 ? 116 ASN A CB   5  
ATOM 10677 C CG   . ASN A 1 116 ? 120.658 -10.229 -111.471 1.00 0.00 ? 116 ASN A CG   5  
ATOM 10678 O OD1  . ASN A 1 116 ? 121.664 -9.726  -111.011 1.00 0.00 ? 116 ASN A OD1  5  
ATOM 10679 N ND2  . ASN A 1 116 ? 120.257 -11.395 -111.043 1.00 0.00 ? 116 ASN A ND2  5  
ATOM 10680 H H    . ASN A 1 116 ? 120.576 -7.006  -111.085 1.00 0.00 ? 116 ASN A H    5  
ATOM 10681 H HA   . ASN A 1 116 ? 118.236 -8.093  -112.531 1.00 0.00 ? 116 ASN A HA   5  
ATOM 10682 H HB2  . ASN A 1 116 ? 119.139 -10.194 -112.989 1.00 0.00 ? 116 ASN A HB2  5  
ATOM 10683 H HB3  . ASN A 1 116 ? 120.520 -9.145  -113.316 1.00 0.00 ? 116 ASN A HB3  5  
ATOM 10684 H HD21 . ASN A 1 116 ? 119.446 -11.800 -111.414 1.00 0.00 ? 116 ASN A HD21 5  
ATOM 10685 H HD22 . ASN A 1 116 ? 120.768 -11.865 -110.351 1.00 0.00 ? 116 ASN A HD22 5  
ATOM 10686 N N    . THR A 1 117 ? 119.359 -8.257  -109.514 1.00 0.00 ? 117 THR A N    5  
ATOM 10687 C CA   . THR A 1 117 ? 118.962 -8.594  -108.118 1.00 0.00 ? 117 THR A CA   5  
ATOM 10688 C C    . THR A 1 117 ? 117.620 -7.937  -107.794 1.00 0.00 ? 117 THR A C    5  
ATOM 10689 O O    . THR A 1 117 ? 116.898 -7.512  -108.674 1.00 0.00 ? 117 THR A O    5  
ATOM 10690 C CB   . THR A 1 117 ? 120.020 -8.095  -107.136 1.00 0.00 ? 117 THR A CB   5  
ATOM 10691 O OG1  . THR A 1 117 ? 121.300 -8.562  -107.540 1.00 0.00 ? 117 THR A OG1  5  
ATOM 10692 C CG2  . THR A 1 117 ? 119.695 -8.629  -105.740 1.00 0.00 ? 117 THR A CG2  5  
ATOM 10693 H H    . THR A 1 117 ? 120.150 -7.705  -109.680 1.00 0.00 ? 117 THR A H    5  
ATOM 10694 H HA   . THR A 1 117 ? 118.864 -9.666  -108.024 1.00 0.00 ? 117 THR A HA   5  
ATOM 10695 H HB   . THR A 1 117 ? 120.017 -7.017  -107.114 1.00 0.00 ? 117 THR A HB   5  
ATOM 10696 H HG1  . THR A 1 117 ? 121.182 -9.409  -107.978 1.00 0.00 ? 117 THR A HG1  5  
ATOM 10697 H HG21 . THR A 1 117 ? 119.283 -7.833  -105.136 1.00 0.00 ? 117 THR A HG21 5  
ATOM 10698 H HG22 . THR A 1 117 ? 120.595 -9.004  -105.279 1.00 0.00 ? 117 THR A HG22 5  
ATOM 10699 H HG23 . THR A 1 117 ? 118.971 -9.429  -105.821 1.00 0.00 ? 117 THR A HG23 5  
ATOM 10700 N N    . THR A 1 118 ? 117.271 -7.865  -106.538 1.00 0.00 ? 118 THR A N    5  
ATOM 10701 C CA   . THR A 1 118 ? 115.967 -7.252  -106.168 1.00 0.00 ? 118 THR A CA   5  
ATOM 10702 C C    . THR A 1 118 ? 115.849 -7.166  -104.644 1.00 0.00 ? 118 THR A C    5  
ATOM 10703 O O    . THR A 1 118 ? 115.789 -6.096  -104.074 1.00 0.00 ? 118 THR A O    5  
ATOM 10704 C CB   . THR A 1 118 ? 114.852 -8.141  -106.710 1.00 0.00 ? 118 THR A CB   5  
ATOM 10705 O OG1  . THR A 1 118 ? 113.755 -8.131  -105.807 1.00 0.00 ? 118 THR A OG1  5  
ATOM 10706 C CG2  . THR A 1 118 ? 115.390 -9.565  -106.858 1.00 0.00 ? 118 THR A CG2  5  
ATOM 10707 H H    . THR A 1 118 ? 117.858 -8.224  -105.843 1.00 0.00 ? 118 THR A H    5  
ATOM 10708 H HA   . THR A 1 118 ? 115.889 -6.266  -106.599 1.00 0.00 ? 118 THR A HA   5  
ATOM 10709 H HB   . THR A 1 118 ? 114.533 -7.778  -107.674 1.00 0.00 ? 118 THR A HB   5  
ATOM 10710 H HG1  . THR A 1 118 ? 113.167 -8.851  -106.047 1.00 0.00 ? 118 THR A HG1  5  
ATOM 10711 H HG21 . THR A 1 118 ? 114.575 -10.268 -106.787 1.00 0.00 ? 118 THR A HG21 5  
ATOM 10712 H HG22 . THR A 1 118 ? 116.105 -9.762  -106.071 1.00 0.00 ? 118 THR A HG22 5  
ATOM 10713 H HG23 . THR A 1 118 ? 115.875 -9.668  -107.817 1.00 0.00 ? 118 THR A HG23 5  
ATOM 10714 N N    . ASP A 1 119 ? 115.802 -8.292  -103.985 1.00 0.00 ? 119 ASP A N    5  
ATOM 10715 C CA   . ASP A 1 119 ? 115.675 -8.289  -102.500 1.00 0.00 ? 119 ASP A CA   5  
ATOM 10716 C C    . ASP A 1 119 ? 116.995 -7.857  -101.860 1.00 0.00 ? 119 ASP A C    5  
ATOM 10717 O O    . ASP A 1 119 ? 118.064 -8.235  -102.297 1.00 0.00 ? 119 ASP A O    5  
ATOM 10718 C CB   . ASP A 1 119 ? 115.321 -9.698  -102.022 1.00 0.00 ? 119 ASP A CB   5  
ATOM 10719 C CG   . ASP A 1 119 ? 113.837 -9.759  -101.658 1.00 0.00 ? 119 ASP A CG   5  
ATOM 10720 O OD1  . ASP A 1 119 ? 113.329 -8.768  -101.160 1.00 0.00 ? 119 ASP A OD1  5  
ATOM 10721 O OD2  . ASP A 1 119 ? 113.232 -10.795 -101.883 1.00 0.00 ? 119 ASP A OD2  5  
ATOM 10722 H H    . ASP A 1 119 ? 115.844 -9.143  -104.469 1.00 0.00 ? 119 ASP A H    5  
ATOM 10723 H HA   . ASP A 1 119 ? 114.893 -7.604  -102.208 1.00 0.00 ? 119 ASP A HA   5  
ATOM 10724 H HB2  . ASP A 1 119 ? 115.530 -10.408 -102.811 1.00 0.00 ? 119 ASP A HB2  5  
ATOM 10725 H HB3  . ASP A 1 119 ? 115.913 -9.943  -101.153 1.00 0.00 ? 119 ASP A HB3  5  
ATOM 10726 N N    . LEU A 1 120 ? 116.927 -7.073  -100.818 1.00 0.00 ? 120 LEU A N    5  
ATOM 10727 C CA   . LEU A 1 120 ? 118.173 -6.623  -100.140 1.00 0.00 ? 120 LEU A CA   5  
ATOM 10728 C C    . LEU A 1 120 ? 118.939 -7.850  -99.648  1.00 0.00 ? 120 LEU A C    5  
ATOM 10729 O O    . LEU A 1 120 ? 120.137 -7.833  -99.452  1.00 0.00 ? 120 LEU A O    5  
ATOM 10730 C CB   . LEU A 1 120 ? 117.799 -5.760  -98.933  1.00 0.00 ? 120 LEU A CB   5  
ATOM 10731 C CG   . LEU A 1 120 ? 118.502 -4.404  -99.041  1.00 0.00 ? 120 LEU A CG   5  
ATOM 10732 C CD1  . LEU A 1 120 ? 118.455 -3.696  -97.686  1.00 0.00 ? 120 LEU A CD1  5  
ATOM 10733 C CD2  . LEU A 1 120 ? 119.964 -4.613  -99.458  1.00 0.00 ? 120 LEU A CD2  5  
ATOM 10734 H H    . LEU A 1 120 ? 116.055 -6.785  -100.479 1.00 0.00 ? 120 LEU A H    5  
ATOM 10735 H HA   . LEU A 1 120 ? 118.751 -6.020  -100.824 1.00 0.00 ? 120 LEU A HA   5  
ATOM 10736 H HB2  . LEU A 1 120 ? 116.728 -5.613  -98.914  1.00 0.00 ? 120 LEU A HB2  5  
ATOM 10737 H HB3  . LEU A 1 120 ? 118.110 -6.254  -98.024  1.00 0.00 ? 120 LEU A HB3  5  
ATOM 10738 H HG   . LEU A 1 120 ? 117.999 -3.797  -99.780  1.00 0.00 ? 120 LEU A HG   5  
ATOM 10739 H HD11 . LEU A 1 120 ? 117.445 -3.373  -97.485  1.00 0.00 ? 120 LEU A HD11 5  
ATOM 10740 H HD12 . LEU A 1 120 ? 119.110 -2.838  -97.705  1.00 0.00 ? 120 LEU A HD12 5  
ATOM 10741 H HD13 . LEU A 1 120 ? 118.775 -4.379  -96.913  1.00 0.00 ? 120 LEU A HD13 5  
ATOM 10742 H HD21 . LEU A 1 120 ? 120.248 -5.639  -99.273  1.00 0.00 ? 120 LEU A HD21 5  
ATOM 10743 H HD22 . LEU A 1 120 ? 120.600 -3.955  -98.886  1.00 0.00 ? 120 LEU A HD22 5  
ATOM 10744 H HD23 . LEU A 1 120 ? 120.075 -4.393  -100.510 1.00 0.00 ? 120 LEU A HD23 5  
ATOM 10745 N N    . GLU A 1 121 ? 118.217 -8.921  -99.457  1.00 0.00 ? 121 GLU A N    5  
ATOM 10746 C CA   . GLU A 1 121 ? 118.813 -10.203 -98.983  1.00 0.00 ? 121 GLU A CA   5  
ATOM 10747 C C    . GLU A 1 121 ? 119.793 -10.751 -100.013 1.00 0.00 ? 121 GLU A C    5  
ATOM 10748 O O    . GLU A 1 121 ? 120.808 -11.321 -99.658  1.00 0.00 ? 121 GLU A O    5  
ATOM 10749 C CB   . GLU A 1 121 ? 117.688 -11.220 -98.787  1.00 0.00 ? 121 GLU A CB   5  
ATOM 10750 C CG   . GLU A 1 121 ? 116.882 -10.859 -97.538  1.00 0.00 ? 121 GLU A CG   5  
ATOM 10751 C CD   . GLU A 1 121 ? 115.714 -9.951  -97.929  1.00 0.00 ? 121 GLU A CD   5  
ATOM 10752 O OE1  . GLU A 1 121 ? 115.236 -10.081 -99.043  1.00 0.00 ? 121 GLU A OE1  5  
ATOM 10753 O OE2  . GLU A 1 121 ? 115.317 -9.143  -97.105  1.00 0.00 ? 121 GLU A OE2  5  
ATOM 10754 H H    . GLU A 1 121 ? 117.258 -8.883  -99.651  1.00 0.00 ? 121 GLU A H    5  
ATOM 10755 H HA   . GLU A 1 121 ? 119.340 -10.088 -98.047  1.00 0.00 ? 121 GLU A HA   5  
ATOM 10756 H HB2  . GLU A 1 121 ? 117.039 -11.210 -99.651  1.00 0.00 ? 121 GLU A HB2  5  
ATOM 10757 H HB3  . GLU A 1 121 ? 118.111 -12.206 -98.666  1.00 0.00 ? 121 GLU A HB3  5  
ATOM 10758 H HG2  . GLU A 1 121 ? 116.501 -11.760 -97.081  1.00 0.00 ? 121 GLU A HG2  5  
ATOM 10759 H HG3  . GLU A 1 121 ? 117.519 -10.340 -96.836  1.00 0.00 ? 121 GLU A HG3  5  
ATOM 10760 N N    . ALA A 1 122 ? 119.534 -10.588 -101.275 1.00 0.00 ? 122 ALA A N    5  
ATOM 10761 C CA   . ALA A 1 122 ? 120.505 -11.116 -102.266 1.00 0.00 ? 122 ALA A CA   5  
ATOM 10762 C C    . ALA A 1 122 ? 121.758 -10.236 -102.219 1.00 0.00 ? 122 ALA A C    5  
ATOM 10763 O O    . ALA A 1 122 ? 122.764 -10.625 -101.657 1.00 0.00 ? 122 ALA A O    5  
ATOM 10764 C CB   . ALA A 1 122 ? 119.890 -11.098 -103.667 1.00 0.00 ? 122 ALA A CB   5  
ATOM 10765 H H    . ALA A 1 122 ? 118.724 -10.120 -101.566 1.00 0.00 ? 122 ALA A H    5  
ATOM 10766 H HA   . ALA A 1 122 ? 120.761 -12.124 -101.979 1.00 0.00 ? 122 ALA A HA   5  
ATOM 10767 H HB1  . ALA A 1 122 ? 120.678 -11.103 -104.406 1.00 0.00 ? 122 ALA A HB1  5  
ATOM 10768 H HB2  . ALA A 1 122 ? 119.290 -10.208 -103.786 1.00 0.00 ? 122 ALA A HB2  5  
ATOM 10769 H HB3  . ALA A 1 122 ? 119.269 -11.972 -103.798 1.00 0.00 ? 122 ALA A HB3  5  
ATOM 10770 N N    . ALA A 1 123 ? 121.725 -9.059  -102.779 1.00 0.00 ? 123 ALA A N    5  
ATOM 10771 C CA   . ALA A 1 123 ? 122.938 -8.198  -102.722 1.00 0.00 ? 123 ALA A CA   5  
ATOM 10772 C C    . ALA A 1 123 ? 123.509 -8.226  -101.301 1.00 0.00 ? 123 ALA A C    5  
ATOM 10773 O O    . ALA A 1 123 ? 124.709 -8.203  -101.105 1.00 0.00 ? 123 ALA A O    5  
ATOM 10774 C CB   . ALA A 1 123 ? 122.564 -6.764  -103.099 1.00 0.00 ? 123 ALA A CB   5  
ATOM 10775 H H    . ALA A 1 123 ? 120.922 -8.735  -103.237 1.00 0.00 ? 123 ALA A H    5  
ATOM 10776 H HA   . ALA A 1 123 ? 123.677 -8.572  -103.416 1.00 0.00 ? 123 ALA A HA   5  
ATOM 10777 H HB1  . ALA A 1 123 ? 121.965 -6.331  -102.312 1.00 0.00 ? 123 ALA A HB1  5  
ATOM 10778 H HB2  . ALA A 1 123 ? 122.002 -6.770  -104.020 1.00 0.00 ? 123 ALA A HB2  5  
ATOM 10779 H HB3  . ALA A 1 123 ? 123.463 -6.180  -103.230 1.00 0.00 ? 123 ALA A HB3  5  
ATOM 10780 N N    . ALA A 1 124 ? 122.664 -8.285  -100.304 1.00 0.00 ? 124 ALA A N    5  
ATOM 10781 C CA   . ALA A 1 124 ? 123.176 -8.328  -98.905  1.00 0.00 ? 124 ALA A CA   5  
ATOM 10782 C C    . ALA A 1 124 ? 124.135 -9.507  -98.772  1.00 0.00 ? 124 ALA A C    5  
ATOM 10783 O O    . ALA A 1 124 ? 125.330 -9.336  -98.632  1.00 0.00 ? 124 ALA A O    5  
ATOM 10784 C CB   . ALA A 1 124 ? 122.013 -8.506  -97.927  1.00 0.00 ? 124 ALA A CB   5  
ATOM 10785 H H    . ALA A 1 124 ? 121.700 -8.311  -100.477 1.00 0.00 ? 124 ALA A H    5  
ATOM 10786 H HA   . ALA A 1 124 ? 123.699 -7.408  -98.682  1.00 0.00 ? 124 ALA A HA   5  
ATOM 10787 H HB1  . ALA A 1 124 ? 121.501 -7.564  -97.799  1.00 0.00 ? 124 ALA A HB1  5  
ATOM 10788 H HB2  . ALA A 1 124 ? 122.394 -8.840  -96.972  1.00 0.00 ? 124 ALA A HB2  5  
ATOM 10789 H HB3  . ALA A 1 124 ? 121.325 -9.241  -98.316  1.00 0.00 ? 124 ALA A HB3  5  
ATOM 10790 N N    . ARG A 1 125 ? 123.624 -10.707 -98.808  1.00 0.00 ? 125 ARG A N    5  
ATOM 10791 C CA   . ARG A 1 125 ? 124.519 -11.888 -98.677  1.00 0.00 ? 125 ARG A CA   5  
ATOM 10792 C C    . ARG A 1 125 ? 125.756 -11.650 -99.540  1.00 0.00 ? 125 ARG A C    5  
ATOM 10793 O O    . ARG A 1 125 ? 126.865 -11.946 -99.146  1.00 0.00 ? 125 ARG A O    5  
ATOM 10794 C CB   . ARG A 1 125 ? 123.789 -13.144 -99.159  1.00 0.00 ? 125 ARG A CB   5  
ATOM 10795 C CG   . ARG A 1 125 ? 124.360 -14.372 -98.446  1.00 0.00 ? 125 ARG A CG   5  
ATOM 10796 C CD   . ARG A 1 125 ? 123.430 -15.567 -98.663  1.00 0.00 ? 125 ARG A CD   5  
ATOM 10797 N NE   . ARG A 1 125 ? 123.632 -16.110 -100.036 1.00 0.00 ? 125 ARG A NE   5  
ATOM 10798 C CZ   . ARG A 1 125 ? 123.179 -17.295 -100.342 1.00 0.00 ? 125 ARG A CZ   5  
ATOM 10799 N NH1  . ARG A 1 125 ? 122.551 -18.005 -99.445  1.00 0.00 ? 125 ARG A NH1  5  
ATOM 10800 N NH2  . ARG A 1 125 ? 123.354 -17.769 -101.545 1.00 0.00 ? 125 ARG A NH2  5  
ATOM 10801 H H    . ARG A 1 125 ? 122.654 -10.826 -98.902  1.00 0.00 ? 125 ARG A H    5  
ATOM 10802 H HA   . ARG A 1 125 ? 124.812 -12.009 -97.645  1.00 0.00 ? 125 ARG A HA   5  
ATOM 10803 H HB2  . ARG A 1 125 ? 122.735 -13.055 -98.939  1.00 0.00 ? 125 ARG A HB2  5  
ATOM 10804 H HB3  . ARG A 1 125 ? 123.927 -13.255 -100.225 1.00 0.00 ? 125 ARG A HB3  5  
ATOM 10805 H HG2  . ARG A 1 125 ? 125.338 -14.597 -98.844  1.00 0.00 ? 125 ARG A HG2  5  
ATOM 10806 H HG3  . ARG A 1 125 ? 124.439 -14.168 -97.388  1.00 0.00 ? 125 ARG A HG3  5  
ATOM 10807 H HD2  . ARG A 1 125 ? 123.655 -16.334 -97.936  1.00 0.00 ? 125 ARG A HD2  5  
ATOM 10808 H HD3  . ARG A 1 125 ? 122.404 -15.251 -98.548  1.00 0.00 ? 125 ARG A HD3  5  
ATOM 10809 H HE   . ARG A 1 125 ? 124.105 -15.576 -100.709 1.00 0.00 ? 125 ARG A HE   5  
ATOM 10810 H HH11 . ARG A 1 125 ? 122.417 -17.641 -98.523  1.00 0.00 ? 125 ARG A HH11 5  
ATOM 10811 H HH12 . ARG A 1 125 ? 122.203 -18.912 -99.680  1.00 0.00 ? 125 ARG A HH12 5  
ATOM 10812 H HH21 . ARG A 1 125 ? 123.836 -17.225 -102.231 1.00 0.00 ? 125 ARG A HH21 5  
ATOM 10813 H HH22 . ARG A 1 125 ? 123.007 -18.677 -101.780 1.00 0.00 ? 125 ARG A HH22 5  
ATOM 10814 N N    . MET A 1 126 ? 125.582 -11.084 -100.702 1.00 0.00 ? 126 MET A N    5  
ATOM 10815 C CA   . MET A 1 126 ? 126.756 -10.799 -101.566 1.00 0.00 ? 126 MET A CA   5  
ATOM 10816 C C    . MET A 1 126 ? 127.775 -9.997  -100.753 1.00 0.00 ? 126 MET A C    5  
ATOM 10817 O O    . MET A 1 126 ? 128.749 -10.528 -100.260 1.00 0.00 ? 126 MET A O    5  
ATOM 10818 C CB   . MET A 1 126 ? 126.306 -9.975  -102.773 1.00 0.00 ? 126 MET A CB   5  
ATOM 10819 C CG   . MET A 1 126 ? 127.377 -10.033 -103.862 1.00 0.00 ? 126 MET A CG   5  
ATOM 10820 S SD   . MET A 1 126 ? 126.584 -10.176 -105.484 1.00 0.00 ? 126 MET A SD   5  
ATOM 10821 C CE   . MET A 1 126 ? 125.601 -8.659  -105.391 1.00 0.00 ? 126 MET A CE   5  
ATOM 10822 H H    . MET A 1 126 ? 124.682 -10.828 -100.995 1.00 0.00 ? 126 MET A H    5  
ATOM 10823 H HA   . MET A 1 126 ? 127.202 -11.723 -101.906 1.00 0.00 ? 126 MET A HA   5  
ATOM 10824 H HB2  . MET A 1 126 ? 125.379 -10.376 -103.158 1.00 0.00 ? 126 MET A HB2  5  
ATOM 10825 H HB3  . MET A 1 126 ? 126.158 -8.949  -102.474 1.00 0.00 ? 126 MET A HB3  5  
ATOM 10826 H HG2  . MET A 1 126 ? 127.968 -9.131  -103.829 1.00 0.00 ? 126 MET A HG2  5  
ATOM 10827 H HG3  . MET A 1 126 ? 128.016 -10.889 -103.698 1.00 0.00 ? 126 MET A HG3  5  
ATOM 10828 H HE1  . MET A 1 126 ? 125.835 -8.028  -106.236 1.00 0.00 ? 126 MET A HE1  5  
ATOM 10829 H HE2  . MET A 1 126 ? 125.832 -8.134  -104.478 1.00 0.00 ? 126 MET A HE2  5  
ATOM 10830 H HE3  . MET A 1 126 ? 124.550 -8.912  -105.401 1.00 0.00 ? 126 MET A HE3  5  
ATOM 10831 N N    . ILE A 1 127 ? 127.544 -8.722  -100.601 1.00 0.00 ? 127 ILE A N    5  
ATOM 10832 C CA   . ILE A 1 127 ? 128.483 -7.865  -99.815  1.00 0.00 ? 127 ILE A CA   5  
ATOM 10833 C C    . ILE A 1 127 ? 128.814 -8.539  -98.481  1.00 0.00 ? 127 ILE A C    5  
ATOM 10834 O O    . ILE A 1 127 ? 129.942 -8.904  -98.214  1.00 0.00 ? 127 ILE A O    5  
ATOM 10835 C CB   . ILE A 1 127 ? 127.802 -6.526  -99.534  1.00 0.00 ? 127 ILE A CB   5  
ATOM 10836 C CG1  . ILE A 1 127 ? 127.577 -5.771  -100.846 1.00 0.00 ? 127 ILE A CG1  5  
ATOM 10837 C CG2  . ILE A 1 127 ? 128.674 -5.686  -98.602  1.00 0.00 ? 127 ILE A CG2  5  
ATOM 10838 C CD1  . ILE A 1 127 ? 128.873 -5.720  -101.647 1.00 0.00 ? 127 ILE A CD1  5  
ATOM 10839 H H    . ILE A 1 127 ? 126.744 -8.322  -101.004 1.00 0.00 ? 127 ILE A H    5  
ATOM 10840 H HA   . ILE A 1 127 ? 129.388 -7.704  -100.377 1.00 0.00 ? 127 ILE A HA   5  
ATOM 10841 H HB   . ILE A 1 127 ? 126.848 -6.707  -99.058  1.00 0.00 ? 127 ILE A HB   5  
ATOM 10842 H HG12 . ILE A 1 127 ? 126.822 -6.278  -101.425 1.00 0.00 ? 127 ILE A HG12 5  
ATOM 10843 H HG13 . ILE A 1 127 ? 127.254 -4.766  -100.630 1.00 0.00 ? 127 ILE A HG13 5  
ATOM 10844 H HG21 . ILE A 1 127 ? 128.133 -4.797  -98.316  1.00 0.00 ? 127 ILE A HG21 5  
ATOM 10845 H HG22 . ILE A 1 127 ? 129.582 -5.408  -99.111  1.00 0.00 ? 127 ILE A HG22 5  
ATOM 10846 H HG23 . ILE A 1 127 ? 128.915 -6.259  -97.719  1.00 0.00 ? 127 ILE A HG23 5  
ATOM 10847 H HD11 . ILE A 1 127 ? 128.970 -6.625  -102.227 1.00 0.00 ? 127 ILE A HD11 5  
ATOM 10848 H HD12 . ILE A 1 127 ? 129.707 -5.630  -100.970 1.00 0.00 ? 127 ILE A HD12 5  
ATOM 10849 H HD13 . ILE A 1 127 ? 128.849 -4.867  -102.308 1.00 0.00 ? 127 ILE A HD13 5  
ATOM 10850 N N    . ALA A 1 128 ? 127.827 -8.708  -97.650  1.00 0.00 ? 128 ALA A N    5  
ATOM 10851 C CA   . ALA A 1 128 ? 128.081 -9.362  -96.337  1.00 0.00 ? 128 ALA A CA   5  
ATOM 10852 C C    . ALA A 1 128 ? 128.606 -10.770 -96.613  1.00 0.00 ? 128 ALA A C    5  
ATOM 10853 O O    . ALA A 1 128 ? 129.768 -11.064 -96.400  1.00 0.00 ? 128 ALA A O    5  
ATOM 10854 C CB   . ALA A 1 128 ? 126.798 -9.419  -95.505  1.00 0.00 ? 128 ALA A CB   5  
ATOM 10855 H H    . ALA A 1 128 ? 126.937 -8.404  -97.927  1.00 0.00 ? 128 ALA A H    5  
ATOM 10856 H HA   . ALA A 1 128 ? 128.850 -8.813  -95.814  1.00 0.00 ? 128 ALA A HA   5  
ATOM 10857 H HB1  . ALA A 1 128 ? 127.019 -9.148  -94.482  1.00 0.00 ? 128 ALA A HB1  5  
ATOM 10858 H HB2  . ALA A 1 128 ? 126.394 -10.421 -95.533  1.00 0.00 ? 128 ALA A HB2  5  
ATOM 10859 H HB3  . ALA A 1 128 ? 126.074 -8.728  -95.912  1.00 0.00 ? 128 ALA A HB3  5  
ATOM 10860 N N    . GLY A 1 129 ? 127.768 -11.650 -97.076  1.00 0.00 ? 129 GLY A N    5  
ATOM 10861 C CA   . GLY A 1 129 ? 128.248 -13.031 -97.347  1.00 0.00 ? 129 GLY A CA   5  
ATOM 10862 C C    . GLY A 1 129 ? 129.616 -12.948 -98.034  1.00 0.00 ? 129 GLY A C    5  
ATOM 10863 O O    . GLY A 1 129 ? 130.529 -13.678 -97.703  1.00 0.00 ? 129 GLY A O    5  
ATOM 10864 H H    . GLY A 1 129 ? 126.827 -11.408 -97.204  1.00 0.00 ? 129 GLY A H    5  
ATOM 10865 H HA2  . GLY A 1 129 ? 128.341 -13.571 -96.415  1.00 0.00 ? 129 GLY A HA2  5  
ATOM 10866 H HA3  . GLY A 1 129 ? 127.553 -13.542 -97.994  1.00 0.00 ? 129 GLY A HA3  5  
ATOM 10867 N N    . SER A 1 130 ? 129.790 -12.044 -98.964  1.00 0.00 ? 130 SER A N    5  
ATOM 10868 C CA   . SER A 1 130 ? 131.126 -11.921 -99.610  1.00 0.00 ? 130 SER A CA   5  
ATOM 10869 C C    . SER A 1 130 ? 132.159 -11.733 -98.501  1.00 0.00 ? 130 SER A C    5  
ATOM 10870 O O    . SER A 1 130 ? 133.160 -12.421 -98.443  1.00 0.00 ? 130 SER A O    5  
ATOM 10871 C CB   . SER A 1 130 ? 131.152 -10.711 -100.546 1.00 0.00 ? 130 SER A CB   5  
ATOM 10872 O OG   . SER A 1 130 ? 130.338 -10.978 -101.681 1.00 0.00 ? 130 SER A OG   5  
ATOM 10873 H H    . SER A 1 130 ? 129.064 -11.438 -99.218  1.00 0.00 ? 130 SER A H    5  
ATOM 10874 H HA   . SER A 1 130 ? 131.346 -12.821 -100.165 1.00 0.00 ? 130 SER A HA   5  
ATOM 10875 H HB2  . SER A 1 130 ? 130.772 -9.845  -100.031 1.00 0.00 ? 130 SER A HB2  5  
ATOM 10876 H HB3  . SER A 1 130 ? 132.171 -10.522 -100.858 1.00 0.00 ? 130 SER A HB3  5  
ATOM 10877 H HG   . SER A 1 130 ? 129.633 -11.570 -101.408 1.00 0.00 ? 130 SER A HG   5  
ATOM 10878 N N    . ALA A 1 131 ? 131.907 -10.820 -97.598  1.00 0.00 ? 131 ALA A N    5  
ATOM 10879 C CA   . ALA A 1 131 ? 132.855 -10.612 -96.471  1.00 0.00 ? 131 ALA A CA   5  
ATOM 10880 C C    . ALA A 1 131 ? 133.155 -11.981 -95.871  1.00 0.00 ? 131 ALA A C    5  
ATOM 10881 O O    . ALA A 1 131 ? 134.298 -12.354 -95.690  1.00 0.00 ? 131 ALA A O    5  
ATOM 10882 C CB   . ALA A 1 131 ? 132.212 -9.706  -95.419  1.00 0.00 ? 131 ALA A CB   5  
ATOM 10883 H H    . ALA A 1 131 ? 131.082 -10.291 -97.650  1.00 0.00 ? 131 ALA A H    5  
ATOM 10884 H HA   . ALA A 1 131 ? 133.771 -10.164 -96.836  1.00 0.00 ? 131 ALA A HA   5  
ATOM 10885 H HB1  . ALA A 1 131 ? 132.933 -8.974  -95.087  1.00 0.00 ? 131 ALA A HB1  5  
ATOM 10886 H HB2  . ALA A 1 131 ? 131.888 -10.301 -94.579  1.00 0.00 ? 131 ALA A HB2  5  
ATOM 10887 H HB3  . ALA A 1 131 ? 131.362 -9.202  -95.854  1.00 0.00 ? 131 ALA A HB3  5  
ATOM 10888 N N    . ARG A 1 132 ? 132.136 -12.761 -95.617  1.00 0.00 ? 132 ARG A N    5  
ATOM 10889 C CA   . ARG A 1 132 ? 132.385 -14.131 -95.095  1.00 0.00 ? 132 ARG A CA   5  
ATOM 10890 C C    . ARG A 1 132 ? 133.491 -14.731 -95.951  1.00 0.00 ? 132 ARG A C    5  
ATOM 10891 O O    . ARG A 1 132 ? 134.525 -15.127 -95.452  1.00 0.00 ? 132 ARG A O    5  
ATOM 10892 C CB   . ARG A 1 132 ? 131.118 -14.984 -95.209  1.00 0.00 ? 132 ARG A CB   5  
ATOM 10893 C CG   . ARG A 1 132 ? 131.403 -16.392 -94.682  1.00 0.00 ? 132 ARG A CG   5  
ATOM 10894 C CD   . ARG A 1 132 ? 132.224 -17.169 -95.715  1.00 0.00 ? 132 ARG A CD   5  
ATOM 10895 N NE   . ARG A 1 132 ? 131.796 -18.596 -95.717  1.00 0.00 ? 132 ARG A NE   5  
ATOM 10896 C CZ   . ARG A 1 132 ? 132.134 -19.378 -96.706  1.00 0.00 ? 132 ARG A CZ   5  
ATOM 10897 N NH1  . ARG A 1 132 ? 132.847 -18.908 -97.693  1.00 0.00 ? 132 ARG A NH1  5  
ATOM 10898 N NH2  . ARG A 1 132 ? 131.760 -20.628 -96.707  1.00 0.00 ? 132 ARG A NH2  5  
ATOM 10899 H H    . ARG A 1 132 ? 131.222 -12.462 -95.817  1.00 0.00 ? 132 ARG A H    5  
ATOM 10900 H HA   . ARG A 1 132 ? 132.725 -14.113 -94.068  1.00 0.00 ? 132 ARG A HA   5  
ATOM 10901 H HB2  . ARG A 1 132 ? 130.328 -14.534 -94.626  1.00 0.00 ? 132 ARG A HB2  5  
ATOM 10902 H HB3  . ARG A 1 132 ? 130.814 -15.044 -96.241  1.00 0.00 ? 132 ARG A HB3  5  
ATOM 10903 H HG2  . ARG A 1 132 ? 131.958 -16.325 -93.757  1.00 0.00 ? 132 ARG A HG2  5  
ATOM 10904 H HG3  . ARG A 1 132 ? 130.470 -16.907 -94.507  1.00 0.00 ? 132 ARG A HG3  5  
ATOM 10905 H HD2  . ARG A 1 132 ? 132.065 -16.745 -96.695  1.00 0.00 ? 132 ARG A HD2  5  
ATOM 10906 H HD3  . ARG A 1 132 ? 133.272 -17.109 -95.462  1.00 0.00 ? 132 ARG A HD3  5  
ATOM 10907 H HE   . ARG A 1 132 ? 131.260 -18.949 -94.976  1.00 0.00 ? 132 ARG A HE   5  
ATOM 10908 H HH11 . ARG A 1 132 ? 133.135 -17.951 -97.692  1.00 0.00 ? 132 ARG A HH11 5  
ATOM 10909 H HH12 . ARG A 1 132 ? 133.108 -19.508 -98.451  1.00 0.00 ? 132 ARG A HH12 5  
ATOM 10910 H HH21 . ARG A 1 132 ? 131.214 -20.987 -95.951  1.00 0.00 ? 132 ARG A HH21 5  
ATOM 10911 H HH22 . ARG A 1 132 ? 132.020 -21.226 -97.465  1.00 0.00 ? 132 ARG A HH22 5  
ATOM 10912 N N    . SER A 1 133 ? 133.315 -14.751 -97.244  1.00 0.00 ? 133 SER A N    5  
ATOM 10913 C CA   . SER A 1 133 ? 134.406 -15.271 -98.107  1.00 0.00 ? 133 SER A CA   5  
ATOM 10914 C C    . SER A 1 133 ? 135.700 -14.655 -97.587  1.00 0.00 ? 133 SER A C    5  
ATOM 10915 O O    . SER A 1 133 ? 136.537 -15.319 -97.008  1.00 0.00 ? 133 SER A O    5  
ATOM 10916 C CB   . SER A 1 133 ? 134.168 -14.828 -99.552  1.00 0.00 ? 133 SER A CB   5  
ATOM 10917 O OG   . SER A 1 133 ? 134.975 -15.611 -100.421 1.00 0.00 ? 133 SER A OG   5  
ATOM 10918 H H    . SER A 1 133 ? 132.492 -14.390 -97.641  1.00 0.00 ? 133 SER A H    5  
ATOM 10919 H HA   . SER A 1 133 ? 134.455 -16.351 -98.057  1.00 0.00 ? 133 SER A HA   5  
ATOM 10920 H HB2  . SER A 1 133 ? 133.132 -14.969 -99.807  1.00 0.00 ? 133 SER A HB2  5  
ATOM 10921 H HB3  . SER A 1 133 ? 134.423 -13.781 -99.652  1.00 0.00 ? 133 SER A HB3  5  
ATOM 10922 H HG   . SER A 1 133 ? 135.147 -16.452 -99.990  1.00 0.00 ? 133 SER A HG   5  
ATOM 10923 N N    . MET A 1 134 ? 135.846 -13.370 -97.765  1.00 0.00 ? 134 MET A N    5  
ATOM 10924 C CA   . MET A 1 134 ? 137.055 -12.661 -97.260  1.00 0.00 ? 134 MET A CA   5  
ATOM 10925 C C    . MET A 1 134 ? 137.340 -13.105 -95.823  1.00 0.00 ? 134 MET A C    5  
ATOM 10926 O O    . MET A 1 134 ? 138.308 -12.691 -95.215  1.00 0.00 ? 134 MET A O    5  
ATOM 10927 C CB   . MET A 1 134 ? 136.769 -11.154 -97.264  1.00 0.00 ? 134 MET A CB   5  
ATOM 10928 C CG   . MET A 1 134 ? 137.953 -10.402 -96.661  1.00 0.00 ? 134 MET A CG   5  
ATOM 10929 S SD   . MET A 1 134 ? 138.353 -8.973  -97.699  1.00 0.00 ? 134 MET A SD   5  
ATOM 10930 C CE   . MET A 1 134 ? 136.845 -8.021  -97.382  1.00 0.00 ? 134 MET A CE   5  
ATOM 10931 H H    . MET A 1 134 ? 135.146 -12.858 -98.224  1.00 0.00 ? 134 MET A H    5  
ATOM 10932 H HA   . MET A 1 134 ? 137.910 -12.868 -97.887  1.00 0.00 ? 134 MET A HA   5  
ATOM 10933 H HB2  . MET A 1 134 ? 136.608 -10.821 -98.277  1.00 0.00 ? 134 MET A HB2  5  
ATOM 10934 H HB3  . MET A 1 134 ? 135.884 -10.956 -96.675  1.00 0.00 ? 134 MET A HB3  5  
ATOM 10935 H HG2  . MET A 1 134 ? 137.697 -10.064 -95.668  1.00 0.00 ? 134 MET A HG2  5  
ATOM 10936 H HG3  . MET A 1 134 ? 138.805 -11.058 -96.608  1.00 0.00 ? 134 MET A HG3  5  
ATOM 10937 H HE1  . MET A 1 134 ? 136.391 -7.740  -98.322  1.00 0.00 ? 134 MET A HE1  5  
ATOM 10938 H HE2  . MET A 1 134 ? 137.090 -7.130  -96.824  1.00 0.00 ? 134 MET A HE2  5  
ATOM 10939 H HE3  . MET A 1 134 ? 136.154 -8.622  -96.809  1.00 0.00 ? 134 MET A HE3  5  
ATOM 10940 N N    . GLY A 1 135 ? 136.487 -13.919 -95.263  1.00 0.00 ? 135 GLY A N    5  
ATOM 10941 C CA   . GLY A 1 135 ? 136.690 -14.359 -93.853  1.00 0.00 ? 135 GLY A CA   5  
ATOM 10942 C C    . GLY A 1 135 ? 135.973 -13.358 -92.952  1.00 0.00 ? 135 GLY A C    5  
ATOM 10943 O O    . GLY A 1 135 ? 135.457 -13.691 -91.904  1.00 0.00 ? 135 GLY A O    5  
ATOM 10944 H H    . GLY A 1 135 ? 135.699 -14.220 -95.760  1.00 0.00 ? 135 GLY A H    5  
ATOM 10945 H HA2  . GLY A 1 135 ? 136.274 -15.347 -93.715  1.00 0.00 ? 135 GLY A HA2  5  
ATOM 10946 H HA3  . GLY A 1 135 ? 137.743 -14.366 -93.618  1.00 0.00 ? 135 GLY A HA3  5  
ATOM 10947 N N    . VAL A 1 136 ? 135.929 -12.130 -93.385  1.00 0.00 ? 136 VAL A N    5  
ATOM 10948 C CA   . VAL A 1 136 ? 135.236 -11.075 -92.600  1.00 0.00 ? 136 VAL A CA   5  
ATOM 10949 C C    . VAL A 1 136 ? 133.890 -11.611 -92.122  1.00 0.00 ? 136 VAL A C    5  
ATOM 10950 O O    . VAL A 1 136 ? 133.406 -12.615 -92.604  1.00 0.00 ? 136 VAL A O    5  
ATOM 10951 C CB   . VAL A 1 136 ? 135.002 -9.858  -93.492  1.00 0.00 ? 136 VAL A CB   5  
ATOM 10952 C CG1  . VAL A 1 136 ? 133.973 -8.932  -92.839  1.00 0.00 ? 136 VAL A CG1  5  
ATOM 10953 C CG2  . VAL A 1 136 ? 136.318 -9.102  -93.675  1.00 0.00 ? 136 VAL A CG2  5  
ATOM 10954 H H    . VAL A 1 136 ? 136.350 -11.915 -94.243  1.00 0.00 ? 136 VAL A H    5  
ATOM 10955 H HA   . VAL A 1 136 ? 135.841 -10.794 -91.751  1.00 0.00 ? 136 VAL A HA   5  
ATOM 10956 H HB   . VAL A 1 136 ? 134.633 -10.187 -94.453  1.00 0.00 ? 136 VAL A HB   5  
ATOM 10957 H HG11 . VAL A 1 136 ? 134.211 -8.809  -91.795  1.00 0.00 ? 136 VAL A HG11 5  
ATOM 10958 H HG12 . VAL A 1 136 ? 132.987 -9.364  -92.935  1.00 0.00 ? 136 VAL A HG12 5  
ATOM 10959 H HG13 . VAL A 1 136 ? 133.995 -7.970  -93.329  1.00 0.00 ? 136 VAL A HG13 5  
ATOM 10960 H HG21 . VAL A 1 136 ? 137.145 -9.788  -93.570  1.00 0.00 ? 136 VAL A HG21 5  
ATOM 10961 H HG22 . VAL A 1 136 ? 136.396 -8.328  -92.927  1.00 0.00 ? 136 VAL A HG22 5  
ATOM 10962 H HG23 . VAL A 1 136 ? 136.343 -8.656  -94.659  1.00 0.00 ? 136 VAL A HG23 5  
ATOM 10963 N N    . GLU A 1 137 ? 133.275 -10.947 -91.187  1.00 0.00 ? 137 GLU A N    5  
ATOM 10964 C CA   . GLU A 1 137 ? 131.953 -11.426 -90.700  1.00 0.00 ? 137 GLU A CA   5  
ATOM 10965 C C    . GLU A 1 137 ? 131.071 -10.225 -90.369  1.00 0.00 ? 137 GLU A C    5  
ATOM 10966 O O    . GLU A 1 137 ? 131.554 -9.122  -90.201  1.00 0.00 ? 137 GLU A O    5  
ATOM 10967 C CB   . GLU A 1 137 ? 132.151 -12.275 -89.442  1.00 0.00 ? 137 GLU A CB   5  
ATOM 10968 C CG   . GLU A 1 137 ? 130.948 -13.202 -89.257  1.00 0.00 ? 137 GLU A CG   5  
ATOM 10969 C CD   . GLU A 1 137 ? 131.260 -14.571 -89.864  1.00 0.00 ? 137 GLU A CD   5  
ATOM 10970 O OE1  . GLU A 1 137 ? 132.408 -14.977 -89.804  1.00 0.00 ? 137 GLU A OE1  5  
ATOM 10971 O OE2  . GLU A 1 137 ? 130.343 -15.190 -90.381  1.00 0.00 ? 137 GLU A OE2  5  
ATOM 10972 H H    . GLU A 1 137 ? 133.678 -10.130 -90.819  1.00 0.00 ? 137 GLU A H    5  
ATOM 10973 H HA   . GLU A 1 137 ? 131.496 -12.028 -91.471  1.00 0.00 ? 137 GLU A HA   5  
ATOM 10974 H HB2  . GLU A 1 137 ? 133.050 -12.866 -89.544  1.00 0.00 ? 137 GLU A HB2  5  
ATOM 10975 H HB3  . GLU A 1 137 ? 132.240 -11.629 -88.582  1.00 0.00 ? 137 GLU A HB3  5  
ATOM 10976 H HG2  . GLU A 1 137 ? 130.739 -13.314 -88.203  1.00 0.00 ? 137 GLU A HG2  5  
ATOM 10977 H HG3  . GLU A 1 137 ? 130.087 -12.778 -89.752  1.00 0.00 ? 137 GLU A HG3  5  
ATOM 10978 N N    . VAL A 1 138 ? 129.789 -10.424 -90.242  1.00 0.00 ? 138 VAL A N    5  
ATOM 10979 C CA   . VAL A 1 138 ? 128.909 -9.280  -89.887  1.00 0.00 ? 138 VAL A CA   5  
ATOM 10980 C C    . VAL A 1 138 ? 129.051 -9.062  -88.382  1.00 0.00 ? 138 VAL A C    5  
ATOM 10981 O O    . VAL A 1 138 ? 128.843 -9.958  -87.588  1.00 0.00 ? 138 VAL A O    5  
ATOM 10982 C CB   . VAL A 1 138 ? 127.458 -9.608  -90.244  1.00 0.00 ? 138 VAL A CB   5  
ATOM 10983 C CG1  . VAL A 1 138 ? 126.689 -8.309  -90.492  1.00 0.00 ? 138 VAL A CG1  5  
ATOM 10984 C CG2  . VAL A 1 138 ? 127.427 -10.469 -91.508  1.00 0.00 ? 138 VAL A CG2  5  
ATOM 10985 H H    . VAL A 1 138 ? 129.413 -11.321 -90.351  1.00 0.00 ? 138 VAL A H    5  
ATOM 10986 H HA   . VAL A 1 138 ? 129.230 -8.394  -90.416  1.00 0.00 ? 138 VAL A HA   5  
ATOM 10987 H HB   . VAL A 1 138 ? 127.000 -10.147 -89.426  1.00 0.00 ? 138 VAL A HB   5  
ATOM 10988 H HG11 . VAL A 1 138 ? 125.766 -8.531  -91.006  1.00 0.00 ? 138 VAL A HG11 5  
ATOM 10989 H HG12 . VAL A 1 138 ? 127.288 -7.647  -91.102  1.00 0.00 ? 138 VAL A HG12 5  
ATOM 10990 H HG13 . VAL A 1 138 ? 126.471 -7.831  -89.550  1.00 0.00 ? 138 VAL A HG13 5  
ATOM 10991 H HG21 . VAL A 1 138 ? 127.988 -9.979  -92.291  1.00 0.00 ? 138 VAL A HG21 5  
ATOM 10992 H HG22 . VAL A 1 138 ? 126.404 -10.602 -91.827  1.00 0.00 ? 138 VAL A HG22 5  
ATOM 10993 H HG23 . VAL A 1 138 ? 127.867 -11.433 -91.299  1.00 0.00 ? 138 VAL A HG23 5  
ATOM 10994 N N    . VAL A 1 139 ? 129.416 -7.874  -87.990  1.00 0.00 ? 139 VAL A N    5  
ATOM 10995 C CA   . VAL A 1 139 ? 129.590 -7.576  -86.542  1.00 0.00 ? 139 VAL A CA   5  
ATOM 10996 C C    . VAL A 1 139 ? 128.365 -8.047  -85.750  1.00 0.00 ? 139 VAL A C    5  
ATOM 10997 O O    . VAL A 1 139 ? 128.276 -7.839  -84.556  1.00 0.00 ? 139 VAL A O    5  
ATOM 10998 C CB   . VAL A 1 139 ? 129.762 -6.068  -86.363  1.00 0.00 ? 139 VAL A CB   5  
ATOM 10999 C CG1  . VAL A 1 139 ? 128.521 -5.355  -86.888  1.00 0.00 ? 139 VAL A CG1  5  
ATOM 11000 C CG2  . VAL A 1 139 ? 129.955 -5.745  -84.881  1.00 0.00 ? 139 VAL A CG2  5  
ATOM 11001 H H    . VAL A 1 139 ? 129.585 -7.174  -88.654  1.00 0.00 ? 139 VAL A H    5  
ATOM 11002 H HA   . VAL A 1 139 ? 130.470 -8.082  -86.174  1.00 0.00 ? 139 VAL A HA   5  
ATOM 11003 H HB   . VAL A 1 139 ? 130.622 -5.734  -86.923  1.00 0.00 ? 139 VAL A HB   5  
ATOM 11004 H HG11 . VAL A 1 139 ? 128.049 -4.812  -86.085  1.00 0.00 ? 139 VAL A HG11 5  
ATOM 11005 H HG12 . VAL A 1 139 ? 127.830 -6.083  -87.288  1.00 0.00 ? 139 VAL A HG12 5  
ATOM 11006 H HG13 . VAL A 1 139 ? 128.808 -4.668  -87.668  1.00 0.00 ? 139 VAL A HG13 5  
ATOM 11007 H HG21 . VAL A 1 139 ? 130.187 -6.653  -84.342  1.00 0.00 ? 139 VAL A HG21 5  
ATOM 11008 H HG22 . VAL A 1 139 ? 129.048 -5.313  -84.485  1.00 0.00 ? 139 VAL A HG22 5  
ATOM 11009 H HG23 . VAL A 1 139 ? 130.768 -5.042  -84.768  1.00 0.00 ? 139 VAL A HG23 5  
ATOM 11010 N N    . GLY A 1 140 ? 127.423 -8.682  -86.394  1.00 0.00 ? 140 GLY A N    5  
ATOM 11011 C CA   . GLY A 1 140 ? 126.219 -9.160  -85.655  1.00 0.00 ? 140 GLY A CA   5  
ATOM 11012 C C    . GLY A 1 140 ? 125.041 -9.321  -86.619  1.00 0.00 ? 140 GLY A C    5  
ATOM 11013 O O    . GLY A 1 140 ? 124.842 -10.367 -87.204  1.00 0.00 ? 140 GLY A O    5  
ATOM 11014 H H    . GLY A 1 140 ? 127.509 -8.848  -87.356  1.00 0.00 ? 140 GLY A H    5  
ATOM 11015 H HA2  . GLY A 1 140 ? 126.438 -10.113 -85.193  1.00 0.00 ? 140 GLY A HA2  5  
ATOM 11016 H HA3  . GLY A 1 140 ? 125.958 -8.444  -84.893  1.00 0.00 ? 140 GLY A HA3  5  
ATOM 11017 N N    . ALA A 1 141 ? 124.252 -8.294  -86.782  1.00 0.00 ? 141 ALA A N    5  
ATOM 11018 C CA   . ALA A 1 141 ? 123.080 -8.389  -87.698  1.00 0.00 ? 141 ALA A CA   5  
ATOM 11019 C C    . ALA A 1 141 ? 121.977 -9.214  -87.030  1.00 0.00 ? 141 ALA A C    5  
ATOM 11020 O O    . ALA A 1 141 ? 121.556 -10.233 -87.540  1.00 0.00 ? 141 ALA A O    5  
ATOM 11021 C CB   . ALA A 1 141 ? 123.505 -9.069  -89.002  1.00 0.00 ? 141 ALA A CB   5  
ATOM 11022 H H    . ALA A 1 141 ? 124.426 -7.461  -86.295  1.00 0.00 ? 141 ALA A H    5  
ATOM 11023 H HA   . ALA A 1 141 ? 122.709 -7.398  -87.914  1.00 0.00 ? 141 ALA A HA   5  
ATOM 11024 H HB1  . ALA A 1 141 ? 122.872 -8.731  -89.809  1.00 0.00 ? 141 ALA A HB1  5  
ATOM 11025 H HB2  . ALA A 1 141 ? 123.412 -10.140 -88.897  1.00 0.00 ? 141 ALA A HB2  5  
ATOM 11026 H HB3  . ALA A 1 141 ? 124.532 -8.818  -89.221  1.00 0.00 ? 141 ALA A HB3  5  
ATOM 11027 N N    . PRO A 1 142 ? 121.514 -8.771  -85.889  1.00 0.00 ? 142 PRO A N    5  
ATOM 11028 C CA   . PRO A 1 142 ? 120.442 -9.489  -85.146  1.00 0.00 ? 142 PRO A CA   5  
ATOM 11029 C C    . PRO A 1 142 ? 119.110 -9.508  -85.906  1.00 0.00 ? 142 PRO A C    5  
ATOM 11030 O O    . PRO A 1 142 ? 119.053 -9.227  -87.086  1.00 0.00 ? 142 PRO A O    5  
ATOM 11031 C CB   . PRO A 1 142 ? 120.314 -8.666  -83.863  1.00 0.00 ? 142 PRO A CB   5  
ATOM 11032 C CG   . PRO A 1 142 ? 121.228 -7.438  -83.966  1.00 0.00 ? 142 PRO A CG   5  
ATOM 11033 C CD   . PRO A 1 142 ? 122.031 -7.525  -85.267  1.00 0.00 ? 142 PRO A CD   5  
ATOM 11034 H HA   . PRO A 1 142 ? 120.754 -10.491 -84.903  1.00 0.00 ? 142 PRO A HA   5  
ATOM 11035 H HB2  . PRO A 1 142 ? 119.289 -8.348  -83.738  1.00 0.00 ? 142 PRO A HB2  5  
ATOM 11036 H HB3  . PRO A 1 142 ? 120.613 -9.266  -83.016  1.00 0.00 ? 142 PRO A HB3  5  
ATOM 11037 H HG2  . PRO A 1 142 ? 120.627 -6.540  -83.969  1.00 0.00 ? 142 PRO A HG2  5  
ATOM 11038 H HG3  . PRO A 1 142 ? 121.905 -7.418  -83.125  1.00 0.00 ? 142 PRO A HG3  5  
ATOM 11039 H HD2  . PRO A 1 142 ? 121.834 -6.666  -85.896  1.00 0.00 ? 142 PRO A HD2  5  
ATOM 11040 H HD3  . PRO A 1 142 ? 123.084 -7.618  -85.059  1.00 0.00 ? 142 PRO A HD3  5  
ATOM 11041 N N    . GLU A 1 143 ? 118.040 -9.838  -85.234  1.00 0.00 ? 143 GLU A N    5  
ATOM 11042 C CA   . GLU A 1 143 ? 116.713 -9.875  -85.910  1.00 0.00 ? 143 GLU A CA   5  
ATOM 11043 C C    . GLU A 1 143 ? 115.667 -9.204  -85.018  1.00 0.00 ? 143 GLU A C    5  
ATOM 11044 O O    . GLU A 1 143 ? 115.994 -8.507  -84.077  1.00 0.00 ? 143 GLU A O    5  
ATOM 11045 C CB   . GLU A 1 143 ? 116.310 -11.330 -86.163  1.00 0.00 ? 143 GLU A CB   5  
ATOM 11046 C CG   . GLU A 1 143 ? 117.428 -12.046 -86.921  1.00 0.00 ? 143 GLU A CG   5  
ATOM 11047 C CD   . GLU A 1 143 ? 117.023 -13.500 -87.177  1.00 0.00 ? 143 GLU A CD   5  
ATOM 11048 O OE1  . GLU A 1 143 ? 115.934 -13.870 -86.769  1.00 0.00 ? 143 GLU A OE1  5  
ATOM 11049 O OE2  . GLU A 1 143 ? 117.808 -14.217 -87.775  1.00 0.00 ? 143 GLU A OE2  5  
ATOM 11050 H H    . GLU A 1 143 ? 118.110 -10.060 -84.281  1.00 0.00 ? 143 GLU A H    5  
ATOM 11051 H HA   . GLU A 1 143 ? 116.774 -9.350  -86.852  1.00 0.00 ? 143 GLU A HA   5  
ATOM 11052 H HB2  . GLU A 1 143 ? 116.140 -11.825 -85.217  1.00 0.00 ? 143 GLU A HB2  5  
ATOM 11053 H HB3  . GLU A 1 143 ? 115.404 -11.356 -86.751  1.00 0.00 ? 143 GLU A HB3  5  
ATOM 11054 H HG2  . GLU A 1 143 ? 117.600 -11.548 -87.865  1.00 0.00 ? 143 GLU A HG2  5  
ATOM 11055 H HG3  . GLU A 1 143 ? 118.333 -12.026 -86.333  1.00 0.00 ? 143 GLU A HG3  5  
ATOM 11056 N N    . VAL A 1 144 ? 114.410 -9.407  -85.304  1.00 0.00 ? 144 VAL A N    5  
ATOM 11057 C CA   . VAL A 1 144 ? 113.344 -8.779  -84.471  1.00 0.00 ? 144 VAL A CA   5  
ATOM 11058 C C    . VAL A 1 144 ? 113.409 -9.342  -83.049  1.00 0.00 ? 144 VAL A C    5  
ATOM 11059 O O    . VAL A 1 144 ? 114.288 -10.113 -82.717  1.00 0.00 ? 144 VAL A O    5  
ATOM 11060 C CB   . VAL A 1 144 ? 111.974 -9.085  -85.078  1.00 0.00 ? 144 VAL A CB   5  
ATOM 11061 C CG1  . VAL A 1 144 ? 112.020 -8.848  -86.588  1.00 0.00 ? 144 VAL A CG1  5  
ATOM 11062 C CG2  . VAL A 1 144 ? 111.611 -10.547 -84.804  1.00 0.00 ? 144 VAL A CG2  5  
ATOM 11063 H H    . VAL A 1 144 ? 114.165 -9.971  -86.067  1.00 0.00 ? 144 VAL A H    5  
ATOM 11064 H HA   . VAL A 1 144 ? 113.494 -7.710  -84.441  1.00 0.00 ? 144 VAL A HA   5  
ATOM 11065 H HB   . VAL A 1 144 ? 111.232 -8.438  -84.634  1.00 0.00 ? 144 VAL A HB   5  
ATOM 11066 H HG11 . VAL A 1 144 ? 112.276 -7.816  -86.782  1.00 0.00 ? 144 VAL A HG11 5  
ATOM 11067 H HG12 . VAL A 1 144 ? 111.052 -9.065  -87.016  1.00 0.00 ? 144 VAL A HG12 5  
ATOM 11068 H HG13 . VAL A 1 144 ? 112.763 -9.493  -87.032  1.00 0.00 ? 144 VAL A HG13 5  
ATOM 11069 H HG21 . VAL A 1 144 ? 112.403 -11.187 -85.163  1.00 0.00 ? 144 VAL A HG21 5  
ATOM 11070 H HG22 . VAL A 1 144 ? 110.692 -10.791 -85.314  1.00 0.00 ? 144 VAL A HG22 5  
ATOM 11071 H HG23 . VAL A 1 144 ? 111.484 -10.693 -83.741  1.00 0.00 ? 144 VAL A HG23 5  
ATOM 11072 N N    . LYS A 1 145 ? 112.485 -8.964  -82.208  1.00 0.00 ? 145 LYS A N    5  
ATOM 11073 C CA   . LYS A 1 145 ? 112.496 -9.478  -80.810  1.00 0.00 ? 145 LYS A CA   5  
ATOM 11074 C C    . LYS A 1 145 ? 111.231 -9.012  -80.085  1.00 0.00 ? 145 LYS A C    5  
ATOM 11075 O O    . LYS A 1 145 ? 110.882 -9.520  -79.037  1.00 0.00 ? 145 LYS A O    5  
ATOM 11076 C CB   . LYS A 1 145 ? 113.728 -8.941  -80.078  1.00 0.00 ? 145 LYS A CB   5  
ATOM 11077 C CG   . LYS A 1 145 ? 113.769 -9.509  -78.657  1.00 0.00 ? 145 LYS A CG   5  
ATOM 11078 C CD   . LYS A 1 145 ? 114.987 -8.952  -77.918  1.00 0.00 ? 145 LYS A CD   5  
ATOM 11079 C CE   . LYS A 1 145 ? 114.524 -7.982  -76.829  1.00 0.00 ? 145 LYS A CE   5  
ATOM 11080 N NZ   . LYS A 1 145 ? 113.949 -6.762  -77.462  1.00 0.00 ? 145 LYS A NZ   5  
ATOM 11081 H H    . LYS A 1 145 ? 111.786 -8.340  -82.496  1.00 0.00 ? 145 LYS A H    5  
ATOM 11082 H HA   . LYS A 1 145 ? 112.526 -10.557 -80.823  1.00 0.00 ? 145 LYS A HA   5  
ATOM 11083 H HB2  . LYS A 1 145 ? 114.620 -9.237  -80.611  1.00 0.00 ? 145 LYS A HB2  5  
ATOM 11084 H HB3  . LYS A 1 145 ? 113.678 -7.863  -80.031  1.00 0.00 ? 145 LYS A HB3  5  
ATOM 11085 H HG2  . LYS A 1 145 ? 112.868 -9.228  -78.133  1.00 0.00 ? 145 LYS A HG2  5  
ATOM 11086 H HG3  . LYS A 1 145 ? 113.838 -10.586 -78.703  1.00 0.00 ? 145 LYS A HG3  5  
ATOM 11087 H HD2  . LYS A 1 145 ? 115.537 -9.766  -77.468  1.00 0.00 ? 145 LYS A HD2  5  
ATOM 11088 H HD3  . LYS A 1 145 ? 115.623 -8.429  -78.616  1.00 0.00 ? 145 LYS A HD3  5  
ATOM 11089 H HE2  . LYS A 1 145 ? 113.772 -8.459  -76.219  1.00 0.00 ? 145 LYS A HE2  5  
ATOM 11090 H HE3  . LYS A 1 145 ? 115.367 -7.705  -76.212  1.00 0.00 ? 145 LYS A HE3  5  
ATOM 11091 H HZ1  . LYS A 1 145 ? 114.536 -6.482  -78.273  1.00 0.00 ? 145 LYS A HZ1  5  
ATOM 11092 H HZ2  . LYS A 1 145 ? 113.927 -5.988  -76.766  1.00 0.00 ? 145 LYS A HZ2  5  
ATOM 11093 H HZ3  . LYS A 1 145 ? 112.983 -6.962  -77.788  1.00 0.00 ? 145 LYS A HZ3  5  
ATOM 11094 N N    . ASP A 1 146 ? 110.539 -8.052  -80.635  1.00 0.00 ? 146 ASP A N    5  
ATOM 11095 C CA   . ASP A 1 146 ? 109.297 -7.557  -79.976  1.00 0.00 ? 146 ASP A CA   5  
ATOM 11096 C C    . ASP A 1 146 ? 108.406 -8.745  -79.606  1.00 0.00 ? 146 ASP A C    5  
ATOM 11097 O O    . ASP A 1 146 ? 107.747 -9.324  -80.448  1.00 0.00 ? 146 ASP A O    5  
ATOM 11098 C CB   . ASP A 1 146 ? 108.544 -6.633  -80.935  1.00 0.00 ? 146 ASP A CB   5  
ATOM 11099 C CG   . ASP A 1 146 ? 107.907 -7.464  -82.050  1.00 0.00 ? 146 ASP A CG   5  
ATOM 11100 O OD1  . ASP A 1 146 ? 108.614 -7.812  -82.982  1.00 0.00 ? 146 ASP A OD1  5  
ATOM 11101 O OD2  . ASP A 1 146 ? 106.722 -7.738  -81.954  1.00 0.00 ? 146 ASP A OD2  5  
ATOM 11102 H H    . ASP A 1 146 ? 110.836 -7.656  -81.480  1.00 0.00 ? 146 ASP A H    5  
ATOM 11103 H HA   . ASP A 1 146 ? 109.557 -7.011  -79.081  1.00 0.00 ? 146 ASP A HA   5  
ATOM 11104 H HB2  . ASP A 1 146 ? 107.774 -6.103  -80.394  1.00 0.00 ? 146 ASP A HB2  5  
ATOM 11105 H HB3  . ASP A 1 146 ? 109.233 -5.924  -81.367  1.00 0.00 ? 146 ASP A HB3  5  
ATOM 11106 N N    . ALA A 1 147 ? 108.380 -9.112  -78.355  1.00 0.00 ? 147 ALA A N    5  
ATOM 11107 C CA   . ALA A 1 147 ? 107.532 -10.262 -77.934  1.00 0.00 ? 147 ALA A CA   5  
ATOM 11108 C C    . ALA A 1 147 ? 107.706 -11.415 -78.924  1.00 0.00 ? 147 ALA A C    5  
ATOM 11109 O O    . ALA A 1 147 ? 106.940 -12.362 -78.843  1.00 0.00 ? 147 ALA A O    5  
ATOM 11110 C CB   . ALA A 1 147 ? 106.064 -9.831  -77.907  1.00 0.00 ? 147 ALA A CB   5  
ATOM 11111 H H    . ALA A 1 147 ? 108.920 -8.633  -77.692  1.00 0.00 ? 147 ALA A H    5  
ATOM 11112 H HA   . ALA A 1 147 ? 107.829 -10.587 -76.947  1.00 0.00 ? 147 ALA A HA   5  
ATOM 11113 H HB1  . ALA A 1 147 ? 105.826 -9.309  -78.822  1.00 0.00 ? 147 ALA A HB1  5  
ATOM 11114 H HB2  . ALA A 1 147 ? 105.897 -9.176  -77.065  1.00 0.00 ? 147 ALA A HB2  5  
ATOM 11115 H HB3  . ALA A 1 147 ? 105.434 -10.703 -77.816  1.00 0.00 ? 147 ALA A HB3  5  
ATOM 11116 N N    . MET A 1 1   ? 131.304 20.393  -121.138 1.00 0.00 ? 1   MET A N    6  
ATOM 11117 C CA   . MET A 1 1   ? 132.724 20.419  -120.686 1.00 0.00 ? 1   MET A CA   6  
ATOM 11118 C C    . MET A 1 1   ? 132.878 19.542  -119.442 1.00 0.00 ? 1   MET A C    6  
ATOM 11119 O O    . MET A 1 1   ? 133.824 19.674  -118.691 1.00 0.00 ? 1   MET A O    6  
ATOM 11120 C CB   . MET A 1 1   ? 133.124 21.857  -120.348 1.00 0.00 ? 1   MET A CB   6  
ATOM 11121 C CG   . MET A 1 1   ? 132.897 22.750  -121.569 1.00 0.00 ? 1   MET A CG   6  
ATOM 11122 S SD   . MET A 1 1   ? 134.490 23.146  -122.332 1.00 0.00 ? 1   MET A SD   6  
ATOM 11123 C CE   . MET A 1 1   ? 134.287 24.944  -122.362 1.00 0.00 ? 1   MET A CE   6  
ATOM 11124 H H1   . MET A 1 1   ? 131.005 19.408  -121.287 1.00 0.00 ? 1   MET A H1   6  
ATOM 11125 H HA   . MET A 1 1   ? 133.359 20.043  -121.473 1.00 0.00 ? 1   MET A HA   6  
ATOM 11126 H HB2  . MET A 1 1   ? 132.524 22.214  -119.523 1.00 0.00 ? 1   MET A HB2  6  
ATOM 11127 H HB3  . MET A 1 1   ? 134.168 21.885  -120.073 1.00 0.00 ? 1   MET A HB3  6  
ATOM 11128 H HG2  . MET A 1 1   ? 132.274 22.232  -122.284 1.00 0.00 ? 1   MET A HG2  6  
ATOM 11129 H HG3  . MET A 1 1   ? 132.409 23.663  -121.261 1.00 0.00 ? 1   MET A HG3  6  
ATOM 11130 H HE1  . MET A 1 1   ? 133.287 25.187  -122.695 1.00 0.00 ? 1   MET A HE1  6  
ATOM 11131 H HE2  . MET A 1 1   ? 135.004 25.377  -123.041 1.00 0.00 ? 1   MET A HE2  6  
ATOM 11132 H HE3  . MET A 1 1   ? 134.449 25.340  -121.369 1.00 0.00 ? 1   MET A HE3  6  
ATOM 11133 N N    . LYS A 1 2   ? 131.957 18.645  -119.218 1.00 0.00 ? 2   LYS A N    6  
ATOM 11134 C CA   . LYS A 1 2   ? 132.053 17.760  -118.022 1.00 0.00 ? 2   LYS A CA   6  
ATOM 11135 C C    . LYS A 1 2   ? 131.472 16.385  -118.359 1.00 0.00 ? 2   LYS A C    6  
ATOM 11136 O O    . LYS A 1 2   ? 130.301 16.249  -118.651 1.00 0.00 ? 2   LYS A O    6  
ATOM 11137 C CB   . LYS A 1 2   ? 131.263 18.378  -116.866 1.00 0.00 ? 2   LYS A CB   6  
ATOM 11138 C CG   . LYS A 1 2   ? 129.860 18.755  -117.347 1.00 0.00 ? 2   LYS A CG   6  
ATOM 11139 C CD   . LYS A 1 2   ? 129.343 19.942  -116.532 1.00 0.00 ? 2   LYS A CD   6  
ATOM 11140 C CE   . LYS A 1 2   ? 129.821 21.248  -117.169 1.00 0.00 ? 2   LYS A CE   6  
ATOM 11141 N NZ   . LYS A 1 2   ? 129.371 22.400  -116.338 1.00 0.00 ? 2   LYS A NZ   6  
ATOM 11142 H H    . LYS A 1 2   ? 131.202 18.554  -119.836 1.00 0.00 ? 2   LYS A H    6  
ATOM 11143 H HA   . LYS A 1 2   ? 133.088 17.654  -117.735 1.00 0.00 ? 2   LYS A HA   6  
ATOM 11144 H HB2  . LYS A 1 2   ? 131.188 17.663  -116.060 1.00 0.00 ? 2   LYS A HB2  6  
ATOM 11145 H HB3  . LYS A 1 2   ? 131.771 19.263  -116.516 1.00 0.00 ? 2   LYS A HB3  6  
ATOM 11146 H HG2  . LYS A 1 2   ? 129.899 19.026  -118.393 1.00 0.00 ? 2   LYS A HG2  6  
ATOM 11147 H HG3  . LYS A 1 2   ? 129.196 17.914  -117.217 1.00 0.00 ? 2   LYS A HG3  6  
ATOM 11148 H HD2  . LYS A 1 2   ? 128.262 19.923  -116.516 1.00 0.00 ? 2   LYS A HD2  6  
ATOM 11149 H HD3  . LYS A 1 2   ? 129.719 19.877  -115.522 1.00 0.00 ? 2   LYS A HD3  6  
ATOM 11150 H HE2  . LYS A 1 2   ? 130.899 21.246  -117.227 1.00 0.00 ? 2   LYS A HE2  6  
ATOM 11151 H HE3  . LYS A 1 2   ? 129.407 21.336  -118.163 1.00 0.00 ? 2   LYS A HE3  6  
ATOM 11152 H HZ1  . LYS A 1 2   ? 129.495 22.173  -115.332 1.00 0.00 ? 2   LYS A HZ1  6  
ATOM 11153 H HZ2  . LYS A 1 2   ? 128.366 22.594  -116.530 1.00 0.00 ? 2   LYS A HZ2  6  
ATOM 11154 H HZ3  . LYS A 1 2   ? 129.937 23.240  -116.574 1.00 0.00 ? 2   LYS A HZ3  6  
ATOM 11155 N N    . LYS A 1 3   ? 132.283 15.363  -118.321 1.00 0.00 ? 3   LYS A N    6  
ATOM 11156 C CA   . LYS A 1 3   ? 131.779 13.998  -118.639 1.00 0.00 ? 3   LYS A CA   6  
ATOM 11157 C C    . LYS A 1 3   ? 132.907 12.982  -118.467 1.00 0.00 ? 3   LYS A C    6  
ATOM 11158 O O    . LYS A 1 3   ? 133.954 13.094  -119.075 1.00 0.00 ? 3   LYS A O    6  
ATOM 11159 C CB   . LYS A 1 3   ? 131.285 13.965  -120.087 1.00 0.00 ? 3   LYS A CB   6  
ATOM 11160 C CG   . LYS A 1 3   ? 130.293 12.814  -120.264 1.00 0.00 ? 3   LYS A CG   6  
ATOM 11161 C CD   . LYS A 1 3   ? 129.936 12.671  -121.744 1.00 0.00 ? 3   LYS A CD   6  
ATOM 11162 C CE   . LYS A 1 3   ? 128.417 12.596  -121.900 1.00 0.00 ? 3   LYS A CE   6  
ATOM 11163 N NZ   . LYS A 1 3   ? 128.054 12.756  -123.336 1.00 0.00 ? 3   LYS A NZ   6  
ATOM 11164 H H    . LYS A 1 3   ? 133.226 15.493  -118.083 1.00 0.00 ? 3   LYS A H    6  
ATOM 11165 H HA   . LYS A 1 3   ? 130.965 13.748  -117.975 1.00 0.00 ? 3   LYS A HA   6  
ATOM 11166 H HB2  . LYS A 1 3   ? 130.798 14.901  -120.323 1.00 0.00 ? 3   LYS A HB2  6  
ATOM 11167 H HB3  . LYS A 1 3   ? 132.126 13.820  -120.749 1.00 0.00 ? 3   LYS A HB3  6  
ATOM 11168 H HG2  . LYS A 1 3   ? 130.741 11.896  -119.910 1.00 0.00 ? 3   LYS A HG2  6  
ATOM 11169 H HG3  . LYS A 1 3   ? 129.398 13.020  -119.698 1.00 0.00 ? 3   LYS A HG3  6  
ATOM 11170 H HD2  . LYS A 1 3   ? 130.313 13.525  -122.290 1.00 0.00 ? 3   LYS A HD2  6  
ATOM 11171 H HD3  . LYS A 1 3   ? 130.381 11.769  -122.137 1.00 0.00 ? 3   LYS A HD3  6  
ATOM 11172 H HE2  . LYS A 1 3   ? 128.065 11.638  -121.544 1.00 0.00 ? 3   LYS A HE2  6  
ATOM 11173 H HE3  . LYS A 1 3   ? 127.956 13.384  -121.322 1.00 0.00 ? 3   LYS A HE3  6  
ATOM 11174 H HZ1  . LYS A 1 3   ? 127.702 13.720  -123.499 1.00 0.00 ? 3   LYS A HZ1  6  
ATOM 11175 H HZ2  . LYS A 1 3   ? 127.314 12.067  -123.585 1.00 0.00 ? 3   LYS A HZ2  6  
ATOM 11176 H HZ3  . LYS A 1 3   ? 128.894 12.592  -123.926 1.00 0.00 ? 3   LYS A HZ3  6  
ATOM 11177 N N    . VAL A 1 4   ? 132.701 11.983  -117.653 1.00 0.00 ? 4   VAL A N    6  
ATOM 11178 C CA   . VAL A 1 4   ? 133.762 10.957  -117.458 1.00 0.00 ? 4   VAL A CA   6  
ATOM 11179 C C    . VAL A 1 4   ? 134.333 10.572  -118.818 1.00 0.00 ? 4   VAL A C    6  
ATOM 11180 O O    . VAL A 1 4   ? 133.612 10.435  -119.786 1.00 0.00 ? 4   VAL A O    6  
ATOM 11181 C CB   . VAL A 1 4   ? 133.159 9.723   -116.789 1.00 0.00 ? 4   VAL A CB   6  
ATOM 11182 C CG1  . VAL A 1 4   ? 131.831 9.384   -117.464 1.00 0.00 ? 4   VAL A CG1  6  
ATOM 11183 C CG2  . VAL A 1 4   ? 134.122 8.542   -116.936 1.00 0.00 ? 4   VAL A CG2  6  
ATOM 11184 H H    . VAL A 1 4   ? 131.848 11.905  -117.177 1.00 0.00 ? 4   VAL A H    6  
ATOM 11185 H HA   . VAL A 1 4   ? 134.548 11.359  -116.838 1.00 0.00 ? 4   VAL A HA   6  
ATOM 11186 H HB   . VAL A 1 4   ? 132.988 9.925   -115.741 1.00 0.00 ? 4   VAL A HB   6  
ATOM 11187 H HG11 . VAL A 1 4   ? 131.127 10.186  -117.297 1.00 0.00 ? 4   VAL A HG11 6  
ATOM 11188 H HG12 . VAL A 1 4   ? 131.439 8.468   -117.049 1.00 0.00 ? 4   VAL A HG12 6  
ATOM 11189 H HG13 . VAL A 1 4   ? 131.989 9.260   -118.526 1.00 0.00 ? 4   VAL A HG13 6  
ATOM 11190 H HG21 . VAL A 1 4   ? 134.079 8.167   -117.948 1.00 0.00 ? 4   VAL A HG21 6  
ATOM 11191 H HG22 . VAL A 1 4   ? 133.836 7.758   -116.249 1.00 0.00 ? 4   VAL A HG22 6  
ATOM 11192 H HG23 . VAL A 1 4   ? 135.126 8.868   -116.714 1.00 0.00 ? 4   VAL A HG23 6  
ATOM 11193 N N    . VAL A 1 5   ? 135.621 10.397  -118.909 1.00 0.00 ? 5   VAL A N    6  
ATOM 11194 C CA   . VAL A 1 5   ? 136.217 10.024  -120.219 1.00 0.00 ? 5   VAL A CA   6  
ATOM 11195 C C    . VAL A 1 5   ? 136.984 8.709   -120.092 1.00 0.00 ? 5   VAL A C    6  
ATOM 11196 O O    . VAL A 1 5   ? 137.134 7.982   -121.053 1.00 0.00 ? 5   VAL A O    6  
ATOM 11197 C CB   . VAL A 1 5   ? 137.155 11.127  -120.711 1.00 0.00 ? 5   VAL A CB   6  
ATOM 11198 C CG1  . VAL A 1 5   ? 136.352 12.399  -120.985 1.00 0.00 ? 5   VAL A CG1  6  
ATOM 11199 C CG2  . VAL A 1 5   ? 138.215 11.411  -119.646 1.00 0.00 ? 5   VAL A CG2  6  
ATOM 11200 H H    . VAL A 1 5   ? 136.193 10.509  -118.121 1.00 0.00 ? 5   VAL A H    6  
ATOM 11201 H HA   . VAL A 1 5   ? 135.431 9.861   -120.940 1.00 0.00 ? 5   VAL A HA   6  
ATOM 11202 H HB   . VAL A 1 5   ? 137.637 10.805  -121.624 1.00 0.00 ? 5   VAL A HB   6  
ATOM 11203 H HG11 . VAL A 1 5   ? 135.374 12.135  -121.359 1.00 0.00 ? 5   VAL A HG11 6  
ATOM 11204 H HG12 . VAL A 1 5   ? 136.868 13.000  -121.720 1.00 0.00 ? 5   VAL A HG12 6  
ATOM 11205 H HG13 . VAL A 1 5   ? 136.248 12.962  -120.070 1.00 0.00 ? 5   VAL A HG13 6  
ATOM 11206 H HG21 . VAL A 1 5   ? 137.753 11.886  -118.797 1.00 0.00 ? 5   VAL A HG21 6  
ATOM 11207 H HG22 . VAL A 1 5   ? 138.972 12.063  -120.057 1.00 0.00 ? 5   VAL A HG22 6  
ATOM 11208 H HG23 . VAL A 1 5   ? 138.670 10.482  -119.335 1.00 0.00 ? 5   VAL A HG23 6  
ATOM 11209 N N    . ALA A 1 6   ? 137.444 8.368   -118.916 1.00 0.00 ? 6   ALA A N    6  
ATOM 11210 C CA   . ALA A 1 6   ? 138.158 7.066   -118.784 1.00 0.00 ? 6   ALA A CA   6  
ATOM 11211 C C    . ALA A 1 6   ? 138.083 6.554   -117.343 1.00 0.00 ? 6   ALA A C    6  
ATOM 11212 O O    . ALA A 1 6   ? 138.769 7.024   -116.457 1.00 0.00 ? 6   ALA A O    6  
ATOM 11213 C CB   . ALA A 1 6   ? 139.616 7.210   -119.216 1.00 0.00 ? 6   ALA A CB   6  
ATOM 11214 H H    . ALA A 1 6   ? 137.302 8.945   -118.132 1.00 0.00 ? 6   ALA A H    6  
ATOM 11215 H HA   . ALA A 1 6   ? 137.656 6.349   -119.415 1.00 0.00 ? 6   ALA A HA   6  
ATOM 11216 H HB1  . ALA A 1 6   ? 139.935 8.230   -119.066 1.00 0.00 ? 6   ALA A HB1  6  
ATOM 11217 H HB2  . ALA A 1 6   ? 139.709 6.953   -120.261 1.00 0.00 ? 6   ALA A HB2  6  
ATOM 11218 H HB3  . ALA A 1 6   ? 140.232 6.549   -118.626 1.00 0.00 ? 6   ALA A HB3  6  
ATOM 11219 N N    . VAL A 1 7   ? 137.255 5.567   -117.127 1.00 0.00 ? 7   VAL A N    6  
ATOM 11220 C CA   . VAL A 1 7   ? 137.108 4.959   -115.774 1.00 0.00 ? 7   VAL A CA   6  
ATOM 11221 C C    . VAL A 1 7   ? 137.974 3.706   -115.708 1.00 0.00 ? 7   VAL A C    6  
ATOM 11222 O O    . VAL A 1 7   ? 137.476 2.602   -115.807 1.00 0.00 ? 7   VAL A O    6  
ATOM 11223 C CB   . VAL A 1 7   ? 135.661 4.527   -115.578 1.00 0.00 ? 7   VAL A CB   6  
ATOM 11224 C CG1  . VAL A 1 7   ? 135.164 3.808   -116.833 1.00 0.00 ? 7   VAL A CG1  6  
ATOM 11225 C CG2  . VAL A 1 7   ? 135.606 3.576   -114.385 1.00 0.00 ? 7   VAL A CG2  6  
ATOM 11226 H H    . VAL A 1 7   ? 136.735 5.207   -117.876 1.00 0.00 ? 7   VAL A H    6  
ATOM 11227 H HA   . VAL A 1 7   ? 137.360 5.667   -115.001 1.00 0.00 ? 7   VAL A HA   6  
ATOM 11228 H HB   . VAL A 1 7   ? 135.045 5.392   -115.385 1.00 0.00 ? 7   VAL A HB   6  
ATOM 11229 H HG11 . VAL A 1 7   ? 134.621 4.503   -117.456 1.00 0.00 ? 7   VAL A HG11 6  
ATOM 11230 H HG12 . VAL A 1 7   ? 134.511 2.996   -116.548 1.00 0.00 ? 7   VAL A HG12 6  
ATOM 11231 H HG13 . VAL A 1 7   ? 136.007 3.415   -117.382 1.00 0.00 ? 7   VAL A HG13 6  
ATOM 11232 H HG21 . VAL A 1 7   ? 134.738 3.798   -113.787 1.00 0.00 ? 7   VAL A HG21 6  
ATOM 11233 H HG22 . VAL A 1 7   ? 136.499 3.703   -113.788 1.00 0.00 ? 7   VAL A HG22 6  
ATOM 11234 H HG23 . VAL A 1 7   ? 135.554 2.558   -114.739 1.00 0.00 ? 7   VAL A HG23 6  
ATOM 11235 N N    . VAL A 1 8   ? 139.256 3.846   -115.611 1.00 0.00 ? 8   VAL A N    6  
ATOM 11236 C CA   . VAL A 1 8   ? 140.110 2.622   -115.625 1.00 0.00 ? 8   VAL A CA   6  
ATOM 11237 C C    . VAL A 1 8   ? 139.570 1.579   -114.639 1.00 0.00 ? 8   VAL A C    6  
ATOM 11238 O O    . VAL A 1 8   ? 139.990 1.523   -113.501 1.00 0.00 ? 8   VAL A O    6  
ATOM 11239 C CB   . VAL A 1 8   ? 141.549 2.973   -115.268 1.00 0.00 ? 8   VAL A CB   6  
ATOM 11240 C CG1  . VAL A 1 8   ? 142.439 1.761   -115.531 1.00 0.00 ? 8   VAL A CG1  6  
ATOM 11241 C CG2  . VAL A 1 8   ? 142.015 4.150   -116.130 1.00 0.00 ? 8   VAL A CG2  6  
ATOM 11242 H H    . VAL A 1 8   ? 139.654 4.743   -115.605 1.00 0.00 ? 8   VAL A H    6  
ATOM 11243 H HA   . VAL A 1 8   ? 140.072 2.224   -116.628 1.00 0.00 ? 8   VAL A HA   6  
ATOM 11244 H HB   . VAL A 1 8   ? 141.605 3.238   -114.225 1.00 0.00 ? 8   VAL A HB   6  
ATOM 11245 H HG11 . VAL A 1 8   ? 143.321 2.071   -116.069 1.00 0.00 ? 8   VAL A HG11 6  
ATOM 11246 H HG12 . VAL A 1 8   ? 141.894 1.036   -116.119 1.00 0.00 ? 8   VAL A HG12 6  
ATOM 11247 H HG13 . VAL A 1 8   ? 142.727 1.317   -114.591 1.00 0.00 ? 8   VAL A HG13 6  
ATOM 11248 H HG21 . VAL A 1 8   ? 142.737 4.735   -115.581 1.00 0.00 ? 8   VAL A HG21 6  
ATOM 11249 H HG22 . VAL A 1 8   ? 141.167 4.770   -116.382 1.00 0.00 ? 8   VAL A HG22 6  
ATOM 11250 H HG23 . VAL A 1 8   ? 142.468 3.775   -117.035 1.00 0.00 ? 8   VAL A HG23 6  
ATOM 11251 N N    . LYS A 1 9   ? 138.658 0.744   -115.076 1.00 0.00 ? 9   LYS A N    6  
ATOM 11252 C CA   . LYS A 1 9   ? 138.097 -0.311  -114.173 1.00 0.00 ? 9   LYS A CA   6  
ATOM 11253 C C    . LYS A 1 9   ? 139.043 -1.515  -114.156 1.00 0.00 ? 9   LYS A C    6  
ATOM 11254 O O    . LYS A 1 9   ? 138.628 -2.656  -114.129 1.00 0.00 ? 9   LYS A O    6  
ATOM 11255 C CB   . LYS A 1 9   ? 136.722 -0.746  -114.684 1.00 0.00 ? 9   LYS A CB   6  
ATOM 11256 C CG   . LYS A 1 9   ? 135.821 -1.086  -113.496 1.00 0.00 ? 9   LYS A CG   6  
ATOM 11257 C CD   . LYS A 1 9   ? 136.303 -2.385  -112.845 1.00 0.00 ? 9   LYS A CD   6  
ATOM 11258 C CE   . LYS A 1 9   ? 135.270 -2.856  -111.819 1.00 0.00 ? 9   LYS A CE   6  
ATOM 11259 N NZ   . LYS A 1 9   ? 133.907 -2.779  -112.415 1.00 0.00 ? 9   LYS A NZ   6  
ATOM 11260 H H    . LYS A 1 9   ? 138.347 0.807   -116.003 1.00 0.00 ? 9   LYS A H    6  
ATOM 11261 H HA   . LYS A 1 9   ? 138.005 0.084   -113.175 1.00 0.00 ? 9   LYS A HA   6  
ATOM 11262 H HB2  . LYS A 1 9   ? 136.279 0.058   -115.254 1.00 0.00 ? 9   LYS A HB2  6  
ATOM 11263 H HB3  . LYS A 1 9   ? 136.831 -1.617  -115.313 1.00 0.00 ? 9   LYS A HB3  6  
ATOM 11264 H HG2  . LYS A 1 9   ? 135.859 -0.284  -112.773 1.00 0.00 ? 9   LYS A HG2  6  
ATOM 11265 H HG3  . LYS A 1 9   ? 134.805 -1.213  -113.840 1.00 0.00 ? 9   LYS A HG3  6  
ATOM 11266 H HD2  . LYS A 1 9   ? 136.428 -3.143  -113.605 1.00 0.00 ? 9   LYS A HD2  6  
ATOM 11267 H HD3  . LYS A 1 9   ? 137.246 -2.211  -112.350 1.00 0.00 ? 9   LYS A HD3  6  
ATOM 11268 H HE2  . LYS A 1 9   ? 135.483 -3.876  -111.537 1.00 0.00 ? 9   LYS A HE2  6  
ATOM 11269 H HE3  . LYS A 1 9   ? 135.317 -2.223  -110.945 1.00 0.00 ? 9   LYS A HE3  6  
ATOM 11270 H HZ1  . LYS A 1 9   ? 133.557 -1.801  -112.357 1.00 0.00 ? 9   LYS A HZ1  6  
ATOM 11271 H HZ2  . LYS A 1 9   ? 133.264 -3.410  -111.894 1.00 0.00 ? 9   LYS A HZ2  6  
ATOM 11272 H HZ3  . LYS A 1 9   ? 133.946 -3.071  -113.412 1.00 0.00 ? 9   LYS A HZ3  6  
ATOM 11273 N N    . LEU A 1 10  ? 140.313 -1.248  -114.192 1.00 0.00 ? 10  LEU A N    6  
ATOM 11274 C CA   . LEU A 1 10  ? 141.341 -2.330  -114.202 1.00 0.00 ? 10  LEU A CA   6  
ATOM 11275 C C    . LEU A 1 10  ? 141.544 -2.912  -112.807 1.00 0.00 ? 10  LEU A C    6  
ATOM 11276 O O    . LEU A 1 10  ? 140.869 -2.562  -111.862 1.00 0.00 ? 10  LEU A O    6  
ATOM 11277 C CB   . LEU A 1 10  ? 142.667 -1.724  -114.656 1.00 0.00 ? 10  LEU A CB   6  
ATOM 11278 C CG   . LEU A 1 10  ? 143.231 -2.573  -115.795 1.00 0.00 ? 10  LEU A CG   6  
ATOM 11279 C CD1  . LEU A 1 10  ? 142.243 -2.587  -116.963 1.00 0.00 ? 10  LEU A CD1  6  
ATOM 11280 C CD2  . LEU A 1 10  ? 144.554 -1.977  -116.261 1.00 0.00 ? 10  LEU A CD2  6  
ATOM 11281 H H    . LEU A 1 10  ? 140.600 -0.313  -114.234 1.00 0.00 ? 10  LEU A H    6  
ATOM 11282 H HA   . LEU A 1 10  ? 141.095 -3.108  -114.910 1.00 0.00 ? 10  LEU A HA   6  
ATOM 11283 H HB2  . LEU A 1 10  ? 142.502 -0.716  -115.003 1.00 0.00 ? 10  LEU A HB2  6  
ATOM 11284 H HB3  . LEU A 1 10  ? 143.366 -1.716  -113.834 1.00 0.00 ? 10  LEU A HB3  6  
ATOM 11285 H HG   . LEU A 1 10  ? 143.392 -3.583  -115.447 1.00 0.00 ? 10  LEU A HG   6  
ATOM 11286 H HD11 . LEU A 1 10  ? 142.772 -2.398  -117.886 1.00 0.00 ? 10  LEU A HD11 6  
ATOM 11287 H HD12 . LEU A 1 10  ? 141.497 -1.821  -116.812 1.00 0.00 ? 10  LEU A HD12 6  
ATOM 11288 H HD13 . LEU A 1 10  ? 141.762 -3.552  -117.016 1.00 0.00 ? 10  LEU A HD13 6  
ATOM 11289 H HD21 . LEU A 1 10  ? 144.392 -1.425  -117.175 1.00 0.00 ? 10  LEU A HD21 6  
ATOM 11290 H HD22 . LEU A 1 10  ? 145.265 -2.770  -116.439 1.00 0.00 ? 10  LEU A HD22 6  
ATOM 11291 H HD23 . LEU A 1 10  ? 144.934 -1.313  -115.500 1.00 0.00 ? 10  LEU A HD23 6  
ATOM 11292 N N    . GLN A 1 11  ? 142.508 -3.784  -112.681 1.00 0.00 ? 11  GLN A N    6  
ATOM 11293 C CA   . GLN A 1 11  ? 142.826 -4.390  -111.360 1.00 0.00 ? 11  GLN A CA   6  
ATOM 11294 C C    . GLN A 1 11  ? 144.301 -4.130  -111.064 1.00 0.00 ? 11  GLN A C    6  
ATOM 11295 O O    . GLN A 1 11  ? 145.016 -3.587  -111.882 1.00 0.00 ? 11  GLN A O    6  
ATOM 11296 C CB   . GLN A 1 11  ? 142.555 -5.898  -111.394 1.00 0.00 ? 11  GLN A CB   6  
ATOM 11297 C CG   . GLN A 1 11  ? 142.649 -6.411  -112.833 1.00 0.00 ? 11  GLN A CG   6  
ATOM 11298 C CD   . GLN A 1 11  ? 144.097 -6.325  -113.316 1.00 0.00 ? 11  GLN A CD   6  
ATOM 11299 O OE1  . GLN A 1 11  ? 144.712 -7.331  -113.613 1.00 0.00 ? 11  GLN A OE1  6  
ATOM 11300 N NE2  . GLN A 1 11  ? 144.671 -5.159  -113.411 1.00 0.00 ? 11  GLN A NE2  6  
ATOM 11301 H H    . GLN A 1 11  ? 143.047 -4.024  -113.464 1.00 0.00 ? 11  GLN A H    6  
ATOM 11302 H HA   . GLN A 1 11  ? 142.227 -3.929  -110.595 1.00 0.00 ? 11  GLN A HA   6  
ATOM 11303 H HB2  . GLN A 1 11  ? 143.286 -6.407  -110.782 1.00 0.00 ? 11  GLN A HB2  6  
ATOM 11304 H HB3  . GLN A 1 11  ? 141.566 -6.094  -111.008 1.00 0.00 ? 11  GLN A HB3  6  
ATOM 11305 H HG2  . GLN A 1 11  ? 142.317 -7.440  -112.869 1.00 0.00 ? 11  GLN A HG2  6  
ATOM 11306 H HG3  . GLN A 1 11  ? 142.022 -5.810  -113.472 1.00 0.00 ? 11  GLN A HG3  6  
ATOM 11307 H HE21 . GLN A 1 11  ? 144.173 -4.349  -113.172 1.00 0.00 ? 11  GLN A HE21 6  
ATOM 11308 H HE22 . GLN A 1 11  ? 145.597 -5.091  -113.720 1.00 0.00 ? 11  GLN A HE22 6  
ATOM 11309 N N    . LEU A 1 12  ? 144.776 -4.520  -109.917 1.00 0.00 ? 12  LEU A N    6  
ATOM 11310 C CA   . LEU A 1 12  ? 146.215 -4.292  -109.609 1.00 0.00 ? 12  LEU A CA   6  
ATOM 11311 C C    . LEU A 1 12  ? 146.619 -5.156  -108.415 1.00 0.00 ? 12  LEU A C    6  
ATOM 11312 O O    . LEU A 1 12  ? 145.828 -5.408  -107.530 1.00 0.00 ? 12  LEU A O    6  
ATOM 11313 C CB   . LEU A 1 12  ? 146.457 -2.815  -109.288 1.00 0.00 ? 12  LEU A CB   6  
ATOM 11314 C CG   . LEU A 1 12  ? 147.102 -2.123  -110.494 1.00 0.00 ? 12  LEU A CG   6  
ATOM 11315 C CD1  . LEU A 1 12  ? 146.127 -1.104  -111.080 1.00 0.00 ? 12  LEU A CD1  6  
ATOM 11316 C CD2  . LEU A 1 12  ? 148.377 -1.404  -110.047 1.00 0.00 ? 12  LEU A CD2  6  
ATOM 11317 H H    . LEU A 1 12  ? 144.199 -4.976  -109.270 1.00 0.00 ? 12  LEU A H    6  
ATOM 11318 H HA   . LEU A 1 12  ? 146.801 -4.573  -110.467 1.00 0.00 ? 12  LEU A HA   6  
ATOM 11319 H HB2  . LEU A 1 12  ? 145.516 -2.338  -109.057 1.00 0.00 ? 12  LEU A HB2  6  
ATOM 11320 H HB3  . LEU A 1 12  ? 147.118 -2.738  -108.439 1.00 0.00 ? 12  LEU A HB3  6  
ATOM 11321 H HG   . LEU A 1 12  ? 147.348 -2.856  -111.248 1.00 0.00 ? 12  LEU A HG   6  
ATOM 11322 H HD11 . LEU A 1 12  ? 146.025 -0.272  -110.400 1.00 0.00 ? 12  LEU A HD11 6  
ATOM 11323 H HD12 . LEU A 1 12  ? 145.165 -1.570  -111.225 1.00 0.00 ? 12  LEU A HD12 6  
ATOM 11324 H HD13 . LEU A 1 12  ? 146.502 -0.751  -112.029 1.00 0.00 ? 12  LEU A HD13 6  
ATOM 11325 H HD21 . LEU A 1 12  ? 148.650 -0.663  -110.784 1.00 0.00 ? 12  LEU A HD21 6  
ATOM 11326 H HD22 . LEU A 1 12  ? 149.178 -2.122  -109.947 1.00 0.00 ? 12  LEU A HD22 6  
ATOM 11327 H HD23 . LEU A 1 12  ? 148.205 -0.921  -109.097 1.00 0.00 ? 12  LEU A HD23 6  
ATOM 11328 N N    . PRO A 1 13  ? 147.839 -5.620  -108.406 1.00 0.00 ? 13  PRO A N    6  
ATOM 11329 C CA   . PRO A 1 13  ? 148.351 -6.495  -107.313 1.00 0.00 ? 13  PRO A CA   6  
ATOM 11330 C C    . PRO A 1 13  ? 148.876 -5.717  -106.099 1.00 0.00 ? 13  PRO A C    6  
ATOM 11331 O O    . PRO A 1 13  ? 149.748 -4.881  -106.226 1.00 0.00 ? 13  PRO A O    6  
ATOM 11332 C CB   . PRO A 1 13  ? 149.514 -7.169  -108.029 1.00 0.00 ? 13  PRO A CB   6  
ATOM 11333 C CG   . PRO A 1 13  ? 150.007 -6.185  -109.092 1.00 0.00 ? 13  PRO A CG   6  
ATOM 11334 C CD   . PRO A 1 13  ? 148.815 -5.315  -109.491 1.00 0.00 ? 13  PRO A CD   6  
ATOM 11335 H HA   . PRO A 1 13  ? 147.625 -7.231  -107.022 1.00 0.00 ? 13  PRO A HA   6  
ATOM 11336 H HB2  . PRO A 1 13  ? 150.300 -7.387  -107.329 1.00 0.00 ? 13  PRO A HB2  6  
ATOM 11337 H HB3  . PRO A 1 13  ? 149.180 -8.077  -108.506 1.00 0.00 ? 13  PRO A HB3  6  
ATOM 11338 H HG2  . PRO A 1 13  ? 150.792 -5.566  -108.680 1.00 0.00 ? 13  PRO A HG2  6  
ATOM 11339 H HG3  . PRO A 1 13  ? 150.375 -6.715  -109.953 1.00 0.00 ? 13  PRO A HG3  6  
ATOM 11340 H HD2  . PRO A 1 13  ? 149.086 -4.266  -109.494 1.00 0.00 ? 13  PRO A HD2  6  
ATOM 11341 H HD3  . PRO A 1 13  ? 148.424 -5.620  -110.447 1.00 0.00 ? 13  PRO A HD3  6  
ATOM 11342 N N    . ALA A 1 14  ? 148.387 -6.005  -104.921 1.00 0.00 ? 14  ALA A N    6  
ATOM 11343 C CA   . ALA A 1 14  ? 148.913 -5.292  -103.725 1.00 0.00 ? 14  ALA A CA   6  
ATOM 11344 C C    . ALA A 1 14  ? 150.301 -5.873  -103.431 1.00 0.00 ? 14  ALA A C    6  
ATOM 11345 O O    . ALA A 1 14  ? 150.525 -7.054  -103.606 1.00 0.00 ? 14  ALA A O    6  
ATOM 11346 C CB   . ALA A 1 14  ? 147.976 -5.495  -102.531 1.00 0.00 ? 14  ALA A CB   6  
ATOM 11347 H H    . ALA A 1 14  ? 147.703 -6.700  -104.823 1.00 0.00 ? 14  ALA A H    6  
ATOM 11348 H HA   . ALA A 1 14  ? 149.000 -4.242  -103.960 1.00 0.00 ? 14  ALA A HA   6  
ATOM 11349 H HB1  . ALA A 1 14  ? 147.483 -4.563  -102.297 1.00 0.00 ? 14  ALA A HB1  6  
ATOM 11350 H HB2  . ALA A 1 14  ? 148.546 -5.827  -101.676 1.00 0.00 ? 14  ALA A HB2  6  
ATOM 11351 H HB3  . ALA A 1 14  ? 147.235 -6.238  -102.780 1.00 0.00 ? 14  ALA A HB3  6  
ATOM 11352 N N    . GLY A 1 15  ? 151.235 -5.067  -102.989 1.00 0.00 ? 15  GLY A N    6  
ATOM 11353 C CA   . GLY A 1 15  ? 152.601 -5.608  -102.703 1.00 0.00 ? 15  GLY A CA   6  
ATOM 11354 C C    . GLY A 1 15  ? 153.073 -6.386  -103.930 1.00 0.00 ? 15  GLY A C    6  
ATOM 11355 O O    . GLY A 1 15  ? 153.382 -7.560  -103.864 1.00 0.00 ? 15  GLY A O    6  
ATOM 11356 H H    . GLY A 1 15  ? 151.042 -4.116  -102.852 1.00 0.00 ? 15  GLY A H    6  
ATOM 11357 H HA2  . GLY A 1 15  ? 153.279 -4.792  -102.501 1.00 0.00 ? 15  GLY A HA2  6  
ATOM 11358 H HA3  . GLY A 1 15  ? 152.560 -6.269  -101.851 1.00 0.00 ? 15  GLY A HA3  6  
ATOM 11359 N N    . LYS A 1 16  ? 153.088 -5.737  -105.057 1.00 0.00 ? 16  LYS A N    6  
ATOM 11360 C CA   . LYS A 1 16  ? 153.487 -6.411  -106.322 1.00 0.00 ? 16  LYS A CA   6  
ATOM 11361 C C    . LYS A 1 16  ? 153.275 -5.450  -107.492 1.00 0.00 ? 16  LYS A C    6  
ATOM 11362 O O    . LYS A 1 16  ? 153.493 -5.795  -108.637 1.00 0.00 ? 16  LYS A O    6  
ATOM 11363 C CB   . LYS A 1 16  ? 152.627 -7.660  -106.510 1.00 0.00 ? 16  LYS A CB   6  
ATOM 11364 C CG   . LYS A 1 16  ? 152.733 -8.144  -107.957 1.00 0.00 ? 16  LYS A CG   6  
ATOM 11365 C CD   . LYS A 1 16  ? 152.278 -9.602  -108.044 1.00 0.00 ? 16  LYS A CD   6  
ATOM 11366 C CE   . LYS A 1 16  ? 152.831 -10.235 -109.322 1.00 0.00 ? 16  LYS A CE   6  
ATOM 11367 N NZ   . LYS A 1 16  ? 154.316 -10.317 -109.235 1.00 0.00 ? 16  LYS A NZ   6  
ATOM 11368 H H    . LYS A 1 16  ? 152.802 -4.800  -105.075 1.00 0.00 ? 16  LYS A H    6  
ATOM 11369 H HA   . LYS A 1 16  ? 154.528 -6.700  -106.323 1.00 0.00 ? 16  LYS A HA   6  
ATOM 11370 H HB2  . LYS A 1 16  ? 152.978 -8.436  -105.845 1.00 0.00 ? 16  LYS A HB2  6  
ATOM 11371 H HB3  . LYS A 1 16  ? 151.603 -7.427  -106.278 1.00 0.00 ? 16  LYS A HB3  6  
ATOM 11372 H HG2  . LYS A 1 16  ? 152.105 -7.532  -108.588 1.00 0.00 ? 16  LYS A HG2  6  
ATOM 11373 H HG3  . LYS A 1 16  ? 153.758 -8.070  -108.287 1.00 0.00 ? 16  LYS A HG3  6  
ATOM 11374 H HD2  . LYS A 1 16  ? 152.646 -10.145 -107.185 1.00 0.00 ? 16  LYS A HD2  6  
ATOM 11375 H HD3  . LYS A 1 16  ? 151.200 -9.644  -108.061 1.00 0.00 ? 16  LYS A HD3  6  
ATOM 11376 H HE2  . LYS A 1 16  ? 152.422 -11.227 -109.440 1.00 0.00 ? 16  LYS A HE2  6  
ATOM 11377 H HE3  . LYS A 1 16  ? 152.553 -9.629  -110.173 1.00 0.00 ? 16  LYS A HE3  6  
ATOM 11378 H HZ1  . LYS A 1 16  ? 154.741 -9.590  -109.846 1.00 0.00 ? 16  LYS A HZ1  6  
ATOM 11379 H HZ2  . LYS A 1 16  ? 154.630 -11.259 -109.546 1.00 0.00 ? 16  LYS A HZ2  6  
ATOM 11380 H HZ3  . LYS A 1 16  ? 154.615 -10.157 -108.253 1.00 0.00 ? 16  LYS A HZ3  6  
ATOM 11381 N N    . ALA A 1 17  ? 152.882 -4.237  -107.216 1.00 0.00 ? 17  ALA A N    6  
ATOM 11382 C CA   . ALA A 1 17  ? 152.695 -3.251  -108.316 1.00 0.00 ? 17  ALA A CA   6  
ATOM 11383 C C    . ALA A 1 17  ? 154.042 -2.578  -108.583 1.00 0.00 ? 17  ALA A C    6  
ATOM 11384 O O    . ALA A 1 17  ? 154.885 -2.502  -107.712 1.00 0.00 ? 17  ALA A O    6  
ATOM 11385 C CB   . ALA A 1 17  ? 151.655 -2.209  -107.907 1.00 0.00 ? 17  ALA A CB   6  
ATOM 11386 H H    . ALA A 1 17  ? 152.733 -3.969  -106.286 1.00 0.00 ? 17  ALA A H    6  
ATOM 11387 H HA   . ALA A 1 17  ? 152.363 -3.761  -109.209 1.00 0.00 ? 17  ALA A HA   6  
ATOM 11388 H HB1  . ALA A 1 17  ? 151.551 -1.478  -108.695 1.00 0.00 ? 17  ALA A HB1  6  
ATOM 11389 H HB2  . ALA A 1 17  ? 151.972 -1.721  -106.999 1.00 0.00 ? 17  ALA A HB2  6  
ATOM 11390 H HB3  . ALA A 1 17  ? 150.705 -2.697  -107.742 1.00 0.00 ? 17  ALA A HB3  6  
ATOM 11391 N N    . THR A 1 18  ? 154.266 -2.105  -109.776 1.00 0.00 ? 18  THR A N    6  
ATOM 11392 C CA   . THR A 1 18  ? 155.575 -1.464  -110.077 1.00 0.00 ? 18  THR A CA   6  
ATOM 11393 C C    . THR A 1 18  ? 155.514 -0.763  -111.432 1.00 0.00 ? 18  THR A C    6  
ATOM 11394 O O    . THR A 1 18  ? 154.617 -0.995  -112.215 1.00 0.00 ? 18  THR A O    6  
ATOM 11395 C CB   . THR A 1 18  ? 156.654 -2.549  -110.125 1.00 0.00 ? 18  THR A CB   6  
ATOM 11396 O OG1  . THR A 1 18  ? 156.032 -3.826  -110.171 1.00 0.00 ? 18  THR A OG1  6  
ATOM 11397 C CG2  . THR A 1 18  ? 157.536 -2.459  -108.884 1.00 0.00 ? 18  THR A CG2  6  
ATOM 11398 H H    . THR A 1 18  ? 153.586 -2.189  -110.475 1.00 0.00 ? 18  THR A H    6  
ATOM 11399 H HA   . THR A 1 18  ? 155.814 -0.748  -109.307 1.00 0.00 ? 18  THR A HA   6  
ATOM 11400 H HB   . THR A 1 18  ? 157.262 -2.415  -111.006 1.00 0.00 ? 18  THR A HB   6  
ATOM 11401 H HG1  . THR A 1 18  ? 156.608 -4.418  -110.660 1.00 0.00 ? 18  THR A HG1  6  
ATOM 11402 H HG21 . THR A 1 18  ? 157.152 -3.123  -108.126 1.00 0.00 ? 18  THR A HG21 6  
ATOM 11403 H HG22 . THR A 1 18  ? 157.535 -1.446  -108.510 1.00 0.00 ? 18  THR A HG22 6  
ATOM 11404 H HG23 . THR A 1 18  ? 158.543 -2.747  -109.140 1.00 0.00 ? 18  THR A HG23 6  
ATOM 11405 N N    . PRO A 1 19  ? 156.479 0.080   -111.707 1.00 0.00 ? 19  PRO A N    6  
ATOM 11406 C CA   . PRO A 1 19  ? 156.538 0.802   -113.003 1.00 0.00 ? 19  PRO A CA   6  
ATOM 11407 C C    . PRO A 1 19  ? 156.357 -0.145  -114.192 1.00 0.00 ? 19  PRO A C    6  
ATOM 11408 O O    . PRO A 1 19  ? 156.920 0.053   -115.250 1.00 0.00 ? 19  PRO A O    6  
ATOM 11409 C CB   . PRO A 1 19  ? 157.939 1.412   -112.983 1.00 0.00 ? 19  PRO A CB   6  
ATOM 11410 C CG   . PRO A 1 19  ? 158.578 1.137   -111.613 1.00 0.00 ? 19  PRO A CG   6  
ATOM 11411 C CD   . PRO A 1 19  ? 157.573 0.368   -110.748 1.00 0.00 ? 19  PRO A CD   6  
ATOM 11412 H HA   . PRO A 1 19  ? 155.804 1.589   -113.049 1.00 0.00 ? 19  PRO A HA   6  
ATOM 11413 H HB2  . PRO A 1 19  ? 158.536 0.968   -113.764 1.00 0.00 ? 19  PRO A HB2  6  
ATOM 11414 H HB3  . PRO A 1 19  ? 157.872 2.478   -113.139 1.00 0.00 ? 19  PRO A HB3  6  
ATOM 11415 H HG2  . PRO A 1 19  ? 159.474 0.547   -111.744 1.00 0.00 ? 19  PRO A HG2  6  
ATOM 11416 H HG3  . PRO A 1 19  ? 158.824 2.071   -111.134 1.00 0.00 ? 19  PRO A HG3  6  
ATOM 11417 H HD2  . PRO A 1 19  ? 158.013 -0.545  -110.373 1.00 0.00 ? 19  PRO A HD2  6  
ATOM 11418 H HD3  . PRO A 1 19  ? 157.211 0.983   -109.939 1.00 0.00 ? 19  PRO A HD3  6  
ATOM 11419 N N    . ALA A 1 20  ? 155.566 -1.165  -114.022 1.00 0.00 ? 20  ALA A N    6  
ATOM 11420 C CA   . ALA A 1 20  ? 155.335 -2.121  -115.140 1.00 0.00 ? 20  ALA A CA   6  
ATOM 11421 C C    . ALA A 1 20  ? 153.941 -2.737  -115.009 1.00 0.00 ? 20  ALA A C    6  
ATOM 11422 O O    . ALA A 1 20  ? 153.788 -3.942  -114.999 1.00 0.00 ? 20  ALA A O    6  
ATOM 11423 C CB   . ALA A 1 20  ? 156.389 -3.228  -115.089 1.00 0.00 ? 20  ALA A CB   6  
ATOM 11424 H H    . ALA A 1 20  ? 155.111 -1.283  -113.161 1.00 0.00 ?